data_4UHX
# 
_entry.id   4UHX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4UHX         
PDBE  EBI-63393    
WWPDB D_1290063393 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4UHW 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'HUMAN ALDEHYDE OXIDASE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4UHX 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Coelho, C.'       1 
'Romao, M.J.'      2 
'Santos-Silva, T.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structural Insights Into Xenobiotic and Inhibitor Binding to Human Aldehyde Oxidase' 
_citation.journal_abbrev            Nat.Chem.Biol. 
_citation.journal_volume            11 
_citation.page_first                779 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1552-4450 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26322824 
_citation.pdbx_database_id_DOI      10.1038/NCHEMBIO.1895 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Coelho, C.'       1 
primary 'Foti, A.'         2 
primary 'Hartmann, T.'     3 
primary 'Santos-Silva, T.' 4 
primary 'Leimkuhler, S.'   5 
primary 'Romao, M.J.'      6 
# 
_cell.entry_id           4UHX 
_cell.length_a           148.732 
_cell.length_b           148.732 
_cell.length_c           132.808 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4UHX 
_symmetry.space_group_name_H-M             'P 42 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                94 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'ALDEHYDE OXIDASE' 148096.500 1  1.2.3.1 ? ? ? 
2  non-polymer syn 'FE2/S2 (INORGANIC) CLUSTER' 175.820    2  ?       ? ? ? 
3  non-polymer syn 
'PHOSPHONIC ACIDMONO-(2-AMINO-5,6-DIMERCAPTO-4-OXO-3,7,8A,9,10,10A-HEXAHYDRO-4H-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-7-YLMETHYL)ESTER' 
395.352    1  ?       ? ? ? 
4  non-polymer syn 'DIOXOTHIOMOLYBDENUM(VI) ION' 161.012    1  ?       ? ? ? 
5  non-polymer syn 'FLAVIN-ADENINE DINUCLEOTIDE' 785.550    1  ?       ? ? ? 
6  non-polymer syn phthalazine 130.147    1  ?       ? ? ? 
7  non-polymer syn '10-{2-[(2S)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine' 370.575    1  ?       ? ? ? 
8  non-polymer syn '10-{2-[(2R)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine' 370.575    1  ?       ? ? ? 
9  non-polymer syn 'MALONATE ION' 102.046    2  ?       ? ? ? 
10 water       nat water 18.015     60 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'ALDEHYDE OXIDASE 1, AZAHETEROCYCLE HYDROXYLASE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHPANACLIPICS
LYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDA
CKTFCKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILA
DVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKC
PNADLKPQEILVSVNIPYSRKWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL
IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKH
HCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVD
IMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKYIQDIVASTLKLPANKVMCHV
RRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASL
DESLFVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLV
THGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKG
TWKDWAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSNTLYSSKGLGESGVFLGCSVF
FAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNVPI
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MDRASELLFYVNGRKVIEKNVDPETMLLPYLRKKLRLTGTKYGCGGGGCGACTVMISRYNPITKRIRHHPANACLIPICS
LYGAAVTTVEGIGSTHTRIHPVQERIAKCHGTQCGFCTPGMVMSIYTLLRNHPEPTLDQLTDALGGNLCRCTGYRPIIDA
CKTFCKTSGCCQSKENGVCCLDQGINGLPEFEEGSKTSPKLFAEEEFLPLDPTQELIFPPELMIMAEKQSQRTRVFGSER
MMWFSPVTLKELLEFKFKYPQAPVIMGNTSVGPEVKFKGVFHPVIISPDRIEELSVVNHAYNGLTLGAGLSLAQVKDILA
DVVQKLPEEKTQMYHALLKHLGTLAGSQIRNMASLGGHIISRHPDSDLNPILAVGNCTLNLLSKEGKRQIPLNEQFLSKC
PNADLKPQEILVSVNIPYSRKWEFVSAFRQAQRQENALAIVNSGMRVFFGEGDGIIRELCISYGGVGPATICAKNSCQKL
IGRHWNEQMLDIACRLILNEVSLLGSAPGGKVEFKRTLIISFLFKFYLEVSQILKKMDPVHYPSLADKYESALEDLHSKH
HCSTLKYQNIGPKQHPEDPIGHPIMHLSGVKHATGEAIYCDDMPLVDQELFLTFVTSSRAHAKIVSIDLSEALSMPGVVD
IMTAEHLSDVNSFCFFTEAEKFLATDKVFCVGQLVCAVLADSEVQAKRAAKRVKIVYQDLEPLILTIEESIQHNSSFKPE
RKLEYGNVDEAFKVVDQILEGEIHMGGQEHFYMETQSMLVVPKGEDQEMDVYVSTQFPKYIQDIVASTLKLPANKVMCHV
RRVGGAFGGKVLKTGIIAAVTAFAANKHGRAVRCVLERGEDMLITGGRHPYLGKYKAGFMNDGRILALDMEHYSNAGASL
DESLFVIEMGLLKMDNAYKFPNLRCRGWACRTNLPSNTAFRGFGFPQAALITESCITEVAAKCGLSPEKVRIINMYKEID
QTPYKQEINAKNLIQCWRECMAMSSYSLRKVAVEKFNAENYWKKKGLAMVPLKFPVGLGSRAAGQAAALVHIYLDGSVLV
THGGIEMGQGVHTKMIQVVSRELRMPMSNVHLRGTSTETVPNANISGGSVVADLNGLAVKDACQTLLKRLEPIISKNPKG
TWKDWAQTAFDESINLSAVGYFRGYESDMNWEKGEGQPFEYFVYGAACSEVEIDCLTGDHKNIRTDIVMDVGCSINPAID
IGQIEGAFIQGMGLYTIEELNYSPQGILHTRGPDQYKIPAICDMPTELHIALLPPSQNSNTLYSSKGLGESGVFLGCSVF
FAIHDAVSAARQERGLHGPLTLNSPLTPEKIRMACEDKFTKMIPRDEPGSYVPWNVPI
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    ASP n 
1 3    ARG n 
1 4    ALA n 
1 5    SER n 
1 6    GLU n 
1 7    LEU n 
1 8    LEU n 
1 9    PHE n 
1 10   TYR n 
1 11   VAL n 
1 12   ASN n 
1 13   GLY n 
1 14   ARG n 
1 15   LYS n 
1 16   VAL n 
1 17   ILE n 
1 18   GLU n 
1 19   LYS n 
1 20   ASN n 
1 21   VAL n 
1 22   ASP n 
1 23   PRO n 
1 24   GLU n 
1 25   THR n 
1 26   MET n 
1 27   LEU n 
1 28   LEU n 
1 29   PRO n 
1 30   TYR n 
1 31   LEU n 
1 32   ARG n 
1 33   LYS n 
1 34   LYS n 
1 35   LEU n 
1 36   ARG n 
1 37   LEU n 
1 38   THR n 
1 39   GLY n 
1 40   THR n 
1 41   LYS n 
1 42   TYR n 
1 43   GLY n 
1 44   CYS n 
1 45   GLY n 
1 46   GLY n 
1 47   GLY n 
1 48   GLY n 
1 49   CYS n 
1 50   GLY n 
1 51   ALA n 
1 52   CYS n 
1 53   THR n 
1 54   VAL n 
1 55   MET n 
1 56   ILE n 
1 57   SER n 
1 58   ARG n 
1 59   TYR n 
1 60   ASN n 
1 61   PRO n 
1 62   ILE n 
1 63   THR n 
1 64   LYS n 
1 65   ARG n 
1 66   ILE n 
1 67   ARG n 
1 68   HIS n 
1 69   HIS n 
1 70   PRO n 
1 71   ALA n 
1 72   ASN n 
1 73   ALA n 
1 74   CYS n 
1 75   LEU n 
1 76   ILE n 
1 77   PRO n 
1 78   ILE n 
1 79   CYS n 
1 80   SER n 
1 81   LEU n 
1 82   TYR n 
1 83   GLY n 
1 84   ALA n 
1 85   ALA n 
1 86   VAL n 
1 87   THR n 
1 88   THR n 
1 89   VAL n 
1 90   GLU n 
1 91   GLY n 
1 92   ILE n 
1 93   GLY n 
1 94   SER n 
1 95   THR n 
1 96   HIS n 
1 97   THR n 
1 98   ARG n 
1 99   ILE n 
1 100  HIS n 
1 101  PRO n 
1 102  VAL n 
1 103  GLN n 
1 104  GLU n 
1 105  ARG n 
1 106  ILE n 
1 107  ALA n 
1 108  LYS n 
1 109  CYS n 
1 110  HIS n 
1 111  GLY n 
1 112  THR n 
1 113  GLN n 
1 114  CYS n 
1 115  GLY n 
1 116  PHE n 
1 117  CYS n 
1 118  THR n 
1 119  PRO n 
1 120  GLY n 
1 121  MET n 
1 122  VAL n 
1 123  MET n 
1 124  SER n 
1 125  ILE n 
1 126  TYR n 
1 127  THR n 
1 128  LEU n 
1 129  LEU n 
1 130  ARG n 
1 131  ASN n 
1 132  HIS n 
1 133  PRO n 
1 134  GLU n 
1 135  PRO n 
1 136  THR n 
1 137  LEU n 
1 138  ASP n 
1 139  GLN n 
1 140  LEU n 
1 141  THR n 
1 142  ASP n 
1 143  ALA n 
1 144  LEU n 
1 145  GLY n 
1 146  GLY n 
1 147  ASN n 
1 148  LEU n 
1 149  CYS n 
1 150  ARG n 
1 151  CYS n 
1 152  THR n 
1 153  GLY n 
1 154  TYR n 
1 155  ARG n 
1 156  PRO n 
1 157  ILE n 
1 158  ILE n 
1 159  ASP n 
1 160  ALA n 
1 161  CYS n 
1 162  LYS n 
1 163  THR n 
1 164  PHE n 
1 165  CYS n 
1 166  LYS n 
1 167  THR n 
1 168  SER n 
1 169  GLY n 
1 170  CYS n 
1 171  CYS n 
1 172  GLN n 
1 173  SER n 
1 174  LYS n 
1 175  GLU n 
1 176  ASN n 
1 177  GLY n 
1 178  VAL n 
1 179  CYS n 
1 180  CYS n 
1 181  LEU n 
1 182  ASP n 
1 183  GLN n 
1 184  GLY n 
1 185  ILE n 
1 186  ASN n 
1 187  GLY n 
1 188  LEU n 
1 189  PRO n 
1 190  GLU n 
1 191  PHE n 
1 192  GLU n 
1 193  GLU n 
1 194  GLY n 
1 195  SER n 
1 196  LYS n 
1 197  THR n 
1 198  SER n 
1 199  PRO n 
1 200  LYS n 
1 201  LEU n 
1 202  PHE n 
1 203  ALA n 
1 204  GLU n 
1 205  GLU n 
1 206  GLU n 
1 207  PHE n 
1 208  LEU n 
1 209  PRO n 
1 210  LEU n 
1 211  ASP n 
1 212  PRO n 
1 213  THR n 
1 214  GLN n 
1 215  GLU n 
1 216  LEU n 
1 217  ILE n 
1 218  PHE n 
1 219  PRO n 
1 220  PRO n 
1 221  GLU n 
1 222  LEU n 
1 223  MET n 
1 224  ILE n 
1 225  MET n 
1 226  ALA n 
1 227  GLU n 
1 228  LYS n 
1 229  GLN n 
1 230  SER n 
1 231  GLN n 
1 232  ARG n 
1 233  THR n 
1 234  ARG n 
1 235  VAL n 
1 236  PHE n 
1 237  GLY n 
1 238  SER n 
1 239  GLU n 
1 240  ARG n 
1 241  MET n 
1 242  MET n 
1 243  TRP n 
1 244  PHE n 
1 245  SER n 
1 246  PRO n 
1 247  VAL n 
1 248  THR n 
1 249  LEU n 
1 250  LYS n 
1 251  GLU n 
1 252  LEU n 
1 253  LEU n 
1 254  GLU n 
1 255  PHE n 
1 256  LYS n 
1 257  PHE n 
1 258  LYS n 
1 259  TYR n 
1 260  PRO n 
1 261  GLN n 
1 262  ALA n 
1 263  PRO n 
1 264  VAL n 
1 265  ILE n 
1 266  MET n 
1 267  GLY n 
1 268  ASN n 
1 269  THR n 
1 270  SER n 
1 271  VAL n 
1 272  GLY n 
1 273  PRO n 
1 274  GLU n 
1 275  VAL n 
1 276  LYS n 
1 277  PHE n 
1 278  LYS n 
1 279  GLY n 
1 280  VAL n 
1 281  PHE n 
1 282  HIS n 
1 283  PRO n 
1 284  VAL n 
1 285  ILE n 
1 286  ILE n 
1 287  SER n 
1 288  PRO n 
1 289  ASP n 
1 290  ARG n 
1 291  ILE n 
1 292  GLU n 
1 293  GLU n 
1 294  LEU n 
1 295  SER n 
1 296  VAL n 
1 297  VAL n 
1 298  ASN n 
1 299  HIS n 
1 300  ALA n 
1 301  TYR n 
1 302  ASN n 
1 303  GLY n 
1 304  LEU n 
1 305  THR n 
1 306  LEU n 
1 307  GLY n 
1 308  ALA n 
1 309  GLY n 
1 310  LEU n 
1 311  SER n 
1 312  LEU n 
1 313  ALA n 
1 314  GLN n 
1 315  VAL n 
1 316  LYS n 
1 317  ASP n 
1 318  ILE n 
1 319  LEU n 
1 320  ALA n 
1 321  ASP n 
1 322  VAL n 
1 323  VAL n 
1 324  GLN n 
1 325  LYS n 
1 326  LEU n 
1 327  PRO n 
1 328  GLU n 
1 329  GLU n 
1 330  LYS n 
1 331  THR n 
1 332  GLN n 
1 333  MET n 
1 334  TYR n 
1 335  HIS n 
1 336  ALA n 
1 337  LEU n 
1 338  LEU n 
1 339  LYS n 
1 340  HIS n 
1 341  LEU n 
1 342  GLY n 
1 343  THR n 
1 344  LEU n 
1 345  ALA n 
1 346  GLY n 
1 347  SER n 
1 348  GLN n 
1 349  ILE n 
1 350  ARG n 
1 351  ASN n 
1 352  MET n 
1 353  ALA n 
1 354  SER n 
1 355  LEU n 
1 356  GLY n 
1 357  GLY n 
1 358  HIS n 
1 359  ILE n 
1 360  ILE n 
1 361  SER n 
1 362  ARG n 
1 363  HIS n 
1 364  PRO n 
1 365  ASP n 
1 366  SER n 
1 367  ASP n 
1 368  LEU n 
1 369  ASN n 
1 370  PRO n 
1 371  ILE n 
1 372  LEU n 
1 373  ALA n 
1 374  VAL n 
1 375  GLY n 
1 376  ASN n 
1 377  CYS n 
1 378  THR n 
1 379  LEU n 
1 380  ASN n 
1 381  LEU n 
1 382  LEU n 
1 383  SER n 
1 384  LYS n 
1 385  GLU n 
1 386  GLY n 
1 387  LYS n 
1 388  ARG n 
1 389  GLN n 
1 390  ILE n 
1 391  PRO n 
1 392  LEU n 
1 393  ASN n 
1 394  GLU n 
1 395  GLN n 
1 396  PHE n 
1 397  LEU n 
1 398  SER n 
1 399  LYS n 
1 400  CYS n 
1 401  PRO n 
1 402  ASN n 
1 403  ALA n 
1 404  ASP n 
1 405  LEU n 
1 406  LYS n 
1 407  PRO n 
1 408  GLN n 
1 409  GLU n 
1 410  ILE n 
1 411  LEU n 
1 412  VAL n 
1 413  SER n 
1 414  VAL n 
1 415  ASN n 
1 416  ILE n 
1 417  PRO n 
1 418  TYR n 
1 419  SER n 
1 420  ARG n 
1 421  LYS n 
1 422  TRP n 
1 423  GLU n 
1 424  PHE n 
1 425  VAL n 
1 426  SER n 
1 427  ALA n 
1 428  PHE n 
1 429  ARG n 
1 430  GLN n 
1 431  ALA n 
1 432  GLN n 
1 433  ARG n 
1 434  GLN n 
1 435  GLU n 
1 436  ASN n 
1 437  ALA n 
1 438  LEU n 
1 439  ALA n 
1 440  ILE n 
1 441  VAL n 
1 442  ASN n 
1 443  SER n 
1 444  GLY n 
1 445  MET n 
1 446  ARG n 
1 447  VAL n 
1 448  PHE n 
1 449  PHE n 
1 450  GLY n 
1 451  GLU n 
1 452  GLY n 
1 453  ASP n 
1 454  GLY n 
1 455  ILE n 
1 456  ILE n 
1 457  ARG n 
1 458  GLU n 
1 459  LEU n 
1 460  CYS n 
1 461  ILE n 
1 462  SER n 
1 463  TYR n 
1 464  GLY n 
1 465  GLY n 
1 466  VAL n 
1 467  GLY n 
1 468  PRO n 
1 469  ALA n 
1 470  THR n 
1 471  ILE n 
1 472  CYS n 
1 473  ALA n 
1 474  LYS n 
1 475  ASN n 
1 476  SER n 
1 477  CYS n 
1 478  GLN n 
1 479  LYS n 
1 480  LEU n 
1 481  ILE n 
1 482  GLY n 
1 483  ARG n 
1 484  HIS n 
1 485  TRP n 
1 486  ASN n 
1 487  GLU n 
1 488  GLN n 
1 489  MET n 
1 490  LEU n 
1 491  ASP n 
1 492  ILE n 
1 493  ALA n 
1 494  CYS n 
1 495  ARG n 
1 496  LEU n 
1 497  ILE n 
1 498  LEU n 
1 499  ASN n 
1 500  GLU n 
1 501  VAL n 
1 502  SER n 
1 503  LEU n 
1 504  LEU n 
1 505  GLY n 
1 506  SER n 
1 507  ALA n 
1 508  PRO n 
1 509  GLY n 
1 510  GLY n 
1 511  LYS n 
1 512  VAL n 
1 513  GLU n 
1 514  PHE n 
1 515  LYS n 
1 516  ARG n 
1 517  THR n 
1 518  LEU n 
1 519  ILE n 
1 520  ILE n 
1 521  SER n 
1 522  PHE n 
1 523  LEU n 
1 524  PHE n 
1 525  LYS n 
1 526  PHE n 
1 527  TYR n 
1 528  LEU n 
1 529  GLU n 
1 530  VAL n 
1 531  SER n 
1 532  GLN n 
1 533  ILE n 
1 534  LEU n 
1 535  LYS n 
1 536  LYS n 
1 537  MET n 
1 538  ASP n 
1 539  PRO n 
1 540  VAL n 
1 541  HIS n 
1 542  TYR n 
1 543  PRO n 
1 544  SER n 
1 545  LEU n 
1 546  ALA n 
1 547  ASP n 
1 548  LYS n 
1 549  TYR n 
1 550  GLU n 
1 551  SER n 
1 552  ALA n 
1 553  LEU n 
1 554  GLU n 
1 555  ASP n 
1 556  LEU n 
1 557  HIS n 
1 558  SER n 
1 559  LYS n 
1 560  HIS n 
1 561  HIS n 
1 562  CYS n 
1 563  SER n 
1 564  THR n 
1 565  LEU n 
1 566  LYS n 
1 567  TYR n 
1 568  GLN n 
1 569  ASN n 
1 570  ILE n 
1 571  GLY n 
1 572  PRO n 
1 573  LYS n 
1 574  GLN n 
1 575  HIS n 
1 576  PRO n 
1 577  GLU n 
1 578  ASP n 
1 579  PRO n 
1 580  ILE n 
1 581  GLY n 
1 582  HIS n 
1 583  PRO n 
1 584  ILE n 
1 585  MET n 
1 586  HIS n 
1 587  LEU n 
1 588  SER n 
1 589  GLY n 
1 590  VAL n 
1 591  LYS n 
1 592  HIS n 
1 593  ALA n 
1 594  THR n 
1 595  GLY n 
1 596  GLU n 
1 597  ALA n 
1 598  ILE n 
1 599  TYR n 
1 600  CYS n 
1 601  ASP n 
1 602  ASP n 
1 603  MET n 
1 604  PRO n 
1 605  LEU n 
1 606  VAL n 
1 607  ASP n 
1 608  GLN n 
1 609  GLU n 
1 610  LEU n 
1 611  PHE n 
1 612  LEU n 
1 613  THR n 
1 614  PHE n 
1 615  VAL n 
1 616  THR n 
1 617  SER n 
1 618  SER n 
1 619  ARG n 
1 620  ALA n 
1 621  HIS n 
1 622  ALA n 
1 623  LYS n 
1 624  ILE n 
1 625  VAL n 
1 626  SER n 
1 627  ILE n 
1 628  ASP n 
1 629  LEU n 
1 630  SER n 
1 631  GLU n 
1 632  ALA n 
1 633  LEU n 
1 634  SER n 
1 635  MET n 
1 636  PRO n 
1 637  GLY n 
1 638  VAL n 
1 639  VAL n 
1 640  ASP n 
1 641  ILE n 
1 642  MET n 
1 643  THR n 
1 644  ALA n 
1 645  GLU n 
1 646  HIS n 
1 647  LEU n 
1 648  SER n 
1 649  ASP n 
1 650  VAL n 
1 651  ASN n 
1 652  SER n 
1 653  PHE n 
1 654  CYS n 
1 655  PHE n 
1 656  PHE n 
1 657  THR n 
1 658  GLU n 
1 659  ALA n 
1 660  GLU n 
1 661  LYS n 
1 662  PHE n 
1 663  LEU n 
1 664  ALA n 
1 665  THR n 
1 666  ASP n 
1 667  LYS n 
1 668  VAL n 
1 669  PHE n 
1 670  CYS n 
1 671  VAL n 
1 672  GLY n 
1 673  GLN n 
1 674  LEU n 
1 675  VAL n 
1 676  CYS n 
1 677  ALA n 
1 678  VAL n 
1 679  LEU n 
1 680  ALA n 
1 681  ASP n 
1 682  SER n 
1 683  GLU n 
1 684  VAL n 
1 685  GLN n 
1 686  ALA n 
1 687  LYS n 
1 688  ARG n 
1 689  ALA n 
1 690  ALA n 
1 691  LYS n 
1 692  ARG n 
1 693  VAL n 
1 694  LYS n 
1 695  ILE n 
1 696  VAL n 
1 697  TYR n 
1 698  GLN n 
1 699  ASP n 
1 700  LEU n 
1 701  GLU n 
1 702  PRO n 
1 703  LEU n 
1 704  ILE n 
1 705  LEU n 
1 706  THR n 
1 707  ILE n 
1 708  GLU n 
1 709  GLU n 
1 710  SER n 
1 711  ILE n 
1 712  GLN n 
1 713  HIS n 
1 714  ASN n 
1 715  SER n 
1 716  SER n 
1 717  PHE n 
1 718  LYS n 
1 719  PRO n 
1 720  GLU n 
1 721  ARG n 
1 722  LYS n 
1 723  LEU n 
1 724  GLU n 
1 725  TYR n 
1 726  GLY n 
1 727  ASN n 
1 728  VAL n 
1 729  ASP n 
1 730  GLU n 
1 731  ALA n 
1 732  PHE n 
1 733  LYS n 
1 734  VAL n 
1 735  VAL n 
1 736  ASP n 
1 737  GLN n 
1 738  ILE n 
1 739  LEU n 
1 740  GLU n 
1 741  GLY n 
1 742  GLU n 
1 743  ILE n 
1 744  HIS n 
1 745  MET n 
1 746  GLY n 
1 747  GLY n 
1 748  GLN n 
1 749  GLU n 
1 750  HIS n 
1 751  PHE n 
1 752  TYR n 
1 753  MET n 
1 754  GLU n 
1 755  THR n 
1 756  GLN n 
1 757  SER n 
1 758  MET n 
1 759  LEU n 
1 760  VAL n 
1 761  VAL n 
1 762  PRO n 
1 763  LYS n 
1 764  GLY n 
1 765  GLU n 
1 766  ASP n 
1 767  GLN n 
1 768  GLU n 
1 769  MET n 
1 770  ASP n 
1 771  VAL n 
1 772  TYR n 
1 773  VAL n 
1 774  SER n 
1 775  THR n 
1 776  GLN n 
1 777  PHE n 
1 778  PRO n 
1 779  LYS n 
1 780  TYR n 
1 781  ILE n 
1 782  GLN n 
1 783  ASP n 
1 784  ILE n 
1 785  VAL n 
1 786  ALA n 
1 787  SER n 
1 788  THR n 
1 789  LEU n 
1 790  LYS n 
1 791  LEU n 
1 792  PRO n 
1 793  ALA n 
1 794  ASN n 
1 795  LYS n 
1 796  VAL n 
1 797  MET n 
1 798  CYS n 
1 799  HIS n 
1 800  VAL n 
1 801  ARG n 
1 802  ARG n 
1 803  VAL n 
1 804  GLY n 
1 805  GLY n 
1 806  ALA n 
1 807  PHE n 
1 808  GLY n 
1 809  GLY n 
1 810  LYS n 
1 811  VAL n 
1 812  LEU n 
1 813  LYS n 
1 814  THR n 
1 815  GLY n 
1 816  ILE n 
1 817  ILE n 
1 818  ALA n 
1 819  ALA n 
1 820  VAL n 
1 821  THR n 
1 822  ALA n 
1 823  PHE n 
1 824  ALA n 
1 825  ALA n 
1 826  ASN n 
1 827  LYS n 
1 828  HIS n 
1 829  GLY n 
1 830  ARG n 
1 831  ALA n 
1 832  VAL n 
1 833  ARG n 
1 834  CYS n 
1 835  VAL n 
1 836  LEU n 
1 837  GLU n 
1 838  ARG n 
1 839  GLY n 
1 840  GLU n 
1 841  ASP n 
1 842  MET n 
1 843  LEU n 
1 844  ILE n 
1 845  THR n 
1 846  GLY n 
1 847  GLY n 
1 848  ARG n 
1 849  HIS n 
1 850  PRO n 
1 851  TYR n 
1 852  LEU n 
1 853  GLY n 
1 854  LYS n 
1 855  TYR n 
1 856  LYS n 
1 857  ALA n 
1 858  GLY n 
1 859  PHE n 
1 860  MET n 
1 861  ASN n 
1 862  ASP n 
1 863  GLY n 
1 864  ARG n 
1 865  ILE n 
1 866  LEU n 
1 867  ALA n 
1 868  LEU n 
1 869  ASP n 
1 870  MET n 
1 871  GLU n 
1 872  HIS n 
1 873  TYR n 
1 874  SER n 
1 875  ASN n 
1 876  ALA n 
1 877  GLY n 
1 878  ALA n 
1 879  SER n 
1 880  LEU n 
1 881  ASP n 
1 882  GLU n 
1 883  SER n 
1 884  LEU n 
1 885  PHE n 
1 886  VAL n 
1 887  ILE n 
1 888  GLU n 
1 889  MET n 
1 890  GLY n 
1 891  LEU n 
1 892  LEU n 
1 893  LYS n 
1 894  MET n 
1 895  ASP n 
1 896  ASN n 
1 897  ALA n 
1 898  TYR n 
1 899  LYS n 
1 900  PHE n 
1 901  PRO n 
1 902  ASN n 
1 903  LEU n 
1 904  ARG n 
1 905  CYS n 
1 906  ARG n 
1 907  GLY n 
1 908  TRP n 
1 909  ALA n 
1 910  CYS n 
1 911  ARG n 
1 912  THR n 
1 913  ASN n 
1 914  LEU n 
1 915  PRO n 
1 916  SER n 
1 917  ASN n 
1 918  THR n 
1 919  ALA n 
1 920  PHE n 
1 921  ARG n 
1 922  GLY n 
1 923  PHE n 
1 924  GLY n 
1 925  PHE n 
1 926  PRO n 
1 927  GLN n 
1 928  ALA n 
1 929  ALA n 
1 930  LEU n 
1 931  ILE n 
1 932  THR n 
1 933  GLU n 
1 934  SER n 
1 935  CYS n 
1 936  ILE n 
1 937  THR n 
1 938  GLU n 
1 939  VAL n 
1 940  ALA n 
1 941  ALA n 
1 942  LYS n 
1 943  CYS n 
1 944  GLY n 
1 945  LEU n 
1 946  SER n 
1 947  PRO n 
1 948  GLU n 
1 949  LYS n 
1 950  VAL n 
1 951  ARG n 
1 952  ILE n 
1 953  ILE n 
1 954  ASN n 
1 955  MET n 
1 956  TYR n 
1 957  LYS n 
1 958  GLU n 
1 959  ILE n 
1 960  ASP n 
1 961  GLN n 
1 962  THR n 
1 963  PRO n 
1 964  TYR n 
1 965  LYS n 
1 966  GLN n 
1 967  GLU n 
1 968  ILE n 
1 969  ASN n 
1 970  ALA n 
1 971  LYS n 
1 972  ASN n 
1 973  LEU n 
1 974  ILE n 
1 975  GLN n 
1 976  CYS n 
1 977  TRP n 
1 978  ARG n 
1 979  GLU n 
1 980  CYS n 
1 981  MET n 
1 982  ALA n 
1 983  MET n 
1 984  SER n 
1 985  SER n 
1 986  TYR n 
1 987  SER n 
1 988  LEU n 
1 989  ARG n 
1 990  LYS n 
1 991  VAL n 
1 992  ALA n 
1 993  VAL n 
1 994  GLU n 
1 995  LYS n 
1 996  PHE n 
1 997  ASN n 
1 998  ALA n 
1 999  GLU n 
1 1000 ASN n 
1 1001 TYR n 
1 1002 TRP n 
1 1003 LYS n 
1 1004 LYS n 
1 1005 LYS n 
1 1006 GLY n 
1 1007 LEU n 
1 1008 ALA n 
1 1009 MET n 
1 1010 VAL n 
1 1011 PRO n 
1 1012 LEU n 
1 1013 LYS n 
1 1014 PHE n 
1 1015 PRO n 
1 1016 VAL n 
1 1017 GLY n 
1 1018 LEU n 
1 1019 GLY n 
1 1020 SER n 
1 1021 ARG n 
1 1022 ALA n 
1 1023 ALA n 
1 1024 GLY n 
1 1025 GLN n 
1 1026 ALA n 
1 1027 ALA n 
1 1028 ALA n 
1 1029 LEU n 
1 1030 VAL n 
1 1031 HIS n 
1 1032 ILE n 
1 1033 TYR n 
1 1034 LEU n 
1 1035 ASP n 
1 1036 GLY n 
1 1037 SER n 
1 1038 VAL n 
1 1039 LEU n 
1 1040 VAL n 
1 1041 THR n 
1 1042 HIS n 
1 1043 GLY n 
1 1044 GLY n 
1 1045 ILE n 
1 1046 GLU n 
1 1047 MET n 
1 1048 GLY n 
1 1049 GLN n 
1 1050 GLY n 
1 1051 VAL n 
1 1052 HIS n 
1 1053 THR n 
1 1054 LYS n 
1 1055 MET n 
1 1056 ILE n 
1 1057 GLN n 
1 1058 VAL n 
1 1059 VAL n 
1 1060 SER n 
1 1061 ARG n 
1 1062 GLU n 
1 1063 LEU n 
1 1064 ARG n 
1 1065 MET n 
1 1066 PRO n 
1 1067 MET n 
1 1068 SER n 
1 1069 ASN n 
1 1070 VAL n 
1 1071 HIS n 
1 1072 LEU n 
1 1073 ARG n 
1 1074 GLY n 
1 1075 THR n 
1 1076 SER n 
1 1077 THR n 
1 1078 GLU n 
1 1079 THR n 
1 1080 VAL n 
1 1081 PRO n 
1 1082 ASN n 
1 1083 ALA n 
1 1084 ASN n 
1 1085 ILE n 
1 1086 SER n 
1 1087 GLY n 
1 1088 GLY n 
1 1089 SER n 
1 1090 VAL n 
1 1091 VAL n 
1 1092 ALA n 
1 1093 ASP n 
1 1094 LEU n 
1 1095 ASN n 
1 1096 GLY n 
1 1097 LEU n 
1 1098 ALA n 
1 1099 VAL n 
1 1100 LYS n 
1 1101 ASP n 
1 1102 ALA n 
1 1103 CYS n 
1 1104 GLN n 
1 1105 THR n 
1 1106 LEU n 
1 1107 LEU n 
1 1108 LYS n 
1 1109 ARG n 
1 1110 LEU n 
1 1111 GLU n 
1 1112 PRO n 
1 1113 ILE n 
1 1114 ILE n 
1 1115 SER n 
1 1116 LYS n 
1 1117 ASN n 
1 1118 PRO n 
1 1119 LYS n 
1 1120 GLY n 
1 1121 THR n 
1 1122 TRP n 
1 1123 LYS n 
1 1124 ASP n 
1 1125 TRP n 
1 1126 ALA n 
1 1127 GLN n 
1 1128 THR n 
1 1129 ALA n 
1 1130 PHE n 
1 1131 ASP n 
1 1132 GLU n 
1 1133 SER n 
1 1134 ILE n 
1 1135 ASN n 
1 1136 LEU n 
1 1137 SER n 
1 1138 ALA n 
1 1139 VAL n 
1 1140 GLY n 
1 1141 TYR n 
1 1142 PHE n 
1 1143 ARG n 
1 1144 GLY n 
1 1145 TYR n 
1 1146 GLU n 
1 1147 SER n 
1 1148 ASP n 
1 1149 MET n 
1 1150 ASN n 
1 1151 TRP n 
1 1152 GLU n 
1 1153 LYS n 
1 1154 GLY n 
1 1155 GLU n 
1 1156 GLY n 
1 1157 GLN n 
1 1158 PRO n 
1 1159 PHE n 
1 1160 GLU n 
1 1161 TYR n 
1 1162 PHE n 
1 1163 VAL n 
1 1164 TYR n 
1 1165 GLY n 
1 1166 ALA n 
1 1167 ALA n 
1 1168 CYS n 
1 1169 SER n 
1 1170 GLU n 
1 1171 VAL n 
1 1172 GLU n 
1 1173 ILE n 
1 1174 ASP n 
1 1175 CYS n 
1 1176 LEU n 
1 1177 THR n 
1 1178 GLY n 
1 1179 ASP n 
1 1180 HIS n 
1 1181 LYS n 
1 1182 ASN n 
1 1183 ILE n 
1 1184 ARG n 
1 1185 THR n 
1 1186 ASP n 
1 1187 ILE n 
1 1188 VAL n 
1 1189 MET n 
1 1190 ASP n 
1 1191 VAL n 
1 1192 GLY n 
1 1193 CYS n 
1 1194 SER n 
1 1195 ILE n 
1 1196 ASN n 
1 1197 PRO n 
1 1198 ALA n 
1 1199 ILE n 
1 1200 ASP n 
1 1201 ILE n 
1 1202 GLY n 
1 1203 GLN n 
1 1204 ILE n 
1 1205 GLU n 
1 1206 GLY n 
1 1207 ALA n 
1 1208 PHE n 
1 1209 ILE n 
1 1210 GLN n 
1 1211 GLY n 
1 1212 MET n 
1 1213 GLY n 
1 1214 LEU n 
1 1215 TYR n 
1 1216 THR n 
1 1217 ILE n 
1 1218 GLU n 
1 1219 GLU n 
1 1220 LEU n 
1 1221 ASN n 
1 1222 TYR n 
1 1223 SER n 
1 1224 PRO n 
1 1225 GLN n 
1 1226 GLY n 
1 1227 ILE n 
1 1228 LEU n 
1 1229 HIS n 
1 1230 THR n 
1 1231 ARG n 
1 1232 GLY n 
1 1233 PRO n 
1 1234 ASP n 
1 1235 GLN n 
1 1236 TYR n 
1 1237 LYS n 
1 1238 ILE n 
1 1239 PRO n 
1 1240 ALA n 
1 1241 ILE n 
1 1242 CYS n 
1 1243 ASP n 
1 1244 MET n 
1 1245 PRO n 
1 1246 THR n 
1 1247 GLU n 
1 1248 LEU n 
1 1249 HIS n 
1 1250 ILE n 
1 1251 ALA n 
1 1252 LEU n 
1 1253 LEU n 
1 1254 PRO n 
1 1255 PRO n 
1 1256 SER n 
1 1257 GLN n 
1 1258 ASN n 
1 1259 SER n 
1 1260 ASN n 
1 1261 THR n 
1 1262 LEU n 
1 1263 TYR n 
1 1264 SER n 
1 1265 SER n 
1 1266 LYS n 
1 1267 GLY n 
1 1268 LEU n 
1 1269 GLY n 
1 1270 GLU n 
1 1271 SER n 
1 1272 GLY n 
1 1273 VAL n 
1 1274 PHE n 
1 1275 LEU n 
1 1276 GLY n 
1 1277 CYS n 
1 1278 SER n 
1 1279 VAL n 
1 1280 PHE n 
1 1281 PHE n 
1 1282 ALA n 
1 1283 ILE n 
1 1284 HIS n 
1 1285 ASP n 
1 1286 ALA n 
1 1287 VAL n 
1 1288 SER n 
1 1289 ALA n 
1 1290 ALA n 
1 1291 ARG n 
1 1292 GLN n 
1 1293 GLU n 
1 1294 ARG n 
1 1295 GLY n 
1 1296 LEU n 
1 1297 HIS n 
1 1298 GLY n 
1 1299 PRO n 
1 1300 LEU n 
1 1301 THR n 
1 1302 LEU n 
1 1303 ASN n 
1 1304 SER n 
1 1305 PRO n 
1 1306 LEU n 
1 1307 THR n 
1 1308 PRO n 
1 1309 GLU n 
1 1310 LYS n 
1 1311 ILE n 
1 1312 ARG n 
1 1313 MET n 
1 1314 ALA n 
1 1315 CYS n 
1 1316 GLU n 
1 1317 ASP n 
1 1318 LYS n 
1 1319 PHE n 
1 1320 THR n 
1 1321 LYS n 
1 1322 MET n 
1 1323 ILE n 
1 1324 PRO n 
1 1325 ARG n 
1 1326 ASP n 
1 1327 GLU n 
1 1328 PRO n 
1 1329 GLY n 
1 1330 SER n 
1 1331 TYR n 
1 1332 VAL n 
1 1333 PRO n 
1 1334 TRP n 
1 1335 ASN n 
1 1336 VAL n 
1 1337 PRO n 
1 1338 ILE n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                LIVER 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               TP1000 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    AOXA_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          Q06278 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4UHX 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 1338 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q06278 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  1338 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       1338 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4FT non-polymer         . phthalazine ?            'C8 H6 N2'           130.147 
ALA 'L-peptide linking' y ALANINE ?            'C3 H7 N O2'         89.093  
ARG 'L-peptide linking' y ARGININE ?            'C6 H15 N4 O2 1'     175.209 
ASN 'L-peptide linking' y ASPARAGINE ?            'C4 H8 N2 O3'        132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?            'C4 H7 N O4'         133.103 
CYS 'L-peptide linking' y CYSTEINE ?            'C3 H7 N O2 S'       121.158 
FAD non-polymer         . 'FLAVIN-ADENINE DINUCLEOTIDE' ?            'C27 H33 N9 O15 P2'  785.550 
FES non-polymer         . 'FE2/S2 (INORGANIC) CLUSTER' ?            'Fe2 S2'             175.820 
GLN 'L-peptide linking' y GLUTAMINE ?            'C5 H10 N2 O3'       146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?            'C5 H9 N O4'         147.129 
GLY 'peptide linking'   y GLYCINE ?            'C2 H5 N O2'         75.067  
HIS 'L-peptide linking' y HISTIDINE ?            'C6 H10 N3 O2 1'     156.162 
HOH non-polymer         . WATER ?            'H2 O'               18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?            'C6 H13 N O2'        131.173 
LEU 'L-peptide linking' y LEUCINE ?            'C6 H13 N O2'        131.173 
LYS 'L-peptide linking' y LYSINE ?            'C6 H15 N2 O2 1'     147.195 
LZU non-polymer         . '10-{2-[(2S)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine' Thioridazine 
'C21 H26 N2 S2'      370.575 
MET 'L-peptide linking' y METHIONINE ?            'C5 H11 N O2 S'      149.211 
MLI non-polymer         . 'MALONATE ION' ?            'C3 H2 O4 -2'        102.046 
MOS non-polymer         . 'DIOXOTHIOMOLYBDENUM(VI) ION' ?            'H Mo O2 S'          161.012 
MTE non-polymer         . 
'PHOSPHONIC ACIDMONO-(2-AMINO-5,6-DIMERCAPTO-4-OXO-3,7,8A,9,10,10A-HEXAHYDRO-4H-8-OXA-1,3,9,10-TETRAAZA-ANTHRACEN-7-YLMETHYL)ESTER' 
?            'C10 H14 N5 O6 P S2' 395.352 
PHE 'L-peptide linking' y PHENYLALANINE ?            'C9 H11 N O2'        165.189 
PRO 'L-peptide linking' y PROLINE ?            'C5 H9 N O2'         115.130 
RTZ non-polymer         . '10-{2-[(2R)-1-methylpiperidin-2-yl]ethyl}-2-(methylsulfanyl)-10H-phenothiazine' ?            
'C21 H26 N2 S2'      370.575 
SER 'L-peptide linking' y SERINE ?            'C3 H7 N O3'         105.093 
THR 'L-peptide linking' y THREONINE ?            'C4 H9 N O3'         119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?            'C11 H12 N2 O2'      204.225 
TYR 'L-peptide linking' y TYROSINE ?            'C9 H11 N O3'        181.189 
VAL 'L-peptide linking' y VALINE ?            'C5 H11 N O2'        117.146 
# 
_exptl.entry_id          4UHX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.45 
_exptl_crystal.density_percent_sol   49.77 
_exptl_crystal.description           NONE 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             0.9 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4UHX 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             74.40 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   41407 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.8 
_reflns.pdbx_Rmerge_I_obs            0.03 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.20 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              12.0 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.81 
_reflns_shell.percent_possible_all   98.7 
_reflns_shell.Rmerge_I_obs           0.59 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.60 
_reflns_shell.pdbx_redundancy        6.5 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4UHX 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     39322 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             105.17 
_refine.ls_d_res_high                            2.70 
_refine.ls_percent_reflns_obs                    99.79 
_refine.ls_R_factor_obs                          0.19774 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19526 
_refine.ls_R_factor_R_free                       0.24408 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2085 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.956 
_refine.correlation_coeff_Fo_to_Fc_free          0.924 
_refine.B_iso_mean                               77.722 
_refine.aniso_B[1][1]                            -0.84 
_refine.aniso_B[2][2]                            -0.84 
_refine.aniso_B[3][3]                            1.68 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.10 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 3ZYV' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.342 
_refine.overall_SU_ML                            0.297 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             32.290 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        10000 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         163 
_refine_hist.number_atoms_solvent             60 
_refine_hist.number_atoms_total               10223 
_refine_hist.d_res_high                       2.70 
_refine_hist.d_res_low                        105.17 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.007  0.019  ? 10384 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.002  0.020  ? 9999  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.164  1.986  ? 14049 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.944  3.002  ? 23069 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.858  5.000  ? 1284  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       36.310 24.182 ? 428   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.343 15.000 ? 1802  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       13.302 15.000 ? 56    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.065  0.200  ? 1558  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.021  ? 11585 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 2295  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  0.933  5.239  ? 5154  'X-RAY DIFFRACTION' ? 
r_mcbond_other               0.933  5.239  ? 5153  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.664  7.854  ? 6432  'X-RAY DIFFRACTION' ? 
r_mcangle_other              1.664  7.854  ? 6433  'X-RAY DIFFRACTION' ? 
r_scbond_it                  0.793  5.439  ? 5230  'X-RAY DIFFRACTION' ? 
r_scbond_other               0.792  5.438  ? 5228  'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              1.389  8.111  ? 7613  'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       3.299  41.693 ? 11115 'X-RAY DIFFRACTION' ? 
r_long_range_B_other         3.299  41.691 ? 11112 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.700 
_refine_ls_shell.d_res_low                        2.770 
_refine_ls_shell.number_reflns_R_work             2835 
_refine_ls_shell.R_factor_R_work                  0.357 
_refine_ls_shell.percent_reflns_obs               98.25 
_refine_ls_shell.R_factor_R_free                  0.397 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             142 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4UHX 
_struct.title                     'Human aldehyde oxidase in complex with phthalazine and thioridazine' 
_struct.pdbx_descriptor           'ALDEHYDE OXIDASE (E.C.1.2.3.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4UHX 
_struct_keywords.pdbx_keywords   OXIDOREDUCTASE 
_struct_keywords.text            
'OXIDOREDUCTASE, ALDEHYDE OXIDASE, DRUG METABOLISM, MOLYBDENUM ENZYMES, XANTHINE OXIDASE, PHTHALAZINE, THIORIDAZINE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 2  ? 
D N N 3  ? 
E N N 4  ? 
F N N 5  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 9  ? 
L N N 10 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  MET A 26   ? LYS A 34   ? MET A 26   LYS A 34   1 ? 9  
HELX_P HELX_P2  2  CYS A 74   ? ILE A 76   ? CYS A 74   ILE A 76   5 ? 3  
HELX_P HELX_P3  3  ILE A 78   ? TYR A 82   ? ILE A 78   TYR A 82   5 ? 5  
HELX_P HELX_P4  4  THR A 88   ? GLY A 93   ? THR A 88   GLY A 93   1 ? 6  
HELX_P HELX_P5  5  HIS A 100  ? CYS A 109  ? HIS A 100  CYS A 109  1 ? 10 
HELX_P HELX_P6  6  CYS A 117  ? HIS A 132  ? CYS A 117  HIS A 132  1 ? 16 
HELX_P HELX_P7  7  THR A 136  ? LEU A 144  ? THR A 136  LEU A 144  1 ? 9  
HELX_P HELX_P8  8  GLY A 145  ? ASN A 147  ? GLY A 145  ASN A 147  5 ? 3  
HELX_P HELX_P9  9  TYR A 154  ? PHE A 164  ? TYR A 154  PHE A 164  1 ? 11 
HELX_P HELX_P10 10 ASP A 211  ? GLU A 215  ? ASP A 211  GLU A 215  5 ? 5  
HELX_P HELX_P11 11 PRO A 219  ? LYS A 228  ? PRO A 219  LYS A 228  1 ? 10 
HELX_P HELX_P12 12 THR A 248  ? TYR A 259  ? THR A 248  TYR A 259  1 ? 12 
HELX_P HELX_P13 13 SER A 270  ? LYS A 278  ? SER A 270  LYS A 278  1 ? 9  
HELX_P HELX_P14 14 ILE A 291  ? SER A 295  ? ILE A 291  SER A 295  5 ? 5  
HELX_P HELX_P15 15 SER A 311  ? LEU A 326  ? SER A 311  LEU A 326  1 ? 16 
HELX_P HELX_P16 16 THR A 331  ? LEU A 344  ? THR A 331  LEU A 344  1 ? 14 
HELX_P HELX_P17 17 GLY A 346  ? ALA A 353  ? GLY A 346  ALA A 353  1 ? 8  
HELX_P HELX_P18 18 SER A 354  ? ARG A 362  ? SER A 354  ARG A 362  1 ? 9  
HELX_P HELX_P19 19 LEU A 368  ? GLY A 375  ? LEU A 368  GLY A 375  1 ? 8  
HELX_P HELX_P20 20 ASN A 393  ? SER A 398  ? ASN A 393  SER A 398  1 ? 6  
HELX_P HELX_P21 21 CYS A 400  ? ASP A 404  ? CYS A 400  ASP A 404  5 ? 5  
HELX_P HELX_P22 22 ALA A 473  ? ILE A 481  ? ALA A 473  ILE A 481  1 ? 9  
HELX_P HELX_P23 23 ASN A 486  ? VAL A 501  ? ASN A 486  VAL A 501  1 ? 16 
HELX_P HELX_P24 24 LYS A 511  ? ASP A 538  ? LYS A 511  ASP A 538  1 ? 28 
HELX_P HELX_P25 25 TYR A 549  ? LEU A 553  ? TYR A 549  LEU A 553  5 ? 5  
HELX_P HELX_P26 26 SER A 588  ? THR A 594  ? SER A 588  THR A 594  1 ? 7  
HELX_P HELX_P27 27 TYR A 599  ? MET A 603  ? TYR A 599  MET A 603  5 ? 5  
HELX_P HELX_P28 28 LEU A 629  ? MET A 635  ? LEU A 629  MET A 635  1 ? 7  
HELX_P HELX_P29 29 THR A 643  ? SER A 648  ? THR A 643  SER A 648  1 ? 6  
HELX_P HELX_P30 30 ASP A 649  ? ASN A 651  ? ASP A 649  ASN A 651  5 ? 3  
HELX_P HELX_P31 31 SER A 682  ? LYS A 691  ? SER A 682  LYS A 691  1 ? 10 
HELX_P HELX_P32 32 THR A 706  ? ILE A 711  ? THR A 706  ILE A 711  1 ? 6  
HELX_P HELX_P33 33 ASN A 727  ? LYS A 733  ? ASN A 727  LYS A 733  1 ? 7  
HELX_P HELX_P34 34 PHE A 777  ? LYS A 790  ? PHE A 777  LYS A 790  1 ? 14 
HELX_P HELX_P35 35 PRO A 792  ? ASN A 794  ? PRO A 792  ASN A 794  5 ? 3  
HELX_P HELX_P36 36 VAL A 811  ? GLY A 829  ? VAL A 811  GLY A 829  1 ? 19 
HELX_P HELX_P37 37 GLU A 837  ? THR A 845  ? GLU A 837  THR A 845  1 ? 9  
HELX_P HELX_P38 38 SER A 883  ? MET A 894  ? SER A 883  MET A 894  1 ? 12 
HELX_P HELX_P39 39 GLY A 924  ? GLY A 944  ? GLY A 924  GLY A 944  1 ? 21 
HELX_P HELX_P40 40 SER A 946  ? ASN A 954  ? SER A 946  ASN A 954  1 ? 9  
HELX_P HELX_P41 41 ALA A 970  ? SER A 985  ? ALA A 970  SER A 985  1 ? 16 
HELX_P HELX_P42 42 SER A 985  ? ASN A 1000 ? SER A 985  ASN A 1000 1 ? 16 
HELX_P HELX_P43 43 GLY A 1050 ? ARG A 1064 ? GLY A 1050 ARG A 1064 1 ? 15 
HELX_P HELX_P44 44 PRO A 1066 ? SER A 1068 ? PRO A 1066 SER A 1068 5 ? 3  
HELX_P HELX_P45 45 VAL A 1090 ? ASN A 1117 ? VAL A 1090 ASN A 1117 1 ? 28 
HELX_P HELX_P46 46 THR A 1121 ? GLU A 1132 ? THR A 1121 GLU A 1132 1 ? 12 
HELX_P HELX_P47 47 ASN A 1196 ? THR A 1216 ? ASN A 1196 THR A 1216 1 ? 21 
HELX_P HELX_P48 48 ARG A 1231 ? GLN A 1235 ? ARG A 1231 GLN A 1235 5 ? 5  
HELX_P HELX_P49 49 THR A 1261 ? SER A 1264 ? THR A 1261 SER A 1264 5 ? 4  
HELX_P HELX_P50 50 GLU A 1270 ? LEU A 1275 ? GLU A 1270 LEU A 1275 5 ? 6  
HELX_P HELX_P51 51 GLY A 1276 ? GLY A 1295 ? GLY A 1276 GLY A 1295 1 ? 20 
HELX_P HELX_P52 52 THR A 1307 ? CYS A 1315 ? THR A 1307 CYS A 1315 1 ? 9  
HELX_P HELX_P53 53 ASP A 1317 ? ILE A 1323 ? ASP A 1317 ILE A 1323 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 49  SG    ? ? ? 1_555 C FES . FE1 ? ? A CYS 49   A FES 3002 1_555 ? ? ? ? ? ? ? 2.184 ? 
metalc2 metalc ? ? A CYS 52  SG    ? ? ? 1_555 C FES . FE2 ? ? A CYS 52   A FES 3002 1_555 ? ? ? ? ? ? ? 2.211 ? 
metalc3 metalc ? ? A CYS 74  SG    ? ? ? 1_555 C FES . FE2 ? ? A CYS 74   A FES 3002 1_555 ? ? ? ? ? ? ? 2.565 ? 
metalc4 metalc ? ? A CYS 114 SG    ? ? ? 1_555 B FES . FE2 ? ? A CYS 114  A FES 3001 1_555 ? ? ? ? ? ? ? 2.330 ? 
metalc5 metalc ? ? A CYS 117 SG    ? ? ? 1_555 B FES . FE1 ? ? A CYS 117  A FES 3001 1_555 ? ? ? ? ? ? ? 2.129 ? 
metalc6 metalc ? ? A CYS 149 SG    ? ? ? 1_555 B FES . FE1 ? ? A CYS 149  A FES 3001 1_555 ? ? ? ? ? ? ? 2.385 ? 
metalc7 metalc ? ? A CYS 151 SG    ? ? ? 1_555 B FES . FE2 ? ? A CYS 151  A FES 3001 1_555 ? ? ? ? ? ? ? 2.523 ? 
metalc8 metalc ? ? D MTE .   "S1'" ? ? ? 1_555 E MOS . MO  ? ? A MTE 3003 A MOS 3004 1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc9 metalc ? ? D MTE .   "S2'" ? ? ? 1_555 E MOS . MO  ? ? A MTE 3003 A MOS 3004 1_555 ? ? ? ? ? ? ? 2.451 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ILE 570  A . ? ILE 570  A GLY 571  A ? GLY 571  A 1 -2.27 
2 GLU 701  A . ? GLU 701  A PRO 702  A ? PRO 702  A 1 -4.14 
3 SER 1304 A . ? SER 1304 A PRO 1305 A ? PRO 1305 A 1 -0.23 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 5 ? 
AB ? 3 ? 
AC ? 5 ? 
AD ? 4 ? 
AE ? 5 ? 
AF ? 8 ? 
AG ? 3 ? 
AH ? 5 ? 
AI ? 2 ? 
AJ ? 4 ? 
AK ? 2 ? 
AL ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AA 3 4 ? anti-parallel 
AA 4 5 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? parallel      
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AC 4 5 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AD 3 4 ? anti-parallel 
AE 1 2 ? parallel      
AE 2 3 ? parallel      
AE 3 4 ? anti-parallel 
AE 4 5 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? parallel      
AF 4 5 ? anti-parallel 
AF 5 6 ? anti-parallel 
AF 6 7 ? parallel      
AF 7 8 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? parallel      
AH 3 4 ? anti-parallel 
AH 4 5 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? parallel      
AJ 2 3 ? anti-parallel 
AJ 3 4 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 ARG A 14   ? LYS A 19   ? ARG A 14   LYS A 19   
AA 2 GLU A 6    ? VAL A 11   ? GLU A 6    VAL A 11   
AA 3 ALA A 85   ? THR A 87   ? ALA A 85   THR A 87   
AA 4 THR A 53   ? ASN A 60   ? THR A 53   ASN A 60   
AA 5 ARG A 65   ? ASN A 72   ? ARG A 65   ASN A 72   
AB 1 ARG A 234  ? GLY A 237  ? ARG A 234  GLY A 237  
AB 2 MET A 242  ? SER A 245  ? MET A 242  SER A 245  
AB 3 VAL A 284  ? ILE A 286  ? VAL A 284  ILE A 286  
AC 1 VAL A 297  ? HIS A 299  ? VAL A 297  HIS A 299  
AC 2 GLY A 303  ? GLY A 307  ? GLY A 303  GLY A 307  
AC 3 ILE A 410  ? PRO A 417  ? ILE A 410  PRO A 417  
AC 4 THR A 378  ? SER A 383  ? THR A 378  SER A 383  
AC 5 GLY A 386  ? PRO A 391  ? GLY A 386  PRO A 391  
AD 1 GLU A 423  ? ALA A 431  ? GLU A 423  ALA A 431  
AD 2 ALA A 439  ? PHE A 448  ? ALA A 439  PHE A 448  
AD 3 GLU A 458  ? GLY A 464  ? GLU A 458  GLY A 464  
AD 4 ILE A 471  ? CYS A 472  ? ILE A 471  CYS A 472  
AE 1 CYS A 562  ? LYS A 566  ? CYS A 562  LYS A 566  
AE 2 GLU A 1247 ? LEU A 1252 ? GLU A 1247 LEU A 1252 
AE 3 HIS A 1180 ? MET A 1189 ? HIS A 1180 MET A 1189 
AE 4 TYR A 1161 ? ASP A 1174 ? TYR A 1161 ASP A 1174 
AE 5 LYS A 1003 ? VAL A 1016 ? LYS A 1003 VAL A 1016 
AF 1 VAL A 638  ? MET A 642  ? VAL A 638  MET A 642  
AF 2 LEU A 674  ? ALA A 680  ? LEU A 674  ALA A 680  
AF 3 LEU A 610  ? THR A 616  ? LEU A 610  THR A 616  
AF 4 VAL A 832  ? VAL A 835  ? VAL A 832  VAL A 835  
AF 5 SER A 757  ? PRO A 762  ? SER A 757  PRO A 762  
AF 6 MET A 769  ? VAL A 773  ? MET A 769  VAL A 773  
AF 7 VAL A 796  ? VAL A 800  ? VAL A 796  VAL A 800  
AF 8 THR A 1075 ? SER A 1076 ? THR A 1075 SER A 1076 
AG 1 LYS A 667  ? VAL A 668  ? LYS A 667  VAL A 668  
AG 2 ALA A 622  ? ASP A 628  ? ALA A 622  ASP A 628  
AG 3 LYS A 694  ? ASP A 699  ? LYS A 694  ASP A 699  
AH 1 ARG A 721  ? TYR A 725  ? ARG A 721  TYR A 725  
AH 2 LEU A 903  ? ARG A 911  ? LEU A 903  ARG A 911  
AH 3 ILE A 865  ? GLY A 877  ? ILE A 865  GLY A 877  
AH 4 TYR A 851  ? PHE A 859  ? TYR A 851  PHE A 859  
AH 5 GLN A 737  ? MET A 745  ? GLN A 737  MET A 745  
AI 1 ILE A 959  ? GLN A 961  ? ILE A 959  GLN A 961  
AI 2 GLU A 967  ? ASN A 969  ? GLU A 967  ASN A 969  
AJ 1 VAL A 1070 ? HIS A 1071 ? VAL A 1070 HIS A 1071 
AJ 2 VAL A 1038 ? HIS A 1042 ? VAL A 1038 HIS A 1042 
AJ 3 ALA A 1026 ? ILE A 1032 ? ALA A 1026 ILE A 1032 
AJ 4 SER A 1137 ? PHE A 1142 ? SER A 1137 PHE A 1142 
AK 1 MET A 1149 ? ASN A 1150 ? MET A 1149 ASN A 1150 
AK 2 GLU A 1155 ? GLY A 1156 ? GLU A 1155 GLY A 1156 
AL 1 ASN A 1221 ? TYR A 1222 ? ASN A 1221 TYR A 1222 
AL 2 LEU A 1228 ? HIS A 1229 ? LEU A 1228 HIS A 1229 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N GLU A 18   ? N GLU A 18   O LEU A 7    ? O LEU A 7    
AA 2 3 O TYR A 10   ? O TYR A 10   N VAL A 86   ? N VAL A 86   
AA 3 4 N THR A 87   ? N THR A 87   O MET A 55   ? O MET A 55   
AA 4 5 N ASN A 60   ? N ASN A 60   O ARG A 65   ? O ARG A 65   
AB 1 2 N PHE A 236  ? N PHE A 236  O TRP A 243  ? O TRP A 243  
AB 2 3 N PHE A 244  ? N PHE A 244  O ILE A 285  ? O ILE A 285  
AC 1 2 N ASN A 298  ? N ASN A 298  O THR A 305  ? O THR A 305  
AC 2 3 N LEU A 306  ? N LEU A 306  O VAL A 414  ? O VAL A 414  
AC 3 4 N ASN A 415  ? N ASN A 415  O THR A 378  ? O THR A 378  
AC 4 5 N SER A 383  ? N SER A 383  O GLY A 386  ? O GLY A 386  
AD 1 2 O GLN A 430  ? O GLN A 430  N ILE A 440  ? N ILE A 440  
AD 2 3 N PHE A 448  ? N PHE A 448  O GLU A 458  ? O GLU A 458  
AD 3 4 N TYR A 463  ? N TYR A 463  O ILE A 471  ? O ILE A 471  
AE 1 2 N THR A 564  ? N THR A 564  O LEU A 1248 ? O LEU A 1248 
AE 2 3 N GLU A 1247 ? N GLU A 1247 O ILE A 1183 ? O ILE A 1183 
AE 3 4 N VAL A 1188 ? N VAL A 1188 O ALA A 1166 ? O ALA A 1166 
AE 4 5 N ILE A 1173 ? N ILE A 1173 O LYS A 1004 ? O LYS A 1004 
AF 1 2 N MET A 642  ? N MET A 642  O ALA A 677  ? O ALA A 677  
AF 2 3 N ALA A 680  ? N ALA A 680  O PHE A 611  ? O PHE A 611  
AF 3 4 N LEU A 612  ? N LEU A 612  O ARG A 833  ? O ARG A 833  
AF 4 5 N CYS A 834  ? N CYS A 834  O MET A 758  ? O MET A 758  
AF 5 6 N VAL A 761  ? N VAL A 761  O ASP A 770  ? O ASP A 770  
AF 6 7 N VAL A 771  ? N VAL A 771  O MET A 797  ? O MET A 797  
AF 7 8 N VAL A 800  ? N VAL A 800  O THR A 1075 ? O THR A 1075 
AG 1 2 N VAL A 668  ? N VAL A 668  O ALA A 622  ? O ALA A 622  
AG 2 3 N ASP A 628  ? N ASP A 628  O LYS A 694  ? O LYS A 694  
AH 1 2 N TYR A 725  ? N TYR A 725  O LEU A 903  ? O LEU A 903  
AH 2 3 N ARG A 904  ? N ARG A 904  O LEU A 868  ? O LEU A 868  
AH 3 4 N TYR A 873  ? N TYR A 873  O LEU A 852  ? O LEU A 852  
AH 4 5 N PHE A 859  ? N PHE A 859  O GLN A 737  ? O GLN A 737  
AI 1 2 N ASP A 960  ? N ASP A 960  O ILE A 968  ? O ILE A 968  
AJ 1 2 N HIS A 1071 ? N HIS A 1071 O VAL A 1038 ? O VAL A 1038 
AJ 2 3 N THR A 1041 ? N THR A 1041 O LEU A 1029 ? O LEU A 1029 
AJ 3 4 N VAL A 1030 ? N VAL A 1030 O ALA A 1138 ? O ALA A 1138 
AK 1 2 N ASN A 1150 ? N ASN A 1150 O GLU A 1155 ? O GLU A 1155 
AL 1 2 N ASN A 1221 ? N ASN A 1221 O HIS A 1229 ? O HIS A 1229 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE FES A 3001' 
AC2 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE FES A 3002' 
AC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE MTE A 3003' 
AC4 Software ? ? ? ? 8  'BINDING SITE FOR RESIDUE MOS A 3004' 
AC5 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE FAD A 3006' 
AC6 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE LZU A 3008' 
AC7 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MLI A 3010' 
AC8 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MLI A 3011' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  GLN A 113  ? GLN A 113  . ? 1_555 ? 
2  AC1 8  CYS A 114  ? CYS A 114  . ? 1_555 ? 
3  AC1 8  GLY A 115  ? GLY A 115  . ? 1_555 ? 
4  AC1 8  CYS A 117  ? CYS A 117  . ? 1_555 ? 
5  AC1 8  CYS A 149  ? CYS A 149  . ? 1_555 ? 
6  AC1 8  ARG A 150  ? ARG A 150  . ? 1_555 ? 
7  AC1 8  CYS A 151  ? CYS A 151  . ? 1_555 ? 
8  AC1 8  MET A 753  ? MET A 753  . ? 1_555 ? 
9  AC2 8  GLY A 43   ? GLY A 43   . ? 1_555 ? 
10 AC2 8  CYS A 44   ? CYS A 44   . ? 1_555 ? 
11 AC2 8  GLY A 47   ? GLY A 47   . ? 1_555 ? 
12 AC2 8  GLY A 48   ? GLY A 48   . ? 1_555 ? 
13 AC2 8  CYS A 49   ? CYS A 49   . ? 1_555 ? 
14 AC2 8  GLY A 50   ? GLY A 50   . ? 1_555 ? 
15 AC2 8  CYS A 52   ? CYS A 52   . ? 1_555 ? 
16 AC2 8  CYS A 74   ? CYS A 74   . ? 1_555 ? 
17 AC3 17 GLN A 113  ? GLN A 113  . ? 1_555 ? 
18 AC3 17 CYS A 151  ? CYS A 151  . ? 1_555 ? 
19 AC3 17 ALA A 806  ? ALA A 806  . ? 1_555 ? 
20 AC3 17 PHE A 807  ? PHE A 807  . ? 1_555 ? 
21 AC3 17 ARG A 921  ? ARG A 921  . ? 1_555 ? 
22 AC3 17 MET A 1047 ? MET A 1047 . ? 1_555 ? 
23 AC3 17 GLY A 1048 ? GLY A 1048 . ? 1_555 ? 
24 AC3 17 GLN A 1049 ? GLN A 1049 . ? 1_555 ? 
25 AC3 17 GLY A 1087 ? GLY A 1087 . ? 1_555 ? 
26 AC3 17 GLY A 1088 ? GLY A 1088 . ? 1_555 ? 
27 AC3 17 SER A 1089 ? SER A 1089 . ? 1_555 ? 
28 AC3 17 VAL A 1090 ? VAL A 1090 . ? 1_555 ? 
29 AC3 17 VAL A 1091 ? VAL A 1091 . ? 1_555 ? 
30 AC3 17 ALA A 1092 ? ALA A 1092 . ? 1_555 ? 
31 AC3 17 GLN A 1203 ? GLN A 1203 . ? 1_555 ? 
32 AC3 17 LEU A 1268 ? LEU A 1268 . ? 1_555 ? 
33 AC3 17 MOS E .    ? MOS A 3004 . ? 1_555 ? 
34 AC4 8  GLN A 776  ? GLN A 776  . ? 1_555 ? 
35 AC4 8  GLY A 808  ? GLY A 808  . ? 1_555 ? 
36 AC4 8  PHE A 920  ? PHE A 920  . ? 1_555 ? 
37 AC4 8  ARG A 921  ? ARG A 921  . ? 1_555 ? 
38 AC4 8  GLY A 1087 ? GLY A 1087 . ? 1_555 ? 
39 AC4 8  GLY A 1088 ? GLY A 1088 . ? 1_555 ? 
40 AC4 8  GLU A 1270 ? GLU A 1270 . ? 1_555 ? 
41 AC4 8  MTE D .    ? MTE A 3003 . ? 1_555 ? 
42 AC5 23 GLY A 46   ? GLY A 46   . ? 1_555 ? 
43 AC5 23 GLY A 47   ? GLY A 47   . ? 1_555 ? 
44 AC5 23 PRO A 263  ? PRO A 263  . ? 1_555 ? 
45 AC5 23 VAL A 264  ? VAL A 264  . ? 1_555 ? 
46 AC5 23 ILE A 265  ? ILE A 265  . ? 1_555 ? 
47 AC5 23 MET A 266  ? MET A 266  . ? 1_555 ? 
48 AC5 23 GLY A 267  ? GLY A 267  . ? 1_555 ? 
49 AC5 23 ASN A 268  ? ASN A 268  . ? 1_555 ? 
50 AC5 23 THR A 269  ? THR A 269  . ? 1_555 ? 
51 AC5 23 SER A 270  ? SER A 270  . ? 1_555 ? 
52 AC5 23 VAL A 271  ? VAL A 271  . ? 1_555 ? 
53 AC5 23 LEU A 344  ? LEU A 344  . ? 1_555 ? 
54 AC5 23 ALA A 345  ? ALA A 345  . ? 1_555 ? 
55 AC5 23 ALA A 353  ? ALA A 353  . ? 1_555 ? 
56 AC5 23 SER A 354  ? SER A 354  . ? 1_555 ? 
57 AC5 23 GLY A 357  ? GLY A 357  . ? 1_555 ? 
58 AC5 23 HIS A 358  ? HIS A 358  . ? 1_555 ? 
59 AC5 23 ILE A 360  ? ILE A 360  . ? 1_555 ? 
60 AC5 23 HIS A 363  ? HIS A 363  . ? 1_555 ? 
61 AC5 23 SER A 366  ? SER A 366  . ? 1_555 ? 
62 AC5 23 ASP A 367  ? ASP A 367  . ? 1_555 ? 
63 AC5 23 LEU A 411  ? LEU A 411  . ? 1_555 ? 
64 AC5 23 LEU A 438  ? LEU A 438  . ? 1_555 ? 
65 AC6 10 ASN A 475  ? ASN A 475  . ? 3_454 ? 
66 AC6 10 HIS A 575  ? HIS A 575  . ? 1_555 ? 
67 AC6 10 GLU A 577  ? GLU A 577  . ? 1_555 ? 
68 AC6 10 ASP A 578  ? ASP A 578  . ? 1_555 ? 
69 AC6 10 SER A 1060 ? SER A 1060 . ? 1_555 ? 
70 AC6 10 ARG A 1061 ? ARG A 1061 . ? 1_555 ? 
71 AC6 10 ARG A 1064 ? ARG A 1064 . ? 1_555 ? 
72 AC6 10 MET A 1065 ? MET A 1065 . ? 1_555 ? 
73 AC6 10 PRO A 1066 ? PRO A 1066 . ? 1_555 ? 
74 AC6 10 TRP A 1125 ? TRP A 1125 . ? 1_555 ? 
75 AC7 7  ARG A 32   ? ARG A 32   . ? 1_555 ? 
76 AC7 7  LYS A 33   ? LYS A 33   . ? 1_555 ? 
77 AC7 7  THR A 38   ? THR A 38   . ? 1_555 ? 
78 AC7 7  ASP A 601  ? ASP A 601  . ? 1_555 ? 
79 AC7 7  MET A 603  ? MET A 603  . ? 1_555 ? 
80 AC7 7  PRO A 604  ? PRO A 604  . ? 1_555 ? 
81 AC7 7  LEU A 605  ? LEU A 605  . ? 1_555 ? 
82 AC8 6  LEU A 148  ? LEU A 148  . ? 1_555 ? 
83 AC8 6  ARG A 433  ? ARG A 433  . ? 1_555 ? 
84 AC8 6  PHE A 751  ? PHE A 751  . ? 1_555 ? 
85 AC8 6  TYR A 1236 ? TYR A 1236 . ? 1_555 ? 
86 AC8 6  LYS A 1237 ? LYS A 1237 . ? 1_555 ? 
87 AC8 6  ILE A 1238 ? ILE A 1238 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4UHX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4UHX 
_atom_sites.fract_transf_matrix[1][1]   0.006724 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006724 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007530 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
FE 
MO 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . ALA A 1  4    ? -65.362 -52.933 -59.088 1.00 95.41  ? 4    ALA A N     1 
ATOM   2     C  CA    . ALA A 1  4    ? -66.022 -52.916 -60.431 1.00 95.62  ? 4    ALA A CA    1 
ATOM   3     C  C     . ALA A 1  4    ? -66.273 -51.490 -60.945 1.00 93.82  ? 4    ALA A C     1 
ATOM   4     O  O     . ALA A 1  4    ? -66.032 -51.210 -62.122 1.00 94.04  ? 4    ALA A O     1 
ATOM   5     C  CB    . ALA A 1  4    ? -67.328 -53.711 -60.392 1.00 96.94  ? 4    ALA A CB    1 
ATOM   6     N  N     . SER A 1  5    ? -66.739 -50.599 -60.068 1.00 91.56  ? 5    SER A N     1 
ATOM   7     C  CA    . SER A 1  5    ? -67.144 -49.244 -60.471 1.00 89.58  ? 5    SER A CA    1 
ATOM   8     C  C     . SER A 1  5    ? -65.975 -48.374 -60.923 1.00 86.60  ? 5    SER A C     1 
ATOM   9     O  O     . SER A 1  5    ? -64.821 -48.629 -60.575 1.00 85.05  ? 5    SER A O     1 
ATOM   10    C  CB    . SER A 1  5    ? -67.882 -48.524 -59.337 1.00 89.43  ? 5    SER A CB    1 
ATOM   11    O  OG    . SER A 1  5    ? -68.879 -49.348 -58.760 1.00 90.42  ? 5    SER A OG    1 
ATOM   12    N  N     . GLU A 1  6    ? -66.305 -47.350 -61.710 1.00 85.60  ? 6    GLU A N     1 
ATOM   13    C  CA    . GLU A 1  6    ? -65.352 -46.339 -62.162 1.00 83.76  ? 6    GLU A CA    1 
ATOM   14    C  C     . GLU A 1  6    ? -65.477 -45.102 -61.291 1.00 81.02  ? 6    GLU A C     1 
ATOM   15    O  O     . GLU A 1  6    ? -66.560 -44.794 -60.783 1.00 81.48  ? 6    GLU A O     1 
ATOM   16    C  CB    . GLU A 1  6    ? -65.625 -45.955 -63.613 1.00 85.45  ? 6    GLU A CB    1 
ATOM   17    C  CG    . GLU A 1  6    ? -65.489 -47.119 -64.582 1.00 88.28  ? 6    GLU A CG    1 
ATOM   18    C  CD    . GLU A 1  6    ? -65.663 -46.723 -66.038 1.00 90.07  ? 6    GLU A CD    1 
ATOM   19    O  OE1   . GLU A 1  6    ? -66.012 -45.555 -66.327 1.00 91.35  ? 6    GLU A OE1   1 
ATOM   20    O  OE2   . GLU A 1  6    ? -65.452 -47.601 -66.900 1.00 91.81  ? 6    GLU A OE2   1 
ATOM   21    N  N     . LEU A 1  7    ? -64.360 -44.406 -61.111 1.00 77.00  ? 7    LEU A N     1 
ATOM   22    C  CA    . LEU A 1  7    ? -64.340 -43.147 -60.382 1.00 74.54  ? 7    LEU A CA    1 
ATOM   23    C  C     . LEU A 1  7    ? -64.264 -42.016 -61.404 1.00 73.83  ? 7    LEU A C     1 
ATOM   24    O  O     . LEU A 1  7    ? -63.223 -41.808 -62.029 1.00 73.31  ? 7    LEU A O     1 
ATOM   25    C  CB    . LEU A 1  7    ? -63.159 -43.104 -59.410 1.00 72.13  ? 7    LEU A CB    1 
ATOM   26    C  CG    . LEU A 1  7    ? -62.852 -41.785 -58.700 1.00 70.40  ? 7    LEU A CG    1 
ATOM   27    C  CD1   . LEU A 1  7    ? -64.087 -41.144 -58.085 1.00 70.48  ? 7    LEU A CD1   1 
ATOM   28    C  CD2   . LEU A 1  7    ? -61.790 -42.044 -57.647 1.00 69.75  ? 7    LEU A CD2   1 
ATOM   29    N  N     . LEU A 1  8    ? -65.385 -41.318 -61.580 1.00 73.26  ? 8    LEU A N     1 
ATOM   30    C  CA    . LEU A 1  8    ? -65.494 -40.190 -62.491 1.00 72.44  ? 8    LEU A CA    1 
ATOM   31    C  C     . LEU A 1  8    ? -65.621 -38.899 -61.684 1.00 70.99  ? 8    LEU A C     1 
ATOM   32    O  O     . LEU A 1  8    ? -66.534 -38.751 -60.863 1.00 71.27  ? 8    LEU A O     1 
ATOM   33    C  CB    . LEU A 1  8    ? -66.707 -40.371 -63.408 1.00 74.62  ? 8    LEU A CB    1 
ATOM   34    C  CG    . LEU A 1  8    ? -66.787 -39.501 -64.674 1.00 75.97  ? 8    LEU A CG    1 
ATOM   35    C  CD1   . LEU A 1  8    ? -67.824 -40.071 -65.639 1.00 77.46  ? 8    LEU A CD1   1 
ATOM   36    C  CD2   . LEU A 1  8    ? -67.088 -38.034 -64.363 1.00 75.80  ? 8    LEU A CD2   1 
ATOM   37    N  N     . PHE A 1  9    ? -64.693 -37.974 -61.915 1.00 68.19  ? 9    PHE A N     1 
ATOM   38    C  CA    . PHE A 1  9    ? -64.803 -36.618 -61.385 1.00 66.60  ? 9    PHE A CA    1 
ATOM   39    C  C     . PHE A 1  9    ? -64.074 -35.650 -62.303 1.00 65.33  ? 9    PHE A C     1 
ATOM   40    O  O     . PHE A 1  9    ? -63.534 -36.062 -63.329 1.00 65.43  ? 9    PHE A O     1 
ATOM   41    C  CB    . PHE A 1  9    ? -64.312 -36.545 -59.924 1.00 65.68  ? 9    PHE A CB    1 
ATOM   42    C  CG    . PHE A 1  9    ? -62.845 -36.840 -59.729 1.00 63.92  ? 9    PHE A CG    1 
ATOM   43    C  CD1   . PHE A 1  9    ? -62.382 -38.151 -59.701 1.00 64.01  ? 9    PHE A CD1   1 
ATOM   44    C  CD2   . PHE A 1  9    ? -61.935 -35.811 -59.513 1.00 62.66  ? 9    PHE A CD2   1 
ATOM   45    C  CE1   . PHE A 1  9    ? -61.038 -38.427 -59.498 1.00 62.85  ? 9    PHE A CE1   1 
ATOM   46    C  CE2   . PHE A 1  9    ? -60.591 -36.084 -59.311 1.00 61.82  ? 9    PHE A CE2   1 
ATOM   47    C  CZ    . PHE A 1  9    ? -60.143 -37.393 -59.305 1.00 62.05  ? 9    PHE A CZ    1 
ATOM   48    N  N     . TYR A 1  10   ? -64.105 -34.366 -61.957 1.00 64.75  ? 10   TYR A N     1 
ATOM   49    C  CA    . TYR A 1  10   ? -63.428 -33.333 -62.731 1.00 64.01  ? 10   TYR A CA    1 
ATOM   50    C  C     . TYR A 1  10   ? -62.357 -32.632 -61.906 1.00 62.44  ? 10   TYR A C     1 
ATOM   51    O  O     . TYR A 1  10   ? -62.489 -32.494 -60.689 1.00 61.00  ? 10   TYR A O     1 
ATOM   52    C  CB    . TYR A 1  10   ? -64.440 -32.309 -63.245 1.00 65.24  ? 10   TYR A CB    1 
ATOM   53    C  CG    . TYR A 1  10   ? -65.103 -32.697 -64.551 1.00 66.90  ? 10   TYR A CG    1 
ATOM   54    C  CD1   . TYR A 1  10   ? -65.898 -33.843 -64.654 1.00 67.66  ? 10   TYR A CD1   1 
ATOM   55    C  CD2   . TYR A 1  10   ? -64.942 -31.911 -65.689 1.00 67.28  ? 10   TYR A CD2   1 
ATOM   56    C  CE1   . TYR A 1  10   ? -66.507 -34.187 -65.852 1.00 68.09  ? 10   TYR A CE1   1 
ATOM   57    C  CE2   . TYR A 1  10   ? -65.547 -32.245 -66.890 1.00 67.70  ? 10   TYR A CE2   1 
ATOM   58    C  CZ    . TYR A 1  10   ? -66.328 -33.380 -66.968 1.00 68.39  ? 10   TYR A CZ    1 
ATOM   59    O  OH    . TYR A 1  10   ? -66.922 -33.690 -68.166 1.00 69.88  ? 10   TYR A OH    1 
ATOM   60    N  N     . VAL A 1  11   ? -61.294 -32.209 -62.592 1.00 61.75  ? 11   VAL A N     1 
ATOM   61    C  CA    . VAL A 1  11   ? -60.236 -31.386 -62.019 1.00 59.99  ? 11   VAL A CA    1 
ATOM   62    C  C     . VAL A 1  11   ? -59.945 -30.277 -63.018 1.00 59.99  ? 11   VAL A C     1 
ATOM   63    O  O     . VAL A 1  11   ? -59.585 -30.559 -64.158 1.00 59.67  ? 11   VAL A O     1 
ATOM   64    C  CB    . VAL A 1  11   ? -58.955 -32.203 -61.751 1.00 59.02  ? 11   VAL A CB    1 
ATOM   65    C  CG1   . VAL A 1  11   ? -57.852 -31.320 -61.176 1.00 57.97  ? 11   VAL A CG1   1 
ATOM   66    C  CG2   . VAL A 1  11   ? -59.260 -33.351 -60.806 1.00 59.43  ? 11   VAL A CG2   1 
ATOM   67    N  N     . ASN A 1  12   ? -60.117 -29.025 -62.596 1.00 60.95  ? 12   ASN A N     1 
ATOM   68    C  CA    . ASN A 1  12   ? -59.888 -27.856 -63.456 1.00 61.68  ? 12   ASN A CA    1 
ATOM   69    C  C     . ASN A 1  12   ? -60.586 -27.976 -64.809 1.00 62.58  ? 12   ASN A C     1 
ATOM   70    O  O     . ASN A 1  12   ? -59.960 -27.857 -65.860 1.00 62.95  ? 12   ASN A O     1 
ATOM   71    C  CB    . ASN A 1  12   ? -58.384 -27.615 -63.642 1.00 60.57  ? 12   ASN A CB    1 
ATOM   72    C  CG    . ASN A 1  12   ? -57.669 -27.363 -62.335 1.00 60.23  ? 12   ASN A CG    1 
ATOM   73    O  OD1   . ASN A 1  12   ? -58.244 -26.816 -61.402 1.00 60.73  ? 12   ASN A OD1   1 
ATOM   74    N  ND2   . ASN A 1  12   ? -56.402 -27.754 -62.263 1.00 60.47  ? 12   ASN A ND2   1 
ATOM   75    N  N     . GLY A 1  13   ? -61.880 -28.269 -64.763 1.00 64.30  ? 13   GLY A N     1 
ATOM   76    C  CA    . GLY A 1  13   ? -62.699 -28.377 -65.965 1.00 66.41  ? 13   GLY A CA    1 
ATOM   77    C  C     . GLY A 1  13   ? -62.562 -29.641 -66.802 1.00 68.02  ? 13   GLY A C     1 
ATOM   78    O  O     . GLY A 1  13   ? -63.387 -29.864 -67.678 1.00 69.34  ? 13   GLY A O     1 
ATOM   79    N  N     . ARG A 1  14   ? -61.562 -30.483 -66.534 1.00 69.86  ? 14   ARG A N     1 
ATOM   80    C  CA    . ARG A 1  14   ? -61.274 -31.648 -67.374 1.00 72.42  ? 14   ARG A CA    1 
ATOM   81    C  C     . ARG A 1  14   ? -61.702 -32.946 -66.696 1.00 71.74  ? 14   ARG A C     1 
ATOM   82    O  O     . ARG A 1  14   ? -61.407 -33.158 -65.517 1.00 70.67  ? 14   ARG A O     1 
ATOM   83    C  CB    . ARG A 1  14   ? -59.782 -31.710 -67.710 1.00 74.35  ? 14   ARG A CB    1 
ATOM   84    C  CG    . ARG A 1  14   ? -59.298 -30.541 -68.550 1.00 78.14  ? 14   ARG A CG    1 
ATOM   85    C  CD    . ARG A 1  14   ? -57.827 -30.694 -68.921 1.00 81.81  ? 14   ARG A CD    1 
ATOM   86    N  NE    . ARG A 1  14   ? -57.244 -29.448 -69.436 1.00 85.39  ? 14   ARG A NE    1 
ATOM   87    C  CZ    . ARG A 1  14   ? -56.864 -28.399 -68.697 1.00 87.28  ? 14   ARG A CZ    1 
ATOM   88    N  NH1   . ARG A 1  14   ? -56.992 -28.397 -67.364 1.00 88.14  ? 14   ARG A NH1   1 
ATOM   89    N  NH2   . ARG A 1  14   ? -56.350 -27.327 -69.299 1.00 88.03  ? 14   ARG A NH2   1 
ATOM   90    N  N     . LYS A 1  15   ? -62.378 -33.809 -67.459 1.00 71.84  ? 15   LYS A N     1 
ATOM   91    C  CA    . LYS A 1  15   ? -62.856 -35.103 -66.973 1.00 72.13  ? 15   LYS A CA    1 
ATOM   92    C  C     . LYS A 1  15   ? -61.692 -35.987 -66.545 1.00 70.38  ? 15   LYS A C     1 
ATOM   93    O  O     . LYS A 1  15   ? -60.637 -35.981 -67.174 1.00 70.50  ? 15   LYS A O     1 
ATOM   94    C  CB    . LYS A 1  15   ? -63.666 -35.816 -68.061 1.00 74.59  ? 15   LYS A CB    1 
ATOM   95    C  CG    . LYS A 1  15   ? -64.305 -37.137 -67.635 1.00 76.47  ? 15   LYS A CG    1 
ATOM   96    C  CD    . LYS A 1  15   ? -64.767 -37.968 -68.826 1.00 78.71  ? 15   LYS A CD    1 
ATOM   97    C  CE    . LYS A 1  15   ? -66.204 -37.683 -69.216 1.00 80.64  ? 15   LYS A CE    1 
ATOM   98    N  NZ    . LYS A 1  15   ? -66.647 -38.498 -70.380 1.00 82.69  ? 15   LYS A NZ    1 
ATOM   99    N  N     . VAL A 1  16   ? -61.901 -36.730 -65.464 1.00 69.61  ? 16   VAL A N     1 
ATOM   100   C  CA    . VAL A 1  16   ? -60.922 -37.665 -64.928 1.00 69.14  ? 16   VAL A CA    1 
ATOM   101   C  C     . VAL A 1  16   ? -61.645 -38.975 -64.679 1.00 70.27  ? 16   VAL A C     1 
ATOM   102   O  O     . VAL A 1  16   ? -62.630 -38.996 -63.946 1.00 70.96  ? 16   VAL A O     1 
ATOM   103   C  CB    . VAL A 1  16   ? -60.322 -37.141 -63.605 1.00 68.65  ? 16   VAL A CB    1 
ATOM   104   C  CG1   . VAL A 1  16   ? -59.560 -38.234 -62.856 1.00 68.38  ? 16   VAL A CG1   1 
ATOM   105   C  CG2   . VAL A 1  16   ? -59.422 -35.942 -63.875 1.00 68.24  ? 16   VAL A CG2   1 
ATOM   106   N  N     . ILE A 1  17   ? -61.158 -40.053 -65.291 1.00 71.01  ? 17   ILE A N     1 
ATOM   107   C  CA    . ILE A 1  17   ? -61.687 -41.400 -65.074 1.00 71.30  ? 17   ILE A CA    1 
ATOM   108   C  C     . ILE A 1  17   ? -60.572 -42.295 -64.548 1.00 71.27  ? 17   ILE A C     1 
ATOM   109   O  O     . ILE A 1  17   ? -59.502 -42.372 -65.147 1.00 70.76  ? 17   ILE A O     1 
ATOM   110   C  CB    . ILE A 1  17   ? -62.284 -41.996 -66.368 1.00 71.60  ? 17   ILE A CB    1 
ATOM   111   C  CG1   . ILE A 1  17   ? -63.561 -41.234 -66.737 1.00 72.62  ? 17   ILE A CG1   1 
ATOM   112   C  CG2   . ILE A 1  17   ? -62.556 -43.493 -66.203 1.00 72.46  ? 17   ILE A CG2   1 
ATOM   113   C  CD1   . ILE A 1  17   ? -64.306 -41.786 -67.935 1.00 74.14  ? 17   ILE A CD1   1 
ATOM   114   N  N     . GLU A 1  18   ? -60.835 -42.962 -63.428 1.00 73.40  ? 18   GLU A N     1 
ATOM   115   C  CA    . GLU A 1  18   ? -59.946 -43.982 -62.887 1.00 75.65  ? 18   GLU A CA    1 
ATOM   116   C  C     . GLU A 1  18   ? -60.706 -45.297 -62.795 1.00 78.26  ? 18   GLU A C     1 
ATOM   117   O  O     . GLU A 1  18   ? -61.768 -45.375 -62.169 1.00 79.81  ? 18   GLU A O     1 
ATOM   118   C  CB    . GLU A 1  18   ? -59.416 -43.574 -61.507 1.00 75.74  ? 18   GLU A CB    1 
ATOM   119   C  CG    . GLU A 1  18   ? -58.317 -42.514 -61.536 1.00 75.44  ? 18   GLU A CG    1 
ATOM   120   C  CD    . GLU A 1  18   ? -57.011 -42.988 -62.164 1.00 75.78  ? 18   GLU A CD    1 
ATOM   121   O  OE1   . GLU A 1  18   ? -56.818 -44.209 -62.359 1.00 77.07  ? 18   GLU A OE1   1 
ATOM   122   O  OE2   . GLU A 1  18   ? -56.162 -42.124 -62.465 1.00 75.43  ? 18   GLU A OE2   1 
ATOM   123   N  N     . LYS A 1  19   ? -60.156 -46.321 -63.437 1.00 80.02  ? 19   LYS A N     1 
ATOM   124   C  CA    . LYS A 1  19   ? -60.728 -47.659 -63.429 1.00 82.82  ? 19   LYS A CA    1 
ATOM   125   C  C     . LYS A 1  19   ? -59.908 -48.507 -62.470 1.00 81.62  ? 19   LYS A C     1 
ATOM   126   O  O     . LYS A 1  19   ? -58.681 -48.365 -62.409 1.00 80.94  ? 19   LYS A O     1 
ATOM   127   C  CB    . LYS A 1  19   ? -60.701 -48.253 -64.840 1.00 85.51  ? 19   LYS A CB    1 
ATOM   128   C  CG    . LYS A 1  19   ? -61.646 -47.568 -65.820 1.00 87.28  ? 19   LYS A CG    1 
ATOM   129   C  CD    . LYS A 1  19   ? -61.313 -47.924 -67.262 1.00 89.46  ? 19   LYS A CD    1 
ATOM   130   C  CE    . LYS A 1  19   ? -62.536 -47.838 -68.162 1.00 91.33  ? 19   LYS A CE    1 
ATOM   131   N  NZ    . LYS A 1  19   ? -62.217 -48.173 -69.577 1.00 92.44  ? 19   LYS A NZ    1 
ATOM   132   N  N     . ASN A 1  20   ? -60.591 -49.374 -61.720 1.00 81.55  ? 20   ASN A N     1 
ATOM   133   C  CA    . ASN A 1  20   ? -59.967 -50.211 -60.688 1.00 81.27  ? 20   ASN A CA    1 
ATOM   134   C  C     . ASN A 1  20   ? -59.121 -49.378 -59.715 1.00 78.42  ? 20   ASN A C     1 
ATOM   135   O  O     . ASN A 1  20   ? -57.988 -49.735 -59.398 1.00 79.55  ? 20   ASN A O     1 
ATOM   136   C  CB    . ASN A 1  20   ? -59.129 -51.328 -61.332 1.00 82.07  ? 20   ASN A CB    1 
ATOM   137   C  CG    . ASN A 1  20   ? -59.911 -52.121 -62.368 1.00 84.99  ? 20   ASN A CG    1 
ATOM   138   O  OD1   . ASN A 1  20   ? -61.009 -52.611 -62.095 1.00 86.97  ? 20   ASN A OD1   1 
ATOM   139   N  ND2   . ASN A 1  20   ? -59.349 -52.245 -63.568 1.00 85.52  ? 20   ASN A ND2   1 
ATOM   140   N  N     . VAL A 1  21   ? -59.685 -48.264 -59.254 1.00 75.49  ? 21   VAL A N     1 
ATOM   141   C  CA    . VAL A 1  21   ? -58.944 -47.297 -58.448 1.00 73.35  ? 21   VAL A CA    1 
ATOM   142   C  C     . VAL A 1  21   ? -58.628 -47.835 -57.050 1.00 72.42  ? 21   VAL A C     1 
ATOM   143   O  O     . VAL A 1  21   ? -59.437 -48.543 -56.453 1.00 72.15  ? 21   VAL A O     1 
ATOM   144   C  CB    . VAL A 1  21   ? -59.690 -45.942 -58.345 1.00 73.63  ? 21   VAL A CB    1 
ATOM   145   C  CG1   . VAL A 1  21   ? -60.917 -46.035 -57.442 1.00 75.09  ? 21   VAL A CG1   1 
ATOM   146   C  CG2   . VAL A 1  21   ? -58.756 -44.841 -57.857 1.00 72.49  ? 21   VAL A CG2   1 
ATOM   147   N  N     . ASP A 1  22   ? -57.438 -47.500 -56.556 1.00 71.02  ? 22   ASP A N     1 
ATOM   148   C  CA    . ASP A 1  22   ? -57.037 -47.805 -55.188 1.00 70.75  ? 22   ASP A CA    1 
ATOM   149   C  C     . ASP A 1  22   ? -57.792 -46.810 -54.287 1.00 70.74  ? 22   ASP A C     1 
ATOM   150   O  O     . ASP A 1  22   ? -57.615 -45.596 -54.445 1.00 69.96  ? 22   ASP A O     1 
ATOM   151   C  CB    . ASP A 1  22   ? -55.512 -47.655 -55.044 1.00 69.61  ? 22   ASP A CB    1 
ATOM   152   C  CG    . ASP A 1  22   ? -54.975 -48.099 -53.674 1.00 69.95  ? 22   ASP A CG    1 
ATOM   153   O  OD1   . ASP A 1  22   ? -55.744 -48.588 -52.815 1.00 70.44  ? 22   ASP A OD1   1 
ATOM   154   O  OD2   . ASP A 1  22   ? -53.750 -47.953 -53.460 1.00 69.32  ? 22   ASP A OD2   1 
ATOM   155   N  N     . PRO A 1  23   ? -58.656 -47.309 -53.370 1.00 70.79  ? 23   PRO A N     1 
ATOM   156   C  CA    . PRO A 1  23   ? -59.413 -46.394 -52.496 1.00 70.22  ? 23   PRO A CA    1 
ATOM   157   C  C     . PRO A 1  23   ? -58.589 -45.622 -51.456 1.00 68.25  ? 23   PRO A C     1 
ATOM   158   O  O     . PRO A 1  23   ? -59.068 -44.603 -50.948 1.00 67.86  ? 23   PRO A O     1 
ATOM   159   C  CB    . PRO A 1  23   ? -60.422 -47.316 -51.794 1.00 72.18  ? 23   PRO A CB    1 
ATOM   160   C  CG    . PRO A 1  23   ? -60.440 -48.575 -52.590 1.00 73.18  ? 23   PRO A CG    1 
ATOM   161   C  CD    . PRO A 1  23   ? -59.057 -48.710 -53.139 1.00 72.09  ? 23   PRO A CD    1 
ATOM   162   N  N     . GLU A 1  24   ? -57.378 -46.097 -51.154 1.00 66.24  ? 24   GLU A N     1 
ATOM   163   C  CA    . GLU A 1  24   ? -56.433 -45.373 -50.287 1.00 64.17  ? 24   GLU A CA    1 
ATOM   164   C  C     . GLU A 1  24   ? -55.744 -44.166 -50.952 1.00 62.17  ? 24   GLU A C     1 
ATOM   165   O  O     . GLU A 1  24   ? -54.978 -43.468 -50.289 1.00 61.33  ? 24   GLU A O     1 
ATOM   166   C  CB    . GLU A 1  24   ? -55.365 -46.331 -49.741 1.00 63.73  ? 24   GLU A CB    1 
ATOM   167   C  CG    . GLU A 1  24   ? -55.890 -47.306 -48.705 1.00 64.88  ? 24   GLU A CG    1 
ATOM   168   C  CD    . GLU A 1  24   ? -54.835 -48.298 -48.260 1.00 65.38  ? 24   GLU A CD    1 
ATOM   169   O  OE1   . GLU A 1  24   ? -54.405 -49.130 -49.094 1.00 65.95  ? 24   GLU A OE1   1 
ATOM   170   O  OE2   . GLU A 1  24   ? -54.436 -48.257 -47.076 1.00 64.60  ? 24   GLU A OE2   1 
ATOM   171   N  N     . THR A 1  25   ? -56.001 -43.916 -52.237 1.00 61.47  ? 25   THR A N     1 
ATOM   172   C  CA    . THR A 1  25   ? -55.421 -42.765 -52.927 1.00 61.33  ? 25   THR A CA    1 
ATOM   173   C  C     . THR A 1  25   ? -56.025 -41.456 -52.418 1.00 62.77  ? 25   THR A C     1 
ATOM   174   O  O     . THR A 1  25   ? -57.247 -41.285 -52.428 1.00 64.53  ? 25   THR A O     1 
ATOM   175   C  CB    . THR A 1  25   ? -55.639 -42.848 -54.454 1.00 60.72  ? 25   THR A CB    1 
ATOM   176   O  OG1   . THR A 1  25   ? -55.162 -44.107 -54.936 1.00 60.92  ? 25   THR A OG1   1 
ATOM   177   C  CG2   . THR A 1  25   ? -54.910 -41.715 -55.184 1.00 59.34  ? 25   THR A CG2   1 
ATOM   178   N  N     . MET A 1  26   ? -55.158 -40.543 -51.982 1.00 63.35  ? 26   MET A N     1 
ATOM   179   C  CA    . MET A 1  26   ? -55.563 -39.217 -51.515 1.00 63.55  ? 26   MET A CA    1 
ATOM   180   C  C     . MET A 1  26   ? -55.401 -38.189 -52.624 1.00 61.17  ? 26   MET A C     1 
ATOM   181   O  O     . MET A 1  26   ? -54.599 -38.379 -53.535 1.00 60.78  ? 26   MET A O     1 
ATOM   182   C  CB    . MET A 1  26   ? -54.740 -38.822 -50.289 1.00 65.08  ? 26   MET A CB    1 
ATOM   183   C  CG    . MET A 1  26   ? -54.940 -39.757 -49.103 1.00 67.29  ? 26   MET A CG    1 
ATOM   184   S  SD    . MET A 1  26   ? -56.621 -39.709 -48.447 1.00 70.76  ? 26   MET A SD    1 
ATOM   185   C  CE    . MET A 1  26   ? -56.694 -41.318 -47.658 1.00 71.95  ? 26   MET A CE    1 
ATOM   186   N  N     . LEU A 1  27   ? -56.164 -37.100 -52.531 1.00 60.36  ? 27   LEU A N     1 
ATOM   187   C  CA    . LEU A 1  27   ? -56.238 -36.105 -53.606 1.00 60.09  ? 27   LEU A CA    1 
ATOM   188   C  C     . LEU A 1  27   ? -54.927 -35.350 -53.819 1.00 59.45  ? 27   LEU A C     1 
ATOM   189   O  O     . LEU A 1  27   ? -54.535 -35.122 -54.963 1.00 60.80  ? 27   LEU A O     1 
ATOM   190   C  CB    . LEU A 1  27   ? -57.384 -35.110 -53.369 1.00 60.10  ? 27   LEU A CB    1 
ATOM   191   C  CG    . LEU A 1  27   ? -57.573 -33.989 -54.408 1.00 60.18  ? 27   LEU A CG    1 
ATOM   192   C  CD1   . LEU A 1  27   ? -57.794 -34.534 -55.812 1.00 60.66  ? 27   LEU A CD1   1 
ATOM   193   C  CD2   . LEU A 1  27   ? -58.724 -33.080 -54.011 1.00 60.64  ? 27   LEU A CD2   1 
ATOM   194   N  N     . LEU A 1  28   ? -54.263 -34.962 -52.731 1.00 58.67  ? 28   LEU A N     1 
ATOM   195   C  CA    . LEU A 1  28   ? -53.014 -34.194 -52.827 1.00 57.88  ? 28   LEU A CA    1 
ATOM   196   C  C     . LEU A 1  28   ? -51.931 -34.949 -53.616 1.00 56.75  ? 28   LEU A C     1 
ATOM   197   O  O     . LEU A 1  28   ? -51.385 -34.391 -54.563 1.00 55.67  ? 28   LEU A O     1 
ATOM   198   C  CB    . LEU A 1  28   ? -52.520 -33.726 -51.439 1.00 57.55  ? 28   LEU A CB    1 
ATOM   199   C  CG    . LEU A 1  28   ? -51.122 -33.101 -51.342 1.00 57.04  ? 28   LEU A CG    1 
ATOM   200   C  CD1   . LEU A 1  28   ? -51.025 -31.877 -52.239 1.00 56.95  ? 28   LEU A CD1   1 
ATOM   201   C  CD2   . LEU A 1  28   ? -50.785 -32.735 -49.905 1.00 57.41  ? 28   LEU A CD2   1 
ATOM   202   N  N     . PRO A 1  29   ? -51.633 -36.214 -53.243 1.00 56.89  ? 29   PRO A N     1 
ATOM   203   C  CA    . PRO A 1  29   ? -50.752 -37.031 -54.094 1.00 56.95  ? 29   PRO A CA    1 
ATOM   204   C  C     . PRO A 1  29   ? -51.256 -37.216 -55.523 1.00 56.81  ? 29   PRO A C     1 
ATOM   205   O  O     . PRO A 1  29   ? -50.464 -37.118 -56.458 1.00 57.45  ? 29   PRO A O     1 
ATOM   206   C  CB    . PRO A 1  29   ? -50.725 -38.385 -53.382 1.00 57.11  ? 29   PRO A CB    1 
ATOM   207   C  CG    . PRO A 1  29   ? -50.973 -38.060 -51.965 1.00 57.43  ? 29   PRO A CG    1 
ATOM   208   C  CD    . PRO A 1  29   ? -51.894 -36.877 -51.953 1.00 57.21  ? 29   PRO A CD    1 
ATOM   209   N  N     . TYR A 1  30   ? -52.552 -37.479 -55.682 1.00 56.42  ? 30   TYR A N     1 
ATOM   210   C  CA    . TYR A 1  30   ? -53.130 -37.717 -57.004 1.00 56.76  ? 30   TYR A CA    1 
ATOM   211   C  C     . TYR A 1  30   ? -52.932 -36.522 -57.935 1.00 57.02  ? 30   TYR A C     1 
ATOM   212   O  O     . TYR A 1  30   ? -52.480 -36.690 -59.070 1.00 56.92  ? 30   TYR A O     1 
ATOM   213   C  CB    . TYR A 1  30   ? -54.620 -38.044 -56.898 1.00 57.23  ? 30   TYR A CB    1 
ATOM   214   C  CG    . TYR A 1  30   ? -55.219 -38.459 -58.212 1.00 56.80  ? 30   TYR A CG    1 
ATOM   215   C  CD1   . TYR A 1  30   ? -55.099 -39.766 -58.662 1.00 57.24  ? 30   TYR A CD1   1 
ATOM   216   C  CD2   . TYR A 1  30   ? -55.890 -37.543 -59.019 1.00 56.95  ? 30   TYR A CD2   1 
ATOM   217   C  CE1   . TYR A 1  30   ? -55.638 -40.158 -59.878 1.00 58.00  ? 30   TYR A CE1   1 
ATOM   218   C  CE2   . TYR A 1  30   ? -56.430 -37.922 -60.241 1.00 57.81  ? 30   TYR A CE2   1 
ATOM   219   C  CZ    . TYR A 1  30   ? -56.302 -39.230 -60.668 1.00 57.79  ? 30   TYR A CZ    1 
ATOM   220   O  OH    . TYR A 1  30   ? -56.837 -39.614 -61.873 1.00 57.56  ? 30   TYR A OH    1 
ATOM   221   N  N     . LEU A 1  31   ? -53.270 -35.329 -57.448 1.00 57.49  ? 31   LEU A N     1 
ATOM   222   C  CA    . LEU A 1  31   ? -53.085 -34.088 -58.212 1.00 58.25  ? 31   LEU A CA    1 
ATOM   223   C  C     . LEU A 1  31   ? -51.641 -33.915 -58.676 1.00 57.44  ? 31   LEU A C     1 
ATOM   224   O  O     . LEU A 1  31   ? -51.385 -33.698 -59.859 1.00 57.95  ? 31   LEU A O     1 
ATOM   225   C  CB    . LEU A 1  31   ? -53.487 -32.864 -57.380 1.00 59.04  ? 31   LEU A CB    1 
ATOM   226   C  CG    . LEU A 1  31   ? -54.979 -32.666 -57.097 1.00 60.17  ? 31   LEU A CG    1 
ATOM   227   C  CD1   . LEU A 1  31   ? -55.187 -31.686 -55.951 1.00 60.19  ? 31   LEU A CD1   1 
ATOM   228   C  CD2   . LEU A 1  31   ? -55.713 -32.197 -58.341 1.00 60.68  ? 31   LEU A CD2   1 
ATOM   229   N  N     . ARG A 1  32   ? -50.709 -34.040 -57.739 1.00 56.21  ? 32   ARG A N     1 
ATOM   230   C  CA    . ARG A 1  32   ? -49.297 -33.768 -58.003 1.00 56.14  ? 32   ARG A CA    1 
ATOM   231   C  C     . ARG A 1  32   ? -48.629 -34.839 -58.872 1.00 56.78  ? 32   ARG A C     1 
ATOM   232   O  O     . ARG A 1  32   ? -47.884 -34.514 -59.799 1.00 55.67  ? 32   ARG A O     1 
ATOM   233   C  CB    . ARG A 1  32   ? -48.529 -33.617 -56.683 1.00 55.08  ? 32   ARG A CB    1 
ATOM   234   C  CG    . ARG A 1  32   ? -48.999 -32.453 -55.812 1.00 54.42  ? 32   ARG A CG    1 
ATOM   235   C  CD    . ARG A 1  32   ? -48.281 -32.418 -54.470 1.00 53.36  ? 32   ARG A CD    1 
ATOM   236   N  NE    . ARG A 1  32   ? -46.838 -32.382 -54.662 1.00 52.63  ? 32   ARG A NE    1 
ATOM   237   C  CZ    . ARG A 1  32   ? -46.140 -31.328 -55.078 1.00 51.97  ? 32   ARG A CZ    1 
ATOM   238   N  NH1   . ARG A 1  32   ? -46.727 -30.159 -55.339 1.00 52.17  ? 32   ARG A NH1   1 
ATOM   239   N  NH2   . ARG A 1  32   ? -44.827 -31.445 -55.234 1.00 51.75  ? 32   ARG A NH2   1 
ATOM   240   N  N     . LYS A 1  33   ? -48.900 -36.108 -58.570 1.00 58.37  ? 33   LYS A N     1 
ATOM   241   C  CA    . LYS A 1  33   ? -48.200 -37.219 -59.207 1.00 59.61  ? 33   LYS A CA    1 
ATOM   242   C  C     . LYS A 1  33   ? -48.921 -37.727 -60.447 1.00 60.33  ? 33   LYS A C     1 
ATOM   243   O  O     . LYS A 1  33   ? -48.294 -37.878 -61.504 1.00 61.85  ? 33   LYS A O     1 
ATOM   244   C  CB    . LYS A 1  33   ? -47.937 -38.350 -58.206 1.00 60.82  ? 33   LYS A CB    1 
ATOM   245   C  CG    . LYS A 1  33   ? -46.854 -37.975 -57.207 1.00 62.15  ? 33   LYS A CG    1 
ATOM   246   C  CD    . LYS A 1  33   ? -46.608 -39.011 -56.121 1.00 64.47  ? 33   LYS A CD    1 
ATOM   247   C  CE    . LYS A 1  33   ? -45.575 -38.467 -55.131 1.00 67.04  ? 33   LYS A CE    1 
ATOM   248   N  NZ    . LYS A 1  33   ? -45.062 -39.439 -54.116 1.00 68.33  ? 33   LYS A NZ    1 
ATOM   249   N  N     . LYS A 1  34   ? -50.222 -37.983 -60.336 1.00 60.01  ? 34   LYS A N     1 
ATOM   250   C  CA    . LYS A 1  34   ? -50.958 -38.564 -61.460 1.00 60.94  ? 34   LYS A CA    1 
ATOM   251   C  C     . LYS A 1  34   ? -51.398 -37.517 -62.482 1.00 59.61  ? 34   LYS A C     1 
ATOM   252   O  O     . LYS A 1  34   ? -51.294 -37.761 -63.679 1.00 59.22  ? 34   LYS A O     1 
ATOM   253   C  CB    . LYS A 1  34   ? -52.147 -39.405 -60.981 1.00 62.74  ? 34   LYS A CB    1 
ATOM   254   C  CG    . LYS A 1  34   ? -52.940 -40.107 -62.085 1.00 65.58  ? 34   LYS A CG    1 
ATOM   255   C  CD    . LYS A 1  34   ? -52.086 -40.926 -63.051 1.00 66.88  ? 34   LYS A CD    1 
ATOM   256   C  CE    . LYS A 1  34   ? -52.928 -41.608 -64.118 1.00 68.10  ? 34   LYS A CE    1 
ATOM   257   N  NZ    . LYS A 1  34   ? -53.579 -42.840 -63.602 1.00 70.01  ? 34   LYS A NZ    1 
ATOM   258   N  N     . LEU A 1  35   ? -51.882 -36.363 -62.024 1.00 59.15  ? 35   LEU A N     1 
ATOM   259   C  CA    . LEU A 1  35   ? -52.304 -35.288 -62.938 1.00 58.59  ? 35   LEU A CA    1 
ATOM   260   C  C     . LEU A 1  35   ? -51.213 -34.266 -63.262 1.00 56.23  ? 35   LEU A C     1 
ATOM   261   O  O     . LEU A 1  35   ? -51.414 -33.421 -64.132 1.00 56.05  ? 35   LEU A O     1 
ATOM   262   C  CB    . LEU A 1  35   ? -53.539 -34.563 -62.392 1.00 59.38  ? 35   LEU A CB    1 
ATOM   263   C  CG    . LEU A 1  35   ? -54.786 -35.404 -62.087 1.00 60.46  ? 35   LEU A CG    1 
ATOM   264   C  CD1   . LEU A 1  35   ? -55.947 -34.490 -61.710 1.00 60.95  ? 35   LEU A CD1   1 
ATOM   265   C  CD2   . LEU A 1  35   ? -55.171 -36.304 -63.254 1.00 60.52  ? 35   LEU A CD2   1 
ATOM   266   N  N     . ARG A 1  36   ? -50.074 -34.338 -62.575 1.00 54.45  ? 36   ARG A N     1 
ATOM   267   C  CA    . ARG A 1  36   ? -48.958 -33.403 -62.786 1.00 53.96  ? 36   ARG A CA    1 
ATOM   268   C  C     . ARG A 1  36   ? -49.349 -31.944 -62.505 1.00 53.47  ? 36   ARG A C     1 
ATOM   269   O  O     . ARG A 1  36   ? -48.916 -31.031 -63.201 1.00 55.37  ? 36   ARG A O     1 
ATOM   270   C  CB    . ARG A 1  36   ? -48.334 -33.563 -64.195 1.00 53.58  ? 36   ARG A CB    1 
ATOM   271   C  CG    . ARG A 1  36   ? -47.471 -34.803 -64.375 1.00 52.74  ? 36   ARG A CG    1 
ATOM   272   C  CD    . ARG A 1  36   ? -48.273 -36.093 -64.470 1.00 52.95  ? 36   ARG A CD    1 
ATOM   273   N  NE    . ARG A 1  36   ? -47.417 -37.199 -64.891 1.00 53.06  ? 36   ARG A NE    1 
ATOM   274   C  CZ    . ARG A 1  36   ? -47.795 -38.471 -65.021 1.00 53.74  ? 36   ARG A CZ    1 
ATOM   275   N  NH1   . ARG A 1  36   ? -49.038 -38.864 -64.752 1.00 54.41  ? 36   ARG A NH1   1 
ATOM   276   N  NH2   . ARG A 1  36   ? -46.904 -39.372 -65.420 1.00 53.52  ? 36   ARG A NH2   1 
ATOM   277   N  N     . LEU A 1  37   ? -50.160 -31.741 -61.469 1.00 52.51  ? 37   LEU A N     1 
ATOM   278   C  CA    . LEU A 1  37   ? -50.599 -30.413 -61.050 1.00 52.24  ? 37   LEU A CA    1 
ATOM   279   C  C     . LEU A 1  37   ? -49.971 -30.112 -59.688 1.00 52.56  ? 37   LEU A C     1 
ATOM   280   O  O     . LEU A 1  37   ? -50.583 -30.318 -58.635 1.00 54.39  ? 37   LEU A O     1 
ATOM   281   C  CB    . LEU A 1  37   ? -52.128 -30.352 -60.998 1.00 52.18  ? 37   LEU A CB    1 
ATOM   282   C  CG    . LEU A 1  37   ? -52.845 -30.510 -62.342 1.00 51.80  ? 37   LEU A CG    1 
ATOM   283   C  CD1   . LEU A 1  37   ? -54.296 -30.897 -62.128 1.00 51.86  ? 37   LEU A CD1   1 
ATOM   284   C  CD2   . LEU A 1  37   ? -52.732 -29.240 -63.171 1.00 51.81  ? 37   LEU A CD2   1 
ATOM   285   N  N     . THR A 1  38   ? -48.739 -29.609 -59.732 1.00 51.93  ? 38   THR A N     1 
ATOM   286   C  CA    . THR A 1  38   ? -47.889 -29.470 -58.547 1.00 50.77  ? 38   THR A CA    1 
ATOM   287   C  C     . THR A 1  38   ? -48.047 -28.139 -57.789 1.00 50.55  ? 38   THR A C     1 
ATOM   288   O  O     . THR A 1  38   ? -47.310 -27.882 -56.830 1.00 49.60  ? 38   THR A O     1 
ATOM   289   C  CB    . THR A 1  38   ? -46.398 -29.699 -58.917 1.00 49.61  ? 38   THR A CB    1 
ATOM   290   O  OG1   . THR A 1  38   ? -45.960 -28.706 -59.847 1.00 47.96  ? 38   THR A OG1   1 
ATOM   291   C  CG2   . THR A 1  38   ? -46.205 -31.068 -59.536 1.00 49.92  ? 38   THR A CG2   1 
ATOM   292   N  N     . GLY A 1  39   ? -48.999 -27.303 -58.205 1.00 50.86  ? 39   GLY A N     1 
ATOM   293   C  CA    . GLY A 1  39   ? -49.292 -26.041 -57.515 1.00 51.44  ? 39   GLY A CA    1 
ATOM   294   C  C     . GLY A 1  39   ? -49.848 -26.227 -56.111 1.00 51.77  ? 39   GLY A C     1 
ATOM   295   O  O     . GLY A 1  39   ? -49.497 -25.488 -55.200 1.00 52.10  ? 39   GLY A O     1 
ATOM   296   N  N     . THR A 1  40   ? -50.722 -27.214 -55.942 1.00 52.04  ? 40   THR A N     1 
ATOM   297   C  CA    . THR A 1  40   ? -51.197 -27.624 -54.626 1.00 52.07  ? 40   THR A CA    1 
ATOM   298   C  C     . THR A 1  40   ? -50.046 -28.304 -53.870 1.00 52.77  ? 40   THR A C     1 
ATOM   299   O  O     . THR A 1  40   ? -49.493 -29.292 -54.346 1.00 53.05  ? 40   THR A O     1 
ATOM   300   C  CB    . THR A 1  40   ? -52.388 -28.584 -54.769 1.00 52.35  ? 40   THR A CB    1 
ATOM   301   O  OG1   . THR A 1  40   ? -53.302 -28.065 -55.744 1.00 53.01  ? 40   THR A OG1   1 
ATOM   302   C  CG2   . THR A 1  40   ? -53.104 -28.757 -53.457 1.00 52.37  ? 40   THR A CG2   1 
ATOM   303   N  N     . LYS A 1  41   ? -49.691 -27.764 -52.701 1.00 53.97  ? 41   LYS A N     1 
ATOM   304   C  CA    . LYS A 1  41   ? -48.467 -28.136 -51.980 1.00 53.72  ? 41   LYS A CA    1 
ATOM   305   C  C     . LYS A 1  41   ? -48.720 -28.979 -50.739 1.00 54.02  ? 41   LYS A C     1 
ATOM   306   O  O     . LYS A 1  41   ? -49.807 -28.946 -50.169 1.00 54.38  ? 41   LYS A O     1 
ATOM   307   C  CB    . LYS A 1  41   ? -47.728 -26.871 -51.519 1.00 54.00  ? 41   LYS A CB    1 
ATOM   308   C  CG    . LYS A 1  41   ? -47.440 -25.829 -52.592 1.00 54.20  ? 41   LYS A CG    1 
ATOM   309   C  CD    . LYS A 1  41   ? -46.696 -26.403 -53.786 1.00 54.46  ? 41   LYS A CD    1 
ATOM   310   C  CE    . LYS A 1  41   ? -46.263 -25.293 -54.728 1.00 55.44  ? 41   LYS A CE    1 
ATOM   311   N  NZ    . LYS A 1  41   ? -45.873 -25.756 -56.089 1.00 55.77  ? 41   LYS A NZ    1 
ATOM   312   N  N     . TYR A 1  42   ? -47.688 -29.713 -50.320 1.00 54.85  ? 42   TYR A N     1 
ATOM   313   C  CA    . TYR A 1  42   ? -47.656 -30.362 -49.010 1.00 55.68  ? 42   TYR A CA    1 
ATOM   314   C  C     . TYR A 1  42   ? -46.969 -29.421 -48.037 1.00 56.86  ? 42   TYR A C     1 
ATOM   315   O  O     . TYR A 1  42   ? -45.831 -29.018 -48.267 1.00 55.80  ? 42   TYR A O     1 
ATOM   316   C  CB    . TYR A 1  42   ? -46.890 -31.694 -49.043 1.00 54.90  ? 42   TYR A CB    1 
ATOM   317   C  CG    . TYR A 1  42   ? -46.726 -32.324 -47.671 1.00 55.32  ? 42   TYR A CG    1 
ATOM   318   C  CD1   . TYR A 1  42   ? -45.642 -31.991 -46.854 1.00 55.81  ? 42   TYR A CD1   1 
ATOM   319   C  CD2   . TYR A 1  42   ? -47.669 -33.230 -47.173 1.00 55.98  ? 42   TYR A CD2   1 
ATOM   320   C  CE1   . TYR A 1  42   ? -45.496 -32.545 -45.586 1.00 56.67  ? 42   TYR A CE1   1 
ATOM   321   C  CE2   . TYR A 1  42   ? -47.525 -33.798 -45.908 1.00 56.78  ? 42   TYR A CE2   1 
ATOM   322   C  CZ    . TYR A 1  42   ? -46.435 -33.452 -45.117 1.00 57.26  ? 42   TYR A CZ    1 
ATOM   323   O  OH    . TYR A 1  42   ? -46.271 -34.002 -43.857 1.00 57.92  ? 42   TYR A OH    1 
ATOM   324   N  N     . GLY A 1  43   ? -47.654 -29.110 -46.941 1.00 60.12  ? 43   GLY A N     1 
ATOM   325   C  CA    . GLY A 1  43   ? -47.081 -28.329 -45.840 1.00 62.99  ? 43   GLY A CA    1 
ATOM   326   C  C     . GLY A 1  43   ? -46.955 -29.126 -44.552 1.00 65.66  ? 43   GLY A C     1 
ATOM   327   O  O     . GLY A 1  43   ? -45.873 -29.178 -43.962 1.00 67.69  ? 43   GLY A O     1 
ATOM   328   N  N     . CYS A 1  44   ? -48.060 -29.736 -44.113 1.00 67.70  ? 44   CYS A N     1 
ATOM   329   C  CA    . CYS A 1  44   ? -48.103 -30.456 -42.827 1.00 69.43  ? 44   CYS A CA    1 
ATOM   330   C  C     . CYS A 1  44   ? -48.879 -31.790 -42.800 1.00 69.60  ? 44   CYS A C     1 
ATOM   331   O  O     . CYS A 1  44   ? -48.615 -32.616 -41.928 1.00 70.73  ? 44   CYS A O     1 
ATOM   332   C  CB    . CYS A 1  44   ? -48.570 -29.509 -41.700 1.00 70.14  ? 44   CYS A CB    1 
ATOM   333   S  SG    . CYS A 1  44   ? -50.350 -29.400 -41.400 1.00 71.91  ? 44   CYS A SG    1 
ATOM   334   N  N     . GLY A 1  45   ? -49.818 -32.012 -43.719 1.00 69.45  ? 45   GLY A N     1 
ATOM   335   C  CA    . GLY A 1  45   ? -50.488 -33.313 -43.841 1.00 70.32  ? 45   GLY A CA    1 
ATOM   336   C  C     . GLY A 1  45   ? -51.513 -33.668 -42.766 1.00 71.82  ? 45   GLY A C     1 
ATOM   337   O  O     . GLY A 1  45   ? -51.857 -34.846 -42.599 1.00 71.22  ? 45   GLY A O     1 
ATOM   338   N  N     . GLY A 1  46   ? -51.991 -32.661 -42.031 1.00 71.97  ? 46   GLY A N     1 
ATOM   339   C  CA    . GLY A 1  46   ? -53.088 -32.831 -41.079 1.00 71.30  ? 46   GLY A CA    1 
ATOM   340   C  C     . GLY A 1  46   ? -54.195 -31.795 -41.186 1.00 70.56  ? 46   GLY A C     1 
ATOM   341   O  O     . GLY A 1  46   ? -55.037 -31.730 -40.302 1.00 72.24  ? 46   GLY A O     1 
ATOM   342   N  N     . GLY A 1  47   ? -54.214 -30.998 -42.257 1.00 69.38  ? 47   GLY A N     1 
ATOM   343   C  CA    . GLY A 1  47   ? -55.236 -29.957 -42.450 1.00 69.20  ? 47   GLY A CA    1 
ATOM   344   C  C     . GLY A 1  47   ? -54.995 -28.634 -41.731 1.00 68.71  ? 47   GLY A C     1 
ATOM   345   O  O     . GLY A 1  47   ? -55.895 -27.787 -41.676 1.00 69.90  ? 47   GLY A O     1 
ATOM   346   N  N     . GLY A 1  48   ? -53.784 -28.438 -41.206 1.00 66.39  ? 48   GLY A N     1 
ATOM   347   C  CA    . GLY A 1  48   ? -53.486 -27.323 -40.307 1.00 64.84  ? 48   GLY A CA    1 
ATOM   348   C  C     . GLY A 1  48   ? -53.054 -26.026 -40.970 1.00 63.40  ? 48   GLY A C     1 
ATOM   349   O  O     . GLY A 1  48   ? -53.420 -24.941 -40.508 1.00 64.18  ? 48   GLY A O     1 
ATOM   350   N  N     . CYS A 1  49   ? -52.277 -26.139 -42.049 1.00 61.36  ? 49   CYS A N     1 
ATOM   351   C  CA    . CYS A 1  49   ? -51.588 -24.994 -42.657 1.00 59.42  ? 49   CYS A CA    1 
ATOM   352   C  C     . CYS A 1  49   ? -52.255 -24.418 -43.902 1.00 57.17  ? 49   CYS A C     1 
ATOM   353   O  O     . CYS A 1  49   ? -51.934 -23.302 -44.297 1.00 57.05  ? 49   CYS A O     1 
ATOM   354   C  CB    . CYS A 1  49   ? -50.143 -25.374 -42.990 1.00 59.63  ? 49   CYS A CB    1 
ATOM   355   S  SG    . CYS A 1  49   ? -49.979 -26.447 -44.441 1.00 62.90  ? 49   CYS A SG    1 
ATOM   356   N  N     . GLY A 1  50   ? -53.145 -25.177 -44.532 1.00 56.11  ? 50   GLY A N     1 
ATOM   357   C  CA    . GLY A 1  50   ? -53.872 -24.708 -45.710 1.00 55.32  ? 50   GLY A CA    1 
ATOM   358   C  C     . GLY A 1  50   ? -53.080 -24.636 -47.005 1.00 54.77  ? 50   GLY A C     1 
ATOM   359   O  O     . GLY A 1  50   ? -53.539 -24.020 -47.961 1.00 55.46  ? 50   GLY A O     1 
ATOM   360   N  N     . ALA A 1  51   ? -51.908 -25.265 -47.060 1.00 53.96  ? 51   ALA A N     1 
ATOM   361   C  CA    . ALA A 1  51   ? -51.074 -25.237 -48.269 1.00 53.64  ? 51   ALA A CA    1 
ATOM   362   C  C     . ALA A 1  51   ? -51.669 -26.090 -49.395 1.00 53.94  ? 51   ALA A C     1 
ATOM   363   O  O     . ALA A 1  51   ? -51.400 -25.837 -50.573 1.00 54.05  ? 51   ALA A O     1 
ATOM   364   C  CB    . ALA A 1  51   ? -49.656 -25.691 -47.948 1.00 52.78  ? 51   ALA A CB    1 
ATOM   365   N  N     . CYS A 1  52   ? -52.479 -27.085 -49.021 1.00 54.09  ? 52   CYS A N     1 
ATOM   366   C  CA    . CYS A 1  52   ? -53.162 -27.969 -49.961 1.00 54.07  ? 52   CYS A CA    1 
ATOM   367   C  C     . CYS A 1  52   ? -54.640 -27.599 -50.185 1.00 54.18  ? 52   CYS A C     1 
ATOM   368   O  O     . CYS A 1  52   ? -55.455 -28.464 -50.539 1.00 53.45  ? 52   CYS A O     1 
ATOM   369   C  CB    . CYS A 1  52   ? -53.071 -29.400 -49.442 1.00 54.82  ? 52   CYS A CB    1 
ATOM   370   S  SG    . CYS A 1  52   ? -53.981 -29.650 -47.904 1.00 57.33  ? 52   CYS A SG    1 
ATOM   371   N  N     . THR A 1  53   ? -54.982 -26.323 -50.006 1.00 54.59  ? 53   THR A N     1 
ATOM   372   C  CA    . THR A 1  53   ? -56.360 -25.858 -50.154 1.00 54.98  ? 53   THR A CA    1 
ATOM   373   C  C     . THR A 1  53   ? -56.816 -25.912 -51.620 1.00 54.98  ? 53   THR A C     1 
ATOM   374   O  O     . THR A 1  53   ? -56.139 -25.401 -52.510 1.00 54.41  ? 53   THR A O     1 
ATOM   375   C  CB    . THR A 1  53   ? -56.539 -24.419 -49.619 1.00 55.44  ? 53   THR A CB    1 
ATOM   376   O  OG1   . THR A 1  53   ? -56.174 -24.366 -48.236 1.00 55.61  ? 53   THR A OG1   1 
ATOM   377   C  CG2   . THR A 1  53   ? -57.983 -23.949 -49.764 1.00 56.53  ? 53   THR A CG2   1 
ATOM   378   N  N     . VAL A 1  54   ? -57.970 -26.536 -51.841 1.00 55.78  ? 54   VAL A N     1 
ATOM   379   C  CA    . VAL A 1  54   ? -58.618 -26.606 -53.154 1.00 56.25  ? 54   VAL A CA    1 
ATOM   380   C  C     . VAL A 1  54   ? -60.098 -26.258 -53.020 1.00 57.47  ? 54   VAL A C     1 
ATOM   381   O  O     . VAL A 1  54   ? -60.617 -26.162 -51.903 1.00 57.75  ? 54   VAL A O     1 
ATOM   382   C  CB    . VAL A 1  54   ? -58.475 -28.007 -53.795 1.00 55.84  ? 54   VAL A CB    1 
ATOM   383   C  CG1   . VAL A 1  54   ? -57.021 -28.275 -54.140 1.00 55.40  ? 54   VAL A CG1   1 
ATOM   384   C  CG2   . VAL A 1  54   ? -59.022 -29.109 -52.889 1.00 55.87  ? 54   VAL A CG2   1 
ATOM   385   N  N     . MET A 1  55   ? -60.765 -26.071 -54.157 1.00 58.21  ? 55   MET A N     1 
ATOM   386   C  CA    . MET A 1  55   ? -62.211 -25.861 -54.190 1.00 59.56  ? 55   MET A CA    1 
ATOM   387   C  C     . MET A 1  55   ? -62.908 -27.132 -54.672 1.00 60.07  ? 55   MET A C     1 
ATOM   388   O  O     . MET A 1  55   ? -62.524 -27.703 -55.683 1.00 59.98  ? 55   MET A O     1 
ATOM   389   C  CB    . MET A 1  55   ? -62.558 -24.693 -55.112 1.00 59.74  ? 55   MET A CB    1 
ATOM   390   C  CG    . MET A 1  55   ? -63.986 -24.195 -54.967 1.00 60.98  ? 55   MET A CG    1 
ATOM   391   S  SD    . MET A 1  55   ? -64.531 -23.216 -56.379 1.00 62.30  ? 55   MET A SD    1 
ATOM   392   C  CE    . MET A 1  55   ? -64.237 -21.600 -55.745 1.00 61.69  ? 55   MET A CE    1 
ATOM   393   N  N     . ILE A 1  56   ? -63.925 -27.565 -53.933 1.00 61.12  ? 56   ILE A N     1 
ATOM   394   C  CA    . ILE A 1  56   ? -64.822 -28.637 -54.365 1.00 61.63  ? 56   ILE A CA    1 
ATOM   395   C  C     . ILE A 1  56   ? -66.140 -28.002 -54.809 1.00 62.46  ? 56   ILE A C     1 
ATOM   396   O  O     . ILE A 1  56   ? -66.641 -27.091 -54.150 1.00 61.94  ? 56   ILE A O     1 
ATOM   397   C  CB    . ILE A 1  56   ? -65.117 -29.629 -53.217 1.00 61.85  ? 56   ILE A CB    1 
ATOM   398   C  CG1   . ILE A 1  56   ? -63.815 -30.160 -52.596 1.00 61.24  ? 56   ILE A CG1   1 
ATOM   399   C  CG2   . ILE A 1  56   ? -66.013 -30.768 -53.697 1.00 62.52  ? 56   ILE A CG2   1 
ATOM   400   C  CD1   . ILE A 1  56   ? -62.868 -30.823 -53.576 1.00 61.06  ? 56   ILE A CD1   1 
ATOM   401   N  N     . SER A 1  57   ? -66.685 -28.485 -55.926 1.00 62.87  ? 57   SER A N     1 
ATOM   402   C  CA    . SER A 1  57   ? -67.987 -28.052 -56.432 1.00 63.19  ? 57   SER A CA    1 
ATOM   403   C  C     . SER A 1  57   ? -68.905 -29.256 -56.615 1.00 64.44  ? 57   SER A C     1 
ATOM   404   O  O     . SER A 1  57   ? -68.452 -30.343 -56.971 1.00 63.80  ? 57   SER A O     1 
ATOM   405   C  CB    . SER A 1  57   ? -67.823 -27.301 -57.748 1.00 62.94  ? 57   SER A CB    1 
ATOM   406   O  OG    . SER A 1  57   ? -67.125 -26.085 -57.549 1.00 62.23  ? 57   SER A OG    1 
ATOM   407   N  N     . ARG A 1  58   ? -70.193 -29.057 -56.341 1.00 66.36  ? 58   ARG A N     1 
ATOM   408   C  CA    . ARG A 1  58   ? -71.205 -30.098 -56.486 1.00 68.77  ? 58   ARG A CA    1 
ATOM   409   C  C     . ARG A 1  58   ? -72.534 -29.464 -56.871 1.00 71.67  ? 58   ARG A C     1 
ATOM   410   O  O     . ARG A 1  58   ? -72.866 -28.385 -56.386 1.00 71.65  ? 58   ARG A O     1 
ATOM   411   C  CB    . ARG A 1  58   ? -71.377 -30.873 -55.177 1.00 69.14  ? 58   ARG A CB    1 
ATOM   412   C  CG    . ARG A 1  58   ? -70.241 -31.822 -54.838 1.00 68.99  ? 58   ARG A CG    1 
ATOM   413   C  CD    . ARG A 1  58   ? -70.572 -32.660 -53.612 1.00 70.14  ? 58   ARG A CD    1 
ATOM   414   N  NE    . ARG A 1  58   ? -69.368 -33.182 -52.958 1.00 70.42  ? 58   ARG A NE    1 
ATOM   415   C  CZ    . ARG A 1  58   ? -68.707 -34.295 -53.298 1.00 70.30  ? 58   ARG A CZ    1 
ATOM   416   N  NH1   . ARG A 1  58   ? -69.109 -35.070 -54.309 1.00 70.98  ? 58   ARG A NH1   1 
ATOM   417   N  NH2   . ARG A 1  58   ? -67.622 -34.641 -52.606 1.00 69.53  ? 58   ARG A NH2   1 
ATOM   418   N  N     . TYR A 1  59   ? -73.279 -30.134 -57.748 1.00 74.60  ? 59   TYR A N     1 
ATOM   419   C  CA    . TYR A 1  59   ? -74.622 -29.709 -58.119 1.00 78.23  ? 59   TYR A CA    1 
ATOM   420   C  C     . TYR A 1  59   ? -75.582 -30.456 -57.224 1.00 81.16  ? 59   TYR A C     1 
ATOM   421   O  O     . TYR A 1  59   ? -75.455 -31.668 -57.048 1.00 81.14  ? 59   TYR A O     1 
ATOM   422   C  CB    . TYR A 1  59   ? -74.914 -30.037 -59.588 1.00 79.78  ? 59   TYR A CB    1 
ATOM   423   C  CG    . TYR A 1  59   ? -76.257 -29.544 -60.121 1.00 82.08  ? 59   TYR A CG    1 
ATOM   424   C  CD1   . TYR A 1  59   ? -76.526 -28.177 -60.252 1.00 82.93  ? 59   TYR A CD1   1 
ATOM   425   C  CD2   . TYR A 1  59   ? -77.246 -30.442 -60.534 1.00 83.53  ? 59   TYR A CD2   1 
ATOM   426   C  CE1   . TYR A 1  59   ? -77.743 -27.722 -60.754 1.00 84.36  ? 59   TYR A CE1   1 
ATOM   427   C  CE2   . TYR A 1  59   ? -78.463 -29.995 -61.041 1.00 85.44  ? 59   TYR A CE2   1 
ATOM   428   C  CZ    . TYR A 1  59   ? -78.709 -28.636 -61.151 1.00 85.87  ? 59   TYR A CZ    1 
ATOM   429   O  OH    . TYR A 1  59   ? -79.916 -28.187 -61.647 1.00 87.30  ? 59   TYR A OH    1 
ATOM   430   N  N     . ASN A 1  60   ? -76.527 -29.727 -56.642 1.00 85.02  ? 60   ASN A N     1 
ATOM   431   C  CA    . ASN A 1  60   ? -77.639 -30.336 -55.937 1.00 88.54  ? 60   ASN A CA    1 
ATOM   432   C  C     . ASN A 1  60   ? -78.816 -30.448 -56.911 1.00 91.35  ? 60   ASN A C     1 
ATOM   433   O  O     . ASN A 1  60   ? -79.361 -29.425 -57.330 1.00 91.90  ? 60   ASN A O     1 
ATOM   434   C  CB    . ASN A 1  60   ? -78.010 -29.493 -54.724 1.00 89.95  ? 60   ASN A CB    1 
ATOM   435   C  CG    . ASN A 1  60   ? -78.925 -30.228 -53.761 1.00 91.68  ? 60   ASN A CG    1 
ATOM   436   O  OD1   . ASN A 1  60   ? -79.919 -30.838 -54.163 1.00 93.15  ? 60   ASN A OD1   1 
ATOM   437   N  ND2   . ASN A 1  60   ? -78.589 -30.174 -52.478 1.00 91.67  ? 60   ASN A ND2   1 
ATOM   438   N  N     . PRO A 1  61   ? -79.212 -31.685 -57.277 1.00 93.68  ? 61   PRO A N     1 
ATOM   439   C  CA    . PRO A 1  61   ? -80.291 -31.840 -58.258 1.00 96.50  ? 61   PRO A CA    1 
ATOM   440   C  C     . PRO A 1  61   ? -81.696 -31.513 -57.718 1.00 99.78  ? 61   PRO A C     1 
ATOM   441   O  O     . PRO A 1  61   ? -82.620 -31.344 -58.518 1.00 100.66 ? 61   PRO A O     1 
ATOM   442   C  CB    . PRO A 1  61   ? -80.179 -33.308 -58.676 1.00 96.54  ? 61   PRO A CB    1 
ATOM   443   C  CG    . PRO A 1  61   ? -79.581 -33.996 -57.502 1.00 95.42  ? 61   PRO A CG    1 
ATOM   444   C  CD    . PRO A 1  61   ? -78.748 -32.987 -56.760 1.00 93.78  ? 61   PRO A CD    1 
ATOM   445   N  N     . ILE A 1  62   ? -81.848 -31.426 -56.392 1.00 101.40 ? 62   ILE A N     1 
ATOM   446   C  CA    . ILE A 1  62   ? -83.115 -31.042 -55.759 1.00 103.43 ? 62   ILE A CA    1 
ATOM   447   C  C     . ILE A 1  62   ? -83.266 -29.517 -55.768 1.00 102.87 ? 62   ILE A C     1 
ATOM   448   O  O     . ILE A 1  62   ? -84.226 -28.993 -56.339 1.00 103.81 ? 62   ILE A O     1 
ATOM   449   C  CB    . ILE A 1  62   ? -83.227 -31.582 -54.305 1.00 104.22 ? 62   ILE A CB    1 
ATOM   450   C  CG1   . ILE A 1  62   ? -83.053 -33.113 -54.262 1.00 104.26 ? 62   ILE A CG1   1 
ATOM   451   C  CG2   . ILE A 1  62   ? -84.556 -31.175 -53.666 1.00 106.38 ? 62   ILE A CG2   1 
ATOM   452   C  CD1   . ILE A 1  62   ? -84.062 -33.903 -55.076 1.00 105.57 ? 62   ILE A CD1   1 
ATOM   453   N  N     . THR A 1  63   ? -82.317 -28.817 -55.146 1.00 100.78 ? 63   THR A N     1 
ATOM   454   C  CA    . THR A 1  63   ? -82.349 -27.346 -55.071 1.00 100.97 ? 63   THR A CA    1 
ATOM   455   C  C     . THR A 1  63   ? -81.883 -26.636 -56.357 1.00 100.56 ? 63   THR A C     1 
ATOM   456   O  O     . THR A 1  63   ? -82.041 -25.418 -56.472 1.00 99.51  ? 63   THR A O     1 
ATOM   457   C  CB    . THR A 1  63   ? -81.523 -26.816 -53.874 1.00 100.32 ? 63   THR A CB    1 
ATOM   458   O  OG1   . THR A 1  63   ? -80.152 -27.203 -54.015 1.00 99.24  ? 63   THR A OG1   1 
ATOM   459   C  CG2   . THR A 1  63   ? -82.062 -27.362 -52.560 1.00 100.37 ? 63   THR A CG2   1 
ATOM   460   N  N     . LYS A 1  64   ? -81.311 -27.391 -57.300 1.00 101.29 ? 64   LYS A N     1 
ATOM   461   C  CA    . LYS A 1  64   ? -80.840 -26.877 -58.601 1.00 101.95 ? 64   LYS A CA    1 
ATOM   462   C  C     . LYS A 1  64   ? -79.828 -25.726 -58.483 1.00 99.96  ? 64   LYS A C     1 
ATOM   463   O  O     . LYS A 1  64   ? -79.898 -24.748 -59.231 1.00 99.25  ? 64   LYS A O     1 
ATOM   464   C  CB    . LYS A 1  64   ? -82.023 -26.491 -59.516 1.00 104.83 ? 64   LYS A CB    1 
ATOM   465   C  CG    . LYS A 1  64   ? -82.930 -27.656 -59.908 1.00 107.08 ? 64   LYS A CG    1 
ATOM   466   C  CD    . LYS A 1  64   ? -83.586 -27.476 -61.279 1.00 108.71 ? 64   LYS A CD    1 
ATOM   467   C  CE    . LYS A 1  64   ? -84.508 -26.261 -61.358 1.00 110.26 ? 64   LYS A CE    1 
ATOM   468   N  NZ    . LYS A 1  64   ? -85.630 -26.295 -60.375 1.00 111.09 ? 64   LYS A NZ    1 
ATOM   469   N  N     . ARG A 1  65   ? -78.888 -25.857 -57.547 1.00 98.86  ? 65   ARG A N     1 
ATOM   470   C  CA    . ARG A 1  65   ? -77.838 -24.852 -57.348 1.00 98.24  ? 65   ARG A CA    1 
ATOM   471   C  C     . ARG A 1  65   ? -76.461 -25.498 -57.142 1.00 93.43  ? 65   ARG A C     1 
ATOM   472   O  O     . ARG A 1  65   ? -76.341 -26.527 -56.468 1.00 91.04  ? 65   ARG A O     1 
ATOM   473   C  CB    . ARG A 1  65   ? -78.188 -23.896 -56.191 1.00 101.61 ? 65   ARG A CB    1 
ATOM   474   C  CG    . ARG A 1  65   ? -78.743 -24.560 -54.935 1.00 105.25 ? 65   ARG A CG    1 
ATOM   475   C  CD    . ARG A 1  65   ? -78.913 -23.589 -53.764 1.00 108.20 ? 65   ARG A CD    1 
ATOM   476   N  NE    . ARG A 1  65   ? -77.694 -22.822 -53.464 1.00 110.75 ? 65   ARG A NE    1 
ATOM   477   C  CZ    . ARG A 1  65   ? -76.600 -23.291 -52.846 1.00 111.15 ? 65   ARG A CZ    1 
ATOM   478   N  NH1   . ARG A 1  65   ? -76.520 -24.557 -52.427 1.00 112.06 ? 65   ARG A NH1   1 
ATOM   479   N  NH2   . ARG A 1  65   ? -75.563 -22.480 -52.643 1.00 109.82 ? 65   ARG A NH2   1 
ATOM   480   N  N     . ILE A 1  66   ? -75.446 -24.898 -57.769 1.00 89.53  ? 66   ILE A N     1 
ATOM   481   C  CA    . ILE A 1  66   ? -74.044 -25.298 -57.594 1.00 86.09  ? 66   ILE A CA    1 
ATOM   482   C  C     . ILE A 1  66   ? -73.513 -24.715 -56.277 1.00 82.10  ? 66   ILE A C     1 
ATOM   483   O  O     . ILE A 1  66   ? -73.629 -23.517 -56.031 1.00 79.99  ? 66   ILE A O     1 
ATOM   484   C  CB    . ILE A 1  66   ? -73.142 -24.895 -58.812 1.00 86.89  ? 66   ILE A CB    1 
ATOM   485   C  CG1   . ILE A 1  66   ? -72.979 -23.360 -58.951 1.00 88.80  ? 66   ILE A CG1   1 
ATOM   486   C  CG2   . ILE A 1  66   ? -73.677 -25.519 -60.099 1.00 86.79  ? 66   ILE A CG2   1 
ATOM   487   C  CD1   . ILE A 1  66   ? -72.387 -22.881 -60.266 1.00 89.09  ? 66   ILE A CD1   1 
ATOM   488   N  N     . ARG A 1  67   ? -72.956 -25.581 -55.432 1.00 79.94  ? 67   ARG A N     1 
ATOM   489   C  CA    . ARG A 1  67   ? -72.400 -25.198 -54.133 1.00 78.80  ? 67   ARG A CA    1 
ATOM   490   C  C     . ARG A 1  67   ? -70.869 -25.348 -54.154 1.00 74.44  ? 67   ARG A C     1 
ATOM   491   O  O     . ARG A 1  67   ? -70.359 -26.448 -54.381 1.00 71.94  ? 67   ARG A O     1 
ATOM   492   C  CB    . ARG A 1  67   ? -73.017 -26.072 -53.032 1.00 81.71  ? 67   ARG A CB    1 
ATOM   493   C  CG    . ARG A 1  67   ? -72.567 -25.732 -51.614 1.00 84.50  ? 67   ARG A CG    1 
ATOM   494   C  CD    . ARG A 1  67   ? -73.215 -26.614 -50.550 1.00 87.45  ? 67   ARG A CD    1 
ATOM   495   N  NE    . ARG A 1  67   ? -72.332 -26.770 -49.383 1.00 89.43  ? 67   ARG A NE    1 
ATOM   496   C  CZ    . ARG A 1  67   ? -71.480 -27.781 -49.159 1.00 89.69  ? 67   ARG A CZ    1 
ATOM   497   N  NH1   . ARG A 1  67   ? -71.366 -28.810 -50.005 1.00 90.67  ? 67   ARG A NH1   1 
ATOM   498   N  NH2   . ARG A 1  67   ? -70.729 -27.768 -48.056 1.00 88.82  ? 67   ARG A NH2   1 
ATOM   499   N  N     . HIS A 1  68   ? -70.151 -24.246 -53.916 1.00 71.40  ? 68   HIS A N     1 
ATOM   500   C  CA    . HIS A 1  68   ? -68.676 -24.238 -53.859 1.00 68.34  ? 68   HIS A CA    1 
ATOM   501   C  C     . HIS A 1  68   ? -68.180 -24.132 -52.411 1.00 66.43  ? 68   HIS A C     1 
ATOM   502   O  O     . HIS A 1  68   ? -68.579 -23.226 -51.690 1.00 66.68  ? 68   HIS A O     1 
ATOM   503   C  CB    . HIS A 1  68   ? -68.103 -23.059 -54.657 1.00 67.34  ? 68   HIS A CB    1 
ATOM   504   C  CG    . HIS A 1  68   ? -68.722 -22.868 -56.006 1.00 67.26  ? 68   HIS A CG    1 
ATOM   505   N  ND1   . HIS A 1  68   ? -68.421 -23.672 -57.085 1.00 67.33  ? 68   HIS A ND1   1 
ATOM   506   C  CD2   . HIS A 1  68   ? -69.604 -21.949 -56.458 1.00 67.95  ? 68   HIS A CD2   1 
ATOM   507   C  CE1   . HIS A 1  68   ? -69.103 -23.263 -58.139 1.00 67.59  ? 68   HIS A CE1   1 
ATOM   508   N  NE2   . HIS A 1  68   ? -69.827 -22.219 -57.785 1.00 68.32  ? 68   HIS A NE2   1 
ATOM   509   N  N     . HIS A 1  69   ? -67.308 -25.046 -51.994 1.00 65.35  ? 69   HIS A N     1 
ATOM   510   C  CA    . HIS A 1  69   ? -66.694 -24.976 -50.669 1.00 65.39  ? 69   HIS A CA    1 
ATOM   511   C  C     . HIS A 1  69   ? -65.185 -25.284 -50.696 1.00 63.55  ? 69   HIS A C     1 
ATOM   512   O  O     . HIS A 1  69   ? -64.724 -26.056 -51.544 1.00 62.73  ? 69   HIS A O     1 
ATOM   513   C  CB    . HIS A 1  69   ? -67.434 -25.891 -49.682 1.00 67.01  ? 69   HIS A CB    1 
ATOM   514   C  CG    . HIS A 1  69   ? -67.143 -27.353 -49.847 1.00 68.16  ? 69   HIS A CG    1 
ATOM   515   N  ND1   . HIS A 1  69   ? -66.053 -27.965 -49.264 1.00 68.35  ? 69   HIS A ND1   1 
ATOM   516   C  CD2   . HIS A 1  69   ? -67.821 -28.332 -50.493 1.00 68.92  ? 69   HIS A CD2   1 
ATOM   517   C  CE1   . HIS A 1  69   ? -66.059 -29.253 -49.562 1.00 68.26  ? 69   HIS A CE1   1 
ATOM   518   N  NE2   . HIS A 1  69   ? -67.123 -29.502 -50.305 1.00 68.95  ? 69   HIS A NE2   1 
ATOM   519   N  N     . PRO A 1  70   ? -64.410 -24.672 -49.774 1.00 62.58  ? 70   PRO A N     1 
ATOM   520   C  CA    . PRO A 1  70   ? -62.981 -24.970 -49.678 1.00 61.63  ? 70   PRO A CA    1 
ATOM   521   C  C     . PRO A 1  70   ? -62.711 -26.264 -48.910 1.00 60.49  ? 70   PRO A C     1 
ATOM   522   O  O     . PRO A 1  70   ? -63.552 -26.704 -48.118 1.00 59.10  ? 70   PRO A O     1 
ATOM   523   C  CB    . PRO A 1  70   ? -62.425 -23.764 -48.917 1.00 61.29  ? 70   PRO A CB    1 
ATOM   524   C  CG    . PRO A 1  70   ? -63.543 -23.362 -48.026 1.00 62.53  ? 70   PRO A CG    1 
ATOM   525   C  CD    . PRO A 1  70   ? -64.807 -23.647 -48.792 1.00 63.34  ? 70   PRO A CD    1 
ATOM   526   N  N     . ALA A 1  71   ? -61.541 -26.853 -49.160 1.00 59.17  ? 71   ALA A N     1 
ATOM   527   C  CA    . ALA A 1  71   ? -61.131 -28.109 -48.528 1.00 58.41  ? 71   ALA A CA    1 
ATOM   528   C  C     . ALA A 1  71   ? -59.619 -28.300 -48.602 1.00 57.17  ? 71   ALA A C     1 
ATOM   529   O  O     . ALA A 1  71   ? -58.968 -27.760 -49.492 1.00 55.85  ? 71   ALA A O     1 
ATOM   530   C  CB    . ALA A 1  71   ? -61.839 -29.286 -49.186 1.00 58.64  ? 71   ALA A CB    1 
ATOM   531   N  N     . ASN A 1  72   ? -59.080 -29.075 -47.661 1.00 57.08  ? 72   ASN A N     1 
ATOM   532   C  CA    . ASN A 1  72   ? -57.668 -29.451 -47.660 1.00 56.62  ? 72   ASN A CA    1 
ATOM   533   C  C     . ASN A 1  72   ? -57.507 -30.783 -48.370 1.00 56.01  ? 72   ASN A C     1 
ATOM   534   O  O     . ASN A 1  72   ? -58.042 -31.800 -47.925 1.00 55.51  ? 72   ASN A O     1 
ATOM   535   C  CB    . ASN A 1  72   ? -57.132 -29.538 -46.230 1.00 57.65  ? 72   ASN A CB    1 
ATOM   536   C  CG    . ASN A 1  72   ? -57.037 -28.179 -45.555 1.00 59.11  ? 72   ASN A CG    1 
ATOM   537   O  OD1   . ASN A 1  72   ? -57.478 -28.007 -44.413 1.00 60.95  ? 72   ASN A OD1   1 
ATOM   538   N  ND2   . ASN A 1  72   ? -56.462 -27.204 -46.255 1.00 58.62  ? 72   ASN A ND2   1 
ATOM   539   N  N     . ALA A 1  73   ? -56.770 -30.766 -49.477 1.00 55.79  ? 73   ALA A N     1 
ATOM   540   C  CA    . ALA A 1  73   ? -56.645 -31.930 -50.356 1.00 56.18  ? 73   ALA A CA    1 
ATOM   541   C  C     . ALA A 1  73   ? -55.901 -33.103 -49.719 1.00 56.42  ? 73   ALA A C     1 
ATOM   542   O  O     . ALA A 1  73   ? -56.117 -34.249 -50.120 1.00 55.85  ? 73   ALA A O     1 
ATOM   543   C  CB    . ALA A 1  73   ? -55.974 -31.534 -51.661 1.00 55.67  ? 73   ALA A CB    1 
ATOM   544   N  N     . CYS A 1  74   ? -55.042 -32.821 -48.733 1.00 56.34  ? 74   CYS A N     1 
ATOM   545   C  CA    . CYS A 1  74   ? -54.278 -33.867 -48.051 1.00 56.85  ? 74   CYS A CA    1 
ATOM   546   C  C     . CYS A 1  74   ? -55.150 -34.917 -47.350 1.00 58.73  ? 74   CYS A C     1 
ATOM   547   O  O     . CYS A 1  74   ? -54.717 -36.061 -47.220 1.00 60.84  ? 74   CYS A O     1 
ATOM   548   C  CB    . CYS A 1  74   ? -53.270 -33.268 -47.062 1.00 56.74  ? 74   CYS A CB    1 
ATOM   549   S  SG    . CYS A 1  74   ? -53.973 -32.475 -45.595 1.00 57.46  ? 74   CYS A SG    1 
ATOM   550   N  N     . LEU A 1  75   ? -56.366 -34.542 -46.927 1.00 59.18  ? 75   LEU A N     1 
ATOM   551   C  CA    . LEU A 1  75   ? -57.295 -35.458 -46.235 1.00 59.59  ? 75   LEU A CA    1 
ATOM   552   C  C     . LEU A 1  75   ? -58.466 -35.992 -47.082 1.00 59.68  ? 75   LEU A C     1 
ATOM   553   O  O     . LEU A 1  75   ? -59.212 -36.854 -46.611 1.00 59.82  ? 75   LEU A O     1 
ATOM   554   C  CB    . LEU A 1  75   ? -57.855 -34.783 -44.973 1.00 60.59  ? 75   LEU A CB    1 
ATOM   555   C  CG    . LEU A 1  75   ? -56.850 -34.463 -43.859 1.00 60.51  ? 75   LEU A CG    1 
ATOM   556   C  CD1   . LEU A 1  75   ? -57.467 -33.505 -42.847 1.00 60.69  ? 75   LEU A CD1   1 
ATOM   557   C  CD2   . LEU A 1  75   ? -56.342 -35.727 -43.178 1.00 60.34  ? 75   LEU A CD2   1 
ATOM   558   N  N     . ILE A 1  76   ? -58.632 -35.501 -48.309 1.00 59.16  ? 76   ILE A N     1 
ATOM   559   C  CA    . ILE A 1  76   ? -59.705 -35.975 -49.195 1.00 59.36  ? 76   ILE A CA    1 
ATOM   560   C  C     . ILE A 1  76   ? -59.288 -37.293 -49.862 1.00 59.93  ? 76   ILE A C     1 
ATOM   561   O  O     . ILE A 1  76   ? -58.286 -37.318 -50.562 1.00 59.14  ? 76   ILE A O     1 
ATOM   562   C  CB    . ILE A 1  76   ? -60.040 -34.930 -50.286 1.00 58.85  ? 76   ILE A CB    1 
ATOM   563   C  CG1   . ILE A 1  76   ? -60.549 -33.632 -49.638 1.00 58.84  ? 76   ILE A CG1   1 
ATOM   564   C  CG2   . ILE A 1  76   ? -61.074 -35.473 -51.271 1.00 59.20  ? 76   ILE A CG2   1 
ATOM   565   C  CD1   . ILE A 1  76   ? -60.540 -32.425 -50.549 1.00 58.66  ? 76   ILE A CD1   1 
ATOM   566   N  N     . PRO A 1  77   ? -60.042 -38.390 -49.644 1.00 62.25  ? 77   PRO A N     1 
ATOM   567   C  CA    . PRO A 1  77   ? -59.807 -39.583 -50.455 1.00 63.40  ? 77   PRO A CA    1 
ATOM   568   C  C     . PRO A 1  77   ? -60.523 -39.406 -51.784 1.00 64.76  ? 77   PRO A C     1 
ATOM   569   O  O     . PRO A 1  77   ? -61.683 -38.976 -51.791 1.00 65.62  ? 77   PRO A O     1 
ATOM   570   C  CB    . PRO A 1  77   ? -60.460 -40.713 -49.633 1.00 64.65  ? 77   PRO A CB    1 
ATOM   571   C  CG    . PRO A 1  77   ? -60.940 -40.081 -48.359 1.00 64.17  ? 77   PRO A CG    1 
ATOM   572   C  CD    . PRO A 1  77   ? -61.120 -38.635 -48.674 1.00 63.54  ? 77   PRO A CD    1 
ATOM   573   N  N     . ILE A 1  78   ? -59.852 -39.731 -52.891 1.00 64.72  ? 78   ILE A N     1 
ATOM   574   C  CA    . ILE A 1  78   ? -60.396 -39.427 -54.222 1.00 64.93  ? 78   ILE A CA    1 
ATOM   575   C  C     . ILE A 1  78   ? -61.704 -40.159 -54.527 1.00 65.97  ? 78   ILE A C     1 
ATOM   576   O  O     . ILE A 1  78   ? -62.521 -39.659 -55.297 1.00 65.70  ? 78   ILE A O     1 
ATOM   577   C  CB    . ILE A 1  78   ? -59.375 -39.639 -55.372 1.00 64.76  ? 78   ILE A CB    1 
ATOM   578   C  CG1   . ILE A 1  78   ? -58.986 -41.115 -55.547 1.00 65.42  ? 78   ILE A CG1   1 
ATOM   579   C  CG2   . ILE A 1  78   ? -58.142 -38.776 -55.147 1.00 64.01  ? 78   ILE A CG2   1 
ATOM   580   C  CD1   . ILE A 1  78   ? -58.213 -41.386 -56.823 1.00 65.06  ? 78   ILE A CD1   1 
ATOM   581   N  N     . CYS A 1  79   ? -61.909 -41.321 -53.909 1.00 67.01  ? 79   CYS A N     1 
ATOM   582   C  CA    . CYS A 1  79   ? -63.166 -42.060 -54.062 1.00 69.07  ? 79   CYS A CA    1 
ATOM   583   C  C     . CYS A 1  79   ? -64.403 -41.314 -53.547 1.00 69.36  ? 79   CYS A C     1 
ATOM   584   O  O     . CYS A 1  79   ? -65.510 -41.582 -54.012 1.00 72.46  ? 79   CYS A O     1 
ATOM   585   C  CB    . CYS A 1  79   ? -63.068 -43.443 -53.417 1.00 70.25  ? 79   CYS A CB    1 
ATOM   586   S  SG    . CYS A 1  79   ? -61.979 -44.555 -54.333 1.00 71.91  ? 79   CYS A SG    1 
ATOM   587   N  N     . SER A 1  80   ? -64.223 -40.377 -52.615 1.00 68.05  ? 80   SER A N     1 
ATOM   588   C  CA    . SER A 1  80   ? -65.326 -39.510 -52.177 1.00 67.70  ? 80   SER A CA    1 
ATOM   589   C  C     . SER A 1  80   ? -65.616 -38.325 -53.122 1.00 66.39  ? 80   SER A C     1 
ATOM   590   O  O     . SER A 1  80   ? -66.554 -37.573 -52.873 1.00 67.51  ? 80   SER A O     1 
ATOM   591   C  CB    . SER A 1  80   ? -65.071 -39.001 -50.755 1.00 67.15  ? 80   SER A CB    1 
ATOM   592   O  OG    . SER A 1  80   ? -64.070 -38.006 -50.745 1.00 66.94  ? 80   SER A OG    1 
ATOM   593   N  N     . LEU A 1  81   ? -64.830 -38.160 -54.191 1.00 65.02  ? 81   LEU A N     1 
ATOM   594   C  CA    . LEU A 1  81   ? -65.027 -37.070 -55.163 1.00 64.00  ? 81   LEU A CA    1 
ATOM   595   C  C     . LEU A 1  81   ? -65.955 -37.404 -56.337 1.00 63.54  ? 81   LEU A C     1 
ATOM   596   O  O     . LEU A 1  81   ? -66.163 -36.545 -57.198 1.00 62.98  ? 81   LEU A O     1 
ATOM   597   C  CB    . LEU A 1  81   ? -63.676 -36.606 -55.728 1.00 62.89  ? 81   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1  81   ? -62.696 -35.981 -54.739 1.00 62.35  ? 81   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1  81   ? -61.340 -35.767 -55.397 1.00 61.46  ? 81   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1  81   ? -63.247 -34.668 -54.194 1.00 62.30  ? 81   LEU A CD2   1 
ATOM   601   N  N     . TYR A 1  82   ? -66.512 -38.619 -56.381 1.00 63.34  ? 82   TYR A N     1 
ATOM   602   C  CA    . TYR A 1  82   ? -67.391 -39.026 -57.484 1.00 64.15  ? 82   TYR A CA    1 
ATOM   603   C  C     . TYR A 1  82   ? -68.424 -37.949 -57.815 1.00 64.59  ? 82   TYR A C     1 
ATOM   604   O  O     . TYR A 1  82   ? -69.152 -37.498 -56.939 1.00 65.39  ? 82   TYR A O     1 
ATOM   605   C  CB    . TYR A 1  82   ? -68.119 -40.340 -57.182 1.00 65.13  ? 82   TYR A CB    1 
ATOM   606   C  CG    . TYR A 1  82   ? -68.815 -40.899 -58.406 1.00 67.07  ? 82   TYR A CG    1 
ATOM   607   C  CD1   . TYR A 1  82   ? -70.105 -40.480 -58.763 1.00 68.73  ? 82   TYR A CD1   1 
ATOM   608   C  CD2   . TYR A 1  82   ? -68.176 -41.819 -59.231 1.00 67.29  ? 82   TYR A CD2   1 
ATOM   609   C  CE1   . TYR A 1  82   ? -70.736 -40.977 -59.897 1.00 69.88  ? 82   TYR A CE1   1 
ATOM   610   C  CE2   . TYR A 1  82   ? -68.801 -42.321 -60.367 1.00 69.01  ? 82   TYR A CE2   1 
ATOM   611   C  CZ    . TYR A 1  82   ? -70.077 -41.900 -60.696 1.00 70.27  ? 82   TYR A CZ    1 
ATOM   612   O  OH    . TYR A 1  82   ? -70.682 -42.408 -61.822 1.00 72.19  ? 82   TYR A OH    1 
ATOM   613   N  N     . GLY A 1  83   ? -68.467 -37.534 -59.078 1.00 64.84  ? 83   GLY A N     1 
ATOM   614   C  CA    . GLY A 1  83   ? -69.433 -36.537 -59.536 1.00 65.06  ? 83   GLY A CA    1 
ATOM   615   C  C     . GLY A 1  83   ? -69.152 -35.100 -59.128 1.00 64.12  ? 83   GLY A C     1 
ATOM   616   O  O     . GLY A 1  83   ? -70.010 -34.244 -59.318 1.00 64.22  ? 83   GLY A O     1 
ATOM   617   N  N     . ALA A 1  84   ? -67.956 -34.829 -58.595 1.00 63.36  ? 84   ALA A N     1 
ATOM   618   C  CA    . ALA A 1  84   ? -67.564 -33.496 -58.120 1.00 63.08  ? 84   ALA A CA    1 
ATOM   619   C  C     . ALA A 1  84   ? -66.513 -32.844 -59.025 1.00 62.59  ? 84   ALA A C     1 
ATOM   620   O  O     . ALA A 1  84   ? -65.878 -33.509 -59.849 1.00 61.89  ? 84   ALA A O     1 
ATOM   621   C  CB    . ALA A 1  84   ? -67.033 -33.592 -56.699 1.00 62.85  ? 84   ALA A CB    1 
ATOM   622   N  N     . ALA A 1  85   ? -66.336 -31.537 -58.850 1.00 62.13  ? 85   ALA A N     1 
ATOM   623   C  CA    . ALA A 1  85   ? -65.441 -30.734 -59.679 1.00 61.22  ? 85   ALA A CA    1 
ATOM   624   C  C     . ALA A 1  85   ? -64.416 -30.046 -58.791 1.00 60.03  ? 85   ALA A C     1 
ATOM   625   O  O     . ALA A 1  85   ? -64.714 -29.023 -58.161 1.00 60.97  ? 85   ALA A O     1 
ATOM   626   C  CB    . ALA A 1  85   ? -66.240 -29.709 -60.478 1.00 62.00  ? 85   ALA A CB    1 
ATOM   627   N  N     . VAL A 1  86   ? -63.214 -30.618 -58.744 1.00 58.92  ? 86   VAL A N     1 
ATOM   628   C  CA    . VAL A 1  86   ? -62.100 -30.042 -57.988 1.00 56.97  ? 86   VAL A CA    1 
ATOM   629   C  C     . VAL A 1  86   ? -61.512 -28.894 -58.793 1.00 56.91  ? 86   VAL A C     1 
ATOM   630   O  O     . VAL A 1  86   ? -61.305 -29.027 -59.999 1.00 57.69  ? 86   VAL A O     1 
ATOM   631   C  CB    . VAL A 1  86   ? -60.983 -31.068 -57.711 1.00 55.81  ? 86   VAL A CB    1 
ATOM   632   C  CG1   . VAL A 1  86   ? -59.811 -30.408 -56.992 1.00 55.21  ? 86   VAL A CG1   1 
ATOM   633   C  CG2   . VAL A 1  86   ? -61.520 -32.238 -56.898 1.00 56.11  ? 86   VAL A CG2   1 
ATOM   634   N  N     . THR A 1  87   ? -61.258 -27.769 -58.130 1.00 56.60  ? 87   THR A N     1 
ATOM   635   C  CA    . THR A 1  87   ? -60.532 -26.666 -58.747 1.00 56.23  ? 87   THR A CA    1 
ATOM   636   C  C     . THR A 1  87   ? -59.288 -26.393 -57.928 1.00 56.17  ? 87   THR A C     1 
ATOM   637   O  O     . THR A 1  87   ? -59.302 -26.415 -56.696 1.00 56.19  ? 87   THR A O     1 
ATOM   638   C  CB    . THR A 1  87   ? -61.371 -25.388 -58.882 1.00 56.83  ? 87   THR A CB    1 
ATOM   639   O  OG1   . THR A 1  87   ? -62.681 -25.721 -59.349 1.00 57.43  ? 87   THR A OG1   1 
ATOM   640   C  CG2   . THR A 1  87   ? -60.722 -24.419 -59.861 1.00 56.82  ? 87   THR A CG2   1 
ATOM   641   N  N     . THR A 1  88   ? -58.220 -26.104 -58.656 1.00 56.58  ? 88   THR A N     1 
ATOM   642   C  CA    . THR A 1  88   ? -56.857 -26.117 -58.160 1.00 55.94  ? 88   THR A CA    1 
ATOM   643   C  C     . THR A 1  88   ? -56.259 -24.753 -58.527 1.00 56.24  ? 88   THR A C     1 
ATOM   644   O  O     . THR A 1  88   ? -56.865 -24.016 -59.312 1.00 57.77  ? 88   THR A O     1 
ATOM   645   C  CB    . THR A 1  88   ? -56.158 -27.359 -58.777 1.00 55.40  ? 88   THR A CB    1 
ATOM   646   O  OG1   . THR A 1  88   ? -56.002 -28.363 -57.767 1.00 56.28  ? 88   THR A OG1   1 
ATOM   647   C  CG2   . THR A 1  88   ? -54.826 -27.075 -59.385 1.00 54.41  ? 88   THR A CG2   1 
ATOM   648   N  N     . VAL A 1  89   ? -55.113 -24.393 -57.951 1.00 55.72  ? 89   VAL A N     1 
ATOM   649   C  CA    . VAL A 1  89   ? -54.491 -23.097 -58.263 1.00 56.01  ? 89   VAL A CA    1 
ATOM   650   C  C     . VAL A 1  89   ? -54.289 -22.891 -59.774 1.00 56.72  ? 89   VAL A C     1 
ATOM   651   O  O     . VAL A 1  89   ? -54.540 -21.799 -60.290 1.00 58.29  ? 89   VAL A O     1 
ATOM   652   C  CB    . VAL A 1  89   ? -53.174 -22.871 -57.477 1.00 55.10  ? 89   VAL A CB    1 
ATOM   653   C  CG1   . VAL A 1  89   ? -52.074 -23.820 -57.930 1.00 54.83  ? 89   VAL A CG1   1 
ATOM   654   C  CG2   . VAL A 1  89   ? -52.718 -21.424 -57.598 1.00 54.91  ? 89   VAL A CG2   1 
ATOM   655   N  N     . GLU A 1  90   ? -53.854 -23.942 -60.467 1.00 56.83  ? 90   GLU A N     1 
ATOM   656   C  CA    . GLU A 1  90   ? -53.709 -23.928 -61.925 1.00 57.31  ? 90   GLU A CA    1 
ATOM   657   C  C     . GLU A 1  90   ? -55.021 -23.650 -62.672 1.00 58.02  ? 90   GLU A C     1 
ATOM   658   O  O     . GLU A 1  90   ? -55.012 -22.991 -63.708 1.00 59.60  ? 90   GLU A O     1 
ATOM   659   C  CB    . GLU A 1  90   ? -53.097 -25.249 -62.419 1.00 57.01  ? 90   GLU A CB    1 
ATOM   660   C  CG    . GLU A 1  90   ? -51.627 -25.455 -62.046 1.00 57.16  ? 90   GLU A CG    1 
ATOM   661   C  CD    . GLU A 1  90   ? -51.390 -26.441 -60.903 1.00 57.75  ? 90   GLU A CD    1 
ATOM   662   O  OE1   . GLU A 1  90   ? -52.195 -26.504 -59.960 1.00 57.44  ? 90   GLU A OE1   1 
ATOM   663   O  OE2   . GLU A 1  90   ? -50.364 -27.156 -60.933 1.00 59.21  ? 90   GLU A OE2   1 
ATOM   664   N  N     . GLY A 1  91   ? -56.134 -24.153 -62.146 1.00 57.53  ? 91   GLY A N     1 
ATOM   665   C  CA    . GLY A 1  91   ? -57.438 -24.025 -62.788 1.00 58.49  ? 91   GLY A CA    1 
ATOM   666   C  C     . GLY A 1  91   ? -57.982 -22.629 -63.018 1.00 59.48  ? 91   GLY A C     1 
ATOM   667   O  O     . GLY A 1  91   ? -58.720 -22.412 -63.973 1.00 60.49  ? 91   GLY A O     1 
ATOM   668   N  N     . ILE A 1  92   ? -57.631 -21.684 -62.149 1.00 59.94  ? 92   ILE A N     1 
ATOM   669   C  CA    . ILE A 1  92   ? -58.241 -20.342 -62.177 1.00 60.78  ? 92   ILE A CA    1 
ATOM   670   C  C     . ILE A 1  92   ? -57.487 -19.358 -63.081 1.00 61.46  ? 92   ILE A C     1 
ATOM   671   O  O     . ILE A 1  92   ? -58.070 -18.389 -63.574 1.00 62.55  ? 92   ILE A O     1 
ATOM   672   C  CB    . ILE A 1  92   ? -58.470 -19.774 -60.745 1.00 60.22  ? 92   ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1  92   ? -57.162 -19.374 -60.042 1.00 59.11  ? 92   ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1  92   ? -59.232 -20.793 -59.901 1.00 59.84  ? 92   ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1  92   ? -57.369 -18.730 -58.685 1.00 58.88  ? 92   ILE A CD1   1 
ATOM   676   N  N     . GLY A 1  93   ? -56.202 -19.613 -63.306 1.00 61.72  ? 93   GLY A N     1 
ATOM   677   C  CA    . GLY A 1  93   ? -55.430 -18.811 -64.253 1.00 62.72  ? 93   GLY A CA    1 
ATOM   678   C  C     . GLY A 1  93   ? -53.974 -19.217 -64.357 1.00 61.80  ? 93   GLY A C     1 
ATOM   679   O  O     . GLY A 1  93   ? -53.469 -19.972 -63.522 1.00 62.23  ? 93   GLY A O     1 
ATOM   680   N  N     . SER A 1  94   ? -53.313 -18.708 -65.392 1.00 61.84  ? 94   SER A N     1 
ATOM   681   C  CA    . SER A 1  94   ? -51.883 -18.915 -65.590 1.00 62.41  ? 94   SER A CA    1 
ATOM   682   C  C     . SER A 1  94   ? -51.273 -17.847 -66.489 1.00 63.58  ? 94   SER A C     1 
ATOM   683   O  O     . SER A 1  94   ? -51.985 -17.079 -67.132 1.00 63.82  ? 94   SER A O     1 
ATOM   684   C  CB    . SER A 1  94   ? -51.623 -20.299 -66.184 1.00 62.16  ? 94   SER A CB    1 
ATOM   685   O  OG    . SER A 1  94   ? -52.288 -20.449 -67.422 1.00 62.68  ? 94   SER A OG    1 
ATOM   686   N  N     . THR A 1  95   ? -49.945 -17.816 -66.523 1.00 64.37  ? 95   THR A N     1 
ATOM   687   C  CA    . THR A 1  95   ? -49.200 -16.910 -67.393 1.00 65.98  ? 95   THR A CA    1 
ATOM   688   C  C     . THR A 1  95   ? -49.382 -17.241 -68.878 1.00 68.71  ? 95   THR A C     1 
ATOM   689   O  O     . THR A 1  95   ? -49.275 -16.349 -69.722 1.00 70.95  ? 95   THR A O     1 
ATOM   690   C  CB    . THR A 1  95   ? -47.693 -16.925 -67.076 1.00 64.58  ? 95   THR A CB    1 
ATOM   691   O  OG1   . THR A 1  95   ? -47.184 -18.255 -67.241 1.00 63.93  ? 95   THR A OG1   1 
ATOM   692   C  CG2   . THR A 1  95   ? -47.419 -16.432 -65.644 1.00 63.85  ? 95   THR A CG2   1 
ATOM   693   N  N     . HIS A 1  96   ? -49.654 -18.511 -69.191 1.00 70.14  ? 96   HIS A N     1 
ATOM   694   C  CA    . HIS A 1  96   ? -49.898 -18.945 -70.582 1.00 72.42  ? 96   HIS A CA    1 
ATOM   695   C  C     . HIS A 1  96   ? -51.371 -18.813 -71.032 1.00 72.95  ? 96   HIS A C     1 
ATOM   696   O  O     . HIS A 1  96   ? -51.640 -18.774 -72.234 1.00 75.55  ? 96   HIS A O     1 
ATOM   697   C  CB    . HIS A 1  96   ? -49.338 -20.358 -70.862 1.00 72.85  ? 96   HIS A CB    1 
ATOM   698   C  CG    . HIS A 1  96   ? -49.832 -21.421 -69.931 1.00 73.91  ? 96   HIS A CG    1 
ATOM   699   N  ND1   . HIS A 1  96   ? -49.169 -21.760 -68.771 1.00 73.58  ? 96   HIS A ND1   1 
ATOM   700   C  CD2   . HIS A 1  96   ? -50.914 -22.234 -69.996 1.00 75.35  ? 96   HIS A CD2   1 
ATOM   701   C  CE1   . HIS A 1  96   ? -49.827 -22.725 -68.154 1.00 73.91  ? 96   HIS A CE1   1 
ATOM   702   N  NE2   . HIS A 1  96   ? -50.889 -23.033 -68.878 1.00 75.17  ? 96   HIS A NE2   1 
ATOM   703   N  N     . THR A 1  97   ? -52.311 -18.746 -70.087 1.00 71.88  ? 97   THR A N     1 
ATOM   704   C  CA    . THR A 1  97   ? -53.713 -18.433 -70.397 1.00 71.55  ? 97   THR A CA    1 
ATOM   705   C  C     . THR A 1  97   ? -53.965 -16.959 -70.038 1.00 71.65  ? 97   THR A C     1 
ATOM   706   O  O     . THR A 1  97   ? -53.495 -16.076 -70.751 1.00 70.89  ? 97   THR A O     1 
ATOM   707   C  CB    . THR A 1  97   ? -54.689 -19.416 -69.707 1.00 71.44  ? 97   THR A CB    1 
ATOM   708   O  OG1   . THR A 1  97   ? -54.602 -19.294 -68.279 1.00 70.60  ? 97   THR A OG1   1 
ATOM   709   C  CG2   . THR A 1  97   ? -54.378 -20.850 -70.111 1.00 70.82  ? 97   THR A CG2   1 
ATOM   710   N  N     . ARG A 1  98   ? -54.687 -16.686 -68.954 1.00 72.64  ? 98   ARG A N     1 
ATOM   711   C  CA    . ARG A 1  98   ? -54.751 -15.336 -68.391 1.00 74.60  ? 98   ARG A CA    1 
ATOM   712   C  C     . ARG A 1  98   ? -54.804 -15.392 -66.865 1.00 72.36  ? 98   ARG A C     1 
ATOM   713   O  O     . ARG A 1  98   ? -55.455 -16.265 -66.285 1.00 71.63  ? 98   ARG A O     1 
ATOM   714   C  CB    . ARG A 1  98   ? -55.936 -14.548 -68.955 1.00 78.48  ? 98   ARG A CB    1 
ATOM   715   C  CG    . ARG A 1  98   ? -57.301 -15.204 -68.802 1.00 81.47  ? 98   ARG A CG    1 
ATOM   716   C  CD    . ARG A 1  98   ? -58.362 -14.444 -69.591 1.00 86.31  ? 98   ARG A CD    1 
ATOM   717   N  NE    . ARG A 1  98   ? -59.528 -15.277 -69.903 1.00 90.95  ? 98   ARG A NE    1 
ATOM   718   C  CZ    . ARG A 1  98   ? -60.484 -14.980 -70.794 1.00 94.19  ? 98   ARG A CZ    1 
ATOM   719   N  NH1   . ARG A 1  98   ? -60.453 -13.850 -71.506 1.00 95.84  ? 98   ARG A NH1   1 
ATOM   720   N  NH2   . ARG A 1  98   ? -61.492 -15.832 -70.978 1.00 95.16  ? 98   ARG A NH2   1 
ATOM   721   N  N     . ILE A 1  99   ? -54.108 -14.454 -66.230 1.00 70.22  ? 99   ILE A N     1 
ATOM   722   C  CA    . ILE A 1  99   ? -53.970 -14.424 -64.777 1.00 67.98  ? 99   ILE A CA    1 
ATOM   723   C  C     . ILE A 1  99   ? -55.289 -13.982 -64.134 1.00 67.39  ? 99   ILE A C     1 
ATOM   724   O  O     . ILE A 1  99   ? -55.882 -12.981 -64.539 1.00 67.30  ? 99   ILE A O     1 
ATOM   725   C  CB    . ILE A 1  99   ? -52.821 -13.480 -64.353 1.00 68.05  ? 99   ILE A CB    1 
ATOM   726   C  CG1   . ILE A 1  99   ? -51.481 -14.009 -64.878 1.00 67.68  ? 99   ILE A CG1   1 
ATOM   727   C  CG2   . ILE A 1  99   ? -52.753 -13.335 -62.835 1.00 68.43  ? 99   ILE A CG2   1 
ATOM   728   C  CD1   . ILE A 1  99   ? -50.442 -12.928 -65.083 1.00 68.10  ? 99   ILE A CD1   1 
ATOM   729   N  N     . HIS A 1  100  ? -55.739 -14.738 -63.136 1.00 65.81  ? 100  HIS A N     1 
ATOM   730   C  CA    . HIS A 1  100  ? -56.947 -14.397 -62.390 1.00 65.98  ? 100  HIS A CA    1 
ATOM   731   C  C     . HIS A 1  100  ? -56.654 -13.220 -61.438 1.00 65.40  ? 100  HIS A C     1 
ATOM   732   O  O     . HIS A 1  100  ? -55.523 -13.095 -60.974 1.00 65.31  ? 100  HIS A O     1 
ATOM   733   C  CB    . HIS A 1  100  ? -57.442 -15.612 -61.605 1.00 65.98  ? 100  HIS A CB    1 
ATOM   734   C  CG    . HIS A 1  100  ? -58.848 -15.472 -61.121 1.00 66.79  ? 100  HIS A CG    1 
ATOM   735   N  ND1   . HIS A 1  100  ? -59.155 -14.952 -59.885 1.00 66.99  ? 100  HIS A ND1   1 
ATOM   736   C  CD2   . HIS A 1  100  ? -60.029 -15.736 -61.725 1.00 67.48  ? 100  HIS A CD2   1 
ATOM   737   C  CE1   . HIS A 1  100  ? -60.467 -14.922 -59.737 1.00 68.24  ? 100  HIS A CE1   1 
ATOM   738   N  NE2   . HIS A 1  100  ? -61.020 -15.391 -60.841 1.00 68.55  ? 100  HIS A NE2   1 
ATOM   739   N  N     . PRO A 1  101  ? -57.652 -12.347 -61.159 1.00 65.23  ? 101  PRO A N     1 
ATOM   740   C  CA    . PRO A 1  101  ? -57.372 -11.176 -60.302 1.00 64.72  ? 101  PRO A CA    1 
ATOM   741   C  C     . PRO A 1  101  ? -56.785 -11.470 -58.918 1.00 62.95  ? 101  PRO A C     1 
ATOM   742   O  O     . PRO A 1  101  ? -55.838 -10.808 -58.508 1.00 62.69  ? 101  PRO A O     1 
ATOM   743   C  CB    . PRO A 1  101  ? -58.737 -10.507 -60.182 1.00 66.09  ? 101  PRO A CB    1 
ATOM   744   C  CG    . PRO A 1  101  ? -59.387 -10.810 -61.485 1.00 66.63  ? 101  PRO A CG    1 
ATOM   745   C  CD    . PRO A 1  101  ? -58.951 -12.199 -61.846 1.00 65.40  ? 101  PRO A CD    1 
ATOM   746   N  N     . VAL A 1  102  ? -57.347 -12.451 -58.217 1.00 62.17  ? 102  VAL A N     1 
ATOM   747   C  CA    . VAL A 1  102  ? -56.781 -12.969 -56.949 1.00 61.07  ? 102  VAL A CA    1 
ATOM   748   C  C     . VAL A 1  102  ? -55.287 -13.295 -57.072 1.00 60.41  ? 102  VAL A C     1 
ATOM   749   O  O     . VAL A 1  102  ? -54.500 -12.964 -56.180 1.00 61.13  ? 102  VAL A O     1 
ATOM   750   C  CB    . VAL A 1  102  ? -57.522 -14.241 -56.454 1.00 60.72  ? 102  VAL A CB    1 
ATOM   751   C  CG1   . VAL A 1  102  ? -56.845 -14.829 -55.217 1.00 60.23  ? 102  VAL A CG1   1 
ATOM   752   C  CG2   . VAL A 1  102  ? -58.991 -13.944 -56.166 1.00 61.20  ? 102  VAL A CG2   1 
ATOM   753   N  N     . GLN A 1  103  ? -54.912 -13.942 -58.174 1.00 59.43  ? 103  GLN A N     1 
ATOM   754   C  CA    . GLN A 1  103  ? -53.513 -14.274 -58.447 1.00 58.26  ? 103  GLN A CA    1 
ATOM   755   C  C     . GLN A 1  103  ? -52.663 -13.023 -58.693 1.00 59.66  ? 103  GLN A C     1 
ATOM   756   O  O     . GLN A 1  103  ? -51.560 -12.900 -58.149 1.00 59.63  ? 103  GLN A O     1 
ATOM   757   C  CB    . GLN A 1  103  ? -53.399 -15.219 -59.646 1.00 56.86  ? 103  GLN A CB    1 
ATOM   758   C  CG    . GLN A 1  103  ? -54.013 -16.590 -59.413 1.00 55.80  ? 103  GLN A CG    1 
ATOM   759   C  CD    . GLN A 1  103  ? -54.043 -17.443 -60.664 1.00 55.18  ? 103  GLN A CD    1 
ATOM   760   O  OE1   . GLN A 1  103  ? -54.190 -16.930 -61.774 1.00 55.28  ? 103  GLN A OE1   1 
ATOM   761   N  NE2   . GLN A 1  103  ? -53.923 -18.756 -60.489 1.00 54.37  ? 103  GLN A NE2   1 
ATOM   762   N  N     . GLU A 1  104  ? -53.179 -12.111 -59.513 1.00 61.27  ? 104  GLU A N     1 
ATOM   763   C  CA    . GLU A 1  104  ? -52.502 -10.839 -59.808 1.00 63.05  ? 104  GLU A CA    1 
ATOM   764   C  C     . GLU A 1  104  ? -52.236 -10.000 -58.562 1.00 62.72  ? 104  GLU A C     1 
ATOM   765   O  O     . GLU A 1  104  ? -51.143 -9.455  -58.396 1.00 61.51  ? 104  GLU A O     1 
ATOM   766   C  CB    . GLU A 1  104  ? -53.341 -9.998  -60.776 1.00 65.22  ? 104  GLU A CB    1 
ATOM   767   C  CG    . GLU A 1  104  ? -52.670 -8.708  -61.240 1.00 66.64  ? 104  GLU A CG    1 
ATOM   768   C  CD    . GLU A 1  104  ? -53.597 -7.800  -62.023 1.00 68.83  ? 104  GLU A CD    1 
ATOM   769   O  OE1   . GLU A 1  104  ? -54.828 -7.837  -61.804 1.00 70.80  ? 104  GLU A OE1   1 
ATOM   770   O  OE2   . GLU A 1  104  ? -53.083 -7.026  -62.853 1.00 70.67  ? 104  GLU A OE2   1 
ATOM   771   N  N     . ARG A 1  105  ? -53.249 -9.891  -57.707 1.00 62.99  ? 105  ARG A N     1 
ATOM   772   C  CA    . ARG A 1  105  ? -53.230 -8.944  -56.597 1.00 63.36  ? 105  ARG A CA    1 
ATOM   773   C  C     . ARG A 1  105  ? -52.418 -9.414  -55.406 1.00 61.78  ? 105  ARG A C     1 
ATOM   774   O  O     . ARG A 1  105  ? -51.691 -8.622  -54.821 1.00 61.76  ? 105  ARG A O     1 
ATOM   775   C  CB    . ARG A 1  105  ? -54.654 -8.598  -56.171 1.00 64.86  ? 105  ARG A CB    1 
ATOM   776   C  CG    . ARG A 1  105  ? -55.414 -7.884  -57.271 1.00 66.34  ? 105  ARG A CG    1 
ATOM   777   C  CD    . ARG A 1  105  ? -56.769 -7.402  -56.808 1.00 67.61  ? 105  ARG A CD    1 
ATOM   778   N  NE    . ARG A 1  105  ? -57.680 -7.173  -57.927 1.00 68.74  ? 105  ARG A NE    1 
ATOM   779   C  CZ    . ARG A 1  105  ? -58.906 -6.667  -57.812 1.00 69.52  ? 105  ARG A CZ    1 
ATOM   780   N  NH1   . ARG A 1  105  ? -59.394 -6.323  -56.618 1.00 69.49  ? 105  ARG A NH1   1 
ATOM   781   N  NH2   . ARG A 1  105  ? -59.654 -6.502  -58.902 1.00 70.39  ? 105  ARG A NH2   1 
ATOM   782   N  N     . ILE A 1  106  ? -52.532 -10.689 -55.045 1.00 60.79  ? 106  ILE A N     1 
ATOM   783   C  CA    . ILE A 1  106  ? -51.703 -11.237 -53.967 1.00 60.24  ? 106  ILE A CA    1 
ATOM   784   C  C     . ILE A 1  106  ? -50.212 -11.140 -54.305 1.00 59.16  ? 106  ILE A C     1 
ATOM   785   O  O     . ILE A 1  106  ? -49.404 -10.923 -53.415 1.00 59.97  ? 106  ILE A O     1 
ATOM   786   C  CB    . ILE A 1  106  ? -52.089 -12.690 -53.590 1.00 59.79  ? 106  ILE A CB    1 
ATOM   787   C  CG1   . ILE A 1  106  ? -51.474 -13.074 -52.237 1.00 59.43  ? 106  ILE A CG1   1 
ATOM   788   C  CG2   . ILE A 1  106  ? -51.683 -13.683 -54.676 1.00 59.50  ? 106  ILE A CG2   1 
ATOM   789   C  CD1   . ILE A 1  106  ? -52.111 -14.291 -51.601 1.00 59.28  ? 106  ILE A CD1   1 
ATOM   790   N  N     . ALA A 1  107  ? -49.865 -11.286 -55.585 1.00 58.68  ? 107  ALA A N     1 
ATOM   791   C  CA    . ALA A 1  107  ? -48.493 -11.099 -56.053 1.00 58.13  ? 107  ALA A CA    1 
ATOM   792   C  C     . ALA A 1  107  ? -48.107 -9.625  -56.032 1.00 59.03  ? 107  ALA A C     1 
ATOM   793   O  O     . ALA A 1  107  ? -47.122 -9.248  -55.398 1.00 59.48  ? 107  ALA A O     1 
ATOM   794   C  CB    . ALA A 1  107  ? -48.325 -11.654 -57.457 1.00 57.88  ? 107  ALA A CB    1 
ATOM   795   N  N     . LYS A 1  108  ? -48.886 -8.798  -56.720 1.00 59.66  ? 108  LYS A N     1 
ATOM   796   C  CA    . LYS A 1  108  ? -48.561 -7.377  -56.868 1.00 60.79  ? 108  LYS A CA    1 
ATOM   797   C  C     . LYS A 1  108  ? -48.679 -6.551  -55.575 1.00 61.05  ? 108  LYS A C     1 
ATOM   798   O  O     . LYS A 1  108  ? -48.044 -5.503  -55.472 1.00 62.01  ? 108  LYS A O     1 
ATOM   799   C  CB    . LYS A 1  108  ? -49.371 -6.748  -58.004 1.00 62.02  ? 108  LYS A CB    1 
ATOM   800   C  CG    . LYS A 1  108  ? -48.917 -7.229  -59.376 1.00 62.34  ? 108  LYS A CG    1 
ATOM   801   C  CD    . LYS A 1  108  ? -49.665 -6.534  -60.498 1.00 63.30  ? 108  LYS A CD    1 
ATOM   802   C  CE    . LYS A 1  108  ? -49.351 -7.173  -61.838 1.00 63.27  ? 108  LYS A CE    1 
ATOM   803   N  NZ    . LYS A 1  108  ? -50.166 -6.587  -62.938 1.00 64.48  ? 108  LYS A NZ    1 
ATOM   804   N  N     . CYS A 1  109  ? -49.442 -7.037  -54.592 1.00 60.12  ? 109  CYS A N     1 
ATOM   805   C  CA    . CYS A 1  109  ? -49.416 -6.474  -53.229 1.00 59.76  ? 109  CYS A CA    1 
ATOM   806   C  C     . CYS A 1  109  ? -48.229 -6.982  -52.388 1.00 58.91  ? 109  CYS A C     1 
ATOM   807   O  O     . CYS A 1  109  ? -48.152 -6.684  -51.196 1.00 59.55  ? 109  CYS A O     1 
ATOM   808   C  CB    . CYS A 1  109  ? -50.735 -6.758  -52.491 1.00 59.61  ? 109  CYS A CB    1 
ATOM   809   S  SG    . CYS A 1  109  ? -52.183 -5.954  -53.218 1.00 60.92  ? 109  CYS A SG    1 
ATOM   810   N  N     . HIS A 1  110  ? -47.308 -7.725  -53.008 1.00 57.76  ? 110  HIS A N     1 
ATOM   811   C  CA    . HIS A 1  110  ? -46.129 -8.289  -52.348 1.00 57.21  ? 110  HIS A CA    1 
ATOM   812   C  C     . HIS A 1  110  ? -46.526 -9.255  -51.236 1.00 57.65  ? 110  HIS A C     1 
ATOM   813   O  O     . HIS A 1  110  ? -45.917 -9.280  -50.158 1.00 58.19  ? 110  HIS A O     1 
ATOM   814   C  CB    . HIS A 1  110  ? -45.194 -7.183  -51.850 1.00 57.31  ? 110  HIS A CB    1 
ATOM   815   C  CG    . HIS A 1  110  ? -44.989 -6.087  -52.846 1.00 58.52  ? 110  HIS A CG    1 
ATOM   816   N  ND1   . HIS A 1  110  ? -44.201 -6.237  -53.965 1.00 58.45  ? 110  HIS A ND1   1 
ATOM   817   C  CD2   . HIS A 1  110  ? -45.484 -4.829  -52.901 1.00 59.88  ? 110  HIS A CD2   1 
ATOM   818   C  CE1   . HIS A 1  110  ? -44.212 -5.116  -54.662 1.00 59.20  ? 110  HIS A CE1   1 
ATOM   819   N  NE2   . HIS A 1  110  ? -44.981 -4.244  -54.037 1.00 59.94  ? 110  HIS A NE2   1 
ATOM   820   N  N     . GLY A 1  111  ? -47.545 -10.064 -51.528 1.00 57.93  ? 111  GLY A N     1 
ATOM   821   C  CA    . GLY A 1  111  ? -48.066 -11.061 -50.592 1.00 58.19  ? 111  GLY A CA    1 
ATOM   822   C  C     . GLY A 1  111  ? -47.441 -12.430 -50.718 1.00 57.66  ? 111  GLY A C     1 
ATOM   823   O  O     . GLY A 1  111  ? -47.945 -13.382 -50.131 1.00 57.59  ? 111  GLY A O     1 
ATOM   824   N  N     . THR A 1  112  ? -46.361 -12.529 -51.494 1.00 57.77  ? 112  THR A N     1 
ATOM   825   C  CA    . THR A 1  112  ? -45.579 -13.748 -51.616 1.00 56.71  ? 112  THR A CA    1 
ATOM   826   C  C     . THR A 1  112  ? -44.130 -13.389 -51.363 1.00 56.44  ? 112  THR A C     1 
ATOM   827   O  O     . THR A 1  112  ? -43.635 -12.385 -51.877 1.00 55.70  ? 112  THR A O     1 
ATOM   828   C  CB    . THR A 1  112  ? -45.695 -14.376 -53.024 1.00 56.48  ? 112  THR A CB    1 
ATOM   829   O  OG1   . THR A 1  112  ? -44.850 -13.680 -53.949 1.00 56.42  ? 112  THR A OG1   1 
ATOM   830   C  CG2   . THR A 1  112  ? -47.136 -14.340 -53.533 1.00 56.79  ? 112  THR A CG2   1 
ATOM   831   N  N     . GLN A 1  113  ? -43.460 -14.202 -50.559 1.00 56.69  ? 113  GLN A N     1 
ATOM   832   C  CA    . GLN A 1  113  ? -42.026 -14.090 -50.383 1.00 57.06  ? 113  GLN A CA    1 
ATOM   833   C  C     . GLN A 1  113  ? -41.404 -15.386 -50.891 1.00 57.34  ? 113  GLN A C     1 
ATOM   834   O  O     . GLN A 1  113  ? -40.943 -15.417 -52.038 1.00 57.52  ? 113  GLN A O     1 
ATOM   835   C  CB    . GLN A 1  113  ? -41.688 -13.772 -48.933 1.00 57.32  ? 113  GLN A CB    1 
ATOM   836   C  CG    . GLN A 1  113  ? -41.863 -12.299 -48.590 1.00 57.26  ? 113  GLN A CG    1 
ATOM   837   C  CD    . GLN A 1  113  ? -41.366 -11.936 -47.203 1.00 57.61  ? 113  GLN A CD    1 
ATOM   838   O  OE1   . GLN A 1  113  ? -40.403 -12.516 -46.701 1.00 57.90  ? 113  GLN A OE1   1 
ATOM   839   N  NE2   . GLN A 1  113  ? -42.013 -10.957 -46.580 1.00 58.13  ? 113  GLN A NE2   1 
ATOM   840   N  N     . CYS A 1  114  ? -41.416 -16.455 -50.088 1.00 57.14  ? 114  CYS A N     1 
ATOM   841   C  CA    . CYS A 1  114  ? -40.945 -17.763 -50.578 1.00 56.66  ? 114  CYS A CA    1 
ATOM   842   C  C     . CYS A 1  114  ? -41.939 -18.331 -51.574 1.00 55.68  ? 114  CYS A C     1 
ATOM   843   O  O     . CYS A 1  114  ? -41.554 -19.064 -52.478 1.00 55.72  ? 114  CYS A O     1 
ATOM   844   C  CB    . CYS A 1  114  ? -40.703 -18.762 -49.443 1.00 57.31  ? 114  CYS A CB    1 
ATOM   845   S  SG    . CYS A 1  114  ? -42.137 -19.756 -48.977 1.00 58.95  ? 114  CYS A SG    1 
ATOM   846   N  N     . GLY A 1  115  ? -43.214 -18.005 -51.377 1.00 56.30  ? 115  GLY A N     1 
ATOM   847   C  CA    . GLY A 1  115  ? -44.279 -18.344 -52.312 1.00 54.87  ? 115  GLY A CA    1 
ATOM   848   C  C     . GLY A 1  115  ? -44.920 -19.704 -52.129 1.00 54.00  ? 115  GLY A C     1 
ATOM   849   O  O     . GLY A 1  115  ? -45.831 -20.061 -52.881 1.00 55.37  ? 115  GLY A O     1 
ATOM   850   N  N     . PHE A 1  116  ? -44.461 -20.469 -51.141 1.00 52.75  ? 116  PHE A N     1 
ATOM   851   C  CA    . PHE A 1  116  ? -44.904 -21.850 -50.986 1.00 52.54  ? 116  PHE A CA    1 
ATOM   852   C  C     . PHE A 1  116  ? -46.332 -21.952 -50.440 1.00 53.04  ? 116  PHE A C     1 
ATOM   853   O  O     . PHE A 1  116  ? -47.037 -22.915 -50.735 1.00 53.15  ? 116  PHE A O     1 
ATOM   854   C  CB    . PHE A 1  116  ? -43.926 -22.628 -50.109 1.00 52.05  ? 116  PHE A CB    1 
ATOM   855   C  CG    . PHE A 1  116  ? -43.973 -24.113 -50.321 1.00 50.88  ? 116  PHE A CG    1 
ATOM   856   C  CD1   . PHE A 1  116  ? -43.362 -24.690 -51.430 1.00 49.85  ? 116  PHE A CD1   1 
ATOM   857   C  CD2   . PHE A 1  116  ? -44.626 -24.938 -49.413 1.00 50.65  ? 116  PHE A CD2   1 
ATOM   858   C  CE1   . PHE A 1  116  ? -43.398 -26.062 -51.626 1.00 49.23  ? 116  PHE A CE1   1 
ATOM   859   C  CE2   . PHE A 1  116  ? -44.665 -26.307 -49.602 1.00 50.31  ? 116  PHE A CE2   1 
ATOM   860   C  CZ    . PHE A 1  116  ? -44.050 -26.873 -50.710 1.00 49.59  ? 116  PHE A CZ    1 
ATOM   861   N  N     . CYS A 1  117  ? -46.761 -20.950 -49.673 1.00 54.16  ? 117  CYS A N     1 
ATOM   862   C  CA    . CYS A 1  117  ? -48.138 -20.885 -49.169 1.00 54.76  ? 117  CYS A CA    1 
ATOM   863   C  C     . CYS A 1  117  ? -49.124 -20.176 -50.105 1.00 55.29  ? 117  CYS A C     1 
ATOM   864   O  O     . CYS A 1  117  ? -50.325 -20.137 -49.799 1.00 54.80  ? 117  CYS A O     1 
ATOM   865   C  CB    . CYS A 1  117  ? -48.164 -20.176 -47.819 1.00 55.36  ? 117  CYS A CB    1 
ATOM   866   S  SG    . CYS A 1  117  ? -47.975 -18.384 -47.935 1.00 56.84  ? 117  CYS A SG    1 
ATOM   867   N  N     . THR A 1  118  ? -48.638 -19.620 -51.224 1.00 55.35  ? 118  THR A N     1 
ATOM   868   C  CA    . THR A 1  118  ? -49.459 -18.739 -52.070 1.00 56.06  ? 118  THR A CA    1 
ATOM   869   C  C     . THR A 1  118  ? -50.645 -19.452 -52.720 1.00 56.88  ? 118  THR A C     1 
ATOM   870   O  O     . THR A 1  118  ? -51.746 -18.905 -52.713 1.00 58.82  ? 118  THR A O     1 
ATOM   871   C  CB    . THR A 1  118  ? -48.640 -18.016 -53.165 1.00 55.61  ? 118  THR A CB    1 
ATOM   872   O  OG1   . THR A 1  118  ? -47.422 -17.518 -52.610 1.00 55.63  ? 118  THR A OG1   1 
ATOM   873   C  CG2   . THR A 1  118  ? -49.424 -16.836 -53.752 1.00 56.27  ? 118  THR A CG2   1 
ATOM   874   N  N     . PRO A 1  119  ? -50.433 -20.663 -53.278 1.00 56.63  ? 119  PRO A N     1 
ATOM   875   C  CA    . PRO A 1  119  ? -51.564 -21.358 -53.896 1.00 56.99  ? 119  PRO A CA    1 
ATOM   876   C  C     . PRO A 1  119  ? -52.710 -21.621 -52.921 1.00 56.86  ? 119  PRO A C     1 
ATOM   877   O  O     . PRO A 1  119  ? -53.873 -21.430 -53.274 1.00 58.44  ? 119  PRO A O     1 
ATOM   878   C  CB    . PRO A 1  119  ? -50.940 -22.669 -54.395 1.00 56.01  ? 119  PRO A CB    1 
ATOM   879   C  CG    . PRO A 1  119  ? -49.513 -22.325 -54.624 1.00 55.65  ? 119  PRO A CG    1 
ATOM   880   C  CD    . PRO A 1  119  ? -49.186 -21.426 -53.464 1.00 56.75  ? 119  PRO A CD    1 
ATOM   881   N  N     . GLY A 1  120  ? -52.378 -22.026 -51.702 1.00 55.85  ? 120  GLY A N     1 
ATOM   882   C  CA    . GLY A 1  120  ? -53.380 -22.248 -50.672 1.00 56.11  ? 120  GLY A CA    1 
ATOM   883   C  C     . GLY A 1  120  ? -54.171 -21.001 -50.337 1.00 56.72  ? 120  GLY A C     1 
ATOM   884   O  O     . GLY A 1  120  ? -55.386 -21.067 -50.158 1.00 57.08  ? 120  GLY A O     1 
ATOM   885   N  N     . MET A 1  121  ? -53.469 -19.870 -50.263 1.00 56.66  ? 121  MET A N     1 
ATOM   886   C  CA    . MET A 1  121  ? -54.079 -18.570 -49.989 1.00 56.66  ? 121  MET A CA    1 
ATOM   887   C  C     . MET A 1  121  ? -55.011 -18.189 -51.125 1.00 57.06  ? 121  MET A C     1 
ATOM   888   O  O     . MET A 1  121  ? -56.144 -17.760 -50.894 1.00 58.22  ? 121  MET A O     1 
ATOM   889   C  CB    . MET A 1  121  ? -53.008 -17.482 -49.847 1.00 57.15  ? 121  MET A CB    1 
ATOM   890   C  CG    . MET A 1  121  ? -52.040 -17.678 -48.688 1.00 57.25  ? 121  MET A CG    1 
ATOM   891   S  SD    . MET A 1  121  ? -52.677 -17.142 -47.094 1.00 58.42  ? 121  MET A SD    1 
ATOM   892   C  CE    . MET A 1  121  ? -51.310 -17.642 -46.048 1.00 57.94  ? 121  MET A CE    1 
ATOM   893   N  N     . VAL A 1  122  ? -54.515 -18.361 -52.350 1.00 56.34  ? 122  VAL A N     1 
ATOM   894   C  CA    . VAL A 1  122  ? -55.264 -18.054 -53.573 1.00 56.21  ? 122  VAL A CA    1 
ATOM   895   C  C     . VAL A 1  122  ? -56.603 -18.809 -53.613 1.00 56.40  ? 122  VAL A C     1 
ATOM   896   O  O     . VAL A 1  122  ? -57.647 -18.217 -53.911 1.00 56.89  ? 122  VAL A O     1 
ATOM   897   C  CB    . VAL A 1  122  ? -54.404 -18.345 -54.839 1.00 55.50  ? 122  VAL A CB    1 
ATOM   898   C  CG1   . VAL A 1  122  ? -55.243 -18.354 -56.116 1.00 56.04  ? 122  VAL A CG1   1 
ATOM   899   C  CG2   . VAL A 1  122  ? -53.273 -17.327 -54.962 1.00 55.31  ? 122  VAL A CG2   1 
ATOM   900   N  N     . MET A 1  123  ? -56.572 -20.097 -53.297 1.00 55.46  ? 123  MET A N     1 
ATOM   901   C  CA    . MET A 1  123  ? -57.776 -20.924 -53.377 1.00 56.24  ? 123  MET A CA    1 
ATOM   902   C  C     . MET A 1  123  ? -58.779 -20.652 -52.252 1.00 56.90  ? 123  MET A C     1 
ATOM   903   O  O     . MET A 1  123  ? -59.986 -20.743 -52.472 1.00 57.36  ? 123  MET A O     1 
ATOM   904   C  CB    . MET A 1  123  ? -57.407 -22.412 -53.461 1.00 55.64  ? 123  MET A CB    1 
ATOM   905   C  CG    . MET A 1  123  ? -56.703 -22.791 -54.759 1.00 55.03  ? 123  MET A CG    1 
ATOM   906   S  SD    . MET A 1  123  ? -57.530 -22.204 -56.260 1.00 56.34  ? 123  MET A SD    1 
ATOM   907   C  CE    . MET A 1  123  ? -59.078 -23.107 -56.196 1.00 56.73  ? 123  MET A CE    1 
ATOM   908   N  N     . SER A 1  124  ? -58.286 -20.307 -51.066 1.00 56.30  ? 124  SER A N     1 
ATOM   909   C  CA    . SER A 1  124  ? -59.147 -19.784 -50.006 1.00 56.65  ? 124  SER A CA    1 
ATOM   910   C  C     . SER A 1  124  ? -59.847 -18.475 -50.421 1.00 57.72  ? 124  SER A C     1 
ATOM   911   O  O     . SER A 1  124  ? -61.063 -18.340 -50.258 1.00 57.96  ? 124  SER A O     1 
ATOM   912   C  CB    . SER A 1  124  ? -58.340 -19.555 -48.735 1.00 56.09  ? 124  SER A CB    1 
ATOM   913   O  OG    . SER A 1  124  ? -57.918 -20.791 -48.187 1.00 56.04  ? 124  SER A OG    1 
ATOM   914   N  N     . ILE A 1  125  ? -59.070 -17.533 -50.963 1.00 57.49  ? 125  ILE A N     1 
ATOM   915   C  CA    . ILE A 1  125  ? -59.594 -16.236 -51.403 1.00 58.15  ? 125  ILE A CA    1 
ATOM   916   C  C     . ILE A 1  125  ? -60.555 -16.421 -52.573 1.00 58.42  ? 125  ILE A C     1 
ATOM   917   O  O     . ILE A 1  125  ? -61.677 -15.903 -52.543 1.00 60.20  ? 125  ILE A O     1 
ATOM   918   C  CB    . ILE A 1  125  ? -58.458 -15.249 -51.786 1.00 58.40  ? 125  ILE A CB    1 
ATOM   919   C  CG1   . ILE A 1  125  ? -57.657 -14.855 -50.538 1.00 58.54  ? 125  ILE A CG1   1 
ATOM   920   C  CG2   . ILE A 1  125  ? -59.012 -13.984 -52.445 1.00 59.18  ? 125  ILE A CG2   1 
ATOM   921   C  CD1   . ILE A 1  125  ? -56.329 -14.188 -50.833 1.00 58.65  ? 125  ILE A CD1   1 
ATOM   922   N  N     . TYR A 1  126  ? -60.108 -17.157 -53.590 1.00 57.00  ? 126  TYR A N     1 
ATOM   923   C  CA    . TYR A 1  126  ? -60.933 -17.477 -54.760 1.00 56.48  ? 126  TYR A CA    1 
ATOM   924   C  C     . TYR A 1  126  ? -62.268 -18.112 -54.379 1.00 56.69  ? 126  TYR A C     1 
ATOM   925   O  O     . TYR A 1  126  ? -63.310 -17.743 -54.927 1.00 57.20  ? 126  TYR A O     1 
ATOM   926   C  CB    . TYR A 1  126  ? -60.184 -18.426 -55.712 1.00 55.28  ? 126  TYR A CB    1 
ATOM   927   C  CG    . TYR A 1  126  ? -60.982 -18.814 -56.942 1.00 54.57  ? 126  TYR A CG    1 
ATOM   928   C  CD1   . TYR A 1  126  ? -61.158 -17.912 -57.984 1.00 55.00  ? 126  TYR A CD1   1 
ATOM   929   C  CD2   . TYR A 1  126  ? -61.569 -20.078 -57.059 1.00 53.91  ? 126  TYR A CD2   1 
ATOM   930   C  CE1   . TYR A 1  126  ? -61.891 -18.249 -59.115 1.00 55.40  ? 126  TYR A CE1   1 
ATOM   931   C  CE2   . TYR A 1  126  ? -62.302 -20.426 -58.191 1.00 54.63  ? 126  TYR A CE2   1 
ATOM   932   C  CZ    . TYR A 1  126  ? -62.464 -19.503 -59.212 1.00 55.34  ? 126  TYR A CZ    1 
ATOM   933   O  OH    . TYR A 1  126  ? -63.188 -19.809 -60.338 1.00 56.63  ? 126  TYR A OH    1 
ATOM   934   N  N     . THR A 1  127  ? -62.220 -19.070 -53.453 1.00 56.16  ? 127  THR A N     1 
ATOM   935   C  CA    . THR A 1  127  ? -63.410 -19.819 -53.055 1.00 57.01  ? 127  THR A CA    1 
ATOM   936   C  C     . THR A 1  127  ? -64.431 -18.931 -52.374 1.00 59.08  ? 127  THR A C     1 
ATOM   937   O  O     . THR A 1  127  ? -65.628 -19.026 -52.675 1.00 60.07  ? 127  THR A O     1 
ATOM   938   C  CB    . THR A 1  127  ? -63.080 -21.052 -52.173 1.00 56.02  ? 127  THR A CB    1 
ATOM   939   O  OG1   . THR A 1  127  ? -62.199 -21.939 -52.881 1.00 54.49  ? 127  THR A OG1   1 
ATOM   940   C  CG2   . THR A 1  127  ? -64.348 -21.818 -51.801 1.00 56.28  ? 127  THR A CG2   1 
ATOM   941   N  N     . LEU A 1  128  ? -63.959 -18.060 -51.483 1.00 59.91  ? 128  LEU A N     1 
ATOM   942   C  CA    . LEU A 1  128  ? -64.832 -17.102 -50.826 1.00 61.14  ? 128  LEU A CA    1 
ATOM   943   C  C     . LEU A 1  128  ? -65.462 -16.157 -51.840 1.00 62.32  ? 128  LEU A C     1 
ATOM   944   O  O     . LEU A 1  128  ? -66.665 -15.911 -51.781 1.00 63.62  ? 128  LEU A O     1 
ATOM   945   C  CB    . LEU A 1  128  ? -64.084 -16.292 -49.777 1.00 61.24  ? 128  LEU A CB    1 
ATOM   946   C  CG    . LEU A 1  128  ? -65.047 -15.443 -48.942 1.00 62.63  ? 128  LEU A CG    1 
ATOM   947   C  CD1   . LEU A 1  128  ? -65.497 -16.199 -47.704 1.00 63.19  ? 128  LEU A CD1   1 
ATOM   948   C  CD2   . LEU A 1  128  ? -64.402 -14.127 -48.586 1.00 63.26  ? 128  LEU A CD2   1 
ATOM   949   N  N     . LEU A 1  129  ? -64.655 -15.634 -52.760 1.00 62.07  ? 129  LEU A N     1 
ATOM   950   C  CA    . LEU A 1  129  ? -65.165 -14.742 -53.805 1.00 63.59  ? 129  LEU A CA    1 
ATOM   951   C  C     . LEU A 1  129  ? -66.225 -15.382 -54.711 1.00 64.24  ? 129  LEU A C     1 
ATOM   952   O  O     . LEU A 1  129  ? -67.098 -14.682 -55.230 1.00 64.78  ? 129  LEU A O     1 
ATOM   953   C  CB    . LEU A 1  129  ? -64.018 -14.198 -54.660 1.00 63.62  ? 129  LEU A CB    1 
ATOM   954   C  CG    . LEU A 1  129  ? -63.097 -13.191 -53.973 1.00 64.09  ? 129  LEU A CG    1 
ATOM   955   C  CD1   . LEU A 1  129  ? -61.895 -12.901 -54.855 1.00 63.77  ? 129  LEU A CD1   1 
ATOM   956   C  CD2   . LEU A 1  129  ? -63.837 -11.902 -53.632 1.00 65.55  ? 129  LEU A CD2   1 
ATOM   957   N  N     . ARG A 1  130  ? -66.143 -16.695 -54.907 1.00 64.39  ? 130  ARG A N     1 
ATOM   958   C  CA    . ARG A 1  130  ? -67.157 -17.416 -55.687 1.00 66.31  ? 130  ARG A CA    1 
ATOM   959   C  C     . ARG A 1  130  ? -68.475 -17.581 -54.920 1.00 67.12  ? 130  ARG A C     1 
ATOM   960   O  O     . ARG A 1  130  ? -69.518 -17.776 -55.538 1.00 68.75  ? 130  ARG A O     1 
ATOM   961   C  CB    . ARG A 1  130  ? -66.622 -18.779 -56.181 1.00 65.77  ? 130  ARG A CB    1 
ATOM   962   C  CG    . ARG A 1  130  ? -65.626 -18.688 -57.336 1.00 65.10  ? 130  ARG A CG    1 
ATOM   963   C  CD    . ARG A 1  130  ? -66.260 -18.206 -58.631 1.00 66.55  ? 130  ARG A CD    1 
ATOM   964   N  NE    . ARG A 1  130  ? -67.345 -19.089 -59.072 1.00 67.68  ? 130  ARG A NE    1 
ATOM   965   C  CZ    . ARG A 1  130  ? -67.220 -20.148 -59.876 1.00 67.38  ? 130  ARG A CZ    1 
ATOM   966   N  NH1   . ARG A 1  130  ? -66.040 -20.512 -60.377 1.00 67.03  ? 130  ARG A NH1   1 
ATOM   967   N  NH2   . ARG A 1  130  ? -68.301 -20.859 -60.189 1.00 67.91  ? 130  ARG A NH2   1 
ATOM   968   N  N     . ASN A 1  131  ? -68.418 -17.522 -53.590 1.00 67.28  ? 131  ASN A N     1 
ATOM   969   C  CA    . ASN A 1  131  ? -69.613 -17.481 -52.738 1.00 68.21  ? 131  ASN A CA    1 
ATOM   970   C  C     . ASN A 1  131  ? -70.082 -16.063 -52.396 1.00 69.28  ? 131  ASN A C     1 
ATOM   971   O  O     . ASN A 1  131  ? -71.277 -15.843 -52.223 1.00 70.04  ? 131  ASN A O     1 
ATOM   972   C  CB    . ASN A 1  131  ? -69.364 -18.265 -51.445 1.00 67.03  ? 131  ASN A CB    1 
ATOM   973   C  CG    . ASN A 1  131  ? -69.093 -19.732 -51.702 1.00 66.20  ? 131  ASN A CG    1 
ATOM   974   O  OD1   . ASN A 1  131  ? -68.044 -20.250 -51.334 1.00 65.07  ? 131  ASN A OD1   1 
ATOM   975   N  ND2   . ASN A 1  131  ? -70.037 -20.408 -52.347 1.00 67.19  ? 131  ASN A ND2   1 
ATOM   976   N  N     . HIS A 1  132  ? -69.142 -15.123 -52.288 1.00 69.92  ? 132  HIS A N     1 
ATOM   977   C  CA    . HIS A 1  132  ? -69.423 -13.726 -51.930 1.00 71.89  ? 132  HIS A CA    1 
ATOM   978   C  C     . HIS A 1  132  ? -68.605 -12.766 -52.809 1.00 72.67  ? 132  HIS A C     1 
ATOM   979   O  O     . HIS A 1  132  ? -67.541 -12.293 -52.388 1.00 71.11  ? 132  HIS A O     1 
ATOM   980   C  CB    . HIS A 1  132  ? -69.120 -13.481 -50.446 1.00 71.71  ? 132  HIS A CB    1 
ATOM   981   C  CG    . HIS A 1  132  ? -69.938 -14.325 -49.525 1.00 72.46  ? 132  HIS A CG    1 
ATOM   982   N  ND1   . HIS A 1  132  ? -71.312 -14.251 -49.473 1.00 74.73  ? 132  HIS A ND1   1 
ATOM   983   C  CD2   . HIS A 1  132  ? -69.579 -15.278 -48.633 1.00 72.85  ? 132  HIS A CD2   1 
ATOM   984   C  CE1   . HIS A 1  132  ? -71.766 -15.116 -48.584 1.00 75.23  ? 132  HIS A CE1   1 
ATOM   985   N  NE2   . HIS A 1  132  ? -70.734 -15.751 -48.059 1.00 74.36  ? 132  HIS A NE2   1 
ATOM   986   N  N     . PRO A 1  133  ? -69.099 -12.480 -54.038 1.00 74.72  ? 133  PRO A N     1 
ATOM   987   C  CA    . PRO A 1  133  ? -68.415 -11.573 -54.984 1.00 75.81  ? 133  PRO A CA    1 
ATOM   988   C  C     . PRO A 1  133  ? -68.232 -10.128 -54.497 1.00 78.27  ? 133  PRO A C     1 
ATOM   989   O  O     . PRO A 1  133  ? -67.336 -9.438  -54.992 1.00 77.92  ? 133  PRO A O     1 
ATOM   990   C  CB    . PRO A 1  133  ? -69.327 -11.588 -56.221 1.00 76.38  ? 133  PRO A CB    1 
ATOM   991   C  CG    . PRO A 1  133  ? -70.161 -12.811 -56.089 1.00 76.14  ? 133  PRO A CG    1 
ATOM   992   C  CD    . PRO A 1  133  ? -70.333 -13.040 -54.622 1.00 75.50  ? 133  PRO A CD    1 
ATOM   993   N  N     . GLU A 1  134  ? -69.079 -9.691  -53.556 1.00 81.20  ? 134  GLU A N     1 
ATOM   994   C  CA    . GLU A 1  134  ? -69.032 -8.355  -52.956 1.00 82.93  ? 134  GLU A CA    1 
ATOM   995   C  C     . GLU A 1  134  ? -68.788 -8.503  -51.443 1.00 80.73  ? 134  GLU A C     1 
ATOM   996   O  O     . GLU A 1  134  ? -69.643 -8.129  -50.639 1.00 82.30  ? 134  GLU A O     1 
ATOM   997   C  CB    . GLU A 1  134  ? -70.371 -7.631  -53.203 1.00 87.40  ? 134  GLU A CB    1 
ATOM   998   C  CG    . GLU A 1  134  ? -70.816 -7.511  -54.665 1.00 90.65  ? 134  GLU A CG    1 
ATOM   999   C  CD    . GLU A 1  134  ? -70.297 -6.263  -55.376 1.00 93.68  ? 134  GLU A CD    1 
ATOM   1000  O  OE1   . GLU A 1  134  ? -69.177 -5.792  -55.064 1.00 94.98  ? 134  GLU A OE1   1 
ATOM   1001  O  OE2   . GLU A 1  134  ? -71.016 -5.753  -56.266 1.00 96.15  ? 134  GLU A OE2   1 
ATOM   1002  N  N     . PRO A 1  135  ? -67.615 -9.037  -51.043 1.00 77.63  ? 135  PRO A N     1 
ATOM   1003  C  CA    . PRO A 1  135  ? -67.407 -9.437  -49.650 1.00 76.13  ? 135  PRO A CA    1 
ATOM   1004  C  C     . PRO A 1  135  ? -67.041 -8.302  -48.700 1.00 75.42  ? 135  PRO A C     1 
ATOM   1005  O  O     . PRO A 1  135  ? -66.673 -7.212  -49.145 1.00 74.78  ? 135  PRO A O     1 
ATOM   1006  C  CB    . PRO A 1  135  ? -66.218 -10.382 -49.759 1.00 74.68  ? 135  PRO A CB    1 
ATOM   1007  C  CG    . PRO A 1  135  ? -65.393 -9.757  -50.828 1.00 74.82  ? 135  PRO A CG    1 
ATOM   1008  C  CD    . PRO A 1  135  ? -66.374 -9.197  -51.824 1.00 76.34  ? 135  PRO A CD    1 
ATOM   1009  N  N     . THR A 1  136  ? -67.153 -8.584  -47.400 1.00 74.74  ? 136  THR A N     1 
ATOM   1010  C  CA    . THR A 1  136  ? -66.550 -7.770  -46.337 1.00 74.52  ? 136  THR A CA    1 
ATOM   1011  C  C     . THR A 1  136  ? -65.232 -8.425  -45.913 1.00 73.01  ? 136  THR A C     1 
ATOM   1012  O  O     . THR A 1  136  ? -65.072 -9.640  -46.032 1.00 72.59  ? 136  THR A O     1 
ATOM   1013  C  CB    . THR A 1  136  ? -67.477 -7.654  -45.108 1.00 75.00  ? 136  THR A CB    1 
ATOM   1014  O  OG1   . THR A 1  136  ? -67.674 -8.947  -44.520 1.00 74.03  ? 136  THR A OG1   1 
ATOM   1015  C  CG2   . THR A 1  136  ? -68.828 -7.059  -45.506 1.00 75.92  ? 136  THR A CG2   1 
ATOM   1016  N  N     . LEU A 1  137  ? -64.297 -7.623  -45.412 1.00 72.55  ? 137  LEU A N     1 
ATOM   1017  C  CA    . LEU A 1  137  ? -62.958 -8.116  -45.056 1.00 71.20  ? 137  LEU A CA    1 
ATOM   1018  C  C     . LEU A 1  137  ? -62.980 -9.251  -44.021 1.00 71.18  ? 137  LEU A C     1 
ATOM   1019  O  O     . LEU A 1  137  ? -62.137 -10.147 -44.075 1.00 70.86  ? 137  LEU A O     1 
ATOM   1020  C  CB    . LEU A 1  137  ? -62.070 -6.965  -44.566 1.00 70.93  ? 137  LEU A CB    1 
ATOM   1021  C  CG    . LEU A 1  137  ? -60.585 -7.263  -44.325 1.00 70.24  ? 137  LEU A CG    1 
ATOM   1022  C  CD1   . LEU A 1  137  ? -59.893 -7.753  -45.591 1.00 69.54  ? 137  LEU A CD1   1 
ATOM   1023  C  CD2   . LEU A 1  137  ? -59.894 -6.026  -43.777 1.00 70.77  ? 137  LEU A CD2   1 
ATOM   1024  N  N     . ASP A 1  138  ? -63.946 -9.212  -43.103 1.00 73.00  ? 138  ASP A N     1 
ATOM   1025  C  CA    . ASP A 1  138  ? -64.158 -10.284 -42.115 1.00 73.33  ? 138  ASP A CA    1 
ATOM   1026  C  C     . ASP A 1  138  ? -64.311 -11.652 -42.773 1.00 71.30  ? 138  ASP A C     1 
ATOM   1027  O  O     . ASP A 1  138  ? -63.695 -12.625 -42.340 1.00 69.62  ? 138  ASP A O     1 
ATOM   1028  C  CB    . ASP A 1  138  ? -65.407 -10.003 -41.271 1.00 76.18  ? 138  ASP A CB    1 
ATOM   1029  C  CG    . ASP A 1  138  ? -65.255 -8.782  -40.387 1.00 79.60  ? 138  ASP A CG    1 
ATOM   1030  O  OD1   . ASP A 1  138  ? -64.180 -8.141  -40.427 1.00 81.37  ? 138  ASP A OD1   1 
ATOM   1031  O  OD2   . ASP A 1  138  ? -66.217 -8.461  -39.652 1.00 82.97  ? 138  ASP A OD2   1 
ATOM   1032  N  N     . GLN A 1  139  ? -65.127 -11.709 -43.822 1.00 70.21  ? 139  GLN A N     1 
ATOM   1033  C  CA    . GLN A 1  139  ? -65.342 -12.947 -44.574 1.00 69.28  ? 139  GLN A CA    1 
ATOM   1034  C  C     . GLN A 1  139  ? -64.067 -13.457 -45.244 1.00 67.53  ? 139  GLN A C     1 
ATOM   1035  O  O     . GLN A 1  139  ? -63.859 -14.669 -45.314 1.00 66.94  ? 139  GLN A O     1 
ATOM   1036  C  CB    . GLN A 1  139  ? -66.447 -12.769 -45.621 1.00 69.32  ? 139  GLN A CB    1 
ATOM   1037  C  CG    . GLN A 1  139  ? -67.827 -12.540 -45.022 1.00 69.72  ? 139  GLN A CG    1 
ATOM   1038  C  CD    . GLN A 1  139  ? -68.841 -12.094 -46.049 1.00 69.94  ? 139  GLN A CD    1 
ATOM   1039  O  OE1   . GLN A 1  139  ? -68.594 -11.166 -46.824 1.00 69.52  ? 139  GLN A OE1   1 
ATOM   1040  N  NE2   . GLN A 1  139  ? -69.997 -12.749 -46.058 1.00 70.39  ? 139  GLN A NE2   1 
ATOM   1041  N  N     . LEU A 1  140  ? -63.229 -12.537 -45.725 1.00 67.02  ? 140  LEU A N     1 
ATOM   1042  C  CA    . LEU A 1  140  ? -61.937 -12.891 -46.331 1.00 66.45  ? 140  LEU A CA    1 
ATOM   1043  C  C     . LEU A 1  140  ? -60.897 -13.356 -45.313 1.00 66.16  ? 140  LEU A C     1 
ATOM   1044  O  O     . LEU A 1  140  ? -60.205 -14.342 -45.555 1.00 64.10  ? 140  LEU A O     1 
ATOM   1045  C  CB    . LEU A 1  140  ? -61.388 -11.736 -47.179 1.00 66.77  ? 140  LEU A CB    1 
ATOM   1046  C  CG    . LEU A 1  140  ? -62.013 -11.606 -48.575 1.00 67.30  ? 140  LEU A CG    1 
ATOM   1047  C  CD1   . LEU A 1  140  ? -61.778 -10.231 -49.186 1.00 67.90  ? 140  LEU A CD1   1 
ATOM   1048  C  CD2   . LEU A 1  140  ? -61.479 -12.683 -49.511 1.00 66.93  ? 140  LEU A CD2   1 
ATOM   1049  N  N     . THR A 1  141  ? -60.788 -12.661 -44.184 1.00 67.28  ? 141  THR A N     1 
ATOM   1050  C  CA    . THR A 1  141  ? -59.854 -13.074 -43.134 1.00 67.17  ? 141  THR A CA    1 
ATOM   1051  C  C     . THR A 1  141  ? -60.307 -14.354 -42.425 1.00 67.62  ? 141  THR A C     1 
ATOM   1052  O  O     . THR A 1  141  ? -59.470 -15.142 -41.996 1.00 67.33  ? 141  THR A O     1 
ATOM   1053  C  CB    . THR A 1  141  ? -59.617 -11.962 -42.096 1.00 68.01  ? 141  THR A CB    1 
ATOM   1054  O  OG1   . THR A 1  141  ? -60.853 -11.613 -41.466 1.00 69.45  ? 141  THR A OG1   1 
ATOM   1055  C  CG2   . THR A 1  141  ? -59.009 -10.730 -42.753 1.00 68.48  ? 141  THR A CG2   1 
ATOM   1056  N  N     . ASP A 1  142  ? -61.619 -14.561 -42.303 1.00 69.74  ? 142  ASP A N     1 
ATOM   1057  C  CA    . ASP A 1  142  ? -62.153 -15.824 -41.761 1.00 70.77  ? 142  ASP A CA    1 
ATOM   1058  C  C     . ASP A 1  142  ? -61.844 -17.014 -42.666 1.00 68.70  ? 142  ASP A C     1 
ATOM   1059  O  O     . ASP A 1  142  ? -61.562 -18.106 -42.163 1.00 68.12  ? 142  ASP A O     1 
ATOM   1060  C  CB    . ASP A 1  142  ? -63.669 -15.742 -41.493 1.00 73.50  ? 142  ASP A CB    1 
ATOM   1061  C  CG    . ASP A 1  142  ? -63.998 -14.986 -40.212 1.00 76.80  ? 142  ASP A CG    1 
ATOM   1062  O  OD1   . ASP A 1  142  ? -63.287 -15.178 -39.200 1.00 78.67  ? 142  ASP A OD1   1 
ATOM   1063  O  OD2   . ASP A 1  142  ? -64.975 -14.203 -40.208 1.00 79.94  ? 142  ASP A OD2   1 
ATOM   1064  N  N     . ALA A 1  143  ? -61.892 -16.800 -43.982 1.00 66.68  ? 143  ALA A N     1 
ATOM   1065  C  CA    . ALA A 1  143  ? -61.495 -17.827 -44.954 1.00 65.11  ? 143  ALA A CA    1 
ATOM   1066  C  C     . ALA A 1  143  ? -60.003 -18.172 -44.851 1.00 63.59  ? 143  ALA A C     1 
ATOM   1067  O  O     . ALA A 1  143  ? -59.625 -19.340 -44.975 1.00 62.95  ? 143  ALA A O     1 
ATOM   1068  C  CB    . ALA A 1  143  ? -61.836 -17.385 -46.370 1.00 65.05  ? 143  ALA A CB    1 
ATOM   1069  N  N     . LEU A 1  144  ? -59.175 -17.153 -44.604 1.00 62.73  ? 144  LEU A N     1 
ATOM   1070  C  CA    . LEU A 1  144  ? -57.731 -17.323 -44.407 1.00 61.51  ? 144  LEU A CA    1 
ATOM   1071  C  C     . LEU A 1  144  ? -57.320 -17.748 -42.983 1.00 61.39  ? 144  LEU A C     1 
ATOM   1072  O  O     . LEU A 1  144  ? -56.122 -17.845 -42.695 1.00 60.05  ? 144  LEU A O     1 
ATOM   1073  C  CB    . LEU A 1  144  ? -56.990 -16.036 -44.793 1.00 61.49  ? 144  LEU A CB    1 
ATOM   1074  C  CG    . LEU A 1  144  ? -57.096 -15.598 -46.252 1.00 62.19  ? 144  LEU A CG    1 
ATOM   1075  C  CD1   . LEU A 1  144  ? -56.394 -14.262 -46.453 1.00 62.80  ? 144  LEU A CD1   1 
ATOM   1076  C  CD2   . LEU A 1  144  ? -56.514 -16.654 -47.181 1.00 62.27  ? 144  LEU A CD2   1 
ATOM   1077  N  N     . GLY A 1  145  ? -58.289 -18.007 -42.101 1.00 61.98  ? 145  GLY A N     1 
ATOM   1078  C  CA    . GLY A 1  145  ? -58.011 -18.479 -40.741 1.00 62.77  ? 145  GLY A CA    1 
ATOM   1079  C  C     . GLY A 1  145  ? -57.191 -19.756 -40.674 1.00 62.72  ? 145  GLY A C     1 
ATOM   1080  O  O     . GLY A 1  145  ? -56.351 -19.912 -39.787 1.00 62.09  ? 145  GLY A O     1 
ATOM   1081  N  N     . GLY A 1  146  ? -57.425 -20.662 -41.623 1.00 63.22  ? 146  GLY A N     1 
ATOM   1082  C  CA    . GLY A 1  146  ? -56.660 -21.905 -41.716 1.00 62.99  ? 146  GLY A CA    1 
ATOM   1083  C  C     . GLY A 1  146  ? -55.430 -21.885 -42.617 1.00 61.45  ? 146  GLY A C     1 
ATOM   1084  O  O     . GLY A 1  146  ? -54.864 -22.948 -42.879 1.00 62.40  ? 146  GLY A O     1 
ATOM   1085  N  N     . ASN A 1  147  ? -55.015 -20.704 -43.087 1.00 59.95  ? 147  ASN A N     1 
ATOM   1086  C  CA    . ASN A 1  147  ? -53.903 -20.560 -44.035 1.00 58.74  ? 147  ASN A CA    1 
ATOM   1087  C  C     . ASN A 1  147  ? -52.687 -19.907 -43.370 1.00 58.81  ? 147  ASN A C     1 
ATOM   1088  O  O     . ASN A 1  147  ? -52.709 -18.707 -43.076 1.00 60.65  ? 147  ASN A O     1 
ATOM   1089  C  CB    . ASN A 1  147  ? -54.320 -19.716 -45.247 1.00 58.47  ? 147  ASN A CB    1 
ATOM   1090  C  CG    . ASN A 1  147  ? -55.291 -20.432 -46.165 1.00 57.99  ? 147  ASN A CG    1 
ATOM   1091  O  OD1   . ASN A 1  147  ? -54.896 -21.005 -47.180 1.00 57.82  ? 147  ASN A OD1   1 
ATOM   1092  N  ND2   . ASN A 1  147  ? -56.564 -20.408 -45.812 1.00 58.04  ? 147  ASN A ND2   1 
ATOM   1093  N  N     . LEU A 1  148  ? -51.631 -20.692 -43.162 1.00 57.54  ? 148  LEU A N     1 
ATOM   1094  C  CA    . LEU A 1  148  ? -50.424 -20.237 -42.473 1.00 56.78  ? 148  LEU A CA    1 
ATOM   1095  C  C     . LEU A 1  148  ? -49.330 -19.741 -43.426 1.00 55.82  ? 148  LEU A C     1 
ATOM   1096  O  O     . LEU A 1  148  ? -49.177 -20.244 -44.542 1.00 55.58  ? 148  LEU A O     1 
ATOM   1097  C  CB    . LEU A 1  148  ? -49.864 -21.370 -41.615 1.00 57.16  ? 148  LEU A CB    1 
ATOM   1098  C  CG    . LEU A 1  148  ? -50.800 -21.915 -40.536 1.00 58.57  ? 148  LEU A CG    1 
ATOM   1099  C  CD1   . LEU A 1  148  ? -50.166 -23.111 -39.849 1.00 58.73  ? 148  LEU A CD1   1 
ATOM   1100  C  CD2   . LEU A 1  148  ? -51.139 -20.833 -39.519 1.00 59.87  ? 148  LEU A CD2   1 
ATOM   1101  N  N     . CYS A 1  149  ? -48.553 -18.768 -42.953 1.00 54.72  ? 149  CYS A N     1 
ATOM   1102  C  CA    . CYS A 1  149  ? -47.440 -18.207 -43.710 1.00 53.14  ? 149  CYS A CA    1 
ATOM   1103  C  C     . CYS A 1  149  ? -46.300 -17.848 -42.757 1.00 53.24  ? 149  CYS A C     1 
ATOM   1104  O  O     . CYS A 1  149  ? -46.529 -17.247 -41.709 1.00 53.42  ? 149  CYS A O     1 
ATOM   1105  C  CB    . CYS A 1  149  ? -47.902 -16.974 -44.475 1.00 52.46  ? 149  CYS A CB    1 
ATOM   1106  S  SG    . CYS A 1  149  ? -46.619 -16.232 -45.498 1.00 51.06  ? 149  CYS A SG    1 
ATOM   1107  N  N     . ARG A 1  150  ? -45.079 -18.226 -43.127 1.00 52.38  ? 150  ARG A N     1 
ATOM   1108  C  CA    . ARG A 1  150  ? -43.903 -18.020 -42.284 1.00 52.59  ? 150  ARG A CA    1 
ATOM   1109  C  C     . ARG A 1  150  ? -43.041 -16.832 -42.724 1.00 53.19  ? 150  ARG A C     1 
ATOM   1110  O  O     . ARG A 1  150  ? -42.132 -16.439 -41.997 1.00 53.84  ? 150  ARG A O     1 
ATOM   1111  C  CB    . ARG A 1  150  ? -43.068 -19.305 -42.268 1.00 52.07  ? 150  ARG A CB    1 
ATOM   1112  C  CG    . ARG A 1  150  ? -41.949 -19.374 -41.237 1.00 52.25  ? 150  ARG A CG    1 
ATOM   1113  C  CD    . ARG A 1  150  ? -42.446 -19.126 -39.823 1.00 53.01  ? 150  ARG A CD    1 
ATOM   1114  N  NE    . ARG A 1  150  ? -41.637 -19.801 -38.809 1.00 53.42  ? 150  ARG A NE    1 
ATOM   1115  C  CZ    . ARG A 1  150  ? -41.680 -19.552 -37.499 1.00 54.47  ? 150  ARG A CZ    1 
ATOM   1116  N  NH1   . ARG A 1  150  ? -42.495 -18.617 -36.996 1.00 55.09  ? 150  ARG A NH1   1 
ATOM   1117  N  NH2   . ARG A 1  150  ? -40.893 -20.244 -36.676 1.00 54.86  ? 150  ARG A NH2   1 
ATOM   1118  N  N     . CYS A 1  151  ? -43.325 -16.251 -43.891 1.00 53.60  ? 151  CYS A N     1 
ATOM   1119  C  CA    . CYS A 1  151  ? -42.501 -15.179 -44.443 1.00 54.20  ? 151  CYS A CA    1 
ATOM   1120  C  C     . CYS A 1  151  ? -43.125 -13.791 -44.354 1.00 55.41  ? 151  CYS A C     1 
ATOM   1121  O  O     . CYS A 1  151  ? -42.474 -12.866 -43.898 1.00 56.39  ? 151  CYS A O     1 
ATOM   1122  C  CB    . CYS A 1  151  ? -42.173 -15.473 -45.902 1.00 54.01  ? 151  CYS A CB    1 
ATOM   1123  S  SG    . CYS A 1  151  ? -41.315 -17.029 -46.186 1.00 54.33  ? 151  CYS A SG    1 
ATOM   1124  N  N     . THR A 1  152  ? -44.372 -13.637 -44.794 1.00 56.34  ? 152  THR A N     1 
ATOM   1125  C  CA    . THR A 1  152  ? -44.916 -12.299 -45.108 1.00 57.75  ? 152  THR A CA    1 
ATOM   1126  C  C     . THR A 1  152  ? -45.419 -11.476 -43.929 1.00 58.79  ? 152  THR A C     1 
ATOM   1127  O  O     . THR A 1  152  ? -45.523 -10.246 -44.031 1.00 59.47  ? 152  THR A O     1 
ATOM   1128  C  CB    . THR A 1  152  ? -46.077 -12.380 -46.119 1.00 58.29  ? 152  THR A CB    1 
ATOM   1129  O  OG1   . THR A 1  152  ? -47.199 -13.049 -45.525 1.00 58.84  ? 152  THR A OG1   1 
ATOM   1130  C  CG2   . THR A 1  152  ? -45.645 -13.119 -47.373 1.00 58.33  ? 152  THR A CG2   1 
ATOM   1131  N  N     . GLY A 1  153  ? -45.770 -12.148 -42.835 1.00 59.05  ? 153  GLY A N     1 
ATOM   1132  C  CA    . GLY A 1  153  ? -46.486 -11.506 -41.739 1.00 60.20  ? 153  GLY A CA    1 
ATOM   1133  C  C     . GLY A 1  153  ? -47.935 -11.130 -42.046 1.00 60.51  ? 153  GLY A C     1 
ATOM   1134  O  O     . GLY A 1  153  ? -48.513 -10.333 -41.319 1.00 61.96  ? 153  GLY A O     1 
ATOM   1135  N  N     . TYR A 1  154  ? -48.513 -11.678 -43.123 1.00 60.19  ? 154  TYR A N     1 
ATOM   1136  C  CA    . TYR A 1  154  ? -49.949 -11.562 -43.462 1.00 60.22  ? 154  TYR A CA    1 
ATOM   1137  C  C     . TYR A 1  154  ? -50.460 -10.210 -43.991 1.00 61.92  ? 154  TYR A C     1 
ATOM   1138  O  O     . TYR A 1  154  ? -51.359 -10.191 -44.837 1.00 62.07  ? 154  TYR A O     1 
ATOM   1139  C  CB    . TYR A 1  154  ? -50.838 -12.044 -42.302 1.00 59.42  ? 154  TYR A CB    1 
ATOM   1140  C  CG    . TYR A 1  154  ? -50.531 -13.453 -41.861 1.00 58.30  ? 154  TYR A CG    1 
ATOM   1141  C  CD1   . TYR A 1  154  ? -51.023 -14.545 -42.572 1.00 57.93  ? 154  TYR A CD1   1 
ATOM   1142  C  CD2   . TYR A 1  154  ? -49.738 -13.703 -40.736 1.00 57.79  ? 154  TYR A CD2   1 
ATOM   1143  C  CE1   . TYR A 1  154  ? -50.740 -15.846 -42.172 1.00 56.89  ? 154  TYR A CE1   1 
ATOM   1144  C  CE2   . TYR A 1  154  ? -49.452 -15.000 -40.329 1.00 56.28  ? 154  TYR A CE2   1 
ATOM   1145  C  CZ    . TYR A 1  154  ? -49.955 -16.065 -41.050 1.00 55.77  ? 154  TYR A CZ    1 
ATOM   1146  O  OH    . TYR A 1  154  ? -49.680 -17.354 -40.666 1.00 54.68  ? 154  TYR A OH    1 
ATOM   1147  N  N     . ARG A 1  155  ? -49.899 -9.098  -43.509 1.00 63.82  ? 155  ARG A N     1 
ATOM   1148  C  CA    . ARG A 1  155  ? -50.352 -7.742  -43.870 1.00 64.80  ? 155  ARG A CA    1 
ATOM   1149  C  C     . ARG A 1  155  ? -50.499 -7.545  -45.390 1.00 63.76  ? 155  ARG A C     1 
ATOM   1150  O  O     . ARG A 1  155  ? -51.516 -7.004  -45.837 1.00 64.25  ? 155  ARG A O     1 
ATOM   1151  C  CB    . ARG A 1  155  ? -49.429 -6.679  -43.223 1.00 66.12  ? 155  ARG A CB    1 
ATOM   1152  C  CG    . ARG A 1  155  ? -49.841 -5.214  -43.384 1.00 67.95  ? 155  ARG A CG    1 
ATOM   1153  C  CD    . ARG A 1  155  ? -49.435 -4.572  -44.713 1.00 68.89  ? 155  ARG A CD    1 
ATOM   1154  N  NE    . ARG A 1  155  ? -48.032 -4.795  -45.079 1.00 69.53  ? 155  ARG A NE    1 
ATOM   1155  C  CZ    . ARG A 1  155  ? -47.507 -4.596  -46.295 1.00 69.81  ? 155  ARG A CZ    1 
ATOM   1156  N  NH1   . ARG A 1  155  ? -48.249 -4.145  -47.313 1.00 69.94  ? 155  ARG A NH1   1 
ATOM   1157  N  NH2   . ARG A 1  155  ? -46.211 -4.837  -46.497 1.00 68.88  ? 155  ARG A NH2   1 
ATOM   1158  N  N     . PRO A 1  156  ? -49.503 -7.991  -46.186 1.00 62.18  ? 156  PRO A N     1 
ATOM   1159  C  CA    . PRO A 1  156  ? -49.628 -7.912  -47.648 1.00 61.54  ? 156  PRO A CA    1 
ATOM   1160  C  C     . PRO A 1  156  ? -50.812 -8.682  -48.241 1.00 60.23  ? 156  PRO A C     1 
ATOM   1161  O  O     . PRO A 1  156  ? -51.441 -8.207  -49.181 1.00 59.98  ? 156  PRO A O     1 
ATOM   1162  C  CB    . PRO A 1  156  ? -48.321 -8.533  -48.136 1.00 60.96  ? 156  PRO A CB    1 
ATOM   1163  C  CG    . PRO A 1  156  ? -47.358 -8.296  -47.040 1.00 61.89  ? 156  PRO A CG    1 
ATOM   1164  C  CD    . PRO A 1  156  ? -48.173 -8.500  -45.800 1.00 62.17  ? 156  PRO A CD    1 
ATOM   1165  N  N     . ILE A 1  157  ? -51.097 -9.859  -47.688 1.00 59.84  ? 157  ILE A N     1 
ATOM   1166  C  CA    . ILE A 1  157  ? -52.208 -10.702 -48.148 1.00 60.13  ? 157  ILE A CA    1 
ATOM   1167  C  C     . ILE A 1  157  ? -53.547 -10.041 -47.790 1.00 61.23  ? 157  ILE A C     1 
ATOM   1168  O  O     . ILE A 1  157  ? -54.509 -10.110 -48.559 1.00 61.22  ? 157  ILE A O     1 
ATOM   1169  C  CB    . ILE A 1  157  ? -52.135 -12.143 -47.553 1.00 59.52  ? 157  ILE A CB    1 
ATOM   1170  C  CG1   . ILE A 1  157  ? -50.825 -12.852 -47.950 1.00 58.40  ? 157  ILE A CG1   1 
ATOM   1171  C  CG2   . ILE A 1  157  ? -53.315 -12.996 -48.019 1.00 59.93  ? 157  ILE A CG2   1 
ATOM   1172  C  CD1   . ILE A 1  157  ? -50.511 -14.094 -47.135 1.00 57.26  ? 157  ILE A CD1   1 
ATOM   1173  N  N     . ILE A 1  158  ? -53.589 -9.391  -46.630 1.00 62.18  ? 158  ILE A N     1 
ATOM   1174  C  CA    . ILE A 1  158  ? -54.788 -8.692  -46.166 1.00 63.59  ? 158  ILE A CA    1 
ATOM   1175  C  C     . ILE A 1  158  ? -55.040 -7.413  -46.987 1.00 65.10  ? 158  ILE A C     1 
ATOM   1176  O  O     . ILE A 1  158  ? -56.199 -7.044  -47.221 1.00 65.42  ? 158  ILE A O     1 
ATOM   1177  C  CB    . ILE A 1  158  ? -54.710 -8.408  -44.642 1.00 64.02  ? 158  ILE A CB    1 
ATOM   1178  C  CG1   . ILE A 1  158  ? -54.682 -9.737  -43.872 1.00 63.60  ? 158  ILE A CG1   1 
ATOM   1179  C  CG2   . ILE A 1  158  ? -55.899 -7.579  -44.169 1.00 64.87  ? 158  ILE A CG2   1 
ATOM   1180  C  CD1   . ILE A 1  158  ? -54.252 -9.620  -42.429 1.00 64.11  ? 158  ILE A CD1   1 
ATOM   1181  N  N     . ASP A 1  159  ? -53.968 -6.744  -47.421 1.00 65.66  ? 159  ASP A N     1 
ATOM   1182  C  CA    . ASP A 1  159  ? -54.088 -5.615  -48.356 1.00 66.62  ? 159  ASP A CA    1 
ATOM   1183  C  C     . ASP A 1  159  ? -54.730 -6.059  -49.674 1.00 66.23  ? 159  ASP A C     1 
ATOM   1184  O  O     . ASP A 1  159  ? -55.597 -5.364  -50.208 1.00 66.68  ? 159  ASP A O     1 
ATOM   1185  C  CB    . ASP A 1  159  ? -52.722 -4.951  -48.630 1.00 67.42  ? 159  ASP A CB    1 
ATOM   1186  C  CG    . ASP A 1  159  ? -52.273 -3.998  -47.509 1.00 68.93  ? 159  ASP A CG    1 
ATOM   1187  O  OD1   . ASP A 1  159  ? -53.124 -3.431  -46.784 1.00 70.36  ? 159  ASP A OD1   1 
ATOM   1188  O  OD2   . ASP A 1  159  ? -51.049 -3.791  -47.372 1.00 69.00  ? 159  ASP A OD2   1 
ATOM   1189  N  N     . ALA A 1  160  ? -54.309 -7.218  -50.181 1.00 65.29  ? 160  ALA A N     1 
ATOM   1190  C  CA    . ALA A 1  160  ? -54.897 -7.797  -51.392 1.00 65.08  ? 160  ALA A CA    1 
ATOM   1191  C  C     . ALA A 1  160  ? -56.377 -8.120  -51.203 1.00 65.41  ? 160  ALA A C     1 
ATOM   1192  O  O     . ALA A 1  160  ? -57.184 -7.856  -52.086 1.00 65.86  ? 160  ALA A O     1 
ATOM   1193  C  CB    . ALA A 1  160  ? -54.135 -9.045  -51.817 1.00 64.08  ? 160  ALA A CB    1 
ATOM   1194  N  N     . CYS A 1  161  ? -56.724 -8.688  -50.052 1.00 65.51  ? 161  CYS A N     1 
ATOM   1195  C  CA    . CYS A 1  161  ? -58.122 -8.957  -49.713 1.00 66.47  ? 161  CYS A CA    1 
ATOM   1196  C  C     . CYS A 1  161  ? -58.985 -7.693  -49.690 1.00 69.05  ? 161  CYS A C     1 
ATOM   1197  O  O     . CYS A 1  161  ? -60.114 -7.718  -50.173 1.00 69.61  ? 161  CYS A O     1 
ATOM   1198  C  CB    . CYS A 1  161  ? -58.220 -9.672  -48.366 1.00 65.87  ? 161  CYS A CB    1 
ATOM   1199  S  SG    . CYS A 1  161  ? -57.587 -11.357 -48.403 1.00 63.83  ? 161  CYS A SG    1 
ATOM   1200  N  N     . LYS A 1  162  ? -58.451 -6.601  -49.139 1.00 71.44  ? 162  LYS A N     1 
ATOM   1201  C  CA    . LYS A 1  162  ? -59.167 -5.314  -49.084 1.00 73.36  ? 162  LYS A CA    1 
ATOM   1202  C  C     . LYS A 1  162  ? -59.523 -4.739  -50.453 1.00 72.97  ? 162  LYS A C     1 
ATOM   1203  O  O     . LYS A 1  162  ? -60.547 -4.072  -50.578 1.00 74.72  ? 162  LYS A O     1 
ATOM   1204  C  CB    . LYS A 1  162  ? -58.382 -4.262  -48.292 1.00 75.98  ? 162  LYS A CB    1 
ATOM   1205  C  CG    . LYS A 1  162  ? -58.501 -4.403  -46.784 1.00 77.95  ? 162  LYS A CG    1 
ATOM   1206  C  CD    . LYS A 1  162  ? -57.762 -3.282  -46.063 1.00 80.38  ? 162  LYS A CD    1 
ATOM   1207  C  CE    . LYS A 1  162  ? -57.762 -3.485  -44.551 1.00 81.60  ? 162  LYS A CE    1 
ATOM   1208  N  NZ    . LYS A 1  162  ? -56.725 -2.667  -43.862 1.00 82.41  ? 162  LYS A NZ    1 
ATOM   1209  N  N     . THR A 1  163  ? -58.703 -5.008  -51.470 1.00 71.74  ? 163  THR A N     1 
ATOM   1210  C  CA    . THR A 1  163  ? -58.979 -4.533  -52.839 1.00 72.02  ? 163  THR A CA    1 
ATOM   1211  C  C     . THR A 1  163  ? -60.276 -5.104  -53.432 1.00 73.04  ? 163  THR A C     1 
ATOM   1212  O  O     . THR A 1  163  ? -60.867 -4.497  -54.326 1.00 73.54  ? 163  THR A O     1 
ATOM   1213  C  CB    . THR A 1  163  ? -57.826 -4.855  -53.817 1.00 71.00  ? 163  THR A CB    1 
ATOM   1214  O  OG1   . THR A 1  163  ? -57.665 -6.271  -53.927 1.00 70.26  ? 163  THR A OG1   1 
ATOM   1215  C  CG2   . THR A 1  163  ? -56.510 -4.234  -53.363 1.00 70.50  ? 163  THR A CG2   1 
ATOM   1216  N  N     . PHE A 1  164  ? -60.693 -6.276  -52.946 1.00 73.81  ? 164  PHE A N     1 
ATOM   1217  C  CA    . PHE A 1  164  ? -61.958 -6.901  -53.344 1.00 75.23  ? 164  PHE A CA    1 
ATOM   1218  C  C     . PHE A 1  164  ? -63.186 -6.409  -52.560 1.00 78.49  ? 164  PHE A C     1 
ATOM   1219  O  O     . PHE A 1  164  ? -64.316 -6.640  -52.993 1.00 79.53  ? 164  PHE A O     1 
ATOM   1220  C  CB    . PHE A 1  164  ? -61.852 -8.428  -53.224 1.00 73.47  ? 164  PHE A CB    1 
ATOM   1221  C  CG    . PHE A 1  164  ? -60.883 -9.045  -54.194 1.00 71.80  ? 164  PHE A CG    1 
ATOM   1222  C  CD1   . PHE A 1  164  ? -61.214 -9.170  -55.542 1.00 71.82  ? 164  PHE A CD1   1 
ATOM   1223  C  CD2   . PHE A 1  164  ? -59.639 -9.503  -53.769 1.00 70.15  ? 164  PHE A CD2   1 
ATOM   1224  C  CE1   . PHE A 1  164  ? -60.323 -9.735  -56.444 1.00 70.53  ? 164  PHE A CE1   1 
ATOM   1225  C  CE2   . PHE A 1  164  ? -58.747 -10.070 -54.666 1.00 68.83  ? 164  PHE A CE2   1 
ATOM   1226  C  CZ    . PHE A 1  164  ? -59.089 -10.186 -56.004 1.00 69.01  ? 164  PHE A CZ    1 
ATOM   1227  N  N     . CYS A 1  165  ? -62.974 -5.749  -51.420 1.00 81.60  ? 165  CYS A N     1 
ATOM   1228  C  CA    . CYS A 1  165  ? -64.068 -5.239  -50.586 1.00 85.11  ? 165  CYS A CA    1 
ATOM   1229  C  C     . CYS A 1  165  ? -64.447 -3.802  -50.945 1.00 90.86  ? 165  CYS A C     1 
ATOM   1230  O  O     . CYS A 1  165  ? -63.587 -2.920  -50.981 1.00 91.58  ? 165  CYS A O     1 
ATOM   1231  C  CB    . CYS A 1  165  ? -63.665 -5.280  -49.112 1.00 83.48  ? 165  CYS A CB    1 
ATOM   1232  S  SG    . CYS A 1  165  ? -63.162 -6.905  -48.505 1.00 79.17  ? 165  CYS A SG    1 
ATOM   1233  N  N     . LYS A 1  166  ? -65.732 -3.571  -51.215 1.00 97.93  ? 166  LYS A N     1 
ATOM   1234  C  CA    . LYS A 1  166  ? -66.276 -2.208  -51.261 1.00 105.06 ? 166  LYS A CA    1 
ATOM   1235  C  C     . LYS A 1  166  ? -66.363 -1.674  -49.825 1.00 109.69 ? 166  LYS A C     1 
ATOM   1236  O  O     . LYS A 1  166  ? -66.534 -2.454  -48.877 1.00 110.30 ? 166  LYS A O     1 
ATOM   1237  C  CB    . LYS A 1  166  ? -67.645 -2.166  -51.962 1.00 107.26 ? 166  LYS A CB    1 
ATOM   1238  C  CG    . LYS A 1  166  ? -68.809 -2.764  -51.174 1.00 108.77 ? 166  LYS A CG    1 
ATOM   1239  C  CD    . LYS A 1  166  ? -70.044 -2.933  -52.047 1.00 110.93 ? 166  LYS A CD    1 
ATOM   1240  C  CE    . LYS A 1  166  ? -71.215 -3.491  -51.252 1.00 111.73 ? 166  LYS A CE    1 
ATOM   1241  N  NZ    . LYS A 1  166  ? -72.519 -3.260  -51.936 1.00 113.18 ? 166  LYS A NZ    1 
ATOM   1242  N  N     . THR A 1  167  ? -66.236 -0.355  -49.674 1.00 113.87 ? 167  THR A N     1 
ATOM   1243  C  CA    . THR A 1  167  ? -66.183 0.294   -48.357 1.00 115.42 ? 167  THR A CA    1 
ATOM   1244  C  C     . THR A 1  167  ? -67.006 1.582   -48.340 1.00 116.49 ? 167  THR A C     1 
ATOM   1245  O  O     . THR A 1  167  ? -68.235 1.545   -48.281 1.00 116.98 ? 167  THR A O     1 
ATOM   1246  C  CB    . THR A 1  167  ? -64.725 0.618   -47.956 1.00 115.57 ? 167  THR A CB    1 
ATOM   1247  O  OG1   . THR A 1  167  ? -64.121 1.458   -48.951 1.00 117.03 ? 167  THR A OG1   1 
ATOM   1248  C  CG2   . THR A 1  167  ? -63.901 -0.663  -47.813 1.00 113.06 ? 167  THR A CG2   1 
ATOM   1249  N  N     . PRO A 1  199  ? -47.269 7.698   -50.594 1.00 101.96 ? 199  PRO A N     1 
ATOM   1250  C  CA    . PRO A 1  199  ? -46.673 6.760   -51.551 1.00 101.04 ? 199  PRO A CA    1 
ATOM   1251  C  C     . PRO A 1  199  ? -46.942 5.297   -51.182 1.00 99.27  ? 199  PRO A C     1 
ATOM   1252  O  O     . PRO A 1  199  ? -46.534 4.851   -50.106 1.00 98.52  ? 199  PRO A O     1 
ATOM   1253  C  CB    . PRO A 1  199  ? -45.166 7.076   -51.481 1.00 101.32 ? 199  PRO A CB    1 
ATOM   1254  C  CG    . PRO A 1  199  ? -44.975 7.830   -50.205 1.00 102.56 ? 199  PRO A CG    1 
ATOM   1255  C  CD    . PRO A 1  199  ? -46.262 8.560   -49.952 1.00 102.92 ? 199  PRO A CD    1 
ATOM   1256  N  N     . LYS A 1  200  ? -47.611 4.569   -52.080 1.00 97.72  ? 200  LYS A N     1 
ATOM   1257  C  CA    . LYS A 1  200  ? -47.979 3.159   -51.867 1.00 94.62  ? 200  LYS A CA    1 
ATOM   1258  C  C     . LYS A 1  200  ? -46.988 2.197   -52.534 1.00 89.58  ? 200  LYS A C     1 
ATOM   1259  O  O     . LYS A 1  200  ? -46.270 2.572   -53.464 1.00 88.26  ? 200  LYS A O     1 
ATOM   1260  C  CB    . LYS A 1  200  ? -49.401 2.897   -52.387 1.00 96.57  ? 200  LYS A CB    1 
ATOM   1261  C  CG    . LYS A 1  200  ? -50.499 3.078   -51.345 1.00 99.13  ? 200  LYS A CG    1 
ATOM   1262  C  CD    . LYS A 1  200  ? -50.580 1.884   -50.394 1.00 99.73  ? 200  LYS A CD    1 
ATOM   1263  C  CE    . LYS A 1  200  ? -51.942 1.773   -49.719 1.00 100.76 ? 200  LYS A CE    1 
ATOM   1264  N  NZ    . LYS A 1  200  ? -52.109 0.461   -49.029 1.00 99.78  ? 200  LYS A NZ    1 
ATOM   1265  N  N     . LEU A 1  201  ? -46.962 0.957   -52.047 1.00 84.91  ? 201  LEU A N     1 
ATOM   1266  C  CA    . LEU A 1  201  ? -46.075 -0.087  -52.590 1.00 81.36  ? 201  LEU A CA    1 
ATOM   1267  C  C     . LEU A 1  201  ? -46.584 -0.723  -53.883 1.00 78.26  ? 201  LEU A C     1 
ATOM   1268  O  O     . LEU A 1  201  ? -45.825 -1.405  -54.565 1.00 75.86  ? 201  LEU A O     1 
ATOM   1269  C  CB    . LEU A 1  201  ? -45.849 -1.194  -51.555 1.00 80.30  ? 201  LEU A CB    1 
ATOM   1270  C  CG    . LEU A 1  201  ? -45.072 -0.791  -50.301 1.00 80.63  ? 201  LEU A CG    1 
ATOM   1271  C  CD1   . LEU A 1  201  ? -45.176 -1.878  -49.240 1.00 80.03  ? 201  LEU A CD1   1 
ATOM   1272  C  CD2   . LEU A 1  201  ? -43.616 -0.491  -50.636 1.00 80.44  ? 201  LEU A CD2   1 
ATOM   1273  N  N     . PHE A 1  202  ? -47.860 -0.512  -54.205 1.00 77.21  ? 202  PHE A N     1 
ATOM   1274  C  CA    . PHE A 1  202  ? -48.495 -1.128  -55.367 1.00 75.90  ? 202  PHE A CA    1 
ATOM   1275  C  C     . PHE A 1  202  ? -49.634 -0.255  -55.892 1.00 76.37  ? 202  PHE A C     1 
ATOM   1276  O  O     . PHE A 1  202  ? -50.298 0.427   -55.109 1.00 76.13  ? 202  PHE A O     1 
ATOM   1277  C  CB    . PHE A 1  202  ? -49.022 -2.513  -54.986 1.00 74.63  ? 202  PHE A CB    1 
ATOM   1278  C  CG    . PHE A 1  202  ? -49.907 -2.516  -53.767 1.00 74.94  ? 202  PHE A CG    1 
ATOM   1279  C  CD1   . PHE A 1  202  ? -49.361 -2.679  -52.493 1.00 75.24  ? 202  PHE A CD1   1 
ATOM   1280  C  CD2   . PHE A 1  202  ? -51.283 -2.355  -53.887 1.00 74.73  ? 202  PHE A CD2   1 
ATOM   1281  C  CE1   . PHE A 1  202  ? -50.170 -2.673  -51.365 1.00 74.75  ? 202  PHE A CE1   1 
ATOM   1282  C  CE2   . PHE A 1  202  ? -52.096 -2.351  -52.763 1.00 75.02  ? 202  PHE A CE2   1 
ATOM   1283  C  CZ    . PHE A 1  202  ? -51.540 -2.510  -51.500 1.00 74.94  ? 202  PHE A CZ    1 
ATOM   1284  N  N     . ALA A 1  203  ? -49.849 -0.286  -57.208 1.00 76.36  ? 203  ALA A N     1 
ATOM   1285  C  CA    . ALA A 1  203  ? -50.904 0.503   -57.864 1.00 77.34  ? 203  ALA A CA    1 
ATOM   1286  C  C     . ALA A 1  203  ? -52.227 -0.273  -57.891 1.00 77.97  ? 203  ALA A C     1 
ATOM   1287  O  O     . ALA A 1  203  ? -52.441 -1.120  -58.757 1.00 77.40  ? 203  ALA A O     1 
ATOM   1288  C  CB    . ALA A 1  203  ? -50.479 0.894   -59.274 1.00 77.05  ? 203  ALA A CB    1 
ATOM   1289  N  N     . GLU A 1  204  ? -53.101 0.025   -56.930 1.00 80.07  ? 204  GLU A N     1 
ATOM   1290  C  CA    . GLU A 1  204  ? -54.395 -0.654  -56.787 1.00 80.39  ? 204  GLU A CA    1 
ATOM   1291  C  C     . GLU A 1  204  ? -55.320 -0.399  -57.977 1.00 81.66  ? 204  GLU A C     1 
ATOM   1292  O  O     . GLU A 1  204  ? -56.021 -1.305  -58.421 1.00 81.56  ? 204  GLU A O     1 
ATOM   1293  C  CB    . GLU A 1  204  ? -55.087 -0.222  -55.485 1.00 81.26  ? 204  GLU A CB    1 
ATOM   1294  C  CG    . GLU A 1  204  ? -56.368 -0.990  -55.155 1.00 81.40  ? 204  GLU A CG    1 
ATOM   1295  C  CD    . GLU A 1  204  ? -57.004 -0.591  -53.827 1.00 81.31  ? 204  GLU A CD    1 
ATOM   1296  O  OE1   . GLU A 1  204  ? -56.274 -0.219  -52.880 1.00 81.11  ? 204  GLU A OE1   1 
ATOM   1297  O  OE2   . GLU A 1  204  ? -58.249 -0.667  -53.724 1.00 80.77  ? 204  GLU A OE2   1 
ATOM   1298  N  N     . GLU A 1  205  ? -55.331 0.839   -58.468 1.00 83.69  ? 205  GLU A N     1 
ATOM   1299  C  CA    . GLU A 1  205  ? -56.139 1.213   -59.639 1.00 85.19  ? 205  GLU A CA    1 
ATOM   1300  C  C     . GLU A 1  205  ? -55.786 0.414   -60.910 1.00 84.96  ? 205  GLU A C     1 
ATOM   1301  O  O     . GLU A 1  205  ? -56.665 0.133   -61.719 1.00 86.19  ? 205  GLU A O     1 
ATOM   1302  C  CB    . GLU A 1  205  ? -56.105 2.741   -59.890 1.00 86.52  ? 205  GLU A CB    1 
ATOM   1303  C  CG    . GLU A 1  205  ? -54.818 3.337   -60.475 1.00 87.04  ? 205  GLU A CG    1 
ATOM   1304  C  CD    . GLU A 1  205  ? -53.656 3.461   -59.495 1.00 87.01  ? 205  GLU A CD    1 
ATOM   1305  O  OE1   . GLU A 1  205  ? -53.774 3.048   -58.321 1.00 86.77  ? 205  GLU A OE1   1 
ATOM   1306  O  OE2   . GLU A 1  205  ? -52.596 3.970   -59.911 1.00 87.79  ? 205  GLU A OE2   1 
ATOM   1307  N  N     . GLU A 1  206  ? -54.518 0.038   -61.069 1.00 84.83  ? 206  GLU A N     1 
ATOM   1308  C  CA    . GLU A 1  206  ? -54.077 -0.743  -62.239 1.00 85.97  ? 206  GLU A CA    1 
ATOM   1309  C  C     . GLU A 1  206  ? -54.518 -2.220  -62.238 1.00 85.12  ? 206  GLU A C     1 
ATOM   1310  O  O     . GLU A 1  206  ? -54.401 -2.888  -63.265 1.00 82.92  ? 206  GLU A O     1 
ATOM   1311  C  CB    . GLU A 1  206  ? -52.550 -0.640  -62.423 1.00 86.83  ? 206  GLU A CB    1 
ATOM   1312  C  CG    . GLU A 1  206  ? -52.092 0.715   -62.956 1.00 89.26  ? 206  GLU A CG    1 
ATOM   1313  C  CD    . GLU A 1  206  ? -50.585 0.933   -62.865 1.00 90.33  ? 206  GLU A CD    1 
ATOM   1314  O  OE1   . GLU A 1  206  ? -49.811 0.022   -63.237 1.00 89.88  ? 206  GLU A OE1   1 
ATOM   1315  O  OE2   . GLU A 1  206  ? -50.171 2.030   -62.429 1.00 91.62  ? 206  GLU A OE2   1 
ATOM   1316  N  N     . PHE A 1  207  ? -55.019 -2.731  -61.111 1.00 86.80  ? 207  PHE A N     1 
ATOM   1317  C  CA    . PHE A 1  207  ? -55.517 -4.112  -61.051 1.00 87.33  ? 207  PHE A CA    1 
ATOM   1318  C  C     . PHE A 1  207  ? -56.820 -4.227  -61.827 1.00 90.43  ? 207  PHE A C     1 
ATOM   1319  O  O     . PHE A 1  207  ? -57.730 -3.417  -61.632 1.00 90.47  ? 207  PHE A O     1 
ATOM   1320  C  CB    . PHE A 1  207  ? -55.776 -4.578  -59.609 1.00 85.77  ? 207  PHE A CB    1 
ATOM   1321  C  CG    . PHE A 1  207  ? -54.578 -4.513  -58.691 1.00 84.38  ? 207  PHE A CG    1 
ATOM   1322  C  CD1   . PHE A 1  207  ? -53.269 -4.625  -59.168 1.00 84.23  ? 207  PHE A CD1   1 
ATOM   1323  C  CD2   . PHE A 1  207  ? -54.772 -4.378  -57.319 1.00 83.69  ? 207  PHE A CD2   1 
ATOM   1324  C  CE1   . PHE A 1  207  ? -52.192 -4.573  -58.294 1.00 84.01  ? 207  PHE A CE1   1 
ATOM   1325  C  CE2   . PHE A 1  207  ? -53.700 -4.334  -56.445 1.00 83.20  ? 207  PHE A CE2   1 
ATOM   1326  C  CZ    . PHE A 1  207  ? -52.408 -4.429  -56.931 1.00 83.52  ? 207  PHE A CZ    1 
ATOM   1327  N  N     . LEU A 1  208  ? -56.910 -5.239  -62.693 1.00 93.87  ? 208  LEU A N     1 
ATOM   1328  C  CA    . LEU A 1  208  ? -58.118 -5.470  -63.494 1.00 97.36  ? 208  LEU A CA    1 
ATOM   1329  C  C     . LEU A 1  208  ? -59.261 -5.970  -62.597 1.00 97.40  ? 208  LEU A C     1 
ATOM   1330  O  O     . LEU A 1  208  ? -59.026 -6.776  -61.687 1.00 96.01  ? 208  LEU A O     1 
ATOM   1331  C  CB    . LEU A 1  208  ? -57.870 -6.445  -64.664 1.00 98.78  ? 208  LEU A CB    1 
ATOM   1332  C  CG    . LEU A 1  208  ? -57.415 -7.900  -64.411 1.00 98.51  ? 208  LEU A CG    1 
ATOM   1333  C  CD1   . LEU A 1  208  ? -58.258 -8.893  -65.208 1.00 98.78  ? 208  LEU A CD1   1 
ATOM   1334  C  CD2   . LEU A 1  208  ? -55.932 -8.109  -64.710 1.00 97.96  ? 208  LEU A CD2   1 
ATOM   1335  N  N     . PRO A 1  209  ? -60.497 -5.494  -62.851 1.00 98.75  ? 209  PRO A N     1 
ATOM   1336  C  CA    . PRO A 1  209  ? -61.601 -5.799  -61.944 1.00 98.49  ? 209  PRO A CA    1 
ATOM   1337  C  C     . PRO A 1  209  ? -62.062 -7.247  -62.043 1.00 96.93  ? 209  PRO A C     1 
ATOM   1338  O  O     . PRO A 1  209  ? -61.955 -7.865  -63.107 1.00 95.57  ? 209  PRO A O     1 
ATOM   1339  C  CB    . PRO A 1  209  ? -62.707 -4.849  -62.413 1.00 100.03 ? 209  PRO A CB    1 
ATOM   1340  C  CG    . PRO A 1  209  ? -62.454 -4.680  -63.870 1.00 100.92 ? 209  PRO A CG    1 
ATOM   1341  C  CD    . PRO A 1  209  ? -60.961 -4.761  -64.047 1.00 99.92  ? 209  PRO A CD    1 
ATOM   1342  N  N     . LEU A 1  210  ? -62.561 -7.775  -60.927 1.00 96.19  ? 210  LEU A N     1 
ATOM   1343  C  CA    . LEU A 1  210  ? -63.156 -9.103  -60.891 1.00 95.33  ? 210  LEU A CA    1 
ATOM   1344  C  C     . LEU A 1  210  ? -64.409 -9.075  -61.755 1.00 97.85  ? 210  LEU A C     1 
ATOM   1345  O  O     . LEU A 1  210  ? -65.213 -8.151  -61.645 1.00 100.54 ? 210  LEU A O     1 
ATOM   1346  C  CB    . LEU A 1  210  ? -63.517 -9.499  -59.457 1.00 93.92  ? 210  LEU A CB    1 
ATOM   1347  C  CG    . LEU A 1  210  ? -63.902 -10.961 -59.210 1.00 93.43  ? 210  LEU A CG    1 
ATOM   1348  C  CD1   . LEU A 1  210  ? -62.679 -11.865 -59.275 1.00 91.84  ? 210  LEU A CD1   1 
ATOM   1349  C  CD2   . LEU A 1  210  ? -64.601 -11.111 -57.867 1.00 93.50  ? 210  LEU A CD2   1 
ATOM   1350  N  N     . ASP A 1  211  ? -64.547 -10.070 -62.629 1.00 99.16  ? 211  ASP A N     1 
ATOM   1351  C  CA    . ASP A 1  211  ? -65.705 -10.197 -63.504 1.00 101.18 ? 211  ASP A CA    1 
ATOM   1352  C  C     . ASP A 1  211  ? -66.424 -11.509 -63.157 1.00 101.84 ? 211  ASP A C     1 
ATOM   1353  O  O     . ASP A 1  211  ? -66.095 -12.557 -63.724 1.00 101.79 ? 211  ASP A O     1 
ATOM   1354  C  CB    . ASP A 1  211  ? -65.252 -10.169 -64.969 1.00 101.88 ? 211  ASP A CB    1 
ATOM   1355  C  CG    . ASP A 1  211  ? -66.391 -9.893  -65.935 1.00 105.02 ? 211  ASP A CG    1 
ATOM   1356  O  OD1   . ASP A 1  211  ? -67.569 -9.870  -65.515 1.00 105.12 ? 211  ASP A OD1   1 
ATOM   1357  O  OD2   . ASP A 1  211  ? -66.101 -9.686  -67.131 1.00 106.96 ? 211  ASP A OD2   1 
ATOM   1358  N  N     . PRO A 1  212  ? -67.403 -11.464 -62.218 1.00 102.97 ? 212  PRO A N     1 
ATOM   1359  C  CA    . PRO A 1  212  ? -68.034 -12.715 -61.752 1.00 102.57 ? 212  PRO A CA    1 
ATOM   1360  C  C     . PRO A 1  212  ? -68.820 -13.482 -62.828 1.00 102.37 ? 212  PRO A C     1 
ATOM   1361  O  O     . PRO A 1  212  ? -69.018 -14.695 -62.695 1.00 101.50 ? 212  PRO A O     1 
ATOM   1362  C  CB    . PRO A 1  212  ? -68.972 -12.252 -60.620 1.00 103.33 ? 212  PRO A CB    1 
ATOM   1363  C  CG    . PRO A 1  212  ? -68.559 -10.860 -60.290 1.00 103.63 ? 212  PRO A CG    1 
ATOM   1364  C  CD    . PRO A 1  212  ? -68.009 -10.290 -61.561 1.00 104.18 ? 212  PRO A CD    1 
ATOM   1365  N  N     . THR A 1  213  ? -69.260 -12.783 -63.873 1.00 102.11 ? 213  THR A N     1 
ATOM   1366  C  CA    . THR A 1  213  ? -69.942 -13.422 -64.993 1.00 102.23 ? 213  THR A CA    1 
ATOM   1367  C  C     . THR A 1  213  ? -68.992 -14.241 -65.895 1.00 98.77  ? 213  THR A C     1 
ATOM   1368  O  O     . THR A 1  213  ? -69.447 -15.149 -66.590 1.00 100.15 ? 213  THR A O     1 
ATOM   1369  C  CB    . THR A 1  213  ? -70.793 -12.399 -65.797 1.00 105.22 ? 213  THR A CB    1 
ATOM   1370  O  OG1   . THR A 1  213  ? -71.737 -13.095 -66.624 1.00 107.85 ? 213  THR A OG1   1 
ATOM   1371  C  CG2   . THR A 1  213  ? -69.937 -11.451 -66.656 1.00 105.36 ? 213  THR A CG2   1 
ATOM   1372  N  N     . GLN A 1  214  ? -67.692 -13.932 -65.872 1.00 95.22  ? 214  GLN A N     1 
ATOM   1373  C  CA    . GLN A 1  214  ? -66.684 -14.667 -66.667 1.00 93.18  ? 214  GLN A CA    1 
ATOM   1374  C  C     . GLN A 1  214  ? -65.835 -15.649 -65.840 1.00 88.76  ? 214  GLN A C     1 
ATOM   1375  O  O     . GLN A 1  214  ? -64.661 -15.869 -66.149 1.00 86.56  ? 214  GLN A O     1 
ATOM   1376  C  CB    . GLN A 1  214  ? -65.764 -13.678 -67.403 1.00 93.72  ? 214  GLN A CB    1 
ATOM   1377  C  CG    . GLN A 1  214  ? -66.487 -12.602 -68.197 1.00 95.64  ? 214  GLN A CG    1 
ATOM   1378  C  CD    . GLN A 1  214  ? -67.470 -13.161 -69.205 1.00 97.56  ? 214  GLN A CD    1 
ATOM   1379  O  OE1   . GLN A 1  214  ? -68.631 -12.753 -69.245 1.00 97.26  ? 214  GLN A OE1   1 
ATOM   1380  N  NE2   . GLN A 1  214  ? -67.013 -14.107 -70.019 1.00 98.51  ? 214  GLN A NE2   1 
ATOM   1381  N  N     . GLU A 1  215  ? -66.432 -16.254 -64.812 1.00 85.85  ? 215  GLU A N     1 
ATOM   1382  C  CA    . GLU A 1  215  ? -65.739 -17.244 -63.977 1.00 82.63  ? 215  GLU A CA    1 
ATOM   1383  C  C     . GLU A 1  215  ? -65.803 -18.627 -64.628 1.00 79.99  ? 215  GLU A C     1 
ATOM   1384  O  O     . GLU A 1  215  ? -66.417 -18.797 -65.679 1.00 81.12  ? 215  GLU A O     1 
ATOM   1385  C  CB    . GLU A 1  215  ? -66.341 -17.278 -62.555 1.00 82.70  ? 215  GLU A CB    1 
ATOM   1386  C  CG    . GLU A 1  215  ? -66.149 -15.997 -61.736 1.00 82.30  ? 215  GLU A CG    1 
ATOM   1387  C  CD    . GLU A 1  215  ? -64.702 -15.708 -61.321 1.00 80.21  ? 215  GLU A CD    1 
ATOM   1388  O  OE1   . GLU A 1  215  ? -63.801 -16.550 -61.544 1.00 79.19  ? 215  GLU A OE1   1 
ATOM   1389  O  OE2   . GLU A 1  215  ? -64.463 -14.615 -60.763 1.00 78.27  ? 215  GLU A OE2   1 
ATOM   1390  N  N     . LEU A 1  216  ? -65.151 -19.605 -64.005 1.00 76.71  ? 216  LEU A N     1 
ATOM   1391  C  CA    . LEU A 1  216  ? -65.174 -20.988 -64.482 1.00 74.97  ? 216  LEU A CA    1 
ATOM   1392  C  C     . LEU A 1  216  ? -66.580 -21.579 -64.440 1.00 75.40  ? 216  LEU A C     1 
ATOM   1393  O  O     . LEU A 1  216  ? -67.217 -21.585 -63.388 1.00 74.11  ? 216  LEU A O     1 
ATOM   1394  C  CB    . LEU A 1  216  ? -64.274 -21.871 -63.616 1.00 72.93  ? 216  LEU A CB    1 
ATOM   1395  C  CG    . LEU A 1  216  ? -62.776 -21.609 -63.568 1.00 70.52  ? 216  LEU A CG    1 
ATOM   1396  C  CD1   . LEU A 1  216  ? -62.148 -22.629 -62.637 1.00 69.73  ? 216  LEU A CD1   1 
ATOM   1397  C  CD2   . LEU A 1  216  ? -62.157 -21.682 -64.952 1.00 70.04  ? 216  LEU A CD2   1 
ATOM   1398  N  N     . ILE A 1  217  ? -67.048 -22.085 -65.582 1.00 76.28  ? 217  ILE A N     1 
ATOM   1399  C  CA    . ILE A 1  217  ? -68.320 -22.804 -65.647 1.00 77.74  ? 217  ILE A CA    1 
ATOM   1400  C  C     . ILE A 1  217  ? -68.163 -24.176 -64.987 1.00 76.29  ? 217  ILE A C     1 
ATOM   1401  O  O     . ILE A 1  217  ? -67.210 -24.898 -65.271 1.00 76.41  ? 217  ILE A O     1 
ATOM   1402  C  CB    . ILE A 1  217  ? -68.820 -22.976 -67.110 1.00 79.48  ? 217  ILE A CB    1 
ATOM   1403  C  CG1   . ILE A 1  217  ? -69.104 -21.604 -67.757 1.00 81.32  ? 217  ILE A CG1   1 
ATOM   1404  C  CG2   . ILE A 1  217  ? -70.053 -23.880 -67.175 1.00 80.28  ? 217  ILE A CG2   1 
ATOM   1405  C  CD1   . ILE A 1  217  ? -68.185 -21.256 -68.911 1.00 81.84  ? 217  ILE A CD1   1 
ATOM   1406  N  N     . PHE A 1  218  ? -69.097 -24.516 -64.101 1.00 75.93  ? 218  PHE A N     1 
ATOM   1407  C  CA    . PHE A 1  218  ? -69.190 -25.859 -63.531 1.00 75.12  ? 218  PHE A CA    1 
ATOM   1408  C  C     . PHE A 1  218  ? -69.406 -26.853 -64.677 1.00 76.06  ? 218  PHE A C     1 
ATOM   1409  O  O     . PHE A 1  218  ? -70.282 -26.627 -65.511 1.00 77.09  ? 218  PHE A O     1 
ATOM   1410  C  CB    . PHE A 1  218  ? -70.362 -25.922 -62.544 1.00 75.32  ? 218  PHE A CB    1 
ATOM   1411  C  CG    . PHE A 1  218  ? -70.548 -27.265 -61.887 1.00 74.45  ? 218  PHE A CG    1 
ATOM   1412  C  CD1   . PHE A 1  218  ? -69.788 -27.622 -60.774 1.00 73.04  ? 218  PHE A CD1   1 
ATOM   1413  C  CD2   . PHE A 1  218  ? -71.505 -28.162 -62.356 1.00 75.16  ? 218  PHE A CD2   1 
ATOM   1414  C  CE1   . PHE A 1  218  ? -69.965 -28.851 -60.154 1.00 72.33  ? 218  PHE A CE1   1 
ATOM   1415  C  CE2   . PHE A 1  218  ? -71.684 -29.395 -61.742 1.00 75.04  ? 218  PHE A CE2   1 
ATOM   1416  C  CZ    . PHE A 1  218  ? -70.914 -29.740 -60.639 1.00 73.62  ? 218  PHE A CZ    1 
ATOM   1417  N  N     . PRO A 1  219  ? -68.609 -27.941 -64.735 1.00 75.91  ? 219  PRO A N     1 
ATOM   1418  C  CA    . PRO A 1  219  ? -68.699 -28.841 -65.895 1.00 76.34  ? 219  PRO A CA    1 
ATOM   1419  C  C     . PRO A 1  219  ? -70.121 -29.380 -66.102 1.00 78.04  ? 219  PRO A C     1 
ATOM   1420  O  O     . PRO A 1  219  ? -70.664 -30.002 -65.188 1.00 77.60  ? 219  PRO A O     1 
ATOM   1421  C  CB    . PRO A 1  219  ? -67.715 -29.969 -65.560 1.00 75.65  ? 219  PRO A CB    1 
ATOM   1422  C  CG    . PRO A 1  219  ? -67.431 -29.842 -64.106 1.00 75.15  ? 219  PRO A CG    1 
ATOM   1423  C  CD    . PRO A 1  219  ? -67.603 -28.400 -63.762 1.00 74.71  ? 219  PRO A CD    1 
ATOM   1424  N  N     . PRO A 1  220  ? -70.733 -29.110 -67.280 1.00 80.16  ? 220  PRO A N     1 
ATOM   1425  C  CA    . PRO A 1  220  ? -72.118 -29.521 -67.557 1.00 81.90  ? 220  PRO A CA    1 
ATOM   1426  C  C     . PRO A 1  220  ? -72.439 -31.015 -67.419 1.00 82.15  ? 220  PRO A C     1 
ATOM   1427  O  O     . PRO A 1  220  ? -73.570 -31.350 -67.082 1.00 83.33  ? 220  PRO A O     1 
ATOM   1428  C  CB    . PRO A 1  220  ? -72.326 -29.079 -69.010 1.00 83.12  ? 220  PRO A CB    1 
ATOM   1429  C  CG    . PRO A 1  220  ? -71.429 -27.910 -69.170 1.00 81.86  ? 220  PRO A CG    1 
ATOM   1430  C  CD    . PRO A 1  220  ? -70.210 -28.248 -68.364 1.00 80.32  ? 220  PRO A CD    1 
ATOM   1431  N  N     . GLU A 1  221  ? -71.474 -31.893 -67.688 1.00 81.82  ? 221  GLU A N     1 
ATOM   1432  C  CA    . GLU A 1  221  ? -71.687 -33.342 -67.557 1.00 83.02  ? 221  GLU A CA    1 
ATOM   1433  C  C     . GLU A 1  221  ? -72.073 -33.757 -66.136 1.00 82.43  ? 221  GLU A C     1 
ATOM   1434  O  O     . GLU A 1  221  ? -72.968 -34.586 -65.960 1.00 83.51  ? 221  GLU A O     1 
ATOM   1435  C  CB    . GLU A 1  221  ? -70.440 -34.123 -67.984 1.00 83.76  ? 221  GLU A CB    1 
ATOM   1436  C  CG    . GLU A 1  221  ? -70.649 -35.637 -68.071 1.00 85.63  ? 221  GLU A CG    1 
ATOM   1437  C  CD    . GLU A 1  221  ? -69.364 -36.415 -68.294 1.00 85.89  ? 221  GLU A CD    1 
ATOM   1438  O  OE1   . GLU A 1  221  ? -68.291 -35.910 -67.917 1.00 85.30  ? 221  GLU A OE1   1 
ATOM   1439  O  OE2   . GLU A 1  221  ? -69.430 -37.542 -68.836 1.00 87.48  ? 221  GLU A OE2   1 
ATOM   1440  N  N     . LEU A 1  222  ? -71.395 -33.190 -65.138 1.00 80.56  ? 222  LEU A N     1 
ATOM   1441  C  CA    . LEU A 1  222  ? -71.672 -33.494 -63.727 1.00 79.97  ? 222  LEU A CA    1 
ATOM   1442  C  C     . LEU A 1  222  ? -73.067 -33.036 -63.305 1.00 82.11  ? 222  LEU A C     1 
ATOM   1443  O  O     . LEU A 1  222  ? -73.700 -33.667 -62.455 1.00 81.64  ? 222  LEU A O     1 
ATOM   1444  C  CB    . LEU A 1  222  ? -70.626 -32.854 -62.809 1.00 77.86  ? 222  LEU A CB    1 
ATOM   1445  C  CG    . LEU A 1  222  ? -69.154 -33.235 -62.997 1.00 75.92  ? 222  LEU A CG    1 
ATOM   1446  C  CD1   . LEU A 1  222  ? -68.315 -32.580 -61.916 1.00 74.71  ? 222  LEU A CD1   1 
ATOM   1447  C  CD2   . LEU A 1  222  ? -68.954 -34.742 -62.980 1.00 76.07  ? 222  LEU A CD2   1 
ATOM   1448  N  N     . MET A 1  223  ? -73.531 -31.935 -63.897 1.00 84.73  ? 223  MET A N     1 
ATOM   1449  C  CA    . MET A 1  223  ? -74.907 -31.464 -63.724 1.00 87.97  ? 223  MET A CA    1 
ATOM   1450  C  C     . MET A 1  223  ? -75.908 -32.452 -64.330 1.00 90.03  ? 223  MET A C     1 
ATOM   1451  O  O     . MET A 1  223  ? -76.962 -32.698 -63.748 1.00 90.78  ? 223  MET A O     1 
ATOM   1452  C  CB    . MET A 1  223  ? -75.080 -30.082 -64.359 1.00 90.30  ? 223  MET A CB    1 
ATOM   1453  C  CG    . MET A 1  223  ? -76.334 -29.344 -63.920 1.00 93.67  ? 223  MET A CG    1 
ATOM   1454  S  SD    . MET A 1  223  ? -76.482 -27.703 -64.657 1.00 97.07  ? 223  MET A SD    1 
ATOM   1455  C  CE    . MET A 1  223  ? -75.038 -26.872 -63.994 1.00 94.84  ? 223  MET A CE    1 
ATOM   1456  N  N     . ILE A 1  224  ? -75.568 -33.008 -65.496 1.00 91.37  ? 224  ILE A N     1 
ATOM   1457  C  CA    . ILE A 1  224  ? -76.375 -34.058 -66.146 1.00 93.02  ? 224  ILE A CA    1 
ATOM   1458  C  C     . ILE A 1  224  ? -76.372 -35.355 -65.319 1.00 93.06  ? 224  ILE A C     1 
ATOM   1459  O  O     . ILE A 1  224  ? -77.412 -36.002 -65.188 1.00 94.84  ? 224  ILE A O     1 
ATOM   1460  C  CB    . ILE A 1  224  ? -75.903 -34.332 -67.609 1.00 93.03  ? 224  ILE A CB    1 
ATOM   1461  C  CG1   . ILE A 1  224  ? -76.132 -33.103 -68.511 1.00 93.80  ? 224  ILE A CG1   1 
ATOM   1462  C  CG2   . ILE A 1  224  ? -76.602 -35.546 -68.215 1.00 94.05  ? 224  ILE A CG2   1 
ATOM   1463  C  CD1   . ILE A 1  224  ? -77.578 -32.807 -68.867 1.00 95.81  ? 224  ILE A CD1   1 
ATOM   1464  N  N     . MET A 1  225  ? -75.216 -35.727 -64.770 1.00 91.96  ? 225  MET A N     1 
ATOM   1465  C  CA    . MET A 1  225  ? -75.110 -36.924 -63.923 1.00 92.03  ? 225  MET A CA    1 
ATOM   1466  C  C     . MET A 1  225  ? -75.955 -36.818 -62.659 1.00 92.81  ? 225  MET A C     1 
ATOM   1467  O  O     . MET A 1  225  ? -76.643 -37.768 -62.293 1.00 92.67  ? 225  MET A O     1 
ATOM   1468  C  CB    . MET A 1  225  ? -73.657 -37.197 -63.533 1.00 90.78  ? 225  MET A CB    1 
ATOM   1469  C  CG    . MET A 1  225  ? -72.800 -37.736 -64.665 1.00 90.70  ? 225  MET A CG    1 
ATOM   1470  S  SD    . MET A 1  225  ? -71.092 -37.971 -64.151 1.00 89.89  ? 225  MET A SD    1 
ATOM   1471  C  CE    . MET A 1  225  ? -71.266 -39.354 -63.024 1.00 89.77  ? 225  MET A CE    1 
ATOM   1472  N  N     . ALA A 1  226  ? -75.891 -35.666 -61.997 1.00 93.42  ? 226  ALA A N     1 
ATOM   1473  C  CA    . ALA A 1  226  ? -76.702 -35.411 -60.802 1.00 96.04  ? 226  ALA A CA    1 
ATOM   1474  C  C     . ALA A 1  226  ? -78.208 -35.386 -61.101 1.00 99.71  ? 226  ALA A C     1 
ATOM   1475  O  O     . ALA A 1  226  ? -79.011 -35.833 -60.275 1.00 100.41 ? 226  ALA A O     1 
ATOM   1476  C  CB    . ALA A 1  226  ? -76.274 -34.110 -60.136 1.00 95.22  ? 226  ALA A CB    1 
ATOM   1477  N  N     . GLU A 1  227  ? -78.574 -34.873 -62.280 1.00 102.48 ? 227  GLU A N     1 
ATOM   1478  C  CA    . GLU A 1  227  ? -79.984 -34.768 -62.707 1.00 105.27 ? 227  GLU A CA    1 
ATOM   1479  C  C     . GLU A 1  227  ? -80.715 -36.118 -62.795 1.00 107.85 ? 227  GLU A C     1 
ATOM   1480  O  O     . GLU A 1  227  ? -81.938 -36.164 -62.639 1.00 109.69 ? 227  GLU A O     1 
ATOM   1481  C  CB    . GLU A 1  227  ? -80.107 -33.994 -64.032 1.00 105.37 ? 227  GLU A CB    1 
ATOM   1482  C  CG    . GLU A 1  227  ? -80.139 -32.476 -63.855 1.00 104.69 ? 227  GLU A CG    1 
ATOM   1483  C  CD    . GLU A 1  227  ? -79.886 -31.688 -65.142 1.00 105.58 ? 227  GLU A CD    1 
ATOM   1484  O  OE1   . GLU A 1  227  ? -79.816 -32.283 -66.246 1.00 106.11 ? 227  GLU A OE1   1 
ATOM   1485  O  OE2   . GLU A 1  227  ? -79.759 -30.448 -65.044 1.00 104.89 ? 227  GLU A OE2   1 
ATOM   1486  N  N     . LYS A 1  228  ? -79.975 -37.195 -63.056 1.00 108.84 ? 228  LYS A N     1 
ATOM   1487  C  CA    . LYS A 1  228  ? -80.484 -38.556 -62.835 1.00 111.54 ? 228  LYS A CA    1 
ATOM   1488  C  C     . LYS A 1  228  ? -79.982 -39.057 -61.474 1.00 111.58 ? 228  LYS A C     1 
ATOM   1489  O  O     . LYS A 1  228  ? -78.794 -39.331 -61.301 1.00 110.60 ? 228  LYS A O     1 
ATOM   1490  C  CB    . LYS A 1  228  ? -80.111 -39.511 -63.990 1.00 112.50 ? 228  LYS A CB    1 
ATOM   1491  C  CG    . LYS A 1  228  ? -78.626 -39.820 -64.187 1.00 111.84 ? 228  LYS A CG    1 
ATOM   1492  C  CD    . LYS A 1  228  ? -78.330 -40.541 -65.499 1.00 113.53 ? 228  LYS A CD    1 
ATOM   1493  C  CE    . LYS A 1  228  ? -78.620 -39.705 -66.741 1.00 114.92 ? 228  LYS A CE    1 
ATOM   1494  N  NZ    . LYS A 1  228  ? -78.053 -38.326 -66.690 1.00 114.03 ? 228  LYS A NZ    1 
ATOM   1495  N  N     . GLN A 1  229  ? -80.885 -39.129 -60.495 1.00 113.17 ? 229  GLN A N     1 
ATOM   1496  C  CA    . GLN A 1  229  ? -80.540 -39.652 -59.166 1.00 112.73 ? 229  GLN A CA    1 
ATOM   1497  C  C     . GLN A 1  229  ? -80.382 -41.172 -59.231 1.00 112.28 ? 229  GLN A C     1 
ATOM   1498  O  O     . GLN A 1  229  ? -81.327 -41.920 -58.969 1.00 114.52 ? 229  GLN A O     1 
ATOM   1499  C  CB    . GLN A 1  229  ? -81.585 -39.264 -58.105 1.00 113.53 ? 229  GLN A CB    1 
ATOM   1500  C  CG    . GLN A 1  229  ? -81.575 -37.795 -57.694 1.00 112.94 ? 229  GLN A CG    1 
ATOM   1501  C  CD    . GLN A 1  229  ? -82.607 -36.955 -58.428 1.00 113.79 ? 229  GLN A CD    1 
ATOM   1502  O  OE1   . GLN A 1  229  ? -82.730 -37.026 -59.650 1.00 114.29 ? 229  GLN A OE1   1 
ATOM   1503  N  NE2   . GLN A 1  229  ? -83.349 -36.147 -57.680 1.00 113.91 ? 229  GLN A NE2   1 
ATOM   1504  N  N     . SER A 1  230  ? -79.180 -41.611 -59.602 1.00 109.72 ? 230  SER A N     1 
ATOM   1505  C  CA    . SER A 1  230  ? -78.839 -43.032 -59.636 1.00 108.43 ? 230  SER A CA    1 
ATOM   1506  C  C     . SER A 1  230  ? -78.850 -43.606 -58.218 1.00 107.27 ? 230  SER A C     1 
ATOM   1507  O  O     . SER A 1  230  ? -78.386 -42.958 -57.277 1.00 106.05 ? 230  SER A O     1 
ATOM   1508  C  CB    . SER A 1  230  ? -77.466 -43.241 -60.283 1.00 106.56 ? 230  SER A CB    1 
ATOM   1509  O  OG    . SER A 1  230  ? -77.120 -44.615 -60.331 1.00 106.94 ? 230  SER A OG    1 
ATOM   1510  N  N     . GLN A 1  231  ? -79.404 -44.808 -58.080 1.00 107.29 ? 231  GLN A N     1 
ATOM   1511  C  CA    . GLN A 1  231  ? -79.460 -45.519 -56.799 1.00 105.68 ? 231  GLN A CA    1 
ATOM   1512  C  C     . GLN A 1  231  ? -78.331 -46.549 -56.653 1.00 102.74 ? 231  GLN A C     1 
ATOM   1513  O  O     . GLN A 1  231  ? -78.179 -47.138 -55.579 1.00 102.09 ? 231  GLN A O     1 
ATOM   1514  C  CB    . GLN A 1  231  ? -80.818 -46.218 -56.633 1.00 108.21 ? 231  GLN A CB    1 
ATOM   1515  C  CG    . GLN A 1  231  ? -82.048 -45.346 -56.881 1.00 109.05 ? 231  GLN A CG    1 
ATOM   1516  C  CD    . GLN A 1  231  ? -82.158 -44.175 -55.921 1.00 107.64 ? 231  GLN A CD    1 
ATOM   1517  O  OE1   . GLN A 1  231  ? -82.923 -44.224 -54.959 1.00 108.73 ? 231  GLN A OE1   1 
ATOM   1518  N  NE2   . GLN A 1  231  ? -81.396 -43.117 -56.177 1.00 105.68 ? 231  GLN A NE2   1 
ATOM   1519  N  N     . ARG A 1  232  ? -77.538 -46.746 -57.715 1.00 100.05 ? 232  ARG A N     1 
ATOM   1520  C  CA    . ARG A 1  232  ? -76.483 -47.767 -57.741 1.00 98.01  ? 232  ARG A CA    1 
ATOM   1521  C  C     . ARG A 1  232  ? -75.384 -47.444 -56.731 1.00 92.81  ? 232  ARG A C     1 
ATOM   1522  O  O     . ARG A 1  232  ? -74.713 -46.419 -56.843 1.00 90.18  ? 232  ARG A O     1 
ATOM   1523  C  CB    . ARG A 1  232  ? -75.881 -47.890 -59.156 1.00 99.53  ? 232  ARG A CB    1 
ATOM   1524  C  CG    . ARG A 1  232  ? -74.824 -48.987 -59.350 1.00 100.30 ? 232  ARG A CG    1 
ATOM   1525  C  CD    . ARG A 1  232  ? -75.404 -50.394 -59.267 1.00 102.73 ? 232  ARG A CD    1 
ATOM   1526  N  NE    . ARG A 1  232  ? -76.343 -50.667 -60.360 1.00 105.67 ? 232  ARG A NE    1 
ATOM   1527  C  CZ    . ARG A 1  232  ? -77.209 -51.685 -60.409 1.00 108.26 ? 232  ARG A CZ    1 
ATOM   1528  N  NH1   . ARG A 1  232  ? -77.293 -52.581 -59.422 1.00 109.01 ? 232  ARG A NH1   1 
ATOM   1529  N  NH2   . ARG A 1  232  ? -78.011 -51.811 -61.465 1.00 110.11 ? 232  ARG A NH2   1 
ATOM   1530  N  N     . THR A 1  233  ? -75.223 -48.329 -55.749 1.00 89.64  ? 233  THR A N     1 
ATOM   1531  C  CA    . THR A 1  233  ? -74.156 -48.233 -54.759 1.00 85.58  ? 233  THR A CA    1 
ATOM   1532  C  C     . THR A 1  233  ? -72.820 -48.553 -55.427 1.00 82.76  ? 233  THR A C     1 
ATOM   1533  O  O     . THR A 1  233  ? -72.658 -49.617 -56.018 1.00 82.00  ? 233  THR A O     1 
ATOM   1534  C  CB    . THR A 1  233  ? -74.417 -49.189 -53.573 1.00 86.03  ? 233  THR A CB    1 
ATOM   1535  O  OG1   . THR A 1  233  ? -75.579 -48.743 -52.862 1.00 86.95  ? 233  THR A OG1   1 
ATOM   1536  C  CG2   . THR A 1  233  ? -73.227 -49.245 -52.609 1.00 85.18  ? 233  THR A CG2   1 
ATOM   1537  N  N     . ARG A 1  234  ? -71.874 -47.622 -55.317 1.00 80.24  ? 234  ARG A N     1 
ATOM   1538  C  CA    . ARG A 1  234  ? -70.575 -47.730 -55.975 1.00 78.70  ? 234  ARG A CA    1 
ATOM   1539  C  C     . ARG A 1  234  ? -69.605 -48.522 -55.113 1.00 78.16  ? 234  ARG A C     1 
ATOM   1540  O  O     . ARG A 1  234  ? -69.661 -48.458 -53.882 1.00 77.41  ? 234  ARG A O     1 
ATOM   1541  C  CB    . ARG A 1  234  ? -70.000 -46.344 -56.265 1.00 77.15  ? 234  ARG A CB    1 
ATOM   1542  C  CG    . ARG A 1  234  ? -70.916 -45.447 -57.086 1.00 77.69  ? 234  ARG A CG    1 
ATOM   1543  C  CD    . ARG A 1  234  ? -70.225 -44.147 -57.463 1.00 77.01  ? 234  ARG A CD    1 
ATOM   1544  N  NE    . ARG A 1  234  ? -69.895 -43.334 -56.288 1.00 76.63  ? 234  ARG A NE    1 
ATOM   1545  C  CZ    . ARG A 1  234  ? -70.643 -42.358 -55.765 1.00 76.45  ? 234  ARG A CZ    1 
ATOM   1546  N  NH1   . ARG A 1  234  ? -71.818 -42.005 -56.291 1.00 76.75  ? 234  ARG A NH1   1 
ATOM   1547  N  NH2   . ARG A 1  234  ? -70.199 -41.718 -54.688 1.00 76.25  ? 234  ARG A NH2   1 
ATOM   1548  N  N     . VAL A 1  235  ? -68.724 -49.273 -55.774 1.00 78.16  ? 235  VAL A N     1 
ATOM   1549  C  CA    . VAL A 1  235  ? -67.749 -50.136 -55.106 1.00 78.12  ? 235  VAL A CA    1 
ATOM   1550  C  C     . VAL A 1  235  ? -66.364 -49.965 -55.733 1.00 76.87  ? 235  VAL A C     1 
ATOM   1551  O  O     . VAL A 1  235  ? -66.219 -49.998 -56.959 1.00 76.30  ? 235  VAL A O     1 
ATOM   1552  C  CB    . VAL A 1  235  ? -68.158 -51.629 -55.174 1.00 79.11  ? 235  VAL A CB    1 
ATOM   1553  C  CG1   . VAL A 1  235  ? -67.186 -52.493 -54.369 1.00 78.84  ? 235  VAL A CG1   1 
ATOM   1554  C  CG2   . VAL A 1  235  ? -69.584 -51.819 -54.672 1.00 80.12  ? 235  VAL A CG2   1 
ATOM   1555  N  N     . PHE A 1  236  ? -65.364 -49.776 -54.873 1.00 76.12  ? 236  PHE A N     1 
ATOM   1556  C  CA    . PHE A 1  236  ? -63.953 -49.701 -55.262 1.00 74.86  ? 236  PHE A CA    1 
ATOM   1557  C  C     . PHE A 1  236  ? -63.161 -50.625 -54.349 1.00 75.37  ? 236  PHE A C     1 
ATOM   1558  O  O     . PHE A 1  236  ? -63.565 -50.877 -53.215 1.00 76.58  ? 236  PHE A O     1 
ATOM   1559  C  CB    . PHE A 1  236  ? -63.434 -48.268 -55.134 1.00 73.28  ? 236  PHE A CB    1 
ATOM   1560  C  CG    . PHE A 1  236  ? -64.335 -47.245 -55.759 1.00 73.50  ? 236  PHE A CG    1 
ATOM   1561  C  CD1   . PHE A 1  236  ? -64.286 -47.001 -57.126 1.00 73.48  ? 236  PHE A CD1   1 
ATOM   1562  C  CD2   . PHE A 1  236  ? -65.246 -46.538 -54.987 1.00 73.58  ? 236  PHE A CD2   1 
ATOM   1563  C  CE1   . PHE A 1  236  ? -65.123 -46.060 -57.708 1.00 73.73  ? 236  PHE A CE1   1 
ATOM   1564  C  CE2   . PHE A 1  236  ? -66.086 -45.596 -55.563 1.00 73.75  ? 236  PHE A CE2   1 
ATOM   1565  C  CZ    . PHE A 1  236  ? -66.027 -45.358 -56.927 1.00 73.83  ? 236  PHE A CZ    1 
ATOM   1566  N  N     . GLY A 1  237  ? -62.036 -51.133 -54.840 1.00 75.57  ? 237  GLY A N     1 
ATOM   1567  C  CA    . GLY A 1  237  ? -61.260 -52.109 -54.085 1.00 75.99  ? 237  GLY A CA    1 
ATOM   1568  C  C     . GLY A 1  237  ? -59.794 -52.212 -54.450 1.00 75.47  ? 237  GLY A C     1 
ATOM   1569  O  O     . GLY A 1  237  ? -59.341 -51.653 -55.451 1.00 74.51  ? 237  GLY A O     1 
ATOM   1570  N  N     . SER A 1  238  ? -59.063 -52.923 -53.597 1.00 75.87  ? 238  SER A N     1 
ATOM   1571  C  CA    . SER A 1  238  ? -57.679 -53.305 -53.843 1.00 75.57  ? 238  SER A CA    1 
ATOM   1572  C  C     . SER A 1  238  ? -57.370 -54.555 -53.011 1.00 77.77  ? 238  SER A C     1 
ATOM   1573  O  O     . SER A 1  238  ? -58.276 -55.138 -52.414 1.00 78.76  ? 238  SER A O     1 
ATOM   1574  C  CB    . SER A 1  238  ? -56.745 -52.156 -53.471 1.00 73.66  ? 238  SER A CB    1 
ATOM   1575  O  OG    . SER A 1  238  ? -56.701 -51.977 -52.071 1.00 73.45  ? 238  SER A OG    1 
ATOM   1576  N  N     . GLU A 1  239  ? -56.104 -54.961 -52.970 1.00 79.35  ? 239  GLU A N     1 
ATOM   1577  C  CA    . GLU A 1  239  ? -55.671 -56.057 -52.091 1.00 81.51  ? 239  GLU A CA    1 
ATOM   1578  C  C     . GLU A 1  239  ? -55.894 -55.727 -50.605 1.00 80.15  ? 239  GLU A C     1 
ATOM   1579  O  O     . GLU A 1  239  ? -56.188 -56.620 -49.817 1.00 82.24  ? 239  GLU A O     1 
ATOM   1580  C  CB    . GLU A 1  239  ? -54.188 -56.398 -52.320 1.00 83.43  ? 239  GLU A CB    1 
ATOM   1581  C  CG    . GLU A 1  239  ? -53.836 -56.936 -53.708 1.00 85.74  ? 239  GLU A CG    1 
ATOM   1582  C  CD    . GLU A 1  239  ? -54.090 -58.431 -53.865 1.00 89.12  ? 239  GLU A CD    1 
ATOM   1583  O  OE1   . GLU A 1  239  ? -55.241 -58.881 -53.646 1.00 91.30  ? 239  GLU A OE1   1 
ATOM   1584  O  OE2   . GLU A 1  239  ? -53.134 -59.156 -54.224 1.00 89.92  ? 239  GLU A OE2   1 
ATOM   1585  N  N     . ARG A 1  240  ? -55.764 -54.452 -50.237 1.00 77.40  ? 240  ARG A N     1 
ATOM   1586  C  CA    . ARG A 1  240  ? -55.792 -54.020 -48.838 1.00 77.14  ? 240  ARG A CA    1 
ATOM   1587  C  C     . ARG A 1  240  ? -57.165 -53.546 -48.351 1.00 78.31  ? 240  ARG A C     1 
ATOM   1588  O  O     . ARG A 1  240  ? -57.534 -53.815 -47.202 1.00 76.86  ? 240  ARG A O     1 
ATOM   1589  C  CB    . ARG A 1  240  ? -54.774 -52.897 -48.626 1.00 75.29  ? 240  ARG A CB    1 
ATOM   1590  C  CG    . ARG A 1  240  ? -53.329 -53.313 -48.834 1.00 74.66  ? 240  ARG A CG    1 
ATOM   1591  C  CD    . ARG A 1  240  ? -52.435 -52.112 -49.076 1.00 73.47  ? 240  ARG A CD    1 
ATOM   1592  N  NE    . ARG A 1  240  ? -52.533 -51.140 -47.989 1.00 73.64  ? 240  ARG A NE    1 
ATOM   1593  C  CZ    . ARG A 1  240  ? -51.907 -51.222 -46.813 1.00 74.11  ? 240  ARG A CZ    1 
ATOM   1594  N  NH1   . ARG A 1  240  ? -51.103 -52.243 -46.515 1.00 74.95  ? 240  ARG A NH1   1 
ATOM   1595  N  NH2   . ARG A 1  240  ? -52.092 -50.258 -45.914 1.00 73.65  ? 240  ARG A NH2   1 
ATOM   1596  N  N     . MET A 1  241  ? -57.905 -52.846 -49.216 1.00 79.55  ? 241  MET A N     1 
ATOM   1597  C  CA    . MET A 1  241  ? -59.119 -52.117 -48.820 1.00 81.12  ? 241  MET A CA    1 
ATOM   1598  C  C     . MET A 1  241  ? -60.308 -52.368 -49.753 1.00 81.64  ? 241  MET A C     1 
ATOM   1599  O  O     . MET A 1  241  ? -60.132 -52.565 -50.954 1.00 81.12  ? 241  MET A O     1 
ATOM   1600  C  CB    . MET A 1  241  ? -58.820 -50.611 -48.774 1.00 81.41  ? 241  MET A CB    1 
ATOM   1601  C  CG    . MET A 1  241  ? -59.959 -49.743 -48.249 1.00 82.59  ? 241  MET A CG    1 
ATOM   1602  S  SD    . MET A 1  241  ? -59.492 -48.019 -47.995 1.00 82.83  ? 241  MET A SD    1 
ATOM   1603  C  CE    . MET A 1  241  ? -58.610 -48.122 -46.437 1.00 81.96  ? 241  MET A CE    1 
ATOM   1604  N  N     . MET A 1  242  ? -61.509 -52.357 -49.170 1.00 82.67  ? 242  MET A N     1 
ATOM   1605  C  CA    . MET A 1  242  ? -62.779 -52.345 -49.901 1.00 83.39  ? 242  MET A CA    1 
ATOM   1606  C  C     . MET A 1  242  ? -63.561 -51.094 -49.492 1.00 80.68  ? 242  MET A C     1 
ATOM   1607  O  O     . MET A 1  242  ? -63.717 -50.815 -48.301 1.00 80.16  ? 242  MET A O     1 
ATOM   1608  C  CB    . MET A 1  242  ? -63.600 -53.600 -49.582 1.00 87.31  ? 242  MET A CB    1 
ATOM   1609  C  CG    . MET A 1  242  ? -63.126 -54.864 -50.290 1.00 90.22  ? 242  MET A CG    1 
ATOM   1610  S  SD    . MET A 1  242  ? -63.435 -54.884 -52.076 1.00 93.37  ? 242  MET A SD    1 
ATOM   1611  C  CE    . MET A 1  242  ? -65.225 -54.997 -52.112 1.00 94.61  ? 242  MET A CE    1 
ATOM   1612  N  N     . TRP A 1  243  ? -64.052 -50.354 -50.485 1.00 77.55  ? 243  TRP A N     1 
ATOM   1613  C  CA    . TRP A 1  243  ? -64.733 -49.075 -50.278 1.00 74.96  ? 243  TRP A CA    1 
ATOM   1614  C  C     . TRP A 1  243  ? -66.132 -49.151 -50.870 1.00 75.21  ? 243  TRP A C     1 
ATOM   1615  O  O     . TRP A 1  243  ? -66.283 -49.406 -52.064 1.00 74.70  ? 243  TRP A O     1 
ATOM   1616  C  CB    . TRP A 1  243  ? -63.942 -47.969 -50.965 1.00 73.19  ? 243  TRP A CB    1 
ATOM   1617  C  CG    . TRP A 1  243  ? -64.491 -46.580 -50.837 1.00 72.00  ? 243  TRP A CG    1 
ATOM   1618  C  CD1   . TRP A 1  243  ? -65.654 -46.092 -51.373 1.00 72.15  ? 243  TRP A CD1   1 
ATOM   1619  C  CD2   . TRP A 1  243  ? -63.865 -45.481 -50.176 1.00 70.87  ? 243  TRP A CD2   1 
ATOM   1620  N  NE1   . TRP A 1  243  ? -65.798 -44.763 -51.064 1.00 71.52  ? 243  TRP A NE1   1 
ATOM   1621  C  CE2   . TRP A 1  243  ? -64.713 -44.360 -50.330 1.00 71.03  ? 243  TRP A CE2   1 
ATOM   1622  C  CE3   . TRP A 1  243  ? -62.673 -45.333 -49.454 1.00 70.21  ? 243  TRP A CE3   1 
ATOM   1623  C  CZ2   . TRP A 1  243  ? -64.406 -43.106 -49.791 1.00 70.46  ? 243  TRP A CZ2   1 
ATOM   1624  C  CZ3   . TRP A 1  243  ? -62.367 -44.085 -48.914 1.00 69.56  ? 243  TRP A CZ3   1 
ATOM   1625  C  CH2   . TRP A 1  243  ? -63.233 -42.988 -49.089 1.00 69.60  ? 243  TRP A CH2   1 
ATOM   1626  N  N     . PHE A 1  244  ? -67.140 -48.900 -50.036 1.00 75.46  ? 244  PHE A N     1 
ATOM   1627  C  CA    . PHE A 1  244  ? -68.542 -48.907 -50.449 1.00 75.43  ? 244  PHE A CA    1 
ATOM   1628  C  C     . PHE A 1  244  ? -69.122 -47.513 -50.287 1.00 74.46  ? 244  PHE A C     1 
ATOM   1629  O  O     . PHE A 1  244  ? -69.118 -46.971 -49.187 1.00 74.60  ? 244  PHE A O     1 
ATOM   1630  C  CB    . PHE A 1  244  ? -69.335 -49.890 -49.596 1.00 76.36  ? 244  PHE A CB    1 
ATOM   1631  C  CG    . PHE A 1  244  ? -68.806 -51.291 -49.644 1.00 76.97  ? 244  PHE A CG    1 
ATOM   1632  C  CD1   . PHE A 1  244  ? -69.035 -52.093 -50.759 1.00 78.27  ? 244  PHE A CD1   1 
ATOM   1633  C  CD2   . PHE A 1  244  ? -68.071 -51.811 -48.583 1.00 76.53  ? 244  PHE A CD2   1 
ATOM   1634  C  CE1   . PHE A 1  244  ? -68.551 -53.394 -50.811 1.00 78.81  ? 244  PHE A CE1   1 
ATOM   1635  C  CE2   . PHE A 1  244  ? -67.583 -53.107 -48.628 1.00 77.54  ? 244  PHE A CE2   1 
ATOM   1636  C  CZ    . PHE A 1  244  ? -67.822 -53.901 -49.744 1.00 78.82  ? 244  PHE A CZ    1 
ATOM   1637  N  N     . SER A 1  245  ? -69.596 -46.930 -51.386 1.00 74.04  ? 245  SER A N     1 
ATOM   1638  C  CA    . SER A 1  245  ? -70.301 -45.653 -51.352 1.00 74.00  ? 245  SER A CA    1 
ATOM   1639  C  C     . SER A 1  245  ? -71.789 -45.894 -51.606 1.00 75.78  ? 245  SER A C     1 
ATOM   1640  O  O     . SER A 1  245  ? -72.213 -45.921 -52.763 1.00 75.36  ? 245  SER A O     1 
ATOM   1641  C  CB    . SER A 1  245  ? -69.729 -44.689 -52.393 1.00 73.07  ? 245  SER A CB    1 
ATOM   1642  O  OG    . SER A 1  245  ? -68.468 -44.198 -51.986 1.00 72.53  ? 245  SER A OG    1 
ATOM   1643  N  N     . PRO A 1  246  ? -72.584 -46.093 -50.531 1.00 77.23  ? 246  PRO A N     1 
ATOM   1644  C  CA    . PRO A 1  246  ? -74.032 -46.197 -50.710 1.00 78.69  ? 246  PRO A CA    1 
ATOM   1645  C  C     . PRO A 1  246  ? -74.635 -44.827 -51.002 1.00 79.18  ? 246  PRO A C     1 
ATOM   1646  O  O     . PRO A 1  246  ? -74.264 -43.843 -50.364 1.00 77.96  ? 246  PRO A O     1 
ATOM   1647  C  CB    . PRO A 1  246  ? -74.515 -46.734 -49.364 1.00 79.59  ? 246  PRO A CB    1 
ATOM   1648  C  CG    . PRO A 1  246  ? -73.511 -46.236 -48.388 1.00 78.54  ? 246  PRO A CG    1 
ATOM   1649  C  CD    . PRO A 1  246  ? -72.200 -46.249 -49.114 1.00 77.11  ? 246  PRO A CD    1 
ATOM   1650  N  N     . VAL A 1  247  ? -75.545 -44.776 -51.970 1.00 81.11  ? 247  VAL A N     1 
ATOM   1651  C  CA    . VAL A 1  247  ? -76.143 -43.517 -52.433 1.00 81.48  ? 247  VAL A CA    1 
ATOM   1652  C  C     . VAL A 1  247  ? -77.604 -43.339 -51.962 1.00 81.95  ? 247  VAL A C     1 
ATOM   1653  O  O     . VAL A 1  247  ? -78.251 -42.355 -52.324 1.00 81.42  ? 247  VAL A O     1 
ATOM   1654  C  CB    . VAL A 1  247  ? -76.008 -43.411 -53.978 1.00 82.23  ? 247  VAL A CB    1 
ATOM   1655  C  CG1   . VAL A 1  247  ? -77.082 -44.218 -54.688 1.00 84.22  ? 247  VAL A CG1   1 
ATOM   1656  C  CG2   . VAL A 1  247  ? -76.015 -41.962 -54.454 1.00 82.41  ? 247  VAL A CG2   1 
ATOM   1657  N  N     . THR A 1  248  ? -78.113 -44.291 -51.170 1.00 82.42  ? 248  THR A N     1 
ATOM   1658  C  CA    . THR A 1  248  ? -79.432 -44.185 -50.522 1.00 83.11  ? 248  THR A CA    1 
ATOM   1659  C  C     . THR A 1  248  ? -79.317 -44.531 -49.035 1.00 83.06  ? 248  THR A C     1 
ATOM   1660  O  O     . THR A 1  248  ? -78.336 -45.140 -48.601 1.00 82.09  ? 248  THR A O     1 
ATOM   1661  C  CB    . THR A 1  248  ? -80.489 -45.116 -51.172 1.00 84.05  ? 248  THR A CB    1 
ATOM   1662  O  OG1   . THR A 1  248  ? -80.250 -46.479 -50.801 1.00 83.57  ? 248  THR A OG1   1 
ATOM   1663  C  CG2   . THR A 1  248  ? -80.470 -45.000 -52.688 1.00 84.14  ? 248  THR A CG2   1 
ATOM   1664  N  N     . LEU A 1  249  ? -80.328 -44.142 -48.266 1.00 84.00  ? 249  LEU A N     1 
ATOM   1665  C  CA    . LEU A 1  249  ? -80.382 -44.463 -46.840 1.00 84.60  ? 249  LEU A CA    1 
ATOM   1666  C  C     . LEU A 1  249  ? -80.537 -45.970 -46.616 1.00 85.70  ? 249  LEU A C     1 
ATOM   1667  O  O     . LEU A 1  249  ? -79.840 -46.549 -45.782 1.00 84.91  ? 249  LEU A O     1 
ATOM   1668  C  CB    . LEU A 1  249  ? -81.526 -43.703 -46.161 1.00 85.72  ? 249  LEU A CB    1 
ATOM   1669  C  CG    . LEU A 1  249  ? -81.791 -43.962 -44.670 1.00 86.65  ? 249  LEU A CG    1 
ATOM   1670  C  CD1   . LEU A 1  249  ? -80.515 -43.849 -43.842 1.00 85.40  ? 249  LEU A CD1   1 
ATOM   1671  C  CD2   . LEU A 1  249  ? -82.870 -43.012 -44.157 1.00 87.43  ? 249  LEU A CD2   1 
ATOM   1672  N  N     . LYS A 1  250  ? -81.451 -46.594 -47.361 1.00 87.59  ? 250  LYS A N     1 
ATOM   1673  C  CA    . LYS A 1  250  ? -81.650 -48.047 -47.304 1.00 88.71  ? 250  LYS A CA    1 
ATOM   1674  C  C     . LYS A 1  250  ? -80.329 -48.798 -47.505 1.00 88.19  ? 250  LYS A C     1 
ATOM   1675  O  O     . LYS A 1  250  ? -80.012 -49.709 -46.742 1.00 88.96  ? 250  LYS A O     1 
ATOM   1676  C  CB    . LYS A 1  250  ? -82.677 -48.498 -48.350 1.00 89.74  ? 250  LYS A CB    1 
ATOM   1677  C  CG    . LYS A 1  250  ? -82.991 -49.990 -48.312 1.00 91.07  ? 250  LYS A CG    1 
ATOM   1678  C  CD    . LYS A 1  250  ? -83.982 -50.396 -49.387 1.00 92.42  ? 250  LYS A CD    1 
ATOM   1679  C  CE    . LYS A 1  250  ? -84.276 -51.882 -49.305 1.00 94.09  ? 250  LYS A CE    1 
ATOM   1680  N  NZ    . LYS A 1  250  ? -85.380 -52.288 -50.217 1.00 96.43  ? 250  LYS A NZ    1 
ATOM   1681  N  N     . GLU A 1  251  ? -79.572 -48.405 -48.527 1.00 87.50  ? 251  GLU A N     1 
ATOM   1682  C  CA    . GLU A 1  251  ? -78.257 -48.994 -48.798 1.00 86.95  ? 251  GLU A CA    1 
ATOM   1683  C  C     . GLU A 1  251  ? -77.251 -48.759 -47.667 1.00 84.76  ? 251  GLU A C     1 
ATOM   1684  O  O     . GLU A 1  251  ? -76.551 -49.685 -47.271 1.00 84.01  ? 251  GLU A O     1 
ATOM   1685  C  CB    . GLU A 1  251  ? -77.689 -48.455 -50.114 1.00 87.72  ? 251  GLU A CB    1 
ATOM   1686  C  CG    . GLU A 1  251  ? -78.406 -48.974 -51.348 1.00 89.90  ? 251  GLU A CG    1 
ATOM   1687  C  CD    . GLU A 1  251  ? -78.073 -50.421 -51.648 1.00 91.85  ? 251  GLU A CD    1 
ATOM   1688  O  OE1   . GLU A 1  251  ? -76.875 -50.731 -51.826 1.00 92.73  ? 251  GLU A OE1   1 
ATOM   1689  O  OE2   . GLU A 1  251  ? -79.009 -51.246 -51.707 1.00 94.37  ? 251  GLU A OE2   1 
ATOM   1690  N  N     . LEU A 1  252  ? -77.191 -47.530 -47.154 1.00 83.12  ? 252  LEU A N     1 
ATOM   1691  C  CA    . LEU A 1  252  ? -76.286 -47.177 -46.046 1.00 81.59  ? 252  LEU A CA    1 
ATOM   1692  C  C     . LEU A 1  252  ? -76.464 -48.086 -44.826 1.00 82.22  ? 252  LEU A C     1 
ATOM   1693  O  O     . LEU A 1  252  ? -75.488 -48.610 -44.285 1.00 81.63  ? 252  LEU A O     1 
ATOM   1694  C  CB    . LEU A 1  252  ? -76.483 -45.709 -45.640 1.00 80.93  ? 252  LEU A CB    1 
ATOM   1695  C  CG    . LEU A 1  252  ? -75.705 -45.171 -44.432 1.00 80.24  ? 252  LEU A CG    1 
ATOM   1696  C  CD1   . LEU A 1  252  ? -74.216 -45.466 -44.537 1.00 79.25  ? 252  LEU A CD1   1 
ATOM   1697  C  CD2   . LEU A 1  252  ? -75.940 -43.676 -44.288 1.00 80.03  ? 252  LEU A CD2   1 
ATOM   1698  N  N     . LEU A 1  253  ? -77.715 -48.275 -44.414 1.00 83.76  ? 253  LEU A N     1 
ATOM   1699  C  CA    . LEU A 1  253  ? -78.041 -49.127 -43.271 1.00 84.70  ? 253  LEU A CA    1 
ATOM   1700  C  C     . LEU A 1  253  ? -77.730 -50.591 -43.558 1.00 85.52  ? 253  LEU A C     1 
ATOM   1701  O  O     . LEU A 1  253  ? -77.320 -51.324 -42.660 1.00 86.03  ? 253  LEU A O     1 
ATOM   1702  C  CB    . LEU A 1  253  ? -79.514 -48.977 -42.887 1.00 86.22  ? 253  LEU A CB    1 
ATOM   1703  C  CG    . LEU A 1  253  ? -79.973 -47.579 -42.451 1.00 85.92  ? 253  LEU A CG    1 
ATOM   1704  C  CD1   . LEU A 1  253  ? -81.491 -47.527 -42.400 1.00 87.49  ? 253  LEU A CD1   1 
ATOM   1705  C  CD2   . LEU A 1  253  ? -79.375 -47.189 -41.111 1.00 85.04  ? 253  LEU A CD2   1 
ATOM   1706  N  N     . GLU A 1  254  ? -77.929 -51.002 -44.811 1.00 86.29  ? 254  GLU A N     1 
ATOM   1707  C  CA    . GLU A 1  254  ? -77.576 -52.349 -45.266 1.00 87.28  ? 254  GLU A CA    1 
ATOM   1708  C  C     . GLU A 1  254  ? -76.073 -52.633 -45.152 1.00 86.18  ? 254  GLU A C     1 
ATOM   1709  O  O     . GLU A 1  254  ? -75.685 -53.738 -44.774 1.00 87.80  ? 254  GLU A O     1 
ATOM   1710  C  CB    . GLU A 1  254  ? -78.052 -52.568 -46.715 1.00 88.33  ? 254  GLU A CB    1 
ATOM   1711  C  CG    . GLU A 1  254  ? -77.868 -53.978 -47.263 1.00 89.18  ? 254  GLU A CG    1 
ATOM   1712  C  CD    . GLU A 1  254  ? -78.527 -55.023 -46.390 1.00 90.78  ? 254  GLU A CD    1 
ATOM   1713  O  OE1   . GLU A 1  254  ? -79.763 -54.955 -46.224 1.00 91.64  ? 254  GLU A OE1   1 
ATOM   1714  O  OE2   . GLU A 1  254  ? -77.808 -55.895 -45.861 1.00 91.07  ? 254  GLU A OE2   1 
ATOM   1715  N  N     . PHE A 1  255  ? -75.239 -51.645 -45.482 1.00 83.96  ? 255  PHE A N     1 
ATOM   1716  C  CA    . PHE A 1  255  ? -73.781 -51.776 -45.330 1.00 82.37  ? 255  PHE A CA    1 
ATOM   1717  C  C     . PHE A 1  255  ? -73.308 -51.627 -43.887 1.00 81.95  ? 255  PHE A C     1 
ATOM   1718  O  O     . PHE A 1  255  ? -72.297 -52.216 -43.507 1.00 81.26  ? 255  PHE A O     1 
ATOM   1719  C  CB    . PHE A 1  255  ? -73.029 -50.814 -46.267 1.00 80.77  ? 255  PHE A CB    1 
ATOM   1720  C  CG    . PHE A 1  255  ? -72.933 -51.324 -47.673 1.00 80.66  ? 255  PHE A CG    1 
ATOM   1721  C  CD1   . PHE A 1  255  ? -71.974 -52.268 -48.011 1.00 80.13  ? 255  PHE A CD1   1 
ATOM   1722  C  CD2   . PHE A 1  255  ? -73.834 -50.911 -48.646 1.00 81.51  ? 255  PHE A CD2   1 
ATOM   1723  C  CE1   . PHE A 1  255  ? -71.898 -52.769 -49.299 1.00 80.65  ? 255  PHE A CE1   1 
ATOM   1724  C  CE2   . PHE A 1  255  ? -73.767 -51.412 -49.937 1.00 81.83  ? 255  PHE A CE2   1 
ATOM   1725  C  CZ    . PHE A 1  255  ? -72.794 -52.340 -50.265 1.00 81.47  ? 255  PHE A CZ    1 
ATOM   1726  N  N     . LYS A 1  256  ? -74.038 -50.859 -43.084 1.00 82.85  ? 256  LYS A N     1 
ATOM   1727  C  CA    . LYS A 1  256  ? -73.738 -50.755 -41.655 1.00 83.94  ? 256  LYS A CA    1 
ATOM   1728  C  C     . LYS A 1  256  ? -74.036 -52.063 -40.891 1.00 85.65  ? 256  LYS A C     1 
ATOM   1729  O  O     . LYS A 1  256  ? -73.402 -52.335 -39.874 1.00 85.43  ? 256  LYS A O     1 
ATOM   1730  C  CB    . LYS A 1  256  ? -74.490 -49.569 -41.033 1.00 84.29  ? 256  LYS A CB    1 
ATOM   1731  C  CG    . LYS A 1  256  ? -74.025 -49.155 -39.641 1.00 84.09  ? 256  LYS A CG    1 
ATOM   1732  C  CD    . LYS A 1  256  ? -72.585 -48.661 -39.604 1.00 82.59  ? 256  LYS A CD    1 
ATOM   1733  C  CE    . LYS A 1  256  ? -72.225 -48.142 -38.221 1.00 82.36  ? 256  LYS A CE    1 
ATOM   1734  N  NZ    . LYS A 1  256  ? -70.777 -48.300 -37.930 1.00 81.83  ? 256  LYS A NZ    1 
ATOM   1735  N  N     . PHE A 1  257  ? -74.981 -52.869 -41.376 1.00 87.32  ? 257  PHE A N     1 
ATOM   1736  C  CA    . PHE A 1  257  ? -75.213 -54.200 -40.803 1.00 89.59  ? 257  PHE A CA    1 
ATOM   1737  C  C     . PHE A 1  257  ? -74.109 -55.191 -41.183 1.00 90.08  ? 257  PHE A C     1 
ATOM   1738  O  O     . PHE A 1  257  ? -73.586 -55.897 -40.319 1.00 90.39  ? 257  PHE A O     1 
ATOM   1739  C  CB    . PHE A 1  257  ? -76.571 -54.765 -41.228 1.00 91.73  ? 257  PHE A CB    1 
ATOM   1740  C  CG    . PHE A 1  257  ? -76.994 -55.962 -40.423 1.00 94.03  ? 257  PHE A CG    1 
ATOM   1741  C  CD1   . PHE A 1  257  ? -76.611 -57.250 -40.801 1.00 94.67  ? 257  PHE A CD1   1 
ATOM   1742  C  CD2   . PHE A 1  257  ? -77.752 -55.801 -39.265 1.00 95.52  ? 257  PHE A CD2   1 
ATOM   1743  C  CE1   . PHE A 1  257  ? -76.985 -58.353 -40.048 1.00 96.30  ? 257  PHE A CE1   1 
ATOM   1744  C  CE2   . PHE A 1  257  ? -78.134 -56.902 -38.509 1.00 97.66  ? 257  PHE A CE2   1 
ATOM   1745  C  CZ    . PHE A 1  257  ? -77.749 -58.179 -38.900 1.00 98.12  ? 257  PHE A CZ    1 
ATOM   1746  N  N     . LYS A 1  258  ? -73.781 -55.251 -42.477 1.00 90.48  ? 258  LYS A N     1 
ATOM   1747  C  CA    . LYS A 1  258  ? -72.781 -56.198 -43.010 1.00 90.86  ? 258  LYS A CA    1 
ATOM   1748  C  C     . LYS A 1  258  ? -71.398 -56.025 -42.391 1.00 88.59  ? 258  LYS A C     1 
ATOM   1749  O  O     . LYS A 1  258  ? -70.765 -56.999 -41.980 1.00 88.16  ? 258  LYS A O     1 
ATOM   1750  C  CB    . LYS A 1  258  ? -72.644 -56.056 -44.535 1.00 91.60  ? 258  LYS A CB    1 
ATOM   1751  C  CG    . LYS A 1  258  ? -73.787 -56.635 -45.351 1.00 94.42  ? 258  LYS A CG    1 
ATOM   1752  C  CD    . LYS A 1  258  ? -73.449 -56.607 -46.838 1.00 95.31  ? 258  LYS A CD    1 
ATOM   1753  C  CE    . LYS A 1  258  ? -74.543 -57.237 -47.689 1.00 97.40  ? 258  LYS A CE    1 
ATOM   1754  N  NZ    . LYS A 1  258  ? -74.142 -57.269 -49.123 1.00 97.12  ? 258  LYS A NZ    1 
ATOM   1755  N  N     . TYR A 1  259  ? -70.944 -54.778 -42.348 1.00 86.68  ? 259  TYR A N     1 
ATOM   1756  C  CA    . TYR A 1  259  ? -69.597 -54.438 -41.921 1.00 85.48  ? 259  TYR A CA    1 
ATOM   1757  C  C     . TYR A 1  259  ? -69.715 -53.512 -40.712 1.00 85.16  ? 259  TYR A C     1 
ATOM   1758  O  O     . TYR A 1  259  ? -69.414 -52.320 -40.806 1.00 84.26  ? 259  TYR A O     1 
ATOM   1759  C  CB    . TYR A 1  259  ? -68.848 -53.773 -43.079 1.00 84.09  ? 259  TYR A CB    1 
ATOM   1760  C  CG    . TYR A 1  259  ? -68.867 -54.577 -44.371 1.00 84.59  ? 259  TYR A CG    1 
ATOM   1761  C  CD1   . TYR A 1  259  ? -67.903 -55.559 -44.626 1.00 84.41  ? 259  TYR A CD1   1 
ATOM   1762  C  CD2   . TYR A 1  259  ? -69.843 -54.347 -45.344 1.00 84.77  ? 259  TYR A CD2   1 
ATOM   1763  C  CE1   . TYR A 1  259  ? -67.916 -56.289 -45.810 1.00 84.42  ? 259  TYR A CE1   1 
ATOM   1764  C  CE2   . TYR A 1  259  ? -69.866 -55.073 -46.527 1.00 85.05  ? 259  TYR A CE2   1 
ATOM   1765  C  CZ    . TYR A 1  259  ? -68.900 -56.041 -46.759 1.00 85.09  ? 259  TYR A CZ    1 
ATOM   1766  O  OH    . TYR A 1  259  ? -68.928 -56.761 -47.936 1.00 85.21  ? 259  TYR A OH    1 
ATOM   1767  N  N     . PRO A 1  260  ? -70.158 -54.061 -39.560 1.00 87.08  ? 260  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1  260  ? -70.513 -53.220 -38.405 1.00 86.63  ? 260  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1  260  ? -69.370 -52.364 -37.850 1.00 84.97  ? 260  PRO A C     1 
ATOM   1770  O  O     . PRO A 1  260  ? -69.634 -51.279 -37.331 1.00 85.50  ? 260  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1  260  ? -70.987 -54.241 -37.362 1.00 88.02  ? 260  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1  260  ? -70.267 -55.492 -37.711 1.00 88.52  ? 260  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1  260  ? -70.208 -55.496 -39.212 1.00 88.28  ? 260  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1  261  ? -68.128 -52.838 -37.971 1.00 83.59  ? 261  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1  261  ? -66.960 -52.120 -37.450 1.00 81.86  ? 261  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1  261  ? -66.290 -51.198 -38.476 1.00 78.34  ? 261  GLN A C     1 
ATOM   1777  O  O     . GLN A 1  261  ? -65.284 -50.567 -38.159 1.00 75.91  ? 261  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1  261  ? -65.930 -53.111 -36.874 1.00 83.23  ? 261  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1  261  ? -66.498 -54.179 -35.936 1.00 85.93  ? 261  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1  261  ? -67.344 -53.615 -34.797 1.00 88.13  ? 261  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1  261  ? -67.098 -52.512 -34.302 1.00 88.41  ? 261  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1  261  ? -68.349 -54.377 -34.376 1.00 90.40  ? 261  GLN A NE2   1 
ATOM   1783  N  N     . ALA A 1  262  ? -66.851 -51.100 -39.684 1.00 77.67  ? 262  ALA A N     1 
ATOM   1784  C  CA    . ALA A 1  262  ? -66.317 -50.212 -40.721 1.00 76.29  ? 262  ALA A CA    1 
ATOM   1785  C  C     . ALA A 1  262  ? -66.709 -48.762 -40.432 1.00 76.05  ? 262  ALA A C     1 
ATOM   1786  O  O     . ALA A 1  262  ? -67.873 -48.503 -40.096 1.00 78.09  ? 262  ALA A O     1 
ATOM   1787  C  CB    . ALA A 1  262  ? -66.833 -50.623 -42.089 1.00 76.47  ? 262  ALA A CB    1 
ATOM   1788  N  N     . PRO A 1  263  ? -65.757 -47.809 -40.577 1.00 74.11  ? 263  PRO A N     1 
ATOM   1789  C  CA    . PRO A 1  263  ? -66.106 -46.436 -40.240 1.00 73.63  ? 263  PRO A CA    1 
ATOM   1790  C  C     . PRO A 1  263  ? -66.932 -45.778 -41.336 1.00 73.68  ? 263  PRO A C     1 
ATOM   1791  O  O     . PRO A 1  263  ? -66.722 -46.059 -42.516 1.00 73.64  ? 263  PRO A O     1 
ATOM   1792  C  CB    . PRO A 1  263  ? -64.744 -45.743 -40.103 1.00 71.87  ? 263  PRO A CB    1 
ATOM   1793  C  CG    . PRO A 1  263  ? -63.741 -46.650 -40.727 1.00 71.32  ? 263  PRO A CG    1 
ATOM   1794  C  CD    . PRO A 1  263  ? -64.442 -47.870 -41.237 1.00 72.56  ? 263  PRO A CD    1 
ATOM   1795  N  N     . VAL A 1  264  ? -67.874 -44.929 -40.932 1.00 74.05  ? 264  VAL A N     1 
ATOM   1796  C  CA    . VAL A 1  264  ? -68.655 -44.131 -41.863 1.00 73.78  ? 264  VAL A CA    1 
ATOM   1797  C  C     . VAL A 1  264  ? -67.888 -42.832 -42.110 1.00 72.38  ? 264  VAL A C     1 
ATOM   1798  O  O     . VAL A 1  264  ? -67.963 -41.901 -41.313 1.00 72.77  ? 264  VAL A O     1 
ATOM   1799  C  CB    . VAL A 1  264  ? -70.075 -43.850 -41.324 1.00 75.60  ? 264  VAL A CB    1 
ATOM   1800  C  CG1   . VAL A 1  264  ? -70.856 -42.957 -42.288 1.00 75.59  ? 264  VAL A CG1   1 
ATOM   1801  C  CG2   . VAL A 1  264  ? -70.814 -45.163 -41.084 1.00 77.31  ? 264  VAL A CG2   1 
ATOM   1802  N  N     . ILE A 1  265  ? -67.139 -42.788 -43.210 1.00 71.17  ? 265  ILE A N     1 
ATOM   1803  C  CA    . ILE A 1  265  ? -66.352 -41.605 -43.578 1.00 69.80  ? 265  ILE A CA    1 
ATOM   1804  C  C     . ILE A 1  265  ? -67.279 -40.534 -44.153 1.00 68.91  ? 265  ILE A C     1 
ATOM   1805  O  O     . ILE A 1  265  ? -68.030 -40.801 -45.093 1.00 68.44  ? 265  ILE A O     1 
ATOM   1806  C  CB    . ILE A 1  265  ? -65.206 -41.954 -44.577 1.00 69.60  ? 265  ILE A CB    1 
ATOM   1807  C  CG1   . ILE A 1  265  ? -63.935 -42.375 -43.825 1.00 69.61  ? 265  ILE A CG1   1 
ATOM   1808  C  CG2   . ILE A 1  265  ? -64.825 -40.766 -45.466 1.00 68.80  ? 265  ILE A CG2   1 
ATOM   1809  C  CD1   . ILE A 1  265  ? -64.126 -43.440 -42.771 1.00 70.35  ? 265  ILE A CD1   1 
ATOM   1810  N  N     . MET A 1  266  ? -67.214 -39.335 -43.572 1.00 68.12  ? 266  MET A N     1 
ATOM   1811  C  CA    . MET A 1  266  ? -67.867 -38.149 -44.126 1.00 68.26  ? 266  MET A CA    1 
ATOM   1812  C  C     . MET A 1  266  ? -66.787 -37.149 -44.562 1.00 66.33  ? 266  MET A C     1 
ATOM   1813  O  O     . MET A 1  266  ? -66.567 -36.965 -45.760 1.00 67.07  ? 266  MET A O     1 
ATOM   1814  C  CB    . MET A 1  266  ? -68.845 -37.522 -43.118 1.00 69.18  ? 266  MET A CB    1 
ATOM   1815  C  CG    . MET A 1  266  ? -69.861 -38.486 -42.513 1.00 70.68  ? 266  MET A CG    1 
ATOM   1816  S  SD    . MET A 1  266  ? -71.061 -39.145 -43.683 1.00 72.40  ? 266  MET A SD    1 
ATOM   1817  C  CE    . MET A 1  266  ? -72.055 -37.701 -44.041 1.00 72.59  ? 266  MET A CE    1 
ATOM   1818  N  N     . GLY A 1  267  ? -66.096 -36.539 -43.602 1.00 64.41  ? 267  GLY A N     1 
ATOM   1819  C  CA    . GLY A 1  267  ? -65.058 -35.539 -43.880 1.00 62.53  ? 267  GLY A CA    1 
ATOM   1820  C  C     . GLY A 1  267  ? -63.630 -36.052 -43.791 1.00 60.92  ? 267  GLY A C     1 
ATOM   1821  O  O     . GLY A 1  267  ? -62.709 -35.422 -44.314 1.00 58.87  ? 267  GLY A O     1 
ATOM   1822  N  N     . ASN A 1  268  ? -63.448 -37.182 -43.107 1.00 61.51  ? 268  ASN A N     1 
ATOM   1823  C  CA    . ASN A 1  268  ? -62.138 -37.821 -42.909 1.00 61.26  ? 268  ASN A CA    1 
ATOM   1824  C  C     . ASN A 1  268  ? -61.128 -36.980 -42.107 1.00 60.42  ? 268  ASN A C     1 
ATOM   1825  O  O     . ASN A 1  268  ? -59.925 -37.239 -42.156 1.00 59.61  ? 268  ASN A O     1 
ATOM   1826  C  CB    . ASN A 1  268  ? -61.543 -38.274 -44.260 1.00 60.45  ? 268  ASN A CB    1 
ATOM   1827  C  CG    . ASN A 1  268  ? -60.566 -39.435 -44.120 1.00 60.86  ? 268  ASN A CG    1 
ATOM   1828  O  OD1   . ASN A 1  268  ? -60.815 -40.397 -43.390 1.00 61.19  ? 268  ASN A OD1   1 
ATOM   1829  N  ND2   . ASN A 1  268  ? -59.441 -39.349 -44.831 1.00 60.62  ? 268  ASN A ND2   1 
ATOM   1830  N  N     . THR A 1  269  ? -61.623 -36.010 -41.336 1.00 61.23  ? 269  THR A N     1 
ATOM   1831  C  CA    . THR A 1  269  ? -60.767 -35.135 -40.533 1.00 60.57  ? 269  THR A CA    1 
ATOM   1832  C  C     . THR A 1  269  ? -60.518 -35.693 -39.130 1.00 60.51  ? 269  THR A C     1 
ATOM   1833  O  O     . THR A 1  269  ? -59.733 -35.119 -38.383 1.00 60.76  ? 269  THR A O     1 
ATOM   1834  C  CB    . THR A 1  269  ? -61.366 -33.726 -40.418 1.00 60.71  ? 269  THR A CB    1 
ATOM   1835  O  OG1   . THR A 1  269  ? -62.647 -33.805 -39.790 1.00 61.97  ? 269  THR A OG1   1 
ATOM   1836  C  CG2   . THR A 1  269  ? -61.522 -33.095 -41.794 1.00 60.06  ? 269  THR A CG2   1 
ATOM   1837  N  N     . SER A 1  270  ? -61.195 -36.787 -38.768 1.00 61.30  ? 270  SER A N     1 
ATOM   1838  C  CA    . SER A 1  270  ? -60.873 -37.545 -37.551 1.00 62.49  ? 270  SER A CA    1 
ATOM   1839  C  C     . SER A 1  270  ? -60.162 -38.855 -37.879 1.00 63.42  ? 270  SER A C     1 
ATOM   1840  O  O     . SER A 1  270  ? -59.111 -39.141 -37.301 1.00 63.41  ? 270  SER A O     1 
ATOM   1841  C  CB    . SER A 1  270  ? -62.132 -37.833 -36.730 1.00 63.25  ? 270  SER A CB    1 
ATOM   1842  O  OG    . SER A 1  270  ? -61.798 -38.402 -35.478 1.00 62.65  ? 270  SER A OG    1 
ATOM   1843  N  N     . VAL A 1  271  ? -60.735 -39.642 -38.792 1.00 64.84  ? 271  VAL A N     1 
ATOM   1844  C  CA    . VAL A 1  271  ? -60.148 -40.933 -39.199 1.00 66.25  ? 271  VAL A CA    1 
ATOM   1845  C  C     . VAL A 1  271  ? -58.843 -40.750 -39.983 1.00 67.46  ? 271  VAL A C     1 
ATOM   1846  O  O     . VAL A 1  271  ? -57.892 -41.508 -39.784 1.00 68.78  ? 271  VAL A O     1 
ATOM   1847  C  CB    . VAL A 1  271  ? -61.123 -41.783 -40.052 1.00 66.60  ? 271  VAL A CB    1 
ATOM   1848  C  CG1   . VAL A 1  271  ? -60.491 -43.121 -40.436 1.00 66.82  ? 271  VAL A CG1   1 
ATOM   1849  C  CG2   . VAL A 1  271  ? -62.433 -42.006 -39.310 1.00 68.12  ? 271  VAL A CG2   1 
ATOM   1850  N  N     . GLY A 1  272  ? -58.811 -39.752 -40.867 1.00 68.36  ? 272  GLY A N     1 
ATOM   1851  C  CA    . GLY A 1  272  ? -57.650 -39.480 -41.708 1.00 69.22  ? 272  GLY A CA    1 
ATOM   1852  C  C     . GLY A 1  272  ? -56.354 -39.263 -40.949 1.00 70.65  ? 272  GLY A C     1 
ATOM   1853  O  O     . GLY A 1  272  ? -55.376 -39.966 -41.202 1.00 71.92  ? 272  GLY A O     1 
ATOM   1854  N  N     . PRO A 1  273  ? -56.328 -38.282 -40.024 1.00 72.40  ? 273  PRO A N     1 
ATOM   1855  C  CA    . PRO A 1  273  ? -55.127 -38.072 -39.210 1.00 73.57  ? 273  PRO A CA    1 
ATOM   1856  C  C     . PRO A 1  273  ? -54.737 -39.254 -38.308 1.00 76.93  ? 273  PRO A C     1 
ATOM   1857  O  O     . PRO A 1  273  ? -53.551 -39.424 -38.027 1.00 78.82  ? 273  PRO A O     1 
ATOM   1858  C  CB    . PRO A 1  273  ? -55.481 -36.835 -38.377 1.00 72.62  ? 273  PRO A CB    1 
ATOM   1859  C  CG    . PRO A 1  273  ? -56.478 -36.107 -39.206 1.00 71.68  ? 273  PRO A CG    1 
ATOM   1860  C  CD    . PRO A 1  273  ? -57.298 -37.186 -39.843 1.00 72.25  ? 273  PRO A CD    1 
ATOM   1861  N  N     . GLU A 1  274  ? -55.711 -40.056 -37.874 1.00 80.51  ? 274  GLU A N     1 
ATOM   1862  C  CA    . GLU A 1  274  ? -55.432 -41.251 -37.066 1.00 84.69  ? 274  GLU A CA    1 
ATOM   1863  C  C     . GLU A 1  274  ? -54.678 -42.320 -37.861 1.00 86.98  ? 274  GLU A C     1 
ATOM   1864  O  O     . GLU A 1  274  ? -53.658 -42.832 -37.401 1.00 88.10  ? 274  GLU A O     1 
ATOM   1865  C  CB    . GLU A 1  274  ? -56.722 -41.839 -36.488 1.00 87.25  ? 274  GLU A CB    1 
ATOM   1866  C  CG    . GLU A 1  274  ? -57.299 -41.034 -35.332 1.00 89.20  ? 274  GLU A CG    1 
ATOM   1867  C  CD    . GLU A 1  274  ? -58.704 -41.463 -34.933 1.00 91.86  ? 274  GLU A CD    1 
ATOM   1868  O  OE1   . GLU A 1  274  ? -59.165 -42.544 -35.364 1.00 92.59  ? 274  GLU A OE1   1 
ATOM   1869  O  OE2   . GLU A 1  274  ? -59.357 -40.713 -34.175 1.00 95.64  ? 274  GLU A OE2   1 
ATOM   1870  N  N     . VAL A 1  275  ? -55.175 -42.653 -39.051 1.00 89.24  ? 275  VAL A N     1 
ATOM   1871  C  CA    . VAL A 1  275  ? -54.481 -43.617 -39.925 1.00 90.82  ? 275  VAL A CA    1 
ATOM   1872  C  C     . VAL A 1  275  ? -53.135 -43.090 -40.437 1.00 90.99  ? 275  VAL A C     1 
ATOM   1873  O  O     . VAL A 1  275  ? -52.218 -43.874 -40.680 1.00 91.50  ? 275  VAL A O     1 
ATOM   1874  C  CB    . VAL A 1  275  ? -55.354 -44.105 -41.122 1.00 90.78  ? 275  VAL A CB    1 
ATOM   1875  C  CG1   . VAL A 1  275  ? -56.642 -44.752 -40.620 1.00 91.73  ? 275  VAL A CG1   1 
ATOM   1876  C  CG2   . VAL A 1  275  ? -55.660 -42.991 -42.125 1.00 89.21  ? 275  VAL A CG2   1 
ATOM   1877  N  N     . LYS A 1  276  ? -53.027 -41.768 -40.587 1.00 92.02  ? 276  LYS A N     1 
ATOM   1878  C  CA    . LYS A 1  276  ? -51.815 -41.125 -41.101 1.00 93.38  ? 276  LYS A CA    1 
ATOM   1879  C  C     . LYS A 1  276  ? -50.632 -41.219 -40.128 1.00 94.22  ? 276  LYS A C     1 
ATOM   1880  O  O     . LYS A 1  276  ? -49.506 -41.477 -40.555 1.00 91.91  ? 276  LYS A O     1 
ATOM   1881  C  CB    . LYS A 1  276  ? -52.104 -39.654 -41.463 1.00 93.50  ? 276  LYS A CB    1 
ATOM   1882  C  CG    . LYS A 1  276  ? -50.983 -38.909 -42.184 1.00 94.07  ? 276  LYS A CG    1 
ATOM   1883  C  CD    . LYS A 1  276  ? -50.683 -39.491 -43.560 1.00 94.96  ? 276  LYS A CD    1 
ATOM   1884  C  CE    . LYS A 1  276  ? -49.520 -38.777 -44.231 1.00 95.03  ? 276  LYS A CE    1 
ATOM   1885  N  NZ    . LYS A 1  276  ? -49.037 -39.526 -45.425 1.00 94.36  ? 276  LYS A NZ    1 
ATOM   1886  N  N     . PHE A 1  277  ? -50.881 -41.006 -38.834 1.00 98.01  ? 277  PHE A N     1 
ATOM   1887  C  CA    . PHE A 1  277  ? -49.812 -41.077 -37.823 1.00 100.24 ? 277  PHE A CA    1 
ATOM   1888  C  C     . PHE A 1  277  ? -50.281 -41.504 -36.418 1.00 100.04 ? 277  PHE A C     1 
ATOM   1889  O  O     . PHE A 1  277  ? -49.832 -40.954 -35.411 1.00 101.55 ? 277  PHE A O     1 
ATOM   1890  C  CB    . PHE A 1  277  ? -48.986 -39.762 -37.795 1.00 100.46 ? 277  PHE A CB    1 
ATOM   1891  C  CG    . PHE A 1  277  ? -49.808 -38.500 -37.958 1.00 100.88 ? 277  PHE A CG    1 
ATOM   1892  C  CD1   . PHE A 1  277  ? -50.797 -38.159 -37.032 1.00 101.39 ? 277  PHE A CD1   1 
ATOM   1893  C  CD2   . PHE A 1  277  ? -49.572 -37.633 -39.031 1.00 99.48  ? 277  PHE A CD2   1 
ATOM   1894  C  CE1   . PHE A 1  277  ? -51.541 -36.993 -37.183 1.00 101.88 ? 277  PHE A CE1   1 
ATOM   1895  C  CE2   . PHE A 1  277  ? -50.313 -36.467 -39.185 1.00 98.95  ? 277  PHE A CE2   1 
ATOM   1896  C  CZ    . PHE A 1  277  ? -51.298 -36.147 -38.260 1.00 100.91 ? 277  PHE A CZ    1 
ATOM   1897  N  N     . LYS A 1  278  ? -51.182 -42.485 -36.359 1.00 100.09 ? 278  LYS A N     1 
ATOM   1898  C  CA    . LYS A 1  278  ? -51.429 -43.253 -35.124 1.00 102.56 ? 278  LYS A CA    1 
ATOM   1899  C  C     . LYS A 1  278  ? -51.564 -44.768 -35.386 1.00 102.96 ? 278  LYS A C     1 
ATOM   1900  O  O     . LYS A 1  278  ? -52.159 -45.489 -34.577 1.00 103.63 ? 278  LYS A O     1 
ATOM   1901  C  CB    . LYS A 1  278  ? -52.655 -42.714 -34.360 1.00 104.14 ? 278  LYS A CB    1 
ATOM   1902  C  CG    . LYS A 1  278  ? -52.532 -41.263 -33.921 1.00 104.34 ? 278  LYS A CG    1 
ATOM   1903  C  CD    . LYS A 1  278  ? -53.635 -40.863 -32.953 1.00 105.39 ? 278  LYS A CD    1 
ATOM   1904  C  CE    . LYS A 1  278  ? -53.478 -39.413 -32.521 1.00 105.54 ? 278  LYS A CE    1 
ATOM   1905  N  NZ    . LYS A 1  278  ? -54.628 -38.938 -31.704 1.00 105.82 ? 278  LYS A NZ    1 
ATOM   1906  N  N     . GLY A 1  279  ? -50.995 -45.244 -36.499 1.00 101.64 ? 279  GLY A N     1 
ATOM   1907  C  CA    . GLY A 1  279  ? -50.942 -46.674 -36.827 1.00 101.23 ? 279  GLY A CA    1 
ATOM   1908  C  C     . GLY A 1  279  ? -52.255 -47.434 -36.967 1.00 101.02 ? 279  GLY A C     1 
ATOM   1909  O  O     . GLY A 1  279  ? -52.271 -48.657 -36.805 1.00 102.56 ? 279  GLY A O     1 
ATOM   1910  N  N     . VAL A 1  280  ? -53.344 -46.728 -37.280 1.00 98.75  ? 280  VAL A N     1 
ATOM   1911  C  CA    . VAL A 1  280  ? -54.679 -47.340 -37.394 1.00 97.67  ? 280  VAL A CA    1 
ATOM   1912  C  C     . VAL A 1  280  ? -54.938 -47.734 -38.852 1.00 95.13  ? 280  VAL A C     1 
ATOM   1913  O  O     . VAL A 1  280  ? -54.458 -47.059 -39.775 1.00 95.77  ? 280  VAL A O     1 
ATOM   1914  C  CB    . VAL A 1  280  ? -55.797 -46.385 -36.904 1.00 98.01  ? 280  VAL A CB    1 
ATOM   1915  C  CG1   . VAL A 1  280  ? -57.145 -47.104 -36.848 1.00 99.13  ? 280  VAL A CG1   1 
ATOM   1916  C  CG2   . VAL A 1  280  ? -55.447 -45.803 -35.537 1.00 98.44  ? 280  VAL A CG2   1 
ATOM   1917  N  N     . PHE A 1  281  ? -55.686 -48.822 -39.052 1.00 90.25  ? 281  PHE A N     1 
ATOM   1918  C  CA    . PHE A 1  281  ? -56.042 -49.283 -40.396 1.00 85.60  ? 281  PHE A CA    1 
ATOM   1919  C  C     . PHE A 1  281  ? -57.447 -49.885 -40.446 1.00 84.38  ? 281  PHE A C     1 
ATOM   1920  O  O     . PHE A 1  281  ? -57.823 -50.668 -39.570 1.00 84.65  ? 281  PHE A O     1 
ATOM   1921  C  CB    . PHE A 1  281  ? -55.022 -50.300 -40.904 1.00 84.29  ? 281  PHE A CB    1 
ATOM   1922  C  CG    . PHE A 1  281  ? -55.331 -50.822 -42.276 1.00 83.38  ? 281  PHE A CG    1 
ATOM   1923  C  CD1   . PHE A 1  281  ? -55.146 -50.015 -43.394 1.00 81.85  ? 281  PHE A CD1   1 
ATOM   1924  C  CD2   . PHE A 1  281  ? -55.832 -52.109 -42.454 1.00 84.06  ? 281  PHE A CD2   1 
ATOM   1925  C  CE1   . PHE A 1  281  ? -55.443 -50.485 -44.664 1.00 81.55  ? 281  PHE A CE1   1 
ATOM   1926  C  CE2   . PHE A 1  281  ? -56.128 -52.585 -43.725 1.00 83.99  ? 281  PHE A CE2   1 
ATOM   1927  C  CZ    . PHE A 1  281  ? -55.932 -51.772 -44.832 1.00 82.56  ? 281  PHE A CZ    1 
ATOM   1928  N  N     . HIS A 1  282  ? -58.197 -49.521 -41.489 1.00 81.19  ? 282  HIS A N     1 
ATOM   1929  C  CA    . HIS A 1  282  ? -59.565 -49.992 -41.702 1.00 79.94  ? 282  HIS A CA    1 
ATOM   1930  C  C     . HIS A 1  282  ? -59.656 -50.727 -43.039 1.00 77.50  ? 282  HIS A C     1 
ATOM   1931  O  O     . HIS A 1  282  ? -59.531 -50.100 -44.090 1.00 76.30  ? 282  HIS A O     1 
ATOM   1932  C  CB    . HIS A 1  282  ? -60.539 -48.813 -41.702 1.00 79.76  ? 282  HIS A CB    1 
ATOM   1933  C  CG    . HIS A 1  282  ? -60.548 -48.041 -40.422 1.00 80.17  ? 282  HIS A CG    1 
ATOM   1934  N  ND1   . HIS A 1  282  ? -61.062 -48.552 -39.250 1.00 81.36  ? 282  HIS A ND1   1 
ATOM   1935  C  CD2   . HIS A 1  282  ? -60.109 -46.795 -40.130 1.00 79.85  ? 282  HIS A CD2   1 
ATOM   1936  C  CE1   . HIS A 1  282  ? -60.936 -47.655 -38.289 1.00 81.61  ? 282  HIS A CE1   1 
ATOM   1937  N  NE2   . HIS A 1  282  ? -60.362 -46.579 -38.797 1.00 80.95  ? 282  HIS A NE2   1 
ATOM   1938  N  N     . PRO A 1  283  ? -59.876 -52.057 -43.010 1.00 76.61  ? 283  PRO A N     1 
ATOM   1939  C  CA    . PRO A 1  283  ? -59.961 -52.804 -44.266 1.00 76.31  ? 283  PRO A CA    1 
ATOM   1940  C  C     . PRO A 1  283  ? -61.215 -52.483 -45.084 1.00 76.47  ? 283  PRO A C     1 
ATOM   1941  O  O     . PRO A 1  283  ? -61.164 -52.505 -46.310 1.00 76.19  ? 283  PRO A O     1 
ATOM   1942  C  CB    . PRO A 1  283  ? -59.972 -54.262 -43.804 1.00 77.60  ? 283  PRO A CB    1 
ATOM   1943  C  CG    . PRO A 1  283  ? -60.577 -54.218 -42.449 1.00 78.40  ? 283  PRO A CG    1 
ATOM   1944  C  CD    . PRO A 1  283  ? -60.134 -52.921 -41.843 1.00 77.65  ? 283  PRO A CD    1 
ATOM   1945  N  N     . VAL A 1  284  ? -62.326 -52.195 -44.410 1.00 77.04  ? 284  VAL A N     1 
ATOM   1946  C  CA    . VAL A 1  284  ? -63.569 -51.819 -45.076 1.00 77.41  ? 284  VAL A CA    1 
ATOM   1947  C  C     . VAL A 1  284  ? -63.929 -50.383 -44.689 1.00 75.66  ? 284  VAL A C     1 
ATOM   1948  O  O     . VAL A 1  284  ? -63.855 -50.024 -43.514 1.00 74.85  ? 284  VAL A O     1 
ATOM   1949  C  CB    . VAL A 1  284  ? -64.718 -52.785 -44.703 1.00 79.90  ? 284  VAL A CB    1 
ATOM   1950  C  CG1   . VAL A 1  284  ? -66.030 -52.358 -45.362 1.00 80.60  ? 284  VAL A CG1   1 
ATOM   1951  C  CG2   . VAL A 1  284  ? -64.355 -54.219 -45.087 1.00 80.43  ? 284  VAL A CG2   1 
ATOM   1952  N  N     . ILE A 1  285  ? -64.300 -49.575 -45.686 1.00 74.16  ? 285  ILE A N     1 
ATOM   1953  C  CA    . ILE A 1  285  ? -64.783 -48.208 -45.484 1.00 73.01  ? 285  ILE A CA    1 
ATOM   1954  C  C     . ILE A 1  285  ? -66.169 -48.091 -46.095 1.00 73.51  ? 285  ILE A C     1 
ATOM   1955  O  O     . ILE A 1  285  ? -66.388 -48.549 -47.214 1.00 73.48  ? 285  ILE A O     1 
ATOM   1956  C  CB    . ILE A 1  285  ? -63.869 -47.169 -46.173 1.00 72.17  ? 285  ILE A CB    1 
ATOM   1957  C  CG1   . ILE A 1  285  ? -62.441 -47.233 -45.614 1.00 71.90  ? 285  ILE A CG1   1 
ATOM   1958  C  CG2   . ILE A 1  285  ? -64.440 -45.756 -46.050 1.00 71.87  ? 285  ILE A CG2   1 
ATOM   1959  C  CD1   . ILE A 1  285  ? -62.324 -46.957 -44.127 1.00 72.39  ? 285  ILE A CD1   1 
ATOM   1960  N  N     . ILE A 1  286  ? -67.096 -47.478 -45.355 1.00 74.08  ? 286  ILE A N     1 
ATOM   1961  C  CA    . ILE A 1  286  ? -68.398 -47.062 -45.895 1.00 74.04  ? 286  ILE A CA    1 
ATOM   1962  C  C     . ILE A 1  286  ? -68.382 -45.535 -45.977 1.00 72.56  ? 286  ILE A C     1 
ATOM   1963  O  O     . ILE A 1  286  ? -68.040 -44.871 -45.004 1.00 71.59  ? 286  ILE A O     1 
ATOM   1964  C  CB    . ILE A 1  286  ? -69.577 -47.530 -45.017 1.00 75.32  ? 286  ILE A CB    1 
ATOM   1965  C  CG1   . ILE A 1  286  ? -69.530 -49.048 -44.794 1.00 76.09  ? 286  ILE A CG1   1 
ATOM   1966  C  CG2   . ILE A 1  286  ? -70.907 -47.130 -45.655 1.00 76.27  ? 286  ILE A CG2   1 
ATOM   1967  C  CD1   . ILE A 1  286  ? -70.300 -49.506 -43.574 1.00 77.26  ? 286  ILE A CD1   1 
ATOM   1968  N  N     . SER A 1  287  ? -68.732 -44.987 -47.136 1.00 72.33  ? 287  SER A N     1 
ATOM   1969  C  CA    . SER A 1  287  ? -68.609 -43.552 -47.387 1.00 72.02  ? 287  SER A CA    1 
ATOM   1970  C  C     . SER A 1  287  ? -69.781 -43.066 -48.222 1.00 73.09  ? 287  SER A C     1 
ATOM   1971  O  O     . SER A 1  287  ? -69.664 -42.958 -49.445 1.00 72.31  ? 287  SER A O     1 
ATOM   1972  C  CB    . SER A 1  287  ? -67.291 -43.250 -48.096 1.00 71.19  ? 287  SER A CB    1 
ATOM   1973  O  OG    . SER A 1  287  ? -67.173 -41.866 -48.376 1.00 71.08  ? 287  SER A OG    1 
ATOM   1974  N  N     . PRO A 1  288  ? -70.909 -42.750 -47.561 1.00 75.22  ? 288  PRO A N     1 
ATOM   1975  C  CA    . PRO A 1  288  ? -72.140 -42.473 -48.285 1.00 77.39  ? 288  PRO A CA    1 
ATOM   1976  C  C     . PRO A 1  288  ? -72.098 -41.165 -49.059 1.00 78.58  ? 288  PRO A C     1 
ATOM   1977  O  O     . PRO A 1  288  ? -71.306 -40.282 -48.734 1.00 76.64  ? 288  PRO A O     1 
ATOM   1978  C  CB    . PRO A 1  288  ? -73.183 -42.390 -47.170 1.00 78.07  ? 288  PRO A CB    1 
ATOM   1979  C  CG    . PRO A 1  288  ? -72.425 -41.864 -46.008 1.00 76.67  ? 288  PRO A CG    1 
ATOM   1980  C  CD    . PRO A 1  288  ? -71.058 -42.471 -46.119 1.00 75.68  ? 288  PRO A CD    1 
ATOM   1981  N  N     . ASP A 1  289  ? -72.956 -41.056 -50.071 1.00 82.83  ? 289  ASP A N     1 
ATOM   1982  C  CA    . ASP A 1  289  ? -73.092 -39.826 -50.851 1.00 85.86  ? 289  ASP A CA    1 
ATOM   1983  C  C     . ASP A 1  289  ? -74.103 -38.941 -50.133 1.00 88.94  ? 289  ASP A C     1 
ATOM   1984  O  O     . ASP A 1  289  ? -74.551 -39.284 -49.034 1.00 90.97  ? 289  ASP A O     1 
ATOM   1985  C  CB    . ASP A 1  289  ? -73.541 -40.134 -52.292 1.00 87.31  ? 289  ASP A CB    1 
ATOM   1986  C  CG    . ASP A 1  289  ? -72.711 -39.398 -53.348 1.00 87.23  ? 289  ASP A CG    1 
ATOM   1987  O  OD1   . ASP A 1  289  ? -72.096 -38.346 -53.047 1.00 85.23  ? 289  ASP A OD1   1 
ATOM   1988  O  OD2   . ASP A 1  289  ? -72.675 -39.893 -54.496 1.00 88.13  ? 289  ASP A OD2   1 
ATOM   1989  N  N     . ARG A 1  290  ? -74.461 -37.805 -50.727 1.00 91.57  ? 290  ARG A N     1 
ATOM   1990  C  CA    . ARG A 1  290  ? -75.421 -36.911 -50.087 1.00 94.46  ? 290  ARG A CA    1 
ATOM   1991  C  C     . ARG A 1  290  ? -76.769 -37.628 -49.981 1.00 95.26  ? 290  ARG A C     1 
ATOM   1992  O  O     . ARG A 1  290  ? -77.525 -37.698 -50.951 1.00 95.83  ? 290  ARG A O     1 
ATOM   1993  C  CB    . ARG A 1  290  ? -75.552 -35.575 -50.831 1.00 96.70  ? 290  ARG A CB    1 
ATOM   1994  C  CG    . ARG A 1  290  ? -76.233 -34.488 -50.004 1.00 99.13  ? 290  ARG A CG    1 
ATOM   1995  C  CD    . ARG A 1  290  ? -76.832 -33.382 -50.861 1.00 100.99 ? 290  ARG A CD    1 
ATOM   1996  N  NE    . ARG A 1  290  ? -77.581 -32.412 -50.053 1.00 102.97 ? 290  ARG A NE    1 
ATOM   1997  C  CZ    . ARG A 1  290  ? -77.055 -31.391 -49.360 1.00 102.84 ? 290  ARG A CZ    1 
ATOM   1998  N  NH1   . ARG A 1  290  ? -75.738 -31.158 -49.342 1.00 101.94 ? 290  ARG A NH1   1 
ATOM   1999  N  NH2   . ARG A 1  290  ? -77.862 -30.588 -48.668 1.00 103.13 ? 290  ARG A NH2   1 
ATOM   2000  N  N     . ILE A 1  291  ? -77.019 -38.206 -48.807 1.00 95.01  ? 291  ILE A N     1 
ATOM   2001  C  CA    . ILE A 1  291  ? -78.306 -38.817 -48.481 1.00 96.41  ? 291  ILE A CA    1 
ATOM   2002  C  C     . ILE A 1  291  ? -79.164 -37.727 -47.842 1.00 96.30  ? 291  ILE A C     1 
ATOM   2003  O  O     . ILE A 1  291  ? -78.767 -37.137 -46.839 1.00 95.81  ? 291  ILE A O     1 
ATOM   2004  C  CB    . ILE A 1  291  ? -78.133 -40.034 -47.544 1.00 96.77  ? 291  ILE A CB    1 
ATOM   2005  C  CG1   . ILE A 1  291  ? -77.416 -41.165 -48.293 1.00 96.55  ? 291  ILE A CG1   1 
ATOM   2006  C  CG2   . ILE A 1  291  ? -79.483 -40.533 -47.031 1.00 98.58  ? 291  ILE A CG2   1 
ATOM   2007  C  CD1   . ILE A 1  291  ? -76.851 -42.247 -47.400 1.00 96.99  ? 291  ILE A CD1   1 
ATOM   2008  N  N     . GLU A 1  292  ? -80.334 -37.474 -48.431 1.00 97.17  ? 292  GLU A N     1 
ATOM   2009  C  CA    . GLU A 1  292  ? -81.182 -36.332 -48.058 1.00 98.16  ? 292  GLU A CA    1 
ATOM   2010  C  C     . GLU A 1  292  ? -81.639 -36.357 -46.590 1.00 96.71  ? 292  GLU A C     1 
ATOM   2011  O  O     . GLU A 1  292  ? -81.787 -35.298 -45.978 1.00 96.87  ? 292  GLU A O     1 
ATOM   2012  C  CB    . GLU A 1  292  ? -82.395 -36.235 -49.008 1.00 101.13 ? 292  GLU A CB    1 
ATOM   2013  C  CG    . GLU A 1  292  ? -83.254 -34.970 -48.890 1.00 103.42 ? 292  GLU A CG    1 
ATOM   2014  C  CD    . GLU A 1  292  ? -82.517 -33.668 -49.212 1.00 103.70 ? 292  GLU A CD    1 
ATOM   2015  O  OE1   . GLU A 1  292  ? -81.492 -33.692 -49.938 1.00 102.36 ? 292  GLU A OE1   1 
ATOM   2016  O  OE2   . GLU A 1  292  ? -82.979 -32.605 -48.735 1.00 104.02 ? 292  GLU A OE2   1 
ATOM   2017  N  N     . GLU A 1  293  ? -81.833 -37.553 -46.028 1.00 94.57  ? 293  GLU A N     1 
ATOM   2018  C  CA    . GLU A 1  293  ? -82.197 -37.705 -44.607 1.00 93.12  ? 293  GLU A CA    1 
ATOM   2019  C  C     . GLU A 1  293  ? -81.091 -37.209 -43.663 1.00 90.90  ? 293  GLU A C     1 
ATOM   2020  O  O     . GLU A 1  293  ? -81.388 -36.665 -42.594 1.00 91.01  ? 293  GLU A O     1 
ATOM   2021  C  CB    . GLU A 1  293  ? -82.546 -39.164 -44.263 1.00 93.25  ? 293  GLU A CB    1 
ATOM   2022  C  CG    . GLU A 1  293  ? -83.910 -39.637 -44.758 1.00 94.44  ? 293  GLU A CG    1 
ATOM   2023  C  CD    . GLU A 1  293  ? -83.942 -40.050 -46.223 1.00 94.64  ? 293  GLU A CD    1 
ATOM   2024  O  OE1   . GLU A 1  293  ? -82.912 -39.936 -46.925 1.00 92.91  ? 293  GLU A OE1   1 
ATOM   2025  O  OE2   . GLU A 1  293  ? -85.016 -40.492 -46.682 1.00 96.37  ? 293  GLU A OE2   1 
ATOM   2026  N  N     . LEU A 1  294  ? -79.830 -37.398 -44.064 1.00 88.57  ? 294  LEU A N     1 
ATOM   2027  C  CA    . LEU A 1  294  ? -78.670 -36.919 -43.295 1.00 86.63  ? 294  LEU A CA    1 
ATOM   2028  C  C     . LEU A 1  294  ? -78.378 -35.420 -43.463 1.00 84.25  ? 294  LEU A C     1 
ATOM   2029  O  O     . LEU A 1  294  ? -77.523 -34.892 -42.754 1.00 82.52  ? 294  LEU A O     1 
ATOM   2030  C  CB    . LEU A 1  294  ? -77.405 -37.713 -43.667 1.00 86.20  ? 294  LEU A CB    1 
ATOM   2031  C  CG    . LEU A 1  294  ? -77.425 -39.245 -43.566 1.00 87.39  ? 294  LEU A CG    1 
ATOM   2032  C  CD1   . LEU A 1  294  ? -76.040 -39.805 -43.852 1.00 86.38  ? 294  LEU A CD1   1 
ATOM   2033  C  CD2   . LEU A 1  294  ? -77.915 -39.727 -42.209 1.00 88.39  ? 294  LEU A CD2   1 
ATOM   2034  N  N     . SER A 1  295  ? -79.053 -34.752 -44.403 1.00 83.92  ? 295  SER A N     1 
ATOM   2035  C  CA    . SER A 1  295  ? -78.887 -33.311 -44.642 1.00 83.07  ? 295  SER A CA    1 
ATOM   2036  C  C     . SER A 1  295  ? -80.079 -32.475 -44.158 1.00 82.91  ? 295  SER A C     1 
ATOM   2037  O  O     . SER A 1  295  ? -80.207 -31.307 -44.529 1.00 82.44  ? 295  SER A O     1 
ATOM   2038  C  CB    . SER A 1  295  ? -78.659 -33.062 -46.142 1.00 83.28  ? 295  SER A CB    1 
ATOM   2039  O  OG    . SER A 1  295  ? -77.495 -33.726 -46.606 1.00 82.76  ? 295  SER A OG    1 
ATOM   2040  N  N     . VAL A 1  296  ? -80.935 -33.056 -43.317 1.00 83.59  ? 296  VAL A N     1 
ATOM   2041  C  CA    . VAL A 1  296  ? -82.169 -32.395 -42.874 1.00 84.73  ? 296  VAL A CA    1 
ATOM   2042  C  C     . VAL A 1  296  ? -81.900 -31.152 -42.006 1.00 84.00  ? 296  VAL A C     1 
ATOM   2043  O  O     . VAL A 1  296  ? -80.994 -31.150 -41.165 1.00 82.28  ? 296  VAL A O     1 
ATOM   2044  C  CB    . VAL A 1  296  ? -83.119 -33.383 -42.133 1.00 86.07  ? 296  VAL A CB    1 
ATOM   2045  C  CG1   . VAL A 1  296  ? -82.581 -33.779 -40.757 1.00 85.71  ? 296  VAL A CG1   1 
ATOM   2046  C  CG2   . VAL A 1  296  ? -84.526 -32.802 -42.016 1.00 87.62  ? 296  VAL A CG2   1 
ATOM   2047  N  N     . VAL A 1  297  ? -82.676 -30.095 -42.264 1.00 84.58  ? 297  VAL A N     1 
ATOM   2048  C  CA    . VAL A 1  297  ? -82.706 -28.882 -41.442 1.00 84.69  ? 297  VAL A CA    1 
ATOM   2049  C  C     . VAL A 1  297  ? -84.177 -28.594 -41.136 1.00 87.37  ? 297  VAL A C     1 
ATOM   2050  O  O     . VAL A 1  297  ? -84.865 -27.905 -41.896 1.00 87.52  ? 297  VAL A O     1 
ATOM   2051  C  CB    . VAL A 1  297  ? -82.034 -27.673 -42.139 1.00 82.72  ? 297  VAL A CB    1 
ATOM   2052  C  CG1   . VAL A 1  297  ? -82.107 -26.428 -41.261 1.00 82.42  ? 297  VAL A CG1   1 
ATOM   2053  C  CG2   . VAL A 1  297  ? -80.586 -27.994 -42.478 1.00 81.37  ? 297  VAL A CG2   1 
ATOM   2054  N  N     . ASN A 1  298  ? -84.643 -29.156 -40.024 1.00 89.38  ? 298  ASN A N     1 
ATOM   2055  C  CA    . ASN A 1  298  ? -86.030 -29.056 -39.596 1.00 92.37  ? 298  ASN A CA    1 
ATOM   2056  C  C     . ASN A 1  298  ? -86.157 -28.039 -38.458 1.00 92.70  ? 298  ASN A C     1 
ATOM   2057  O  O     . ASN A 1  298  ? -85.592 -28.247 -37.386 1.00 91.40  ? 298  ASN A O     1 
ATOM   2058  C  CB    . ASN A 1  298  ? -86.521 -30.441 -39.152 1.00 93.94  ? 298  ASN A CB    1 
ATOM   2059  C  CG    . ASN A 1  298  ? -87.910 -30.410 -38.537 1.00 96.83  ? 298  ASN A CG    1 
ATOM   2060  O  OD1   . ASN A 1  298  ? -88.811 -29.731 -39.031 1.00 98.70  ? 298  ASN A OD1   1 
ATOM   2061  N  ND2   . ASN A 1  298  ? -88.088 -31.155 -37.452 1.00 97.94  ? 298  ASN A ND2   1 
ATOM   2062  N  N     . HIS A 1  299  ? -86.882 -26.945 -38.709 1.00 94.12  ? 299  HIS A N     1 
ATOM   2063  C  CA    . HIS A 1  299  ? -87.214 -25.951 -37.679 1.00 95.12  ? 299  HIS A CA    1 
ATOM   2064  C  C     . HIS A 1  299  ? -88.472 -26.407 -36.943 1.00 96.69  ? 299  HIS A C     1 
ATOM   2065  O  O     . HIS A 1  299  ? -89.594 -26.169 -37.400 1.00 98.25  ? 299  HIS A O     1 
ATOM   2066  C  CB    . HIS A 1  299  ? -87.432 -24.559 -38.293 1.00 95.64  ? 299  HIS A CB    1 
ATOM   2067  C  CG    . HIS A 1  299  ? -86.200 -23.962 -38.898 1.00 95.11  ? 299  HIS A CG    1 
ATOM   2068  N  ND1   . HIS A 1  299  ? -85.805 -24.220 -40.193 1.00 95.24  ? 299  HIS A ND1   1 
ATOM   2069  C  CD2   . HIS A 1  299  ? -85.277 -23.112 -38.387 1.00 94.75  ? 299  HIS A CD2   1 
ATOM   2070  C  CE1   . HIS A 1  299  ? -84.690 -23.562 -40.454 1.00 93.64  ? 299  HIS A CE1   1 
ATOM   2071  N  NE2   . HIS A 1  299  ? -84.348 -22.881 -39.374 1.00 94.09  ? 299  HIS A NE2   1 
ATOM   2072  N  N     . ALA A 1  300  ? -88.277 -27.061 -35.800 1.00 96.63  ? 300  ALA A N     1 
ATOM   2073  C  CA    . ALA A 1  300  ? -89.380 -27.620 -35.016 1.00 97.74  ? 300  ALA A CA    1 
ATOM   2074  C  C     . ALA A 1  300  ? -90.075 -26.551 -34.165 1.00 98.82  ? 300  ALA A C     1 
ATOM   2075  O  O     . ALA A 1  300  ? -89.712 -25.374 -34.195 1.00 98.51  ? 300  ALA A O     1 
ATOM   2076  C  CB    . ALA A 1  300  ? -88.869 -28.757 -34.136 1.00 97.33  ? 300  ALA A CB    1 
ATOM   2077  N  N     . TYR A 1  301  ? -91.089 -26.977 -33.419 1.00 100.55 ? 301  TYR A N     1 
ATOM   2078  C  CA    . TYR A 1  301  ? -91.785 -26.109 -32.471 1.00 101.56 ? 301  TYR A CA    1 
ATOM   2079  C  C     . TYR A 1  301  ? -90.924 -25.804 -31.243 1.00 100.81 ? 301  TYR A C     1 
ATOM   2080  O  O     . TYR A 1  301  ? -90.848 -24.654 -30.808 1.00 100.98 ? 301  TYR A O     1 
ATOM   2081  C  CB    . TYR A 1  301  ? -93.095 -26.766 -32.034 1.00 103.37 ? 301  TYR A CB    1 
ATOM   2082  C  CG    . TYR A 1  301  ? -93.901 -25.961 -31.046 1.00 104.61 ? 301  TYR A CG    1 
ATOM   2083  C  CD1   . TYR A 1  301  ? -94.779 -24.966 -31.481 1.00 105.62 ? 301  TYR A CD1   1 
ATOM   2084  C  CD2   . TYR A 1  301  ? -93.805 -26.206 -29.671 1.00 105.33 ? 301  TYR A CD2   1 
ATOM   2085  C  CE1   . TYR A 1  301  ? -95.538 -24.233 -30.576 1.00 107.49 ? 301  TYR A CE1   1 
ATOM   2086  C  CE2   . TYR A 1  301  ? -94.554 -25.473 -28.757 1.00 107.12 ? 301  TYR A CE2   1 
ATOM   2087  C  CZ    . TYR A 1  301  ? -95.420 -24.490 -29.213 1.00 107.94 ? 301  TYR A CZ    1 
ATOM   2088  O  OH    . TYR A 1  301  ? -96.163 -23.763 -28.314 1.00 109.28 ? 301  TYR A OH    1 
ATOM   2089  N  N     . ASN A 1  302  ? -90.298 -26.840 -30.683 1.00 100.03 ? 302  ASN A N     1 
ATOM   2090  C  CA    . ASN A 1  302  ? -89.493 -26.712 -29.463 1.00 99.59  ? 302  ASN A CA    1 
ATOM   2091  C  C     . ASN A 1  302  ? -87.973 -26.682 -29.702 1.00 96.57  ? 302  ASN A C     1 
ATOM   2092  O  O     . ASN A 1  302  ? -87.199 -26.784 -28.746 1.00 96.70  ? 302  ASN A O     1 
ATOM   2093  C  CB    . ASN A 1  302  ? -89.865 -27.829 -28.469 1.00 102.05 ? 302  ASN A CB    1 
ATOM   2094  C  CG    . ASN A 1  302  ? -89.335 -29.203 -28.877 1.00 103.10 ? 302  ASN A CG    1 
ATOM   2095  O  OD1   . ASN A 1  302  ? -89.137 -29.493 -30.062 1.00 103.47 ? 302  ASN A OD1   1 
ATOM   2096  N  ND2   . ASN A 1  302  ? -89.112 -30.058 -27.884 1.00 104.29 ? 302  ASN A ND2   1 
ATOM   2097  N  N     . GLY A 1  303  ? -87.546 -26.525 -30.957 1.00 93.41  ? 303  GLY A N     1 
ATOM   2098  C  CA    . GLY A 1  303  ? -86.122 -26.529 -31.291 1.00 90.30  ? 303  GLY A CA    1 
ATOM   2099  C  C     . GLY A 1  303  ? -85.856 -26.782 -32.760 1.00 88.68  ? 303  GLY A C     1 
ATOM   2100  O  O     . GLY A 1  303  ? -86.641 -26.378 -33.621 1.00 88.77  ? 303  GLY A O     1 
ATOM   2101  N  N     . LEU A 1  304  ? -84.734 -27.438 -33.046 1.00 86.41  ? 304  LEU A N     1 
ATOM   2102  C  CA    . LEU A 1  304  ? -84.427 -27.872 -34.403 1.00 84.97  ? 304  LEU A CA    1 
ATOM   2103  C  C     . LEU A 1  304  ? -83.610 -29.151 -34.449 1.00 83.10  ? 304  LEU A C     1 
ATOM   2104  O  O     . LEU A 1  304  ? -82.875 -29.476 -33.514 1.00 82.55  ? 304  LEU A O     1 
ATOM   2105  C  CB    . LEU A 1  304  ? -83.738 -26.764 -35.216 1.00 84.29  ? 304  LEU A CB    1 
ATOM   2106  C  CG    . LEU A 1  304  ? -82.653 -25.887 -34.597 1.00 83.56  ? 304  LEU A CG    1 
ATOM   2107  C  CD1   . LEU A 1  304  ? -81.563 -26.696 -33.914 1.00 83.53  ? 304  LEU A CD1   1 
ATOM   2108  C  CD2   . LEU A 1  304  ? -82.048 -25.002 -35.677 1.00 82.99  ? 304  LEU A CD2   1 
ATOM   2109  N  N     . THR A 1  305  ? -83.761 -29.857 -35.566 1.00 81.57  ? 305  THR A N     1 
ATOM   2110  C  CA    . THR A 1  305  ? -83.101 -31.116 -35.817 1.00 80.17  ? 305  THR A CA    1 
ATOM   2111  C  C     . THR A 1  305  ? -82.124 -30.889 -36.962 1.00 77.92  ? 305  THR A C     1 
ATOM   2112  O  O     . THR A 1  305  ? -82.543 -30.531 -38.068 1.00 77.88  ? 305  THR A O     1 
ATOM   2113  C  CB    . THR A 1  305  ? -84.132 -32.193 -36.207 1.00 81.66  ? 305  THR A CB    1 
ATOM   2114  O  OG1   . THR A 1  305  ? -85.144 -32.277 -35.193 1.00 83.06  ? 305  THR A OG1   1 
ATOM   2115  C  CG2   . THR A 1  305  ? -83.468 -33.554 -36.386 1.00 81.25  ? 305  THR A CG2   1 
ATOM   2116  N  N     . LEU A 1  306  ? -80.829 -31.069 -36.688 1.00 75.77  ? 306  LEU A N     1 
ATOM   2117  C  CA    . LEU A 1  306  ? -79.771 -30.887 -37.691 1.00 73.46  ? 306  LEU A CA    1 
ATOM   2118  C  C     . LEU A 1  306  ? -79.226 -32.237 -38.122 1.00 72.31  ? 306  LEU A C     1 
ATOM   2119  O  O     . LEU A 1  306  ? -78.847 -33.057 -37.281 1.00 71.86  ? 306  LEU A O     1 
ATOM   2120  C  CB    . LEU A 1  306  ? -78.635 -30.030 -37.133 1.00 72.13  ? 306  LEU A CB    1 
ATOM   2121  C  CG    . LEU A 1  306  ? -79.008 -28.617 -36.686 1.00 72.43  ? 306  LEU A CG    1 
ATOM   2122  C  CD1   . LEU A 1  306  ? -77.788 -27.949 -36.075 1.00 71.58  ? 306  LEU A CD1   1 
ATOM   2123  C  CD2   . LEU A 1  306  ? -79.561 -27.790 -37.839 1.00 72.42  ? 306  LEU A CD2   1 
ATOM   2124  N  N     . GLY A 1  307  ? -79.189 -32.460 -39.434 1.00 71.59  ? 307  GLY A N     1 
ATOM   2125  C  CA    . GLY A 1  307  ? -78.716 -33.714 -40.000 1.00 70.92  ? 307  GLY A CA    1 
ATOM   2126  C  C     . GLY A 1  307  ? -77.245 -33.991 -39.724 1.00 69.46  ? 307  GLY A C     1 
ATOM   2127  O  O     . GLY A 1  307  ? -76.426 -33.074 -39.638 1.00 68.19  ? 307  GLY A O     1 
ATOM   2128  N  N     . ALA A 1  308  ? -76.921 -35.273 -39.596 1.00 69.55  ? 308  ALA A N     1 
ATOM   2129  C  CA    . ALA A 1  308  ? -75.572 -35.715 -39.251 1.00 68.57  ? 308  ALA A CA    1 
ATOM   2130  C  C     . ALA A 1  308  ? -74.555 -35.456 -40.368 1.00 67.34  ? 308  ALA A C     1 
ATOM   2131  O  O     . ALA A 1  308  ? -73.360 -35.324 -40.096 1.00 66.33  ? 308  ALA A O     1 
ATOM   2132  C  CB    . ALA A 1  308  ? -75.598 -37.194 -38.893 1.00 69.22  ? 308  ALA A CB    1 
ATOM   2133  N  N     . GLY A 1  309  ? -75.034 -35.390 -41.611 1.00 67.47  ? 309  GLY A N     1 
ATOM   2134  C  CA    . GLY A 1  309  ? -74.194 -35.117 -42.775 1.00 66.41  ? 309  GLY A CA    1 
ATOM   2135  C  C     . GLY A 1  309  ? -73.910 -33.653 -43.071 1.00 65.84  ? 309  GLY A C     1 
ATOM   2136  O  O     . GLY A 1  309  ? -73.136 -33.355 -43.975 1.00 64.65  ? 309  GLY A O     1 
ATOM   2137  N  N     . LEU A 1  310  ? -74.534 -32.737 -42.332 1.00 67.08  ? 310  LEU A N     1 
ATOM   2138  C  CA    . LEU A 1  310  ? -74.260 -31.312 -42.493 1.00 66.71  ? 310  LEU A CA    1 
ATOM   2139  C  C     . LEU A 1  310  ? -72.840 -31.028 -42.035 1.00 65.43  ? 310  LEU A C     1 
ATOM   2140  O  O     . LEU A 1  310  ? -72.392 -31.570 -41.023 1.00 65.25  ? 310  LEU A O     1 
ATOM   2141  C  CB    . LEU A 1  310  ? -75.230 -30.461 -41.667 1.00 68.28  ? 310  LEU A CB    1 
ATOM   2142  C  CG    . LEU A 1  310  ? -76.718 -30.514 -42.025 1.00 69.97  ? 310  LEU A CG    1 
ATOM   2143  C  CD1   . LEU A 1  310  ? -77.552 -29.801 -40.966 1.00 70.81  ? 310  LEU A CD1   1 
ATOM   2144  C  CD2   . LEU A 1  310  ? -76.964 -29.911 -43.399 1.00 70.15  ? 310  LEU A CD2   1 
ATOM   2145  N  N     . SER A 1  311  ? -72.137 -30.184 -42.785 1.00 64.63  ? 311  SER A N     1 
ATOM   2146  C  CA    . SER A 1  311  ? -70.800 -29.749 -42.405 1.00 63.92  ? 311  SER A CA    1 
ATOM   2147  C  C     . SER A 1  311  ? -70.896 -28.746 -41.270 1.00 64.44  ? 311  SER A C     1 
ATOM   2148  O  O     . SER A 1  311  ? -71.935 -28.109 -41.088 1.00 65.82  ? 311  SER A O     1 
ATOM   2149  C  CB    . SER A 1  311  ? -70.063 -29.124 -43.594 1.00 63.40  ? 311  SER A CB    1 
ATOM   2150  O  OG    . SER A 1  311  ? -70.591 -27.852 -43.936 1.00 63.88  ? 311  SER A OG    1 
ATOM   2151  N  N     . LEU A 1  312  ? -69.809 -28.598 -40.521 1.00 63.94  ? 312  LEU A N     1 
ATOM   2152  C  CA    . LEU A 1  312  ? -69.751 -27.623 -39.429 1.00 64.88  ? 312  LEU A CA    1 
ATOM   2153  C  C     . LEU A 1  312  ? -69.950 -26.190 -39.944 1.00 65.98  ? 312  LEU A C     1 
ATOM   2154  O  O     . LEU A 1  312  ? -70.571 -25.367 -39.263 1.00 67.73  ? 312  LEU A O     1 
ATOM   2155  C  CB    . LEU A 1  312  ? -68.426 -27.724 -38.658 1.00 63.84  ? 312  LEU A CB    1 
ATOM   2156  C  CG    . LEU A 1  312  ? -68.063 -29.062 -38.003 1.00 63.65  ? 312  LEU A CG    1 
ATOM   2157  C  CD1   . LEU A 1  312  ? -66.773 -28.923 -37.210 1.00 63.33  ? 312  LEU A CD1   1 
ATOM   2158  C  CD2   . LEU A 1  312  ? -69.183 -29.578 -37.113 1.00 64.70  ? 312  LEU A CD2   1 
ATOM   2159  N  N     . ALA A 1  313  ? -69.435 -25.906 -41.141 1.00 65.96  ? 313  ALA A N     1 
ATOM   2160  C  CA    . ALA A 1  313  ? -69.619 -24.608 -41.793 1.00 66.33  ? 313  ALA A CA    1 
ATOM   2161  C  C     . ALA A 1  313  ? -71.092 -24.339 -42.122 1.00 68.02  ? 313  ALA A C     1 
ATOM   2162  O  O     . ALA A 1  313  ? -71.586 -23.229 -41.911 1.00 68.92  ? 313  ALA A O     1 
ATOM   2163  C  CB    . ALA A 1  313  ? -68.767 -24.520 -43.051 1.00 64.87  ? 313  ALA A CB    1 
ATOM   2164  N  N     . GLN A 1  314  ? -71.783 -25.356 -42.635 1.00 68.71  ? 314  GLN A N     1 
ATOM   2165  C  CA    . GLN A 1  314  ? -73.232 -25.275 -42.859 1.00 70.64  ? 314  GLN A CA    1 
ATOM   2166  C  C     . GLN A 1  314  ? -74.032 -25.057 -41.571 1.00 71.11  ? 314  GLN A C     1 
ATOM   2167  O  O     . GLN A 1  314  ? -75.017 -24.322 -41.577 1.00 71.86  ? 314  GLN A O     1 
ATOM   2168  C  CB    . GLN A 1  314  ? -73.751 -26.534 -43.558 1.00 72.05  ? 314  GLN A CB    1 
ATOM   2169  C  CG    . GLN A 1  314  ? -73.442 -26.589 -45.041 1.00 72.54  ? 314  GLN A CG    1 
ATOM   2170  C  CD    . GLN A 1  314  ? -73.885 -27.894 -45.664 1.00 74.34  ? 314  GLN A CD    1 
ATOM   2171  O  OE1   . GLN A 1  314  ? -73.690 -28.966 -45.092 1.00 74.88  ? 314  GLN A OE1   1 
ATOM   2172  N  NE2   . GLN A 1  314  ? -74.485 -27.812 -46.844 1.00 76.47  ? 314  GLN A NE2   1 
ATOM   2173  N  N     . VAL A 1  315  ? -73.618 -25.710 -40.487 1.00 70.83  ? 315  VAL A N     1 
ATOM   2174  C  CA    . VAL A 1  315  ? -74.275 -25.547 -39.187 1.00 71.45  ? 315  VAL A CA    1 
ATOM   2175  C  C     . VAL A 1  315  ? -74.100 -24.111 -38.715 1.00 71.62  ? 315  VAL A C     1 
ATOM   2176  O  O     . VAL A 1  315  ? -75.050 -23.502 -38.228 1.00 72.89  ? 315  VAL A O     1 
ATOM   2177  C  CB    . VAL A 1  315  ? -73.735 -26.546 -38.130 1.00 71.48  ? 315  VAL A CB    1 
ATOM   2178  C  CG1   . VAL A 1  315  ? -74.231 -26.209 -36.725 1.00 72.09  ? 315  VAL A CG1   1 
ATOM   2179  C  CG2   . VAL A 1  315  ? -74.141 -27.971 -38.492 1.00 72.19  ? 315  VAL A CG2   1 
ATOM   2180  N  N     . LYS A 1  316  ? -72.894 -23.573 -38.880 1.00 71.08  ? 316  LYS A N     1 
ATOM   2181  C  CA    . LYS A 1  316  ? -72.604 -22.188 -38.511 1.00 71.88  ? 316  LYS A CA    1 
ATOM   2182  C  C     . LYS A 1  316  ? -73.514 -21.196 -39.237 1.00 71.87  ? 316  LYS A C     1 
ATOM   2183  O  O     . LYS A 1  316  ? -73.969 -20.225 -38.634 1.00 73.19  ? 316  LYS A O     1 
ATOM   2184  C  CB    . LYS A 1  316  ? -71.136 -21.852 -38.782 1.00 72.15  ? 316  LYS A CB    1 
ATOM   2185  C  CG    . LYS A 1  316  ? -70.688 -20.521 -38.206 1.00 73.85  ? 316  LYS A CG    1 
ATOM   2186  C  CD    . LYS A 1  316  ? -69.215 -20.282 -38.474 1.00 74.21  ? 316  LYS A CD    1 
ATOM   2187  C  CE    . LYS A 1  316  ? -68.832 -18.835 -38.218 1.00 75.71  ? 316  LYS A CE    1 
ATOM   2188  N  NZ    . LYS A 1  316  ? -67.481 -18.551 -38.774 1.00 75.94  ? 316  LYS A NZ    1 
ATOM   2189  N  N     . ASP A 1  317  ? -73.784 -21.451 -40.517 1.00 70.91  ? 317  ASP A N     1 
ATOM   2190  C  CA    . ASP A 1  317  ? -74.716 -20.628 -41.300 1.00 71.48  ? 317  ASP A CA    1 
ATOM   2191  C  C     . ASP A 1  317  ? -76.167 -20.754 -40.831 1.00 71.99  ? 317  ASP A C     1 
ATOM   2192  O  O     . ASP A 1  317  ? -76.860 -19.745 -40.689 1.00 72.11  ? 317  ASP A O     1 
ATOM   2193  C  CB    . ASP A 1  317  ? -74.642 -20.989 -42.788 1.00 71.03  ? 317  ASP A CB    1 
ATOM   2194  C  CG    . ASP A 1  317  ? -73.330 -20.591 -43.423 1.00 70.52  ? 317  ASP A CG    1 
ATOM   2195  O  OD1   . ASP A 1  317  ? -72.658 -19.681 -42.897 1.00 70.84  ? 317  ASP A OD1   1 
ATOM   2196  O  OD2   . ASP A 1  317  ? -72.975 -21.185 -44.464 1.00 70.95  ? 317  ASP A OD2   1 
ATOM   2197  N  N     . ILE A 1  318  ? -76.606 -21.994 -40.613 1.00 71.46  ? 318  ILE A N     1 
ATOM   2198  C  CA    . ILE A 1  318  ? -77.962 -22.301 -40.141 1.00 72.74  ? 318  ILE A CA    1 
ATOM   2199  C  C     . ILE A 1  318  ? -78.229 -21.647 -38.782 1.00 74.33  ? 318  ILE A C     1 
ATOM   2200  O  O     . ILE A 1  318  ? -79.283 -21.041 -38.579 1.00 74.81  ? 318  ILE A O     1 
ATOM   2201  C  CB    . ILE A 1  318  ? -78.187 -23.833 -40.045 1.00 72.44  ? 318  ILE A CB    1 
ATOM   2202  C  CG1   . ILE A 1  318  ? -78.214 -24.465 -41.443 1.00 71.89  ? 318  ILE A CG1   1 
ATOM   2203  C  CG2   . ILE A 1  318  ? -79.483 -24.172 -39.314 1.00 73.75  ? 318  ILE A CG2   1 
ATOM   2204  C  CD1   . ILE A 1  318  ? -77.820 -25.927 -41.459 1.00 71.15  ? 318  ILE A CD1   1 
ATOM   2205  N  N     . LEU A 1  319  ? -77.270 -21.774 -37.865 1.00 74.91  ? 319  LEU A N     1 
ATOM   2206  C  CA    . LEU A 1  319  ? -77.410 -21.233 -36.509 1.00 76.44  ? 319  LEU A CA    1 
ATOM   2207  C  C     . LEU A 1  319  ? -77.260 -19.704 -36.461 1.00 77.46  ? 319  LEU A C     1 
ATOM   2208  O  O     . LEU A 1  319  ? -77.918 -19.044 -35.655 1.00 78.10  ? 319  LEU A O     1 
ATOM   2209  C  CB    . LEU A 1  319  ? -76.422 -21.908 -35.544 1.00 75.67  ? 319  LEU A CB    1 
ATOM   2210  C  CG    . LEU A 1  319  ? -76.560 -23.400 -35.216 1.00 75.67  ? 319  LEU A CG    1 
ATOM   2211  C  CD1   . LEU A 1  319  ? -75.521 -23.792 -34.172 1.00 75.02  ? 319  LEU A CD1   1 
ATOM   2212  C  CD2   . LEU A 1  319  ? -77.957 -23.760 -34.737 1.00 77.14  ? 319  LEU A CD2   1 
ATOM   2213  N  N     . ALA A 1  320  ? -76.400 -19.144 -37.310 1.00 77.77  ? 320  ALA A N     1 
ATOM   2214  C  CA    . ALA A 1  320  ? -76.268 -17.681 -37.421 1.00 78.64  ? 320  ALA A CA    1 
ATOM   2215  C  C     . ALA A 1  320  ? -77.530 -17.037 -37.997 1.00 80.39  ? 320  ALA A C     1 
ATOM   2216  O  O     . ALA A 1  320  ? -77.838 -15.883 -37.695 1.00 80.90  ? 320  ALA A O     1 
ATOM   2217  C  CB    . ALA A 1  320  ? -75.059 -17.310 -38.267 1.00 77.49  ? 320  ALA A CB    1 
ATOM   2218  N  N     . ASP A 1  321  ? -78.243 -17.790 -38.835 1.00 81.72  ? 321  ASP A N     1 
ATOM   2219  C  CA    . ASP A 1  321  ? -79.506 -17.350 -39.406 1.00 83.97  ? 321  ASP A CA    1 
ATOM   2220  C  C     . ASP A 1  321  ? -80.596 -17.275 -38.327 1.00 85.77  ? 321  ASP A C     1 
ATOM   2221  O  O     . ASP A 1  321  ? -81.250 -16.236 -38.185 1.00 86.30  ? 321  ASP A O     1 
ATOM   2222  C  CB    . ASP A 1  321  ? -79.928 -18.283 -40.552 1.00 84.76  ? 321  ASP A CB    1 
ATOM   2223  C  CG    . ASP A 1  321  ? -81.218 -17.839 -41.231 1.00 87.52  ? 321  ASP A CG    1 
ATOM   2224  O  OD1   . ASP A 1  321  ? -81.276 -16.687 -41.709 1.00 88.79  ? 321  ASP A OD1   1 
ATOM   2225  O  OD2   . ASP A 1  321  ? -82.175 -18.644 -41.287 1.00 88.65  ? 321  ASP A OD2   1 
ATOM   2226  N  N     . VAL A 1  322  ? -80.776 -18.356 -37.562 1.00 85.79  ? 322  VAL A N     1 
ATOM   2227  C  CA    . VAL A 1  322  ? -81.875 -18.424 -36.581 1.00 87.60  ? 322  VAL A CA    1 
ATOM   2228  C  C     . VAL A 1  322  ? -81.703 -17.462 -35.399 1.00 88.68  ? 322  VAL A C     1 
ATOM   2229  O  O     . VAL A 1  322  ? -82.682 -16.857 -34.959 1.00 90.79  ? 322  VAL A O     1 
ATOM   2230  C  CB    . VAL A 1  322  ? -82.165 -19.863 -36.068 1.00 87.64  ? 322  VAL A CB    1 
ATOM   2231  C  CG1   . VAL A 1  322  ? -82.428 -20.814 -37.235 1.00 87.75  ? 322  VAL A CG1   1 
ATOM   2232  C  CG2   . VAL A 1  322  ? -81.055 -20.383 -35.160 1.00 86.58  ? 322  VAL A CG2   1 
ATOM   2233  N  N     . VAL A 1  323  ? -80.475 -17.299 -34.906 1.00 87.98  ? 323  VAL A N     1 
ATOM   2234  C  CA    . VAL A 1  323  ? -80.201 -16.337 -33.820 1.00 88.63  ? 323  VAL A CA    1 
ATOM   2235  C  C     . VAL A 1  323  ? -80.505 -14.880 -34.203 1.00 90.77  ? 323  VAL A C     1 
ATOM   2236  O  O     . VAL A 1  323  ? -80.808 -14.064 -33.330 1.00 92.11  ? 323  VAL A O     1 
ATOM   2237  C  CB    . VAL A 1  323  ? -78.752 -16.430 -33.267 1.00 86.49  ? 323  VAL A CB    1 
ATOM   2238  C  CG1   . VAL A 1  323  ? -78.466 -17.826 -32.710 1.00 85.57  ? 323  VAL A CG1   1 
ATOM   2239  C  CG2   . VAL A 1  323  ? -77.718 -16.005 -34.307 1.00 85.64  ? 323  VAL A CG2   1 
ATOM   2240  N  N     . GLN A 1  324  ? -80.417 -14.563 -35.495 1.00 92.06  ? 324  GLN A N     1 
ATOM   2241  C  CA    . GLN A 1  324  ? -80.755 -13.230 -35.999 1.00 94.16  ? 324  GLN A CA    1 
ATOM   2242  C  C     . GLN A 1  324  ? -82.266 -13.011 -36.183 1.00 95.38  ? 324  GLN A C     1 
ATOM   2243  O  O     . GLN A 1  324  ? -82.715 -11.866 -36.134 1.00 96.62  ? 324  GLN A O     1 
ATOM   2244  C  CB    . GLN A 1  324  ? -80.016 -12.966 -37.318 1.00 94.90  ? 324  GLN A CB    1 
ATOM   2245  C  CG    . GLN A 1  324  ? -79.938 -11.499 -37.722 1.00 96.78  ? 324  GLN A CG    1 
ATOM   2246  C  CD    . GLN A 1  324  ? -79.033 -11.277 -38.926 1.00 97.56  ? 324  GLN A CD    1 
ATOM   2247  O  OE1   . GLN A 1  324  ? -77.816 -11.464 -38.850 1.00 96.45  ? 324  GLN A OE1   1 
ATOM   2248  N  NE2   . GLN A 1  324  ? -79.626 -10.875 -40.047 1.00 98.68  ? 324  GLN A NE2   1 
ATOM   2249  N  N     . LYS A 1  325  ? -83.040 -14.084 -36.393 1.00 95.47  ? 325  LYS A N     1 
ATOM   2250  C  CA    . LYS A 1  325  ? -84.499 -13.981 -36.609 1.00 97.61  ? 325  LYS A CA    1 
ATOM   2251  C  C     . LYS A 1  325  ? -85.413 -14.539 -35.496 1.00 98.87  ? 325  LYS A C     1 
ATOM   2252  O  O     . LYS A 1  325  ? -86.632 -14.357 -35.574 1.00 99.74  ? 325  LYS A O     1 
ATOM   2253  C  CB    . LYS A 1  325  ? -84.889 -14.588 -37.966 1.00 98.50  ? 325  LYS A CB    1 
ATOM   2254  C  CG    . LYS A 1  325  ? -84.838 -16.112 -38.075 1.00 98.61  ? 325  LYS A CG    1 
ATOM   2255  C  CD    . LYS A 1  325  ? -85.677 -16.639 -39.243 1.00 100.00 ? 325  LYS A CD    1 
ATOM   2256  C  CE    . LYS A 1  325  ? -84.928 -16.631 -40.574 1.00 99.41  ? 325  LYS A CE    1 
ATOM   2257  N  NZ    . LYS A 1  325  ? -84.603 -15.274 -41.097 1.00 99.13  ? 325  LYS A NZ    1 
ATOM   2258  N  N     . LEU A 1  326  ? -84.849 -15.219 -34.491 1.00 98.12  ? 326  LEU A N     1 
ATOM   2259  C  CA    . LEU A 1  326  ? -85.604 -15.628 -33.286 1.00 98.34  ? 326  LEU A CA    1 
ATOM   2260  C  C     . LEU A 1  326  ? -85.225 -14.757 -32.081 1.00 98.11  ? 326  LEU A C     1 
ATOM   2261  O  O     . LEU A 1  326  ? -84.160 -14.127 -32.088 1.00 96.98  ? 326  LEU A O     1 
ATOM   2262  C  CB    . LEU A 1  326  ? -85.377 -17.112 -32.952 1.00 97.85  ? 326  LEU A CB    1 
ATOM   2263  C  CG    . LEU A 1  326  ? -86.448 -18.085 -33.445 1.00 98.44  ? 326  LEU A CG    1 
ATOM   2264  C  CD1   . LEU A 1  326  ? -86.563 -18.047 -34.962 1.00 98.51  ? 326  LEU A CD1   1 
ATOM   2265  C  CD2   . LEU A 1  326  ? -86.144 -19.493 -32.951 1.00 97.35  ? 326  LEU A CD2   1 
ATOM   2266  N  N     . PRO A 1  327  ? -86.093 -14.720 -31.039 1.00 98.77  ? 327  PRO A N     1 
ATOM   2267  C  CA    . PRO A 1  327  ? -85.760 -13.978 -29.814 1.00 98.56  ? 327  PRO A CA    1 
ATOM   2268  C  C     . PRO A 1  327  ? -84.630 -14.636 -29.016 1.00 97.54  ? 327  PRO A C     1 
ATOM   2269  O  O     . PRO A 1  327  ? -84.481 -15.858 -29.052 1.00 96.36  ? 327  PRO A O     1 
ATOM   2270  C  CB    . PRO A 1  327  ? -87.076 -13.982 -29.024 1.00 100.14 ? 327  PRO A CB    1 
ATOM   2271  C  CG    . PRO A 1  327  ? -87.839 -15.148 -29.535 1.00 100.53 ? 327  PRO A CG    1 
ATOM   2272  C  CD    . PRO A 1  327  ? -87.444 -15.314 -30.972 1.00 99.83  ? 327  PRO A CD    1 
ATOM   2273  N  N     . GLU A 1  328  ? -83.858 -13.820 -28.299 1.00 98.18  ? 328  GLU A N     1 
ATOM   2274  C  CA    . GLU A 1  328  ? -82.636 -14.274 -27.601 1.00 98.30  ? 328  GLU A CA    1 
ATOM   2275  C  C     . GLU A 1  328  ? -82.886 -15.327 -26.516 1.00 97.09  ? 328  GLU A C     1 
ATOM   2276  O  O     . GLU A 1  328  ? -82.012 -16.142 -26.216 1.00 96.41  ? 328  GLU A O     1 
ATOM   2277  C  CB    . GLU A 1  328  ? -81.906 -13.084 -26.973 1.00 100.15 ? 328  GLU A CB    1 
ATOM   2278  C  CG    . GLU A 1  328  ? -81.341 -12.094 -27.975 1.00 101.12 ? 328  GLU A CG    1 
ATOM   2279  C  CD    . GLU A 1  328  ? -80.720 -10.890 -27.296 1.00 102.77 ? 328  GLU A CD    1 
ATOM   2280  O  OE1   . GLU A 1  328  ? -79.602 -11.025 -26.751 1.00 103.22 ? 328  GLU A OE1   1 
ATOM   2281  O  OE2   . GLU A 1  328  ? -81.350 -9.810  -27.307 1.00 104.17 ? 328  GLU A OE2   1 
ATOM   2282  N  N     . GLU A 1  329  ? -84.075 -15.280 -25.929 1.00 97.22  ? 329  GLU A N     1 
ATOM   2283  C  CA    . GLU A 1  329  ? -84.520 -16.229 -24.907 1.00 97.03  ? 329  GLU A CA    1 
ATOM   2284  C  C     . GLU A 1  329  ? -84.521 -17.692 -25.376 1.00 95.80  ? 329  GLU A C     1 
ATOM   2285  O  O     . GLU A 1  329  ? -84.277 -18.591 -24.569 1.00 94.96  ? 329  GLU A O     1 
ATOM   2286  C  CB    . GLU A 1  329  ? -85.928 -15.827 -24.458 1.00 98.53  ? 329  GLU A CB    1 
ATOM   2287  C  CG    . GLU A 1  329  ? -86.516 -16.592 -23.290 1.00 99.10  ? 329  GLU A CG    1 
ATOM   2288  C  CD    . GLU A 1  329  ? -87.979 -16.264 -23.106 1.00 100.00 ? 329  GLU A CD    1 
ATOM   2289  O  OE1   . GLU A 1  329  ? -88.278 -15.158 -22.607 1.00 100.37 ? 329  GLU A OE1   1 
ATOM   2290  O  OE2   . GLU A 1  329  ? -88.821 -17.106 -23.479 1.00 99.61  ? 329  GLU A OE2   1 
ATOM   2291  N  N     . LYS A 1  330  ? -84.810 -17.915 -26.662 1.00 95.03  ? 330  LYS A N     1 
ATOM   2292  C  CA    . LYS A 1  330  ? -84.861 -19.263 -27.262 1.00 94.26  ? 330  LYS A CA    1 
ATOM   2293  C  C     . LYS A 1  330  ? -83.562 -19.709 -27.958 1.00 91.64  ? 330  LYS A C     1 
ATOM   2294  O  O     . LYS A 1  330  ? -83.341 -20.912 -28.125 1.00 91.46  ? 330  LYS A O     1 
ATOM   2295  C  CB    . LYS A 1  330  ? -86.027 -19.368 -28.261 1.00 95.50  ? 330  LYS A CB    1 
ATOM   2296  C  CG    . LYS A 1  330  ? -87.401 -19.514 -27.616 1.00 97.77  ? 330  LYS A CG    1 
ATOM   2297  C  CD    . LYS A 1  330  ? -88.484 -19.836 -28.644 1.00 98.57  ? 330  LYS A CD    1 
ATOM   2298  C  CE    . LYS A 1  330  ? -89.725 -20.440 -27.995 1.00 99.91  ? 330  LYS A CE    1 
ATOM   2299  N  NZ    . LYS A 1  330  ? -90.373 -19.513 -27.026 1.00 100.88 ? 330  LYS A NZ    1 
ATOM   2300  N  N     . THR A 1  331  ? -82.707 -18.757 -28.344 1.00 89.61  ? 331  THR A N     1 
ATOM   2301  C  CA    . THR A 1  331  ? -81.502 -19.045 -29.135 1.00 86.72  ? 331  THR A CA    1 
ATOM   2302  C  C     . THR A 1  331  ? -80.247 -19.117 -28.263 1.00 85.42  ? 331  THR A C     1 
ATOM   2303  O  O     . THR A 1  331  ? -79.170 -18.701 -28.689 1.00 84.68  ? 331  THR A O     1 
ATOM   2304  C  CB    . THR A 1  331  ? -81.281 -17.966 -30.220 1.00 86.06  ? 331  THR A CB    1 
ATOM   2305  O  OG1   . THR A 1  331  ? -80.986 -16.702 -29.602 1.00 85.57  ? 331  THR A OG1   1 
ATOM   2306  C  CG2   . THR A 1  331  ? -82.505 -17.831 -31.129 1.00 87.25  ? 331  THR A CG2   1 
ATOM   2307  N  N     . GLN A 1  332  ? -80.374 -19.664 -27.056 1.00 84.92  ? 332  GLN A N     1 
ATOM   2308  C  CA    . GLN A 1  332  ? -79.285 -19.627 -26.082 1.00 83.38  ? 332  GLN A CA    1 
ATOM   2309  C  C     . GLN A 1  332  ? -78.206 -20.664 -26.410 1.00 81.90  ? 332  GLN A C     1 
ATOM   2310  O  O     . GLN A 1  332  ? -77.014 -20.344 -26.394 1.00 81.44  ? 332  GLN A O     1 
ATOM   2311  C  CB    . GLN A 1  332  ? -79.828 -19.837 -24.668 1.00 83.64  ? 332  GLN A CB    1 
ATOM   2312  C  CG    . GLN A 1  332  ? -78.926 -19.303 -23.571 1.00 82.60  ? 332  GLN A CG    1 
ATOM   2313  C  CD    . GLN A 1  332  ? -79.081 -17.822 -23.295 1.00 82.15  ? 332  GLN A CD    1 
ATOM   2314  O  OE1   . GLN A 1  332  ? -80.154 -17.242 -23.476 1.00 82.78  ? 332  GLN A OE1   1 
ATOM   2315  N  NE2   . GLN A 1  332  ? -78.001 -17.201 -22.836 1.00 81.21  ? 332  GLN A NE2   1 
ATOM   2316  N  N     . MET A 1  333  ? -78.632 -21.898 -26.685 1.00 81.60  ? 333  MET A N     1 
ATOM   2317  C  CA    . MET A 1  333  ? -77.722 -22.972 -27.116 1.00 79.86  ? 333  MET A CA    1 
ATOM   2318  C  C     . MET A 1  333  ? -77.038 -22.668 -28.440 1.00 77.72  ? 333  MET A C     1 
ATOM   2319  O  O     . MET A 1  333  ? -75.881 -23.032 -28.631 1.00 77.32  ? 333  MET A O     1 
ATOM   2320  C  CB    . MET A 1  333  ? -78.463 -24.311 -27.251 1.00 80.85  ? 333  MET A CB    1 
ATOM   2321  C  CG    . MET A 1  333  ? -78.631 -25.069 -25.946 1.00 82.08  ? 333  MET A CG    1 
ATOM   2322  S  SD    . MET A 1  333  ? -77.074 -25.729 -25.318 1.00 81.79  ? 333  MET A SD    1 
ATOM   2323  C  CE    . MET A 1  333  ? -76.689 -26.966 -26.556 1.00 80.36  ? 333  MET A CE    1 
ATOM   2324  N  N     . TYR A 1  334  ? -77.753 -22.004 -29.345 1.00 77.26  ? 334  TYR A N     1 
ATOM   2325  C  CA    . TYR A 1  334  ? -77.230 -21.716 -30.684 1.00 75.91  ? 334  TYR A CA    1 
ATOM   2326  C  C     . TYR A 1  334  ? -76.165 -20.623 -30.667 1.00 75.76  ? 334  TYR A C     1 
ATOM   2327  O  O     . TYR A 1  334  ? -75.325 -20.597 -31.558 1.00 75.53  ? 334  TYR A O     1 
ATOM   2328  C  CB    . TYR A 1  334  ? -78.352 -21.354 -31.673 1.00 76.13  ? 334  TYR A CB    1 
ATOM   2329  C  CG    . TYR A 1  334  ? -79.563 -22.273 -31.615 1.00 76.94  ? 334  TYR A CG    1 
ATOM   2330  C  CD1   . TYR A 1  334  ? -79.419 -23.660 -31.505 1.00 76.72  ? 334  TYR A CD1   1 
ATOM   2331  C  CD2   . TYR A 1  334  ? -80.856 -21.754 -31.660 1.00 77.89  ? 334  TYR A CD2   1 
ATOM   2332  C  CE1   . TYR A 1  334  ? -80.525 -24.491 -31.438 1.00 77.30  ? 334  TYR A CE1   1 
ATOM   2333  C  CE2   . TYR A 1  334  ? -81.963 -22.580 -31.597 1.00 78.52  ? 334  TYR A CE2   1 
ATOM   2334  C  CZ    . TYR A 1  334  ? -81.792 -23.945 -31.484 1.00 78.44  ? 334  TYR A CZ    1 
ATOM   2335  O  OH    . TYR A 1  334  ? -82.884 -24.771 -31.415 1.00 80.12  ? 334  TYR A OH    1 
ATOM   2336  N  N     . HIS A 1  335  ? -76.203 -19.725 -29.678 1.00 77.14  ? 335  HIS A N     1 
ATOM   2337  C  CA    . HIS A 1  335  ? -75.124 -18.740 -29.476 1.00 77.46  ? 335  HIS A CA    1 
ATOM   2338  C  C     . HIS A 1  335  ? -73.821 -19.417 -29.053 1.00 75.18  ? 335  HIS A C     1 
ATOM   2339  O  O     . HIS A 1  335  ? -72.756 -19.097 -29.579 1.00 73.55  ? 335  HIS A O     1 
ATOM   2340  C  CB    . HIS A 1  335  ? -75.490 -17.688 -28.412 1.00 80.49  ? 335  HIS A CB    1 
ATOM   2341  C  CG    . HIS A 1  335  ? -76.427 -16.622 -28.890 1.00 83.01  ? 335  HIS A CG    1 
ATOM   2342  N  ND1   . HIS A 1  335  ? -76.236 -15.931 -30.068 1.00 83.11  ? 335  HIS A ND1   1 
ATOM   2343  C  CD2   . HIS A 1  335  ? -77.541 -16.095 -28.322 1.00 86.06  ? 335  HIS A CD2   1 
ATOM   2344  C  CE1   . HIS A 1  335  ? -77.206 -15.046 -30.219 1.00 84.83  ? 335  HIS A CE1   1 
ATOM   2345  N  NE2   . HIS A 1  335  ? -78.011 -15.126 -29.175 1.00 86.61  ? 335  HIS A NE2   1 
ATOM   2346  N  N     . ALA A 1  336  ? -73.921 -20.329 -28.085 1.00 74.77  ? 336  ALA A N     1 
ATOM   2347  C  CA    . ALA A 1  336  ? -72.760 -21.048 -27.548 1.00 73.81  ? 336  ALA A CA    1 
ATOM   2348  C  C     . ALA A 1  336  ? -72.050 -21.885 -28.612 1.00 72.73  ? 336  ALA A C     1 
ATOM   2349  O  O     . ALA A 1  336  ? -70.818 -21.873 -28.694 1.00 71.34  ? 336  ALA A O     1 
ATOM   2350  C  CB    . ALA A 1  336  ? -73.177 -21.929 -26.379 1.00 74.30  ? 336  ALA A CB    1 
ATOM   2351  N  N     . LEU A 1  337  ? -72.830 -22.598 -29.424 1.00 72.76  ? 337  LEU A N     1 
ATOM   2352  C  CA    . LEU A 1  337  ? -72.285 -23.356 -30.554 1.00 72.25  ? 337  LEU A CA    1 
ATOM   2353  C  C     . LEU A 1  337  ? -71.647 -22.432 -31.606 1.00 71.06  ? 337  LEU A C     1 
ATOM   2354  O  O     . LEU A 1  337  ? -70.548 -22.719 -32.079 1.00 70.77  ? 337  LEU A O     1 
ATOM   2355  C  CB    . LEU A 1  337  ? -73.365 -24.242 -31.196 1.00 72.88  ? 337  LEU A CB    1 
ATOM   2356  C  CG    . LEU A 1  337  ? -73.925 -25.372 -30.319 1.00 73.68  ? 337  LEU A CG    1 
ATOM   2357  C  CD1   . LEU A 1  337  ? -75.195 -25.960 -30.920 1.00 74.31  ? 337  LEU A CD1   1 
ATOM   2358  C  CD2   . LEU A 1  337  ? -72.893 -26.467 -30.092 1.00 73.12  ? 337  LEU A CD2   1 
ATOM   2359  N  N     . LEU A 1  338  ? -72.330 -21.336 -31.955 1.00 70.73  ? 338  LEU A N     1 
ATOM   2360  C  CA    . LEU A 1  338  ? -71.774 -20.297 -32.859 1.00 70.18  ? 338  LEU A CA    1 
ATOM   2361  C  C     . LEU A 1  338  ? -70.405 -19.792 -32.441 1.00 68.97  ? 338  LEU A C     1 
ATOM   2362  O  O     . LEU A 1  338  ? -69.511 -19.655 -33.276 1.00 67.33  ? 338  LEU A O     1 
ATOM   2363  C  CB    . LEU A 1  338  ? -72.692 -19.064 -32.967 1.00 71.45  ? 338  LEU A CB    1 
ATOM   2364  C  CG    . LEU A 1  338  ? -73.224 -18.744 -34.360 1.00 71.94  ? 338  LEU A CG    1 
ATOM   2365  C  CD1   . LEU A 1  338  ? -74.325 -19.711 -34.723 1.00 72.82  ? 338  LEU A CD1   1 
ATOM   2366  C  CD2   . LEU A 1  338  ? -73.736 -17.312 -34.439 1.00 73.12  ? 338  LEU A CD2   1 
ATOM   2367  N  N     . LYS A 1  339  ? -70.285 -19.478 -31.153 1.00 69.79  ? 339  LYS A N     1 
ATOM   2368  C  CA    . LYS A 1  339  ? -69.068 -18.924 -30.568 1.00 69.85  ? 339  LYS A CA    1 
ATOM   2369  C  C     . LYS A 1  339  ? -67.878 -19.855 -30.793 1.00 68.98  ? 339  LYS A C     1 
ATOM   2370  O  O     . LYS A 1  339  ? -66.832 -19.428 -31.286 1.00 68.70  ? 339  LYS A O     1 
ATOM   2371  C  CB    . LYS A 1  339  ? -69.280 -18.679 -29.070 1.00 71.19  ? 339  LYS A CB    1 
ATOM   2372  C  CG    . LYS A 1  339  ? -68.131 -17.984 -28.360 1.00 71.75  ? 339  LYS A CG    1 
ATOM   2373  C  CD    . LYS A 1  339  ? -68.437 -17.805 -26.882 1.00 73.47  ? 339  LYS A CD    1 
ATOM   2374  C  CE    . LYS A 1  339  ? -67.193 -17.408 -26.100 1.00 73.85  ? 339  LYS A CE    1 
ATOM   2375  N  NZ    . LYS A 1  339  ? -67.453 -17.344 -24.633 1.00 75.17  ? 339  LYS A NZ    1 
ATOM   2376  N  N     . HIS A 1  340  ? -68.059 -21.127 -30.452 1.00 69.14  ? 340  HIS A N     1 
ATOM   2377  C  CA    . HIS A 1  340  ? -67.005 -22.137 -30.601 1.00 68.53  ? 340  HIS A CA    1 
ATOM   2378  C  C     . HIS A 1  340  ? -66.790 -22.615 -32.042 1.00 67.64  ? 340  HIS A C     1 
ATOM   2379  O  O     . HIS A 1  340  ? -65.684 -23.046 -32.377 1.00 66.82  ? 340  HIS A O     1 
ATOM   2380  C  CB    . HIS A 1  340  ? -67.261 -23.322 -29.665 1.00 68.85  ? 340  HIS A CB    1 
ATOM   2381  C  CG    . HIS A 1  340  ? -66.803 -23.078 -28.263 1.00 69.65  ? 340  HIS A CG    1 
ATOM   2382  N  ND1   . HIS A 1  340  ? -66.551 -24.099 -27.372 1.00 70.35  ? 340  HIS A ND1   1 
ATOM   2383  C  CD2   . HIS A 1  340  ? -66.518 -21.929 -27.607 1.00 69.96  ? 340  HIS A CD2   1 
ATOM   2384  C  CE1   . HIS A 1  340  ? -66.149 -23.589 -26.224 1.00 70.47  ? 340  HIS A CE1   1 
ATOM   2385  N  NE2   . HIS A 1  340  ? -66.116 -22.274 -26.341 1.00 70.49  ? 340  HIS A NE2   1 
ATOM   2386  N  N     . LEU A 1  341  ? -67.833 -22.547 -32.872 1.00 67.48  ? 341  LEU A N     1 
ATOM   2387  C  CA    . LEU A 1  341  ? -67.704 -22.780 -34.317 1.00 67.05  ? 341  LEU A CA    1 
ATOM   2388  C  C     . LEU A 1  341  ? -66.918 -21.670 -35.026 1.00 66.70  ? 341  LEU A C     1 
ATOM   2389  O  O     . LEU A 1  341  ? -66.312 -21.915 -36.067 1.00 66.46  ? 341  LEU A O     1 
ATOM   2390  C  CB    . LEU A 1  341  ? -69.079 -22.937 -34.984 1.00 67.74  ? 341  LEU A CB    1 
ATOM   2391  C  CG    . LEU A 1  341  ? -69.801 -24.279 -34.810 1.00 68.25  ? 341  LEU A CG    1 
ATOM   2392  C  CD1   . LEU A 1  341  ? -71.257 -24.149 -35.226 1.00 69.25  ? 341  LEU A CD1   1 
ATOM   2393  C  CD2   . LEU A 1  341  ? -69.122 -25.388 -35.604 1.00 67.75  ? 341  LEU A CD2   1 
ATOM   2394  N  N     . GLY A 1  342  ? -66.942 -20.456 -34.480 1.00 67.19  ? 342  GLY A N     1 
ATOM   2395  C  CA    . GLY A 1  342  ? -66.126 -19.357 -34.996 1.00 66.86  ? 342  GLY A CA    1 
ATOM   2396  C  C     . GLY A 1  342  ? -64.627 -19.600 -34.908 1.00 66.03  ? 342  GLY A C     1 
ATOM   2397  O  O     . GLY A 1  342  ? -63.877 -19.134 -35.762 1.00 65.28  ? 342  GLY A O     1 
ATOM   2398  N  N     . THR A 1  343  ? -64.201 -20.331 -33.877 1.00 66.42  ? 343  THR A N     1 
ATOM   2399  C  CA    . THR A 1  343  ? -62.790 -20.630 -33.619 1.00 66.17  ? 343  THR A CA    1 
ATOM   2400  C  C     . THR A 1  343  ? -62.386 -22.075 -33.963 1.00 66.35  ? 343  THR A C     1 
ATOM   2401  O  O     . THR A 1  343  ? -61.199 -22.415 -33.879 1.00 67.16  ? 343  THR A O     1 
ATOM   2402  C  CB    . THR A 1  343  ? -62.442 -20.358 -32.138 1.00 66.82  ? 343  THR A CB    1 
ATOM   2403  O  OG1   . THR A 1  343  ? -63.350 -21.070 -31.284 1.00 68.16  ? 343  THR A OG1   1 
ATOM   2404  C  CG2   . THR A 1  343  ? -62.531 -18.874 -31.830 1.00 66.88  ? 343  THR A CG2   1 
ATOM   2405  N  N     . LEU A 1  344  ? -63.347 -22.908 -34.368 1.00 66.31  ? 344  LEU A N     1 
ATOM   2406  C  CA    . LEU A 1  344  ? -63.093 -24.333 -34.620 1.00 65.53  ? 344  LEU A CA    1 
ATOM   2407  C  C     . LEU A 1  344  ? -62.277 -24.518 -35.902 1.00 64.93  ? 344  LEU A C     1 
ATOM   2408  O  O     . LEU A 1  344  ? -62.815 -24.409 -37.005 1.00 65.08  ? 344  LEU A O     1 
ATOM   2409  C  CB    . LEU A 1  344  ? -64.418 -25.108 -34.701 1.00 66.08  ? 344  LEU A CB    1 
ATOM   2410  C  CG    . LEU A 1  344  ? -64.355 -26.616 -34.442 1.00 66.48  ? 344  LEU A CG    1 
ATOM   2411  C  CD1   . LEU A 1  344  ? -65.693 -27.117 -33.911 1.00 67.71  ? 344  LEU A CD1   1 
ATOM   2412  C  CD2   . LEU A 1  344  ? -63.927 -27.408 -35.673 1.00 65.75  ? 344  LEU A CD2   1 
ATOM   2413  N  N     . ALA A 1  345  ? -60.977 -24.782 -35.747 1.00 64.95  ? 345  ALA A N     1 
ATOM   2414  C  CA    . ALA A 1  345  ? -60.051 -24.958 -36.877 1.00 63.45  ? 345  ALA A CA    1 
ATOM   2415  C  C     . ALA A 1  345  ? -60.075 -23.717 -37.795 1.00 62.59  ? 345  ALA A C     1 
ATOM   2416  O  O     . ALA A 1  345  ? -60.171 -22.594 -37.294 1.00 63.90  ? 345  ALA A O     1 
ATOM   2417  C  CB    . ALA A 1  345  ? -60.383 -26.247 -37.631 1.00 63.23  ? 345  ALA A CB    1 
ATOM   2418  N  N     . GLY A 1  346  ? -59.961 -23.916 -39.110 1.00 61.38  ? 346  GLY A N     1 
ATOM   2419  C  CA    . GLY A 1  346  ? -60.261 -22.886 -40.102 1.00 60.48  ? 346  GLY A CA    1 
ATOM   2420  C  C     . GLY A 1  346  ? -61.413 -23.306 -41.006 1.00 60.23  ? 346  GLY A C     1 
ATOM   2421  O  O     . GLY A 1  346  ? -62.018 -24.359 -40.808 1.00 59.75  ? 346  GLY A O     1 
ATOM   2422  N  N     . SER A 1  347  ? -61.683 -22.477 -42.014 1.00 59.99  ? 347  SER A N     1 
ATOM   2423  C  CA    . SER A 1  347  ? -62.803 -22.658 -42.949 1.00 59.73  ? 347  SER A CA    1 
ATOM   2424  C  C     . SER A 1  347  ? -62.757 -23.969 -43.745 1.00 59.28  ? 347  SER A C     1 
ATOM   2425  O  O     . SER A 1  347  ? -63.808 -24.533 -44.067 1.00 59.41  ? 347  SER A O     1 
ATOM   2426  C  CB    . SER A 1  347  ? -62.858 -21.472 -43.918 1.00 60.06  ? 347  SER A CB    1 
ATOM   2427  O  OG    . SER A 1  347  ? -64.039 -21.489 -44.704 1.00 61.61  ? 347  SER A OG    1 
ATOM   2428  N  N     . GLN A 1  348  ? -61.552 -24.459 -44.041 1.00 58.29  ? 348  GLN A N     1 
ATOM   2429  C  CA    . GLN A 1  348  ? -61.388 -25.686 -44.835 1.00 58.44  ? 348  GLN A CA    1 
ATOM   2430  C  C     . GLN A 1  348  ? -61.906 -26.905 -44.075 1.00 58.62  ? 348  GLN A C     1 
ATOM   2431  O  O     . GLN A 1  348  ? -62.717 -27.671 -44.597 1.00 58.47  ? 348  GLN A O     1 
ATOM   2432  C  CB    . GLN A 1  348  ? -59.923 -25.924 -45.223 1.00 57.73  ? 348  GLN A CB    1 
ATOM   2433  C  CG    . GLN A 1  348  ? -59.289 -24.811 -46.047 1.00 57.50  ? 348  GLN A CG    1 
ATOM   2434  C  CD    . GLN A 1  348  ? -58.549 -23.790 -45.199 1.00 57.33  ? 348  GLN A CD    1 
ATOM   2435  O  OE1   . GLN A 1  348  ? -58.963 -23.469 -44.079 1.00 57.24  ? 348  GLN A OE1   1 
ATOM   2436  N  NE2   . GLN A 1  348  ? -57.454 -23.268 -45.733 1.00 56.64  ? 348  GLN A NE2   1 
ATOM   2437  N  N     . ILE A 1  349  ? -61.428 -27.063 -42.841 1.00 58.23  ? 349  ILE A N     1 
ATOM   2438  C  CA    . ILE A 1  349  ? -61.834 -28.170 -41.974 1.00 58.52  ? 349  ILE A CA    1 
ATOM   2439  C  C     . ILE A 1  349  ? -63.315 -28.087 -41.600 1.00 58.94  ? 349  ILE A C     1 
ATOM   2440  O  O     . ILE A 1  349  ? -63.994 -29.112 -41.547 1.00 59.91  ? 349  ILE A O     1 
ATOM   2441  C  CB    . ILE A 1  349  ? -60.926 -28.257 -40.715 1.00 58.71  ? 349  ILE A CB    1 
ATOM   2442  C  CG1   . ILE A 1  349  ? -59.518 -28.729 -41.110 1.00 58.15  ? 349  ILE A CG1   1 
ATOM   2443  C  CG2   . ILE A 1  349  ? -61.506 -29.172 -39.638 1.00 59.23  ? 349  ILE A CG2   1 
ATOM   2444  C  CD1   . ILE A 1  349  ? -59.424 -30.164 -41.600 1.00 58.05  ? 349  ILE A CD1   1 
ATOM   2445  N  N     . ARG A 1  350  ? -63.818 -26.882 -41.361 1.00 58.94  ? 350  ARG A N     1 
ATOM   2446  C  CA    . ARG A 1  350  ? -65.246 -26.704 -41.090 1.00 59.91  ? 350  ARG A CA    1 
ATOM   2447  C  C     . ARG A 1  350  ? -66.121 -27.141 -42.272 1.00 60.62  ? 350  ARG A C     1 
ATOM   2448  O  O     . ARG A 1  350  ? -67.167 -27.754 -42.062 1.00 61.71  ? 350  ARG A O     1 
ATOM   2449  C  CB    . ARG A 1  350  ? -65.561 -25.257 -40.707 1.00 59.73  ? 350  ARG A CB    1 
ATOM   2450  C  CG    . ARG A 1  350  ? -65.067 -24.874 -39.326 1.00 59.43  ? 350  ARG A CG    1 
ATOM   2451  C  CD    . ARG A 1  350  ? -65.682 -23.565 -38.856 1.00 59.88  ? 350  ARG A CD    1 
ATOM   2452  N  NE    . ARG A 1  350  ? -65.201 -22.394 -39.601 1.00 58.89  ? 350  ARG A NE    1 
ATOM   2453  C  CZ    . ARG A 1  350  ? -64.078 -21.713 -39.350 1.00 57.27  ? 350  ARG A CZ    1 
ATOM   2454  N  NH1   . ARG A 1  350  ? -63.252 -22.065 -38.365 1.00 56.59  ? 350  ARG A NH1   1 
ATOM   2455  N  NH2   . ARG A 1  350  ? -63.768 -20.663 -40.108 1.00 56.63  ? 350  ARG A NH2   1 
ATOM   2456  N  N     . ASN A 1  351  ? -65.693 -26.835 -43.499 1.00 59.93  ? 351  ASN A N     1 
ATOM   2457  C  CA    . ASN A 1  351  ? -66.440 -27.246 -44.699 1.00 60.25  ? 351  ASN A CA    1 
ATOM   2458  C  C     . ASN A 1  351  ? -66.300 -28.721 -45.066 1.00 60.51  ? 351  ASN A C     1 
ATOM   2459  O  O     . ASN A 1  351  ? -67.038 -29.204 -45.927 1.00 61.79  ? 351  ASN A O     1 
ATOM   2460  C  CB    . ASN A 1  351  ? -66.064 -26.392 -45.913 1.00 59.92  ? 351  ASN A CB    1 
ATOM   2461  C  CG    . ASN A 1  351  ? -66.747 -25.049 -45.912 1.00 59.90  ? 351  ASN A CG    1 
ATOM   2462  O  OD1   . ASN A 1  351  ? -67.831 -24.895 -46.471 1.00 60.70  ? 351  ASN A OD1   1 
ATOM   2463  N  ND2   . ASN A 1  351  ? -66.119 -24.067 -45.285 1.00 59.51  ? 351  ASN A ND2   1 
ATOM   2464  N  N     . MET A 1  352  ? -65.353 -29.422 -44.448 1.00 60.83  ? 352  MET A N     1 
ATOM   2465  C  CA    . MET A 1  352  ? -65.192 -30.868 -44.631 1.00 62.22  ? 352  MET A CA    1 
ATOM   2466  C  C     . MET A 1  352  ? -65.867 -31.647 -43.509 1.00 62.81  ? 352  MET A C     1 
ATOM   2467  O  O     . MET A 1  352  ? -66.684 -32.533 -43.767 1.00 63.14  ? 352  MET A O     1 
ATOM   2468  C  CB    . MET A 1  352  ? -63.709 -31.230 -44.691 1.00 62.68  ? 352  MET A CB    1 
ATOM   2469  C  CG    . MET A 1  352  ? -62.993 -30.669 -45.906 1.00 63.13  ? 352  MET A CG    1 
ATOM   2470  S  SD    . MET A 1  352  ? -61.198 -30.739 -45.751 1.00 64.33  ? 352  MET A SD    1 
ATOM   2471  C  CE    . MET A 1  352  ? -60.920 -32.505 -45.910 1.00 63.32  ? 352  MET A CE    1 
ATOM   2472  N  N     . ALA A 1  353  ? -65.510 -31.307 -42.268 1.00 63.10  ? 353  ALA A N     1 
ATOM   2473  C  CA    . ALA A 1  353  ? -66.015 -31.990 -41.066 1.00 63.55  ? 353  ALA A CA    1 
ATOM   2474  C  C     . ALA A 1  353  ? -67.535 -31.945 -40.963 1.00 63.91  ? 353  ALA A C     1 
ATOM   2475  O  O     . ALA A 1  353  ? -68.132 -30.897 -41.174 1.00 64.59  ? 353  ALA A O     1 
ATOM   2476  C  CB    . ALA A 1  353  ? -65.411 -31.367 -39.821 1.00 63.55  ? 353  ALA A CB    1 
ATOM   2477  N  N     . SER A 1  354  ? -68.140 -33.087 -40.635 1.00 63.91  ? 354  SER A N     1 
ATOM   2478  C  CA    . SER A 1  354  ? -69.585 -33.202 -40.437 1.00 63.90  ? 354  SER A CA    1 
ATOM   2479  C  C     . SER A 1  354  ? -69.938 -33.145 -38.954 1.00 64.31  ? 354  SER A C     1 
ATOM   2480  O  O     . SER A 1  354  ? -69.089 -33.402 -38.090 1.00 63.14  ? 354  SER A O     1 
ATOM   2481  C  CB    . SER A 1  354  ? -70.104 -34.508 -41.041 1.00 63.88  ? 354  SER A CB    1 
ATOM   2482  O  OG    . SER A 1  354  ? -69.668 -35.631 -40.298 1.00 63.61  ? 354  SER A OG    1 
ATOM   2483  N  N     . LEU A 1  355  ? -71.199 -32.817 -38.676 1.00 65.24  ? 355  LEU A N     1 
ATOM   2484  C  CA    . LEU A 1  355  ? -71.692 -32.693 -37.303 1.00 65.97  ? 355  LEU A CA    1 
ATOM   2485  C  C     . LEU A 1  355  ? -71.739 -34.060 -36.621 1.00 66.98  ? 355  LEU A C     1 
ATOM   2486  O  O     . LEU A 1  355  ? -71.286 -34.204 -35.479 1.00 67.08  ? 355  LEU A O     1 
ATOM   2487  C  CB    . LEU A 1  355  ? -73.081 -32.040 -37.284 1.00 66.70  ? 355  LEU A CB    1 
ATOM   2488  C  CG    . LEU A 1  355  ? -73.747 -31.786 -35.921 1.00 67.36  ? 355  LEU A CG    1 
ATOM   2489  C  CD1   . LEU A 1  355  ? -73.046 -30.671 -35.160 1.00 66.55  ? 355  LEU A CD1   1 
ATOM   2490  C  CD2   . LEU A 1  355  ? -75.217 -31.456 -36.115 1.00 68.60  ? 355  LEU A CD2   1 
ATOM   2491  N  N     . GLY A 1  356  ? -72.296 -35.048 -37.323 1.00 67.54  ? 356  GLY A N     1 
ATOM   2492  C  CA    . GLY A 1  356  ? -72.349 -36.429 -36.839 1.00 68.67  ? 356  GLY A CA    1 
ATOM   2493  C  C     . GLY A 1  356  ? -70.970 -37.012 -36.583 1.00 68.39  ? 356  GLY A C     1 
ATOM   2494  O  O     . GLY A 1  356  ? -70.746 -37.661 -35.562 1.00 69.02  ? 356  GLY A O     1 
ATOM   2495  N  N     . GLY A 1  357  ? -70.046 -36.771 -37.512 1.00 67.68  ? 357  GLY A N     1 
ATOM   2496  C  CA    . GLY A 1  357  ? -68.647 -37.157 -37.348 1.00 66.78  ? 357  GLY A CA    1 
ATOM   2497  C  C     . GLY A 1  357  ? -67.999 -36.514 -36.138 1.00 66.74  ? 357  GLY A C     1 
ATOM   2498  O  O     . GLY A 1  357  ? -67.232 -37.161 -35.432 1.00 66.77  ? 357  GLY A O     1 
ATOM   2499  N  N     . HIS A 1  358  ? -68.304 -35.242 -35.899 1.00 66.93  ? 358  HIS A N     1 
ATOM   2500  C  CA    . HIS A 1  358  ? -67.835 -34.566 -34.696 1.00 67.50  ? 358  HIS A CA    1 
ATOM   2501  C  C     . HIS A 1  358  ? -68.349 -35.251 -33.435 1.00 68.92  ? 358  HIS A C     1 
ATOM   2502  O  O     . HIS A 1  358  ? -67.576 -35.536 -32.522 1.00 70.39  ? 358  HIS A O     1 
ATOM   2503  C  CB    . HIS A 1  358  ? -68.271 -33.103 -34.665 1.00 67.69  ? 358  HIS A CB    1 
ATOM   2504  C  CG    . HIS A 1  358  ? -67.627 -32.325 -33.568 1.00 67.98  ? 358  HIS A CG    1 
ATOM   2505  N  ND1   . HIS A 1  358  ? -66.553 -31.489 -33.780 1.00 67.92  ? 358  HIS A ND1   1 
ATOM   2506  C  CD2   . HIS A 1  358  ? -67.875 -32.290 -32.238 1.00 69.06  ? 358  HIS A CD2   1 
ATOM   2507  C  CE1   . HIS A 1  358  ? -66.180 -30.958 -32.631 1.00 68.29  ? 358  HIS A CE1   1 
ATOM   2508  N  NE2   . HIS A 1  358  ? -66.967 -31.427 -31.680 1.00 68.89  ? 358  HIS A NE2   1 
ATOM   2509  N  N     . ILE A 1  359  ? -69.655 -35.500 -33.394 1.00 69.55  ? 359  ILE A N     1 
ATOM   2510  C  CA    . ILE A 1  359  ? -70.299 -36.087 -32.218 1.00 70.74  ? 359  ILE A CA    1 
ATOM   2511  C  C     . ILE A 1  359  ? -69.821 -37.525 -31.969 1.00 70.50  ? 359  ILE A C     1 
ATOM   2512  O  O     . ILE A 1  359  ? -69.488 -37.868 -30.838 1.00 70.52  ? 359  ILE A O     1 
ATOM   2513  C  CB    . ILE A 1  359  ? -71.849 -36.018 -32.327 1.00 72.35  ? 359  ILE A CB    1 
ATOM   2514  C  CG1   . ILE A 1  359  ? -72.320 -34.554 -32.257 1.00 72.32  ? 359  ILE A CG1   1 
ATOM   2515  C  CG2   . ILE A 1  359  ? -72.523 -36.822 -31.218 1.00 73.95  ? 359  ILE A CG2   1 
ATOM   2516  C  CD1   . ILE A 1  359  ? -73.737 -34.325 -32.741 1.00 73.02  ? 359  ILE A CD1   1 
ATOM   2517  N  N     . ILE A 1  360  ? -69.778 -38.348 -33.018 1.00 69.35  ? 360  ILE A N     1 
ATOM   2518  C  CA    . ILE A 1  360  ? -69.399 -39.762 -32.884 1.00 69.01  ? 360  ILE A CA    1 
ATOM   2519  C  C     . ILE A 1  360  ? -67.906 -39.942 -32.567 1.00 68.31  ? 360  ILE A C     1 
ATOM   2520  O  O     . ILE A 1  360  ? -67.555 -40.816 -31.773 1.00 68.45  ? 360  ILE A O     1 
ATOM   2521  C  CB    . ILE A 1  360  ? -69.801 -40.586 -34.143 1.00 68.68  ? 360  ILE A CB    1 
ATOM   2522  C  CG1   . ILE A 1  360  ? -71.333 -40.614 -34.326 1.00 69.78  ? 360  ILE A CG1   1 
ATOM   2523  C  CG2   . ILE A 1  360  ? -69.261 -42.013 -34.088 1.00 68.69  ? 360  ILE A CG2   1 
ATOM   2524  C  CD1   . ILE A 1  360  ? -72.124 -41.331 -33.244 1.00 71.16  ? 360  ILE A CD1   1 
ATOM   2525  N  N     . SER A 1  361  ? -67.040 -39.124 -33.170 1.00 67.66  ? 361  SER A N     1 
ATOM   2526  C  CA    . SER A 1  361  ? -65.580 -39.246 -32.972 1.00 67.11  ? 361  SER A CA    1 
ATOM   2527  C  C     . SER A 1  361  ? -65.110 -38.950 -31.543 1.00 67.25  ? 361  SER A C     1 
ATOM   2528  O  O     . SER A 1  361  ? -64.034 -39.396 -31.153 1.00 66.97  ? 361  SER A O     1 
ATOM   2529  C  CB    . SER A 1  361  ? -64.803 -38.368 -33.961 1.00 65.91  ? 361  SER A CB    1 
ATOM   2530  O  OG    . SER A 1  361  ? -65.081 -36.992 -33.771 1.00 66.32  ? 361  SER A OG    1 
ATOM   2531  N  N     . ARG A 1  362  ? -65.903 -38.189 -30.788 1.00 68.10  ? 362  ARG A N     1 
ATOM   2532  C  CA    . ARG A 1  362  ? -65.708 -38.003 -29.344 1.00 68.62  ? 362  ARG A CA    1 
ATOM   2533  C  C     . ARG A 1  362  ? -64.269 -37.670 -28.944 1.00 68.21  ? 362  ARG A C     1 
ATOM   2534  O  O     . ARG A 1  362  ? -63.685 -38.331 -28.081 1.00 68.43  ? 362  ARG A O     1 
ATOM   2535  C  CB    . ARG A 1  362  ? -66.242 -39.230 -28.580 1.00 69.62  ? 362  ARG A CB    1 
ATOM   2536  C  CG    . ARG A 1  362  ? -67.711 -39.098 -28.215 1.00 70.65  ? 362  ARG A CG    1 
ATOM   2537  C  CD    . ARG A 1  362  ? -68.388 -40.426 -27.922 1.00 71.77  ? 362  ARG A CD    1 
ATOM   2538  N  NE    . ARG A 1  362  ? -68.636 -41.224 -29.124 1.00 70.97  ? 362  ARG A NE    1 
ATOM   2539  C  CZ    . ARG A 1  362  ? -69.495 -42.243 -29.210 1.00 71.11  ? 362  ARG A CZ    1 
ATOM   2540  N  NH1   . ARG A 1  362  ? -70.223 -42.630 -28.165 1.00 72.31  ? 362  ARG A NH1   1 
ATOM   2541  N  NH2   . ARG A 1  362  ? -69.630 -42.882 -30.364 1.00 71.05  ? 362  ARG A NH2   1 
ATOM   2542  N  N     . HIS A 1  363  ? -63.706 -36.643 -29.584 1.00 67.92  ? 363  HIS A N     1 
ATOM   2543  C  CA    . HIS A 1  363  ? -62.383 -36.139 -29.207 1.00 67.74  ? 363  HIS A CA    1 
ATOM   2544  C  C     . HIS A 1  363  ? -62.464 -35.498 -27.817 1.00 68.96  ? 363  HIS A C     1 
ATOM   2545  O  O     . HIS A 1  363  ? -63.400 -34.731 -27.559 1.00 68.94  ? 363  HIS A O     1 
ATOM   2546  C  CB    . HIS A 1  363  ? -61.869 -35.088 -30.197 1.00 66.63  ? 363  HIS A CB    1 
ATOM   2547  C  CG    . HIS A 1  363  ? -61.586 -35.620 -31.568 1.00 66.06  ? 363  HIS A CG    1 
ATOM   2548  N  ND1   . HIS A 1  363  ? -61.232 -34.801 -32.620 1.00 64.99  ? 363  HIS A ND1   1 
ATOM   2549  C  CD2   . HIS A 1  363  ? -61.621 -36.878 -32.065 1.00 66.04  ? 363  HIS A CD2   1 
ATOM   2550  C  CE1   . HIS A 1  363  ? -61.052 -35.533 -33.702 1.00 64.23  ? 363  HIS A CE1   1 
ATOM   2551  N  NE2   . HIS A 1  363  ? -61.283 -36.797 -33.393 1.00 65.21  ? 363  HIS A NE2   1 
ATOM   2552  N  N     . PRO A 1  364  ? -61.491 -35.792 -26.922 1.00 69.39  ? 364  PRO A N     1 
ATOM   2553  C  CA    . PRO A 1  364  ? -61.508 -35.172 -25.582 1.00 70.68  ? 364  PRO A CA    1 
ATOM   2554  C  C     . PRO A 1  364  ? -61.487 -33.638 -25.586 1.00 70.78  ? 364  PRO A C     1 
ATOM   2555  O  O     . PRO A 1  364  ? -62.085 -33.019 -24.695 1.00 71.44  ? 364  PRO A O     1 
ATOM   2556  C  CB    . PRO A 1  364  ? -60.241 -35.726 -24.907 1.00 70.99  ? 364  PRO A CB    1 
ATOM   2557  C  CG    . PRO A 1  364  ? -59.406 -36.300 -25.998 1.00 69.15  ? 364  PRO A CG    1 
ATOM   2558  C  CD    . PRO A 1  364  ? -60.343 -36.702 -27.091 1.00 68.68  ? 364  PRO A CD    1 
ATOM   2559  N  N     . ASP A 1  365  ? -60.815 -33.055 -26.584 1.00 69.90  ? 365  ASP A N     1 
ATOM   2560  C  CA    . ASP A 1  365  ? -60.735 -31.596 -26.776 1.00 69.67  ? 365  ASP A CA    1 
ATOM   2561  C  C     . ASP A 1  365  ? -61.792 -31.027 -27.747 1.00 68.60  ? 365  ASP A C     1 
ATOM   2562  O  O     . ASP A 1  365  ? -61.624 -29.917 -28.275 1.00 68.47  ? 365  ASP A O     1 
ATOM   2563  C  CB    . ASP A 1  365  ? -59.337 -31.220 -27.271 1.00 69.78  ? 365  ASP A CB    1 
ATOM   2564  C  CG    . ASP A 1  365  ? -59.086 -31.677 -28.693 1.00 69.78  ? 365  ASP A CG    1 
ATOM   2565  O  OD1   . ASP A 1  365  ? -59.048 -32.901 -28.917 1.00 70.71  ? 365  ASP A OD1   1 
ATOM   2566  O  OD2   . ASP A 1  365  ? -58.963 -30.816 -29.585 1.00 71.02  ? 365  ASP A OD2   1 
ATOM   2567  N  N     . SER A 1  366  ? -62.860 -31.789 -27.992 1.00 68.23  ? 366  SER A N     1 
ATOM   2568  C  CA    . SER A 1  366  ? -64.014 -31.310 -28.756 1.00 67.33  ? 366  SER A CA    1 
ATOM   2569  C  C     . SER A 1  366  ? -64.577 -30.031 -28.128 1.00 67.90  ? 366  SER A C     1 
ATOM   2570  O  O     . SER A 1  366  ? -64.776 -29.967 -26.907 1.00 69.80  ? 366  SER A O     1 
ATOM   2571  C  CB    . SER A 1  366  ? -65.104 -32.385 -28.804 1.00 67.63  ? 366  SER A CB    1 
ATOM   2572  O  OG    . SER A 1  366  ? -66.323 -31.868 -29.296 1.00 67.51  ? 366  SER A OG    1 
ATOM   2573  N  N     . ASP A 1  367  ? -64.809 -29.027 -28.971 1.00 66.45  ? 367  ASP A N     1 
ATOM   2574  C  CA    . ASP A 1  367  ? -65.371 -27.740 -28.549 1.00 66.28  ? 367  ASP A CA    1 
ATOM   2575  C  C     . ASP A 1  367  ? -66.896 -27.717 -28.517 1.00 67.00  ? 367  ASP A C     1 
ATOM   2576  O  O     . ASP A 1  367  ? -67.483 -26.930 -27.772 1.00 68.53  ? 367  ASP A O     1 
ATOM   2577  C  CB    . ASP A 1  367  ? -64.885 -26.619 -29.471 1.00 65.12  ? 367  ASP A CB    1 
ATOM   2578  C  CG    . ASP A 1  367  ? -63.452 -26.231 -29.212 1.00 64.68  ? 367  ASP A CG    1 
ATOM   2579  O  OD1   . ASP A 1  367  ? -63.071 -26.094 -28.028 1.00 65.96  ? 367  ASP A OD1   1 
ATOM   2580  O  OD2   . ASP A 1  367  ? -62.702 -26.021 -30.186 1.00 62.93  ? 367  ASP A OD2   1 
ATOM   2581  N  N     . LEU A 1  368  ? -67.527 -28.562 -29.326 1.00 66.44  ? 368  LEU A N     1 
ATOM   2582  C  CA    . LEU A 1  368  ? -68.979 -28.582 -29.452 1.00 67.59  ? 368  LEU A CA    1 
ATOM   2583  C  C     . LEU A 1  368  ? -69.637 -29.561 -28.486 1.00 69.40  ? 368  LEU A C     1 
ATOM   2584  O  O     . LEU A 1  368  ? -70.691 -29.254 -27.930 1.00 71.00  ? 368  LEU A O     1 
ATOM   2585  C  CB    . LEU A 1  368  ? -69.379 -28.918 -30.890 1.00 67.37  ? 368  LEU A CB    1 
ATOM   2586  C  CG    . LEU A 1  368  ? -68.715 -28.089 -32.002 1.00 66.16  ? 368  LEU A CG    1 
ATOM   2587  C  CD1   . LEU A 1  368  ? -69.227 -28.531 -33.367 1.00 65.60  ? 368  LEU A CD1   1 
ATOM   2588  C  CD2   . LEU A 1  368  ? -68.935 -26.595 -31.806 1.00 66.27  ? 368  LEU A CD2   1 
ATOM   2589  N  N     . ASN A 1  369  ? -69.018 -30.725 -28.279 1.00 69.76  ? 369  ASN A N     1 
ATOM   2590  C  CA    . ASN A 1  369  ? -69.605 -31.784 -27.427 1.00 70.70  ? 369  ASN A CA    1 
ATOM   2591  C  C     . ASN A 1  369  ? -69.868 -31.419 -25.954 1.00 71.19  ? 369  ASN A C     1 
ATOM   2592  O  O     . ASN A 1  369  ? -70.846 -31.906 -25.379 1.00 71.94  ? 369  ASN A O     1 
ATOM   2593  C  CB    . ASN A 1  369  ? -68.767 -33.073 -27.492 1.00 70.50  ? 369  ASN A CB    1 
ATOM   2594  C  CG    . ASN A 1  369  ? -68.863 -33.777 -28.836 1.00 70.09  ? 369  ASN A CG    1 
ATOM   2595  O  OD1   . ASN A 1  369  ? -69.808 -33.575 -29.603 1.00 70.06  ? 369  ASN A OD1   1 
ATOM   2596  N  ND2   . ASN A 1  369  ? -67.876 -34.620 -29.124 1.00 70.08  ? 369  ASN A ND2   1 
ATOM   2597  N  N     . PRO A 1  370  ? -68.999 -30.588 -25.339 1.00 70.64  ? 370  PRO A N     1 
ATOM   2598  C  CA    . PRO A 1  370  ? -69.306 -30.078 -23.996 1.00 71.46  ? 370  PRO A CA    1 
ATOM   2599  C  C     . PRO A 1  370  ? -70.544 -29.182 -23.957 1.00 71.50  ? 370  PRO A C     1 
ATOM   2600  O  O     . PRO A 1  370  ? -71.297 -29.227 -22.990 1.00 71.62  ? 370  PRO A O     1 
ATOM   2601  C  CB    . PRO A 1  370  ? -68.053 -29.277 -23.622 1.00 70.97  ? 370  PRO A CB    1 
ATOM   2602  C  CG    . PRO A 1  370  ? -66.974 -29.829 -24.476 1.00 70.11  ? 370  PRO A CG    1 
ATOM   2603  C  CD    . PRO A 1  370  ? -67.638 -30.214 -25.758 1.00 69.71  ? 370  PRO A CD    1 
ATOM   2604  N  N     . ILE A 1  371  ? -70.751 -28.393 -25.010 1.00 70.85  ? 371  ILE A N     1 
ATOM   2605  C  CA    . ILE A 1  371  ? -71.921 -27.519 -25.103 1.00 71.78  ? 371  ILE A CA    1 
ATOM   2606  C  C     . ILE A 1  371  ? -73.173 -28.361 -25.359 1.00 72.71  ? 371  ILE A C     1 
ATOM   2607  O  O     . ILE A 1  371  ? -74.224 -28.111 -24.768 1.00 74.41  ? 371  ILE A O     1 
ATOM   2608  C  CB    . ILE A 1  371  ? -71.768 -26.448 -26.211 1.00 70.96  ? 371  ILE A CB    1 
ATOM   2609  C  CG1   . ILE A 1  371  ? -70.530 -25.572 -25.964 1.00 70.50  ? 371  ILE A CG1   1 
ATOM   2610  C  CG2   . ILE A 1  371  ? -73.015 -25.567 -26.288 1.00 71.60  ? 371  ILE A CG2   1 
ATOM   2611  C  CD1   . ILE A 1  371  ? -70.007 -24.894 -27.210 1.00 69.36  ? 371  ILE A CD1   1 
ATOM   2612  N  N     . LEU A 1  372  ? -73.056 -29.351 -26.242 1.00 72.00  ? 372  LEU A N     1 
ATOM   2613  C  CA    . LEU A 1  372  ? -74.157 -30.274 -26.523 1.00 73.19  ? 372  LEU A CA    1 
ATOM   2614  C  C     . LEU A 1  372  ? -74.533 -31.095 -25.285 1.00 75.03  ? 372  LEU A C     1 
ATOM   2615  O  O     . LEU A 1  372  ? -75.721 -31.323 -25.026 1.00 76.53  ? 372  LEU A O     1 
ATOM   2616  C  CB    . LEU A 1  372  ? -73.808 -31.203 -27.697 1.00 72.36  ? 372  LEU A CB    1 
ATOM   2617  C  CG    . LEU A 1  372  ? -73.657 -30.533 -29.074 1.00 71.25  ? 372  LEU A CG    1 
ATOM   2618  C  CD1   . LEU A 1  372  ? -73.015 -31.476 -30.082 1.00 70.02  ? 372  LEU A CD1   1 
ATOM   2619  C  CD2   . LEU A 1  372  ? -74.993 -30.016 -29.598 1.00 71.78  ? 372  LEU A CD2   1 
ATOM   2620  N  N     . ALA A 1  373  ? -73.524 -31.512 -24.519 1.00 75.11  ? 373  ALA A N     1 
ATOM   2621  C  CA    . ALA A 1  373  ? -73.726 -32.323 -23.312 1.00 76.50  ? 373  ALA A CA    1 
ATOM   2622  C  C     . ALA A 1  373  ? -74.660 -31.668 -22.315 1.00 77.55  ? 373  ALA A C     1 
ATOM   2623  O  O     . ALA A 1  373  ? -75.537 -32.326 -21.759 1.00 79.27  ? 373  ALA A O     1 
ATOM   2624  C  CB    . ALA A 1  373  ? -72.393 -32.616 -22.640 1.00 76.56  ? 373  ALA A CB    1 
ATOM   2625  N  N     . VAL A 1  374  ? -74.460 -30.369 -22.103 1.00 77.80  ? 374  VAL A N     1 
ATOM   2626  C  CA    . VAL A 1  374  ? -75.233 -29.601 -21.115 1.00 79.01  ? 374  VAL A CA    1 
ATOM   2627  C  C     . VAL A 1  374  ? -76.642 -29.182 -21.564 1.00 79.92  ? 374  VAL A C     1 
ATOM   2628  O  O     . VAL A 1  374  ? -77.453 -28.794 -20.724 1.00 81.33  ? 374  VAL A O     1 
ATOM   2629  C  CB    . VAL A 1  374  ? -74.459 -28.344 -20.629 1.00 78.05  ? 374  VAL A CB    1 
ATOM   2630  C  CG1   . VAL A 1  374  ? -73.132 -28.750 -20.006 1.00 77.39  ? 374  VAL A CG1   1 
ATOM   2631  C  CG2   . VAL A 1  374  ? -74.242 -27.324 -21.745 1.00 76.82  ? 374  VAL A CG2   1 
ATOM   2632  N  N     . GLY A 1  375  ? -76.929 -29.260 -22.867 1.00 79.51  ? 375  GLY A N     1 
ATOM   2633  C  CA    . GLY A 1  375  ? -78.166 -28.712 -23.441 1.00 79.75  ? 375  GLY A CA    1 
ATOM   2634  C  C     . GLY A 1  375  ? -79.299 -29.676 -23.744 1.00 80.34  ? 375  GLY A C     1 
ATOM   2635  O  O     . GLY A 1  375  ? -80.139 -29.368 -24.591 1.00 80.21  ? 375  GLY A O     1 
ATOM   2636  N  N     . ASN A 1  376  ? -79.337 -30.823 -23.057 1.00 81.21  ? 376  ASN A N     1 
ATOM   2637  C  CA    . ASN A 1  376  ? -80.401 -31.827 -23.225 1.00 82.59  ? 376  ASN A CA    1 
ATOM   2638  C  C     . ASN A 1  376  ? -80.606 -32.256 -24.682 1.00 82.53  ? 376  ASN A C     1 
ATOM   2639  O  O     . ASN A 1  376  ? -81.740 -32.370 -25.149 1.00 83.63  ? 376  ASN A O     1 
ATOM   2640  C  CB    . ASN A 1  376  ? -81.736 -31.321 -22.633 1.00 83.79  ? 376  ASN A CB    1 
ATOM   2641  C  CG    . ASN A 1  376  ? -81.715 -31.230 -21.120 1.00 84.56  ? 376  ASN A CG    1 
ATOM   2642  O  OD1   . ASN A 1  376  ? -81.854 -30.146 -20.551 1.00 85.12  ? 376  ASN A OD1   1 
ATOM   2643  N  ND2   . ASN A 1  376  ? -81.560 -32.372 -20.459 1.00 84.66  ? 376  ASN A ND2   1 
ATOM   2644  N  N     . CYS A 1  377  ? -79.512 -32.485 -25.399 1.00 82.08  ? 377  CYS A N     1 
ATOM   2645  C  CA    . CYS A 1  377  ? -79.596 -32.834 -26.818 1.00 82.02  ? 377  CYS A CA    1 
ATOM   2646  C  C     . CYS A 1  377  ? -79.749 -34.334 -26.981 1.00 82.43  ? 377  CYS A C     1 
ATOM   2647  O  O     . CYS A 1  377  ? -79.148 -35.102 -26.235 1.00 82.79  ? 377  CYS A O     1 
ATOM   2648  C  CB    . CYS A 1  377  ? -78.370 -32.336 -27.569 1.00 80.88  ? 377  CYS A CB    1 
ATOM   2649  S  SG    . CYS A 1  377  ? -78.200 -30.543 -27.463 1.00 81.93  ? 377  CYS A SG    1 
ATOM   2650  N  N     . THR A 1  378  ? -80.565 -34.738 -27.952 1.00 83.23  ? 378  THR A N     1 
ATOM   2651  C  CA    . THR A 1  378  ? -80.845 -36.152 -28.209 1.00 84.09  ? 378  THR A CA    1 
ATOM   2652  C  C     . THR A 1  378  ? -80.468 -36.507 -29.644 1.00 82.84  ? 378  THR A C     1 
ATOM   2653  O  O     . THR A 1  378  ? -80.512 -35.660 -30.535 1.00 82.42  ? 378  THR A O     1 
ATOM   2654  C  CB    . THR A 1  378  ? -82.328 -36.510 -27.942 1.00 85.94  ? 378  THR A CB    1 
ATOM   2655  O  OG1   . THR A 1  378  ? -83.172 -35.859 -28.899 1.00 86.83  ? 378  THR A OG1   1 
ATOM   2656  C  CG2   . THR A 1  378  ? -82.745 -36.096 -26.530 1.00 86.13  ? 378  THR A CG2   1 
ATOM   2657  N  N     . LEU A 1  379  ? -80.105 -37.771 -29.841 1.00 82.64  ? 379  LEU A N     1 
ATOM   2658  C  CA    . LEU A 1  379  ? -79.595 -38.272 -31.109 1.00 81.08  ? 379  LEU A CA    1 
ATOM   2659  C  C     . LEU A 1  379  ? -80.636 -39.166 -31.762 1.00 81.77  ? 379  LEU A C     1 
ATOM   2660  O  O     . LEU A 1  379  ? -81.190 -40.047 -31.114 1.00 82.62  ? 379  LEU A O     1 
ATOM   2661  C  CB    . LEU A 1  379  ? -78.330 -39.087 -30.863 1.00 80.60  ? 379  LEU A CB    1 
ATOM   2662  C  CG    . LEU A 1  379  ? -77.223 -38.412 -30.053 1.00 79.82  ? 379  LEU A CG    1 
ATOM   2663  C  CD1   . LEU A 1  379  ? -76.076 -39.388 -29.844 1.00 79.28  ? 379  LEU A CD1   1 
ATOM   2664  C  CD2   . LEU A 1  379  ? -76.751 -37.137 -30.738 1.00 78.83  ? 379  LEU A CD2   1 
ATOM   2665  N  N     . ASN A 1  380  ? -80.888 -38.935 -33.048 1.00 81.67  ? 380  ASN A N     1 
ATOM   2666  C  CA    . ASN A 1  380  ? -81.805 -39.758 -33.832 1.00 82.60  ? 380  ASN A CA    1 
ATOM   2667  C  C     . ASN A 1  380  ? -81.042 -40.872 -34.535 1.00 82.51  ? 380  ASN A C     1 
ATOM   2668  O  O     . ASN A 1  380  ? -80.421 -40.653 -35.580 1.00 80.99  ? 380  ASN A O     1 
ATOM   2669  C  CB    . ASN A 1  380  ? -82.565 -38.903 -34.844 1.00 82.19  ? 380  ASN A CB    1 
ATOM   2670  C  CG    . ASN A 1  380  ? -83.491 -37.913 -34.176 1.00 82.48  ? 380  ASN A CG    1 
ATOM   2671  O  OD1   . ASN A 1  380  ? -84.351 -38.295 -33.388 1.00 83.45  ? 380  ASN A OD1   1 
ATOM   2672  N  ND2   . ASN A 1  380  ? -83.311 -36.634 -34.476 1.00 81.72  ? 380  ASN A ND2   1 
ATOM   2673  N  N     . LEU A 1  381  ? -81.086 -42.058 -33.934 1.00 84.02  ? 381  LEU A N     1 
ATOM   2674  C  CA    . LEU A 1  381  ? -80.418 -43.243 -34.469 1.00 83.63  ? 381  LEU A CA    1 
ATOM   2675  C  C     . LEU A 1  381  ? -81.331 -43.956 -35.457 1.00 85.14  ? 381  LEU A C     1 
ATOM   2676  O  O     . LEU A 1  381  ? -82.551 -43.743 -35.466 1.00 86.68  ? 381  LEU A O     1 
ATOM   2677  C  CB    . LEU A 1  381  ? -80.006 -44.195 -33.336 1.00 83.75  ? 381  LEU A CB    1 
ATOM   2678  C  CG    . LEU A 1  381  ? -78.690 -43.899 -32.601 1.00 82.23  ? 381  LEU A CG    1 
ATOM   2679  C  CD1   . LEU A 1  381  ? -78.421 -42.414 -32.389 1.00 81.05  ? 381  LEU A CD1   1 
ATOM   2680  C  CD2   . LEU A 1  381  ? -78.655 -44.640 -31.272 1.00 83.21  ? 381  LEU A CD2   1 
ATOM   2681  N  N     . LEU A 1  382  ? -80.730 -44.793 -36.294 1.00 84.98  ? 382  LEU A N     1 
ATOM   2682  C  CA    . LEU A 1  382  ? -81.482 -45.583 -37.257 1.00 86.67  ? 382  LEU A CA    1 
ATOM   2683  C  C     . LEU A 1  382  ? -80.687 -46.810 -37.680 1.00 87.61  ? 382  LEU A C     1 
ATOM   2684  O  O     . LEU A 1  382  ? -79.497 -46.719 -37.966 1.00 86.57  ? 382  LEU A O     1 
ATOM   2685  C  CB    . LEU A 1  382  ? -81.836 -44.735 -38.481 1.00 86.31  ? 382  LEU A CB    1 
ATOM   2686  C  CG    . LEU A 1  382  ? -82.749 -45.371 -39.539 1.00 87.61  ? 382  LEU A CG    1 
ATOM   2687  C  CD1   . LEU A 1  382  ? -84.110 -45.713 -38.952 1.00 89.09  ? 382  LEU A CD1   1 
ATOM   2688  C  CD2   . LEU A 1  382  ? -82.902 -44.452 -40.745 1.00 87.01  ? 382  LEU A CD2   1 
ATOM   2689  N  N     . SER A 1  383  ? -81.372 -47.950 -37.721 1.00 90.89  ? 383  SER A N     1 
ATOM   2690  C  CA    . SER A 1  383  ? -80.797 -49.226 -38.121 1.00 91.45  ? 383  SER A CA    1 
ATOM   2691  C  C     . SER A 1  383  ? -81.642 -49.837 -39.226 1.00 93.36  ? 383  SER A C     1 
ATOM   2692  O  O     . SER A 1  383  ? -82.682 -49.295 -39.611 1.00 93.50  ? 383  SER A O     1 
ATOM   2693  C  CB    . SER A 1  383  ? -80.781 -50.180 -36.926 1.00 92.89  ? 383  SER A CB    1 
ATOM   2694  O  OG    . SER A 1  383  ? -80.097 -51.381 -37.235 1.00 93.56  ? 383  SER A OG    1 
ATOM   2695  N  N     . LYS A 1  384  ? -81.193 -50.987 -39.716 1.00 94.90  ? 384  LYS A N     1 
ATOM   2696  C  CA    . LYS A 1  384  ? -81.980 -51.793 -40.642 1.00 96.24  ? 384  LYS A CA    1 
ATOM   2697  C  C     . LYS A 1  384  ? -83.239 -52.326 -39.947 1.00 98.16  ? 384  LYS A C     1 
ATOM   2698  O  O     . LYS A 1  384  ? -84.298 -52.401 -40.570 1.00 98.81  ? 384  LYS A O     1 
ATOM   2699  C  CB    . LYS A 1  384  ? -81.141 -52.946 -41.205 1.00 96.46  ? 384  LYS A CB    1 
ATOM   2700  C  CG    . LYS A 1  384  ? -81.700 -53.549 -42.480 1.00 97.49  ? 384  LYS A CG    1 
ATOM   2701  C  CD    . LYS A 1  384  ? -80.895 -54.756 -42.934 1.00 97.89  ? 384  LYS A CD    1 
ATOM   2702  C  CE    . LYS A 1  384  ? -81.714 -55.631 -43.871 1.00 99.98  ? 384  LYS A CE    1 
ATOM   2703  N  NZ    . LYS A 1  384  ? -80.962 -56.828 -44.334 1.00 100.55 ? 384  LYS A NZ    1 
ATOM   2704  N  N     . GLU A 1  385  ? -83.117 -52.669 -38.660 1.00 99.29  ? 385  GLU A N     1 
ATOM   2705  C  CA    . GLU A 1  385  ? -84.250 -53.168 -37.855 1.00 101.55 ? 385  GLU A CA    1 
ATOM   2706  C  C     . GLU A 1  385  ? -85.030 -52.087 -37.074 1.00 100.38 ? 385  GLU A C     1 
ATOM   2707  O  O     . GLU A 1  385  ? -85.825 -52.424 -36.196 1.00 101.27 ? 385  GLU A O     1 
ATOM   2708  C  CB    . GLU A 1  385  ? -83.815 -54.338 -36.933 1.00 103.67 ? 385  GLU A CB    1 
ATOM   2709  C  CG    . GLU A 1  385  ? -83.180 -54.005 -35.573 1.00 104.50 ? 385  GLU A CG    1 
ATOM   2710  C  CD    . GLU A 1  385  ? -81.728 -53.561 -35.652 1.00 103.84 ? 385  GLU A CD    1 
ATOM   2711  O  OE1   . GLU A 1  385  ? -80.951 -54.132 -36.452 1.00 104.47 ? 385  GLU A OE1   1 
ATOM   2712  O  OE2   . GLU A 1  385  ? -81.352 -52.636 -34.900 1.00 103.89 ? 385  GLU A OE2   1 
ATOM   2713  N  N     . GLY A 1  386  ? -84.808 -50.806 -37.386 1.00 97.96  ? 386  GLY A N     1 
ATOM   2714  C  CA    . GLY A 1  386  ? -85.699 -49.732 -36.930 1.00 97.32  ? 386  GLY A CA    1 
ATOM   2715  C  C     . GLY A 1  386  ? -85.070 -48.450 -36.412 1.00 95.42  ? 386  GLY A C     1 
ATOM   2716  O  O     . GLY A 1  386  ? -83.844 -48.325 -36.288 1.00 92.62  ? 386  GLY A O     1 
ATOM   2717  N  N     . LYS A 1  387  ? -85.955 -47.502 -36.104 1.00 96.31  ? 387  LYS A N     1 
ATOM   2718  C  CA    . LYS A 1  387  ? -85.599 -46.186 -35.569 1.00 95.57  ? 387  LYS A CA    1 
ATOM   2719  C  C     . LYS A 1  387  ? -85.382 -46.270 -34.056 1.00 94.84  ? 387  LYS A C     1 
ATOM   2720  O  O     . LYS A 1  387  ? -85.920 -47.161 -33.392 1.00 95.89  ? 387  LYS A O     1 
ATOM   2721  C  CB    . LYS A 1  387  ? -86.716 -45.188 -35.893 1.00 97.15  ? 387  LYS A CB    1 
ATOM   2722  C  CG    . LYS A 1  387  ? -86.328 -43.722 -35.774 1.00 97.35  ? 387  LYS A CG    1 
ATOM   2723  C  CD    . LYS A 1  387  ? -87.511 -42.806 -36.060 1.00 99.19  ? 387  LYS A CD    1 
ATOM   2724  C  CE    . LYS A 1  387  ? -87.869 -42.765 -37.539 1.00 99.56  ? 387  LYS A CE    1 
ATOM   2725  N  NZ    . LYS A 1  387  ? -88.951 -41.779 -37.809 1.00 100.86 ? 387  LYS A NZ    1 
ATOM   2726  N  N     . ARG A 1  388  ? -84.586 -45.346 -33.525 1.00 92.84  ? 388  ARG A N     1 
ATOM   2727  C  CA    . ARG A 1  388  ? -84.243 -45.310 -32.097 1.00 92.42  ? 388  ARG A CA    1 
ATOM   2728  C  C     . ARG A 1  388  ? -83.714 -43.915 -31.725 1.00 90.91  ? 388  ARG A C     1 
ATOM   2729  O  O     . ARG A 1  388  ? -83.156 -43.212 -32.576 1.00 90.27  ? 388  ARG A O     1 
ATOM   2730  C  CB    . ARG A 1  388  ? -83.193 -46.384 -31.795 1.00 92.03  ? 388  ARG A CB    1 
ATOM   2731  C  CG    . ARG A 1  388  ? -82.922 -46.655 -30.324 1.00 92.40  ? 388  ARG A CG    1 
ATOM   2732  C  CD    . ARG A 1  388  ? -81.708 -47.554 -30.154 1.00 92.30  ? 388  ARG A CD    1 
ATOM   2733  N  NE    . ARG A 1  388  ? -81.081 -47.355 -28.849 1.00 93.09  ? 388  ARG A NE    1 
ATOM   2734  C  CZ    . ARG A 1  388  ? -79.816 -47.652 -28.539 1.00 93.01  ? 388  ARG A CZ    1 
ATOM   2735  N  NH1   . ARG A 1  388  ? -78.980 -48.182 -29.430 1.00 92.08  ? 388  ARG A NH1   1 
ATOM   2736  N  NH2   . ARG A 1  388  ? -79.375 -47.413 -27.306 1.00 93.96  ? 388  ARG A NH2   1 
ATOM   2737  N  N     . GLN A 1  389  ? -83.889 -43.523 -30.464 1.00 90.11  ? 389  GLN A N     1 
ATOM   2738  C  CA    . GLN A 1  389  ? -83.494 -42.193 -30.001 1.00 88.18  ? 389  GLN A CA    1 
ATOM   2739  C  C     . GLN A 1  389  ? -82.902 -42.232 -28.596 1.00 87.24  ? 389  GLN A C     1 
ATOM   2740  O  O     . GLN A 1  389  ? -83.575 -42.624 -27.646 1.00 88.35  ? 389  GLN A O     1 
ATOM   2741  C  CB    . GLN A 1  389  ? -84.699 -41.262 -30.035 1.00 89.38  ? 389  GLN A CB    1 
ATOM   2742  C  CG    . GLN A 1  389  ? -84.372 -39.793 -29.823 1.00 89.11  ? 389  GLN A CG    1 
ATOM   2743  C  CD    . GLN A 1  389  ? -85.617 -38.927 -29.852 1.00 90.76  ? 389  GLN A CD    1 
ATOM   2744  O  OE1   . GLN A 1  389  ? -86.414 -39.000 -30.789 1.00 91.29  ? 389  GLN A OE1   1 
ATOM   2745  N  NE2   . GLN A 1  389  ? -85.797 -38.109 -28.821 1.00 91.34  ? 389  GLN A NE2   1 
ATOM   2746  N  N     . ILE A 1  390  ? -81.650 -41.794 -28.479 1.00 85.13  ? 390  ILE A N     1 
ATOM   2747  C  CA    . ILE A 1  390  ? -80.922 -41.792 -27.211 1.00 84.85  ? 390  ILE A CA    1 
ATOM   2748  C  C     . ILE A 1  390  ? -80.463 -40.377 -26.879 1.00 83.90  ? 390  ILE A C     1 
ATOM   2749  O  O     . ILE A 1  390  ? -80.316 -39.553 -27.782 1.00 82.42  ? 390  ILE A O     1 
ATOM   2750  C  CB    . ILE A 1  390  ? -79.700 -42.742 -27.241 1.00 84.40  ? 390  ILE A CB    1 
ATOM   2751  C  CG1   . ILE A 1  390  ? -78.701 -42.366 -28.347 1.00 82.53  ? 390  ILE A CG1   1 
ATOM   2752  C  CG2   . ILE A 1  390  ? -80.161 -44.182 -27.423 1.00 85.73  ? 390  ILE A CG2   1 
ATOM   2753  C  CD1   . ILE A 1  390  ? -77.391 -43.122 -28.269 1.00 81.93  ? 390  ILE A CD1   1 
ATOM   2754  N  N     . PRO A 1  391  ? -80.240 -40.088 -25.584 1.00 84.97  ? 391  PRO A N     1 
ATOM   2755  C  CA    . PRO A 1  391  ? -79.722 -38.773 -25.198 1.00 84.33  ? 391  PRO A CA    1 
ATOM   2756  C  C     . PRO A 1  391  ? -78.215 -38.669 -25.394 1.00 83.10  ? 391  PRO A C     1 
ATOM   2757  O  O     . PRO A 1  391  ? -77.521 -39.686 -25.356 1.00 82.46  ? 391  PRO A O     1 
ATOM   2758  C  CB    . PRO A 1  391  ? -80.073 -38.687 -23.712 1.00 85.40  ? 391  PRO A CB    1 
ATOM   2759  C  CG    . PRO A 1  391  ? -80.042 -40.100 -23.253 1.00 86.23  ? 391  PRO A CG    1 
ATOM   2760  C  CD    . PRO A 1  391  ? -80.540 -40.923 -24.405 1.00 86.14  ? 391  PRO A CD    1 
ATOM   2761  N  N     . LEU A 1  392  ? -77.734 -37.445 -25.613 1.00 83.23  ? 392  LEU A N     1 
ATOM   2762  C  CA    . LEU A 1  392  ? -76.302 -37.145 -25.660 1.00 82.83  ? 392  LEU A CA    1 
ATOM   2763  C  C     . LEU A 1  392  ? -75.854 -36.697 -24.262 1.00 84.19  ? 392  LEU A C     1 
ATOM   2764  O  O     . LEU A 1  392  ? -75.981 -35.524 -23.898 1.00 83.87  ? 392  LEU A O     1 
ATOM   2765  C  CB    . LEU A 1  392  ? -76.009 -36.079 -26.727 1.00 81.77  ? 392  LEU A CB    1 
ATOM   2766  C  CG    . LEU A 1  392  ? -74.560 -35.971 -27.238 1.00 80.46  ? 392  LEU A CG    1 
ATOM   2767  C  CD1   . LEU A 1  392  ? -74.495 -35.132 -28.505 1.00 79.58  ? 392  LEU A CD1   1 
ATOM   2768  C  CD2   . LEU A 1  392  ? -73.605 -35.408 -26.188 1.00 80.24  ? 392  LEU A CD2   1 
ATOM   2769  N  N     . ASN A 1  393  ? -75.335 -37.653 -23.494 1.00 86.31  ? 393  ASN A N     1 
ATOM   2770  C  CA    . ASN A 1  393  ? -74.936 -37.455 -22.091 1.00 88.76  ? 393  ASN A CA    1 
ATOM   2771  C  C     . ASN A 1  393  ? -73.470 -37.846 -21.869 1.00 89.91  ? 393  ASN A C     1 
ATOM   2772  O  O     . ASN A 1  393  ? -72.792 -38.246 -22.816 1.00 89.38  ? 393  ASN A O     1 
ATOM   2773  C  CB    . ASN A 1  393  ? -75.877 -38.239 -21.158 1.00 90.17  ? 393  ASN A CB    1 
ATOM   2774  C  CG    . ASN A 1  393  ? -76.074 -39.686 -21.584 1.00 90.56  ? 393  ASN A CG    1 
ATOM   2775  O  OD1   . ASN A 1  393  ? -75.234 -40.272 -22.265 1.00 91.04  ? 393  ASN A OD1   1 
ATOM   2776  N  ND2   . ASN A 1  393  ? -77.194 -40.267 -21.186 1.00 92.01  ? 393  ASN A ND2   1 
ATOM   2777  N  N     . GLU A 1  394  ? -72.981 -37.712 -20.632 1.00 92.43  ? 394  GLU A N     1 
ATOM   2778  C  CA    . GLU A 1  394  ? -71.590 -38.076 -20.293 1.00 93.24  ? 394  GLU A CA    1 
ATOM   2779  C  C     . GLU A 1  394  ? -71.229 -39.521 -20.625 1.00 92.14  ? 394  GLU A C     1 
ATOM   2780  O  O     . GLU A 1  394  ? -70.104 -39.793 -21.048 1.00 91.52  ? 394  GLU A O     1 
ATOM   2781  C  CB    . GLU A 1  394  ? -71.269 -37.812 -18.812 1.00 96.08  ? 394  GLU A CB    1 
ATOM   2782  C  CG    . GLU A 1  394  ? -72.155 -38.537 -17.794 1.00 99.78  ? 394  GLU A CG    1 
ATOM   2783  C  CD    . GLU A 1  394  ? -71.441 -38.888 -16.498 1.00 102.61 ? 394  GLU A CD    1 
ATOM   2784  O  OE1   . GLU A 1  394  ? -70.442 -38.221 -16.149 1.00 103.63 ? 394  GLU A OE1   1 
ATOM   2785  O  OE2   . GLU A 1  394  ? -71.893 -39.839 -15.820 1.00 105.02 ? 394  GLU A OE2   1 
ATOM   2786  N  N     . GLN A 1  395  ? -72.184 -40.429 -20.435 1.00 92.02  ? 395  GLN A N     1 
ATOM   2787  C  CA    . GLN A 1  395  ? -71.962 -41.859 -20.655 1.00 91.70  ? 395  GLN A CA    1 
ATOM   2788  C  C     . GLN A 1  395  ? -71.820 -42.174 -22.141 1.00 90.02  ? 395  GLN A C     1 
ATOM   2789  O  O     . GLN A 1  395  ? -71.006 -43.025 -22.519 1.00 89.80  ? 395  GLN A O     1 
ATOM   2790  C  CB    . GLN A 1  395  ? -73.095 -42.682 -20.033 1.00 92.74  ? 395  GLN A CB    1 
ATOM   2791  C  CG    . GLN A 1  395  ? -73.106 -42.639 -18.512 1.00 93.57  ? 395  GLN A CG    1 
ATOM   2792  C  CD    . GLN A 1  395  ? -74.436 -42.184 -17.954 1.00 94.62  ? 395  GLN A CD    1 
ATOM   2793  O  OE1   . GLN A 1  395  ? -74.865 -41.053 -18.187 1.00 93.27  ? 395  GLN A OE1   1 
ATOM   2794  N  NE2   . GLN A 1  395  ? -75.095 -43.062 -17.210 1.00 96.71  ? 395  GLN A NE2   1 
ATOM   2795  N  N     . PHE A 1  396  ? -72.609 -41.491 -22.971 1.00 88.23  ? 396  PHE A N     1 
ATOM   2796  C  CA    . PHE A 1  396  ? -72.433 -41.552 -24.423 1.00 86.61  ? 396  PHE A CA    1 
ATOM   2797  C  C     . PHE A 1  396  ? -71.048 -41.036 -24.820 1.00 84.96  ? 396  PHE A C     1 
ATOM   2798  O  O     . PHE A 1  396  ? -70.363 -41.672 -25.622 1.00 84.38  ? 396  PHE A O     1 
ATOM   2799  C  CB    . PHE A 1  396  ? -73.524 -40.762 -25.154 1.00 86.05  ? 396  PHE A CB    1 
ATOM   2800  C  CG    . PHE A 1  396  ? -73.228 -40.524 -26.608 1.00 84.45  ? 396  PHE A CG    1 
ATOM   2801  C  CD1   . PHE A 1  396  ? -73.391 -41.541 -27.538 1.00 84.49  ? 396  PHE A CD1   1 
ATOM   2802  C  CD2   . PHE A 1  396  ? -72.764 -39.285 -27.047 1.00 83.10  ? 396  PHE A CD2   1 
ATOM   2803  C  CE1   . PHE A 1  396  ? -73.106 -41.327 -28.881 1.00 82.82  ? 396  PHE A CE1   1 
ATOM   2804  C  CE2   . PHE A 1  396  ? -72.478 -39.068 -28.385 1.00 81.77  ? 396  PHE A CE2   1 
ATOM   2805  C  CZ    . PHE A 1  396  ? -72.650 -40.090 -29.304 1.00 81.30  ? 396  PHE A CZ    1 
ATOM   2806  N  N     . LEU A 1  397  ? -70.641 -39.901 -24.248 1.00 84.14  ? 397  LEU A N     1 
ATOM   2807  C  CA    . LEU A 1  397  ? -69.332 -39.292 -24.547 1.00 82.55  ? 397  LEU A CA    1 
ATOM   2808  C  C     . LEU A 1  397  ? -68.143 -40.121 -24.040 1.00 82.48  ? 397  LEU A C     1 
ATOM   2809  O  O     . LEU A 1  397  ? -67.058 -40.062 -24.624 1.00 81.08  ? 397  LEU A O     1 
ATOM   2810  C  CB    . LEU A 1  397  ? -69.266 -37.850 -24.019 1.00 81.68  ? 397  LEU A CB    1 
ATOM   2811  C  CG    . LEU A 1  397  ? -70.249 -36.879 -24.689 1.00 81.08  ? 397  LEU A CG    1 
ATOM   2812  C  CD1   . LEU A 1  397  ? -70.301 -35.551 -23.956 1.00 81.20  ? 397  LEU A CD1   1 
ATOM   2813  C  CD2   . LEU A 1  397  ? -69.908 -36.655 -26.158 1.00 79.81  ? 397  LEU A CD2   1 
ATOM   2814  N  N     . SER A 1  398  ? -68.364 -40.895 -22.974 1.00 83.98  ? 398  SER A N     1 
ATOM   2815  C  CA    . SER A 1  398  ? -67.382 -41.854 -22.450 1.00 84.67  ? 398  SER A CA    1 
ATOM   2816  C  C     . SER A 1  398  ? -67.463 -43.255 -23.090 1.00 85.52  ? 398  SER A C     1 
ATOM   2817  O  O     . SER A 1  398  ? -66.740 -44.159 -22.672 1.00 85.12  ? 398  SER A O     1 
ATOM   2818  C  CB    . SER A 1  398  ? -67.552 -41.982 -20.936 1.00 86.53  ? 398  SER A CB    1 
ATOM   2819  O  OG    . SER A 1  398  ? -67.526 -40.711 -20.315 1.00 86.74  ? 398  SER A OG    1 
ATOM   2820  N  N     . LYS A 1  399  ? -68.341 -43.426 -24.083 1.00 86.90  ? 399  LYS A N     1 
ATOM   2821  C  CA    . LYS A 1  399  ? -68.463 -44.653 -24.886 1.00 88.82  ? 399  LYS A CA    1 
ATOM   2822  C  C     . LYS A 1  399  ? -68.879 -45.896 -24.089 1.00 92.25  ? 399  LYS A C     1 
ATOM   2823  O  O     . LYS A 1  399  ? -68.418 -47.010 -24.370 1.00 92.88  ? 399  LYS A O     1 
ATOM   2824  C  CB    . LYS A 1  399  ? -67.179 -44.913 -25.692 1.00 87.90  ? 399  LYS A CB    1 
ATOM   2825  C  CG    . LYS A 1  399  ? -66.780 -43.758 -26.594 1.00 86.51  ? 399  LYS A CG    1 
ATOM   2826  C  CD    . LYS A 1  399  ? -65.531 -44.077 -27.397 1.00 85.95  ? 399  LYS A CD    1 
ATOM   2827  C  CE    . LYS A 1  399  ? -65.303 -43.023 -28.471 1.00 85.05  ? 399  LYS A CE    1 
ATOM   2828  N  NZ    . LYS A 1  399  ? -64.021 -43.218 -29.200 1.00 84.13  ? 399  LYS A NZ    1 
ATOM   2829  N  N     . CYS A 1  400  ? -69.766 -45.700 -23.111 1.00 95.05  ? 400  CYS A N     1 
ATOM   2830  C  CA    . CYS A 1  400  ? -70.366 -46.810 -22.372 1.00 98.21  ? 400  CYS A CA    1 
ATOM   2831  C  C     . CYS A 1  400  ? -71.330 -47.545 -23.308 1.00 99.92  ? 400  CYS A C     1 
ATOM   2832  O  O     . CYS A 1  400  ? -72.277 -46.924 -23.797 1.00 100.56 ? 400  CYS A O     1 
ATOM   2833  C  CB    . CYS A 1  400  ? -71.123 -46.310 -21.138 1.00 99.65  ? 400  CYS A CB    1 
ATOM   2834  S  SG    . CYS A 1  400  ? -70.072 -45.580 -19.863 1.00 100.16 ? 400  CYS A SG    1 
ATOM   2835  N  N     . PRO A 1  401  ? -71.096 -48.856 -23.568 1.00 101.56 ? 401  PRO A N     1 
ATOM   2836  C  CA    . PRO A 1  401  ? -71.902 -49.626 -24.533 1.00 102.11 ? 401  PRO A CA    1 
ATOM   2837  C  C     . PRO A 1  401  ? -73.417 -49.436 -24.426 1.00 102.68 ? 401  PRO A C     1 
ATOM   2838  O  O     . PRO A 1  401  ? -74.079 -49.217 -25.440 1.00 102.60 ? 401  PRO A O     1 
ATOM   2839  C  CB    . PRO A 1  401  ? -71.522 -51.074 -24.221 1.00 103.58 ? 401  PRO A CB    1 
ATOM   2840  C  CG    . PRO A 1  401  ? -70.116 -50.981 -23.751 1.00 102.86 ? 401  PRO A CG    1 
ATOM   2841  C  CD    . PRO A 1  401  ? -70.017 -49.688 -22.994 1.00 102.18 ? 401  PRO A CD    1 
ATOM   2842  N  N     . ASN A 1  402  ? -73.948 -49.502 -23.209 1.00 103.86 ? 402  ASN A N     1 
ATOM   2843  C  CA    . ASN A 1  402  ? -75.386 -49.303 -22.974 1.00 105.27 ? 402  ASN A CA    1 
ATOM   2844  C  C     . ASN A 1  402  ? -75.929 -47.894 -23.320 1.00 103.39 ? 402  ASN A C     1 
ATOM   2845  O  O     . ASN A 1  402  ? -77.134 -47.743 -23.531 1.00 104.52 ? 402  ASN A O     1 
ATOM   2846  C  CB    . ASN A 1  402  ? -75.784 -49.715 -21.539 1.00 108.02 ? 402  ASN A CB    1 
ATOM   2847  C  CG    . ASN A 1  402  ? -75.008 -48.969 -20.458 1.00 109.06 ? 402  ASN A CG    1 
ATOM   2848  O  OD1   . ASN A 1  402  ? -73.850 -48.587 -20.653 1.00 107.83 ? 402  ASN A OD1   1 
ATOM   2849  N  ND2   . ASN A 1  402  ? -75.640 -48.779 -19.297 1.00 111.07 ? 402  ASN A ND2   1 
ATOM   2850  N  N     . ALA A 1  403  ? -75.054 -46.883 -23.380 1.00 100.04 ? 403  ALA A N     1 
ATOM   2851  C  CA    . ALA A 1  403  ? -75.422 -45.515 -23.802 1.00 97.35  ? 403  ALA A CA    1 
ATOM   2852  C  C     . ALA A 1  403  ? -74.962 -45.147 -25.217 1.00 94.34  ? 403  ALA A C     1 
ATOM   2853  O  O     . ALA A 1  403  ? -75.284 -44.063 -25.705 1.00 93.03  ? 403  ALA A O     1 
ATOM   2854  C  CB    . ALA A 1  403  ? -74.865 -44.504 -22.814 1.00 96.96  ? 403  ALA A CB    1 
ATOM   2855  N  N     . ASP A 1  404  ? -74.219 -46.041 -25.863 1.00 92.93  ? 404  ASP A N     1 
ATOM   2856  C  CA    . ASP A 1  404  ? -73.614 -45.780 -27.168 1.00 90.68  ? 404  ASP A CA    1 
ATOM   2857  C  C     . ASP A 1  404  ? -74.582 -46.191 -28.278 1.00 90.43  ? 404  ASP A C     1 
ATOM   2858  O  O     . ASP A 1  404  ? -75.681 -46.680 -28.006 1.00 91.80  ? 404  ASP A O     1 
ATOM   2859  C  CB    . ASP A 1  404  ? -72.302 -46.584 -27.280 1.00 89.77  ? 404  ASP A CB    1 
ATOM   2860  C  CG    . ASP A 1  404  ? -71.322 -46.010 -28.298 1.00 87.77  ? 404  ASP A CG    1 
ATOM   2861  O  OD1   . ASP A 1  404  ? -71.691 -45.098 -29.066 1.00 86.09  ? 404  ASP A OD1   1 
ATOM   2862  O  OD2   . ASP A 1  404  ? -70.169 -46.484 -28.332 1.00 87.59  ? 404  ASP A OD2   1 
ATOM   2863  N  N     . LEU A 1  405  ? -74.188 -45.953 -29.528 1.00 89.05  ? 405  LEU A N     1 
ATOM   2864  C  CA    . LEU A 1  405  ? -74.830 -46.590 -30.679 1.00 89.21  ? 405  LEU A CA    1 
ATOM   2865  C  C     . LEU A 1  405  ? -74.450 -48.055 -30.691 1.00 90.06  ? 405  LEU A C     1 
ATOM   2866  O  O     . LEU A 1  405  ? -73.353 -48.420 -30.262 1.00 90.86  ? 405  LEU A O     1 
ATOM   2867  C  CB    . LEU A 1  405  ? -74.374 -45.976 -32.010 1.00 87.21  ? 405  LEU A CB    1 
ATOM   2868  C  CG    . LEU A 1  405  ? -74.963 -44.636 -32.446 1.00 86.43  ? 405  LEU A CG    1 
ATOM   2869  C  CD1   . LEU A 1  405  ? -74.416 -43.485 -31.615 1.00 85.71  ? 405  LEU A CD1   1 
ATOM   2870  C  CD2   . LEU A 1  405  ? -74.691 -44.410 -33.928 1.00 85.19  ? 405  LEU A CD2   1 
ATOM   2871  N  N     . LYS A 1  406  ? -75.350 -48.890 -31.200 1.00 91.21  ? 406  LYS A N     1 
ATOM   2872  C  CA    . LYS A 1  406  ? -75.027 -50.283 -31.498 1.00 91.99  ? 406  LYS A CA    1 
ATOM   2873  C  C     . LYS A 1  406  ? -74.113 -50.313 -32.728 1.00 90.25  ? 406  LYS A C     1 
ATOM   2874  O  O     . LYS A 1  406  ? -74.104 -49.356 -33.512 1.00 89.04  ? 406  LYS A O     1 
ATOM   2875  C  CB    . LYS A 1  406  ? -76.294 -51.096 -31.772 1.00 94.05  ? 406  LYS A CB    1 
ATOM   2876  C  CG    . LYS A 1  406  ? -77.266 -51.185 -30.601 1.00 95.95  ? 406  LYS A CG    1 
ATOM   2877  C  CD    . LYS A 1  406  ? -78.678 -51.483 -31.081 1.00 97.58  ? 406  LYS A CD    1 
ATOM   2878  C  CE    . LYS A 1  406  ? -79.648 -51.626 -29.921 1.00 99.56  ? 406  LYS A CE    1 
ATOM   2879  N  NZ    . LYS A 1  406  ? -81.013 -52.007 -30.381 1.00 100.99 ? 406  LYS A NZ    1 
ATOM   2880  N  N     . PRO A 1  407  ? -73.350 -51.410 -32.920 1.00 89.86  ? 407  PRO A N     1 
ATOM   2881  C  CA    . PRO A 1  407  ? -72.506 -51.499 -34.122 1.00 88.43  ? 407  PRO A CA    1 
ATOM   2882  C  C     . PRO A 1  407  ? -73.241 -51.439 -35.481 1.00 87.89  ? 407  PRO A C     1 
ATOM   2883  O  O     . PRO A 1  407  ? -72.606 -51.115 -36.487 1.00 86.97  ? 407  PRO A O     1 
ATOM   2884  C  CB    . PRO A 1  407  ? -71.792 -52.849 -33.951 1.00 89.16  ? 407  PRO A CB    1 
ATOM   2885  C  CG    . PRO A 1  407  ? -71.824 -53.119 -32.486 1.00 90.06  ? 407  PRO A CG    1 
ATOM   2886  C  CD    . PRO A 1  407  ? -73.130 -52.556 -32.016 1.00 90.94  ? 407  PRO A CD    1 
ATOM   2887  N  N     . GLN A 1  408  ? -74.549 -51.719 -35.505 1.00 88.82  ? 408  GLN A N     1 
ATOM   2888  C  CA    . GLN A 1  408  ? -75.314 -51.830 -36.755 1.00 89.29  ? 408  GLN A CA    1 
ATOM   2889  C  C     . GLN A 1  408  ? -76.084 -50.562 -37.144 1.00 87.58  ? 408  GLN A C     1 
ATOM   2890  O  O     . GLN A 1  408  ? -76.745 -50.556 -38.184 1.00 87.56  ? 408  GLN A O     1 
ATOM   2891  C  CB    . GLN A 1  408  ? -76.315 -52.999 -36.696 1.00 92.64  ? 408  GLN A CB    1 
ATOM   2892  C  CG    . GLN A 1  408  ? -75.833 -54.263 -35.986 1.00 95.02  ? 408  GLN A CG    1 
ATOM   2893  C  CD    . GLN A 1  408  ? -76.165 -54.301 -34.496 1.00 97.23  ? 408  GLN A CD    1 
ATOM   2894  O  OE1   . GLN A 1  408  ? -76.882 -53.441 -33.973 1.00 97.39  ? 408  GLN A OE1   1 
ATOM   2895  N  NE2   . GLN A 1  408  ? -75.632 -55.302 -33.802 1.00 98.71  ? 408  GLN A NE2   1 
ATOM   2896  N  N     . GLU A 1  409  ? -76.007 -49.501 -36.338 1.00 85.93  ? 409  GLU A N     1 
ATOM   2897  C  CA    . GLU A 1  409  ? -76.819 -48.297 -36.575 1.00 85.18  ? 409  GLU A CA    1 
ATOM   2898  C  C     . GLU A 1  409  ? -75.986 -47.037 -36.780 1.00 82.18  ? 409  GLU A C     1 
ATOM   2899  O  O     . GLU A 1  409  ? -74.805 -46.992 -36.422 1.00 81.62  ? 409  GLU A O     1 
ATOM   2900  C  CB    . GLU A 1  409  ? -77.864 -48.103 -35.461 1.00 86.75  ? 409  GLU A CB    1 
ATOM   2901  C  CG    . GLU A 1  409  ? -77.337 -47.880 -34.051 1.00 86.94  ? 409  GLU A CG    1 
ATOM   2902  C  CD    . GLU A 1  409  ? -78.431 -47.975 -32.984 1.00 88.51  ? 409  GLU A CD    1 
ATOM   2903  O  OE1   . GLU A 1  409  ? -79.638 -47.887 -33.309 1.00 89.14  ? 409  GLU A OE1   1 
ATOM   2904  O  OE2   . GLU A 1  409  ? -78.079 -48.138 -31.798 1.00 88.14  ? 409  GLU A OE2   1 
ATOM   2905  N  N     . ILE A 1  410  ? -76.622 -46.030 -37.378 1.00 80.36  ? 410  ILE A N     1 
ATOM   2906  C  CA    . ILE A 1  410  ? -75.988 -44.748 -37.693 1.00 78.13  ? 410  ILE A CA    1 
ATOM   2907  C  C     . ILE A 1  410  ? -76.714 -43.593 -37.020 1.00 77.64  ? 410  ILE A C     1 
ATOM   2908  O  O     . ILE A 1  410  ? -77.877 -43.716 -36.640 1.00 78.88  ? 410  ILE A O     1 
ATOM   2909  C  CB    . ILE A 1  410  ? -75.960 -44.466 -39.213 1.00 77.50  ? 410  ILE A CB    1 
ATOM   2910  C  CG1   . ILE A 1  410  ? -77.378 -44.395 -39.808 1.00 78.52  ? 410  ILE A CG1   1 
ATOM   2911  C  CG2   . ILE A 1  410  ? -75.135 -45.526 -39.925 1.00 77.59  ? 410  ILE A CG2   1 
ATOM   2912  C  CD1   . ILE A 1  410  ? -77.429 -43.810 -41.201 1.00 77.91  ? 410  ILE A CD1   1 
ATOM   2913  N  N     . LEU A 1  411  ? -76.012 -42.471 -36.908 1.00 75.47  ? 411  LEU A N     1 
ATOM   2914  C  CA    . LEU A 1  411  ? -76.590 -41.212 -36.459 1.00 74.39  ? 411  LEU A CA    1 
ATOM   2915  C  C     . LEU A 1  411  ? -77.192 -40.503 -37.674 1.00 74.18  ? 411  LEU A C     1 
ATOM   2916  O  O     . LEU A 1  411  ? -76.485 -40.222 -38.641 1.00 72.69  ? 411  LEU A O     1 
ATOM   2917  C  CB    . LEU A 1  411  ? -75.503 -40.352 -35.805 1.00 72.64  ? 411  LEU A CB    1 
ATOM   2918  C  CG    . LEU A 1  411  ? -75.831 -38.937 -35.328 1.00 71.83  ? 411  LEU A CG    1 
ATOM   2919  C  CD1   . LEU A 1  411  ? -77.114 -38.893 -34.517 1.00 73.25  ? 411  LEU A CD1   1 
ATOM   2920  C  CD2   . LEU A 1  411  ? -74.658 -38.404 -34.522 1.00 70.66  ? 411  LEU A CD2   1 
ATOM   2921  N  N     . VAL A 1  412  ? -78.495 -40.237 -37.628 1.00 75.64  ? 412  VAL A N     1 
ATOM   2922  C  CA    . VAL A 1  412  ? -79.200 -39.545 -38.717 1.00 76.15  ? 412  VAL A CA    1 
ATOM   2923  C  C     . VAL A 1  412  ? -79.166 -38.035 -38.499 1.00 75.23  ? 412  VAL A C     1 
ATOM   2924  O  O     . VAL A 1  412  ? -78.831 -37.273 -39.407 1.00 73.18  ? 412  VAL A O     1 
ATOM   2925  C  CB    . VAL A 1  412  ? -80.678 -40.000 -38.823 1.00 77.75  ? 412  VAL A CB    1 
ATOM   2926  C  CG1   . VAL A 1  412  ? -81.388 -39.302 -39.985 1.00 77.76  ? 412  VAL A CG1   1 
ATOM   2927  C  CG2   . VAL A 1  412  ? -80.755 -41.513 -38.970 1.00 78.87  ? 412  VAL A CG2   1 
ATOM   2928  N  N     . SER A 1  413  ? -79.536 -37.622 -37.293 1.00 76.30  ? 413  SER A N     1 
ATOM   2929  C  CA    . SER A 1  413  ? -79.607 -36.212 -36.934 1.00 76.72  ? 413  SER A CA    1 
ATOM   2930  C  C     . SER A 1  413  ? -79.563 -36.028 -35.422 1.00 77.44  ? 413  SER A C     1 
ATOM   2931  O  O     . SER A 1  413  ? -79.726 -36.988 -34.663 1.00 77.46  ? 413  SER A O     1 
ATOM   2932  C  CB    . SER A 1  413  ? -80.898 -35.598 -37.481 1.00 77.93  ? 413  SER A CB    1 
ATOM   2933  O  OG    . SER A 1  413  ? -82.041 -36.253 -36.955 1.00 79.29  ? 413  SER A OG    1 
ATOM   2934  N  N     . VAL A 1  414  ? -79.362 -34.781 -35.005 1.00 77.89  ? 414  VAL A N     1 
ATOM   2935  C  CA    . VAL A 1  414  ? -79.327 -34.401 -33.587 1.00 78.12  ? 414  VAL A CA    1 
ATOM   2936  C  C     . VAL A 1  414  ? -80.358 -33.304 -33.327 1.00 78.64  ? 414  VAL A C     1 
ATOM   2937  O  O     . VAL A 1  414  ? -80.498 -32.376 -34.123 1.00 77.69  ? 414  VAL A O     1 
ATOM   2938  C  CB    . VAL A 1  414  ? -77.909 -33.952 -33.133 1.00 76.84  ? 414  VAL A CB    1 
ATOM   2939  C  CG1   . VAL A 1  414  ? -77.408 -32.738 -33.908 1.00 75.71  ? 414  VAL A CG1   1 
ATOM   2940  C  CG2   . VAL A 1  414  ? -77.877 -33.671 -31.634 1.00 77.53  ? 414  VAL A CG2   1 
ATOM   2941  N  N     . ASN A 1  415  ? -81.072 -33.433 -32.210 1.00 80.36  ? 415  ASN A N     1 
ATOM   2942  C  CA    . ASN A 1  415  ? -82.056 -32.447 -31.772 1.00 81.32  ? 415  ASN A CA    1 
ATOM   2943  C  C     . ASN A 1  415  ? -81.430 -31.529 -30.737 1.00 80.35  ? 415  ASN A C     1 
ATOM   2944  O  O     . ASN A 1  415  ? -80.912 -32.004 -29.725 1.00 79.99  ? 415  ASN A O     1 
ATOM   2945  C  CB    . ASN A 1  415  ? -83.270 -33.147 -31.163 1.00 83.93  ? 415  ASN A CB    1 
ATOM   2946  C  CG    . ASN A 1  415  ? -83.903 -34.150 -32.113 1.00 85.44  ? 415  ASN A CG    1 
ATOM   2947  O  OD1   . ASN A 1  415  ? -84.103 -33.861 -33.293 1.00 85.98  ? 415  ASN A OD1   1 
ATOM   2948  N  ND2   . ASN A 1  415  ? -84.224 -35.335 -31.600 1.00 86.69  ? 415  ASN A ND2   1 
ATOM   2949  N  N     . ILE A 1  416  ? -81.465 -30.225 -31.003 1.00 80.00  ? 416  ILE A N     1 
ATOM   2950  C  CA    . ILE A 1  416  ? -80.941 -29.205 -30.094 1.00 79.61  ? 416  ILE A CA    1 
ATOM   2951  C  C     . ILE A 1  416  ? -82.118 -28.301 -29.738 1.00 81.00  ? 416  ILE A C     1 
ATOM   2952  O  O     . ILE A 1  416  ? -82.538 -27.488 -30.563 1.00 81.64  ? 416  ILE A O     1 
ATOM   2953  C  CB    . ILE A 1  416  ? -79.810 -28.368 -30.741 1.00 77.96  ? 416  ILE A CB    1 
ATOM   2954  C  CG1   . ILE A 1  416  ? -78.719 -29.275 -31.332 1.00 76.78  ? 416  ILE A CG1   1 
ATOM   2955  C  CG2   . ILE A 1  416  ? -79.200 -27.415 -29.716 1.00 77.69  ? 416  ILE A CG2   1 
ATOM   2956  C  CD1   . ILE A 1  416  ? -77.844 -28.593 -32.360 1.00 75.53  ? 416  ILE A CD1   1 
ATOM   2957  N  N     . PRO A 1  417  ? -82.665 -28.441 -28.517 1.00 82.08  ? 417  PRO A N     1 
ATOM   2958  C  CA    . PRO A 1  417  ? -83.885 -27.699 -28.198 1.00 83.67  ? 417  PRO A CA    1 
ATOM   2959  C  C     . PRO A 1  417  ? -83.666 -26.192 -27.994 1.00 83.52  ? 417  PRO A C     1 
ATOM   2960  O  O     . PRO A 1  417  ? -82.545 -25.754 -27.705 1.00 82.42  ? 417  PRO A O     1 
ATOM   2961  C  CB    . PRO A 1  417  ? -84.367 -28.366 -26.905 1.00 84.67  ? 417  PRO A CB    1 
ATOM   2962  C  CG    . PRO A 1  417  ? -83.126 -28.865 -26.258 1.00 83.78  ? 417  PRO A CG    1 
ATOM   2963  C  CD    . PRO A 1  417  ? -82.185 -29.233 -27.370 1.00 82.31  ? 417  PRO A CD    1 
ATOM   2964  N  N     . TYR A 1  418  ? -84.740 -25.418 -28.170 1.00 84.43  ? 418  TYR A N     1 
ATOM   2965  C  CA    . TYR A 1  418  ? -84.754 -24.007 -27.793 1.00 84.56  ? 418  TYR A CA    1 
ATOM   2966  C  C     . TYR A 1  418  ? -84.626 -23.914 -26.287 1.00 84.60  ? 418  TYR A C     1 
ATOM   2967  O  O     . TYR A 1  418  ? -85.113 -24.782 -25.563 1.00 85.55  ? 418  TYR A O     1 
ATOM   2968  C  CB    . TYR A 1  418  ? -86.067 -23.307 -28.183 1.00 86.39  ? 418  TYR A CB    1 
ATOM   2969  C  CG    . TYR A 1  418  ? -86.391 -23.224 -29.660 1.00 86.67  ? 418  TYR A CG    1 
ATOM   2970  C  CD1   . TYR A 1  418  ? -85.397 -23.003 -30.615 1.00 85.94  ? 418  TYR A CD1   1 
ATOM   2971  C  CD2   . TYR A 1  418  ? -87.712 -23.318 -30.102 1.00 88.36  ? 418  TYR A CD2   1 
ATOM   2972  C  CE1   . TYR A 1  418  ? -85.705 -22.920 -31.968 1.00 86.14  ? 418  TYR A CE1   1 
ATOM   2973  C  CE2   . TYR A 1  418  ? -88.030 -23.232 -31.452 1.00 88.60  ? 418  TYR A CE2   1 
ATOM   2974  C  CZ    . TYR A 1  418  ? -87.028 -23.033 -32.381 1.00 87.46  ? 418  TYR A CZ    1 
ATOM   2975  O  OH    . TYR A 1  418  ? -87.357 -22.950 -33.715 1.00 87.40  ? 418  TYR A OH    1 
ATOM   2976  N  N     . SER A 1  419  ? -83.984 -22.852 -25.821 1.00 83.89  ? 419  SER A N     1 
ATOM   2977  C  CA    . SER A 1  419  ? -83.917 -22.564 -24.396 1.00 84.52  ? 419  SER A CA    1 
ATOM   2978  C  C     . SER A 1  419  ? -85.245 -21.978 -23.921 1.00 86.45  ? 419  SER A C     1 
ATOM   2979  O  O     . SER A 1  419  ? -86.012 -21.421 -24.708 1.00 86.93  ? 419  SER A O     1 
ATOM   2980  C  CB    . SER A 1  419  ? -82.769 -21.602 -24.100 1.00 83.87  ? 419  SER A CB    1 
ATOM   2981  O  OG    . SER A 1  419  ? -82.720 -20.577 -25.073 1.00 83.65  ? 419  SER A OG    1 
ATOM   2982  N  N     . ARG A 1  420  ? -85.513 -22.137 -22.630 1.00 87.69  ? 420  ARG A N     1 
ATOM   2983  C  CA    . ARG A 1  420  ? -86.691 -21.560 -21.986 1.00 88.75  ? 420  ARG A CA    1 
ATOM   2984  C  C     . ARG A 1  420  ? -86.311 -20.206 -21.393 1.00 89.16  ? 420  ARG A C     1 
ATOM   2985  O  O     . ARG A 1  420  ? -85.140 -19.819 -21.421 1.00 88.23  ? 420  ARG A O     1 
ATOM   2986  C  CB    . ARG A 1  420  ? -87.199 -22.501 -20.891 1.00 89.57  ? 420  ARG A CB    1 
ATOM   2987  C  CG    . ARG A 1  420  ? -87.666 -23.861 -21.402 1.00 89.41  ? 420  ARG A CG    1 
ATOM   2988  C  CD    . ARG A 1  420  ? -87.757 -24.890 -20.283 1.00 89.91  ? 420  ARG A CD    1 
ATOM   2989  N  NE    . ARG A 1  420  ? -86.438 -25.291 -19.783 1.00 88.69  ? 420  ARG A NE    1 
ATOM   2990  C  CZ    . ARG A 1  420  ? -86.223 -26.157 -18.790 1.00 88.90  ? 420  ARG A CZ    1 
ATOM   2991  N  NH1   . ARG A 1  420  ? -87.237 -26.742 -18.153 1.00 90.66  ? 420  ARG A NH1   1 
ATOM   2992  N  NH2   . ARG A 1  420  ? -84.975 -26.441 -18.421 1.00 87.50  ? 420  ARG A NH2   1 
ATOM   2993  N  N     . LYS A 1  421  ? -87.300 -19.482 -20.870 1.00 91.24  ? 421  LYS A N     1 
ATOM   2994  C  CA    . LYS A 1  421  ? -87.033 -18.253 -20.117 1.00 91.86  ? 421  LYS A CA    1 
ATOM   2995  C  C     . LYS A 1  421  ? -86.307 -18.626 -18.824 1.00 91.94  ? 421  LYS A C     1 
ATOM   2996  O  O     . LYS A 1  421  ? -86.609 -19.652 -18.210 1.00 92.57  ? 421  LYS A O     1 
ATOM   2997  C  CB    . LYS A 1  421  ? -88.324 -17.486 -19.802 1.00 93.91  ? 421  LYS A CB    1 
ATOM   2998  C  CG    . LYS A 1  421  ? -88.090 -16.047 -19.339 1.00 94.86  ? 421  LYS A CG    1 
ATOM   2999  C  CD    . LYS A 1  421  ? -89.340 -15.388 -18.770 1.00 96.62  ? 421  LYS A CD    1 
ATOM   3000  C  CE    . LYS A 1  421  ? -90.294 -14.931 -19.861 1.00 97.31  ? 421  LYS A CE    1 
ATOM   3001  N  NZ    . LYS A 1  421  ? -91.578 -14.436 -19.292 1.00 99.31  ? 421  LYS A NZ    1 
ATOM   3002  N  N     . TRP A 1  422  ? -85.348 -17.788 -18.435 1.00 91.29  ? 422  TRP A N     1 
ATOM   3003  C  CA    . TRP A 1  422  ? -84.467 -18.034 -17.283 1.00 91.02  ? 422  TRP A CA    1 
ATOM   3004  C  C     . TRP A 1  422  ? -83.583 -19.276 -17.452 1.00 89.49  ? 422  TRP A C     1 
ATOM   3005  O  O     . TRP A 1  422  ? -83.194 -19.903 -16.465 1.00 89.35  ? 422  TRP A O     1 
ATOM   3006  C  CB    . TRP A 1  422  ? -85.259 -18.111 -15.968 1.00 93.11  ? 422  TRP A CB    1 
ATOM   3007  C  CG    . TRP A 1  422  ? -86.265 -17.024 -15.807 1.00 94.45  ? 422  TRP A CG    1 
ATOM   3008  C  CD1   . TRP A 1  422  ? -87.595 -17.094 -16.086 1.00 95.62  ? 422  TRP A CD1   1 
ATOM   3009  C  CD2   . TRP A 1  422  ? -86.019 -15.697 -15.338 1.00 94.96  ? 422  TRP A CD2   1 
ATOM   3010  N  NE1   . TRP A 1  422  ? -88.198 -15.889 -15.821 1.00 97.03  ? 422  TRP A NE1   1 
ATOM   3011  C  CE2   . TRP A 1  422  ? -87.254 -15.013 -15.359 1.00 96.43  ? 422  TRP A CE2   1 
ATOM   3012  C  CE3   . TRP A 1  422  ? -84.875 -15.018 -14.899 1.00 94.55  ? 422  TRP A CE3   1 
ATOM   3013  C  CZ2   . TRP A 1  422  ? -87.380 -13.680 -14.959 1.00 97.10  ? 422  TRP A CZ2   1 
ATOM   3014  C  CZ3   . TRP A 1  422  ? -85.001 -13.689 -14.499 1.00 95.49  ? 422  TRP A CZ3   1 
ATOM   3015  C  CH2   . TRP A 1  422  ? -86.246 -13.037 -14.535 1.00 96.55  ? 422  TRP A CH2   1 
ATOM   3016  N  N     . GLU A 1  423  ? -83.269 -19.616 -18.704 1.00 87.95  ? 423  GLU A N     1 
ATOM   3017  C  CA    . GLU A 1  423  ? -82.330 -20.678 -19.019 1.00 87.05  ? 423  GLU A CA    1 
ATOM   3018  C  C     . GLU A 1  423  ? -81.191 -20.052 -19.807 1.00 85.48  ? 423  GLU A C     1 
ATOM   3019  O  O     . GLU A 1  423  ? -81.424 -19.425 -20.841 1.00 84.67  ? 423  GLU A O     1 
ATOM   3020  C  CB    . GLU A 1  423  ? -82.993 -21.782 -19.840 1.00 87.64  ? 423  GLU A CB    1 
ATOM   3021  C  CG    . GLU A 1  423  ? -82.077 -22.972 -20.084 1.00 87.19  ? 423  GLU A CG    1 
ATOM   3022  C  CD    . GLU A 1  423  ? -82.829 -24.226 -20.468 1.00 88.18  ? 423  GLU A CD    1 
ATOM   3023  O  OE1   . GLU A 1  423  ? -83.488 -24.233 -21.529 1.00 87.60  ? 423  GLU A OE1   1 
ATOM   3024  O  OE2   . GLU A 1  423  ? -82.755 -25.210 -19.704 1.00 89.62  ? 423  GLU A OE2   1 
ATOM   3025  N  N     . PHE A 1  424  ? -79.970 -20.217 -19.304 1.00 84.66  ? 424  PHE A N     1 
ATOM   3026  C  CA    . PHE A 1  424  ? -78.784 -19.584 -19.873 1.00 83.93  ? 424  PHE A CA    1 
ATOM   3027  C  C     . PHE A 1  424  ? -77.695 -20.632 -20.091 1.00 84.35  ? 424  PHE A C     1 
ATOM   3028  O  O     . PHE A 1  424  ? -77.580 -21.580 -19.316 1.00 85.05  ? 424  PHE A O     1 
ATOM   3029  C  CB    . PHE A 1  424  ? -78.291 -18.460 -18.953 1.00 83.77  ? 424  PHE A CB    1 
ATOM   3030  C  CG    . PHE A 1  424  ? -79.397 -17.587 -18.427 1.00 84.58  ? 424  PHE A CG    1 
ATOM   3031  C  CD1   . PHE A 1  424  ? -80.246 -16.919 -19.307 1.00 84.45  ? 424  PHE A CD1   1 
ATOM   3032  C  CD2   . PHE A 1  424  ? -79.615 -17.451 -17.060 1.00 85.28  ? 424  PHE A CD2   1 
ATOM   3033  C  CE1   . PHE A 1  424  ? -81.285 -16.129 -18.834 1.00 85.48  ? 424  PHE A CE1   1 
ATOM   3034  C  CE2   . PHE A 1  424  ? -80.647 -16.658 -16.583 1.00 86.49  ? 424  PHE A CE2   1 
ATOM   3035  C  CZ    . PHE A 1  424  ? -81.480 -15.994 -17.472 1.00 86.55  ? 424  PHE A CZ    1 
ATOM   3036  N  N     . VAL A 1  425  ? -76.907 -20.456 -21.149 1.00 84.33  ? 425  VAL A N     1 
ATOM   3037  C  CA    . VAL A 1  425  ? -75.800 -21.362 -21.473 1.00 84.88  ? 425  VAL A CA    1 
ATOM   3038  C  C     . VAL A 1  425  ? -74.596 -20.550 -21.931 1.00 82.97  ? 425  VAL A C     1 
ATOM   3039  O  O     . VAL A 1  425  ? -74.749 -19.560 -22.648 1.00 83.07  ? 425  VAL A O     1 
ATOM   3040  C  CB    . VAL A 1  425  ? -76.134 -22.441 -22.560 1.00 86.11  ? 425  VAL A CB    1 
ATOM   3041  C  CG1   . VAL A 1  425  ? -76.119 -23.842 -21.969 1.00 87.36  ? 425  VAL A CG1   1 
ATOM   3042  C  CG2   . VAL A 1  425  ? -77.455 -22.180 -23.273 1.00 86.67  ? 425  VAL A CG2   1 
ATOM   3043  N  N     . SER A 1  426  ? -73.410 -20.978 -21.507 1.00 81.14  ? 426  SER A N     1 
ATOM   3044  C  CA    . SER A 1  426  ? -72.163 -20.342 -21.904 1.00 79.81  ? 426  SER A CA    1 
ATOM   3045  C  C     . SER A 1  426  ? -71.147 -21.387 -22.321 1.00 77.90  ? 426  SER A C     1 
ATOM   3046  O  O     . SER A 1  426  ? -71.130 -22.501 -21.795 1.00 77.80  ? 426  SER A O     1 
ATOM   3047  C  CB    . SER A 1  426  ? -71.598 -19.518 -20.754 1.00 80.75  ? 426  SER A CB    1 
ATOM   3048  O  OG    . SER A 1  426  ? -72.447 -18.429 -20.457 1.00 82.47  ? 426  SER A OG    1 
ATOM   3049  N  N     . ALA A 1  427  ? -70.302 -21.005 -23.272 1.00 76.17  ? 427  ALA A N     1 
ATOM   3050  C  CA    . ALA A 1  427  ? -69.192 -21.830 -23.720 1.00 75.15  ? 427  ALA A CA    1 
ATOM   3051  C  C     . ALA A 1  427  ? -67.899 -21.053 -23.541 1.00 73.47  ? 427  ALA A C     1 
ATOM   3052  O  O     . ALA A 1  427  ? -67.842 -19.869 -23.878 1.00 73.13  ? 427  ALA A O     1 
ATOM   3053  C  CB    . ALA A 1  427  ? -69.377 -22.213 -25.179 1.00 75.12  ? 427  ALA A CB    1 
ATOM   3054  N  N     . PHE A 1  428  ? -66.872 -21.713 -23.010 1.00 72.68  ? 428  PHE A N     1 
ATOM   3055  C  CA    . PHE A 1  428  ? -65.551 -21.101 -22.832 1.00 71.94  ? 428  PHE A CA    1 
ATOM   3056  C  C     . PHE A 1  428  ? -64.466 -21.995 -23.396 1.00 70.49  ? 428  PHE A C     1 
ATOM   3057  O  O     . PHE A 1  428  ? -64.629 -23.206 -23.446 1.00 70.15  ? 428  PHE A O     1 
ATOM   3058  C  CB    . PHE A 1  428  ? -65.272 -20.846 -21.355 1.00 72.81  ? 428  PHE A CB    1 
ATOM   3059  C  CG    . PHE A 1  428  ? -66.320 -20.020 -20.679 1.00 73.87  ? 428  PHE A CG    1 
ATOM   3060  C  CD1   . PHE A 1  428  ? -66.336 -18.637 -20.832 1.00 73.95  ? 428  PHE A CD1   1 
ATOM   3061  C  CD2   . PHE A 1  428  ? -67.304 -20.624 -19.901 1.00 75.04  ? 428  PHE A CD2   1 
ATOM   3062  C  CE1   . PHE A 1  428  ? -67.308 -17.868 -20.211 1.00 75.07  ? 428  PHE A CE1   1 
ATOM   3063  C  CE2   . PHE A 1  428  ? -68.278 -19.861 -19.277 1.00 75.99  ? 428  PHE A CE2   1 
ATOM   3064  C  CZ    . PHE A 1  428  ? -68.282 -18.481 -19.432 1.00 76.30  ? 428  PHE A CZ    1 
ATOM   3065  N  N     . ARG A 1  429  ? -63.365 -21.393 -23.833 1.00 70.12  ? 429  ARG A N     1 
ATOM   3066  C  CA    . ARG A 1  429  ? -62.189 -22.158 -24.255 1.00 69.66  ? 429  ARG A CA    1 
ATOM   3067  C  C     . ARG A 1  429  ? -60.902 -21.349 -24.137 1.00 69.40  ? 429  ARG A C     1 
ATOM   3068  O  O     . ARG A 1  429  ? -60.914 -20.121 -24.281 1.00 69.41  ? 429  ARG A O     1 
ATOM   3069  C  CB    . ARG A 1  429  ? -62.357 -22.682 -25.693 1.00 68.74  ? 429  ARG A CB    1 
ATOM   3070  C  CG    . ARG A 1  429  ? -62.081 -21.674 -26.808 1.00 67.91  ? 429  ARG A CG    1 
ATOM   3071  C  CD    . ARG A 1  429  ? -62.562 -22.184 -28.155 1.00 67.41  ? 429  ARG A CD    1 
ATOM   3072  N  NE    . ARG A 1  429  ? -61.916 -23.441 -28.543 1.00 67.35  ? 429  ARG A NE    1 
ATOM   3073  C  CZ    . ARG A 1  429  ? -60.777 -23.561 -29.234 1.00 66.71  ? 429  ARG A CZ    1 
ATOM   3074  N  NH1   . ARG A 1  429  ? -60.081 -22.496 -29.634 1.00 66.72  ? 429  ARG A NH1   1 
ATOM   3075  N  NH2   . ARG A 1  429  ? -60.312 -24.776 -29.522 1.00 66.08  ? 429  ARG A NH2   1 
ATOM   3076  N  N     . GLN A 1  430  ? -59.802 -22.050 -23.874 1.00 69.32  ? 430  GLN A N     1 
ATOM   3077  C  CA    . GLN A 1  430  ? -58.469 -21.472 -23.978 1.00 69.42  ? 430  GLN A CA    1 
ATOM   3078  C  C     . GLN A 1  430  ? -57.536 -22.424 -24.704 1.00 69.14  ? 430  GLN A C     1 
ATOM   3079  O  O     . GLN A 1  430  ? -57.579 -23.638 -24.484 1.00 69.06  ? 430  GLN A O     1 
ATOM   3080  C  CB    . GLN A 1  430  ? -57.898 -21.139 -22.602 1.00 70.60  ? 430  GLN A CB    1 
ATOM   3081  C  CG    . GLN A 1  430  ? -56.576 -20.379 -22.648 1.00 70.63  ? 430  GLN A CG    1 
ATOM   3082  C  CD    . GLN A 1  430  ? -56.669 -19.063 -23.407 1.00 70.47  ? 430  GLN A CD    1 
ATOM   3083  O  OE1   . GLN A 1  430  ? -57.698 -18.390 -23.387 1.00 71.69  ? 430  GLN A OE1   1 
ATOM   3084  N  NE2   . GLN A 1  430  ? -55.590 -18.693 -24.080 1.00 70.19  ? 430  GLN A NE2   1 
ATOM   3085  N  N     . ALA A 1  431  ? -56.688 -21.846 -25.555 1.00 69.14  ? 431  ALA A N     1 
ATOM   3086  C  CA    . ALA A 1  431  ? -55.745 -22.586 -26.382 1.00 68.14  ? 431  ALA A CA    1 
ATOM   3087  C  C     . ALA A 1  431  ? -54.458 -21.774 -26.508 1.00 68.81  ? 431  ALA A C     1 
ATOM   3088  O  O     . ALA A 1  431  ? -54.321 -20.735 -25.863 1.00 70.18  ? 431  ALA A O     1 
ATOM   3089  C  CB    . ALA A 1  431  ? -56.366 -22.832 -27.745 1.00 67.69  ? 431  ALA A CB    1 
ATOM   3090  N  N     . GLN A 1  432  ? -53.523 -22.248 -27.332 1.00 69.37  ? 432  GLN A N     1 
ATOM   3091  C  CA    . GLN A 1  432  ? -52.248 -21.553 -27.578 1.00 69.04  ? 432  GLN A CA    1 
ATOM   3092  C  C     . GLN A 1  432  ? -52.414 -20.224 -28.335 1.00 69.98  ? 432  GLN A C     1 
ATOM   3093  O  O     . GLN A 1  432  ? -51.616 -19.299 -28.155 1.00 70.17  ? 432  GLN A O     1 
ATOM   3094  C  CB    . GLN A 1  432  ? -51.292 -22.464 -28.353 1.00 67.72  ? 432  GLN A CB    1 
ATOM   3095  C  CG    . GLN A 1  432  ? -49.821 -22.114 -28.191 1.00 67.48  ? 432  GLN A CG    1 
ATOM   3096  C  CD    . GLN A 1  432  ? -49.257 -22.499 -26.836 1.00 68.03  ? 432  GLN A CD    1 
ATOM   3097  O  OE1   . GLN A 1  432  ? -49.937 -23.122 -26.014 1.00 69.05  ? 432  GLN A OE1   1 
ATOM   3098  N  NE2   . GLN A 1  432  ? -47.999 -22.131 -26.597 1.00 67.57  ? 432  GLN A NE2   1 
ATOM   3099  N  N     . ARG A 1  433  ? -53.424 -20.159 -29.203 1.00 70.95  ? 433  ARG A N     1 
ATOM   3100  C  CA    . ARG A 1  433  ? -53.820 -18.925 -29.894 1.00 72.19  ? 433  ARG A CA    1 
ATOM   3101  C  C     . ARG A 1  433  ? -55.330 -18.958 -30.135 1.00 73.29  ? 433  ARG A C     1 
ATOM   3102  O  O     . ARG A 1  433  ? -55.952 -20.009 -29.992 1.00 72.53  ? 433  ARG A O     1 
ATOM   3103  C  CB    . ARG A 1  433  ? -53.059 -18.766 -31.213 1.00 71.78  ? 433  ARG A CB    1 
ATOM   3104  C  CG    . ARG A 1  433  ? -53.206 -19.957 -32.146 1.00 72.00  ? 433  ARG A CG    1 
ATOM   3105  C  CD    . ARG A 1  433  ? -52.517 -19.771 -33.488 1.00 71.62  ? 433  ARG A CD    1 
ATOM   3106  N  NE    . ARG A 1  433  ? -52.790 -20.931 -34.342 1.00 71.61  ? 433  ARG A NE    1 
ATOM   3107  C  CZ    . ARG A 1  433  ? -52.077 -21.308 -35.403 1.00 71.13  ? 433  ARG A CZ    1 
ATOM   3108  N  NH1   . ARG A 1  433  ? -51.012 -20.627 -35.803 1.00 71.69  ? 433  ARG A NH1   1 
ATOM   3109  N  NH2   . ARG A 1  433  ? -52.440 -22.396 -36.080 1.00 71.50  ? 433  ARG A NH2   1 
ATOM   3110  N  N     . GLN A 1  434  ? -55.905 -17.817 -30.507 1.00 76.15  ? 434  GLN A N     1 
ATOM   3111  C  CA    . GLN A 1  434  ? -57.373 -17.656 -30.551 1.00 79.17  ? 434  GLN A CA    1 
ATOM   3112  C  C     . GLN A 1  434  ? -58.081 -18.527 -31.588 1.00 78.43  ? 434  GLN A C     1 
ATOM   3113  O  O     . GLN A 1  434  ? -59.191 -18.991 -31.344 1.00 79.63  ? 434  GLN A O     1 
ATOM   3114  C  CB    . GLN A 1  434  ? -57.766 -16.183 -30.771 1.00 81.20  ? 434  GLN A CB    1 
ATOM   3115  C  CG    . GLN A 1  434  ? -57.681 -15.329 -29.512 1.00 83.74  ? 434  GLN A CG    1 
ATOM   3116  C  CD    . GLN A 1  434  ? -57.817 -13.837 -29.782 1.00 86.05  ? 434  GLN A CD    1 
ATOM   3117  O  OE1   . GLN A 1  434  ? -58.168 -13.417 -30.889 1.00 87.81  ? 434  GLN A OE1   1 
ATOM   3118  N  NE2   . GLN A 1  434  ? -57.537 -13.026 -28.764 1.00 86.09  ? 434  GLN A NE2   1 
ATOM   3119  N  N     . GLU A 1  435  ? -57.431 -18.748 -32.725 1.00 78.43  ? 435  GLU A N     1 
ATOM   3120  C  CA    . GLU A 1  435  ? -58.040 -19.406 -33.875 1.00 78.49  ? 435  GLU A CA    1 
ATOM   3121  C  C     . GLU A 1  435  ? -57.161 -20.567 -34.349 1.00 75.82  ? 435  GLU A C     1 
ATOM   3122  O  O     . GLU A 1  435  ? -55.939 -20.541 -34.176 1.00 74.88  ? 435  GLU A O     1 
ATOM   3123  C  CB    . GLU A 1  435  ? -58.211 -18.365 -34.985 1.00 81.10  ? 435  GLU A CB    1 
ATOM   3124  C  CG    . GLU A 1  435  ? -59.307 -18.659 -35.998 1.00 84.45  ? 435  GLU A CG    1 
ATOM   3125  C  CD    . GLU A 1  435  ? -59.519 -17.522 -36.994 1.00 86.92  ? 435  GLU A CD    1 
ATOM   3126  O  OE1   . GLU A 1  435  ? -59.092 -16.377 -36.720 1.00 88.38  ? 435  GLU A OE1   1 
ATOM   3127  O  OE2   . GLU A 1  435  ? -60.125 -17.770 -38.059 1.00 88.86  ? 435  GLU A OE2   1 
ATOM   3128  N  N     . ASN A 1  436  ? -57.793 -21.586 -34.932 1.00 73.00  ? 436  ASN A N     1 
ATOM   3129  C  CA    . ASN A 1  436  ? -57.088 -22.706 -35.570 1.00 70.26  ? 436  ASN A CA    1 
ATOM   3130  C  C     . ASN A 1  436  ? -56.051 -23.347 -34.646 1.00 68.68  ? 436  ASN A C     1 
ATOM   3131  O  O     . ASN A 1  436  ? -54.877 -23.474 -34.992 1.00 68.59  ? 436  ASN A O     1 
ATOM   3132  C  CB    . ASN A 1  436  ? -56.455 -22.247 -36.899 1.00 69.14  ? 436  ASN A CB    1 
ATOM   3133  C  CG    . ASN A 1  436  ? -55.994 -23.406 -37.782 1.00 68.14  ? 436  ASN A CG    1 
ATOM   3134  O  OD1   . ASN A 1  436  ? -56.491 -24.529 -37.682 1.00 67.83  ? 436  ASN A OD1   1 
ATOM   3135  N  ND2   . ASN A 1  436  ? -55.039 -23.128 -38.660 1.00 67.31  ? 436  ASN A ND2   1 
ATOM   3136  N  N     . ALA A 1  437  ? -56.503 -23.729 -33.456 1.00 67.70  ? 437  ALA A N     1 
ATOM   3137  C  CA    . ALA A 1  437  ? -55.645 -24.379 -32.463 1.00 66.27  ? 437  ALA A CA    1 
ATOM   3138  C  C     . ALA A 1  437  ? -56.501 -25.125 -31.456 1.00 65.59  ? 437  ALA A C     1 
ATOM   3139  O  O     . ALA A 1  437  ? -57.506 -24.598 -30.986 1.00 66.79  ? 437  ALA A O     1 
ATOM   3140  C  CB    . ALA A 1  437  ? -54.781 -23.351 -31.754 1.00 66.70  ? 437  ALA A CB    1 
ATOM   3141  N  N     . LEU A 1  438  ? -56.098 -26.345 -31.125 1.00 64.45  ? 438  LEU A N     1 
ATOM   3142  C  CA    . LEU A 1  438  ? -56.893 -27.209 -30.256 1.00 64.80  ? 438  LEU A CA    1 
ATOM   3143  C  C     . LEU A 1  438  ? -56.912 -26.676 -28.829 1.00 65.10  ? 438  LEU A C     1 
ATOM   3144  O  O     . LEU A 1  438  ? -55.972 -26.013 -28.395 1.00 65.29  ? 438  LEU A O     1 
ATOM   3145  C  CB    . LEU A 1  438  ? -56.359 -28.646 -30.286 1.00 65.08  ? 438  LEU A CB    1 
ATOM   3146  C  CG    . LEU A 1  438  ? -56.345 -29.385 -31.639 1.00 64.27  ? 438  LEU A CG    1 
ATOM   3147  C  CD1   . LEU A 1  438  ? -55.953 -30.843 -31.438 1.00 64.22  ? 438  LEU A CD1   1 
ATOM   3148  C  CD2   . LEU A 1  438  ? -57.678 -29.288 -32.377 1.00 64.39  ? 438  LEU A CD2   1 
ATOM   3149  N  N     . ALA A 1  439  ? -57.994 -26.966 -28.114 1.00 65.72  ? 439  ALA A N     1 
ATOM   3150  C  CA    . ALA A 1  439  ? -58.213 -26.410 -26.779 1.00 65.83  ? 439  ALA A CA    1 
ATOM   3151  C  C     . ALA A 1  439  ? -57.346 -27.096 -25.734 1.00 66.49  ? 439  ALA A C     1 
ATOM   3152  O  O     . ALA A 1  439  ? -57.106 -28.303 -25.807 1.00 66.78  ? 439  ALA A O     1 
ATOM   3153  C  CB    . ALA A 1  439  ? -59.680 -26.520 -26.394 1.00 66.13  ? 439  ALA A CB    1 
ATOM   3154  N  N     . ILE A 1  440  ? -56.873 -26.312 -24.768 1.00 67.53  ? 440  ILE A N     1 
ATOM   3155  C  CA    . ILE A 1  440  ? -56.177 -26.840 -23.593 1.00 68.39  ? 440  ILE A CA    1 
ATOM   3156  C  C     . ILE A 1  440  ? -57.250 -27.273 -22.607 1.00 69.52  ? 440  ILE A C     1 
ATOM   3157  O  O     . ILE A 1  440  ? -57.229 -28.402 -22.105 1.00 70.05  ? 440  ILE A O     1 
ATOM   3158  C  CB    . ILE A 1  440  ? -55.248 -25.786 -22.949 1.00 68.24  ? 440  ILE A CB    1 
ATOM   3159  C  CG1   . ILE A 1  440  ? -54.175 -25.333 -23.947 1.00 66.95  ? 440  ILE A CG1   1 
ATOM   3160  C  CG2   . ILE A 1  440  ? -54.592 -26.349 -21.691 1.00 69.47  ? 440  ILE A CG2   1 
ATOM   3161  C  CD1   . ILE A 1  440  ? -53.629 -23.954 -23.659 1.00 67.16  ? 440  ILE A CD1   1 
ATOM   3162  N  N     . VAL A 1  441  ? -58.168 -26.348 -22.324 1.00 70.41  ? 441  VAL A N     1 
ATOM   3163  C  CA    . VAL A 1  441  ? -59.425 -26.638 -21.630 1.00 71.40  ? 441  VAL A CA    1 
ATOM   3164  C  C     . VAL A 1  441  ? -60.552 -25.858 -22.308 1.00 71.15  ? 441  VAL A C     1 
ATOM   3165  O  O     . VAL A 1  441  ? -60.356 -24.722 -22.749 1.00 70.56  ? 441  VAL A O     1 
ATOM   3166  C  CB    . VAL A 1  441  ? -59.384 -26.252 -20.129 1.00 72.55  ? 441  VAL A CB    1 
ATOM   3167  C  CG1   . VAL A 1  441  ? -60.684 -26.654 -19.430 1.00 73.60  ? 441  VAL A CG1   1 
ATOM   3168  C  CG2   . VAL A 1  441  ? -58.195 -26.899 -19.435 1.00 72.73  ? 441  VAL A CG2   1 
ATOM   3169  N  N     . ASN A 1  442  ? -61.721 -26.486 -22.399 1.00 71.27  ? 442  ASN A N     1 
ATOM   3170  C  CA    . ASN A 1  442  ? -62.948 -25.803 -22.798 1.00 71.13  ? 442  ASN A CA    1 
ATOM   3171  C  C     . ASN A 1  442  ? -64.094 -26.222 -21.888 1.00 72.50  ? 442  ASN A C     1 
ATOM   3172  O  O     . ASN A 1  442  ? -63.926 -27.097 -21.034 1.00 72.34  ? 442  ASN A O     1 
ATOM   3173  C  CB    . ASN A 1  442  ? -63.271 -26.058 -24.277 1.00 70.34  ? 442  ASN A CB    1 
ATOM   3174  C  CG    . ASN A 1  442  ? -63.363 -27.535 -24.622 1.00 70.54  ? 442  ASN A CG    1 
ATOM   3175  O  OD1   . ASN A 1  442  ? -63.969 -28.318 -23.899 1.00 72.15  ? 442  ASN A OD1   1 
ATOM   3176  N  ND2   . ASN A 1  442  ? -62.770 -27.917 -25.745 1.00 69.84  ? 442  ASN A ND2   1 
ATOM   3177  N  N     . SER A 1  443  ? -65.252 -25.593 -22.064 1.00 73.60  ? 443  SER A N     1 
ATOM   3178  C  CA    . SER A 1  443  ? -66.419 -25.914 -21.256 1.00 75.03  ? 443  SER A CA    1 
ATOM   3179  C  C     . SER A 1  443  ? -67.747 -25.526 -21.897 1.00 75.25  ? 443  SER A C     1 
ATOM   3180  O  O     . SER A 1  443  ? -67.814 -24.626 -22.730 1.00 73.86  ? 443  SER A O     1 
ATOM   3181  C  CB    . SER A 1  443  ? -66.311 -25.227 -19.895 1.00 76.49  ? 443  SER A CB    1 
ATOM   3182  O  OG    . SER A 1  443  ? -67.385 -25.610 -19.056 1.00 78.65  ? 443  SER A OG    1 
ATOM   3183  N  N     . GLY A 1  444  ? -68.791 -26.247 -21.501 1.00 76.93  ? 444  GLY A N     1 
ATOM   3184  C  CA    . GLY A 1  444  ? -70.180 -25.837 -21.687 1.00 78.54  ? 444  GLY A CA    1 
ATOM   3185  C  C     . GLY A 1  444  ? -70.813 -25.839 -20.309 1.00 81.18  ? 444  GLY A C     1 
ATOM   3186  O  O     . GLY A 1  444  ? -70.513 -26.722 -19.498 1.00 81.98  ? 444  GLY A O     1 
ATOM   3187  N  N     . MET A 1  445  ? -71.655 -24.844 -20.024 1.00 83.49  ? 445  MET A N     1 
ATOM   3188  C  CA    . MET A 1  445  ? -72.304 -24.712 -18.705 1.00 85.96  ? 445  MET A CA    1 
ATOM   3189  C  C     . MET A 1  445  ? -73.717 -24.155 -18.853 1.00 86.97  ? 445  MET A C     1 
ATOM   3190  O  O     . MET A 1  445  ? -73.886 -23.103 -19.466 1.00 87.35  ? 445  MET A O     1 
ATOM   3191  C  CB    . MET A 1  445  ? -71.494 -23.779 -17.795 1.00 86.60  ? 445  MET A CB    1 
ATOM   3192  C  CG    . MET A 1  445  ? -70.015 -24.119 -17.679 1.00 86.21  ? 445  MET A CG    1 
ATOM   3193  S  SD    . MET A 1  445  ? -69.195 -23.182 -16.377 1.00 87.20  ? 445  MET A SD    1 
ATOM   3194  C  CE    . MET A 1  445  ? -67.488 -23.682 -16.589 1.00 85.47  ? 445  MET A CE    1 
ATOM   3195  N  N     . ARG A 1  446  ? -74.713 -24.849 -18.292 1.00 88.36  ? 446  ARG A N     1 
ATOM   3196  C  CA    . ARG A 1  446  ? -76.122 -24.403 -18.306 1.00 89.06  ? 446  ARG A CA    1 
ATOM   3197  C  C     . ARG A 1  446  ? -76.651 -24.146 -16.897 1.00 90.53  ? 446  ARG A C     1 
ATOM   3198  O  O     . ARG A 1  446  ? -76.228 -24.805 -15.949 1.00 90.54  ? 446  ARG A O     1 
ATOM   3199  C  CB    . ARG A 1  446  ? -77.022 -25.449 -18.979 1.00 89.08  ? 446  ARG A CB    1 
ATOM   3200  C  CG    . ARG A 1  446  ? -78.457 -24.982 -19.206 1.00 89.65  ? 446  ARG A CG    1 
ATOM   3201  C  CD    . ARG A 1  446  ? -79.242 -25.930 -20.095 1.00 89.79  ? 446  ARG A CD    1 
ATOM   3202  N  NE    . ARG A 1  446  ? -79.326 -27.278 -19.537 1.00 90.50  ? 446  ARG A NE    1 
ATOM   3203  C  CZ    . ARG A 1  446  ? -80.103 -27.655 -18.517 1.00 92.35  ? 446  ARG A CZ    1 
ATOM   3204  N  NH1   . ARG A 1  446  ? -80.903 -26.793 -17.884 1.00 92.87  ? 446  ARG A NH1   1 
ATOM   3205  N  NH2   . ARG A 1  446  ? -80.075 -28.925 -18.117 1.00 93.10  ? 446  ARG A NH2   1 
ATOM   3206  N  N     . VAL A 1  447  ? -77.586 -23.197 -16.786 1.00 92.09  ? 447  VAL A N     1 
ATOM   3207  C  CA    . VAL A 1  447  ? -78.359 -22.940 -15.550 1.00 94.63  ? 447  VAL A CA    1 
ATOM   3208  C  C     . VAL A 1  447  ? -79.855 -22.867 -15.855 1.00 95.38  ? 447  VAL A C     1 
ATOM   3209  O  O     . VAL A 1  447  ? -80.248 -22.548 -16.977 1.00 94.88  ? 447  VAL A O     1 
ATOM   3210  C  CB    . VAL A 1  447  ? -77.949 -21.623 -14.838 1.00 95.21  ? 447  VAL A CB    1 
ATOM   3211  C  CG1   . VAL A 1  447  ? -76.585 -21.769 -14.180 1.00 95.20  ? 447  VAL A CG1   1 
ATOM   3212  C  CG2   . VAL A 1  447  ? -77.965 -20.431 -15.795 1.00 94.47  ? 447  VAL A CG2   1 
ATOM   3213  N  N     . PHE A 1  448  ? -80.678 -23.151 -14.848 1.00 96.89  ? 448  PHE A N     1 
ATOM   3214  C  CA    . PHE A 1  448  ? -82.126 -22.985 -14.968 1.00 98.11  ? 448  PHE A CA    1 
ATOM   3215  C  C     . PHE A 1  448  ? -82.731 -22.511 -13.652 1.00 100.80 ? 448  PHE A C     1 
ATOM   3216  O  O     . PHE A 1  448  ? -82.526 -23.129 -12.608 1.00 100.96 ? 448  PHE A O     1 
ATOM   3217  C  CB    . PHE A 1  448  ? -82.797 -24.287 -15.416 1.00 97.67  ? 448  PHE A CB    1 
ATOM   3218  C  CG    . PHE A 1  448  ? -84.276 -24.147 -15.698 1.00 98.38  ? 448  PHE A CG    1 
ATOM   3219  C  CD1   . PHE A 1  448  ? -84.727 -23.327 -16.729 1.00 97.77  ? 448  PHE A CD1   1 
ATOM   3220  C  CD2   . PHE A 1  448  ? -85.222 -24.837 -14.935 1.00 99.49  ? 448  PHE A CD2   1 
ATOM   3221  C  CE1   . PHE A 1  448  ? -86.086 -23.192 -16.993 1.00 98.35  ? 448  PHE A CE1   1 
ATOM   3222  C  CE2   . PHE A 1  448  ? -86.581 -24.705 -15.196 1.00 99.94  ? 448  PHE A CE2   1 
ATOM   3223  C  CZ    . PHE A 1  448  ? -87.013 -23.881 -16.225 1.00 99.34  ? 448  PHE A CZ    1 
ATOM   3224  N  N     . PHE A 1  449  ? -83.454 -21.406 -13.702 1.00 103.58 ? 449  PHE A N     1 
ATOM   3225  C  CA    . PHE A 1  449  ? -84.018 -20.814 -12.507 1.00 106.78 ? 449  PHE A CA    1 
ATOM   3226  C  C     . PHE A 1  449  ? -85.514 -20.974 -12.469 1.00 109.84 ? 449  PHE A C     1 
ATOM   3227  O  O     . PHE A 1  449  ? -86.100 -21.200 -11.422 1.00 111.69 ? 449  PHE A O     1 
ATOM   3228  C  CB    . PHE A 1  449  ? -83.668 -19.343 -12.455 1.00 105.65 ? 449  PHE A CB    1 
ATOM   3229  C  CG    . PHE A 1  449  ? -82.234 -19.092 -12.172 1.00 103.33 ? 449  PHE A CG    1 
ATOM   3230  C  CD1   . PHE A 1  449  ? -81.693 -19.459 -10.974 1.00 103.29 ? 449  PHE A CD1   1 
ATOM   3231  C  CD2   . PHE A 1  449  ? -81.428 -18.519 -13.112 1.00 101.31 ? 449  PHE A CD2   1 
ATOM   3232  C  CE1   . PHE A 1  449  ? -80.372 -19.238 -10.704 1.00 101.67 ? 449  PHE A CE1   1 
ATOM   3233  C  CE2   . PHE A 1  449  ? -80.105 -18.298 -12.855 1.00 99.60  ? 449  PHE A CE2   1 
ATOM   3234  C  CZ    . PHE A 1  449  ? -79.575 -18.653 -11.648 1.00 99.90  ? 449  PHE A CZ    1 
ATOM   3235  N  N     . GLY A 1  450  ? -86.129 -20.850 -13.626 1.00 113.54 ? 450  GLY A N     1 
ATOM   3236  C  CA    . GLY A 1  450  ? -87.564 -20.960 -13.722 1.00 118.11 ? 450  GLY A CA    1 
ATOM   3237  C  C     . GLY A 1  450  ? -88.202 -20.048 -12.716 1.00 122.26 ? 450  GLY A C     1 
ATOM   3238  O  O     . GLY A 1  450  ? -87.531 -19.206 -12.121 1.00 123.79 ? 450  GLY A O     1 
ATOM   3239  N  N     . GLU A 1  451  ? -89.505 -20.204 -12.524 1.00 125.14 ? 451  GLU A N     1 
ATOM   3240  C  CA    . GLU A 1  451  ? -90.243 -19.388 -11.570 1.00 127.90 ? 451  GLU A CA    1 
ATOM   3241  C  C     . GLU A 1  451  ? -89.892 -17.933 -11.824 1.00 130.56 ? 451  GLU A C     1 
ATOM   3242  O  O     . GLU A 1  451  ? -90.719 -17.150 -12.275 1.00 132.83 ? 451  GLU A O     1 
ATOM   3243  C  CB    . GLU A 1  451  ? -89.908 -19.789 -10.122 1.00 129.02 ? 451  GLU A CB    1 
ATOM   3244  C  CG    . GLU A 1  451  ? -90.683 -19.042 -9.034  1.00 130.85 ? 451  GLU A CG    1 
ATOM   3245  C  CD    . GLU A 1  451  ? -92.176 -19.320 -9.052  1.00 130.92 ? 451  GLU A CD    1 
ATOM   3246  O  OE1   . GLU A 1  451  ? -92.600 -20.274 -9.739  1.00 129.67 ? 451  GLU A OE1   1 
ATOM   3247  O  OE2   . GLU A 1  451  ? -92.922 -18.588 -8.373  1.00 132.38 ? 451  GLU A OE2   1 
ATOM   3248  N  N     . GLY A 1  452  ? -88.628 -17.609 -11.574 1.00 130.74 ? 452  GLY A N     1 
ATOM   3249  C  CA    . GLY A 1  452  ? -88.121 -16.273 -11.777 1.00 132.06 ? 452  GLY A CA    1 
ATOM   3250  C  C     . GLY A 1  452  ? -87.242 -15.865 -10.624 1.00 133.02 ? 452  GLY A C     1 
ATOM   3251  O  O     . GLY A 1  452  ? -86.465 -14.932 -10.735 1.00 133.53 ? 452  GLY A O     1 
ATOM   3252  N  N     . ASP A 1  453  ? -87.359 -16.566 -9.508  1.00 133.28 ? 453  ASP A N     1 
ATOM   3253  C  CA    . ASP A 1  453  ? -86.521 -16.269 -8.361  1.00 132.65 ? 453  ASP A CA    1 
ATOM   3254  C  C     . ASP A 1  453  ? -85.101 -16.759 -8.616  1.00 129.22 ? 453  ASP A C     1 
ATOM   3255  O  O     . ASP A 1  453  ? -84.829 -17.341 -9.641  1.00 127.68 ? 453  ASP A O     1 
ATOM   3256  C  CB    . ASP A 1  453  ? -87.091 -16.912 -7.105  1.00 135.06 ? 453  ASP A CB    1 
ATOM   3257  C  CG    . ASP A 1  453  ? -86.107 -16.911 -5.961  1.00 137.50 ? 453  ASP A CG    1 
ATOM   3258  O  OD1   . ASP A 1  453  ? -85.179 -16.076 -6.001  1.00 138.62 ? 453  ASP A OD1   1 
ATOM   3259  O  OD2   . ASP A 1  453  ? -86.229 -17.760 -5.066  1.00 139.97 ? 453  ASP A OD2   1 
ATOM   3260  N  N     . GLY A 1  454  ? -84.208 -16.547 -7.657  1.00 126.32 ? 454  GLY A N     1 
ATOM   3261  C  CA    . GLY A 1  454  ? -82.812 -16.954 -7.856  1.00 122.16 ? 454  GLY A CA    1 
ATOM   3262  C  C     . GLY A 1  454  ? -82.395 -18.345 -7.404  1.00 119.30 ? 454  GLY A C     1 
ATOM   3263  O  O     . GLY A 1  454  ? -81.197 -18.631 -7.364  1.00 117.32 ? 454  GLY A O     1 
ATOM   3264  N  N     . ILE A 1  455  ? -83.359 -19.208 -7.066  1.00 117.44 ? 455  ILE A N     1 
ATOM   3265  C  CA    . ILE A 1  455  ? -83.066 -20.602 -6.697  1.00 114.99 ? 455  ILE A CA    1 
ATOM   3266  C  C     . ILE A 1  455  ? -82.737 -21.381 -7.969  1.00 110.99 ? 455  ILE A C     1 
ATOM   3267  O  O     . ILE A 1  455  ? -83.550 -21.433 -8.900  1.00 109.55 ? 455  ILE A O     1 
ATOM   3268  C  CB    . ILE A 1  455  ? -84.258 -21.279 -5.968  1.00 116.70 ? 455  ILE A CB    1 
ATOM   3269  C  CG1   . ILE A 1  455  ? -84.595 -20.547 -4.657  1.00 118.64 ? 455  ILE A CG1   1 
ATOM   3270  C  CG2   . ILE A 1  455  ? -83.989 -22.763 -5.707  1.00 116.27 ? 455  ILE A CG2   1 
ATOM   3271  C  CD1   . ILE A 1  455  ? -83.531 -20.609 -3.580  1.00 119.02 ? 455  ILE A CD1   1 
ATOM   3272  N  N     . ILE A 1  456  ? -81.553 -21.993 -7.999  1.00 107.36 ? 456  ILE A N     1 
ATOM   3273  C  CA    . ILE A 1  456  ? -81.095 -22.707 -9.186  1.00 104.62 ? 456  ILE A CA    1 
ATOM   3274  C  C     . ILE A 1  456  ? -81.747 -24.098 -9.171  1.00 103.95 ? 456  ILE A C     1 
ATOM   3275  O  O     . ILE A 1  456  ? -81.616 -24.847 -8.196  1.00 104.10 ? 456  ILE A O     1 
ATOM   3276  C  CB    . ILE A 1  456  ? -79.536 -22.705 -9.341  1.00 103.16 ? 456  ILE A CB    1 
ATOM   3277  C  CG1   . ILE A 1  456  ? -78.824 -23.759 -8.470  1.00 103.43 ? 456  ILE A CG1   1 
ATOM   3278  C  CG2   . ILE A 1  456  ? -78.958 -21.304 -9.121  1.00 103.12 ? 456  ILE A CG2   1 
ATOM   3279  C  CD1   . ILE A 1  456  ? -78.524 -25.034 -9.232  1.00 102.99 ? 456  ILE A CD1   1 
ATOM   3280  N  N     . ARG A 1  457  ? -82.487 -24.410 -10.237 1.00 102.01 ? 457  ARG A N     1 
ATOM   3281  C  CA    . ARG A 1  457  ? -83.294 -25.634 -10.326 1.00 101.21 ? 457  ARG A CA    1 
ATOM   3282  C  C     . ARG A 1  457  ? -82.669 -26.728 -11.199 1.00 98.37  ? 457  ARG A C     1 
ATOM   3283  O  O     . ARG A 1  457  ? -82.944 -27.904 -10.976 1.00 99.45  ? 457  ARG A O     1 
ATOM   3284  C  CB    . ARG A 1  457  ? -84.717 -25.299 -10.794 1.00 102.05 ? 457  ARG A CB    1 
ATOM   3285  C  CG    . ARG A 1  457  ? -85.570 -24.671 -9.699  1.00 103.87 ? 457  ARG A CG    1 
ATOM   3286  C  CD    . ARG A 1  457  ? -86.839 -24.043 -10.248 1.00 104.93 ? 457  ARG A CD    1 
ATOM   3287  N  NE    . ARG A 1  457  ? -87.858 -23.820 -9.209  1.00 107.28 ? 457  ARG A NE    1 
ATOM   3288  C  CZ    . ARG A 1  457  ? -87.890 -22.806 -8.336  1.00 107.61 ? 457  ARG A CZ    1 
ATOM   3289  N  NH1   . ARG A 1  457  ? -86.948 -21.862 -8.313  1.00 107.08 ? 457  ARG A NH1   1 
ATOM   3290  N  NH2   . ARG A 1  457  ? -88.885 -22.739 -7.457  1.00 109.43 ? 457  ARG A NH2   1 
ATOM   3291  N  N     . GLU A 1  458  ? -81.855 -26.354 -12.190 1.00 94.99  ? 458  GLU A N     1 
ATOM   3292  C  CA    . GLU A 1  458  ? -81.024 -27.319 -12.928 1.00 92.63  ? 458  GLU A CA    1 
ATOM   3293  C  C     . GLU A 1  458  ? -79.622 -26.770 -13.154 1.00 90.83  ? 458  GLU A C     1 
ATOM   3294  O  O     . GLU A 1  458  ? -79.400 -25.560 -13.098 1.00 90.47  ? 458  GLU A O     1 
ATOM   3295  C  CB    . GLU A 1  458  ? -81.640 -27.684 -14.282 1.00 91.45  ? 458  GLU A CB    1 
ATOM   3296  C  CG    . GLU A 1  458  ? -83.089 -28.158 -14.240 1.00 92.02  ? 458  GLU A CG    1 
ATOM   3297  C  CD    . GLU A 1  458  ? -83.643 -28.481 -15.619 1.00 90.70  ? 458  GLU A CD    1 
ATOM   3298  O  OE1   . GLU A 1  458  ? -82.849 -28.782 -16.539 1.00 89.15  ? 458  GLU A OE1   1 
ATOM   3299  O  OE2   . GLU A 1  458  ? -84.882 -28.438 -15.782 1.00 90.65  ? 458  GLU A OE2   1 
ATOM   3300  N  N     . LEU A 1  459  ? -78.683 -27.676 -13.416 1.00 89.99  ? 459  LEU A N     1 
ATOM   3301  C  CA    . LEU A 1  459  ? -77.283 -27.313 -13.644 1.00 88.87  ? 459  LEU A CA    1 
ATOM   3302  C  C     . LEU A 1  459  ? -76.508 -28.464 -14.323 1.00 87.92  ? 459  LEU A C     1 
ATOM   3303  O  O     . LEU A 1  459  ? -76.462 -29.576 -13.800 1.00 88.47  ? 459  LEU A O     1 
ATOM   3304  C  CB    . LEU A 1  459  ? -76.621 -26.926 -12.306 1.00 89.63  ? 459  LEU A CB    1 
ATOM   3305  C  CG    . LEU A 1  459  ? -75.370 -26.039 -12.331 1.00 88.80  ? 459  LEU A CG    1 
ATOM   3306  C  CD1   . LEU A 1  459  ? -75.688 -24.612 -12.763 1.00 88.43  ? 459  LEU A CD1   1 
ATOM   3307  C  CD2   . LEU A 1  459  ? -74.706 -26.035 -10.961 1.00 89.52  ? 459  LEU A CD2   1 
ATOM   3308  N  N     . CYS A 1  460  ? -75.931 -28.199 -15.496 1.00 86.51  ? 460  CYS A N     1 
ATOM   3309  C  CA    . CYS A 1  460  ? -75.023 -29.144 -16.163 1.00 85.75  ? 460  CYS A CA    1 
ATOM   3310  C  C     . CYS A 1  460  ? -73.753 -28.393 -16.532 1.00 83.16  ? 460  CYS A C     1 
ATOM   3311  O  O     . CYS A 1  460  ? -73.820 -27.338 -17.153 1.00 82.59  ? 460  CYS A O     1 
ATOM   3312  C  CB    . CYS A 1  460  ? -75.664 -29.756 -17.419 1.00 86.12  ? 460  CYS A CB    1 
ATOM   3313  S  SG    . CYS A 1  460  ? -76.987 -30.954 -17.098 1.00 90.04  ? 460  CYS A SG    1 
ATOM   3314  N  N     . ILE A 1  461  ? -72.603 -28.934 -16.132 1.00 81.77  ? 461  ILE A N     1 
ATOM   3315  C  CA    . ILE A 1  461  ? -71.308 -28.289 -16.333 1.00 80.60  ? 461  ILE A CA    1 
ATOM   3316  C  C     . ILE A 1  461  ? -70.339 -29.305 -16.940 1.00 79.28  ? 461  ILE A C     1 
ATOM   3317  O  O     . ILE A 1  461  ? -69.837 -30.186 -16.243 1.00 79.54  ? 461  ILE A O     1 
ATOM   3318  C  CB    . ILE A 1  461  ? -70.760 -27.723 -14.998 1.00 81.71  ? 461  ILE A CB    1 
ATOM   3319  C  CG1   . ILE A 1  461  ? -71.639 -26.560 -14.516 1.00 82.50  ? 461  ILE A CG1   1 
ATOM   3320  C  CG2   . ILE A 1  461  ? -69.313 -27.254 -15.149 1.00 81.25  ? 461  ILE A CG2   1 
ATOM   3321  C  CD1   . ILE A 1  461  ? -71.320 -26.066 -13.120 1.00 83.70  ? 461  ILE A CD1   1 
ATOM   3322  N  N     . SER A 1  462  ? -70.082 -29.169 -18.237 1.00 78.30  ? 462  SER A N     1 
ATOM   3323  C  CA    . SER A 1  462  ? -69.194 -30.079 -18.965 1.00 77.56  ? 462  SER A CA    1 
ATOM   3324  C  C     . SER A 1  462  ? -67.848 -29.424 -19.257 1.00 76.23  ? 462  SER A C     1 
ATOM   3325  O  O     . SER A 1  462  ? -67.800 -28.232 -19.559 1.00 75.29  ? 462  SER A O     1 
ATOM   3326  C  CB    . SER A 1  462  ? -69.840 -30.505 -20.279 1.00 76.81  ? 462  SER A CB    1 
ATOM   3327  O  OG    . SER A 1  462  ? -69.065 -31.502 -20.917 1.00 75.63  ? 462  SER A OG    1 
ATOM   3328  N  N     . TYR A 1  463  ? -66.772 -30.211 -19.167 1.00 75.95  ? 463  TYR A N     1 
ATOM   3329  C  CA    . TYR A 1  463  ? -65.413 -29.768 -19.521 1.00 75.30  ? 463  TYR A CA    1 
ATOM   3330  C  C     . TYR A 1  463  ? -64.773 -30.710 -20.536 1.00 75.52  ? 463  TYR A C     1 
ATOM   3331  O  O     . TYR A 1  463  ? -65.034 -31.914 -20.527 1.00 77.11  ? 463  TYR A O     1 
ATOM   3332  C  CB    . TYR A 1  463  ? -64.507 -29.706 -18.287 1.00 75.08  ? 463  TYR A CB    1 
ATOM   3333  C  CG    . TYR A 1  463  ? -64.859 -28.628 -17.288 1.00 75.08  ? 463  TYR A CG    1 
ATOM   3334  C  CD1   . TYR A 1  463  ? -64.532 -27.292 -17.522 1.00 73.78  ? 463  TYR A CD1   1 
ATOM   3335  C  CD2   . TYR A 1  463  ? -65.504 -28.950 -16.097 1.00 76.38  ? 463  TYR A CD2   1 
ATOM   3336  C  CE1   . TYR A 1  463  ? -64.855 -26.304 -16.603 1.00 75.24  ? 463  TYR A CE1   1 
ATOM   3337  C  CE2   . TYR A 1  463  ? -65.829 -27.975 -15.166 1.00 77.54  ? 463  TYR A CE2   1 
ATOM   3338  C  CZ    . TYR A 1  463  ? -65.512 -26.654 -15.417 1.00 76.89  ? 463  TYR A CZ    1 
ATOM   3339  O  OH    . TYR A 1  463  ? -65.844 -25.712 -14.466 1.00 76.56  ? 463  TYR A OH    1 
ATOM   3340  N  N     . GLY A 1  464  ? -63.921 -30.153 -21.392 1.00 74.97  ? 464  GLY A N     1 
ATOM   3341  C  CA    . GLY A 1  464  ? -63.092 -30.940 -22.309 1.00 74.74  ? 464  GLY A CA    1 
ATOM   3342  C  C     . GLY A 1  464  ? -61.621 -30.635 -22.109 1.00 74.34  ? 464  GLY A C     1 
ATOM   3343  O  O     . GLY A 1  464  ? -61.262 -29.617 -21.512 1.00 74.96  ? 464  GLY A O     1 
ATOM   3344  N  N     . GLY A 1  465  ? -60.772 -31.530 -22.606 1.00 73.60  ? 465  GLY A N     1 
ATOM   3345  C  CA    . GLY A 1  465  ? -59.324 -31.395 -22.478 1.00 72.58  ? 465  GLY A CA    1 
ATOM   3346  C  C     . GLY A 1  465  ? -58.778 -31.656 -21.084 1.00 73.04  ? 465  GLY A C     1 
ATOM   3347  O  O     . GLY A 1  465  ? -57.669 -31.224 -20.771 1.00 72.53  ? 465  GLY A O     1 
ATOM   3348  N  N     . VAL A 1  466  ? -59.538 -32.374 -20.256 1.00 74.35  ? 466  VAL A N     1 
ATOM   3349  C  CA    . VAL A 1  466  ? -59.134 -32.678 -18.873 1.00 76.66  ? 466  VAL A CA    1 
ATOM   3350  C  C     . VAL A 1  466  ? -59.222 -34.187 -18.565 1.00 77.31  ? 466  VAL A C     1 
ATOM   3351  O  O     . VAL A 1  466  ? -59.372 -34.597 -17.408 1.00 79.65  ? 466  VAL A O     1 
ATOM   3352  C  CB    . VAL A 1  466  ? -59.954 -31.844 -17.850 1.00 77.71  ? 466  VAL A CB    1 
ATOM   3353  C  CG1   . VAL A 1  466  ? -59.565 -30.376 -17.929 1.00 77.17  ? 466  VAL A CG1   1 
ATOM   3354  C  CG2   . VAL A 1  466  ? -61.451 -32.010 -18.070 1.00 78.45  ? 466  VAL A CG2   1 
ATOM   3355  N  N     . GLY A 1  467  ? -59.090 -35.008 -19.602 1.00 75.70  ? 467  GLY A N     1 
ATOM   3356  C  CA    . GLY A 1  467  ? -59.255 -36.452 -19.480 1.00 75.65  ? 467  GLY A CA    1 
ATOM   3357  C  C     . GLY A 1  467  ? -59.408 -37.110 -20.838 1.00 74.15  ? 467  GLY A C     1 
ATOM   3358  O  O     . GLY A 1  467  ? -59.408 -36.420 -21.859 1.00 72.93  ? 467  GLY A O     1 
ATOM   3359  N  N     . PRO A 1  468  ? -59.551 -38.448 -20.863 1.00 74.70  ? 468  PRO A N     1 
ATOM   3360  C  CA    . PRO A 1  468  ? -59.688 -39.174 -22.131 1.00 74.03  ? 468  PRO A CA    1 
ATOM   3361  C  C     . PRO A 1  468  ? -60.981 -38.855 -22.891 1.00 73.91  ? 468  PRO A C     1 
ATOM   3362  O  O     . PRO A 1  468  ? -61.029 -39.039 -24.109 1.00 72.94  ? 468  PRO A O     1 
ATOM   3363  C  CB    . PRO A 1  468  ? -59.664 -40.656 -21.710 1.00 75.27  ? 468  PRO A CB    1 
ATOM   3364  C  CG    . PRO A 1  468  ? -59.361 -40.679 -20.249 1.00 76.40  ? 468  PRO A CG    1 
ATOM   3365  C  CD    . PRO A 1  468  ? -59.735 -39.339 -19.705 1.00 76.39  ? 468  PRO A CD    1 
ATOM   3366  N  N     . ALA A 1  469  ? -62.011 -38.407 -22.170 1.00 75.23  ? 469  ALA A N     1 
ATOM   3367  C  CA    . ALA A 1  469  ? -63.272 -37.981 -22.765 1.00 75.34  ? 469  ALA A CA    1 
ATOM   3368  C  C     . ALA A 1  469  ? -63.750 -36.670 -22.159 1.00 76.05  ? 469  ALA A C     1 
ATOM   3369  O  O     . ALA A 1  469  ? -63.169 -36.156 -21.198 1.00 76.71  ? 469  ALA A O     1 
ATOM   3370  C  CB    . ALA A 1  469  ? -64.327 -39.056 -22.571 1.00 76.39  ? 469  ALA A CB    1 
ATOM   3371  N  N     . THR A 1  470  ? -64.815 -36.140 -22.752 1.00 76.49  ? 470  THR A N     1 
ATOM   3372  C  CA    . THR A 1  470  ? -65.534 -34.984 -22.226 1.00 77.54  ? 470  THR A CA    1 
ATOM   3373  C  C     . THR A 1  470  ? -66.238 -35.398 -20.921 1.00 80.04  ? 470  THR A C     1 
ATOM   3374  O  O     . THR A 1  470  ? -66.870 -36.456 -20.870 1.00 81.30  ? 470  THR A O     1 
ATOM   3375  C  CB    . THR A 1  470  ? -66.556 -34.482 -23.271 1.00 76.92  ? 470  THR A CB    1 
ATOM   3376  O  OG1   . THR A 1  470  ? -65.873 -34.140 -24.488 1.00 76.18  ? 470  THR A OG1   1 
ATOM   3377  C  CG2   . THR A 1  470  ? -67.322 -33.272 -22.772 1.00 77.41  ? 470  THR A CG2   1 
ATOM   3378  N  N     . ILE A 1  471  ? -66.118 -34.578 -19.875 1.00 81.47  ? 471  ILE A N     1 
ATOM   3379  C  CA    . ILE A 1  471  ? -66.633 -34.933 -18.544 1.00 84.12  ? 471  ILE A CA    1 
ATOM   3380  C  C     . ILE A 1  471  ? -67.623 -33.905 -18.008 1.00 85.59  ? 471  ILE A C     1 
ATOM   3381  O  O     . ILE A 1  471  ? -67.375 -32.703 -18.081 1.00 85.69  ? 471  ILE A O     1 
ATOM   3382  C  CB    . ILE A 1  471  ? -65.500 -35.168 -17.512 1.00 84.90  ? 471  ILE A CB    1 
ATOM   3383  C  CG1   . ILE A 1  471  ? -64.562 -33.956 -17.397 1.00 84.62  ? 471  ILE A CG1   1 
ATOM   3384  C  CG2   . ILE A 1  471  ? -64.698 -36.412 -17.885 1.00 84.94  ? 471  ILE A CG2   1 
ATOM   3385  C  CD1   . ILE A 1  471  ? -63.525 -34.095 -16.303 1.00 85.77  ? 471  ILE A CD1   1 
ATOM   3386  N  N     . CYS A 1  472  ? -68.746 -34.399 -17.484 1.00 87.54  ? 472  CYS A N     1 
ATOM   3387  C  CA    . CYS A 1  472  ? -69.760 -33.576 -16.834 1.00 88.49  ? 472  CYS A CA    1 
ATOM   3388  C  C     . CYS A 1  472  ? -69.615 -33.709 -15.329 1.00 88.87  ? 472  CYS A C     1 
ATOM   3389  O  O     . CYS A 1  472  ? -69.546 -34.825 -14.809 1.00 89.01  ? 472  CYS A O     1 
ATOM   3390  C  CB    . CYS A 1  472  ? -71.163 -34.034 -17.233 1.00 90.02  ? 472  CYS A CB    1 
ATOM   3391  S  SG    . CYS A 1  472  ? -71.488 -33.992 -19.007 1.00 91.10  ? 472  CYS A SG    1 
ATOM   3392  N  N     . ALA A 1  473  ? -69.586 -32.576 -14.633 1.00 88.76  ? 473  ALA A N     1 
ATOM   3393  C  CA    . ALA A 1  473  ? -69.567 -32.559 -13.173 1.00 90.18  ? 473  ALA A CA    1 
ATOM   3394  C  C     . ALA A 1  473  ? -70.982 -32.776 -12.621 1.00 91.21  ? 473  ALA A C     1 
ATOM   3395  O  O     . ALA A 1  473  ? -71.604 -31.856 -12.086 1.00 91.55  ? 473  ALA A O     1 
ATOM   3396  C  CB    . ALA A 1  473  ? -68.980 -31.249 -12.671 1.00 90.26  ? 473  ALA A CB    1 
ATOM   3397  N  N     . LYS A 1  474  ? -71.471 -34.007 -12.751 1.00 91.70  ? 474  LYS A N     1 
ATOM   3398  C  CA    . LYS A 1  474  ? -72.848 -34.360 -12.380 1.00 93.47  ? 474  LYS A CA    1 
ATOM   3399  C  C     . LYS A 1  474  ? -73.113 -34.302 -10.870 1.00 94.83  ? 474  LYS A C     1 
ATOM   3400  O  O     . LYS A 1  474  ? -74.209 -33.925 -10.449 1.00 95.58  ? 474  LYS A O     1 
ATOM   3401  C  CB    . LYS A 1  474  ? -73.213 -35.748 -12.929 1.00 94.33  ? 474  LYS A CB    1 
ATOM   3402  C  CG    . LYS A 1  474  ? -72.455 -36.920 -12.302 1.00 96.22  ? 474  LYS A CG    1 
ATOM   3403  C  CD    . LYS A 1  474  ? -71.935 -37.893 -13.350 1.00 96.51  ? 474  LYS A CD    1 
ATOM   3404  C  CE    . LYS A 1  474  ? -71.084 -39.008 -12.742 1.00 97.65  ? 474  LYS A CE    1 
ATOM   3405  N  NZ    . LYS A 1  474  ? -69.801 -38.526 -12.153 1.00 97.42  ? 474  LYS A NZ    1 
ATOM   3406  N  N     . ASN A 1  475  ? -72.100 -34.652 -10.075 1.00 94.49  ? 475  ASN A N     1 
ATOM   3407  C  CA    . ASN A 1  475  ? -72.221 -34.752 -8.620  1.00 95.64  ? 475  ASN A CA    1 
ATOM   3408  C  C     . ASN A 1  475  ? -72.093 -33.400 -7.920  1.00 96.04  ? 475  ASN A C     1 
ATOM   3409  O  O     . ASN A 1  475  ? -72.797 -33.137 -6.935  1.00 97.22  ? 475  ASN A O     1 
ATOM   3410  C  CB    . ASN A 1  475  ? -71.179 -35.731 -8.067  1.00 95.62  ? 475  ASN A CB    1 
ATOM   3411  C  CG    . ASN A 1  475  ? -71.310 -37.126 -8.660  1.00 95.45  ? 475  ASN A CG    1 
ATOM   3412  O  OD1   . ASN A 1  475  ? -72.363 -37.502 -9.176  1.00 95.10  ? 475  ASN A OD1   1 
ATOM   3413  N  ND2   . ASN A 1  475  ? -70.237 -37.903 -8.586  1.00 95.61  ? 475  ASN A ND2   1 
ATOM   3414  N  N     . SER A 1  476  ? -71.190 -32.556 -8.420  1.00 94.42  ? 476  SER A N     1 
ATOM   3415  C  CA    . SER A 1  476  ? -71.083 -31.168 -7.972  1.00 94.54  ? 476  SER A CA    1 
ATOM   3416  C  C     . SER A 1  476  ? -72.393 -30.441 -8.229  1.00 94.41  ? 476  SER A C     1 
ATOM   3417  O  O     . SER A 1  476  ? -72.968 -29.844 -7.319  1.00 94.90  ? 476  SER A O     1 
ATOM   3418  C  CB    . SER A 1  476  ? -69.960 -30.438 -8.714  1.00 93.91  ? 476  SER A CB    1 
ATOM   3419  O  OG    . SER A 1  476  ? -68.688 -30.924 -8.326  1.00 94.71  ? 476  SER A OG    1 
ATOM   3420  N  N     . CYS A 1  477  ? -72.857 -30.515 -9.475  1.00 93.22  ? 477  CYS A N     1 
ATOM   3421  C  CA    . CYS A 1  477  ? -74.111 -29.876 -9.892  1.00 93.20  ? 477  CYS A CA    1 
ATOM   3422  C  C     . CYS A 1  477  ? -75.322 -30.331 -9.072  1.00 94.12  ? 477  CYS A C     1 
ATOM   3423  O  O     . CYS A 1  477  ? -76.168 -29.511 -8.715  1.00 93.88  ? 477  CYS A O     1 
ATOM   3424  C  CB    . CYS A 1  477  ? -74.370 -30.108 -11.386 1.00 92.06  ? 477  CYS A CB    1 
ATOM   3425  S  SG    . CYS A 1  477  ? -73.327 -29.117 -12.484 1.00 90.38  ? 477  CYS A SG    1 
ATOM   3426  N  N     . GLN A 1  478  ? -75.387 -31.625 -8.769  1.00 94.26  ? 478  GLN A N     1 
ATOM   3427  C  CA    . GLN A 1  478  ? -76.448 -32.173 -7.929  1.00 95.63  ? 478  GLN A CA    1 
ATOM   3428  C  C     . GLN A 1  478  ? -76.444 -31.511 -6.545  1.00 97.04  ? 478  GLN A C     1 
ATOM   3429  O  O     . GLN A 1  478  ? -77.502 -31.125 -6.045  1.00 98.28  ? 478  GLN A O     1 
ATOM   3430  C  CB    . GLN A 1  478  ? -76.307 -33.700 -7.807  1.00 96.07  ? 478  GLN A CB    1 
ATOM   3431  C  CG    . GLN A 1  478  ? -77.477 -34.415 -7.135  1.00 97.88  ? 478  GLN A CG    1 
ATOM   3432  C  CD    . GLN A 1  478  ? -78.785 -34.277 -7.897  1.00 97.95  ? 478  GLN A CD    1 
ATOM   3433  O  OE1   . GLN A 1  478  ? -79.778 -33.773 -7.366  1.00 98.58  ? 478  GLN A OE1   1 
ATOM   3434  N  NE2   . GLN A 1  478  ? -78.790 -34.722 -9.152  1.00 96.78  ? 478  GLN A NE2   1 
ATOM   3435  N  N     . LYS A 1  479  ? -75.260 -31.365 -5.947  1.00 96.83  ? 479  LYS A N     1 
ATOM   3436  C  CA    . LYS A 1  479  ? -75.117 -30.704 -4.633  1.00 97.95  ? 479  LYS A CA    1 
ATOM   3437  C  C     . LYS A 1  479  ? -75.464 -29.207 -4.643  1.00 97.64  ? 479  LYS A C     1 
ATOM   3438  O  O     . LYS A 1  479  ? -75.864 -28.661 -3.616  1.00 99.25  ? 479  LYS A O     1 
ATOM   3439  C  CB    . LYS A 1  479  ? -73.700 -30.896 -4.069  1.00 97.85  ? 479  LYS A CB    1 
ATOM   3440  C  CG    . LYS A 1  479  ? -73.403 -32.317 -3.614  1.00 98.92  ? 479  LYS A CG    1 
ATOM   3441  C  CD    . LYS A 1  479  ? -71.962 -32.493 -3.142  1.00 99.03  ? 479  LYS A CD    1 
ATOM   3442  C  CE    . LYS A 1  479  ? -71.690 -31.826 -1.794  1.00 100.71 ? 479  LYS A CE    1 
ATOM   3443  N  NZ    . LYS A 1  479  ? -72.505 -32.375 -0.671  1.00 102.55 ? 479  LYS A NZ    1 
ATOM   3444  N  N     . LEU A 1  480  ? -75.300 -28.555 -5.793  1.00 96.17  ? 480  LEU A N     1 
ATOM   3445  C  CA    . LEU A 1  480  ? -75.604 -27.126 -5.948  1.00 95.77  ? 480  LEU A CA    1 
ATOM   3446  C  C     . LEU A 1  480  ? -77.083 -26.800 -6.244  1.00 96.45  ? 480  LEU A C     1 
ATOM   3447  O  O     . LEU A 1  480  ? -77.453 -25.623 -6.231  1.00 96.46  ? 480  LEU A O     1 
ATOM   3448  C  CB    . LEU A 1  480  ? -74.717 -26.523 -7.044  1.00 93.88  ? 480  LEU A CB    1 
ATOM   3449  C  CG    . LEU A 1  480  ? -73.206 -26.565 -6.784  1.00 93.39  ? 480  LEU A CG    1 
ATOM   3450  C  CD1   . LEU A 1  480  ? -72.429 -26.367 -8.080  1.00 91.41  ? 480  LEU A CD1   1 
ATOM   3451  C  CD2   . LEU A 1  480  ? -72.796 -25.533 -5.743  1.00 94.39  ? 480  LEU A CD2   1 
ATOM   3452  N  N     . ILE A 1  481  ? -77.920 -27.815 -6.494  1.00 96.97  ? 481  ILE A N     1 
ATOM   3453  C  CA    . ILE A 1  481  ? -79.347 -27.590 -6.789  1.00 97.57  ? 481  ILE A CA    1 
ATOM   3454  C  C     . ILE A 1  481  ? -80.051 -27.082 -5.536  1.00 99.78  ? 481  ILE A C     1 
ATOM   3455  O  O     . ILE A 1  481  ? -79.870 -27.642 -4.455  1.00 101.48 ? 481  ILE A O     1 
ATOM   3456  C  CB    . ILE A 1  481  ? -80.082 -28.863 -7.293  1.00 97.54  ? 481  ILE A CB    1 
ATOM   3457  C  CG1   . ILE A 1  481  ? -79.394 -29.469 -8.529  1.00 95.88  ? 481  ILE A CG1   1 
ATOM   3458  C  CG2   . ILE A 1  481  ? -81.551 -28.559 -7.599  1.00 98.16  ? 481  ILE A CG2   1 
ATOM   3459  C  CD1   . ILE A 1  481  ? -79.091 -28.492 -9.648  1.00 94.27  ? 481  ILE A CD1   1 
ATOM   3460  N  N     . GLY A 1  482  ? -80.843 -26.020 -5.693  1.00 100.37 ? 482  GLY A N     1 
ATOM   3461  C  CA    . GLY A 1  482  ? -81.531 -25.371 -4.572  1.00 102.03 ? 482  GLY A CA    1 
ATOM   3462  C  C     . GLY A 1  482  ? -80.844 -24.125 -4.023  1.00 102.25 ? 482  GLY A C     1 
ATOM   3463  O  O     . GLY A 1  482  ? -81.487 -23.329 -3.341  1.00 102.65 ? 482  GLY A O     1 
ATOM   3464  N  N     . ARG A 1  483  ? -79.550 -23.948 -4.316  1.00 101.76 ? 483  ARG A N     1 
ATOM   3465  C  CA    . ARG A 1  483  ? -78.785 -22.786 -3.837  1.00 102.05 ? 483  ARG A CA    1 
ATOM   3466  C  C     . ARG A 1  483  ? -79.040 -21.534 -4.674  1.00 101.19 ? 483  ARG A C     1 
ATOM   3467  O  O     . ARG A 1  483  ? -79.540 -21.612 -5.799  1.00 99.80  ? 483  ARG A O     1 
ATOM   3468  C  CB    . ARG A 1  483  ? -77.281 -23.084 -3.826  1.00 101.54 ? 483  ARG A CB    1 
ATOM   3469  C  CG    . ARG A 1  483  ? -76.860 -24.176 -2.858  1.00 103.19 ? 483  ARG A CG    1 
ATOM   3470  C  CD    . ARG A 1  483  ? -75.365 -24.430 -2.957  1.00 103.09 ? 483  ARG A CD    1 
ATOM   3471  N  NE    . ARG A 1  483  ? -74.941 -25.600 -2.183  1.00 104.64 ? 483  ARG A NE    1 
ATOM   3472  C  CZ    . ARG A 1  483  ? -74.747 -25.632 -0.862  1.00 106.41 ? 483  ARG A CZ    1 
ATOM   3473  N  NH1   . ARG A 1  483  ? -74.931 -24.551 -0.098  1.00 107.48 ? 483  ARG A NH1   1 
ATOM   3474  N  NH2   . ARG A 1  483  ? -74.356 -26.770 -0.290  1.00 107.26 ? 483  ARG A NH2   1 
ATOM   3475  N  N     . HIS A 1  484  ? -78.679 -20.386 -4.104  1.00 102.46 ? 484  HIS A N     1 
ATOM   3476  C  CA    . HIS A 1  484  ? -78.813 -19.086 -4.767  1.00 102.72 ? 484  HIS A CA    1 
ATOM   3477  C  C     . HIS A 1  484  ? -77.595 -18.772 -5.624  1.00 101.78 ? 484  HIS A C     1 
ATOM   3478  O  O     . HIS A 1  484  ? -76.552 -19.426 -5.516  1.00 102.34 ? 484  HIS A O     1 
ATOM   3479  C  CB    . HIS A 1  484  ? -79.017 -17.973 -3.737  1.00 104.31 ? 484  HIS A CB    1 
ATOM   3480  C  CG    . HIS A 1  484  ? -80.377 -17.972 -3.121  1.00 106.11 ? 484  HIS A CG    1 
ATOM   3481  N  ND1   . HIS A 1  484  ? -81.427 -17.248 -3.644  1.00 106.50 ? 484  HIS A ND1   1 
ATOM   3482  C  CD2   . HIS A 1  484  ? -80.865 -18.611 -2.031  1.00 107.99 ? 484  HIS A CD2   1 
ATOM   3483  C  CE1   . HIS A 1  484  ? -82.502 -17.437 -2.901  1.00 108.58 ? 484  HIS A CE1   1 
ATOM   3484  N  NE2   . HIS A 1  484  ? -82.187 -18.257 -1.914  1.00 109.57 ? 484  HIS A NE2   1 
ATOM   3485  N  N     . TRP A 1  485  ? -77.740 -17.757 -6.471  1.00 101.44 ? 485  TRP A N     1 
ATOM   3486  C  CA    . TRP A 1  485  ? -76.676 -17.331 -7.374  1.00 100.00 ? 485  TRP A CA    1 
ATOM   3487  C  C     . TRP A 1  485  ? -75.919 -16.155 -6.742  1.00 101.22 ? 485  TRP A C     1 
ATOM   3488  O  O     . TRP A 1  485  ? -76.206 -14.987 -7.015  1.00 101.35 ? 485  TRP A O     1 
ATOM   3489  C  CB    . TRP A 1  485  ? -77.270 -16.982 -8.748  1.00 98.48  ? 485  TRP A CB    1 
ATOM   3490  C  CG    . TRP A 1  485  ? -76.285 -17.058 -9.864  1.00 95.86  ? 485  TRP A CG    1 
ATOM   3491  C  CD1   . TRP A 1  485  ? -75.656 -16.019 -10.468 1.00 94.52  ? 485  TRP A CD1   1 
ATOM   3492  C  CD2   . TRP A 1  485  ? -75.814 -18.245 -10.509 1.00 94.41  ? 485  TRP A CD2   1 
ATOM   3493  N  NE1   . TRP A 1  485  ? -74.814 -16.479 -11.453 1.00 92.79  ? 485  TRP A NE1   1 
ATOM   3494  C  CE2   . TRP A 1  485  ? -74.891 -17.845 -11.499 1.00 92.55  ? 485  TRP A CE2   1 
ATOM   3495  C  CE3   . TRP A 1  485  ? -76.082 -19.610 -10.347 1.00 94.48  ? 485  TRP A CE3   1 
ATOM   3496  C  CZ2   . TRP A 1  485  ? -74.232 -18.765 -12.329 1.00 90.81  ? 485  TRP A CZ2   1 
ATOM   3497  C  CZ3   . TRP A 1  485  ? -75.423 -20.526 -11.168 1.00 92.66  ? 485  TRP A CZ3   1 
ATOM   3498  C  CH2   . TRP A 1  485  ? -74.507 -20.095 -12.144 1.00 90.89  ? 485  TRP A CH2   1 
ATOM   3499  N  N     . ASN A 1  486  ? -74.961 -16.488 -5.875  1.00 102.65 ? 486  ASN A N     1 
ATOM   3500  C  CA    . ASN A 1  486  ? -74.140 -15.498 -5.161  1.00 104.24 ? 486  ASN A CA    1 
ATOM   3501  C  C     . ASN A 1  486  ? -72.700 -15.980 -5.009  1.00 104.59 ? 486  ASN A C     1 
ATOM   3502  O  O     . ASN A 1  486  ? -72.383 -17.112 -5.380  1.00 103.68 ? 486  ASN A O     1 
ATOM   3503  C  CB    . ASN A 1  486  ? -74.759 -15.170 -3.794  1.00 106.38 ? 486  ASN A CB    1 
ATOM   3504  C  CG    . ASN A 1  486  ? -74.973 -16.402 -2.925  1.00 107.35 ? 486  ASN A CG    1 
ATOM   3505  O  OD1   . ASN A 1  486  ? -74.082 -17.237 -2.775  1.00 107.11 ? 486  ASN A OD1   1 
ATOM   3506  N  ND2   . ASN A 1  486  ? -76.159 -16.509 -2.331  1.00 108.55 ? 486  ASN A ND2   1 
ATOM   3507  N  N     . GLU A 1  487  ? -71.835 -15.129 -4.460  1.00 106.61 ? 487  GLU A N     1 
ATOM   3508  C  CA    . GLU A 1  487  ? -70.410 -15.457 -4.336  1.00 107.53 ? 487  GLU A CA    1 
ATOM   3509  C  C     . GLU A 1  487  ? -70.125 -16.588 -3.341  1.00 109.03 ? 487  GLU A C     1 
ATOM   3510  O  O     . GLU A 1  487  ? -69.115 -17.281 -3.475  1.00 109.00 ? 487  GLU A O     1 
ATOM   3511  C  CB    . GLU A 1  487  ? -69.582 -14.216 -3.981  1.00 108.33 ? 487  GLU A CB    1 
ATOM   3512  C  CG    . GLU A 1  487  ? -68.091 -14.405 -4.220  1.00 107.87 ? 487  GLU A CG    1 
ATOM   3513  C  CD    . GLU A 1  487  ? -67.349 -13.096 -4.422  1.00 108.44 ? 487  GLU A CD    1 
ATOM   3514  O  OE1   . GLU A 1  487  ? -67.426 -12.222 -3.530  1.00 109.43 ? 487  GLU A OE1   1 
ATOM   3515  O  OE2   . GLU A 1  487  ? -66.683 -12.952 -5.473  1.00 107.34 ? 487  GLU A OE2   1 
ATOM   3516  N  N     . GLN A 1  488  ? -71.010 -16.779 -2.363  1.00 111.56 ? 488  GLN A N     1 
ATOM   3517  C  CA    . GLN A 1  488  ? -70.891 -17.900 -1.423  1.00 113.67 ? 488  GLN A CA    1 
ATOM   3518  C  C     . GLN A 1  488  ? -71.052 -19.263 -2.107  1.00 113.30 ? 488  GLN A C     1 
ATOM   3519  O  O     . GLN A 1  488  ? -70.472 -20.250 -1.649  1.00 113.36 ? 488  GLN A O     1 
ATOM   3520  C  CB    . GLN A 1  488  ? -71.893 -17.763 -0.272  1.00 115.88 ? 488  GLN A CB    1 
ATOM   3521  C  CG    . GLN A 1  488  ? -71.771 -18.859 0.776   1.00 117.36 ? 488  GLN A CG    1 
ATOM   3522  C  CD    . GLN A 1  488  ? -72.396 -18.485 2.098   1.00 120.60 ? 488  GLN A CD    1 
ATOM   3523  O  OE1   . GLN A 1  488  ? -71.828 -18.753 3.154   1.00 123.31 ? 488  GLN A OE1   1 
ATOM   3524  N  NE2   . GLN A 1  488  ? -73.567 -17.857 2.053   1.00 121.62 ? 488  GLN A NE2   1 
ATOM   3525  N  N     . MET A 1  489  ? -71.843 -19.318 -3.182  1.00 113.83 ? 489  MET A N     1 
ATOM   3526  C  CA    . MET A 1  489  ? -71.914 -20.518 -4.029  1.00 113.67 ? 489  MET A CA    1 
ATOM   3527  C  C     . MET A 1  489  ? -70.577 -20.795 -4.716  1.00 112.20 ? 489  MET A C     1 
ATOM   3528  O  O     . MET A 1  489  ? -70.135 -21.939 -4.743  1.00 111.80 ? 489  MET A O     1 
ATOM   3529  C  CB    . MET A 1  489  ? -73.020 -20.406 -5.090  1.00 113.74 ? 489  MET A CB    1 
ATOM   3530  C  CG    . MET A 1  489  ? -73.023 -21.542 -6.117  1.00 113.70 ? 489  MET A CG    1 
ATOM   3531  S  SD    . MET A 1  489  ? -74.096 -21.270 -7.538  1.00 113.62 ? 489  MET A SD    1 
ATOM   3532  C  CE    . MET A 1  489  ? -73.240 -19.944 -8.393  1.00 111.45 ? 489  MET A CE    1 
ATOM   3533  N  N     . LEU A 1  490  ? -69.951 -19.759 -5.275  1.00 111.07 ? 490  LEU A N     1 
ATOM   3534  C  CA    . LEU A 1  490  ? -68.710 -19.925 -6.051  1.00 109.88 ? 490  LEU A CA    1 
ATOM   3535  C  C     . LEU A 1  490  ? -67.593 -20.596 -5.277  1.00 109.53 ? 490  LEU A C     1 
ATOM   3536  O  O     . LEU A 1  490  ? -66.960 -21.516 -5.788  1.00 108.23 ? 490  LEU A O     1 
ATOM   3537  C  CB    . LEU A 1  490  ? -68.192 -18.586 -6.595  1.00 109.81 ? 490  LEU A CB    1 
ATOM   3538  C  CG    . LEU A 1  490  ? -68.633 -18.265 -8.017  1.00 108.35 ? 490  LEU A CG    1 
ATOM   3539  C  CD1   . LEU A 1  490  ? -70.145 -18.121 -8.083  1.00 109.26 ? 490  LEU A CD1   1 
ATOM   3540  C  CD2   . LEU A 1  490  ? -67.936 -17.006 -8.503  1.00 107.46 ? 490  LEU A CD2   1 
ATOM   3541  N  N     . ASP A 1  491  ? -67.362 -20.132 -4.053  1.00 109.95 ? 491  ASP A N     1 
ATOM   3542  C  CA    . ASP A 1  491  ? -66.278 -20.660 -3.228  1.00 110.66 ? 491  ASP A CA    1 
ATOM   3543  C  C     . ASP A 1  491  ? -66.438 -22.167 -3.015  1.00 109.70 ? 491  ASP A C     1 
ATOM   3544  O  O     . ASP A 1  491  ? -65.475 -22.910 -3.172  1.00 108.97 ? 491  ASP A O     1 
ATOM   3545  C  CB    . ASP A 1  491  ? -66.197 -19.926 -1.879  1.00 113.92 ? 491  ASP A CB    1 
ATOM   3546  C  CG    . ASP A 1  491  ? -65.845 -18.440 -2.021  1.00 114.57 ? 491  ASP A CG    1 
ATOM   3547  O  OD1   . ASP A 1  491  ? -65.422 -18.006 -3.117  1.00 112.97 ? 491  ASP A OD1   1 
ATOM   3548  O  OD2   . ASP A 1  491  ? -65.997 -17.701 -1.021  1.00 117.66 ? 491  ASP A OD2   1 
ATOM   3549  N  N     . ILE A 1  492  ? -67.655 -22.610 -2.691  1.00 109.29 ? 492  ILE A N     1 
ATOM   3550  C  CA    . ILE A 1  492  ? -67.938 -24.047 -2.514  1.00 108.35 ? 492  ILE A CA    1 
ATOM   3551  C  C     . ILE A 1  492  ? -68.065 -24.782 -3.858  1.00 105.11 ? 492  ILE A C     1 
ATOM   3552  O  O     . ILE A 1  492  ? -67.577 -25.904 -3.994  1.00 104.12 ? 492  ILE A O     1 
ATOM   3553  C  CB    . ILE A 1  492  ? -69.164 -24.316 -1.591  1.00 110.10 ? 492  ILE A CB    1 
ATOM   3554  C  CG1   . ILE A 1  492  ? -70.497 -23.923 -2.251  1.00 109.83 ? 492  ILE A CG1   1 
ATOM   3555  C  CG2   . ILE A 1  492  ? -68.986 -23.607 -0.248  1.00 111.90 ? 492  ILE A CG2   1 
ATOM   3556  C  CD1   . ILE A 1  492  ? -71.710 -24.172 -1.382  1.00 111.91 ? 492  ILE A CD1   1 
ATOM   3557  N  N     . ALA A 1  493  ? -68.705 -24.146 -4.841  1.00 102.86 ? 493  ALA A N     1 
ATOM   3558  C  CA    . ALA A 1  493  ? -68.833 -24.704 -6.197  1.00 100.17 ? 493  ALA A CA    1 
ATOM   3559  C  C     . ALA A 1  493  ? -67.472 -24.952 -6.855  1.00 97.77  ? 493  ALA A C     1 
ATOM   3560  O  O     . ALA A 1  493  ? -67.304 -25.927 -7.577  1.00 95.94  ? 493  ALA A O     1 
ATOM   3561  C  CB    . ALA A 1  493  ? -69.682 -23.802 -7.081  1.00 99.36  ? 493  ALA A CB    1 
ATOM   3562  N  N     . CYS A 1  494  ? -66.515 -24.063 -6.597  1.00 96.52  ? 494  CYS A N     1 
ATOM   3563  C  CA    . CYS A 1  494  ? -65.150 -24.231 -7.088  1.00 94.50  ? 494  CYS A CA    1 
ATOM   3564  C  C     . CYS A 1  494  ? -64.457 -25.449 -6.464  1.00 95.59  ? 494  CYS A C     1 
ATOM   3565  O  O     . CYS A 1  494  ? -63.807 -26.208 -7.176  1.00 95.17  ? 494  CYS A O     1 
ATOM   3566  C  CB    . CYS A 1  494  ? -64.321 -22.959 -6.849  1.00 93.78  ? 494  CYS A CB    1 
ATOM   3567  S  SG    . CYS A 1  494  ? -64.756 -21.541 -7.892  1.00 91.43  ? 494  CYS A SG    1 
ATOM   3568  N  N     . ARG A 1  495  ? -64.612 -25.653 -5.155  1.00 98.22  ? 495  ARG A N     1 
ATOM   3569  C  CA    . ARG A 1  495  ? -63.886 -26.727 -4.456  1.00 99.99  ? 495  ARG A CA    1 
ATOM   3570  C  C     . ARG A 1  495  ? -64.372 -28.127 -4.810  1.00 98.99  ? 495  ARG A C     1 
ATOM   3571  O  O     . ARG A 1  495  ? -63.552 -28.999 -5.090  1.00 99.48  ? 495  ARG A O     1 
ATOM   3572  C  CB    . ARG A 1  495  ? -63.900 -26.530 -2.932  1.00 103.44 ? 495  ARG A CB    1 
ATOM   3573  C  CG    . ARG A 1  495  ? -63.090 -25.325 -2.491  1.00 105.46 ? 495  ARG A CG    1 
ATOM   3574  C  CD    . ARG A 1  495  ? -62.642 -25.368 -1.042  1.00 108.85 ? 495  ARG A CD    1 
ATOM   3575  N  NE    . ARG A 1  495  ? -61.955 -24.120 -0.686  1.00 111.00 ? 495  ARG A NE    1 
ATOM   3576  C  CZ    . ARG A 1  495  ? -62.549 -22.949 -0.419  1.00 113.13 ? 495  ARG A CZ    1 
ATOM   3577  N  NH1   . ARG A 1  495  ? -63.879 -22.810 -0.454  1.00 114.01 ? 495  ARG A NH1   1 
ATOM   3578  N  NH2   . ARG A 1  495  ? -61.802 -21.890 -0.113  1.00 113.97 ? 495  ARG A NH2   1 
ATOM   3579  N  N     . LEU A 1  496  ? -65.686 -28.353 -4.799  1.00 98.51  ? 496  LEU A N     1 
ATOM   3580  C  CA    . LEU A 1  496  ? -66.215 -29.681 -5.162  1.00 98.16  ? 496  LEU A CA    1 
ATOM   3581  C  C     . LEU A 1  496  ? -66.107 -29.990 -6.670  1.00 95.45  ? 496  LEU A C     1 
ATOM   3582  O  O     . LEU A 1  496  ? -66.114 -31.161 -7.051  1.00 95.23  ? 496  LEU A O     1 
ATOM   3583  C  CB    . LEU A 1  496  ? -67.633 -29.951 -4.600  1.00 99.78  ? 496  LEU A CB    1 
ATOM   3584  C  CG    . LEU A 1  496  ? -68.772 -28.926 -4.585  1.00 100.03 ? 496  LEU A CG    1 
ATOM   3585  C  CD1   . LEU A 1  496  ? -68.911 -28.267 -5.942  1.00 99.06  ? 496  LEU A CD1   1 
ATOM   3586  C  CD2   . LEU A 1  496  ? -70.085 -29.573 -4.165  1.00 100.65 ? 496  LEU A CD2   1 
ATOM   3587  N  N     . ILE A 1  497  ? -65.998 -28.955 -7.510  1.00 93.37  ? 497  ILE A N     1 
ATOM   3588  C  CA    . ILE A 1  497  ? -65.602 -29.127 -8.922  1.00 90.66  ? 497  ILE A CA    1 
ATOM   3589  C  C     . ILE A 1  497  ? -64.134 -29.560 -9.011  1.00 89.86  ? 497  ILE A C     1 
ATOM   3590  O  O     . ILE A 1  497  ? -63.810 -30.488 -9.753  1.00 89.01  ? 497  ILE A O     1 
ATOM   3591  C  CB    . ILE A 1  497  ? -65.851 -27.845 -9.766  1.00 89.19  ? 497  ILE A CB    1 
ATOM   3592  C  CG1   . ILE A 1  497  ? -67.356 -27.658 -10.018 1.00 89.49  ? 497  ILE A CG1   1 
ATOM   3593  C  CG2   . ILE A 1  497  ? -65.092 -27.866 -11.095 1.00 87.11  ? 497  ILE A CG2   1 
ATOM   3594  C  CD1   . ILE A 1  497  ? -67.956 -28.539 -11.090 1.00 88.66  ? 497  ILE A CD1   1 
ATOM   3595  N  N     . LEU A 1  498  ? -63.258 -28.889 -8.261  1.00 89.88  ? 498  LEU A N     1 
ATOM   3596  C  CA    . LEU A 1  498  ? -61.842 -29.271 -8.192  1.00 89.48  ? 498  LEU A CA    1 
ATOM   3597  C  C     . LEU A 1  498  ? -61.636 -30.688 -7.650  1.00 90.63  ? 498  LEU A C     1 
ATOM   3598  O  O     . LEU A 1  498  ? -60.702 -31.368 -8.061  1.00 90.71  ? 498  LEU A O     1 
ATOM   3599  C  CB    . LEU A 1  498  ? -61.034 -28.271 -7.356  1.00 89.68  ? 498  LEU A CB    1 
ATOM   3600  C  CG    . LEU A 1  498  ? -60.813 -26.901 -8.001  1.00 88.63  ? 498  LEU A CG    1 
ATOM   3601  C  CD1   . LEU A 1  498  ? -60.399 -25.879 -6.951  1.00 89.61  ? 498  LEU A CD1   1 
ATOM   3602  C  CD2   . LEU A 1  498  ? -59.795 -26.970 -9.131  1.00 86.82  ? 498  LEU A CD2   1 
ATOM   3603  N  N     . ASN A 1  499  ? -62.497 -31.127 -6.733  1.00 92.71  ? 499  ASN A N     1 
ATOM   3604  C  CA    . ASN A 1  499  ? -62.500 -32.525 -6.289  1.00 94.32  ? 499  ASN A CA    1 
ATOM   3605  C  C     . ASN A 1  499  ? -62.955 -33.461 -7.401  1.00 93.76  ? 499  ASN A C     1 
ATOM   3606  O  O     . ASN A 1  499  ? -62.268 -34.439 -7.704  1.00 93.57  ? 499  ASN A O     1 
ATOM   3607  C  CB    . ASN A 1  499  ? -63.397 -32.722 -5.061  1.00 96.13  ? 499  ASN A CB    1 
ATOM   3608  C  CG    . ASN A 1  499  ? -62.816 -32.105 -3.801  1.00 97.93  ? 499  ASN A CG    1 
ATOM   3609  O  OD1   . ASN A 1  499  ? -61.749 -31.492 -3.819  1.00 98.01  ? 499  ASN A OD1   1 
ATOM   3610  N  ND2   . ASN A 1  499  ? -63.524 -32.270 -2.691  1.00 100.07 ? 499  ASN A ND2   1 
ATOM   3611  N  N     . GLU A 1  500  ? -64.098 -33.145 -8.010  1.00 93.86  ? 500  GLU A N     1 
ATOM   3612  C  CA    . GLU A 1  500  ? -64.718 -34.021 -9.010  1.00 93.69  ? 500  GLU A CA    1 
ATOM   3613  C  C     . GLU A 1  500  ? -63.875 -34.182 -10.286 1.00 92.55  ? 500  GLU A C     1 
ATOM   3614  O  O     . GLU A 1  500  ? -63.504 -35.309 -10.629 1.00 91.54  ? 500  GLU A O     1 
ATOM   3615  C  CB    . GLU A 1  500  ? -66.136 -33.554 -9.354  1.00 93.52  ? 500  GLU A CB    1 
ATOM   3616  C  CG    . GLU A 1  500  ? -66.912 -34.566 -10.188 1.00 93.32  ? 500  GLU A CG    1 
ATOM   3617  C  CD    . GLU A 1  500  ? -68.408 -34.316 -10.227 1.00 94.24  ? 500  GLU A CD    1 
ATOM   3618  O  OE1   . GLU A 1  500  ? -68.863 -33.203 -9.883  1.00 94.33  ? 500  GLU A OE1   1 
ATOM   3619  O  OE2   . GLU A 1  500  ? -69.143 -35.248 -10.619 1.00 94.82  ? 500  GLU A OE2   1 
ATOM   3620  N  N     . VAL A 1  501  ? -63.576 -33.080 -10.978 1.00 91.79  ? 501  VAL A N     1 
ATOM   3621  C  CA    . VAL A 1  501  ? -62.665 -33.139 -12.132 1.00 91.26  ? 501  VAL A CA    1 
ATOM   3622  C  C     . VAL A 1  501  ? -61.204 -33.143 -11.653 1.00 91.58  ? 501  VAL A C     1 
ATOM   3623  O  O     . VAL A 1  501  ? -60.527 -32.115 -11.632 1.00 90.59  ? 501  VAL A O     1 
ATOM   3624  C  CB    . VAL A 1  501  ? -62.964 -32.061 -13.214 1.00 90.42  ? 501  VAL A CB    1 
ATOM   3625  C  CG1   . VAL A 1  501  ? -64.416 -32.160 -13.655 1.00 91.19  ? 501  VAL A CG1   1 
ATOM   3626  C  CG2   . VAL A 1  501  ? -62.651 -30.645 -12.752 1.00 91.01  ? 501  VAL A CG2   1 
ATOM   3627  N  N     . SER A 1  502  ? -60.739 -34.323 -11.245 1.00 92.95  ? 502  SER A N     1 
ATOM   3628  C  CA    . SER A 1  502  ? -59.356 -34.503 -10.803 1.00 93.15  ? 502  SER A CA    1 
ATOM   3629  C  C     . SER A 1  502  ? -58.450 -34.658 -12.021 1.00 91.06  ? 502  SER A C     1 
ATOM   3630  O  O     . SER A 1  502  ? -58.829 -35.290 -13.011 1.00 88.11  ? 502  SER A O     1 
ATOM   3631  C  CB    . SER A 1  502  ? -59.220 -35.721 -9.870  1.00 95.28  ? 502  SER A CB    1 
ATOM   3632  O  OG    . SER A 1  502  ? -59.096 -36.947 -10.583 1.00 95.39  ? 502  SER A OG    1 
ATOM   3633  N  N     . LEU A 1  503  ? -57.265 -34.057 -11.936 1.00 90.74  ? 503  LEU A N     1 
ATOM   3634  C  CA    . LEU A 1  503  ? -56.193 -34.264 -12.900 1.00 89.24  ? 503  LEU A CA    1 
ATOM   3635  C  C     . LEU A 1  503  ? -54.973 -34.746 -12.137 1.00 89.26  ? 503  LEU A C     1 
ATOM   3636  O  O     . LEU A 1  503  ? -54.502 -34.065 -11.229 1.00 88.91  ? 503  LEU A O     1 
ATOM   3637  C  CB    . LEU A 1  503  ? -55.855 -32.962 -13.626 1.00 88.62  ? 503  LEU A CB    1 
ATOM   3638  C  CG    . LEU A 1  503  ? -56.760 -32.542 -14.784 1.00 88.08  ? 503  LEU A CG    1 
ATOM   3639  C  CD1   . LEU A 1  503  ? -56.444 -31.110 -15.191 1.00 87.72  ? 503  LEU A CD1   1 
ATOM   3640  C  CD2   . LEU A 1  503  ? -56.605 -33.481 -15.976 1.00 87.51  ? 503  LEU A CD2   1 
ATOM   3641  N  N     . LEU A 1  504  ? -54.474 -35.925 -12.499 1.00 89.22  ? 504  LEU A N     1 
ATOM   3642  C  CA    . LEU A 1  504  ? -53.207 -36.419 -11.965 1.00 89.77  ? 504  LEU A CA    1 
ATOM   3643  C  C     . LEU A 1  504  ? -52.091 -35.538 -12.517 1.00 88.57  ? 504  LEU A C     1 
ATOM   3644  O  O     . LEU A 1  504  ? -52.111 -35.192 -13.698 1.00 87.52  ? 504  LEU A O     1 
ATOM   3645  C  CB    . LEU A 1  504  ? -52.970 -37.887 -12.355 1.00 90.01  ? 504  LEU A CB    1 
ATOM   3646  C  CG    . LEU A 1  504  ? -53.655 -38.977 -11.513 1.00 91.55  ? 504  LEU A CG    1 
ATOM   3647  C  CD1   . LEU A 1  504  ? -55.164 -38.787 -11.406 1.00 91.91  ? 504  LEU A CD1   1 
ATOM   3648  C  CD2   . LEU A 1  504  ? -53.329 -40.347 -12.090 1.00 90.92  ? 504  LEU A CD2   1 
ATOM   3649  N  N     . GLY A 1  505  ? -51.126 -35.178 -11.670 1.00 88.97  ? 505  GLY A N     1 
ATOM   3650  C  CA    . GLY A 1  505  ? -49.960 -34.380 -12.082 1.00 87.88  ? 505  GLY A CA    1 
ATOM   3651  C  C     . GLY A 1  505  ? -49.192 -34.925 -13.281 1.00 86.62  ? 505  GLY A C     1 
ATOM   3652  O  O     . GLY A 1  505  ? -48.499 -34.172 -13.972 1.00 85.47  ? 505  GLY A O     1 
ATOM   3653  N  N     . SER A 1  506  ? -49.309 -36.235 -13.515 1.00 86.60  ? 506  SER A N     1 
ATOM   3654  C  CA    . SER A 1  506  ? -48.742 -36.906 -14.687 1.00 85.21  ? 506  SER A CA    1 
ATOM   3655  C  C     . SER A 1  506  ? -49.662 -36.954 -15.917 1.00 83.63  ? 506  SER A C     1 
ATOM   3656  O  O     . SER A 1  506  ? -49.324 -37.622 -16.894 1.00 83.42  ? 506  SER A O     1 
ATOM   3657  C  CB    . SER A 1  506  ? -48.388 -38.343 -14.298 1.00 86.30  ? 506  SER A CB    1 
ATOM   3658  O  OG    . SER A 1  506  ? -49.553 -39.064 -13.943 1.00 87.17  ? 506  SER A OG    1 
ATOM   3659  N  N     . ALA A 1  507  ? -50.796 -36.250 -15.890 1.00 82.99  ? 507  ALA A N     1 
ATOM   3660  C  CA    . ALA A 1  507  ? -51.836 -36.420 -16.918 1.00 81.59  ? 507  ALA A CA    1 
ATOM   3661  C  C     . ALA A 1  507  ? -51.355 -36.082 -18.339 1.00 78.98  ? 507  ALA A C     1 
ATOM   3662  O  O     . ALA A 1  507  ? -50.476 -35.227 -18.504 1.00 78.35  ? 507  ALA A O     1 
ATOM   3663  C  CB    . ALA A 1  507  ? -53.076 -35.595 -16.582 1.00 82.10  ? 507  ALA A CB    1 
ATOM   3664  N  N     . PRO A 1  508  ? -51.929 -36.755 -19.365 1.00 76.65  ? 508  PRO A N     1 
ATOM   3665  C  CA    . PRO A 1  508  ? -51.618 -36.404 -20.753 1.00 74.54  ? 508  PRO A CA    1 
ATOM   3666  C  C     . PRO A 1  508  ? -51.968 -34.953 -21.068 1.00 73.68  ? 508  PRO A C     1 
ATOM   3667  O  O     . PRO A 1  508  ? -52.949 -34.431 -20.538 1.00 75.10  ? 508  PRO A O     1 
ATOM   3668  C  CB    . PRO A 1  508  ? -52.503 -37.351 -21.573 1.00 74.21  ? 508  PRO A CB    1 
ATOM   3669  C  CG    . PRO A 1  508  ? -52.854 -38.462 -20.655 1.00 75.66  ? 508  PRO A CG    1 
ATOM   3670  C  CD    . PRO A 1  508  ? -52.891 -37.871 -19.286 1.00 76.62  ? 508  PRO A CD    1 
ATOM   3671  N  N     . GLY A 1  509  ? -51.164 -34.320 -21.918 1.00 72.21  ? 509  GLY A N     1 
ATOM   3672  C  CA    . GLY A 1  509  ? -51.309 -32.902 -22.247 1.00 71.06  ? 509  GLY A CA    1 
ATOM   3673  C  C     . GLY A 1  509  ? -50.477 -31.959 -21.394 1.00 71.21  ? 509  GLY A C     1 
ATOM   3674  O  O     . GLY A 1  509  ? -50.185 -30.840 -21.825 1.00 69.93  ? 509  GLY A O     1 
ATOM   3675  N  N     . GLY A 1  510  ? -50.092 -32.396 -20.189 1.00 72.27  ? 510  GLY A N     1 
ATOM   3676  C  CA    . GLY A 1  510  ? -49.368 -31.547 -19.250 1.00 72.77  ? 510  GLY A CA    1 
ATOM   3677  C  C     . GLY A 1  510  ? -50.223 -30.371 -18.831 1.00 73.38  ? 510  GLY A C     1 
ATOM   3678  O  O     . GLY A 1  510  ? -51.448 -30.489 -18.763 1.00 73.44  ? 510  GLY A O     1 
ATOM   3679  N  N     . LYS A 1  511  ? -49.573 -29.238 -18.567 1.00 74.26  ? 511  LYS A N     1 
ATOM   3680  C  CA    . LYS A 1  511  ? -50.245 -27.986 -18.183 1.00 75.11  ? 511  LYS A CA    1 
ATOM   3681  C  C     . LYS A 1  511  ? -51.238 -28.163 -17.027 1.00 76.36  ? 511  LYS A C     1 
ATOM   3682  O  O     . LYS A 1  511  ? -52.281 -27.516 -16.983 1.00 76.57  ? 511  LYS A O     1 
ATOM   3683  C  CB    . LYS A 1  511  ? -50.941 -27.364 -19.401 1.00 74.46  ? 511  LYS A CB    1 
ATOM   3684  C  CG    . LYS A 1  511  ? -49.989 -26.962 -20.512 1.00 74.11  ? 511  LYS A CG    1 
ATOM   3685  C  CD    . LYS A 1  511  ? -50.692 -26.111 -21.561 1.00 73.96  ? 511  LYS A CD    1 
ATOM   3686  C  CE    . LYS A 1  511  ? -49.689 -25.492 -22.527 1.00 73.64  ? 511  LYS A CE    1 
ATOM   3687  N  NZ    . LYS A 1  511  ? -48.921 -26.541 -23.268 1.00 73.75  ? 511  LYS A NZ    1 
ATOM   3688  N  N     . VAL A 1  512  ? -50.886 -29.021 -16.077 1.00 78.17  ? 512  VAL A N     1 
ATOM   3689  C  CA    . VAL A 1  512  ? -51.837 -29.494 -15.071 1.00 79.69  ? 512  VAL A CA    1 
ATOM   3690  C  C     . VAL A 1  512  ? -52.339 -28.351 -14.190 1.00 80.58  ? 512  VAL A C     1 
ATOM   3691  O  O     . VAL A 1  512  ? -53.547 -28.187 -14.022 1.00 80.11  ? 512  VAL A O     1 
ATOM   3692  C  CB    . VAL A 1  512  ? -51.228 -30.632 -14.218 1.00 80.72  ? 512  VAL A CB    1 
ATOM   3693  C  CG1   . VAL A 1  512  ? -52.126 -30.982 -13.032 1.00 81.98  ? 512  VAL A CG1   1 
ATOM   3694  C  CG2   . VAL A 1  512  ? -50.985 -31.860 -15.093 1.00 79.63  ? 512  VAL A CG2   1 
ATOM   3695  N  N     . GLU A 1  513  ? -51.408 -27.556 -13.669 1.00 82.00  ? 513  GLU A N     1 
ATOM   3696  C  CA    . GLU A 1  513  ? -51.739 -26.442 -12.766 1.00 83.79  ? 513  GLU A CA    1 
ATOM   3697  C  C     . GLU A 1  513  ? -52.580 -25.372 -13.481 1.00 81.87  ? 513  GLU A C     1 
ATOM   3698  O  O     . GLU A 1  513  ? -53.473 -24.771 -12.887 1.00 82.73  ? 513  GLU A O     1 
ATOM   3699  C  CB    . GLU A 1  513  ? -50.466 -25.816 -12.168 1.00 85.67  ? 513  GLU A CB    1 
ATOM   3700  C  CG    . GLU A 1  513  ? -49.512 -26.817 -11.514 1.00 88.05  ? 513  GLU A CG    1 
ATOM   3701  C  CD    . GLU A 1  513  ? -48.622 -26.210 -10.436 1.00 91.17  ? 513  GLU A CD    1 
ATOM   3702  O  OE1   . GLU A 1  513  ? -48.203 -25.035 -10.573 1.00 92.27  ? 513  GLU A OE1   1 
ATOM   3703  O  OE2   . GLU A 1  513  ? -48.335 -26.922 -9.446  1.00 92.89  ? 513  GLU A OE2   1 
ATOM   3704  N  N     . PHE A 1  514  ? -52.294 -25.165 -14.762 1.00 79.52  ? 514  PHE A N     1 
ATOM   3705  C  CA    . PHE A 1  514  ? -53.041 -24.235 -15.610 1.00 78.05  ? 514  PHE A CA    1 
ATOM   3706  C  C     . PHE A 1  514  ? -54.451 -24.752 -15.921 1.00 77.92  ? 514  PHE A C     1 
ATOM   3707  O  O     . PHE A 1  514  ? -55.424 -23.997 -15.823 1.00 77.98  ? 514  PHE A O     1 
ATOM   3708  C  CB    . PHE A 1  514  ? -52.243 -23.979 -16.900 1.00 75.81  ? 514  PHE A CB    1 
ATOM   3709  C  CG    . PHE A 1  514  ? -52.861 -22.979 -17.847 1.00 74.17  ? 514  PHE A CG    1 
ATOM   3710  C  CD1   . PHE A 1  514  ? -53.538 -21.845 -17.394 1.00 74.55  ? 514  PHE A CD1   1 
ATOM   3711  C  CD2   . PHE A 1  514  ? -52.713 -23.154 -19.216 1.00 72.72  ? 514  PHE A CD2   1 
ATOM   3712  C  CE1   . PHE A 1  514  ? -54.078 -20.938 -18.293 1.00 73.60  ? 514  PHE A CE1   1 
ATOM   3713  C  CE2   . PHE A 1  514  ? -53.241 -22.242 -20.115 1.00 71.69  ? 514  PHE A CE2   1 
ATOM   3714  C  CZ    . PHE A 1  514  ? -53.925 -21.135 -19.654 1.00 71.94  ? 514  PHE A CZ    1 
ATOM   3715  N  N     . LYS A 1  515  ? -54.553 -26.031 -16.289 1.00 77.48  ? 515  LYS A N     1 
ATOM   3716  C  CA    . LYS A 1  515  ? -55.848 -26.677 -16.546 1.00 77.47  ? 515  LYS A CA    1 
ATOM   3717  C  C     . LYS A 1  515  ? -56.777 -26.554 -15.344 1.00 78.38  ? 515  LYS A C     1 
ATOM   3718  O  O     . LYS A 1  515  ? -57.916 -26.106 -15.478 1.00 78.96  ? 515  LYS A O     1 
ATOM   3719  C  CB    . LYS A 1  515  ? -55.673 -28.160 -16.888 1.00 77.88  ? 515  LYS A CB    1 
ATOM   3720  C  CG    . LYS A 1  515  ? -55.177 -28.446 -18.295 1.00 77.08  ? 515  LYS A CG    1 
ATOM   3721  C  CD    . LYS A 1  515  ? -55.220 -29.938 -18.568 1.00 77.15  ? 515  LYS A CD    1 
ATOM   3722  C  CE    . LYS A 1  515  ? -54.654 -30.285 -19.929 1.00 75.55  ? 515  LYS A CE    1 
ATOM   3723  N  NZ    . LYS A 1  515  ? -54.448 -31.755 -20.026 1.00 76.09  ? 515  LYS A NZ    1 
ATOM   3724  N  N     . ARG A 1  516  ? -56.272 -26.955 -14.177 1.00 78.67  ? 516  ARG A N     1 
ATOM   3725  C  CA    . ARG A 1  516  ? -56.975 -26.791 -12.892 1.00 79.68  ? 516  ARG A CA    1 
ATOM   3726  C  C     . ARG A 1  516  ? -57.575 -25.397 -12.717 1.00 79.98  ? 516  ARG A C     1 
ATOM   3727  O  O     . ARG A 1  516  ? -58.729 -25.253 -12.307 1.00 81.05  ? 516  ARG A O     1 
ATOM   3728  C  CB    . ARG A 1  516  ? -56.031 -27.090 -11.716 1.00 79.90  ? 516  ARG A CB    1 
ATOM   3729  C  CG    . ARG A 1  516  ? -55.808 -28.573 -11.486 1.00 79.50  ? 516  ARG A CG    1 
ATOM   3730  C  CD    . ARG A 1  516  ? -54.687 -28.853 -10.504 1.00 79.71  ? 516  ARG A CD    1 
ATOM   3731  N  NE    . ARG A 1  516  ? -54.431 -30.291 -10.419 1.00 79.61  ? 516  ARG A NE    1 
ATOM   3732  C  CZ    . ARG A 1  516  ? -53.343 -30.857 -9.892  1.00 80.18  ? 516  ARG A CZ    1 
ATOM   3733  N  NH1   . ARG A 1  516  ? -52.353 -30.127 -9.378  1.00 80.70  ? 516  ARG A NH1   1 
ATOM   3734  N  NH2   . ARG A 1  516  ? -53.233 -32.180 -9.894  1.00 80.59  ? 516  ARG A NH2   1 
ATOM   3735  N  N     . THR A 1  517  ? -56.781 -24.384 -13.046 1.00 79.46  ? 517  THR A N     1 
ATOM   3736  C  CA    . THR A 1  517  ? -57.185 -22.992 -12.897 1.00 79.96  ? 517  THR A CA    1 
ATOM   3737  C  C     . THR A 1  517  ? -58.275 -22.593 -13.895 1.00 79.14  ? 517  THR A C     1 
ATOM   3738  O  O     . THR A 1  517  ? -59.248 -21.939 -13.516 1.00 79.71  ? 517  THR A O     1 
ATOM   3739  C  CB    . THR A 1  517  ? -55.966 -22.065 -13.033 1.00 79.60  ? 517  THR A CB    1 
ATOM   3740  O  OG1   . THR A 1  517  ? -54.887 -22.600 -12.256 1.00 80.38  ? 517  THR A OG1   1 
ATOM   3741  C  CG2   . THR A 1  517  ? -56.290 -20.675 -12.529 1.00 80.60  ? 517  THR A CG2   1 
ATOM   3742  N  N     . LEU A 1  518  ? -58.109 -22.991 -15.156 1.00 78.34  ? 518  LEU A N     1 
ATOM   3743  C  CA    . LEU A 1  518  ? -59.088 -22.697 -16.216 1.00 77.66  ? 518  LEU A CA    1 
ATOM   3744  C  C     . LEU A 1  518  ? -60.479 -23.252 -15.905 1.00 78.64  ? 518  LEU A C     1 
ATOM   3745  O  O     . LEU A 1  518  ? -61.483 -22.582 -16.144 1.00 78.44  ? 518  LEU A O     1 
ATOM   3746  C  CB    . LEU A 1  518  ? -58.609 -23.247 -17.566 1.00 76.00  ? 518  LEU A CB    1 
ATOM   3747  C  CG    . LEU A 1  518  ? -57.403 -22.563 -18.222 1.00 74.97  ? 518  LEU A CG    1 
ATOM   3748  C  CD1   . LEU A 1  518  ? -56.941 -23.369 -19.430 1.00 73.48  ? 518  LEU A CD1   1 
ATOM   3749  C  CD2   . LEU A 1  518  ? -57.725 -21.130 -18.621 1.00 74.53  ? 518  LEU A CD2   1 
ATOM   3750  N  N     . ILE A 1  519  ? -60.512 -24.476 -15.376 1.00 79.94  ? 519  ILE A N     1 
ATOM   3751  C  CA    . ILE A 1  519  ? -61.748 -25.142 -14.933 1.00 80.92  ? 519  ILE A CA    1 
ATOM   3752  C  C     . ILE A 1  519  ? -62.574 -24.246 -14.015 1.00 81.86  ? 519  ILE A C     1 
ATOM   3753  O  O     . ILE A 1  519  ? -63.769 -24.054 -14.240 1.00 81.47  ? 519  ILE A O     1 
ATOM   3754  C  CB    . ILE A 1  519  ? -61.419 -26.493 -14.241 1.00 81.91  ? 519  ILE A CB    1 
ATOM   3755  C  CG1   . ILE A 1  519  ? -61.072 -27.542 -15.304 1.00 81.53  ? 519  ILE A CG1   1 
ATOM   3756  C  CG2   . ILE A 1  519  ? -62.567 -27.008 -13.378 1.00 83.12  ? 519  ILE A CG2   1 
ATOM   3757  C  CD1   . ILE A 1  519  ? -60.279 -28.725 -14.787 1.00 82.30  ? 519  ILE A CD1   1 
ATOM   3758  N  N     . ILE A 1  520  ? -61.922 -23.698 -12.995 1.00 83.06  ? 520  ILE A N     1 
ATOM   3759  C  CA    . ILE A 1  520  ? -62.587 -22.798 -12.039 1.00 85.03  ? 520  ILE A CA    1 
ATOM   3760  C  C     . ILE A 1  520  ? -62.679 -21.340 -12.514 1.00 84.44  ? 520  ILE A C     1 
ATOM   3761  O  O     . ILE A 1  520  ? -63.597 -20.619 -12.104 1.00 85.35  ? 520  ILE A O     1 
ATOM   3762  C  CB    . ILE A 1  520  ? -61.967 -22.877 -10.617 1.00 86.76  ? 520  ILE A CB    1 
ATOM   3763  C  CG1   . ILE A 1  520  ? -60.488 -22.458 -10.601 1.00 86.67  ? 520  ILE A CG1   1 
ATOM   3764  C  CG2   . ILE A 1  520  ? -62.138 -24.282 -10.049 1.00 87.36  ? 520  ILE A CG2   1 
ATOM   3765  C  CD1   . ILE A 1  520  ? -59.906 -22.357 -9.209  1.00 88.37  ? 520  ILE A CD1   1 
ATOM   3766  N  N     . SER A 1  521  ? -61.739 -20.907 -13.359 1.00 82.42  ? 521  SER A N     1 
ATOM   3767  C  CA    . SER A 1  521  ? -61.780 -19.557 -13.942 1.00 81.84  ? 521  SER A CA    1 
ATOM   3768  C  C     . SER A 1  521  ? -62.937 -19.377 -14.940 1.00 81.57  ? 521  SER A C     1 
ATOM   3769  O  O     . SER A 1  521  ? -63.522 -18.294 -15.016 1.00 82.04  ? 521  SER A O     1 
ATOM   3770  C  CB    . SER A 1  521  ? -60.449 -19.214 -14.617 1.00 80.65  ? 521  SER A CB    1 
ATOM   3771  O  OG    . SER A 1  521  ? -59.384 -19.241 -13.683 1.00 80.92  ? 521  SER A OG    1 
ATOM   3772  N  N     . PHE A 1  522  ? -63.252 -20.428 -15.706 1.00 80.67  ? 522  PHE A N     1 
ATOM   3773  C  CA    . PHE A 1  522  ? -64.442 -20.432 -16.571 1.00 79.76  ? 522  PHE A CA    1 
ATOM   3774  C  C     . PHE A 1  522  ? -65.717 -20.443 -15.732 1.00 80.46  ? 522  PHE A C     1 
ATOM   3775  O  O     . PHE A 1  522  ? -66.686 -19.764 -16.070 1.00 80.79  ? 522  PHE A O     1 
ATOM   3776  C  CB    . PHE A 1  522  ? -64.468 -21.644 -17.527 1.00 78.92  ? 522  PHE A CB    1 
ATOM   3777  C  CG    . PHE A 1  522  ? -63.355 -21.674 -18.558 1.00 77.31  ? 522  PHE A CG    1 
ATOM   3778  C  CD1   . PHE A 1  522  ? -62.803 -20.504 -19.096 1.00 76.46  ? 522  PHE A CD1   1 
ATOM   3779  C  CD2   . PHE A 1  522  ? -62.884 -22.903 -19.028 1.00 76.61  ? 522  PHE A CD2   1 
ATOM   3780  C  CE1   . PHE A 1  522  ? -61.798 -20.569 -20.052 1.00 75.13  ? 522  PHE A CE1   1 
ATOM   3781  C  CE2   . PHE A 1  522  ? -61.876 -22.968 -19.984 1.00 75.03  ? 522  PHE A CE2   1 
ATOM   3782  C  CZ    . PHE A 1  522  ? -61.334 -21.799 -20.497 1.00 74.41  ? 522  PHE A CZ    1 
ATOM   3783  N  N     . LEU A 1  523  ? -65.710 -21.222 -14.648 1.00 81.23  ? 523  LEU A N     1 
ATOM   3784  C  CA    . LEU A 1  523  ? -66.812 -21.239 -13.675 1.00 82.58  ? 523  LEU A CA    1 
ATOM   3785  C  C     . LEU A 1  523  ? -67.067 -19.851 -13.070 1.00 83.39  ? 523  LEU A C     1 
ATOM   3786  O  O     . LEU A 1  523  ? -68.218 -19.483 -12.842 1.00 83.84  ? 523  LEU A O     1 
ATOM   3787  C  CB    . LEU A 1  523  ? -66.530 -22.251 -12.558 1.00 83.76  ? 523  LEU A CB    1 
ATOM   3788  C  CG    . LEU A 1  523  ? -67.673 -22.607 -11.601 1.00 85.24  ? 523  LEU A CG    1 
ATOM   3789  C  CD1   . LEU A 1  523  ? -68.751 -23.401 -12.325 1.00 85.14  ? 523  LEU A CD1   1 
ATOM   3790  C  CD2   . LEU A 1  523  ? -67.141 -23.389 -10.407 1.00 85.85  ? 523  LEU A CD2   1 
ATOM   3791  N  N     . PHE A 1  524  ? -65.992 -19.099 -12.816 1.00 83.51  ? 524  PHE A N     1 
ATOM   3792  C  CA    . PHE A 1  524  ? -66.088 -17.696 -12.386 1.00 84.25  ? 524  PHE A CA    1 
ATOM   3793  C  C     . PHE A 1  524  ? -66.690 -16.798 -13.468 1.00 83.73  ? 524  PHE A C     1 
ATOM   3794  O  O     . PHE A 1  524  ? -67.550 -15.973 -13.177 1.00 85.01  ? 524  PHE A O     1 
ATOM   3795  C  CB    . PHE A 1  524  ? -64.715 -17.148 -11.971 1.00 84.24  ? 524  PHE A CB    1 
ATOM   3796  C  CG    . PHE A 1  524  ? -64.732 -15.688 -11.587 1.00 84.96  ? 524  PHE A CG    1 
ATOM   3797  C  CD1   . PHE A 1  524  ? -65.491 -15.250 -10.507 1.00 86.30  ? 524  PHE A CD1   1 
ATOM   3798  C  CD2   . PHE A 1  524  ? -63.994 -14.750 -12.305 1.00 84.14  ? 524  PHE A CD2   1 
ATOM   3799  C  CE1   . PHE A 1  524  ? -65.514 -13.913 -10.145 1.00 87.03  ? 524  PHE A CE1   1 
ATOM   3800  C  CE2   . PHE A 1  524  ? -64.014 -13.408 -11.949 1.00 84.80  ? 524  PHE A CE2   1 
ATOM   3801  C  CZ    . PHE A 1  524  ? -64.775 -12.989 -10.867 1.00 86.42  ? 524  PHE A CZ    1 
ATOM   3802  N  N     . LYS A 1  525  ? -66.223 -16.945 -14.703 1.00 82.38  ? 525  LYS A N     1 
ATOM   3803  C  CA    . LYS A 1  525  ? -66.780 -16.186 -15.825 1.00 82.11  ? 525  LYS A CA    1 
ATOM   3804  C  C     . LYS A 1  525  ? -68.253 -16.505 -16.067 1.00 82.31  ? 525  LYS A C     1 
ATOM   3805  O  O     . LYS A 1  525  ? -69.031 -15.613 -16.410 1.00 82.67  ? 525  LYS A O     1 
ATOM   3806  C  CB    . LYS A 1  525  ? -65.988 -16.442 -17.106 1.00 81.57  ? 525  LYS A CB    1 
ATOM   3807  C  CG    . LYS A 1  525  ? -64.652 -15.723 -17.163 1.00 81.64  ? 525  LYS A CG    1 
ATOM   3808  C  CD    . LYS A 1  525  ? -64.041 -15.858 -18.544 1.00 80.41  ? 525  LYS A CD    1 
ATOM   3809  C  CE    . LYS A 1  525  ? -62.895 -14.889 -18.758 1.00 80.62  ? 525  LYS A CE    1 
ATOM   3810  N  NZ    . LYS A 1  525  ? -62.602 -14.779 -20.214 1.00 79.83  ? 525  LYS A NZ    1 
ATOM   3811  N  N     . PHE A 1  526  ? -68.623 -17.775 -15.897 1.00 82.17  ? 526  PHE A N     1 
ATOM   3812  C  CA    . PHE A 1  526  ? -70.016 -18.207 -16.019 1.00 82.90  ? 526  PHE A CA    1 
ATOM   3813  C  C     . PHE A 1  526  ? -70.904 -17.544 -14.966 1.00 85.53  ? 526  PHE A C     1 
ATOM   3814  O  O     . PHE A 1  526  ? -72.028 -17.136 -15.271 1.00 86.87  ? 526  PHE A O     1 
ATOM   3815  C  CB    . PHE A 1  526  ? -70.123 -19.733 -15.909 1.00 82.32  ? 526  PHE A CB    1 
ATOM   3816  C  CG    . PHE A 1  526  ? -71.524 -20.268 -16.094 1.00 82.35  ? 526  PHE A CG    1 
ATOM   3817  C  CD1   . PHE A 1  526  ? -72.291 -19.906 -17.202 1.00 81.59  ? 526  PHE A CD1   1 
ATOM   3818  C  CD2   . PHE A 1  526  ? -72.075 -21.154 -15.164 1.00 82.95  ? 526  PHE A CD2   1 
ATOM   3819  C  CE1   . PHE A 1  526  ? -73.577 -20.401 -17.371 1.00 82.26  ? 526  PHE A CE1   1 
ATOM   3820  C  CE2   . PHE A 1  526  ? -73.361 -21.653 -15.332 1.00 83.65  ? 526  PHE A CE2   1 
ATOM   3821  C  CZ    . PHE A 1  526  ? -74.113 -21.277 -16.437 1.00 83.18  ? 526  PHE A CZ    1 
ATOM   3822  N  N     . TYR A 1  527  ? -70.401 -17.443 -13.735 1.00 86.34  ? 527  TYR A N     1 
ATOM   3823  C  CA    . TYR A 1  527  ? -71.092 -16.702 -12.680 1.00 88.33  ? 527  TYR A CA    1 
ATOM   3824  C  C     . TYR A 1  527  ? -71.421 -15.276 -13.116 1.00 88.47  ? 527  TYR A C     1 
ATOM   3825  O  O     . TYR A 1  527  ? -72.556 -14.825 -12.956 1.00 89.53  ? 527  TYR A O     1 
ATOM   3826  C  CB    . TYR A 1  527  ? -70.265 -16.675 -11.393 1.00 89.52  ? 527  TYR A CB    1 
ATOM   3827  C  CG    . TYR A 1  527  ? -70.851 -15.784 -10.313 1.00 91.56  ? 527  TYR A CG    1 
ATOM   3828  C  CD1   . TYR A 1  527  ? -72.090 -16.075 -9.740  1.00 92.55  ? 527  TYR A CD1   1 
ATOM   3829  C  CD2   . TYR A 1  527  ? -70.172 -14.645 -9.870  1.00 92.13  ? 527  TYR A CD2   1 
ATOM   3830  C  CE1   . TYR A 1  527  ? -72.631 -15.263 -8.751  1.00 94.74  ? 527  TYR A CE1   1 
ATOM   3831  C  CE2   . TYR A 1  527  ? -70.707 -13.826 -8.884  1.00 93.90  ? 527  TYR A CE2   1 
ATOM   3832  C  CZ    . TYR A 1  527  ? -71.935 -14.137 -8.326  1.00 95.31  ? 527  TYR A CZ    1 
ATOM   3833  O  OH    . TYR A 1  527  ? -72.469 -13.325 -7.349  1.00 96.95  ? 527  TYR A OH    1 
ATOM   3834  N  N     . LEU A 1  528  ? -70.430 -14.591 -13.683 1.00 87.65  ? 528  LEU A N     1 
ATOM   3835  C  CA    . LEU A 1  528  ? -70.574 -13.190 -14.076 1.00 87.80  ? 528  LEU A CA    1 
ATOM   3836  C  C     . LEU A 1  528  ? -71.550 -12.983 -15.238 1.00 87.17  ? 528  LEU A C     1 
ATOM   3837  O  O     . LEU A 1  528  ? -72.319 -12.023 -15.228 1.00 87.40  ? 528  LEU A O     1 
ATOM   3838  C  CB    . LEU A 1  528  ? -69.206 -12.586 -14.420 1.00 87.31  ? 528  LEU A CB    1 
ATOM   3839  C  CG    . LEU A 1  528  ? -68.158 -12.535 -13.302 1.00 87.77  ? 528  LEU A CG    1 
ATOM   3840  C  CD1   . LEU A 1  528  ? -66.888 -11.865 -13.809 1.00 87.05  ? 528  LEU A CD1   1 
ATOM   3841  C  CD2   . LEU A 1  528  ? -68.691 -11.815 -12.071 1.00 89.26  ? 528  LEU A CD2   1 
ATOM   3842  N  N     . GLU A 1  529  ? -71.514 -13.871 -16.231 1.00 86.47  ? 529  GLU A N     1 
ATOM   3843  C  CA    . GLU A 1  529  ? -72.442 -13.794 -17.367 1.00 86.74  ? 529  GLU A CA    1 
ATOM   3844  C  C     . GLU A 1  529  ? -73.887 -13.997 -16.917 1.00 88.22  ? 529  GLU A C     1 
ATOM   3845  O  O     . GLU A 1  529  ? -74.781 -13.258 -17.340 1.00 88.93  ? 529  GLU A O     1 
ATOM   3846  C  CB    . GLU A 1  529  ? -72.083 -14.812 -18.459 1.00 85.81  ? 529  GLU A CB    1 
ATOM   3847  C  CG    . GLU A 1  529  ? -70.828 -14.451 -19.248 1.00 85.16  ? 529  GLU A CG    1 
ATOM   3848  C  CD    . GLU A 1  529  ? -70.576 -15.347 -20.456 1.00 84.24  ? 529  GLU A CD    1 
ATOM   3849  O  OE1   . GLU A 1  529  ? -71.521 -15.986 -20.964 1.00 84.94  ? 529  GLU A OE1   1 
ATOM   3850  O  OE2   . GLU A 1  529  ? -69.415 -15.401 -20.915 1.00 83.07  ? 529  GLU A OE2   1 
ATOM   3851  N  N     . VAL A 1  530  ? -74.100 -14.991 -16.057 1.00 88.83  ? 530  VAL A N     1 
ATOM   3852  C  CA    . VAL A 1  530  ? -75.433 -15.284 -15.521 1.00 90.15  ? 530  VAL A CA    1 
ATOM   3853  C  C     . VAL A 1  530  ? -75.876 -14.198 -14.539 1.00 91.11  ? 530  VAL A C     1 
ATOM   3854  O  O     . VAL A 1  530  ? -77.027 -13.767 -14.591 1.00 91.56  ? 530  VAL A O     1 
ATOM   3855  C  CB    . VAL A 1  530  ? -75.504 -16.688 -14.873 1.00 90.67  ? 530  VAL A CB    1 
ATOM   3856  C  CG1   . VAL A 1  530  ? -76.839 -16.910 -14.165 1.00 92.63  ? 530  VAL A CG1   1 
ATOM   3857  C  CG2   . VAL A 1  530  ? -75.289 -17.767 -15.927 1.00 89.31  ? 530  VAL A CG2   1 
ATOM   3858  N  N     . SER A 1  531  ? -74.976 -13.737 -13.668 1.00 91.57  ? 531  SER A N     1 
ATOM   3859  C  CA    . SER A 1  531  ? -75.275 -12.608 -12.775 1.00 93.40  ? 531  SER A CA    1 
ATOM   3860  C  C     . SER A 1  531  ? -75.083 -11.281 -13.517 1.00 94.75  ? 531  SER A C     1 
ATOM   3861  O  O     . SER A 1  531  ? -74.302 -10.432 -13.101 1.00 96.27  ? 531  SER A O     1 
ATOM   3862  C  CB    . SER A 1  531  ? -74.420 -12.655 -11.502 1.00 93.10  ? 531  SER A CB    1 
ATOM   3863  O  OG    . SER A 1  531  ? -73.049 -12.472 -11.784 1.00 91.27  ? 531  SER A OG    1 
ATOM   3864  N  N     . GLN A 1  532  ? -75.815 -11.129 -14.618 1.00 95.90  ? 532  GLN A N     1 
ATOM   3865  C  CA    . GLN A 1  532  ? -75.808 -9.925  -15.456 1.00 96.40  ? 532  GLN A CA    1 
ATOM   3866  C  C     . GLN A 1  532  ? -77.042 -9.919  -16.358 1.00 96.79  ? 532  GLN A C     1 
ATOM   3867  O  O     . GLN A 1  532  ? -77.751 -8.914  -16.430 1.00 98.41  ? 532  GLN A O     1 
ATOM   3868  C  CB    . GLN A 1  532  ? -74.547 -9.817  -16.313 1.00 95.25  ? 532  GLN A CB    1 
ATOM   3869  C  CG    . GLN A 1  532  ? -74.423 -8.454  -16.996 1.00 96.21  ? 532  GLN A CG    1 
ATOM   3870  C  CD    . GLN A 1  532  ? -73.531 -8.439  -18.226 1.00 96.33  ? 532  GLN A CD    1 
ATOM   3871  O  OE1   . GLN A 1  532  ? -72.758 -7.502  -18.414 1.00 97.63  ? 532  GLN A OE1   1 
ATOM   3872  N  NE2   . GLN A 1  532  ? -73.650 -9.455  -19.084 1.00 95.88  ? 532  GLN A NE2   1 
ATOM   3873  N  N     . ILE A 1  533  ? -77.274 -11.029 -17.063 1.00 95.78  ? 533  ILE A N     1 
ATOM   3874  C  CA    . ILE A 1  533  ? -78.548 -11.266 -17.754 1.00 96.41  ? 533  ILE A CA    1 
ATOM   3875  C  C     . ILE A 1  533  ? -79.718 -11.269 -16.749 1.00 97.23  ? 533  ILE A C     1 
ATOM   3876  O  O     . ILE A 1  533  ? -80.823 -10.836 -17.082 1.00 98.20  ? 533  ILE A O     1 
ATOM   3877  C  CB    . ILE A 1  533  ? -78.510 -12.567 -18.612 1.00 96.57  ? 533  ILE A CB    1 
ATOM   3878  C  CG1   . ILE A 1  533  ? -79.659 -12.606 -19.634 1.00 97.61  ? 533  ILE A CG1   1 
ATOM   3879  C  CG2   . ILE A 1  533  ? -78.523 -13.820 -17.746 1.00 97.00  ? 533  ILE A CG2   1 
ATOM   3880  C  CD1   . ILE A 1  533  ? -79.461 -11.687 -20.825 1.00 97.49  ? 533  ILE A CD1   1 
ATOM   3881  N  N     . LEU A 1  534  ? -79.463 -11.742 -15.525 1.00 96.43  ? 534  LEU A N     1 
ATOM   3882  C  CA    . LEU A 1  534  ? -80.415 -11.621 -14.415 1.00 96.91  ? 534  LEU A CA    1 
ATOM   3883  C  C     . LEU A 1  534  ? -80.663 -10.163 -14.006 1.00 97.85  ? 534  LEU A C     1 
ATOM   3884  O  O     . LEU A 1  534  ? -81.808 -9.779  -13.763 1.00 98.92  ? 534  LEU A O     1 
ATOM   3885  C  CB    . LEU A 1  534  ? -79.944 -12.434 -13.201 1.00 96.72  ? 534  LEU A CB    1 
ATOM   3886  C  CG    . LEU A 1  534  ? -80.009 -13.960 -13.330 1.00 95.65  ? 534  LEU A CG    1 
ATOM   3887  C  CD1   . LEU A 1  534  ? -79.220 -14.623 -12.211 1.00 95.66  ? 534  LEU A CD1   1 
ATOM   3888  C  CD2   . LEU A 1  534  ? -81.446 -14.467 -13.343 1.00 96.43  ? 534  LEU A CD2   1 
ATOM   3889  N  N     . LYS A 1  535  ? -79.597 -9.367  -13.921 1.00 97.20  ? 535  LYS A N     1 
ATOM   3890  C  CA    . LYS A 1  535  ? -79.721 -7.925  -13.676 1.00 98.06  ? 535  LYS A CA    1 
ATOM   3891  C  C     . LYS A 1  535  ? -80.477 -7.218  -14.807 1.00 98.32  ? 535  LYS A C     1 
ATOM   3892  O  O     . LYS A 1  535  ? -81.310 -6.354  -14.552 1.00 99.04  ? 535  LYS A O     1 
ATOM   3893  C  CB    . LYS A 1  535  ? -78.336 -7.286  -13.488 1.00 97.75  ? 535  LYS A CB    1 
ATOM   3894  C  CG    . LYS A 1  535  ? -78.333 -5.782  -13.222 1.00 99.28  ? 535  LYS A CG    1 
ATOM   3895  C  CD    . LYS A 1  535  ? -78.953 -5.453  -11.874 1.00 102.12 ? 535  LYS A CD    1 
ATOM   3896  C  CE    . LYS A 1  535  ? -79.079 -3.956  -11.639 1.00 103.71 ? 535  LYS A CE    1 
ATOM   3897  N  NZ    . LYS A 1  535  ? -79.545 -3.624  -10.258 1.00 105.85 ? 535  LYS A NZ    1 
ATOM   3898  N  N     . LYS A 1  536  ? -80.171 -7.587  -16.050 1.00 97.88  ? 536  LYS A N     1 
ATOM   3899  C  CA    . LYS A 1  536  ? -80.838 -7.025  -17.232 1.00 98.72  ? 536  LYS A CA    1 
ATOM   3900  C  C     . LYS A 1  536  ? -82.344 -7.311  -17.208 1.00 98.89  ? 536  LYS A C     1 
ATOM   3901  O  O     . LYS A 1  536  ? -83.159 -6.397  -17.350 1.00 99.18  ? 536  LYS A O     1 
ATOM   3902  C  CB    . LYS A 1  536  ? -80.193 -7.588  -18.508 1.00 98.72  ? 536  LYS A CB    1 
ATOM   3903  C  CG    . LYS A 1  536  ? -80.730 -7.057  -19.835 1.00 100.44 ? 536  LYS A CG    1 
ATOM   3904  C  CD    . LYS A 1  536  ? -79.852 -7.529  -20.996 1.00 100.71 ? 536  LYS A CD    1 
ATOM   3905  C  CE    . LYS A 1  536  ? -80.587 -7.536  -22.332 1.00 101.64 ? 536  LYS A CE    1 
ATOM   3906  N  NZ    . LYS A 1  536  ? -80.998 -6.170  -22.766 1.00 103.06 ? 536  LYS A NZ    1 
ATOM   3907  N  N     . MET A 1  537  ? -82.694 -8.577  -16.999 1.00 98.21  ? 537  MET A N     1 
ATOM   3908  C  CA    . MET A 1  537  ? -84.092 -9.011  -16.965 1.00 99.11  ? 537  MET A CA    1 
ATOM   3909  C  C     . MET A 1  537  ? -84.848 -8.526  -15.725 1.00 100.68 ? 537  MET A C     1 
ATOM   3910  O  O     . MET A 1  537  ? -85.943 -7.980  -15.853 1.00 101.70 ? 537  MET A O     1 
ATOM   3911  C  CB    . MET A 1  537  ? -84.174 -10.535 -17.051 1.00 98.72  ? 537  MET A CB    1 
ATOM   3912  C  CG    . MET A 1  537  ? -83.757 -11.091 -18.398 1.00 97.40  ? 537  MET A CG    1 
ATOM   3913  S  SD    . MET A 1  537  ? -83.651 -12.889 -18.390 1.00 97.55  ? 537  MET A SD    1 
ATOM   3914  C  CE    . MET A 1  537  ? -85.386 -13.311 -18.234 1.00 99.20  ? 537  MET A CE    1 
ATOM   3915  N  N     . ASP A 1  538  ? -84.261 -8.733  -14.545 1.00 101.21 ? 538  ASP A N     1 
ATOM   3916  C  CA    . ASP A 1  538  ? -84.891 -8.411  -13.254 1.00 103.59 ? 538  ASP A CA    1 
ATOM   3917  C  C     . ASP A 1  538  ? -83.965 -7.497  -12.438 1.00 104.93 ? 538  ASP A C     1 
ATOM   3918  O  O     . ASP A 1  538  ? -83.278 -7.964  -11.524 1.00 103.67 ? 538  ASP A O     1 
ATOM   3919  C  CB    . ASP A 1  538  ? -85.203 -9.710  -12.497 1.00 104.17 ? 538  ASP A CB    1 
ATOM   3920  C  CG    . ASP A 1  538  ? -86.127 -9.505  -11.298 1.00 106.30 ? 538  ASP A CG    1 
ATOM   3921  O  OD1   . ASP A 1  538  ? -86.179 -8.395  -10.726 1.00 107.96 ? 538  ASP A OD1   1 
ATOM   3922  O  OD2   . ASP A 1  538  ? -86.808 -10.480 -10.914 1.00 106.73 ? 538  ASP A OD2   1 
ATOM   3923  N  N     . PRO A 1  539  ? -83.956 -6.184  -12.752 1.00 107.43 ? 539  PRO A N     1 
ATOM   3924  C  CA    . PRO A 1  539  ? -82.981 -5.269  -12.139 1.00 108.20 ? 539  PRO A CA    1 
ATOM   3925  C  C     . PRO A 1  539  ? -83.184 -4.954  -10.650 1.00 110.92 ? 539  PRO A C     1 
ATOM   3926  O  O     . PRO A 1  539  ? -82.191 -4.736  -9.948  1.00 111.29 ? 539  PRO A O     1 
ATOM   3927  C  CB    . PRO A 1  539  ? -83.103 -4.004  -12.998 1.00 107.90 ? 539  PRO A CB    1 
ATOM   3928  C  CG    . PRO A 1  539  ? -84.498 -4.031  -13.509 1.00 108.69 ? 539  PRO A CG    1 
ATOM   3929  C  CD    . PRO A 1  539  ? -84.854 -5.478  -13.688 1.00 107.98 ? 539  PRO A CD    1 
ATOM   3930  N  N     . VAL A 1  540  ? -84.430 -4.930  -10.171 1.00 113.55 ? 540  VAL A N     1 
ATOM   3931  C  CA    . VAL A 1  540  ? -84.692 -4.627  -8.749  1.00 116.45 ? 540  VAL A CA    1 
ATOM   3932  C  C     . VAL A 1  540  ? -84.223 -5.731  -7.786  1.00 117.19 ? 540  VAL A C     1 
ATOM   3933  O  O     . VAL A 1  540  ? -83.717 -5.430  -6.703  1.00 118.22 ? 540  VAL A O     1 
ATOM   3934  C  CB    . VAL A 1  540  ? -86.179 -4.260  -8.464  1.00 118.00 ? 540  VAL A CB    1 
ATOM   3935  C  CG1   . VAL A 1  540  ? -86.615 -3.081  -9.327  1.00 118.04 ? 540  VAL A CG1   1 
ATOM   3936  C  CG2   . VAL A 1  540  ? -87.113 -5.454  -8.647  1.00 118.33 ? 540  VAL A CG2   1 
ATOM   3937  N  N     . HIS A 1  541  ? -84.367 -6.996  -8.189  1.00 117.54 ? 541  HIS A N     1 
ATOM   3938  C  CA    . HIS A 1  541  ? -84.037 -8.144  -7.323  1.00 118.58 ? 541  HIS A CA    1 
ATOM   3939  C  C     . HIS A 1  541  ? -82.537 -8.458  -7.243  1.00 117.23 ? 541  HIS A C     1 
ATOM   3940  O  O     . HIS A 1  541  ? -82.010 -8.668  -6.149  1.00 117.94 ? 541  HIS A O     1 
ATOM   3941  C  CB    . HIS A 1  541  ? -84.822 -9.397  -7.753  1.00 118.65 ? 541  HIS A CB    1 
ATOM   3942  C  CG    . HIS A 1  541  ? -86.275 -9.344  -7.396  1.00 120.91 ? 541  HIS A CG    1 
ATOM   3943  N  ND1   . HIS A 1  541  ? -87.217 -8.722  -8.187  1.00 121.46 ? 541  HIS A ND1   1 
ATOM   3944  C  CD2   . HIS A 1  541  ? -86.946 -9.821  -6.319  1.00 122.43 ? 541  HIS A CD2   1 
ATOM   3945  C  CE1   . HIS A 1  541  ? -88.405 -8.822  -7.617  1.00 122.91 ? 541  HIS A CE1   1 
ATOM   3946  N  NE2   . HIS A 1  541  ? -88.267 -9.485  -6.483  1.00 123.71 ? 541  HIS A NE2   1 
ATOM   3947  N  N     . TYR A 1  542  ? -81.858 -8.491  -8.389  1.00 115.45 ? 542  TYR A N     1 
ATOM   3948  C  CA    . TYR A 1  542  ? -80.433 -8.847  -8.444  1.00 114.11 ? 542  TYR A CA    1 
ATOM   3949  C  C     . TYR A 1  542  ? -79.530 -7.608  -8.409  1.00 112.97 ? 542  TYR A C     1 
ATOM   3950  O  O     . TYR A 1  542  ? -79.967 -6.520  -8.794  1.00 111.95 ? 542  TYR A O     1 
ATOM   3951  C  CB    . TYR A 1  542  ? -80.148 -9.687  -9.688  1.00 112.74 ? 542  TYR A CB    1 
ATOM   3952  C  CG    . TYR A 1  542  ? -80.946 -10.965 -9.710  1.00 113.61 ? 542  TYR A CG    1 
ATOM   3953  C  CD1   . TYR A 1  542  ? -80.468 -12.122 -9.095  1.00 113.80 ? 542  TYR A CD1   1 
ATOM   3954  C  CD2   . TYR A 1  542  ? -82.198 -11.013 -10.321 1.00 114.51 ? 542  TYR A CD2   1 
ATOM   3955  C  CE1   . TYR A 1  542  ? -81.211 -13.297 -9.107  1.00 114.40 ? 542  TYR A CE1   1 
ATOM   3956  C  CE2   . TYR A 1  542  ? -82.948 -12.178 -10.341 1.00 114.74 ? 542  TYR A CE2   1 
ATOM   3957  C  CZ    . TYR A 1  542  ? -82.452 -13.316 -9.733  1.00 114.71 ? 542  TYR A CZ    1 
ATOM   3958  O  OH    . TYR A 1  542  ? -83.201 -14.466 -9.757  1.00 115.57 ? 542  TYR A OH    1 
ATOM   3959  N  N     . PRO A 1  543  ? -78.269 -7.768  -7.946  1.00 112.56 ? 543  PRO A N     1 
ATOM   3960  C  CA    . PRO A 1  543  ? -77.357 -6.632  -7.818  1.00 112.76 ? 543  PRO A CA    1 
ATOM   3961  C  C     . PRO A 1  543  ? -76.555 -6.346  -9.090  1.00 111.45 ? 543  PRO A C     1 
ATOM   3962  O  O     . PRO A 1  543  ? -76.341 -7.246  -9.913  1.00 109.37 ? 543  PRO A O     1 
ATOM   3963  C  CB    . PRO A 1  543  ? -76.417 -7.084  -6.700  1.00 113.06 ? 543  PRO A CB    1 
ATOM   3964  C  CG    . PRO A 1  543  ? -76.325 -8.560  -6.881  1.00 112.07 ? 543  PRO A CG    1 
ATOM   3965  C  CD    . PRO A 1  543  ? -77.610 -9.021  -7.525  1.00 112.04 ? 543  PRO A CD    1 
ATOM   3966  N  N     . SER A 1  544  ? -76.119 -5.094  -9.233  1.00 112.01 ? 544  SER A N     1 
ATOM   3967  C  CA    . SER A 1  544  ? -75.270 -4.674  -10.350 1.00 110.48 ? 544  SER A CA    1 
ATOM   3968  C  C     . SER A 1  544  ? -73.859 -5.217  -10.142 1.00 109.76 ? 544  SER A C     1 
ATOM   3969  O  O     . SER A 1  544  ? -73.435 -5.423  -9.001  1.00 110.45 ? 544  SER A O     1 
ATOM   3970  C  CB    . SER A 1  544  ? -75.224 -3.142  -10.454 1.00 111.17 ? 544  SER A CB    1 
ATOM   3971  O  OG    . SER A 1  544  ? -76.444 -2.547  -10.033 1.00 112.98 ? 544  SER A OG    1 
ATOM   3972  N  N     . LEU A 1  545  ? -73.135 -5.437  -11.238 1.00 108.53 ? 545  LEU A N     1 
ATOM   3973  C  CA    . LEU A 1  545  ? -71.767 -5.969  -11.167 1.00 108.07 ? 545  LEU A CA    1 
ATOM   3974  C  C     . LEU A 1  545  ? -70.808 -4.914  -10.622 1.00 108.84 ? 545  LEU A C     1 
ATOM   3975  O  O     . LEU A 1  545  ? -71.047 -3.711  -10.773 1.00 109.37 ? 545  LEU A O     1 
ATOM   3976  C  CB    . LEU A 1  545  ? -71.265 -6.446  -12.539 1.00 106.49 ? 545  LEU A CB    1 
ATOM   3977  C  CG    . LEU A 1  545  ? -71.870 -7.746  -13.087 1.00 105.88 ? 545  LEU A CG    1 
ATOM   3978  C  CD1   . LEU A 1  545  ? -73.279 -7.512  -13.617 1.00 106.45 ? 545  LEU A CD1   1 
ATOM   3979  C  CD2   . LEU A 1  545  ? -70.978 -8.355  -14.164 1.00 103.30 ? 545  LEU A CD2   1 
ATOM   3980  N  N     . ALA A 1  546  ? -69.729 -5.371  -9.989  1.00 108.83 ? 546  ALA A N     1 
ATOM   3981  C  CA    . ALA A 1  546  ? -68.650 -4.479  -9.565  1.00 109.61 ? 546  ALA A CA    1 
ATOM   3982  C  C     . ALA A 1  546  ? -68.040 -3.821  -10.804 1.00 109.49 ? 546  ALA A C     1 
ATOM   3983  O  O     . ALA A 1  546  ? -67.880 -4.469  -11.845 1.00 107.93 ? 546  ALA A O     1 
ATOM   3984  C  CB    . ALA A 1  546  ? -67.592 -5.241  -8.780  1.00 109.27 ? 546  ALA A CB    1 
ATOM   3985  N  N     . ASP A 1  547  ? -67.701 -2.541  -10.676 1.00 110.75 ? 547  ASP A N     1 
ATOM   3986  C  CA    . ASP A 1  547  ? -67.322 -1.705  -11.825 1.00 110.25 ? 547  ASP A CA    1 
ATOM   3987  C  C     . ASP A 1  547  ? -66.044 -2.207  -12.490 1.00 109.15 ? 547  ASP A C     1 
ATOM   3988  O  O     . ASP A 1  547  ? -65.970 -2.305  -13.715 1.00 108.16 ? 547  ASP A O     1 
ATOM   3989  C  CB    . ASP A 1  547  ? -67.141 -0.244  -11.395 1.00 111.76 ? 547  ASP A CB    1 
ATOM   3990  C  CG    . ASP A 1  547  ? -68.358 0.310   -10.669 1.00 113.70 ? 547  ASP A CG    1 
ATOM   3991  O  OD1   . ASP A 1  547  ? -69.494 -0.018  -11.069 1.00 114.48 ? 547  ASP A OD1   1 
ATOM   3992  O  OD2   . ASP A 1  547  ? -68.179 1.065   -9.690  1.00 114.96 ? 547  ASP A OD2   1 
ATOM   3993  N  N     . LYS A 1  548  ? -65.052 -2.523  -11.660 1.00 109.32 ? 548  LYS A N     1 
ATOM   3994  C  CA    . LYS A 1  548  ? -63.779 -3.116  -12.113 1.00 107.80 ? 548  LYS A CA    1 
ATOM   3995  C  C     . LYS A 1  548  ? -63.886 -4.538  -12.699 1.00 105.45 ? 548  LYS A C     1 
ATOM   3996  O  O     . LYS A 1  548  ? -63.036 -4.939  -13.497 1.00 104.26 ? 548  LYS A O     1 
ATOM   3997  C  CB    . LYS A 1  548  ? -62.728 -3.087  -10.983 1.00 109.09 ? 548  LYS A CB    1 
ATOM   3998  C  CG    . LYS A 1  548  ? -63.168 -3.708  -9.657  1.00 111.01 ? 548  LYS A CG    1 
ATOM   3999  C  CD    . LYS A 1  548  ? -62.002 -3.962  -8.717  1.00 111.87 ? 548  LYS A CD    1 
ATOM   4000  C  CE    . LYS A 1  548  ? -62.493 -4.402  -7.347  1.00 113.50 ? 548  LYS A CE    1 
ATOM   4001  N  NZ    . LYS A 1  548  ? -61.370 -4.635  -6.396  1.00 114.43 ? 548  LYS A NZ    1 
ATOM   4002  N  N     . TYR A 1  549  ? -64.914 -5.288  -12.302 1.00 104.99 ? 549  TYR A N     1 
ATOM   4003  C  CA    . TYR A 1  549  ? -65.099 -6.689  -12.734 1.00 103.64 ? 549  TYR A CA    1 
ATOM   4004  C  C     . TYR A 1  549  ? -65.630 -6.882  -14.174 1.00 102.32 ? 549  TYR A C     1 
ATOM   4005  O  O     . TYR A 1  549  ? -65.457 -7.962  -14.743 1.00 101.33 ? 549  TYR A O     1 
ATOM   4006  C  CB    . TYR A 1  549  ? -66.031 -7.433  -11.745 1.00 104.20 ? 549  TYR A CB    1 
ATOM   4007  C  CG    . TYR A 1  549  ? -65.367 -8.066  -10.519 1.00 103.94 ? 549  TYR A CG    1 
ATOM   4008  C  CD1   . TYR A 1  549  ? -64.223 -7.512  -9.925  1.00 103.85 ? 549  TYR A CD1   1 
ATOM   4009  C  CD2   . TYR A 1  549  ? -65.911 -9.217  -9.934  1.00 103.65 ? 549  TYR A CD2   1 
ATOM   4010  C  CE1   . TYR A 1  549  ? -63.636 -8.100  -8.808  1.00 104.08 ? 549  TYR A CE1   1 
ATOM   4011  C  CE2   . TYR A 1  549  ? -65.330 -9.807  -8.815  1.00 103.83 ? 549  TYR A CE2   1 
ATOM   4012  C  CZ    . TYR A 1  549  ? -64.195 -9.248  -8.257  1.00 104.04 ? 549  TYR A CZ    1 
ATOM   4013  O  OH    . TYR A 1  549  ? -63.624 -9.835  -7.154  1.00 104.46 ? 549  TYR A OH    1 
ATOM   4014  N  N     . GLU A 1  550  ? -66.259 -5.860  -14.760 1.00 102.36 ? 550  GLU A N     1 
ATOM   4015  C  CA    . GLU A 1  550  ? -67.048 -6.033  -16.000 1.00 101.54 ? 550  GLU A CA    1 
ATOM   4016  C  C     . GLU A 1  550  ? -66.266 -6.473  -17.247 1.00 99.85  ? 550  GLU A C     1 
ATOM   4017  O  O     . GLU A 1  550  ? -66.833 -7.106  -18.141 1.00 98.10  ? 550  GLU A O     1 
ATOM   4018  C  CB    . GLU A 1  550  ? -67.851 -4.765  -16.310 1.00 103.01 ? 550  GLU A CB    1 
ATOM   4019  C  CG    . GLU A 1  550  ? -68.956 -4.503  -15.296 1.00 106.42 ? 550  GLU A CG    1 
ATOM   4020  C  CD    . GLU A 1  550  ? -69.651 -3.166  -15.487 1.00 108.64 ? 550  GLU A CD    1 
ATOM   4021  O  OE1   . GLU A 1  550  ? -69.793 -2.717  -16.647 1.00 109.27 ? 550  GLU A OE1   1 
ATOM   4022  O  OE2   . GLU A 1  550  ? -70.067 -2.567  -14.470 1.00 110.48 ? 550  GLU A OE2   1 
ATOM   4023  N  N     . SER A 1  551  ? -64.976 -6.146  -17.297 1.00 99.65  ? 551  SER A N     1 
ATOM   4024  C  CA    . SER A 1  551  ? -64.115 -6.489  -18.440 1.00 97.93  ? 551  SER A CA    1 
ATOM   4025  C  C     . SER A 1  551  ? -63.886 -7.997  -18.638 1.00 97.26  ? 551  SER A C     1 
ATOM   4026  O  O     . SER A 1  551  ? -63.520 -8.426  -19.735 1.00 93.90  ? 551  SER A O     1 
ATOM   4027  C  CB    . SER A 1  551  ? -62.768 -5.766  -18.319 1.00 97.98  ? 551  SER A CB    1 
ATOM   4028  O  OG    . SER A 1  551  ? -62.223 -5.889  -17.010 1.00 98.69  ? 551  SER A OG    1 
ATOM   4029  N  N     . ALA A 1  552  ? -64.100 -8.785  -17.582 1.00 99.24  ? 552  ALA A N     1 
ATOM   4030  C  CA    . ALA A 1  552  ? -64.043 -10.251 -17.647 1.00 99.40  ? 552  ALA A CA    1 
ATOM   4031  C  C     . ALA A 1  552  ? -64.983 -10.878 -18.689 1.00 99.96  ? 552  ALA A C     1 
ATOM   4032  O  O     . ALA A 1  552  ? -64.679 -11.946 -19.219 1.00 98.50  ? 552  ALA A O     1 
ATOM   4033  C  CB    . ALA A 1  552  ? -64.327 -10.845 -16.274 1.00 100.07 ? 552  ALA A CB    1 
ATOM   4034  N  N     . LEU A 1  553  ? -66.111 -10.222 -18.976 1.00 102.81 ? 553  LEU A N     1 
ATOM   4035  C  CA    . LEU A 1  553  ? -67.129 -10.772 -19.882 1.00 104.14 ? 553  LEU A CA    1 
ATOM   4036  C  C     . LEU A 1  553  ? -66.782 -10.659 -21.365 1.00 104.76 ? 553  LEU A C     1 
ATOM   4037  O  O     . LEU A 1  553  ? -66.903 -11.643 -22.103 1.00 103.33 ? 553  LEU A O     1 
ATOM   4038  C  CB    . LEU A 1  553  ? -68.487 -10.112 -19.625 1.00 105.07 ? 553  LEU A CB    1 
ATOM   4039  C  CG    . LEU A 1  553  ? -69.040 -10.236 -18.200 1.00 106.24 ? 553  LEU A CG    1 
ATOM   4040  C  CD1   . LEU A 1  553  ? -70.449 -9.672  -18.140 1.00 106.92 ? 553  LEU A CD1   1 
ATOM   4041  C  CD2   . LEU A 1  553  ? -69.025 -11.680 -17.708 1.00 105.92 ? 553  LEU A CD2   1 
ATOM   4042  N  N     . GLU A 1  554  ? -66.370 -9.468  -21.804 1.00 107.62 ? 554  GLU A N     1 
ATOM   4043  C  CA    . GLU A 1  554  ? -66.000 -9.269  -23.209 1.00 109.83 ? 554  GLU A CA    1 
ATOM   4044  C  C     . GLU A 1  554  ? -64.713 -10.023 -23.555 1.00 110.06 ? 554  GLU A C     1 
ATOM   4045  O  O     . GLU A 1  554  ? -63.701 -9.891  -22.864 1.00 108.23 ? 554  GLU A O     1 
ATOM   4046  C  CB    . GLU A 1  554  ? -65.877 -7.781  -23.588 1.00 111.74 ? 554  GLU A CB    1 
ATOM   4047  C  CG    . GLU A 1  554  ? -64.855 -6.950  -22.812 1.00 113.42 ? 554  GLU A CG    1 
ATOM   4048  C  CD    . GLU A 1  554  ? -65.488 -5.884  -21.932 1.00 116.25 ? 554  GLU A CD    1 
ATOM   4049  O  OE1   . GLU A 1  554  ? -66.379 -6.223  -21.125 1.00 119.56 ? 554  GLU A OE1   1 
ATOM   4050  O  OE2   . GLU A 1  554  ? -65.085 -4.703  -22.037 1.00 116.33 ? 554  GLU A OE2   1 
ATOM   4051  N  N     . ASP A 1  555  ? -64.779 -10.839 -24.604 1.00 112.79 ? 555  ASP A N     1 
ATOM   4052  C  CA    . ASP A 1  555  ? -63.609 -11.552 -25.120 1.00 114.16 ? 555  ASP A CA    1 
ATOM   4053  C  C     . ASP A 1  555  ? -62.832 -10.633 -26.060 1.00 112.61 ? 555  ASP A C     1 
ATOM   4054  O  O     . ASP A 1  555  ? -63.335 -9.584  -26.477 1.00 112.00 ? 555  ASP A O     1 
ATOM   4055  C  CB    . ASP A 1  555  ? -64.015 -12.850 -25.841 1.00 115.97 ? 555  ASP A CB    1 
ATOM   4056  C  CG    . ASP A 1  555  ? -64.573 -13.914 -24.887 1.00 118.40 ? 555  ASP A CG    1 
ATOM   4057  O  OD1   . ASP A 1  555  ? -64.033 -14.090 -23.772 1.00 119.58 ? 555  ASP A OD1   1 
ATOM   4058  O  OD2   . ASP A 1  555  ? -65.551 -14.592 -25.267 1.00 119.89 ? 555  ASP A OD2   1 
ATOM   4059  N  N     . LEU A 1  556  ? -61.609 -11.047 -26.390 1.00 111.22 ? 556  LEU A N     1 
ATOM   4060  C  CA    . LEU A 1  556  ? -60.679 -10.234 -27.169 1.00 110.66 ? 556  LEU A CA    1 
ATOM   4061  C  C     . LEU A 1  556  ? -60.819 -10.576 -28.661 1.00 111.10 ? 556  LEU A C     1 
ATOM   4062  O  O     . LEU A 1  556  ? -60.372 -11.635 -29.120 1.00 107.84 ? 556  LEU A O     1 
ATOM   4063  C  CB    . LEU A 1  556  ? -59.241 -10.433 -26.673 1.00 109.15 ? 556  LEU A CB    1 
ATOM   4064  C  CG    . LEU A 1  556  ? -59.003 -10.155 -25.173 1.00 108.41 ? 556  LEU A CG    1 
ATOM   4065  C  CD1   . LEU A 1  556  ? -59.252 -11.389 -24.310 1.00 108.34 ? 556  LEU A CD1   1 
ATOM   4066  C  CD2   . LEU A 1  556  ? -57.598 -9.626  -24.915 1.00 108.10 ? 556  LEU A CD2   1 
ATOM   4067  N  N     . HIS A 1  557  ? -61.435 -9.654  -29.404 1.00 114.00 ? 557  HIS A N     1 
ATOM   4068  C  CA    . HIS A 1  557  ? -61.846 -9.871  -30.798 1.00 114.14 ? 557  HIS A CA    1 
ATOM   4069  C  C     . HIS A 1  557  ? -60.697 -9.428  -31.725 1.00 111.05 ? 557  HIS A C     1 
ATOM   4070  O  O     . HIS A 1  557  ? -59.536 -9.718  -31.425 1.00 109.88 ? 557  HIS A O     1 
ATOM   4071  C  CB    . HIS A 1  557  ? -63.167 -9.121  -31.094 1.00 117.57 ? 557  HIS A CB    1 
ATOM   4072  C  CG    . HIS A 1  557  ? -64.187 -9.210  -29.996 1.00 121.02 ? 557  HIS A CG    1 
ATOM   4073  N  ND1   . HIS A 1  557  ? -64.764 -10.400 -29.606 1.00 121.76 ? 557  HIS A ND1   1 
ATOM   4074  C  CD2   . HIS A 1  557  ? -64.731 -8.252  -29.208 1.00 122.46 ? 557  HIS A CD2   1 
ATOM   4075  C  CE1   . HIS A 1  557  ? -65.617 -10.172 -28.623 1.00 123.27 ? 557  HIS A CE1   1 
ATOM   4076  N  NE2   . HIS A 1  557  ? -65.616 -8.877  -28.363 1.00 123.95 ? 557  HIS A NE2   1 
ATOM   4077  N  N     . SER A 1  558  ? -61.005 -8.776  -32.852 1.00 109.43 ? 558  SER A N     1 
ATOM   4078  C  CA    . SER A 1  558  ? -59.987 -8.168  -33.718 1.00 107.55 ? 558  SER A CA    1 
ATOM   4079  C  C     . SER A 1  558  ? -60.464 -6.806  -34.212 1.00 107.54 ? 558  SER A C     1 
ATOM   4080  O  O     . SER A 1  558  ? -60.348 -5.805  -33.506 1.00 107.44 ? 558  SER A O     1 
ATOM   4081  C  CB    . SER A 1  558  ? -59.669 -9.084  -34.905 1.00 104.96 ? 558  SER A CB    1 
ATOM   4082  O  OG    . SER A 1  558  ? -60.823 -9.341  -35.689 1.00 103.59 ? 558  SER A OG    1 
ATOM   4083  N  N     . HIS A 1  560  ? -60.575 -6.590  -37.393 1.00 109.53 ? 560  HIS A N     1 
ATOM   4084  C  CA    . HIS A 1  560  ? -59.988 -5.443  -38.078 1.00 110.54 ? 560  HIS A CA    1 
ATOM   4085  C  C     . HIS A 1  560  ? -58.469 -5.560  -38.135 1.00 107.70 ? 560  HIS A C     1 
ATOM   4086  O  O     . HIS A 1  560  ? -57.845 -6.072  -37.199 1.00 106.32 ? 560  HIS A O     1 
ATOM   4087  C  CB    . HIS A 1  560  ? -60.385 -4.143  -37.378 1.00 113.38 ? 560  HIS A CB    1 
ATOM   4088  C  CG    . HIS A 1  560  ? -61.863 -3.912  -37.341 1.00 117.03 ? 560  HIS A CG    1 
ATOM   4089  N  ND1   . HIS A 1  560  ? -62.678 -4.470  -36.379 1.00 118.74 ? 560  HIS A ND1   1 
ATOM   4090  C  CD2   . HIS A 1  560  ? -62.676 -3.199  -38.156 1.00 118.40 ? 560  HIS A CD2   1 
ATOM   4091  C  CE1   . HIS A 1  560  ? -63.928 -4.103  -36.597 1.00 119.51 ? 560  HIS A CE1   1 
ATOM   4092  N  NE2   . HIS A 1  560  ? -63.955 -3.333  -37.671 1.00 119.84 ? 560  HIS A NE2   1 
ATOM   4093  N  N     . HIS A 1  561  ? -57.888 -5.098  -39.244 1.00 105.05 ? 561  HIS A N     1 
ATOM   4094  C  CA    . HIS A 1  561  ? -56.433 -5.064  -39.435 1.00 102.32 ? 561  HIS A CA    1 
ATOM   4095  C  C     . HIS A 1  561  ? -56.034 -3.789  -40.192 1.00 101.03 ? 561  HIS A C     1 
ATOM   4096  O  O     . HIS A 1  561  ? -56.217 -3.699  -41.407 1.00 100.21 ? 561  HIS A O     1 
ATOM   4097  C  CB    . HIS A 1  561  ? -55.944 -6.319  -40.170 1.00 100.89 ? 561  HIS A CB    1 
ATOM   4098  C  CG    . HIS A 1  561  ? -56.157 -7.587  -39.398 1.00 100.42 ? 561  HIS A CG    1 
ATOM   4099  N  ND1   . HIS A 1  561  ? -55.323 -7.986  -38.376 1.00 100.08 ? 561  HIS A ND1   1 
ATOM   4100  C  CD2   . HIS A 1  561  ? -57.123 -8.532  -39.485 1.00 99.81  ? 561  HIS A CD2   1 
ATOM   4101  C  CE1   . HIS A 1  561  ? -55.760 -9.126  -37.871 1.00 99.02  ? 561  HIS A CE1   1 
ATOM   4102  N  NE2   . HIS A 1  561  ? -56.852 -9.480  -38.527 1.00 99.14  ? 561  HIS A NE2   1 
ATOM   4103  N  N     . CYS A 1  562  ? -55.506 -2.815  -39.446 1.00 100.08 ? 562  CYS A N     1 
ATOM   4104  C  CA    . CYS A 1  562  ? -55.093 -1.497  -39.960 1.00 98.75  ? 562  CYS A CA    1 
ATOM   4105  C  C     . CYS A 1  562  ? -53.564 -1.431  -40.078 1.00 94.19  ? 562  CYS A C     1 
ATOM   4106  O  O     . CYS A 1  562  ? -52.855 -2.006  -39.247 1.00 92.65  ? 562  CYS A O     1 
ATOM   4107  C  CB    . CYS A 1  562  ? -55.614 -0.395  -39.016 1.00 101.22 ? 562  CYS A CB    1 
ATOM   4108  S  SG    . CYS A 1  562  ? -54.918 1.266   -39.230 1.00 105.51 ? 562  CYS A SG    1 
ATOM   4109  N  N     . SER A 1  563  ? -53.060 -0.752  -41.114 1.00 89.97  ? 563  SER A N     1 
ATOM   4110  C  CA    . SER A 1  563  ? -51.613 -0.543  -41.261 1.00 86.86  ? 563  SER A CA    1 
ATOM   4111  C  C     . SER A 1  563  ? -51.225 0.636   -42.159 1.00 86.13  ? 563  SER A C     1 
ATOM   4112  O  O     . SER A 1  563  ? -51.976 1.018   -43.059 1.00 86.79  ? 563  SER A O     1 
ATOM   4113  C  CB    . SER A 1  563  ? -50.922 -1.815  -41.766 1.00 84.70  ? 563  SER A CB    1 
ATOM   4114  O  OG    . SER A 1  563  ? -51.337 -2.144  -43.077 1.00 84.79  ? 563  SER A OG    1 
ATOM   4115  N  N     . THR A 1  564  ? -50.047 1.197   -41.883 1.00 84.97  ? 564  THR A N     1 
ATOM   4116  C  CA    . THR A 1  564  ? -49.447 2.284   -42.668 1.00 85.00  ? 564  THR A CA    1 
ATOM   4117  C  C     . THR A 1  564  ? -47.962 1.997   -42.870 1.00 84.67  ? 564  THR A C     1 
ATOM   4118  O  O     . THR A 1  564  ? -47.317 1.436   -41.985 1.00 84.30  ? 564  THR A O     1 
ATOM   4119  C  CB    . THR A 1  564  ? -49.584 3.644   -41.957 1.00 85.59  ? 564  THR A CB    1 
ATOM   4120  O  OG1   . THR A 1  564  ? -48.919 3.593   -40.689 1.00 84.29  ? 564  THR A OG1   1 
ATOM   4121  C  CG2   . THR A 1  564  ? -51.047 4.005   -41.744 1.00 86.23  ? 564  THR A CG2   1 
ATOM   4122  N  N     . LEU A 1  565  ? -47.426 2.389   -44.024 1.00 85.45  ? 565  LEU A N     1 
ATOM   4123  C  CA    . LEU A 1  565  ? -46.046 2.067   -44.400 1.00 86.05  ? 565  LEU A CA    1 
ATOM   4124  C  C     . LEU A 1  565  ? -45.335 3.290   -44.983 1.00 86.99  ? 565  LEU A C     1 
ATOM   4125  O  O     . LEU A 1  565  ? -45.584 3.680   -46.123 1.00 85.47  ? 565  LEU A O     1 
ATOM   4126  C  CB    . LEU A 1  565  ? -46.022 0.907   -45.404 1.00 85.63  ? 565  LEU A CB    1 
ATOM   4127  C  CG    . LEU A 1  565  ? -46.827 -0.357  -45.050 1.00 85.04  ? 565  LEU A CG    1 
ATOM   4128  C  CD1   . LEU A 1  565  ? -46.913 -1.296  -46.252 1.00 84.40  ? 565  LEU A CD1   1 
ATOM   4129  C  CD2   . LEU A 1  565  ? -46.268 -1.090  -43.833 1.00 84.62  ? 565  LEU A CD2   1 
ATOM   4130  N  N     . LYS A 1  566  ? -44.455 3.890   -44.187 1.00 89.62  ? 566  LYS A N     1 
ATOM   4131  C  CA    . LYS A 1  566  ? -43.713 5.086   -44.591 1.00 93.38  ? 566  LYS A CA    1 
ATOM   4132  C  C     . LYS A 1  566  ? -42.360 4.682   -45.179 1.00 93.55  ? 566  LYS A C     1 
ATOM   4133  O  O     . LYS A 1  566  ? -41.671 3.823   -44.623 1.00 92.05  ? 566  LYS A O     1 
ATOM   4134  C  CB    . LYS A 1  566  ? -43.541 6.033   -43.390 1.00 95.55  ? 566  LYS A CB    1 
ATOM   4135  C  CG    . LYS A 1  566  ? -42.589 7.213   -43.578 1.00 97.91  ? 566  LYS A CG    1 
ATOM   4136  C  CD    . LYS A 1  566  ? -43.047 8.184   -44.651 1.00 99.66  ? 566  LYS A CD    1 
ATOM   4137  C  CE    . LYS A 1  566  ? -42.001 9.265   -44.875 1.00 101.67 ? 566  LYS A CE    1 
ATOM   4138  N  NZ    . LYS A 1  566  ? -42.399 10.208  -45.954 1.00 102.75 ? 566  LYS A NZ    1 
ATOM   4139  N  N     . TYR A 1  567  ? -41.999 5.296   -46.307 1.00 94.89  ? 567  TYR A N     1 
ATOM   4140  C  CA    . TYR A 1  567  ? -40.673 5.115   -46.902 1.00 96.00  ? 567  TYR A CA    1 
ATOM   4141  C  C     . TYR A 1  567  ? -40.295 6.255   -47.860 1.00 99.80  ? 567  TYR A C     1 
ATOM   4142  O  O     . TYR A 1  567  ? -41.156 6.995   -48.344 1.00 98.82  ? 567  TYR A O     1 
ATOM   4143  C  CB    . TYR A 1  567  ? -40.564 3.751   -47.609 1.00 93.83  ? 567  TYR A CB    1 
ATOM   4144  C  CG    . TYR A 1  567  ? -41.468 3.568   -48.813 1.00 92.97  ? 567  TYR A CG    1 
ATOM   4145  C  CD1   . TYR A 1  567  ? -42.840 3.362   -48.660 1.00 92.90  ? 567  TYR A CD1   1 
ATOM   4146  C  CD2   . TYR A 1  567  ? -40.948 3.585   -50.111 1.00 92.01  ? 567  TYR A CD2   1 
ATOM   4147  C  CE1   . TYR A 1  567  ? -43.670 3.194   -49.763 1.00 92.37  ? 567  TYR A CE1   1 
ATOM   4148  C  CE2   . TYR A 1  567  ? -41.769 3.418   -51.218 1.00 92.17  ? 567  TYR A CE2   1 
ATOM   4149  C  CZ    . TYR A 1  567  ? -43.128 3.222   -51.040 1.00 92.30  ? 567  TYR A CZ    1 
ATOM   4150  O  OH    . TYR A 1  567  ? -43.945 3.054   -52.133 1.00 92.44  ? 567  TYR A OH    1 
ATOM   4151  N  N     . GLN A 1  568  ? -38.990 6.374   -48.109 1.00 104.79 ? 568  GLN A N     1 
ATOM   4152  C  CA    . GLN A 1  568  ? -38.431 7.374   -49.029 1.00 109.10 ? 568  GLN A CA    1 
ATOM   4153  C  C     . GLN A 1  568  ? -38.730 6.998   -50.483 1.00 109.89 ? 568  GLN A C     1 
ATOM   4154  O  O     . GLN A 1  568  ? -38.804 5.815   -50.809 1.00 110.68 ? 568  GLN A O     1 
ATOM   4155  C  CB    . GLN A 1  568  ? -36.907 7.561   -48.793 1.00 111.22 ? 568  GLN A CB    1 
ATOM   4156  C  CG    . GLN A 1  568  ? -35.937 6.477   -49.327 1.00 111.22 ? 568  GLN A CG    1 
ATOM   4157  C  CD    . GLN A 1  568  ? -35.639 5.303   -48.381 1.00 110.68 ? 568  GLN A CD    1 
ATOM   4158  O  OE1   . GLN A 1  568  ? -35.296 4.204   -48.832 1.00 106.68 ? 568  GLN A OE1   1 
ATOM   4159  N  NE2   . GLN A 1  568  ? -35.742 5.535   -47.074 1.00 111.78 ? 568  GLN A NE2   1 
ATOM   4160  N  N     . ASN A 1  569  ? -38.898 7.998   -51.348 1.00 112.08 ? 569  ASN A N     1 
ATOM   4161  C  CA    . ASN A 1  569  ? -39.173 7.752   -52.775 1.00 112.33 ? 569  ASN A CA    1 
ATOM   4162  C  C     . ASN A 1  569  ? -38.349 8.651   -53.700 1.00 114.04 ? 569  ASN A C     1 
ATOM   4163  O  O     . ASN A 1  569  ? -38.861 9.585   -54.321 1.00 116.47 ? 569  ASN A O     1 
ATOM   4164  C  CB    . ASN A 1  569  ? -40.685 7.825   -53.081 1.00 112.38 ? 569  ASN A CB    1 
ATOM   4165  C  CG    . ASN A 1  569  ? -41.361 9.062   -52.499 1.00 114.15 ? 569  ASN A CG    1 
ATOM   4166  O  OD1   . ASN A 1  569  ? -40.720 9.917   -51.884 1.00 113.78 ? 569  ASN A OD1   1 
ATOM   4167  N  ND2   . ASN A 1  569  ? -42.672 9.155   -52.696 1.00 114.58 ? 569  ASN A ND2   1 
ATOM   4168  N  N     . ILE A 1  570  ? -37.055 8.346   -53.772 1.00 114.21 ? 570  ILE A N     1 
ATOM   4169  C  CA    . ILE A 1  570  ? -36.133 9.020   -54.691 1.00 115.56 ? 570  ILE A CA    1 
ATOM   4170  C  C     . ILE A 1  570  ? -36.423 8.561   -56.140 1.00 114.53 ? 570  ILE A C     1 
ATOM   4171  O  O     . ILE A 1  570  ? -36.588 7.360   -56.377 1.00 110.14 ? 570  ILE A O     1 
ATOM   4172  C  CB    . ILE A 1  570  ? -34.646 8.764   -54.286 1.00 116.51 ? 570  ILE A CB    1 
ATOM   4173  C  CG1   . ILE A 1  570  ? -33.693 9.779   -54.939 1.00 117.68 ? 570  ILE A CG1   1 
ATOM   4174  C  CG2   . ILE A 1  570  ? -34.195 7.332   -54.590 1.00 114.71 ? 570  ILE A CG2   1 
ATOM   4175  C  CD1   . ILE A 1  570  ? -33.749 11.173  -54.344 1.00 119.17 ? 570  ILE A CD1   1 
ATOM   4176  N  N     . GLY A 1  571  ? -36.518 9.474   -57.113 1.00 115.97 ? 571  GLY A N     1 
ATOM   4177  C  CA    . GLY A 1  571  ? -36.416 10.932  -56.934 1.00 116.17 ? 571  GLY A CA    1 
ATOM   4178  C  C     . GLY A 1  571  ? -36.185 11.656  -58.252 1.00 116.30 ? 571  GLY A C     1 
ATOM   4179  O  O     . GLY A 1  571  ? -36.070 11.009  -59.298 1.00 114.96 ? 571  GLY A O     1 
ATOM   4180  N  N     . PRO A 1  572  ? -36.104 13.001  -58.212 1.00 117.47 ? 572  PRO A N     1 
ATOM   4181  C  CA    . PRO A 1  572  ? -35.923 13.796  -59.437 1.00 117.83 ? 572  PRO A CA    1 
ATOM   4182  C  C     . PRO A 1  572  ? -34.547 13.603  -60.088 1.00 116.04 ? 572  PRO A C     1 
ATOM   4183  O  O     . PRO A 1  572  ? -34.458 13.502  -61.313 1.00 115.32 ? 572  PRO A O     1 
ATOM   4184  C  CB    . PRO A 1  572  ? -36.119 15.242  -58.960 1.00 120.12 ? 572  PRO A CB    1 
ATOM   4185  C  CG    . PRO A 1  572  ? -35.813 15.224  -57.503 1.00 120.38 ? 572  PRO A CG    1 
ATOM   4186  C  CD    . PRO A 1  572  ? -36.106 13.839  -56.997 1.00 118.51 ? 572  PRO A CD    1 
ATOM   4187  N  N     . LYS A 1  573  ? -33.498 13.556  -59.269 1.00 114.87 ? 573  LYS A N     1 
ATOM   4188  C  CA    . LYS A 1  573  ? -32.132 13.262  -59.726 1.00 114.46 ? 573  LYS A CA    1 
ATOM   4189  C  C     . LYS A 1  573  ? -31.999 11.961  -60.545 1.00 109.32 ? 573  LYS A C     1 
ATOM   4190  O  O     . LYS A 1  573  ? -31.250 11.916  -61.523 1.00 109.42 ? 573  LYS A O     1 
ATOM   4191  C  CB    . LYS A 1  573  ? -31.169 13.217  -58.523 1.00 117.36 ? 573  LYS A CB    1 
ATOM   4192  C  CG    . LYS A 1  573  ? -31.431 12.088  -57.516 1.00 117.43 ? 573  LYS A CG    1 
ATOM   4193  C  CD    . LYS A 1  573  ? -30.682 12.275  -56.200 1.00 119.53 ? 573  LYS A CD    1 
ATOM   4194  C  CE    . LYS A 1  573  ? -31.230 13.437  -55.378 1.00 122.43 ? 573  LYS A CE    1 
ATOM   4195  N  NZ    . LYS A 1  573  ? -30.757 13.425  -53.965 1.00 123.07 ? 573  LYS A NZ    1 
ATOM   4196  N  N     . GLN A 1  574  ? -32.730 10.921  -60.145 1.00 103.34 ? 574  GLN A N     1 
ATOM   4197  C  CA    . GLN A 1  574  ? -32.592 9.590   -60.742 1.00 97.97  ? 574  GLN A CA    1 
ATOM   4198  C  C     . GLN A 1  574  ? -33.373 9.448   -62.047 1.00 95.28  ? 574  GLN A C     1 
ATOM   4199  O  O     . GLN A 1  574  ? -34.425 10.062  -62.221 1.00 94.55  ? 574  GLN A O     1 
ATOM   4200  C  CB    . GLN A 1  574  ? -33.053 8.528   -59.743 1.00 96.26  ? 574  GLN A CB    1 
ATOM   4201  C  CG    . GLN A 1  574  ? -32.656 7.107   -60.104 1.00 94.16  ? 574  GLN A CG    1 
ATOM   4202  C  CD    . GLN A 1  574  ? -32.881 6.134   -58.960 1.00 92.43  ? 574  GLN A CD    1 
ATOM   4203  O  OE1   . GLN A 1  574  ? -32.332 6.301   -57.874 1.00 92.89  ? 574  GLN A OE1   1 
ATOM   4204  N  NE2   . GLN A 1  574  ? -33.685 5.110   -59.202 1.00 90.82  ? 574  GLN A NE2   1 
ATOM   4205  N  N     . HIS A 1  575  ? -32.842 8.622   -62.947 1.00 93.13  ? 575  HIS A N     1 
ATOM   4206  C  CA    . HIS A 1  575  ? -33.483 8.277   -64.225 1.00 91.83  ? 575  HIS A CA    1 
ATOM   4207  C  C     . HIS A 1  575  ? -34.771 7.506   -63.896 1.00 89.40  ? 575  HIS A C     1 
ATOM   4208  O  O     . HIS A 1  575  ? -34.747 6.647   -63.012 1.00 87.91  ? 575  HIS A O     1 
ATOM   4209  C  CB    . HIS A 1  575  ? -32.526 7.389   -65.039 1.00 91.61  ? 575  HIS A CB    1 
ATOM   4210  C  CG    . HIS A 1  575  ? -32.752 7.396   -66.522 1.00 92.93  ? 575  HIS A CG    1 
ATOM   4211  N  ND1   . HIS A 1  575  ? -33.887 6.891   -67.116 1.00 92.53  ? 575  HIS A ND1   1 
ATOM   4212  C  CD2   . HIS A 1  575  ? -31.942 7.783   -67.537 1.00 94.50  ? 575  HIS A CD2   1 
ATOM   4213  C  CE1   . HIS A 1  575  ? -33.788 7.003   -68.428 1.00 93.55  ? 575  HIS A CE1   1 
ATOM   4214  N  NE2   . HIS A 1  575  ? -32.615 7.539   -68.711 1.00 94.62  ? 575  HIS A NE2   1 
ATOM   4215  N  N     . PRO A 1  576  ? -35.898 7.811   -64.580 1.00 88.89  ? 576  PRO A N     1 
ATOM   4216  C  CA    . PRO A 1  576  ? -37.180 7.162   -64.218 1.00 87.74  ? 576  PRO A CA    1 
ATOM   4217  C  C     . PRO A 1  576  ? -37.282 5.641   -64.479 1.00 85.46  ? 576  PRO A C     1 
ATOM   4218  O  O     . PRO A 1  576  ? -38.196 4.994   -63.965 1.00 84.12  ? 576  PRO A O     1 
ATOM   4219  C  CB    . PRO A 1  576  ? -38.214 7.932   -65.058 1.00 88.92  ? 576  PRO A CB    1 
ATOM   4220  C  CG    . PRO A 1  576  ? -37.440 8.527   -66.184 1.00 89.62  ? 576  PRO A CG    1 
ATOM   4221  C  CD    . PRO A 1  576  ? -36.087 8.840   -65.622 1.00 90.02  ? 576  PRO A CD    1 
ATOM   4222  N  N     . GLU A 1  577  ? -36.344 5.100   -65.257 1.00 84.64  ? 577  GLU A N     1 
ATOM   4223  C  CA    . GLU A 1  577  ? -36.261 3.684   -65.607 1.00 83.01  ? 577  GLU A CA    1 
ATOM   4224  C  C     . GLU A 1  577  ? -35.173 2.924   -64.819 1.00 80.12  ? 577  GLU A C     1 
ATOM   4225  O  O     . GLU A 1  577  ? -35.016 1.715   -64.994 1.00 78.60  ? 577  GLU A O     1 
ATOM   4226  C  CB    . GLU A 1  577  ? -35.992 3.562   -67.111 1.00 84.66  ? 577  GLU A CB    1 
ATOM   4227  C  CG    . GLU A 1  577  ? -37.078 4.172   -67.989 1.00 86.75  ? 577  GLU A CG    1 
ATOM   4228  C  CD    . GLU A 1  577  ? -38.364 3.360   -67.987 1.00 87.09  ? 577  GLU A CD    1 
ATOM   4229  O  OE1   . GLU A 1  577  ? -38.303 2.138   -68.245 1.00 87.56  ? 577  GLU A OE1   1 
ATOM   4230  O  OE2   . GLU A 1  577  ? -39.443 3.940   -67.735 1.00 88.16  ? 577  GLU A OE2   1 
ATOM   4231  N  N     . ASP A 1  578  ? -34.417 3.632   -63.978 1.00 77.94  ? 578  ASP A N     1 
ATOM   4232  C  CA    . ASP A 1  578  ? -33.530 3.012   -62.992 1.00 75.05  ? 578  ASP A CA    1 
ATOM   4233  C  C     . ASP A 1  578  ? -34.422 2.354   -61.938 1.00 72.95  ? 578  ASP A C     1 
ATOM   4234  O  O     . ASP A 1  578  ? -35.188 3.051   -61.279 1.00 73.37  ? 578  ASP A O     1 
ATOM   4235  C  CB    . ASP A 1  578  ? -32.658 4.091   -62.339 1.00 75.66  ? 578  ASP A CB    1 
ATOM   4236  C  CG    . ASP A 1  578  ? -31.536 3.526   -61.484 1.00 74.07  ? 578  ASP A CG    1 
ATOM   4237  O  OD1   . ASP A 1  578  ? -31.574 2.346   -61.086 1.00 72.47  ? 578  ASP A OD1   1 
ATOM   4238  O  OD2   . ASP A 1  578  ? -30.601 4.292   -61.201 1.00 74.00  ? 578  ASP A OD2   1 
ATOM   4239  N  N     . PRO A 1  579  ? -34.346 1.018   -61.782 1.00 70.42  ? 579  PRO A N     1 
ATOM   4240  C  CA    . PRO A 1  579  ? -35.262 0.371   -60.842 1.00 68.72  ? 579  PRO A CA    1 
ATOM   4241  C  C     . PRO A 1  579  ? -34.794 0.333   -59.382 1.00 67.09  ? 579  PRO A C     1 
ATOM   4242  O  O     . PRO A 1  579  ? -35.574 -0.076  -58.519 1.00 66.12  ? 579  PRO A O     1 
ATOM   4243  C  CB    . PRO A 1  579  ? -35.381 -1.045  -61.407 1.00 68.24  ? 579  PRO A CB    1 
ATOM   4244  C  CG    . PRO A 1  579  ? -34.056 -1.303  -62.028 1.00 68.60  ? 579  PRO A CG    1 
ATOM   4245  C  CD    . PRO A 1  579  ? -33.498 0.028   -62.471 1.00 70.18  ? 579  PRO A CD    1 
ATOM   4246  N  N     . ILE A 1  580  ? -33.567 0.769   -59.095 1.00 66.64  ? 580  ILE A N     1 
ATOM   4247  C  CA    . ILE A 1  580  ? -33.061 0.763   -57.721 1.00 66.76  ? 580  ILE A CA    1 
ATOM   4248  C  C     . ILE A 1  580  ? -33.809 1.824   -56.907 1.00 67.35  ? 580  ILE A C     1 
ATOM   4249  O  O     . ILE A 1  580  ? -33.922 2.976   -57.329 1.00 67.29  ? 580  ILE A O     1 
ATOM   4250  C  CB    . ILE A 1  580  ? -31.537 1.019   -57.640 1.00 67.59  ? 580  ILE A CB    1 
ATOM   4251  C  CG1   . ILE A 1  580  ? -30.743 -0.050  -58.421 1.00 66.78  ? 580  ILE A CG1   1 
ATOM   4252  C  CG2   . ILE A 1  580  ? -31.077 1.061   -56.180 1.00 67.89  ? 580  ILE A CG2   1 
ATOM   4253  C  CD1   . ILE A 1  580  ? -30.692 -1.422  -57.774 1.00 65.65  ? 580  ILE A CD1   1 
ATOM   4254  N  N     . GLY A 1  581  ? -34.324 1.413   -55.749 1.00 67.55  ? 581  GLY A N     1 
ATOM   4255  C  CA    . GLY A 1  581  ? -35.186 2.257   -54.918 1.00 68.53  ? 581  GLY A CA    1 
ATOM   4256  C  C     . GLY A 1  581  ? -36.679 2.015   -55.092 1.00 68.09  ? 581  GLY A C     1 
ATOM   4257  O  O     . GLY A 1  581  ? -37.455 2.328   -54.190 1.00 67.88  ? 581  GLY A O     1 
ATOM   4258  N  N     . HIS A 1  582  ? -37.084 1.463   -56.238 1.00 68.07  ? 582  HIS A N     1 
ATOM   4259  C  CA    . HIS A 1  582  ? -38.501 1.224   -56.534 1.00 68.13  ? 582  HIS A CA    1 
ATOM   4260  C  C     . HIS A 1  582  ? -38.986 -0.076  -55.889 1.00 65.85  ? 582  HIS A C     1 
ATOM   4261  O  O     . HIS A 1  582  ? -38.197 -1.008  -55.709 1.00 63.87  ? 582  HIS A O     1 
ATOM   4262  C  CB    . HIS A 1  582  ? -38.737 1.158   -58.045 1.00 69.27  ? 582  HIS A CB    1 
ATOM   4263  C  CG    . HIS A 1  582  ? -38.380 2.421   -58.770 1.00 71.19  ? 582  HIS A CG    1 
ATOM   4264  N  ND1   . HIS A 1  582  ? -39.329 3.292   -59.257 1.00 72.68  ? 582  HIS A ND1   1 
ATOM   4265  C  CD2   . HIS A 1  582  ? -37.180 2.958   -59.086 1.00 71.83  ? 582  HIS A CD2   1 
ATOM   4266  C  CE1   . HIS A 1  582  ? -38.728 4.311   -59.845 1.00 73.61  ? 582  HIS A CE1   1 
ATOM   4267  N  NE2   . HIS A 1  582  ? -37.424 4.131   -59.758 1.00 73.44  ? 582  HIS A NE2   1 
ATOM   4268  N  N     . PRO A 1  583  ? -40.288 -0.154  -55.552 1.00 65.53  ? 583  PRO A N     1 
ATOM   4269  C  CA    . PRO A 1  583  ? -40.830 -1.360  -54.933 1.00 64.44  ? 583  PRO A CA    1 
ATOM   4270  C  C     . PRO A 1  583  ? -41.190 -2.423  -55.986 1.00 63.00  ? 583  PRO A C     1 
ATOM   4271  O  O     . PRO A 1  583  ? -42.363 -2.749  -56.172 1.00 62.53  ? 583  PRO A O     1 
ATOM   4272  C  CB    . PRO A 1  583  ? -42.058 -0.828  -54.183 1.00 64.85  ? 583  PRO A CB    1 
ATOM   4273  C  CG    . PRO A 1  583  ? -42.535 0.303   -55.021 1.00 65.94  ? 583  PRO A CG    1 
ATOM   4274  C  CD    . PRO A 1  583  ? -41.338 0.866   -55.744 1.00 66.61  ? 583  PRO A CD    1 
ATOM   4275  N  N     . ILE A 1  584  ? -40.167 -2.969  -56.648 1.00 62.58  ? 584  ILE A N     1 
ATOM   4276  C  CA    . ILE A 1  584  ? -40.359 -3.885  -57.782 1.00 61.67  ? 584  ILE A CA    1 
ATOM   4277  C  C     . ILE A 1  584  ? -40.788 -5.251  -57.259 1.00 61.17  ? 584  ILE A C     1 
ATOM   4278  O  O     . ILE A 1  584  ? -40.116 -5.815  -56.393 1.00 60.87  ? 584  ILE A O     1 
ATOM   4279  C  CB    . ILE A 1  584  ? -39.068 -4.068  -58.627 1.00 61.18  ? 584  ILE A CB    1 
ATOM   4280  C  CG1   . ILE A 1  584  ? -38.521 -2.722  -59.144 1.00 62.02  ? 584  ILE A CG1   1 
ATOM   4281  C  CG2   . ILE A 1  584  ? -39.305 -5.043  -59.780 1.00 60.59  ? 584  ILE A CG2   1 
ATOM   4282  C  CD1   . ILE A 1  584  ? -39.505 -1.873  -59.922 1.00 62.72  ? 584  ILE A CD1   1 
ATOM   4283  N  N     . MET A 1  585  ? -41.891 -5.779  -57.797 1.00 60.90  ? 585  MET A N     1 
ATOM   4284  C  CA    . MET A 1  585  ? -42.433 -7.077  -57.384 1.00 59.37  ? 585  MET A CA    1 
ATOM   4285  C  C     . MET A 1  585  ? -41.401 -8.193  -57.532 1.00 58.78  ? 585  MET A C     1 
ATOM   4286  O  O     . MET A 1  585  ? -40.579 -8.174  -58.447 1.00 59.46  ? 585  MET A O     1 
ATOM   4287  C  CB    . MET A 1  585  ? -43.670 -7.426  -58.215 1.00 59.37  ? 585  MET A CB    1 
ATOM   4288  C  CG    . MET A 1  585  ? -44.347 -8.740  -57.839 1.00 58.79  ? 585  MET A CG    1 
ATOM   4289  S  SD    . MET A 1  585  ? -45.849 -9.102  -58.771 1.00 60.42  ? 585  MET A SD    1 
ATOM   4290  C  CE    . MET A 1  585  ? -45.322 -8.787  -60.460 1.00 59.49  ? 585  MET A CE    1 
ATOM   4291  N  N     . HIS A 1  586  ? -41.460 -9.152  -56.609 1.00 58.63  ? 586  HIS A N     1 
ATOM   4292  C  CA    . HIS A 1  586  ? -40.665 -10.382 -56.661 1.00 57.75  ? 586  HIS A CA    1 
ATOM   4293  C  C     . HIS A 1  586  ? -40.848 -11.031 -58.043 1.00 57.12  ? 586  HIS A C     1 
ATOM   4294  O  O     . HIS A 1  586  ? -41.980 -11.260 -58.469 1.00 56.93  ? 586  HIS A O     1 
ATOM   4295  C  CB    . HIS A 1  586  ? -41.137 -11.327 -55.538 1.00 57.41  ? 586  HIS A CB    1 
ATOM   4296  C  CG    . HIS A 1  586  ? -40.183 -12.435 -55.205 1.00 57.31  ? 586  HIS A CG    1 
ATOM   4297  N  ND1   . HIS A 1  586  ? -40.008 -13.540 -56.012 1.00 56.49  ? 586  HIS A ND1   1 
ATOM   4298  C  CD2   . HIS A 1  586  ? -39.392 -12.631 -54.124 1.00 57.19  ? 586  HIS A CD2   1 
ATOM   4299  C  CE1   . HIS A 1  586  ? -39.131 -14.356 -55.456 1.00 56.04  ? 586  HIS A CE1   1 
ATOM   4300  N  NE2   . HIS A 1  586  ? -38.745 -13.831 -54.306 1.00 56.14  ? 586  HIS A NE2   1 
ATOM   4301  N  N     . LEU A 1  587  ? -39.745 -11.310 -58.738 1.00 56.80  ? 587  LEU A N     1 
ATOM   4302  C  CA    . LEU A 1  587  ? -39.779 -11.836 -60.122 1.00 56.50  ? 587  LEU A CA    1 
ATOM   4303  C  C     . LEU A 1  587  ? -40.636 -13.083 -60.269 1.00 55.73  ? 587  LEU A C     1 
ATOM   4304  O  O     . LEU A 1  587  ? -41.379 -13.228 -61.234 1.00 56.33  ? 587  LEU A O     1 
ATOM   4305  C  CB    . LEU A 1  587  ? -38.372 -12.187 -60.610 1.00 56.31  ? 587  LEU A CB    1 
ATOM   4306  C  CG    . LEU A 1  587  ? -37.338 -11.066 -60.740 1.00 56.87  ? 587  LEU A CG    1 
ATOM   4307  C  CD1   . LEU A 1  587  ? -35.988 -11.645 -61.149 1.00 56.21  ? 587  LEU A CD1   1 
ATOM   4308  C  CD2   . LEU A 1  587  ? -37.799 -9.994  -61.716 1.00 57.17  ? 587  LEU A CD2   1 
ATOM   4309  N  N     . SER A 1  588  ? -40.486 -13.992 -59.314 1.00 55.55  ? 588  SER A N     1 
ATOM   4310  C  CA    . SER A 1  588  ? -41.297 -15.210 -59.223 1.00 55.23  ? 588  SER A CA    1 
ATOM   4311  C  C     . SER A 1  588  ? -42.684 -15.057 -58.550 1.00 54.93  ? 588  SER A C     1 
ATOM   4312  O  O     . SER A 1  588  ? -43.384 -16.056 -58.362 1.00 54.51  ? 588  SER A O     1 
ATOM   4313  C  CB    . SER A 1  588  ? -40.481 -16.278 -58.491 1.00 55.00  ? 588  SER A CB    1 
ATOM   4314  O  OG    . SER A 1  588  ? -41.115 -17.537 -58.559 1.00 55.82  ? 588  SER A OG    1 
ATOM   4315  N  N     . GLY A 1  589  ? -43.097 -13.829 -58.228 1.00 54.80  ? 589  GLY A N     1 
ATOM   4316  C  CA    . GLY A 1  589  ? -44.311 -13.570 -57.450 1.00 54.57  ? 589  GLY A CA    1 
ATOM   4317  C  C     . GLY A 1  589  ? -45.622 -13.990 -58.089 1.00 54.80  ? 589  GLY A C     1 
ATOM   4318  O  O     . GLY A 1  589  ? -46.486 -14.554 -57.423 1.00 54.54  ? 589  GLY A O     1 
ATOM   4319  N  N     . VAL A 1  590  ? -45.782 -13.703 -59.378 1.00 55.47  ? 590  VAL A N     1 
ATOM   4320  C  CA    . VAL A 1  590  ? -46.976 -14.119 -60.115 1.00 55.44  ? 590  VAL A CA    1 
ATOM   4321  C  C     . VAL A 1  590  ? -46.967 -15.642 -60.292 1.00 55.10  ? 590  VAL A C     1 
ATOM   4322  O  O     . VAL A 1  590  ? -48.009 -16.288 -60.163 1.00 56.45  ? 590  VAL A O     1 
ATOM   4323  C  CB    . VAL A 1  590  ? -47.092 -13.401 -61.479 1.00 56.00  ? 590  VAL A CB    1 
ATOM   4324  C  CG1   . VAL A 1  590  ? -48.265 -13.940 -62.295 1.00 56.38  ? 590  VAL A CG1   1 
ATOM   4325  C  CG2   . VAL A 1  590  ? -47.245 -11.903 -61.267 1.00 57.04  ? 590  VAL A CG2   1 
ATOM   4326  N  N     . LYS A 1  591  ? -45.795 -16.211 -60.562 1.00 54.21  ? 591  LYS A N     1 
ATOM   4327  C  CA    . LYS A 1  591  ? -45.655 -17.667 -60.634 1.00 54.26  ? 591  LYS A CA    1 
ATOM   4328  C  C     . LYS A 1  591  ? -45.940 -18.360 -59.300 1.00 53.43  ? 591  LYS A C     1 
ATOM   4329  O  O     . LYS A 1  591  ? -46.398 -19.506 -59.298 1.00 53.29  ? 591  LYS A O     1 
ATOM   4330  C  CB    . LYS A 1  591  ? -44.268 -18.073 -61.137 1.00 54.54  ? 591  LYS A CB    1 
ATOM   4331  C  CG    . LYS A 1  591  ? -44.016 -17.713 -62.589 1.00 55.10  ? 591  LYS A CG    1 
ATOM   4332  C  CD    . LYS A 1  591  ? -42.754 -18.372 -63.115 1.00 55.47  ? 591  LYS A CD    1 
ATOM   4333  C  CE    . LYS A 1  591  ? -41.477 -17.788 -62.529 1.00 55.44  ? 591  LYS A CE    1 
ATOM   4334  N  NZ    . LYS A 1  591  ? -41.265 -16.386 -62.971 1.00 56.55  ? 591  LYS A NZ    1 
ATOM   4335  N  N     . HIS A 1  592  ? -45.656 -17.686 -58.180 1.00 52.43  ? 592  HIS A N     1 
ATOM   4336  C  CA    . HIS A 1  592  ? -46.077 -18.182 -56.869 1.00 51.43  ? 592  HIS A CA    1 
ATOM   4337  C  C     . HIS A 1  592  ? -47.602 -18.282 -56.850 1.00 52.02  ? 592  HIS A C     1 
ATOM   4338  O  O     . HIS A 1  592  ? -48.158 -19.297 -56.440 1.00 52.48  ? 592  HIS A O     1 
ATOM   4339  C  CB    . HIS A 1  592  ? -45.600 -17.283 -55.721 1.00 51.24  ? 592  HIS A CB    1 
ATOM   4340  C  CG    . HIS A 1  592  ? -44.110 -17.199 -55.581 1.00 51.54  ? 592  HIS A CG    1 
ATOM   4341  N  ND1   . HIS A 1  592  ? -43.470 -16.075 -55.101 1.00 52.49  ? 592  HIS A ND1   1 
ATOM   4342  C  CD2   . HIS A 1  592  ? -43.132 -18.095 -55.851 1.00 51.25  ? 592  HIS A CD2   1 
ATOM   4343  C  CE1   . HIS A 1  592  ? -42.166 -16.280 -55.081 1.00 51.30  ? 592  HIS A CE1   1 
ATOM   4344  N  NE2   . HIS A 1  592  ? -41.934 -17.499 -55.532 1.00 51.39  ? 592  HIS A NE2   1 
ATOM   4345  N  N     . ALA A 1  593  ? -48.264 -17.237 -57.337 1.00 52.41  ? 593  ALA A N     1 
ATOM   4346  C  CA    . ALA A 1  593  ? -49.723 -17.173 -57.354 1.00 53.63  ? 593  ALA A CA    1 
ATOM   4347  C  C     . ALA A 1  593  ? -50.417 -18.161 -58.294 1.00 53.99  ? 593  ALA A C     1 
ATOM   4348  O  O     . ALA A 1  593  ? -51.532 -18.591 -58.005 1.00 55.13  ? 593  ALA A O     1 
ATOM   4349  C  CB    . ALA A 1  593  ? -50.179 -15.752 -57.665 1.00 54.84  ? 593  ALA A CB    1 
ATOM   4350  N  N     . THR A 1  594  ? -49.785 -18.510 -59.414 1.00 54.28  ? 594  THR A N     1 
ATOM   4351  C  CA    . THR A 1  594  ? -50.379 -19.464 -60.370 1.00 54.48  ? 594  THR A CA    1 
ATOM   4352  C  C     . THR A 1  594  ? -49.967 -20.921 -60.130 1.00 54.62  ? 594  THR A C     1 
ATOM   4353  O  O     . THR A 1  594  ? -50.491 -21.831 -60.780 1.00 54.27  ? 594  THR A O     1 
ATOM   4354  C  CB    . THR A 1  594  ? -50.046 -19.078 -61.825 1.00 53.87  ? 594  THR A CB    1 
ATOM   4355  O  OG1   . THR A 1  594  ? -48.634 -18.910 -61.972 1.00 52.72  ? 594  THR A OG1   1 
ATOM   4356  C  CG2   . THR A 1  594  ? -50.741 -17.787 -62.196 1.00 54.77  ? 594  THR A CG2   1 
ATOM   4357  N  N     . GLY A 1  595  ? -49.039 -21.141 -59.201 1.00 55.89  ? 595  GLY A N     1 
ATOM   4358  C  CA    . GLY A 1  595  ? -48.481 -22.468 -58.952 1.00 57.28  ? 595  GLY A CA    1 
ATOM   4359  C  C     . GLY A 1  595  ? -47.556 -22.960 -60.057 1.00 58.61  ? 595  GLY A C     1 
ATOM   4360  O  O     . GLY A 1  595  ? -47.289 -24.161 -60.148 1.00 61.16  ? 595  GLY A O     1 
ATOM   4361  N  N     . GLU A 1  596  ? -47.066 -22.042 -60.892 1.00 58.97  ? 596  GLU A N     1 
ATOM   4362  C  CA    . GLU A 1  596  ? -46.160 -22.384 -61.984 1.00 59.10  ? 596  GLU A CA    1 
ATOM   4363  C  C     . GLU A 1  596  ? -44.707 -22.406 -61.508 1.00 58.45  ? 596  GLU A C     1 
ATOM   4364  O  O     . GLU A 1  596  ? -43.863 -23.014 -62.160 1.00 60.56  ? 596  GLU A O     1 
ATOM   4365  C  CB    . GLU A 1  596  ? -46.328 -21.410 -63.155 1.00 60.05  ? 596  GLU A CB    1 
ATOM   4366  C  CG    . GLU A 1  596  ? -47.717 -21.429 -63.777 1.00 60.80  ? 596  GLU A CG    1 
ATOM   4367  C  CD    . GLU A 1  596  ? -47.872 -20.444 -64.922 1.00 61.63  ? 596  GLU A CD    1 
ATOM   4368  O  OE1   . GLU A 1  596  ? -47.495 -20.796 -66.054 1.00 63.71  ? 596  GLU A OE1   1 
ATOM   4369  O  OE2   . GLU A 1  596  ? -48.387 -19.329 -64.707 1.00 61.42  ? 596  GLU A OE2   1 
ATOM   4370  N  N     . ALA A 1  597  ? -44.422 -21.743 -60.386 1.00 57.82  ? 597  ALA A N     1 
ATOM   4371  C  CA    . ALA A 1  597  ? -43.112 -21.819 -59.735 1.00 57.41  ? 597  ALA A CA    1 
ATOM   4372  C  C     . ALA A 1  597  ? -42.783 -23.251 -59.304 1.00 57.14  ? 597  ALA A C     1 
ATOM   4373  O  O     . ALA A 1  597  ? -43.476 -23.822 -58.461 1.00 57.35  ? 597  ALA A O     1 
ATOM   4374  C  CB    . ALA A 1  597  ? -43.067 -20.897 -58.525 1.00 57.24  ? 597  ALA A CB    1 
ATOM   4375  N  N     . ILE A 1  598  ? -41.725 -23.816 -59.886 1.00 56.58  ? 598  ILE A N     1 
ATOM   4376  C  CA    . ILE A 1  598  ? -41.296 -25.179 -59.589 1.00 55.66  ? 598  ILE A CA    1 
ATOM   4377  C  C     . ILE A 1  598  ? -40.393 -25.163 -58.364 1.00 54.43  ? 598  ILE A C     1 
ATOM   4378  O  O     . ILE A 1  598  ? -39.325 -24.572 -58.392 1.00 55.49  ? 598  ILE A O     1 
ATOM   4379  C  CB    . ILE A 1  598  ? -40.537 -25.813 -60.786 1.00 56.23  ? 598  ILE A CB    1 
ATOM   4380  C  CG1   . ILE A 1  598  ? -41.410 -25.824 -62.052 1.00 56.76  ? 598  ILE A CG1   1 
ATOM   4381  C  CG2   . ILE A 1  598  ? -40.059 -27.230 -60.462 1.00 55.89  ? 598  ILE A CG2   1 
ATOM   4382  C  CD1   . ILE A 1  598  ? -42.695 -26.629 -61.946 1.00 57.07  ? 598  ILE A CD1   1 
ATOM   4383  N  N     . TYR A 1  599  ? -40.847 -25.798 -57.289 1.00 53.98  ? 599  TYR A N     1 
ATOM   4384  C  CA    . TYR A 1  599  ? -40.008 -26.124 -56.138 1.00 52.81  ? 599  TYR A CA    1 
ATOM   4385  C  C     . TYR A 1  599  ? -39.477 -27.546 -56.329 1.00 53.08  ? 599  TYR A C     1 
ATOM   4386  O  O     . TYR A 1  599  ? -39.892 -28.252 -57.241 1.00 53.34  ? 599  TYR A O     1 
ATOM   4387  C  CB    . TYR A 1  599  ? -40.805 -25.978 -54.831 1.00 52.70  ? 599  TYR A CB    1 
ATOM   4388  C  CG    . TYR A 1  599  ? -41.319 -24.569 -54.601 1.00 52.21  ? 599  TYR A CG    1 
ATOM   4389  C  CD1   . TYR A 1  599  ? -42.510 -24.136 -55.184 1.00 52.19  ? 599  TYR A CD1   1 
ATOM   4390  C  CD2   . TYR A 1  599  ? -40.603 -23.658 -53.825 1.00 52.65  ? 599  TYR A CD2   1 
ATOM   4391  C  CE1   . TYR A 1  599  ? -42.980 -22.846 -54.998 1.00 52.29  ? 599  TYR A CE1   1 
ATOM   4392  C  CE2   . TYR A 1  599  ? -41.069 -22.362 -53.629 1.00 53.04  ? 599  TYR A CE2   1 
ATOM   4393  C  CZ    . TYR A 1  599  ? -42.258 -21.962 -54.222 1.00 52.48  ? 599  TYR A CZ    1 
ATOM   4394  O  OH    . TYR A 1  599  ? -42.728 -20.689 -54.054 1.00 52.10  ? 599  TYR A OH    1 
ATOM   4395  N  N     . CYS A 1  600  ? -38.560 -27.971 -55.470 1.00 54.50  ? 600  CYS A N     1 
ATOM   4396  C  CA    . CYS A 1  600  ? -37.806 -29.209 -55.694 1.00 54.40  ? 600  CYS A CA    1 
ATOM   4397  C  C     . CYS A 1  600  ? -38.672 -30.462 -55.918 1.00 53.39  ? 600  CYS A C     1 
ATOM   4398  O  O     . CYS A 1  600  ? -38.426 -31.206 -56.863 1.00 53.71  ? 600  CYS A O     1 
ATOM   4399  C  CB    . CYS A 1  600  ? -36.808 -29.442 -54.560 1.00 55.63  ? 600  CYS A CB    1 
ATOM   4400  S  SG    . CYS A 1  600  ? -35.643 -30.781 -54.893 1.00 58.55  ? 600  CYS A SG    1 
ATOM   4401  N  N     . ASP A 1  601  ? -39.683 -30.686 -55.076 1.00 52.95  ? 601  ASP A N     1 
ATOM   4402  C  CA    . ASP A 1  601  ? -40.591 -31.843 -55.238 1.00 52.49  ? 601  ASP A CA    1 
ATOM   4403  C  C     . ASP A 1  601  ? -41.562 -31.677 -56.412 1.00 52.42  ? 601  ASP A C     1 
ATOM   4404  O  O     . ASP A 1  601  ? -42.170 -32.651 -56.858 1.00 53.55  ? 601  ASP A O     1 
ATOM   4405  C  CB    . ASP A 1  601  ? -41.368 -32.125 -53.948 1.00 52.89  ? 601  ASP A CB    1 
ATOM   4406  C  CG    . ASP A 1  601  ? -42.182 -33.433 -54.003 1.00 53.79  ? 601  ASP A CG    1 
ATOM   4407  O  OD1   . ASP A 1  601  ? -41.621 -34.520 -54.281 1.00 53.11  ? 601  ASP A OD1   1 
ATOM   4408  O  OD2   . ASP A 1  601  ? -43.405 -33.366 -53.759 1.00 54.64  ? 601  ASP A OD2   1 
ATOM   4409  N  N     . ASP A 1  602  ? -41.706 -30.452 -56.912 1.00 52.65  ? 602  ASP A N     1 
ATOM   4410  C  CA    . ASP A 1  602  ? -42.528 -30.183 -58.091 1.00 52.80  ? 602  ASP A CA    1 
ATOM   4411  C  C     . ASP A 1  602  ? -41.847 -30.612 -59.387 1.00 52.64  ? 602  ASP A C     1 
ATOM   4412  O  O     . ASP A 1  602  ? -42.488 -30.620 -60.444 1.00 54.25  ? 602  ASP A O     1 
ATOM   4413  C  CB    . ASP A 1  602  ? -42.897 -28.695 -58.189 1.00 52.74  ? 602  ASP A CB    1 
ATOM   4414  C  CG    . ASP A 1  602  ? -43.614 -28.176 -56.957 1.00 52.93  ? 602  ASP A CG    1 
ATOM   4415  O  OD1   . ASP A 1  602  ? -44.300 -28.952 -56.260 1.00 53.41  ? 602  ASP A OD1   1 
ATOM   4416  O  OD2   . ASP A 1  602  ? -43.487 -26.969 -56.689 1.00 52.67  ? 602  ASP A OD2   1 
ATOM   4417  N  N     . MET A 1  603  ? -40.559 -30.944 -59.325 1.00 52.25  ? 603  MET A N     1 
ATOM   4418  C  CA    . MET A 1  603  ? -39.860 -31.509 -60.480 1.00 51.88  ? 603  MET A CA    1 
ATOM   4419  C  C     . MET A 1  603  ? -40.530 -32.816 -60.879 1.00 51.40  ? 603  MET A C     1 
ATOM   4420  O  O     . MET A 1  603  ? -40.902 -33.602 -60.003 1.00 51.80  ? 603  MET A O     1 
ATOM   4421  C  CB    . MET A 1  603  ? -38.394 -31.772 -60.167 1.00 52.34  ? 603  MET A CB    1 
ATOM   4422  C  CG    . MET A 1  603  ? -37.581 -30.509 -59.995 1.00 53.08  ? 603  MET A CG    1 
ATOM   4423  S  SD    . MET A 1  603  ? -35.845 -30.871 -59.736 1.00 54.35  ? 603  MET A SD    1 
ATOM   4424  C  CE    . MET A 1  603  ? -35.236 -29.192 -59.584 1.00 56.94  ? 603  MET A CE    1 
ATOM   4425  N  N     . PRO A 1  604  ? -40.698 -33.053 -62.193 1.00 50.09  ? 604  PRO A N     1 
ATOM   4426  C  CA    . PRO A 1  604  ? -41.378 -34.270 -62.617 1.00 49.60  ? 604  PRO A CA    1 
ATOM   4427  C  C     . PRO A 1  604  ? -40.693 -35.562 -62.186 1.00 49.23  ? 604  PRO A C     1 
ATOM   4428  O  O     . PRO A 1  604  ? -39.512 -35.564 -61.848 1.00 47.84  ? 604  PRO A O     1 
ATOM   4429  C  CB    . PRO A 1  604  ? -41.370 -34.162 -64.144 1.00 50.20  ? 604  PRO A CB    1 
ATOM   4430  C  CG    . PRO A 1  604  ? -41.306 -32.712 -64.413 1.00 50.37  ? 604  PRO A CG    1 
ATOM   4431  C  CD    . PRO A 1  604  ? -40.428 -32.161 -63.334 1.00 50.10  ? 604  PRO A CD    1 
ATOM   4432  N  N     . LEU A 1  605  ? -41.459 -36.646 -62.214 1.00 50.56  ? 605  LEU A N     1 
ATOM   4433  C  CA    . LEU A 1  605  ? -40.953 -37.976 -61.916 1.00 51.39  ? 605  LEU A CA    1 
ATOM   4434  C  C     . LEU A 1  605  ? -39.861 -38.334 -62.916 1.00 50.97  ? 605  LEU A C     1 
ATOM   4435  O  O     . LEU A 1  605  ? -40.110 -38.373 -64.122 1.00 51.23  ? 605  LEU A O     1 
ATOM   4436  C  CB    . LEU A 1  605  ? -42.091 -38.996 -62.008 1.00 53.44  ? 605  LEU A CB    1 
ATOM   4437  C  CG    . LEU A 1  605  ? -41.817 -40.458 -61.641 1.00 54.92  ? 605  LEU A CG    1 
ATOM   4438  C  CD1   . LEU A 1  605  ? -41.651 -40.611 -60.132 1.00 55.37  ? 605  LEU A CD1   1 
ATOM   4439  C  CD2   . LEU A 1  605  ? -42.938 -41.358 -62.153 1.00 55.39  ? 605  LEU A CD2   1 
ATOM   4440  N  N     . VAL A 1  606  ? -38.651 -38.561 -62.409 1.00 49.80  ? 606  VAL A N     1 
ATOM   4441  C  CA    . VAL A 1  606  ? -37.537 -39.024 -63.230 1.00 48.85  ? 606  VAL A CA    1 
ATOM   4442  C  C     . VAL A 1  606  ? -37.724 -40.525 -63.465 1.00 49.50  ? 606  VAL A C     1 
ATOM   4443  O  O     . VAL A 1  606  ? -38.146 -41.251 -62.562 1.00 49.10  ? 606  VAL A O     1 
ATOM   4444  C  CB    . VAL A 1  606  ? -36.181 -38.724 -62.565 1.00 48.02  ? 606  VAL A CB    1 
ATOM   4445  C  CG1   . VAL A 1  606  ? -35.030 -39.340 -63.344 1.00 48.27  ? 606  VAL A CG1   1 
ATOM   4446  C  CG2   . VAL A 1  606  ? -35.981 -37.223 -62.453 1.00 47.59  ? 606  VAL A CG2   1 
ATOM   4447  N  N     . ASP A 1  607  ? -37.412 -40.974 -64.682 1.00 49.26  ? 607  ASP A N     1 
ATOM   4448  C  CA    . ASP A 1  607  ? -37.668 -42.351 -65.106 1.00 49.36  ? 607  ASP A CA    1 
ATOM   4449  C  C     . ASP A 1  607  ? -37.032 -43.353 -64.142 1.00 49.60  ? 607  ASP A C     1 
ATOM   4450  O  O     . ASP A 1  607  ? -35.832 -43.290 -63.883 1.00 48.83  ? 607  ASP A O     1 
ATOM   4451  C  CB    . ASP A 1  607  ? -37.141 -42.571 -66.528 1.00 49.80  ? 607  ASP A CB    1 
ATOM   4452  C  CG    . ASP A 1  607  ? -37.512 -43.932 -67.095 1.00 50.13  ? 607  ASP A CG    1 
ATOM   4453  O  OD1   . ASP A 1  607  ? -38.689 -44.330 -66.990 1.00 49.29  ? 607  ASP A OD1   1 
ATOM   4454  O  OD2   . ASP A 1  607  ? -36.623 -44.596 -67.671 1.00 49.88  ? 607  ASP A OD2   1 
ATOM   4455  N  N     . GLN A 1  608  ? -37.869 -44.240 -63.601 1.00 50.74  ? 608  GLN A N     1 
ATOM   4456  C  CA    . GLN A 1  608  ? -37.474 -45.291 -62.650 1.00 51.61  ? 608  GLN A CA    1 
ATOM   4457  C  C     . GLN A 1  608  ? -36.929 -44.806 -61.305 1.00 51.18  ? 608  GLN A C     1 
ATOM   4458  O  O     . GLN A 1  608  ? -36.233 -45.567 -60.621 1.00 50.80  ? 608  GLN A O     1 
ATOM   4459  C  CB    . GLN A 1  608  ? -36.436 -46.237 -63.260 1.00 52.67  ? 608  GLN A CB    1 
ATOM   4460  C  CG    . GLN A 1  608  ? -36.802 -46.828 -64.595 1.00 53.52  ? 608  GLN A CG    1 
ATOM   4461  C  CD    . GLN A 1  608  ? -35.897 -47.989 -64.914 1.00 55.05  ? 608  GLN A CD    1 
ATOM   4462  O  OE1   . GLN A 1  608  ? -34.672 -47.833 -64.978 1.00 55.95  ? 608  GLN A OE1   1 
ATOM   4463  N  NE2   . GLN A 1  608  ? -36.484 -49.163 -65.093 1.00 55.63  ? 608  GLN A NE2   1 
ATOM   4464  N  N     . GLU A 1  609  ? -37.247 -43.574 -60.902 1.00 50.20  ? 609  GLU A N     1 
ATOM   4465  C  CA    . GLU A 1  609  ? -36.716 -43.061 -59.642 1.00 49.60  ? 609  GLU A CA    1 
ATOM   4466  C  C     . GLU A 1  609  ? -37.271 -43.814 -58.441 1.00 49.08  ? 609  GLU A C     1 
ATOM   4467  O  O     . GLU A 1  609  ? -38.401 -44.293 -58.461 1.00 49.72  ? 609  GLU A O     1 
ATOM   4468  C  CB    . GLU A 1  609  ? -36.939 -41.554 -59.483 1.00 49.54  ? 609  GLU A CB    1 
ATOM   4469  C  CG    . GLU A 1  609  ? -38.367 -41.111 -59.208 1.00 49.75  ? 609  GLU A CG    1 
ATOM   4470  C  CD    . GLU A 1  609  ? -38.427 -39.680 -58.714 1.00 49.69  ? 609  GLU A CD    1 
ATOM   4471  O  OE1   . GLU A 1  609  ? -38.103 -38.746 -59.481 1.00 49.03  ? 609  GLU A OE1   1 
ATOM   4472  O  OE2   . GLU A 1  609  ? -38.809 -39.487 -57.543 1.00 50.68  ? 609  GLU A OE2   1 
ATOM   4473  N  N     . LEU A 1  610  ? -36.444 -43.924 -57.412 1.00 48.79  ? 610  LEU A N     1 
ATOM   4474  C  CA    . LEU A 1  610  ? -36.811 -44.559 -56.158 1.00 49.03  ? 610  LEU A CA    1 
ATOM   4475  C  C     . LEU A 1  610  ? -37.079 -43.477 -55.125 1.00 48.71  ? 610  LEU A C     1 
ATOM   4476  O  O     . LEU A 1  610  ? -36.824 -42.294 -55.369 1.00 48.32  ? 610  LEU A O     1 
ATOM   4477  C  CB    . LEU A 1  610  ? -35.675 -45.465 -55.692 1.00 49.20  ? 610  LEU A CB    1 
ATOM   4478  C  CG    . LEU A 1  610  ? -35.274 -46.541 -56.707 1.00 49.13  ? 610  LEU A CG    1 
ATOM   4479  C  CD1   . LEU A 1  610  ? -33.987 -47.228 -56.282 1.00 49.67  ? 610  LEU A CD1   1 
ATOM   4480  C  CD2   . LEU A 1  610  ? -36.397 -47.552 -56.892 1.00 49.44  ? 610  LEU A CD2   1 
ATOM   4481  N  N     . PHE A 1  611  ? -37.601 -43.889 -53.976 1.00 49.20  ? 611  PHE A N     1 
ATOM   4482  C  CA    . PHE A 1  611  ? -37.861 -42.979 -52.862 1.00 48.81  ? 611  PHE A CA    1 
ATOM   4483  C  C     . PHE A 1  611  ? -37.122 -43.434 -51.611 1.00 49.21  ? 611  PHE A C     1 
ATOM   4484  O  O     . PHE A 1  611  ? -37.135 -44.619 -51.273 1.00 49.19  ? 611  PHE A O     1 
ATOM   4485  C  CB    . PHE A 1  611  ? -39.359 -42.891 -52.572 1.00 49.15  ? 611  PHE A CB    1 
ATOM   4486  C  CG    . PHE A 1  611  ? -39.736 -41.695 -51.749 1.00 49.01  ? 611  PHE A CG    1 
ATOM   4487  C  CD1   . PHE A 1  611  ? -39.961 -40.460 -52.360 1.00 47.72  ? 611  PHE A CD1   1 
ATOM   4488  C  CD2   . PHE A 1  611  ? -39.835 -41.789 -50.356 1.00 49.05  ? 611  PHE A CD2   1 
ATOM   4489  C  CE1   . PHE A 1  611  ? -40.292 -39.349 -51.604 1.00 47.34  ? 611  PHE A CE1   1 
ATOM   4490  C  CE2   . PHE A 1  611  ? -40.166 -40.681 -49.595 1.00 48.60  ? 611  PHE A CE2   1 
ATOM   4491  C  CZ    . PHE A 1  611  ? -40.399 -39.461 -50.222 1.00 48.25  ? 611  PHE A CZ    1 
ATOM   4492  N  N     . LEU A 1  612  ? -36.488 -42.482 -50.931 1.00 49.90  ? 612  LEU A N     1 
ATOM   4493  C  CA    . LEU A 1  612  ? -35.797 -42.732 -49.673 1.00 51.08  ? 612  LEU A CA    1 
ATOM   4494  C  C     . LEU A 1  612  ? -36.584 -42.161 -48.500 1.00 50.58  ? 612  LEU A C     1 
ATOM   4495  O  O     . LEU A 1  612  ? -37.032 -41.016 -48.552 1.00 49.76  ? 612  LEU A O     1 
ATOM   4496  C  CB    . LEU A 1  612  ? -34.410 -42.094 -49.694 1.00 51.95  ? 612  LEU A CB    1 
ATOM   4497  C  CG    . LEU A 1  612  ? -33.440 -42.663 -48.651 1.00 53.12  ? 612  LEU A CG    1 
ATOM   4498  C  CD1   . LEU A 1  612  ? -32.721 -43.884 -49.195 1.00 53.57  ? 612  LEU A CD1   1 
ATOM   4499  C  CD2   . LEU A 1  612  ? -32.432 -41.615 -48.216 1.00 54.12  ? 612  LEU A CD2   1 
ATOM   4500  N  N     . THR A 1  613  ? -36.735 -42.968 -47.450 1.00 51.38  ? 613  THR A N     1 
ATOM   4501  C  CA    . THR A 1  613  ? -37.248 -42.514 -46.151 1.00 52.79  ? 613  THR A CA    1 
ATOM   4502  C  C     . THR A 1  613  ? -36.407 -43.108 -45.012 1.00 53.28  ? 613  THR A C     1 
ATOM   4503  O  O     . THR A 1  613  ? -35.856 -44.201 -45.145 1.00 53.86  ? 613  THR A O     1 
ATOM   4504  C  CB    . THR A 1  613  ? -38.743 -42.868 -45.959 1.00 54.10  ? 613  THR A CB    1 
ATOM   4505  O  OG1   . THR A 1  613  ? -39.213 -42.295 -44.733 1.00 56.82  ? 613  THR A OG1   1 
ATOM   4506  C  CG2   . THR A 1  613  ? -38.976 -44.371 -45.912 1.00 55.06  ? 613  THR A CG2   1 
ATOM   4507  N  N     . PHE A 1  614  ? -36.326 -42.390 -43.893 1.00 53.62  ? 614  PHE A N     1 
ATOM   4508  C  CA    . PHE A 1  614  ? -35.473 -42.784 -42.763 1.00 54.74  ? 614  PHE A CA    1 
ATOM   4509  C  C     . PHE A 1  614  ? -36.249 -43.414 -41.610 1.00 54.84  ? 614  PHE A C     1 
ATOM   4510  O  O     . PHE A 1  614  ? -37.337 -42.967 -41.286 1.00 55.30  ? 614  PHE A O     1 
ATOM   4511  C  CB    . PHE A 1  614  ? -34.708 -41.569 -42.226 1.00 55.26  ? 614  PHE A CB    1 
ATOM   4512  C  CG    . PHE A 1  614  ? -33.754 -40.972 -43.216 1.00 55.77  ? 614  PHE A CG    1 
ATOM   4513  C  CD1   . PHE A 1  614  ? -32.466 -41.481 -43.352 1.00 56.87  ? 614  PHE A CD1   1 
ATOM   4514  C  CD2   . PHE A 1  614  ? -34.139 -39.910 -44.019 1.00 55.38  ? 614  PHE A CD2   1 
ATOM   4515  C  CE1   . PHE A 1  614  ? -31.582 -40.937 -44.268 1.00 56.85  ? 614  PHE A CE1   1 
ATOM   4516  C  CE2   . PHE A 1  614  ? -33.260 -39.364 -44.941 1.00 55.53  ? 614  PHE A CE2   1 
ATOM   4517  C  CZ    . PHE A 1  614  ? -31.980 -39.876 -45.066 1.00 56.12  ? 614  PHE A CZ    1 
ATOM   4518  N  N     . VAL A 1  615  ? -35.681 -44.452 -41.002 1.00 55.72  ? 615  VAL A N     1 
ATOM   4519  C  CA    . VAL A 1  615  ? -36.070 -44.870 -39.658 1.00 56.94  ? 615  VAL A CA    1 
ATOM   4520  C  C     . VAL A 1  615  ? -35.224 -44.029 -38.707 1.00 57.41  ? 615  VAL A C     1 
ATOM   4521  O  O     . VAL A 1  615  ? -33.999 -44.004 -38.833 1.00 57.03  ? 615  VAL A O     1 
ATOM   4522  C  CB    . VAL A 1  615  ? -35.805 -46.370 -39.397 1.00 58.19  ? 615  VAL A CB    1 
ATOM   4523  C  CG1   . VAL A 1  615  ? -36.216 -46.759 -37.975 1.00 58.90  ? 615  VAL A CG1   1 
ATOM   4524  C  CG2   . VAL A 1  615  ? -36.524 -47.230 -40.433 1.00 58.17  ? 615  VAL A CG2   1 
ATOM   4525  N  N     . THR A 1  616  ? -35.874 -43.337 -37.774 1.00 58.70  ? 616  THR A N     1 
ATOM   4526  C  CA    . THR A 1  616  ? -35.181 -42.485 -36.803 1.00 59.75  ? 616  THR A CA    1 
ATOM   4527  C  C     . THR A 1  616  ? -35.245 -43.066 -35.396 1.00 61.36  ? 616  THR A C     1 
ATOM   4528  O  O     . THR A 1  616  ? -36.062 -43.942 -35.108 1.00 62.37  ? 616  THR A O     1 
ATOM   4529  C  CB    . THR A 1  616  ? -35.762 -41.061 -36.770 1.00 59.43  ? 616  THR A CB    1 
ATOM   4530  O  OG1   . THR A 1  616  ? -37.124 -41.098 -36.323 1.00 60.21  ? 616  THR A OG1   1 
ATOM   4531  C  CG2   . THR A 1  616  ? -35.690 -40.415 -38.145 1.00 58.27  ? 616  THR A CG2   1 
ATOM   4532  N  N     . SER A 1  617  ? -34.373 -42.565 -34.528 1.00 62.72  ? 617  SER A N     1 
ATOM   4533  C  CA    . SER A 1  617  ? -34.295 -43.029 -33.143 1.00 64.64  ? 617  SER A CA    1 
ATOM   4534  C  C     . SER A 1  617  ? -35.542 -42.648 -32.355 1.00 65.24  ? 617  SER A C     1 
ATOM   4535  O  O     . SER A 1  617  ? -36.042 -41.527 -32.479 1.00 65.02  ? 617  SER A O     1 
ATOM   4536  C  CB    . SER A 1  617  ? -33.070 -42.437 -32.448 1.00 65.34  ? 617  SER A CB    1 
ATOM   4537  O  OG    . SER A 1  617  ? -32.986 -42.880 -31.106 1.00 66.30  ? 617  SER A OG    1 
ATOM   4538  N  N     . SER A 1  618  ? -36.027 -43.595 -31.553 1.00 66.83  ? 618  SER A N     1 
ATOM   4539  C  CA    . SER A 1  618  ? -37.164 -43.386 -30.656 1.00 67.79  ? 618  SER A CA    1 
ATOM   4540  C  C     . SER A 1  618  ? -36.728 -43.270 -29.183 1.00 69.74  ? 618  SER A C     1 
ATOM   4541  O  O     . SER A 1  618  ? -37.580 -43.243 -28.291 1.00 69.89  ? 618  SER A O     1 
ATOM   4542  C  CB    . SER A 1  618  ? -38.162 -44.534 -30.819 1.00 68.08  ? 618  SER A CB    1 
ATOM   4543  O  OG    . SER A 1  618  ? -37.646 -45.746 -30.290 1.00 69.66  ? 618  SER A OG    1 
ATOM   4544  N  N     . ARG A 1  619  ? -35.415 -43.197 -28.941 1.00 70.65  ? 619  ARG A N     1 
ATOM   4545  C  CA    . ARG A 1  619  ? -34.853 -43.063 -27.599 1.00 72.44  ? 619  ARG A CA    1 
ATOM   4546  C  C     . ARG A 1  619  ? -33.861 -41.903 -27.547 1.00 71.54  ? 619  ARG A C     1 
ATOM   4547  O  O     . ARG A 1  619  ? -33.179 -41.623 -28.526 1.00 71.13  ? 619  ARG A O     1 
ATOM   4548  C  CB    . ARG A 1  619  ? -34.151 -44.361 -27.195 1.00 74.93  ? 619  ARG A CB    1 
ATOM   4549  C  CG    . ARG A 1  619  ? -35.053 -45.589 -27.152 1.00 76.78  ? 619  ARG A CG    1 
ATOM   4550  C  CD    . ARG A 1  619  ? -36.145 -45.485 -26.093 1.00 78.39  ? 619  ARG A CD    1 
ATOM   4551  N  NE    . ARG A 1  619  ? -36.885 -46.742 -25.962 1.00 80.23  ? 619  ARG A NE    1 
ATOM   4552  C  CZ    . ARG A 1  619  ? -36.461 -47.828 -25.308 1.00 82.37  ? 619  ARG A CZ    1 
ATOM   4553  N  NH1   . ARG A 1  619  ? -35.276 -47.854 -24.693 1.00 83.10  ? 619  ARG A NH1   1 
ATOM   4554  N  NH2   . ARG A 1  619  ? -37.234 -48.912 -25.268 1.00 83.59  ? 619  ARG A NH2   1 
ATOM   4555  N  N     . ALA A 1  620  ? -33.778 -41.246 -26.391 1.00 72.46  ? 620  ALA A N     1 
ATOM   4556  C  CA    . ALA A 1  620  ? -32.911 -40.076 -26.205 1.00 72.47  ? 620  ALA A CA    1 
ATOM   4557  C  C     . ALA A 1  620  ? -31.440 -40.437 -25.956 1.00 73.34  ? 620  ALA A C     1 
ATOM   4558  O  O     . ALA A 1  620  ? -30.548 -39.762 -26.448 1.00 72.21  ? 620  ALA A O     1 
ATOM   4559  C  CB    . ALA A 1  620  ? -33.438 -39.211 -25.071 1.00 73.31  ? 620  ALA A CB    1 
ATOM   4560  N  N     . HIS A 1  621  ? -31.186 -41.474 -25.166 1.00 75.48  ? 621  HIS A N     1 
ATOM   4561  C  CA    . HIS A 1  621  ? -29.820 -41.962 -24.953 1.00 77.70  ? 621  HIS A CA    1 
ATOM   4562  C  C     . HIS A 1  621  ? -29.857 -43.450 -24.602 1.00 78.92  ? 621  HIS A C     1 
ATOM   4563  O  O     . HIS A 1  621  ? -30.148 -43.829 -23.462 1.00 81.35  ? 621  HIS A O     1 
ATOM   4564  C  CB    . HIS A 1  621  ? -29.101 -41.131 -23.878 1.00 79.83  ? 621  HIS A CB    1 
ATOM   4565  C  CG    . HIS A 1  621  ? -27.640 -41.439 -23.737 1.00 81.55  ? 621  HIS A CG    1 
ATOM   4566  N  ND1   . HIS A 1  621  ? -26.943 -41.218 -22.568 1.00 83.48  ? 621  HIS A ND1   1 
ATOM   4567  C  CD2   . HIS A 1  621  ? -26.745 -41.959 -24.613 1.00 81.93  ? 621  HIS A CD2   1 
ATOM   4568  C  CE1   . HIS A 1  621  ? -25.684 -41.583 -22.731 1.00 84.07  ? 621  HIS A CE1   1 
ATOM   4569  N  NE2   . HIS A 1  621  ? -25.539 -42.039 -23.962 1.00 82.96  ? 621  HIS A NE2   1 
ATOM   4570  N  N     . ALA A 1  622  ? -29.578 -44.280 -25.603 1.00 77.86  ? 622  ALA A N     1 
ATOM   4571  C  CA    . ALA A 1  622  ? -29.705 -45.725 -25.492 1.00 78.50  ? 622  ALA A CA    1 
ATOM   4572  C  C     . ALA A 1  622  ? -28.719 -46.435 -26.411 1.00 79.29  ? 622  ALA A C     1 
ATOM   4573  O  O     . ALA A 1  622  ? -28.222 -45.852 -27.381 1.00 77.36  ? 622  ALA A O     1 
ATOM   4574  C  CB    . ALA A 1  622  ? -31.126 -46.141 -25.835 1.00 77.67  ? 622  ALA A CB    1 
ATOM   4575  N  N     . LYS A 1  623  ? -28.436 -47.694 -26.087 1.00 81.87  ? 623  LYS A N     1 
ATOM   4576  C  CA    . LYS A 1  623  ? -27.631 -48.560 -26.941 1.00 83.24  ? 623  LYS A CA    1 
ATOM   4577  C  C     . LYS A 1  623  ? -28.548 -49.309 -27.905 1.00 82.19  ? 623  LYS A C     1 
ATOM   4578  O  O     . LYS A 1  623  ? -29.588 -49.820 -27.499 1.00 82.36  ? 623  LYS A O     1 
ATOM   4579  C  CB    . LYS A 1  623  ? -26.828 -49.558 -26.099 1.00 86.60  ? 623  LYS A CB    1 
ATOM   4580  C  CG    . LYS A 1  623  ? -25.813 -50.364 -26.903 1.00 88.16  ? 623  LYS A CG    1 
ATOM   4581  C  CD    . LYS A 1  623  ? -25.200 -51.513 -26.110 1.00 91.08  ? 623  LYS A CD    1 
ATOM   4582  C  CE    . LYS A 1  623  ? -24.635 -52.587 -27.035 1.00 91.77  ? 623  LYS A CE    1 
ATOM   4583  N  NZ    . LYS A 1  623  ? -23.798 -52.043 -28.149 1.00 90.70  ? 623  LYS A NZ    1 
ATOM   4584  N  N     . ILE A 1  624  ? -28.155 -49.360 -29.178 1.00 81.36  ? 624  ILE A N     1 
ATOM   4585  C  CA    . ILE A 1  624  ? -28.840 -50.166 -30.191 1.00 80.76  ? 624  ILE A CA    1 
ATOM   4586  C  C     . ILE A 1  624  ? -28.375 -51.614 -30.024 1.00 82.33  ? 624  ILE A C     1 
ATOM   4587  O  O     . ILE A 1  624  ? -27.318 -51.982 -30.545 1.00 82.78  ? 624  ILE A O     1 
ATOM   4588  C  CB    . ILE A 1  624  ? -28.522 -49.667 -31.631 1.00 78.78  ? 624  ILE A CB    1 
ATOM   4589  C  CG1   . ILE A 1  624  ? -29.018 -48.227 -31.833 1.00 77.04  ? 624  ILE A CG1   1 
ATOM   4590  C  CG2   . ILE A 1  624  ? -29.131 -50.594 -32.685 1.00 78.39  ? 624  ILE A CG2   1 
ATOM   4591  C  CD1   . ILE A 1  624  ? -28.484 -47.552 -33.081 1.00 75.60  ? 624  ILE A CD1   1 
ATOM   4592  N  N     . VAL A 1  625  ? -29.142 -52.429 -29.296 1.00 83.46  ? 625  VAL A N     1 
ATOM   4593  C  CA    . VAL A 1  625  ? -28.740 -53.829 -29.090 1.00 86.13  ? 625  VAL A CA    1 
ATOM   4594  C  C     . VAL A 1  625  ? -28.901 -54.649 -30.378 1.00 85.63  ? 625  VAL A C     1 
ATOM   4595  O  O     . VAL A 1  625  ? -28.063 -55.508 -30.651 1.00 87.85  ? 625  VAL A O     1 
ATOM   4596  C  CB    . VAL A 1  625  ? -29.397 -54.518 -27.851 1.00 88.11  ? 625  VAL A CB    1 
ATOM   4597  C  CG1   . VAL A 1  625  ? -29.134 -53.707 -26.591 1.00 89.08  ? 625  VAL A CG1   1 
ATOM   4598  C  CG2   . VAL A 1  625  ? -30.890 -54.760 -28.018 1.00 87.52  ? 625  VAL A CG2   1 
ATOM   4599  N  N     . SER A 1  626  ? -29.946 -54.376 -31.168 1.00 83.58  ? 626  SER A N     1 
ATOM   4600  C  CA    . SER A 1  626  ? -30.095 -55.003 -32.495 1.00 82.15  ? 626  SER A CA    1 
ATOM   4601  C  C     . SER A 1  626  ? -31.089 -54.296 -33.419 1.00 80.42  ? 626  SER A C     1 
ATOM   4602  O  O     . SER A 1  626  ? -31.996 -53.594 -32.964 1.00 80.26  ? 626  SER A O     1 
ATOM   4603  C  CB    . SER A 1  626  ? -30.527 -56.465 -32.357 1.00 82.88  ? 626  SER A CB    1 
ATOM   4604  O  OG    . SER A 1  626  ? -31.845 -56.553 -31.851 1.00 82.98  ? 626  SER A OG    1 
ATOM   4605  N  N     . ILE A 1  627  ? -30.901 -54.520 -34.721 1.00 78.85  ? 627  ILE A N     1 
ATOM   4606  C  CA    . ILE A 1  627  ? -31.843 -54.107 -35.763 1.00 76.72  ? 627  ILE A CA    1 
ATOM   4607  C  C     . ILE A 1  627  ? -32.256 -55.353 -36.546 1.00 76.67  ? 627  ILE A C     1 
ATOM   4608  O  O     . ILE A 1  627  ? -31.415 -56.187 -36.870 1.00 77.15  ? 627  ILE A O     1 
ATOM   4609  C  CB    . ILE A 1  627  ? -31.220 -53.089 -36.745 1.00 74.71  ? 627  ILE A CB    1 
ATOM   4610  C  CG1   . ILE A 1  627  ? -30.682 -51.862 -35.995 1.00 74.42  ? 627  ILE A CG1   1 
ATOM   4611  C  CG2   . ILE A 1  627  ? -32.242 -52.668 -37.803 1.00 73.26  ? 627  ILE A CG2   1 
ATOM   4612  C  CD1   . ILE A 1  627  ? -29.812 -50.953 -36.838 1.00 73.32  ? 627  ILE A CD1   1 
ATOM   4613  N  N     . ASP A 1  628  ? -33.548 -55.462 -36.847 1.00 76.88  ? 628  ASP A N     1 
ATOM   4614  C  CA    . ASP A 1  628  ? -34.095 -56.576 -37.615 1.00 77.47  ? 628  ASP A CA    1 
ATOM   4615  C  C     . ASP A 1  628  ? -34.813 -56.023 -38.846 1.00 75.63  ? 628  ASP A C     1 
ATOM   4616  O  O     . ASP A 1  628  ? -35.884 -55.420 -38.737 1.00 74.98  ? 628  ASP A O     1 
ATOM   4617  C  CB    . ASP A 1  628  ? -35.056 -57.394 -36.747 1.00 79.51  ? 628  ASP A CB    1 
ATOM   4618  C  CG    . ASP A 1  628  ? -35.685 -58.557 -37.497 1.00 80.63  ? 628  ASP A CG    1 
ATOM   4619  O  OD1   . ASP A 1  628  ? -34.950 -59.292 -38.186 1.00 82.08  ? 628  ASP A OD1   1 
ATOM   4620  O  OD2   . ASP A 1  628  ? -36.918 -58.741 -37.392 1.00 81.16  ? 628  ASP A OD2   1 
ATOM   4621  N  N     . LEU A 1  629  ? -34.211 -56.240 -40.011 1.00 74.10  ? 629  LEU A N     1 
ATOM   4622  C  CA    . LEU A 1  629  ? -34.731 -55.737 -41.276 1.00 72.92  ? 629  LEU A CA    1 
ATOM   4623  C  C     . LEU A 1  629  ? -35.446 -56.822 -42.093 1.00 73.83  ? 629  LEU A C     1 
ATOM   4624  O  O     . LEU A 1  629  ? -35.760 -56.608 -43.266 1.00 73.72  ? 629  LEU A O     1 
ATOM   4625  C  CB    . LEU A 1  629  ? -33.574 -55.159 -42.093 1.00 72.15  ? 629  LEU A CB    1 
ATOM   4626  C  CG    . LEU A 1  629  ? -32.709 -54.099 -41.405 1.00 71.69  ? 629  LEU A CG    1 
ATOM   4627  C  CD1   . LEU A 1  629  ? -31.483 -53.773 -42.246 1.00 71.03  ? 629  LEU A CD1   1 
ATOM   4628  C  CD2   . LEU A 1  629  ? -33.519 -52.842 -41.126 1.00 70.77  ? 629  LEU A CD2   1 
ATOM   4629  N  N     . SER A 1  630  ? -35.730 -57.963 -41.467 1.00 75.58  ? 630  SER A N     1 
ATOM   4630  C  CA    . SER A 1  630  ? -36.208 -59.160 -42.164 1.00 75.66  ? 630  SER A CA    1 
ATOM   4631  C  C     . SER A 1  630  ? -37.591 -58.981 -42.790 1.00 74.91  ? 630  SER A C     1 
ATOM   4632  O  O     . SER A 1  630  ? -37.787 -59.278 -43.969 1.00 74.57  ? 630  SER A O     1 
ATOM   4633  C  CB    . SER A 1  630  ? -36.241 -60.338 -41.188 1.00 76.91  ? 630  SER A CB    1 
ATOM   4634  O  OG    . SER A 1  630  ? -36.990 -60.004 -40.031 1.00 76.57  ? 630  SER A OG    1 
ATOM   4635  N  N     . GLU A 1  631  ? -38.542 -58.506 -41.992 1.00 75.28  ? 631  GLU A N     1 
ATOM   4636  C  CA    . GLU A 1  631  ? -39.899 -58.248 -42.476 1.00 75.25  ? 631  GLU A CA    1 
ATOM   4637  C  C     . GLU A 1  631  ? -39.877 -57.082 -43.464 1.00 73.86  ? 631  GLU A C     1 
ATOM   4638  O  O     . GLU A 1  631  ? -40.501 -57.149 -44.521 1.00 74.20  ? 631  GLU A O     1 
ATOM   4639  C  CB    . GLU A 1  631  ? -40.864 -57.965 -41.311 1.00 76.07  ? 631  GLU A CB    1 
ATOM   4640  C  CG    . GLU A 1  631  ? -42.339 -58.113 -41.680 1.00 77.32  ? 631  GLU A CG    1 
ATOM   4641  C  CD    . GLU A 1  631  ? -43.307 -57.863 -40.522 1.00 79.03  ? 631  GLU A CD    1 
ATOM   4642  O  OE1   . GLU A 1  631  ? -42.872 -57.703 -39.356 1.00 80.65  ? 631  GLU A OE1   1 
ATOM   4643  O  OE2   . GLU A 1  631  ? -44.528 -57.829 -40.785 1.00 78.83  ? 631  GLU A OE2   1 
ATOM   4644  N  N     . ALA A 1  632  ? -39.132 -56.032 -43.123 1.00 72.41  ? 632  ALA A N     1 
ATOM   4645  C  CA    . ALA A 1  632  ? -39.042 -54.842 -43.962 1.00 70.89  ? 632  ALA A CA    1 
ATOM   4646  C  C     . ALA A 1  632  ? -38.435 -55.117 -45.345 1.00 70.01  ? 632  ALA A C     1 
ATOM   4647  O  O     . ALA A 1  632  ? -38.942 -54.599 -46.343 1.00 70.01  ? 632  ALA A O     1 
ATOM   4648  C  CB    . ALA A 1  632  ? -38.260 -53.750 -43.246 1.00 70.45  ? 632  ALA A CB    1 
ATOM   4649  N  N     . LEU A 1  633  ? -37.372 -55.921 -45.406 1.00 69.25  ? 633  LEU A N     1 
ATOM   4650  C  CA    . LEU A 1  633  ? -36.703 -56.243 -46.692 1.00 68.48  ? 633  LEU A CA    1 
ATOM   4651  C  C     . LEU A 1  633  ? -37.570 -57.067 -47.648 1.00 68.77  ? 633  LEU A C     1 
ATOM   4652  O  O     . LEU A 1  633  ? -37.472 -56.913 -48.863 1.00 68.98  ? 633  LEU A O     1 
ATOM   4653  C  CB    . LEU A 1  633  ? -35.364 -56.964 -46.468 1.00 67.91  ? 633  LEU A CB    1 
ATOM   4654  C  CG    . LEU A 1  633  ? -34.176 -56.087 -46.055 1.00 66.84  ? 633  LEU A CG    1 
ATOM   4655  C  CD1   . LEU A 1  633  ? -33.057 -56.946 -45.486 1.00 67.59  ? 633  LEU A CD1   1 
ATOM   4656  C  CD2   . LEU A 1  633  ? -33.669 -55.245 -47.217 1.00 65.46  ? 633  LEU A CD2   1 
ATOM   4657  N  N     . SER A 1  634  ? -38.415 -57.928 -47.093 1.00 70.24  ? 634  SER A N     1 
ATOM   4658  C  CA    . SER A 1  634  ? -39.291 -58.793 -47.883 1.00 71.24  ? 634  SER A CA    1 
ATOM   4659  C  C     . SER A 1  634  ? -40.523 -58.085 -48.463 1.00 70.56  ? 634  SER A C     1 
ATOM   4660  O  O     . SER A 1  634  ? -41.190 -58.640 -49.338 1.00 70.98  ? 634  SER A O     1 
ATOM   4661  C  CB    . SER A 1  634  ? -39.752 -59.972 -47.019 1.00 72.39  ? 634  SER A CB    1 
ATOM   4662  O  OG    . SER A 1  634  ? -40.405 -59.511 -45.845 1.00 72.39  ? 634  SER A OG    1 
ATOM   4663  N  N     . MET A 1  635  ? -40.826 -56.878 -47.983 1.00 69.99  ? 635  MET A N     1 
ATOM   4664  C  CA    . MET A 1  635  ? -42.098 -56.217 -48.297 1.00 69.86  ? 635  MET A CA    1 
ATOM   4665  C  C     . MET A 1  635  ? -42.146 -55.613 -49.703 1.00 67.27  ? 635  MET A C     1 
ATOM   4666  O  O     . MET A 1  635  ? -41.098 -55.360 -50.297 1.00 66.23  ? 635  MET A O     1 
ATOM   4667  C  CB    . MET A 1  635  ? -42.429 -55.155 -47.244 1.00 70.90  ? 635  MET A CB    1 
ATOM   4668  C  CG    . MET A 1  635  ? -43.171 -55.742 -46.060 1.00 73.39  ? 635  MET A CG    1 
ATOM   4669  S  SD    . MET A 1  635  ? -43.437 -54.545 -44.755 1.00 75.75  ? 635  MET A SD    1 
ATOM   4670  C  CE    . MET A 1  635  ? -44.665 -53.484 -45.521 1.00 73.86  ? 635  MET A CE    1 
ATOM   4671  N  N     . PRO A 1  636  ? -43.371 -55.382 -50.235 1.00 65.20  ? 636  PRO A N     1 
ATOM   4672  C  CA    . PRO A 1  636  ? -43.534 -54.892 -51.614 1.00 63.29  ? 636  PRO A CA    1 
ATOM   4673  C  C     . PRO A 1  636  ? -42.731 -53.639 -51.935 1.00 61.03  ? 636  PRO A C     1 
ATOM   4674  O  O     . PRO A 1  636  ? -42.719 -52.699 -51.143 1.00 60.95  ? 636  PRO A O     1 
ATOM   4675  C  CB    . PRO A 1  636  ? -45.034 -54.589 -51.705 1.00 63.40  ? 636  PRO A CB    1 
ATOM   4676  C  CG    . PRO A 1  636  ? -45.665 -55.492 -50.710 1.00 64.45  ? 636  PRO A CG    1 
ATOM   4677  C  CD    . PRO A 1  636  ? -44.679 -55.624 -49.589 1.00 64.82  ? 636  PRO A CD    1 
ATOM   4678  N  N     . GLY A 1  637  ? -42.043 -53.654 -53.073 1.00 60.28  ? 637  GLY A N     1 
ATOM   4679  C  CA    . GLY A 1  637  ? -41.342 -52.477 -53.591 1.00 58.56  ? 637  GLY A CA    1 
ATOM   4680  C  C     . GLY A 1  637  ? -39.975 -52.172 -53.008 1.00 58.03  ? 637  GLY A C     1 
ATOM   4681  O  O     . GLY A 1  637  ? -39.253 -51.330 -53.545 1.00 57.19  ? 637  GLY A O     1 
ATOM   4682  N  N     . VAL A 1  638  ? -39.595 -52.860 -51.933 1.00 58.74  ? 638  VAL A N     1 
ATOM   4683  C  CA    . VAL A 1  638  ? -38.395 -52.507 -51.176 1.00 58.70  ? 638  VAL A CA    1 
ATOM   4684  C  C     . VAL A 1  638  ? -37.167 -52.948 -51.957 1.00 58.16  ? 638  VAL A C     1 
ATOM   4685  O  O     . VAL A 1  638  ? -37.031 -54.116 -52.292 1.00 59.56  ? 638  VAL A O     1 
ATOM   4686  C  CB    . VAL A 1  638  ? -38.405 -53.135 -49.761 1.00 59.35  ? 638  VAL A CB    1 
ATOM   4687  C  CG1   . VAL A 1  638  ? -37.108 -52.840 -49.017 1.00 59.28  ? 638  VAL A CG1   1 
ATOM   4688  C  CG2   . VAL A 1  638  ? -39.600 -52.610 -48.979 1.00 59.54  ? 638  VAL A CG2   1 
ATOM   4689  N  N     . VAL A 1  639  ? -36.300 -51.989 -52.253 1.00 57.22  ? 639  VAL A N     1 
ATOM   4690  C  CA    . VAL A 1  639  ? -35.072 -52.230 -53.003 1.00 57.33  ? 639  VAL A CA    1 
ATOM   4691  C  C     . VAL A 1  639  ? -33.889 -52.463 -52.061 1.00 58.62  ? 639  VAL A C     1 
ATOM   4692  O  O     . VAL A 1  639  ? -33.037 -53.317 -52.325 1.00 59.18  ? 639  VAL A O     1 
ATOM   4693  C  CB    . VAL A 1  639  ? -34.781 -51.037 -53.946 1.00 56.08  ? 639  VAL A CB    1 
ATOM   4694  C  CG1   . VAL A 1  639  ? -33.450 -51.207 -54.678 1.00 55.94  ? 639  VAL A CG1   1 
ATOM   4695  C  CG2   . VAL A 1  639  ? -35.936 -50.864 -54.931 1.00 55.61  ? 639  VAL A CG2   1 
ATOM   4696  N  N     . ASP A 1  640  ? -33.826 -51.690 -50.977 1.00 58.92  ? 640  ASP A N     1 
ATOM   4697  C  CA    . ASP A 1  640  ? -32.683 -51.720 -50.069 1.00 59.54  ? 640  ASP A CA    1 
ATOM   4698  C  C     . ASP A 1  640  ? -33.027 -51.026 -48.759 1.00 59.85  ? 640  ASP A C     1 
ATOM   4699  O  O     . ASP A 1  640  ? -33.869 -50.122 -48.727 1.00 59.01  ? 640  ASP A O     1 
ATOM   4700  C  CB    . ASP A 1  640  ? -31.480 -51.015 -50.722 1.00 58.81  ? 640  ASP A CB    1 
ATOM   4701  C  CG    . ASP A 1  640  ? -30.144 -51.364 -50.071 1.00 59.46  ? 640  ASP A CG    1 
ATOM   4702  O  OD1   . ASP A 1  640  ? -30.106 -52.049 -49.036 1.00 61.00  ? 640  ASP A OD1   1 
ATOM   4703  O  OD2   . ASP A 1  640  ? -29.102 -50.944 -50.611 1.00 59.76  ? 640  ASP A OD2   1 
ATOM   4704  N  N     . ILE A 1  641  ? -32.382 -51.473 -47.683 1.00 61.09  ? 641  ILE A N     1 
ATOM   4705  C  CA    . ILE A 1  641  ? -32.372 -50.754 -46.415 1.00 62.12  ? 641  ILE A CA    1 
ATOM   4706  C  C     . ILE A 1  641  ? -30.923 -50.665 -45.928 1.00 64.03  ? 641  ILE A C     1 
ATOM   4707  O  O     . ILE A 1  641  ? -30.245 -51.687 -45.809 1.00 65.41  ? 641  ILE A O     1 
ATOM   4708  C  CB    . ILE A 1  641  ? -33.279 -51.419 -45.355 1.00 62.51  ? 641  ILE A CB    1 
ATOM   4709  C  CG1   . ILE A 1  641  ? -34.729 -51.469 -45.863 1.00 62.05  ? 641  ILE A CG1   1 
ATOM   4710  C  CG2   . ILE A 1  641  ? -33.188 -50.659 -44.029 1.00 62.70  ? 641  ILE A CG2   1 
ATOM   4711  C  CD1   . ILE A 1  641  ? -35.709 -52.166 -44.945 1.00 62.79  ? 641  ILE A CD1   1 
ATOM   4712  N  N     . MET A 1  642  ? -30.462 -49.444 -45.652 1.00 64.99  ? 642  MET A N     1 
ATOM   4713  C  CA    . MET A 1  642  ? -29.083 -49.193 -45.235 1.00 66.22  ? 642  MET A CA    1 
ATOM   4714  C  C     . MET A 1  642  ? -28.980 -48.867 -43.749 1.00 67.29  ? 642  MET A C     1 
ATOM   4715  O  O     . MET A 1  642  ? -29.774 -48.088 -43.227 1.00 67.42  ? 642  MET A O     1 
ATOM   4716  C  CB    . MET A 1  642  ? -28.495 -48.045 -46.048 1.00 66.68  ? 642  MET A CB    1 
ATOM   4717  C  CG    . MET A 1  642  ? -28.212 -48.414 -47.491 1.00 67.60  ? 642  MET A CG    1 
ATOM   4718  S  SD    . MET A 1  642  ? -28.169 -47.002 -48.615 1.00 68.59  ? 642  MET A SD    1 
ATOM   4719  C  CE    . MET A 1  642  ? -28.839 -47.794 -50.076 1.00 68.82  ? 642  MET A CE    1 
ATOM   4720  N  N     . THR A 1  643  ? -28.008 -49.481 -43.080 1.00 68.92  ? 643  THR A N     1 
ATOM   4721  C  CA    . THR A 1  643  ? -27.583 -49.074 -41.738 1.00 70.44  ? 643  THR A CA    1 
ATOM   4722  C  C     . THR A 1  643  ? -26.195 -48.449 -41.854 1.00 71.01  ? 643  THR A C     1 
ATOM   4723  O  O     . THR A 1  643  ? -25.630 -48.389 -42.951 1.00 71.11  ? 643  THR A O     1 
ATOM   4724  C  CB    . THR A 1  643  ? -27.534 -50.273 -40.775 1.00 72.25  ? 643  THR A CB    1 
ATOM   4725  O  OG1   . THR A 1  643  ? -26.599 -51.247 -41.261 1.00 73.69  ? 643  THR A OG1   1 
ATOM   4726  C  CG2   . THR A 1  643  ? -28.914 -50.907 -40.645 1.00 72.38  ? 643  THR A CG2   1 
ATOM   4727  N  N     . ALA A 1  644  ? -25.646 -47.988 -40.731 1.00 72.15  ? 644  ALA A N     1 
ATOM   4728  C  CA    . ALA A 1  644  ? -24.275 -47.448 -40.686 1.00 73.03  ? 644  ALA A CA    1 
ATOM   4729  C  C     . ALA A 1  644  ? -23.222 -48.435 -41.220 1.00 73.96  ? 644  ALA A C     1 
ATOM   4730  O  O     . ALA A 1  644  ? -22.236 -48.024 -41.837 1.00 73.34  ? 644  ALA A O     1 
ATOM   4731  C  CB    . ALA A 1  644  ? -23.921 -47.019 -39.269 1.00 73.83  ? 644  ALA A CB    1 
ATOM   4732  N  N     . GLU A 1  645  ? -23.449 -49.726 -40.975 1.00 75.18  ? 645  GLU A N     1 
ATOM   4733  C  CA    . GLU A 1  645  ? -22.625 -50.805 -41.525 1.00 76.60  ? 645  GLU A CA    1 
ATOM   4734  C  C     . GLU A 1  645  ? -22.474 -50.720 -43.048 1.00 74.73  ? 645  GLU A C     1 
ATOM   4735  O  O     . GLU A 1  645  ? -21.376 -50.897 -43.582 1.00 73.10  ? 645  GLU A O     1 
ATOM   4736  C  CB    . GLU A 1  645  ? -23.228 -52.168 -41.141 1.00 78.33  ? 645  GLU A CB    1 
ATOM   4737  C  CG    . GLU A 1  645  ? -22.454 -53.382 -41.645 1.00 80.29  ? 645  GLU A CG    1 
ATOM   4738  C  CD    . GLU A 1  645  ? -23.019 -54.706 -41.155 1.00 82.59  ? 645  GLU A CD    1 
ATOM   4739  O  OE1   . GLU A 1  645  ? -24.147 -54.734 -40.609 1.00 83.33  ? 645  GLU A OE1   1 
ATOM   4740  O  OE2   . GLU A 1  645  ? -22.324 -55.732 -41.323 1.00 83.97  ? 645  GLU A OE2   1 
ATOM   4741  N  N     . HIS A 1  646  ? -23.578 -50.435 -43.731 1.00 73.94  ? 646  HIS A N     1 
ATOM   4742  C  CA    . HIS A 1  646  ? -23.615 -50.478 -45.193 1.00 73.37  ? 646  HIS A CA    1 
ATOM   4743  C  C     . HIS A 1  646  ? -22.995 -49.239 -45.840 1.00 73.07  ? 646  HIS A C     1 
ATOM   4744  O  O     . HIS A 1  646  ? -22.751 -49.231 -47.045 1.00 71.71  ? 646  HIS A O     1 
ATOM   4745  C  CB    . HIS A 1  646  ? -25.048 -50.682 -45.693 1.00 72.78  ? 646  HIS A CB    1 
ATOM   4746  C  CG    . HIS A 1  646  ? -25.724 -51.890 -45.120 1.00 73.93  ? 646  HIS A CG    1 
ATOM   4747  N  ND1   . HIS A 1  646  ? -27.051 -52.175 -45.350 1.00 74.65  ? 646  HIS A ND1   1 
ATOM   4748  C  CD2   . HIS A 1  646  ? -25.266 -52.873 -44.311 1.00 75.59  ? 646  HIS A CD2   1 
ATOM   4749  C  CE1   . HIS A 1  646  ? -27.379 -53.286 -44.718 1.00 75.40  ? 646  HIS A CE1   1 
ATOM   4750  N  NE2   . HIS A 1  646  ? -26.313 -53.729 -44.079 1.00 76.42  ? 646  HIS A NE2   1 
ATOM   4751  N  N     . LEU A 1  647  ? -22.755 -48.199 -45.041 1.00 73.93  ? 647  LEU A N     1 
ATOM   4752  C  CA    . LEU A 1  647  ? -21.996 -47.029 -45.483 1.00 74.45  ? 647  LEU A CA    1 
ATOM   4753  C  C     . LEU A 1  647  ? -20.502 -47.126 -45.146 1.00 75.68  ? 647  LEU A C     1 
ATOM   4754  O  O     . LEU A 1  647  ? -19.699 -46.398 -45.727 1.00 76.01  ? 647  LEU A O     1 
ATOM   4755  C  CB    . LEU A 1  647  ? -22.602 -45.745 -44.907 1.00 74.51  ? 647  LEU A CB    1 
ATOM   4756  C  CG    . LEU A 1  647  ? -23.786 -45.182 -45.705 1.00 73.95  ? 647  LEU A CG    1 
ATOM   4757  C  CD1   . LEU A 1  647  ? -24.891 -46.210 -45.899 1.00 73.98  ? 647  LEU A CD1   1 
ATOM   4758  C  CD2   . LEU A 1  647  ? -24.327 -43.931 -45.025 1.00 74.15  ? 647  LEU A CD2   1 
ATOM   4759  N  N     . SER A 1  648  ? -20.138 -48.012 -44.214 1.00 77.19  ? 648  SER A N     1 
ATOM   4760  C  CA    . SER A 1  648  ? -18.734 -48.313 -43.873 1.00 78.18  ? 648  SER A CA    1 
ATOM   4761  C  C     . SER A 1  648  ? -17.920 -47.039 -43.538 1.00 79.16  ? 648  SER A C     1 
ATOM   4762  O  O     . SER A 1  648  ? -18.329 -46.281 -42.655 1.00 79.15  ? 648  SER A O     1 
ATOM   4763  C  CB    . SER A 1  648  ? -18.079 -49.196 -44.961 1.00 77.46  ? 648  SER A CB    1 
ATOM   4764  O  OG    . SER A 1  648  ? -17.819 -48.484 -46.160 1.00 75.33  ? 648  SER A OG    1 
ATOM   4765  N  N     . ASP A 1  649  ? -16.819 -46.785 -44.252 1.00 80.28  ? 649  ASP A N     1 
ATOM   4766  C  CA    . ASP A 1  649  ? -15.925 -45.647 -43.962 1.00 80.42  ? 649  ASP A CA    1 
ATOM   4767  C  C     . ASP A 1  649  ? -16.433 -44.271 -44.420 1.00 78.60  ? 649  ASP A C     1 
ATOM   4768  O  O     . ASP A 1  649  ? -15.818 -43.257 -44.087 1.00 78.44  ? 649  ASP A O     1 
ATOM   4769  C  CB    . ASP A 1  649  ? -14.540 -45.888 -44.579 1.00 81.65  ? 649  ASP A CB    1 
ATOM   4770  C  CG    . ASP A 1  649  ? -14.537 -45.742 -46.094 1.00 81.72  ? 649  ASP A CG    1 
ATOM   4771  O  OD1   . ASP A 1  649  ? -15.542 -46.124 -46.742 1.00 81.47  ? 649  ASP A OD1   1 
ATOM   4772  O  OD2   . ASP A 1  649  ? -13.527 -45.247 -46.633 1.00 83.15  ? 649  ASP A OD2   1 
ATOM   4773  N  N     . VAL A 1  650  ? -17.523 -44.236 -45.193 1.00 76.85  ? 650  VAL A N     1 
ATOM   4774  C  CA    . VAL A 1  650  ? -18.120 -42.972 -45.649 1.00 75.63  ? 650  VAL A CA    1 
ATOM   4775  C  C     . VAL A 1  650  ? -19.437 -42.680 -44.916 1.00 76.53  ? 650  VAL A C     1 
ATOM   4776  O  O     . VAL A 1  650  ? -20.420 -42.221 -45.517 1.00 75.16  ? 650  VAL A O     1 
ATOM   4777  C  CB    . VAL A 1  650  ? -18.288 -42.922 -47.191 1.00 74.27  ? 650  VAL A CB    1 
ATOM   4778  C  CG1   . VAL A 1  650  ? -16.926 -42.846 -47.861 1.00 75.10  ? 650  VAL A CG1   1 
ATOM   4779  C  CG2   . VAL A 1  650  ? -19.089 -44.104 -47.726 1.00 73.88  ? 650  VAL A CG2   1 
ATOM   4780  N  N     . ASN A 1  651  ? -19.425 -42.925 -43.604 1.00 78.17  ? 651  ASN A N     1 
ATOM   4781  C  CA    . ASN A 1  651  ? -20.538 -42.617 -42.714 1.00 78.88  ? 651  ASN A CA    1 
ATOM   4782  C  C     . ASN A 1  651  ? -20.150 -41.475 -41.765 1.00 81.64  ? 651  ASN A C     1 
ATOM   4783  O  O     . ASN A 1  651  ? -20.481 -41.508 -40.583 1.00 82.95  ? 651  ASN A O     1 
ATOM   4784  C  CB    . ASN A 1  651  ? -20.921 -43.878 -41.929 1.00 78.61  ? 651  ASN A CB    1 
ATOM   4785  C  CG    . ASN A 1  651  ? -22.217 -43.721 -41.147 1.00 77.29  ? 651  ASN A CG    1 
ATOM   4786  O  OD1   . ASN A 1  651  ? -23.197 -43.174 -41.649 1.00 75.00  ? 651  ASN A OD1   1 
ATOM   4787  N  ND2   . ASN A 1  651  ? -22.223 -44.197 -39.908 1.00 78.50  ? 651  ASN A ND2   1 
ATOM   4788  N  N     . SER A 1  652  ? -19.447 -40.470 -42.291 1.00 83.74  ? 652  SER A N     1 
ATOM   4789  C  CA    . SER A 1  652  ? -18.995 -39.320 -41.497 1.00 85.74  ? 652  SER A CA    1 
ATOM   4790  C  C     . SER A 1  652  ? -18.533 -38.181 -42.405 1.00 85.59  ? 652  SER A C     1 
ATOM   4791  O  O     . SER A 1  652  ? -18.343 -38.381 -43.604 1.00 84.92  ? 652  SER A O     1 
ATOM   4792  C  CB    . SER A 1  652  ? -17.860 -39.725 -40.551 1.00 86.81  ? 652  SER A CB    1 
ATOM   4793  O  OG    . SER A 1  652  ? -16.798 -40.323 -41.269 1.00 87.76  ? 652  SER A OG    1 
ATOM   4794  N  N     . PHE A 1  653  ? -18.369 -36.994 -41.826 1.00 86.71  ? 653  PHE A N     1 
ATOM   4795  C  CA    . PHE A 1  653  ? -17.867 -35.829 -42.561 1.00 87.36  ? 653  PHE A CA    1 
ATOM   4796  C  C     . PHE A 1  653  ? -17.300 -34.766 -41.609 1.00 91.86  ? 653  PHE A C     1 
ATOM   4797  O  O     . PHE A 1  653  ? -17.903 -34.489 -40.567 1.00 94.17  ? 653  PHE A O     1 
ATOM   4798  C  CB    . PHE A 1  653  ? -18.980 -35.221 -43.417 1.00 84.58  ? 653  PHE A CB    1 
ATOM   4799  C  CG    . PHE A 1  653  ? -18.506 -34.128 -44.333 1.00 83.58  ? 653  PHE A CG    1 
ATOM   4800  C  CD1   . PHE A 1  653  ? -17.713 -34.428 -45.438 1.00 82.96  ? 653  PHE A CD1   1 
ATOM   4801  C  CD2   . PHE A 1  653  ? -18.850 -32.797 -44.099 1.00 83.21  ? 653  PHE A CD2   1 
ATOM   4802  C  CE1   . PHE A 1  653  ? -17.266 -33.424 -46.290 1.00 82.50  ? 653  PHE A CE1   1 
ATOM   4803  C  CE2   . PHE A 1  653  ? -18.407 -31.790 -44.951 1.00 83.05  ? 653  PHE A CE2   1 
ATOM   4804  C  CZ    . PHE A 1  653  ? -17.615 -32.103 -46.047 1.00 82.40  ? 653  PHE A CZ    1 
ATOM   4805  N  N     . CYS A 1  654  ? -16.144 -34.200 -41.977 1.00 93.61  ? 654  CYS A N     1 
ATOM   4806  C  CA    . CYS A 1  654  ? -15.485 -33.087 -41.261 1.00 95.27  ? 654  CYS A CA    1 
ATOM   4807  C  C     . CYS A 1  654  ? -15.298 -33.325 -39.757 1.00 97.39  ? 654  CYS A C     1 
ATOM   4808  O  O     . CYS A 1  654  ? -14.333 -32.850 -39.156 1.00 98.65  ? 654  CYS A O     1 
ATOM   4809  C  CB    . CYS A 1  654  ? -16.220 -31.753 -41.518 1.00 94.77  ? 654  CYS A CB    1 
ATOM   4810  S  SG    . CYS A 1  654  ? -17.582 -31.325 -40.394 1.00 95.98  ? 654  CYS A SG    1 
ATOM   4811  N  N     . LYS A 1  661  ? -21.167 -38.392 -37.774 1.00 81.06  ? 661  LYS A N     1 
ATOM   4812  C  CA    . LYS A 1  661  ? -21.662 -39.613 -38.405 1.00 81.47  ? 661  LYS A CA    1 
ATOM   4813  C  C     . LYS A 1  661  ? -23.107 -39.468 -38.894 1.00 79.90  ? 661  LYS A C     1 
ATOM   4814  O  O     . LYS A 1  661  ? -23.951 -38.921 -38.186 1.00 81.02  ? 661  LYS A O     1 
ATOM   4815  C  CB    . LYS A 1  661  ? -21.530 -40.810 -37.451 1.00 83.82  ? 661  LYS A CB    1 
ATOM   4816  C  CG    . LYS A 1  661  ? -22.260 -40.665 -36.116 1.00 85.94  ? 661  LYS A CG    1 
ATOM   4817  C  CD    . LYS A 1  661  ? -21.540 -41.390 -34.977 1.00 88.88  ? 661  LYS A CD    1 
ATOM   4818  C  CE    . LYS A 1  661  ? -22.106 -41.016 -33.609 1.00 90.53  ? 661  LYS A CE    1 
ATOM   4819  N  NZ    . LYS A 1  661  ? -21.141 -41.298 -32.505 1.00 92.19  ? 661  LYS A NZ    1 
ATOM   4820  N  N     . PHE A 1  662  ? -23.387 -39.963 -40.101 1.00 77.40  ? 662  PHE A N     1 
ATOM   4821  C  CA    . PHE A 1  662  ? -24.706 -39.784 -40.719 1.00 74.31  ? 662  PHE A CA    1 
ATOM   4822  C  C     . PHE A 1  662  ? -25.725 -40.680 -40.035 1.00 73.46  ? 662  PHE A C     1 
ATOM   4823  O  O     . PHE A 1  662  ? -26.731 -40.195 -39.514 1.00 73.70  ? 662  PHE A O     1 
ATOM   4824  C  CB    . PHE A 1  662  ? -24.699 -40.086 -42.233 1.00 73.30  ? 662  PHE A CB    1 
ATOM   4825  C  CG    . PHE A 1  662  ? -23.647 -39.340 -43.025 1.00 73.03  ? 662  PHE A CG    1 
ATOM   4826  C  CD1   . PHE A 1  662  ? -23.180 -38.080 -42.635 1.00 72.84  ? 662  PHE A CD1   1 
ATOM   4827  C  CD2   . PHE A 1  662  ? -23.146 -39.896 -44.203 1.00 72.46  ? 662  PHE A CD2   1 
ATOM   4828  C  CE1   . PHE A 1  662  ? -22.221 -37.416 -43.385 1.00 72.30  ? 662  PHE A CE1   1 
ATOM   4829  C  CE2   . PHE A 1  662  ? -22.192 -39.229 -44.958 1.00 72.46  ? 662  PHE A CE2   1 
ATOM   4830  C  CZ    . PHE A 1  662  ? -21.731 -37.985 -44.551 1.00 72.36  ? 662  PHE A CZ    1 
ATOM   4831  N  N     . LEU A 1  663  ? -25.449 -41.981 -40.043 1.00 72.39  ? 663  LEU A N     1 
ATOM   4832  C  CA    . LEU A 1  663  ? -26.330 -42.985 -39.454 1.00 72.61  ? 663  LEU A CA    1 
ATOM   4833  C  C     . LEU A 1  663  ? -25.758 -43.481 -38.130 1.00 73.30  ? 663  LEU A C     1 
ATOM   4834  O  O     . LEU A 1  663  ? -24.538 -43.596 -37.979 1.00 73.88  ? 663  LEU A O     1 
ATOM   4835  C  CB    . LEU A 1  663  ? -26.515 -44.160 -40.418 1.00 72.46  ? 663  LEU A CB    1 
ATOM   4836  C  CG    . LEU A 1  663  ? -27.147 -43.856 -41.783 1.00 71.36  ? 663  LEU A CG    1 
ATOM   4837  C  CD1   . LEU A 1  663  ? -27.186 -45.121 -42.624 1.00 71.63  ? 663  LEU A CD1   1 
ATOM   4838  C  CD2   . LEU A 1  663  ? -28.548 -43.277 -41.651 1.00 70.83  ? 663  LEU A CD2   1 
ATOM   4839  N  N     . ALA A 1  664  ? -26.645 -43.775 -37.181 1.00 72.89  ? 664  ALA A N     1 
ATOM   4840  C  CA    . ALA A 1  664  ? -26.241 -44.246 -35.855 1.00 73.68  ? 664  ALA A CA    1 
ATOM   4841  C  C     . ALA A 1  664  ? -25.600 -45.622 -35.956 1.00 74.18  ? 664  ALA A C     1 
ATOM   4842  O  O     . ALA A 1  664  ? -26.015 -46.455 -36.769 1.00 74.06  ? 664  ALA A O     1 
ATOM   4843  C  CB    . ALA A 1  664  ? -27.429 -44.285 -34.902 1.00 73.70  ? 664  ALA A CB    1 
ATOM   4844  N  N     . THR A 1  665  ? -24.586 -45.844 -35.126 1.00 74.83  ? 665  THR A N     1 
ATOM   4845  C  CA    . THR A 1  665  ? -23.787 -47.058 -35.167 1.00 75.14  ? 665  THR A CA    1 
ATOM   4846  C  C     . THR A 1  665  ? -24.267 -48.033 -34.085 1.00 76.16  ? 665  THR A C     1 
ATOM   4847  O  O     . THR A 1  665  ? -25.162 -48.832 -34.347 1.00 75.66  ? 665  THR A O     1 
ATOM   4848  C  CB    . THR A 1  665  ? -22.291 -46.721 -35.031 1.00 75.54  ? 665  THR A CB    1 
ATOM   4849  O  OG1   . THR A 1  665  ? -22.049 -46.080 -33.774 1.00 76.77  ? 665  THR A OG1   1 
ATOM   4850  C  CG2   . THR A 1  665  ? -21.843 -45.800 -36.156 1.00 74.08  ? 665  THR A CG2   1 
ATOM   4851  N  N     . ASP A 1  666  ? -23.694 -47.951 -32.880 1.00 77.54  ? 666  ASP A N     1 
ATOM   4852  C  CA    . ASP A 1  666  ? -24.061 -48.833 -31.758 1.00 79.29  ? 666  ASP A CA    1 
ATOM   4853  C  C     . ASP A 1  666  ? -24.915 -48.147 -30.679 1.00 79.68  ? 666  ASP A C     1 
ATOM   4854  O  O     . ASP A 1  666  ? -25.535 -48.834 -29.864 1.00 80.62  ? 666  ASP A O     1 
ATOM   4855  C  CB    . ASP A 1  666  ? -22.808 -49.469 -31.128 1.00 81.09  ? 666  ASP A CB    1 
ATOM   4856  C  CG    . ASP A 1  666  ? -21.879 -48.448 -30.468 1.00 82.56  ? 666  ASP A CG    1 
ATOM   4857  O  OD1   . ASP A 1  666  ? -21.902 -47.254 -30.849 1.00 81.27  ? 666  ASP A OD1   1 
ATOM   4858  O  OD2   . ASP A 1  666  ? -21.113 -48.849 -29.568 1.00 85.24  ? 666  ASP A OD2   1 
ATOM   4859  N  N     . LYS A 1  667  ? -24.946 -46.811 -30.670 1.00 78.91  ? 667  LYS A N     1 
ATOM   4860  C  CA    . LYS A 1  667  ? -25.741 -46.035 -29.713 1.00 78.89  ? 667  LYS A CA    1 
ATOM   4861  C  C     . LYS A 1  667  ? -26.482 -44.885 -30.399 1.00 76.10  ? 667  LYS A C     1 
ATOM   4862  O  O     . LYS A 1  667  ? -26.071 -44.420 -31.462 1.00 75.18  ? 667  LYS A O     1 
ATOM   4863  C  CB    . LYS A 1  667  ? -24.833 -45.478 -28.612 1.00 81.34  ? 667  LYS A CB    1 
ATOM   4864  C  CG    . LYS A 1  667  ? -24.239 -46.547 -27.705 1.00 84.21  ? 667  LYS A CG    1 
ATOM   4865  C  CD    . LYS A 1  667  ? -23.331 -45.957 -26.637 1.00 86.48  ? 667  LYS A CD    1 
ATOM   4866  C  CE    . LYS A 1  667  ? -21.965 -45.589 -27.195 1.00 87.33  ? 667  LYS A CE    1 
ATOM   4867  N  NZ    . LYS A 1  667  ? -21.016 -45.195 -26.118 1.00 89.50  ? 667  LYS A NZ    1 
ATOM   4868  N  N     . VAL A 1  668  ? -27.576 -44.446 -29.776 1.00 74.70  ? 668  VAL A N     1 
ATOM   4869  C  CA    . VAL A 1  668  ? -28.321 -43.254 -30.206 1.00 72.89  ? 668  VAL A CA    1 
ATOM   4870  C  C     . VAL A 1  668  ? -28.164 -42.192 -29.121 1.00 73.86  ? 668  VAL A C     1 
ATOM   4871  O  O     . VAL A 1  668  ? -28.164 -42.523 -27.935 1.00 75.50  ? 668  VAL A O     1 
ATOM   4872  C  CB    . VAL A 1  668  ? -29.824 -43.532 -30.490 1.00 71.76  ? 668  VAL A CB    1 
ATOM   4873  C  CG1   . VAL A 1  668  ? -29.989 -44.374 -31.742 1.00 70.95  ? 668  VAL A CG1   1 
ATOM   4874  C  CG2   . VAL A 1  668  ? -30.531 -44.202 -29.315 1.00 72.90  ? 668  VAL A CG2   1 
ATOM   4875  N  N     . PHE A 1  669  ? -28.005 -40.932 -29.527 1.00 73.42  ? 669  PHE A N     1 
ATOM   4876  C  CA    . PHE A 1  669  ? -27.777 -39.815 -28.588 1.00 73.95  ? 669  PHE A CA    1 
ATOM   4877  C  C     . PHE A 1  669  ? -28.899 -38.773 -28.536 1.00 72.31  ? 669  PHE A C     1 
ATOM   4878  O  O     . PHE A 1  669  ? -28.791 -37.801 -27.795 1.00 72.58  ? 669  PHE A O     1 
ATOM   4879  C  CB    . PHE A 1  669  ? -26.436 -39.145 -28.899 1.00 74.90  ? 669  PHE A CB    1 
ATOM   4880  C  CG    . PHE A 1  669  ? -25.254 -40.053 -28.694 1.00 76.96  ? 669  PHE A CG    1 
ATOM   4881  C  CD1   . PHE A 1  669  ? -24.785 -40.854 -29.733 1.00 76.67  ? 669  PHE A CD1   1 
ATOM   4882  C  CD2   . PHE A 1  669  ? -24.620 -40.125 -27.455 1.00 78.93  ? 669  PHE A CD2   1 
ATOM   4883  C  CE1   . PHE A 1  669  ? -23.702 -41.699 -29.545 1.00 78.28  ? 669  PHE A CE1   1 
ATOM   4884  C  CE2   . PHE A 1  669  ? -23.532 -40.963 -27.262 1.00 80.42  ? 669  PHE A CE2   1 
ATOM   4885  C  CZ    . PHE A 1  669  ? -23.073 -41.755 -28.309 1.00 80.09  ? 669  PHE A CZ    1 
ATOM   4886  N  N     . CYS A 1  670  ? -29.970 -38.986 -29.301 1.00 70.97  ? 670  CYS A N     1 
ATOM   4887  C  CA    . CYS A 1  670  ? -31.210 -38.209 -29.183 1.00 70.12  ? 670  CYS A CA    1 
ATOM   4888  C  C     . CYS A 1  670  ? -32.330 -38.881 -29.970 1.00 69.86  ? 670  CYS A C     1 
ATOM   4889  O  O     . CYS A 1  670  ? -32.076 -39.746 -30.809 1.00 69.52  ? 670  CYS A O     1 
ATOM   4890  C  CB    . CYS A 1  670  ? -31.037 -36.781 -29.700 1.00 68.72  ? 670  CYS A CB    1 
ATOM   4891  S  SG    . CYS A 1  670  ? -30.691 -36.671 -31.465 1.00 66.32  ? 670  CYS A SG    1 
ATOM   4892  N  N     . VAL A 1  671  ? -33.565 -38.471 -29.695 1.00 70.60  ? 671  VAL A N     1 
ATOM   4893  C  CA    . VAL A 1  671  ? -34.719 -38.881 -30.499 1.00 70.31  ? 671  VAL A CA    1 
ATOM   4894  C  C     . VAL A 1  671  ? -34.637 -38.169 -31.853 1.00 68.00  ? 671  VAL A C     1 
ATOM   4895  O  O     . VAL A 1  671  ? -34.247 -37.003 -31.920 1.00 67.48  ? 671  VAL A O     1 
ATOM   4896  C  CB    . VAL A 1  671  ? -36.050 -38.554 -29.776 1.00 71.97  ? 671  VAL A CB    1 
ATOM   4897  C  CG1   . VAL A 1  671  ? -37.259 -38.735 -30.692 1.00 71.96  ? 671  VAL A CG1   1 
ATOM   4898  C  CG2   . VAL A 1  671  ? -36.200 -39.422 -28.532 1.00 73.79  ? 671  VAL A CG2   1 
ATOM   4899  N  N     . GLY A 1  672  ? -34.984 -38.880 -32.924 1.00 66.03  ? 672  GLY A N     1 
ATOM   4900  C  CA    . GLY A 1  672  ? -34.965 -38.307 -34.270 1.00 65.52  ? 672  GLY A CA    1 
ATOM   4901  C  C     . GLY A 1  672  ? -33.646 -38.426 -35.018 1.00 65.67  ? 672  GLY A C     1 
ATOM   4902  O  O     . GLY A 1  672  ? -33.544 -37.972 -36.157 1.00 65.21  ? 672  GLY A O     1 
ATOM   4903  N  N     . GLN A 1  673  ? -32.636 -39.024 -34.386 1.00 66.83  ? 673  GLN A N     1 
ATOM   4904  C  CA    . GLN A 1  673  ? -31.358 -39.303 -35.041 1.00 66.52  ? 673  GLN A CA    1 
ATOM   4905  C  C     . GLN A 1  673  ? -31.564 -40.378 -36.105 1.00 65.21  ? 673  GLN A C     1 
ATOM   4906  O  O     . GLN A 1  673  ? -32.378 -41.284 -35.917 1.00 65.30  ? 673  GLN A O     1 
ATOM   4907  C  CB    . GLN A 1  673  ? -30.322 -39.767 -34.003 1.00 68.16  ? 673  GLN A CB    1 
ATOM   4908  C  CG    . GLN A 1  673  ? -28.927 -40.042 -34.558 1.00 68.26  ? 673  GLN A CG    1 
ATOM   4909  C  CD    . GLN A 1  673  ? -27.922 -40.449 -33.495 1.00 68.75  ? 673  GLN A CD    1 
ATOM   4910  O  OE1   . GLN A 1  673  ? -28.181 -40.357 -32.296 1.00 68.92  ? 673  GLN A OE1   1 
ATOM   4911  N  NE2   . GLN A 1  673  ? -26.762 -40.905 -33.936 1.00 69.28  ? 673  GLN A NE2   1 
ATOM   4912  N  N     . LEU A 1  674  ? -30.819 -40.281 -37.205 1.00 63.37  ? 674  LEU A N     1 
ATOM   4913  C  CA    . LEU A 1  674  ? -30.993 -41.193 -38.339 1.00 62.03  ? 674  LEU A CA    1 
ATOM   4914  C  C     . LEU A 1  674  ? -30.379 -42.548 -38.007 1.00 63.12  ? 674  LEU A C     1 
ATOM   4915  O  O     . LEU A 1  674  ? -29.259 -42.612 -37.499 1.00 63.09  ? 674  LEU A O     1 
ATOM   4916  C  CB    . LEU A 1  674  ? -30.357 -40.622 -39.608 1.00 60.77  ? 674  LEU A CB    1 
ATOM   4917  C  CG    . LEU A 1  674  ? -30.751 -39.201 -40.031 1.00 59.59  ? 674  LEU A CG    1 
ATOM   4918  C  CD1   . LEU A 1  674  ? -30.115 -38.861 -41.367 1.00 58.72  ? 674  LEU A CD1   1 
ATOM   4919  C  CD2   . LEU A 1  674  ? -32.259 -39.032 -40.095 1.00 59.05  ? 674  LEU A CD2   1 
ATOM   4920  N  N     . VAL A 1  675  ? -31.127 -43.617 -38.290 1.00 63.87  ? 675  VAL A N     1 
ATOM   4921  C  CA    . VAL A 1  675  ? -30.709 -44.995 -37.987 1.00 65.38  ? 675  VAL A CA    1 
ATOM   4922  C  C     . VAL A 1  675  ? -30.662 -45.850 -39.260 1.00 65.51  ? 675  VAL A C     1 
ATOM   4923  O  O     . VAL A 1  675  ? -29.614 -46.404 -39.589 1.00 67.99  ? 675  VAL A O     1 
ATOM   4924  C  CB    . VAL A 1  675  ? -31.630 -45.649 -36.927 1.00 66.13  ? 675  VAL A CB    1 
ATOM   4925  C  CG1   . VAL A 1  675  ? -31.160 -47.063 -36.591 1.00 67.24  ? 675  VAL A CG1   1 
ATOM   4926  C  CG2   . VAL A 1  675  ? -31.683 -44.790 -35.667 1.00 66.78  ? 675  VAL A CG2   1 
ATOM   4927  N  N     . CYS A 1  676  ? -31.792 -45.969 -39.954 1.00 65.22  ? 676  CYS A N     1 
ATOM   4928  C  CA    . CYS A 1  676  ? -31.852 -46.667 -41.245 1.00 64.89  ? 676  CYS A CA    1 
ATOM   4929  C  C     . CYS A 1  676  ? -32.348 -45.762 -42.367 1.00 62.43  ? 676  CYS A C     1 
ATOM   4930  O  O     . CYS A 1  676  ? -32.996 -44.746 -42.128 1.00 60.04  ? 676  CYS A O     1 
ATOM   4931  C  CB    . CYS A 1  676  ? -32.771 -47.886 -41.178 1.00 66.12  ? 676  CYS A CB    1 
ATOM   4932  S  SG    . CYS A 1  676  ? -32.536 -48.932 -39.737 1.00 69.05  ? 676  CYS A SG    1 
ATOM   4933  N  N     . ALA A 1  677  ? -32.035 -46.167 -43.593 1.00 61.92  ? 677  ALA A N     1 
ATOM   4934  C  CA    . ALA A 1  677  ? -32.482 -45.496 -44.801 1.00 60.66  ? 677  ALA A CA    1 
ATOM   4935  C  C     . ALA A 1  677  ? -33.165 -46.544 -45.663 1.00 60.33  ? 677  ALA A C     1 
ATOM   4936  O  O     . ALA A 1  677  ? -32.515 -47.469 -46.141 1.00 61.15  ? 677  ALA A O     1 
ATOM   4937  C  CB    . ALA A 1  677  ? -31.295 -44.887 -45.526 1.00 60.24  ? 677  ALA A CB    1 
ATOM   4938  N  N     . VAL A 1  678  ? -34.476 -46.412 -45.829 1.00 59.78  ? 678  VAL A N     1 
ATOM   4939  C  CA    . VAL A 1  678  ? -35.277 -47.381 -46.567 1.00 59.82  ? 678  VAL A CA    1 
ATOM   4940  C  C     . VAL A 1  678  ? -35.479 -46.851 -47.986 1.00 58.21  ? 678  VAL A C     1 
ATOM   4941  O  O     . VAL A 1  678  ? -35.963 -45.736 -48.166 1.00 56.46  ? 678  VAL A O     1 
ATOM   4942  C  CB    . VAL A 1  678  ? -36.639 -47.625 -45.873 1.00 60.79  ? 678  VAL A CB    1 
ATOM   4943  C  CG1   . VAL A 1  678  ? -37.465 -48.669 -46.622 1.00 61.35  ? 678  VAL A CG1   1 
ATOM   4944  C  CG2   . VAL A 1  678  ? -36.424 -48.064 -44.430 1.00 61.88  ? 678  VAL A CG2   1 
ATOM   4945  N  N     . LEU A 1  679  ? -35.101 -47.657 -48.978 1.00 57.79  ? 679  LEU A N     1 
ATOM   4946  C  CA    . LEU A 1  679  ? -35.213 -47.290 -50.385 1.00 56.81  ? 679  LEU A CA    1 
ATOM   4947  C  C     . LEU A 1  679  ? -36.226 -48.205 -51.067 1.00 56.82  ? 679  LEU A C     1 
ATOM   4948  O  O     . LEU A 1  679  ? -36.080 -49.423 -51.028 1.00 57.13  ? 679  LEU A O     1 
ATOM   4949  C  CB    . LEU A 1  679  ? -33.848 -47.415 -51.057 1.00 57.00  ? 679  LEU A CB    1 
ATOM   4950  C  CG    . LEU A 1  679  ? -33.690 -46.833 -52.464 1.00 56.26  ? 679  LEU A CG    1 
ATOM   4951  C  CD1   . LEU A 1  679  ? -33.667 -45.317 -52.428 1.00 55.22  ? 679  LEU A CD1   1 
ATOM   4952  C  CD2   . LEU A 1  679  ? -32.419 -47.365 -53.109 1.00 57.21  ? 679  LEU A CD2   1 
ATOM   4953  N  N     . ALA A 1  680  ? -37.243 -47.614 -51.695 1.00 56.49  ? 680  ALA A N     1 
ATOM   4954  C  CA    . ALA A 1  680  ? -38.310 -48.387 -52.339 1.00 57.22  ? 680  ALA A CA    1 
ATOM   4955  C  C     . ALA A 1  680  ? -38.768 -47.767 -53.651 1.00 56.61  ? 680  ALA A C     1 
ATOM   4956  O  O     . ALA A 1  680  ? -38.395 -46.647 -53.980 1.00 55.64  ? 680  ALA A O     1 
ATOM   4957  C  CB    . ALA A 1  680  ? -39.490 -48.536 -51.391 1.00 58.29  ? 680  ALA A CB    1 
ATOM   4958  N  N     . ASP A 1  681  ? -39.593 -48.512 -54.385 1.00 58.18  ? 681  ASP A N     1 
ATOM   4959  C  CA    . ASP A 1  681  ? -40.114 -48.076 -55.689 1.00 58.34  ? 681  ASP A CA    1 
ATOM   4960  C  C     . ASP A 1  681  ? -41.125 -46.936 -55.587 1.00 59.35  ? 681  ASP A C     1 
ATOM   4961  O  O     . ASP A 1  681  ? -41.405 -46.273 -56.589 1.00 60.57  ? 681  ASP A O     1 
ATOM   4962  C  CB    . ASP A 1  681  ? -40.774 -49.241 -56.436 1.00 58.45  ? 681  ASP A CB    1 
ATOM   4963  C  CG    . ASP A 1  681  ? -39.790 -50.306 -56.868 1.00 59.05  ? 681  ASP A CG    1 
ATOM   4964  O  OD1   . ASP A 1  681  ? -38.593 -50.003 -57.055 1.00 59.55  ? 681  ASP A OD1   1 
ATOM   4965  O  OD2   . ASP A 1  681  ? -40.229 -51.461 -57.040 1.00 60.35  ? 681  ASP A OD2   1 
ATOM   4966  N  N     . SER A 1  682  ? -41.701 -46.736 -54.404 1.00 59.79  ? 682  SER A N     1 
ATOM   4967  C  CA    . SER A 1  682  ? -42.593 -45.611 -54.165 1.00 59.51  ? 682  SER A CA    1 
ATOM   4968  C  C     . SER A 1  682  ? -42.493 -45.145 -52.725 1.00 60.56  ? 682  SER A C     1 
ATOM   4969  O  O     . SER A 1  682  ? -41.917 -45.827 -51.869 1.00 60.01  ? 682  SER A O     1 
ATOM   4970  C  CB    . SER A 1  682  ? -44.036 -45.994 -54.484 1.00 59.29  ? 682  SER A CB    1 
ATOM   4971  O  OG    . SER A 1  682  ? -44.549 -46.901 -53.523 1.00 60.04  ? 682  SER A OG    1 
ATOM   4972  N  N     . GLU A 1  683  ? -43.074 -43.978 -52.478 1.00 61.26  ? 683  GLU A N     1 
ATOM   4973  C  CA    . GLU A 1  683  ? -43.107 -43.388 -51.149 1.00 62.01  ? 683  GLU A CA    1 
ATOM   4974  C  C     . GLU A 1  683  ? -43.918 -44.239 -50.165 1.00 63.20  ? 683  GLU A C     1 
ATOM   4975  O  O     . GLU A 1  683  ? -43.445 -44.503 -49.054 1.00 62.75  ? 683  GLU A O     1 
ATOM   4976  C  CB    . GLU A 1  683  ? -43.672 -41.972 -51.231 1.00 62.26  ? 683  GLU A CB    1 
ATOM   4977  C  CG    . GLU A 1  683  ? -43.756 -41.231 -49.906 1.00 63.82  ? 683  GLU A CG    1 
ATOM   4978  C  CD    . GLU A 1  683  ? -44.248 -39.810 -50.071 1.00 64.65  ? 683  GLU A CD    1 
ATOM   4979  O  OE1   . GLU A 1  683  ? -44.318 -39.328 -51.224 1.00 64.93  ? 683  GLU A OE1   1 
ATOM   4980  O  OE2   . GLU A 1  683  ? -44.570 -39.179 -49.043 1.00 66.19  ? 683  GLU A OE2   1 
ATOM   4981  N  N     . VAL A 1  684  ? -45.119 -44.669 -50.566 1.00 63.66  ? 684  VAL A N     1 
ATOM   4982  C  CA    . VAL A 1  684  ? -45.987 -45.448 -49.661 1.00 65.03  ? 684  VAL A CA    1 
ATOM   4983  C  C     . VAL A 1  684  ? -45.322 -46.750 -49.236 1.00 64.86  ? 684  VAL A C     1 
ATOM   4984  O  O     . VAL A 1  684  ? -45.385 -47.129 -48.061 1.00 65.93  ? 684  VAL A O     1 
ATOM   4985  C  CB    . VAL A 1  684  ? -47.415 -45.746 -50.226 1.00 66.03  ? 684  VAL A CB    1 
ATOM   4986  C  CG1   . VAL A 1  684  ? -48.171 -44.453 -50.514 1.00 65.46  ? 684  VAL A CG1   1 
ATOM   4987  C  CG2   . VAL A 1  684  ? -47.382 -46.654 -51.455 1.00 66.79  ? 684  VAL A CG2   1 
ATOM   4988  N  N     . GLN A 1  685  ? -44.668 -47.408 -50.193 1.00 63.55  ? 685  GLN A N     1 
ATOM   4989  C  CA    . GLN A 1  685  ? -44.017 -48.692 -49.955 1.00 63.31  ? 685  GLN A CA    1 
ATOM   4990  C  C     . GLN A 1  685  ? -42.853 -48.543 -48.999 1.00 62.92  ? 685  GLN A C     1 
ATOM   4991  O  O     . GLN A 1  685  ? -42.639 -49.406 -48.149 1.00 65.33  ? 685  GLN A O     1 
ATOM   4992  C  CB    . GLN A 1  685  ? -43.552 -49.311 -51.273 1.00 62.66  ? 685  GLN A CB    1 
ATOM   4993  C  CG    . GLN A 1  685  ? -44.708 -49.783 -52.141 1.00 62.52  ? 685  GLN A CG    1 
ATOM   4994  C  CD    . GLN A 1  685  ? -44.294 -50.148 -53.551 1.00 62.30  ? 685  GLN A CD    1 
ATOM   4995  O  OE1   . GLN A 1  685  ? -43.532 -49.429 -54.199 1.00 60.75  ? 685  GLN A OE1   1 
ATOM   4996  N  NE2   . GLN A 1  685  ? -44.808 -51.271 -54.043 1.00 63.59  ? 685  GLN A NE2   1 
ATOM   4997  N  N     . ALA A 1  686  ? -42.122 -47.441 -49.135 1.00 62.28  ? 686  ALA A N     1 
ATOM   4998  C  CA    . ALA A 1  686  ? -40.995 -47.133 -48.255 1.00 62.70  ? 686  ALA A CA    1 
ATOM   4999  C  C     . ALA A 1  686  ? -41.448 -46.860 -46.822 1.00 62.73  ? 686  ALA A C     1 
ATOM   5000  O  O     . ALA A 1  686  ? -40.875 -47.396 -45.875 1.00 62.07  ? 686  ALA A O     1 
ATOM   5001  C  CB    . ALA A 1  686  ? -40.205 -45.945 -48.795 1.00 61.87  ? 686  ALA A CB    1 
ATOM   5002  N  N     . LYS A 1  687  ? -42.475 -46.026 -46.676 1.00 63.82  ? 687  LYS A N     1 
ATOM   5003  C  CA    . LYS A 1  687  ? -43.025 -45.683 -45.360 1.00 64.99  ? 687  LYS A CA    1 
ATOM   5004  C  C     . LYS A 1  687  ? -43.587 -46.924 -44.662 1.00 65.51  ? 687  LYS A C     1 
ATOM   5005  O  O     . LYS A 1  687  ? -43.377 -47.107 -43.463 1.00 65.75  ? 687  LYS A O     1 
ATOM   5006  C  CB    . LYS A 1  687  ? -44.107 -44.605 -45.490 1.00 65.98  ? 687  LYS A CB    1 
ATOM   5007  C  CG    . LYS A 1  687  ? -43.605 -43.244 -45.964 1.00 66.20  ? 687  LYS A CG    1 
ATOM   5008  C  CD    . LYS A 1  687  ? -43.023 -42.426 -44.822 1.00 68.54  ? 687  LYS A CD    1 
ATOM   5009  C  CE    . LYS A 1  687  ? -42.264 -41.203 -45.321 1.00 70.26  ? 687  LYS A CE    1 
ATOM   5010  N  NZ    . LYS A 1  687  ? -43.079 -40.335 -46.223 1.00 71.80  ? 687  LYS A NZ    1 
ATOM   5011  N  N     . ARG A 1  688  ? -44.280 -47.769 -45.428 1.00 65.71  ? 688  ARG A N     1 
ATOM   5012  C  CA    . ARG A 1  688  ? -44.824 -49.043 -44.929 1.00 66.71  ? 688  ARG A CA    1 
ATOM   5013  C  C     . ARG A 1  688  ? -43.757 -49.995 -44.412 1.00 66.90  ? 688  ARG A C     1 
ATOM   5014  O  O     . ARG A 1  688  ? -43.905 -50.565 -43.328 1.00 68.37  ? 688  ARG A O     1 
ATOM   5015  C  CB    . ARG A 1  688  ? -45.627 -49.767 -46.017 1.00 67.12  ? 688  ARG A CB    1 
ATOM   5016  C  CG    . ARG A 1  688  ? -47.059 -49.295 -46.147 1.00 66.99  ? 688  ARG A CG    1 
ATOM   5017  C  CD    . ARG A 1  688  ? -47.771 -50.003 -47.283 1.00 67.39  ? 688  ARG A CD    1 
ATOM   5018  N  NE    . ARG A 1  688  ? -48.984 -49.284 -47.656 1.00 67.95  ? 688  ARG A NE    1 
ATOM   5019  C  CZ    . ARG A 1  688  ? -49.715 -49.514 -48.745 1.00 68.01  ? 688  ARG A CZ    1 
ATOM   5020  N  NH1   . ARG A 1  688  ? -49.385 -50.474 -49.607 1.00 68.55  ? 688  ARG A NH1   1 
ATOM   5021  N  NH2   . ARG A 1  688  ? -50.800 -48.774 -48.967 1.00 67.91  ? 688  ARG A NH2   1 
ATOM   5022  N  N     . ALA A 1  689  ? -42.707 -50.185 -45.205 1.00 65.57  ? 689  ALA A N     1 
ATOM   5023  C  CA    . ALA A 1  689  ? -41.606 -51.066 -44.824 1.00 66.43  ? 689  ALA A CA    1 
ATOM   5024  C  C     . ALA A 1  689  ? -40.790 -50.502 -43.659 1.00 66.62  ? 689  ALA A C     1 
ATOM   5025  O  O     . ALA A 1  689  ? -40.276 -51.264 -42.845 1.00 67.02  ? 689  ALA A O     1 
ATOM   5026  C  CB    . ALA A 1  689  ? -40.706 -51.336 -46.016 1.00 66.13  ? 689  ALA A CB    1 
ATOM   5027  N  N     . ALA A 1  690  ? -40.679 -49.175 -43.587 1.00 66.14  ? 690  ALA A N     1 
ATOM   5028  C  CA    . ALA A 1  690  ? -39.954 -48.508 -42.510 1.00 66.90  ? 690  ALA A CA    1 
ATOM   5029  C  C     . ALA A 1  690  ? -40.567 -48.798 -41.139 1.00 70.19  ? 690  ALA A C     1 
ATOM   5030  O  O     . ALA A 1  690  ? -39.844 -48.961 -40.150 1.00 71.29  ? 690  ALA A O     1 
ATOM   5031  C  CB    . ALA A 1  690  ? -39.909 -47.010 -42.757 1.00 65.52  ? 690  ALA A CB    1 
ATOM   5032  N  N     . LYS A 1  691  ? -41.898 -48.877 -41.093 1.00 72.22  ? 691  LYS A N     1 
ATOM   5033  C  CA    . LYS A 1  691  ? -42.632 -49.149 -39.851 1.00 73.95  ? 691  LYS A CA    1 
ATOM   5034  C  C     . LYS A 1  691  ? -42.485 -50.569 -39.319 1.00 75.10  ? 691  LYS A C     1 
ATOM   5035  O  O     . LYS A 1  691  ? -42.769 -50.809 -38.147 1.00 75.94  ? 691  LYS A O     1 
ATOM   5036  C  CB    . LYS A 1  691  ? -44.119 -48.823 -40.020 1.00 74.98  ? 691  LYS A CB    1 
ATOM   5037  C  CG    . LYS A 1  691  ? -44.407 -47.334 -40.096 1.00 75.49  ? 691  LYS A CG    1 
ATOM   5038  C  CD    . LYS A 1  691  ? -45.888 -47.083 -40.311 1.00 77.08  ? 691  LYS A CD    1 
ATOM   5039  C  CE    . LYS A 1  691  ? -46.172 -45.629 -40.644 1.00 77.51  ? 691  LYS A CE    1 
ATOM   5040  N  NZ    . LYS A 1  691  ? -47.552 -45.488 -41.185 1.00 78.54  ? 691  LYS A NZ    1 
ATOM   5041  N  N     . ARG A 1  692  ? -42.063 -51.504 -40.170 1.00 77.26  ? 692  ARG A N     1 
ATOM   5042  C  CA    . ARG A 1  692  ? -41.844 -52.897 -39.769 1.00 80.00  ? 692  ARG A CA    1 
ATOM   5043  C  C     . ARG A 1  692  ? -40.370 -53.236 -39.539 1.00 79.80  ? 692  ARG A C     1 
ATOM   5044  O  O     . ARG A 1  692  ? -40.035 -54.401 -39.326 1.00 81.64  ? 692  ARG A O     1 
ATOM   5045  C  CB    . ARG A 1  692  ? -42.467 -53.842 -40.799 1.00 82.43  ? 692  ARG A CB    1 
ATOM   5046  C  CG    . ARG A 1  692  ? -43.910 -53.482 -41.127 1.00 84.94  ? 692  ARG A CG    1 
ATOM   5047  C  CD    . ARG A 1  692  ? -44.780 -54.698 -41.378 1.00 89.42  ? 692  ARG A CD    1 
ATOM   5048  N  NE    . ARG A 1  692  ? -46.181 -54.323 -41.601 1.00 92.03  ? 692  ARG A NE    1 
ATOM   5049  C  CZ    . ARG A 1  692  ? -47.097 -55.059 -42.240 1.00 94.30  ? 692  ARG A CZ    1 
ATOM   5050  N  NH1   . ARG A 1  692  ? -46.800 -56.251 -42.774 1.00 94.53  ? 692  ARG A NH1   1 
ATOM   5051  N  NH2   . ARG A 1  692  ? -48.338 -54.589 -42.356 1.00 95.52  ? 692  ARG A NH2   1 
ATOM   5052  N  N     . VAL A 1  693  ? -39.499 -52.226 -39.574 1.00 79.18  ? 693  VAL A N     1 
ATOM   5053  C  CA    . VAL A 1  693  ? -38.118 -52.373 -39.119 1.00 80.28  ? 693  VAL A CA    1 
ATOM   5054  C  C     . VAL A 1  693  ? -38.142 -52.433 -37.596 1.00 82.66  ? 693  VAL A C     1 
ATOM   5055  O  O     . VAL A 1  693  ? -38.569 -51.481 -36.948 1.00 82.21  ? 693  VAL A O     1 
ATOM   5056  C  CB    . VAL A 1  693  ? -37.232 -51.198 -39.578 1.00 79.07  ? 693  VAL A CB    1 
ATOM   5057  C  CG1   . VAL A 1  693  ? -35.852 -51.250 -38.917 1.00 79.41  ? 693  VAL A CG1   1 
ATOM   5058  C  CG2   . VAL A 1  693  ? -37.112 -51.202 -41.094 1.00 78.59  ? 693  VAL A CG2   1 
ATOM   5059  N  N     . LYS A 1  694  ? -37.686 -53.549 -37.035 1.00 86.31  ? 694  LYS A N     1 
ATOM   5060  C  CA    . LYS A 1  694  ? -37.742 -53.776 -35.595 1.00 89.03  ? 694  LYS A CA    1 
ATOM   5061  C  C     . LYS A 1  694  ? -36.381 -53.465 -34.991 1.00 88.11  ? 694  LYS A C     1 
ATOM   5062  O  O     . LYS A 1  694  ? -35.390 -54.131 -35.307 1.00 86.92  ? 694  LYS A O     1 
ATOM   5063  C  CB    . LYS A 1  694  ? -38.151 -55.222 -35.286 1.00 92.43  ? 694  LYS A CB    1 
ATOM   5064  C  CG    . LYS A 1  694  ? -39.479 -55.668 -35.895 1.00 93.90  ? 694  LYS A CG    1 
ATOM   5065  C  CD    . LYS A 1  694  ? -40.676 -54.986 -35.241 1.00 95.41  ? 694  LYS A CD    1 
ATOM   5066  C  CE    . LYS A 1  694  ? -41.995 -55.465 -35.834 1.00 96.24  ? 694  LYS A CE    1 
ATOM   5067  N  NZ    . LYS A 1  694  ? -42.312 -56.879 -35.479 1.00 97.78  ? 694  LYS A NZ    1 
ATOM   5068  N  N     . ILE A 1  695  ? -36.340 -52.435 -34.147 1.00 87.34  ? 695  ILE A N     1 
ATOM   5069  C  CA    . ILE A 1  695  ? -35.134 -52.057 -33.411 1.00 87.47  ? 695  ILE A CA    1 
ATOM   5070  C  C     . ILE A 1  695  ? -35.429 -52.242 -31.930 1.00 87.77  ? 695  ILE A C     1 
ATOM   5071  O  O     . ILE A 1  695  ? -36.527 -51.920 -31.472 1.00 88.95  ? 695  ILE A O     1 
ATOM   5072  C  CB    . ILE A 1  695  ? -34.724 -50.587 -33.674 1.00 86.18  ? 695  ILE A CB    1 
ATOM   5073  C  CG1   . ILE A 1  695  ? -34.519 -50.348 -35.178 1.00 85.46  ? 695  ILE A CG1   1 
ATOM   5074  C  CG2   . ILE A 1  695  ? -33.456 -50.236 -32.896 1.00 86.55  ? 695  ILE A CG2   1 
ATOM   5075  C  CD1   . ILE A 1  695  ? -34.319 -48.898 -35.562 1.00 84.69  ? 695  ILE A CD1   1 
ATOM   5076  N  N     . VAL A 1  696  ? -34.454 -52.765 -31.190 1.00 87.25  ? 696  VAL A N     1 
ATOM   5077  C  CA    . VAL A 1  696  ? -34.555 -52.856 -29.732 1.00 88.12  ? 696  VAL A CA    1 
ATOM   5078  C  C     . VAL A 1  696  ? -33.369 -52.138 -29.091 1.00 86.68  ? 696  VAL A C     1 
ATOM   5079  O  O     . VAL A 1  696  ? -32.229 -52.259 -29.551 1.00 85.30  ? 696  VAL A O     1 
ATOM   5080  C  CB    . VAL A 1  696  ? -34.701 -54.313 -29.213 1.00 90.23  ? 696  VAL A CB    1 
ATOM   5081  C  CG1   . VAL A 1  696  ? -36.120 -54.816 -29.451 1.00 90.89  ? 696  VAL A CG1   1 
ATOM   5082  C  CG2   . VAL A 1  696  ? -33.685 -55.254 -29.844 1.00 90.69  ? 696  VAL A CG2   1 
ATOM   5083  N  N     . TYR A 1  697  ? -33.672 -51.373 -28.044 1.00 85.30  ? 697  TYR A N     1 
ATOM   5084  C  CA    . TYR A 1  697  ? -32.715 -50.488 -27.401 1.00 84.69  ? 697  TYR A CA    1 
ATOM   5085  C  C     . TYR A 1  697  ? -32.432 -50.933 -25.967 1.00 86.15  ? 697  TYR A C     1 
ATOM   5086  O  O     . TYR A 1  697  ? -33.056 -51.861 -25.456 1.00 86.61  ? 697  TYR A O     1 
ATOM   5087  C  CB    . TYR A 1  697  ? -33.255 -49.054 -27.370 1.00 83.44  ? 697  TYR A CB    1 
ATOM   5088  C  CG    . TYR A 1  697  ? -33.695 -48.471 -28.699 1.00 80.86  ? 697  TYR A CG    1 
ATOM   5089  C  CD1   . TYR A 1  697  ? -34.981 -48.692 -29.188 1.00 80.32  ? 697  TYR A CD1   1 
ATOM   5090  C  CD2   . TYR A 1  697  ? -32.842 -47.653 -29.444 1.00 79.67  ? 697  TYR A CD2   1 
ATOM   5091  C  CE1   . TYR A 1  697  ? -35.400 -48.140 -30.395 1.00 78.93  ? 697  TYR A CE1   1 
ATOM   5092  C  CE2   . TYR A 1  697  ? -33.248 -47.095 -30.653 1.00 78.16  ? 697  TYR A CE2   1 
ATOM   5093  C  CZ    . TYR A 1  697  ? -34.529 -47.339 -31.126 1.00 77.82  ? 697  TYR A CZ    1 
ATOM   5094  O  OH    . TYR A 1  697  ? -34.945 -46.792 -32.324 1.00 75.84  ? 697  TYR A OH    1 
ATOM   5095  N  N     . GLN A 1  698  ? -31.473 -50.255 -25.340 1.00 87.28  ? 698  GLN A N     1 
ATOM   5096  C  CA    . GLN A 1  698  ? -31.199 -50.358 -23.901 1.00 88.72  ? 698  GLN A CA    1 
ATOM   5097  C  C     . GLN A 1  698  ? -30.824 -48.954 -23.405 1.00 87.65  ? 698  GLN A C     1 
ATOM   5098  O  O     . GLN A 1  698  ? -29.720 -48.481 -23.689 1.00 87.59  ? 698  GLN A O     1 
ATOM   5099  C  CB    . GLN A 1  698  ? -30.052 -51.341 -23.647 1.00 90.86  ? 698  GLN A CB    1 
ATOM   5100  C  CG    . GLN A 1  698  ? -29.655 -51.516 -22.181 1.00 93.51  ? 698  GLN A CG    1 
ATOM   5101  C  CD    . GLN A 1  698  ? -28.346 -52.272 -22.006 1.00 95.14  ? 698  GLN A CD    1 
ATOM   5102  O  OE1   . GLN A 1  698  ? -27.420 -52.150 -22.813 1.00 94.75  ? 698  GLN A OE1   1 
ATOM   5103  N  NE2   . GLN A 1  698  ? -28.260 -53.050 -20.937 1.00 97.19  ? 698  GLN A NE2   1 
ATOM   5104  N  N     . ASP A 1  699  ? -31.734 -48.297 -22.682 1.00 86.61  ? 699  ASP A N     1 
ATOM   5105  C  CA    . ASP A 1  699  ? -31.509 -46.922 -22.202 1.00 85.95  ? 699  ASP A CA    1 
ATOM   5106  C  C     . ASP A 1  699  ? -30.238 -46.800 -21.358 1.00 86.67  ? 699  ASP A C     1 
ATOM   5107  O  O     . ASP A 1  699  ? -29.876 -47.725 -20.628 1.00 87.06  ? 699  ASP A O     1 
ATOM   5108  C  CB    . ASP A 1  699  ? -32.714 -46.402 -21.396 1.00 86.69  ? 699  ASP A CB    1 
ATOM   5109  C  CG    . ASP A 1  699  ? -33.860 -45.923 -22.280 1.00 86.02  ? 699  ASP A CG    1 
ATOM   5110  O  OD1   . ASP A 1  699  ? -33.610 -45.198 -23.272 1.00 84.87  ? 699  ASP A OD1   1 
ATOM   5111  O  OD2   . ASP A 1  699  ? -35.023 -46.255 -21.967 1.00 87.01  ? 699  ASP A OD2   1 
ATOM   5112  N  N     . LEU A 1  700  ? -29.576 -45.649 -21.483 1.00 86.11  ? 700  LEU A N     1 
ATOM   5113  C  CA    . LEU A 1  700  ? -28.309 -45.365 -20.813 1.00 87.67  ? 700  LEU A CA    1 
ATOM   5114  C  C     . LEU A 1  700  ? -28.444 -44.128 -19.935 1.00 89.44  ? 700  LEU A C     1 
ATOM   5115  O  O     . LEU A 1  700  ? -29.134 -43.175 -20.309 1.00 88.51  ? 700  LEU A O     1 
ATOM   5116  C  CB    . LEU A 1  700  ? -27.212 -45.100 -21.845 1.00 86.31  ? 700  LEU A CB    1 
ATOM   5117  C  CG    . LEU A 1  700  ? -26.859 -46.217 -22.826 1.00 85.89  ? 700  LEU A CG    1 
ATOM   5118  C  CD1   . LEU A 1  700  ? -25.911 -45.691 -23.896 1.00 85.16  ? 700  LEU A CD1   1 
ATOM   5119  C  CD2   . LEU A 1  700  ? -26.255 -47.412 -22.106 1.00 87.22  ? 700  LEU A CD2   1 
ATOM   5120  N  N     . GLU A 1  701  ? -27.779 -44.151 -18.779 1.00 92.43  ? 701  GLU A N     1 
ATOM   5121  C  CA    . GLU A 1  701  ? -27.615 -42.960 -17.941 1.00 94.29  ? 701  GLU A CA    1 
ATOM   5122  C  C     . GLU A 1  701  ? -26.279 -42.285 -18.282 1.00 94.19  ? 701  GLU A C     1 
ATOM   5123  O  O     . GLU A 1  701  ? -25.350 -42.971 -18.711 1.00 94.05  ? 701  GLU A O     1 
ATOM   5124  C  CB    . GLU A 1  701  ? -27.671 -43.317 -16.446 1.00 97.75  ? 701  GLU A CB    1 
ATOM   5125  C  CG    . GLU A 1  701  ? -28.959 -42.909 -15.737 1.00 99.36  ? 701  GLU A CG    1 
ATOM   5126  C  CD    . GLU A 1  701  ? -30.175 -43.722 -16.155 1.00 99.70  ? 701  GLU A CD    1 
ATOM   5127  O  OE1   . GLU A 1  701  ? -30.328 -44.029 -17.361 1.00 98.09  ? 701  GLU A OE1   1 
ATOM   5128  O  OE2   . GLU A 1  701  ? -30.996 -44.044 -15.268 1.00 101.37 ? 701  GLU A OE2   1 
ATOM   5129  N  N     . PRO A 1  702  ? -26.161 -40.961 -18.117 1.00 94.15  ? 702  PRO A N     1 
ATOM   5130  C  CA    . PRO A 1  702  ? -27.247 -40.064 -17.709 1.00 92.92  ? 702  PRO A CA    1 
ATOM   5131  C  C     . PRO A 1  702  ? -28.072 -39.585 -18.905 1.00 89.77  ? 702  PRO A C     1 
ATOM   5132  O  O     . PRO A 1  702  ? -27.546 -39.474 -20.022 1.00 88.36  ? 702  PRO A O     1 
ATOM   5133  C  CB    . PRO A 1  702  ? -26.497 -38.891 -17.081 1.00 94.09  ? 702  PRO A CB    1 
ATOM   5134  C  CG    . PRO A 1  702  ? -25.209 -38.830 -17.835 1.00 94.21  ? 702  PRO A CG    1 
ATOM   5135  C  CD    . PRO A 1  702  ? -24.896 -40.228 -18.311 1.00 94.64  ? 702  PRO A CD    1 
ATOM   5136  N  N     . LEU A 1  703  ? -29.353 -39.313 -18.663 1.00 87.89  ? 703  LEU A N     1 
ATOM   5137  C  CA    . LEU A 1  703  ? -30.239 -38.727 -19.668 1.00 85.04  ? 703  LEU A CA    1 
ATOM   5138  C  C     . LEU A 1  703  ? -30.292 -37.215 -19.450 1.00 84.06  ? 703  LEU A C     1 
ATOM   5139  O  O     . LEU A 1  703  ? -31.028 -36.721 -18.592 1.00 83.93  ? 703  LEU A O     1 
ATOM   5140  C  CB    . LEU A 1  703  ? -31.639 -39.353 -19.597 1.00 85.05  ? 703  LEU A CB    1 
ATOM   5141  C  CG    . LEU A 1  703  ? -32.749 -38.807 -20.517 1.00 84.16  ? 703  LEU A CG    1 
ATOM   5142  C  CD1   . LEU A 1  703  ? -32.285 -38.568 -21.950 1.00 83.12  ? 703  LEU A CD1   1 
ATOM   5143  C  CD2   . LEU A 1  703  ? -33.955 -39.738 -20.508 1.00 83.74  ? 703  LEU A CD2   1 
ATOM   5144  N  N     . ILE A 1  704  ? -29.491 -36.496 -20.237 1.00 82.91  ? 704  ILE A N     1 
ATOM   5145  C  CA    . ILE A 1  704  ? -29.338 -35.049 -20.119 1.00 82.15  ? 704  ILE A CA    1 
ATOM   5146  C  C     . ILE A 1  704  ? -30.344 -34.369 -21.043 1.00 79.21  ? 704  ILE A C     1 
ATOM   5147  O  O     . ILE A 1  704  ? -30.278 -34.550 -22.252 1.00 78.57  ? 704  ILE A O     1 
ATOM   5148  C  CB    . ILE A 1  704  ? -27.905 -34.610 -20.509 1.00 82.95  ? 704  ILE A CB    1 
ATOM   5149  C  CG1   . ILE A 1  704  ? -26.851 -35.352 -19.670 1.00 85.29  ? 704  ILE A CG1   1 
ATOM   5150  C  CG2   . ILE A 1  704  ? -27.734 -33.104 -20.337 1.00 83.09  ? 704  ILE A CG2   1 
ATOM   5151  C  CD1   . ILE A 1  704  ? -25.474 -35.386 -20.303 1.00 85.84  ? 704  ILE A CD1   1 
ATOM   5152  N  N     . LEU A 1  705  ? -31.273 -33.601 -20.475 1.00 78.17  ? 705  LEU A N     1 
ATOM   5153  C  CA    . LEU A 1  705  ? -32.257 -32.849 -21.264 1.00 76.56  ? 705  LEU A CA    1 
ATOM   5154  C  C     . LEU A 1  705  ? -32.100 -31.341 -21.108 1.00 76.06  ? 705  LEU A C     1 
ATOM   5155  O  O     . LEU A 1  705  ? -32.080 -30.619 -22.103 1.00 74.32  ? 705  LEU A O     1 
ATOM   5156  C  CB    . LEU A 1  705  ? -33.681 -33.268 -20.889 1.00 77.04  ? 705  LEU A CB    1 
ATOM   5157  C  CG    . LEU A 1  705  ? -34.047 -34.743 -21.108 1.00 77.36  ? 705  LEU A CG    1 
ATOM   5158  C  CD1   . LEU A 1  705  ? -35.444 -35.026 -20.572 1.00 77.36  ? 705  LEU A CD1   1 
ATOM   5159  C  CD2   . LEU A 1  705  ? -33.942 -35.127 -22.579 1.00 76.30  ? 705  LEU A CD2   1 
ATOM   5160  N  N     . THR A 1  706  ? -32.001 -30.866 -19.868 1.00 77.95  ? 706  THR A N     1 
ATOM   5161  C  CA    . THR A 1  706  ? -31.871 -29.430 -19.594 1.00 78.70  ? 706  THR A CA    1 
ATOM   5162  C  C     . THR A 1  706  ? -30.412 -28.959 -19.541 1.00 79.89  ? 706  THR A C     1 
ATOM   5163  O  O     . THR A 1  706  ? -29.478 -29.761 -19.433 1.00 79.93  ? 706  THR A O     1 
ATOM   5164  C  CB    . THR A 1  706  ? -32.586 -29.028 -18.281 1.00 79.47  ? 706  THR A CB    1 
ATOM   5165  O  OG1   . THR A 1  706  ? -32.034 -29.752 -17.175 1.00 80.57  ? 706  THR A OG1   1 
ATOM   5166  C  CG2   . THR A 1  706  ? -34.082 -29.300 -18.379 1.00 78.72  ? 706  THR A CG2   1 
ATOM   5167  N  N     . ILE A 1  707  ? -30.253 -27.639 -19.615 1.00 80.57  ? 707  ILE A N     1 
ATOM   5168  C  CA    . ILE A 1  707  ? -28.949 -26.964 -19.567 1.00 81.41  ? 707  ILE A CA    1 
ATOM   5169  C  C     . ILE A 1  707  ? -28.251 -27.161 -18.207 1.00 83.60  ? 707  ILE A C     1 
ATOM   5170  O  O     . ILE A 1  707  ? -27.034 -27.348 -18.157 1.00 83.97  ? 707  ILE A O     1 
ATOM   5171  C  CB    . ILE A 1  707  ? -29.105 -25.454 -19.903 1.00 80.89  ? 707  ILE A CB    1 
ATOM   5172  C  CG1   . ILE A 1  707  ? -29.534 -25.281 -21.369 1.00 78.87  ? 707  ILE A CG1   1 
ATOM   5173  C  CG2   . ILE A 1  707  ? -27.812 -24.681 -19.651 1.00 82.05  ? 707  ILE A CG2   1 
ATOM   5174  C  CD1   . ILE A 1  707  ? -30.043 -23.899 -21.720 1.00 78.26  ? 707  ILE A CD1   1 
ATOM   5175  N  N     . GLU A 1  708  ? -29.023 -27.118 -17.120 1.00 85.25  ? 708  GLU A N     1 
ATOM   5176  C  CA    . GLU A 1  708  ? -28.489 -27.349 -15.769 1.00 87.57  ? 708  GLU A CA    1 
ATOM   5177  C  C     . GLU A 1  708  ? -27.934 -28.762 -15.613 1.00 88.64  ? 708  GLU A C     1 
ATOM   5178  O  O     . GLU A 1  708  ? -26.912 -28.959 -14.954 1.00 90.01  ? 708  GLU A O     1 
ATOM   5179  C  CB    . GLU A 1  708  ? -29.555 -27.099 -14.693 1.00 88.71  ? 708  GLU A CB    1 
ATOM   5180  C  CG    . GLU A 1  708  ? -29.879 -25.630 -14.439 1.00 89.28  ? 708  GLU A CG    1 
ATOM   5181  C  CD    . GLU A 1  708  ? -31.033 -25.103 -15.283 1.00 88.07  ? 708  GLU A CD    1 
ATOM   5182  O  OE1   . GLU A 1  708  ? -31.064 -25.362 -16.509 1.00 85.40  ? 708  GLU A OE1   1 
ATOM   5183  O  OE2   . GLU A 1  708  ? -31.912 -24.415 -14.713 1.00 88.51  ? 708  GLU A OE2   1 
ATOM   5184  N  N     . GLU A 1  709  ? -28.615 -29.736 -16.217 1.00 88.48  ? 709  GLU A N     1 
ATOM   5185  C  CA    . GLU A 1  709  ? -28.145 -31.124 -16.238 1.00 89.38  ? 709  GLU A CA    1 
ATOM   5186  C  C     . GLU A 1  709  ? -26.843 -31.289 -17.029 1.00 89.92  ? 709  GLU A C     1 
ATOM   5187  O  O     . GLU A 1  709  ? -25.970 -32.062 -16.626 1.00 92.82  ? 709  GLU A O     1 
ATOM   5188  C  CB    . GLU A 1  709  ? -29.229 -32.058 -16.792 1.00 87.90  ? 709  GLU A CB    1 
ATOM   5189  C  CG    . GLU A 1  709  ? -30.408 -32.232 -15.845 1.00 88.20  ? 709  GLU A CG    1 
ATOM   5190  C  CD    . GLU A 1  709  ? -31.600 -32.955 -16.455 1.00 86.82  ? 709  GLU A CD    1 
ATOM   5191  O  OE1   . GLU A 1  709  ? -31.747 -32.994 -17.698 1.00 84.60  ? 709  GLU A OE1   1 
ATOM   5192  O  OE2   . GLU A 1  709  ? -32.413 -33.482 -15.668 1.00 87.89  ? 709  GLU A OE2   1 
ATOM   5193  N  N     . SER A 1  710  ? -26.707 -30.559 -18.135 1.00 88.64  ? 710  SER A N     1 
ATOM   5194  C  CA    . SER A 1  710  ? -25.490 -30.617 -18.957 1.00 88.49  ? 710  SER A CA    1 
ATOM   5195  C  C     . SER A 1  710  ? -24.236 -30.064 -18.268 1.00 90.00  ? 710  SER A C     1 
ATOM   5196  O  O     . SER A 1  710  ? -23.123 -30.451 -18.616 1.00 90.44  ? 710  SER A O     1 
ATOM   5197  C  CB    . SER A 1  710  ? -25.704 -29.893 -20.286 1.00 86.06  ? 710  SER A CB    1 
ATOM   5198  O  OG    . SER A 1  710  ? -24.568 -30.033 -21.118 1.00 85.29  ? 710  SER A OG    1 
ATOM   5199  N  N     . ILE A 1  711  ? -24.422 -29.171 -17.300 1.00 91.92  ? 711  ILE A N     1 
ATOM   5200  C  CA    . ILE A 1  711  ? -23.308 -28.615 -16.514 1.00 95.19  ? 711  ILE A CA    1 
ATOM   5201  C  C     . ILE A 1  711  ? -22.669 -29.660 -15.564 1.00 97.83  ? 711  ILE A C     1 
ATOM   5202  O  O     . ILE A 1  711  ? -21.594 -29.417 -15.010 1.00 99.89  ? 711  ILE A O     1 
ATOM   5203  C  CB    . ILE A 1  711  ? -23.748 -27.300 -15.805 1.00 95.79  ? 711  ILE A CB    1 
ATOM   5204  C  CG1   . ILE A 1  711  ? -24.046 -26.227 -16.868 1.00 94.48  ? 711  ILE A CG1   1 
ATOM   5205  C  CG2   . ILE A 1  711  ? -22.686 -26.764 -14.851 1.00 97.58  ? 711  ILE A CG2   1 
ATOM   5206  C  CD1   . ILE A 1  711  ? -24.856 -25.047 -16.373 1.00 94.66  ? 711  ILE A CD1   1 
ATOM   5207  N  N     . GLN A 1  712  ? -23.304 -30.825 -15.399 1.00 98.45  ? 712  GLN A N     1 
ATOM   5208  C  CA    . GLN A 1  712  ? -22.638 -32.004 -14.814 1.00 99.63  ? 712  GLN A CA    1 
ATOM   5209  C  C     . GLN A 1  712  ? -23.273 -33.319 -15.295 1.00 96.60  ? 712  GLN A C     1 
ATOM   5210  O  O     . GLN A 1  712  ? -22.698 -34.038 -16.113 1.00 92.06  ? 712  GLN A O     1 
ATOM   5211  C  CB    . GLN A 1  712  ? -22.588 -31.917 -13.272 1.00 102.97 ? 712  GLN A CB    1 
ATOM   5212  C  CG    . GLN A 1  712  ? -23.835 -32.357 -12.502 1.00 104.86 ? 712  GLN A CG    1 
ATOM   5213  C  CD    . GLN A 1  712  ? -25.115 -31.690 -12.973 1.00 104.49 ? 712  GLN A CD    1 
ATOM   5214  O  OE1   . GLN A 1  712  ? -26.125 -32.357 -13.198 1.00 105.12 ? 712  GLN A OE1   1 
ATOM   5215  N  NE2   . GLN A 1  712  ? -25.076 -30.371 -13.133 1.00 104.58 ? 712  GLN A NE2   1 
ATOM   5216  N  N     . SER A 1  716  ? -16.325 -32.290 -18.715 1.00 113.25 ? 716  SER A N     1 
ATOM   5217  C  CA    . SER A 1  716  ? -14.954 -32.602 -19.106 1.00 113.90 ? 716  SER A CA    1 
ATOM   5218  C  C     . SER A 1  716  ? -14.156 -31.326 -19.438 1.00 114.17 ? 716  SER A C     1 
ATOM   5219  O  O     . SER A 1  716  ? -13.338 -30.888 -18.624 1.00 116.65 ? 716  SER A O     1 
ATOM   5220  C  CB    . SER A 1  716  ? -14.940 -33.593 -20.278 1.00 112.25 ? 716  SER A CB    1 
ATOM   5221  O  OG    . SER A 1  716  ? -15.730 -33.125 -21.360 1.00 109.44 ? 716  SER A OG    1 
ATOM   5222  N  N     . PHE A 1  717  ? -14.395 -30.738 -20.615 1.00 111.62 ? 717  PHE A N     1 
ATOM   5223  C  CA    . PHE A 1  717  ? -13.752 -29.472 -21.014 1.00 110.19 ? 717  PHE A CA    1 
ATOM   5224  C  C     . PHE A 1  717  ? -14.456 -28.803 -22.199 1.00 108.08 ? 717  PHE A C     1 
ATOM   5225  O  O     . PHE A 1  717  ? -14.491 -29.363 -23.300 1.00 105.80 ? 717  PHE A O     1 
ATOM   5226  C  CB    . PHE A 1  717  ? -12.272 -29.682 -21.365 1.00 110.28 ? 717  PHE A CB    1 
ATOM   5227  C  CG    . PHE A 1  717  ? -11.634 -28.486 -22.029 1.00 108.82 ? 717  PHE A CG    1 
ATOM   5228  C  CD1   . PHE A 1  717  ? -11.329 -27.345 -21.290 1.00 109.65 ? 717  PHE A CD1   1 
ATOM   5229  C  CD2   . PHE A 1  717  ? -11.356 -28.489 -23.396 1.00 106.46 ? 717  PHE A CD2   1 
ATOM   5230  C  CE1   . PHE A 1  717  ? -10.753 -26.237 -21.896 1.00 108.66 ? 717  PHE A CE1   1 
ATOM   5231  C  CE2   . PHE A 1  717  ? -10.780 -27.383 -24.006 1.00 105.87 ? 717  PHE A CE2   1 
ATOM   5232  C  CZ    . PHE A 1  717  ? -10.478 -26.256 -23.256 1.00 106.92 ? 717  PHE A CZ    1 
ATOM   5233  N  N     . LYS A 1  718  ? -14.984 -27.599 -21.963 1.00 107.97 ? 718  LYS A N     1 
ATOM   5234  C  CA    . LYS A 1  718  ? -15.599 -26.766 -23.002 1.00 105.81 ? 718  LYS A CA    1 
ATOM   5235  C  C     . LYS A 1  718  ? -14.706 -25.551 -23.271 1.00 104.10 ? 718  LYS A C     1 
ATOM   5236  O  O     . LYS A 1  718  ? -14.178 -24.969 -22.323 1.00 105.37 ? 718  LYS A O     1 
ATOM   5237  C  CB    . LYS A 1  718  ? -16.976 -26.270 -22.544 1.00 106.32 ? 718  LYS A CB    1 
ATOM   5238  C  CG    . LYS A 1  718  ? -18.017 -27.364 -22.355 1.00 106.75 ? 718  LYS A CG    1 
ATOM   5239  C  CD    . LYS A 1  718  ? -19.221 -26.856 -21.577 1.00 107.70 ? 718  LYS A CD    1 
ATOM   5240  C  CE    . LYS A 1  718  ? -20.190 -27.984 -21.253 1.00 108.54 ? 718  LYS A CE    1 
ATOM   5241  N  NZ    . LYS A 1  718  ? -21.171 -27.596 -20.201 1.00 109.19 ? 718  LYS A NZ    1 
ATOM   5242  N  N     . PRO A 1  719  ? -14.528 -25.163 -24.553 1.00 101.57 ? 719  PRO A N     1 
ATOM   5243  C  CA    . PRO A 1  719  ? -13.828 -23.898 -24.822 1.00 101.20 ? 719  PRO A CA    1 
ATOM   5244  C  C     . PRO A 1  719  ? -14.656 -22.677 -24.406 1.00 99.78  ? 719  PRO A C     1 
ATOM   5245  O  O     . PRO A 1  719  ? -15.862 -22.632 -24.655 1.00 99.64  ? 719  PRO A O     1 
ATOM   5246  C  CB    . PRO A 1  719  ? -13.609 -23.922 -26.344 1.00 99.98  ? 719  PRO A CB    1 
ATOM   5247  C  CG    . PRO A 1  719  ? -14.634 -24.859 -26.871 1.00 98.91  ? 719  PRO A CG    1 
ATOM   5248  C  CD    . PRO A 1  719  ? -14.847 -25.887 -25.798 1.00 99.88  ? 719  PRO A CD    1 
ATOM   5249  N  N     . GLU A 1  720  ? -14.003 -21.708 -23.772 1.00 99.07  ? 720  GLU A N     1 
ATOM   5250  C  CA    . GLU A 1  720  ? -14.665 -20.502 -23.290 1.00 97.50  ? 720  GLU A CA    1 
ATOM   5251  C  C     . GLU A 1  720  ? -14.590 -19.400 -24.343 1.00 95.13  ? 720  GLU A C     1 
ATOM   5252  O  O     . GLU A 1  720  ? -13.590 -19.279 -25.052 1.00 94.07  ? 720  GLU A O     1 
ATOM   5253  C  CB    . GLU A 1  720  ? -14.003 -20.023 -21.996 1.00 99.56  ? 720  GLU A CB    1 
ATOM   5254  C  CG    . GLU A 1  720  ? -14.801 -18.973 -21.235 1.00 99.80  ? 720  GLU A CG    1 
ATOM   5255  C  CD    . GLU A 1  720  ? -14.053 -18.430 -20.035 1.00 101.90 ? 720  GLU A CD    1 
ATOM   5256  O  OE1   . GLU A 1  720  ? -12.896 -17.994 -20.204 1.00 102.99 ? 720  GLU A OE1   1 
ATOM   5257  O  OE2   . GLU A 1  720  ? -14.625 -18.430 -18.923 1.00 102.86 ? 720  GLU A OE2   1 
ATOM   5258  N  N     . ARG A 1  721  ? -15.663 -18.617 -24.442 1.00 93.37  ? 721  ARG A N     1 
ATOM   5259  C  CA    . ARG A 1  721  ? -15.652 -17.339 -25.155 1.00 92.61  ? 721  ARG A CA    1 
ATOM   5260  C  C     . ARG A 1  721  ? -15.935 -16.235 -24.146 1.00 93.13  ? 721  ARG A C     1 
ATOM   5261  O  O     . ARG A 1  721  ? -16.813 -16.388 -23.296 1.00 93.34  ? 721  ARG A O     1 
ATOM   5262  C  CB    . ARG A 1  721  ? -16.701 -17.321 -26.258 1.00 90.73  ? 721  ARG A CB    1 
ATOM   5263  C  CG    . ARG A 1  721  ? -16.384 -18.241 -27.420 1.00 90.23  ? 721  ARG A CG    1 
ATOM   5264  C  CD    . ARG A 1  721  ? -15.275 -17.688 -28.302 1.00 90.32  ? 721  ARG A CD    1 
ATOM   5265  N  NE    . ARG A 1  721  ? -14.841 -18.676 -29.287 1.00 89.48  ? 721  ARG A NE    1 
ATOM   5266  C  CZ    . ARG A 1  721  ? -14.065 -19.729 -29.027 1.00 90.29  ? 721  ARG A CZ    1 
ATOM   5267  N  NH1   . ARG A 1  721  ? -13.596 -19.968 -27.801 1.00 91.83  ? 721  ARG A NH1   1 
ATOM   5268  N  NH2   . ARG A 1  721  ? -13.748 -20.561 -30.013 1.00 90.28  ? 721  ARG A NH2   1 
ATOM   5269  N  N     . LYS A 1  722  ? -15.201 -15.127 -24.256 1.00 92.51  ? 722  LYS A N     1 
ATOM   5270  C  CA    . LYS A 1  722  ? -15.201 -14.083 -23.233 1.00 92.35  ? 722  LYS A CA    1 
ATOM   5271  C  C     . LYS A 1  722  ? -15.068 -12.683 -23.843 1.00 91.31  ? 722  LYS A C     1 
ATOM   5272  O  O     . LYS A 1  722  ? -14.349 -12.496 -24.826 1.00 90.59  ? 722  LYS A O     1 
ATOM   5273  C  CB    . LYS A 1  722  ? -14.048 -14.341 -22.254 1.00 94.48  ? 722  LYS A CB    1 
ATOM   5274  C  CG    . LYS A 1  722  ? -14.367 -14.033 -20.797 1.00 96.01  ? 722  LYS A CG    1 
ATOM   5275  C  CD    . LYS A 1  722  ? -13.160 -14.266 -19.901 1.00 97.77  ? 722  LYS A CD    1 
ATOM   5276  C  CE    . LYS A 1  722  ? -12.207 -13.085 -19.929 1.00 99.19  ? 722  LYS A CE    1 
ATOM   5277  N  NZ    . LYS A 1  722  ? -10.797 -13.501 -19.711 1.00 101.07 ? 722  LYS A NZ    1 
ATOM   5278  N  N     . LEU A 1  723  ? -15.772 -11.714 -23.259 1.00 91.19  ? 723  LEU A N     1 
ATOM   5279  C  CA    . LEU A 1  723  ? -15.587 -10.296 -23.570 1.00 91.35  ? 723  LEU A CA    1 
ATOM   5280  C  C     . LEU A 1  723  ? -15.360 -9.546  -22.269 1.00 93.29  ? 723  LEU A C     1 
ATOM   5281  O  O     . LEU A 1  723  ? -16.193 -9.621  -21.369 1.00 93.59  ? 723  LEU A O     1 
ATOM   5282  C  CB    . LEU A 1  723  ? -16.813 -9.727  -24.283 1.00 90.33  ? 723  LEU A CB    1 
ATOM   5283  C  CG    . LEU A 1  723  ? -16.955 -10.028 -25.780 1.00 89.13  ? 723  LEU A CG    1 
ATOM   5284  C  CD1   . LEU A 1  723  ? -18.334 -9.619  -26.267 1.00 88.32  ? 723  LEU A CD1   1 
ATOM   5285  C  CD2   . LEU A 1  723  ? -15.881 -9.327  -26.601 1.00 89.54  ? 723  LEU A CD2   1 
ATOM   5286  N  N     . GLU A 1  724  ? -14.224 -8.850  -22.176 1.00 95.25  ? 724  GLU A N     1 
ATOM   5287  C  CA    . GLU A 1  724  ? -13.880 -8.002  -21.032 1.00 97.12  ? 724  GLU A CA    1 
ATOM   5288  C  C     . GLU A 1  724  ? -13.844 -6.553  -21.502 1.00 97.46  ? 724  GLU A C     1 
ATOM   5289  O  O     . GLU A 1  724  ? -13.109 -6.221  -22.436 1.00 97.63  ? 724  GLU A O     1 
ATOM   5290  C  CB    . GLU A 1  724  ? -12.502 -8.369  -20.477 1.00 99.23  ? 724  GLU A CB    1 
ATOM   5291  C  CG    . GLU A 1  724  ? -12.418 -9.737  -19.814 1.00 100.00 ? 724  GLU A CG    1 
ATOM   5292  C  CD    . GLU A 1  724  ? -12.742 -9.726  -18.327 1.00 101.77 ? 724  GLU A CD    1 
ATOM   5293  O  OE1   . GLU A 1  724  ? -12.175 -8.894  -17.584 1.00 103.86 ? 724  GLU A OE1   1 
ATOM   5294  O  OE2   . GLU A 1  724  ? -13.549 -10.572 -17.893 1.00 101.12 ? 724  GLU A OE2   1 
ATOM   5295  N  N     . TYR A 1  725  ? -14.643 -5.703  -20.863 1.00 97.84  ? 725  TYR A N     1 
ATOM   5296  C  CA    . TYR A 1  725  ? -14.619 -4.259  -21.096 1.00 98.17  ? 725  TYR A CA    1 
ATOM   5297  C  C     . TYR A 1  725  ? -14.571 -3.577  -19.735 1.00 99.66  ? 725  TYR A C     1 
ATOM   5298  O  O     . TYR A 1  725  ? -15.315 -3.962  -18.836 1.00 99.97  ? 725  TYR A O     1 
ATOM   5299  C  CB    . TYR A 1  725  ? -15.859 -3.827  -21.879 1.00 96.86  ? 725  TYR A CB    1 
ATOM   5300  C  CG    . TYR A 1  725  ? -15.773 -2.430  -22.443 1.00 97.35  ? 725  TYR A CG    1 
ATOM   5301  C  CD1   . TYR A 1  725  ? -15.084 -2.176  -23.628 1.00 96.44  ? 725  TYR A CD1   1 
ATOM   5302  C  CD2   . TYR A 1  725  ? -16.377 -1.357  -21.793 1.00 98.67  ? 725  TYR A CD2   1 
ATOM   5303  C  CE1   . TYR A 1  725  ? -15.003 -0.895  -24.151 1.00 96.93  ? 725  TYR A CE1   1 
ATOM   5304  C  CE2   . TYR A 1  725  ? -16.300 -0.070  -22.308 1.00 99.39  ? 725  TYR A CE2   1 
ATOM   5305  C  CZ    . TYR A 1  725  ? -15.610 0.154   -23.489 1.00 98.54  ? 725  TYR A CZ    1 
ATOM   5306  O  OH    . TYR A 1  725  ? -15.525 1.425   -24.010 1.00 99.35  ? 725  TYR A OH    1 
ATOM   5307  N  N     . GLY A 1  726  ? -13.683 -2.594  -19.576 1.00 100.94 ? 726  GLY A N     1 
ATOM   5308  C  CA    . GLY A 1  726  ? -13.489 -1.919  -18.290 1.00 102.88 ? 726  GLY A CA    1 
ATOM   5309  C  C     . GLY A 1  726  ? -12.999 -2.860  -17.197 1.00 104.20 ? 726  GLY A C     1 
ATOM   5310  O  O     . GLY A 1  726  ? -12.277 -3.819  -17.474 1.00 104.54 ? 726  GLY A O     1 
ATOM   5311  N  N     . ASN A 1  727  ? -13.394 -2.576  -15.956 1.00 105.36 ? 727  ASN A N     1 
ATOM   5312  C  CA    . ASN A 1  727  ? -13.101 -3.435  -14.806 1.00 106.35 ? 727  ASN A CA    1 
ATOM   5313  C  C     . ASN A 1  727  ? -14.380 -3.662  -13.999 1.00 106.32 ? 727  ASN A C     1 
ATOM   5314  O  O     . ASN A 1  727  ? -14.846 -2.769  -13.285 1.00 107.59 ? 727  ASN A O     1 
ATOM   5315  C  CB    . ASN A 1  727  ? -12.007 -2.810  -13.937 1.00 108.78 ? 727  ASN A CB    1 
ATOM   5316  C  CG    . ASN A 1  727  ? -11.556 -3.728  -12.813 1.00 110.01 ? 727  ASN A CG    1 
ATOM   5317  O  OD1   . ASN A 1  727  ? -12.308 -4.000  -11.876 1.00 110.48 ? 727  ASN A OD1   1 
ATOM   5318  N  ND2   . ASN A 1  727  ? -10.321 -4.200  -12.895 1.00 110.85 ? 727  ASN A ND2   1 
ATOM   5319  N  N     . VAL A 1  728  ? -14.937 -4.863  -14.116 1.00 105.05 ? 728  VAL A N     1 
ATOM   5320  C  CA    . VAL A 1  728  ? -16.224 -5.184  -13.502 1.00 104.87 ? 728  VAL A CA    1 
ATOM   5321  C  C     . VAL A 1  728  ? -16.149 -5.305  -11.976 1.00 106.29 ? 728  VAL A C     1 
ATOM   5322  O  O     . VAL A 1  728  ? -17.082 -4.910  -11.283 1.00 106.57 ? 728  VAL A O     1 
ATOM   5323  C  CB    . VAL A 1  728  ? -16.849 -6.457  -14.136 1.00 103.52 ? 728  VAL A CB    1 
ATOM   5324  C  CG1   . VAL A 1  728  ? -16.165 -7.736  -13.652 1.00 104.37 ? 728  VAL A CG1   1 
ATOM   5325  C  CG2   . VAL A 1  728  ? -18.350 -6.506  -13.878 1.00 102.88 ? 728  VAL A CG2   1 
ATOM   5326  N  N     . ASP A 1  729  ? -15.036 -5.826  -11.463 1.00 107.81 ? 729  ASP A N     1 
ATOM   5327  C  CA    . ASP A 1  729  ? -14.889 -6.093  -10.025 1.00 109.66 ? 729  ASP A CA    1 
ATOM   5328  C  C     . ASP A 1  729  ? -14.739 -4.820  -9.193  1.00 111.43 ? 729  ASP A C     1 
ATOM   5329  O  O     . ASP A 1  729  ? -15.264 -4.744  -8.077  1.00 112.68 ? 729  ASP A O     1 
ATOM   5330  C  CB    . ASP A 1  729  ? -13.710 -7.038  -9.770  1.00 110.71 ? 729  ASP A CB    1 
ATOM   5331  C  CG    . ASP A 1  729  ? -13.918 -8.406  -10.394 1.00 108.91 ? 729  ASP A CG    1 
ATOM   5332  O  OD1   . ASP A 1  729  ? -14.940 -9.050  -10.084 1.00 108.07 ? 729  ASP A OD1   1 
ATOM   5333  O  OD2   . ASP A 1  729  ? -13.063 -8.835  -11.195 1.00 108.47 ? 729  ASP A OD2   1 
ATOM   5334  N  N     . GLU A 1  730  ? -14.025 -3.831  -9.730  1.00 111.49 ? 730  GLU A N     1 
ATOM   5335  C  CA    . GLU A 1  730  ? -13.948 -2.505  -9.102  1.00 113.15 ? 730  GLU A CA    1 
ATOM   5336  C  C     . GLU A 1  730  ? -15.267 -1.740  -9.204  1.00 112.18 ? 730  GLU A C     1 
ATOM   5337  O  O     . GLU A 1  730  ? -15.622 -0.994  -8.290  1.00 113.91 ? 730  GLU A O     1 
ATOM   5338  C  CB    . GLU A 1  730  ? -12.800 -1.673  -9.698  1.00 113.70 ? 730  GLU A CB    1 
ATOM   5339  C  CG    . GLU A 1  730  ? -11.413 -2.151  -9.290  1.00 115.08 ? 730  GLU A CG    1 
ATOM   5340  C  CD    . GLU A 1  730  ? -11.221 -2.184  -7.781  1.00 117.32 ? 730  GLU A CD    1 
ATOM   5341  O  OE1   . GLU A 1  730  ? -11.572 -1.192  -7.108  1.00 118.09 ? 730  GLU A OE1   1 
ATOM   5342  O  OE2   . GLU A 1  730  ? -10.733 -3.210  -7.265  1.00 118.02 ? 730  GLU A OE2   1 
ATOM   5343  N  N     . ALA A 1  731  ? -15.988 -1.933  -10.306 1.00 109.75 ? 731  ALA A N     1 
ATOM   5344  C  CA    . ALA A 1  731  ? -17.294 -1.300  -10.506 1.00 108.65 ? 731  ALA A CA    1 
ATOM   5345  C  C     . ALA A 1  731  ? -18.350 -1.740  -9.479  1.00 108.82 ? 731  ALA A C     1 
ATOM   5346  O  O     . ALA A 1  731  ? -19.146 -0.913  -9.034  1.00 109.70 ? 731  ALA A O     1 
ATOM   5347  C  CB    . ALA A 1  731  ? -17.790 -1.557  -11.919 1.00 106.12 ? 731  ALA A CB    1 
ATOM   5348  N  N     . PHE A 1  732  ? -18.351 -3.024  -9.107  1.00 108.26 ? 732  PHE A N     1 
ATOM   5349  C  CA    . PHE A 1  732  ? -19.282 -3.547  -8.078  1.00 108.40 ? 732  PHE A CA    1 
ATOM   5350  C  C     . PHE A 1  732  ? -19.122 -2.905  -6.680  1.00 110.41 ? 732  PHE A C     1 
ATOM   5351  O  O     . PHE A 1  732  ? -20.083 -2.854  -5.905  1.00 109.57 ? 732  PHE A O     1 
ATOM   5352  C  CB    . PHE A 1  732  ? -19.174 -5.084  -7.949  1.00 107.61 ? 732  PHE A CB    1 
ATOM   5353  C  CG    . PHE A 1  732  ? -19.953 -5.852  -8.991  1.00 104.89 ? 732  PHE A CG    1 
ATOM   5354  C  CD1   . PHE A 1  732  ? -21.341 -5.735  -9.073  1.00 103.59 ? 732  PHE A CD1   1 
ATOM   5355  C  CD2   . PHE A 1  732  ? -19.307 -6.725  -9.866  1.00 103.62 ? 732  PHE A CD2   1 
ATOM   5356  C  CE1   . PHE A 1  732  ? -22.062 -6.450  -10.025 1.00 101.07 ? 732  PHE A CE1   1 
ATOM   5357  C  CE2   . PHE A 1  732  ? -20.026 -7.442  -10.816 1.00 100.98 ? 732  PHE A CE2   1 
ATOM   5358  C  CZ    . PHE A 1  732  ? -21.403 -7.304  -10.895 1.00 99.75  ? 732  PHE A CZ    1 
ATOM   5359  N  N     . LYS A 1  733  ? -17.920 -2.431  -6.360  1.00 112.13 ? 733  LYS A N     1 
ATOM   5360  C  CA    . LYS A 1  733  ? -17.666 -1.755  -5.081  1.00 115.14 ? 733  LYS A CA    1 
ATOM   5361  C  C     . LYS A 1  733  ? -18.275 -0.345  -4.971  1.00 115.90 ? 733  LYS A C     1 
ATOM   5362  O  O     . LYS A 1  733  ? -18.474 0.141   -3.854  1.00 117.33 ? 733  LYS A O     1 
ATOM   5363  C  CB    . LYS A 1  733  ? -16.158 -1.691  -4.800  1.00 117.15 ? 733  LYS A CB    1 
ATOM   5364  C  CG    . LYS A 1  733  ? -15.524 -3.051  -4.551  1.00 117.45 ? 733  LYS A CG    1 
ATOM   5365  C  CD    . LYS A 1  733  ? -14.006 -2.973  -4.499  1.00 119.19 ? 733  LYS A CD    1 
ATOM   5366  C  CE    . LYS A 1  733  ? -13.393 -4.338  -4.223  1.00 119.38 ? 733  LYS A CE    1 
ATOM   5367  N  NZ    . LYS A 1  733  ? -11.912 -4.345  -4.374  1.00 120.74 ? 733  LYS A NZ    1 
ATOM   5368  N  N     . VAL A 1  734  ? -18.573 0.297   -6.109  1.00 114.78 ? 734  VAL A N     1 
ATOM   5369  C  CA    . VAL A 1  734  ? -19.021 1.706   -6.147  1.00 115.41 ? 734  VAL A CA    1 
ATOM   5370  C  C     . VAL A 1  734  ? -20.445 1.882   -6.720  1.00 113.14 ? 734  VAL A C     1 
ATOM   5371  O  O     . VAL A 1  734  ? -20.750 2.929   -7.302  1.00 113.28 ? 734  VAL A O     1 
ATOM   5372  C  CB    . VAL A 1  734  ? -18.022 2.589   -6.960  1.00 116.06 ? 734  VAL A CB    1 
ATOM   5373  C  CG1   . VAL A 1  734  ? -18.194 4.079   -6.633  1.00 117.93 ? 734  VAL A CG1   1 
ATOM   5374  C  CG2   . VAL A 1  734  ? -16.578 2.151   -6.719  1.00 117.42 ? 734  VAL A CG2   1 
ATOM   5375  N  N     . VAL A 1  735  ? -21.317 0.884   -6.539  1.00 111.15 ? 735  VAL A N     1 
ATOM   5376  C  CA    . VAL A 1  735  ? -22.698 0.940   -7.073  1.00 108.56 ? 735  VAL A CA    1 
ATOM   5377  C  C     . VAL A 1  735  ? -23.759 0.945   -5.970  1.00 108.66 ? 735  VAL A C     1 
ATOM   5378  O  O     . VAL A 1  735  ? -23.549 0.379   -4.897  1.00 109.69 ? 735  VAL A O     1 
ATOM   5379  C  CB    . VAL A 1  735  ? -23.001 -0.179  -8.106  1.00 105.53 ? 735  VAL A CB    1 
ATOM   5380  C  CG1   . VAL A 1  735  ? -22.266 0.096   -9.413  1.00 104.21 ? 735  VAL A CG1   1 
ATOM   5381  C  CG2   . VAL A 1  735  ? -22.662 -1.561  -7.561  1.00 105.55 ? 735  VAL A CG2   1 
ATOM   5382  N  N     . ASP A 1  736  ? -24.897 1.578   -6.257  1.00 107.30 ? 736  ASP A N     1 
ATOM   5383  C  CA    . ASP A 1  736  ? -25.968 1.761   -5.272  1.00 108.10 ? 736  ASP A CA    1 
ATOM   5384  C  C     . ASP A 1  736  ? -26.643 0.445   -4.886  1.00 107.38 ? 736  ASP A C     1 
ATOM   5385  O  O     . ASP A 1  736  ? -26.919 0.215   -3.710  1.00 109.26 ? 736  ASP A O     1 
ATOM   5386  C  CB    . ASP A 1  736  ? -27.032 2.746   -5.784  1.00 107.30 ? 736  ASP A CB    1 
ATOM   5387  C  CG    . ASP A 1  736  ? -26.504 4.168   -5.945  1.00 108.60 ? 736  ASP A CG    1 
ATOM   5388  O  OD1   . ASP A 1  736  ? -25.611 4.586   -5.179  1.00 110.56 ? 736  ASP A OD1   1 
ATOM   5389  O  OD2   . ASP A 1  736  ? -27.002 4.884   -6.837  1.00 107.58 ? 736  ASP A OD2   1 
ATOM   5390  N  N     . GLN A 1  737  ? -26.916 -0.401  -5.878  1.00 105.42 ? 737  GLN A N     1 
ATOM   5391  C  CA    . GLN A 1  737  ? -27.566 -1.696  -5.663  1.00 104.45 ? 737  GLN A CA    1 
ATOM   5392  C  C     . GLN A 1  737  ? -26.944 -2.785  -6.543  1.00 103.62 ? 737  GLN A C     1 
ATOM   5393  O  O     . GLN A 1  737  ? -26.464 -2.505  -7.649  1.00 102.25 ? 737  GLN A O     1 
ATOM   5394  C  CB    . GLN A 1  737  ? -29.052 -1.609  -6.007  1.00 102.89 ? 737  GLN A CB    1 
ATOM   5395  C  CG    . GLN A 1  737  ? -29.882 -0.616  -5.211  1.00 103.72 ? 737  GLN A CG    1 
ATOM   5396  C  CD    . GLN A 1  737  ? -31.266 -0.441  -5.815  1.00 101.89 ? 737  GLN A CD    1 
ATOM   5397  O  OE1   . GLN A 1  737  ? -32.106 -1.341  -5.748  1.00 100.32 ? 737  GLN A OE1   1 
ATOM   5398  N  NE2   . GLN A 1  737  ? -31.505 0.715   -6.424  1.00 101.61 ? 737  GLN A NE2   1 
ATOM   5399  N  N     . ILE A 1  738  ? -26.975 -4.021  -6.043  1.00 104.04 ? 738  ILE A N     1 
ATOM   5400  C  CA    . ILE A 1  738  ? -26.563 -5.214  -6.790  1.00 102.18 ? 738  ILE A CA    1 
ATOM   5401  C  C     . ILE A 1  738  ? -27.772 -6.148  -6.914  1.00 100.89 ? 738  ILE A C     1 
ATOM   5402  O  O     . ILE A 1  738  ? -28.569 -6.280  -5.985  1.00 100.98 ? 738  ILE A O     1 
ATOM   5403  C  CB    . ILE A 1  738  ? -25.354 -5.915  -6.123  1.00 103.37 ? 738  ILE A CB    1 
ATOM   5404  C  CG1   . ILE A 1  738  ? -24.106 -5.029  -6.267  1.00 104.23 ? 738  ILE A CG1   1 
ATOM   5405  C  CG2   . ILE A 1  738  ? -25.100 -7.298  -6.728  1.00 102.02 ? 738  ILE A CG2   1 
ATOM   5406  C  CD1   . ILE A 1  738  ? -22.897 -5.499  -5.484  1.00 105.86 ? 738  ILE A CD1   1 
ATOM   5407  N  N     . LEU A 1  739  ? -27.887 -6.793  -8.072  1.00 99.73  ? 739  LEU A N     1 
ATOM   5408  C  CA    . LEU A 1  739  ? -29.067 -7.561  -8.446  1.00 98.63  ? 739  LEU A CA    1 
ATOM   5409  C  C     . LEU A 1  739  ? -28.644 -8.808  -9.207  1.00 97.32  ? 739  LEU A C     1 
ATOM   5410  O  O     . LEU A 1  739  ? -27.944 -8.704  -10.214 1.00 96.48  ? 739  LEU A O     1 
ATOM   5411  C  CB    . LEU A 1  739  ? -29.949 -6.680  -9.331  1.00 98.35  ? 739  LEU A CB    1 
ATOM   5412  C  CG    . LEU A 1  739  ? -31.092 -7.263  -10.171 1.00 97.36  ? 739  LEU A CG    1 
ATOM   5413  C  CD1   . LEU A 1  739  ? -32.331 -7.468  -9.310  1.00 98.46  ? 739  LEU A CD1   1 
ATOM   5414  C  CD2   . LEU A 1  739  ? -31.391 -6.339  -11.343 1.00 96.10  ? 739  LEU A CD2   1 
ATOM   5415  N  N     . GLU A 1  740  ? -29.065 -9.976  -8.722  1.00 97.31  ? 740  GLU A N     1 
ATOM   5416  C  CA    . GLU A 1  740  ? -28.901 -11.233 -9.454  1.00 96.12  ? 740  GLU A CA    1 
ATOM   5417  C  C     . GLU A 1  740  ? -30.249 -11.700 -9.999  1.00 94.65  ? 740  GLU A C     1 
ATOM   5418  O  O     . GLU A 1  740  ? -31.296 -11.503 -9.375  1.00 94.49  ? 740  GLU A O     1 
ATOM   5419  C  CB    . GLU A 1  740  ? -28.291 -12.321 -8.563  1.00 97.52  ? 740  GLU A CB    1 
ATOM   5420  C  CG    . GLU A 1  740  ? -26.805 -12.128 -8.284  1.00 99.20  ? 740  GLU A CG    1 
ATOM   5421  C  CD    . GLU A 1  740  ? -26.171 -13.291 -7.536  1.00 100.05 ? 740  GLU A CD    1 
ATOM   5422  O  OE1   . GLU A 1  740  ? -26.475 -14.461 -7.852  1.00 98.85  ? 740  GLU A OE1   1 
ATOM   5423  O  OE2   . GLU A 1  740  ? -25.351 -13.035 -6.630  1.00 102.07 ? 740  GLU A OE2   1 
ATOM   5424  N  N     . GLY A 1  741  ? -30.211 -12.321 -11.173 1.00 93.23  ? 741  GLY A N     1 
ATOM   5425  C  CA    . GLY A 1  741  ? -31.411 -12.868 -11.793 1.00 91.92  ? 741  GLY A CA    1 
ATOM   5426  C  C     . GLY A 1  741  ? -31.073 -13.695 -13.013 1.00 90.34  ? 741  GLY A C     1 
ATOM   5427  O  O     . GLY A 1  741  ? -29.938 -13.668 -13.493 1.00 90.96  ? 741  GLY A O     1 
ATOM   5428  N  N     . GLU A 1  742  ? -32.064 -14.427 -13.512 1.00 88.73  ? 742  GLU A N     1 
ATOM   5429  C  CA    . GLU A 1  742  ? -31.886 -15.256 -14.700 1.00 86.71  ? 742  GLU A CA    1 
ATOM   5430  C  C     . GLU A 1  742  ? -33.177 -15.427 -15.480 1.00 84.52  ? 742  GLU A C     1 
ATOM   5431  O  O     . GLU A 1  742  ? -34.265 -15.140 -14.976 1.00 84.93  ? 742  GLU A O     1 
ATOM   5432  C  CB    . GLU A 1  742  ? -31.325 -16.629 -14.317 1.00 87.79  ? 742  GLU A CB    1 
ATOM   5433  C  CG    . GLU A 1  742  ? -32.177 -17.421 -13.334 1.00 89.01  ? 742  GLU A CG    1 
ATOM   5434  C  CD    . GLU A 1  742  ? -31.722 -18.862 -13.204 1.00 89.68  ? 742  GLU A CD    1 
ATOM   5435  O  OE1   . GLU A 1  742  ? -30.522 -19.083 -12.939 1.00 91.22  ? 742  GLU A OE1   1 
ATOM   5436  O  OE2   . GLU A 1  742  ? -32.562 -19.773 -13.361 1.00 89.42  ? 742  GLU A OE2   1 
ATOM   5437  N  N     . ILE A 1  743  ? -33.030 -15.904 -16.713 1.00 82.50  ? 743  ILE A N     1 
ATOM   5438  C  CA    . ILE A 1  743  ? -34.161 -16.194 -17.592 1.00 80.36  ? 743  ILE A CA    1 
ATOM   5439  C  C     . ILE A 1  743  ? -33.814 -17.349 -18.535 1.00 79.00  ? 743  ILE A C     1 
ATOM   5440  O  O     . ILE A 1  743  ? -32.724 -17.388 -19.113 1.00 78.77  ? 743  ILE A O     1 
ATOM   5441  C  CB    . ILE A 1  743  ? -34.606 -14.934 -18.383 1.00 79.45  ? 743  ILE A CB    1 
ATOM   5442  C  CG1   . ILE A 1  743  ? -35.845 -15.232 -19.231 1.00 78.22  ? 743  ILE A CG1   1 
ATOM   5443  C  CG2   . ILE A 1  743  ? -33.484 -14.382 -19.260 1.00 79.00  ? 743  ILE A CG2   1 
ATOM   5444  C  CD1   . ILE A 1  743  ? -36.523 -13.988 -19.764 1.00 78.11  ? 743  ILE A CD1   1 
ATOM   5445  N  N     . HIS A 1  744  ? -34.740 -18.298 -18.653 1.00 78.04  ? 744  HIS A N     1 
ATOM   5446  C  CA    . HIS A 1  744  ? -34.642 -19.375 -19.629 1.00 76.46  ? 744  HIS A CA    1 
ATOM   5447  C  C     . HIS A 1  744  ? -35.392 -18.955 -20.877 1.00 74.82  ? 744  HIS A C     1 
ATOM   5448  O  O     . HIS A 1  744  ? -36.384 -18.229 -20.790 1.00 75.53  ? 744  HIS A O     1 
ATOM   5449  C  CB    . HIS A 1  744  ? -35.258 -20.657 -19.085 1.00 77.10  ? 744  HIS A CB    1 
ATOM   5450  C  CG    . HIS A 1  744  ? -34.513 -21.233 -17.926 1.00 79.66  ? 744  HIS A CG    1 
ATOM   5451  N  ND1   . HIS A 1  744  ? -34.714 -20.810 -16.629 1.00 82.05  ? 744  HIS A ND1   1 
ATOM   5452  C  CD2   . HIS A 1  744  ? -33.566 -22.197 -17.868 1.00 80.51  ? 744  HIS A CD2   1 
ATOM   5453  C  CE1   . HIS A 1  744  ? -33.920 -21.489 -15.821 1.00 83.25  ? 744  HIS A CE1   1 
ATOM   5454  N  NE2   . HIS A 1  744  ? -33.213 -22.336 -16.547 1.00 83.02  ? 744  HIS A NE2   1 
ATOM   5455  N  N     . MET A 1  745  ? -34.917 -19.422 -22.029 1.00 72.73  ? 745  MET A N     1 
ATOM   5456  C  CA    . MET A 1  745  ? -35.538 -19.128 -23.314 1.00 69.96  ? 745  MET A CA    1 
ATOM   5457  C  C     . MET A 1  745  ? -35.639 -20.399 -24.145 1.00 68.27  ? 745  MET A C     1 
ATOM   5458  O  O     . MET A 1  745  ? -34.655 -21.111 -24.320 1.00 67.76  ? 745  MET A O     1 
ATOM   5459  C  CB    . MET A 1  745  ? -34.720 -18.085 -24.060 1.00 69.49  ? 745  MET A CB    1 
ATOM   5460  C  CG    . MET A 1  745  ? -35.337 -17.637 -25.369 1.00 67.75  ? 745  MET A CG    1 
ATOM   5461  S  SD    . MET A 1  745  ? -34.504 -16.173 -25.986 1.00 67.36  ? 745  MET A SD    1 
ATOM   5462  C  CE    . MET A 1  745  ? -35.260 -16.021 -27.604 1.00 65.27  ? 745  MET A CE    1 
ATOM   5463  N  N     . GLY A 1  746  ? -36.835 -20.667 -24.657 1.00 66.97  ? 746  GLY A N     1 
ATOM   5464  C  CA    . GLY A 1  746  ? -37.084 -21.833 -25.479 1.00 65.80  ? 746  GLY A CA    1 
ATOM   5465  C  C     . GLY A 1  746  ? -36.551 -21.688 -26.889 1.00 64.90  ? 746  GLY A C     1 
ATOM   5466  O  O     . GLY A 1  746  ? -36.219 -20.582 -27.346 1.00 64.87  ? 746  GLY A O     1 
ATOM   5467  N  N     . GLY A 1  747  ? -36.480 -22.819 -27.581 1.00 63.79  ? 747  GLY A N     1 
ATOM   5468  C  CA    . GLY A 1  747  ? -36.019 -22.866 -28.957 1.00 63.53  ? 747  GLY A CA    1 
ATOM   5469  C  C     . GLY A 1  747  ? -37.076 -22.388 -29.934 1.00 62.57  ? 747  GLY A C     1 
ATOM   5470  O  O     . GLY A 1  747  ? -37.938 -21.585 -29.593 1.00 62.92  ? 747  GLY A O     1 
ATOM   5471  N  N     . GLN A 1  748  ? -36.990 -22.879 -31.162 1.00 62.08  ? 748  GLN A N     1 
ATOM   5472  C  CA    . GLN A 1  748  ? -37.913 -22.487 -32.221 1.00 61.11  ? 748  GLN A CA    1 
ATOM   5473  C  C     . GLN A 1  748  ? -37.715 -23.398 -33.423 1.00 61.81  ? 748  GLN A C     1 
ATOM   5474  O  O     . GLN A 1  748  ? -36.584 -23.556 -33.891 1.00 61.48  ? 748  GLN A O     1 
ATOM   5475  C  CB    . GLN A 1  748  ? -37.653 -21.039 -32.645 1.00 59.64  ? 748  GLN A CB    1 
ATOM   5476  C  CG    . GLN A 1  748  ? -38.810 -20.409 -33.395 1.00 58.52  ? 748  GLN A CG    1 
ATOM   5477  C  CD    . GLN A 1  748  ? -38.553 -18.965 -33.783 1.00 58.10  ? 748  GLN A CD    1 
ATOM   5478  O  OE1   . GLN A 1  748  ? -37.412 -18.502 -33.795 1.00 58.89  ? 748  GLN A OE1   1 
ATOM   5479  N  NE2   . GLN A 1  748  ? -39.620 -18.240 -34.100 1.00 57.39  ? 748  GLN A NE2   1 
ATOM   5480  N  N     . GLU A 1  749  ? -38.790 -24.014 -33.913 1.00 63.15  ? 749  GLU A N     1 
ATOM   5481  C  CA    . GLU A 1  749  ? -38.723 -24.705 -35.203 1.00 64.49  ? 749  GLU A CA    1 
ATOM   5482  C  C     . GLU A 1  749  ? -38.718 -23.686 -36.324 1.00 62.14  ? 749  GLU A C     1 
ATOM   5483  O  O     . GLU A 1  749  ? -39.342 -22.629 -36.217 1.00 61.70  ? 749  GLU A O     1 
ATOM   5484  C  CB    . GLU A 1  749  ? -39.866 -25.716 -35.409 1.00 66.88  ? 749  GLU A CB    1 
ATOM   5485  C  CG    . GLU A 1  749  ? -39.506 -27.146 -35.015 1.00 70.34  ? 749  GLU A CG    1 
ATOM   5486  C  CD    . GLU A 1  749  ? -38.313 -27.736 -35.780 1.00 72.84  ? 749  GLU A CD    1 
ATOM   5487  O  OE1   . GLU A 1  749  ? -37.981 -27.279 -36.912 1.00 72.48  ? 749  GLU A OE1   1 
ATOM   5488  O  OE2   . GLU A 1  749  ? -37.696 -28.678 -35.228 1.00 75.87  ? 749  GLU A OE2   1 
ATOM   5489  N  N     . HIS A 1  750  ? -38.002 -24.016 -37.395 1.00 60.57  ? 750  HIS A N     1 
ATOM   5490  C  CA    . HIS A 1  750  ? -37.885 -23.138 -38.551 1.00 58.73  ? 750  HIS A CA    1 
ATOM   5491  C  C     . HIS A 1  750  ? -39.250 -22.967 -39.180 1.00 56.91  ? 750  HIS A C     1 
ATOM   5492  O  O     . HIS A 1  750  ? -39.654 -21.851 -39.496 1.00 56.07  ? 750  HIS A O     1 
ATOM   5493  C  CB    . HIS A 1  750  ? -36.879 -23.684 -39.565 1.00 58.80  ? 750  HIS A CB    1 
ATOM   5494  C  CG    . HIS A 1  750  ? -35.501 -23.851 -39.008 1.00 60.23  ? 750  HIS A CG    1 
ATOM   5495  N  ND1   . HIS A 1  750  ? -35.052 -25.047 -38.490 1.00 61.91  ? 750  HIS A ND1   1 
ATOM   5496  C  CD2   . HIS A 1  750  ? -34.484 -22.971 -38.862 1.00 61.21  ? 750  HIS A CD2   1 
ATOM   5497  C  CE1   . HIS A 1  750  ? -33.815 -24.896 -38.051 1.00 62.34  ? 750  HIS A CE1   1 
ATOM   5498  N  NE2   . HIS A 1  750  ? -33.444 -23.646 -38.267 1.00 62.31  ? 750  HIS A NE2   1 
ATOM   5499  N  N     . PHE A 1  751  ? -39.961 -24.082 -39.322 1.00 55.85  ? 751  PHE A N     1 
ATOM   5500  C  CA    . PHE A 1  751  ? -41.263 -24.127 -39.982 1.00 55.71  ? 751  PHE A CA    1 
ATOM   5501  C  C     . PHE A 1  751  ? -41.269 -23.395 -41.332 1.00 53.96  ? 751  PHE A C     1 
ATOM   5502  O  O     . PHE A 1  751  ? -42.174 -22.634 -41.654 1.00 53.79  ? 751  PHE A O     1 
ATOM   5503  C  CB    . PHE A 1  751  ? -42.384 -23.645 -39.037 1.00 57.30  ? 751  PHE A CB    1 
ATOM   5504  C  CG    . PHE A 1  751  ? -43.603 -24.533 -39.047 1.00 57.31  ? 751  PHE A CG    1 
ATOM   5505  C  CD1   . PHE A 1  751  ? -44.427 -24.590 -40.161 1.00 57.20  ? 751  PHE A CD1   1 
ATOM   5506  C  CD2   . PHE A 1  751  ? -43.908 -25.332 -37.950 1.00 58.76  ? 751  PHE A CD2   1 
ATOM   5507  C  CE1   . PHE A 1  751  ? -45.542 -25.418 -40.182 1.00 57.78  ? 751  PHE A CE1   1 
ATOM   5508  C  CE2   . PHE A 1  751  ? -45.023 -26.160 -37.961 1.00 59.22  ? 751  PHE A CE2   1 
ATOM   5509  C  CZ    . PHE A 1  751  ? -45.842 -26.203 -39.079 1.00 58.50  ? 751  PHE A CZ    1 
ATOM   5510  N  N     . TYR A 1  752  ? -40.215 -23.623 -42.104 1.00 53.86  ? 752  TYR A N     1 
ATOM   5511  C  CA    . TYR A 1  752  ? -40.257 -23.418 -43.545 1.00 53.37  ? 752  TYR A CA    1 
ATOM   5512  C  C     . TYR A 1  752  ? -41.446 -24.231 -44.078 1.00 53.36  ? 752  TYR A C     1 
ATOM   5513  O  O     . TYR A 1  752  ? -41.662 -25.370 -43.655 1.00 51.82  ? 752  TYR A O     1 
ATOM   5514  C  CB    . TYR A 1  752  ? -38.935 -23.838 -44.217 1.00 52.15  ? 752  TYR A CB    1 
ATOM   5515  C  CG    . TYR A 1  752  ? -38.197 -25.005 -43.565 1.00 51.71  ? 752  TYR A CG    1 
ATOM   5516  C  CD1   . TYR A 1  752  ? -38.731 -26.295 -43.560 1.00 51.56  ? 752  TYR A CD1   1 
ATOM   5517  C  CD2   . TYR A 1  752  ? -36.968 -24.814 -42.950 1.00 51.69  ? 752  TYR A CD2   1 
ATOM   5518  C  CE1   . TYR A 1  752  ? -38.060 -27.353 -42.970 1.00 51.42  ? 752  TYR A CE1   1 
ATOM   5519  C  CE2   . TYR A 1  752  ? -36.291 -25.866 -42.355 1.00 52.29  ? 752  TYR A CE2   1 
ATOM   5520  C  CZ    . TYR A 1  752  ? -36.842 -27.132 -42.366 1.00 52.17  ? 752  TYR A CZ    1 
ATOM   5521  O  OH    . TYR A 1  752  ? -36.168 -28.174 -41.777 1.00 52.98  ? 752  TYR A OH    1 
ATOM   5522  N  N     . MET A 1  753  ? -42.253 -23.625 -44.945 1.00 54.36  ? 753  MET A N     1 
ATOM   5523  C  CA    . MET A 1  753  ? -43.463 -24.295 -45.431 1.00 55.83  ? 753  MET A CA    1 
ATOM   5524  C  C     . MET A 1  753  ? -43.125 -25.475 -46.353 1.00 54.28  ? 753  MET A C     1 
ATOM   5525  O  O     . MET A 1  753  ? -43.819 -26.495 -46.327 1.00 53.30  ? 753  MET A O     1 
ATOM   5526  C  CB    . MET A 1  753  ? -44.425 -23.307 -46.111 1.00 57.86  ? 753  MET A CB    1 
ATOM   5527  C  CG    . MET A 1  753  ? -45.182 -22.379 -45.159 1.00 60.16  ? 753  MET A CG    1 
ATOM   5528  S  SD    . MET A 1  753  ? -46.101 -23.132 -43.790 1.00 62.07  ? 753  MET A SD    1 
ATOM   5529  C  CE    . MET A 1  753  ? -47.059 -24.378 -44.643 1.00 61.66  ? 753  MET A CE    1 
ATOM   5530  N  N     . GLU A 1  754  ? -42.065 -25.333 -47.152 1.00 52.93  ? 754  GLU A N     1 
ATOM   5531  C  CA    . GLU A 1  754  ? -41.498 -26.452 -47.905 1.00 51.77  ? 754  GLU A CA    1 
ATOM   5532  C  C     . GLU A 1  754  ? -40.598 -27.274 -46.985 1.00 51.22  ? 754  GLU A C     1 
ATOM   5533  O  O     . GLU A 1  754  ? -39.559 -26.784 -46.546 1.00 50.85  ? 754  GLU A O     1 
ATOM   5534  C  CB    . GLU A 1  754  ? -40.683 -25.940 -49.097 1.00 51.32  ? 754  GLU A CB    1 
ATOM   5535  C  CG    . GLU A 1  754  ? -40.134 -27.042 -50.000 1.00 50.99  ? 754  GLU A CG    1 
ATOM   5536  C  CD    . GLU A 1  754  ? -39.026 -26.581 -50.929 1.00 51.17  ? 754  GLU A CD    1 
ATOM   5537  O  OE1   . GLU A 1  754  ? -38.230 -25.703 -50.530 1.00 50.75  ? 754  GLU A OE1   1 
ATOM   5538  O  OE2   . GLU A 1  754  ? -38.940 -27.114 -52.061 1.00 51.53  ? 754  GLU A OE2   1 
ATOM   5539  N  N     . THR A 1  755  ? -40.981 -28.521 -46.716 1.00 50.89  ? 755  THR A N     1 
ATOM   5540  C  CA    . THR A 1  755  ? -40.150 -29.430 -45.921 1.00 51.35  ? 755  THR A CA    1 
ATOM   5541  C  C     . THR A 1  755  ? -38.885 -29.825 -46.682 1.00 51.50  ? 755  THR A C     1 
ATOM   5542  O  O     . THR A 1  755  ? -38.765 -29.567 -47.883 1.00 51.97  ? 755  THR A O     1 
ATOM   5543  C  CB    . THR A 1  755  ? -40.905 -30.716 -45.528 1.00 51.38  ? 755  THR A CB    1 
ATOM   5544  O  OG1   . THR A 1  755  ? -41.353 -31.395 -46.706 1.00 50.74  ? 755  THR A OG1   1 
ATOM   5545  C  CG2   . THR A 1  755  ? -42.098 -30.393 -44.632 1.00 52.18  ? 755  THR A CG2   1 
ATOM   5546  N  N     . GLN A 1  756  ? -37.948 -30.449 -45.970 1.00 52.02  ? 756  GLN A N     1 
ATOM   5547  C  CA    . GLN A 1  756  ? -36.681 -30.903 -46.544 1.00 51.71  ? 756  GLN A CA    1 
ATOM   5548  C  C     . GLN A 1  756  ? -36.980 -31.733 -47.785 1.00 51.78  ? 756  GLN A C     1 
ATOM   5549  O  O     . GLN A 1  756  ? -37.711 -32.723 -47.705 1.00 50.87  ? 756  GLN A O     1 
ATOM   5550  C  CB    . GLN A 1  756  ? -35.903 -31.754 -45.541 1.00 52.33  ? 756  GLN A CB    1 
ATOM   5551  C  CG    . GLN A 1  756  ? -35.372 -31.011 -44.318 1.00 53.43  ? 756  GLN A CG    1 
ATOM   5552  C  CD    . GLN A 1  756  ? -34.247 -30.035 -44.614 1.00 53.58  ? 756  GLN A CD    1 
ATOM   5553  O  OE1   . GLN A 1  756  ? -33.543 -30.144 -45.623 1.00 53.81  ? 756  GLN A OE1   1 
ATOM   5554  N  NE2   . GLN A 1  756  ? -34.071 -29.066 -43.721 1.00 53.97  ? 756  GLN A NE2   1 
ATOM   5555  N  N     . SER A 1  757  ? -36.446 -31.301 -48.926 1.00 51.82  ? 757  SER A N     1 
ATOM   5556  C  CA    . SER A 1  757  ? -36.762 -31.906 -50.219 1.00 51.48  ? 757  SER A CA    1 
ATOM   5557  C  C     . SER A 1  757  ? -35.522 -31.968 -51.113 1.00 51.88  ? 757  SER A C     1 
ATOM   5558  O  O     . SER A 1  757  ? -34.764 -30.996 -51.197 1.00 52.79  ? 757  SER A O     1 
ATOM   5559  C  CB    . SER A 1  757  ? -37.860 -31.095 -50.909 1.00 51.10  ? 757  SER A CB    1 
ATOM   5560  O  OG    . SER A 1  757  ? -39.024 -31.002 -50.101 1.00 50.63  ? 757  SER A OG    1 
ATOM   5561  N  N     . MET A 1  758  ? -35.312 -33.110 -51.769 1.00 52.36  ? 758  MET A N     1 
ATOM   5562  C  CA    . MET A 1  758  ? -34.217 -33.256 -52.737 1.00 52.42  ? 758  MET A CA    1 
ATOM   5563  C  C     . MET A 1  758  ? -34.447 -34.369 -53.755 1.00 52.48  ? 758  MET A C     1 
ATOM   5564  O  O     . MET A 1  758  ? -35.154 -35.348 -53.489 1.00 52.25  ? 758  MET A O     1 
ATOM   5565  C  CB    . MET A 1  758  ? -32.881 -33.474 -52.024 1.00 52.87  ? 758  MET A CB    1 
ATOM   5566  C  CG    . MET A 1  758  ? -32.832 -34.687 -51.113 1.00 53.66  ? 758  MET A CG    1 
ATOM   5567  S  SD    . MET A 1  758  ? -31.458 -34.607 -49.952 1.00 53.53  ? 758  MET A SD    1 
ATOM   5568  C  CE    . MET A 1  758  ? -32.050 -33.366 -48.805 1.00 54.28  ? 758  MET A CE    1 
ATOM   5569  N  N     . LEU A 1  759  ? -33.844 -34.185 -54.927 1.00 52.48  ? 759  LEU A N     1 
ATOM   5570  C  CA    . LEU A 1  759  ? -33.814 -35.189 -55.987 1.00 52.82  ? 759  LEU A CA    1 
ATOM   5571  C  C     . LEU A 1  759  ? -32.371 -35.344 -56.424 1.00 52.85  ? 759  LEU A C     1 
ATOM   5572  O  O     . LEU A 1  759  ? -31.715 -34.369 -56.795 1.00 52.68  ? 759  LEU A O     1 
ATOM   5573  C  CB    . LEU A 1  759  ? -34.668 -34.748 -57.167 1.00 52.82  ? 759  LEU A CB    1 
ATOM   5574  C  CG    . LEU A 1  759  ? -34.768 -35.677 -58.374 1.00 53.17  ? 759  LEU A CG    1 
ATOM   5575  C  CD1   . LEU A 1  759  ? -35.306 -37.043 -57.985 1.00 54.14  ? 759  LEU A CD1   1 
ATOM   5576  C  CD2   . LEU A 1  759  ? -35.671 -35.033 -59.407 1.00 53.39  ? 759  LEU A CD2   1 
ATOM   5577  N  N     . VAL A 1  760  ? -31.883 -36.574 -56.370 1.00 53.60  ? 760  VAL A N     1 
ATOM   5578  C  CA    . VAL A 1  760  ? -30.489 -36.872 -56.631 1.00 54.43  ? 760  VAL A CA    1 
ATOM   5579  C  C     . VAL A 1  760  ? -30.472 -37.762 -57.859 1.00 54.68  ? 760  VAL A C     1 
ATOM   5580  O  O     . VAL A 1  760  ? -31.013 -38.865 -57.821 1.00 55.40  ? 760  VAL A O     1 
ATOM   5581  C  CB    . VAL A 1  760  ? -29.867 -37.565 -55.407 1.00 55.29  ? 760  VAL A CB    1 
ATOM   5582  C  CG1   . VAL A 1  760  ? -28.399 -37.848 -55.630 1.00 55.70  ? 760  VAL A CG1   1 
ATOM   5583  C  CG2   . VAL A 1  760  ? -30.059 -36.699 -54.168 1.00 56.06  ? 760  VAL A CG2   1 
ATOM   5584  N  N     . VAL A 1  761  ? -29.887 -37.264 -58.950 1.00 55.39  ? 761  VAL A N     1 
ATOM   5585  C  CA    . VAL A 1  761  ? -29.948 -37.918 -60.268 1.00 54.94  ? 761  VAL A CA    1 
ATOM   5586  C  C     . VAL A 1  761  ? -28.540 -38.258 -60.765 1.00 55.45  ? 761  VAL A C     1 
ATOM   5587  O  O     . VAL A 1  761  ? -27.790 -37.351 -61.127 1.00 56.02  ? 761  VAL A O     1 
ATOM   5588  C  CB    . VAL A 1  761  ? -30.645 -37.014 -61.317 1.00 53.56  ? 761  VAL A CB    1 
ATOM   5589  C  CG1   . VAL A 1  761  ? -30.778 -37.737 -62.653 1.00 53.87  ? 761  VAL A CG1   1 
ATOM   5590  C  CG2   . VAL A 1  761  ? -32.011 -36.582 -60.821 1.00 53.53  ? 761  VAL A CG2   1 
ATOM   5591  N  N     . PRO A 1  762  ? -28.170 -39.559 -60.777 1.00 56.75  ? 762  PRO A N     1 
ATOM   5592  C  CA    . PRO A 1  762  ? -26.897 -39.959 -61.396 1.00 57.25  ? 762  PRO A CA    1 
ATOM   5593  C  C     . PRO A 1  762  ? -26.980 -39.904 -62.920 1.00 58.36  ? 762  PRO A C     1 
ATOM   5594  O  O     . PRO A 1  762  ? -28.005 -40.270 -63.490 1.00 59.30  ? 762  PRO A O     1 
ATOM   5595  C  CB    . PRO A 1  762  ? -26.713 -41.404 -60.921 1.00 57.52  ? 762  PRO A CB    1 
ATOM   5596  C  CG    . PRO A 1  762  ? -28.089 -41.899 -60.670 1.00 57.47  ? 762  PRO A CG    1 
ATOM   5597  C  CD    . PRO A 1  762  ? -28.884 -40.717 -60.201 1.00 56.83  ? 762  PRO A CD    1 
ATOM   5598  N  N     . LYS A 1  763  ? -25.910 -39.450 -63.566 1.00 60.62  ? 763  LYS A N     1 
ATOM   5599  C  CA    . LYS A 1  763  ? -25.890 -39.271 -65.020 1.00 62.65  ? 763  LYS A CA    1 
ATOM   5600  C  C     . LYS A 1  763  ? -25.622 -40.578 -65.765 1.00 62.04  ? 763  LYS A C     1 
ATOM   5601  O  O     . LYS A 1  763  ? -26.099 -40.760 -66.882 1.00 62.73  ? 763  LYS A O     1 
ATOM   5602  C  CB    . LYS A 1  763  ? -24.834 -38.228 -65.408 1.00 65.80  ? 763  LYS A CB    1 
ATOM   5603  C  CG    . LYS A 1  763  ? -24.945 -37.677 -66.825 1.00 69.71  ? 763  LYS A CG    1 
ATOM   5604  C  CD    . LYS A 1  763  ? -26.196 -36.830 -67.020 1.00 72.81  ? 763  LYS A CD    1 
ATOM   5605  C  CE    . LYS A 1  763  ? -26.129 -36.013 -68.305 1.00 76.45  ? 763  LYS A CE    1 
ATOM   5606  N  NZ    . LYS A 1  763  ? -25.969 -36.863 -69.524 1.00 78.68  ? 763  LYS A NZ    1 
ATOM   5607  N  N     . GLY A 1  764  ? -24.851 -41.472 -65.149 1.00 61.53  ? 764  GLY A N     1 
ATOM   5608  C  CA    . GLY A 1  764  ? -24.461 -42.741 -65.765 1.00 60.86  ? 764  GLY A CA    1 
ATOM   5609  C  C     . GLY A 1  764  ? -23.208 -42.663 -66.618 1.00 60.35  ? 764  GLY A C     1 
ATOM   5610  O  O     . GLY A 1  764  ? -23.032 -43.479 -67.525 1.00 62.45  ? 764  GLY A O     1 
ATOM   5611  N  N     . GLU A 1  765  ? -22.350 -41.680 -66.328 1.00 58.75  ? 765  GLU A N     1 
ATOM   5612  C  CA    . GLU A 1  765  ? -21.057 -41.483 -66.996 1.00 57.82  ? 765  GLU A CA    1 
ATOM   5613  C  C     . GLU A 1  765  ? -20.096 -40.884 -65.994 1.00 57.54  ? 765  GLU A C     1 
ATOM   5614  O  O     . GLU A 1  765  ? -20.424 -39.868 -65.369 1.00 58.19  ? 765  GLU A O     1 
ATOM   5615  C  CB    . GLU A 1  765  ? -21.160 -40.484 -68.150 1.00 56.90  ? 765  GLU A CB    1 
ATOM   5616  C  CG    . GLU A 1  765  ? -21.740 -41.022 -69.443 1.00 56.67  ? 765  GLU A CG    1 
ATOM   5617  C  CD    . GLU A 1  765  ? -21.621 -40.045 -70.610 1.00 56.07  ? 765  GLU A CD    1 
ATOM   5618  O  OE1   . GLU A 1  765  ? -20.788 -39.113 -70.569 1.00 54.32  ? 765  GLU A OE1   1 
ATOM   5619  O  OE2   . GLU A 1  765  ? -22.373 -40.216 -71.592 1.00 56.18  ? 765  GLU A OE2   1 
ATOM   5620  N  N     . ASP A 1  766  ? -18.921 -41.493 -65.847 1.00 57.13  ? 766  ASP A N     1 
ATOM   5621  C  CA    . ASP A 1  766  ? -17.854 -40.984 -64.973 1.00 57.15  ? 766  ASP A CA    1 
ATOM   5622  C  C     . ASP A 1  766  ? -18.304 -40.729 -63.524 1.00 57.38  ? 766  ASP A C     1 
ATOM   5623  O  O     . ASP A 1  766  ? -17.735 -39.877 -62.835 1.00 57.82  ? 766  ASP A O     1 
ATOM   5624  C  CB    . ASP A 1  766  ? -17.248 -39.702 -65.568 1.00 57.25  ? 766  ASP A CB    1 
ATOM   5625  C  CG    . ASP A 1  766  ? -16.782 -39.881 -67.003 1.00 57.79  ? 766  ASP A CG    1 
ATOM   5626  O  OD1   . ASP A 1  766  ? -16.073 -40.866 -67.287 1.00 58.50  ? 766  ASP A OD1   1 
ATOM   5627  O  OD2   . ASP A 1  766  ? -17.115 -39.030 -67.849 1.00 58.22  ? 766  ASP A OD2   1 
ATOM   5628  N  N     . GLN A 1  767  ? -19.313 -41.476 -63.071 1.00 57.63  ? 767  GLN A N     1 
ATOM   5629  C  CA    . GLN A 1  767  ? -19.936 -41.292 -61.754 1.00 58.17  ? 767  GLN A CA    1 
ATOM   5630  C  C     . GLN A 1  767  ? -20.444 -39.873 -61.476 1.00 56.98  ? 767  GLN A C     1 
ATOM   5631  O  O     . GLN A 1  767  ? -20.380 -39.400 -60.343 1.00 57.69  ? 767  GLN A O     1 
ATOM   5632  C  CB    . GLN A 1  767  ? -18.976 -41.733 -60.648 1.00 60.28  ? 767  GLN A CB    1 
ATOM   5633  C  CG    . GLN A 1  767  ? -18.260 -43.036 -60.947 1.00 62.74  ? 767  GLN A CG    1 
ATOM   5634  C  CD    . GLN A 1  767  ? -17.529 -43.580 -59.745 1.00 64.44  ? 767  GLN A CD    1 
ATOM   5635  O  OE1   . GLN A 1  767  ? -16.296 -43.583 -59.708 1.00 65.01  ? 767  GLN A OE1   1 
ATOM   5636  N  NE2   . GLN A 1  767  ? -18.285 -44.030 -58.741 1.00 64.89  ? 767  GLN A NE2   1 
ATOM   5637  N  N     . GLU A 1  768  ? -20.963 -39.207 -62.502 1.00 55.97  ? 768  GLU A N     1 
ATOM   5638  C  CA    . GLU A 1  768  ? -21.495 -37.859 -62.335 1.00 56.08  ? 768  GLU A CA    1 
ATOM   5639  C  C     . GLU A 1  768  ? -22.833 -37.880 -61.612 1.00 56.53  ? 768  GLU A C     1 
ATOM   5640  O  O     . GLU A 1  768  ? -23.720 -38.651 -61.976 1.00 56.45  ? 768  GLU A O     1 
ATOM   5641  C  CB    . GLU A 1  768  ? -21.689 -37.172 -63.676 1.00 55.57  ? 768  GLU A CB    1 
ATOM   5642  C  CG    . GLU A 1  768  ? -20.412 -36.670 -64.305 1.00 55.46  ? 768  GLU A CG    1 
ATOM   5643  C  CD    . GLU A 1  768  ? -20.655 -36.053 -65.665 1.00 54.82  ? 768  GLU A CD    1 
ATOM   5644  O  OE1   . GLU A 1  768  ? -21.745 -35.484 -65.906 1.00 52.70  ? 768  GLU A OE1   1 
ATOM   5645  O  OE2   . GLU A 1  768  ? -19.746 -36.147 -66.511 1.00 54.92  ? 768  GLU A OE2   1 
ATOM   5646  N  N     . MET A 1  769  ? -22.957 -37.023 -60.600 1.00 57.64  ? 769  MET A N     1 
ATOM   5647  C  CA    . MET A 1  769  ? -24.213 -36.789 -59.894 1.00 58.18  ? 769  MET A CA    1 
ATOM   5648  C  C     . MET A 1  769  ? -24.687 -35.374 -60.152 1.00 55.31  ? 769  MET A C     1 
ATOM   5649  O  O     . MET A 1  769  ? -23.891 -34.438 -60.145 1.00 55.13  ? 769  MET A O     1 
ATOM   5650  C  CB    . MET A 1  769  ? -24.018 -36.937 -58.388 1.00 61.13  ? 769  MET A CB    1 
ATOM   5651  C  CG    . MET A 1  769  ? -23.646 -38.328 -57.914 1.00 64.42  ? 769  MET A CG    1 
ATOM   5652  S  SD    . MET A 1  769  ? -24.813 -39.658 -58.289 1.00 68.79  ? 769  MET A SD    1 
ATOM   5653  C  CE    . MET A 1  769  ? -26.372 -38.853 -57.984 1.00 66.47  ? 769  MET A CE    1 
ATOM   5654  N  N     . ASP A 1  770  ? -25.985 -35.232 -60.380 1.00 53.92  ? 770  ASP A N     1 
ATOM   5655  C  CA    . ASP A 1  770  ? -26.663 -33.950 -60.296 1.00 53.05  ? 770  ASP A CA    1 
ATOM   5656  C  C     . ASP A 1  770  ? -27.572 -34.004 -59.080 1.00 52.71  ? 770  ASP A C     1 
ATOM   5657  O  O     . ASP A 1  770  ? -28.369 -34.936 -58.933 1.00 52.33  ? 770  ASP A O     1 
ATOM   5658  C  CB    . ASP A 1  770  ? -27.463 -33.676 -61.562 1.00 52.63  ? 770  ASP A CB    1 
ATOM   5659  C  CG    . ASP A 1  770  ? -26.581 -33.290 -62.717 1.00 52.47  ? 770  ASP A CG    1 
ATOM   5660  O  OD1   . ASP A 1  770  ? -25.917 -32.237 -62.617 1.00 51.84  ? 770  ASP A OD1   1 
ATOM   5661  O  OD2   . ASP A 1  770  ? -26.541 -34.040 -63.712 1.00 52.51  ? 770  ASP A OD2   1 
ATOM   5662  N  N     . VAL A 1  771  ? -27.430 -33.012 -58.205 1.00 52.76  ? 771  VAL A N     1 
ATOM   5663  C  CA    . VAL A 1  771  ? -28.166 -32.955 -56.947 1.00 52.64  ? 771  VAL A CA    1 
ATOM   5664  C  C     . VAL A 1  771  ? -29.054 -31.713 -56.971 1.00 51.40  ? 771  VAL A C     1 
ATOM   5665  O  O     . VAL A 1  771  ? -28.552 -30.592 -57.009 1.00 51.17  ? 771  VAL A O     1 
ATOM   5666  C  CB    . VAL A 1  771  ? -27.197 -32.935 -55.744 1.00 53.31  ? 771  VAL A CB    1 
ATOM   5667  C  CG1   . VAL A 1  771  ? -27.959 -33.042 -54.426 1.00 54.01  ? 771  VAL A CG1   1 
ATOM   5668  C  CG2   . VAL A 1  771  ? -26.194 -34.074 -55.862 1.00 53.56  ? 771  VAL A CG2   1 
ATOM   5669  N  N     . TYR A 1  772  ? -30.369 -31.936 -56.989 1.00 50.37  ? 772  TYR A N     1 
ATOM   5670  C  CA    . TYR A 1  772  ? -31.370 -30.873 -56.921 1.00 50.12  ? 772  TYR A CA    1 
ATOM   5671  C  C     . TYR A 1  772  ? -31.912 -30.880 -55.507 1.00 50.64  ? 772  TYR A C     1 
ATOM   5672  O  O     . TYR A 1  772  ? -32.530 -31.858 -55.094 1.00 50.79  ? 772  TYR A O     1 
ATOM   5673  C  CB    . TYR A 1  772  ? -32.496 -31.120 -57.936 1.00 49.60  ? 772  TYR A CB    1 
ATOM   5674  C  CG    . TYR A 1  772  ? -31.965 -31.299 -59.335 1.00 49.09  ? 772  TYR A CG    1 
ATOM   5675  C  CD1   . TYR A 1  772  ? -31.611 -30.198 -60.104 1.00 48.76  ? 772  TYR A CD1   1 
ATOM   5676  C  CD2   . TYR A 1  772  ? -31.762 -32.572 -59.871 1.00 48.64  ? 772  TYR A CD2   1 
ATOM   5677  C  CE1   . TYR A 1  772  ? -31.095 -30.349 -61.377 1.00 49.08  ? 772  TYR A CE1   1 
ATOM   5678  C  CE2   . TYR A 1  772  ? -31.247 -32.736 -61.144 1.00 48.79  ? 772  TYR A CE2   1 
ATOM   5679  C  CZ    . TYR A 1  772  ? -30.913 -31.620 -61.892 1.00 49.13  ? 772  TYR A CZ    1 
ATOM   5680  O  OH    . TYR A 1  772  ? -30.396 -31.762 -63.153 1.00 49.59  ? 772  TYR A OH    1 
ATOM   5681  N  N     . VAL A 1  773  ? -31.669 -29.807 -54.760 1.00 51.29  ? 773  VAL A N     1 
ATOM   5682  C  CA    . VAL A 1  773  ? -32.019 -29.781 -53.344 1.00 52.18  ? 773  VAL A CA    1 
ATOM   5683  C  C     . VAL A 1  773  ? -32.442 -28.397 -52.857 1.00 52.81  ? 773  VAL A C     1 
ATOM   5684  O  O     . VAL A 1  773  ? -31.888 -27.376 -53.275 1.00 52.37  ? 773  VAL A O     1 
ATOM   5685  C  CB    . VAL A 1  773  ? -30.858 -30.344 -52.487 1.00 52.81  ? 773  VAL A CB    1 
ATOM   5686  C  CG1   . VAL A 1  773  ? -29.550 -29.625 -52.778 1.00 53.16  ? 773  VAL A CG1   1 
ATOM   5687  C  CG2   . VAL A 1  773  ? -31.191 -30.297 -51.001 1.00 53.53  ? 773  VAL A CG2   1 
ATOM   5688  N  N     . SER A 1  774  ? -33.444 -28.385 -51.977 1.00 53.28  ? 774  SER A N     1 
ATOM   5689  C  CA    . SER A 1  774  ? -33.823 -27.189 -51.233 1.00 53.65  ? 774  SER A CA    1 
ATOM   5690  C  C     . SER A 1  774  ? -32.778 -26.977 -50.129 1.00 54.32  ? 774  SER A C     1 
ATOM   5691  O  O     . SER A 1  774  ? -32.864 -27.587 -49.056 1.00 54.91  ? 774  SER A O     1 
ATOM   5692  C  CB    . SER A 1  774  ? -35.235 -27.355 -50.652 1.00 53.23  ? 774  SER A CB    1 
ATOM   5693  O  OG    . SER A 1  774  ? -35.685 -26.170 -50.030 1.00 52.55  ? 774  SER A OG    1 
ATOM   5694  N  N     . THR A 1  775  ? -31.777 -26.145 -50.430 1.00 54.47  ? 775  THR A N     1 
ATOM   5695  C  CA    . THR A 1  775  ? -30.671 -25.838 -49.507 1.00 55.23  ? 775  THR A CA    1 
ATOM   5696  C  C     . THR A 1  775  ? -30.190 -24.394 -49.626 1.00 55.39  ? 775  THR A C     1 
ATOM   5697  O  O     . THR A 1  775  ? -30.379 -23.745 -50.658 1.00 55.25  ? 775  THR A O     1 
ATOM   5698  C  CB    . THR A 1  775  ? -29.443 -26.747 -49.740 1.00 55.70  ? 775  THR A CB    1 
ATOM   5699  O  OG1   . THR A 1  775  ? -28.470 -26.525 -48.708 1.00 55.83  ? 775  THR A OG1   1 
ATOM   5700  C  CG2   . THR A 1  775  ? -28.796 -26.473 -51.108 1.00 55.59  ? 775  THR A CG2   1 
ATOM   5701  N  N     . GLN A 1  776  ? -29.534 -23.932 -48.565 1.00 55.57  ? 776  GLN A N     1 
ATOM   5702  C  CA    . GLN A 1  776  ? -28.915 -22.610 -48.513 1.00 56.10  ? 776  GLN A CA    1 
ATOM   5703  C  C     . GLN A 1  776  ? -27.438 -22.632 -48.890 1.00 55.72  ? 776  GLN A C     1 
ATOM   5704  O  O     . GLN A 1  776  ? -26.837 -21.567 -49.018 1.00 55.67  ? 776  GLN A O     1 
ATOM   5705  C  CB    . GLN A 1  776  ? -29.014 -22.034 -47.100 1.00 57.02  ? 776  GLN A CB    1 
ATOM   5706  C  CG    . GLN A 1  776  ? -30.413 -21.984 -46.532 1.00 57.63  ? 776  GLN A CG    1 
ATOM   5707  C  CD    . GLN A 1  776  ? -30.416 -21.501 -45.104 1.00 59.35  ? 776  GLN A CD    1 
ATOM   5708  O  OE1   . GLN A 1  776  ? -30.746 -22.254 -44.194 1.00 60.56  ? 776  GLN A OE1   1 
ATOM   5709  N  NE2   . GLN A 1  776  ? -30.032 -20.247 -44.895 1.00 60.25  ? 776  GLN A NE2   1 
ATOM   5710  N  N     . PHE A 1  777  ? -26.852 -23.821 -49.048 1.00 54.99  ? 777  PHE A N     1 
ATOM   5711  C  CA    . PHE A 1  777  ? -25.402 -23.949 -49.210 1.00 55.84  ? 777  PHE A CA    1 
ATOM   5712  C  C     . PHE A 1  777  ? -25.035 -25.028 -50.249 1.00 55.51  ? 777  PHE A C     1 
ATOM   5713  O  O     . PHE A 1  777  ? -24.591 -26.119 -49.881 1.00 55.25  ? 777  PHE A O     1 
ATOM   5714  C  CB    . PHE A 1  777  ? -24.786 -24.259 -47.833 1.00 56.44  ? 777  PHE A CB    1 
ATOM   5715  C  CG    . PHE A 1  777  ? -23.328 -23.874 -47.671 1.00 57.02  ? 777  PHE A CG    1 
ATOM   5716  C  CD1   . PHE A 1  777  ? -22.561 -23.317 -48.705 1.00 57.30  ? 777  PHE A CD1   1 
ATOM   5717  C  CD2   . PHE A 1  777  ? -22.706 -24.111 -46.445 1.00 57.60  ? 777  PHE A CD2   1 
ATOM   5718  C  CE1   . PHE A 1  777  ? -21.222 -22.998 -48.499 1.00 58.65  ? 777  PHE A CE1   1 
ATOM   5719  C  CE2   . PHE A 1  777  ? -21.372 -23.796 -46.238 1.00 58.24  ? 777  PHE A CE2   1 
ATOM   5720  C  CZ    . PHE A 1  777  ? -20.628 -23.237 -47.265 1.00 59.06  ? 777  PHE A CZ    1 
ATOM   5721  N  N     . PRO A 1  778  ? -25.215 -24.724 -51.553 1.00 55.39  ? 778  PRO A N     1 
ATOM   5722  C  CA    . PRO A 1  778  ? -24.888 -25.675 -52.635 1.00 55.54  ? 778  PRO A CA    1 
ATOM   5723  C  C     . PRO A 1  778  ? -23.468 -26.256 -52.573 1.00 56.38  ? 778  PRO A C     1 
ATOM   5724  O  O     . PRO A 1  778  ? -23.291 -27.462 -52.738 1.00 57.29  ? 778  PRO A O     1 
ATOM   5725  C  CB    . PRO A 1  778  ? -25.060 -24.839 -53.909 1.00 55.14  ? 778  PRO A CB    1 
ATOM   5726  C  CG    . PRO A 1  778  ? -26.037 -23.787 -53.534 1.00 55.34  ? 778  PRO A CG    1 
ATOM   5727  C  CD    . PRO A 1  778  ? -25.784 -23.472 -52.089 1.00 55.42  ? 778  PRO A CD    1 
ATOM   5728  N  N     . LYS A 1  779  ? -22.481 -25.401 -52.331 1.00 57.12  ? 779  LYS A N     1 
ATOM   5729  C  CA    . LYS A 1  779  ? -21.084 -25.825 -52.207 1.00 58.36  ? 779  LYS A CA    1 
ATOM   5730  C  C     . LYS A 1  779  ? -20.887 -26.899 -51.120 1.00 58.63  ? 779  LYS A C     1 
ATOM   5731  O  O     . LYS A 1  779  ? -20.135 -27.847 -51.326 1.00 58.40  ? 779  LYS A O     1 
ATOM   5732  C  CB    . LYS A 1  779  ? -20.195 -24.613 -51.922 1.00 60.01  ? 779  LYS A CB    1 
ATOM   5733  C  CG    . LYS A 1  779  ? -18.698 -24.886 -51.949 1.00 61.64  ? 779  LYS A CG    1 
ATOM   5734  C  CD    . LYS A 1  779  ? -17.959 -23.986 -50.968 1.00 64.23  ? 779  LYS A CD    1 
ATOM   5735  C  CE    . LYS A 1  779  ? -16.543 -24.473 -50.710 1.00 65.14  ? 779  LYS A CE    1 
ATOM   5736  N  NZ    . LYS A 1  779  ? -16.495 -25.831 -50.102 1.00 64.32  ? 779  LYS A NZ    1 
ATOM   5737  N  N     . TYR A 1  780  ? -21.556 -26.752 -49.978 1.00 58.49  ? 780  TYR A N     1 
ATOM   5738  C  CA    . TYR A 1  780  ? -21.496 -27.771 -48.919 1.00 59.43  ? 780  TYR A CA    1 
ATOM   5739  C  C     . TYR A 1  780  ? -22.149 -29.094 -49.332 1.00 58.97  ? 780  TYR A C     1 
ATOM   5740  O  O     . TYR A 1  780  ? -21.637 -30.164 -48.983 1.00 59.44  ? 780  TYR A O     1 
ATOM   5741  C  CB    . TYR A 1  780  ? -22.122 -27.253 -47.632 1.00 60.71  ? 780  TYR A CB    1 
ATOM   5742  C  CG    . TYR A 1  780  ? -22.383 -28.314 -46.593 1.00 62.19  ? 780  TYR A CG    1 
ATOM   5743  C  CD1   . TYR A 1  780  ? -21.338 -28.877 -45.862 1.00 64.10  ? 780  TYR A CD1   1 
ATOM   5744  C  CD2   . TYR A 1  780  ? -23.681 -28.752 -46.332 1.00 62.79  ? 780  TYR A CD2   1 
ATOM   5745  C  CE1   . TYR A 1  780  ? -21.580 -29.847 -44.898 1.00 65.43  ? 780  TYR A CE1   1 
ATOM   5746  C  CE2   . TYR A 1  780  ? -23.932 -29.719 -45.372 1.00 63.69  ? 780  TYR A CE2   1 
ATOM   5747  C  CZ    . TYR A 1  780  ? -22.884 -30.264 -44.658 1.00 65.38  ? 780  TYR A CZ    1 
ATOM   5748  O  OH    . TYR A 1  780  ? -23.150 -31.223 -43.709 1.00 68.04  ? 780  TYR A OH    1 
ATOM   5749  N  N     . ILE A 1  781  ? -23.261 -29.016 -50.070 1.00 57.48  ? 781  ILE A N     1 
ATOM   5750  C  CA    . ILE A 1  781  ? -23.930 -30.211 -50.611 1.00 56.62  ? 781  ILE A CA    1 
ATOM   5751  C  C     . ILE A 1  781  ? -22.991 -30.919 -51.591 1.00 56.43  ? 781  ILE A C     1 
ATOM   5752  O  O     . ILE A 1  781  ? -22.803 -32.137 -51.511 1.00 56.75  ? 781  ILE A O     1 
ATOM   5753  C  CB    . ILE A 1  781  ? -25.273 -29.886 -51.335 1.00 56.26  ? 781  ILE A CB    1 
ATOM   5754  C  CG1   . ILE A 1  781  ? -26.272 -29.173 -50.407 1.00 56.12  ? 781  ILE A CG1   1 
ATOM   5755  C  CG2   . ILE A 1  781  ? -25.901 -31.151 -51.937 1.00 56.07  ? 781  ILE A CG2   1 
ATOM   5756  C  CD1   . ILE A 1  781  ? -26.626 -29.904 -49.130 1.00 57.02  ? 781  ILE A CD1   1 
ATOM   5757  N  N     . GLN A 1  782  ? -22.414 -30.148 -52.508 1.00 55.79  ? 782  GLN A N     1 
ATOM   5758  C  CA    . GLN A 1  782  ? -21.394 -30.655 -53.429 1.00 56.58  ? 782  GLN A CA    1 
ATOM   5759  C  C     . GLN A 1  782  ? -20.310 -31.425 -52.668 1.00 56.91  ? 782  GLN A C     1 
ATOM   5760  O  O     . GLN A 1  782  ? -20.015 -32.573 -52.992 1.00 57.03  ? 782  GLN A O     1 
ATOM   5761  C  CB    . GLN A 1  782  ? -20.772 -29.495 -54.223 1.00 57.04  ? 782  GLN A CB    1 
ATOM   5762  C  CG    . GLN A 1  782  ? -19.781 -29.900 -55.303 1.00 57.62  ? 782  GLN A CG    1 
ATOM   5763  C  CD    . GLN A 1  782  ? -19.238 -28.710 -56.080 1.00 58.92  ? 782  GLN A CD    1 
ATOM   5764  O  OE1   . GLN A 1  782  ? -19.131 -27.596 -55.558 1.00 60.12  ? 782  GLN A OE1   1 
ATOM   5765  N  NE2   . GLN A 1  782  ? -18.880 -28.945 -57.334 1.00 59.11  ? 782  GLN A NE2   1 
ATOM   5766  N  N     . ASP A 1  783  ? -19.764 -30.800 -51.630 1.00 57.03  ? 783  ASP A N     1 
ATOM   5767  C  CA    . ASP A 1  783  ? -18.653 -31.375 -50.881 1.00 58.28  ? 783  ASP A CA    1 
ATOM   5768  C  C     . ASP A 1  783  ? -19.021 -32.662 -50.159 1.00 57.71  ? 783  ASP A C     1 
ATOM   5769  O  O     . ASP A 1  783  ? -18.309 -33.664 -50.283 1.00 58.45  ? 783  ASP A O     1 
ATOM   5770  C  CB    . ASP A 1  783  ? -18.100 -30.373 -49.863 1.00 59.90  ? 783  ASP A CB    1 
ATOM   5771  C  CG    . ASP A 1  783  ? -17.438 -29.169 -50.517 1.00 61.11  ? 783  ASP A CG    1 
ATOM   5772  O  OD1   . ASP A 1  783  ? -17.391 -29.079 -51.773 1.00 61.30  ? 783  ASP A OD1   1 
ATOM   5773  O  OD2   . ASP A 1  783  ? -16.977 -28.294 -49.755 1.00 62.47  ? 783  ASP A OD2   1 
ATOM   5774  N  N     . ILE A 1  784  ? -20.113 -32.638 -49.401 1.00 56.37  ? 784  ILE A N     1 
ATOM   5775  C  CA    . ILE A 1  784  ? -20.495 -33.810 -48.605 1.00 55.79  ? 784  ILE A CA    1 
ATOM   5776  C  C     . ILE A 1  784  ? -20.903 -34.991 -49.499 1.00 54.83  ? 784  ILE A C     1 
ATOM   5777  O  O     . ILE A 1  784  ? -20.550 -36.129 -49.201 1.00 54.98  ? 784  ILE A O     1 
ATOM   5778  C  CB    . ILE A 1  784  ? -21.555 -33.482 -47.516 1.00 55.09  ? 784  ILE A CB    1 
ATOM   5779  C  CG1   . ILE A 1  784  ? -21.602 -34.602 -46.472 1.00 55.54  ? 784  ILE A CG1   1 
ATOM   5780  C  CG2   . ILE A 1  784  ? -22.935 -33.234 -48.112 1.00 54.24  ? 784  ILE A CG2   1 
ATOM   5781  C  CD1   . ILE A 1  784  ? -22.548 -34.322 -45.331 1.00 56.08  ? 784  ILE A CD1   1 
ATOM   5782  N  N     . VAL A 1  785  ? -21.601 -34.720 -50.599 1.00 54.26  ? 785  VAL A N     1 
ATOM   5783  C  CA    . VAL A 1  785  ? -21.967 -35.770 -51.560 1.00 54.51  ? 785  VAL A CA    1 
ATOM   5784  C  C     . VAL A 1  785  ? -20.709 -36.347 -52.224 1.00 54.52  ? 785  VAL A C     1 
ATOM   5785  O  O     . VAL A 1  785  ? -20.535 -37.566 -52.266 1.00 54.19  ? 785  VAL A O     1 
ATOM   5786  C  CB    . VAL A 1  785  ? -22.970 -35.258 -52.628 1.00 54.30  ? 785  VAL A CB    1 
ATOM   5787  C  CG1   . VAL A 1  785  ? -23.164 -36.269 -53.759 1.00 53.91  ? 785  VAL A CG1   1 
ATOM   5788  C  CG2   . VAL A 1  785  ? -24.312 -34.939 -51.979 1.00 53.99  ? 785  VAL A CG2   1 
ATOM   5789  N  N     . ALA A 1  786  ? -19.845 -35.465 -52.726 1.00 54.50  ? 786  ALA A N     1 
ATOM   5790  C  CA    . ALA A 1  786  ? -18.596 -35.871 -53.388 1.00 55.06  ? 786  ALA A CA    1 
ATOM   5791  C  C     . ALA A 1  786  ? -17.700 -36.686 -52.465 1.00 55.90  ? 786  ALA A C     1 
ATOM   5792  O  O     . ALA A 1  786  ? -17.190 -37.743 -52.860 1.00 56.62  ? 786  ALA A O     1 
ATOM   5793  C  CB    . ALA A 1  786  ? -17.844 -34.655 -53.901 1.00 55.08  ? 786  ALA A CB    1 
ATOM   5794  N  N     . SER A 1  787  ? -17.525 -36.181 -51.244 1.00 55.85  ? 787  SER A N     1 
ATOM   5795  C  CA    . SER A 1  787  ? -16.790 -36.871 -50.185 1.00 56.50  ? 787  SER A CA    1 
ATOM   5796  C  C     . SER A 1  787  ? -17.344 -38.273 -49.930 1.00 56.98  ? 787  SER A C     1 
ATOM   5797  O  O     . SER A 1  787  ? -16.587 -39.249 -49.896 1.00 57.56  ? 787  SER A O     1 
ATOM   5798  C  CB    . SER A 1  787  ? -16.842 -36.045 -48.896 1.00 56.91  ? 787  SER A CB    1 
ATOM   5799  O  OG    . SER A 1  787  ? -16.206 -36.712 -47.822 1.00 58.21  ? 787  SER A OG    1 
ATOM   5800  N  N     . THR A 1  788  ? -18.664 -38.362 -49.778 1.00 56.98  ? 788  THR A N     1 
ATOM   5801  C  CA    . THR A 1  788  ? -19.354 -39.633 -49.530 1.00 57.49  ? 788  THR A CA    1 
ATOM   5802  C  C     . THR A 1  788  ? -19.135 -40.638 -50.668 1.00 58.31  ? 788  THR A C     1 
ATOM   5803  O  O     . THR A 1  788  ? -18.891 -41.823 -50.421 1.00 58.98  ? 788  THR A O     1 
ATOM   5804  C  CB    . THR A 1  788  ? -20.867 -39.403 -49.324 1.00 57.07  ? 788  THR A CB    1 
ATOM   5805  O  OG1   . THR A 1  788  ? -21.068 -38.504 -48.225 1.00 56.61  ? 788  THR A OG1   1 
ATOM   5806  C  CG2   . THR A 1  788  ? -21.605 -40.720 -49.047 1.00 57.62  ? 788  THR A CG2   1 
ATOM   5807  N  N     . LEU A 1  789  ? -19.207 -40.153 -51.906 1.00 58.11  ? 789  LEU A N     1 
ATOM   5808  C  CA    . LEU A 1  789  ? -18.977 -40.992 -53.086 1.00 58.03  ? 789  LEU A CA    1 
ATOM   5809  C  C     . LEU A 1  789  ? -17.498 -41.202 -53.433 1.00 58.39  ? 789  LEU A C     1 
ATOM   5810  O  O     . LEU A 1  789  ? -17.194 -41.968 -54.351 1.00 57.72  ? 789  LEU A O     1 
ATOM   5811  C  CB    . LEU A 1  789  ? -19.724 -40.417 -54.298 1.00 57.07  ? 789  LEU A CB    1 
ATOM   5812  C  CG    . LEU A 1  789  ? -21.248 -40.341 -54.140 1.00 56.34  ? 789  LEU A CG    1 
ATOM   5813  C  CD1   . LEU A 1  789  ? -21.877 -39.666 -55.348 1.00 55.12  ? 789  LEU A CD1   1 
ATOM   5814  C  CD2   . LEU A 1  789  ? -21.855 -41.720 -53.920 1.00 56.33  ? 789  LEU A CD2   1 
ATOM   5815  N  N     . LYS A 1  790  ? -16.599 -40.535 -52.705 1.00 59.20  ? 790  LYS A N     1 
ATOM   5816  C  CA    . LYS A 1  790  ? -15.153 -40.576 -52.949 1.00 60.67  ? 790  LYS A CA    1 
ATOM   5817  C  C     . LYS A 1  790  ? -14.818 -40.093 -54.356 1.00 59.84  ? 790  LYS A C     1 
ATOM   5818  O  O     . LYS A 1  790  ? -14.036 -40.720 -55.076 1.00 60.27  ? 790  LYS A O     1 
ATOM   5819  C  CB    . LYS A 1  790  ? -14.579 -41.975 -52.699 1.00 62.40  ? 790  LYS A CB    1 
ATOM   5820  C  CG    . LYS A 1  790  ? -14.821 -42.512 -51.305 1.00 64.13  ? 790  LYS A CG    1 
ATOM   5821  C  CD    . LYS A 1  790  ? -14.286 -43.927 -51.208 1.00 66.76  ? 790  LYS A CD    1 
ATOM   5822  C  CE    . LYS A 1  790  ? -14.320 -44.448 -49.784 1.00 69.60  ? 790  LYS A CE    1 
ATOM   5823  N  NZ    . LYS A 1  790  ? -13.494 -43.621 -48.858 1.00 71.49  ? 790  LYS A NZ    1 
ATOM   5824  N  N     . LEU A 1  791  ? -15.422 -38.964 -54.724 1.00 58.83  ? 791  LEU A N     1 
ATOM   5825  C  CA    . LEU A 1  791  ? -15.291 -38.384 -56.055 1.00 58.03  ? 791  LEU A CA    1 
ATOM   5826  C  C     . LEU A 1  791  ? -14.705 -36.981 -55.956 1.00 57.78  ? 791  LEU A C     1 
ATOM   5827  O  O     . LEU A 1  791  ? -14.907 -36.296 -54.950 1.00 58.17  ? 791  LEU A O     1 
ATOM   5828  C  CB    . LEU A 1  791  ? -16.663 -38.297 -56.730 1.00 57.15  ? 791  LEU A CB    1 
ATOM   5829  C  CG    . LEU A 1  791  ? -17.377 -39.606 -57.070 1.00 56.61  ? 791  LEU A CG    1 
ATOM   5830  C  CD1   . LEU A 1  791  ? -18.741 -39.309 -57.667 1.00 55.64  ? 791  LEU A CD1   1 
ATOM   5831  C  CD2   . LEU A 1  791  ? -16.545 -40.448 -58.027 1.00 56.88  ? 791  LEU A CD2   1 
ATOM   5832  N  N     . PRO A 1  792  ? -13.984 -36.540 -57.003 1.00 57.16  ? 792  PRO A N     1 
ATOM   5833  C  CA    . PRO A 1  792  ? -13.642 -35.127 -57.076 1.00 56.94  ? 792  PRO A CA    1 
ATOM   5834  C  C     . PRO A 1  792  ? -14.887 -34.261 -57.178 1.00 56.82  ? 792  PRO A C     1 
ATOM   5835  O  O     . PRO A 1  792  ? -15.926 -34.714 -57.669 1.00 55.74  ? 792  PRO A O     1 
ATOM   5836  C  CB    . PRO A 1  792  ? -12.821 -35.022 -58.362 1.00 56.98  ? 792  PRO A CB    1 
ATOM   5837  C  CG    . PRO A 1  792  ? -12.280 -36.387 -58.582 1.00 57.59  ? 792  PRO A CG    1 
ATOM   5838  C  CD    . PRO A 1  792  ? -13.348 -37.312 -58.083 1.00 57.36  ? 792  PRO A CD    1 
ATOM   5839  N  N     . ALA A 1  793  ? -14.766 -33.022 -56.718 1.00 57.21  ? 793  ALA A N     1 
ATOM   5840  C  CA    . ALA A 1  793  ? -15.866 -32.070 -56.748 1.00 56.17  ? 793  ALA A CA    1 
ATOM   5841  C  C     . ALA A 1  793  ? -16.394 -31.811 -58.157 1.00 55.65  ? 793  ALA A C     1 
ATOM   5842  O  O     . ALA A 1  793  ? -17.575 -31.521 -58.312 1.00 56.16  ? 793  ALA A O     1 
ATOM   5843  C  CB    . ALA A 1  793  ? -15.442 -30.763 -56.104 1.00 56.80  ? 793  ALA A CB    1 
ATOM   5844  N  N     . ASN A 1  794  ? -15.531 -31.920 -59.173 1.00 55.97  ? 794  ASN A N     1 
ATOM   5845  C  CA    . ASN A 1  794  ? -15.942 -31.693 -60.569 1.00 55.65  ? 794  ASN A CA    1 
ATOM   5846  C  C     . ASN A 1  794  ? -16.947 -32.717 -61.139 1.00 55.94  ? 794  ASN A C     1 
ATOM   5847  O  O     . ASN A 1  794  ? -17.555 -32.472 -62.189 1.00 55.49  ? 794  ASN A O     1 
ATOM   5848  C  CB    . ASN A 1  794  ? -14.718 -31.494 -61.500 1.00 56.28  ? 794  ASN A CB    1 
ATOM   5849  C  CG    . ASN A 1  794  ? -13.851 -32.746 -61.665 1.00 56.66  ? 794  ASN A CG    1 
ATOM   5850  O  OD1   . ASN A 1  794  ? -14.251 -33.854 -61.334 1.00 56.07  ? 794  ASN A OD1   1 
ATOM   5851  N  ND2   . ASN A 1  794  ? -12.646 -32.559 -62.198 1.00 56.91  ? 794  ASN A ND2   1 
ATOM   5852  N  N     . LYS A 1  795  ? -17.114 -33.853 -60.450 1.00 57.07  ? 795  LYS A N     1 
ATOM   5853  C  CA    . LYS A 1  795  ? -18.142 -34.854 -60.795 1.00 56.98  ? 795  LYS A CA    1 
ATOM   5854  C  C     . LYS A 1  795  ? -19.532 -34.564 -60.213 1.00 55.88  ? 795  LYS A C     1 
ATOM   5855  O  O     . LYS A 1  795  ? -20.536 -34.929 -60.825 1.00 56.56  ? 795  LYS A O     1 
ATOM   5856  C  CB    . LYS A 1  795  ? -17.693 -36.266 -60.387 1.00 58.19  ? 795  LYS A CB    1 
ATOM   5857  C  CG    . LYS A 1  795  ? -16.974 -37.035 -61.487 1.00 59.15  ? 795  LYS A CG    1 
ATOM   5858  C  CD    . LYS A 1  795  ? -15.687 -36.351 -61.896 1.00 59.83  ? 795  LYS A CD    1 
ATOM   5859  C  CE    . LYS A 1  795  ? -14.854 -37.183 -62.855 1.00 60.13  ? 795  LYS A CE    1 
ATOM   5860  N  NZ    . LYS A 1  795  ? -13.418 -36.802 -62.731 1.00 60.66  ? 795  LYS A NZ    1 
ATOM   5861  N  N     . VAL A 1  796  ? -19.592 -33.920 -59.048 1.00 55.98  ? 796  VAL A N     1 
ATOM   5862  C  CA    . VAL A 1  796  ? -20.869 -33.602 -58.388 1.00 55.18  ? 796  VAL A CA    1 
ATOM   5863  C  C     . VAL A 1  796  ? -21.238 -32.130 -58.579 1.00 53.88  ? 796  VAL A C     1 
ATOM   5864  O  O     . VAL A 1  796  ? -20.453 -31.247 -58.250 1.00 53.44  ? 796  VAL A O     1 
ATOM   5865  C  CB    . VAL A 1  796  ? -20.813 -33.910 -56.877 1.00 56.14  ? 796  VAL A CB    1 
ATOM   5866  C  CG1   . VAL A 1  796  ? -22.186 -33.698 -56.232 1.00 56.34  ? 796  VAL A CG1   1 
ATOM   5867  C  CG2   . VAL A 1  796  ? -20.315 -35.333 -56.641 1.00 56.34  ? 796  VAL A CG2   1 
ATOM   5868  N  N     . MET A 1  797  ? -22.436 -31.880 -59.107 1.00 53.08  ? 797  MET A N     1 
ATOM   5869  C  CA    . MET A 1  797  ? -22.974 -30.522 -59.241 1.00 52.30  ? 797  MET A CA    1 
ATOM   5870  C  C     . MET A 1  797  ? -24.290 -30.401 -58.478 1.00 51.50  ? 797  MET A C     1 
ATOM   5871  O  O     . MET A 1  797  ? -25.108 -31.319 -58.495 1.00 51.92  ? 797  MET A O     1 
ATOM   5872  C  CB    . MET A 1  797  ? -23.173 -30.155 -60.717 1.00 51.84  ? 797  MET A CB    1 
ATOM   5873  C  CG    . MET A 1  797  ? -21.879 -30.120 -61.524 1.00 52.16  ? 797  MET A CG    1 
ATOM   5874  S  SD    . MET A 1  797  ? -20.701 -28.864 -60.969 1.00 51.89  ? 797  MET A SD    1 
ATOM   5875  C  CE    . MET A 1  797  ? -19.169 -29.789 -61.026 1.00 52.31  ? 797  MET A CE    1 
ATOM   5876  N  N     . CYS A 1  798  ? -24.470 -29.272 -57.796 1.00 51.01  ? 798  CYS A N     1 
ATOM   5877  C  CA    . CYS A 1  798  ? -25.667 -28.998 -57.019 1.00 50.35  ? 798  CYS A CA    1 
ATOM   5878  C  C     . CYS A 1  798  ? -26.378 -27.813 -57.648 1.00 49.18  ? 798  CYS A C     1 
ATOM   5879  O  O     . CYS A 1  798  ? -25.761 -26.781 -57.879 1.00 48.56  ? 798  CYS A O     1 
ATOM   5880  C  CB    . CYS A 1  798  ? -25.305 -28.688 -55.565 1.00 51.38  ? 798  CYS A CB    1 
ATOM   5881  S  SG    . CYS A 1  798  ? -26.735 -28.334 -54.507 1.00 52.59  ? 798  CYS A SG    1 
ATOM   5882  N  N     . HIS A 1  799  ? -27.673 -27.973 -57.912 1.00 48.74  ? 799  HIS A N     1 
ATOM   5883  C  CA    . HIS A 1  799  ? -28.484 -26.962 -58.603 1.00 48.12  ? 799  HIS A CA    1 
ATOM   5884  C  C     . HIS A 1  799  ? -29.668 -26.579 -57.738 1.00 47.37  ? 799  HIS A C     1 
ATOM   5885  O  O     . HIS A 1  799  ? -30.378 -27.453 -57.244 1.00 47.33  ? 799  HIS A O     1 
ATOM   5886  C  CB    . HIS A 1  799  ? -28.998 -27.505 -59.939 1.00 47.89  ? 799  HIS A CB    1 
ATOM   5887  C  CG    . HIS A 1  799  ? -27.969 -28.253 -60.723 1.00 48.10  ? 799  HIS A CG    1 
ATOM   5888  N  ND1   . HIS A 1  799  ? -26.993 -27.621 -61.462 1.00 48.47  ? 799  HIS A ND1   1 
ATOM   5889  C  CD2   . HIS A 1  799  ? -27.756 -29.582 -60.873 1.00 48.04  ? 799  HIS A CD2   1 
ATOM   5890  C  CE1   . HIS A 1  799  ? -26.230 -28.529 -62.045 1.00 48.75  ? 799  HIS A CE1   1 
ATOM   5891  N  NE2   . HIS A 1  799  ? -26.670 -29.727 -61.701 1.00 48.55  ? 799  HIS A NE2   1 
ATOM   5892  N  N     . VAL A 1  800  ? -29.877 -25.277 -57.561 1.00 48.02  ? 800  VAL A N     1 
ATOM   5893  C  CA    . VAL A 1  800  ? -30.984 -24.755 -56.754 1.00 48.91  ? 800  VAL A CA    1 
ATOM   5894  C  C     . VAL A 1  800  ? -31.646 -23.568 -57.452 1.00 49.81  ? 800  VAL A C     1 
ATOM   5895  O  O     . VAL A 1  800  ? -31.027 -22.516 -57.606 1.00 52.19  ? 800  VAL A O     1 
ATOM   5896  C  CB    . VAL A 1  800  ? -30.515 -24.285 -55.361 1.00 48.74  ? 800  VAL A CB    1 
ATOM   5897  C  CG1   . VAL A 1  800  ? -31.710 -23.836 -54.521 1.00 49.03  ? 800  VAL A CG1   1 
ATOM   5898  C  CG2   . VAL A 1  800  ? -29.717 -25.376 -54.667 1.00 48.77  ? 800  VAL A CG2   1 
ATOM   5899  N  N     . ARG A 1  801  ? -32.902 -23.740 -57.851 1.00 49.98  ? 801  ARG A N     1 
ATOM   5900  C  CA    . ARG A 1  801  ? -33.693 -22.664 -58.432 1.00 50.75  ? 801  ARG A CA    1 
ATOM   5901  C  C     . ARG A 1  801  ? -34.333 -21.796 -57.344 1.00 50.97  ? 801  ARG A C     1 
ATOM   5902  O  O     . ARG A 1  801  ? -34.231 -20.570 -57.377 1.00 52.26  ? 801  ARG A O     1 
ATOM   5903  C  CB    . ARG A 1  801  ? -34.768 -23.251 -59.334 1.00 51.81  ? 801  ARG A CB    1 
ATOM   5904  C  CG    . ARG A 1  801  ? -35.444 -22.217 -60.202 1.00 53.55  ? 801  ARG A CG    1 
ATOM   5905  C  CD    . ARG A 1  801  ? -36.331 -22.850 -61.251 1.00 55.31  ? 801  ARG A CD    1 
ATOM   5906  N  NE    . ARG A 1  801  ? -36.667 -21.864 -62.278 1.00 57.21  ? 801  ARG A NE    1 
ATOM   5907  C  CZ    . ARG A 1  801  ? -36.102 -21.760 -63.484 1.00 57.90  ? 801  ARG A CZ    1 
ATOM   5908  N  NH1   . ARG A 1  801  ? -35.142 -22.594 -63.902 1.00 58.45  ? 801  ARG A NH1   1 
ATOM   5909  N  NH2   . ARG A 1  801  ? -36.522 -20.800 -64.296 1.00 58.65  ? 801  ARG A NH2   1 
ATOM   5910  N  N     . ARG A 1  802  ? -35.010 -22.438 -56.397 1.00 50.60  ? 802  ARG A N     1 
ATOM   5911  C  CA    . ARG A 1  802  ? -35.605 -21.742 -55.261 1.00 50.95  ? 802  ARG A CA    1 
ATOM   5912  C  C     . ARG A 1  802  ? -35.836 -22.670 -54.067 1.00 51.70  ? 802  ARG A C     1 
ATOM   5913  O  O     . ARG A 1  802  ? -35.935 -23.895 -54.210 1.00 51.04  ? 802  ARG A O     1 
ATOM   5914  C  CB    . ARG A 1  802  ? -36.925 -21.067 -55.661 1.00 50.84  ? 802  ARG A CB    1 
ATOM   5915  C  CG    . ARG A 1  802  ? -38.001 -22.032 -56.138 1.00 50.17  ? 802  ARG A CG    1 
ATOM   5916  C  CD    . ARG A 1  802  ? -39.367 -21.375 -56.311 1.00 49.86  ? 802  ARG A CD    1 
ATOM   5917  N  NE    . ARG A 1  802  ? -39.452 -20.406 -57.405 1.00 49.70  ? 802  ARG A NE    1 
ATOM   5918  C  CZ    . ARG A 1  802  ? -39.376 -20.696 -58.708 1.00 49.37  ? 802  ARG A CZ    1 
ATOM   5919  N  NH1   . ARG A 1  802  ? -39.166 -21.944 -59.141 1.00 48.39  ? 802  ARG A NH1   1 
ATOM   5920  N  NH2   . ARG A 1  802  ? -39.490 -19.715 -59.601 1.00 49.24  ? 802  ARG A NH2   1 
ATOM   5921  N  N     . VAL A 1  803  ? -35.935 -22.049 -52.896 1.00 52.89  ? 803  VAL A N     1 
ATOM   5922  C  CA    . VAL A 1  803  ? -36.164 -22.727 -51.634 1.00 53.13  ? 803  VAL A CA    1 
ATOM   5923  C  C     . VAL A 1  803  ? -37.426 -22.128 -51.034 1.00 53.94  ? 803  VAL A C     1 
ATOM   5924  O  O     . VAL A 1  803  ? -37.566 -20.907 -50.984 1.00 54.38  ? 803  VAL A O     1 
ATOM   5925  C  CB    . VAL A 1  803  ? -34.962 -22.519 -50.694 1.00 53.25  ? 803  VAL A CB    1 
ATOM   5926  C  CG1   . VAL A 1  803  ? -35.249 -23.037 -49.287 1.00 53.36  ? 803  VAL A CG1   1 
ATOM   5927  C  CG2   . VAL A 1  803  ? -33.725 -23.178 -51.283 1.00 53.11  ? 803  VAL A CG2   1 
ATOM   5928  N  N     . GLY A 1  804  ? -38.341 -22.987 -50.583 1.00 54.67  ? 804  GLY A N     1 
ATOM   5929  C  CA    . GLY A 1  804  ? -39.589 -22.554 -49.943 1.00 55.69  ? 804  GLY A CA    1 
ATOM   5930  C  C     . GLY A 1  804  ? -39.396 -22.248 -48.465 1.00 56.22  ? 804  GLY A C     1 
ATOM   5931  O  O     . GLY A 1  804  ? -39.958 -22.931 -47.603 1.00 56.51  ? 804  GLY A O     1 
ATOM   5932  N  N     . GLY A 1  805  ? -38.604 -21.215 -48.179 1.00 56.01  ? 805  GLY A N     1 
ATOM   5933  C  CA    . GLY A 1  805  ? -38.221 -20.862 -46.814 1.00 56.17  ? 805  GLY A CA    1 
ATOM   5934  C  C     . GLY A 1  805  ? -37.084 -21.730 -46.309 1.00 55.54  ? 805  GLY A C     1 
ATOM   5935  O  O     . GLY A 1  805  ? -36.996 -22.908 -46.662 1.00 56.67  ? 805  GLY A O     1 
ATOM   5936  N  N     . ALA A 1  806  ? -36.217 -21.151 -45.483 1.00 54.74  ? 806  ALA A N     1 
ATOM   5937  C  CA    . ALA A 1  806  ? -35.081 -21.877 -44.898 1.00 54.78  ? 806  ALA A CA    1 
ATOM   5938  C  C     . ALA A 1  806  ? -34.757 -21.393 -43.481 1.00 55.83  ? 806  ALA A C     1 
ATOM   5939  O  O     . ALA A 1  806  ? -34.738 -22.180 -42.542 1.00 56.02  ? 806  ALA A O     1 
ATOM   5940  C  CB    . ALA A 1  806  ? -33.859 -21.762 -45.798 1.00 54.35  ? 806  ALA A CB    1 
ATOM   5941  N  N     . PHE A 1  807  ? -34.477 -20.102 -43.342 1.00 57.20  ? 807  PHE A N     1 
ATOM   5942  C  CA    . PHE A 1  807  ? -34.236 -19.471 -42.037 1.00 58.55  ? 807  PHE A CA    1 
ATOM   5943  C  C     . PHE A 1  807  ? -33.097 -20.106 -41.233 1.00 59.49  ? 807  PHE A C     1 
ATOM   5944  O  O     . PHE A 1  807  ? -33.108 -20.043 -40.003 1.00 60.38  ? 807  PHE A O     1 
ATOM   5945  C  CB    . PHE A 1  807  ? -35.520 -19.466 -41.191 1.00 58.21  ? 807  PHE A CB    1 
ATOM   5946  C  CG    . PHE A 1  807  ? -36.744 -19.038 -41.944 1.00 56.74  ? 807  PHE A CG    1 
ATOM   5947  C  CD1   . PHE A 1  807  ? -36.964 -17.701 -42.221 1.00 56.66  ? 807  PHE A CD1   1 
ATOM   5948  C  CD2   . PHE A 1  807  ? -37.675 -19.972 -42.373 1.00 55.90  ? 807  PHE A CD2   1 
ATOM   5949  C  CE1   . PHE A 1  807  ? -38.090 -17.297 -42.918 1.00 56.58  ? 807  PHE A CE1   1 
ATOM   5950  C  CE2   . PHE A 1  807  ? -38.802 -19.579 -43.071 1.00 55.22  ? 807  PHE A CE2   1 
ATOM   5951  C  CZ    . PHE A 1  807  ? -39.009 -18.240 -43.348 1.00 55.71  ? 807  PHE A CZ    1 
ATOM   5952  N  N     . GLY A 1  808  ? -32.127 -20.712 -41.925 1.00 59.23  ? 808  GLY A N     1 
ATOM   5953  C  CA    . GLY A 1  808  ? -31.021 -21.431 -41.279 1.00 59.88  ? 808  GLY A CA    1 
ATOM   5954  C  C     . GLY A 1  808  ? -31.146 -22.949 -41.225 1.00 59.65  ? 808  GLY A C     1 
ATOM   5955  O  O     . GLY A 1  808  ? -30.134 -23.648 -41.095 1.00 60.07  ? 808  GLY A O     1 
ATOM   5956  N  N     . GLY A 1  809  ? -32.367 -23.473 -41.349 1.00 58.79  ? 809  GLY A N     1 
ATOM   5957  C  CA    . GLY A 1  809  ? -32.615 -24.910 -41.196 1.00 58.73  ? 809  GLY A CA    1 
ATOM   5958  C  C     . GLY A 1  809  ? -32.493 -25.793 -42.433 1.00 58.03  ? 809  GLY A C     1 
ATOM   5959  O  O     . GLY A 1  809  ? -33.007 -26.917 -42.431 1.00 56.93  ? 809  GLY A O     1 
ATOM   5960  N  N     . LYS A 1  810  ? -31.830 -25.305 -43.484 1.00 57.60  ? 810  LYS A N     1 
ATOM   5961  C  CA    . LYS A 1  810  ? -31.581 -26.098 -44.688 1.00 57.07  ? 810  LYS A CA    1 
ATOM   5962  C  C     . LYS A 1  810  ? -30.099 -26.056 -45.066 1.00 58.07  ? 810  LYS A C     1 
ATOM   5963  O  O     . LYS A 1  810  ? -29.731 -25.606 -46.150 1.00 58.22  ? 810  LYS A O     1 
ATOM   5964  C  CB    . LYS A 1  810  ? -32.488 -25.635 -45.836 1.00 56.01  ? 810  LYS A CB    1 
ATOM   5965  C  CG    . LYS A 1  810  ? -33.873 -26.257 -45.782 1.00 55.53  ? 810  LYS A CG    1 
ATOM   5966  C  CD    . LYS A 1  810  ? -34.851 -25.608 -46.741 1.00 54.87  ? 810  LYS A CD    1 
ATOM   5967  C  CE    . LYS A 1  810  ? -36.217 -26.269 -46.617 1.00 54.99  ? 810  LYS A CE    1 
ATOM   5968  N  NZ    . LYS A 1  810  ? -37.309 -25.490 -47.259 1.00 54.84  ? 810  LYS A NZ    1 
ATOM   5969  N  N     . VAL A 1  811  ? -29.258 -26.532 -44.145 1.00 59.26  ? 811  VAL A N     1 
ATOM   5970  C  CA    . VAL A 1  811  ? -27.805 -26.556 -44.323 1.00 59.82  ? 811  VAL A CA    1 
ATOM   5971  C  C     . VAL A 1  811  ? -27.252 -27.937 -43.958 1.00 61.55  ? 811  VAL A C     1 
ATOM   5972  O  O     . VAL A 1  811  ? -27.158 -28.791 -44.831 1.00 62.39  ? 811  VAL A O     1 
ATOM   5973  C  CB    . VAL A 1  811  ? -27.094 -25.437 -43.517 1.00 60.68  ? 811  VAL A CB    1 
ATOM   5974  C  CG1   . VAL A 1  811  ? -25.590 -25.467 -43.771 1.00 61.40  ? 811  VAL A CG1   1 
ATOM   5975  C  CG2   . VAL A 1  811  ? -27.666 -24.068 -43.857 1.00 60.64  ? 811  VAL A CG2   1 
ATOM   5976  N  N     . LEU A 1  812  ? -26.941 -28.178 -42.681 1.00 64.31  ? 812  LEU A N     1 
ATOM   5977  C  CA    . LEU A 1  812  ? -26.120 -29.334 -42.272 1.00 66.25  ? 812  LEU A CA    1 
ATOM   5978  C  C     . LEU A 1  812  ? -26.858 -30.663 -42.391 1.00 64.48  ? 812  LEU A C     1 
ATOM   5979  O  O     . LEU A 1  812  ? -26.313 -31.631 -42.925 1.00 64.53  ? 812  LEU A O     1 
ATOM   5980  C  CB    . LEU A 1  812  ? -25.613 -29.170 -40.834 1.00 69.35  ? 812  LEU A CB    1 
ATOM   5981  C  CG    . LEU A 1  812  ? -24.745 -27.942 -40.531 1.00 72.34  ? 812  LEU A CG    1 
ATOM   5982  C  CD1   . LEU A 1  812  ? -24.574 -27.770 -39.022 1.00 74.50  ? 812  LEU A CD1   1 
ATOM   5983  C  CD2   . LEU A 1  812  ? -23.392 -28.026 -41.232 1.00 72.68  ? 812  LEU A CD2   1 
ATOM   5984  N  N     . LYS A 1  813  ? -28.086 -30.704 -41.878 1.00 63.15  ? 813  LYS A N     1 
ATOM   5985  C  CA    . LYS A 1  813  ? -28.919 -31.903 -41.962 1.00 62.74  ? 813  LYS A CA    1 
ATOM   5986  C  C     . LYS A 1  813  ? -29.330 -32.192 -43.398 1.00 59.95  ? 813  LYS A C     1 
ATOM   5987  O  O     . LYS A 1  813  ? -29.421 -33.356 -43.786 1.00 58.65  ? 813  LYS A O     1 
ATOM   5988  C  CB    . LYS A 1  813  ? -30.158 -31.783 -41.070 1.00 64.48  ? 813  LYS A CB    1 
ATOM   5989  C  CG    . LYS A 1  813  ? -29.867 -32.010 -39.594 1.00 67.49  ? 813  LYS A CG    1 
ATOM   5990  C  CD    . LYS A 1  813  ? -29.804 -33.495 -39.237 1.00 69.10  ? 813  LYS A CD    1 
ATOM   5991  C  CE    . LYS A 1  813  ? -29.103 -33.729 -37.901 1.00 71.09  ? 813  LYS A CE    1 
ATOM   5992  N  NZ    . LYS A 1  813  ? -29.663 -32.926 -36.771 1.00 72.00  ? 813  LYS A NZ    1 
ATOM   5993  N  N     . THR A 1  814  ? -29.576 -31.129 -44.168 1.00 58.01  ? 814  THR A N     1 
ATOM   5994  C  CA    . THR A 1  814  ? -29.880 -31.230 -45.596 1.00 56.33  ? 814  THR A CA    1 
ATOM   5995  C  C     . THR A 1  814  ? -28.784 -31.974 -46.332 1.00 56.10  ? 814  THR A C     1 
ATOM   5996  O  O     . THR A 1  814  ? -29.073 -32.854 -47.144 1.00 56.48  ? 814  THR A O     1 
ATOM   5997  C  CB    . THR A 1  814  ? -30.033 -29.834 -46.244 1.00 56.11  ? 814  THR A CB    1 
ATOM   5998  O  OG1   . THR A 1  814  ? -31.029 -29.086 -45.544 1.00 55.39  ? 814  THR A OG1   1 
ATOM   5999  C  CG2   . THR A 1  814  ? -30.428 -29.938 -47.723 1.00 55.14  ? 814  THR A CG2   1 
ATOM   6000  N  N     . GLY A 1  815  ? -27.535 -31.614 -46.045 1.00 55.87  ? 815  GLY A N     1 
ATOM   6001  C  CA    . GLY A 1  815  ? -26.379 -32.273 -46.635 1.00 56.00  ? 815  GLY A CA    1 
ATOM   6002  C  C     . GLY A 1  815  ? -26.193 -33.708 -46.187 1.00 56.26  ? 815  GLY A C     1 
ATOM   6003  O  O     . GLY A 1  815  ? -25.812 -34.548 -46.994 1.00 57.12  ? 815  GLY A O     1 
ATOM   6004  N  N     . ILE A 1  816  ? -26.444 -33.988 -44.909 1.00 56.62  ? 816  ILE A N     1 
ATOM   6005  C  CA    . ILE A 1  816  ? -26.406 -35.362 -44.396 1.00 57.67  ? 816  ILE A CA    1 
ATOM   6006  C  C     . ILE A 1  816  ? -27.399 -36.235 -45.160 1.00 57.22  ? 816  ILE A C     1 
ATOM   6007  O  O     . ILE A 1  816  ? -27.052 -37.326 -45.612 1.00 57.77  ? 816  ILE A O     1 
ATOM   6008  C  CB    . ILE A 1  816  ? -26.708 -35.428 -42.876 1.00 58.88  ? 816  ILE A CB    1 
ATOM   6009  C  CG1   . ILE A 1  816  ? -25.524 -34.860 -42.086 1.00 60.16  ? 816  ILE A CG1   1 
ATOM   6010  C  CG2   . ILE A 1  816  ? -26.985 -36.864 -42.419 1.00 58.74  ? 816  ILE A CG2   1 
ATOM   6011  C  CD1   . ILE A 1  816  ? -25.836 -34.560 -40.633 1.00 60.97  ? 816  ILE A CD1   1 
ATOM   6012  N  N     . ILE A 1  817  ? -28.627 -35.743 -45.297 1.00 56.55  ? 817  ILE A N     1 
ATOM   6013  C  CA    . ILE A 1  817  ? -29.674 -36.461 -46.016 1.00 55.90  ? 817  ILE A CA    1 
ATOM   6014  C  C     . ILE A 1  817  ? -29.304 -36.600 -47.499 1.00 55.51  ? 817  ILE A C     1 
ATOM   6015  O  O     . ILE A 1  817  ? -29.513 -37.666 -48.082 1.00 57.23  ? 817  ILE A O     1 
ATOM   6016  C  CB    . ILE A 1  817  ? -31.058 -35.786 -45.848 1.00 55.69  ? 817  ILE A CB    1 
ATOM   6017  C  CG1   . ILE A 1  817  ? -31.502 -35.834 -44.378 1.00 56.08  ? 817  ILE A CG1   1 
ATOM   6018  C  CG2   . ILE A 1  817  ? -32.110 -36.480 -46.711 1.00 55.54  ? 817  ILE A CG2   1 
ATOM   6019  C  CD1   . ILE A 1  817  ? -32.579 -34.830 -44.030 1.00 55.87  ? 817  ILE A CD1   1 
ATOM   6020  N  N     . ALA A 1  818  ? -28.751 -35.542 -48.095 1.00 54.31  ? 818  ALA A N     1 
ATOM   6021  C  CA    . ALA A 1  818  ? -28.285 -35.578 -49.494 1.00 52.54  ? 818  ALA A CA    1 
ATOM   6022  C  C     . ALA A 1  818  ? -27.116 -36.535 -49.699 1.00 52.41  ? 818  ALA A C     1 
ATOM   6023  O  O     . ALA A 1  818  ? -27.034 -37.195 -50.732 1.00 52.52  ? 818  ALA A O     1 
ATOM   6024  C  CB    . ALA A 1  818  ? -27.921 -34.181 -49.976 1.00 51.66  ? 818  ALA A CB    1 
ATOM   6025  N  N     . ALA A 1  819  ? -26.224 -36.609 -48.714 1.00 52.30  ? 819  ALA A N     1 
ATOM   6026  C  CA    . ALA A 1  819  ? -25.105 -37.543 -48.750 1.00 53.23  ? 819  ALA A CA    1 
ATOM   6027  C  C     . ALA A 1  819  ? -25.596 -38.989 -48.737 1.00 54.16  ? 819  ALA A C     1 
ATOM   6028  O  O     . ALA A 1  819  ? -25.167 -39.792 -49.564 1.00 55.55  ? 819  ALA A O     1 
ATOM   6029  C  CB    . ALA A 1  819  ? -24.163 -37.290 -47.586 1.00 53.72  ? 819  ALA A CB    1 
ATOM   6030  N  N     . VAL A 1  820  ? -26.506 -39.301 -47.812 1.00 54.30  ? 820  VAL A N     1 
ATOM   6031  C  CA    . VAL A 1  820  ? -27.092 -40.646 -47.694 1.00 54.25  ? 820  VAL A CA    1 
ATOM   6032  C  C     . VAL A 1  820  ? -27.911 -40.989 -48.937 1.00 53.54  ? 820  VAL A C     1 
ATOM   6033  O  O     . VAL A 1  820  ? -27.815 -42.099 -49.453 1.00 53.91  ? 820  VAL A O     1 
ATOM   6034  C  CB    . VAL A 1  820  ? -28.004 -40.787 -46.447 1.00 54.41  ? 820  VAL A CB    1 
ATOM   6035  C  CG1   . VAL A 1  820  ? -28.697 -42.150 -46.418 1.00 54.38  ? 820  VAL A CG1   1 
ATOM   6036  C  CG2   . VAL A 1  820  ? -27.215 -40.576 -45.161 1.00 55.45  ? 820  VAL A CG2   1 
ATOM   6037  N  N     . THR A 1  821  ? -28.721 -40.038 -49.396 1.00 52.78  ? 821  THR A N     1 
ATOM   6038  C  CA    . THR A 1  821  ? -29.529 -40.214 -50.601 1.00 53.19  ? 821  THR A CA    1 
ATOM   6039  C  C     . THR A 1  821  ? -28.669 -40.500 -51.842 1.00 53.50  ? 821  THR A C     1 
ATOM   6040  O  O     . THR A 1  821  ? -29.012 -41.376 -52.637 1.00 52.87  ? 821  THR A O     1 
ATOM   6041  C  CB    . THR A 1  821  ? -30.420 -38.979 -50.857 1.00 52.74  ? 821  THR A CB    1 
ATOM   6042  O  OG1   . THR A 1  821  ? -31.254 -38.757 -49.718 1.00 53.07  ? 821  THR A OG1   1 
ATOM   6043  C  CG2   . THR A 1  821  ? -31.312 -39.180 -52.072 1.00 52.53  ? 821  THR A CG2   1 
ATOM   6044  N  N     . ALA A 1  822  ? -27.561 -39.765 -51.990 1.00 54.09  ? 822  ALA A N     1 
ATOM   6045  C  CA    . ALA A 1  822  ? -26.635 -39.929 -53.130 1.00 53.20  ? 822  ALA A CA    1 
ATOM   6046  C  C     . ALA A 1  822  ? -25.864 -41.245 -53.087 1.00 53.56  ? 822  ALA A C     1 
ATOM   6047  O  O     . ALA A 1  822  ? -25.532 -41.805 -54.134 1.00 52.62  ? 822  ALA A O     1 
ATOM   6048  C  CB    . ALA A 1  822  ? -25.665 -38.762 -53.198 1.00 53.03  ? 822  ALA A CB    1 
ATOM   6049  N  N     . PHE A 1  823  ? -25.580 -41.732 -51.879 1.00 54.50  ? 823  PHE A N     1 
ATOM   6050  C  CA    . PHE A 1  823  ? -25.008 -43.065 -51.709 1.00 55.56  ? 823  PHE A CA    1 
ATOM   6051  C  C     . PHE A 1  823  ? -25.910 -44.149 -52.299 1.00 55.76  ? 823  PHE A C     1 
ATOM   6052  O  O     . PHE A 1  823  ? -25.437 -45.026 -53.021 1.00 56.06  ? 823  PHE A O     1 
ATOM   6053  C  CB    . PHE A 1  823  ? -24.742 -43.379 -50.241 1.00 55.87  ? 823  PHE A CB    1 
ATOM   6054  C  CG    . PHE A 1  823  ? -23.911 -44.610 -50.043 1.00 57.40  ? 823  PHE A CG    1 
ATOM   6055  C  CD1   . PHE A 1  823  ? -22.519 -44.546 -50.132 1.00 58.19  ? 823  PHE A CD1   1 
ATOM   6056  C  CD2   . PHE A 1  823  ? -24.510 -45.843 -49.802 1.00 57.81  ? 823  PHE A CD2   1 
ATOM   6057  C  CE1   . PHE A 1  823  ? -21.739 -45.683 -49.958 1.00 58.38  ? 823  PHE A CE1   1 
ATOM   6058  C  CE2   . PHE A 1  823  ? -23.737 -46.982 -49.629 1.00 58.72  ? 823  PHE A CE2   1 
ATOM   6059  C  CZ    . PHE A 1  823  ? -22.349 -46.900 -49.705 1.00 58.83  ? 823  PHE A CZ    1 
ATOM   6060  N  N     . ALA A 1  824  ? -27.201 -44.076 -51.981 1.00 55.51  ? 824  ALA A N     1 
ATOM   6061  C  CA    . ALA A 1  824  ? -28.202 -45.006 -52.511 1.00 54.84  ? 824  ALA A CA    1 
ATOM   6062  C  C     . ALA A 1  824  ? -28.317 -44.900 -54.026 1.00 54.29  ? 824  ALA A C     1 
ATOM   6063  O  O     . ALA A 1  824  ? -28.281 -45.913 -54.728 1.00 55.86  ? 824  ALA A O     1 
ATOM   6064  C  CB    . ALA A 1  824  ? -29.561 -44.750 -51.866 1.00 54.35  ? 824  ALA A CB    1 
ATOM   6065  N  N     . ALA A 1  825  ? -28.445 -43.671 -54.519 1.00 52.85  ? 825  ALA A N     1 
ATOM   6066  C  CA    . ALA A 1  825  ? -28.597 -43.417 -55.948 1.00 52.73  ? 825  ALA A CA    1 
ATOM   6067  C  C     . ALA A 1  825  ? -27.440 -44.019 -56.739 1.00 54.16  ? 825  ALA A C     1 
ATOM   6068  O  O     . ALA A 1  825  ? -27.656 -44.758 -57.706 1.00 54.95  ? 825  ALA A O     1 
ATOM   6069  C  CB    . ALA A 1  825  ? -28.704 -41.924 -56.209 1.00 52.33  ? 825  ALA A CB    1 
ATOM   6070  N  N     . ASN A 1  826  ? -26.218 -43.718 -56.304 1.00 54.42  ? 826  ASN A N     1 
ATOM   6071  C  CA    . ASN A 1  826  ? -25.014 -44.313 -56.885 1.00 54.78  ? 826  ASN A CA    1 
ATOM   6072  C  C     . ASN A 1  826  ? -24.973 -45.841 -56.765 1.00 56.13  ? 826  ASN A C     1 
ATOM   6073  O  O     . ASN A 1  826  ? -24.619 -46.523 -57.721 1.00 57.70  ? 826  ASN A O     1 
ATOM   6074  C  CB    . ASN A 1  826  ? -23.765 -43.708 -56.240 1.00 54.78  ? 826  ASN A CB    1 
ATOM   6075  C  CG    . ASN A 1  826  ? -22.483 -44.319 -56.760 1.00 54.65  ? 826  ASN A CG    1 
ATOM   6076  O  OD1   . ASN A 1  826  ? -21.972 -43.929 -57.809 1.00 54.16  ? 826  ASN A OD1   1 
ATOM   6077  N  ND2   . ASN A 1  826  ? -21.948 -45.278 -56.019 1.00 55.92  ? 826  ASN A ND2   1 
ATOM   6078  N  N     . LYS A 1  827  ? -25.323 -46.369 -55.594 1.00 56.99  ? 827  LYS A N     1 
ATOM   6079  C  CA    . LYS A 1  827  ? -25.308 -47.817 -55.361 1.00 57.88  ? 827  LYS A CA    1 
ATOM   6080  C  C     . LYS A 1  827  ? -26.199 -48.570 -56.339 1.00 58.28  ? 827  LYS A C     1 
ATOM   6081  O  O     . LYS A 1  827  ? -25.802 -49.606 -56.875 1.00 59.85  ? 827  LYS A O     1 
ATOM   6082  C  CB    . LYS A 1  827  ? -25.744 -48.152 -53.931 1.00 57.98  ? 827  LYS A CB    1 
ATOM   6083  C  CG    . LYS A 1  827  ? -25.605 -49.621 -53.560 1.00 58.47  ? 827  LYS A CG    1 
ATOM   6084  C  CD    . LYS A 1  827  ? -26.063 -49.874 -52.138 1.00 58.92  ? 827  LYS A CD    1 
ATOM   6085  C  CE    . LYS A 1  827  ? -26.000 -51.350 -51.790 1.00 59.51  ? 827  LYS A CE    1 
ATOM   6086  N  NZ    . LYS A 1  827  ? -26.443 -51.608 -50.396 1.00 60.07  ? 827  LYS A NZ    1 
ATOM   6087  N  N     . HIS A 1  828  ? -27.398 -48.046 -56.562 1.00 57.78  ? 828  HIS A N     1 
ATOM   6088  C  CA    . HIS A 1  828  ? -28.401 -48.740 -57.365 1.00 57.45  ? 828  HIS A CA    1 
ATOM   6089  C  C     . HIS A 1  828  ? -28.534 -48.219 -58.799 1.00 56.07  ? 828  HIS A C     1 
ATOM   6090  O  O     . HIS A 1  828  ? -29.333 -48.751 -59.570 1.00 55.92  ? 828  HIS A O     1 
ATOM   6091  C  CB    . HIS A 1  828  ? -29.736 -48.709 -56.620 1.00 56.99  ? 828  HIS A CB    1 
ATOM   6092  C  CG    . HIS A 1  828  ? -29.671 -49.374 -55.282 1.00 57.35  ? 828  HIS A CG    1 
ATOM   6093  N  ND1   . HIS A 1  828  ? -29.767 -50.740 -55.126 1.00 57.90  ? 828  HIS A ND1   1 
ATOM   6094  C  CD2   . HIS A 1  828  ? -29.472 -48.868 -54.042 1.00 57.23  ? 828  HIS A CD2   1 
ATOM   6095  C  CE1   . HIS A 1  828  ? -29.650 -51.045 -53.846 1.00 57.82  ? 828  HIS A CE1   1 
ATOM   6096  N  NE2   . HIS A 1  828  ? -29.471 -49.927 -53.168 1.00 57.83  ? 828  HIS A NE2   1 
ATOM   6097  N  N     . GLY A 1  829  ? -27.734 -47.215 -59.164 1.00 55.11  ? 829  GLY A N     1 
ATOM   6098  C  CA    . GLY A 1  829  ? -27.779 -46.620 -60.503 1.00 54.58  ? 829  GLY A CA    1 
ATOM   6099  C  C     . GLY A 1  829  ? -29.161 -46.109 -60.855 1.00 53.97  ? 829  GLY A C     1 
ATOM   6100  O  O     . GLY A 1  829  ? -29.700 -46.449 -61.896 1.00 54.67  ? 829  GLY A O     1 
ATOM   6101  N  N     . ARG A 1  830  ? -29.740 -45.321 -59.954 1.00 53.99  ? 830  ARG A N     1 
ATOM   6102  C  CA    . ARG A 1  830  ? -31.106 -44.817 -60.089 1.00 53.33  ? 830  ARG A CA    1 
ATOM   6103  C  C     . ARG A 1  830  ? -31.204 -43.432 -59.488 1.00 52.27  ? 830  ARG A C     1 
ATOM   6104  O  O     . ARG A 1  830  ? -30.480 -43.109 -58.553 1.00 52.13  ? 830  ARG A O     1 
ATOM   6105  C  CB    . ARG A 1  830  ? -32.091 -45.718 -59.338 1.00 54.38  ? 830  ARG A CB    1 
ATOM   6106  C  CG    . ARG A 1  830  ? -32.328 -47.093 -59.945 1.00 55.04  ? 830  ARG A CG    1 
ATOM   6107  C  CD    . ARG A 1  830  ? -33.113 -47.021 -61.239 1.00 54.79  ? 830  ARG A CD    1 
ATOM   6108  N  NE    . ARG A 1  830  ? -33.666 -48.326 -61.589 1.00 55.95  ? 830  ARG A NE    1 
ATOM   6109  C  CZ    . ARG A 1  830  ? -34.724 -48.905 -61.014 1.00 56.32  ? 830  ARG A CZ    1 
ATOM   6110  N  NH1   . ARG A 1  830  ? -35.397 -48.310 -60.030 1.00 55.95  ? 830  ARG A NH1   1 
ATOM   6111  N  NH2   . ARG A 1  830  ? -35.118 -50.104 -61.433 1.00 57.37  ? 830  ARG A NH2   1 
ATOM   6112  N  N     . ALA A 1  831  ? -32.118 -42.623 -60.012 1.00 51.78  ? 831  ALA A N     1 
ATOM   6113  C  CA    . ALA A 1  831  ? -32.460 -41.362 -59.368 1.00 51.82  ? 831  ALA A CA    1 
ATOM   6114  C  C     . ALA A 1  831  ? -33.210 -41.674 -58.069 1.00 51.14  ? 831  ALA A C     1 
ATOM   6115  O  O     . ALA A 1  831  ? -34.020 -42.597 -58.033 1.00 50.45  ? 831  ALA A O     1 
ATOM   6116  C  CB    . ALA A 1  831  ? -33.297 -40.497 -60.292 1.00 51.93  ? 831  ALA A CB    1 
ATOM   6117  N  N     . VAL A 1  832  ? -32.902 -40.941 -57.001 1.00 50.65  ? 832  VAL A N     1 
ATOM   6118  C  CA    . VAL A 1  832  ? -33.561 -41.137 -55.699 1.00 50.73  ? 832  VAL A CA    1 
ATOM   6119  C  C     . VAL A 1  832  ? -34.063 -39.790 -55.183 1.00 50.33  ? 832  VAL A C     1 
ATOM   6120  O  O     . VAL A 1  832  ? -33.332 -38.799 -55.212 1.00 50.08  ? 832  VAL A O     1 
ATOM   6121  C  CB    . VAL A 1  832  ? -32.623 -41.794 -54.656 1.00 50.86  ? 832  VAL A CB    1 
ATOM   6122  C  CG1   . VAL A 1  832  ? -33.354 -42.027 -53.339 1.00 51.20  ? 832  VAL A CG1   1 
ATOM   6123  C  CG2   . VAL A 1  832  ? -32.082 -43.116 -55.176 1.00 51.02  ? 832  VAL A CG2   1 
ATOM   6124  N  N     . ARG A 1  833  ? -35.313 -39.772 -54.720 1.00 50.95  ? 833  ARG A N     1 
ATOM   6125  C  CA    . ARG A 1  833  ? -35.958 -38.575 -54.189 1.00 51.42  ? 833  ARG A CA    1 
ATOM   6126  C  C     . ARG A 1  833  ? -36.220 -38.783 -52.707 1.00 51.86  ? 833  ARG A C     1 
ATOM   6127  O  O     . ARG A 1  833  ? -36.724 -39.832 -52.305 1.00 51.83  ? 833  ARG A O     1 
ATOM   6128  C  CB    . ARG A 1  833  ? -37.279 -38.320 -54.917 1.00 52.31  ? 833  ARG A CB    1 
ATOM   6129  C  CG    . ARG A 1  833  ? -37.971 -36.999 -54.589 1.00 52.57  ? 833  ARG A CG    1 
ATOM   6130  C  CD    . ARG A 1  833  ? -39.337 -36.907 -55.259 1.00 52.62  ? 833  ARG A CD    1 
ATOM   6131  N  NE    . ARG A 1  833  ? -39.244 -36.950 -56.726 1.00 52.98  ? 833  ARG A NE    1 
ATOM   6132  C  CZ    . ARG A 1  833  ? -39.517 -35.949 -57.577 1.00 53.80  ? 833  ARG A CZ    1 
ATOM   6133  N  NH1   . ARG A 1  833  ? -39.962 -34.766 -57.163 1.00 54.19  ? 833  ARG A NH1   1 
ATOM   6134  N  NH2   . ARG A 1  833  ? -39.361 -36.146 -58.884 1.00 54.10  ? 833  ARG A NH2   1 
ATOM   6135  N  N     . CYS A 1  834  ? -35.867 -37.780 -51.907 1.00 52.37  ? 834  CYS A N     1 
ATOM   6136  C  CA    . CYS A 1  834  ? -36.147 -37.764 -50.471 1.00 52.29  ? 834  CYS A CA    1 
ATOM   6137  C  C     . CYS A 1  834  ? -36.861 -36.458 -50.132 1.00 51.77  ? 834  CYS A C     1 
ATOM   6138  O  O     . CYS A 1  834  ? -36.324 -35.370 -50.346 1.00 51.17  ? 834  CYS A O     1 
ATOM   6139  C  CB    . CYS A 1  834  ? -34.856 -37.884 -49.666 1.00 52.88  ? 834  CYS A CB    1 
ATOM   6140  S  SG    . CYS A 1  834  ? -35.115 -38.098 -47.896 1.00 54.09  ? 834  CYS A SG    1 
ATOM   6141  N  N     . VAL A 1  835  ? -38.091 -36.592 -49.643 1.00 51.78  ? 835  VAL A N     1 
ATOM   6142  C  CA    . VAL A 1  835  ? -38.908 -35.480 -49.177 1.00 51.01  ? 835  VAL A CA    1 
ATOM   6143  C  C     . VAL A 1  835  ? -39.486 -35.906 -47.836 1.00 50.93  ? 835  VAL A C     1 
ATOM   6144  O  O     . VAL A 1  835  ? -40.130 -36.945 -47.746 1.00 50.56  ? 835  VAL A O     1 
ATOM   6145  C  CB    . VAL A 1  835  ? -40.043 -35.159 -50.173 1.00 50.74  ? 835  VAL A CB    1 
ATOM   6146  C  CG1   . VAL A 1  835  ? -40.998 -34.112 -49.610 1.00 51.00  ? 835  VAL A CG1   1 
ATOM   6147  C  CG2   . VAL A 1  835  ? -39.454 -34.684 -51.488 1.00 50.85  ? 835  VAL A CG2   1 
ATOM   6148  N  N     . LEU A 1  836  ? -39.253 -35.102 -46.803 1.00 51.40  ? 836  LEU A N     1 
ATOM   6149  C  CA    . LEU A 1  836  ? -39.702 -35.425 -45.447 1.00 51.96  ? 836  LEU A CA    1 
ATOM   6150  C  C     . LEU A 1  836  ? -41.090 -34.867 -45.139 1.00 51.50  ? 836  LEU A C     1 
ATOM   6151  O  O     . LEU A 1  836  ? -41.427 -33.764 -45.555 1.00 50.75  ? 836  LEU A O     1 
ATOM   6152  C  CB    . LEU A 1  836  ? -38.704 -34.888 -44.418 1.00 52.14  ? 836  LEU A CB    1 
ATOM   6153  C  CG    . LEU A 1  836  ? -37.264 -35.384 -44.539 1.00 51.98  ? 836  LEU A CG    1 
ATOM   6154  C  CD1   . LEU A 1  836  ? -36.450 -34.864 -43.373 1.00 52.73  ? 836  LEU A CD1   1 
ATOM   6155  C  CD2   . LEU A 1  836  ? -37.202 -36.902 -44.591 1.00 52.75  ? 836  LEU A CD2   1 
ATOM   6156  N  N     . GLU A 1  837  ? -41.883 -35.648 -44.407 1.00 52.54  ? 837  GLU A N     1 
ATOM   6157  C  CA    . GLU A 1  837  ? -43.143 -35.173 -43.831 1.00 52.97  ? 837  GLU A CA    1 
ATOM   6158  C  C     . GLU A 1  837  ? -42.841 -34.276 -42.638 1.00 53.33  ? 837  GLU A C     1 
ATOM   6159  O  O     . GLU A 1  837  ? -41.749 -34.341 -42.061 1.00 53.11  ? 837  GLU A O     1 
ATOM   6160  C  CB    . GLU A 1  837  ? -44.020 -36.341 -43.384 1.00 53.55  ? 837  GLU A CB    1 
ATOM   6161  C  CG    . GLU A 1  837  ? -44.521 -37.207 -44.522 1.00 53.75  ? 837  GLU A CG    1 
ATOM   6162  C  CD    . GLU A 1  837  ? -45.361 -38.374 -44.047 1.00 54.96  ? 837  GLU A CD    1 
ATOM   6163  O  OE1   . GLU A 1  837  ? -46.177 -38.201 -43.118 1.00 56.88  ? 837  GLU A OE1   1 
ATOM   6164  O  OE2   . GLU A 1  837  ? -45.219 -39.471 -44.617 1.00 55.96  ? 837  GLU A OE2   1 
ATOM   6165  N  N     . ARG A 1  838  ? -43.822 -33.462 -42.265 1.00 53.51  ? 838  ARG A N     1 
ATOM   6166  C  CA    . ARG A 1  838  ? -43.645 -32.434 -41.235 1.00 54.41  ? 838  ARG A CA    1 
ATOM   6167  C  C     . ARG A 1  838  ? -43.192 -32.971 -39.868 1.00 54.86  ? 838  ARG A C     1 
ATOM   6168  O  O     . ARG A 1  838  ? -42.328 -32.374 -39.230 1.00 55.08  ? 838  ARG A O     1 
ATOM   6169  C  CB    . ARG A 1  838  ? -44.936 -31.613 -41.096 1.00 54.97  ? 838  ARG A CB    1 
ATOM   6170  C  CG    . ARG A 1  838  ? -44.904 -30.470 -40.089 1.00 55.39  ? 838  ARG A CG    1 
ATOM   6171  C  CD    . ARG A 1  838  ? -43.850 -29.434 -40.430 1.00 54.98  ? 838  ARG A CD    1 
ATOM   6172  N  NE    . ARG A 1  838  ? -44.145 -28.754 -41.688 1.00 54.61  ? 838  ARG A NE    1 
ATOM   6173  C  CZ    . ARG A 1  838  ? -43.364 -27.837 -42.256 1.00 55.23  ? 838  ARG A CZ    1 
ATOM   6174  N  NH1   . ARG A 1  838  ? -42.204 -27.479 -41.702 1.00 55.99  ? 838  ARG A NH1   1 
ATOM   6175  N  NH2   . ARG A 1  838  ? -43.739 -27.268 -43.394 1.00 55.56  ? 838  ARG A NH2   1 
ATOM   6176  N  N     . GLY A 1  839  ? -43.766 -34.090 -39.432 1.00 56.32  ? 839  GLY A N     1 
ATOM   6177  C  CA    . GLY A 1  839  ? -43.379 -34.730 -38.171 1.00 57.88  ? 839  GLY A CA    1 
ATOM   6178  C  C     . GLY A 1  839  ? -41.923 -35.164 -38.154 1.00 59.60  ? 839  GLY A C     1 
ATOM   6179  O  O     . GLY A 1  839  ? -41.170 -34.772 -37.266 1.00 59.50  ? 839  GLY A O     1 
ATOM   6180  N  N     . GLU A 1  840  ? -41.538 -35.970 -39.146 1.00 61.84  ? 840  GLU A N     1 
ATOM   6181  C  CA    . GLU A 1  840  ? -40.134 -36.360 -39.368 1.00 63.66  ? 840  GLU A CA    1 
ATOM   6182  C  C     . GLU A 1  840  ? -39.200 -35.146 -39.382 1.00 62.94  ? 840  GLU A C     1 
ATOM   6183  O  O     . GLU A 1  840  ? -38.145 -35.154 -38.746 1.00 62.99  ? 840  GLU A O     1 
ATOM   6184  C  CB    . GLU A 1  840  ? -39.951 -37.031 -40.737 1.00 65.71  ? 840  GLU A CB    1 
ATOM   6185  C  CG    . GLU A 1  840  ? -40.610 -38.377 -40.990 1.00 66.91  ? 840  GLU A CG    1 
ATOM   6186  C  CD    . GLU A 1  840  ? -40.477 -38.788 -42.454 1.00 67.46  ? 840  GLU A CD    1 
ATOM   6187  O  OE1   . GLU A 1  840  ? -40.709 -37.935 -43.341 1.00 64.82  ? 840  GLU A OE1   1 
ATOM   6188  O  OE2   . GLU A 1  840  ? -40.132 -39.957 -42.723 1.00 70.29  ? 840  GLU A OE2   1 
ATOM   6189  N  N     . ASP A 1  841  ? -39.597 -34.128 -40.148 1.00 61.58  ? 841  ASP A N     1 
ATOM   6190  C  CA    . ASP A 1  841  ? -38.775 -32.947 -40.392 1.00 61.31  ? 841  ASP A CA    1 
ATOM   6191  C  C     . ASP A 1  841  ? -38.452 -32.241 -39.087 1.00 63.29  ? 841  ASP A C     1 
ATOM   6192  O  O     . ASP A 1  841  ? -37.296 -31.942 -38.816 1.00 64.51  ? 841  ASP A O     1 
ATOM   6193  C  CB    . ASP A 1  841  ? -39.485 -31.988 -41.358 1.00 60.14  ? 841  ASP A CB    1 
ATOM   6194  C  CG    . ASP A 1  841  ? -38.551 -30.946 -41.958 1.00 58.89  ? 841  ASP A CG    1 
ATOM   6195  O  OD1   . ASP A 1  841  ? -37.917 -30.182 -41.204 1.00 59.26  ? 841  ASP A OD1   1 
ATOM   6196  O  OD2   . ASP A 1  841  ? -38.472 -30.875 -43.198 1.00 56.92  ? 841  ASP A OD2   1 
ATOM   6197  N  N     . MET A 1  842  ? -39.474 -31.997 -38.276 1.00 65.12  ? 842  MET A N     1 
ATOM   6198  C  CA    . MET A 1  842  ? -39.285 -31.361 -36.968 1.00 66.80  ? 842  MET A CA    1 
ATOM   6199  C  C     . MET A 1  842  ? -38.412 -32.187 -36.016 1.00 67.64  ? 842  MET A C     1 
ATOM   6200  O  O     . MET A 1  842  ? -37.655 -31.625 -35.228 1.00 70.45  ? 842  MET A O     1 
ATOM   6201  C  CB    . MET A 1  842  ? -40.640 -31.068 -36.320 1.00 68.11  ? 842  MET A CB    1 
ATOM   6202  C  CG    . MET A 1  842  ? -41.416 -29.961 -37.018 1.00 68.12  ? 842  MET A CG    1 
ATOM   6203  S  SD    . MET A 1  842  ? -43.061 -29.716 -36.328 1.00 69.52  ? 842  MET A SD    1 
ATOM   6204  C  CE    . MET A 1  842  ? -42.690 -28.977 -34.733 1.00 70.13  ? 842  MET A CE    1 
ATOM   6205  N  N     . LEU A 1  843  ? -38.510 -33.511 -36.109 1.00 67.58  ? 843  LEU A N     1 
ATOM   6206  C  CA    . LEU A 1  843  ? -37.718 -34.424 -35.278 1.00 68.02  ? 843  LEU A CA    1 
ATOM   6207  C  C     . LEU A 1  843  ? -36.261 -34.535 -35.756 1.00 67.02  ? 843  LEU A C     1 
ATOM   6208  O  O     . LEU A 1  843  ? -35.334 -34.458 -34.950 1.00 68.24  ? 843  LEU A O     1 
ATOM   6209  C  CB    . LEU A 1  843  ? -38.378 -35.813 -35.246 1.00 68.98  ? 843  LEU A CB    1 
ATOM   6210  C  CG    . LEU A 1  843  ? -38.233 -36.613 -33.947 1.00 71.27  ? 843  LEU A CG    1 
ATOM   6211  C  CD1   . LEU A 1  843  ? -39.068 -36.004 -32.826 1.00 72.65  ? 843  LEU A CD1   1 
ATOM   6212  C  CD2   . LEU A 1  843  ? -38.628 -38.069 -34.165 1.00 71.81  ? 843  LEU A CD2   1 
ATOM   6213  N  N     . ILE A 1  844  ? -36.072 -34.722 -37.061 1.00 65.49  ? 844  ILE A N     1 
ATOM   6214  C  CA    . ILE A 1  844  ? -34.741 -34.904 -37.656 1.00 65.55  ? 844  ILE A CA    1 
ATOM   6215  C  C     . ILE A 1  844  ? -33.954 -33.601 -37.668 1.00 66.49  ? 844  ILE A C     1 
ATOM   6216  O  O     . ILE A 1  844  ? -32.792 -33.566 -37.270 1.00 65.50  ? 844  ILE A O     1 
ATOM   6217  C  CB    . ILE A 1  844  ? -34.839 -35.456 -39.099 1.00 64.73  ? 844  ILE A CB    1 
ATOM   6218  C  CG1   . ILE A 1  844  ? -35.398 -36.886 -39.072 1.00 64.97  ? 844  ILE A CG1   1 
ATOM   6219  C  CG2   . ILE A 1  844  ? -33.481 -35.426 -39.805 1.00 64.09  ? 844  ILE A CG2   1 
ATOM   6220  C  CD1   . ILE A 1  844  ? -35.911 -37.388 -40.405 1.00 63.69  ? 844  ILE A CD1   1 
ATOM   6221  N  N     . THR A 1  845  ? -34.594 -32.543 -38.160 1.00 68.54  ? 845  THR A N     1 
ATOM   6222  C  CA    . THR A 1  845  ? -33.976 -31.220 -38.240 1.00 69.10  ? 845  THR A CA    1 
ATOM   6223  C  C     . THR A 1  845  ? -33.950 -30.616 -36.831 1.00 71.35  ? 845  THR A C     1 
ATOM   6224  O  O     . THR A 1  845  ? -34.775 -30.967 -35.975 1.00 74.25  ? 845  THR A O     1 
ATOM   6225  C  CB    . THR A 1  845  ? -34.704 -30.312 -39.280 1.00 68.19  ? 845  THR A CB    1 
ATOM   6226  O  OG1   . THR A 1  845  ? -33.740 -29.554 -40.010 1.00 69.42  ? 845  THR A OG1   1 
ATOM   6227  C  CG2   . THR A 1  845  ? -35.737 -29.334 -38.645 1.00 69.09  ? 845  THR A CG2   1 
ATOM   6228  N  N     . GLY A 1  846  ? -33.008 -29.714 -36.585 1.00 71.22  ? 846  GLY A N     1 
ATOM   6229  C  CA    . GLY A 1  846  ? -32.942 -29.030 -35.295 1.00 72.02  ? 846  GLY A CA    1 
ATOM   6230  C  C     . GLY A 1  846  ? -33.944 -27.895 -35.184 1.00 70.90  ? 846  GLY A C     1 
ATOM   6231  O  O     . GLY A 1  846  ? -34.945 -27.852 -35.903 1.00 71.49  ? 846  GLY A O     1 
ATOM   6232  N  N     . GLY A 1  847  ? -33.670 -26.986 -34.256 1.00 69.96  ? 847  GLY A N     1 
ATOM   6233  C  CA    . GLY A 1  847  ? -34.350 -25.699 -34.183 1.00 68.96  ? 847  GLY A CA    1 
ATOM   6234  C  C     . GLY A 1  847  ? -33.382 -24.612 -33.761 1.00 68.33  ? 847  GLY A C     1 
ATOM   6235  O  O     . GLY A 1  847  ? -32.165 -24.804 -33.798 1.00 68.05  ? 847  GLY A O     1 
ATOM   6236  N  N     . ARG A 1  848  ? -33.925 -23.464 -33.368 1.00 67.66  ? 848  ARG A N     1 
ATOM   6237  C  CA    . ARG A 1  848  ? -33.139 -22.414 -32.727 1.00 67.94  ? 848  ARG A CA    1 
ATOM   6238  C  C     . ARG A 1  848  ? -32.629 -22.936 -31.391 1.00 68.70  ? 848  ARG A C     1 
ATOM   6239  O  O     . ARG A 1  848  ? -33.282 -23.769 -30.762 1.00 69.01  ? 848  ARG A O     1 
ATOM   6240  C  CB    . ARG A 1  848  ? -33.989 -21.165 -32.491 1.00 67.70  ? 848  ARG A CB    1 
ATOM   6241  C  CG    . ARG A 1  848  ? -33.181 -19.933 -32.139 1.00 68.18  ? 848  ARG A CG    1 
ATOM   6242  C  CD    . ARG A 1  848  ? -34.073 -18.786 -31.699 1.00 68.18  ? 848  ARG A CD    1 
ATOM   6243  N  NE    . ARG A 1  848  ? -34.780 -18.146 -32.808 1.00 66.80  ? 848  ARG A NE    1 
ATOM   6244  C  CZ    . ARG A 1  848  ? -34.230 -17.331 -33.713 1.00 65.98  ? 848  ARG A CZ    1 
ATOM   6245  N  NH1   . ARG A 1  848  ? -32.926 -17.044 -33.703 1.00 65.98  ? 848  ARG A NH1   1 
ATOM   6246  N  NH2   . ARG A 1  848  ? -35.002 -16.793 -34.652 1.00 65.29  ? 848  ARG A NH2   1 
ATOM   6247  N  N     . HIS A 1  849  ? -31.469 -22.442 -30.966 1.00 69.44  ? 849  HIS A N     1 
ATOM   6248  C  CA    . HIS A 1  849  ? -30.891 -22.814 -29.670 1.00 69.90  ? 849  HIS A CA    1 
ATOM   6249  C  C     . HIS A 1  849  ? -31.701 -22.235 -28.512 1.00 68.87  ? 849  HIS A C     1 
ATOM   6250  O  O     . HIS A 1  849  ? -31.905 -21.021 -28.449 1.00 68.09  ? 849  HIS A O     1 
ATOM   6251  C  CB    . HIS A 1  849  ? -29.444 -22.326 -29.553 1.00 71.26  ? 849  HIS A CB    1 
ATOM   6252  C  CG    . HIS A 1  849  ? -28.486 -23.080 -30.419 1.00 71.53  ? 849  HIS A CG    1 
ATOM   6253  N  ND1   . HIS A 1  849  ? -28.350 -22.836 -31.768 1.00 71.10  ? 849  HIS A ND1   1 
ATOM   6254  C  CD2   . HIS A 1  849  ? -27.623 -24.081 -30.128 1.00 72.69  ? 849  HIS A CD2   1 
ATOM   6255  C  CE1   . HIS A 1  849  ? -27.439 -23.650 -32.270 1.00 71.11  ? 849  HIS A CE1   1 
ATOM   6256  N  NE2   . HIS A 1  849  ? -26.984 -24.417 -31.296 1.00 72.38  ? 849  HIS A NE2   1 
ATOM   6257  N  N     . PRO A 1  850  ? -32.190 -23.105 -27.608 1.00 68.99  ? 850  PRO A N     1 
ATOM   6258  C  CA    . PRO A 1  850  ? -32.678 -22.598 -26.326 1.00 70.33  ? 850  PRO A CA    1 
ATOM   6259  C  C     . PRO A 1  850  ? -31.521 -22.011 -25.513 1.00 72.08  ? 850  PRO A C     1 
ATOM   6260  O  O     . PRO A 1  850  ? -30.416 -22.567 -25.533 1.00 72.93  ? 850  PRO A O     1 
ATOM   6261  C  CB    . PRO A 1  850  ? -33.253 -23.845 -25.636 1.00 70.19  ? 850  PRO A CB    1 
ATOM   6262  C  CG    . PRO A 1  850  ? -33.470 -24.839 -26.719 1.00 69.00  ? 850  PRO A CG    1 
ATOM   6263  C  CD    . PRO A 1  850  ? -32.442 -24.549 -27.762 1.00 68.24  ? 850  PRO A CD    1 
ATOM   6264  N  N     . TYR A 1  851  ? -31.772 -20.897 -24.826 1.00 72.95  ? 851  TYR A N     1 
ATOM   6265  C  CA    . TYR A 1  851  ? -30.752 -20.226 -24.008 1.00 74.25  ? 851  TYR A CA    1 
ATOM   6266  C  C     . TYR A 1  851  ? -31.126 -20.219 -22.532 1.00 75.01  ? 851  TYR A C     1 
ATOM   6267  O  O     . TYR A 1  851  ? -32.301 -20.331 -22.175 1.00 74.44  ? 851  TYR A O     1 
ATOM   6268  C  CB    . TYR A 1  851  ? -30.551 -18.778 -24.469 1.00 74.20  ? 851  TYR A CB    1 
ATOM   6269  C  CG    . TYR A 1  851  ? -29.339 -18.537 -25.348 1.00 74.09  ? 851  TYR A CG    1 
ATOM   6270  C  CD1   . TYR A 1  851  ? -29.130 -19.281 -26.516 1.00 72.48  ? 851  TYR A CD1   1 
ATOM   6271  C  CD2   . TYR A 1  851  ? -28.422 -17.523 -25.039 1.00 74.74  ? 851  TYR A CD2   1 
ATOM   6272  C  CE1   . TYR A 1  851  ? -28.028 -19.040 -27.331 1.00 71.97  ? 851  TYR A CE1   1 
ATOM   6273  C  CE2   . TYR A 1  851  ? -27.322 -17.277 -25.850 1.00 74.51  ? 851  TYR A CE2   1 
ATOM   6274  C  CZ    . TYR A 1  851  ? -27.128 -18.035 -26.993 1.00 73.03  ? 851  TYR A CZ    1 
ATOM   6275  O  OH    . TYR A 1  851  ? -26.034 -17.783 -27.787 1.00 73.00  ? 851  TYR A OH    1 
ATOM   6276  N  N     . LEU A 1  852  ? -30.101 -20.096 -21.693 1.00 76.35  ? 852  LEU A N     1 
ATOM   6277  C  CA    . LEU A 1  852  ? -30.247 -19.702 -20.293 1.00 78.34  ? 852  LEU A CA    1 
ATOM   6278  C  C     . LEU A 1  852  ? -29.274 -18.549 -20.065 1.00 80.25  ? 852  LEU A C     1 
ATOM   6279  O  O     . LEU A 1  852  ? -28.085 -18.676 -20.373 1.00 80.75  ? 852  LEU A O     1 
ATOM   6280  C  CB    . LEU A 1  852  ? -29.937 -20.871 -19.352 1.00 79.04  ? 852  LEU A CB    1 
ATOM   6281  C  CG    . LEU A 1  852  ? -29.758 -20.578 -17.852 1.00 80.66  ? 852  LEU A CG    1 
ATOM   6282  C  CD1   . LEU A 1  852  ? -30.913 -19.757 -17.286 1.00 80.95  ? 852  LEU A CD1   1 
ATOM   6283  C  CD2   . LEU A 1  852  ? -29.592 -21.880 -17.082 1.00 81.15  ? 852  LEU A CD2   1 
ATOM   6284  N  N     . GLY A 1  853  ? -29.784 -17.429 -19.550 1.00 81.47  ? 853  GLY A N     1 
ATOM   6285  C  CA    . GLY A 1  853  ? -28.969 -16.251 -19.253 1.00 82.99  ? 853  GLY A CA    1 
ATOM   6286  C  C     . GLY A 1  853  ? -28.903 -16.024 -17.759 1.00 84.75  ? 853  GLY A C     1 
ATOM   6287  O  O     . GLY A 1  853  ? -29.941 -15.982 -17.108 1.00 86.19  ? 853  GLY A O     1 
ATOM   6288  N  N     . LYS A 1  854  ? -27.690 -15.899 -17.216 1.00 85.96  ? 854  LYS A N     1 
ATOM   6289  C  CA    . LYS A 1  854  ? -27.480 -15.545 -15.806 1.00 87.59  ? 854  LYS A CA    1 
ATOM   6290  C  C     . LYS A 1  854  ? -26.696 -14.238 -15.734 1.00 88.46  ? 854  LYS A C     1 
ATOM   6291  O  O     . LYS A 1  854  ? -25.633 -14.120 -16.342 1.00 87.88  ? 854  LYS A O     1 
ATOM   6292  C  CB    . LYS A 1  854  ? -26.703 -16.638 -15.076 1.00 89.02  ? 854  LYS A CB    1 
ATOM   6293  C  CG    . LYS A 1  854  ? -27.447 -17.950 -14.911 1.00 89.20  ? 854  LYS A CG    1 
ATOM   6294  C  CD    . LYS A 1  854  ? -26.709 -18.876 -13.953 1.00 91.44  ? 854  LYS A CD    1 
ATOM   6295  C  CE    . LYS A 1  854  ? -27.204 -20.310 -14.066 1.00 91.28  ? 854  LYS A CE    1 
ATOM   6296  N  NZ    . LYS A 1  854  ? -26.456 -21.243 -13.176 1.00 93.02  ? 854  LYS A NZ    1 
ATOM   6297  N  N     . TYR A 1  855  ? -27.215 -13.273 -14.979 1.00 90.02  ? 855  TYR A N     1 
ATOM   6298  C  CA    . TYR A 1  855  ? -26.573 -11.965 -14.840 1.00 91.83  ? 855  TYR A CA    1 
ATOM   6299  C  C     . TYR A 1  855  ? -26.522 -11.498 -13.395 1.00 93.99  ? 855  TYR A C     1 
ATOM   6300  O  O     . TYR A 1  855  ? -27.440 -11.762 -12.616 1.00 93.58  ? 855  TYR A O     1 
ATOM   6301  C  CB    . TYR A 1  855  ? -27.280 -10.905 -15.689 1.00 91.33  ? 855  TYR A CB    1 
ATOM   6302  C  CG    . TYR A 1  855  ? -28.791 -10.891 -15.586 1.00 90.97  ? 855  TYR A CG    1 
ATOM   6303  C  CD1   . TYR A 1  855  ? -29.444 -10.199 -14.559 1.00 92.16  ? 855  TYR A CD1   1 
ATOM   6304  C  CD2   . TYR A 1  855  ? -29.570 -11.557 -16.531 1.00 89.13  ? 855  TYR A CD2   1 
ATOM   6305  C  CE1   . TYR A 1  855  ? -30.832 -10.184 -14.477 1.00 91.81  ? 855  TYR A CE1   1 
ATOM   6306  C  CE2   . TYR A 1  855  ? -30.953 -11.549 -16.459 1.00 88.89  ? 855  TYR A CE2   1 
ATOM   6307  C  CZ    . TYR A 1  855  ? -31.582 -10.864 -15.434 1.00 90.77  ? 855  TYR A CZ    1 
ATOM   6308  O  OH    . TYR A 1  855  ? -32.955 -10.869 -15.385 1.00 90.98  ? 855  TYR A OH    1 
ATOM   6309  N  N     . LYS A 1  856  ? -25.423 -10.816 -13.064 1.00 96.21  ? 856  LYS A N     1 
ATOM   6310  C  CA    . LYS A 1  856  ? -25.270 -10.063 -11.819 1.00 99.02  ? 856  LYS A CA    1 
ATOM   6311  C  C     . LYS A 1  856  ? -24.999 -8.610  -12.240 1.00 98.18  ? 856  LYS A C     1 
ATOM   6312  O  O     . LYS A 1  856  ? -24.029 -8.346  -12.957 1.00 97.39  ? 856  LYS A O     1 
ATOM   6313  C  CB    . LYS A 1  856  ? -24.125 -10.627 -10.951 1.00 101.69 ? 856  LYS A CB    1 
ATOM   6314  C  CG    . LYS A 1  856  ? -24.102 -12.158 -10.848 1.00 102.29 ? 856  LYS A CG    1 
ATOM   6315  C  CD    . LYS A 1  856  ? -23.184 -12.830 -11.880 1.00 101.70 ? 856  LYS A CD    1 
ATOM   6316  C  CE    . LYS A 1  856  ? -23.818 -14.038 -12.568 1.00 99.69  ? 856  LYS A CE    1 
ATOM   6317  N  NZ    . LYS A 1  856  ? -24.347 -15.066 -11.631 1.00 99.93  ? 856  LYS A NZ    1 
ATOM   6318  N  N     . ALA A 1  857  ? -25.870 -7.688  -11.825 1.00 97.55  ? 857  ALA A N     1 
ATOM   6319  C  CA    . ALA A 1  857  ? -25.844 -6.304  -12.314 1.00 96.84  ? 857  ALA A CA    1 
ATOM   6320  C  C     . ALA A 1  857  ? -25.683 -5.310  -11.175 1.00 98.59  ? 857  ALA A C     1 
ATOM   6321  O  O     . ALA A 1  857  ? -26.506 -5.278  -10.265 1.00 99.67  ? 857  ALA A O     1 
ATOM   6322  C  CB    . ALA A 1  857  ? -27.118 -6.000  -13.080 1.00 94.90  ? 857  ALA A CB    1 
ATOM   6323  N  N     . GLY A 1  858  ? -24.618 -4.513  -11.230 1.00 99.15  ? 858  GLY A N     1 
ATOM   6324  C  CA    . GLY A 1  858  ? -24.440 -3.364  -10.346 1.00 101.46 ? 858  GLY A CA    1 
ATOM   6325  C  C     . GLY A 1  858  ? -24.946 -2.108  -11.028 1.00 100.83 ? 858  GLY A C     1 
ATOM   6326  O  O     . GLY A 1  858  ? -24.626 -1.872  -12.192 1.00 99.59  ? 858  GLY A O     1 
ATOM   6327  N  N     . PHE A 1  859  ? -25.726 -1.298  -10.314 1.00 102.38 ? 859  PHE A N     1 
ATOM   6328  C  CA    . PHE A 1  859  ? -26.358 -0.118  -10.917 1.00 102.65 ? 859  PHE A CA    1 
ATOM   6329  C  C     . PHE A 1  859  ? -26.616 1.031   -9.939  1.00 105.17 ? 859  PHE A C     1 
ATOM   6330  O  O     . PHE A 1  859  ? -26.666 0.840   -8.722  1.00 106.29 ? 859  PHE A O     1 
ATOM   6331  C  CB    . PHE A 1  859  ? -27.668 -0.512  -11.622 1.00 100.49 ? 859  PHE A CB    1 
ATOM   6332  C  CG    . PHE A 1  859  ? -28.690 -1.144  -10.711 1.00 100.40 ? 859  PHE A CG    1 
ATOM   6333  C  CD1   . PHE A 1  859  ? -28.572 -2.477  -10.334 1.00 100.11 ? 859  PHE A CD1   1 
ATOM   6334  C  CD2   . PHE A 1  859  ? -29.776 -0.412  -10.234 1.00 100.61 ? 859  PHE A CD2   1 
ATOM   6335  C  CE1   . PHE A 1  859  ? -29.506 -3.062  -9.493  1.00 100.20 ? 859  PHE A CE1   1 
ATOM   6336  C  CE2   . PHE A 1  859  ? -30.717 -0.996  -9.396  1.00 100.52 ? 859  PHE A CE2   1 
ATOM   6337  C  CZ    . PHE A 1  859  ? -30.584 -2.323  -9.026  1.00 100.28 ? 859  PHE A CZ    1 
ATOM   6338  N  N     . MET A 1  860  ? -26.777 2.224   -10.511 1.00 106.36 ? 860  MET A N     1 
ATOM   6339  C  CA    . MET A 1  860  ? -27.064 3.455   -9.771  1.00 108.66 ? 860  MET A CA    1 
ATOM   6340  C  C     . MET A 1  860  ? -28.571 3.587   -9.546  1.00 107.46 ? 860  MET A C     1 
ATOM   6341  O  O     . MET A 1  860  ? -29.362 2.938   -10.234 1.00 105.76 ? 860  MET A O     1 
ATOM   6342  C  CB    . MET A 1  860  ? -26.597 4.671   -10.575 1.00 110.10 ? 860  MET A CB    1 
ATOM   6343  C  CG    . MET A 1  860  ? -25.125 4.709   -10.952 1.00 111.32 ? 860  MET A CG    1 
ATOM   6344  S  SD    . MET A 1  860  ? -24.077 5.287   -9.611  1.00 117.07 ? 860  MET A SD    1 
ATOM   6345  C  CE    . MET A 1  860  ? -23.661 3.752   -8.807  1.00 116.42 ? 860  MET A CE    1 
ATOM   6346  N  N     . ASN A 1  861  ? -28.970 4.464   -8.627  1.00 108.02 ? 861  ASN A N     1 
ATOM   6347  C  CA    . ASN A 1  861  ? -30.398 4.699   -8.350  1.00 107.12 ? 861  ASN A CA    1 
ATOM   6348  C  C     . ASN A 1  861  ? -31.182 5.397   -9.479  1.00 105.82 ? 861  ASN A C     1 
ATOM   6349  O  O     . ASN A 1  861  ? -32.411 5.323   -9.496  1.00 104.52 ? 861  ASN A O     1 
ATOM   6350  C  CB    . ASN A 1  861  ? -30.579 5.459   -7.023  1.00 108.69 ? 861  ASN A CB    1 
ATOM   6351  C  CG    . ASN A 1  861  ? -30.183 4.631   -5.807  1.00 109.18 ? 861  ASN A CG    1 
ATOM   6352  O  OD1   . ASN A 1  861  ? -30.239 3.402   -5.820  1.00 108.06 ? 861  ASN A OD1   1 
ATOM   6353  N  ND2   . ASN A 1  861  ? -29.789 5.310   -4.743  1.00 111.29 ? 861  ASN A ND2   1 
ATOM   6354  N  N     . ASP A 1  862  ? -30.487 6.074   -10.400 1.00 106.31 ? 862  ASP A N     1 
ATOM   6355  C  CA    . ASP A 1  862  ? -31.114 6.601   -11.632 1.00 105.47 ? 862  ASP A CA    1 
ATOM   6356  C  C     . ASP A 1  862  ? -31.227 5.554   -12.753 1.00 103.96 ? 862  ASP A C     1 
ATOM   6357  O  O     . ASP A 1  862  ? -31.854 5.819   -13.777 1.00 103.04 ? 862  ASP A O     1 
ATOM   6358  C  CB    . ASP A 1  862  ? -30.398 7.869   -12.144 1.00 106.87 ? 862  ASP A CB    1 
ATOM   6359  C  CG    . ASP A 1  862  ? -28.977 7.606   -12.660 1.00 107.22 ? 862  ASP A CG    1 
ATOM   6360  O  OD1   . ASP A 1  862  ? -28.341 6.625   -12.234 1.00 107.38 ? 862  ASP A OD1   1 
ATOM   6361  O  OD2   . ASP A 1  862  ? -28.484 8.402   -13.484 1.00 107.49 ? 862  ASP A OD2   1 
ATOM   6362  N  N     . GLY A 1  863  ? -30.604 4.389   -12.566 1.00 104.32 ? 863  GLY A N     1 
ATOM   6363  C  CA    . GLY A 1  863  ? -30.748 3.249   -13.469 1.00 103.06 ? 863  GLY A CA    1 
ATOM   6364  C  C     . GLY A 1  863  ? -29.603 3.019   -14.448 1.00 103.79 ? 863  GLY A C     1 
ATOM   6365  O  O     . GLY A 1  863  ? -29.784 2.309   -15.442 1.00 101.91 ? 863  GLY A O     1 
ATOM   6366  N  N     . ARG A 1  864  ? -28.429 3.597   -14.182 1.00 106.43 ? 864  ARG A N     1 
ATOM   6367  C  CA    . ARG A 1  864  ? -27.245 3.360   -15.019 1.00 106.37 ? 864  ARG A CA    1 
ATOM   6368  C  C     . ARG A 1  864  ? -26.532 2.093   -14.558 1.00 105.22 ? 864  ARG A C     1 
ATOM   6369  O  O     . ARG A 1  864  ? -26.068 2.028   -13.420 1.00 105.92 ? 864  ARG A O     1 
ATOM   6370  C  CB    . ARG A 1  864  ? -26.280 4.550   -14.966 1.00 109.25 ? 864  ARG A CB    1 
ATOM   6371  C  CG    . ARG A 1  864  ? -26.905 5.866   -15.415 1.00 110.73 ? 864  ARG A CG    1 
ATOM   6372  C  CD    . ARG A 1  864  ? -25.878 6.974   -15.628 1.00 112.65 ? 864  ARG A CD    1 
ATOM   6373  N  NE    . ARG A 1  864  ? -25.167 7.347   -14.398 1.00 115.26 ? 864  ARG A NE    1 
ATOM   6374  C  CZ    . ARG A 1  864  ? -24.370 8.410   -14.266 1.00 116.90 ? 864  ARG A CZ    1 
ATOM   6375  N  NH1   . ARG A 1  864  ? -24.163 9.259   -15.280 1.00 117.21 ? 864  ARG A NH1   1 
ATOM   6376  N  NH2   . ARG A 1  864  ? -23.773 8.636   -13.098 1.00 119.04 ? 864  ARG A NH2   1 
ATOM   6377  N  N     . ILE A 1  865  ? -26.461 1.090   -15.434 1.00 102.44 ? 865  ILE A N     1 
ATOM   6378  C  CA    . ILE A 1  865  ? -25.729 -0.142  -15.153 1.00 101.67 ? 865  ILE A CA    1 
ATOM   6379  C  C     . ILE A 1  865  ? -24.253 0.135   -15.419 1.00 101.91 ? 865  ILE A C     1 
ATOM   6380  O  O     . ILE A 1  865  ? -23.807 0.124   -16.570 1.00 101.45 ? 865  ILE A O     1 
ATOM   6381  C  CB    . ILE A 1  865  ? -26.222 -1.343  -16.007 1.00 99.93  ? 865  ILE A CB    1 
ATOM   6382  C  CG1   . ILE A 1  865  ? -27.681 -1.705  -15.660 1.00 99.83  ? 865  ILE A CG1   1 
ATOM   6383  C  CG2   . ILE A 1  865  ? -25.319 -2.560  -15.808 1.00 99.66  ? 865  ILE A CG2   1 
ATOM   6384  C  CD1   . ILE A 1  865  ? -28.730 -1.021  -16.512 1.00 98.92  ? 865  ILE A CD1   1 
ATOM   6385  N  N     . LEU A 1  866  ? -23.511 0.399   -14.345 1.00 102.93 ? 866  LEU A N     1 
ATOM   6386  C  CA    . LEU A 1  866  ? -22.064 0.612   -14.419 1.00 103.29 ? 866  LEU A CA    1 
ATOM   6387  C  C     . LEU A 1  866  ? -21.253 -0.684  -14.286 1.00 102.43 ? 866  LEU A C     1 
ATOM   6388  O  O     . LEU A 1  866  ? -20.056 -0.671  -14.548 1.00 102.72 ? 866  LEU A O     1 
ATOM   6389  C  CB    . LEU A 1  866  ? -21.621 1.619   -13.352 1.00 106.13 ? 866  LEU A CB    1 
ATOM   6390  C  CG    . LEU A 1  866  ? -22.170 3.044   -13.510 1.00 106.64 ? 866  LEU A CG    1 
ATOM   6391  C  CD1   . LEU A 1  866  ? -22.033 3.815   -12.205 1.00 109.09 ? 866  LEU A CD1   1 
ATOM   6392  C  CD2   . LEU A 1  866  ? -21.485 3.786   -14.653 1.00 106.18 ? 866  LEU A CD2   1 
ATOM   6393  N  N     . ALA A 1  867  ? -21.894 -1.782  -13.874 1.00 101.54 ? 867  ALA A N     1 
ATOM   6394  C  CA    . ALA A 1  867  ? -21.247 -3.100  -13.783 1.00 101.01 ? 867  ALA A CA    1 
ATOM   6395  C  C     . ALA A 1  867  ? -22.224 -4.216  -14.163 1.00 98.95  ? 867  ALA A C     1 
ATOM   6396  O  O     . ALA A 1  867  ? -23.349 -4.246  -13.664 1.00 99.24  ? 867  ALA A O     1 
ATOM   6397  C  CB    . ALA A 1  867  ? -20.718 -3.330  -12.376 1.00 103.05 ? 867  ALA A CB    1 
ATOM   6398  N  N     . LEU A 1  868  ? -21.786 -5.131  -15.024 1.00 97.48  ? 868  LEU A N     1 
ATOM   6399  C  CA    . LEU A 1  868  ? -22.628 -6.237  -15.492 1.00 95.86  ? 868  LEU A CA    1 
ATOM   6400  C  C     . LEU A 1  868  ? -21.770 -7.470  -15.759 1.00 95.48  ? 868  LEU A C     1 
ATOM   6401  O  O     . LEU A 1  868  ? -20.815 -7.403  -16.533 1.00 95.97  ? 868  LEU A O     1 
ATOM   6402  C  CB    . LEU A 1  868  ? -23.363 -5.821  -16.773 1.00 94.44  ? 868  LEU A CB    1 
ATOM   6403  C  CG    . LEU A 1  868  ? -24.329 -6.806  -17.446 1.00 92.24  ? 868  LEU A CG    1 
ATOM   6404  C  CD1   . LEU A 1  868  ? -25.440 -7.234  -16.498 1.00 92.63  ? 868  LEU A CD1   1 
ATOM   6405  C  CD2   . LEU A 1  868  ? -24.918 -6.190  -18.706 1.00 90.61  ? 868  LEU A CD2   1 
ATOM   6406  N  N     . ASP A 1  869  ? -22.111 -8.587  -15.117 1.00 95.02  ? 869  ASP A N     1 
ATOM   6407  C  CA    . ASP A 1  869  ? -21.374 -9.843  -15.268 1.00 94.71  ? 869  ASP A CA    1 
ATOM   6408  C  C     . ASP A 1  869  ? -22.322 -10.887 -15.851 1.00 92.03  ? 869  ASP A C     1 
ATOM   6409  O  O     . ASP A 1  869  ? -23.069 -11.541 -15.122 1.00 91.83  ? 869  ASP A O     1 
ATOM   6410  C  CB    . ASP A 1  869  ? -20.794 -10.293 -13.917 1.00 97.62  ? 869  ASP A CB    1 
ATOM   6411  C  CG    . ASP A 1  869  ? -20.005 -11.595 -14.010 1.00 98.25  ? 869  ASP A CG    1 
ATOM   6412  O  OD1   . ASP A 1  869  ? -19.387 -11.864 -15.064 1.00 97.47  ? 869  ASP A OD1   1 
ATOM   6413  O  OD2   . ASP A 1  869  ? -19.999 -12.349 -13.014 1.00 99.78  ? 869  ASP A OD2   1 
ATOM   6414  N  N     . MET A 1  870  ? -22.271 -11.030 -17.175 1.00 89.77  ? 870  MET A N     1 
ATOM   6415  C  CA    . MET A 1  870  ? -23.219 -11.845 -17.929 1.00 86.89  ? 870  MET A CA    1 
ATOM   6416  C  C     . MET A 1  870  ? -22.680 -13.250 -18.192 1.00 85.74  ? 870  MET A C     1 
ATOM   6417  O  O     . MET A 1  870  ? -21.486 -13.435 -18.423 1.00 86.20  ? 870  MET A O     1 
ATOM   6418  C  CB    . MET A 1  870  ? -23.536 -11.144 -19.258 1.00 85.91  ? 870  MET A CB    1 
ATOM   6419  C  CG    . MET A 1  870  ? -24.626 -11.790 -20.105 1.00 84.04  ? 870  MET A CG    1 
ATOM   6420  S  SD    . MET A 1  870  ? -26.216 -11.906 -19.267 1.00 84.03  ? 870  MET A SD    1 
ATOM   6421  C  CE    . MET A 1  870  ? -26.675 -10.175 -19.217 1.00 84.75  ? 870  MET A CE    1 
ATOM   6422  N  N     . GLU A 1  871  ? -23.581 -14.230 -18.146 1.00 84.80  ? 871  GLU A N     1 
ATOM   6423  C  CA    . GLU A 1  871  ? -23.303 -15.606 -18.558 1.00 84.02  ? 871  GLU A CA    1 
ATOM   6424  C  C     . GLU A 1  871  ? -24.401 -16.077 -19.510 1.00 81.80  ? 871  GLU A C     1 
ATOM   6425  O  O     . GLU A 1  871  ? -25.581 -15.932 -19.195 1.00 81.53  ? 871  GLU A O     1 
ATOM   6426  C  CB    . GLU A 1  871  ? -23.261 -16.528 -17.344 1.00 85.60  ? 871  GLU A CB    1 
ATOM   6427  C  CG    . GLU A 1  871  ? -22.033 -16.348 -16.469 1.00 88.16  ? 871  GLU A CG    1 
ATOM   6428  C  CD    . GLU A 1  871  ? -22.013 -17.275 -15.262 1.00 90.10  ? 871  GLU A CD    1 
ATOM   6429  O  OE1   . GLU A 1  871  ? -23.031 -17.940 -14.972 1.00 89.66  ? 871  GLU A OE1   1 
ATOM   6430  O  OE2   . GLU A 1  871  ? -20.962 -17.334 -14.591 1.00 93.14  ? 871  GLU A OE2   1 
ATOM   6431  N  N     . HIS A 1  872  ? -24.013 -16.607 -20.673 1.00 80.40  ? 872  HIS A N     1 
ATOM   6432  C  CA    . HIS A 1  872  ? -24.944 -17.262 -21.604 1.00 78.25  ? 872  HIS A CA    1 
ATOM   6433  C  C     . HIS A 1  872  ? -24.697 -18.769 -21.622 1.00 77.56  ? 872  HIS A C     1 
ATOM   6434  O  O     . HIS A 1  872  ? -23.558 -19.217 -21.528 1.00 78.03  ? 872  HIS A O     1 
ATOM   6435  C  CB    . HIS A 1  872  ? -24.771 -16.750 -23.036 1.00 77.18  ? 872  HIS A CB    1 
ATOM   6436  C  CG    . HIS A 1  872  ? -25.022 -15.284 -23.213 1.00 77.73  ? 872  HIS A CG    1 
ATOM   6437  N  ND1   . HIS A 1  872  ? -24.772 -14.638 -24.405 1.00 77.29  ? 872  HIS A ND1   1 
ATOM   6438  C  CD2   . HIS A 1  872  ? -25.482 -14.336 -22.362 1.00 78.59  ? 872  HIS A CD2   1 
ATOM   6439  C  CE1   . HIS A 1  872  ? -25.072 -13.358 -24.283 1.00 77.49  ? 872  HIS A CE1   1 
ATOM   6440  N  NE2   . HIS A 1  872  ? -25.506 -13.149 -23.054 1.00 78.34  ? 872  HIS A NE2   1 
ATOM   6441  N  N     . TYR A 1  873  ? -25.772 -19.544 -21.750 1.00 76.63  ? 873  TYR A N     1 
ATOM   6442  C  CA    . TYR A 1  873  ? -25.684 -20.991 -21.961 1.00 75.71  ? 873  TYR A CA    1 
ATOM   6443  C  C     . TYR A 1  873  ? -26.654 -21.396 -23.066 1.00 73.49  ? 873  TYR A C     1 
ATOM   6444  O  O     . TYR A 1  873  ? -27.852 -21.182 -22.925 1.00 73.29  ? 873  TYR A O     1 
ATOM   6445  C  CB    . TYR A 1  873  ? -26.031 -21.754 -20.680 1.00 76.71  ? 873  TYR A CB    1 
ATOM   6446  C  CG    . TYR A 1  873  ? -25.168 -21.415 -19.484 1.00 78.71  ? 873  TYR A CG    1 
ATOM   6447  C  CD1   . TYR A 1  873  ? -25.457 -20.307 -18.681 1.00 79.78  ? 873  TYR A CD1   1 
ATOM   6448  C  CD2   . TYR A 1  873  ? -24.076 -22.213 -19.138 1.00 79.22  ? 873  TYR A CD2   1 
ATOM   6449  C  CE1   . TYR A 1  873  ? -24.674 -19.991 -17.580 1.00 81.50  ? 873  TYR A CE1   1 
ATOM   6450  C  CE2   . TYR A 1  873  ? -23.291 -21.912 -18.035 1.00 81.33  ? 873  TYR A CE2   1 
ATOM   6451  C  CZ    . TYR A 1  873  ? -23.590 -20.797 -17.260 1.00 82.41  ? 873  TYR A CZ    1 
ATOM   6452  O  OH    . TYR A 1  873  ? -22.810 -20.481 -16.170 1.00 83.55  ? 873  TYR A OH    1 
ATOM   6453  N  N     . SER A 1  874  ? -26.145 -21.965 -24.157 1.00 72.55  ? 874  SER A N     1 
ATOM   6454  C  CA    . SER A 1  874  ? -26.999 -22.482 -25.233 1.00 71.59  ? 874  SER A CA    1 
ATOM   6455  C  C     . SER A 1  874  ? -27.212 -23.982 -25.074 1.00 70.98  ? 874  SER A C     1 
ATOM   6456  O  O     . SER A 1  874  ? -26.289 -24.700 -24.690 1.00 71.15  ? 874  SER A O     1 
ATOM   6457  C  CB    . SER A 1  874  ? -26.398 -22.183 -26.612 1.00 71.16  ? 874  SER A CB    1 
ATOM   6458  O  OG    . SER A 1  874  ? -25.297 -23.024 -26.910 1.00 71.90  ? 874  SER A OG    1 
ATOM   6459  N  N     . ASN A 1  875  ? -28.428 -24.445 -25.364 1.00 70.15  ? 875  ASN A N     1 
ATOM   6460  C  CA    . ASN A 1  875  ? -28.717 -25.876 -25.440 1.00 70.29  ? 875  ASN A CA    1 
ATOM   6461  C  C     . ASN A 1  875  ? -28.406 -26.359 -26.858 1.00 69.64  ? 875  ASN A C     1 
ATOM   6462  O  O     . ASN A 1  875  ? -29.124 -26.042 -27.804 1.00 68.62  ? 875  ASN A O     1 
ATOM   6463  C  CB    . ASN A 1  875  ? -30.176 -26.156 -25.052 1.00 69.73  ? 875  ASN A CB    1 
ATOM   6464  C  CG    . ASN A 1  875  ? -30.448 -27.631 -24.799 1.00 70.02  ? 875  ASN A CG    1 
ATOM   6465  O  OD1   . ASN A 1  875  ? -29.806 -28.505 -25.374 1.00 70.13  ? 875  ASN A OD1   1 
ATOM   6466  N  ND2   . ASN A 1  875  ? -31.411 -27.912 -23.932 1.00 70.69  ? 875  ASN A ND2   1 
ATOM   6467  N  N     . ALA A 1  876  ? -27.325 -27.122 -26.995 1.00 71.07  ? 876  ALA A N     1 
ATOM   6468  C  CA    . ALA A 1  876  ? -26.794 -27.505 -28.308 1.00 71.19  ? 876  ALA A CA    1 
ATOM   6469  C  C     . ALA A 1  876  ? -27.488 -28.715 -28.946 1.00 71.40  ? 876  ALA A C     1 
ATOM   6470  O  O     . ALA A 1  876  ? -27.441 -28.885 -30.169 1.00 70.28  ? 876  ALA A O     1 
ATOM   6471  C  CB    . ALA A 1  876  ? -25.299 -27.763 -28.198 1.00 71.95  ? 876  ALA A CB    1 
ATOM   6472  N  N     . GLY A 1  877  ? -28.127 -29.548 -28.130 1.00 73.35  ? 877  GLY A N     1 
ATOM   6473  C  CA    . GLY A 1  877  ? -28.625 -30.840 -28.585 1.00 75.13  ? 877  GLY A CA    1 
ATOM   6474  C  C     . GLY A 1  877  ? -27.479 -31.836 -28.614 1.00 77.63  ? 877  GLY A C     1 
ATOM   6475  O  O     . GLY A 1  877  ? -26.488 -31.652 -27.910 1.00 77.72  ? 877  GLY A O     1 
ATOM   6476  N  N     . ALA A 1  878  ? -27.613 -32.884 -29.427 1.00 79.93  ? 878  ALA A N     1 
ATOM   6477  C  CA    . ALA A 1  878  ? -26.640 -33.990 -29.466 1.00 82.59  ? 878  ALA A CA    1 
ATOM   6478  C  C     . ALA A 1  878  ? -25.238 -33.617 -29.976 1.00 84.79  ? 878  ALA A C     1 
ATOM   6479  O  O     . ALA A 1  878  ? -24.257 -34.264 -29.590 1.00 85.43  ? 878  ALA A O     1 
ATOM   6480  C  CB    . ALA A 1  878  ? -27.197 -35.144 -30.288 1.00 81.69  ? 878  ALA A CB    1 
ATOM   6481  N  N     . SER A 1  879  ? -25.148 -32.588 -30.825 1.00 86.21  ? 879  SER A N     1 
ATOM   6482  C  CA    . SER A 1  879  ? -23.889 -32.192 -31.464 1.00 88.70  ? 879  SER A CA    1 
ATOM   6483  C  C     . SER A 1  879  ? -23.635 -30.682 -31.410 1.00 90.07  ? 879  SER A C     1 
ATOM   6484  O  O     . SER A 1  879  ? -24.555 -29.886 -31.196 1.00 89.62  ? 879  SER A O     1 
ATOM   6485  C  CB    . SER A 1  879  ? -23.881 -32.675 -32.922 1.00 88.70  ? 879  SER A CB    1 
ATOM   6486  O  OG    . SER A 1  879  ? -22.847 -32.069 -33.685 1.00 90.63  ? 879  SER A OG    1 
ATOM   6487  N  N     . LEU A 1  880  ? -22.368 -30.320 -31.617 1.00 92.27  ? 880  LEU A N     1 
ATOM   6488  C  CA    . LEU A 1  880  ? -21.914 -28.932 -31.738 1.00 94.06  ? 880  LEU A CA    1 
ATOM   6489  C  C     . LEU A 1  880  ? -21.509 -28.680 -33.193 1.00 93.31  ? 880  LEU A C     1 
ATOM   6490  O  O     . LEU A 1  880  ? -21.940 -27.705 -33.814 1.00 91.58  ? 880  LEU A O     1 
ATOM   6491  C  CB    . LEU A 1  880  ? -20.746 -28.674 -30.766 1.00 97.41  ? 880  LEU A CB    1 
ATOM   6492  C  CG    . LEU A 1  880  ? -19.573 -27.744 -31.131 1.00 99.82  ? 880  LEU A CG    1 
ATOM   6493  C  CD1   . LEU A 1  880  ? -20.016 -26.305 -31.343 1.00 99.81  ? 880  LEU A CD1   1 
ATOM   6494  C  CD2   . LEU A 1  880  ? -18.495 -27.801 -30.054 1.00 101.67 ? 880  LEU A CD2   1 
ATOM   6495  N  N     . SER A 1  883  ? -22.910 -23.798 -33.088 1.00 87.40  ? 883  SER A N     1 
ATOM   6496  C  CA    . SER A 1  883  ? -23.385 -23.788 -31.713 1.00 88.51  ? 883  SER A CA    1 
ATOM   6497  C  C     . SER A 1  883  ? -22.526 -22.877 -30.901 1.00 88.98  ? 883  SER A C     1 
ATOM   6498  O  O     . SER A 1  883  ? -22.991 -22.068 -30.132 1.00 89.65  ? 883  SER A O     1 
ATOM   6499  C  CB    . SER A 1  883  ? -23.310 -25.169 -31.110 1.00 88.79  ? 883  SER A CB    1 
ATOM   6500  O  OG    . SER A 1  883  ? -24.158 -25.233 -29.994 1.00 88.12  ? 883  SER A OG    1 
ATOM   6501  N  N     . LEU A 1  884  ? -21.243 -23.043 -31.090 1.00 89.13  ? 884  LEU A N     1 
ATOM   6502  C  CA    . LEU A 1  884  ? -20.220 -22.117 -30.584 1.00 90.50  ? 884  LEU A CA    1 
ATOM   6503  C  C     . LEU A 1  884  ? -20.128 -20.860 -31.461 1.00 88.95  ? 884  LEU A C     1 
ATOM   6504  O  O     . LEU A 1  884  ? -19.788 -19.782 -30.974 1.00 88.91  ? 884  LEU A O     1 
ATOM   6505  C  CB    . LEU A 1  884  ? -18.854 -22.810 -30.482 1.00 91.86  ? 884  LEU A CB    1 
ATOM   6506  C  CG    . LEU A 1  884  ? -17.810 -22.139 -29.572 1.00 94.54  ? 884  LEU A CG    1 
ATOM   6507  C  CD1   . LEU A 1  884  ? -18.163 -22.290 -28.094 1.00 95.40  ? 884  LEU A CD1   1 
ATOM   6508  C  CD2   . LEU A 1  884  ? -16.417 -22.697 -29.838 1.00 95.62  ? 884  LEU A CD2   1 
ATOM   6509  N  N     . PHE A 1  885  ? -20.428 -21.016 -32.749 1.00 87.76  ? 885  PHE A N     1 
ATOM   6510  C  CA    . PHE A 1  885  ? -20.615 -19.888 -33.666 1.00 87.21  ? 885  PHE A CA    1 
ATOM   6511  C  C     . PHE A 1  885  ? -21.726 -18.976 -33.128 1.00 84.79  ? 885  PHE A C     1 
ATOM   6512  O  O     . PHE A 1  885  ? -21.604 -17.752 -33.154 1.00 83.43  ? 885  PHE A O     1 
ATOM   6513  C  CB    . PHE A 1  885  ? -21.010 -20.385 -35.070 1.00 88.35  ? 885  PHE A CB    1 
ATOM   6514  C  CG    . PHE A 1  885  ? -19.853 -20.869 -35.930 1.00 91.59  ? 885  PHE A CG    1 
ATOM   6515  C  CD1   . PHE A 1  885  ? -18.791 -21.619 -35.403 1.00 92.94  ? 885  PHE A CD1   1 
ATOM   6516  C  CD2   . PHE A 1  885  ? -19.856 -20.610 -37.309 1.00 93.02  ? 885  PHE A CD2   1 
ATOM   6517  C  CE1   . PHE A 1  885  ? -17.754 -22.062 -36.222 1.00 93.49  ? 885  PHE A CE1   1 
ATOM   6518  C  CE2   . PHE A 1  885  ? -18.821 -21.058 -38.129 1.00 93.38  ? 885  PHE A CE2   1 
ATOM   6519  C  CZ    . PHE A 1  885  ? -17.769 -21.783 -37.584 1.00 93.23  ? 885  PHE A CZ    1 
ATOM   6520  N  N     . VAL A 1  886  ? -22.800 -19.597 -32.636 1.00 82.76  ? 886  VAL A N     1 
ATOM   6521  C  CA    . VAL A 1  886  ? -23.976 -18.894 -32.106 1.00 81.27  ? 886  VAL A CA    1 
ATOM   6522  C  C     . VAL A 1  886  ? -23.683 -18.214 -30.763 1.00 82.20  ? 886  VAL A C     1 
ATOM   6523  O  O     . VAL A 1  886  ? -24.203 -17.130 -30.498 1.00 82.80  ? 886  VAL A O     1 
ATOM   6524  C  CB    . VAL A 1  886  ? -25.195 -19.844 -31.960 1.00 80.13  ? 886  VAL A CB    1 
ATOM   6525  C  CG1   . VAL A 1  886  ? -26.402 -19.112 -31.376 1.00 79.80  ? 886  VAL A CG1   1 
ATOM   6526  C  CG2   . VAL A 1  886  ? -25.560 -20.468 -33.306 1.00 79.29  ? 886  VAL A CG2   1 
ATOM   6527  N  N     . ILE A 1  887  ? -22.873 -18.852 -29.917 1.00 82.25  ? 887  ILE A N     1 
ATOM   6528  C  CA    . ILE A 1  887  ? -22.430 -18.240 -28.658 1.00 82.73  ? 887  ILE A CA    1 
ATOM   6529  C  C     . ILE A 1  887  ? -21.609 -16.980 -28.943 1.00 83.12  ? 887  ILE A C     1 
ATOM   6530  O  O     . ILE A 1  887  ? -21.863 -15.931 -28.338 1.00 84.38  ? 887  ILE A O     1 
ATOM   6531  C  CB    . ILE A 1  887  ? -21.621 -19.235 -27.783 1.00 83.49  ? 887  ILE A CB    1 
ATOM   6532  C  CG1   . ILE A 1  887  ? -22.533 -20.340 -27.225 1.00 82.62  ? 887  ILE A CG1   1 
ATOM   6533  C  CG2   . ILE A 1  887  ? -20.896 -18.528 -26.638 1.00 85.68  ? 887  ILE A CG2   1 
ATOM   6534  C  CD1   . ILE A 1  887  ? -23.581 -19.888 -26.224 1.00 82.55  ? 887  ILE A CD1   1 
ATOM   6535  N  N     . GLU A 1  888  ? -20.642 -17.095 -29.857 1.00 81.89  ? 888  GLU A N     1 
ATOM   6536  C  CA    . GLU A 1  888  ? -19.791 -15.969 -30.273 1.00 82.29  ? 888  GLU A CA    1 
ATOM   6537  C  C     . GLU A 1  888  ? -20.603 -14.754 -30.701 1.00 82.49  ? 888  GLU A C     1 
ATOM   6538  O  O     . GLU A 1  888  ? -20.397 -13.656 -30.177 1.00 85.66  ? 888  GLU A O     1 
ATOM   6539  C  CB    . GLU A 1  888  ? -18.856 -16.379 -31.415 1.00 81.68  ? 888  GLU A CB    1 
ATOM   6540  C  CG    . GLU A 1  888  ? -17.688 -17.242 -30.969 1.00 82.75  ? 888  GLU A CG    1 
ATOM   6541  C  CD    . GLU A 1  888  ? -16.970 -17.951 -32.107 1.00 81.95  ? 888  GLU A CD    1 
ATOM   6542  O  OE1   . GLU A 1  888  ? -17.309 -17.743 -33.291 1.00 79.88  ? 888  GLU A OE1   1 
ATOM   6543  O  OE2   . GLU A 1  888  ? -16.044 -18.732 -31.802 1.00 83.24  ? 888  GLU A OE2   1 
ATOM   6544  N  N     . MET A 1  889  ? -21.527 -14.954 -31.637 1.00 80.90  ? 889  MET A N     1 
ATOM   6545  C  CA    . MET A 1  889  ? -22.410 -13.870 -32.089 1.00 81.11  ? 889  MET A CA    1 
ATOM   6546  C  C     . MET A 1  889  ? -23.337 -13.374 -30.981 1.00 81.03  ? 889  MET A C     1 
ATOM   6547  O  O     . MET A 1  889  ? -23.675 -12.194 -30.946 1.00 80.55  ? 889  MET A O     1 
ATOM   6548  C  CB    . MET A 1  889  ? -23.238 -14.296 -33.310 1.00 80.19  ? 889  MET A CB    1 
ATOM   6549  C  CG    . MET A 1  889  ? -22.419 -14.539 -34.567 1.00 80.43  ? 889  MET A CG    1 
ATOM   6550  S  SD    . MET A 1  889  ? -21.397 -13.136 -35.058 1.00 82.77  ? 889  MET A SD    1 
ATOM   6551  C  CE    . MET A 1  889  ? -20.724 -13.715 -36.615 1.00 82.77  ? 889  MET A CE    1 
ATOM   6552  N  N     . GLY A 1  890  ? -23.748 -14.275 -30.087 1.00 80.75  ? 890  GLY A N     1 
ATOM   6553  C  CA    . GLY A 1  890  ? -24.479 -13.899 -28.886 1.00 80.45  ? 890  GLY A CA    1 
ATOM   6554  C  C     . GLY A 1  890  ? -23.733 -12.819 -28.133 1.00 81.54  ? 890  GLY A C     1 
ATOM   6555  O  O     . GLY A 1  890  ? -24.277 -11.740 -27.889 1.00 80.04  ? 890  GLY A O     1 
ATOM   6556  N  N     . LEU A 1  891  ? -22.468 -13.102 -27.819 1.00 82.40  ? 891  LEU A N     1 
ATOM   6557  C  CA    . LEU A 1  891  ? -21.631 -12.198 -27.025 1.00 83.80  ? 891  LEU A CA    1 
ATOM   6558  C  C     . LEU A 1  891  ? -21.332 -10.871 -27.728 1.00 83.45  ? 891  LEU A C     1 
ATOM   6559  O  O     . LEU A 1  891  ? -21.369 -9.808  -27.095 1.00 83.99  ? 891  LEU A O     1 
ATOM   6560  C  CB    . LEU A 1  891  ? -20.303 -12.869 -26.641 1.00 85.02  ? 891  LEU A CB    1 
ATOM   6561  C  CG    . LEU A 1  891  ? -20.264 -14.205 -25.882 1.00 85.46  ? 891  LEU A CG    1 
ATOM   6562  C  CD1   . LEU A 1  891  ? -18.937 -14.349 -25.147 1.00 87.13  ? 891  LEU A CD1   1 
ATOM   6563  C  CD2   . LEU A 1  891  ? -21.419 -14.368 -24.905 1.00 85.61  ? 891  LEU A CD2   1 
ATOM   6564  N  N     . LEU A 1  892  ? -21.034 -10.937 -29.025 1.00 81.79  ? 892  LEU A N     1 
ATOM   6565  C  CA    . LEU A 1  892  ? -20.695 -9.740  -29.807 1.00 81.59  ? 892  LEU A CA    1 
ATOM   6566  C  C     . LEU A 1  892  ? -21.878 -8.789  -30.002 1.00 81.19  ? 892  LEU A C     1 
ATOM   6567  O  O     . LEU A 1  892  ? -21.688 -7.578  -30.116 1.00 82.43  ? 892  LEU A O     1 
ATOM   6568  C  CB    . LEU A 1  892  ? -20.103 -10.130 -31.168 1.00 80.50  ? 892  LEU A CB    1 
ATOM   6569  C  CG    . LEU A 1  892  ? -18.679 -10.699 -31.129 1.00 80.84  ? 892  LEU A CG    1 
ATOM   6570  C  CD1   . LEU A 1  892  ? -18.372 -11.469 -32.401 1.00 79.39  ? 892  LEU A CD1   1 
ATOM   6571  C  CD2   . LEU A 1  892  ? -17.648 -9.599  -30.921 1.00 82.19  ? 892  LEU A CD2   1 
ATOM   6572  N  N     . LYS A 1  893  ? -23.089 -9.336  -30.036 1.00 80.09  ? 893  LYS A N     1 
ATOM   6573  C  CA    . LYS A 1  893  ? -24.302 -8.537  -30.235 1.00 79.65  ? 893  LYS A CA    1 
ATOM   6574  C  C     . LYS A 1  893  ? -25.105 -8.304  -28.949 1.00 79.71  ? 893  LYS A C     1 
ATOM   6575  O  O     . LYS A 1  893  ? -26.103 -7.588  -28.977 1.00 79.10  ? 893  LYS A O     1 
ATOM   6576  C  CB    . LYS A 1  893  ? -25.171 -9.197  -31.301 1.00 78.37  ? 893  LYS A CB    1 
ATOM   6577  C  CG    . LYS A 1  893  ? -24.407 -9.559  -32.566 1.00 78.19  ? 893  LYS A CG    1 
ATOM   6578  C  CD    . LYS A 1  893  ? -25.336 -10.031 -33.663 1.00 77.57  ? 893  LYS A CD    1 
ATOM   6579  C  CE    . LYS A 1  893  ? -24.589 -10.264 -34.962 1.00 76.84  ? 893  LYS A CE    1 
ATOM   6580  N  NZ    . LYS A 1  893  ? -25.548 -10.452 -36.081 1.00 75.76  ? 893  LYS A NZ    1 
ATOM   6581  N  N     . MET A 1  894  ? -24.644 -8.896  -27.843 1.00 80.76  ? 894  MET A N     1 
ATOM   6582  C  CA    . MET A 1  894  ? -25.239 -8.769  -26.496 1.00 81.95  ? 894  MET A CA    1 
ATOM   6583  C  C     . MET A 1  894  ? -25.484 -7.325  -26.043 1.00 82.34  ? 894  MET A C     1 
ATOM   6584  O  O     . MET A 1  894  ? -26.482 -7.038  -25.383 1.00 81.95  ? 894  MET A O     1 
ATOM   6585  C  CB    . MET A 1  894  ? -24.301 -9.434  -25.475 1.00 84.05  ? 894  MET A CB    1 
ATOM   6586  C  CG    . MET A 1  894  ? -24.821 -9.528  -24.051 1.00 85.99  ? 894  MET A CG    1 
ATOM   6587  S  SD    . MET A 1  894  ? -23.645 -8.874  -22.851 1.00 89.51  ? 894  MET A SD    1 
ATOM   6588  C  CE    . MET A 1  894  ? -23.666 -7.132  -23.257 1.00 90.12  ? 894  MET A CE    1 
ATOM   6589  N  N     . ASP A 1  895  ? -24.547 -6.437  -26.358 1.00 82.43  ? 895  ASP A N     1 
ATOM   6590  C  CA    . ASP A 1  895  ? -24.659 -5.027  -25.972 1.00 83.27  ? 895  ASP A CA    1 
ATOM   6591  C  C     . ASP A 1  895  ? -25.925 -4.329  -26.501 1.00 82.83  ? 895  ASP A C     1 
ATOM   6592  O  O     . ASP A 1  895  ? -26.571 -3.579  -25.765 1.00 84.14  ? 895  ASP A O     1 
ATOM   6593  C  CB    . ASP A 1  895  ? -23.394 -4.238  -26.355 1.00 84.05  ? 895  ASP A CB    1 
ATOM   6594  C  CG    . ASP A 1  895  ? -23.044 -4.339  -27.831 1.00 82.99  ? 895  ASP A CG    1 
ATOM   6595  O  OD1   . ASP A 1  895  ? -22.985 -5.471  -28.363 1.00 82.44  ? 895  ASP A OD1   1 
ATOM   6596  O  OD2   . ASP A 1  895  ? -22.799 -3.281  -28.445 1.00 82.72  ? 895  ASP A OD2   1 
ATOM   6597  N  N     . ASN A 1  896  ? -26.278 -4.598  -27.758 1.00 81.92  ? 896  ASN A N     1 
ATOM   6598  C  CA    . ASN A 1  896  ? -27.463 -4.021  -28.410 1.00 80.92  ? 896  ASN A CA    1 
ATOM   6599  C  C     . ASN A 1  896  ? -27.412 -2.478  -28.407 1.00 81.19  ? 896  ASN A C     1 
ATOM   6600  O  O     . ASN A 1  896  ? -26.515 -1.913  -29.022 1.00 81.91  ? 896  ASN A O     1 
ATOM   6601  C  CB    . ASN A 1  896  ? -28.756 -4.621  -27.815 1.00 80.87  ? 896  ASN A CB    1 
ATOM   6602  C  CG    . ASN A 1  896  ? -30.020 -4.203  -28.563 1.00 80.55  ? 896  ASN A CG    1 
ATOM   6603  O  OD1   . ASN A 1  896  ? -29.988 -3.852  -29.748 1.00 79.40  ? 896  ASN A OD1   1 
ATOM   6604  N  ND2   . ASN A 1  896  ? -31.146 -4.241  -27.860 1.00 80.91  ? 896  ASN A ND2   1 
ATOM   6605  N  N     . ALA A 1  897  ? -28.308 -1.794  -27.695 1.00 80.90  ? 897  ALA A N     1 
ATOM   6606  C  CA    . ALA A 1  897  ? -28.388 -0.336  -27.773 1.00 80.99  ? 897  ALA A CA    1 
ATOM   6607  C  C     . ALA A 1  897  ? -27.590 0.359   -26.670 1.00 82.23  ? 897  ALA A C     1 
ATOM   6608  O  O     . ALA A 1  897  ? -27.451 1.581   -26.700 1.00 82.79  ? 897  ALA A O     1 
ATOM   6609  C  CB    . ALA A 1  897  ? -29.843 0.102   -27.717 1.00 80.51  ? 897  ALA A CB    1 
ATOM   6610  N  N     . TYR A 1  898  ? -27.033 -0.416  -25.734 1.00 82.13  ? 898  TYR A N     1 
ATOM   6611  C  CA    . TYR A 1  898  ? -26.584 0.106   -24.444 1.00 83.21  ? 898  TYR A CA    1 
ATOM   6612  C  C     . TYR A 1  898  ? -25.073 0.019   -24.250 1.00 83.94  ? 898  TYR A C     1 
ATOM   6613  O  O     . TYR A 1  898  ? -24.464 -1.002  -24.571 1.00 82.42  ? 898  TYR A O     1 
ATOM   6614  C  CB    . TYR A 1  898  ? -27.278 -0.666  -23.320 1.00 83.07  ? 898  TYR A CB    1 
ATOM   6615  C  CG    . TYR A 1  898  ? -28.721 -0.986  -23.633 1.00 81.44  ? 898  TYR A CG    1 
ATOM   6616  C  CD1   . TYR A 1  898  ? -29.696 0.013   -23.600 1.00 81.74  ? 898  TYR A CD1   1 
ATOM   6617  C  CD2   . TYR A 1  898  ? -29.112 -2.277  -23.989 1.00 79.14  ? 898  TYR A CD2   1 
ATOM   6618  C  CE1   . TYR A 1  898  ? -31.019 -0.264  -23.897 1.00 80.02  ? 898  TYR A CE1   1 
ATOM   6619  C  CE2   . TYR A 1  898  ? -30.435 -2.562  -24.285 1.00 78.09  ? 898  TYR A CE2   1 
ATOM   6620  C  CZ    . TYR A 1  898  ? -31.384 -1.551  -24.238 1.00 78.34  ? 898  TYR A CZ    1 
ATOM   6621  O  OH    . TYR A 1  898  ? -32.697 -1.811  -24.528 1.00 77.58  ? 898  TYR A OH    1 
ATOM   6622  N  N     . LYS A 1  899  ? -24.482 1.090   -23.717 1.00 85.87  ? 899  LYS A N     1 
ATOM   6623  C  CA    . LYS A 1  899  ? -23.087 1.069   -23.284 1.00 86.94  ? 899  LYS A CA    1 
ATOM   6624  C  C     . LYS A 1  899  ? -23.022 0.498   -21.880 1.00 88.18  ? 899  LYS A C     1 
ATOM   6625  O  O     . LYS A 1  899  ? -23.638 1.043   -20.969 1.00 89.25  ? 899  LYS A O     1 
ATOM   6626  C  CB    . LYS A 1  899  ? -22.471 2.468   -23.295 1.00 87.90  ? 899  LYS A CB    1 
ATOM   6627  C  CG    . LYS A 1  899  ? -21.014 2.481   -22.851 1.00 89.26  ? 899  LYS A CG    1 
ATOM   6628  C  CD    . LYS A 1  899  ? -20.134 3.266   -23.801 1.00 89.82  ? 899  LYS A CD    1 
ATOM   6629  C  CE    . LYS A 1  899  ? -18.659 3.107   -23.466 1.00 91.14  ? 899  LYS A CE    1 
ATOM   6630  N  NZ    . LYS A 1  899  ? -18.309 3.679   -22.134 1.00 93.62  ? 899  LYS A NZ    1 
ATOM   6631  N  N     . PHE A 1  900  ? -22.290 -0.603  -21.725 1.00 88.59  ? 900  PHE A N     1 
ATOM   6632  C  CA    . PHE A 1  900  ? -22.012 -1.203  -20.424 1.00 90.49  ? 900  PHE A CA    1 
ATOM   6633  C  C     . PHE A 1  900  ? -20.542 -0.941  -20.085 1.00 93.09  ? 900  PHE A C     1 
ATOM   6634  O  O     . PHE A 1  900  ? -19.678 -1.735  -20.462 1.00 92.49  ? 900  PHE A O     1 
ATOM   6635  C  CB    . PHE A 1  900  ? -22.323 -2.702  -20.452 1.00 88.80  ? 900  PHE A CB    1 
ATOM   6636  C  CG    . PHE A 1  900  ? -23.793 -3.010  -20.578 1.00 87.44  ? 900  PHE A CG    1 
ATOM   6637  C  CD1   . PHE A 1  900  ? -24.663 -2.751  -19.524 1.00 88.18  ? 900  PHE A CD1   1 
ATOM   6638  C  CD2   . PHE A 1  900  ? -24.311 -3.558  -21.751 1.00 85.70  ? 900  PHE A CD2   1 
ATOM   6639  C  CE1   . PHE A 1  900  ? -26.020 -3.028  -19.636 1.00 87.26  ? 900  PHE A CE1   1 
ATOM   6640  C  CE2   . PHE A 1  900  ? -25.667 -3.843  -21.864 1.00 84.26  ? 900  PHE A CE2   1 
ATOM   6641  C  CZ    . PHE A 1  900  ? -26.523 -3.579  -20.806 1.00 85.03  ? 900  PHE A CZ    1 
ATOM   6642  N  N     . PRO A 1  901  ? -20.251 0.176   -19.375 1.00 96.49  ? 901  PRO A N     1 
ATOM   6643  C  CA    . PRO A 1  901  ? -18.854 0.623   -19.172 1.00 98.82  ? 901  PRO A CA    1 
ATOM   6644  C  C     . PRO A 1  901  ? -17.922 -0.393  -18.513 1.00 99.36  ? 901  PRO A C     1 
ATOM   6645  O  O     . PRO A 1  901  ? -16.708 -0.315  -18.707 1.00 100.91 ? 901  PRO A O     1 
ATOM   6646  C  CB    . PRO A 1  901  ? -18.994 1.858   -18.263 1.00 100.98 ? 901  PRO A CB    1 
ATOM   6647  C  CG    . PRO A 1  901  ? -20.411 2.289   -18.397 1.00 100.29 ? 901  PRO A CG    1 
ATOM   6648  C  CD    . PRO A 1  901  ? -21.196 1.037   -18.638 1.00 97.89  ? 901  PRO A CD    1 
ATOM   6649  N  N     . ASN A 1  902  ? -18.484 -1.299  -17.713 1.00 98.88  ? 902  ASN A N     1 
ATOM   6650  C  CA    . ASN A 1  902  ? -17.743 -2.425  -17.155 1.00 99.24  ? 902  ASN A CA    1 
ATOM   6651  C  C     . ASN A 1  902  ? -18.543 -3.706  -17.367 1.00 98.00  ? 902  ASN A C     1 
ATOM   6652  O  O     . ASN A 1  902  ? -19.620 -3.871  -16.790 1.00 97.48  ? 902  ASN A O     1 
ATOM   6653  C  CB    . ASN A 1  902  ? -17.447 -2.195  -15.676 1.00 101.39 ? 902  ASN A CB    1 
ATOM   6654  C  CG    . ASN A 1  902  ? -16.784 -0.853  -15.420 1.00 102.74 ? 902  ASN A CG    1 
ATOM   6655  O  OD1   . ASN A 1  902  ? -15.634 -0.640  -15.798 1.00 103.41 ? 902  ASN A OD1   1 
ATOM   6656  N  ND2   . ASN A 1  902  ? -17.513 0.064   -14.797 1.00 103.07 ? 902  ASN A ND2   1 
ATOM   6657  N  N     . LEU A 1  903  ? -18.007 -4.596  -18.206 1.00 98.00  ? 903  LEU A N     1 
ATOM   6658  C  CA    . LEU A 1  903  ? -18.737 -5.758  -18.713 1.00 96.89  ? 903  LEU A CA    1 
ATOM   6659  C  C     . LEU A 1  903  ? -17.870 -7.016  -18.726 1.00 97.50  ? 903  LEU A C     1 
ATOM   6660  O  O     . LEU A 1  903  ? -16.733 -6.982  -19.198 1.00 97.58  ? 903  LEU A O     1 
ATOM   6661  C  CB    . LEU A 1  903  ? -19.229 -5.465  -20.133 1.00 95.07  ? 903  LEU A CB    1 
ATOM   6662  C  CG    . LEU A 1  903  ? -20.087 -6.525  -20.830 1.00 93.10  ? 903  LEU A CG    1 
ATOM   6663  C  CD1   . LEU A 1  903  ? -21.352 -6.798  -20.030 1.00 92.94  ? 903  LEU A CD1   1 
ATOM   6664  C  CD2   . LEU A 1  903  ? -20.421 -6.084  -22.246 1.00 91.59  ? 903  LEU A CD2   1 
ATOM   6665  N  N     . ARG A 1  904  ? -18.416 -8.118  -18.208 1.00 98.67  ? 904  ARG A N     1 
ATOM   6666  C  CA    . ARG A 1  904  ? -17.774 -9.434  -18.266 1.00 100.31 ? 904  ARG A CA    1 
ATOM   6667  C  C     . ARG A 1  904  ? -18.783 -10.448 -18.803 1.00 98.78  ? 904  ARG A C     1 
ATOM   6668  O  O     . ARG A 1  904  ? -19.558 -11.034 -18.043 1.00 99.38  ? 904  ARG A O     1 
ATOM   6669  C  CB    . ARG A 1  904  ? -17.247 -9.852  -16.888 1.00 103.48 ? 904  ARG A CB    1 
ATOM   6670  C  CG    . ARG A 1  904  ? -16.561 -11.216 -16.872 1.00 105.02 ? 904  ARG A CG    1 
ATOM   6671  C  CD    . ARG A 1  904  ? -15.568 -11.357 -15.722 1.00 109.67 ? 904  ARG A CD    1 
ATOM   6672  N  NE    . ARG A 1  904  ? -16.216 -11.567 -14.422 1.00 112.70 ? 904  ARG A NE    1 
ATOM   6673  C  CZ    . ARG A 1  904  ? -16.552 -12.750 -13.891 1.00 113.44 ? 904  ARG A CZ    1 
ATOM   6674  N  NH1   . ARG A 1  904  ? -16.321 -13.901 -14.532 1.00 112.97 ? 904  ARG A NH1   1 
ATOM   6675  N  NH2   . ARG A 1  904  ? -17.137 -12.785 -12.695 1.00 114.81 ? 904  ARG A NH2   1 
ATOM   6676  N  N     . CYS A 1  905  ? -18.765 -10.640 -20.120 1.00 97.49  ? 905  CYS A N     1 
ATOM   6677  C  CA    . CYS A 1  905  ? -19.712 -11.517 -20.802 1.00 95.63  ? 905  CYS A CA    1 
ATOM   6678  C  C     . CYS A 1  905  ? -19.060 -12.846 -21.164 1.00 93.64  ? 905  CYS A C     1 
ATOM   6679  O  O     . CYS A 1  905  ? -18.054 -12.864 -21.870 1.00 93.49  ? 905  CYS A O     1 
ATOM   6680  C  CB    . CYS A 1  905  ? -20.232 -10.831 -22.062 1.00 94.96  ? 905  CYS A CB    1 
ATOM   6681  S  SG    . CYS A 1  905  ? -21.785 -11.541 -22.628 1.00 95.90  ? 905  CYS A SG    1 
ATOM   6682  N  N     . ARG A 1  906  ? -19.635 -13.948 -20.682 1.00 92.15  ? 906  ARG A N     1 
ATOM   6683  C  CA    . ARG A 1  906  ? -19.098 -15.292 -20.913 1.00 91.59  ? 906  ARG A CA    1 
ATOM   6684  C  C     . ARG A 1  906  ? -20.181 -16.216 -21.455 1.00 88.98  ? 906  ARG A C     1 
ATOM   6685  O  O     . ARG A 1  906  ? -21.356 -16.037 -21.141 1.00 88.66  ? 906  ARG A O     1 
ATOM   6686  C  CB    . ARG A 1  906  ? -18.510 -15.860 -19.622 1.00 94.45  ? 906  ARG A CB    1 
ATOM   6687  C  CG    . ARG A 1  906  ? -17.573 -14.890 -18.914 1.00 98.00  ? 906  ARG A CG    1 
ATOM   6688  C  CD    . ARG A 1  906  ? -16.545 -15.593 -18.042 1.00 100.78 ? 906  ARG A CD    1 
ATOM   6689  N  NE    . ARG A 1  906  ? -17.156 -16.252 -16.887 1.00 102.43 ? 906  ARG A NE    1 
ATOM   6690  C  CZ    . ARG A 1  906  ? -16.503 -17.000 -15.996 1.00 104.59 ? 906  ARG A CZ    1 
ATOM   6691  N  NH1   . ARG A 1  906  ? -15.188 -17.210 -16.097 1.00 105.72 ? 906  ARG A NH1   1 
ATOM   6692  N  NH2   . ARG A 1  906  ? -17.174 -17.550 -14.987 1.00 105.84 ? 906  ARG A NH2   1 
ATOM   6693  N  N     . GLY A 1  907  ? -19.779 -17.197 -22.267 1.00 87.12  ? 907  GLY A N     1 
ATOM   6694  C  CA    . GLY A 1  907  ? -20.716 -18.101 -22.953 1.00 84.60  ? 907  GLY A CA    1 
ATOM   6695  C  C     . GLY A 1  907  ? -20.194 -19.520 -23.115 1.00 83.90  ? 907  GLY A C     1 
ATOM   6696  O  O     . GLY A 1  907  ? -18.997 -19.723 -23.298 1.00 85.34  ? 907  GLY A O     1 
ATOM   6697  N  N     . TRP A 1  908  ? -21.100 -20.495 -23.059 1.00 82.83  ? 908  TRP A N     1 
ATOM   6698  C  CA    . TRP A 1  908  ? -20.757 -21.920 -23.130 1.00 82.55  ? 908  TRP A CA    1 
ATOM   6699  C  C     . TRP A 1  908  ? -21.883 -22.721 -23.782 1.00 80.15  ? 908  TRP A C     1 
ATOM   6700  O  O     . TRP A 1  908  ? -23.022 -22.658 -23.326 1.00 79.18  ? 908  TRP A O     1 
ATOM   6701  C  CB    . TRP A 1  908  ? -20.541 -22.488 -21.724 1.00 84.55  ? 908  TRP A CB    1 
ATOM   6702  C  CG    . TRP A 1  908  ? -19.381 -21.921 -20.976 1.00 87.29  ? 908  TRP A CG    1 
ATOM   6703  C  CD1   . TRP A 1  908  ? -18.059 -22.177 -21.195 1.00 88.56  ? 908  TRP A CD1   1 
ATOM   6704  C  CD2   . TRP A 1  908  ? -19.436 -21.023 -19.864 1.00 89.36  ? 908  TRP A CD2   1 
ATOM   6705  N  NE1   . TRP A 1  908  ? -17.284 -21.484 -20.297 1.00 90.57  ? 908  TRP A NE1   1 
ATOM   6706  C  CE2   . TRP A 1  908  ? -18.103 -20.767 -19.465 1.00 91.27  ? 908  TRP A CE2   1 
ATOM   6707  C  CE3   . TRP A 1  908  ? -20.482 -20.401 -19.170 1.00 89.72  ? 908  TRP A CE3   1 
ATOM   6708  C  CZ2   . TRP A 1  908  ? -17.786 -19.915 -18.396 1.00 93.14  ? 908  TRP A CZ2   1 
ATOM   6709  C  CZ3   . TRP A 1  908  ? -20.168 -19.553 -18.103 1.00 91.83  ? 908  TRP A CZ3   1 
ATOM   6710  C  CH2   . TRP A 1  908  ? -18.828 -19.319 -17.730 1.00 93.18  ? 908  TRP A CH2   1 
ATOM   6711  N  N     . ALA A 1  909  ? -21.566 -23.492 -24.822 1.00 78.67  ? 909  ALA A N     1 
ATOM   6712  C  CA    . ALA A 1  909  ? -22.552 -24.376 -25.462 1.00 76.72  ? 909  ALA A CA    1 
ATOM   6713  C  C     . ALA A 1  909  ? -22.687 -25.665 -24.663 1.00 76.77  ? 909  ALA A C     1 
ATOM   6714  O  O     . ALA A 1  909  ? -21.690 -26.198 -24.187 1.00 77.84  ? 909  ALA A O     1 
ATOM   6715  C  CB    . ALA A 1  909  ? -22.154 -24.675 -26.897 1.00 75.39  ? 909  ALA A CB    1 
ATOM   6716  N  N     . CYS A 1  910  ? -23.917 -26.165 -24.530 1.00 76.87  ? 910  CYS A N     1 
ATOM   6717  C  CA    . CYS A 1  910  ? -24.216 -27.306 -23.652 1.00 78.53  ? 910  CYS A CA    1 
ATOM   6718  C  C     . CYS A 1  910  ? -24.843 -28.487 -24.393 1.00 77.51  ? 910  CYS A C     1 
ATOM   6719  O  O     . CYS A 1  910  ? -25.957 -28.400 -24.902 1.00 75.72  ? 910  CYS A O     1 
ATOM   6720  C  CB    . CYS A 1  910  ? -25.130 -26.862 -22.513 1.00 79.81  ? 910  CYS A CB    1 
ATOM   6721  S  SG    . CYS A 1  910  ? -24.396 -25.574 -21.479 1.00 83.23  ? 910  CYS A SG    1 
ATOM   6722  N  N     . ARG A 1  911  ? -24.108 -29.594 -24.420 1.00 79.23  ? 911  ARG A N     1 
ATOM   6723  C  CA    . ARG A 1  911  ? -24.517 -30.819 -25.091 1.00 80.28  ? 911  ARG A CA    1 
ATOM   6724  C  C     . ARG A 1  911  ? -25.608 -31.515 -24.273 1.00 79.59  ? 911  ARG A C     1 
ATOM   6725  O  O     . ARG A 1  911  ? -25.428 -31.766 -23.079 1.00 80.96  ? 911  ARG A O     1 
ATOM   6726  C  CB    . ARG A 1  911  ? -23.295 -31.741 -25.249 1.00 83.90  ? 911  ARG A CB    1 
ATOM   6727  C  CG    . ARG A 1  911  ? -23.460 -32.929 -26.181 1.00 86.39  ? 911  ARG A CG    1 
ATOM   6728  C  CD    . ARG A 1  911  ? -22.341 -33.946 -25.975 1.00 91.08  ? 911  ARG A CD    1 
ATOM   6729  N  NE    . ARG A 1  911  ? -22.338 -34.998 -27.000 1.00 95.12  ? 911  ARG A NE    1 
ATOM   6730  C  CZ    . ARG A 1  911  ? -23.181 -36.039 -27.064 1.00 97.11  ? 911  ARG A CZ    1 
ATOM   6731  N  NH1   . ARG A 1  911  ? -24.148 -36.219 -26.156 1.00 98.66  ? 911  ARG A NH1   1 
ATOM   6732  N  NH2   . ARG A 1  911  ? -23.057 -36.918 -28.059 1.00 96.06  ? 911  ARG A NH2   1 
ATOM   6733  N  N     . THR A 1  912  ? -26.734 -31.805 -24.922 1.00 77.46  ? 912  THR A N     1 
ATOM   6734  C  CA    . THR A 1  912  ? -27.855 -32.540 -24.324 1.00 76.90  ? 912  THR A CA    1 
ATOM   6735  C  C     . THR A 1  912  ? -28.293 -33.695 -25.239 1.00 75.26  ? 912  THR A C     1 
ATOM   6736  O  O     . THR A 1  912  ? -27.748 -33.870 -26.330 1.00 74.35  ? 912  THR A O     1 
ATOM   6737  C  CB    . THR A 1  912  ? -29.051 -31.602 -24.063 1.00 76.33  ? 912  THR A CB    1 
ATOM   6738  O  OG1   . THR A 1  912  ? -29.548 -31.091 -25.308 1.00 74.23  ? 912  THR A OG1   1 
ATOM   6739  C  CG2   . THR A 1  912  ? -28.638 -30.445 -23.160 1.00 77.18  ? 912  THR A CG2   1 
ATOM   6740  N  N     . ASN A 1  913  ? -29.277 -34.474 -24.788 1.00 74.26  ? 913  ASN A N     1 
ATOM   6741  C  CA    . ASN A 1  913  ? -29.802 -35.604 -25.553 1.00 73.09  ? 913  ASN A CA    1 
ATOM   6742  C  C     . ASN A 1  913  ? -31.120 -35.260 -26.253 1.00 72.74  ? 913  ASN A C     1 
ATOM   6743  O  O     . ASN A 1  913  ? -32.123 -35.974 -26.133 1.00 73.33  ? 913  ASN A O     1 
ATOM   6744  C  CB    . ASN A 1  913  ? -29.936 -36.829 -24.646 1.00 73.45  ? 913  ASN A CB    1 
ATOM   6745  C  CG    . ASN A 1  913  ? -28.595 -37.304 -24.114 1.00 74.08  ? 913  ASN A CG    1 
ATOM   6746  O  OD1   . ASN A 1  913  ? -28.340 -37.271 -22.904 1.00 75.17  ? 913  ASN A OD1   1 
ATOM   6747  N  ND2   . ASN A 1  913  ? -27.724 -37.740 -25.016 1.00 73.02  ? 913  ASN A ND2   1 
ATOM   6748  N  N     . LEU A 1  914  ? -31.083 -34.153 -26.997 1.00 72.39  ? 914  LEU A N     1 
ATOM   6749  C  CA    . LEU A 1  914  ? -32.209 -33.657 -27.785 1.00 71.77  ? 914  LEU A CA    1 
ATOM   6750  C  C     . LEU A 1  914  ? -31.729 -33.449 -29.212 1.00 70.75  ? 914  LEU A C     1 
ATOM   6751  O  O     . LEU A 1  914  ? -30.524 -33.448 -29.453 1.00 71.07  ? 914  LEU A O     1 
ATOM   6752  C  CB    . LEU A 1  914  ? -32.696 -32.323 -27.219 1.00 72.61  ? 914  LEU A CB    1 
ATOM   6753  C  CG    . LEU A 1  914  ? -33.302 -32.362 -25.814 1.00 74.50  ? 914  LEU A CG    1 
ATOM   6754  C  CD1   . LEU A 1  914  ? -33.411 -30.956 -25.240 1.00 75.05  ? 914  LEU A CD1   1 
ATOM   6755  C  CD2   . LEU A 1  914  ? -34.655 -33.058 -25.823 1.00 74.40  ? 914  LEU A CD2   1 
ATOM   6756  N  N     . PRO A 1  915  ? -32.663 -33.278 -30.170 1.00 69.99  ? 915  PRO A N     1 
ATOM   6757  C  CA    . PRO A 1  915  ? -32.243 -32.996 -31.536 1.00 68.80  ? 915  PRO A CA    1 
ATOM   6758  C  C     . PRO A 1  915  ? -31.208 -31.881 -31.611 1.00 69.10  ? 915  PRO A C     1 
ATOM   6759  O  O     . PRO A 1  915  ? -31.347 -30.862 -30.935 1.00 69.00  ? 915  PRO A O     1 
ATOM   6760  C  CB    . PRO A 1  915  ? -33.547 -32.581 -32.219 1.00 67.97  ? 915  PRO A CB    1 
ATOM   6761  C  CG    . PRO A 1  915  ? -34.583 -33.387 -31.519 1.00 68.71  ? 915  PRO A CG    1 
ATOM   6762  C  CD    . PRO A 1  915  ? -34.119 -33.512 -30.090 1.00 69.98  ? 915  PRO A CD    1 
ATOM   6763  N  N     . SER A 1  916  ? -30.171 -32.111 -32.412 1.00 69.68  ? 916  SER A N     1 
ATOM   6764  C  CA    . SER A 1  916  ? -29.065 -31.175 -32.571 1.00 70.44  ? 916  SER A CA    1 
ATOM   6765  C  C     . SER A 1  916  ? -29.536 -29.876 -33.225 1.00 69.82  ? 916  SER A C     1 
ATOM   6766  O  O     . SER A 1  916  ? -29.902 -29.860 -34.399 1.00 69.40  ? 916  SER A O     1 
ATOM   6767  C  CB    . SER A 1  916  ? -27.957 -31.818 -33.406 1.00 70.40  ? 916  SER A CB    1 
ATOM   6768  O  OG    . SER A 1  916  ? -26.842 -30.959 -33.507 1.00 71.57  ? 916  SER A OG    1 
ATOM   6769  N  N     . ASN A 1  917  ? -29.518 -28.794 -32.452 1.00 71.24  ? 917  ASN A N     1 
ATOM   6770  C  CA    . ASN A 1  917  ? -30.028 -27.499 -32.908 1.00 71.36  ? 917  ASN A CA    1 
ATOM   6771  C  C     . ASN A 1  917  ? -29.068 -26.789 -33.855 1.00 71.92  ? 917  ASN A C     1 
ATOM   6772  O  O     . ASN A 1  917  ? -27.858 -26.972 -33.769 1.00 72.37  ? 917  ASN A O     1 
ATOM   6773  C  CB    . ASN A 1  917  ? -30.369 -26.608 -31.706 1.00 71.36  ? 917  ASN A CB    1 
ATOM   6774  C  CG    . ASN A 1  917  ? -31.514 -27.168 -30.869 1.00 71.23  ? 917  ASN A CG    1 
ATOM   6775  O  OD1   . ASN A 1  917  ? -32.429 -27.814 -31.384 1.00 68.71  ? 917  ASN A OD1   1 
ATOM   6776  N  ND2   . ASN A 1  917  ? -31.466 -26.925 -29.565 1.00 73.11  ? 917  ASN A ND2   1 
ATOM   6777  N  N     . THR A 1  918  ? -29.632 -25.990 -34.760 1.00 73.56  ? 918  THR A N     1 
ATOM   6778  C  CA    . THR A 1  918  ? -28.885 -25.309 -35.828 1.00 74.32  ? 918  THR A CA    1 
ATOM   6779  C  C     . THR A 1  918  ? -29.051 -23.793 -35.713 1.00 73.97  ? 918  THR A C     1 
ATOM   6780  O  O     . THR A 1  918  ? -29.772 -23.301 -34.840 1.00 74.37  ? 918  THR A O     1 
ATOM   6781  C  CB    . THR A 1  918  ? -29.370 -25.768 -37.228 1.00 74.00  ? 918  THR A CB    1 
ATOM   6782  O  OG1   . THR A 1  918  ? -30.749 -25.425 -37.400 1.00 72.97  ? 918  THR A OG1   1 
ATOM   6783  C  CG2   . THR A 1  918  ? -29.200 -27.276 -37.409 1.00 74.82  ? 918  THR A CG2   1 
ATOM   6784  N  N     . ALA A 1  919  ? -28.372 -23.064 -36.598 1.00 74.15  ? 919  ALA A N     1 
ATOM   6785  C  CA    . ALA A 1  919  ? -28.501 -21.607 -36.692 1.00 74.06  ? 919  ALA A CA    1 
ATOM   6786  C  C     . ALA A 1  919  ? -29.869 -21.214 -37.240 1.00 71.71  ? 919  ALA A C     1 
ATOM   6787  O  O     . ALA A 1  919  ? -30.497 -21.978 -37.980 1.00 71.93  ? 919  ALA A O     1 
ATOM   6788  C  CB    . ALA A 1  919  ? -27.397 -21.023 -37.564 1.00 75.13  ? 919  ALA A CB    1 
ATOM   6789  N  N     . PHE A 1  920  ? -30.308 -20.016 -36.866 1.00 69.48  ? 920  PHE A N     1 
ATOM   6790  C  CA    . PHE A 1  920  ? -31.657 -19.532 -37.147 1.00 67.84  ? 920  PHE A CA    1 
ATOM   6791  C  C     . PHE A 1  920  ? -31.586 -18.033 -37.438 1.00 67.24  ? 920  PHE A C     1 
ATOM   6792  O  O     . PHE A 1  920  ? -30.701 -17.346 -36.929 1.00 68.01  ? 920  PHE A O     1 
ATOM   6793  C  CB    . PHE A 1  920  ? -32.556 -19.805 -35.931 1.00 67.90  ? 920  PHE A CB    1 
ATOM   6794  C  CG    . PHE A 1  920  ? -34.027 -19.951 -36.249 1.00 66.91  ? 920  PHE A CG    1 
ATOM   6795  C  CD1   . PHE A 1  920  ? -34.779 -18.880 -36.727 1.00 66.49  ? 920  PHE A CD1   1 
ATOM   6796  C  CD2   . PHE A 1  920  ? -34.677 -21.157 -36.023 1.00 66.74  ? 920  PHE A CD2   1 
ATOM   6797  C  CE1   . PHE A 1  920  ? -36.134 -19.013 -36.991 1.00 66.22  ? 920  PHE A CE1   1 
ATOM   6798  C  CE2   . PHE A 1  920  ? -36.032 -21.295 -36.281 1.00 65.90  ? 920  PHE A CE2   1 
ATOM   6799  C  CZ    . PHE A 1  920  ? -36.765 -20.220 -36.766 1.00 65.47  ? 920  PHE A CZ    1 
ATOM   6800  N  N     . ARG A 1  921  ? -32.496 -17.551 -38.281 1.00 66.38  ? 921  ARG A N     1 
ATOM   6801  C  CA    . ARG A 1  921  ? -32.720 -16.111 -38.509 1.00 67.02  ? 921  ARG A CA    1 
ATOM   6802  C  C     . ARG A 1  921  ? -32.585 -15.278 -37.223 1.00 68.90  ? 921  ARG A C     1 
ATOM   6803  O  O     . ARG A 1  921  ? -33.457 -15.308 -36.353 1.00 68.30  ? 921  ARG A O     1 
ATOM   6804  C  CB    . ARG A 1  921  ? -34.107 -15.892 -39.132 1.00 65.99  ? 921  ARG A CB    1 
ATOM   6805  C  CG    . ARG A 1  921  ? -34.338 -14.512 -39.718 1.00 65.66  ? 921  ARG A CG    1 
ATOM   6806  C  CD    . ARG A 1  921  ? -35.755 -14.390 -40.249 1.00 65.20  ? 921  ARG A CD    1 
ATOM   6807  N  NE    . ARG A 1  921  ? -35.908 -13.318 -41.229 1.00 65.59  ? 921  ARG A NE    1 
ATOM   6808  C  CZ    . ARG A 1  921  ? -37.030 -13.047 -41.900 1.00 65.68  ? 921  ARG A CZ    1 
ATOM   6809  N  NH1   . ARG A 1  921  ? -38.132 -13.780 -41.735 1.00 65.97  ? 921  ARG A NH1   1 
ATOM   6810  N  NH2   . ARG A 1  921  ? -37.043 -12.035 -42.763 1.00 65.42  ? 921  ARG A NH2   1 
ATOM   6811  N  N     . GLY A 1  922  ? -31.468 -14.559 -37.115 1.00 71.23  ? 922  GLY A N     1 
ATOM   6812  C  CA    . GLY A 1  922  ? -31.123 -13.776 -35.928 1.00 74.48  ? 922  GLY A CA    1 
ATOM   6813  C  C     . GLY A 1  922  ? -29.744 -14.168 -35.427 1.00 76.45  ? 922  GLY A C     1 
ATOM   6814  O  O     . GLY A 1  922  ? -28.939 -13.303 -35.072 1.00 78.12  ? 922  GLY A O     1 
ATOM   6815  N  N     . PHE A 1  923  ? -29.498 -15.478 -35.373 1.00 76.80  ? 923  PHE A N     1 
ATOM   6816  C  CA    . PHE A 1  923  ? -28.162 -16.041 -35.187 1.00 78.76  ? 923  PHE A CA    1 
ATOM   6817  C  C     . PHE A 1  923  ? -27.514 -15.579 -33.872 1.00 78.75  ? 923  PHE A C     1 
ATOM   6818  O  O     . PHE A 1  923  ? -26.434 -14.969 -33.859 1.00 79.27  ? 923  PHE A O     1 
ATOM   6819  C  CB    . PHE A 1  923  ? -27.301 -15.706 -36.424 1.00 81.17  ? 923  PHE A CB    1 
ATOM   6820  C  CG    . PHE A 1  923  ? -26.018 -16.499 -36.547 1.00 83.84  ? 923  PHE A CG    1 
ATOM   6821  C  CD1   . PHE A 1  923  ? -25.941 -17.853 -36.187 1.00 85.74  ? 923  PHE A CD1   1 
ATOM   6822  C  CD2   . PHE A 1  923  ? -24.883 -15.896 -37.079 1.00 85.53  ? 923  PHE A CD2   1 
ATOM   6823  C  CE1   . PHE A 1  923  ? -24.752 -18.562 -36.324 1.00 86.79  ? 923  PHE A CE1   1 
ATOM   6824  C  CE2   . PHE A 1  923  ? -23.695 -16.604 -37.222 1.00 87.44  ? 923  PHE A CE2   1 
ATOM   6825  C  CZ    . PHE A 1  923  ? -23.628 -17.936 -36.840 1.00 87.44  ? 923  PHE A CZ    1 
ATOM   6826  N  N     . GLY A 1  924  ? -28.212 -15.859 -32.771 1.00 76.77  ? 924  GLY A N     1 
ATOM   6827  C  CA    . GLY A 1  924  ? -27.733 -15.567 -31.418 1.00 76.10  ? 924  GLY A CA    1 
ATOM   6828  C  C     . GLY A 1  924  ? -28.290 -14.299 -30.794 1.00 75.43  ? 924  GLY A C     1 
ATOM   6829  O  O     . GLY A 1  924  ? -28.424 -14.223 -29.570 1.00 74.95  ? 924  GLY A O     1 
ATOM   6830  N  N     . PHE A 1  925  ? -28.610 -13.309 -31.628 1.00 74.10  ? 925  PHE A N     1 
ATOM   6831  C  CA    . PHE A 1  925  ? -29.062 -11.996 -31.154 1.00 73.95  ? 925  PHE A CA    1 
ATOM   6832  C  C     . PHE A 1  925  ? -30.435 -12.023 -30.475 1.00 72.89  ? 925  PHE A C     1 
ATOM   6833  O  O     . PHE A 1  925  ? -30.587 -11.431 -29.412 1.00 73.83  ? 925  PHE A O     1 
ATOM   6834  C  CB    . PHE A 1  925  ? -29.036 -10.969 -32.297 1.00 73.56  ? 925  PHE A CB    1 
ATOM   6835  C  CG    . PHE A 1  925  ? -29.455 -9.585  -31.886 1.00 74.82  ? 925  PHE A CG    1 
ATOM   6836  C  CD1   . PHE A 1  925  ? -28.679 -8.841  -31.001 1.00 76.78  ? 925  PHE A CD1   1 
ATOM   6837  C  CD2   . PHE A 1  925  ? -30.622 -9.017  -32.387 1.00 74.66  ? 925  PHE A CD2   1 
ATOM   6838  C  CE1   . PHE A 1  925  ? -29.056 -7.556  -30.624 1.00 77.53  ? 925  PHE A CE1   1 
ATOM   6839  C  CE2   . PHE A 1  925  ? -31.002 -7.736  -32.017 1.00 75.49  ? 925  PHE A CE2   1 
ATOM   6840  C  CZ    . PHE A 1  925  ? -30.221 -7.005  -31.132 1.00 77.18  ? 925  PHE A CZ    1 
ATOM   6841  N  N     . PRO A 1  926  ? -31.432 -12.718 -31.063 1.00 71.39  ? 926  PRO A N     1 
ATOM   6842  C  CA    . PRO A 1  926  ? -32.738 -12.794 -30.399 1.00 71.40  ? 926  PRO A CA    1 
ATOM   6843  C  C     . PRO A 1  926  ? -32.675 -13.316 -28.958 1.00 72.28  ? 926  PRO A C     1 
ATOM   6844  O  O     . PRO A 1  926  ? -33.440 -12.862 -28.106 1.00 71.97  ? 926  PRO A O     1 
ATOM   6845  C  CB    . PRO A 1  926  ? -33.524 -13.765 -31.287 1.00 70.02  ? 926  PRO A CB    1 
ATOM   6846  C  CG    . PRO A 1  926  ? -32.898 -13.618 -32.623 1.00 69.29  ? 926  PRO A CG    1 
ATOM   6847  C  CD    . PRO A 1  926  ? -31.439 -13.478 -32.327 1.00 70.29  ? 926  PRO A CD    1 
ATOM   6848  N  N     . GLN A 1  927  ? -31.758 -14.252 -28.707 1.00 72.79  ? 927  GLN A N     1 
ATOM   6849  C  CA    . GLN A 1  927  ? -31.503 -14.769 -27.368 1.00 73.57  ? 927  GLN A CA    1 
ATOM   6850  C  C     . GLN A 1  927  ? -30.674 -13.794 -26.548 1.00 74.86  ? 927  GLN A C     1 
ATOM   6851  O  O     . GLN A 1  927  ? -31.052 -13.444 -25.434 1.00 77.40  ? 927  GLN A O     1 
ATOM   6852  C  CB    . GLN A 1  927  ? -30.779 -16.119 -27.426 1.00 73.90  ? 927  GLN A CB    1 
ATOM   6853  C  CG    . GLN A 1  927  ? -31.527 -17.231 -28.159 1.00 72.98  ? 927  GLN A CG    1 
ATOM   6854  C  CD    . GLN A 1  927  ? -30.965 -17.537 -29.539 1.00 72.26  ? 927  GLN A CD    1 
ATOM   6855  O  OE1   . GLN A 1  927  ? -30.648 -16.630 -30.311 1.00 73.07  ? 927  GLN A OE1   1 
ATOM   6856  N  NE2   . GLN A 1  927  ? -30.845 -18.823 -29.859 1.00 71.53  ? 927  GLN A NE2   1 
ATOM   6857  N  N     . ALA A 1  928  ? -29.543 -13.362 -27.102 1.00 74.97  ? 928  ALA A N     1 
ATOM   6858  C  CA    . ALA A 1  928  ? -28.611 -12.475 -26.396 1.00 75.42  ? 928  ALA A CA    1 
ATOM   6859  C  C     . ALA A 1  928  ? -29.203 -11.100 -26.080 1.00 75.92  ? 928  ALA A C     1 
ATOM   6860  O  O     . ALA A 1  928  ? -28.857 -10.494 -25.073 1.00 78.32  ? 928  ALA A O     1 
ATOM   6861  C  CB    . ALA A 1  928  ? -27.323 -12.315 -27.190 1.00 75.27  ? 928  ALA A CB    1 
ATOM   6862  N  N     . ALA A 1  929  ? -30.089 -10.605 -26.935 1.00 74.76  ? 929  ALA A N     1 
ATOM   6863  C  CA    . ALA A 1  929  ? -30.728 -9.313  -26.696 1.00 75.35  ? 929  ALA A CA    1 
ATOM   6864  C  C     . ALA A 1  929  ? -31.828 -9.407  -25.631 1.00 75.47  ? 929  ALA A C     1 
ATOM   6865  O  O     . ALA A 1  929  ? -31.920 -8.529  -24.771 1.00 75.58  ? 929  ALA A O     1 
ATOM   6866  C  CB    . ALA A 1  929  ? -31.268 -8.744  -27.993 1.00 74.05  ? 929  ALA A CB    1 
ATOM   6867  N  N     . LEU A 1  930  ? -32.636 -10.473 -25.679 1.00 74.64  ? 930  LEU A N     1 
ATOM   6868  C  CA    . LEU A 1  930  ? -33.712 -10.684 -24.698 1.00 75.74  ? 930  LEU A CA    1 
ATOM   6869  C  C     . LEU A 1  930  ? -33.192 -10.703 -23.270 1.00 77.86  ? 930  LEU A C     1 
ATOM   6870  O  O     . LEU A 1  930  ? -33.803 -10.100 -22.383 1.00 79.42  ? 930  LEU A O     1 
ATOM   6871  C  CB    . LEU A 1  930  ? -34.477 -11.994 -24.951 1.00 74.38  ? 930  LEU A CB    1 
ATOM   6872  C  CG    . LEU A 1  930  ? -35.621 -12.291 -23.959 1.00 74.85  ? 930  LEU A CG    1 
ATOM   6873  C  CD1   . LEU A 1  930  ? -36.764 -11.300 -24.134 1.00 75.18  ? 930  LEU A CD1   1 
ATOM   6874  C  CD2   . LEU A 1  930  ? -36.118 -13.717 -24.092 1.00 74.09  ? 930  LEU A CD2   1 
ATOM   6875  N  N     . ILE A 1  931  ? -32.094 -11.424 -23.053 1.00 78.06  ? 931  ILE A N     1 
ATOM   6876  C  CA    . ILE A 1  931  ? -31.496 -11.530 -21.715 1.00 79.45  ? 931  ILE A CA    1 
ATOM   6877  C  C     . ILE A 1  931  ? -31.037 -10.181 -21.153 1.00 79.77  ? 931  ILE A C     1 
ATOM   6878  O  O     . ILE A 1  931  ? -31.167 -9.956  -19.951 1.00 81.35  ? 931  ILE A O     1 
ATOM   6879  C  CB    . ILE A 1  931  ? -30.358 -12.593 -21.627 1.00 80.15  ? 931  ILE A CB    1 
ATOM   6880  C  CG1   . ILE A 1  931  ? -29.191 -12.266 -22.560 1.00 80.46  ? 931  ILE A CG1   1 
ATOM   6881  C  CG2   . ILE A 1  931  ? -30.886 -13.990 -21.953 1.00 78.70  ? 931  ILE A CG2   1 
ATOM   6882  C  CD1   . ILE A 1  931  ? -28.129 -11.361 -21.984 1.00 81.49  ? 931  ILE A CD1   1 
ATOM   6883  N  N     . THR A 1  932  ? -30.516 -9.287  -21.999 1.00 78.61  ? 932  THR A N     1 
ATOM   6884  C  CA    . THR A 1  932  ? -30.121 -7.943  -21.528 1.00 79.75  ? 932  THR A CA    1 
ATOM   6885  C  C     . THR A 1  932  ? -31.337 -7.065  -21.239 1.00 79.62  ? 932  THR A C     1 
ATOM   6886  O  O     . THR A 1  932  ? -31.298 -6.247  -20.323 1.00 81.56  ? 932  THR A O     1 
ATOM   6887  C  CB    . THR A 1  932  ? -29.189 -7.194  -22.506 1.00 79.42  ? 932  THR A CB    1 
ATOM   6888  O  OG1   . THR A 1  932  ? -29.859 -6.964  -23.746 1.00 79.32  ? 932  THR A OG1   1 
ATOM   6889  C  CG2   . THR A 1  932  ? -27.908 -7.976  -22.744 1.00 78.99  ? 932  THR A CG2   1 
ATOM   6890  N  N     . GLU A 1  933  ? -32.402 -7.233  -22.022 1.00 77.94  ? 933  GLU A N     1 
ATOM   6891  C  CA    . GLU A 1  933  ? -33.674 -6.554  -21.759 1.00 77.30  ? 933  GLU A CA    1 
ATOM   6892  C  C     . GLU A 1  933  ? -34.322 -7.075  -20.484 1.00 77.84  ? 933  GLU A C     1 
ATOM   6893  O  O     . GLU A 1  933  ? -34.971 -6.315  -19.770 1.00 79.40  ? 933  GLU A O     1 
ATOM   6894  C  CB    . GLU A 1  933  ? -34.661 -6.733  -22.920 1.00 75.67  ? 933  GLU A CB    1 
ATOM   6895  C  CG    . GLU A 1  933  ? -34.228 -6.162  -24.263 1.00 74.68  ? 933  GLU A CG    1 
ATOM   6896  C  CD    . GLU A 1  933  ? -33.891 -4.683  -24.232 1.00 75.48  ? 933  GLU A CD    1 
ATOM   6897  O  OE1   . GLU A 1  933  ? -34.410 -3.948  -23.363 1.00 75.46  ? 933  GLU A OE1   1 
ATOM   6898  O  OE2   . GLU A 1  933  ? -33.108 -4.251  -25.102 1.00 75.17  ? 933  GLU A OE2   1 
ATOM   6899  N  N     . SER A 1  934  ? -34.163 -8.371  -20.218 1.00 77.28  ? 934  SER A N     1 
ATOM   6900  C  CA    . SER A 1  934  ? -34.634 -8.964  -18.970 1.00 78.95  ? 934  SER A CA    1 
ATOM   6901  C  C     . SER A 1  934  ? -33.896 -8.357  -17.774 1.00 80.80  ? 934  SER A C     1 
ATOM   6902  O  O     . SER A 1  934  ? -34.513 -8.032  -16.757 1.00 81.27  ? 934  SER A O     1 
ATOM   6903  C  CB    . SER A 1  934  ? -34.463 -10.486 -18.990 1.00 78.65  ? 934  SER A CB    1 
ATOM   6904  O  OG    . SER A 1  934  ? -34.826 -11.056 -17.743 1.00 80.87  ? 934  SER A OG    1 
ATOM   6905  N  N     . CYS A 1  935  ? -32.582 -8.203  -17.916 1.00 81.48  ? 935  CYS A N     1 
ATOM   6906  C  CA    . CYS A 1  935  ? -31.752 -7.543  -16.908 1.00 83.54  ? 935  CYS A CA    1 
ATOM   6907  C  C     . CYS A 1  935  ? -32.153 -6.080  -16.711 1.00 84.61  ? 935  CYS A C     1 
ATOM   6908  O  O     . CYS A 1  935  ? -32.267 -5.614  -15.575 1.00 86.66  ? 935  CYS A O     1 
ATOM   6909  C  CB    . CYS A 1  935  ? -30.278 -7.631  -17.297 1.00 83.78  ? 935  CYS A CB    1 
ATOM   6910  S  SG    . CYS A 1  935  ? -29.160 -6.897  -16.091 1.00 86.94  ? 935  CYS A SG    1 
ATOM   6911  N  N     . ILE A 1  936  ? -32.367 -5.370  -17.820 1.00 83.30  ? 936  ILE A N     1 
ATOM   6912  C  CA    . ILE A 1  936  ? -32.854 -3.983  -17.795 1.00 83.83  ? 936  ILE A CA    1 
ATOM   6913  C  C     . ILE A 1  936  ? -34.214 -3.860  -17.100 1.00 84.48  ? 936  ILE A C     1 
ATOM   6914  O  O     . ILE A 1  936  ? -34.415 -2.941  -16.309 1.00 86.16  ? 936  ILE A O     1 
ATOM   6915  C  CB    . ILE A 1  936  ? -32.910 -3.379  -19.226 1.00 82.47  ? 936  ILE A CB    1 
ATOM   6916  C  CG1   . ILE A 1  936  ? -31.490 -3.067  -19.702 1.00 82.38  ? 936  ILE A CG1   1 
ATOM   6917  C  CG2   . ILE A 1  936  ? -33.754 -2.105  -19.285 1.00 83.21  ? 936  ILE A CG2   1 
ATOM   6918  C  CD1   . ILE A 1  936  ? -31.378 -2.809  -21.183 1.00 80.87  ? 936  ILE A CD1   1 
ATOM   6919  N  N     . THR A 1  937  ? -35.135 -4.775  -17.393 1.00 84.21  ? 937  THR A N     1 
ATOM   6920  C  CA    . THR A 1  937  ? -36.476 -4.742  -16.795 1.00 85.37  ? 937  THR A CA    1 
ATOM   6921  C  C     . THR A 1  937  ? -36.448 -4.993  -15.279 1.00 87.78  ? 937  THR A C     1 
ATOM   6922  O  O     . THR A 1  937  ? -37.214 -4.371  -14.535 1.00 88.94  ? 937  THR A O     1 
ATOM   6923  C  CB    . THR A 1  937  ? -37.426 -5.743  -17.483 1.00 83.51  ? 937  THR A CB    1 
ATOM   6924  O  OG1   . THR A 1  937  ? -37.450 -5.475  -18.889 1.00 83.28  ? 937  THR A OG1   1 
ATOM   6925  C  CG2   . THR A 1  937  ? -38.847 -5.630  -16.937 1.00 83.74  ? 937  THR A CG2   1 
ATOM   6926  N  N     . GLU A 1  938  ? -35.565 -5.888  -14.834 1.00 89.01  ? 938  GLU A N     1 
ATOM   6927  C  CA    . GLU A 1  938  ? -35.379 -6.157  -13.399 1.00 91.43  ? 938  GLU A CA    1 
ATOM   6928  C  C     . GLU A 1  938  ? -34.753 -4.980  -12.627 1.00 93.07  ? 938  GLU A C     1 
ATOM   6929  O  O     . GLU A 1  938  ? -35.112 -4.738  -11.466 1.00 92.93  ? 938  GLU A O     1 
ATOM   6930  C  CB    . GLU A 1  938  ? -34.548 -7.427  -13.178 1.00 91.77  ? 938  GLU A CB    1 
ATOM   6931  C  CG    . GLU A 1  938  ? -35.304 -8.725  -13.441 1.00 90.90  ? 938  GLU A CG    1 
ATOM   6932  C  CD    . GLU A 1  938  ? -34.666 -9.929  -12.770 1.00 92.24  ? 938  GLU A CD    1 
ATOM   6933  O  OE1   . GLU A 1  938  ? -34.289 -9.832  -11.581 1.00 94.92  ? 938  GLU A OE1   1 
ATOM   6934  O  OE2   . GLU A 1  938  ? -34.552 -10.985 -13.424 1.00 92.13  ? 938  GLU A OE2   1 
ATOM   6935  N  N     . VAL A 1  939  ? -33.820 -4.271  -13.269 1.00 92.85  ? 939  VAL A N     1 
ATOM   6936  C  CA    . VAL A 1  939  ? -33.213 -3.051  -12.706 1.00 94.24  ? 939  VAL A CA    1 
ATOM   6937  C  C     . VAL A 1  939  ? -34.263 -1.939  -12.585 1.00 94.35  ? 939  VAL A C     1 
ATOM   6938  O  O     . VAL A 1  939  ? -34.407 -1.327  -11.522 1.00 96.24  ? 939  VAL A O     1 
ATOM   6939  C  CB    . VAL A 1  939  ? -32.005 -2.570  -13.558 1.00 93.97  ? 939  VAL A CB    1 
ATOM   6940  C  CG1   . VAL A 1  939  ? -31.552 -1.164  -13.174 1.00 95.61  ? 939  VAL A CG1   1 
ATOM   6941  C  CG2   . VAL A 1  939  ? -30.841 -3.547  -13.429 1.00 94.30  ? 939  VAL A CG2   1 
ATOM   6942  N  N     . ALA A 1  940  ? -34.984 -1.698  -13.680 1.00 92.57  ? 940  ALA A N     1 
ATOM   6943  C  CA    . ALA A 1  940  ? -36.085 -0.726  -13.720 1.00 92.42  ? 940  ALA A CA    1 
ATOM   6944  C  C     . ALA A 1  940  ? -37.029 -0.882  -12.530 1.00 93.05  ? 940  ALA A C     1 
ATOM   6945  O  O     . ALA A 1  940  ? -37.333 0.097   -11.846 1.00 94.47  ? 940  ALA A O     1 
ATOM   6946  C  CB    . ALA A 1  940  ? -36.858 -0.865  -15.024 1.00 90.46  ? 940  ALA A CB    1 
ATOM   6947  N  N     . ALA A 1  941  ? -37.457 -2.121  -12.282 1.00 92.10  ? 941  ALA A N     1 
ATOM   6948  C  CA    . ALA A 1  941  ? -38.291 -2.466  -11.124 1.00 92.50  ? 941  ALA A CA    1 
ATOM   6949  C  C     . ALA A 1  941  ? -37.672 -2.026  -9.791  1.00 94.21  ? 941  ALA A C     1 
ATOM   6950  O  O     . ALA A 1  941  ? -38.353 -1.416  -8.973  1.00 95.42  ? 941  ALA A O     1 
ATOM   6951  C  CB    . ALA A 1  941  ? -38.580 -3.961  -11.101 1.00 91.12  ? 941  ALA A CB    1 
ATOM   6952  N  N     . LYS A 1  942  ? -36.387 -2.322  -9.592  1.00 94.60  ? 942  LYS A N     1 
ATOM   6953  C  CA    . LYS A 1  942  ? -35.675 -1.934  -8.364  1.00 97.04  ? 942  LYS A CA    1 
ATOM   6954  C  C     . LYS A 1  942  ? -35.509 -0.413  -8.251  1.00 98.58  ? 942  LYS A C     1 
ATOM   6955  O  O     . LYS A 1  942  ? -35.493 0.128   -7.139  1.00 100.20 ? 942  LYS A O     1 
ATOM   6956  C  CB    . LYS A 1  942  ? -34.289 -2.585  -8.300  1.00 97.58  ? 942  LYS A CB    1 
ATOM   6957  C  CG    . LYS A 1  942  ? -34.287 -4.106  -8.225  1.00 97.09  ? 942  LYS A CG    1 
ATOM   6958  C  CD    . LYS A 1  942  ? -34.569 -4.640  -6.829  1.00 98.58  ? 942  LYS A CD    1 
ATOM   6959  C  CE    . LYS A 1  942  ? -34.303 -6.138  -6.777  1.00 98.03  ? 942  LYS A CE    1 
ATOM   6960  N  NZ    . LYS A 1  942  ? -34.696 -6.761  -5.485  1.00 99.19  ? 942  LYS A NZ    1 
ATOM   6961  N  N     . CYS A 1  943  ? -35.378 0.258   -9.401  1.00 97.84  ? 943  CYS A N     1 
ATOM   6962  C  CA    . CYS A 1  943  ? -35.223 1.720   -9.463  1.00 99.21  ? 943  CYS A CA    1 
ATOM   6963  C  C     . CYS A 1  943  ? -36.544 2.500   -9.349  1.00 99.21  ? 943  CYS A C     1 
ATOM   6964  O  O     . CYS A 1  943  ? -36.519 3.714   -9.133  1.00 101.15 ? 943  CYS A O     1 
ATOM   6965  C  CB    . CYS A 1  943  ? -34.530 2.117   -10.799 1.00 98.38  ? 943  CYS A CB    1 
ATOM   6966  S  SG    . CYS A 1  943  ? -32.836 1.436   -10.681 1.00 100.09 ? 943  CYS A SG    1 
ATOM   6967  N  N     . GLY A 1  944  ? -37.685 1.829   -9.519  1.00 97.75  ? 944  GLY A N     1 
ATOM   6968  C  CA    . GLY A 1  944  ? -38.984 2.508   -9.562  1.00 97.70  ? 944  GLY A CA    1 
ATOM   6969  C  C     . GLY A 1  944  ? -39.202 3.343   -10.816 1.00 96.67  ? 944  GLY A C     1 
ATOM   6970  O  O     . GLY A 1  944  ? -40.106 4.173   -10.860 1.00 96.76  ? 944  GLY A O     1 
ATOM   6971  N  N     . LEU A 1  945  ? -38.380 3.111   -11.835 1.00 96.24  ? 945  LEU A N     1 
ATOM   6972  C  CA    . LEU A 1  945  ? -38.466 3.804   -13.109 1.00 95.20  ? 945  LEU A CA    1 
ATOM   6973  C  C     . LEU A 1  945  ? -39.034 2.803   -14.091 1.00 92.94  ? 945  LEU A C     1 
ATOM   6974  O  O     . LEU A 1  945  ? -38.918 1.594   -13.878 1.00 91.89  ? 945  LEU A O     1 
ATOM   6975  C  CB    . LEU A 1  945  ? -37.073 4.238   -13.560 1.00 95.35  ? 945  LEU A CB    1 
ATOM   6976  C  CG    . LEU A 1  945  ? -36.360 5.213   -12.620 1.00 97.10  ? 945  LEU A CG    1 
ATOM   6977  C  CD1   . LEU A 1  945  ? -34.863 5.214   -12.886 1.00 97.41  ? 945  LEU A CD1   1 
ATOM   6978  C  CD2   . LEU A 1  945  ? -36.940 6.614   -12.760 1.00 97.66  ? 945  LEU A CD2   1 
ATOM   6979  N  N     . SER A 1  946  ? -39.657 3.298   -15.159 1.00 92.47  ? 946  SER A N     1 
ATOM   6980  C  CA    . SER A 1  946  ? -40.142 2.420   -16.225 1.00 90.76  ? 946  SER A CA    1 
ATOM   6981  C  C     . SER A 1  946  ? -38.928 1.863   -16.968 1.00 90.83  ? 946  SER A C     1 
ATOM   6982  O  O     . SER A 1  946  ? -37.876 2.511   -16.998 1.00 91.98  ? 946  SER A O     1 
ATOM   6983  C  CB    . SER A 1  946  ? -41.073 3.162   -17.195 1.00 89.86  ? 946  SER A CB    1 
ATOM   6984  O  OG    . SER A 1  946  ? -40.370 4.062   -18.036 1.00 89.25  ? 946  SER A OG    1 
ATOM   6985  N  N     . PRO A 1  947  ? -39.059 0.662   -17.566 1.00 89.80  ? 947  PRO A N     1 
ATOM   6986  C  CA    . PRO A 1  947  ? -37.953 0.130   -18.368 1.00 89.12  ? 947  PRO A CA    1 
ATOM   6987  C  C     . PRO A 1  947  ? -37.420 1.102   -19.431 1.00 88.89  ? 947  PRO A C     1 
ATOM   6988  O  O     . PRO A 1  947  ? -36.221 1.126   -19.686 1.00 89.46  ? 947  PRO A O     1 
ATOM   6989  C  CB    . PRO A 1  947  ? -38.568 -1.112  -19.016 1.00 87.59  ? 947  PRO A CB    1 
ATOM   6990  C  CG    . PRO A 1  947  ? -39.585 -1.568  -18.028 1.00 87.56  ? 947  PRO A CG    1 
ATOM   6991  C  CD    . PRO A 1  947  ? -40.167 -0.307  -17.459 1.00 88.67  ? 947  PRO A CD    1 
ATOM   6992  N  N     . GLU A 1  948  ? -38.299 1.924   -19.993 1.00 88.90  ? 948  GLU A N     1 
ATOM   6993  C  CA    . GLU A 1  948  ? -37.948 2.812   -21.100 1.00 89.48  ? 948  GLU A CA    1 
ATOM   6994  C  C     . GLU A 1  948  ? -37.045 3.965   -20.659 1.00 91.56  ? 948  GLU A C     1 
ATOM   6995  O  O     . GLU A 1  948  ? -36.234 4.451   -21.452 1.00 91.84  ? 948  GLU A O     1 
ATOM   6996  C  CB    . GLU A 1  948  ? -39.213 3.343   -21.794 1.00 89.24  ? 948  GLU A CB    1 
ATOM   6997  C  CG    . GLU A 1  948  ? -39.949 2.303   -22.645 1.00 87.45  ? 948  GLU A CG    1 
ATOM   6998  C  CD    . GLU A 1  948  ? -40.555 1.149   -21.847 1.00 87.01  ? 948  GLU A CD    1 
ATOM   6999  O  OE1   . GLU A 1  948  ? -40.723 1.269   -20.611 1.00 88.31  ? 948  GLU A OE1   1 
ATOM   7000  O  OE2   . GLU A 1  948  ? -40.867 0.109   -22.460 1.00 84.77  ? 948  GLU A OE2   1 
ATOM   7001  N  N     . LYS A 1  949  ? -37.180 4.393   -19.405 1.00 93.36  ? 949  LYS A N     1 
ATOM   7002  C  CA    . LYS A 1  949  ? -36.260 5.373   -18.820 1.00 96.17  ? 949  LYS A CA    1 
ATOM   7003  C  C     . LYS A 1  949  ? -34.871 4.755   -18.588 1.00 94.80  ? 949  LYS A C     1 
ATOM   7004  O  O     . LYS A 1  949  ? -33.856 5.431   -18.754 1.00 95.01  ? 949  LYS A O     1 
ATOM   7005  C  CB    . LYS A 1  949  ? -36.802 5.929   -17.494 1.00 99.97  ? 949  LYS A CB    1 
ATOM   7006  C  CG    . LYS A 1  949  ? -38.145 6.650   -17.575 1.00 102.10 ? 949  LYS A CG    1 
ATOM   7007  C  CD    . LYS A 1  949  ? -38.090 7.942   -18.379 1.00 104.25 ? 949  LYS A CD    1 
ATOM   7008  C  CE    . LYS A 1  949  ? -39.358 8.764   -18.169 1.00 105.85 ? 949  LYS A CE    1 
ATOM   7009  N  NZ    . LYS A 1  949  ? -39.468 9.923   -19.100 1.00 106.56 ? 949  LYS A NZ    1 
ATOM   7010  N  N     . VAL A 1  950  ? -34.834 3.481   -18.192 1.00 92.84  ? 950  VAL A N     1 
ATOM   7011  C  CA    . VAL A 1  950  ? -33.570 2.754   -17.998 1.00 92.47  ? 950  VAL A CA    1 
ATOM   7012  C  C     . VAL A 1  950  ? -32.921 2.416   -19.348 1.00 91.03  ? 950  VAL A C     1 
ATOM   7013  O  O     . VAL A 1  950  ? -31.695 2.374   -19.458 1.00 91.65  ? 950  VAL A O     1 
ATOM   7014  C  CB    . VAL A 1  950  ? -33.766 1.475   -17.140 1.00 92.01  ? 950  VAL A CB    1 
ATOM   7015  C  CG1   . VAL A 1  950  ? -32.466 0.683   -17.007 1.00 92.03  ? 950  VAL A CG1   1 
ATOM   7016  C  CG2   . VAL A 1  950  ? -34.294 1.844   -15.760 1.00 93.38  ? 950  VAL A CG2   1 
ATOM   7017  N  N     . ARG A 1  951  ? -33.736 2.169   -20.369 1.00 89.20  ? 951  ARG A N     1 
ATOM   7018  C  CA    . ARG A 1  951  ? -33.217 1.949   -21.716 1.00 87.78  ? 951  ARG A CA    1 
ATOM   7019  C  C     . ARG A 1  951  ? -32.559 3.212   -22.267 1.00 89.15  ? 951  ARG A C     1 
ATOM   7020  O  O     . ARG A 1  951  ? -31.433 3.154   -22.763 1.00 89.42  ? 951  ARG A O     1 
ATOM   7021  C  CB    . ARG A 1  951  ? -34.314 1.439   -22.658 1.00 85.60  ? 951  ARG A CB    1 
ATOM   7022  C  CG    . ARG A 1  951  ? -34.674 -0.016  -22.399 1.00 84.10  ? 951  ARG A CG    1 
ATOM   7023  C  CD    . ARG A 1  951  ? -35.765 -0.540  -23.319 1.00 81.84  ? 951  ARG A CD    1 
ATOM   7024  N  NE    . ARG A 1  951  ? -36.057 -1.944  -23.011 1.00 80.49  ? 951  ARG A NE    1 
ATOM   7025  C  CZ    . ARG A 1  951  ? -37.212 -2.440  -22.552 1.00 80.43  ? 951  ARG A CZ    1 
ATOM   7026  N  NH1   . ARG A 1  951  ? -38.288 -1.679  -22.338 1.00 80.81  ? 951  ARG A NH1   1 
ATOM   7027  N  NH2   . ARG A 1  951  ? -37.298 -3.747  -22.315 1.00 79.96  ? 951  ARG A NH2   1 
ATOM   7028  N  N     . ILE A 1  952  ? -33.246 4.349   -22.150 1.00 90.76  ? 952  ILE A N     1 
ATOM   7029  C  CA    . ILE A 1  952  ? -32.741 5.613   -22.701 1.00 92.46  ? 952  ILE A CA    1 
ATOM   7030  C  C     . ILE A 1  952  ? -31.534 6.178   -21.923 1.00 93.74  ? 952  ILE A C     1 
ATOM   7031  O  O     . ILE A 1  952  ? -30.685 6.843   -22.520 1.00 94.60  ? 952  ILE A O     1 
ATOM   7032  C  CB    . ILE A 1  952  ? -33.870 6.674   -22.853 1.00 93.72  ? 952  ILE A CB    1 
ATOM   7033  C  CG1   . ILE A 1  952  ? -33.481 7.743   -23.889 1.00 94.50  ? 952  ILE A CG1   1 
ATOM   7034  C  CG2   . ILE A 1  952  ? -34.226 7.317   -21.518 1.00 95.51  ? 952  ILE A CG2   1 
ATOM   7035  C  CD1   . ILE A 1  952  ? -34.593 8.721   -24.225 1.00 94.71  ? 952  ILE A CD1   1 
ATOM   7036  N  N     . ILE A 1  953  ? -31.449 5.911   -20.618 1.00 94.05  ? 953  ILE A N     1 
ATOM   7037  C  CA    . ILE A 1  953  ? -30.309 6.382   -19.813 1.00 95.65  ? 953  ILE A CA    1 
ATOM   7038  C  C     . ILE A 1  953  ? -29.026 5.579   -20.072 1.00 94.65  ? 953  ILE A C     1 
ATOM   7039  O  O     . ILE A 1  953  ? -27.926 6.102   -19.884 1.00 96.55  ? 953  ILE A O     1 
ATOM   7040  C  CB    . ILE A 1  953  ? -30.637 6.416   -18.291 1.00 97.29  ? 953  ILE A CB    1 
ATOM   7041  C  CG1   . ILE A 1  953  ? -29.716 7.399   -17.557 1.00 99.71  ? 953  ILE A CG1   1 
ATOM   7042  C  CG2   . ILE A 1  953  ? -30.550 5.032   -17.655 1.00 96.74  ? 953  ILE A CG2   1 
ATOM   7043  C  CD1   . ILE A 1  953  ? -30.063 7.588   -16.095 1.00 101.49 ? 953  ILE A CD1   1 
ATOM   7044  N  N     . ASN A 1  954  ? -29.172 4.321   -20.490 1.00 92.02  ? 954  ASN A N     1 
ATOM   7045  C  CA    . ASN A 1  954  ? -28.031 3.442   -20.793 1.00 90.97  ? 954  ASN A CA    1 
ATOM   7046  C  C     . ASN A 1  954  ? -27.624 3.389   -22.269 1.00 89.91  ? 954  ASN A C     1 
ATOM   7047  O  O     . ASN A 1  954  ? -26.664 2.702   -22.612 1.00 89.17  ? 954  ASN A O     1 
ATOM   7048  C  CB    . ASN A 1  954  ? -28.318 2.023   -20.294 1.00 89.62  ? 954  ASN A CB    1 
ATOM   7049  C  CG    . ASN A 1  954  ? -28.167 1.901   -18.798 1.00 90.85  ? 954  ASN A CG    1 
ATOM   7050  O  OD1   . ASN A 1  954  ? -27.056 1.972   -18.273 1.00 91.98  ? 954  ASN A OD1   1 
ATOM   7051  N  ND2   . ASN A 1  954  ? -29.279 1.718   -18.101 1.00 91.08  ? 954  ASN A ND2   1 
ATOM   7052  N  N     . MET A 1  955  ? -28.328 4.121   -23.132 1.00 90.00  ? 955  MET A N     1 
ATOM   7053  C  CA    . MET A 1  955  ? -28.072 4.062   -24.574 1.00 89.30  ? 955  MET A CA    1 
ATOM   7054  C  C     . MET A 1  955  ? -26.704 4.614   -24.972 1.00 89.57  ? 955  MET A C     1 
ATOM   7055  O  O     . MET A 1  955  ? -26.181 5.522   -24.332 1.00 91.62  ? 955  MET A O     1 
ATOM   7056  C  CB    . MET A 1  955  ? -29.177 4.771   -25.378 1.00 89.64  ? 955  MET A CB    1 
ATOM   7057  C  CG    . MET A 1  955  ? -30.118 3.808   -26.086 1.00 88.88  ? 955  MET A CG    1 
ATOM   7058  S  SD    . MET A 1  955  ? -31.420 4.596   -27.053 1.00 90.26  ? 955  MET A SD    1 
ATOM   7059  C  CE    . MET A 1  955  ? -30.460 5.566   -28.212 1.00 89.80  ? 955  MET A CE    1 
ATOM   7060  N  N     . TYR A 1  956  ? -26.138 4.039   -26.031 1.00 88.39  ? 956  TYR A N     1 
ATOM   7061  C  CA    . TYR A 1  956  ? -24.933 4.559   -26.676 1.00 89.30  ? 956  TYR A CA    1 
ATOM   7062  C  C     . TYR A 1  956  ? -25.148 5.997   -27.145 1.00 90.86  ? 956  TYR A C     1 
ATOM   7063  O  O     . TYR A 1  956  ? -26.197 6.319   -27.706 1.00 90.22  ? 956  TYR A O     1 
ATOM   7064  C  CB    . TYR A 1  956  ? -24.570 3.715   -27.911 1.00 87.72  ? 956  TYR A CB    1 
ATOM   7065  C  CG    . TYR A 1  956  ? -23.912 2.374   -27.637 1.00 86.47  ? 956  TYR A CG    1 
ATOM   7066  C  CD1   . TYR A 1  956  ? -22.682 2.300   -26.992 1.00 87.40  ? 956  TYR A CD1   1 
ATOM   7067  C  CD2   . TYR A 1  956  ? -24.494 1.182   -28.070 1.00 84.67  ? 956  TYR A CD2   1 
ATOM   7068  C  CE1   . TYR A 1  956  ? -22.064 1.086   -26.753 1.00 86.62  ? 956  TYR A CE1   1 
ATOM   7069  C  CE2   . TYR A 1  956  ? -23.879 -0.040  -27.836 1.00 83.88  ? 956  TYR A CE2   1 
ATOM   7070  C  CZ    . TYR A 1  956  ? -22.665 -0.079  -27.178 1.00 84.74  ? 956  TYR A CZ    1 
ATOM   7071  O  OH    . TYR A 1  956  ? -22.044 -1.278  -26.945 1.00 83.96  ? 956  TYR A OH    1 
ATOM   7072  N  N     . LYS A 1  957  ? -24.149 6.849   -26.932 1.00 93.74  ? 957  LYS A N     1 
ATOM   7073  C  CA    . LYS A 1  957  ? -24.163 8.213   -27.480 1.00 95.84  ? 957  LYS A CA    1 
ATOM   7074  C  C     . LYS A 1  957  ? -23.846 8.173   -28.972 1.00 94.84  ? 957  LYS A C     1 
ATOM   7075  O  O     . LYS A 1  957  ? -23.415 7.141   -29.490 1.00 93.56  ? 957  LYS A O     1 
ATOM   7076  C  CB    . LYS A 1  957  ? -23.183 9.138   -26.733 1.00 98.86  ? 957  LYS A CB    1 
ATOM   7077  C  CG    . LYS A 1  957  ? -23.854 10.127  -25.790 1.00 101.27 ? 957  LYS A CG    1 
ATOM   7078  C  CD    . LYS A 1  957  ? -24.627 9.451   -24.664 1.00 101.63 ? 957  LYS A CD    1 
ATOM   7079  C  CE    . LYS A 1  957  ? -25.298 10.485  -23.770 1.00 103.22 ? 957  LYS A CE    1 
ATOM   7080  N  NZ    . LYS A 1  957  ? -25.999 9.867   -22.608 1.00 103.21 ? 957  LYS A NZ    1 
ATOM   7081  N  N     . GLU A 1  958  ? -24.057 9.304   -29.649 1.00 95.70  ? 958  GLU A N     1 
ATOM   7082  C  CA    . GLU A 1  958  ? -23.886 9.410   -31.110 1.00 94.86  ? 958  GLU A CA    1 
ATOM   7083  C  C     . GLU A 1  958  ? -22.576 8.781   -31.586 1.00 93.47  ? 958  GLU A C     1 
ATOM   7084  O  O     . GLU A 1  958  ? -22.578 7.982   -32.517 1.00 91.79  ? 958  GLU A O     1 
ATOM   7085  C  CB    . GLU A 1  958  ? -23.967 10.877  -31.568 1.00 96.99  ? 958  GLU A CB    1 
ATOM   7086  C  CG    . GLU A 1  958  ? -24.005 11.058  -33.085 1.00 96.53  ? 958  GLU A CG    1 
ATOM   7087  C  CD    . GLU A 1  958  ? -24.296 12.486  -33.527 1.00 97.88  ? 958  GLU A CD    1 
ATOM   7088  O  OE1   . GLU A 1  958  ? -24.223 13.417  -32.694 1.00 99.22  ? 958  GLU A OE1   1 
ATOM   7089  O  OE2   . GLU A 1  958  ? -24.596 12.676  -34.725 1.00 97.91  ? 958  GLU A OE2   1 
ATOM   7090  N  N     . ILE A 1  959  ? -21.475 9.151   -30.937 1.00 94.32  ? 959  ILE A N     1 
ATOM   7091  C  CA    . ILE A 1  959  ? -20.175 8.510   -31.132 1.00 93.66  ? 959  ILE A CA    1 
ATOM   7092  C  C     . ILE A 1  959  ? -19.885 7.694   -29.880 1.00 93.39  ? 959  ILE A C     1 
ATOM   7093  O  O     . ILE A 1  959  ? -20.018 8.206   -28.768 1.00 94.97  ? 959  ILE A O     1 
ATOM   7094  C  CB    . ILE A 1  959  ? -19.048 9.548   -31.342 1.00 95.10  ? 959  ILE A CB    1 
ATOM   7095  C  CG1   . ILE A 1  959  ? -19.373 10.488  -32.517 1.00 95.08  ? 959  ILE A CG1   1 
ATOM   7096  C  CG2   . ILE A 1  959  ? -17.701 8.853   -31.540 1.00 94.88  ? 959  ILE A CG2   1 
ATOM   7097  C  CD1   . ILE A 1  959  ? -19.574 9.802   -33.858 1.00 93.32  ? 959  ILE A CD1   1 
ATOM   7098  N  N     . ASP A 1  960  ? -19.505 6.428   -30.055 1.00 91.66  ? 960  ASP A N     1 
ATOM   7099  C  CA    . ASP A 1  960  ? -19.252 5.537   -28.918 1.00 91.57  ? 960  ASP A CA    1 
ATOM   7100  C  C     . ASP A 1  960  ? -18.458 4.276   -29.311 1.00 90.47  ? 960  ASP A C     1 
ATOM   7101  O  O     . ASP A 1  960  ? -18.068 4.126   -30.470 1.00 89.87  ? 960  ASP A O     1 
ATOM   7102  C  CB    . ASP A 1  960  ? -20.584 5.152   -28.250 1.00 90.98  ? 960  ASP A CB    1 
ATOM   7103  C  CG    . ASP A 1  960  ? -20.509 5.183   -26.738 1.00 92.94  ? 960  ASP A CG    1 
ATOM   7104  O  OD1   . ASP A 1  960  ? -19.424 4.878   -26.193 1.00 94.17  ? 960  ASP A OD1   1 
ATOM   7105  O  OD2   . ASP A 1  960  ? -21.536 5.504   -26.099 1.00 93.58  ? 960  ASP A OD2   1 
ATOM   7106  N  N     . GLN A 1  961  ? -18.228 3.386   -28.338 1.00 90.03  ? 961  GLN A N     1 
ATOM   7107  C  CA    . GLN A 1  961  ? -17.383 2.204   -28.509 1.00 89.08  ? 961  GLN A CA    1 
ATOM   7108  C  C     . GLN A 1  961  ? -18.041 0.946   -27.935 1.00 87.59  ? 961  GLN A C     1 
ATOM   7109  O  O     . GLN A 1  961  ? -18.614 0.983   -26.841 1.00 87.57  ? 961  GLN A O     1 
ATOM   7110  C  CB    . GLN A 1  961  ? -16.052 2.449   -27.803 1.00 91.25  ? 961  GLN A CB    1 
ATOM   7111  C  CG    . GLN A 1  961  ? -14.973 1.412   -28.062 1.00 91.25  ? 961  GLN A CG    1 
ATOM   7112  C  CD    . GLN A 1  961  ? -13.673 1.763   -27.366 1.00 93.52  ? 961  GLN A CD    1 
ATOM   7113  O  OE1   . GLN A 1  961  ? -12.695 2.125   -28.013 1.00 94.78  ? 961  GLN A OE1   1 
ATOM   7114  N  NE2   . GLN A 1  961  ? -13.661 1.672   -26.039 1.00 94.54  ? 961  GLN A NE2   1 
ATOM   7115  N  N     . THR A 1  962  ? -17.929 -0.165  -28.666 1.00 85.55  ? 962  THR A N     1 
ATOM   7116  C  CA    . THR A 1  962  ? -18.507 -1.450  -28.256 1.00 84.38  ? 962  THR A CA    1 
ATOM   7117  C  C     . THR A 1  962  ? -17.582 -2.174  -27.276 1.00 85.54  ? 962  THR A C     1 
ATOM   7118  O  O     . THR A 1  962  ? -16.415 -1.803  -27.163 1.00 86.83  ? 962  THR A O     1 
ATOM   7119  C  CB    . THR A 1  962  ? -18.738 -2.365  -29.475 1.00 82.26  ? 962  THR A CB    1 
ATOM   7120  O  OG1   . THR A 1  962  ? -17.496 -2.595  -30.149 1.00 82.48  ? 962  THR A OG1   1 
ATOM   7121  C  CG2   . THR A 1  962  ? -19.725 -1.736  -30.440 1.00 81.33  ? 962  THR A CG2   1 
ATOM   7122  N  N     . PRO A 1  963  ? -18.087 -3.222  -26.580 1.00 85.85  ? 963  PRO A N     1 
ATOM   7123  C  CA    . PRO A 1  963  ? -17.251 -4.079  -25.716 1.00 87.33  ? 963  PRO A CA    1 
ATOM   7124  C  C     . PRO A 1  963  ? -15.990 -4.675  -26.369 1.00 87.63  ? 963  PRO A C     1 
ATOM   7125  O  O     . PRO A 1  963  ? -15.008 -4.935  -25.672 1.00 89.58  ? 963  PRO A O     1 
ATOM   7126  C  CB    . PRO A 1  963  ? -18.211 -5.203  -25.319 1.00 86.37  ? 963  PRO A CB    1 
ATOM   7127  C  CG    . PRO A 1  963  ? -19.544 -4.547  -25.299 1.00 85.53  ? 963  PRO A CG    1 
ATOM   7128  C  CD    . PRO A 1  963  ? -19.519 -3.561  -26.433 1.00 85.07  ? 963  PRO A CD    1 
ATOM   7129  N  N     . TYR A 1  964  ? -16.026 -4.849  -27.690 1.00 86.76  ? 964  TYR A N     1 
ATOM   7130  C  CA    . TYR A 1  964  ? -14.929 -5.433  -28.484 1.00 86.71  ? 964  TYR A CA    1 
ATOM   7131  C  C     . TYR A 1  964  ? -14.130 -4.342  -29.230 1.00 88.19  ? 964  TYR A C     1 
ATOM   7132  O  O     . TYR A 1  964  ? -13.494 -4.610  -30.255 1.00 86.43  ? 964  TYR A O     1 
ATOM   7133  C  CB    . TYR A 1  964  ? -15.484 -6.500  -29.456 1.00 84.31  ? 964  TYR A CB    1 
ATOM   7134  C  CG    . TYR A 1  964  ? -16.720 -6.055  -30.211 1.00 82.64  ? 964  TYR A CG    1 
ATOM   7135  C  CD1   . TYR A 1  964  ? -17.993 -6.241  -29.668 1.00 82.02  ? 964  TYR A CD1   1 
ATOM   7136  C  CD2   . TYR A 1  964  ? -16.622 -5.423  -31.450 1.00 81.98  ? 964  TYR A CD2   1 
ATOM   7137  C  CE1   . TYR A 1  964  ? -19.128 -5.814  -30.335 1.00 81.12  ? 964  TYR A CE1   1 
ATOM   7138  C  CE2   . TYR A 1  964  ? -17.758 -5.000  -32.132 1.00 80.94  ? 964  TYR A CE2   1 
ATOM   7139  C  CZ    . TYR A 1  964  ? -19.010 -5.193  -31.569 1.00 80.24  ? 964  TYR A CZ    1 
ATOM   7140  O  OH    . TYR A 1  964  ? -20.143 -4.774  -32.229 1.00 78.11  ? 964  TYR A OH    1 
ATOM   7141  N  N     . LYS A 1  965  ? -14.175 -3.114  -28.703 1.00 91.15  ? 965  LYS A N     1 
ATOM   7142  C  CA    . LYS A 1  965  ? -13.374 -1.984  -29.180 1.00 94.12  ? 965  LYS A CA    1 
ATOM   7143  C  C     . LYS A 1  965  ? -13.584 -1.622  -30.663 1.00 94.02  ? 965  LYS A C     1 
ATOM   7144  O  O     . LYS A 1  965  ? -12.616 -1.383  -31.393 1.00 95.97  ? 965  LYS A O     1 
ATOM   7145  C  CB    . LYS A 1  965  ? -11.879 -2.218  -28.880 1.00 95.88  ? 965  LYS A CB    1 
ATOM   7146  C  CG    . LYS A 1  965  ? -11.555 -2.650  -27.451 1.00 97.67  ? 965  LYS A CG    1 
ATOM   7147  C  CD    . LYS A 1  965  ? -12.128 -1.700  -26.408 1.00 99.40  ? 965  LYS A CD    1 
ATOM   7148  C  CE    . LYS A 1  965  ? -11.606 -1.995  -25.008 1.00 101.74 ? 965  LYS A CE    1 
ATOM   7149  N  NZ    . LYS A 1  965  ? -10.419 -1.169  -24.639 1.00 104.45 ? 965  LYS A NZ    1 
ATOM   7150  N  N     . GLN A 1  966  ? -14.843 -1.582  -31.102 1.00 93.21  ? 966  GLN A N     1 
ATOM   7151  C  CA    . GLN A 1  966  ? -15.185 -1.030  -32.419 1.00 93.07  ? 966  GLN A CA    1 
ATOM   7152  C  C     . GLN A 1  966  ? -15.929 0.297   -32.245 1.00 94.53  ? 966  GLN A C     1 
ATOM   7153  O  O     . GLN A 1  966  ? -16.861 0.392   -31.445 1.00 94.40  ? 966  GLN A O     1 
ATOM   7154  C  CB    . GLN A 1  966  ? -16.022 -2.009  -33.252 1.00 90.59  ? 966  GLN A CB    1 
ATOM   7155  C  CG    . GLN A 1  966  ? -16.027 -1.646  -34.735 1.00 89.97  ? 966  GLN A CG    1 
ATOM   7156  C  CD    . GLN A 1  966  ? -16.882 -2.558  -35.599 1.00 88.03  ? 966  GLN A CD    1 
ATOM   7157  O  OE1   . GLN A 1  966  ? -17.057 -3.739  -35.306 1.00 87.82  ? 966  GLN A OE1   1 
ATOM   7158  N  NE2   . GLN A 1  966  ? -17.404 -2.010  -36.691 1.00 86.97  ? 966  GLN A NE2   1 
ATOM   7159  N  N     . GLU A 1  967  ? -15.500 1.313   -32.995 1.00 96.38  ? 967  GLU A N     1 
ATOM   7160  C  CA    . GLU A 1  967  ? -16.147 2.631   -32.986 1.00 97.95  ? 967  GLU A CA    1 
ATOM   7161  C  C     . GLU A 1  967  ? -17.448 2.570   -33.782 1.00 95.85  ? 967  GLU A C     1 
ATOM   7162  O  O     . GLU A 1  967  ? -17.459 2.067   -34.908 1.00 95.45  ? 967  GLU A O     1 
ATOM   7163  C  CB    . GLU A 1  967  ? -15.220 3.702   -33.582 1.00 100.52 ? 967  GLU A CB    1 
ATOM   7164  C  CG    . GLU A 1  967  ? -14.099 4.146   -32.654 1.00 103.37 ? 967  GLU A CG    1 
ATOM   7165  C  CD    . GLU A 1  967  ? -14.534 5.241   -31.693 1.00 106.70 ? 967  GLU A CD    1 
ATOM   7166  O  OE1   . GLU A 1  967  ? -14.860 6.353   -32.166 1.00 108.40 ? 967  GLU A OE1   1 
ATOM   7167  O  OE2   . GLU A 1  967  ? -14.542 4.996   -30.467 1.00 108.35 ? 967  GLU A OE2   1 
ATOM   7168  N  N     . ILE A 1  968  ? -18.532 3.084   -33.197 1.00 94.86  ? 968  ILE A N     1 
ATOM   7169  C  CA    . ILE A 1  968  ? -19.853 3.078   -33.836 1.00 91.85  ? 968  ILE A CA    1 
ATOM   7170  C  C     . ILE A 1  968  ? -20.453 4.476   -33.870 1.00 91.79  ? 968  ILE A C     1 
ATOM   7171  O  O     . ILE A 1  968  ? -20.239 5.273   -32.955 1.00 92.60  ? 968  ILE A O     1 
ATOM   7172  C  CB    . ILE A 1  968  ? -20.834 2.101   -33.146 1.00 90.51  ? 968  ILE A CB    1 
ATOM   7173  C  CG1   . ILE A 1  968  ? -21.021 2.434   -31.655 1.00 91.87  ? 968  ILE A CG1   1 
ATOM   7174  C  CG2   . ILE A 1  968  ? -20.342 0.670   -33.308 1.00 89.40  ? 968  ILE A CG2   1 
ATOM   7175  C  CD1   . ILE A 1  968  ? -22.125 1.644   -30.980 1.00 90.87  ? 968  ILE A CD1   1 
ATOM   7176  N  N     . ASN A 1  969  ? -21.188 4.762   -34.941 1.00 90.88  ? 969  ASN A N     1 
ATOM   7177  C  CA    . ASN A 1  969  ? -21.965 5.986   -35.064 1.00 91.87  ? 969  ASN A CA    1 
ATOM   7178  C  C     . ASN A 1  969  ? -23.432 5.655   -34.776 1.00 91.52  ? 969  ASN A C     1 
ATOM   7179  O  O     . ASN A 1  969  ? -24.162 5.197   -35.663 1.00 90.59  ? 969  ASN A O     1 
ATOM   7180  C  CB    . ASN A 1  969  ? -21.784 6.598   -36.458 1.00 91.36  ? 969  ASN A CB    1 
ATOM   7181  C  CG    . ASN A 1  969  ? -22.217 8.051   -36.525 1.00 92.50  ? 969  ASN A CG    1 
ATOM   7182  O  OD1   . ASN A 1  969  ? -23.224 8.447   -35.934 1.00 93.36  ? 969  ASN A OD1   1 
ATOM   7183  N  ND2   . ASN A 1  969  ? -21.458 8.855   -37.258 1.00 93.25  ? 969  ASN A ND2   1 
ATOM   7184  N  N     . ALA A 1  970  ? -23.849 5.884   -33.530 1.00 92.24  ? 970  ALA A N     1 
ATOM   7185  C  CA    . ALA A 1  970  ? -25.209 5.570   -33.075 1.00 92.11  ? 970  ALA A CA    1 
ATOM   7186  C  C     . ALA A 1  970  ? -26.179 6.759   -33.164 1.00 92.81  ? 970  ALA A C     1 
ATOM   7187  O  O     . ALA A 1  970  ? -27.082 6.886   -32.334 1.00 92.91  ? 970  ALA A O     1 
ATOM   7188  C  CB    . ALA A 1  970  ? -25.164 5.022   -31.653 1.00 92.80  ? 970  ALA A CB    1 
ATOM   7189  N  N     . LYS A 1  971  ? -25.999 7.614   -34.174 1.00 93.56  ? 971  LYS A N     1 
ATOM   7190  C  CA    . LYS A 1  971  ? -26.934 8.706   -34.466 1.00 94.23  ? 971  LYS A CA    1 
ATOM   7191  C  C     . LYS A 1  971  ? -28.316 8.144   -34.778 1.00 91.46  ? 971  LYS A C     1 
ATOM   7192  O  O     . LYS A 1  971  ? -29.327 8.602   -34.241 1.00 91.11  ? 971  LYS A O     1 
ATOM   7193  C  CB    . LYS A 1  971  ? -26.430 9.517   -35.665 1.00 95.79  ? 971  LYS A CB    1 
ATOM   7194  C  CG    . LYS A 1  971  ? -27.248 10.752  -36.002 1.00 98.32  ? 971  LYS A CG    1 
ATOM   7195  C  CD    . LYS A 1  971  ? -26.657 11.472  -37.204 1.00 100.61 ? 971  LYS A CD    1 
ATOM   7196  C  CE    . LYS A 1  971  ? -27.605 12.522  -37.763 1.00 102.22 ? 971  LYS A CE    1 
ATOM   7197  N  NZ    . LYS A 1  971  ? -28.827 11.921  -38.376 1.00 101.53 ? 971  LYS A NZ    1 
ATOM   7198  N  N     . ASN A 1  972  ? -28.337 7.136   -35.645 1.00 88.70  ? 972  ASN A N     1 
ATOM   7199  C  CA    . ASN A 1  972  ? -29.578 6.527   -36.103 1.00 86.74  ? 972  ASN A CA    1 
ATOM   7200  C  C     . ASN A 1  972  ? -30.241 5.614   -35.071 1.00 86.00  ? 972  ASN A C     1 
ATOM   7201  O  O     . ASN A 1  972  ? -31.439 5.354   -35.173 1.00 86.02  ? 972  ASN A O     1 
ATOM   7202  C  CB    . ASN A 1  972  ? -29.346 5.781   -37.419 1.00 85.04  ? 972  ASN A CB    1 
ATOM   7203  C  CG    . ASN A 1  972  ? -28.918 6.707   -38.545 1.00 84.91  ? 972  ASN A CG    1 
ATOM   7204  O  OD1   . ASN A 1  972  ? -28.871 7.927   -38.385 1.00 86.48  ? 972  ASN A OD1   1 
ATOM   7205  N  ND2   . ASN A 1  972  ? -28.605 6.128   -39.693 1.00 83.87  ? 972  ASN A ND2   1 
ATOM   7206  N  N     . LEU A 1  973  ? -29.475 5.127   -34.094 1.00 85.48  ? 973  LEU A N     1 
ATOM   7207  C  CA    . LEU A 1  973  ? -30.049 4.433   -32.932 1.00 84.61  ? 973  LEU A CA    1 
ATOM   7208  C  C     . LEU A 1  973  ? -30.935 5.388   -32.138 1.00 86.02  ? 973  LEU A C     1 
ATOM   7209  O  O     . LEU A 1  973  ? -32.069 5.051   -31.789 1.00 84.98  ? 973  LEU A O     1 
ATOM   7210  C  CB    . LEU A 1  973  ? -28.940 3.894   -32.022 1.00 84.58  ? 973  LEU A CB    1 
ATOM   7211  C  CG    . LEU A 1  973  ? -29.343 3.099   -30.776 1.00 83.97  ? 973  LEU A CG    1 
ATOM   7212  C  CD1   . LEU A 1  973  ? -30.107 1.834   -31.141 1.00 82.25  ? 973  LEU A CD1   1 
ATOM   7213  C  CD2   . LEU A 1  973  ? -28.108 2.766   -29.954 1.00 84.63  ? 973  LEU A CD2   1 
ATOM   7214  N  N     . ILE A 1  974  ? -30.396 6.578   -31.874 1.00 88.51  ? 974  ILE A N     1 
ATOM   7215  C  CA    . ILE A 1  974  ? -31.080 7.632   -31.118 1.00 89.92  ? 974  ILE A CA    1 
ATOM   7216  C  C     . ILE A 1  974  ? -32.266 8.175   -31.914 1.00 90.78  ? 974  ILE A C     1 
ATOM   7217  O  O     . ILE A 1  974  ? -33.358 8.345   -31.368 1.00 91.05  ? 974  ILE A O     1 
ATOM   7218  C  CB    . ILE A 1  974  ? -30.103 8.782   -30.742 1.00 91.03  ? 974  ILE A CB    1 
ATOM   7219  C  CG1   . ILE A 1  974  ? -28.999 8.267   -29.798 1.00 91.13  ? 974  ILE A CG1   1 
ATOM   7220  C  CG2   . ILE A 1  974  ? -30.839 9.947   -30.082 1.00 92.17  ? 974  ILE A CG2   1 
ATOM   7221  C  CD1   . ILE A 1  974  ? -27.718 9.074   -29.824 1.00 92.32  ? 974  ILE A CD1   1 
ATOM   7222  N  N     . GLN A 1  975  ? -32.051 8.429   -33.202 1.00 91.53  ? 975  GLN A N     1 
ATOM   7223  C  CA    . GLN A 1  975  ? -33.097 8.981   -34.066 1.00 92.78  ? 975  GLN A CA    1 
ATOM   7224  C  C     . GLN A 1  975  ? -34.267 8.003   -34.249 1.00 90.52  ? 975  GLN A C     1 
ATOM   7225  O  O     . GLN A 1  975  ? -35.426 8.424   -34.256 1.00 90.47  ? 975  GLN A O     1 
ATOM   7226  C  CB    . GLN A 1  975  ? -32.513 9.386   -35.421 1.00 94.95  ? 975  GLN A CB    1 
ATOM   7227  C  CG    . GLN A 1  975  ? -33.318 10.438  -36.165 1.00 97.71  ? 975  GLN A CG    1 
ATOM   7228  C  CD    . GLN A 1  975  ? -32.791 10.694  -37.569 1.00 99.48  ? 975  GLN A CD    1 
ATOM   7229  O  OE1   . GLN A 1  975  ? -31.616 10.447  -37.867 1.00 100.23 ? 975  GLN A OE1   1 
ATOM   7230  N  NE2   . GLN A 1  975  ? -33.661 11.191  -38.441 1.00 100.33 ? 975  GLN A NE2   1 
ATOM   7231  N  N     . CYS A 1  976  ? -33.961 6.712   -34.390 1.00 88.43  ? 976  CYS A N     1 
ATOM   7232  C  CA    . CYS A 1  976  ? -34.997 5.664   -34.445 1.00 87.18  ? 976  CYS A CA    1 
ATOM   7233  C  C     . CYS A 1  976  ? -35.844 5.641   -33.172 1.00 87.18  ? 976  CYS A C     1 
ATOM   7234  O  O     . CYS A 1  976  ? -37.069 5.528   -33.245 1.00 86.55  ? 976  CYS A O     1 
ATOM   7235  C  CB    . CYS A 1  976  ? -34.391 4.268   -34.673 1.00 86.14  ? 976  CYS A CB    1 
ATOM   7236  S  SG    . CYS A 1  976  ? -34.015 3.868   -36.395 1.00 85.33  ? 976  CYS A SG    1 
ATOM   7237  N  N     . TRP A 1  977  ? -35.181 5.744   -32.020 1.00 87.02  ? 977  TRP A N     1 
ATOM   7238  C  CA    . TRP A 1  977  ? -35.855 5.739   -30.722 1.00 86.49  ? 977  TRP A CA    1 
ATOM   7239  C  C     . TRP A 1  977  ? -36.803 6.923   -30.582 1.00 88.30  ? 977  TRP A C     1 
ATOM   7240  O  O     . TRP A 1  977  ? -37.936 6.752   -30.140 1.00 88.89  ? 977  TRP A O     1 
ATOM   7241  C  CB    . TRP A 1  977  ? -34.826 5.751   -29.586 1.00 86.56  ? 977  TRP A CB    1 
ATOM   7242  C  CG    . TRP A 1  977  ? -35.413 5.750   -28.209 1.00 85.86  ? 977  TRP A CG    1 
ATOM   7243  C  CD1   . TRP A 1  977  ? -35.662 6.838   -27.426 1.00 86.89  ? 977  TRP A CD1   1 
ATOM   7244  C  CD2   . TRP A 1  977  ? -35.816 4.607   -27.448 1.00 84.50  ? 977  TRP A CD2   1 
ATOM   7245  N  NE1   . TRP A 1  977  ? -36.201 6.448   -26.227 1.00 86.91  ? 977  TRP A NE1   1 
ATOM   7246  C  CE2   . TRP A 1  977  ? -36.306 5.083   -26.211 1.00 85.46  ? 977  TRP A CE2   1 
ATOM   7247  C  CE3   . TRP A 1  977  ? -35.816 3.229   -27.692 1.00 82.68  ? 977  TRP A CE3   1 
ATOM   7248  C  CZ2   . TRP A 1  977  ? -36.790 4.227   -25.214 1.00 84.91  ? 977  TRP A CZ2   1 
ATOM   7249  C  CZ3   . TRP A 1  977  ? -36.299 2.377   -26.703 1.00 82.67  ? 977  TRP A CZ3   1 
ATOM   7250  C  CH2   . TRP A 1  977  ? -36.778 2.882   -25.478 1.00 83.85  ? 977  TRP A CH2   1 
ATOM   7251  N  N     . ARG A 1  978  ? -36.334 8.112   -30.960 1.00 90.31  ? 978  ARG A N     1 
ATOM   7252  C  CA    . ARG A 1  978  ? -37.148 9.333   -30.864 1.00 92.36  ? 978  ARG A CA    1 
ATOM   7253  C  C     . ARG A 1  978  ? -38.345 9.323   -31.814 1.00 91.41  ? 978  ARG A C     1 
ATOM   7254  O  O     . ARG A 1  978  ? -39.463 9.658   -31.404 1.00 91.53  ? 978  ARG A O     1 
ATOM   7255  C  CB    . ARG A 1  978  ? -36.304 10.595  -31.098 1.00 94.24  ? 978  ARG A CB    1 
ATOM   7256  C  CG    . ARG A 1  978  ? -35.571 11.072  -29.859 1.00 96.41  ? 978  ARG A CG    1 
ATOM   7257  C  CD    . ARG A 1  978  ? -34.578 12.166  -30.188 1.00 98.69  ? 978  ARG A CD    1 
ATOM   7258  N  NE    . ARG A 1  978  ? -33.650 12.388  -29.080 1.00 101.22 ? 978  ARG A NE    1 
ATOM   7259  C  CZ    . ARG A 1  978  ? -32.490 13.044  -29.165 1.00 103.40 ? 978  ARG A CZ    1 
ATOM   7260  N  NH1   . ARG A 1  978  ? -32.072 13.577  -30.315 1.00 103.95 ? 978  ARG A NH1   1 
ATOM   7261  N  NH2   . ARG A 1  978  ? -31.731 13.169  -28.079 1.00 104.91 ? 978  ARG A NH2   1 
ATOM   7262  N  N     . GLU A 1  979  ? -38.115 8.944   -33.071 1.00 89.81  ? 979  GLU A N     1 
ATOM   7263  C  CA    . GLU A 1  979  ? -39.197 8.898   -34.057 1.00 88.75  ? 979  GLU A CA    1 
ATOM   7264  C  C     . GLU A 1  979  ? -40.245 7.853   -33.677 1.00 86.94  ? 979  GLU A C     1 
ATOM   7265  O  O     . GLU A 1  979  ? -41.440 8.078   -33.872 1.00 87.74  ? 979  GLU A O     1 
ATOM   7266  C  CB    . GLU A 1  979  ? -38.665 8.634   -35.467 1.00 87.92  ? 979  GLU A CB    1 
ATOM   7267  C  CG    . GLU A 1  979  ? -39.711 8.872   -36.545 1.00 88.37  ? 979  GLU A CG    1 
ATOM   7268  C  CD    . GLU A 1  979  ? -39.152 8.761   -37.949 1.00 88.50  ? 979  GLU A CD    1 
ATOM   7269  O  OE1   . GLU A 1  979  ? -38.238 9.543   -38.284 1.00 90.10  ? 979  GLU A OE1   1 
ATOM   7270  O  OE2   . GLU A 1  979  ? -39.638 7.902   -38.718 1.00 86.98  ? 979  GLU A OE2   1 
ATOM   7271  N  N     . CYS A 1  980  ? -39.793 6.729   -33.122 1.00 84.88  ? 980  CYS A N     1 
ATOM   7272  C  CA    . CYS A 1  980  ? -40.698 5.683   -32.648 1.00 82.93  ? 980  CYS A CA    1 
ATOM   7273  C  C     . CYS A 1  980  ? -41.551 6.141   -31.456 1.00 82.74  ? 980  CYS A C     1 
ATOM   7274  O  O     . CYS A 1  980  ? -42.725 5.791   -31.381 1.00 82.16  ? 980  CYS A O     1 
ATOM   7275  C  CB    . CYS A 1  980  ? -39.928 4.408   -32.297 1.00 81.88  ? 980  CYS A CB    1 
ATOM   7276  S  SG    . CYS A 1  980  ? -40.984 2.957   -32.121 1.00 80.14  ? 980  CYS A SG    1 
ATOM   7277  N  N     . MET A 1  981  ? -40.970 6.917   -30.540 1.00 83.36  ? 981  MET A N     1 
ATOM   7278  C  CA    . MET A 1  981  ? -41.742 7.546   -29.450 1.00 84.36  ? 981  MET A CA    1 
ATOM   7279  C  C     . MET A 1  981  ? -42.789 8.532   -29.988 1.00 85.54  ? 981  MET A C     1 
ATOM   7280  O  O     . MET A 1  981  ? -43.916 8.577   -29.487 1.00 85.02  ? 981  MET A O     1 
ATOM   7281  C  CB    . MET A 1  981  ? -40.821 8.261   -28.447 1.00 85.13  ? 981  MET A CB    1 
ATOM   7282  C  CG    . MET A 1  981  ? -39.981 7.344   -27.564 1.00 84.49  ? 981  MET A CG    1 
ATOM   7283  S  SD    . MET A 1  981  ? -40.831 6.642   -26.131 1.00 83.87  ? 981  MET A SD    1 
ATOM   7284  C  CE    . MET A 1  981  ? -41.122 8.114   -25.147 1.00 86.31  ? 981  MET A CE    1 
ATOM   7285  N  N     . ALA A 1  982  ? -42.412 9.303   -31.013 1.00 87.35  ? 982  ALA A N     1 
ATOM   7286  C  CA    . ALA A 1  982  ? -43.282 10.332  -31.597 1.00 88.74  ? 982  ALA A CA    1 
ATOM   7287  C  C     . ALA A 1  982  ? -44.426 9.736   -32.413 1.00 88.51  ? 982  ALA A C     1 
ATOM   7288  O  O     . ALA A 1  982  ? -45.592 10.045  -32.151 1.00 88.62  ? 982  ALA A O     1 
ATOM   7289  C  CB    . ALA A 1  982  ? -42.469 11.294  -32.454 1.00 89.17  ? 982  ALA A CB    1 
ATOM   7290  N  N     . MET A 1  983  ? -44.096 8.881   -33.386 1.00 88.49  ? 983  MET A N     1 
ATOM   7291  C  CA    . MET A 1  983  ? -45.112 8.279   -34.263 1.00 88.40  ? 983  MET A CA    1 
ATOM   7292  C  C     . MET A 1  983  ? -46.098 7.400   -33.487 1.00 86.76  ? 983  MET A C     1 
ATOM   7293  O  O     . MET A 1  983  ? -47.292 7.399   -33.789 1.00 86.71  ? 983  MET A O     1 
ATOM   7294  C  CB    . MET A 1  983  ? -44.480 7.502   -35.440 1.00 89.59  ? 983  MET A CB    1 
ATOM   7295  C  CG    . MET A 1  983  ? -43.952 6.099   -35.137 1.00 90.54  ? 983  MET A CG    1 
ATOM   7296  S  SD    . MET A 1  983  ? -43.431 5.179   -36.604 1.00 92.95  ? 983  MET A SD    1 
ATOM   7297  C  CE    . MET A 1  983  ? -45.000 4.882   -37.407 1.00 91.39  ? 983  MET A CE    1 
ATOM   7298  N  N     . SER A 1  984  ? -45.600 6.674   -32.485 1.00 85.57  ? 984  SER A N     1 
ATOM   7299  C  CA    . SER A 1  984  ? -46.448 5.799   -31.664 1.00 84.90  ? 984  SER A CA    1 
ATOM   7300  C  C     . SER A 1  984  ? -47.271 6.530   -30.601 1.00 85.68  ? 984  SER A C     1 
ATOM   7301  O  O     . SER A 1  984  ? -48.173 5.932   -30.031 1.00 84.95  ? 984  SER A O     1 
ATOM   7302  C  CB    . SER A 1  984  ? -45.615 4.696   -30.993 1.00 84.03  ? 984  SER A CB    1 
ATOM   7303  O  OG    . SER A 1  984  ? -44.909 5.181   -29.863 1.00 85.12  ? 984  SER A OG    1 
ATOM   7304  N  N     . SER A 1  985  ? -46.961 7.803   -30.336 1.00 86.82  ? 985  SER A N     1 
ATOM   7305  C  CA    . SER A 1  985  ? -47.618 8.578   -29.282 1.00 88.86  ? 985  SER A CA    1 
ATOM   7306  C  C     . SER A 1  985  ? -47.531 7.816   -27.966 1.00 89.00  ? 985  SER A C     1 
ATOM   7307  O  O     . SER A 1  985  ? -48.541 7.552   -27.307 1.00 88.61  ? 985  SER A O     1 
ATOM   7308  C  CB    . SER A 1  985  ? -49.068 8.901   -29.655 1.00 89.37  ? 985  SER A CB    1 
ATOM   7309  O  OG    . SER A 1  985  ? -49.123 9.608   -30.879 1.00 89.78  ? 985  SER A OG    1 
ATOM   7310  N  N     . TYR A 1  986  ? -46.296 7.462   -27.615 1.00 89.14  ? 986  TYR A N     1 
ATOM   7311  C  CA    . TYR A 1  986  ? -46.003 6.583   -26.487 1.00 89.33  ? 986  TYR A CA    1 
ATOM   7312  C  C     . TYR A 1  986  ? -46.505 7.152   -25.154 1.00 90.97  ? 986  TYR A C     1 
ATOM   7313  O  O     . TYR A 1  986  ? -47.196 6.462   -24.400 1.00 90.33  ? 986  TYR A O     1 
ATOM   7314  C  CB    . TYR A 1  986  ? -44.490 6.300   -26.411 1.00 89.08  ? 986  TYR A CB    1 
ATOM   7315  C  CG    . TYR A 1  986  ? -44.117 5.327   -25.319 1.00 89.42  ? 986  TYR A CG    1 
ATOM   7316  C  CD1   . TYR A 1  986  ? -44.190 3.954   -25.535 1.00 88.30  ? 986  TYR A CD1   1 
ATOM   7317  C  CD2   . TYR A 1  986  ? -43.715 5.777   -24.061 1.00 91.22  ? 986  TYR A CD2   1 
ATOM   7318  C  CE1   . TYR A 1  986  ? -43.865 3.051   -24.535 1.00 88.75  ? 986  TYR A CE1   1 
ATOM   7319  C  CE2   . TYR A 1  986  ? -43.392 4.885   -23.053 1.00 91.88  ? 986  TYR A CE2   1 
ATOM   7320  C  CZ    . TYR A 1  986  ? -43.467 3.524   -23.296 1.00 90.93  ? 986  TYR A CZ    1 
ATOM   7321  O  OH    . TYR A 1  986  ? -43.152 2.637   -22.299 1.00 92.72  ? 986  TYR A OH    1 
ATOM   7322  N  N     . SER A 1  987  ? -46.160 8.410   -24.887 1.00 92.74  ? 987  SER A N     1 
ATOM   7323  C  CA    . SER A 1  987  ? -46.482 9.055   -23.612 1.00 94.63  ? 987  SER A CA    1 
ATOM   7324  C  C     . SER A 1  987  ? -47.988 9.184   -23.347 1.00 95.14  ? 987  SER A C     1 
ATOM   7325  O  O     . SER A 1  987  ? -48.419 9.072   -22.198 1.00 96.49  ? 987  SER A O     1 
ATOM   7326  C  CB    . SER A 1  987  ? -45.811 10.430  -23.530 1.00 96.03  ? 987  SER A CB    1 
ATOM   7327  O  OG    . SER A 1  987  ? -44.400 10.309  -23.618 1.00 95.83  ? 987  SER A OG    1 
ATOM   7328  N  N     . LEU A 1  988  ? -48.778 9.394   -24.400 1.00 94.55  ? 988  LEU A N     1 
ATOM   7329  C  CA    . LEU A 1  988  ? -50.238 9.527   -24.263 1.00 94.99  ? 988  LEU A CA    1 
ATOM   7330  C  C     . LEU A 1  988  ? -50.909 8.167   -24.024 1.00 93.40  ? 988  LEU A C     1 
ATOM   7331  O  O     . LEU A 1  988  ? -51.852 8.062   -23.236 1.00 94.14  ? 988  LEU A O     1 
ATOM   7332  C  CB    . LEU A 1  988  ? -50.857 10.212  -25.493 1.00 95.28  ? 988  LEU A CB    1 
ATOM   7333  C  CG    . LEU A 1  988  ? -50.474 11.680  -25.757 1.00 97.06  ? 988  LEU A CG    1 
ATOM   7334  C  CD1   . LEU A 1  988  ? -49.269 11.804  -26.692 1.00 97.01  ? 988  LEU A CD1   1 
ATOM   7335  C  CD2   . LEU A 1  988  ? -51.656 12.454  -26.327 1.00 97.38  ? 988  LEU A CD2   1 
ATOM   7336  N  N     . ARG A 1  989  ? -50.422 7.139   -24.715 1.00 90.75  ? 989  ARG A N     1 
ATOM   7337  C  CA    . ARG A 1  989  ? -50.919 5.771   -24.547 1.00 88.83  ? 989  ARG A CA    1 
ATOM   7338  C  C     . ARG A 1  989  ? -50.464 5.135   -23.233 1.00 88.24  ? 989  ARG A C     1 
ATOM   7339  O  O     . ARG A 1  989  ? -51.158 4.281   -22.690 1.00 86.72  ? 989  ARG A O     1 
ATOM   7340  C  CB    . ARG A 1  989  ? -50.472 4.896   -25.719 1.00 87.85  ? 989  ARG A CB    1 
ATOM   7341  C  CG    . ARG A 1  989  ? -51.059 5.317   -27.061 1.00 87.84  ? 989  ARG A CG    1 
ATOM   7342  C  CD    . ARG A 1  989  ? -50.259 4.750   -28.218 1.00 86.41  ? 989  ARG A CD    1 
ATOM   7343  N  NE    . ARG A 1  989  ? -50.349 3.296   -28.304 1.00 85.11  ? 989  ARG A NE    1 
ATOM   7344  C  CZ    . ARG A 1  989  ? -49.584 2.524   -29.078 1.00 84.49  ? 989  ARG A CZ    1 
ATOM   7345  N  NH1   . ARG A 1  989  ? -48.649 3.043   -29.875 1.00 85.25  ? 989  ARG A NH1   1 
ATOM   7346  N  NH2   . ARG A 1  989  ? -49.759 1.211   -29.060 1.00 83.60  ? 989  ARG A NH2   1 
ATOM   7347  N  N     . LYS A 1  990  ? -49.297 5.542   -22.737 1.00 89.40  ? 990  LYS A N     1 
ATOM   7348  C  CA    . LYS A 1  990  ? -48.791 5.083   -21.436 1.00 90.62  ? 990  LYS A CA    1 
ATOM   7349  C  C     . LYS A 1  990  ? -49.809 5.328   -20.310 1.00 91.69  ? 990  LYS A C     1 
ATOM   7350  O  O     . LYS A 1  990  ? -50.098 4.418   -19.525 1.00 91.77  ? 990  LYS A O     1 
ATOM   7351  C  CB    . LYS A 1  990  ? -47.451 5.770   -21.116 1.00 92.09  ? 990  LYS A CB    1 
ATOM   7352  C  CG    . LYS A 1  990  ? -46.777 5.361   -19.808 1.00 93.91  ? 990  LYS A CG    1 
ATOM   7353  C  CD    . LYS A 1  990  ? -46.425 3.882   -19.770 1.00 94.07  ? 990  LYS A CD    1 
ATOM   7354  C  CE    . LYS A 1  990  ? -45.599 3.537   -18.538 1.00 95.64  ? 990  LYS A CE    1 
ATOM   7355  N  NZ    . LYS A 1  990  ? -45.268 2.085   -18.482 1.00 94.87  ? 990  LYS A NZ    1 
ATOM   7356  N  N     . VAL A 1  991  ? -50.360 6.540   -20.249 1.00 92.11  ? 991  VAL A N     1 
ATOM   7357  C  CA    . VAL A 1  991  ? -51.348 6.886   -19.217 1.00 93.25  ? 991  VAL A CA    1 
ATOM   7358  C  C     . VAL A 1  991  ? -52.733 6.291   -19.517 1.00 92.06  ? 991  VAL A C     1 
ATOM   7359  O  O     . VAL A 1  991  ? -53.507 6.034   -18.593 1.00 92.56  ? 991  VAL A O     1 
ATOM   7360  C  CB    . VAL A 1  991  ? -51.433 8.417   -18.951 1.00 95.15  ? 991  VAL A CB    1 
ATOM   7361  C  CG1   . VAL A 1  991  ? -50.042 8.991   -18.705 1.00 95.60  ? 991  VAL A CG1   1 
ATOM   7362  C  CG2   . VAL A 1  991  ? -52.145 9.161   -20.078 1.00 94.93  ? 991  VAL A CG2   1 
ATOM   7363  N  N     . ALA A 1  992  ? -53.041 6.073   -20.797 1.00 90.53  ? 992  ALA A N     1 
ATOM   7364  C  CA    . ALA A 1  992  ? -54.250 5.333   -21.198 1.00 88.88  ? 992  ALA A CA    1 
ATOM   7365  C  C     . ALA A 1  992  ? -54.233 3.879   -20.708 1.00 87.60  ? 992  ALA A C     1 
ATOM   7366  O  O     . ALA A 1  992  ? -55.280 3.333   -20.348 1.00 87.59  ? 992  ALA A O     1 
ATOM   7367  C  CB    . ALA A 1  992  ? -54.427 5.376   -22.710 1.00 87.25  ? 992  ALA A CB    1 
ATOM   7368  N  N     . VAL A 1  993  ? -53.048 3.266   -20.698 1.00 86.16  ? 993  VAL A N     1 
ATOM   7369  C  CA    . VAL A 1  993  ? -52.866 1.906   -20.175 1.00 85.58  ? 993  VAL A CA    1 
ATOM   7370  C  C     . VAL A 1  993  ? -52.944 1.880   -18.639 1.00 86.56  ? 993  VAL A C     1 
ATOM   7371  O  O     . VAL A 1  993  ? -53.550 0.975   -18.069 1.00 86.09  ? 993  VAL A O     1 
ATOM   7372  C  CB    . VAL A 1  993  ? -51.535 1.277   -20.671 1.00 84.83  ? 993  VAL A CB    1 
ATOM   7373  C  CG1   . VAL A 1  993  ? -51.279 -0.083  -20.021 1.00 84.13  ? 993  VAL A CG1   1 
ATOM   7374  C  CG2   . VAL A 1  993  ? -51.533 1.142   -22.191 1.00 83.47  ? 993  VAL A CG2   1 
ATOM   7375  N  N     . GLU A 1  994  ? -52.333 2.859   -17.974 1.00 88.29  ? 994  GLU A N     1 
ATOM   7376  C  CA    . GLU A 1  994  ? -52.453 2.996   -16.513 1.00 89.81  ? 994  GLU A CA    1 
ATOM   7377  C  C     . GLU A 1  994  ? -53.893 3.297   -16.097 1.00 90.66  ? 994  GLU A C     1 
ATOM   7378  O  O     . GLU A 1  994  ? -54.355 2.808   -15.067 1.00 91.62  ? 994  GLU A O     1 
ATOM   7379  C  CB    . GLU A 1  994  ? -51.520 4.086   -15.983 1.00 91.40  ? 994  GLU A CB    1 
ATOM   7380  C  CG    . GLU A 1  994  ? -50.042 3.742   -16.095 1.00 91.66  ? 994  GLU A CG    1 
ATOM   7381  C  CD    . GLU A 1  994  ? -49.125 4.918   -15.789 1.00 93.70  ? 994  GLU A CD    1 
ATOM   7382  O  OE1   . GLU A 1  994  ? -49.518 5.815   -15.007 1.00 95.70  ? 994  GLU A OE1   1 
ATOM   7383  O  OE2   . GLU A 1  994  ? -47.999 4.941   -16.330 1.00 93.36  ? 994  GLU A OE2   1 
ATOM   7384  N  N     . LYS A 1  995  ? -54.584 4.107   -16.902 1.00 90.98  ? 995  LYS A N     1 
ATOM   7385  C  CA    . LYS A 1  995  ? -56.016 4.400   -16.726 1.00 91.47  ? 995  LYS A CA    1 
ATOM   7386  C  C     . LYS A 1  995  ? -56.869 3.133   -16.828 1.00 90.25  ? 995  LYS A C     1 
ATOM   7387  O  O     . LYS A 1  995  ? -57.738 2.890   -15.982 1.00 90.51  ? 995  LYS A O     1 
ATOM   7388  C  CB    . LYS A 1  995  ? -56.476 5.437   -17.766 1.00 91.75  ? 995  LYS A CB    1 
ATOM   7389  C  CG    . LYS A 1  995  ? -57.970 5.741   -17.778 1.00 92.82  ? 995  LYS A CG    1 
ATOM   7390  C  CD    . LYS A 1  995  ? -58.265 7.100   -18.401 1.00 93.79  ? 995  LYS A CD    1 
ATOM   7391  C  CE    . LYS A 1  995  ? -59.710 7.218   -18.862 1.00 93.81  ? 995  LYS A CE    1 
ATOM   7392  N  NZ    . LYS A 1  995  ? -60.706 6.947   -17.789 1.00 94.58  ? 995  LYS A NZ    1 
ATOM   7393  N  N     . PHE A 1  996  ? -56.610 2.337   -17.866 1.00 88.09  ? 996  PHE A N     1 
ATOM   7394  C  CA    . PHE A 1  996  ? -57.298 1.062   -18.068 1.00 86.51  ? 996  PHE A CA    1 
ATOM   7395  C  C     . PHE A 1  996  ? -57.056 0.112   -16.891 1.00 87.15  ? 996  PHE A C     1 
ATOM   7396  O  O     . PHE A 1  996  ? -58.008 -0.465  -16.359 1.00 88.13  ? 996  PHE A O     1 
ATOM   7397  C  CB    . PHE A 1  996  ? -56.862 0.407   -19.394 1.00 84.41  ? 996  PHE A CB    1 
ATOM   7398  C  CG    . PHE A 1  996  ? -57.668 -0.813  -19.771 1.00 82.63  ? 996  PHE A CG    1 
ATOM   7399  C  CD1   . PHE A 1  996  ? -58.834 -0.690  -20.519 1.00 81.88  ? 996  PHE A CD1   1 
ATOM   7400  C  CD2   . PHE A 1  996  ? -57.262 -2.087  -19.373 1.00 81.57  ? 996  PHE A CD2   1 
ATOM   7401  C  CE1   . PHE A 1  996  ? -59.582 -1.808  -20.860 1.00 80.81  ? 996  PHE A CE1   1 
ATOM   7402  C  CE2   . PHE A 1  996  ? -58.005 -3.209  -19.709 1.00 80.37  ? 996  PHE A CE2   1 
ATOM   7403  C  CZ    . PHE A 1  996  ? -59.168 -3.068  -20.451 1.00 80.33  ? 996  PHE A CZ    1 
ATOM   7404  N  N     . ASN A 1  997  ? -55.797 -0.018  -16.472 1.00 87.12  ? 997  ASN A N     1 
ATOM   7405  C  CA    . ASN A 1  997  ? -55.415 -0.979  -15.421 1.00 87.06  ? 997  ASN A CA    1 
ATOM   7406  C  C     . ASN A 1  997  ? -55.980 -0.661  -14.043 1.00 88.23  ? 997  ASN A C     1 
ATOM   7407  O  O     . ASN A 1  997  ? -56.273 -1.571  -13.270 1.00 88.87  ? 997  ASN A O     1 
ATOM   7408  C  CB    . ASN A 1  997  ? -53.890 -1.122  -15.339 1.00 86.49  ? 997  ASN A CB    1 
ATOM   7409  C  CG    . ASN A 1  997  ? -53.295 -1.802  -16.568 1.00 84.27  ? 997  ASN A CG    1 
ATOM   7410  O  OD1   . ASN A 1  997  ? -53.988 -2.504  -17.309 1.00 81.62  ? 997  ASN A OD1   1 
ATOM   7411  N  ND2   . ASN A 1  997  ? -52.002 -1.592  -16.788 1.00 84.18  ? 997  ASN A ND2   1 
ATOM   7412  N  N     . ALA A 1  998  ? -56.126 0.623   -13.745 1.00 89.70  ? 998  ALA A N     1 
ATOM   7413  C  CA    . ALA A 1  998  ? -56.771 1.066   -12.513 1.00 90.85  ? 998  ALA A CA    1 
ATOM   7414  C  C     . ALA A 1  998  ? -58.290 0.853   -12.561 1.00 91.52  ? 998  ALA A C     1 
ATOM   7415  O  O     . ALA A 1  998  ? -58.937 0.734   -11.513 1.00 93.47  ? 998  ALA A O     1 
ATOM   7416  C  CB    . ALA A 1  998  ? -56.448 2.527   -12.262 1.00 91.75  ? 998  ALA A CB    1 
ATOM   7417  N  N     . GLU A 1  999  ? -58.854 0.826   -13.772 1.00 90.05  ? 999  GLU A N     1 
ATOM   7418  C  CA    . GLU A 1  999  ? -60.293 0.630   -13.979 1.00 89.65  ? 999  GLU A CA    1 
ATOM   7419  C  C     . GLU A 1  999  ? -60.708 -0.819  -14.261 1.00 87.40  ? 999  GLU A C     1 
ATOM   7420  O  O     . GLU A 1  999  ? -61.895 -1.125  -14.220 1.00 87.73  ? 999  GLU A O     1 
ATOM   7421  C  CB    . GLU A 1  999  ? -60.780 1.537   -15.118 1.00 89.92  ? 999  GLU A CB    1 
ATOM   7422  C  CG    . GLU A 1  999  ? -60.785 3.018   -14.758 1.00 91.59  ? 999  GLU A CG    1 
ATOM   7423  C  CD    . GLU A 1  999  ? -61.115 3.933   -15.930 1.00 91.31  ? 999  GLU A CD    1 
ATOM   7424  O  OE1   . GLU A 1  999  ? -61.304 3.443   -17.067 1.00 89.51  ? 999  GLU A OE1   1 
ATOM   7425  O  OE2   . GLU A 1  999  ? -61.181 5.162   -15.711 1.00 92.05  ? 999  GLU A OE2   1 
ATOM   7426  N  N     . ASN A 1  1000 ? -59.754 -1.705  -14.543 1.00 85.40  ? 1000 ASN A N     1 
ATOM   7427  C  CA    . ASN A 1  1000 ? -60.061 -3.091  -14.910 1.00 83.69  ? 1000 ASN A CA    1 
ATOM   7428  C  C     . ASN A 1  1000 ? -59.205 -4.084  -14.121 1.00 82.76  ? 1000 ASN A C     1 
ATOM   7429  O  O     . ASN A 1  1000 ? -57.985 -3.941  -14.065 1.00 81.85  ? 1000 ASN A O     1 
ATOM   7430  C  CB    . ASN A 1  1000 ? -59.878 -3.281  -16.419 1.00 82.29  ? 1000 ASN A CB    1 
ATOM   7431  C  CG    . ASN A 1  1000 ? -60.884 -2.473  -17.235 1.00 82.72  ? 1000 ASN A CG    1 
ATOM   7432  O  OD1   . ASN A 1  1000 ? -62.051 -2.839  -17.330 1.00 83.10  ? 1000 ASN A OD1   1 
ATOM   7433  N  ND2   . ASN A 1  1000 ? -60.436 -1.365  -17.817 1.00 82.77  ? 1000 ASN A ND2   1 
ATOM   7434  N  N     . TYR A 1  1001 ? -59.860 -5.077  -13.516 1.00 82.58  ? 1001 TYR A N     1 
ATOM   7435  C  CA    . TYR A 1  1001 ? -59.219 -6.037  -12.603 1.00 82.45  ? 1001 TYR A CA    1 
ATOM   7436  C  C     . TYR A 1  1001 ? -58.863 -7.366  -13.260 1.00 80.90  ? 1001 TYR A C     1 
ATOM   7437  O  O     . TYR A 1  1001 ? -57.809 -7.928  -12.969 1.00 81.06  ? 1001 TYR A O     1 
ATOM   7438  C  CB    . TYR A 1  1001 ? -60.134 -6.311  -11.408 1.00 83.29  ? 1001 TYR A CB    1 
ATOM   7439  C  CG    . TYR A 1  1001 ? -59.435 -6.912  -10.204 1.00 83.64  ? 1001 TYR A CG    1 
ATOM   7440  C  CD1   . TYR A 1  1001 ? -59.272 -8.292  -10.075 1.00 82.77  ? 1001 TYR A CD1   1 
ATOM   7441  C  CD2   . TYR A 1  1001 ? -58.949 -6.097  -9.182  1.00 85.22  ? 1001 TYR A CD2   1 
ATOM   7442  C  CE1   . TYR A 1  1001 ? -58.638 -8.840  -8.967  1.00 83.38  ? 1001 TYR A CE1   1 
ATOM   7443  C  CE2   . TYR A 1  1001 ? -58.313 -6.633  -8.070  1.00 85.66  ? 1001 TYR A CE2   1 
ATOM   7444  C  CZ    . TYR A 1  1001 ? -58.161 -8.002  -7.964  1.00 84.78  ? 1001 TYR A CZ    1 
ATOM   7445  O  OH    . TYR A 1  1001 ? -57.538 -8.521  -6.858  1.00 84.96  ? 1001 TYR A OH    1 
ATOM   7446  N  N     . TRP A 1  1002 ? -59.756 -7.875  -14.109 1.00 80.18  ? 1002 TRP A N     1 
ATOM   7447  C  CA    . TRP A 1  1002 ? -59.571 -9.169  -14.785 1.00 79.23  ? 1002 TRP A CA    1 
ATOM   7448  C  C     . TRP A 1  1002 ? -59.043 -9.076  -16.230 1.00 78.27  ? 1002 TRP A C     1 
ATOM   7449  O  O     . TRP A 1  1002 ? -58.817 -10.108 -16.873 1.00 77.00  ? 1002 TRP A O     1 
ATOM   7450  C  CB    . TRP A 1  1002 ? -60.887 -9.941  -14.768 1.00 79.01  ? 1002 TRP A CB    1 
ATOM   7451  C  CG    . TRP A 1  1002 ? -61.400 -10.189 -13.392 1.00 80.03  ? 1002 TRP A CG    1 
ATOM   7452  C  CD1   . TRP A 1  1002 ? -62.565 -9.727  -12.859 1.00 80.95  ? 1002 TRP A CD1   1 
ATOM   7453  C  CD2   . TRP A 1  1002 ? -60.760 -10.953 -12.362 1.00 80.53  ? 1002 TRP A CD2   1 
ATOM   7454  N  NE1   . TRP A 1  1002 ? -62.698 -10.162 -11.565 1.00 82.00  ? 1002 TRP A NE1   1 
ATOM   7455  C  CE2   . TRP A 1  1002 ? -61.606 -10.917 -11.233 1.00 81.73  ? 1002 TRP A CE2   1 
ATOM   7456  C  CE3   . TRP A 1  1002 ? -59.559 -11.672 -12.285 1.00 80.02  ? 1002 TRP A CE3   1 
ATOM   7457  C  CZ2   . TRP A 1  1002 ? -61.290 -11.572 -10.035 1.00 82.54  ? 1002 TRP A CZ2   1 
ATOM   7458  C  CZ3   . TRP A 1  1002 ? -59.245 -12.325 -11.090 1.00 80.82  ? 1002 TRP A CZ3   1 
ATOM   7459  C  CH2   . TRP A 1  1002 ? -60.110 -12.268 -9.984  1.00 81.91  ? 1002 TRP A CH2   1 
ATOM   7460  N  N     . LYS A 1  1003 ? -58.883 -7.849  -16.731 1.00 79.44  ? 1003 LYS A N     1 
ATOM   7461  C  CA    . LYS A 1  1003 ? -58.197 -7.561  -17.994 1.00 79.18  ? 1003 LYS A CA    1 
ATOM   7462  C  C     . LYS A 1  1003 ? -57.196 -6.426  -17.761 1.00 79.86  ? 1003 LYS A C     1 
ATOM   7463  O  O     . LYS A 1  1003 ? -57.526 -5.431  -17.118 1.00 81.34  ? 1003 LYS A O     1 
ATOM   7464  C  CB    . LYS A 1  1003 ? -59.194 -7.110  -19.062 1.00 79.49  ? 1003 LYS A CB    1 
ATOM   7465  C  CG    . LYS A 1  1003 ? -60.177 -8.170  -19.522 1.00 79.70  ? 1003 LYS A CG    1 
ATOM   7466  C  CD    . LYS A 1  1003 ? -59.559 -9.118  -20.530 1.00 79.02  ? 1003 LYS A CD    1 
ATOM   7467  C  CE    . LYS A 1  1003 ? -60.602 -10.037 -21.147 1.00 79.24  ? 1003 LYS A CE    1 
ATOM   7468  N  NZ    . LYS A 1  1003 ? -61.401 -10.770 -20.128 1.00 80.95  ? 1003 LYS A NZ    1 
ATOM   7469  N  N     . LYS A 1  1004 ? -55.982 -6.581  -18.285 1.00 79.39  ? 1004 LYS A N     1 
ATOM   7470  C  CA    . LYS A 1  1004 ? -54.949 -5.548  -18.195 1.00 79.31  ? 1004 LYS A CA    1 
ATOM   7471  C  C     . LYS A 1  1004 ? -54.333 -5.290  -19.558 1.00 77.57  ? 1004 LYS A C     1 
ATOM   7472  O  O     . LYS A 1  1004 ? -54.280 -6.184  -20.402 1.00 76.56  ? 1004 LYS A O     1 
ATOM   7473  C  CB    . LYS A 1  1004 ? -53.843 -5.976  -17.228 1.00 79.84  ? 1004 LYS A CB    1 
ATOM   7474  C  CG    . LYS A 1  1004 ? -54.306 -6.266  -15.811 1.00 81.30  ? 1004 LYS A CG    1 
ATOM   7475  C  CD    . LYS A 1  1004 ? -54.764 -5.020  -15.073 1.00 82.61  ? 1004 LYS A CD    1 
ATOM   7476  C  CE    . LYS A 1  1004 ? -55.304 -5.381  -13.697 1.00 83.95  ? 1004 LYS A CE    1 
ATOM   7477  N  NZ    . LYS A 1  1004 ? -55.594 -4.191  -12.854 1.00 85.24  ? 1004 LYS A NZ    1 
ATOM   7478  N  N     . LYS A 1  1005 ? -53.871 -4.062  -19.765 1.00 77.26  ? 1005 LYS A N     1 
ATOM   7479  C  CA    . LYS A 1  1005 ? -53.080 -3.718  -20.935 1.00 75.98  ? 1005 LYS A CA    1 
ATOM   7480  C  C     . LYS A 1  1005 ? -51.652 -3.448  -20.518 1.00 76.29  ? 1005 LYS A C     1 
ATOM   7481  O  O     . LYS A 1  1005 ? -51.385 -3.116  -19.364 1.00 77.98  ? 1005 LYS A O     1 
ATOM   7482  C  CB    . LYS A 1  1005 ? -53.661 -2.500  -21.637 1.00 76.35  ? 1005 LYS A CB    1 
ATOM   7483  C  CG    . LYS A 1  1005 ? -55.020 -2.766  -22.248 1.00 76.17  ? 1005 LYS A CG    1 
ATOM   7484  C  CD    . LYS A 1  1005 ? -55.507 -1.575  -23.047 1.00 76.61  ? 1005 LYS A CD    1 
ATOM   7485  C  CE    . LYS A 1  1005 ? -56.888 -1.829  -23.621 1.00 76.25  ? 1005 LYS A CE    1 
ATOM   7486  N  NZ    . LYS A 1  1005 ? -57.239 -0.801  -24.634 1.00 76.55  ? 1005 LYS A NZ    1 
ATOM   7487  N  N     . GLY A 1  1006 ? -50.737 -3.608  -21.464 1.00 75.04  ? 1006 GLY A N     1 
ATOM   7488  C  CA    . GLY A 1  1006 ? -49.327 -3.320  -21.236 1.00 75.90  ? 1006 GLY A CA    1 
ATOM   7489  C  C     . GLY A 1  1006 ? -48.691 -2.700  -22.464 1.00 75.96  ? 1006 GLY A C     1 
ATOM   7490  O  O     . GLY A 1  1006 ? -49.197 -2.851  -23.584 1.00 74.66  ? 1006 GLY A O     1 
ATOM   7491  N  N     . LEU A 1  1007 ? -47.583 -1.997  -22.243 1.00 76.73  ? 1007 LEU A N     1 
ATOM   7492  C  CA    . LEU A 1  1007 ? -46.898 -1.260  -23.297 1.00 76.59  ? 1007 LEU A CA    1 
ATOM   7493  C  C     . LEU A 1  1007 ? -45.395 -1.281  -23.058 1.00 76.99  ? 1007 LEU A C     1 
ATOM   7494  O  O     . LEU A 1  1007 ? -44.936 -1.118  -21.925 1.00 77.74  ? 1007 LEU A O     1 
ATOM   7495  C  CB    . LEU A 1  1007 ? -47.399 0.181   -23.330 1.00 77.89  ? 1007 LEU A CB    1 
ATOM   7496  C  CG    . LEU A 1  1007 ? -46.979 1.050   -24.518 1.00 77.85  ? 1007 LEU A CG    1 
ATOM   7497  C  CD1   . LEU A 1  1007 ? -47.772 0.695   -25.765 1.00 76.55  ? 1007 LEU A CD1   1 
ATOM   7498  C  CD2   . LEU A 1  1007 ? -47.168 2.519   -24.173 1.00 79.61  ? 1007 LEU A CD2   1 
ATOM   7499  N  N     . ALA A 1  1008 ? -44.638 -1.486  -24.131 1.00 76.32  ? 1008 ALA A N     1 
ATOM   7500  C  CA    . ALA A 1  1008 ? -43.185 -1.545  -24.050 1.00 77.20  ? 1008 ALA A CA    1 
ATOM   7501  C  C     . ALA A 1  1008 ? -42.550 -1.028  -25.328 1.00 77.64  ? 1008 ALA A C     1 
ATOM   7502  O  O     . ALA A 1  1008 ? -43.111 -1.202  -26.414 1.00 77.31  ? 1008 ALA A O     1 
ATOM   7503  C  CB    . ALA A 1  1008 ? -42.732 -2.972  -23.781 1.00 76.17  ? 1008 ALA A CB    1 
ATOM   7504  N  N     . MET A 1  1009 ? -41.390 -0.385  -25.188 1.00 79.57  ? 1009 MET A N     1 
ATOM   7505  C  CA    . MET A 1  1009 ? -40.545 -0.026  -26.327 1.00 80.32  ? 1009 MET A CA    1 
ATOM   7506  C  C     . MET A 1  1009 ? -39.144 -0.603  -26.151 1.00 80.46  ? 1009 MET A C     1 
ATOM   7507  O  O     . MET A 1  1009 ? -38.597 -0.627  -25.043 1.00 81.01  ? 1009 MET A O     1 
ATOM   7508  C  CB    . MET A 1  1009 ? -40.459 1.486   -26.527 1.00 82.34  ? 1009 MET A CB    1 
ATOM   7509  C  CG    . MET A 1  1009 ? -39.860 1.861   -27.879 1.00 82.26  ? 1009 MET A CG    1 
ATOM   7510  S  SD    . MET A 1  1009 ? -39.769 3.629   -28.170 1.00 84.69  ? 1009 MET A SD    1 
ATOM   7511  C  CE    . MET A 1  1009 ? -41.490 3.969   -28.514 1.00 84.88  ? 1009 MET A CE    1 
ATOM   7512  N  N     . VAL A 1  1010 ? -38.575 -1.044  -27.272 1.00 79.76  ? 1010 VAL A N     1 
ATOM   7513  C  CA    . VAL A 1  1010 ? -37.306 -1.759  -27.311 1.00 79.15  ? 1010 VAL A CA    1 
ATOM   7514  C  C     . VAL A 1  1010 ? -36.480 -1.209  -28.483 1.00 78.37  ? 1010 VAL A C     1 
ATOM   7515  O  O     . VAL A 1  1010 ? -37.034 -1.022  -29.565 1.00 78.07  ? 1010 VAL A O     1 
ATOM   7516  C  CB    . VAL A 1  1010 ? -37.572 -3.260  -27.511 1.00 78.28  ? 1010 VAL A CB    1 
ATOM   7517  C  CG1   . VAL A 1  1010 ? -36.278 -4.017  -27.739 1.00 78.97  ? 1010 VAL A CG1   1 
ATOM   7518  C  CG2   . VAL A 1  1010 ? -38.324 -3.831  -26.315 1.00 78.60  ? 1010 VAL A CG2   1 
ATOM   7519  N  N     . PRO A 1  1011 ? -35.168 -0.943  -28.277 1.00 78.43  ? 1011 PRO A N     1 
ATOM   7520  C  CA    . PRO A 1  1011 ? -34.289 -0.474  -29.355 1.00 78.07  ? 1011 PRO A CA    1 
ATOM   7521  C  C     . PRO A 1  1011 ? -33.524 -1.613  -30.023 1.00 76.70  ? 1011 PRO A C     1 
ATOM   7522  O  O     . PRO A 1  1011 ? -33.350 -2.671  -29.427 1.00 75.80  ? 1011 PRO A O     1 
ATOM   7523  C  CB    . PRO A 1  1011 ? -33.312 0.431   -28.617 1.00 79.32  ? 1011 PRO A CB    1 
ATOM   7524  C  CG    . PRO A 1  1011 ? -33.144 -0.253  -27.302 1.00 80.13  ? 1011 PRO A CG    1 
ATOM   7525  C  CD    . PRO A 1  1011 ? -34.452 -0.934  -26.988 1.00 79.63  ? 1011 PRO A CD    1 
ATOM   7526  N  N     . LEU A 1  1012 ? -33.039 -1.367  -31.235 1.00 76.54  ? 1012 LEU A N     1 
ATOM   7527  C  CA    . LEU A 1  1012 ? -32.350 -2.377  -32.032 1.00 75.82  ? 1012 LEU A CA    1 
ATOM   7528  C  C     . LEU A 1  1012 ? -30.992 -1.870  -32.486 1.00 76.76  ? 1012 LEU A C     1 
ATOM   7529  O  O     . LEU A 1  1012 ? -30.891 -0.772  -33.028 1.00 77.66  ? 1012 LEU A O     1 
ATOM   7530  C  CB    . LEU A 1  1012 ? -33.188 -2.726  -33.262 1.00 74.38  ? 1012 LEU A CB    1 
ATOM   7531  C  CG    . LEU A 1  1012 ? -32.596 -3.670  -34.311 1.00 73.41  ? 1012 LEU A CG    1 
ATOM   7532  C  CD1   . LEU A 1  1012 ? -32.283 -5.019  -33.685 1.00 72.95  ? 1012 LEU A CD1   1 
ATOM   7533  C  CD2   . LEU A 1  1012 ? -33.557 -3.829  -35.479 1.00 72.43  ? 1012 LEU A CD2   1 
ATOM   7534  N  N     . LYS A 1  1013 ? -29.959 -2.669  -32.229 1.00 76.93  ? 1013 LYS A N     1 
ATOM   7535  C  CA    . LYS A 1  1013 ? -28.695 -2.600  -32.956 1.00 77.09  ? 1013 LYS A CA    1 
ATOM   7536  C  C     . LYS A 1  1013 ? -28.382 -4.022  -33.392 1.00 74.85  ? 1013 LYS A C     1 
ATOM   7537  O  O     . LYS A 1  1013 ? -28.076 -4.874  -32.552 1.00 74.53  ? 1013 LYS A O     1 
ATOM   7538  C  CB    . LYS A 1  1013 ? -27.558 -2.057  -32.082 1.00 79.95  ? 1013 LYS A CB    1 
ATOM   7539  C  CG    . LYS A 1  1013 ? -26.199 -2.005  -32.783 1.00 81.32  ? 1013 LYS A CG    1 
ATOM   7540  C  CD    . LYS A 1  1013 ? -25.091 -1.463  -31.888 1.00 83.66  ? 1013 LYS A CD    1 
ATOM   7541  C  CE    . LYS A 1  1013 ? -24.501 -2.538  -30.981 1.00 84.28  ? 1013 LYS A CE    1 
ATOM   7542  N  NZ    . LYS A 1  1013 ? -23.405 -3.342  -31.591 1.00 84.66  ? 1013 LYS A NZ    1 
ATOM   7543  N  N     . PHE A 1  1014 ? -28.488 -4.275  -34.696 1.00 73.31  ? 1014 PHE A N     1 
ATOM   7544  C  CA    . PHE A 1  1014 ? -28.124 -5.564  -35.277 1.00 71.74  ? 1014 PHE A CA    1 
ATOM   7545  C  C     . PHE A 1  1014 ? -26.889 -5.388  -36.158 1.00 71.06  ? 1014 PHE A C     1 
ATOM   7546  O  O     . PHE A 1  1014 ? -27.003 -4.947  -37.305 1.00 69.84  ? 1014 PHE A O     1 
ATOM   7547  C  CB    . PHE A 1  1014 ? -29.278 -6.157  -36.080 1.00 70.66  ? 1014 PHE A CB    1 
ATOM   7548  C  CG    . PHE A 1  1014 ? -29.027 -7.564  -36.520 1.00 69.98  ? 1014 PHE A CG    1 
ATOM   7549  C  CD1   . PHE A 1  1014 ? -29.204 -8.614  -35.632 1.00 70.32  ? 1014 PHE A CD1   1 
ATOM   7550  C  CD2   . PHE A 1  1014 ? -28.585 -7.840  -37.807 1.00 69.78  ? 1014 PHE A CD2   1 
ATOM   7551  C  CE1   . PHE A 1  1014 ? -28.961 -9.923  -36.020 1.00 70.00  ? 1014 PHE A CE1   1 
ATOM   7552  C  CE2   . PHE A 1  1014 ? -28.339 -9.145  -38.206 1.00 69.33  ? 1014 PHE A CE2   1 
ATOM   7553  C  CZ    . PHE A 1  1014 ? -28.529 -10.190 -37.311 1.00 69.57  ? 1014 PHE A CZ    1 
ATOM   7554  N  N     . PRO A 1  1015 ? -25.699 -5.697  -35.613 1.00 71.76  ? 1015 PRO A N     1 
ATOM   7555  C  CA    . PRO A 1  1015 ? -24.488 -5.645  -36.432 1.00 71.94  ? 1015 PRO A CA    1 
ATOM   7556  C  C     . PRO A 1  1015 ? -24.475 -6.726  -37.496 1.00 70.42  ? 1015 PRO A C     1 
ATOM   7557  O  O     . PRO A 1  1015 ? -24.871 -7.859  -37.225 1.00 69.49  ? 1015 PRO A O     1 
ATOM   7558  C  CB    . PRO A 1  1015 ? -23.346 -5.888  -35.442 1.00 73.22  ? 1015 PRO A CB    1 
ATOM   7559  C  CG    . PRO A 1  1015 ? -23.948 -6.147  -34.120 1.00 73.60  ? 1015 PRO A CG    1 
ATOM   7560  C  CD    . PRO A 1  1015 ? -25.415 -5.902  -34.180 1.00 72.97  ? 1015 PRO A CD    1 
ATOM   7561  N  N     . VAL A 1  1016 ? -24.009 -6.366  -38.687 1.00 70.58  ? 1016 VAL A N     1 
ATOM   7562  C  CA    . VAL A 1  1016 ? -23.915 -7.285  -39.808 1.00 69.69  ? 1016 VAL A CA    1 
ATOM   7563  C  C     . VAL A 1  1016 ? -22.447 -7.447  -40.173 1.00 71.19  ? 1016 VAL A C     1 
ATOM   7564  O  O     . VAL A 1  1016 ? -21.699 -6.474  -40.252 1.00 71.38  ? 1016 VAL A O     1 
ATOM   7565  C  CB    . VAL A 1  1016 ? -24.702 -6.764  -41.025 1.00 68.87  ? 1016 VAL A CB    1 
ATOM   7566  C  CG1   . VAL A 1  1016 ? -24.601 -7.742  -42.190 1.00 67.57  ? 1016 VAL A CG1   1 
ATOM   7567  C  CG2   . VAL A 1  1016 ? -26.157 -6.515  -40.646 1.00 68.41  ? 1016 VAL A CG2   1 
ATOM   7568  N  N     . GLY A 1  1017 ? -22.047 -8.690  -40.402 1.00 72.52  ? 1017 GLY A N     1 
ATOM   7569  C  CA    . GLY A 1  1017 ? -20.663 -9.010  -40.715 1.00 74.78  ? 1017 GLY A CA    1 
ATOM   7570  C  C     . GLY A 1  1017 ? -20.331 -10.427 -40.300 1.00 75.54  ? 1017 GLY A C     1 
ATOM   7571  O  O     . GLY A 1  1017 ? -20.776 -10.895 -39.246 1.00 76.38  ? 1017 GLY A O     1 
ATOM   7572  N  N     . LEU A 1  1018 ? -19.543 -11.097 -41.133 1.00 75.93  ? 1018 LEU A N     1 
ATOM   7573  C  CA    . LEU A 1  1018 ? -19.158 -12.486 -40.916 1.00 76.33  ? 1018 LEU A CA    1 
ATOM   7574  C  C     . LEU A 1  1018 ? -17.819 -12.510 -40.162 1.00 79.13  ? 1018 LEU A C     1 
ATOM   7575  O  O     . LEU A 1  1018 ? -17.326 -11.460 -39.728 1.00 81.42  ? 1018 LEU A O     1 
ATOM   7576  C  CB    . LEU A 1  1018 ? -19.078 -13.202 -42.268 1.00 75.44  ? 1018 LEU A CB    1 
ATOM   7577  C  CG    . LEU A 1  1018 ? -20.335 -13.062 -43.157 1.00 74.43  ? 1018 LEU A CG    1 
ATOM   7578  C  CD1   . LEU A 1  1018 ? -19.979 -13.040 -44.635 1.00 73.70  ? 1018 LEU A CD1   1 
ATOM   7579  C  CD2   . LEU A 1  1018 ? -21.364 -14.154 -42.872 1.00 73.51  ? 1018 LEU A CD2   1 
ATOM   7580  N  N     . GLY A 1  1019 ? -17.239 -13.694 -39.983 1.00 79.22  ? 1019 GLY A N     1 
ATOM   7581  C  CA    . GLY A 1  1019 ? -15.970 -13.825 -39.260 1.00 81.36  ? 1019 GLY A CA    1 
ATOM   7582  C  C     . GLY A 1  1019 ? -14.752 -13.245 -39.966 1.00 82.18  ? 1019 GLY A C     1 
ATOM   7583  O  O     . GLY A 1  1019 ? -13.899 -12.616 -39.329 1.00 81.79  ? 1019 GLY A O     1 
ATOM   7584  N  N     . SER A 1  1020 ? -14.677 -13.460 -41.279 1.00 81.52  ? 1020 SER A N     1 
ATOM   7585  C  CA    . SER A 1  1020 ? -13.494 -13.127 -42.072 1.00 81.27  ? 1020 SER A CA    1 
ATOM   7586  C  C     . SER A 1  1020 ? -13.863 -12.599 -43.455 1.00 79.75  ? 1020 SER A C     1 
ATOM   7587  O  O     . SER A 1  1020 ? -15.025 -12.652 -43.865 1.00 77.67  ? 1020 SER A O     1 
ATOM   7588  C  CB    . SER A 1  1020 ? -12.611 -14.372 -42.207 1.00 81.39  ? 1020 SER A CB    1 
ATOM   7589  O  OG    . SER A 1  1020 ? -13.378 -15.494 -42.619 1.00 80.04  ? 1020 SER A OG    1 
ATOM   7590  N  N     . ARG A 1  1021 ? -12.856 -12.094 -44.162 1.00 80.06  ? 1021 ARG A N     1 
ATOM   7591  C  CA    . ARG A 1  1021 ? -13.029 -11.583 -45.523 1.00 80.02  ? 1021 ARG A CA    1 
ATOM   7592  C  C     . ARG A 1  1021 ? -13.394 -12.678 -46.528 1.00 77.34  ? 1021 ARG A C     1 
ATOM   7593  O  O     . ARG A 1  1021 ? -14.173 -12.433 -47.448 1.00 77.18  ? 1021 ARG A O     1 
ATOM   7594  C  CB    . ARG A 1  1021 ? -11.763 -10.862 -45.993 1.00 82.57  ? 1021 ARG A CB    1 
ATOM   7595  C  CG    . ARG A 1  1021 ? -11.975 -9.953  -47.190 1.00 84.56  ? 1021 ARG A CG    1 
ATOM   7596  C  CD    . ARG A 1  1021 ? -10.648 -9.482  -47.752 1.00 88.37  ? 1021 ARG A CD    1 
ATOM   7597  N  NE    . ARG A 1  1021 ? -10.819 -8.459  -48.786 1.00 91.17  ? 1021 ARG A NE    1 
ATOM   7598  C  CZ    . ARG A 1  1021 ? -9.834  -7.948  -49.530 1.00 93.65  ? 1021 ARG A CZ    1 
ATOM   7599  N  NH1   . ARG A 1  1021 ? -8.569  -8.352  -49.376 1.00 94.14  ? 1021 ARG A NH1   1 
ATOM   7600  N  NH2   . ARG A 1  1021 ? -10.117 -7.018  -50.443 1.00 94.06  ? 1021 ARG A NH2   1 
ATOM   7601  N  N     . ALA A 1  1022 ? -12.821 -13.869 -46.357 1.00 75.15  ? 1022 ALA A N     1 
ATOM   7602  C  CA    . ALA A 1  1022 ? -13.082 -15.001 -47.250 1.00 73.02  ? 1022 ALA A CA    1 
ATOM   7603  C  C     . ALA A 1  1022 ? -14.535 -15.491 -47.171 1.00 71.14  ? 1022 ALA A C     1 
ATOM   7604  O  O     . ALA A 1  1022 ? -15.118 -15.880 -48.185 1.00 69.67  ? 1022 ALA A O     1 
ATOM   7605  C  CB    . ALA A 1  1022 ? -12.124 -16.144 -46.948 1.00 73.17  ? 1022 ALA A CB    1 
ATOM   7606  N  N     . ALA A 1  1023 ? -15.112 -15.460 -45.972 1.00 70.34  ? 1023 ALA A N     1 
ATOM   7607  C  CA    . ALA A 1  1023 ? -16.514 -15.828 -45.771 1.00 69.09  ? 1023 ALA A CA    1 
ATOM   7608  C  C     . ALA A 1  1023 ? -17.501 -14.904 -46.501 1.00 68.09  ? 1023 ALA A C     1 
ATOM   7609  O  O     . ALA A 1  1023 ? -18.601 -15.333 -46.868 1.00 67.07  ? 1023 ALA A O     1 
ATOM   7610  C  CB    . ALA A 1  1023 ? -16.831 -15.864 -44.283 1.00 70.12  ? 1023 ALA A CB    1 
ATOM   7611  N  N     . GLY A 1  1024 ? -17.111 -13.642 -46.696 1.00 68.43  ? 1024 GLY A N     1 
ATOM   7612  C  CA    . GLY A 1  1024 ? -17.936 -12.651 -47.389 1.00 67.88  ? 1024 GLY A CA    1 
ATOM   7613  C  C     . GLY A 1  1024 ? -17.661 -12.459 -48.873 1.00 67.21  ? 1024 GLY A C     1 
ATOM   7614  O  O     . GLY A 1  1024 ? -18.249 -11.565 -49.485 1.00 67.77  ? 1024 GLY A O     1 
ATOM   7615  N  N     . GLN A 1  1025 ? -16.786 -13.277 -49.464 1.00 66.09  ? 1025 GLN A N     1 
ATOM   7616  C  CA    . GLN A 1  1025 ? -16.554 -13.215 -50.910 1.00 65.24  ? 1025 GLN A CA    1 
ATOM   7617  C  C     . GLN A 1  1025 ? -17.756 -13.790 -51.663 1.00 64.00  ? 1025 GLN A C     1 
ATOM   7618  O  O     . GLN A 1  1025 ? -18.505 -14.616 -51.133 1.00 63.70  ? 1025 GLN A O     1 
ATOM   7619  C  CB    . GLN A 1  1025 ? -15.248 -13.924 -51.311 1.00 65.88  ? 1025 GLN A CB    1 
ATOM   7620  C  CG    . GLN A 1  1025 ? -15.332 -15.437 -51.506 1.00 65.25  ? 1025 GLN A CG    1 
ATOM   7621  C  CD    . GLN A 1  1025 ? -13.963 -16.094 -51.588 1.00 65.54  ? 1025 GLN A CD    1 
ATOM   7622  O  OE1   . GLN A 1  1025 ? -13.482 -16.422 -52.670 1.00 66.13  ? 1025 GLN A OE1   1 
ATOM   7623  N  NE2   . GLN A 1  1025 ? -13.329 -16.281 -50.442 1.00 65.85  ? 1025 GLN A NE2   1 
ATOM   7624  N  N     . ALA A 1  1026 ? -17.934 -13.339 -52.897 1.00 63.28  ? 1026 ALA A N     1 
ATOM   7625  C  CA    . ALA A 1  1026 ? -19.071 -13.743 -53.716 1.00 61.23  ? 1026 ALA A CA    1 
ATOM   7626  C  C     . ALA A 1  1026 ? -18.738 -13.570 -55.185 1.00 60.99  ? 1026 ALA A C     1 
ATOM   7627  O  O     . ALA A 1  1026 ? -17.854 -12.788 -55.542 1.00 60.13  ? 1026 ALA A O     1 
ATOM   7628  C  CB    . ALA A 1  1026 ? -20.296 -12.923 -53.353 1.00 60.87  ? 1026 ALA A CB    1 
ATOM   7629  N  N     . ALA A 1  1027 ? -19.471 -14.293 -56.024 1.00 61.06  ? 1027 ALA A N     1 
ATOM   7630  C  CA    . ALA A 1  1027 ? -19.183 -14.374 -57.452 1.00 61.18  ? 1027 ALA A CA    1 
ATOM   7631  C  C     . ALA A 1  1027 ? -20.449 -14.451 -58.301 1.00 60.60  ? 1027 ALA A C     1 
ATOM   7632  O  O     . ALA A 1  1027 ? -21.519 -14.831 -57.820 1.00 60.39  ? 1027 ALA A O     1 
ATOM   7633  C  CB    . ALA A 1  1027 ? -18.287 -15.574 -57.734 1.00 61.06  ? 1027 ALA A CB    1 
ATOM   7634  N  N     . ALA A 1  1028 ? -20.300 -14.093 -59.574 1.00 60.74  ? 1028 ALA A N     1 
ATOM   7635  C  CA    . ALA A 1  1028 ? -21.401 -14.090 -60.531 1.00 59.48  ? 1028 ALA A CA    1 
ATOM   7636  C  C     . ALA A 1  1028 ? -20.903 -14.459 -61.920 1.00 58.89  ? 1028 ALA A C     1 
ATOM   7637  O  O     . ALA A 1  1028 ? -19.691 -14.520 -62.154 1.00 59.58  ? 1028 ALA A O     1 
ATOM   7638  C  CB    . ALA A 1  1028 ? -22.066 -12.722 -60.554 1.00 59.68  ? 1028 ALA A CB    1 
ATOM   7639  N  N     . LEU A 1  1029 ? -21.839 -14.715 -62.829 1.00 57.63  ? 1029 LEU A N     1 
ATOM   7640  C  CA    . LEU A 1  1029 ? -21.520 -14.978 -64.233 1.00 57.35  ? 1029 LEU A CA    1 
ATOM   7641  C  C     . LEU A 1  1029 ? -22.575 -14.313 -65.105 1.00 57.54  ? 1029 LEU A C     1 
ATOM   7642  O  O     . LEU A 1  1029 ? -23.762 -14.567 -64.922 1.00 56.70  ? 1029 LEU A O     1 
ATOM   7643  C  CB    . LEU A 1  1029 ? -21.487 -16.483 -64.504 1.00 56.17  ? 1029 LEU A CB    1 
ATOM   7644  C  CG    . LEU A 1  1029 ? -21.067 -16.944 -65.905 1.00 56.16  ? 1029 LEU A CG    1 
ATOM   7645  C  CD1   . LEU A 1  1029 ? -19.591 -16.677 -66.143 1.00 56.84  ? 1029 LEU A CD1   1 
ATOM   7646  C  CD2   . LEU A 1  1029 ? -21.378 -18.421 -66.112 1.00 55.45  ? 1029 LEU A CD2   1 
ATOM   7647  N  N     . VAL A 1  1030 ? -22.132 -13.467 -66.038 1.00 58.31  ? 1030 VAL A N     1 
ATOM   7648  C  CA    . VAL A 1  1030 ? -23.026 -12.702 -66.907 1.00 58.60  ? 1030 VAL A CA    1 
ATOM   7649  C  C     . VAL A 1  1030 ? -22.674 -12.942 -68.381 1.00 58.94  ? 1030 VAL A C     1 
ATOM   7650  O  O     . VAL A 1  1030 ? -21.522 -12.752 -68.786 1.00 59.31  ? 1030 VAL A O     1 
ATOM   7651  C  CB    . VAL A 1  1030 ? -22.954 -11.187 -66.597 1.00 59.52  ? 1030 VAL A CB    1 
ATOM   7652  C  CG1   . VAL A 1  1030 ? -23.911 -10.402 -67.494 1.00 60.01  ? 1030 VAL A CG1   1 
ATOM   7653  C  CG2   . VAL A 1  1030 ? -23.262 -10.920 -65.127 1.00 59.42  ? 1030 VAL A CG2   1 
ATOM   7654  N  N     . HIS A 1  1031 ? -23.674 -13.365 -69.162 1.00 57.82  ? 1031 HIS A N     1 
ATOM   7655  C  CA    . HIS A 1  1031 ? -23.567 -13.506 -70.616 1.00 57.48  ? 1031 HIS A CA    1 
ATOM   7656  C  C     . HIS A 1  1031 ? -24.477 -12.490 -71.279 1.00 58.21  ? 1031 HIS A C     1 
ATOM   7657  O  O     . HIS A 1  1031 ? -25.596 -12.289 -70.823 1.00 58.60  ? 1031 HIS A O     1 
ATOM   7658  C  CB    . HIS A 1  1031 ? -24.038 -14.889 -71.080 1.00 56.48  ? 1031 HIS A CB    1 
ATOM   7659  C  CG    . HIS A 1  1031 ? -23.374 -16.038 -70.389 1.00 54.98  ? 1031 HIS A CG    1 
ATOM   7660  N  ND1   . HIS A 1  1031 ? -22.038 -16.041 -70.051 1.00 55.24  ? 1031 HIS A ND1   1 
ATOM   7661  C  CD2   . HIS A 1  1031 ? -23.863 -17.236 -69.999 1.00 53.63  ? 1031 HIS A CD2   1 
ATOM   7662  C  CE1   . HIS A 1  1031 ? -21.738 -17.186 -69.467 1.00 54.32  ? 1031 HIS A CE1   1 
ATOM   7663  N  NE2   . HIS A 1  1031 ? -22.827 -17.928 -69.423 1.00 53.70  ? 1031 HIS A NE2   1 
ATOM   7664  N  N     . ILE A 1  1032 ? -24.006 -11.864 -72.355 1.00 58.98  ? 1032 ILE A N     1 
ATOM   7665  C  CA    . ILE A 1  1032 ? -24.871 -11.095 -73.251 1.00 59.51  ? 1032 ILE A CA    1 
ATOM   7666  C  C     . ILE A 1  1032 ? -24.935 -11.846 -74.581 1.00 58.96  ? 1032 ILE A C     1 
ATOM   7667  O  O     . ILE A 1  1032 ? -23.905 -12.063 -75.230 1.00 59.31  ? 1032 ILE A O     1 
ATOM   7668  C  CB    . ILE A 1  1032 ? -24.367 -9.653  -73.485 1.00 61.03  ? 1032 ILE A CB    1 
ATOM   7669  C  CG1   . ILE A 1  1032 ? -24.016 -8.972  -72.150 1.00 61.43  ? 1032 ILE A CG1   1 
ATOM   7670  C  CG2   . ILE A 1  1032 ? -25.418 -8.838  -74.240 1.00 61.82  ? 1032 ILE A CG2   1 
ATOM   7671  C  CD1   . ILE A 1  1032 ? -23.640 -7.508  -72.272 1.00 62.34  ? 1032 ILE A CD1   1 
ATOM   7672  N  N     . TYR A 1  1033 ? -26.142 -12.248 -74.971 1.00 57.46  ? 1033 TYR A N     1 
ATOM   7673  C  CA    . TYR A 1  1033 ? -26.368 -12.899 -76.257 1.00 57.36  ? 1033 TYR A CA    1 
ATOM   7674  C  C     . TYR A 1  1033 ? -26.518 -11.849 -77.361 1.00 58.74  ? 1033 TYR A C     1 
ATOM   7675  O  O     . TYR A 1  1033 ? -26.735 -10.662 -77.078 1.00 59.46  ? 1033 TYR A O     1 
ATOM   7676  C  CB    . TYR A 1  1033 ? -27.578 -13.836 -76.182 1.00 56.17  ? 1033 TYR A CB    1 
ATOM   7677  C  CG    . TYR A 1  1033 ? -27.371 -14.955 -75.189 1.00 55.41  ? 1033 TYR A CG    1 
ATOM   7678  C  CD1   . TYR A 1  1033 ? -26.616 -16.078 -75.519 1.00 55.29  ? 1033 TYR A CD1   1 
ATOM   7679  C  CD2   . TYR A 1  1033 ? -27.900 -14.878 -73.904 1.00 55.46  ? 1033 TYR A CD2   1 
ATOM   7680  C  CE1   . TYR A 1  1033 ? -26.409 -17.097 -74.598 1.00 54.96  ? 1033 TYR A CE1   1 
ATOM   7681  C  CE2   . TYR A 1  1033 ? -27.700 -15.890 -72.978 1.00 54.27  ? 1033 TYR A CE2   1 
ATOM   7682  C  CZ    . TYR A 1  1033 ? -26.955 -16.994 -73.322 1.00 54.34  ? 1033 TYR A CZ    1 
ATOM   7683  O  OH    . TYR A 1  1033 ? -26.769 -17.996 -72.390 1.00 54.25  ? 1033 TYR A OH    1 
ATOM   7684  N  N     . LEU A 1  1034 ? -26.400 -12.295 -78.613 1.00 59.00  ? 1034 LEU A N     1 
ATOM   7685  C  CA    . LEU A 1  1034 ? -26.347 -11.391 -79.779 1.00 60.17  ? 1034 LEU A CA    1 
ATOM   7686  C  C     . LEU A 1  1034 ? -27.648 -10.653 -80.085 1.00 60.13  ? 1034 LEU A C     1 
ATOM   7687  O  O     . LEU A 1  1034 ? -27.616 -9.644  -80.786 1.00 62.46  ? 1034 LEU A O     1 
ATOM   7688  C  CB    . LEU A 1  1034 ? -25.842 -12.117 -81.042 1.00 61.08  ? 1034 LEU A CB    1 
ATOM   7689  C  CG    . LEU A 1  1034 ? -24.321 -12.108 -81.258 1.00 62.00  ? 1034 LEU A CG    1 
ATOM   7690  C  CD1   . LEU A 1  1034 ? -23.556 -12.586 -80.034 1.00 60.97  ? 1034 LEU A CD1   1 
ATOM   7691  C  CD2   . LEU A 1  1034 ? -23.966 -12.956 -82.468 1.00 62.62  ? 1034 LEU A CD2   1 
ATOM   7692  N  N     . ASP A 1  1035 ? -28.777 -11.143 -79.567 1.00 58.88  ? 1035 ASP A N     1 
ATOM   7693  C  CA    . ASP A 1  1035 ? -30.035 -10.378 -79.597 1.00 59.03  ? 1035 ASP A CA    1 
ATOM   7694  C  C     . ASP A 1  1035 ? -30.099 -9.276  -78.507 1.00 60.15  ? 1035 ASP A C     1 
ATOM   7695  O  O     . ASP A 1  1035 ? -31.123 -8.589  -78.379 1.00 60.64  ? 1035 ASP A O     1 
ATOM   7696  C  CB    . ASP A 1  1035 ? -31.259 -11.314 -79.525 1.00 57.49  ? 1035 ASP A CB    1 
ATOM   7697  C  CG    . ASP A 1  1035 ? -31.519 -11.882 -78.125 1.00 56.14  ? 1035 ASP A CG    1 
ATOM   7698  O  OD1   . ASP A 1  1035 ? -30.636 -11.813 -77.243 1.00 55.29  ? 1035 ASP A OD1   1 
ATOM   7699  O  OD2   . ASP A 1  1035 ? -32.627 -12.423 -77.913 1.00 55.27  ? 1035 ASP A OD2   1 
ATOM   7700  N  N     . GLY A 1  1036 ? -29.028 -9.138  -77.715 1.00 59.71  ? 1036 GLY A N     1 
ATOM   7701  C  CA    . GLY A 1  1036 ? -28.931 -8.116  -76.686 1.00 60.29  ? 1036 GLY A CA    1 
ATOM   7702  C  C     . GLY A 1  1036 ? -29.407 -8.540  -75.311 1.00 59.52  ? 1036 GLY A C     1 
ATOM   7703  O  O     . GLY A 1  1036 ? -29.203 -7.792  -74.350 1.00 59.08  ? 1036 GLY A O     1 
ATOM   7704  N  N     . SER A 1  1037 ? -30.028 -9.723  -75.204 1.00 58.80  ? 1037 SER A N     1 
ATOM   7705  C  CA    . SER A 1  1037 ? -30.581 -10.207 -73.927 1.00 58.28  ? 1037 SER A CA    1 
ATOM   7706  C  C     . SER A 1  1037 ? -29.469 -10.735 -73.015 1.00 58.19  ? 1037 SER A C     1 
ATOM   7707  O  O     . SER A 1  1037 ? -28.424 -11.186 -73.495 1.00 58.01  ? 1037 SER A O     1 
ATOM   7708  C  CB    . SER A 1  1037 ? -31.660 -11.281 -74.149 1.00 57.35  ? 1037 SER A CB    1 
ATOM   7709  O  OG    . SER A 1  1037 ? -31.114 -12.493 -74.654 1.00 56.83  ? 1037 SER A OG    1 
ATOM   7710  N  N     . VAL A 1  1038 ? -29.710 -10.673 -71.704 1.00 57.78  ? 1038 VAL A N     1 
ATOM   7711  C  CA    . VAL A 1  1038 ? -28.704 -11.023 -70.700 1.00 57.55  ? 1038 VAL A CA    1 
ATOM   7712  C  C     . VAL A 1  1038 ? -29.164 -12.186 -69.817 1.00 56.58  ? 1038 VAL A C     1 
ATOM   7713  O  O     . VAL A 1  1038 ? -30.318 -12.224 -69.376 1.00 56.74  ? 1038 VAL A O     1 
ATOM   7714  C  CB    . VAL A 1  1038 ? -28.366 -9.807  -69.810 1.00 58.06  ? 1038 VAL A CB    1 
ATOM   7715  C  CG1   . VAL A 1  1038 ? -27.384 -10.186 -68.697 1.00 57.70  ? 1038 VAL A CG1   1 
ATOM   7716  C  CG2   . VAL A 1  1038 ? -27.815 -8.675  -70.667 1.00 59.11  ? 1038 VAL A CG2   1 
ATOM   7717  N  N     . LEU A 1  1039 ? -28.250 -13.130 -69.581 1.00 55.14  ? 1039 LEU A N     1 
ATOM   7718  C  CA    . LEU A 1  1039 ? -28.435 -14.170 -68.582 1.00 53.47  ? 1039 LEU A CA    1 
ATOM   7719  C  C     . LEU A 1  1039 ? -27.400 -13.961 -67.490 1.00 52.82  ? 1039 LEU A C     1 
ATOM   7720  O  O     . LEU A 1  1039 ? -26.212 -13.843 -67.774 1.00 52.92  ? 1039 LEU A O     1 
ATOM   7721  C  CB    . LEU A 1  1039 ? -28.293 -15.565 -69.185 1.00 52.52  ? 1039 LEU A CB    1 
ATOM   7722  C  CG    . LEU A 1  1039 ? -28.747 -16.700 -68.262 1.00 51.45  ? 1039 LEU A CG    1 
ATOM   7723  C  CD1   . LEU A 1  1039 ? -30.266 -16.831 -68.264 1.00 50.88  ? 1039 LEU A CD1   1 
ATOM   7724  C  CD2   . LEU A 1  1039 ? -28.099 -18.010 -68.674 1.00 51.35  ? 1039 LEU A CD2   1 
ATOM   7725  N  N     . VAL A 1  1040 ? -27.870 -13.919 -66.249 1.00 52.05  ? 1040 VAL A N     1 
ATOM   7726  C  CA    . VAL A 1  1040 ? -27.024 -13.706 -65.083 1.00 51.98  ? 1040 VAL A CA    1 
ATOM   7727  C  C     . VAL A 1  1040 ? -27.253 -14.837 -64.079 1.00 51.68  ? 1040 VAL A C     1 
ATOM   7728  O  O     . VAL A 1  1040 ? -28.341 -15.413 -64.008 1.00 52.20  ? 1040 VAL A O     1 
ATOM   7729  C  CB    . VAL A 1  1040 ? -27.284 -12.319 -64.442 1.00 52.40  ? 1040 VAL A CB    1 
ATOM   7730  C  CG1   . VAL A 1  1040 ? -28.757 -12.124 -64.076 1.00 52.35  ? 1040 VAL A CG1   1 
ATOM   7731  C  CG2   . VAL A 1  1040 ? -26.385 -12.086 -63.231 1.00 52.43  ? 1040 VAL A CG2   1 
ATOM   7732  N  N     . THR A 1  1041 ? -26.215 -15.169 -63.326 1.00 52.03  ? 1041 THR A N     1 
ATOM   7733  C  CA    . THR A 1  1041 ? -26.349 -16.062 -62.180 1.00 52.08  ? 1041 THR A CA    1 
ATOM   7734  C  C     . THR A 1  1041 ? -25.276 -15.740 -61.139 1.00 52.57  ? 1041 THR A C     1 
ATOM   7735  O  O     . THR A 1  1041 ? -24.368 -14.961 -61.405 1.00 53.69  ? 1041 THR A O     1 
ATOM   7736  C  CB    . THR A 1  1041 ? -26.291 -17.546 -62.607 1.00 51.39  ? 1041 THR A CB    1 
ATOM   7737  O  OG1   . THR A 1  1041 ? -26.625 -18.377 -61.489 1.00 51.55  ? 1041 THR A OG1   1 
ATOM   7738  C  CG2   . THR A 1  1041 ? -24.912 -17.932 -63.138 1.00 51.23  ? 1041 THR A CG2   1 
ATOM   7739  N  N     . HIS A 1  1042 ? -25.401 -16.341 -59.962 1.00 53.03  ? 1042 HIS A N     1 
ATOM   7740  C  CA    . HIS A 1  1042 ? -24.497 -16.075 -58.836 1.00 54.53  ? 1042 HIS A CA    1 
ATOM   7741  C  C     . HIS A 1  1042 ? -24.699 -17.109 -57.732 1.00 54.09  ? 1042 HIS A C     1 
ATOM   7742  O  O     . HIS A 1  1042 ? -25.678 -17.858 -57.740 1.00 54.45  ? 1042 HIS A O     1 
ATOM   7743  C  CB    . HIS A 1  1042 ? -24.752 -14.677 -58.275 1.00 55.52  ? 1042 HIS A CB    1 
ATOM   7744  C  CG    . HIS A 1  1042 ? -26.192 -14.419 -57.987 1.00 56.12  ? 1042 HIS A CG    1 
ATOM   7745  N  ND1   . HIS A 1  1042 ? -26.742 -14.565 -56.733 1.00 56.09  ? 1042 HIS A ND1   1 
ATOM   7746  C  CD2   . HIS A 1  1042 ? -27.210 -14.077 -58.808 1.00 56.75  ? 1042 HIS A CD2   1 
ATOM   7747  C  CE1   . HIS A 1  1042 ? -28.032 -14.298 -56.788 1.00 56.61  ? 1042 HIS A CE1   1 
ATOM   7748  N  NE2   . HIS A 1  1042 ? -28.343 -14.008 -58.040 1.00 56.77  ? 1042 HIS A NE2   1 
ATOM   7749  N  N     . GLY A 1  1043 ? -23.777 -17.115 -56.777 1.00 54.35  ? 1043 GLY A N     1 
ATOM   7750  C  CA    . GLY A 1  1043 ? -23.774 -18.077 -55.679 1.00 54.23  ? 1043 GLY A CA    1 
ATOM   7751  C  C     . GLY A 1  1043 ? -24.916 -18.012 -54.684 1.00 53.23  ? 1043 GLY A C     1 
ATOM   7752  O  O     . GLY A 1  1043 ? -25.183 -18.983 -53.991 1.00 53.84  ? 1043 GLY A O     1 
ATOM   7753  N  N     . GLY A 1  1044 ? -25.559 -16.859 -54.584 1.00 53.86  ? 1044 GLY A N     1 
ATOM   7754  C  CA    . GLY A 1  1044 ? -26.733 -16.673 -53.723 1.00 54.79  ? 1044 GLY A CA    1 
ATOM   7755  C  C     . GLY A 1  1044 ? -27.969 -17.498 -54.067 1.00 54.87  ? 1044 GLY A C     1 
ATOM   7756  O  O     . GLY A 1  1044 ? -28.191 -17.849 -55.228 1.00 54.10  ? 1044 GLY A O     1 
ATOM   7757  N  N     . ILE A 1  1045 ? -28.776 -17.782 -53.042 1.00 55.86  ? 1045 ILE A N     1 
ATOM   7758  C  CA    . ILE A 1  1045 ? -29.971 -18.634 -53.142 1.00 55.51  ? 1045 ILE A CA    1 
ATOM   7759  C  C     . ILE A 1  1045 ? -31.235 -17.832 -52.847 1.00 55.18  ? 1045 ILE A C     1 
ATOM   7760  O  O     . ILE A 1  1045 ? -31.278 -17.077 -51.874 1.00 55.53  ? 1045 ILE A O     1 
ATOM   7761  C  CB    . ILE A 1  1045 ? -29.913 -19.791 -52.116 1.00 55.51  ? 1045 ILE A CB    1 
ATOM   7762  C  CG1   . ILE A 1  1045 ? -28.691 -20.682 -52.371 1.00 55.95  ? 1045 ILE A CG1   1 
ATOM   7763  C  CG2   . ILE A 1  1045 ? -31.203 -20.613 -52.127 1.00 54.99  ? 1045 ILE A CG2   1 
ATOM   7764  C  CD1   . ILE A 1  1045 ? -28.809 -21.581 -53.584 1.00 56.13  ? 1045 ILE A CD1   1 
ATOM   7765  N  N     . GLU A 1  1046 ? -32.266 -18.028 -53.667 1.00 54.66  ? 1046 GLU A N     1 
ATOM   7766  C  CA    . GLU A 1  1046 ? -33.584 -17.439 -53.420 1.00 54.96  ? 1046 GLU A CA    1 
ATOM   7767  C  C     . GLU A 1  1046 ? -34.344 -18.333 -52.441 1.00 54.86  ? 1046 GLU A C     1 
ATOM   7768  O  O     . GLU A 1  1046 ? -34.662 -19.480 -52.756 1.00 54.05  ? 1046 GLU A O     1 
ATOM   7769  C  CB    . GLU A 1  1046 ? -34.361 -17.260 -54.730 1.00 54.41  ? 1046 GLU A CB    1 
ATOM   7770  C  CG    . GLU A 1  1046 ? -35.772 -16.697 -54.601 1.00 54.37  ? 1046 GLU A CG    1 
ATOM   7771  C  CD    . GLU A 1  1046 ? -35.815 -15.259 -54.127 1.00 55.33  ? 1046 GLU A CD    1 
ATOM   7772  O  OE1   . GLU A 1  1046 ? -35.420 -14.348 -54.890 1.00 57.14  ? 1046 GLU A OE1   1 
ATOM   7773  O  OE2   . GLU A 1  1046 ? -36.289 -15.027 -52.997 1.00 55.10  ? 1046 GLU A OE2   1 
ATOM   7774  N  N     . MET A 1  1047 ? -34.595 -17.792 -51.251 1.00 56.17  ? 1047 MET A N     1 
ATOM   7775  C  CA    . MET A 1  1047 ? -35.362 -18.445 -50.192 1.00 56.61  ? 1047 MET A CA    1 
ATOM   7776  C  C     . MET A 1  1047 ? -36.695 -17.722 -49.950 1.00 55.50  ? 1047 MET A C     1 
ATOM   7777  O  O     . MET A 1  1047 ? -37.441 -18.093 -49.041 1.00 54.79  ? 1047 MET A O     1 
ATOM   7778  C  CB    . MET A 1  1047 ? -34.559 -18.431 -48.886 1.00 58.96  ? 1047 MET A CB    1 
ATOM   7779  C  CG    . MET A 1  1047 ? -33.081 -18.773 -49.030 1.00 61.04  ? 1047 MET A CG    1 
ATOM   7780  S  SD    . MET A 1  1047 ? -32.141 -18.754 -47.488 1.00 62.96  ? 1047 MET A SD    1 
ATOM   7781  C  CE    . MET A 1  1047 ? -32.315 -17.049 -46.985 1.00 65.82  ? 1047 MET A CE    1 
ATOM   7782  N  N     . GLY A 1  1048 ? -36.988 -16.702 -50.760 1.00 53.92  ? 1048 GLY A N     1 
ATOM   7783  C  CA    . GLY A 1  1048 ? -38.138 -15.832 -50.554 1.00 53.58  ? 1048 GLY A CA    1 
ATOM   7784  C  C     . GLY A 1  1048 ? -37.788 -14.401 -50.202 1.00 54.07  ? 1048 GLY A C     1 
ATOM   7785  O  O     . GLY A 1  1048 ? -38.654 -13.525 -50.230 1.00 53.97  ? 1048 GLY A O     1 
ATOM   7786  N  N     . GLN A 1  1049 ? -36.514 -14.163 -49.889 1.00 54.54  ? 1049 GLN A N     1 
ATOM   7787  C  CA    . GLN A 1  1049 ? -36.012 -12.822 -49.563 1.00 55.11  ? 1049 GLN A CA    1 
ATOM   7788  C  C     . GLN A 1  1049 ? -35.873 -11.889 -50.776 1.00 55.63  ? 1049 GLN A C     1 
ATOM   7789  O  O     . GLN A 1  1049 ? -35.534 -10.716 -50.610 1.00 57.21  ? 1049 GLN A O     1 
ATOM   7790  C  CB    . GLN A 1  1049 ? -34.681 -12.911 -48.783 1.00 55.26  ? 1049 GLN A CB    1 
ATOM   7791  C  CG    . GLN A 1  1049 ? -33.399 -13.097 -49.602 1.00 55.36  ? 1049 GLN A CG    1 
ATOM   7792  C  CD    . GLN A 1  1049 ? -33.160 -14.521 -50.071 1.00 55.34  ? 1049 GLN A CD    1 
ATOM   7793  O  OE1   . GLN A 1  1049 ? -34.093 -15.232 -50.458 1.00 54.69  ? 1049 GLN A OE1   1 
ATOM   7794  N  NE2   . GLN A 1  1049 ? -31.901 -14.948 -50.047 1.00 55.58  ? 1049 GLN A NE2   1 
ATOM   7795  N  N     . GLY A 1  1050 ? -36.103 -12.399 -51.983 1.00 55.12  ? 1050 GLY A N     1 
ATOM   7796  C  CA    . GLY A 1  1050 ? -36.084 -11.573 -53.185 1.00 56.26  ? 1050 GLY A CA    1 
ATOM   7797  C  C     . GLY A 1  1050 ? -34.694 -11.142 -53.612 1.00 56.95  ? 1050 GLY A C     1 
ATOM   7798  O  O     . GLY A 1  1050 ? -34.513 -10.036 -54.118 1.00 56.95  ? 1050 GLY A O     1 
ATOM   7799  N  N     . VAL A 1  1051 ? -33.715 -12.020 -53.405 1.00 57.82  ? 1051 VAL A N     1 
ATOM   7800  C  CA    . VAL A 1  1051 ? -32.336 -11.759 -53.824 1.00 58.22  ? 1051 VAL A CA    1 
ATOM   7801  C  C     . VAL A 1  1051 ? -32.224 -11.658 -55.345 1.00 58.49  ? 1051 VAL A C     1 
ATOM   7802  O  O     . VAL A 1  1051 ? -31.633 -10.714 -55.848 1.00 59.72  ? 1051 VAL A O     1 
ATOM   7803  C  CB    . VAL A 1  1051 ? -31.326 -12.799 -53.252 1.00 57.63  ? 1051 VAL A CB    1 
ATOM   7804  C  CG1   . VAL A 1  1051 ? -31.548 -14.202 -53.806 1.00 56.51  ? 1051 VAL A CG1   1 
ATOM   7805  C  CG2   . VAL A 1  1051 ? -29.894 -12.353 -53.514 1.00 58.49  ? 1051 VAL A CG2   1 
ATOM   7806  N  N     . HIS A 1  1052 ? -32.828 -12.598 -56.069 1.00 58.79  ? 1052 HIS A N     1 
ATOM   7807  C  CA    . HIS A 1  1052 ? -32.715 -12.635 -57.533 1.00 59.43  ? 1052 HIS A CA    1 
ATOM   7808  C  C     . HIS A 1  1052 ? -33.340 -11.407 -58.169 1.00 59.62  ? 1052 HIS A C     1 
ATOM   7809  O  O     . HIS A 1  1052 ? -32.790 -10.858 -59.116 1.00 59.96  ? 1052 HIS A O     1 
ATOM   7810  C  CB    . HIS A 1  1052 ? -33.329 -13.920 -58.115 1.00 59.16  ? 1052 HIS A CB    1 
ATOM   7811  C  CG    . HIS A 1  1052 ? -32.547 -15.160 -57.798 1.00 59.32  ? 1052 HIS A CG    1 
ATOM   7812  N  ND1   . HIS A 1  1052 ? -33.077 -16.428 -57.907 1.00 60.07  ? 1052 HIS A ND1   1 
ATOM   7813  C  CD2   . HIS A 1  1052 ? -31.276 -15.325 -57.367 1.00 59.33  ? 1052 HIS A CD2   1 
ATOM   7814  C  CE1   . HIS A 1  1052 ? -32.162 -17.319 -57.564 1.00 59.48  ? 1052 HIS A CE1   1 
ATOM   7815  N  NE2   . HIS A 1  1052 ? -31.059 -16.674 -57.233 1.00 59.78  ? 1052 HIS A NE2   1 
ATOM   7816  N  N     . THR A 1  1053 ? -34.473 -10.973 -57.622 1.00 60.90  ? 1053 THR A N     1 
ATOM   7817  C  CA    . THR A 1  1053 ? -35.108 -9.709  -58.010 1.00 61.59  ? 1053 THR A CA    1 
ATOM   7818  C  C     . THR A 1  1053 ? -34.146 -8.519  -57.886 1.00 62.43  ? 1053 THR A C     1 
ATOM   7819  O  O     . THR A 1  1053 ? -34.041 -7.707  -58.808 1.00 63.90  ? 1053 THR A O     1 
ATOM   7820  C  CB    . THR A 1  1053 ? -36.371 -9.439  -57.163 1.00 61.38  ? 1053 THR A CB    1 
ATOM   7821  O  OG1   . THR A 1  1053 ? -37.125 -10.651 -57.027 1.00 60.92  ? 1053 THR A OG1   1 
ATOM   7822  C  CG2   . THR A 1  1053 ? -37.241 -8.373  -57.802 1.00 61.87  ? 1053 THR A CG2   1 
ATOM   7823  N  N     . LYS A 1  1054 ? -33.438 -8.437  -56.760 1.00 61.78  ? 1054 LYS A N     1 
ATOM   7824  C  CA    . LYS A 1  1054 ? -32.458 -7.361  -56.530 1.00 61.79  ? 1054 LYS A CA    1 
ATOM   7825  C  C     . LYS A 1  1054 ? -31.246 -7.403  -57.464 1.00 60.82  ? 1054 LYS A C     1 
ATOM   7826  O  O     . LYS A 1  1054 ? -30.672 -6.360  -57.774 1.00 61.05  ? 1054 LYS A O     1 
ATOM   7827  C  CB    . LYS A 1  1054 ? -31.975 -7.363  -55.076 1.00 61.38  ? 1054 LYS A CB    1 
ATOM   7828  C  CG    . LYS A 1  1054 ? -33.024 -6.918  -54.082 1.00 61.30  ? 1054 LYS A CG    1 
ATOM   7829  C  CD    . LYS A 1  1054 ? -32.534 -7.138  -52.668 1.00 61.84  ? 1054 LYS A CD    1 
ATOM   7830  C  CE    . LYS A 1  1054 ? -33.507 -6.576  -51.653 1.00 62.87  ? 1054 LYS A CE    1 
ATOM   7831  N  NZ    . LYS A 1  1054 ? -32.943 -6.673  -50.280 1.00 63.96  ? 1054 LYS A NZ    1 
ATOM   7832  N  N     . MET A 1  1055 ? -30.846 -8.598  -57.888 1.00 59.82  ? 1055 MET A N     1 
ATOM   7833  C  CA    . MET A 1  1055 ? -29.703 -8.744  -58.790 1.00 60.14  ? 1055 MET A CA    1 
ATOM   7834  C  C     . MET A 1  1055 ? -30.058 -8.273  -60.197 1.00 60.45  ? 1055 MET A C     1 
ATOM   7835  O  O     . MET A 1  1055 ? -29.222 -7.681  -60.882 1.00 60.90  ? 1055 MET A O     1 
ATOM   7836  C  CB    . MET A 1  1055 ? -29.212 -10.189 -58.823 1.00 59.34  ? 1055 MET A CB    1 
ATOM   7837  C  CG    . MET A 1  1055 ? -28.753 -10.751 -57.480 1.00 59.21  ? 1055 MET A CG    1 
ATOM   7838  S  SD    . MET A 1  1055 ? -27.434 -9.876  -56.617 1.00 59.82  ? 1055 MET A SD    1 
ATOM   7839  C  CE    . MET A 1  1055 ? -28.352 -8.764  -55.557 1.00 60.07  ? 1055 MET A CE    1 
ATOM   7840  N  N     . ILE A 1  1056 ? -31.300 -8.520  -60.611 1.00 59.86  ? 1056 ILE A N     1 
ATOM   7841  C  CA    . ILE A 1  1056 ? -31.803 -8.016  -61.889 1.00 60.42  ? 1056 ILE A CA    1 
ATOM   7842  C  C     . ILE A 1  1056 ? -31.961 -6.483  -61.844 1.00 60.55  ? 1056 ILE A C     1 
ATOM   7843  O  O     . ILE A 1  1056 ? -31.722 -5.810  -62.850 1.00 61.00  ? 1056 ILE A O     1 
ATOM   7844  C  CB    . ILE A 1  1056 ? -33.133 -8.705  -62.296 1.00 60.41  ? 1056 ILE A CB    1 
ATOM   7845  C  CG1   . ILE A 1  1056 ? -32.969 -10.232 -62.423 1.00 59.66  ? 1056 ILE A CG1   1 
ATOM   7846  C  CG2   . ILE A 1  1056 ? -33.670 -8.134  -63.604 1.00 61.22  ? 1056 ILE A CG2   1 
ATOM   7847  C  CD1   . ILE A 1  1056 ? -32.098 -10.711 -63.563 1.00 60.28  ? 1056 ILE A CD1   1 
ATOM   7848  N  N     . GLN A 1  1057 ? -32.360 -5.942  -60.689 1.00 60.35  ? 1057 GLN A N     1 
ATOM   7849  C  CA    . GLN A 1  1057 ? -32.367 -4.483  -60.465 1.00 61.37  ? 1057 GLN A CA    1 
ATOM   7850  C  C     . GLN A 1  1057 ? -30.962 -3.895  -60.583 1.00 62.59  ? 1057 GLN A C     1 
ATOM   7851  O  O     . GLN A 1  1057 ? -30.788 -2.825  -61.169 1.00 64.25  ? 1057 GLN A O     1 
ATOM   7852  C  CB    . GLN A 1  1057 ? -32.954 -4.115  -59.092 1.00 61.04  ? 1057 GLN A CB    1 
ATOM   7853  C  CG    . GLN A 1  1057 ? -34.458 -4.295  -58.973 1.00 60.43  ? 1057 GLN A CG    1 
ATOM   7854  C  CD    . GLN A 1  1057 ? -34.979 -3.979  -57.584 1.00 60.15  ? 1057 GLN A CD    1 
ATOM   7855  O  OE1   . GLN A 1  1057 ? -34.818 -4.763  -56.655 1.00 59.52  ? 1057 GLN A OE1   1 
ATOM   7856  N  NE2   . GLN A 1  1057 ? -35.624 -2.835  -57.442 1.00 61.15  ? 1057 GLN A NE2   1 
ATOM   7857  N  N     . VAL A 1  1058 ? -29.971 -4.593  -60.020 1.00 62.63  ? 1058 VAL A N     1 
ATOM   7858  C  CA    . VAL A 1  1058 ? -28.562 -4.201  -60.159 1.00 63.49  ? 1058 VAL A CA    1 
ATOM   7859  C  C     . VAL A 1  1058 ? -28.135 -4.237  -61.630 1.00 64.23  ? 1058 VAL A C     1 
ATOM   7860  O  O     . VAL A 1  1058 ? -27.541 -3.273  -62.111 1.00 66.32  ? 1058 VAL A O     1 
ATOM   7861  C  CB    . VAL A 1  1058 ? -27.613 -5.083  -59.304 1.00 62.74  ? 1058 VAL A CB    1 
ATOM   7862  C  CG1   . VAL A 1  1058 ? -26.144 -4.819  -59.640 1.00 63.14  ? 1058 VAL A CG1   1 
ATOM   7863  C  CG2   . VAL A 1  1058 ? -27.860 -4.855  -57.815 1.00 62.85  ? 1058 VAL A CG2   1 
ATOM   7864  N  N     . VAL A 1  1059 ? -28.445 -5.329  -62.334 1.00 63.27  ? 1059 VAL A N     1 
ATOM   7865  C  CA    . VAL A 1  1059 ? -28.076 -5.461  -63.756 1.00 63.31  ? 1059 VAL A CA    1 
ATOM   7866  C  C     . VAL A 1  1059 ? -28.745 -4.370  -64.587 1.00 64.11  ? 1059 VAL A C     1 
ATOM   7867  O  O     . VAL A 1  1059 ? -28.116 -3.785  -65.467 1.00 65.06  ? 1059 VAL A O     1 
ATOM   7868  C  CB    . VAL A 1  1059 ? -28.417 -6.857  -64.347 1.00 62.20  ? 1059 VAL A CB    1 
ATOM   7869  C  CG1   . VAL A 1  1059 ? -28.130 -6.905  -65.849 1.00 62.25  ? 1059 VAL A CG1   1 
ATOM   7870  C  CG2   . VAL A 1  1059 ? -27.628 -7.959  -63.642 1.00 61.40  ? 1059 VAL A CG2   1 
ATOM   7871  N  N     . SER A 1  1060 ? -30.013 -4.098  -64.299 1.00 64.27  ? 1060 SER A N     1 
ATOM   7872  C  CA    . SER A 1  1060 ? -30.744 -3.044  -64.991 1.00 66.04  ? 1060 SER A CA    1 
ATOM   7873  C  C     . SER A 1  1060 ? -30.087 -1.659  -64.855 1.00 68.09  ? 1060 SER A C     1 
ATOM   7874  O  O     . SER A 1  1060 ? -30.052 -0.904  -65.826 1.00 69.98  ? 1060 SER A O     1 
ATOM   7875  C  CB    . SER A 1  1060 ? -32.196 -2.993  -64.506 1.00 65.73  ? 1060 SER A CB    1 
ATOM   7876  O  OG    . SER A 1  1060 ? -32.880 -1.876  -65.049 1.00 66.45  ? 1060 SER A OG    1 
ATOM   7877  N  N     . ARG A 1  1061 ? -29.574 -1.332  -63.667 1.00 68.66  ? 1061 ARG A N     1 
ATOM   7878  C  CA    . ARG A 1  1061 ? -28.901 -0.044  -63.450 1.00 70.41  ? 1061 ARG A CA    1 
ATOM   7879  C  C     . ARG A 1  1061 ? -27.564 0.028   -64.178 1.00 70.88  ? 1061 ARG A C     1 
ATOM   7880  O  O     . ARG A 1  1061 ? -27.273 1.012   -64.859 1.00 72.88  ? 1061 ARG A O     1 
ATOM   7881  C  CB    . ARG A 1  1061 ? -28.660 0.225   -61.957 1.00 71.34  ? 1061 ARG A CB    1 
ATOM   7882  C  CG    . ARG A 1  1061 ? -28.282 1.679   -61.657 1.00 73.32  ? 1061 ARG A CG    1 
ATOM   7883  C  CD    . ARG A 1  1061 ? -27.385 1.864   -60.441 1.00 74.12  ? 1061 ARG A CD    1 
ATOM   7884  N  NE    . ARG A 1  1061 ? -28.103 2.174   -59.199 1.00 74.49  ? 1061 ARG A NE    1 
ATOM   7885  C  CZ    . ARG A 1  1061 ? -28.649 3.351   -58.891 1.00 76.02  ? 1061 ARG A CZ    1 
ATOM   7886  N  NH1   . ARG A 1  1061 ? -28.608 4.376   -59.741 1.00 78.71  ? 1061 ARG A NH1   1 
ATOM   7887  N  NH2   . ARG A 1  1061 ? -29.256 3.507   -57.719 1.00 75.57  ? 1061 ARG A NH2   1 
ATOM   7888  N  N     . GLU A 1  1062 ? -26.762 -1.020  -64.028 1.00 70.09  ? 1062 GLU A N     1 
ATOM   7889  C  CA    . GLU A 1  1062 ? -25.363 -1.001  -64.454 1.00 70.43  ? 1062 GLU A CA    1 
ATOM   7890  C  C     . GLU A 1  1062 ? -25.172 -1.112  -65.964 1.00 71.05  ? 1062 GLU A C     1 
ATOM   7891  O  O     . GLU A 1  1062 ? -24.302 -0.447  -66.524 1.00 72.01  ? 1062 GLU A O     1 
ATOM   7892  C  CB    . GLU A 1  1062 ? -24.583 -2.103  -63.729 1.00 69.00  ? 1062 GLU A CB    1 
ATOM   7893  C  CG    . GLU A 1  1062 ? -24.527 -1.919  -62.215 1.00 68.36  ? 1062 GLU A CG    1 
ATOM   7894  C  CD    . GLU A 1  1062 ? -23.769 -0.671  -61.782 1.00 68.80  ? 1062 GLU A CD    1 
ATOM   7895  O  OE1   . GLU A 1  1062 ? -22.764 -0.320  -62.439 1.00 68.66  ? 1062 GLU A OE1   1 
ATOM   7896  O  OE2   . GLU A 1  1062 ? -24.173 -0.050  -60.774 1.00 68.19  ? 1062 GLU A OE2   1 
ATOM   7897  N  N     . LEU A 1  1063 ? -25.970 -1.957  -66.611 1.00 71.25  ? 1063 LEU A N     1 
ATOM   7898  C  CA    . LEU A 1  1063 ? -25.959 -2.073  -68.072 1.00 72.25  ? 1063 LEU A CA    1 
ATOM   7899  C  C     . LEU A 1  1063 ? -26.958 -1.134  -68.758 1.00 73.40  ? 1063 LEU A C     1 
ATOM   7900  O  O     . LEU A 1  1063 ? -26.956 -1.030  -69.982 1.00 72.83  ? 1063 LEU A O     1 
ATOM   7901  C  CB    . LEU A 1  1063 ? -26.216 -3.525  -68.495 1.00 71.04  ? 1063 LEU A CB    1 
ATOM   7902  C  CG    . LEU A 1  1063 ? -25.190 -4.561  -68.029 1.00 70.02  ? 1063 LEU A CG    1 
ATOM   7903  C  CD1   . LEU A 1  1063 ? -25.523 -5.918  -68.630 1.00 69.12  ? 1063 LEU A CD1   1 
ATOM   7904  C  CD2   . LEU A 1  1063 ? -23.769 -4.152  -68.390 1.00 70.61  ? 1063 LEU A CD2   1 
ATOM   7905  N  N     . ARG A 1  1064 ? -27.795 -0.453  -67.973 1.00 75.16  ? 1064 ARG A N     1 
ATOM   7906  C  CA    . ARG A 1  1064 ? -28.761 0.525   -68.485 1.00 77.43  ? 1064 ARG A CA    1 
ATOM   7907  C  C     . ARG A 1  1064 ? -29.728 -0.141  -69.463 1.00 74.70  ? 1064 ARG A C     1 
ATOM   7908  O  O     . ARG A 1  1064 ? -29.803 0.225   -70.635 1.00 76.55  ? 1064 ARG A O     1 
ATOM   7909  C  CB    . ARG A 1  1064 ? -28.058 1.746   -69.117 1.00 82.28  ? 1064 ARG A CB    1 
ATOM   7910  C  CG    . ARG A 1  1064 ? -27.087 2.461   -68.187 1.00 85.89  ? 1064 ARG A CG    1 
ATOM   7911  C  CD    . ARG A 1  1064 ? -26.731 3.863   -68.678 1.00 90.29  ? 1064 ARG A CD    1 
ATOM   7912  N  NE    . ARG A 1  1064 ? -25.948 3.833   -69.922 1.00 93.21  ? 1064 ARG A NE    1 
ATOM   7913  C  CZ    . ARG A 1  1064 ? -24.650 3.519   -70.024 1.00 93.62  ? 1064 ARG A CZ    1 
ATOM   7914  N  NH1   . ARG A 1  1064 ? -23.925 3.187   -68.953 1.00 93.33  ? 1064 ARG A NH1   1 
ATOM   7915  N  NH2   . ARG A 1  1064 ? -24.066 3.529   -71.221 1.00 94.46  ? 1064 ARG A NH2   1 
ATOM   7916  N  N     . MET A 1  1065 ? -30.441 -1.146  -68.962 1.00 70.41  ? 1065 MET A N     1 
ATOM   7917  C  CA    . MET A 1  1065 ? -31.409 -1.902  -69.755 1.00 67.22  ? 1065 MET A CA    1 
ATOM   7918  C  C     . MET A 1  1065 ? -32.597 -2.277  -68.887 1.00 65.24  ? 1065 MET A C     1 
ATOM   7919  O  O     . MET A 1  1065 ? -32.462 -2.345  -67.668 1.00 64.10  ? 1065 MET A O     1 
ATOM   7920  C  CB    . MET A 1  1065 ? -30.769 -3.170  -70.323 1.00 65.64  ? 1065 MET A CB    1 
ATOM   7921  C  CG    . MET A 1  1065 ? -30.098 -4.064  -69.285 1.00 64.12  ? 1065 MET A CG    1 
ATOM   7922  S  SD    . MET A 1  1065 ? -29.445 -5.596  -69.969 1.00 61.57  ? 1065 MET A SD    1 
ATOM   7923  C  CE    . MET A 1  1065 ? -28.204 -4.984  -71.100 1.00 62.34  ? 1065 MET A CE    1 
ATOM   7924  N  N     . PRO A 1  1066 ? -33.765 -2.529  -69.507 1.00 63.96  ? 1066 PRO A N     1 
ATOM   7925  C  CA    . PRO A 1  1066 ? -34.918 -2.943  -68.704 1.00 63.63  ? 1066 PRO A CA    1 
ATOM   7926  C  C     . PRO A 1  1066 ? -34.688 -4.288  -67.995 1.00 62.75  ? 1066 PRO A C     1 
ATOM   7927  O  O     . PRO A 1  1066 ? -33.867 -5.096  -68.448 1.00 62.52  ? 1066 PRO A O     1 
ATOM   7928  C  CB    . PRO A 1  1066 ? -36.048 -3.074  -69.739 1.00 63.27  ? 1066 PRO A CB    1 
ATOM   7929  C  CG    . PRO A 1  1066 ? -35.567 -2.379  -70.958 1.00 63.89  ? 1066 PRO A CG    1 
ATOM   7930  C  CD    . PRO A 1  1066 ? -34.082 -2.512  -70.944 1.00 63.94  ? 1066 PRO A CD    1 
ATOM   7931  N  N     . MET A 1  1067 ? -35.412 -4.517  -66.903 1.00 62.20  ? 1067 MET A N     1 
ATOM   7932  C  CA    . MET A 1  1067 ? -35.342 -5.791  -66.178 1.00 60.64  ? 1067 MET A CA    1 
ATOM   7933  C  C     . MET A 1  1067 ? -35.914 -6.948  -67.002 1.00 59.76  ? 1067 MET A C     1 
ATOM   7934  O  O     . MET A 1  1067 ? -35.487 -8.093  -66.848 1.00 59.52  ? 1067 MET A O     1 
ATOM   7935  C  CB    . MET A 1  1067 ? -36.055 -5.681  -64.833 1.00 60.67  ? 1067 MET A CB    1 
ATOM   7936  C  CG    . MET A 1  1067 ? -35.352 -4.740  -63.866 1.00 61.89  ? 1067 MET A CG    1 
ATOM   7937  S  SD    . MET A 1  1067 ? -36.208 -4.543  -62.295 1.00 62.32  ? 1067 MET A SD    1 
ATOM   7938  C  CE    . MET A 1  1067 ? -35.919 -6.138  -61.534 1.00 60.64  ? 1067 MET A CE    1 
ATOM   7939  N  N     . SER A 1  1068 ? -36.863 -6.640  -67.885 1.00 59.81  ? 1068 SER A N     1 
ATOM   7940  C  CA    . SER A 1  1068 ? -37.408 -7.608  -68.837 1.00 58.90  ? 1068 SER A CA    1 
ATOM   7941  C  C     . SER A 1  1068 ? -36.360 -8.198  -69.779 1.00 59.04  ? 1068 SER A C     1 
ATOM   7942  O  O     . SER A 1  1068 ? -36.533 -9.315  -70.262 1.00 59.41  ? 1068 SER A O     1 
ATOM   7943  C  CB    . SER A 1  1068 ? -38.510 -6.958  -69.670 1.00 59.64  ? 1068 SER A CB    1 
ATOM   7944  O  OG    . SER A 1  1068 ? -38.030 -5.802  -70.335 1.00 60.59  ? 1068 SER A OG    1 
ATOM   7945  N  N     . ASN A 1  1069 ? -35.297 -7.443  -70.055 1.00 59.89  ? 1069 ASN A N     1 
ATOM   7946  C  CA    . ASN A 1  1069 ? -34.205 -7.914  -70.911 1.00 59.97  ? 1069 ASN A CA    1 
ATOM   7947  C  C     . ASN A 1  1069 ? -33.180 -8.813  -70.212 1.00 59.19  ? 1069 ASN A C     1 
ATOM   7948  O  O     . ASN A 1  1069 ? -32.339 -9.421  -70.871 1.00 60.24  ? 1069 ASN A O     1 
ATOM   7949  C  CB    . ASN A 1  1069 ? -33.482 -6.727  -71.543 1.00 60.82  ? 1069 ASN A CB    1 
ATOM   7950  C  CG    . ASN A 1  1069 ? -32.655 -7.132  -72.741 1.00 61.04  ? 1069 ASN A CG    1 
ATOM   7951  O  OD1   . ASN A 1  1069 ? -33.175 -7.714  -73.688 1.00 61.54  ? 1069 ASN A OD1   1 
ATOM   7952  N  ND2   . ASN A 1  1069 ? -31.360 -6.851  -72.696 1.00 61.36  ? 1069 ASN A ND2   1 
ATOM   7953  N  N     . VAL A 1  1070 ? -33.242 -8.886  -68.885 1.00 58.74  ? 1070 VAL A N     1 
ATOM   7954  C  CA    . VAL A 1  1070 ? -32.348 -9.729  -68.103 1.00 57.68  ? 1070 VAL A CA    1 
ATOM   7955  C  C     . VAL A 1  1070 ? -33.149 -10.931 -67.636 1.00 56.04  ? 1070 VAL A C     1 
ATOM   7956  O  O     . VAL A 1  1070 ? -34.343 -10.815 -67.361 1.00 56.18  ? 1070 VAL A O     1 
ATOM   7957  C  CB    . VAL A 1  1070 ? -31.785 -8.988  -66.868 1.00 58.24  ? 1070 VAL A CB    1 
ATOM   7958  C  CG1   . VAL A 1  1070 ? -30.560 -9.707  -66.323 1.00 57.71  ? 1070 VAL A CG1   1 
ATOM   7959  C  CG2   . VAL A 1  1070 ? -31.426 -7.545  -67.205 1.00 59.52  ? 1070 VAL A CG2   1 
ATOM   7960  N  N     . HIS A 1  1071 ? -32.492 -12.083 -67.557 1.00 55.35  ? 1071 HIS A N     1 
ATOM   7961  C  CA    . HIS A 1  1071 ? -33.099 -13.289 -67.002 1.00 54.49  ? 1071 HIS A CA    1 
ATOM   7962  C  C     . HIS A 1  1071 ? -32.096 -14.076 -66.169 1.00 53.21  ? 1071 HIS A C     1 
ATOM   7963  O  O     . HIS A 1  1071 ? -30.896 -14.031 -66.417 1.00 53.71  ? 1071 HIS A O     1 
ATOM   7964  C  CB    . HIS A 1  1071 ? -33.664 -14.179 -68.111 1.00 54.90  ? 1071 HIS A CB    1 
ATOM   7965  C  CG    . HIS A 1  1071 ? -34.435 -15.352 -67.593 1.00 54.64  ? 1071 HIS A CG    1 
ATOM   7966  N  ND1   . HIS A 1  1071 ? -35.538 -15.211 -66.780 1.00 54.98  ? 1071 HIS A ND1   1 
ATOM   7967  C  CD2   . HIS A 1  1071 ? -34.246 -16.682 -67.742 1.00 54.15  ? 1071 HIS A CD2   1 
ATOM   7968  C  CE1   . HIS A 1  1071 ? -36.005 -16.404 -66.465 1.00 53.72  ? 1071 HIS A CE1   1 
ATOM   7969  N  NE2   . HIS A 1  1071 ? -35.237 -17.313 -67.034 1.00 53.43  ? 1071 HIS A NE2   1 
ATOM   7970  N  N     . LEU A 1  1072 ? -32.613 -14.778 -65.169 1.00 52.01  ? 1072 LEU A N     1 
ATOM   7971  C  CA    . LEU A 1  1072 ? -31.837 -15.660 -64.314 1.00 50.84  ? 1072 LEU A CA    1 
ATOM   7972  C  C     . LEU A 1  1072 ? -32.638 -16.945 -64.175 1.00 51.09  ? 1072 LEU A C     1 
ATOM   7973  O  O     . LEU A 1  1072 ? -33.864 -16.903 -64.022 1.00 50.63  ? 1072 LEU A O     1 
ATOM   7974  C  CB    . LEU A 1  1072 ? -31.617 -15.003 -62.955 1.00 50.42  ? 1072 LEU A CB    1 
ATOM   7975  C  CG    . LEU A 1  1072 ? -30.889 -15.804 -61.868 1.00 49.96  ? 1072 LEU A CG    1 
ATOM   7976  C  CD1   . LEU A 1  1072 ? -29.958 -14.913 -61.052 1.00 50.78  ? 1072 LEU A CD1   1 
ATOM   7977  C  CD2   . LEU A 1  1072 ? -31.849 -16.540 -60.944 1.00 49.10  ? 1072 LEU A CD2   1 
ATOM   7978  N  N     . ARG A 1  1073 ? -31.943 -18.078 -64.247 1.00 51.68  ? 1073 ARG A N     1 
ATOM   7979  C  CA    . ARG A 1  1073 ? -32.564 -19.395 -64.149 1.00 51.43  ? 1073 ARG A CA    1 
ATOM   7980  C  C     . ARG A 1  1073 ? -32.521 -19.901 -62.721 1.00 51.29  ? 1073 ARG A C     1 
ATOM   7981  O  O     . ARG A 1  1073 ? -33.530 -20.351 -62.197 1.00 52.34  ? 1073 ARG A O     1 
ATOM   7982  C  CB    . ARG A 1  1073 ? -31.847 -20.395 -65.053 1.00 51.27  ? 1073 ARG A CB    1 
ATOM   7983  C  CG    . ARG A 1  1073 ? -31.796 -19.981 -66.509 1.00 51.99  ? 1073 ARG A CG    1 
ATOM   7984  C  CD    . ARG A 1  1073 ? -31.579 -21.186 -67.405 1.00 52.47  ? 1073 ARG A CD    1 
ATOM   7985  N  NE    . ARG A 1  1073 ? -32.798 -21.981 -67.560 1.00 52.73  ? 1073 ARG A NE    1 
ATOM   7986  C  CZ    . ARG A 1  1073 ? -32.868 -23.176 -68.148 1.00 52.69  ? 1073 ARG A CZ    1 
ATOM   7987  N  NH1   . ARG A 1  1073 ? -31.787 -23.770 -68.649 1.00 52.85  ? 1073 ARG A NH1   1 
ATOM   7988  N  NH2   . ARG A 1  1073 ? -34.041 -23.792 -68.230 1.00 53.38  ? 1073 ARG A NH2   1 
ATOM   7989  N  N     . GLY A 1  1074 ? -31.344 -19.841 -62.106 1.00 51.08  ? 1074 GLY A N     1 
ATOM   7990  C  CA    . GLY A 1  1074 ? -31.165 -20.288 -60.731 1.00 50.21  ? 1074 GLY A CA    1 
ATOM   7991  C  C     . GLY A 1  1074 ? -29.724 -20.191 -60.261 1.00 50.39  ? 1074 GLY A C     1 
ATOM   7992  O  O     . GLY A 1  1074 ? -28.969 -19.327 -60.707 1.00 51.29  ? 1074 GLY A O     1 
ATOM   7993  N  N     . THR A 1  1075 ? -29.360 -21.082 -59.347 1.00 50.12  ? 1075 THR A N     1 
ATOM   7994  C  CA    . THR A 1  1075 ? -28.033 -21.140 -58.747 1.00 50.88  ? 1075 THR A CA    1 
ATOM   7995  C  C     . THR A 1  1075 ? -27.450 -22.528 -59.030 1.00 50.80  ? 1075 THR A C     1 
ATOM   7996  O  O     . THR A 1  1075 ? -28.174 -23.523 -58.990 1.00 50.64  ? 1075 THR A O     1 
ATOM   7997  C  CB    . THR A 1  1075 ? -28.118 -20.898 -57.223 1.00 51.05  ? 1075 THR A CB    1 
ATOM   7998  O  OG1   . THR A 1  1075 ? -28.891 -19.718 -56.967 1.00 52.09  ? 1075 THR A OG1   1 
ATOM   7999  C  CG2   . THR A 1  1075 ? -26.723 -20.753 -56.592 1.00 50.91  ? 1075 THR A CG2   1 
ATOM   8000  N  N     . SER A 1  1076 ? -26.156 -22.588 -59.339 1.00 51.42  ? 1076 SER A N     1 
ATOM   8001  C  CA    . SER A 1  1076 ? -25.502 -23.852 -59.683 1.00 51.79  ? 1076 SER A CA    1 
ATOM   8002  C  C     . SER A 1  1076 ? -23.998 -23.800 -59.441 1.00 52.99  ? 1076 SER A C     1 
ATOM   8003  O  O     . SER A 1  1076 ? -23.344 -22.800 -59.756 1.00 55.48  ? 1076 SER A O     1 
ATOM   8004  C  CB    . SER A 1  1076 ? -25.762 -24.209 -61.151 1.00 51.68  ? 1076 SER A CB    1 
ATOM   8005  O  OG    . SER A 1  1076 ? -25.181 -25.459 -61.497 1.00 51.17  ? 1076 SER A OG    1 
ATOM   8006  N  N     . THR A 1  1077 ? -23.460 -24.893 -58.902 1.00 52.46  ? 1077 THR A N     1 
ATOM   8007  C  CA    . THR A 1  1077 ? -22.019 -25.071 -58.750 1.00 52.47  ? 1077 THR A CA    1 
ATOM   8008  C  C     . THR A 1  1077 ? -21.314 -25.275 -60.097 1.00 52.93  ? 1077 THR A C     1 
ATOM   8009  O  O     . THR A 1  1077 ? -20.091 -25.119 -60.185 1.00 53.10  ? 1077 THR A O     1 
ATOM   8010  C  CB    . THR A 1  1077 ? -21.707 -26.271 -57.846 1.00 52.73  ? 1077 THR A CB    1 
ATOM   8011  O  OG1   . THR A 1  1077 ? -22.385 -27.425 -58.349 1.00 52.60  ? 1077 THR A OG1   1 
ATOM   8012  C  CG2   . THR A 1  1077 ? -22.162 -26.003 -56.408 1.00 52.73  ? 1077 THR A CG2   1 
ATOM   8013  N  N     . GLU A 1  1078 ? -22.081 -25.636 -61.134 1.00 52.53  ? 1078 GLU A N     1 
ATOM   8014  C  CA    . GLU A 1  1078 ? -21.559 -25.747 -62.502 1.00 52.12  ? 1078 GLU A CA    1 
ATOM   8015  C  C     . GLU A 1  1078 ? -21.287 -24.387 -63.152 1.00 51.10  ? 1078 GLU A C     1 
ATOM   8016  O  O     . GLU A 1  1078 ? -20.435 -24.298 -64.023 1.00 51.85  ? 1078 GLU A O     1 
ATOM   8017  C  CB    . GLU A 1  1078 ? -22.514 -26.571 -63.376 1.00 51.85  ? 1078 GLU A CB    1 
ATOM   8018  C  CG    . GLU A 1  1078 ? -21.876 -27.168 -64.631 1.00 52.03  ? 1078 GLU A CG    1 
ATOM   8019  C  CD    . GLU A 1  1078 ? -22.765 -28.188 -65.340 1.00 52.06  ? 1078 GLU A CD    1 
ATOM   8020  O  OE1   . GLU A 1  1078 ? -23.686 -28.751 -64.708 1.00 52.11  ? 1078 GLU A OE1   1 
ATOM   8021  O  OE2   . GLU A 1  1078 ? -22.541 -28.444 -66.542 1.00 52.01  ? 1078 GLU A OE2   1 
ATOM   8022  N  N     . THR A 1  1079 ? -21.996 -23.342 -62.733 1.00 50.24  ? 1079 THR A N     1 
ATOM   8023  C  CA    . THR A 1  1079 ? -21.827 -22.004 -63.304 1.00 50.89  ? 1079 THR A CA    1 
ATOM   8024  C  C     . THR A 1  1079 ? -20.955 -21.091 -62.449 1.00 51.66  ? 1079 THR A C     1 
ATOM   8025  O  O     . THR A 1  1079 ? -20.091 -20.379 -62.973 1.00 53.01  ? 1079 THR A O     1 
ATOM   8026  C  CB    . THR A 1  1079 ? -23.186 -21.316 -63.528 1.00 50.36  ? 1079 THR A CB    1 
ATOM   8027  O  OG1   . THR A 1  1079 ? -23.941 -21.327 -62.310 1.00 49.59  ? 1079 THR A OG1   1 
ATOM   8028  C  CG2   . THR A 1  1079 ? -23.961 -22.030 -64.629 1.00 49.65  ? 1079 THR A CG2   1 
ATOM   8029  N  N     . VAL A 1  1080 ? -21.193 -21.092 -61.144 1.00 51.50  ? 1080 VAL A N     1 
ATOM   8030  C  CA    . VAL A 1  1080 ? -20.421 -20.267 -60.220 1.00 52.38  ? 1080 VAL A CA    1 
ATOM   8031  C  C     . VAL A 1  1080 ? -19.886 -21.155 -59.099 1.00 53.20  ? 1080 VAL A C     1 
ATOM   8032  O  O     . VAL A 1  1080 ? -20.651 -21.582 -58.235 1.00 53.45  ? 1080 VAL A O     1 
ATOM   8033  C  CB    . VAL A 1  1080 ? -21.280 -19.126 -59.660 1.00 52.34  ? 1080 VAL A CB    1 
ATOM   8034  C  CG1   . VAL A 1  1080 ? -20.513 -18.330 -58.604 1.00 53.44  ? 1080 VAL A CG1   1 
ATOM   8035  C  CG2   . VAL A 1  1080 ? -21.748 -18.229 -60.800 1.00 52.01  ? 1080 VAL A CG2   1 
ATOM   8036  N  N     . PRO A 1  1081 ? -18.568 -21.440 -59.111 1.00 55.12  ? 1081 PRO A N     1 
ATOM   8037  C  CA    . PRO A 1  1081 ? -17.981 -22.350 -58.129 1.00 55.82  ? 1081 PRO A CA    1 
ATOM   8038  C  C     . PRO A 1  1081 ? -17.656 -21.673 -56.801 1.00 56.11  ? 1081 PRO A C     1 
ATOM   8039  O  O     . PRO A 1  1081 ? -17.556 -20.446 -56.739 1.00 56.30  ? 1081 PRO A O     1 
ATOM   8040  C  CB    . PRO A 1  1081 ? -16.681 -22.778 -58.810 1.00 56.39  ? 1081 PRO A CB    1 
ATOM   8041  C  CG    . PRO A 1  1081 ? -16.255 -21.547 -59.542 1.00 56.45  ? 1081 PRO A CG    1 
ATOM   8042  C  CD    . PRO A 1  1081 ? -17.531 -20.895 -60.013 1.00 55.92  ? 1081 PRO A CD    1 
ATOM   8043  N  N     . ASN A 1  1082 ? -17.491 -22.487 -55.760 1.00 56.67  ? 1082 ASN A N     1 
ATOM   8044  C  CA    . ASN A 1  1082 ? -16.935 -22.059 -54.464 1.00 56.74  ? 1082 ASN A CA    1 
ATOM   8045  C  C     . ASN A 1  1082 ? -17.720 -20.961 -53.728 1.00 57.28  ? 1082 ASN A C     1 
ATOM   8046  O  O     . ASN A 1  1082 ? -17.140 -20.203 -52.947 1.00 58.89  ? 1082 ASN A O     1 
ATOM   8047  C  CB    . ASN A 1  1082 ? -15.472 -21.616 -54.651 1.00 57.38  ? 1082 ASN A CB    1 
ATOM   8048  C  CG    . ASN A 1  1082 ? -14.671 -22.572 -55.520 1.00 57.13  ? 1082 ASN A CG    1 
ATOM   8049  O  OD1   . ASN A 1  1082 ? -14.921 -23.778 -55.534 1.00 57.04  ? 1082 ASN A OD1   1 
ATOM   8050  N  ND2   . ASN A 1  1082 ? -13.699 -22.037 -56.242 1.00 57.58  ? 1082 ASN A ND2   1 
ATOM   8051  N  N     . ALA A 1  1083 ? -19.028 -20.884 -53.964 1.00 56.85  ? 1083 ALA A N     1 
ATOM   8052  C  CA    . ALA A 1  1083 ? -19.863 -19.845 -53.361 1.00 57.37  ? 1083 ALA A CA    1 
ATOM   8053  C  C     . ALA A 1  1083 ? -20.130 -20.143 -51.890 1.00 59.16  ? 1083 ALA A C     1 
ATOM   8054  O  O     . ALA A 1  1083 ? -20.415 -21.292 -51.525 1.00 59.25  ? 1083 ALA A O     1 
ATOM   8055  C  CB    . ALA A 1  1083 ? -21.181 -19.731 -54.100 1.00 56.67  ? 1083 ALA A CB    1 
ATOM   8056  N  N     . ASN A 1  1084 ? -20.052 -19.101 -51.058 1.00 60.11  ? 1084 ASN A N     1 
ATOM   8057  C  CA    . ASN A 1  1084 ? -20.366 -19.213 -49.629 1.00 60.29  ? 1084 ASN A CA    1 
ATOM   8058  C  C     . ASN A 1  1084 ? -21.861 -19.422 -49.368 1.00 59.70  ? 1084 ASN A C     1 
ATOM   8059  O  O     . ASN A 1  1084 ? -22.703 -19.284 -50.264 1.00 58.46  ? 1084 ASN A O     1 
ATOM   8060  C  CB    . ASN A 1  1084 ? -19.878 -17.974 -48.860 1.00 61.51  ? 1084 ASN A CB    1 
ATOM   8061  C  CG    . ASN A 1  1084 ? -18.376 -17.970 -48.650 1.00 62.74  ? 1084 ASN A CG    1 
ATOM   8062  O  OD1   . ASN A 1  1084 ? -17.840 -18.823 -47.943 1.00 63.79  ? 1084 ASN A OD1   1 
ATOM   8063  N  ND2   . ASN A 1  1084 ? -17.690 -16.998 -49.243 1.00 63.13  ? 1084 ASN A ND2   1 
ATOM   8064  N  N     . ILE A 1  1085 ? -22.165 -19.769 -48.123 1.00 60.59  ? 1085 ILE A N     1 
ATOM   8065  C  CA    . ILE A 1  1085 ? -23.536 -19.984 -47.654 1.00 60.27  ? 1085 ILE A CA    1 
ATOM   8066  C  C     . ILE A 1  1085 ? -24.425 -18.762 -47.895 1.00 60.30  ? 1085 ILE A C     1 
ATOM   8067  O  O     . ILE A 1  1085 ? -23.971 -17.627 -47.759 1.00 61.43  ? 1085 ILE A O     1 
ATOM   8068  C  CB    . ILE A 1  1085 ? -23.552 -20.355 -46.144 1.00 60.52  ? 1085 ILE A CB    1 
ATOM   8069  C  CG1   . ILE A 1  1085 ? -24.945 -20.842 -45.722 1.00 60.64  ? 1085 ILE A CG1   1 
ATOM   8070  C  CG2   . ILE A 1  1085 ? -23.082 -19.189 -45.269 1.00 60.49  ? 1085 ILE A CG2   1 
ATOM   8071  C  CD1   . ILE A 1  1085 ? -24.998 -21.402 -44.319 1.00 60.96  ? 1085 ILE A CD1   1 
ATOM   8072  N  N     . SER A 1  1086 ? -25.680 -19.007 -48.268 1.00 60.31  ? 1086 SER A N     1 
ATOM   8073  C  CA    . SER A 1  1086 ? -26.686 -17.950 -48.337 1.00 60.68  ? 1086 SER A CA    1 
ATOM   8074  C  C     . SER A 1  1086 ? -27.250 -17.747 -46.939 1.00 62.83  ? 1086 SER A C     1 
ATOM   8075  O  O     . SER A 1  1086 ? -28.252 -18.358 -46.552 1.00 61.50  ? 1086 SER A O     1 
ATOM   8076  C  CB    . SER A 1  1086 ? -27.790 -18.274 -49.344 1.00 59.89  ? 1086 SER A CB    1 
ATOM   8077  O  OG    . SER A 1  1086 ? -27.359 -17.975 -50.658 1.00 59.39  ? 1086 SER A OG    1 
ATOM   8078  N  N     . GLY A 1  1087 ? -26.558 -16.898 -46.182 1.00 66.12  ? 1087 GLY A N     1 
ATOM   8079  C  CA    . GLY A 1  1087 ? -26.952 -16.539 -44.826 1.00 68.15  ? 1087 GLY A CA    1 
ATOM   8080  C  C     . GLY A 1  1087 ? -26.274 -15.259 -44.360 1.00 71.20  ? 1087 GLY A C     1 
ATOM   8081  O  O     . GLY A 1  1087 ? -25.535 -14.625 -45.121 1.00 72.97  ? 1087 GLY A O     1 
ATOM   8082  N  N     . GLY A 1  1088 ? -26.538 -14.881 -43.107 1.00 72.95  ? 1088 GLY A N     1 
ATOM   8083  C  CA    . GLY A 1  1088 ? -25.874 -13.745 -42.455 1.00 73.81  ? 1088 GLY A CA    1 
ATOM   8084  C  C     . GLY A 1  1088 ? -26.329 -12.343 -42.846 1.00 74.65  ? 1088 GLY A C     1 
ATOM   8085  O  O     . GLY A 1  1088 ? -25.597 -11.380 -42.603 1.00 76.37  ? 1088 GLY A O     1 
ATOM   8086  N  N     . SER A 1  1089 ? -27.526 -12.227 -43.435 1.00 73.67  ? 1089 SER A N     1 
ATOM   8087  C  CA    . SER A 1  1089 ? -28.118 -10.940 -43.875 1.00 72.52  ? 1089 SER A CA    1 
ATOM   8088  C  C     . SER A 1  1089 ? -27.349 -10.203 -44.977 1.00 71.17  ? 1089 SER A C     1 
ATOM   8089  O  O     . SER A 1  1089 ? -27.584 -9.020  -45.194 1.00 71.77  ? 1089 SER A O     1 
ATOM   8090  C  CB    . SER A 1  1089 ? -28.332 -9.983  -42.688 1.00 73.67  ? 1089 SER A CB    1 
ATOM   8091  O  OG    . SER A 1  1089 ? -28.918 -10.647 -41.587 1.00 74.43  ? 1089 SER A OG    1 
ATOM   8092  N  N     . VAL A 1  1090 ? -26.489 -10.910 -45.707 1.00 69.72  ? 1090 VAL A N     1 
ATOM   8093  C  CA    . VAL A 1  1090 ? -25.578 -10.279 -46.674 1.00 69.69  ? 1090 VAL A CA    1 
ATOM   8094  C  C     . VAL A 1  1090 ? -25.610 -10.889 -48.082 1.00 68.14  ? 1090 VAL A C     1 
ATOM   8095  O  O     . VAL A 1  1090 ? -24.755 -10.573 -48.905 1.00 67.83  ? 1090 VAL A O     1 
ATOM   8096  C  CB    . VAL A 1  1090 ? -24.122 -10.290 -46.138 1.00 70.22  ? 1090 VAL A CB    1 
ATOM   8097  C  CG1   . VAL A 1  1090 ? -23.978 -9.305  -44.997 1.00 70.75  ? 1090 VAL A CG1   1 
ATOM   8098  C  CG2   . VAL A 1  1090 ? -23.699 -11.689 -45.695 1.00 69.93  ? 1090 VAL A CG2   1 
ATOM   8099  N  N     . VAL A 1  1091 ? -26.607 -11.721 -48.376 1.00 67.87  ? 1091 VAL A N     1 
ATOM   8100  C  CA    . VAL A 1  1091 ? -26.617 -12.480 -49.630 1.00 68.37  ? 1091 VAL A CA    1 
ATOM   8101  C  C     . VAL A 1  1091 ? -26.687 -11.516 -50.815 1.00 68.97  ? 1091 VAL A C     1 
ATOM   8102  O  O     . VAL A 1  1091 ? -25.783 -11.502 -51.651 1.00 69.59  ? 1091 VAL A O     1 
ATOM   8103  C  CB    . VAL A 1  1091 ? -27.769 -13.522 -49.693 1.00 67.59  ? 1091 VAL A CB    1 
ATOM   8104  C  CG1   . VAL A 1  1091 ? -27.723 -14.328 -50.989 1.00 67.14  ? 1091 VAL A CG1   1 
ATOM   8105  C  CG2   . VAL A 1  1091 ? -27.702 -14.479 -48.509 1.00 67.44  ? 1091 VAL A CG2   1 
ATOM   8106  N  N     . ALA A 1  1092 ? -27.745 -10.710 -50.868 1.00 69.43  ? 1092 ALA A N     1 
ATOM   8107  C  CA    . ALA A 1  1092 ? -27.921 -9.723  -51.944 1.00 69.51  ? 1092 ALA A CA    1 
ATOM   8108  C  C     . ALA A 1  1092 ? -26.816 -8.671  -51.907 1.00 69.81  ? 1092 ALA A C     1 
ATOM   8109  O  O     . ALA A 1  1092 ? -26.292 -8.264  -52.941 1.00 69.31  ? 1092 ALA A O     1 
ATOM   8110  C  CB    . ALA A 1  1092 ? -29.287 -9.055  -51.840 1.00 69.38  ? 1092 ALA A CB    1 
ATOM   8111  N  N     . ASP A 1  1093 ? -26.473 -8.262  -50.693 1.00 71.29  ? 1093 ASP A N     1 
ATOM   8112  C  CA    . ASP A 1  1093 ? -25.406 -7.299  -50.419 1.00 73.60  ? 1093 ASP A CA    1 
ATOM   8113  C  C     . ASP A 1  1093 ? -24.093 -7.653  -51.132 1.00 72.54  ? 1093 ASP A C     1 
ATOM   8114  O  O     . ASP A 1  1093 ? -23.505 -6.813  -51.817 1.00 73.42  ? 1093 ASP A O     1 
ATOM   8115  C  CB    . ASP A 1  1093 ? -25.186 -7.239  -48.895 1.00 76.41  ? 1093 ASP A CB    1 
ATOM   8116  C  CG    . ASP A 1  1093 ? -24.522 -5.969  -48.434 1.00 79.96  ? 1093 ASP A CG    1 
ATOM   8117  O  OD1   . ASP A 1  1093 ? -23.915 -5.239  -49.256 1.00 83.29  ? 1093 ASP A OD1   1 
ATOM   8118  O  OD2   . ASP A 1  1093 ? -24.599 -5.711  -47.213 1.00 80.99  ? 1093 ASP A OD2   1 
ATOM   8119  N  N     . LEU A 1  1094 ? -23.660 -8.904  -50.981 1.00 70.74  ? 1094 LEU A N     1 
ATOM   8120  C  CA    . LEU A 1  1094 ? -22.361 -9.366  -51.489 1.00 69.98  ? 1094 LEU A CA    1 
ATOM   8121  C  C     . LEU A 1  1094 ? -22.414 -9.863  -52.932 1.00 68.95  ? 1094 LEU A C     1 
ATOM   8122  O  O     . LEU A 1  1094 ? -21.531 -9.544  -53.729 1.00 70.11  ? 1094 LEU A O     1 
ATOM   8123  C  CB    . LEU A 1  1094 ? -21.800 -10.463 -50.583 1.00 69.55  ? 1094 LEU A CB    1 
ATOM   8124  C  CG    . LEU A 1  1094 ? -21.509 -10.013 -49.147 1.00 70.71  ? 1094 LEU A CG    1 
ATOM   8125  C  CD1   . LEU A 1  1094 ? -21.281 -11.213 -48.238 1.00 69.94  ? 1094 LEU A CD1   1 
ATOM   8126  C  CD2   . LEU A 1  1094 ? -20.335 -9.039  -49.108 1.00 72.30  ? 1094 LEU A CD2   1 
ATOM   8127  N  N     . ASN A 1  1095 ? -23.430 -10.658 -53.260 1.00 67.34  ? 1095 ASN A N     1 
ATOM   8128  C  CA    . ASN A 1  1095 ? -23.638 -11.114 -54.644 1.00 65.97  ? 1095 ASN A CA    1 
ATOM   8129  C  C     . ASN A 1  1095 ? -23.998 -9.963  -55.581 1.00 65.94  ? 1095 ASN A C     1 
ATOM   8130  O  O     . ASN A 1  1095 ? -23.683 -10.012 -56.770 1.00 66.02  ? 1095 ASN A O     1 
ATOM   8131  C  CB    . ASN A 1  1095 ? -24.703 -12.211 -54.720 1.00 64.68  ? 1095 ASN A CB    1 
ATOM   8132  C  CG    . ASN A 1  1095 ? -24.210 -13.534 -54.168 1.00 64.25  ? 1095 ASN A CG    1 
ATOM   8133  O  OD1   . ASN A 1  1095 ? -23.543 -14.297 -54.872 1.00 65.30  ? 1095 ASN A OD1   1 
ATOM   8134  N  ND2   . ASN A 1  1095 ? -24.534 -13.819 -52.911 1.00 63.49  ? 1095 ASN A ND2   1 
ATOM   8135  N  N     . GLY A 1  1096 ? -24.653 -8.936  -55.040 1.00 65.33  ? 1096 GLY A N     1 
ATOM   8136  C  CA    . GLY A 1  1096 ? -24.895 -7.696  -55.766 1.00 65.76  ? 1096 GLY A CA    1 
ATOM   8137  C  C     . GLY A 1  1096 ? -23.629 -6.987  -56.203 1.00 66.34  ? 1096 GLY A C     1 
ATOM   8138  O  O     . GLY A 1  1096 ? -23.564 -6.496  -57.327 1.00 66.57  ? 1096 GLY A O     1 
ATOM   8139  N  N     . LEU A 1  1097 ? -22.627 -6.936  -55.327 1.00 66.83  ? 1097 LEU A N     1 
ATOM   8140  C  CA    . LEU A 1  1097 ? -21.322 -6.349  -55.678 1.00 68.22  ? 1097 LEU A CA    1 
ATOM   8141  C  C     . LEU A 1  1097 ? -20.607 -7.147  -56.770 1.00 67.98  ? 1097 LEU A C     1 
ATOM   8142  O  O     . LEU A 1  1097 ? -19.957 -6.565  -57.637 1.00 69.68  ? 1097 LEU A O     1 
ATOM   8143  C  CB    . LEU A 1  1097 ? -20.411 -6.206  -54.444 1.00 69.15  ? 1097 LEU A CB    1 
ATOM   8144  C  CG    . LEU A 1  1097 ? -20.797 -5.142  -53.404 1.00 69.69  ? 1097 LEU A CG    1 
ATOM   8145  C  CD1   . LEU A 1  1097 ? -19.945 -5.261  -52.154 1.00 70.35  ? 1097 LEU A CD1   1 
ATOM   8146  C  CD2   . LEU A 1  1097 ? -20.688 -3.736  -53.970 1.00 70.49  ? 1097 LEU A CD2   1 
ATOM   8147  N  N     . ALA A 1  1098 ? -20.730 -8.472  -56.720 1.00 67.36  ? 1098 ALA A N     1 
ATOM   8148  C  CA    . ALA A 1  1098 ? -20.159 -9.345  -57.748 1.00 66.74  ? 1098 ALA A CA    1 
ATOM   8149  C  C     . ALA A 1  1098 ? -20.899 -9.197  -59.075 1.00 65.96  ? 1098 ALA A C     1 
ATOM   8150  O  O     . ALA A 1  1098 ? -20.278 -9.164  -60.133 1.00 66.13  ? 1098 ALA A O     1 
ATOM   8151  C  CB    . ALA A 1  1098 ? -20.180 -10.797 -57.290 1.00 66.04  ? 1098 ALA A CB    1 
ATOM   8152  N  N     . VAL A 1  1099 ? -22.226 -9.113  -59.013 1.00 64.70  ? 1099 VAL A N     1 
ATOM   8153  C  CA    . VAL A 1  1099 ? -23.040 -8.863  -60.204 1.00 63.89  ? 1099 VAL A CA    1 
ATOM   8154  C  C     . VAL A 1  1099 ? -22.707 -7.490  -60.802 1.00 65.00  ? 1099 VAL A C     1 
ATOM   8155  O  O     . VAL A 1  1099 ? -22.638 -7.347  -62.024 1.00 65.54  ? 1099 VAL A O     1 
ATOM   8156  C  CB    . VAL A 1  1099 ? -24.555 -9.010  -59.901 1.00 62.41  ? 1099 VAL A CB    1 
ATOM   8157  C  CG1   . VAL A 1  1099 ? -25.414 -8.477  -61.039 1.00 62.64  ? 1099 VAL A CG1   1 
ATOM   8158  C  CG2   . VAL A 1  1099 ? -24.897 -10.469 -59.635 1.00 61.18  ? 1099 VAL A CG2   1 
ATOM   8159  N  N     . LYS A 1  1100 ? -22.490 -6.493  -59.942 1.00 66.09  ? 1100 LYS A N     1 
ATOM   8160  C  CA    . LYS A 1  1100 ? -22.087 -5.151  -60.387 1.00 67.00  ? 1100 LYS A CA    1 
ATOM   8161  C  C     . LYS A 1  1100 ? -20.737 -5.227  -61.095 1.00 66.37  ? 1100 LYS A C     1 
ATOM   8162  O  O     . LYS A 1  1100 ? -20.586 -4.715  -62.204 1.00 67.96  ? 1100 LYS A O     1 
ATOM   8163  C  CB    . LYS A 1  1100 ? -22.008 -4.172  -59.207 1.00 67.75  ? 1100 LYS A CB    1 
ATOM   8164  C  CG    . LYS A 1  1100 ? -22.095 -2.710  -59.610 1.00 69.34  ? 1100 LYS A CG    1 
ATOM   8165  C  CD    . LYS A 1  1100 ? -21.814 -1.759  -58.457 1.00 70.86  ? 1100 LYS A CD    1 
ATOM   8166  C  CE    . LYS A 1  1100 ? -20.329 -1.665  -58.148 1.00 72.21  ? 1100 LYS A CE    1 
ATOM   8167  N  NZ    . LYS A 1  1100 ? -20.050 -0.610  -57.140 1.00 73.90  ? 1100 LYS A NZ    1 
ATOM   8168  N  N     . ASP A 1  1101 ? -19.784 -5.894  -60.450 1.00 64.65  ? 1101 ASP A N     1 
ATOM   8169  C  CA    . ASP A 1  1101 ? -18.428 -6.079  -60.981 1.00 64.84  ? 1101 ASP A CA    1 
ATOM   8170  C  C     . ASP A 1  1101 ? -18.402 -6.679  -62.398 1.00 65.24  ? 1101 ASP A C     1 
ATOM   8171  O  O     . ASP A 1  1101 ? -17.640 -6.222  -63.250 1.00 66.05  ? 1101 ASP A O     1 
ATOM   8172  C  CB    . ASP A 1  1101 ? -17.609 -6.946  -60.015 1.00 63.63  ? 1101 ASP A CB    1 
ATOM   8173  C  CG    . ASP A 1  1101 ? -16.186 -7.153  -60.473 1.00 63.78  ? 1101 ASP A CG    1 
ATOM   8174  O  OD1   . ASP A 1  1101 ? -15.476 -6.149  -60.684 1.00 65.00  ? 1101 ASP A OD1   1 
ATOM   8175  O  OD2   . ASP A 1  1101 ? -15.774 -8.325  -60.615 1.00 63.13  ? 1101 ASP A OD2   1 
ATOM   8176  N  N     . ALA A 1  1102 ? -19.237 -7.689  -62.642 1.00 65.30  ? 1102 ALA A N     1 
ATOM   8177  C  CA    . ALA A 1  1102 ? -19.337 -8.319  -63.965 1.00 65.48  ? 1102 ALA A CA    1 
ATOM   8178  C  C     . ALA A 1  1102 ? -19.872 -7.356  -65.021 1.00 66.38  ? 1102 ALA A C     1 
ATOM   8179  O  O     . ALA A 1  1102 ? -19.337 -7.298  -66.129 1.00 67.00  ? 1102 ALA A O     1 
ATOM   8180  C  CB    . ALA A 1  1102 ? -20.215 -9.559  -63.910 1.00 64.84  ? 1102 ALA A CB    1 
ATOM   8181  N  N     . CYS A 1  1103 ? -20.923 -6.614  -64.677 1.00 66.61  ? 1103 CYS A N     1 
ATOM   8182  C  CA    . CYS A 1  1103 ? -21.525 -5.632  -65.592 1.00 67.03  ? 1103 CYS A CA    1 
ATOM   8183  C  C     . CYS A 1  1103 ? -20.557 -4.516  -65.987 1.00 69.46  ? 1103 CYS A C     1 
ATOM   8184  O  O     . CYS A 1  1103 ? -20.541 -4.092  -67.141 1.00 70.21  ? 1103 CYS A O     1 
ATOM   8185  C  CB    . CYS A 1  1103 ? -22.787 -5.022  -64.979 1.00 66.03  ? 1103 CYS A CB    1 
ATOM   8186  S  SG    . CYS A 1  1103 ? -24.110 -6.213  -64.693 1.00 62.92  ? 1103 CYS A SG    1 
ATOM   8187  N  N     . GLN A 1  1104 ? -19.760 -4.044  -65.031 1.00 71.69  ? 1104 GLN A N     1 
ATOM   8188  C  CA    . GLN A 1  1104 ? -18.760 -3.007  -65.302 1.00 74.00  ? 1104 GLN A CA    1 
ATOM   8189  C  C     . GLN A 1  1104 ? -17.629 -3.522  -66.196 1.00 73.45  ? 1104 GLN A C     1 
ATOM   8190  O  O     . GLN A 1  1104 ? -17.199 -2.821  -67.109 1.00 74.77  ? 1104 GLN A O     1 
ATOM   8191  C  CB    . GLN A 1  1104 ? -18.211 -2.429  -63.997 1.00 75.83  ? 1104 GLN A CB    1 
ATOM   8192  C  CG    . GLN A 1  1104 ? -19.259 -1.632  -63.237 1.00 77.47  ? 1104 GLN A CG    1 
ATOM   8193  C  CD    . GLN A 1  1104 ? -18.735 -1.002  -61.961 1.00 79.63  ? 1104 GLN A CD    1 
ATOM   8194  O  OE1   . GLN A 1  1104 ? -17.592 -1.228  -61.562 1.00 81.85  ? 1104 GLN A OE1   1 
ATOM   8195  N  NE2   . GLN A 1  1104 ? -19.577 -0.205  -61.310 1.00 80.53  ? 1104 GLN A NE2   1 
ATOM   8196  N  N     . THR A 1  1105 ? -17.172 -4.749  -65.947 1.00 71.73  ? 1105 THR A N     1 
ATOM   8197  C  CA    . THR A 1  1105 ? -16.218 -5.420  -66.833 1.00 71.21  ? 1105 THR A CA    1 
ATOM   8198  C  C     . THR A 1  1105 ? -16.720 -5.449  -68.273 1.00 71.61  ? 1105 THR A C     1 
ATOM   8199  O  O     . THR A 1  1105 ? -15.949 -5.204  -69.199 1.00 73.55  ? 1105 THR A O     1 
ATOM   8200  C  CB    . THR A 1  1105 ? -15.949 -6.874  -66.393 1.00 69.63  ? 1105 THR A CB    1 
ATOM   8201  O  OG1   . THR A 1  1105 ? -15.535 -6.893  -65.024 1.00 69.69  ? 1105 THR A OG1   1 
ATOM   8202  C  CG2   . THR A 1  1105 ? -14.872 -7.522  -67.255 1.00 69.42  ? 1105 THR A CG2   1 
ATOM   8203  N  N     . LEU A 1  1106 ? -18.006 -5.746  -68.451 1.00 70.94  ? 1106 LEU A N     1 
ATOM   8204  C  CA    . LEU A 1  1106 ? -18.616 -5.768  -69.782 1.00 71.68  ? 1106 LEU A CA    1 
ATOM   8205  C  C     . LEU A 1  1106 ? -18.686 -4.381  -70.429 1.00 74.90  ? 1106 LEU A C     1 
ATOM   8206  O  O     . LEU A 1  1106 ? -18.484 -4.266  -71.638 1.00 77.61  ? 1106 LEU A O     1 
ATOM   8207  C  CB    . LEU A 1  1106 ? -20.003 -6.419  -69.739 1.00 69.75  ? 1106 LEU A CB    1 
ATOM   8208  C  CG    . LEU A 1  1106 ? -20.005 -7.926  -69.436 1.00 67.80  ? 1106 LEU A CG    1 
ATOM   8209  C  CD1   . LEU A 1  1106 ? -21.405 -8.433  -69.122 1.00 66.39  ? 1106 LEU A CD1   1 
ATOM   8210  C  CD2   . LEU A 1  1106 ? -19.398 -8.726  -70.582 1.00 67.66  ? 1106 LEU A CD2   1 
ATOM   8211  N  N     . LEU A 1  1107 ? -18.953 -3.342  -69.637 1.00 77.01  ? 1107 LEU A N     1 
ATOM   8212  C  CA    . LEU A 1  1107 ? -18.963 -1.963  -70.142 1.00 79.68  ? 1107 LEU A CA    1 
ATOM   8213  C  C     . LEU A 1  1107 ? -17.581 -1.477  -70.586 1.00 82.75  ? 1107 LEU A C     1 
ATOM   8214  O  O     . LEU A 1  1107 ? -17.467 -0.845  -71.639 1.00 84.98  ? 1107 LEU A O     1 
ATOM   8215  C  CB    . LEU A 1  1107 ? -19.531 -0.994  -69.100 1.00 80.63  ? 1107 LEU A CB    1 
ATOM   8216  C  CG    . LEU A 1  1107 ? -21.037 -1.025  -68.830 1.00 80.75  ? 1107 LEU A CG    1 
ATOM   8217  C  CD1   . LEU A 1  1107 ? -21.375 -0.127  -67.641 1.00 81.79  ? 1107 LEU A CD1   1 
ATOM   8218  C  CD2   . LEU A 1  1107 ? -21.832 -0.620  -70.069 1.00 81.48  ? 1107 LEU A CD2   1 
ATOM   8219  N  N     . LYS A 1  1108 ? -16.544 -1.756  -69.791 1.00 83.98  ? 1108 LYS A N     1 
ATOM   8220  C  CA    . LYS A 1  1108 ? -15.157 -1.411  -70.167 1.00 86.41  ? 1108 LYS A CA    1 
ATOM   8221  C  C     . LYS A 1  1108 ? -14.815 -1.906  -71.573 1.00 86.24  ? 1108 LYS A C     1 
ATOM   8222  O  O     . LYS A 1  1108 ? -14.274 -1.153  -72.382 1.00 88.77  ? 1108 LYS A O     1 
ATOM   8223  C  CB    . LYS A 1  1108 ? -14.126 -1.973  -69.168 1.00 87.92  ? 1108 LYS A CB    1 
ATOM   8224  C  CG    . LYS A 1  1108 ? -13.716 -1.028  -68.043 1.00 90.06  ? 1108 LYS A CG    1 
ATOM   8225  C  CD    . LYS A 1  1108 ? -14.693 -1.056  -66.876 1.00 91.06  ? 1108 LYS A CD    1 
ATOM   8226  C  CE    . LYS A 1  1108 ? -14.234 -0.179  -65.716 1.00 93.03  ? 1108 LYS A CE    1 
ATOM   8227  N  NZ    . LYS A 1  1108 ? -15.242 -0.138  -64.618 1.00 92.64  ? 1108 LYS A NZ    1 
ATOM   8228  N  N     . ARG A 1  1109 ? -15.144 -3.167  -71.847 1.00 84.38  ? 1109 ARG A N     1 
ATOM   8229  C  CA    . ARG A 1  1109 ? -14.927 -3.772  -73.168 1.00 83.64  ? 1109 ARG A CA    1 
ATOM   8230  C  C     . ARG A 1  1109 ? -15.753 -3.099  -74.260 1.00 84.18  ? 1109 ARG A C     1 
ATOM   8231  O  O     . ARG A 1  1109 ? -15.261 -2.863  -75.366 1.00 84.96  ? 1109 ARG A O     1 
ATOM   8232  C  CB    . ARG A 1  1109 ? -15.276 -5.261  -73.140 1.00 81.52  ? 1109 ARG A CB    1 
ATOM   8233  C  CG    . ARG A 1  1109 ? -14.371 -6.109  -72.264 1.00 80.34  ? 1109 ARG A CG    1 
ATOM   8234  C  CD    . ARG A 1  1109 ? -14.775 -7.569  -72.346 1.00 78.60  ? 1109 ARG A CD    1 
ATOM   8235  N  NE    . ARG A 1  1109 ? -14.373 -8.321  -71.159 1.00 76.95  ? 1109 ARG A NE    1 
ATOM   8236  C  CZ    . ARG A 1  1109 ? -14.847 -9.521  -70.817 1.00 75.76  ? 1109 ARG A CZ    1 
ATOM   8237  N  NH1   . ARG A 1  1109 ? -15.753 -10.149 -71.566 1.00 74.97  ? 1109 ARG A NH1   1 
ATOM   8238  N  NH2   . ARG A 1  1109 ? -14.410 -10.108 -69.705 1.00 75.72  ? 1109 ARG A NH2   1 
ATOM   8239  N  N     . LEU A 1  1110 ? -17.008 -2.799  -73.933 1.00 83.88  ? 1110 LEU A N     1 
ATOM   8240  C  CA    . LEU A 1  1110 ? -17.947 -2.177  -74.870 1.00 85.27  ? 1110 LEU A CA    1 
ATOM   8241  C  C     . LEU A 1  1110 ? -17.873 -0.646  -74.957 1.00 88.41  ? 1110 LEU A C     1 
ATOM   8242  O  O     . LEU A 1  1110 ? -18.612 -0.058  -75.745 1.00 90.20  ? 1110 LEU A O     1 
ATOM   8243  C  CB    . LEU A 1  1110 ? -19.382 -2.595  -74.516 1.00 83.48  ? 1110 LEU A CB    1 
ATOM   8244  C  CG    . LEU A 1  1110 ? -19.710 -4.086  -74.649 1.00 80.71  ? 1110 LEU A CG    1 
ATOM   8245  C  CD1   . LEU A 1  1110 ? -20.980 -4.411  -73.884 1.00 79.24  ? 1110 LEU A CD1   1 
ATOM   8246  C  CD2   . LEU A 1  1110 ? -19.853 -4.486  -76.108 1.00 80.54  ? 1110 LEU A CD2   1 
ATOM   8247  N  N     . GLU A 1  1111 ? -17.011 0.004   -74.168 1.00 91.39  ? 1111 GLU A N     1 
ATOM   8248  C  CA    . GLU A 1  1111 ? -16.866 1.477   -74.227 1.00 95.04  ? 1111 GLU A CA    1 
ATOM   8249  C  C     . GLU A 1  1111 ? -16.596 2.014   -75.647 1.00 94.86  ? 1111 GLU A C     1 
ATOM   8250  O  O     . GLU A 1  1111 ? -17.275 2.951   -76.073 1.00 95.67  ? 1111 GLU A O     1 
ATOM   8251  C  CB    . GLU A 1  1111 ? -15.800 2.007   -73.240 1.00 98.50  ? 1111 GLU A CB    1 
ATOM   8252  C  CG    . GLU A 1  1111 ? -16.356 2.477   -71.899 1.00 100.59 ? 1111 GLU A CG    1 
ATOM   8253  C  CD    . GLU A 1  1111 ? -15.308 3.159   -71.032 1.00 103.61 ? 1111 GLU A CD    1 
ATOM   8254  O  OE1   . GLU A 1  1111 ? -14.428 2.452   -70.489 1.00 104.79 ? 1111 GLU A OE1   1 
ATOM   8255  O  OE2   . GLU A 1  1111 ? -15.367 4.402   -70.882 1.00 104.85 ? 1111 GLU A OE2   1 
ATOM   8256  N  N     . PRO A 1  1112 ? -15.611 1.430   -76.371 1.00 93.47  ? 1112 PRO A N     1 
ATOM   8257  C  CA    . PRO A 1  1112 ? -15.445 1.740   -77.793 1.00 94.02  ? 1112 PRO A CA    1 
ATOM   8258  C  C     . PRO A 1  1112 ? -16.740 1.631   -78.597 1.00 93.64  ? 1112 PRO A C     1 
ATOM   8259  O  O     . PRO A 1  1112 ? -17.088 2.564   -79.315 1.00 95.32  ? 1112 PRO A O     1 
ATOM   8260  C  CB    . PRO A 1  1112 ? -14.431 0.692   -78.259 1.00 93.51  ? 1112 PRO A CB    1 
ATOM   8261  C  CG    . PRO A 1  1112 ? -13.583 0.459   -77.065 1.00 93.39  ? 1112 PRO A CG    1 
ATOM   8262  C  CD    . PRO A 1  1112 ? -14.470 0.642   -75.862 1.00 93.03  ? 1112 PRO A CD    1 
ATOM   8263  N  N     . ILE A 1  1113 ? -17.453 0.517   -78.435 1.00 91.67  ? 1113 ILE A N     1 
ATOM   8264  C  CA    . ILE A 1  1113 ? -18.678 0.241   -79.195 1.00 90.77  ? 1113 ILE A CA    1 
ATOM   8265  C  C     . ILE A 1  1113 ? -19.775 1.269   -78.879 1.00 91.86  ? 1113 ILE A C     1 
ATOM   8266  O  O     . ILE A 1  1113 ? -20.459 1.748   -79.787 1.00 92.84  ? 1113 ILE A O     1 
ATOM   8267  C  CB    . ILE A 1  1113 ? -19.206 -1.197  -78.925 1.00 88.88  ? 1113 ILE A CB    1 
ATOM   8268  C  CG1   . ILE A 1  1113 ? -18.192 -2.268  -79.379 1.00 88.20  ? 1113 ILE A CG1   1 
ATOM   8269  C  CG2   . ILE A 1  1113 ? -20.559 -1.435  -79.598 1.00 88.69  ? 1113 ILE A CG2   1 
ATOM   8270  C  CD1   . ILE A 1  1113 ? -18.123 -2.500  -80.874 1.00 88.47  ? 1113 ILE A CD1   1 
ATOM   8271  N  N     . ILE A 1  1114 ? -19.922 1.610   -77.599 1.00 91.70  ? 1114 ILE A N     1 
ATOM   8272  C  CA    . ILE A 1  1114 ? -21.004 2.491   -77.136 1.00 92.36  ? 1114 ILE A CA    1 
ATOM   8273  C  C     . ILE A 1  1114 ? -20.794 3.949   -77.560 1.00 94.03  ? 1114 ILE A C     1 
ATOM   8274  O  O     . ILE A 1  1114 ? -21.761 4.648   -77.868 1.00 94.14  ? 1114 ILE A O     1 
ATOM   8275  C  CB    . ILE A 1  1114 ? -21.196 2.382   -75.601 1.00 92.19  ? 1114 ILE A CB    1 
ATOM   8276  C  CG1   . ILE A 1  1114 ? -21.631 0.957   -75.217 1.00 90.88  ? 1114 ILE A CG1   1 
ATOM   8277  C  CG2   . ILE A 1  1114 ? -22.243 3.374   -75.093 1.00 92.79  ? 1114 ILE A CG2   1 
ATOM   8278  C  CD1   . ILE A 1  1114 ? -21.296 0.570   -73.793 1.00 90.30  ? 1114 ILE A CD1   1 
ATOM   8279  N  N     . SER A 1  1115 ? -19.541 4.402   -77.578 1.00 95.50  ? 1115 SER A N     1 
ATOM   8280  C  CA    . SER A 1  1115 ? -19.220 5.780   -77.971 1.00 97.10  ? 1115 SER A CA    1 
ATOM   8281  C  C     . SER A 1  1115 ? -19.460 6.048   -79.465 1.00 98.12  ? 1115 SER A C     1 
ATOM   8282  O  O     . SER A 1  1115 ? -19.996 7.098   -79.821 1.00 99.07  ? 1115 SER A O     1 
ATOM   8283  C  CB    . SER A 1  1115 ? -17.777 6.125   -77.587 1.00 97.53  ? 1115 SER A CB    1 
ATOM   8284  O  OG    . SER A 1  1115 ? -16.870 5.170   -78.107 1.00 97.28  ? 1115 SER A OG    1 
ATOM   8285  N  N     . LYS A 1  1116 ? -19.076 5.100   -80.325 1.00 97.98  ? 1116 LYS A N     1 
ATOM   8286  C  CA    . LYS A 1  1116 ? -19.325 5.205   -81.782 1.00 98.77  ? 1116 LYS A CA    1 
ATOM   8287  C  C     . LYS A 1  1116 ? -20.815 5.186   -82.153 1.00 97.61  ? 1116 LYS A C     1 
ATOM   8288  O  O     . LYS A 1  1116 ? -21.190 5.705   -83.201 1.00 99.02  ? 1116 LYS A O     1 
ATOM   8289  C  CB    . LYS A 1  1116 ? -18.602 4.095   -82.572 1.00 98.72  ? 1116 LYS A CB    1 
ATOM   8290  C  CG    . LYS A 1  1116 ? -17.154 4.392   -82.945 1.00 101.03 ? 1116 LYS A CG    1 
ATOM   8291  C  CD    . LYS A 1  1116 ? -16.189 4.032   -81.828 1.00 101.19 ? 1116 LYS A CD    1 
ATOM   8292  C  CE    . LYS A 1  1116 ? -14.756 4.433   -82.146 1.00 103.04 ? 1116 LYS A CE    1 
ATOM   8293  N  NZ    . LYS A 1  1116 ? -13.847 4.149   -80.998 1.00 102.30 ? 1116 LYS A NZ    1 
ATOM   8294  N  N     . ASN A 1  1117 ? -21.641 4.573   -81.304 1.00 95.48  ? 1117 ASN A N     1 
ATOM   8295  C  CA    . ASN A 1  1117 ? -23.078 4.430   -81.536 1.00 94.14  ? 1117 ASN A CA    1 
ATOM   8296  C  C     . ASN A 1  1117 ? -23.833 4.643   -80.211 1.00 92.57  ? 1117 ASN A C     1 
ATOM   8297  O  O     . ASN A 1  1117 ? -24.286 3.680   -79.588 1.00 90.49  ? 1117 ASN A O     1 
ATOM   8298  C  CB    . ASN A 1  1117 ? -23.341 3.039   -82.136 1.00 92.88  ? 1117 ASN A CB    1 
ATOM   8299  C  CG    . ASN A 1  1117 ? -24.795 2.810   -82.526 1.00 92.38  ? 1117 ASN A CG    1 
ATOM   8300  O  OD1   . ASN A 1  1117 ? -25.627 3.721   -82.497 1.00 92.69  ? 1117 ASN A OD1   1 
ATOM   8301  N  ND2   . ASN A 1  1117 ? -25.105 1.571   -82.896 1.00 91.05  ? 1117 ASN A ND2   1 
ATOM   8302  N  N     . PRO A 1  1118 ? -23.955 5.910   -79.763 1.00 93.26  ? 1118 PRO A N     1 
ATOM   8303  C  CA    . PRO A 1  1118 ? -24.634 6.200   -78.488 1.00 92.18  ? 1118 PRO A CA    1 
ATOM   8304  C  C     . PRO A 1  1118 ? -26.143 5.920   -78.504 1.00 90.93  ? 1118 PRO A C     1 
ATOM   8305  O  O     . PRO A 1  1118 ? -26.692 5.447   -77.507 1.00 88.88  ? 1118 PRO A O     1 
ATOM   8306  C  CB    . PRO A 1  1118 ? -24.369 7.703   -78.272 1.00 94.07  ? 1118 PRO A CB    1 
ATOM   8307  C  CG    . PRO A 1  1118 ? -23.328 8.089   -79.266 1.00 95.04  ? 1118 PRO A CG    1 
ATOM   8308  C  CD    . PRO A 1  1118 ? -23.488 7.148   -80.415 1.00 94.84  ? 1118 PRO A CD    1 
ATOM   8309  N  N     . LYS A 1  1119 ? -26.795 6.206   -79.630 1.00 91.96  ? 1119 LYS A N     1 
ATOM   8310  C  CA    . LYS A 1  1119 ? -28.229 5.934   -79.802 1.00 91.72  ? 1119 LYS A CA    1 
ATOM   8311  C  C     . LYS A 1  1119 ? -28.582 4.448   -79.953 1.00 88.97  ? 1119 LYS A C     1 
ATOM   8312  O  O     . LYS A 1  1119 ? -29.761 4.098   -79.900 1.00 88.33  ? 1119 LYS A O     1 
ATOM   8313  C  CB    . LYS A 1  1119 ? -28.772 6.689   -81.022 1.00 94.24  ? 1119 LYS A CB    1 
ATOM   8314  C  CG    . LYS A 1  1119 ? -28.750 8.203   -80.888 1.00 96.95  ? 1119 LYS A CG    1 
ATOM   8315  C  CD    . LYS A 1  1119 ? -28.994 8.886   -82.229 1.00 99.49  ? 1119 LYS A CD    1 
ATOM   8316  C  CE    . LYS A 1  1119 ? -27.738 8.939   -83.097 1.00 100.77 ? 1119 LYS A CE    1 
ATOM   8317  N  NZ    . LYS A 1  1119 ? -26.681 9.842   -82.556 1.00 101.77 ? 1119 LYS A NZ    1 
ATOM   8318  N  N     . GLY A 1  1120 ? -27.582 3.587   -80.152 1.00 87.19  ? 1120 GLY A N     1 
ATOM   8319  C  CA    . GLY A 1  1120 ? -27.809 2.170   -80.439 1.00 85.52  ? 1120 GLY A CA    1 
ATOM   8320  C  C     . GLY A 1  1120 ? -28.492 1.350   -79.356 1.00 82.68  ? 1120 GLY A C     1 
ATOM   8321  O  O     . GLY A 1  1120 ? -28.479 1.714   -78.173 1.00 83.48  ? 1120 GLY A O     1 
ATOM   8322  N  N     . THR A 1  1121 ? -29.098 0.242   -79.785 1.00 79.55  ? 1121 THR A N     1 
ATOM   8323  C  CA    . THR A 1  1121 ? -29.723 -0.727  -78.885 1.00 76.09  ? 1121 THR A CA    1 
ATOM   8324  C  C     . THR A 1  1121 ? -28.671 -1.709  -78.382 1.00 73.33  ? 1121 THR A C     1 
ATOM   8325  O  O     . THR A 1  1121 ? -27.554 -1.748  -78.891 1.00 74.17  ? 1121 THR A O     1 
ATOM   8326  C  CB    . THR A 1  1121 ? -30.854 -1.508  -79.588 1.00 75.20  ? 1121 THR A CB    1 
ATOM   8327  O  OG1   . THR A 1  1121 ? -30.317 -2.306  -80.650 1.00 75.05  ? 1121 THR A OG1   1 
ATOM   8328  C  CG2   . THR A 1  1121 ? -31.900 -0.557  -80.151 1.00 76.00  ? 1121 THR A CG2   1 
ATOM   8329  N  N     . TRP A 1  1122 ? -29.030 -2.496  -77.378 1.00 71.01  ? 1122 TRP A N     1 
ATOM   8330  C  CA    . TRP A 1  1122 ? -28.131 -3.538  -76.873 1.00 70.00  ? 1122 TRP A CA    1 
ATOM   8331  C  C     . TRP A 1  1122 ? -27.884 -4.649  -77.904 1.00 69.41  ? 1122 TRP A C     1 
ATOM   8332  O  O     . TRP A 1  1122 ? -26.781 -5.201  -77.974 1.00 67.78  ? 1122 TRP A O     1 
ATOM   8333  C  CB    . TRP A 1  1122 ? -28.631 -4.109  -75.533 1.00 68.52  ? 1122 TRP A CB    1 
ATOM   8334  C  CG    . TRP A 1  1122 ? -28.024 -3.388  -74.376 1.00 69.03  ? 1122 TRP A CG    1 
ATOM   8335  C  CD1   . TRP A 1  1122 ? -28.601 -2.421  -73.604 1.00 69.33  ? 1122 TRP A CD1   1 
ATOM   8336  C  CD2   . TRP A 1  1122 ? -26.689 -3.548  -73.892 1.00 69.29  ? 1122 TRP A CD2   1 
ATOM   8337  N  NE1   . TRP A 1  1122 ? -27.708 -1.984  -72.653 1.00 69.90  ? 1122 TRP A NE1   1 
ATOM   8338  C  CE2   . TRP A 1  1122 ? -26.524 -2.658  -72.812 1.00 69.93  ? 1122 TRP A CE2   1 
ATOM   8339  C  CE3   . TRP A 1  1122 ? -25.614 -4.363  -74.267 1.00 69.02  ? 1122 TRP A CE3   1 
ATOM   8340  C  CZ2   . TRP A 1  1122 ? -25.318 -2.570  -72.091 1.00 69.95  ? 1122 TRP A CZ2   1 
ATOM   8341  C  CZ3   . TRP A 1  1122 ? -24.425 -4.276  -73.557 1.00 69.01  ? 1122 TRP A CZ3   1 
ATOM   8342  C  CH2   . TRP A 1  1122 ? -24.285 -3.385  -72.483 1.00 69.57  ? 1122 TRP A CH2   1 
ATOM   8343  N  N     . LYS A 1  1123 ? -28.906 -4.954  -78.702 1.00 69.94  ? 1123 LYS A N     1 
ATOM   8344  C  CA    . LYS A 1  1123 ? -28.785 -5.898  -79.812 1.00 70.29  ? 1123 LYS A CA    1 
ATOM   8345  C  C     . LYS A 1  1123 ? -27.713 -5.469  -80.815 1.00 71.58  ? 1123 LYS A C     1 
ATOM   8346  O  O     . LYS A 1  1123 ? -26.962 -6.302  -81.307 1.00 72.18  ? 1123 LYS A O     1 
ATOM   8347  C  CB    . LYS A 1  1123 ? -30.135 -6.060  -80.519 1.00 70.94  ? 1123 LYS A CB    1 
ATOM   8348  C  CG    . LYS A 1  1123 ? -30.130 -7.046  -81.674 1.00 71.46  ? 1123 LYS A CG    1 
ATOM   8349  C  CD    . LYS A 1  1123 ? -31.535 -7.363  -82.146 1.00 72.54  ? 1123 LYS A CD    1 
ATOM   8350  C  CE    . LYS A 1  1123 ? -31.507 -8.332  -83.319 1.00 73.99  ? 1123 LYS A CE    1 
ATOM   8351  N  NZ    . LYS A 1  1123 ? -32.871 -8.647  -83.831 1.00 75.25  ? 1123 LYS A NZ    1 
ATOM   8352  N  N     . ASP A 1  1124 ? -27.645 -4.173  -81.108 1.00 73.25  ? 1124 ASP A N     1 
ATOM   8353  C  CA    . ASP A 1  1124 ? -26.647 -3.638  -82.042 1.00 74.72  ? 1124 ASP A CA    1 
ATOM   8354  C  C     . ASP A 1  1124 ? -25.250 -3.701  -81.454 1.00 73.94  ? 1124 ASP A C     1 
ATOM   8355  O  O     . ASP A 1  1124 ? -24.299 -4.076  -82.145 1.00 73.55  ? 1124 ASP A O     1 
ATOM   8356  C  CB    . ASP A 1  1124 ? -26.952 -2.182  -82.408 1.00 76.99  ? 1124 ASP A CB    1 
ATOM   8357  C  CG    . ASP A 1  1124 ? -28.338 -1.996  -82.984 1.00 77.87  ? 1124 ASP A CG    1 
ATOM   8358  O  OD1   . ASP A 1  1124 ? -28.900 -2.971  -83.535 1.00 77.32  ? 1124 ASP A OD1   1 
ATOM   8359  O  OD2   . ASP A 1  1124 ? -28.867 -0.867  -82.864 1.00 79.05  ? 1124 ASP A OD2   1 
ATOM   8360  N  N     . TRP A 1  1125 ? -25.141 -3.314  -80.182 1.00 73.87  ? 1125 TRP A N     1 
ATOM   8361  C  CA    . TRP A 1  1125 ? -23.860 -3.292  -79.464 1.00 74.34  ? 1125 TRP A CA    1 
ATOM   8362  C  C     . TRP A 1  1125 ? -23.278 -4.693  -79.284 1.00 72.07  ? 1125 TRP A C     1 
ATOM   8363  O  O     . TRP A 1  1125 ? -22.079 -4.899  -79.487 1.00 71.54  ? 1125 TRP A O     1 
ATOM   8364  C  CB    . TRP A 1  1125 ? -24.006 -2.611  -78.093 1.00 74.76  ? 1125 TRP A CB    1 
ATOM   8365  C  CG    . TRP A 1  1125 ? -24.354 -1.144  -78.143 1.00 76.65  ? 1125 TRP A CG    1 
ATOM   8366  C  CD1   . TRP A 1  1125 ? -24.303 -0.316  -79.232 1.00 78.28  ? 1125 TRP A CD1   1 
ATOM   8367  C  CD2   . TRP A 1  1125 ? -24.772 -0.328  -77.042 1.00 77.63  ? 1125 TRP A CD2   1 
ATOM   8368  N  NE1   . TRP A 1  1125 ? -24.681 0.956   -78.880 1.00 79.58  ? 1125 TRP A NE1   1 
ATOM   8369  C  CE2   . TRP A 1  1125 ? -24.972 0.980   -77.543 1.00 78.81  ? 1125 TRP A CE2   1 
ATOM   8370  C  CE3   . TRP A 1  1125 ? -25.005 -0.576  -75.681 1.00 76.97  ? 1125 TRP A CE3   1 
ATOM   8371  C  CZ2   . TRP A 1  1125 ? -25.392 2.039   -76.734 1.00 79.23  ? 1125 TRP A CZ2   1 
ATOM   8372  C  CZ3   . TRP A 1  1125 ? -25.423 0.481   -74.873 1.00 77.90  ? 1125 TRP A CZ3   1 
ATOM   8373  C  CH2   . TRP A 1  1125 ? -25.613 1.773   -75.407 1.00 78.96  ? 1125 TRP A CH2   1 
ATOM   8374  N  N     . ALA A 1  1126 ? -24.136 -5.639  -78.901 1.00 69.95  ? 1126 ALA A N     1 
ATOM   8375  C  CA    . ALA A 1  1126 ? -23.761 -7.049  -78.795 1.00 68.76  ? 1126 ALA A CA    1 
ATOM   8376  C  C     . ALA A 1  1126 ? -23.319 -7.626  -80.137 1.00 69.11  ? 1126 ALA A C     1 
ATOM   8377  O  O     . ALA A 1  1126 ? -22.302 -8.318  -80.214 1.00 68.98  ? 1126 ALA A O     1 
ATOM   8378  C  CB    . ALA A 1  1126 ? -24.921 -7.863  -78.237 1.00 67.60  ? 1126 ALA A CB    1 
ATOM   8379  N  N     . GLN A 1  1127 ? -24.081 -7.334  -81.190 1.00 69.78  ? 1127 GLN A N     1 
ATOM   8380  C  CA    . GLN A 1  1127 ? -23.774 -7.842  -82.524 1.00 70.26  ? 1127 GLN A CA    1 
ATOM   8381  C  C     . GLN A 1  1127 ? -22.450 -7.276  -83.034 1.00 71.46  ? 1127 GLN A C     1 
ATOM   8382  O  O     . GLN A 1  1127 ? -21.596 -8.037  -83.478 1.00 71.27  ? 1127 GLN A O     1 
ATOM   8383  C  CB    . GLN A 1  1127 ? -24.916 -7.545  -83.507 1.00 71.34  ? 1127 GLN A CB    1 
ATOM   8384  C  CG    . GLN A 1  1127 ? -24.816 -8.272  -84.846 1.00 72.51  ? 1127 GLN A CG    1 
ATOM   8385  C  CD    . GLN A 1  1127 ? -24.848 -9.789  -84.704 1.00 72.07  ? 1127 GLN A CD    1 
ATOM   8386  O  OE1   . GLN A 1  1127 ? -25.812 -10.358 -84.186 1.00 71.88  ? 1127 GLN A OE1   1 
ATOM   8387  N  NE2   . GLN A 1  1127 ? -23.789 -10.449 -85.162 1.00 72.04  ? 1127 GLN A NE2   1 
ATOM   8388  N  N     . THR A 1  1128 ? -22.273 -5.957  -82.945 1.00 73.38  ? 1128 THR A N     1 
ATOM   8389  C  CA    . THR A 1  1128 ? -21.028 -5.312  -83.394 1.00 75.36  ? 1128 THR A CA    1 
ATOM   8390  C  C     . THR A 1  1128 ? -19.826 -5.672  -82.506 1.00 74.77  ? 1128 THR A C     1 
ATOM   8391  O  O     . THR A 1  1128 ? -18.685 -5.617  -82.971 1.00 76.58  ? 1128 THR A O     1 
ATOM   8392  C  CB    . THR A 1  1128 ? -21.160 -3.771  -83.530 1.00 77.51  ? 1128 THR A CB    1 
ATOM   8393  O  OG1   . THR A 1  1128 ? -21.742 -3.217  -82.346 1.00 78.19  ? 1128 THR A OG1   1 
ATOM   8394  C  CG2   . THR A 1  1128 ? -22.035 -3.402  -84.725 1.00 78.79  ? 1128 THR A CG2   1 
ATOM   8395  N  N     . ALA A 1  1129 ? -20.079 -6.042  -81.247 1.00 72.83  ? 1129 ALA A N     1 
ATOM   8396  C  CA    . ALA A 1  1129 ? -19.029 -6.578  -80.363 1.00 71.75  ? 1129 ALA A CA    1 
ATOM   8397  C  C     . ALA A 1  1129 ? -18.534 -7.940  -80.846 1.00 70.15  ? 1129 ALA A C     1 
ATOM   8398  O  O     . ALA A 1  1129 ? -17.324 -8.182  -80.912 1.00 69.55  ? 1129 ALA A O     1 
ATOM   8399  C  CB    . ALA A 1  1129 ? -19.530 -6.688  -78.927 1.00 71.05  ? 1129 ALA A CB    1 
ATOM   8400  N  N     . PHE A 1  1130 ? -19.477 -8.821  -81.173 1.00 68.91  ? 1130 PHE A N     1 
ATOM   8401  C  CA    . PHE A 1  1130 ? -19.150 -10.119 -81.759 1.00 68.54  ? 1130 PHE A CA    1 
ATOM   8402  C  C     . PHE A 1  1130 ? -18.392 -9.949  -83.071 1.00 69.64  ? 1130 PHE A C     1 
ATOM   8403  O  O     . PHE A 1  1130 ? -17.376 -10.606 -83.285 1.00 69.78  ? 1130 PHE A O     1 
ATOM   8404  C  CB    . PHE A 1  1130 ? -20.410 -10.965 -81.991 1.00 67.28  ? 1130 PHE A CB    1 
ATOM   8405  C  CG    . PHE A 1  1130 ? -20.128 -12.328 -82.574 1.00 66.33  ? 1130 PHE A CG    1 
ATOM   8406  C  CD1   . PHE A 1  1130 ? -19.704 -13.379 -81.757 1.00 65.09  ? 1130 PHE A CD1   1 
ATOM   8407  C  CD2   . PHE A 1  1130 ? -20.277 -12.566 -83.941 1.00 66.25  ? 1130 PHE A CD2   1 
ATOM   8408  C  CE1   . PHE A 1  1130 ? -19.445 -14.633 -82.292 1.00 64.23  ? 1130 PHE A CE1   1 
ATOM   8409  C  CE2   . PHE A 1  1130 ? -20.017 -13.818 -84.479 1.00 65.16  ? 1130 PHE A CE2   1 
ATOM   8410  C  CZ    . PHE A 1  1130 ? -19.600 -14.850 -83.656 1.00 64.30  ? 1130 PHE A CZ    1 
ATOM   8411  N  N     . ASP A 1  1131 ? -18.875 -9.052  -83.926 1.00 70.90  ? 1131 ASP A N     1 
ATOM   8412  C  CA    . ASP A 1  1131 ? -18.251 -8.800  -85.228 1.00 72.45  ? 1131 ASP A CA    1 
ATOM   8413  C  C     . ASP A 1  1131 ? -16.794 -8.340  -85.097 1.00 73.60  ? 1131 ASP A C     1 
ATOM   8414  O  O     . ASP A 1  1131 ? -15.983 -8.626  -85.973 1.00 74.40  ? 1131 ASP A O     1 
ATOM   8415  C  CB    . ASP A 1  1131 ? -19.058 -7.767  -86.037 1.00 73.78  ? 1131 ASP A CB    1 
ATOM   8416  C  CG    . ASP A 1  1131 ? -20.477 -8.242  -86.386 1.00 73.20  ? 1131 ASP A CG    1 
ATOM   8417  O  OD1   . ASP A 1  1131 ? -20.815 -9.425  -86.156 1.00 71.92  ? 1131 ASP A OD1   1 
ATOM   8418  O  OD2   . ASP A 1  1131 ? -21.265 -7.412  -86.888 1.00 73.92  ? 1131 ASP A OD2   1 
ATOM   8419  N  N     . GLU A 1  1132 ? -16.470 -7.646  -84.002 1.00 74.47  ? 1132 GLU A N     1 
ATOM   8420  C  CA    . GLU A 1  1132 ? -15.103 -7.185  -83.718 1.00 75.82  ? 1132 GLU A CA    1 
ATOM   8421  C  C     . GLU A 1  1132 ? -14.361 -8.025  -82.668 1.00 74.22  ? 1132 GLU A C     1 
ATOM   8422  O  O     . GLU A 1  1132 ? -13.404 -7.546  -82.063 1.00 75.06  ? 1132 GLU A O     1 
ATOM   8423  C  CB    . GLU A 1  1132 ? -15.141 -5.723  -83.258 1.00 78.04  ? 1132 GLU A CB    1 
ATOM   8424  C  CG    . GLU A 1  1132 ? -15.721 -4.758  -84.281 1.00 80.13  ? 1132 GLU A CG    1 
ATOM   8425  C  CD    . GLU A 1  1132 ? -15.886 -3.359  -83.730 1.00 82.09  ? 1132 GLU A CD    1 
ATOM   8426  O  OE1   . GLU A 1  1132 ? -15.204 -3.014  -82.736 1.00 82.07  ? 1132 GLU A OE1   1 
ATOM   8427  O  OE2   . GLU A 1  1132 ? -16.700 -2.601  -84.300 1.00 84.83  ? 1132 GLU A OE2   1 
ATOM   8428  N  N     . SER A 1  1133 ? -14.789 -9.269  -82.459 1.00 72.64  ? 1133 SER A N     1 
ATOM   8429  C  CA    . SER A 1  1133 ? -14.122 -10.201 -81.544 1.00 71.01  ? 1133 SER A CA    1 
ATOM   8430  C  C     . SER A 1  1133 ? -13.895 -9.629  -80.139 1.00 70.23  ? 1133 SER A C     1 
ATOM   8431  O  O     . SER A 1  1133 ? -12.772 -9.618  -79.618 1.00 69.56  ? 1133 SER A O     1 
ATOM   8432  C  CB    . SER A 1  1133 ? -12.813 -10.706 -82.161 1.00 71.50  ? 1133 SER A CB    1 
ATOM   8433  O  OG    . SER A 1  1133 ? -13.065 -11.377 -83.383 1.00 71.88  ? 1133 SER A OG    1 
ATOM   8434  N  N     . ILE A 1  1134 ? -14.981 -9.139  -79.548 1.00 69.30  ? 1134 ILE A N     1 
ATOM   8435  C  CA    . ILE A 1  1134 ? -14.989 -8.703  -78.159 1.00 69.06  ? 1134 ILE A CA    1 
ATOM   8436  C  C     . ILE A 1  1134 ? -15.884 -9.664  -77.383 1.00 67.98  ? 1134 ILE A C     1 
ATOM   8437  O  O     . ILE A 1  1134 ? -17.039 -9.884  -77.744 1.00 68.22  ? 1134 ILE A O     1 
ATOM   8438  C  CB    . ILE A 1  1134 ? -15.446 -7.234  -78.017 1.00 70.07  ? 1134 ILE A CB    1 
ATOM   8439  C  CG1   . ILE A 1  1134 ? -14.350 -6.295  -78.563 1.00 71.20  ? 1134 ILE A CG1   1 
ATOM   8440  C  CG2   . ILE A 1  1134 ? -15.751 -6.893  -76.558 1.00 69.83  ? 1134 ILE A CG2   1 
ATOM   8441  C  CD1   . ILE A 1  1134 ? -14.819 -4.895  -78.901 1.00 71.83  ? 1134 ILE A CD1   1 
ATOM   8442  N  N     . ASN A 1  1135 ? -15.326 -10.228 -76.317 1.00 67.91  ? 1135 ASN A N     1 
ATOM   8443  C  CA    . ASN A 1  1135 ? -15.991 -11.231 -75.486 1.00 66.36  ? 1135 ASN A CA    1 
ATOM   8444  C  C     . ASN A 1  1135 ? -17.209 -10.625 -74.764 1.00 65.52  ? 1135 ASN A C     1 
ATOM   8445  O  O     . ASN A 1  1135 ? -17.115 -9.524  -74.210 1.00 65.22  ? 1135 ASN A O     1 
ATOM   8446  C  CB    . ASN A 1  1135 ? -14.956 -11.789 -74.491 1.00 66.23  ? 1135 ASN A CB    1 
ATOM   8447  C  CG    . ASN A 1  1135 ? -15.489 -12.913 -73.625 1.00 65.10  ? 1135 ASN A CG    1 
ATOM   8448  O  OD1   . ASN A 1  1135 ? -16.504 -13.532 -73.927 1.00 65.44  ? 1135 ASN A OD1   1 
ATOM   8449  N  ND2   . ASN A 1  1135 ? -14.791 -13.180 -72.532 1.00 64.96  ? 1135 ASN A ND2   1 
ATOM   8450  N  N     . LEU A 1  1136 ? -18.342 -11.340 -74.798 1.00 64.21  ? 1136 LEU A N     1 
ATOM   8451  C  CA    . LEU A 1  1136 ? -19.600 -10.915 -74.145 1.00 63.08  ? 1136 LEU A CA    1 
ATOM   8452  C  C     . LEU A 1  1136 ? -20.002 -11.791 -72.940 1.00 60.63  ? 1136 LEU A C     1 
ATOM   8453  O  O     . LEU A 1  1136 ? -21.155 -11.779 -72.511 1.00 59.67  ? 1136 LEU A O     1 
ATOM   8454  C  CB    . LEU A 1  1136 ? -20.739 -10.898 -75.172 1.00 63.51  ? 1136 LEU A CB    1 
ATOM   8455  C  CG    . LEU A 1  1136 ? -20.623 -9.894  -76.318 1.00 65.01  ? 1136 LEU A CG    1 
ATOM   8456  C  CD1   . LEU A 1  1136 ? -21.574 -10.283 -77.440 1.00 64.99  ? 1136 LEU A CD1   1 
ATOM   8457  C  CD2   . LEU A 1  1136 ? -20.897 -8.475  -75.834 1.00 65.92  ? 1136 LEU A CD2   1 
ATOM   8458  N  N     . SER A 1  1137 ? -19.049 -12.544 -72.400 1.00 59.71  ? 1137 SER A N     1 
ATOM   8459  C  CA    . SER A 1  1137 ? -19.234 -13.295 -71.166 1.00 58.64  ? 1137 SER A CA    1 
ATOM   8460  C  C     . SER A 1  1137 ? -18.220 -12.783 -70.148 1.00 59.56  ? 1137 SER A C     1 
ATOM   8461  O  O     . SER A 1  1137 ? -17.062 -12.530 -70.491 1.00 60.14  ? 1137 SER A O     1 
ATOM   8462  C  CB    . SER A 1  1137 ? -19.026 -14.785 -71.416 1.00 57.51  ? 1137 SER A CB    1 
ATOM   8463  O  OG    . SER A 1  1137 ? -19.332 -15.541 -70.261 1.00 55.85  ? 1137 SER A OG    1 
ATOM   8464  N  N     . ALA A 1  1138 ? -18.652 -12.634 -68.900 1.00 59.92  ? 1138 ALA A N     1 
ATOM   8465  C  CA    . ALA A 1  1138 ? -17.775 -12.138 -67.851 1.00 61.26  ? 1138 ALA A CA    1 
ATOM   8466  C  C     . ALA A 1  1138 ? -18.107 -12.737 -66.492 1.00 61.60  ? 1138 ALA A C     1 
ATOM   8467  O  O     . ALA A 1  1138 ? -19.278 -12.900 -66.135 1.00 61.40  ? 1138 ALA A O     1 
ATOM   8468  C  CB    . ALA A 1  1138 ? -17.850 -10.622 -67.783 1.00 62.42  ? 1138 ALA A CB    1 
ATOM   8469  N  N     . VAL A 1  1139 ? -17.052 -13.072 -65.756 1.00 62.63  ? 1139 VAL A N     1 
ATOM   8470  C  CA    . VAL A 1  1139 ? -17.144 -13.432 -64.352 1.00 62.81  ? 1139 VAL A CA    1 
ATOM   8471  C  C     . VAL A 1  1139 ? -17.198 -12.131 -63.561 1.00 64.20  ? 1139 VAL A C     1 
ATOM   8472  O  O     . VAL A 1  1139 ? -16.588 -11.133 -63.948 1.00 67.01  ? 1139 VAL A O     1 
ATOM   8473  C  CB    . VAL A 1  1139 ? -15.927 -14.275 -63.907 1.00 63.22  ? 1139 VAL A CB    1 
ATOM   8474  C  CG1   . VAL A 1  1139 ? -15.918 -14.496 -62.398 1.00 63.19  ? 1139 VAL A CG1   1 
ATOM   8475  C  CG2   . VAL A 1  1139 ? -15.918 -15.611 -64.646 1.00 62.49  ? 1139 VAL A CG2   1 
ATOM   8476  N  N     . GLY A 1  1140 ? -17.955 -12.156 -62.470 1.00 63.89  ? 1140 GLY A N     1 
ATOM   8477  C  CA    . GLY A 1  1140 ? -18.006 -11.075 -61.493 1.00 64.12  ? 1140 GLY A CA    1 
ATOM   8478  C  C     . GLY A 1  1140 ? -17.491 -11.606 -60.176 1.00 63.72  ? 1140 GLY A C     1 
ATOM   8479  O  O     . GLY A 1  1140 ? -17.646 -12.791 -59.887 1.00 62.37  ? 1140 GLY A O     1 
ATOM   8480  N  N     . TYR A 1  1141 ? -16.869 -10.734 -59.387 1.00 65.06  ? 1141 TYR A N     1 
ATOM   8481  C  CA    . TYR A 1  1141 ? -16.242 -11.133 -58.129 1.00 65.52  ? 1141 TYR A CA    1 
ATOM   8482  C  C     . TYR A 1  1141 ? -16.166 -9.984  -57.132 1.00 66.92  ? 1141 TYR A C     1 
ATOM   8483  O  O     . TYR A 1  1141 ? -15.830 -8.851  -57.494 1.00 67.36  ? 1141 TYR A O     1 
ATOM   8484  C  CB    . TYR A 1  1141 ? -14.834 -11.667 -58.393 1.00 66.10  ? 1141 TYR A CB    1 
ATOM   8485  C  CG    . TYR A 1  1141 ? -14.220 -12.390 -57.217 1.00 66.53  ? 1141 TYR A CG    1 
ATOM   8486  C  CD1   . TYR A 1  1141 ? -14.762 -13.591 -56.755 1.00 65.91  ? 1141 TYR A CD1   1 
ATOM   8487  C  CD2   . TYR A 1  1141 ? -13.090 -11.888 -56.572 1.00 67.70  ? 1141 TYR A CD2   1 
ATOM   8488  C  CE1   . TYR A 1  1141 ? -14.205 -14.265 -55.679 1.00 66.12  ? 1141 TYR A CE1   1 
ATOM   8489  C  CE2   . TYR A 1  1141 ? -12.522 -12.559 -55.497 1.00 68.31  ? 1141 TYR A CE2   1 
ATOM   8490  C  CZ    . TYR A 1  1141 ? -13.085 -13.745 -55.052 1.00 67.64  ? 1141 TYR A CZ    1 
ATOM   8491  O  OH    . TYR A 1  1141 ? -12.533 -14.416 -53.988 1.00 67.92  ? 1141 TYR A OH    1 
ATOM   8492  N  N     . PHE A 1  1142 ? -16.504 -10.287 -55.882 1.00 67.94  ? 1142 PHE A N     1 
ATOM   8493  C  CA    . PHE A 1  1142 ? -16.236 -9.399  -54.756 1.00 69.66  ? 1142 PHE A CA    1 
ATOM   8494  C  C     . PHE A 1  1142 ? -15.421 -10.181 -53.733 1.00 70.17  ? 1142 PHE A C     1 
ATOM   8495  O  O     . PHE A 1  1142 ? -15.793 -11.293 -53.358 1.00 68.48  ? 1142 PHE A O     1 
ATOM   8496  C  CB    . PHE A 1  1142 ? -17.529 -8.866  -54.134 1.00 69.41  ? 1142 PHE A CB    1 
ATOM   8497  C  CG    . PHE A 1  1142 ? -17.296 -7.901  -53.002 1.00 70.70  ? 1142 PHE A CG    1 
ATOM   8498  C  CD1   . PHE A 1  1142 ? -16.603 -6.710  -53.221 1.00 71.78  ? 1142 PHE A CD1   1 
ATOM   8499  C  CD2   . PHE A 1  1142 ? -17.753 -8.179  -51.718 1.00 70.60  ? 1142 PHE A CD2   1 
ATOM   8500  C  CE1   . PHE A 1  1142 ? -16.371 -5.819  -52.183 1.00 72.46  ? 1142 PHE A CE1   1 
ATOM   8501  C  CE2   . PHE A 1  1142 ? -17.522 -7.290  -50.675 1.00 71.61  ? 1142 PHE A CE2   1 
ATOM   8502  C  CZ    . PHE A 1  1142 ? -16.831 -6.108  -50.907 1.00 72.14  ? 1142 PHE A CZ    1 
ATOM   8503  N  N     . ARG A 1  1143 ? -14.319 -9.581  -53.287 1.00 72.51  ? 1143 ARG A N     1 
ATOM   8504  C  CA    . ARG A 1  1143 ? -13.356 -10.238 -52.397 1.00 73.46  ? 1143 ARG A CA    1 
ATOM   8505  C  C     . ARG A 1  1143 ? -13.880 -10.407 -50.969 1.00 72.90  ? 1143 ARG A C     1 
ATOM   8506  O  O     . ARG A 1  1143 ? -13.420 -11.287 -50.243 1.00 72.44  ? 1143 ARG A O     1 
ATOM   8507  C  CB    . ARG A 1  1143 ? -12.046 -9.446  -52.350 1.00 75.91  ? 1143 ARG A CB    1 
ATOM   8508  C  CG    . ARG A 1  1143 ? -11.378 -9.229  -53.702 1.00 76.47  ? 1143 ARG A CG    1 
ATOM   8509  C  CD    . ARG A 1  1143 ? -9.936  -8.786  -53.524 1.00 78.55  ? 1143 ARG A CD    1 
ATOM   8510  N  NE    . ARG A 1  1143 ? -9.115  -9.839  -52.917 1.00 79.24  ? 1143 ARG A NE    1 
ATOM   8511  C  CZ    . ARG A 1  1143 ? -7.877  -9.682  -52.444 1.00 80.49  ? 1143 ARG A CZ    1 
ATOM   8512  N  NH1   . ARG A 1  1143 ? -7.264  -8.500  -52.487 1.00 82.26  ? 1143 ARG A NH1   1 
ATOM   8513  N  NH2   . ARG A 1  1143 ? -7.240  -10.724 -51.917 1.00 80.76  ? 1143 ARG A NH2   1 
ATOM   8514  N  N     . GLY A 1  1144 ? -14.808 -9.537  -50.571 1.00 72.84  ? 1144 GLY A N     1 
ATOM   8515  C  CA    . GLY A 1  1144 ? -15.481 -9.618  -49.272 1.00 73.35  ? 1144 GLY A CA    1 
ATOM   8516  C  C     . GLY A 1  1144 ? -15.143 -8.429  -48.398 1.00 75.30  ? 1144 GLY A C     1 
ATOM   8517  O  O     . GLY A 1  1144 ? -14.145 -7.741  -48.625 1.00 76.15  ? 1144 GLY A O     1 
ATOM   8518  N  N     . TYR A 1  1145 ? -15.986 -8.182  -47.403 1.00 76.33  ? 1145 TYR A N     1 
ATOM   8519  C  CA    . TYR A 1  1145 ? -15.746 -7.117  -46.435 1.00 78.21  ? 1145 TYR A CA    1 
ATOM   8520  C  C     . TYR A 1  1145 ? -14.628 -7.537  -45.496 1.00 80.22  ? 1145 TYR A C     1 
ATOM   8521  O  O     . TYR A 1  1145 ? -14.596 -8.681  -45.046 1.00 78.97  ? 1145 TYR A O     1 
ATOM   8522  C  CB    . TYR A 1  1145 ? -16.993 -6.828  -45.594 1.00 77.97  ? 1145 TYR A CB    1 
ATOM   8523  C  CG    . TYR A 1  1145 ? -18.205 -6.329  -46.353 1.00 76.86  ? 1145 TYR A CG    1 
ATOM   8524  C  CD1   . TYR A 1  1145 ? -18.095 -5.323  -47.316 1.00 77.25  ? 1145 TYR A CD1   1 
ATOM   8525  C  CD2   . TYR A 1  1145 ? -19.478 -6.833  -46.073 1.00 75.83  ? 1145 TYR A CD2   1 
ATOM   8526  C  CE1   . TYR A 1  1145 ? -19.208 -4.859  -47.998 1.00 76.79  ? 1145 TYR A CE1   1 
ATOM   8527  C  CE2   . TYR A 1  1145 ? -20.599 -6.370  -46.747 1.00 75.91  ? 1145 TYR A CE2   1 
ATOM   8528  C  CZ    . TYR A 1  1145 ? -20.458 -5.385  -47.710 1.00 76.53  ? 1145 TYR A CZ    1 
ATOM   8529  O  OH    . TYR A 1  1145 ? -21.562 -4.921  -48.386 1.00 76.97  ? 1145 TYR A OH    1 
ATOM   8530  N  N     . GLU A 1  1146 ? -13.728 -6.601  -45.197 1.00 83.79  ? 1146 GLU A N     1 
ATOM   8531  C  CA    . GLU A 1  1146 ? -12.663 -6.837  -44.228 1.00 86.39  ? 1146 GLU A CA    1 
ATOM   8532  C  C     . GLU A 1  1146 ? -13.301 -7.045  -42.861 1.00 86.53  ? 1146 GLU A C     1 
ATOM   8533  O  O     . GLU A 1  1146 ? -14.192 -6.292  -42.467 1.00 86.71  ? 1146 GLU A O     1 
ATOM   8534  C  CB    . GLU A 1  1146 ? -11.680 -5.662  -44.182 1.00 89.50  ? 1146 GLU A CB    1 
ATOM   8535  C  CG    . GLU A 1  1146 ? -10.888 -5.435  -45.465 1.00 91.17  ? 1146 GLU A CG    1 
ATOM   8536  C  CD    . GLU A 1  1146 ? -9.849  -6.509  -45.749 1.00 93.48  ? 1146 GLU A CD    1 
ATOM   8537  O  OE1   . GLU A 1  1146 ? -9.680  -7.448  -44.936 1.00 94.99  ? 1146 GLU A OE1   1 
ATOM   8538  O  OE2   . GLU A 1  1146 ? -9.185  -6.410  -46.803 1.00 95.37  ? 1146 GLU A OE2   1 
ATOM   8539  N  N     . SER A 1  1147 ? -12.856 -8.083  -42.159 1.00 86.48  ? 1147 SER A N     1 
ATOM   8540  C  CA    . SER A 1  1147 ? -13.507 -8.533  -40.931 1.00 85.52  ? 1147 SER A CA    1 
ATOM   8541  C  C     . SER A 1  1147 ? -12.553 -9.405  -40.117 1.00 85.55  ? 1147 SER A C     1 
ATOM   8542  O  O     . SER A 1  1147 ? -11.850 -10.245 -40.682 1.00 86.47  ? 1147 SER A O     1 
ATOM   8543  C  CB    . SER A 1  1147 ? -14.784 -9.309  -41.283 1.00 83.68  ? 1147 SER A CB    1 
ATOM   8544  O  OG    . SER A 1  1147 ? -15.421 -9.846  -40.136 1.00 83.17  ? 1147 SER A OG    1 
ATOM   8545  N  N     . ASP A 1  1148 ? -12.526 -9.196  -38.802 1.00 85.53  ? 1148 ASP A N     1 
ATOM   8546  C  CA    . ASP A 1  1148 ? -11.662 -9.974  -37.906 1.00 86.46  ? 1148 ASP A CA    1 
ATOM   8547  C  C     . ASP A 1  1148 ? -12.091 -9.866  -36.448 1.00 86.97  ? 1148 ASP A C     1 
ATOM   8548  O  O     . ASP A 1  1148 ? -12.690 -8.870  -36.037 1.00 87.45  ? 1148 ASP A O     1 
ATOM   8549  C  CB    . ASP A 1  1148 ? -10.203 -9.526  -38.040 1.00 87.39  ? 1148 ASP A CB    1 
ATOM   8550  C  CG    . ASP A 1  1148 ? -10.038 -8.038  -37.844 1.00 88.23  ? 1148 ASP A CG    1 
ATOM   8551  O  OD1   . ASP A 1  1148 ? -10.009 -7.588  -36.678 1.00 88.78  ? 1148 ASP A OD1   1 
ATOM   8552  O  OD2   . ASP A 1  1148 ? -9.947  -7.324  -38.862 1.00 88.10  ? 1148 ASP A OD2   1 
ATOM   8553  N  N     . MET A 1  1149 ? -11.756 -10.894 -35.675 1.00 87.02  ? 1149 MET A N     1 
ATOM   8554  C  CA    . MET A 1  1149 ? -12.088 -10.951 -34.256 1.00 87.01  ? 1149 MET A CA    1 
ATOM   8555  C  C     . MET A 1  1149 ? -11.072 -11.818 -33.514 1.00 88.27  ? 1149 MET A C     1 
ATOM   8556  O  O     . MET A 1  1149 ? -10.984 -13.026 -33.744 1.00 87.64  ? 1149 MET A O     1 
ATOM   8557  C  CB    . MET A 1  1149 ? -13.515 -11.491 -34.064 1.00 84.65  ? 1149 MET A CB    1 
ATOM   8558  C  CG    . MET A 1  1149 ? -14.010 -11.535 -32.619 1.00 84.86  ? 1149 MET A CG    1 
ATOM   8559  S  SD    . MET A 1  1149 ? -13.921 -9.960  -31.735 1.00 84.96  ? 1149 MET A SD    1 
ATOM   8560  C  CE    . MET A 1  1149 ? -14.050 -10.525 -30.042 1.00 86.21  ? 1149 MET A CE    1 
ATOM   8561  N  N     . ASN A 1  1150 ? -10.303 -11.175 -32.640 1.00 90.66  ? 1150 ASN A N     1 
ATOM   8562  C  CA    . ASN A 1  1150 ? -9.366  -11.847 -31.751 1.00 92.20  ? 1150 ASN A CA    1 
ATOM   8563  C  C     . ASN A 1  1150 ? -10.087 -12.197 -30.445 1.00 92.61  ? 1150 ASN A C     1 
ATOM   8564  O  O     . ASN A 1  1150 ? -10.245 -11.347 -29.565 1.00 93.93  ? 1150 ASN A O     1 
ATOM   8565  C  CB    . ASN A 1  1150 ? -8.162  -10.930 -31.500 1.00 94.32  ? 1150 ASN A CB    1 
ATOM   8566  C  CG    . ASN A 1  1150 ? -7.027  -11.620 -30.767 1.00 95.89  ? 1150 ASN A CG    1 
ATOM   8567  O  OD1   . ASN A 1  1150 ? -7.185  -12.712 -30.229 1.00 96.26  ? 1150 ASN A OD1   1 
ATOM   8568  N  ND2   . ASN A 1  1150 ? -5.869  -10.974 -30.744 1.00 97.79  ? 1150 ASN A ND2   1 
ATOM   8569  N  N     . TRP A 1  1151 ? -10.526 -13.450 -30.329 1.00 91.11  ? 1151 TRP A N     1 
ATOM   8570  C  CA    . TRP A 1  1151 ? -11.270 -13.912 -29.144 1.00 91.29  ? 1151 TRP A CA    1 
ATOM   8571  C  C     . TRP A 1  1151 ? -10.423 -14.131 -27.879 1.00 93.31  ? 1151 TRP A C     1 
ATOM   8572  O  O     . TRP A 1  1151 ? -10.983 -14.269 -26.791 1.00 93.43  ? 1151 TRP A O     1 
ATOM   8573  C  CB    . TRP A 1  1151 ? -12.070 -15.180 -29.469 1.00 89.52  ? 1151 TRP A CB    1 
ATOM   8574  C  CG    . TRP A 1  1151 ? -13.367 -14.874 -30.120 1.00 87.80  ? 1151 TRP A CG    1 
ATOM   8575  C  CD1   . TRP A 1  1151 ? -13.675 -14.990 -31.442 1.00 86.73  ? 1151 TRP A CD1   1 
ATOM   8576  C  CD2   . TRP A 1  1151 ? -14.537 -14.371 -29.476 1.00 87.60  ? 1151 TRP A CD2   1 
ATOM   8577  N  NE1   . TRP A 1  1151 ? -14.973 -14.602 -31.663 1.00 85.72  ? 1151 TRP A NE1   1 
ATOM   8578  C  CE2   . TRP A 1  1151 ? -15.526 -14.214 -30.472 1.00 86.41  ? 1151 TRP A CE2   1 
ATOM   8579  C  CE3   . TRP A 1  1151 ? -14.850 -14.042 -28.150 1.00 88.12  ? 1151 TRP A CE3   1 
ATOM   8580  C  CZ2   . TRP A 1  1151 ? -16.809 -13.742 -30.185 1.00 85.68  ? 1151 TRP A CZ2   1 
ATOM   8581  C  CZ3   . TRP A 1  1151 ? -16.122 -13.573 -27.864 1.00 87.82  ? 1151 TRP A CZ3   1 
ATOM   8582  C  CH2   . TRP A 1  1151 ? -17.087 -13.428 -28.881 1.00 86.56  ? 1151 TRP A CH2   1 
ATOM   8583  N  N     . GLU A 1  1152 ? -9.097  -14.182 -28.022 1.00 95.23  ? 1152 GLU A N     1 
ATOM   8584  C  CA    . GLU A 1  1152 ? -8.180  -14.185 -26.873 1.00 98.07  ? 1152 GLU A CA    1 
ATOM   8585  C  C     . GLU A 1  1152 ? -8.254  -12.828 -26.172 1.00 99.78  ? 1152 GLU A C     1 
ATOM   8586  O  O     . GLU A 1  1152 ? -8.576  -12.750 -24.986 1.00 100.57 ? 1152 GLU A O     1 
ATOM   8587  C  CB    . GLU A 1  1152 ? -6.740  -14.493 -27.325 1.00 99.31  ? 1152 GLU A CB    1 
ATOM   8588  C  CG    . GLU A 1  1152 ? -5.640  -14.219 -26.301 1.00 102.84 ? 1152 GLU A CG    1 
ATOM   8589  C  CD    . GLU A 1  1152 ? -5.757  -15.034 -25.021 1.00 104.29 ? 1152 GLU A CD    1 
ATOM   8590  O  OE1   . GLU A 1  1152 ? -6.403  -16.108 -25.029 1.00 103.26 ? 1152 GLU A OE1   1 
ATOM   8591  O  OE2   . GLU A 1  1152 ? -5.177  -14.598 -24.000 1.00 106.47 ? 1152 GLU A OE2   1 
ATOM   8592  N  N     . LYS A 1  1153 ? -7.963  -11.772 -26.926 1.00 100.21 ? 1153 LYS A N     1 
ATOM   8593  C  CA    . LYS A 1  1153 ? -8.018  -10.397 -26.418 1.00 101.35 ? 1153 LYS A CA    1 
ATOM   8594  C  C     . LYS A 1  1153 ? -9.454  -9.892  -26.221 1.00 99.56  ? 1153 LYS A C     1 
ATOM   8595  O  O     . LYS A 1  1153 ? -9.701  -9.038  -25.370 1.00 99.98  ? 1153 LYS A O     1 
ATOM   8596  C  CB    . LYS A 1  1153 ? -7.270  -9.452  -27.364 1.00 102.63 ? 1153 LYS A CB    1 
ATOM   8597  C  CG    . LYS A 1  1153 ? -5.794  -9.777  -27.517 1.00 105.25 ? 1153 LYS A CG    1 
ATOM   8598  C  CD    . LYS A 1  1153 ? -5.081  -8.768  -28.401 1.00 106.80 ? 1153 LYS A CD    1 
ATOM   8599  C  CE    . LYS A 1  1153 ? -3.634  -9.176  -28.640 1.00 108.41 ? 1153 LYS A CE    1 
ATOM   8600  N  NZ    . LYS A 1  1153 ? -2.962  -8.313  -29.652 1.00 109.01 ? 1153 LYS A NZ    1 
ATOM   8601  N  N     . GLY A 1  1154 ? -10.389 -10.419 -27.009 1.00 97.18  ? 1154 GLY A N     1 
ATOM   8602  C  CA    . GLY A 1  1154 ? -11.781 -9.981  -26.978 1.00 95.67  ? 1154 GLY A CA    1 
ATOM   8603  C  C     . GLY A 1  1154 ? -12.004 -8.634  -27.645 1.00 95.04  ? 1154 GLY A C     1 
ATOM   8604  O  O     . GLY A 1  1154 ? -12.789 -7.826  -27.153 1.00 95.15  ? 1154 GLY A O     1 
ATOM   8605  N  N     . GLU A 1  1155 ? -11.320 -8.396  -28.765 1.00 94.41  ? 1155 GLU A N     1 
ATOM   8606  C  CA    . GLU A 1  1155 ? -11.453 -7.148  -29.527 1.00 94.40  ? 1155 GLU A CA    1 
ATOM   8607  C  C     . GLU A 1  1155 ? -11.242 -7.381  -31.019 1.00 92.42  ? 1155 GLU A C     1 
ATOM   8608  O  O     . GLU A 1  1155 ? -10.511 -8.290  -31.412 1.00 92.53  ? 1155 GLU A O     1 
ATOM   8609  C  CB    . GLU A 1  1155 ? -10.464 -6.090  -29.017 1.00 97.24  ? 1155 GLU A CB    1 
ATOM   8610  C  CG    . GLU A 1  1155 ? -8.988  -6.451  -29.158 1.00 98.73  ? 1155 GLU A CG    1 
ATOM   8611  C  CD    . GLU A 1  1155 ? -8.059  -5.370  -28.621 1.00 101.54 ? 1155 GLU A CD    1 
ATOM   8612  O  OE1   . GLU A 1  1155 ? -8.276  -4.883  -27.490 1.00 102.27 ? 1155 GLU A OE1   1 
ATOM   8613  O  OE2   . GLU A 1  1155 ? -7.096  -5.010  -29.331 1.00 102.73 ? 1155 GLU A OE2   1 
ATOM   8614  N  N     . GLY A 1  1156 ? -11.876 -6.549  -31.840 1.00 91.05  ? 1156 GLY A N     1 
ATOM   8615  C  CA    . GLY A 1  1156 ? -11.720 -6.632  -33.292 1.00 89.52  ? 1156 GLY A CA    1 
ATOM   8616  C  C     . GLY A 1  1156 ? -12.662 -5.741  -34.083 1.00 88.57  ? 1156 GLY A C     1 
ATOM   8617  O  O     . GLY A 1  1156 ? -13.353 -4.880  -33.526 1.00 89.22  ? 1156 GLY A O     1 
ATOM   8618  N  N     . GLN A 1  1157 ? -12.691 -5.982  -35.394 1.00 86.84  ? 1157 GLN A N     1 
ATOM   8619  C  CA    . GLN A 1  1157 ? -13.508 -5.231  -36.348 1.00 85.46  ? 1157 GLN A CA    1 
ATOM   8620  C  C     . GLN A 1  1157 ? -14.371 -6.201  -37.165 1.00 81.83  ? 1157 GLN A C     1 
ATOM   8621  O  O     . GLN A 1  1157 ? -14.269 -6.241  -38.389 1.00 80.77  ? 1157 GLN A O     1 
ATOM   8622  C  CB    . GLN A 1  1157 ? -12.584 -4.387  -37.250 1.00 87.59  ? 1157 GLN A CB    1 
ATOM   8623  C  CG    . GLN A 1  1157 ? -12.577 -2.897  -36.932 1.00 90.67  ? 1157 GLN A CG    1 
ATOM   8624  C  CD    . GLN A 1  1157 ? -13.722 -2.139  -37.591 1.00 91.17  ? 1157 GLN A CD    1 
ATOM   8625  O  OE1   . GLN A 1  1157 ? -14.709 -2.730  -38.045 1.00 90.21  ? 1157 GLN A OE1   1 
ATOM   8626  N  NE2   . GLN A 1  1157 ? -13.594 -0.817  -37.647 1.00 92.85  ? 1157 GLN A NE2   1 
ATOM   8627  N  N     . PRO A 1  1158 ? -15.238 -6.986  -36.487 1.00 79.61  ? 1158 PRO A N     1 
ATOM   8628  C  CA    . PRO A 1  1158 ? -15.988 -8.044  -37.172 1.00 76.74  ? 1158 PRO A CA    1 
ATOM   8629  C  C     . PRO A 1  1158 ? -17.161 -7.570  -38.030 1.00 74.31  ? 1158 PRO A C     1 
ATOM   8630  O  O     . PRO A 1  1158 ? -17.585 -8.312  -38.927 1.00 73.29  ? 1158 PRO A O     1 
ATOM   8631  C  CB    . PRO A 1  1158 ? -16.514 -8.889  -36.012 1.00 76.79  ? 1158 PRO A CB    1 
ATOM   8632  C  CG    . PRO A 1  1158 ? -16.748 -7.891  -34.944 1.00 78.78  ? 1158 PRO A CG    1 
ATOM   8633  C  CD    . PRO A 1  1158 ? -15.617 -6.908  -35.062 1.00 80.48  ? 1158 PRO A CD    1 
ATOM   8634  N  N     . PHE A 1  1159 ? -17.675 -6.366  -37.767 1.00 72.90  ? 1159 PHE A N     1 
ATOM   8635  C  CA    . PHE A 1  1159 ? -18.898 -5.886  -38.413 1.00 70.92  ? 1159 PHE A CA    1 
ATOM   8636  C  C     . PHE A 1  1159 ? -18.658 -4.716  -39.364 1.00 70.66  ? 1159 PHE A C     1 
ATOM   8637  O  O     . PHE A 1  1159 ? -17.969 -3.757  -39.031 1.00 70.98  ? 1159 PHE A O     1 
ATOM   8638  C  CB    . PHE A 1  1159 ? -19.935 -5.531  -37.350 1.00 70.85  ? 1159 PHE A CB    1 
ATOM   8639  C  CG    . PHE A 1  1159 ? -20.213 -6.659  -36.390 1.00 69.89  ? 1159 PHE A CG    1 
ATOM   8640  C  CD1   . PHE A 1  1159 ? -20.690 -7.881  -36.855 1.00 68.06  ? 1159 PHE A CD1   1 
ATOM   8641  C  CD2   . PHE A 1  1159 ? -19.996 -6.505  -35.025 1.00 70.35  ? 1159 PHE A CD2   1 
ATOM   8642  C  CE1   . PHE A 1  1159 ? -20.941 -8.925  -35.980 1.00 67.26  ? 1159 PHE A CE1   1 
ATOM   8643  C  CE2   . PHE A 1  1159 ? -20.242 -7.548  -34.146 1.00 69.52  ? 1159 PHE A CE2   1 
ATOM   8644  C  CZ    . PHE A 1  1159 ? -20.714 -8.758  -34.624 1.00 68.27  ? 1159 PHE A CZ    1 
ATOM   8645  N  N     . GLU A 1  1160 ? -19.244 -4.826  -40.555 1.00 70.24  ? 1160 GLU A N     1 
ATOM   8646  C  CA    . GLU A 1  1160 ? -19.077 -3.851  -41.628 1.00 70.54  ? 1160 GLU A CA    1 
ATOM   8647  C  C     . GLU A 1  1160 ? -19.992 -2.646  -41.434 1.00 70.36  ? 1160 GLU A C     1 
ATOM   8648  O  O     . GLU A 1  1160 ? -19.608 -1.523  -41.754 1.00 71.27  ? 1160 GLU A O     1 
ATOM   8649  C  CB    . GLU A 1  1160 ? -19.360 -4.522  -42.983 1.00 69.56  ? 1160 GLU A CB    1 
ATOM   8650  C  CG    . GLU A 1  1160 ? -19.128 -3.648  -44.214 1.00 70.67  ? 1160 GLU A CG    1 
ATOM   8651  C  CD    . GLU A 1  1160 ? -17.679 -3.221  -44.412 1.00 72.15  ? 1160 GLU A CD    1 
ATOM   8652  O  OE1   . GLU A 1  1160 ? -16.773 -3.789  -43.769 1.00 72.89  ? 1160 GLU A OE1   1 
ATOM   8653  O  OE2   . GLU A 1  1160 ? -17.443 -2.307  -45.230 1.00 73.47  ? 1160 GLU A OE2   1 
ATOM   8654  N  N     . TYR A 1  1161 ? -21.203 -2.893  -40.941 1.00 69.27  ? 1161 TYR A N     1 
ATOM   8655  C  CA    . TYR A 1  1161 ? -22.167 -1.835  -40.636 1.00 69.84  ? 1161 TYR A CA    1 
ATOM   8656  C  C     . TYR A 1  1161 ? -23.184 -2.328  -39.603 1.00 70.05  ? 1161 TYR A C     1 
ATOM   8657  O  O     . TYR A 1  1161 ? -23.131 -3.487  -39.183 1.00 69.54  ? 1161 TYR A O     1 
ATOM   8658  C  CB    . TYR A 1  1161 ? -22.862 -1.366  -41.918 1.00 69.13  ? 1161 TYR A CB    1 
ATOM   8659  C  CG    . TYR A 1  1161 ? -23.569 -2.469  -42.661 1.00 68.20  ? 1161 TYR A CG    1 
ATOM   8660  C  CD1   . TYR A 1  1161 ? -24.868 -2.853  -42.317 1.00 67.46  ? 1161 TYR A CD1   1 
ATOM   8661  C  CD2   . TYR A 1  1161 ? -22.939 -3.142  -43.710 1.00 67.52  ? 1161 TYR A CD2   1 
ATOM   8662  C  CE1   . TYR A 1  1161 ? -25.515 -3.875  -42.998 1.00 66.02  ? 1161 TYR A CE1   1 
ATOM   8663  C  CE2   . TYR A 1  1161 ? -23.581 -4.160  -44.398 1.00 66.01  ? 1161 TYR A CE2   1 
ATOM   8664  C  CZ    . TYR A 1  1161 ? -24.864 -4.524  -44.038 1.00 64.99  ? 1161 TYR A CZ    1 
ATOM   8665  O  OH    . TYR A 1  1161 ? -25.502 -5.533  -44.720 1.00 63.77  ? 1161 TYR A OH    1 
ATOM   8666  N  N     . PHE A 1  1162 ? -24.095 -1.444  -39.197 1.00 71.22  ? 1162 PHE A N     1 
ATOM   8667  C  CA    . PHE A 1  1162 ? -25.054 -1.719  -38.121 1.00 71.26  ? 1162 PHE A CA    1 
ATOM   8668  C  C     . PHE A 1  1162 ? -26.476 -1.295  -38.505 1.00 70.70  ? 1162 PHE A C     1 
ATOM   8669  O  O     . PHE A 1  1162 ? -26.718 -0.130  -38.822 1.00 70.47  ? 1162 PHE A O     1 
ATOM   8670  C  CB    . PHE A 1  1162 ? -24.624 -0.982  -36.845 1.00 72.54  ? 1162 PHE A CB    1 
ATOM   8671  C  CG    . PHE A 1  1162 ? -23.270 -1.392  -36.336 1.00 72.62  ? 1162 PHE A CG    1 
ATOM   8672  C  CD1   . PHE A 1  1162 ? -22.114 -0.840  -36.876 1.00 73.07  ? 1162 PHE A CD1   1 
ATOM   8673  C  CD2   . PHE A 1  1162 ? -23.146 -2.339  -35.324 1.00 72.41  ? 1162 PHE A CD2   1 
ATOM   8674  C  CE1   . PHE A 1  1162 ? -20.863 -1.222  -36.421 1.00 73.68  ? 1162 PHE A CE1   1 
ATOM   8675  C  CE2   . PHE A 1  1162 ? -21.895 -2.721  -34.860 1.00 72.91  ? 1162 PHE A CE2   1 
ATOM   8676  C  CZ    . PHE A 1  1162 ? -20.753 -2.166  -35.410 1.00 73.61  ? 1162 PHE A CZ    1 
ATOM   8677  N  N     . VAL A 1  1163 ? -27.409 -2.243  -38.464 1.00 70.15  ? 1163 VAL A N     1 
ATOM   8678  C  CA    . VAL A 1  1163 ? -28.825 -1.957  -38.699 1.00 70.42  ? 1163 VAL A CA    1 
ATOM   8679  C  C     . VAL A 1  1163 ? -29.457 -1.495  -37.384 1.00 71.78  ? 1163 VAL A C     1 
ATOM   8680  O  O     . VAL A 1  1163 ? -29.500 -2.265  -36.418 1.00 72.28  ? 1163 VAL A O     1 
ATOM   8681  C  CB    . VAL A 1  1163 ? -29.577 -3.197  -39.227 1.00 68.65  ? 1163 VAL A CB    1 
ATOM   8682  C  CG1   . VAL A 1  1163 ? -31.059 -2.889  -39.436 1.00 68.50  ? 1163 VAL A CG1   1 
ATOM   8683  C  CG2   . VAL A 1  1163 ? -28.937 -3.691  -40.514 1.00 68.01  ? 1163 VAL A CG2   1 
ATOM   8684  N  N     . TYR A 1  1164 ? -29.939 -0.248  -37.355 1.00 72.44  ? 1164 TYR A N     1 
ATOM   8685  C  CA    . TYR A 1  1164 ? -30.566 0.338   -36.161 1.00 73.20  ? 1164 TYR A CA    1 
ATOM   8686  C  C     . TYR A 1  1164 ? -32.086 0.384   -36.277 1.00 72.40  ? 1164 TYR A C     1 
ATOM   8687  O  O     . TYR A 1  1164 ? -32.633 0.507   -37.373 1.00 71.68  ? 1164 TYR A O     1 
ATOM   8688  C  CB    . TYR A 1  1164 ? -30.036 1.752   -35.910 1.00 74.96  ? 1164 TYR A CB    1 
ATOM   8689  C  CG    . TYR A 1  1164 ? -28.555 1.797   -35.627 1.00 75.60  ? 1164 TYR A CG    1 
ATOM   8690  C  CD1   . TYR A 1  1164 ? -28.036 1.233   -34.466 1.00 75.95  ? 1164 TYR A CD1   1 
ATOM   8691  C  CD2   . TYR A 1  1164 ? -27.667 2.393   -36.524 1.00 76.19  ? 1164 TYR A CD2   1 
ATOM   8692  C  CE1   . TYR A 1  1164 ? -26.676 1.263   -34.199 1.00 77.17  ? 1164 TYR A CE1   1 
ATOM   8693  C  CE2   . TYR A 1  1164 ? -26.303 2.427   -36.267 1.00 77.20  ? 1164 TYR A CE2   1 
ATOM   8694  C  CZ    . TYR A 1  1164 ? -25.813 1.859   -35.102 1.00 77.63  ? 1164 TYR A CZ    1 
ATOM   8695  O  OH    . TYR A 1  1164 ? -24.464 1.883   -34.834 1.00 79.08  ? 1164 TYR A OH    1 
ATOM   8696  N  N     . GLY A 1  1165 ? -32.764 0.302   -35.139 1.00 72.46  ? 1165 GLY A N     1 
ATOM   8697  C  CA    . GLY A 1  1165 ? -34.218 0.384   -35.118 1.00 72.63  ? 1165 GLY A CA    1 
ATOM   8698  C  C     . GLY A 1  1165 ? -34.815 0.574   -33.736 1.00 73.85  ? 1165 GLY A C     1 
ATOM   8699  O  O     . GLY A 1  1165 ? -34.098 0.662   -32.729 1.00 74.87  ? 1165 GLY A O     1 
ATOM   8700  N  N     . ALA A 1  1166 ? -36.142 0.651   -33.705 1.00 73.06  ? 1166 ALA A N     1 
ATOM   8701  C  CA    . ALA A 1  1166 ? -36.902 0.647   -32.459 1.00 73.08  ? 1166 ALA A CA    1 
ATOM   8702  C  C     . ALA A 1  1166 ? -38.298 0.092   -32.720 1.00 71.55  ? 1166 ALA A C     1 
ATOM   8703  O  O     . ALA A 1  1166 ? -38.794 0.145   -33.849 1.00 69.73  ? 1166 ALA A O     1 
ATOM   8704  C  CB    . ALA A 1  1166 ? -36.976 2.048   -31.865 1.00 74.57  ? 1166 ALA A CB    1 
ATOM   8705  N  N     . ALA A 1  1167 ? -38.917 -0.440  -31.671 1.00 71.72  ? 1167 ALA A N     1 
ATOM   8706  C  CA    . ALA A 1  1167 ? -40.234 -1.054  -31.777 1.00 71.54  ? 1167 ALA A CA    1 
ATOM   8707  C  C     . ALA A 1  1167 ? -41.036 -0.865  -30.500 1.00 72.83  ? 1167 ALA A C     1 
ATOM   8708  O  O     . ALA A 1  1167 ? -40.576 -1.212  -29.410 1.00 72.72  ? 1167 ALA A O     1 
ATOM   8709  C  CB    . ALA A 1  1167 ? -40.106 -2.536  -32.097 1.00 70.56  ? 1167 ALA A CB    1 
ATOM   8710  N  N     . CYS A 1  1168 ? -42.235 -0.312  -30.660 1.00 74.15  ? 1168 CYS A N     1 
ATOM   8711  C  CA    . CYS A 1  1168 ? -43.200 -0.140  -29.588 1.00 75.77  ? 1168 CYS A CA    1 
ATOM   8712  C  C     . CYS A 1  1168 ? -44.333 -1.133  -29.828 1.00 74.66  ? 1168 CYS A C     1 
ATOM   8713  O  O     . CYS A 1  1168 ? -44.770 -1.285  -30.966 1.00 72.99  ? 1168 CYS A O     1 
ATOM   8714  C  CB    . CYS A 1  1168 ? -43.745 1.280   -29.624 1.00 77.88  ? 1168 CYS A CB    1 
ATOM   8715  S  SG    . CYS A 1  1168 ? -44.894 1.655   -28.291 1.00 81.86  ? 1168 CYS A SG    1 
ATOM   8716  N  N     . SER A 1  1169 ? -44.799 -1.800  -28.771 1.00 74.86  ? 1169 SER A N     1 
ATOM   8717  C  CA    . SER A 1  1169 ? -45.903 -2.771  -28.867 1.00 73.95  ? 1169 SER A CA    1 
ATOM   8718  C  C     . SER A 1  1169 ? -46.877 -2.654  -27.696 1.00 74.05  ? 1169 SER A C     1 
ATOM   8719  O  O     . SER A 1  1169 ? -46.459 -2.455  -26.556 1.00 74.81  ? 1169 SER A O     1 
ATOM   8720  C  CB    . SER A 1  1169 ? -45.364 -4.206  -28.924 1.00 73.29  ? 1169 SER A CB    1 
ATOM   8721  O  OG    . SER A 1  1169 ? -44.946 -4.560  -30.228 1.00 72.16  ? 1169 SER A OG    1 
ATOM   8722  N  N     . GLU A 1  1170 ? -48.169 -2.803  -27.989 1.00 73.30  ? 1170 GLU A N     1 
ATOM   8723  C  CA    . GLU A 1  1170 ? -49.229 -2.764  -26.984 1.00 73.98  ? 1170 GLU A CA    1 
ATOM   8724  C  C     . GLU A 1  1170 ? -49.990 -4.078  -26.992 1.00 72.14  ? 1170 GLU A C     1 
ATOM   8725  O  O     . GLU A 1  1170 ? -50.218 -4.656  -28.052 1.00 70.98  ? 1170 GLU A O     1 
ATOM   8726  C  CB    . GLU A 1  1170 ? -50.186 -1.608  -27.272 1.00 75.53  ? 1170 GLU A CB    1 
ATOM   8727  C  CG    . GLU A 1  1170 ? -51.291 -1.412  -26.239 1.00 77.37  ? 1170 GLU A CG    1 
ATOM   8728  C  CD    . GLU A 1  1170 ? -52.124 -0.154  -26.468 1.00 78.91  ? 1170 GLU A CD    1 
ATOM   8729  O  OE1   . GLU A 1  1170 ? -51.991 0.489   -27.536 1.00 78.98  ? 1170 GLU A OE1   1 
ATOM   8730  O  OE2   . GLU A 1  1170 ? -52.928 0.192   -25.573 1.00 80.18  ? 1170 GLU A OE2   1 
ATOM   8731  N  N     . VAL A 1  1171 ? -50.379 -4.545  -25.806 1.00 72.38  ? 1171 VAL A N     1 
ATOM   8732  C  CA    . VAL A 1  1171 ? -51.180 -5.767  -25.668 1.00 71.38  ? 1171 VAL A CA    1 
ATOM   8733  C  C     . VAL A 1  1171 ? -52.280 -5.597  -24.629 1.00 71.36  ? 1171 VAL A C     1 
ATOM   8734  O  O     . VAL A 1  1171 ? -52.213 -4.704  -23.800 1.00 72.62  ? 1171 VAL A O     1 
ATOM   8735  C  CB    . VAL A 1  1171 ? -50.319 -7.008  -25.293 1.00 70.60  ? 1171 VAL A CB    1 
ATOM   8736  C  CG1   . VAL A 1  1171 ? -49.213 -7.227  -26.318 1.00 69.54  ? 1171 VAL A CG1   1 
ATOM   8737  C  CG2   . VAL A 1  1171 ? -49.750 -6.903  -23.879 1.00 71.32  ? 1171 VAL A CG2   1 
ATOM   8738  N  N     . GLU A 1  1172 ? -53.304 -6.441  -24.721 1.00 70.83  ? 1172 GLU A N     1 
ATOM   8739  C  CA    . GLU A 1  1172 ? -54.266 -6.643  -23.641 1.00 71.81  ? 1172 GLU A CA    1 
ATOM   8740  C  C     . GLU A 1  1172 ? -54.265 -8.126  -23.303 1.00 71.32  ? 1172 GLU A C     1 
ATOM   8741  O  O     . GLU A 1  1172 ? -54.303 -8.964  -24.204 1.00 70.21  ? 1172 GLU A O     1 
ATOM   8742  C  CB    . GLU A 1  1172 ? -55.680 -6.191  -24.031 1.00 72.07  ? 1172 GLU A CB    1 
ATOM   8743  C  CG    . GLU A 1  1172 ? -56.687 -6.264  -22.878 1.00 73.22  ? 1172 GLU A CG    1 
ATOM   8744  C  CD    . GLU A 1  1172 ? -58.063 -5.697  -23.208 1.00 73.52  ? 1172 GLU A CD    1 
ATOM   8745  O  OE1   . GLU A 1  1172 ? -58.267 -5.175  -24.324 1.00 73.15  ? 1172 GLU A OE1   1 
ATOM   8746  O  OE2   . GLU A 1  1172 ? -58.956 -5.776  -22.335 1.00 73.85  ? 1172 GLU A OE2   1 
ATOM   8747  N  N     . ILE A 1  1173 ? -54.218 -8.437  -22.007 1.00 72.16  ? 1173 ILE A N     1 
ATOM   8748  C  CA    . ILE A 1  1173 ? -54.240 -9.818  -21.524 1.00 72.21  ? 1173 ILE A CA    1 
ATOM   8749  C  C     . ILE A 1  1173 ? -55.566 -10.128 -20.835 1.00 73.52  ? 1173 ILE A C     1 
ATOM   8750  O  O     . ILE A 1  1173 ? -56.282 -9.218  -20.409 1.00 74.89  ? 1173 ILE A O     1 
ATOM   8751  C  CB    . ILE A 1  1173 ? -53.046 -10.124 -20.576 1.00 72.39  ? 1173 ILE A CB    1 
ATOM   8752  C  CG1   . ILE A 1  1173 ? -53.221 -9.492  -19.183 1.00 73.68  ? 1173 ILE A CG1   1 
ATOM   8753  C  CG2   . ILE A 1  1173 ? -51.741 -9.655  -21.209 1.00 72.01  ? 1173 ILE A CG2   1 
ATOM   8754  C  CD1   . ILE A 1  1173 ? -52.112 -9.836  -18.211 1.00 74.11  ? 1173 ILE A CD1   1 
ATOM   8755  N  N     . ASP A 1  1174 ? -55.871 -11.419 -20.740 1.00 73.88  ? 1174 ASP A N     1 
ATOM   8756  C  CA    . ASP A 1  1174 ? -57.007 -11.929 -19.980 1.00 75.44  ? 1174 ASP A CA    1 
ATOM   8757  C  C     . ASP A 1  1174 ? -56.448 -12.643 -18.760 1.00 76.40  ? 1174 ASP A C     1 
ATOM   8758  O  O     . ASP A 1  1174 ? -55.967 -13.770 -18.864 1.00 77.46  ? 1174 ASP A O     1 
ATOM   8759  C  CB    . ASP A 1  1174 ? -57.836 -12.885 -20.846 1.00 74.93  ? 1174 ASP A CB    1 
ATOM   8760  C  CG    . ASP A 1  1174 ? -59.193 -13.217 -20.239 1.00 75.66  ? 1174 ASP A CG    1 
ATOM   8761  O  OD1   . ASP A 1  1174 ? -59.305 -13.399 -19.005 1.00 77.68  ? 1174 ASP A OD1   1 
ATOM   8762  O  OD2   . ASP A 1  1174 ? -60.162 -13.307 -21.016 1.00 74.96  ? 1174 ASP A OD2   1 
ATOM   8763  N  N     . CYS A 1  1175 ? -56.516 -11.990 -17.605 1.00 77.49  ? 1175 CYS A N     1 
ATOM   8764  C  CA    . CYS A 1  1175 ? -55.913 -12.523 -16.383 1.00 78.67  ? 1175 CYS A CA    1 
ATOM   8765  C  C     . CYS A 1  1175 ? -56.541 -13.839 -15.909 1.00 78.82  ? 1175 CYS A C     1 
ATOM   8766  O  O     . CYS A 1  1175 ? -55.887 -14.612 -15.211 1.00 78.76  ? 1175 CYS A O     1 
ATOM   8767  C  CB    . CYS A 1  1175 ? -55.979 -11.479 -15.264 1.00 80.83  ? 1175 CYS A CB    1 
ATOM   8768  S  SG    . CYS A 1  1175 ? -55.281 -9.872  -15.719 1.00 80.85  ? 1175 CYS A SG    1 
ATOM   8769  N  N     . LEU A 1  1176 ? -57.798 -14.085 -16.290 1.00 78.90  ? 1176 LEU A N     1 
ATOM   8770  C  CA    . LEU A 1  1176 ? -58.499 -15.323 -15.938 1.00 79.30  ? 1176 LEU A CA    1 
ATOM   8771  C  C     . LEU A 1  1176 ? -58.105 -16.510 -16.822 1.00 78.19  ? 1176 LEU A C     1 
ATOM   8772  O  O     . LEU A 1  1176 ? -57.893 -17.607 -16.314 1.00 78.84  ? 1176 LEU A O     1 
ATOM   8773  C  CB    . LEU A 1  1176 ? -60.022 -15.122 -15.986 1.00 79.65  ? 1176 LEU A CB    1 
ATOM   8774  C  CG    . LEU A 1  1176 ? -60.618 -14.170 -14.940 1.00 80.87  ? 1176 LEU A CG    1 
ATOM   8775  C  CD1   . LEU A 1  1176 ? -62.070 -13.864 -15.274 1.00 81.38  ? 1176 LEU A CD1   1 
ATOM   8776  C  CD2   . LEU A 1  1176 ? -60.508 -14.738 -13.534 1.00 81.65  ? 1176 LEU A CD2   1 
ATOM   8777  N  N     . THR A 1  1177 ? -58.022 -16.296 -18.133 1.00 76.99  ? 1177 THR A N     1 
ATOM   8778  C  CA    . THR A 1  1177 ? -57.729 -17.377 -19.081 1.00 75.74  ? 1177 THR A CA    1 
ATOM   8779  C  C     . THR A 1  1177 ? -56.258 -17.457 -19.492 1.00 75.19  ? 1177 THR A C     1 
ATOM   8780  O  O     . THR A 1  1177 ? -55.763 -18.544 -19.760 1.00 75.63  ? 1177 THR A O     1 
ATOM   8781  C  CB    . THR A 1  1177 ? -58.612 -17.286 -20.350 1.00 75.26  ? 1177 THR A CB    1 
ATOM   8782  O  OG1   . THR A 1  1177 ? -58.167 -16.220 -21.200 1.00 74.27  ? 1177 THR A OG1   1 
ATOM   8783  C  CG2   . THR A 1  1177 ? -60.081 -17.070 -19.970 1.00 76.10  ? 1177 THR A CG2   1 
ATOM   8784  N  N     . GLY A 1  1178 ? -55.561 -16.321 -19.533 1.00 74.95  ? 1178 GLY A N     1 
ATOM   8785  C  CA    . GLY A 1  1178 ? -54.181 -16.260 -20.036 1.00 74.09  ? 1178 GLY A CA    1 
ATOM   8786  C  C     . GLY A 1  1178 ? -54.083 -15.949 -21.522 1.00 72.77  ? 1178 GLY A C     1 
ATOM   8787  O  O     . GLY A 1  1178 ? -53.001 -15.991 -22.097 1.00 72.14  ? 1178 GLY A O     1 
ATOM   8788  N  N     . ASP A 1  1179 ? -55.213 -15.628 -22.146 1.00 72.95  ? 1179 ASP A N     1 
ATOM   8789  C  CA    . ASP A 1  1179 ? -55.250 -15.170 -23.529 1.00 71.91  ? 1179 ASP A CA    1 
ATOM   8790  C  C     . ASP A 1  1179 ? -54.602 -13.787 -23.591 1.00 71.42  ? 1179 ASP A C     1 
ATOM   8791  O  O     . ASP A 1  1179 ? -54.468 -13.110 -22.570 1.00 72.25  ? 1179 ASP A O     1 
ATOM   8792  C  CB    . ASP A 1  1179 ? -56.716 -15.088 -24.001 1.00 72.92  ? 1179 ASP A CB    1 
ATOM   8793  C  CG    . ASP A 1  1179 ? -56.867 -14.856 -25.504 1.00 72.67  ? 1179 ASP A CG    1 
ATOM   8794  O  OD1   . ASP A 1  1179 ? -55.869 -14.919 -26.255 1.00 73.11  ? 1179 ASP A OD1   1 
ATOM   8795  O  OD2   . ASP A 1  1179 ? -58.015 -14.609 -25.940 1.00 73.43  ? 1179 ASP A OD2   1 
ATOM   8796  N  N     . HIS A 1  1180 ? -54.176 -13.385 -24.780 1.00 69.71  ? 1180 HIS A N     1 
ATOM   8797  C  CA    . HIS A 1  1180 ? -53.827 -11.991 -25.020 1.00 69.42  ? 1180 HIS A CA    1 
ATOM   8798  C  C     . HIS A 1  1180 ? -54.106 -11.590 -26.465 1.00 69.13  ? 1180 HIS A C     1 
ATOM   8799  O  O     . HIS A 1  1180 ? -54.307 -12.437 -27.337 1.00 68.05  ? 1180 HIS A O     1 
ATOM   8800  C  CB    . HIS A 1  1180 ? -52.374 -11.696 -24.608 1.00 68.69  ? 1180 HIS A CB    1 
ATOM   8801  C  CG    . HIS A 1  1180 ? -51.358 -11.968 -25.676 1.00 66.90  ? 1180 HIS A CG    1 
ATOM   8802  N  ND1   . HIS A 1  1180 ? -50.868 -13.228 -25.942 1.00 65.66  ? 1180 HIS A ND1   1 
ATOM   8803  C  CD2   . HIS A 1  1180 ? -50.725 -11.131 -26.531 1.00 65.98  ? 1180 HIS A CD2   1 
ATOM   8804  C  CE1   . HIS A 1  1180 ? -49.985 -13.157 -26.922 1.00 64.90  ? 1180 HIS A CE1   1 
ATOM   8805  N  NE2   . HIS A 1  1180 ? -49.878 -11.894 -27.294 1.00 64.88  ? 1180 HIS A NE2   1 
ATOM   8806  N  N     . LYS A 1  1181 ? -54.150 -10.282 -26.682 1.00 70.79  ? 1181 LYS A N     1 
ATOM   8807  C  CA    . LYS A 1  1181 ? -54.344 -9.697  -27.995 1.00 71.24  ? 1181 LYS A CA    1 
ATOM   8808  C  C     . LYS A 1  1181 ? -53.250 -8.660  -28.200 1.00 70.98  ? 1181 LYS A C     1 
ATOM   8809  O  O     . LYS A 1  1181 ? -52.948 -7.894  -27.284 1.00 72.50  ? 1181 LYS A O     1 
ATOM   8810  C  CB    . LYS A 1  1181 ? -55.724 -9.034  -28.074 1.00 73.39  ? 1181 LYS A CB    1 
ATOM   8811  C  CG    . LYS A 1  1181 ? -56.080 -8.407  -29.418 1.00 75.03  ? 1181 LYS A CG    1 
ATOM   8812  C  CD    . LYS A 1  1181 ? -56.296 -9.454  -30.502 1.00 75.83  ? 1181 LYS A CD    1 
ATOM   8813  C  CE    . LYS A 1  1181 ? -56.547 -8.816  -31.859 1.00 76.68  ? 1181 LYS A CE    1 
ATOM   8814  N  NZ    . LYS A 1  1181 ? -57.112 -9.793  -32.834 1.00 76.82  ? 1181 LYS A NZ    1 
ATOM   8815  N  N     . ASN A 1  1182 ? -52.657 -8.651  -29.390 1.00 69.33  ? 1182 ASN A N     1 
ATOM   8816  C  CA    . ASN A 1  1182 ? -51.708 -7.619  -29.790 1.00 68.86  ? 1182 ASN A CA    1 
ATOM   8817  C  C     . ASN A 1  1182 ? -52.489 -6.504  -30.470 1.00 68.80  ? 1182 ASN A C     1 
ATOM   8818  O  O     . ASN A 1  1182 ? -53.016 -6.696  -31.562 1.00 67.05  ? 1182 ASN A O     1 
ATOM   8819  C  CB    . ASN A 1  1182 ? -50.650 -8.205  -30.729 1.00 67.89  ? 1182 ASN A CB    1 
ATOM   8820  C  CG    . ASN A 1  1182 ? -49.924 -9.399  -30.120 1.00 67.46  ? 1182 ASN A CG    1 
ATOM   8821  O  OD1   . ASN A 1  1182 ? -49.699 -9.454  -28.909 1.00 67.43  ? 1182 ASN A OD1   1 
ATOM   8822  N  ND2   . ASN A 1  1182 ? -49.560 -10.363 -30.961 1.00 66.19  ? 1182 ASN A ND2   1 
ATOM   8823  N  N     . ILE A 1  1183 ? -52.605 -5.353  -29.803 1.00 70.73  ? 1183 ILE A N     1 
ATOM   8824  C  CA    . ILE A 1  1183 ? -53.402 -4.234  -30.326 1.00 71.67  ? 1183 ILE A CA    1 
ATOM   8825  C  C     . ILE A 1  1183 ? -52.634 -3.486  -31.403 1.00 71.56  ? 1183 ILE A C     1 
ATOM   8826  O  O     . ILE A 1  1183 ? -53.125 -3.319  -32.513 1.00 71.28  ? 1183 ILE A O     1 
ATOM   8827  C  CB    . ILE A 1  1183 ? -53.857 -3.252  -29.209 1.00 72.51  ? 1183 ILE A CB    1 
ATOM   8828  C  CG1   . ILE A 1  1183 ? -54.817 -3.958  -28.237 1.00 72.43  ? 1183 ILE A CG1   1 
ATOM   8829  C  CG2   . ILE A 1  1183 ? -54.519 -2.001  -29.792 1.00 73.12  ? 1183 ILE A CG2   1 
ATOM   8830  C  CD1   . ILE A 1  1183 ? -54.246 -4.159  -26.859 1.00 73.45  ? 1183 ILE A CD1   1 
ATOM   8831  N  N     . ARG A 1  1184 ? -51.432 -3.033  -31.070 1.00 72.79  ? 1184 ARG A N     1 
ATOM   8832  C  CA    . ARG A 1  1184 ? -50.693 -2.138  -31.949 1.00 73.93  ? 1184 ARG A CA    1 
ATOM   8833  C  C     . ARG A 1  1184 ? -49.194 -2.322  -31.803 1.00 73.79  ? 1184 ARG A C     1 
ATOM   8834  O  O     . ARG A 1  1184 ? -48.698 -2.579  -30.708 1.00 74.44  ? 1184 ARG A O     1 
ATOM   8835  C  CB    . ARG A 1  1184 ? -51.083 -0.690  -31.652 1.00 76.05  ? 1184 ARG A CB    1 
ATOM   8836  C  CG    . ARG A 1  1184 ? -50.311 0.359   -32.435 1.00 76.72  ? 1184 ARG A CG    1 
ATOM   8837  C  CD    . ARG A 1  1184 ? -50.983 1.713   -32.321 1.00 78.45  ? 1184 ARG A CD    1 
ATOM   8838  N  NE    . ARG A 1  1184 ? -50.228 2.748   -33.021 1.00 79.44  ? 1184 ARG A NE    1 
ATOM   8839  C  CZ    . ARG A 1  1184 ? -50.444 4.059   -32.915 1.00 81.15  ? 1184 ARG A CZ    1 
ATOM   8840  N  NH1   . ARG A 1  1184 ? -51.395 4.544   -32.113 1.00 82.53  ? 1184 ARG A NH1   1 
ATOM   8841  N  NH2   . ARG A 1  1184 ? -49.688 4.900   -33.617 1.00 81.90  ? 1184 ARG A NH2   1 
ATOM   8842  N  N     . THR A 1  1185 ? -48.491 -2.185  -32.925 1.00 73.36  ? 1185 THR A N     1 
ATOM   8843  C  CA    . THR A 1  1185 ? -47.043 -2.264  -32.963 1.00 73.27  ? 1185 THR A CA    1 
ATOM   8844  C  C     . THR A 1  1185 ? -46.513 -1.227  -33.959 1.00 74.73  ? 1185 THR A C     1 
ATOM   8845  O  O     . THR A 1  1185 ? -46.893 -1.246  -35.128 1.00 75.70  ? 1185 THR A O     1 
ATOM   8846  C  CB    . THR A 1  1185 ? -46.572 -3.684  -33.343 1.00 71.46  ? 1185 THR A CB    1 
ATOM   8847  O  OG1   . THR A 1  1185 ? -47.035 -4.625  -32.361 1.00 70.99  ? 1185 THR A OG1   1 
ATOM   8848  C  CG2   . THR A 1  1185 ? -45.041 -3.760  -33.429 1.00 71.52  ? 1185 THR A CG2   1 
ATOM   8849  N  N     . ASP A 1  1186 ? -45.654 -0.324  -33.481 1.00 75.82  ? 1186 ASP A N     1 
ATOM   8850  C  CA    . ASP A 1  1186 ? -45.002 0.678   -34.326 1.00 76.86  ? 1186 ASP A CA    1 
ATOM   8851  C  C     . ASP A 1  1186 ? -43.532 0.314   -34.480 1.00 76.41  ? 1186 ASP A C     1 
ATOM   8852  O  O     . ASP A 1  1186 ? -42.890 -0.032  -33.495 1.00 76.55  ? 1186 ASP A O     1 
ATOM   8853  C  CB    . ASP A 1  1186 ? -45.116 2.066   -33.696 1.00 79.46  ? 1186 ASP A CB    1 
ATOM   8854  C  CG    . ASP A 1  1186 ? -46.558 2.492   -33.474 1.00 80.45  ? 1186 ASP A CG    1 
ATOM   8855  O  OD1   . ASP A 1  1186 ? -47.215 1.940   -32.556 1.00 80.84  ? 1186 ASP A OD1   1 
ATOM   8856  O  OD2   . ASP A 1  1186 ? -47.028 3.386   -34.213 1.00 80.78  ? 1186 ASP A OD2   1 
ATOM   8857  N  N     . ILE A 1  1187 ? -43.008 0.385   -35.705 1.00 76.25  ? 1187 ILE A N     1 
ATOM   8858  C  CA    . ILE A 1  1187 ? -41.605 0.044   -35.990 1.00 76.31  ? 1187 ILE A CA    1 
ATOM   8859  C  C     . ILE A 1  1187 ? -40.940 1.131   -36.841 1.00 77.24  ? 1187 ILE A C     1 
ATOM   8860  O  O     . ILE A 1  1187 ? -41.451 1.489   -37.903 1.00 76.70  ? 1187 ILE A O     1 
ATOM   8861  C  CB    . ILE A 1  1187 ? -41.478 -1.319  -36.722 1.00 74.96  ? 1187 ILE A CB    1 
ATOM   8862  C  CG1   . ILE A 1  1187 ? -42.073 -2.451  -35.867 1.00 74.25  ? 1187 ILE A CG1   1 
ATOM   8863  C  CG2   . ILE A 1  1187 ? -40.016 -1.613  -37.069 1.00 74.58  ? 1187 ILE A CG2   1 
ATOM   8864  C  CD1   . ILE A 1  1187 ? -42.090 -3.810  -36.543 1.00 72.78  ? 1187 ILE A CD1   1 
ATOM   8865  N  N     . VAL A 1  1188 ? -39.802 1.642   -36.364 1.00 78.86  ? 1188 VAL A N     1 
ATOM   8866  C  CA    . VAL A 1  1188 ? -38.941 2.551   -37.130 1.00 79.94  ? 1188 VAL A CA    1 
ATOM   8867  C  C     . VAL A 1  1188 ? -37.603 1.858   -37.331 1.00 80.23  ? 1188 VAL A C     1 
ATOM   8868  O  O     . VAL A 1  1188 ? -37.077 1.258   -36.394 1.00 80.57  ? 1188 VAL A O     1 
ATOM   8869  C  CB    . VAL A 1  1188 ? -38.715 3.892   -36.404 1.00 81.34  ? 1188 VAL A CB    1 
ATOM   8870  C  CG1   . VAL A 1  1188 ? -37.803 4.803   -37.223 1.00 82.05  ? 1188 VAL A CG1   1 
ATOM   8871  C  CG2   . VAL A 1  1188 ? -40.045 4.578   -36.123 1.00 81.74  ? 1188 VAL A CG2   1 
ATOM   8872  N  N     . MET A 1  1189 ? -37.046 1.967   -38.537 1.00 81.34  ? 1189 MET A N     1 
ATOM   8873  C  CA    . MET A 1  1189 ? -35.903 1.143   -38.949 1.00 82.70  ? 1189 MET A CA    1 
ATOM   8874  C  C     . MET A 1  1189 ? -34.936 1.891   -39.873 1.00 83.38  ? 1189 MET A C     1 
ATOM   8875  O  O     . MET A 1  1189 ? -35.343 2.407   -40.915 1.00 85.16  ? 1189 MET A O     1 
ATOM   8876  C  CB    . MET A 1  1189 ? -36.435 -0.097  -39.669 1.00 82.11  ? 1189 MET A CB    1 
ATOM   8877  C  CG    . MET A 1  1189 ? -35.404 -1.170  -40.003 1.00 82.77  ? 1189 MET A CG    1 
ATOM   8878  S  SD    . MET A 1  1189 ? -35.022 -2.302  -38.654 1.00 84.25  ? 1189 MET A SD    1 
ATOM   8879  C  CE    . MET A 1  1189 ? -36.600 -3.097  -38.389 1.00 83.17  ? 1189 MET A CE    1 
ATOM   8880  N  N     . ASP A 1  1190 ? -33.660 1.930   -39.491 1.00 82.84  ? 1190 ASP A N     1 
ATOM   8881  C  CA    . ASP A 1  1190 ? -32.594 2.433   -40.360 1.00 82.54  ? 1190 ASP A CA    1 
ATOM   8882  C  C     . ASP A 1  1190 ? -32.167 1.317   -41.306 1.00 80.58  ? 1190 ASP A C     1 
ATOM   8883  O  O     . ASP A 1  1190 ? -31.587 0.325   -40.874 1.00 80.04  ? 1190 ASP A O     1 
ATOM   8884  C  CB    . ASP A 1  1190 ? -31.398 2.921   -39.531 1.00 84.07  ? 1190 ASP A CB    1 
ATOM   8885  C  CG    . ASP A 1  1190 ? -30.196 3.333   -40.387 1.00 84.40  ? 1190 ASP A CG    1 
ATOM   8886  O  OD1   . ASP A 1  1190 ? -30.361 3.683   -41.578 1.00 83.53  ? 1190 ASP A OD1   1 
ATOM   8887  O  OD2   . ASP A 1  1190 ? -29.071 3.314   -39.843 1.00 85.35  ? 1190 ASP A OD2   1 
ATOM   8888  N  N     . VAL A 1  1191 ? -32.438 1.507   -42.593 1.00 80.38  ? 1191 VAL A N     1 
ATOM   8889  C  CA    . VAL A 1  1191 ? -32.121 0.522   -43.639 1.00 79.46  ? 1191 VAL A CA    1 
ATOM   8890  C  C     . VAL A 1  1191 ? -31.084 1.069   -44.646 1.00 78.99  ? 1191 VAL A C     1 
ATOM   8891  O  O     . VAL A 1  1191 ? -30.742 0.399   -45.625 1.00 77.76  ? 1191 VAL A O     1 
ATOM   8892  C  CB    . VAL A 1  1191 ? -33.425 0.056   -44.352 1.00 79.30  ? 1191 VAL A CB    1 
ATOM   8893  C  CG1   . VAL A 1  1191 ? -34.190 1.224   -44.973 1.00 80.44  ? 1191 VAL A CG1   1 
ATOM   8894  C  CG2   . VAL A 1  1191 ? -33.151 -1.012  -45.402 1.00 79.53  ? 1191 VAL A CG2   1 
ATOM   8895  N  N     . GLY A 1  1192 ? -30.555 2.265   -44.388 1.00 79.60  ? 1192 GLY A N     1 
ATOM   8896  C  CA    . GLY A 1  1192 ? -29.777 2.993   -45.387 1.00 79.80  ? 1192 GLY A CA    1 
ATOM   8897  C  C     . GLY A 1  1192 ? -30.677 3.376   -46.547 1.00 79.05  ? 1192 GLY A C     1 
ATOM   8898  O  O     . GLY A 1  1192 ? -31.808 3.837   -46.339 1.00 79.30  ? 1192 GLY A O     1 
ATOM   8899  N  N     . CYS A 1  1193 ? -30.180 3.169   -47.764 1.00 78.04  ? 1193 CYS A N     1 
ATOM   8900  C  CA    . CYS A 1  1193 ? -30.977 3.332   -48.979 1.00 77.41  ? 1193 CYS A CA    1 
ATOM   8901  C  C     . CYS A 1  1193 ? -31.490 1.965   -49.411 1.00 75.28  ? 1193 CYS A C     1 
ATOM   8902  O  O     . CYS A 1  1193 ? -30.705 1.091   -49.785 1.00 74.48  ? 1193 CYS A O     1 
ATOM   8903  C  CB    . CYS A 1  1193 ? -30.134 3.960   -50.085 1.00 77.82  ? 1193 CYS A CB    1 
ATOM   8904  S  SG    . CYS A 1  1193 ? -29.225 5.401   -49.506 1.00 80.84  ? 1193 CYS A SG    1 
ATOM   8905  N  N     . SER A 1  1194 ? -32.806 1.784   -49.351 1.00 74.21  ? 1194 SER A N     1 
ATOM   8906  C  CA    . SER A 1  1194 ? -33.422 0.507   -49.686 1.00 72.50  ? 1194 SER A CA    1 
ATOM   8907  C  C     . SER A 1  1194 ? -33.351 0.257   -51.185 1.00 71.72  ? 1194 SER A C     1 
ATOM   8908  O  O     . SER A 1  1194 ? -33.803 1.090   -51.971 1.00 71.80  ? 1194 SER A O     1 
ATOM   8909  C  CB    . SER A 1  1194 ? -34.879 0.487   -49.234 1.00 73.08  ? 1194 SER A CB    1 
ATOM   8910  O  OG    . SER A 1  1194 ? -35.484 -0.757  -49.524 1.00 72.91  ? 1194 SER A OG    1 
ATOM   8911  N  N     . ILE A 1  1195 ? -32.777 -0.884  -51.570 1.00 70.48  ? 1195 ILE A N     1 
ATOM   8912  C  CA    . ILE A 1  1195 ? -32.711 -1.297  -52.980 1.00 69.59  ? 1195 ILE A CA    1 
ATOM   8913  C  C     . ILE A 1  1195 ? -34.114 -1.647  -53.487 1.00 68.44  ? 1195 ILE A C     1 
ATOM   8914  O  O     . ILE A 1  1195 ? -34.425 -1.437  -54.666 1.00 68.12  ? 1195 ILE A O     1 
ATOM   8915  C  CB    . ILE A 1  1195 ? -31.727 -2.478  -53.184 1.00 69.41  ? 1195 ILE A CB    1 
ATOM   8916  C  CG1   . ILE A 1  1195 ? -30.291 -2.029  -52.877 1.00 70.48  ? 1195 ILE A CG1   1 
ATOM   8917  C  CG2   . ILE A 1  1195 ? -31.795 -3.026  -54.609 1.00 69.40  ? 1195 ILE A CG2   1 
ATOM   8918  C  CD1   . ILE A 1  1195 ? -29.353 -3.163  -52.513 1.00 70.34  ? 1195 ILE A CD1   1 
ATOM   8919  N  N     . ASN A 1  1196 ? -34.948 -2.168  -52.586 1.00 67.14  ? 1196 ASN A N     1 
ATOM   8920  C  CA    . ASN A 1  1196 ? -36.339 -2.472  -52.880 1.00 66.39  ? 1196 ASN A CA    1 
ATOM   8921  C  C     . ASN A 1  1196 ? -37.177 -2.382  -51.594 1.00 65.70  ? 1196 ASN A C     1 
ATOM   8922  O  O     . ASN A 1  1196 ? -37.164 -3.311  -50.782 1.00 65.13  ? 1196 ASN A O     1 
ATOM   8923  C  CB    . ASN A 1  1196 ? -36.438 -3.866  -53.505 1.00 66.20  ? 1196 ASN A CB    1 
ATOM   8924  C  CG    . ASN A 1  1196 ? -37.818 -4.162  -54.063 1.00 66.85  ? 1196 ASN A CG    1 
ATOM   8925  O  OD1   . ASN A 1  1196 ? -38.834 -3.775  -53.478 1.00 68.24  ? 1196 ASN A OD1   1 
ATOM   8926  N  ND2   . ASN A 1  1196 ? -37.865 -4.857  -55.196 1.00 66.00  ? 1196 ASN A ND2   1 
ATOM   8927  N  N     . PRO A 1  1197 ? -37.901 -1.261  -51.394 1.00 65.45  ? 1197 PRO A N     1 
ATOM   8928  C  CA    . PRO A 1  1197 ? -38.669 -1.089  -50.154 1.00 65.03  ? 1197 PRO A CA    1 
ATOM   8929  C  C     . PRO A 1  1197 ? -39.897 -1.997  -49.988 1.00 64.19  ? 1197 PRO A C     1 
ATOM   8930  O  O     . PRO A 1  1197 ? -40.379 -2.150  -48.866 1.00 63.54  ? 1197 PRO A O     1 
ATOM   8931  C  CB    . PRO A 1  1197 ? -39.088 0.383   -50.202 1.00 65.93  ? 1197 PRO A CB    1 
ATOM   8932  C  CG    . PRO A 1  1197 ? -39.087 0.728   -51.643 1.00 66.06  ? 1197 PRO A CG    1 
ATOM   8933  C  CD    . PRO A 1  1197 ? -37.960 -0.052  -52.235 1.00 65.79  ? 1197 PRO A CD    1 
ATOM   8934  N  N     . ALA A 1  1198 ? -40.403 -2.585  -51.072 1.00 63.21  ? 1198 ALA A N     1 
ATOM   8935  C  CA    . ALA A 1  1198 ? -41.460 -3.591  -50.954 1.00 62.59  ? 1198 ALA A CA    1 
ATOM   8936  C  C     . ALA A 1  1198 ? -40.896 -4.827  -50.269 1.00 62.28  ? 1198 ALA A C     1 
ATOM   8937  O  O     . ALA A 1  1198 ? -41.463 -5.320  -49.284 1.00 61.02  ? 1198 ALA A O     1 
ATOM   8938  C  CB    . ALA A 1  1198 ? -42.028 -3.956  -52.316 1.00 62.25  ? 1198 ALA A CB    1 
ATOM   8939  N  N     . ILE A 1  1199 ? -39.766 -5.295  -50.804 1.00 62.46  ? 1199 ILE A N     1 
ATOM   8940  C  CA    . ILE A 1  1199 ? -39.060 -6.474  -50.304 1.00 61.93  ? 1199 ILE A CA    1 
ATOM   8941  C  C     . ILE A 1  1199 ? -38.481 -6.229  -48.913 1.00 62.53  ? 1199 ILE A C     1 
ATOM   8942  O  O     . ILE A 1  1199 ? -38.593 -7.093  -48.040 1.00 63.86  ? 1199 ILE A O     1 
ATOM   8943  C  CB    . ILE A 1  1199 ? -37.947 -6.926  -51.287 1.00 61.40  ? 1199 ILE A CB    1 
ATOM   8944  C  CG1   . ILE A 1  1199 ? -38.583 -7.504  -52.553 1.00 60.45  ? 1199 ILE A CG1   1 
ATOM   8945  C  CG2   . ILE A 1  1199 ? -37.021 -7.965  -50.657 1.00 60.93  ? 1199 ILE A CG2   1 
ATOM   8946  C  CD1   . ILE A 1  1199 ? -37.611 -7.709  -53.694 1.00 60.55  ? 1199 ILE A CD1   1 
ATOM   8947  N  N     . ASP A 1  1200 ? -37.868 -5.066  -48.706 1.00 62.40  ? 1200 ASP A N     1 
ATOM   8948  C  CA    . ASP A 1  1200 ? -37.245 -4.762  -47.418 1.00 62.67  ? 1200 ASP A CA    1 
ATOM   8949  C  C     . ASP A 1  1200 ? -38.273 -4.562  -46.298 1.00 62.75  ? 1200 ASP A C     1 
ATOM   8950  O  O     . ASP A 1  1200 ? -38.059 -5.048  -45.195 1.00 63.87  ? 1200 ASP A O     1 
ATOM   8951  C  CB    . ASP A 1  1200 ? -36.264 -3.585  -47.538 1.00 63.34  ? 1200 ASP A CB    1 
ATOM   8952  C  CG    . ASP A 1  1200 ? -35.034 -3.929  -48.394 1.00 62.78  ? 1200 ASP A CG    1 
ATOM   8953  O  OD1   . ASP A 1  1200 ? -34.698 -5.126  -48.526 1.00 61.44  ? 1200 ASP A OD1   1 
ATOM   8954  O  OD2   . ASP A 1  1200 ? -34.392 -3.005  -48.935 1.00 63.18  ? 1200 ASP A OD2   1 
ATOM   8955  N  N     . ILE A 1  1201 ? -39.396 -3.901  -46.576 1.00 62.69  ? 1201 ILE A N     1 
ATOM   8956  C  CA    . ILE A 1  1201 ? -40.493 -3.820  -45.590 1.00 63.21  ? 1201 ILE A CA    1 
ATOM   8957  C  C     . ILE A 1  1201 ? -41.070 -5.216  -45.290 1.00 63.07  ? 1201 ILE A C     1 
ATOM   8958  O  O     . ILE A 1  1201 ? -41.401 -5.519  -44.142 1.00 63.98  ? 1201 ILE A O     1 
ATOM   8959  C  CB    . ILE A 1  1201 ? -41.599 -2.824  -46.024 1.00 63.82  ? 1201 ILE A CB    1 
ATOM   8960  C  CG1   . ILE A 1  1201 ? -41.060 -1.389  -45.932 1.00 65.29  ? 1201 ILE A CG1   1 
ATOM   8961  C  CG2   . ILE A 1  1201 ? -42.849 -2.954  -45.151 1.00 63.77  ? 1201 ILE A CG2   1 
ATOM   8962  C  CD1   . ILE A 1  1201 ? -41.910 -0.346  -46.625 1.00 66.05  ? 1201 ILE A CD1   1 
ATOM   8963  N  N     . GLY A 1  1202 ? -41.171 -6.059  -46.315 1.00 61.98  ? 1202 GLY A N     1 
ATOM   8964  C  CA    . GLY A 1  1202 ? -41.593 -7.447  -46.139 1.00 61.12  ? 1202 GLY A CA    1 
ATOM   8965  C  C     . GLY A 1  1202 ? -40.667 -8.279  -45.266 1.00 60.87  ? 1202 GLY A C     1 
ATOM   8966  O  O     . GLY A 1  1202 ? -41.121 -9.186  -44.566 1.00 60.26  ? 1202 GLY A O     1 
ATOM   8967  N  N     . GLN A 1  1203 ? -39.369 -7.985  -45.323 1.00 61.21  ? 1203 GLN A N     1 
ATOM   8968  C  CA    . GLN A 1  1203 ? -38.391 -8.629  -44.441 1.00 61.56  ? 1203 GLN A CA    1 
ATOM   8969  C  C     . GLN A 1  1203 ? -38.550 -8.215  -42.976 1.00 62.17  ? 1203 GLN A C     1 
ATOM   8970  O  O     . GLN A 1  1203 ? -38.374 -9.046  -42.086 1.00 61.96  ? 1203 GLN A O     1 
ATOM   8971  C  CB    . GLN A 1  1203 ? -36.959 -8.347  -44.910 1.00 62.03  ? 1203 GLN A CB    1 
ATOM   8972  C  CG    . GLN A 1  1203 ? -36.588 -9.054  -46.195 1.00 62.04  ? 1203 GLN A CG    1 
ATOM   8973  C  CD    . GLN A 1  1203 ? -36.569 -10.559 -46.031 1.00 61.92  ? 1203 GLN A CD    1 
ATOM   8974  O  OE1   . GLN A 1  1203 ? -35.683 -11.099 -45.376 1.00 63.67  ? 1203 GLN A OE1   1 
ATOM   8975  N  NE2   . GLN A 1  1203 ? -37.550 -11.244 -46.612 1.00 61.13  ? 1203 GLN A NE2   1 
ATOM   8976  N  N     . ILE A 1  1204 ? -38.889 -6.947  -42.734 1.00 62.44  ? 1204 ILE A N     1 
ATOM   8977  C  CA    . ILE A 1  1204 ? -39.080 -6.441  -41.370 1.00 63.64  ? 1204 ILE A CA    1 
ATOM   8978  C  C     . ILE A 1  1204 ? -40.304 -7.099  -40.711 1.00 63.32  ? 1204 ILE A C     1 
ATOM   8979  O  O     . ILE A 1  1204 ? -40.227 -7.562  -39.571 1.00 62.59  ? 1204 ILE A O     1 
ATOM   8980  C  CB    . ILE A 1  1204 ? -39.222 -4.897  -41.340 1.00 65.37  ? 1204 ILE A CB    1 
ATOM   8981  C  CG1   . ILE A 1  1204 ? -37.937 -4.232  -41.857 1.00 65.99  ? 1204 ILE A CG1   1 
ATOM   8982  C  CG2   . ILE A 1  1204 ? -39.532 -4.404  -39.925 1.00 66.26  ? 1204 ILE A CG2   1 
ATOM   8983  C  CD1   . ILE A 1  1204 ? -38.064 -2.755  -42.175 1.00 66.65  ? 1204 ILE A CD1   1 
ATOM   8984  N  N     . GLU A 1  1205 ? -41.415 -7.137  -41.443 1.00 63.55  ? 1205 GLU A N     1 
ATOM   8985  C  CA    . GLU A 1  1205 ? -42.663 -7.741  -40.968 1.00 63.53  ? 1205 GLU A CA    1 
ATOM   8986  C  C     . GLU A 1  1205 ? -42.504 -9.221  -40.657 1.00 62.93  ? 1205 GLU A C     1 
ATOM   8987  O  O     . GLU A 1  1205 ? -42.910 -9.685  -39.587 1.00 64.24  ? 1205 GLU A O     1 
ATOM   8988  C  CB    . GLU A 1  1205 ? -43.759 -7.586  -42.016 1.00 64.11  ? 1205 GLU A CB    1 
ATOM   8989  C  CG    . GLU A 1  1205 ? -44.224 -6.157  -42.194 1.00 66.32  ? 1205 GLU A CG    1 
ATOM   8990  C  CD    . GLU A 1  1205 ? -45.257 -6.010  -43.290 1.00 67.56  ? 1205 GLU A CD    1 
ATOM   8991  O  OE1   . GLU A 1  1205 ? -45.027 -6.522  -44.411 1.00 68.26  ? 1205 GLU A OE1   1 
ATOM   8992  O  OE2   . GLU A 1  1205 ? -46.298 -5.361  -43.034 1.00 68.50  ? 1205 GLU A OE2   1 
ATOM   8993  N  N     . GLY A 1  1206 ? -41.919 -9.950  -41.608 1.00 60.57  ? 1206 GLY A N     1 
ATOM   8994  C  CA    . GLY A 1  1206 ? -41.646 -11.370 -41.455 1.00 59.12  ? 1206 GLY A CA    1 
ATOM   8995  C  C     . GLY A 1  1206 ? -40.762 -11.682 -40.271 1.00 59.48  ? 1206 GLY A C     1 
ATOM   8996  O  O     . GLY A 1  1206 ? -41.091 -12.538 -39.453 1.00 59.93  ? 1206 GLY A O     1 
ATOM   8997  N  N     . ALA A 1  1207 ? -39.640 -10.977 -40.182 1.00 59.63  ? 1207 ALA A N     1 
ATOM   8998  C  CA    . ALA A 1  1207 ? -38.734 -11.113 -39.048 1.00 59.94  ? 1207 ALA A CA    1 
ATOM   8999  C  C     . ALA A 1  1207 ? -39.456 -10.816 -37.736 1.00 60.98  ? 1207 ALA A C     1 
ATOM   9000  O  O     . ALA A 1  1207 ? -39.388 -11.610 -36.794 1.00 60.61  ? 1207 ALA A O     1 
ATOM   9001  C  CB    . ALA A 1  1207 ? -37.536 -10.194 -39.214 1.00 60.69  ? 1207 ALA A CB    1 
ATOM   9002  N  N     . PHE A 1  1208 ? -40.173 -9.692  -37.700 1.00 61.91  ? 1208 PHE A N     1 
ATOM   9003  C  CA    . PHE A 1  1208 ? -40.922 -9.277  -36.507 1.00 63.23  ? 1208 PHE A CA    1 
ATOM   9004  C  C     . PHE A 1  1208 ? -41.904 -10.342 -36.031 1.00 62.42  ? 1208 PHE A C     1 
ATOM   9005  O  O     . PHE A 1  1208 ? -41.903 -10.699 -34.849 1.00 61.64  ? 1208 PHE A O     1 
ATOM   9006  C  CB    . PHE A 1  1208 ? -41.661 -7.955  -36.748 1.00 64.81  ? 1208 PHE A CB    1 
ATOM   9007  C  CG    . PHE A 1  1208 ? -42.649 -7.619  -35.669 1.00 66.54  ? 1208 PHE A CG    1 
ATOM   9008  C  CD1   . PHE A 1  1208 ? -42.213 -7.186  -34.423 1.00 67.95  ? 1208 PHE A CD1   1 
ATOM   9009  C  CD2   . PHE A 1  1208 ? -44.017 -7.767  -35.885 1.00 67.03  ? 1208 PHE A CD2   1 
ATOM   9010  C  CE1   . PHE A 1  1208 ? -43.126 -6.891  -33.417 1.00 68.93  ? 1208 PHE A CE1   1 
ATOM   9011  C  CE2   . PHE A 1  1208 ? -44.931 -7.477  -34.881 1.00 68.38  ? 1208 PHE A CE2   1 
ATOM   9012  C  CZ    . PHE A 1  1208 ? -44.485 -7.044  -33.645 1.00 68.62  ? 1208 PHE A CZ    1 
ATOM   9013  N  N     . ILE A 1  1209 ? -42.724 -10.848 -36.955 1.00 61.34  ? 1209 ILE A N     1 
ATOM   9014  C  CA    . ILE A 1  1209 ? -43.722 -11.875 -36.630 1.00 60.47  ? 1209 ILE A CA    1 
ATOM   9015  C  C     . ILE A 1  1209 ? -43.051 -13.184 -36.214 1.00 60.83  ? 1209 ILE A C     1 
ATOM   9016  O  O     . ILE A 1  1209 ? -43.533 -13.864 -35.310 1.00 62.04  ? 1209 ILE A O     1 
ATOM   9017  C  CB    . ILE A 1  1209 ? -44.711 -12.109 -37.799 1.00 59.51  ? 1209 ILE A CB    1 
ATOM   9018  C  CG1   . ILE A 1  1209 ? -45.559 -10.850 -38.053 1.00 60.32  ? 1209 ILE A CG1   1 
ATOM   9019  C  CG2   . ILE A 1  1209 ? -45.626 -13.309 -37.540 1.00 58.83  ? 1209 ILE A CG2   1 
ATOM   9020  C  CD1   . ILE A 1  1209 ? -46.619 -10.558 -37.004 1.00 61.23  ? 1209 ILE A CD1   1 
ATOM   9021  N  N     . GLN A 1  1210 ? -41.931 -13.518 -36.852 1.00 61.24  ? 1210 GLN A N     1 
ATOM   9022  C  CA    . GLN A 1  1210 ? -41.160 -14.717 -36.495 1.00 61.69  ? 1210 GLN A CA    1 
ATOM   9023  C  C     . GLN A 1  1210 ? -40.550 -14.571 -35.099 1.00 62.55  ? 1210 GLN A C     1 
ATOM   9024  O  O     . GLN A 1  1210 ? -40.459 -15.540 -34.343 1.00 62.18  ? 1210 GLN A O     1 
ATOM   9025  C  CB    . GLN A 1  1210 ? -40.081 -14.988 -37.548 1.00 62.09  ? 1210 GLN A CB    1 
ATOM   9026  C  CG    . GLN A 1  1210 ? -39.534 -16.405 -37.556 1.00 62.77  ? 1210 GLN A CG    1 
ATOM   9027  C  CD    . GLN A 1  1210 ? -38.942 -16.792 -38.905 1.00 63.98  ? 1210 GLN A CD    1 
ATOM   9028  O  OE1   . GLN A 1  1210 ? -38.284 -15.986 -39.564 1.00 63.76  ? 1210 GLN A OE1   1 
ATOM   9029  N  NE2   . GLN A 1  1210 ? -39.180 -18.034 -39.323 1.00 64.55  ? 1210 GLN A NE2   1 
ATOM   9030  N  N     . GLY A 1  1211 ? -40.144 -13.351 -34.762 1.00 63.80  ? 1211 GLY A N     1 
ATOM   9031  C  CA    . GLY A 1  1211 ? -39.751 -13.016 -33.402 1.00 65.38  ? 1211 GLY A CA    1 
ATOM   9032  C  C     . GLY A 1  1211 ? -40.898 -13.063 -32.412 1.00 66.19  ? 1211 GLY A C     1 
ATOM   9033  O  O     . GLY A 1  1211 ? -40.769 -13.653 -31.342 1.00 66.33  ? 1211 GLY A O     1 
ATOM   9034  N  N     . MET A 1  1212 ? -42.024 -12.445 -32.769 1.00 66.61  ? 1212 MET A N     1 
ATOM   9035  C  CA    . MET A 1  1212 ? -43.221 -12.454 -31.919 1.00 68.19  ? 1212 MET A CA    1 
ATOM   9036  C  C     . MET A 1  1212 ? -43.610 -13.874 -31.511 1.00 67.46  ? 1212 MET A C     1 
ATOM   9037  O  O     . MET A 1  1212 ? -43.902 -14.123 -30.338 1.00 68.26  ? 1212 MET A O     1 
ATOM   9038  C  CB    . MET A 1  1212 ? -44.402 -11.802 -32.635 1.00 69.16  ? 1212 MET A CB    1 
ATOM   9039  C  CG    . MET A 1  1212 ? -45.653 -11.657 -31.778 1.00 70.51  ? 1212 MET A CG    1 
ATOM   9040  S  SD    . MET A 1  1212 ? -47.095 -11.234 -32.765 1.00 72.67  ? 1212 MET A SD    1 
ATOM   9041  C  CE    . MET A 1  1212 ? -47.296 -12.724 -33.737 1.00 70.90  ? 1212 MET A CE    1 
ATOM   9042  N  N     . GLY A 1  1213 ? -43.616 -14.785 -32.482 1.00 65.24  ? 1213 GLY A N     1 
ATOM   9043  C  CA    . GLY A 1  1213 ? -43.879 -16.200 -32.228 1.00 64.44  ? 1213 GLY A CA    1 
ATOM   9044  C  C     . GLY A 1  1213 ? -42.897 -16.836 -31.254 1.00 63.81  ? 1213 GLY A C     1 
ATOM   9045  O  O     . GLY A 1  1213 ? -43.317 -17.465 -30.281 1.00 64.41  ? 1213 GLY A O     1 
ATOM   9046  N  N     . LEU A 1  1214 ? -41.598 -16.654 -31.511 1.00 62.17  ? 1214 LEU A N     1 
ATOM   9047  C  CA    . LEU A 1  1214 ? -40.522 -17.127 -30.625 1.00 61.98  ? 1214 LEU A CA    1 
ATOM   9048  C  C     . LEU A 1  1214 ? -40.748 -16.720 -29.169 1.00 62.87  ? 1214 LEU A C     1 
ATOM   9049  O  O     . LEU A 1  1214 ? -40.623 -17.538 -28.259 1.00 63.01  ? 1214 LEU A O     1 
ATOM   9050  C  CB    . LEU A 1  1214 ? -39.161 -16.573 -31.089 1.00 61.63  ? 1214 LEU A CB    1 
ATOM   9051  C  CG    . LEU A 1  1214 ? -37.900 -16.750 -30.229 1.00 61.62  ? 1214 LEU A CG    1 
ATOM   9052  C  CD1   . LEU A 1  1214 ? -37.506 -18.213 -30.104 1.00 61.36  ? 1214 LEU A CD1   1 
ATOM   9053  C  CD2   . LEU A 1  1214 ? -36.755 -15.940 -30.815 1.00 61.45  ? 1214 LEU A CD2   1 
ATOM   9054  N  N     . TYR A 1  1215 ? -41.076 -15.449 -28.967 1.00 63.09  ? 1215 TYR A N     1 
ATOM   9055  C  CA    . TYR A 1  1215 ? -41.226 -14.899 -27.631 1.00 64.21  ? 1215 TYR A CA    1 
ATOM   9056  C  C     . TYR A 1  1215 ? -42.593 -15.154 -26.969 1.00 65.30  ? 1215 TYR A C     1 
ATOM   9057  O  O     . TYR A 1  1215 ? -42.680 -15.047 -25.746 1.00 67.43  ? 1215 TYR A O     1 
ATOM   9058  C  CB    . TYR A 1  1215 ? -40.909 -13.401 -27.636 1.00 64.70  ? 1215 TYR A CB    1 
ATOM   9059  C  CG    . TYR A 1  1215 ? -39.497 -13.055 -28.104 1.00 64.27  ? 1215 TYR A CG    1 
ATOM   9060  C  CD1   . TYR A 1  1215 ? -38.371 -13.493 -27.399 1.00 64.32  ? 1215 TYR A CD1   1 
ATOM   9061  C  CD2   . TYR A 1  1215 ? -39.289 -12.266 -29.237 1.00 63.01  ? 1215 TYR A CD2   1 
ATOM   9062  C  CE1   . TYR A 1  1215 ? -37.086 -13.167 -27.824 1.00 63.97  ? 1215 TYR A CE1   1 
ATOM   9063  C  CE2   . TYR A 1  1215 ? -38.014 -11.939 -29.668 1.00 62.60  ? 1215 TYR A CE2   1 
ATOM   9064  C  CZ    . TYR A 1  1215 ? -36.915 -12.388 -28.963 1.00 62.96  ? 1215 TYR A CZ    1 
ATOM   9065  O  OH    . TYR A 1  1215 ? -35.655 -12.055 -29.402 1.00 61.84  ? 1215 TYR A OH    1 
ATOM   9066  N  N     . THR A 1  1216 ? -43.637 -15.511 -27.731 1.00 64.60  ? 1216 THR A N     1 
ATOM   9067  C  CA    . THR A 1  1216 ? -44.989 -15.711 -27.153 1.00 64.64  ? 1216 THR A CA    1 
ATOM   9068  C  C     . THR A 1  1216 ? -45.612 -17.101 -27.336 1.00 64.18  ? 1216 THR A C     1 
ATOM   9069  O  O     . THR A 1  1216 ? -45.738 -17.854 -26.366 1.00 64.05  ? 1216 THR A O     1 
ATOM   9070  C  CB    . THR A 1  1216 ? -45.989 -14.647 -27.652 1.00 64.81  ? 1216 THR A CB    1 
ATOM   9071  O  OG1   . THR A 1  1216 ? -46.219 -14.804 -29.054 1.00 63.36  ? 1216 THR A OG1   1 
ATOM   9072  C  CG2   . THR A 1  1216 ? -45.460 -13.243 -27.368 1.00 65.89  ? 1216 THR A CG2   1 
ATOM   9073  N  N     . ILE A 1  1217 ? -46.001 -17.440 -28.564 1.00 63.92  ? 1217 ILE A N     1 
ATOM   9074  C  CA    . ILE A 1  1217 ? -46.846 -18.627 -28.802 1.00 63.78  ? 1217 ILE A CA    1 
ATOM   9075  C  C     . ILE A 1  1217 ? -46.117 -19.887 -29.262 1.00 63.49  ? 1217 ILE A C     1 
ATOM   9076  O  O     . ILE A 1  1217 ? -46.710 -20.964 -29.217 1.00 64.10  ? 1217 ILE A O     1 
ATOM   9077  C  CB    . ILE A 1  1217 ? -48.020 -18.338 -29.772 1.00 63.70  ? 1217 ILE A CB    1 
ATOM   9078  C  CG1   . ILE A 1  1217 ? -47.529 -17.825 -31.131 1.00 63.55  ? 1217 ILE A CG1   1 
ATOM   9079  C  CG2   . ILE A 1  1217 ? -48.985 -17.340 -29.149 1.00 64.28  ? 1217 ILE A CG2   1 
ATOM   9080  C  CD1   . ILE A 1  1217 ? -48.572 -17.893 -32.228 1.00 63.41  ? 1217 ILE A CD1   1 
ATOM   9081  N  N     . GLU A 1  1218 ? -44.860 -19.769 -29.701 1.00 63.72  ? 1218 GLU A N     1 
ATOM   9082  C  CA    . GLU A 1  1218 ? -44.104 -20.935 -30.199 1.00 63.66  ? 1218 GLU A CA    1 
ATOM   9083  C  C     . GLU A 1  1218 ? -43.423 -21.663 -29.053 1.00 64.97  ? 1218 GLU A C     1 
ATOM   9084  O  O     . GLU A 1  1218 ? -42.613 -21.073 -28.345 1.00 66.06  ? 1218 GLU A O     1 
ATOM   9085  C  CB    . GLU A 1  1218 ? -43.088 -20.534 -31.273 1.00 62.50  ? 1218 GLU A CB    1 
ATOM   9086  C  CG    . GLU A 1  1218 ? -43.765 -20.182 -32.585 1.00 62.14  ? 1218 GLU A CG    1 
ATOM   9087  C  CD    . GLU A 1  1218 ? -42.806 -19.784 -33.687 1.00 61.53  ? 1218 GLU A CD    1 
ATOM   9088  O  OE1   . GLU A 1  1218 ? -41.841 -20.533 -33.961 1.00 59.92  ? 1218 GLU A OE1   1 
ATOM   9089  O  OE2   . GLU A 1  1218 ? -43.039 -18.726 -34.309 1.00 60.77  ? 1218 GLU A OE2   1 
ATOM   9090  N  N     . GLU A 1  1219 ? -43.753 -22.945 -28.893 1.00 65.69  ? 1219 GLU A N     1 
ATOM   9091  C  CA    . GLU A 1  1219 ? -43.339 -23.733 -27.735 1.00 67.63  ? 1219 GLU A CA    1 
ATOM   9092  C  C     . GLU A 1  1219 ? -43.215 -25.212 -28.100 1.00 68.27  ? 1219 GLU A C     1 
ATOM   9093  O  O     . GLU A 1  1219 ? -44.182 -25.814 -28.574 1.00 68.44  ? 1219 GLU A O     1 
ATOM   9094  C  CB    . GLU A 1  1219 ? -44.357 -23.567 -26.600 1.00 68.74  ? 1219 GLU A CB    1 
ATOM   9095  C  CG    . GLU A 1  1219 ? -44.035 -24.367 -25.346 1.00 70.11  ? 1219 GLU A CG    1 
ATOM   9096  C  CD    . GLU A 1  1219 ? -44.930 -24.016 -24.178 1.00 71.34  ? 1219 GLU A CD    1 
ATOM   9097  O  OE1   . GLU A 1  1219 ? -46.168 -24.047 -24.347 1.00 71.14  ? 1219 GLU A OE1   1 
ATOM   9098  O  OE2   . GLU A 1  1219 ? -44.388 -23.721 -23.091 1.00 72.81  ? 1219 GLU A OE2   1 
ATOM   9099  N  N     . LEU A 1  1220 ? -42.032 -25.782 -27.863 1.00 69.08  ? 1220 LEU A N     1 
ATOM   9100  C  CA    . LEU A 1  1220 ? -41.760 -27.199 -28.104 1.00 68.69  ? 1220 LEU A CA    1 
ATOM   9101  C  C     . LEU A 1  1220 ? -41.839 -27.941 -26.782 1.00 70.13  ? 1220 LEU A C     1 
ATOM   9102  O  O     . LEU A 1  1220 ? -41.184 -27.548 -25.817 1.00 71.19  ? 1220 LEU A O     1 
ATOM   9103  C  CB    . LEU A 1  1220 ? -40.363 -27.381 -28.695 1.00 68.50  ? 1220 LEU A CB    1 
ATOM   9104  C  CG    . LEU A 1  1220 ? -40.125 -26.723 -30.054 1.00 67.48  ? 1220 LEU A CG    1 
ATOM   9105  C  CD1   . LEU A 1  1220 ? -38.640 -26.482 -30.294 1.00 67.78  ? 1220 LEU A CD1   1 
ATOM   9106  C  CD2   . LEU A 1  1220 ? -40.739 -27.566 -31.162 1.00 66.67  ? 1220 LEU A CD2   1 
ATOM   9107  N  N     . ASN A 1  1221 ? -42.633 -29.007 -26.739 1.00 70.66  ? 1221 ASN A N     1 
ATOM   9108  C  CA    . ASN A 1  1221 ? -42.821 -29.798 -25.520 1.00 72.35  ? 1221 ASN A CA    1 
ATOM   9109  C  C     . ASN A 1  1221 ? -42.079 -31.119 -25.622 1.00 71.88  ? 1221 ASN A C     1 
ATOM   9110  O  O     . ASN A 1  1221 ? -42.327 -31.892 -26.547 1.00 72.20  ? 1221 ASN A O     1 
ATOM   9111  C  CB    . ASN A 1  1221 ? -44.310 -30.061 -25.284 1.00 72.80  ? 1221 ASN A CB    1 
ATOM   9112  C  CG    . ASN A 1  1221 ? -45.106 -28.782 -25.115 1.00 72.59  ? 1221 ASN A CG    1 
ATOM   9113  O  OD1   . ASN A 1  1221 ? -44.764 -27.932 -24.290 1.00 73.40  ? 1221 ASN A OD1   1 
ATOM   9114  N  ND2   . ASN A 1  1221 ? -46.171 -28.636 -25.897 1.00 71.32  ? 1221 ASN A ND2   1 
ATOM   9115  N  N     . TYR A 1  1222 ? -41.168 -31.364 -24.681 1.00 72.24  ? 1222 TYR A N     1 
ATOM   9116  C  CA    . TYR A 1  1222 ? -40.412 -32.613 -24.614 1.00 73.07  ? 1222 TYR A CA    1 
ATOM   9117  C  C     . TYR A 1  1222 ? -40.767 -33.369 -23.333 1.00 74.11  ? 1222 TYR A C     1 
ATOM   9118  O  O     . TYR A 1  1222 ? -40.891 -32.759 -22.269 1.00 74.78  ? 1222 TYR A O     1 
ATOM   9119  C  CB    . TYR A 1  1222 ? -38.904 -32.333 -24.664 1.00 73.24  ? 1222 TYR A CB    1 
ATOM   9120  C  CG    . TYR A 1  1222 ? -38.419 -31.757 -25.977 1.00 72.55  ? 1222 TYR A CG    1 
ATOM   9121  C  CD1   . TYR A 1  1222 ? -38.104 -32.589 -27.058 1.00 72.48  ? 1222 TYR A CD1   1 
ATOM   9122  C  CD2   . TYR A 1  1222 ? -38.270 -30.380 -26.143 1.00 72.53  ? 1222 TYR A CD2   1 
ATOM   9123  C  CE1   . TYR A 1  1222 ? -37.658 -32.062 -28.267 1.00 71.68  ? 1222 TYR A CE1   1 
ATOM   9124  C  CE2   . TYR A 1  1222 ? -37.825 -29.841 -27.347 1.00 72.18  ? 1222 TYR A CE2   1 
ATOM   9125  C  CZ    . TYR A 1  1222 ? -37.519 -30.682 -28.406 1.00 72.14  ? 1222 TYR A CZ    1 
ATOM   9126  O  OH    . TYR A 1  1222 ? -37.077 -30.141 -29.598 1.00 71.90  ? 1222 TYR A OH    1 
ATOM   9127  N  N     . SER A 1  1223 ? -40.921 -34.692 -23.434 1.00 74.26  ? 1223 SER A N     1 
ATOM   9128  C  CA    . SER A 1  1223 ? -41.196 -35.536 -22.265 1.00 76.49  ? 1223 SER A CA    1 
ATOM   9129  C  C     . SER A 1  1223 ? -39.933 -35.702 -21.411 1.00 78.69  ? 1223 SER A C     1 
ATOM   9130  O  O     . SER A 1  1223 ? -38.834 -35.404 -21.879 1.00 79.42  ? 1223 SER A O     1 
ATOM   9131  C  CB    . SER A 1  1223 ? -41.733 -36.917 -22.683 1.00 75.94  ? 1223 SER A CB    1 
ATOM   9132  O  OG    . SER A 1  1223 ? -40.695 -37.812 -23.054 1.00 75.08  ? 1223 SER A OG    1 
ATOM   9133  N  N     . PRO A 1  1224 ? -40.077 -36.193 -20.163 1.00 80.97  ? 1224 PRO A N     1 
ATOM   9134  C  CA    . PRO A 1  1224 ? -38.907 -36.555 -19.350 1.00 82.02  ? 1224 PRO A CA    1 
ATOM   9135  C  C     . PRO A 1  1224 ? -37.979 -37.620 -19.947 1.00 82.36  ? 1224 PRO A C     1 
ATOM   9136  O  O     . PRO A 1  1224 ? -36.857 -37.769 -19.458 1.00 83.65  ? 1224 PRO A O     1 
ATOM   9137  C  CB    . PRO A 1  1224 ? -39.533 -37.088 -18.063 1.00 83.59  ? 1224 PRO A CB    1 
ATOM   9138  C  CG    . PRO A 1  1224 ? -40.811 -36.349 -17.949 1.00 83.39  ? 1224 PRO A CG    1 
ATOM   9139  C  CD    . PRO A 1  1224 ? -41.315 -36.220 -19.359 1.00 82.01  ? 1224 PRO A CD    1 
ATOM   9140  N  N     . GLN A 1  1225 ? -38.449 -38.367 -20.953 1.00 81.50  ? 1225 GLN A N     1 
ATOM   9141  C  CA    . GLN A 1  1225 ? -37.605 -39.295 -21.723 1.00 80.98  ? 1225 GLN A CA    1 
ATOM   9142  C  C     . GLN A 1  1225 ? -37.075 -38.708 -23.052 1.00 79.64  ? 1225 GLN A C     1 
ATOM   9143  O  O     . GLN A 1  1225 ? -36.511 -39.441 -23.865 1.00 78.73  ? 1225 GLN A O     1 
ATOM   9144  C  CB    . GLN A 1  1225 ? -38.365 -40.608 -21.978 1.00 80.75  ? 1225 GLN A CB    1 
ATOM   9145  C  CG    . GLN A 1  1225 ? -38.816 -41.333 -20.714 1.00 82.26  ? 1225 GLN A CG    1 
ATOM   9146  C  CD    . GLN A 1  1225 ? -37.675 -41.624 -19.750 1.00 84.07  ? 1225 GLN A CD    1 
ATOM   9147  O  OE1   . GLN A 1  1225 ? -37.770 -41.341 -18.555 1.00 86.38  ? 1225 GLN A OE1   1 
ATOM   9148  N  NE2   . GLN A 1  1225 ? -36.583 -42.173 -20.269 1.00 83.97  ? 1225 GLN A NE2   1 
ATOM   9149  N  N     . GLY A 1  1226 ? -37.232 -37.399 -23.257 1.00 79.13  ? 1226 GLY A N     1 
ATOM   9150  C  CA    . GLY A 1  1226 ? -36.708 -36.715 -24.436 1.00 78.20  ? 1226 GLY A CA    1 
ATOM   9151  C  C     . GLY A 1  1226 ? -37.530 -36.826 -25.710 1.00 78.23  ? 1226 GLY A C     1 
ATOM   9152  O  O     . GLY A 1  1226 ? -37.050 -36.447 -26.781 1.00 77.34  ? 1226 GLY A O     1 
ATOM   9153  N  N     . ILE A 1  1227 ? -38.764 -37.328 -25.612 1.00 79.67  ? 1227 ILE A N     1 
ATOM   9154  C  CA    . ILE A 1  1227 ? -39.645 -37.442 -26.778 1.00 79.38  ? 1227 ILE A CA    1 
ATOM   9155  C  C     . ILE A 1  1227 ? -40.312 -36.092 -27.021 1.00 79.40  ? 1227 ILE A C     1 
ATOM   9156  O  O     . ILE A 1  1227 ? -40.816 -35.478 -26.086 1.00 79.92  ? 1227 ILE A O     1 
ATOM   9157  C  CB    . ILE A 1  1227 ? -40.723 -38.542 -26.601 1.00 79.53  ? 1227 ILE A CB    1 
ATOM   9158  C  CG1   . ILE A 1  1227 ? -40.081 -39.939 -26.635 1.00 79.88  ? 1227 ILE A CG1   1 
ATOM   9159  C  CG2   . ILE A 1  1227 ? -41.800 -38.441 -27.683 1.00 78.94  ? 1227 ILE A CG2   1 
ATOM   9160  C  CD1   . ILE A 1  1227 ? -39.568 -40.424 -25.301 1.00 81.78  ? 1227 ILE A CD1   1 
ATOM   9161  N  N     . LEU A 1  1228 ? -40.316 -35.649 -28.279 1.00 79.07  ? 1228 LEU A N     1 
ATOM   9162  C  CA    . LEU A 1  1228 ? -41.023 -34.432 -28.679 1.00 78.43  ? 1228 LEU A CA    1 
ATOM   9163  C  C     . LEU A 1  1228 ? -42.512 -34.735 -28.798 1.00 78.80  ? 1228 LEU A C     1 
ATOM   9164  O  O     . LEU A 1  1228 ? -42.903 -35.617 -29.563 1.00 77.57  ? 1228 LEU A O     1 
ATOM   9165  C  CB    . LEU A 1  1228 ? -40.485 -33.908 -30.016 1.00 77.22  ? 1228 LEU A CB    1 
ATOM   9166  C  CG    . LEU A 1  1228 ? -41.171 -32.696 -30.656 1.00 76.44  ? 1228 LEU A CG    1 
ATOM   9167  C  CD1   . LEU A 1  1228 ? -41.299 -31.531 -29.681 1.00 77.20  ? 1228 LEU A CD1   1 
ATOM   9168  C  CD2   . LEU A 1  1228 ? -40.416 -32.278 -31.907 1.00 75.52  ? 1228 LEU A CD2   1 
ATOM   9169  N  N     . HIS A 1  1229 ? -43.332 -34.011 -28.037 1.00 81.01  ? 1229 HIS A N     1 
ATOM   9170  C  CA    . HIS A 1  1229 ? -44.788 -34.130 -28.136 1.00 81.99  ? 1229 HIS A CA    1 
ATOM   9171  C  C     . HIS A 1  1229 ? -45.288 -33.261 -29.280 1.00 82.17  ? 1229 HIS A C     1 
ATOM   9172  O  O     . HIS A 1  1229 ? -44.851 -32.121 -29.442 1.00 81.55  ? 1229 HIS A O     1 
ATOM   9173  C  CB    . HIS A 1  1229 ? -45.475 -33.747 -26.827 1.00 82.52  ? 1229 HIS A CB    1 
ATOM   9174  C  CG    . HIS A 1  1229 ? -45.235 -34.721 -25.716 1.00 83.36  ? 1229 HIS A CG    1 
ATOM   9175  N  ND1   . HIS A 1  1229 ? -45.413 -36.080 -25.862 1.00 84.07  ? 1229 HIS A ND1   1 
ATOM   9176  C  CD2   . HIS A 1  1229 ? -44.839 -34.530 -24.436 1.00 84.51  ? 1229 HIS A CD2   1 
ATOM   9177  C  CE1   . HIS A 1  1229 ? -45.129 -36.683 -24.721 1.00 85.56  ? 1229 HIS A CE1   1 
ATOM   9178  N  NE2   . HIS A 1  1229 ? -44.784 -35.764 -23.838 1.00 85.74  ? 1229 HIS A NE2   1 
ATOM   9179  N  N     . THR A 1  1230 ? -46.211 -33.818 -30.059 1.00 84.04  ? 1230 THR A N     1 
ATOM   9180  C  CA    . THR A 1  1230 ? -46.578 -33.271 -31.362 1.00 85.28  ? 1230 THR A CA    1 
ATOM   9181  C  C     . THR A 1  1230 ? -48.077 -33.446 -31.718 1.00 87.22  ? 1230 THR A C     1 
ATOM   9182  O  O     . THR A 1  1230 ? -48.448 -33.376 -32.895 1.00 88.19  ? 1230 THR A O     1 
ATOM   9183  C  CB    . THR A 1  1230 ? -45.678 -33.930 -32.442 1.00 84.14  ? 1230 THR A CB    1 
ATOM   9184  O  OG1   . THR A 1  1230 ? -45.770 -33.210 -33.676 1.00 84.61  ? 1230 THR A OG1   1 
ATOM   9185  C  CG2   . THR A 1  1230 ? -46.056 -35.404 -32.674 1.00 84.20  ? 1230 THR A CG2   1 
ATOM   9186  N  N     . ARG A 1  1231 ? -48.932 -33.639 -30.710 1.00 88.94  ? 1231 ARG A N     1 
ATOM   9187  C  CA    . ARG A 1  1231 ? -50.345 -33.949 -30.933 1.00 89.76  ? 1231 ARG A CA    1 
ATOM   9188  C  C     . ARG A 1  1231 ? -51.212 -33.461 -29.774 1.00 88.60  ? 1231 ARG A C     1 
ATOM   9189  O  O     . ARG A 1  1231 ? -50.818 -33.561 -28.609 1.00 88.16  ? 1231 ARG A O     1 
ATOM   9190  C  CB    . ARG A 1  1231 ? -50.527 -35.461 -31.127 1.00 93.36  ? 1231 ARG A CB    1 
ATOM   9191  C  CG    . ARG A 1  1231 ? -51.911 -35.899 -31.607 1.00 98.05  ? 1231 ARG A CG    1 
ATOM   9192  C  CD    . ARG A 1  1231 ? -52.285 -35.294 -32.964 1.00 100.58 ? 1231 ARG A CD    1 
ATOM   9193  N  NE    . ARG A 1  1231 ? -53.552 -35.810 -33.489 1.00 103.31 ? 1231 ARG A NE    1 
ATOM   9194  C  CZ    . ARG A 1  1231 ? -54.774 -35.463 -33.064 1.00 105.16 ? 1231 ARG A CZ    1 
ATOM   9195  N  NH1   . ARG A 1  1231 ? -54.957 -34.583 -32.074 1.00 104.63 ? 1231 ARG A NH1   1 
ATOM   9196  N  NH2   . ARG A 1  1231 ? -55.840 -36.015 -33.638 1.00 106.98 ? 1231 ARG A NH2   1 
ATOM   9197  N  N     . GLY A 1  1232 ? -52.387 -32.926 -30.110 1.00 86.55  ? 1232 GLY A N     1 
ATOM   9198  C  CA    . GLY A 1  1232 ? -53.331 -32.391 -29.128 1.00 85.26  ? 1232 GLY A CA    1 
ATOM   9199  C  C     . GLY A 1  1232 ? -53.024 -30.924 -28.868 1.00 83.90  ? 1232 GLY A C     1 
ATOM   9200  O  O     . GLY A 1  1232 ? -52.670 -30.200 -29.799 1.00 82.67  ? 1232 GLY A O     1 
ATOM   9201  N  N     . PRO A 1  1233 ? -53.163 -30.466 -27.607 1.00 83.57  ? 1233 PRO A N     1 
ATOM   9202  C  CA    . PRO A 1  1233 ? -52.637 -29.134 -27.256 1.00 82.59  ? 1233 PRO A CA    1 
ATOM   9203  C  C     . PRO A 1  1233 ? -51.100 -28.985 -27.309 1.00 80.35  ? 1233 PRO A C     1 
ATOM   9204  O  O     . PRO A 1  1233 ? -50.606 -27.858 -27.240 1.00 79.30  ? 1233 PRO A O     1 
ATOM   9205  C  CB    . PRO A 1  1233 ? -53.153 -28.908 -25.821 1.00 84.59  ? 1233 PRO A CB    1 
ATOM   9206  C  CG    . PRO A 1  1233 ? -53.555 -30.254 -25.323 1.00 85.74  ? 1233 PRO A CG    1 
ATOM   9207  C  CD    . PRO A 1  1233 ? -54.011 -31.012 -26.534 1.00 84.74  ? 1233 PRO A CD    1 
ATOM   9208  N  N     . ASP A 1  1234 ? -50.364 -30.099 -27.410 1.00 78.56  ? 1234 ASP A N     1 
ATOM   9209  C  CA    . ASP A 1  1234 ? -48.909 -30.068 -27.615 1.00 76.65  ? 1234 ASP A CA    1 
ATOM   9210  C  C     . ASP A 1  1234 ? -48.500 -29.633 -29.037 1.00 73.44  ? 1234 ASP A C     1 
ATOM   9211  O  O     . ASP A 1  1234 ? -47.330 -29.320 -29.270 1.00 71.88  ? 1234 ASP A O     1 
ATOM   9212  C  CB    . ASP A 1  1234 ? -48.278 -31.440 -27.314 1.00 77.96  ? 1234 ASP A CB    1 
ATOM   9213  C  CG    . ASP A 1  1234 ? -48.427 -31.866 -25.855 1.00 79.89  ? 1234 ASP A CG    1 
ATOM   9214  O  OD1   . ASP A 1  1234 ? -48.287 -31.019 -24.948 1.00 81.97  ? 1234 ASP A OD1   1 
ATOM   9215  O  OD2   . ASP A 1  1234 ? -48.658 -33.073 -25.613 1.00 79.99  ? 1234 ASP A OD2   1 
ATOM   9216  N  N     . GLN A 1  1235 ? -49.443 -29.627 -29.981 1.00 70.61  ? 1235 GLN A N     1 
ATOM   9217  C  CA    . GLN A 1  1235 ? -49.169 -29.172 -31.345 1.00 68.40  ? 1235 GLN A CA    1 
ATOM   9218  C  C     . GLN A 1  1235 ? -48.512 -27.795 -31.374 1.00 67.57  ? 1235 GLN A C     1 
ATOM   9219  O  O     . GLN A 1  1235 ? -48.908 -26.898 -30.636 1.00 69.49  ? 1235 GLN A O     1 
ATOM   9220  C  CB    . GLN A 1  1235 ? -50.445 -29.150 -32.182 1.00 67.80  ? 1235 GLN A CB    1 
ATOM   9221  C  CG    . GLN A 1  1235 ? -50.938 -30.531 -32.566 1.00 68.43  ? 1235 GLN A CG    1 
ATOM   9222  C  CD    . GLN A 1  1235 ? -52.145 -30.497 -33.479 1.00 69.08  ? 1235 GLN A CD    1 
ATOM   9223  O  OE1   . GLN A 1  1235 ? -52.638 -29.432 -33.849 1.00 70.32  ? 1235 GLN A OE1   1 
ATOM   9224  N  NE2   . GLN A 1  1235 ? -52.630 -31.675 -33.849 1.00 69.74  ? 1235 GLN A NE2   1 
ATOM   9225  N  N     . TYR A 1  1236 ? -47.508 -27.656 -32.238 1.00 66.27  ? 1236 TYR A N     1 
ATOM   9226  C  CA    . TYR A 1  1236 ? -46.682 -26.453 -32.346 1.00 65.29  ? 1236 TYR A CA    1 
ATOM   9227  C  C     . TYR A 1  1236 ? -47.352 -25.448 -33.278 1.00 64.67  ? 1236 TYR A C     1 
ATOM   9228  O  O     . TYR A 1  1236 ? -47.792 -25.802 -34.375 1.00 65.89  ? 1236 TYR A O     1 
ATOM   9229  C  CB    . TYR A 1  1236 ? -45.298 -26.842 -32.876 1.00 64.59  ? 1236 TYR A CB    1 
ATOM   9230  C  CG    . TYR A 1  1236 ? -44.276 -25.730 -32.942 1.00 64.07  ? 1236 TYR A CG    1 
ATOM   9231  C  CD1   . TYR A 1  1236 ? -44.165 -24.925 -34.077 1.00 63.22  ? 1236 TYR A CD1   1 
ATOM   9232  C  CD2   . TYR A 1  1236 ? -43.390 -25.506 -31.889 1.00 64.23  ? 1236 TYR A CD2   1 
ATOM   9233  C  CE1   . TYR A 1  1236 ? -43.216 -23.916 -34.151 1.00 62.98  ? 1236 TYR A CE1   1 
ATOM   9234  C  CE2   . TYR A 1  1236 ? -42.438 -24.498 -31.956 1.00 63.74  ? 1236 TYR A CE2   1 
ATOM   9235  C  CZ    . TYR A 1  1236 ? -42.358 -23.705 -33.084 1.00 62.70  ? 1236 TYR A CZ    1 
ATOM   9236  O  OH    . TYR A 1  1236 ? -41.410 -22.713 -33.155 1.00 61.70  ? 1236 TYR A OH    1 
ATOM   9237  N  N     . LYS A 1  1237 ? -47.403 -24.195 -32.845 1.00 64.97  ? 1237 LYS A N     1 
ATOM   9238  C  CA    . LYS A 1  1237 ? -48.166 -23.157 -33.520 1.00 64.75  ? 1237 LYS A CA    1 
ATOM   9239  C  C     . LYS A 1  1237 ? -47.285 -21.964 -33.868 1.00 64.01  ? 1237 LYS A C     1 
ATOM   9240  O  O     . LYS A 1  1237 ? -46.785 -21.279 -32.975 1.00 65.55  ? 1237 LYS A O     1 
ATOM   9241  C  CB    . LYS A 1  1237 ? -49.322 -22.705 -32.619 1.00 66.11  ? 1237 LYS A CB    1 
ATOM   9242  C  CG    . LYS A 1  1237 ? -50.272 -23.817 -32.192 1.00 67.50  ? 1237 LYS A CG    1 
ATOM   9243  C  CD    . LYS A 1  1237 ? -50.993 -24.427 -33.389 1.00 68.70  ? 1237 LYS A CD    1 
ATOM   9244  C  CE    . LYS A 1  1237 ? -51.991 -25.496 -32.976 1.00 70.24  ? 1237 LYS A CE    1 
ATOM   9245  N  NZ    . LYS A 1  1237 ? -52.659 -26.105 -34.159 1.00 70.18  ? 1237 LYS A NZ    1 
ATOM   9246  N  N     . ILE A 1  1238 ? -47.084 -21.737 -35.167 1.00 62.28  ? 1238 ILE A N     1 
ATOM   9247  C  CA    . ILE A 1  1238 ? -46.511 -20.476 -35.663 1.00 61.76  ? 1238 ILE A CA    1 
ATOM   9248  C  C     . ILE A 1  1238 ? -47.613 -19.410 -35.661 1.00 60.76  ? 1238 ILE A C     1 
ATOM   9249  O  O     . ILE A 1  1238 ? -48.781 -19.756 -35.550 1.00 60.41  ? 1238 ILE A O     1 
ATOM   9250  C  CB    . ILE A 1  1238 ? -45.871 -20.623 -37.072 1.00 61.86  ? 1238 ILE A CB    1 
ATOM   9251  C  CG1   . ILE A 1  1238 ? -46.921 -20.924 -38.164 1.00 61.92  ? 1238 ILE A CG1   1 
ATOM   9252  C  CG2   . ILE A 1  1238 ? -44.786 -21.698 -37.050 1.00 62.06  ? 1238 ILE A CG2   1 
ATOM   9253  C  CD1   . ILE A 1  1238 ? -46.342 -21.115 -39.552 1.00 61.45  ? 1238 ILE A CD1   1 
ATOM   9254  N  N     . PRO A 1  1239 ? -47.253 -18.113 -35.762 1.00 60.08  ? 1239 PRO A N     1 
ATOM   9255  C  CA    . PRO A 1  1239 ? -48.295 -17.080 -35.809 1.00 60.20  ? 1239 PRO A CA    1 
ATOM   9256  C  C     . PRO A 1  1239 ? -49.239 -17.192 -37.008 1.00 60.38  ? 1239 PRO A C     1 
ATOM   9257  O  O     . PRO A 1  1239 ? -48.804 -17.538 -38.105 1.00 61.04  ? 1239 PRO A O     1 
ATOM   9258  C  CB    . PRO A 1  1239 ? -47.497 -15.777 -35.887 1.00 59.86  ? 1239 PRO A CB    1 
ATOM   9259  C  CG    . PRO A 1  1239 ? -46.211 -16.088 -35.233 1.00 59.87  ? 1239 PRO A CG    1 
ATOM   9260  C  CD    . PRO A 1  1239 ? -45.920 -17.528 -35.537 1.00 59.88  ? 1239 PRO A CD    1 
ATOM   9261  N  N     . ALA A 1  1240 ? -50.518 -16.914 -36.768 1.00 61.64  ? 1240 ALA A N     1 
ATOM   9262  C  CA    . ALA A 1  1240 ? -51.552 -16.858 -37.804 1.00 61.95  ? 1240 ALA A CA    1 
ATOM   9263  C  C     . ALA A 1  1240 ? -52.041 -15.411 -37.957 1.00 63.05  ? 1240 ALA A C     1 
ATOM   9264  O  O     . ALA A 1  1240 ? -51.459 -14.497 -37.363 1.00 63.98  ? 1240 ALA A O     1 
ATOM   9265  C  CB    . ALA A 1  1240 ? -52.697 -17.793 -37.439 1.00 61.86  ? 1240 ALA A CB    1 
ATOM   9266  N  N     . ILE A 1  1241 ? -53.085 -15.201 -38.764 1.00 64.16  ? 1241 ILE A N     1 
ATOM   9267  C  CA    . ILE A 1  1241 ? -53.696 -13.868 -38.939 1.00 65.37  ? 1241 ILE A CA    1 
ATOM   9268  C  C     . ILE A 1  1241 ? -54.264 -13.331 -37.622 1.00 66.13  ? 1241 ILE A C     1 
ATOM   9269  O  O     . ILE A 1  1241 ? -54.152 -12.136 -37.342 1.00 67.66  ? 1241 ILE A O     1 
ATOM   9270  C  CB    . ILE A 1  1241 ? -54.798 -13.865 -40.038 1.00 65.74  ? 1241 ILE A CB    1 
ATOM   9271  C  CG1   . ILE A 1  1241 ? -54.157 -14.048 -41.415 1.00 65.43  ? 1241 ILE A CG1   1 
ATOM   9272  C  CG2   . ILE A 1  1241 ? -55.607 -12.564 -40.025 1.00 66.52  ? 1241 ILE A CG2   1 
ATOM   9273  C  CD1   . ILE A 1  1241 ? -55.147 -14.147 -42.557 1.00 66.19  ? 1241 ILE A CD1   1 
ATOM   9274  N  N     . CYS A 1  1242 ? -54.862 -14.206 -36.815 1.00 66.22  ? 1242 CYS A N     1 
ATOM   9275  C  CA    . CYS A 1  1242 ? -55.417 -13.793 -35.522 1.00 66.85  ? 1242 CYS A CA    1 
ATOM   9276  C  C     . CYS A 1  1242 ? -54.343 -13.248 -34.576 1.00 67.14  ? 1242 CYS A C     1 
ATOM   9277  O  O     . CYS A 1  1242 ? -54.624 -12.352 -33.792 1.00 69.18  ? 1242 CYS A O     1 
ATOM   9278  C  CB    . CYS A 1  1242 ? -56.186 -14.941 -34.864 1.00 66.44  ? 1242 CYS A CB    1 
ATOM   9279  S  SG    . CYS A 1  1242 ? -55.228 -16.455 -34.657 1.00 66.32  ? 1242 CYS A SG    1 
ATOM   9280  N  N     . ASP A 1  1243 ? -53.122 -13.772 -34.681 1.00 67.37  ? 1243 ASP A N     1 
ATOM   9281  C  CA    . ASP A 1  1243 ? -51.973 -13.314 -33.878 1.00 68.54  ? 1243 ASP A CA    1 
ATOM   9282  C  C     . ASP A 1  1243 ? -51.323 -12.004 -34.351 1.00 69.98  ? 1243 ASP A C     1 
ATOM   9283  O  O     . ASP A 1  1243 ? -50.516 -11.421 -33.624 1.00 69.30  ? 1243 ASP A O     1 
ATOM   9284  C  CB    . ASP A 1  1243 ? -50.891 -14.405 -33.848 1.00 67.55  ? 1243 ASP A CB    1 
ATOM   9285  C  CG    . ASP A 1  1243 ? -51.352 -15.660 -33.146 1.00 67.35  ? 1243 ASP A CG    1 
ATOM   9286  O  OD1   . ASP A 1  1243 ? -51.680 -15.562 -31.945 1.00 67.88  ? 1243 ASP A OD1   1 
ATOM   9287  O  OD2   . ASP A 1  1243 ? -51.386 -16.738 -33.786 1.00 66.26  ? 1243 ASP A OD2   1 
ATOM   9288  N  N     . MET A 1  1244 ? -51.664 -11.550 -35.553 1.00 72.39  ? 1244 MET A N     1 
ATOM   9289  C  CA    . MET A 1  1244 ? -50.999 -10.405 -36.167 1.00 75.99  ? 1244 MET A CA    1 
ATOM   9290  C  C     . MET A 1  1244 ? -51.533 -9.126  -35.514 1.00 76.12  ? 1244 MET A C     1 
ATOM   9291  O  O     . MET A 1  1244 ? -52.743 -9.029  -35.282 1.00 76.86  ? 1244 MET A O     1 
ATOM   9292  C  CB    . MET A 1  1244 ? -51.253 -10.415 -37.683 1.00 80.03  ? 1244 MET A CB    1 
ATOM   9293  C  CG    . MET A 1  1244 ? -50.222 -9.675  -38.522 1.00 84.64  ? 1244 MET A CG    1 
ATOM   9294  S  SD    . MET A 1  1244 ? -50.755 -8.050  -39.118 1.00 93.19  ? 1244 MET A SD    1 
ATOM   9295  C  CE    . MET A 1  1244 ? -52.024 -8.516  -40.292 1.00 89.89  ? 1244 MET A CE    1 
ATOM   9296  N  N     . PRO A 1  1245 ? -50.646 -8.151  -35.190 1.00 75.20  ? 1245 PRO A N     1 
ATOM   9297  C  CA    . PRO A 1  1245 ? -51.121 -6.948  -34.484 1.00 74.89  ? 1245 PRO A CA    1 
ATOM   9298  C  C     . PRO A 1  1245 ? -52.244 -6.237  -35.231 1.00 74.63  ? 1245 PRO A C     1 
ATOM   9299  O  O     . PRO A 1  1245 ? -52.151 -6.060  -36.446 1.00 73.68  ? 1245 PRO A O     1 
ATOM   9300  C  CB    . PRO A 1  1245 ? -49.877 -6.052  -34.415 1.00 75.19  ? 1245 PRO A CB    1 
ATOM   9301  C  CG    . PRO A 1  1245 ? -48.724 -6.974  -34.573 1.00 75.05  ? 1245 PRO A CG    1 
ATOM   9302  C  CD    . PRO A 1  1245 ? -49.198 -8.078  -35.469 1.00 74.48  ? 1245 PRO A CD    1 
ATOM   9303  N  N     . THR A 1  1246 ? -53.296 -5.857  -34.503 1.00 75.72  ? 1246 THR A N     1 
ATOM   9304  C  CA    . THR A 1  1246 ? -54.471 -5.195  -35.081 1.00 76.68  ? 1246 THR A CA    1 
ATOM   9305  C  C     . THR A 1  1246 ? -54.077 -3.925  -35.828 1.00 77.12  ? 1246 THR A C     1 
ATOM   9306  O  O     . THR A 1  1246 ? -54.604 -3.658  -36.900 1.00 77.44  ? 1246 THR A O     1 
ATOM   9307  C  CB    . THR A 1  1246 ? -55.529 -4.874  -33.996 1.00 78.70  ? 1246 THR A CB    1 
ATOM   9308  O  OG1   . THR A 1  1246 ? -55.973 -6.094  -33.389 1.00 79.05  ? 1246 THR A OG1   1 
ATOM   9309  C  CG2   . THR A 1  1246 ? -56.741 -4.115  -34.575 1.00 79.50  ? 1246 THR A CG2   1 
ATOM   9310  N  N     . GLU A 1  1247 ? -53.141 -3.163  -35.262 1.00 78.05  ? 1247 GLU A N     1 
ATOM   9311  C  CA    . GLU A 1  1247 ? -52.604 -1.964  -35.899 1.00 78.48  ? 1247 GLU A CA    1 
ATOM   9312  C  C     . GLU A 1  1247 ? -51.092 -2.115  -36.094 1.00 76.95  ? 1247 GLU A C     1 
ATOM   9313  O  O     . GLU A 1  1247 ? -50.392 -2.578  -35.199 1.00 76.48  ? 1247 GLU A O     1 
ATOM   9314  C  CB    . GLU A 1  1247 ? -52.935 -0.738  -35.049 1.00 80.49  ? 1247 GLU A CB    1 
ATOM   9315  C  CG    . GLU A 1  1247 ? -53.300 0.494   -35.861 1.00 81.78  ? 1247 GLU A CG    1 
ATOM   9316  C  CD    . GLU A 1  1247 ? -53.763 1.648   -34.992 1.00 83.71  ? 1247 GLU A CD    1 
ATOM   9317  O  OE1   . GLU A 1  1247 ? -54.622 1.431   -34.110 1.00 84.62  ? 1247 GLU A OE1   1 
ATOM   9318  O  OE2   . GLU A 1  1247 ? -53.272 2.778   -35.200 1.00 84.59  ? 1247 GLU A OE2   1 
ATOM   9319  N  N     . LEU A 1  1248 ? -50.594 -1.735  -37.267 1.00 75.69  ? 1248 LEU A N     1 
ATOM   9320  C  CA    . LEU A 1  1248 ? -49.186 -1.923  -37.601 1.00 75.38  ? 1248 LEU A CA    1 
ATOM   9321  C  C     . LEU A 1  1248 ? -48.648 -0.745  -38.399 1.00 75.39  ? 1248 LEU A C     1 
ATOM   9322  O  O     . LEU A 1  1248 ? -49.044 -0.536  -39.536 1.00 75.94  ? 1248 LEU A O     1 
ATOM   9323  C  CB    . LEU A 1  1248 ? -49.009 -3.221  -38.395 1.00 75.07  ? 1248 LEU A CB    1 
ATOM   9324  C  CG    . LEU A 1  1248 ? -47.586 -3.641  -38.785 1.00 74.89  ? 1248 LEU A CG    1 
ATOM   9325  C  CD1   . LEU A 1  1248 ? -46.716 -3.860  -37.556 1.00 75.32  ? 1248 LEU A CD1   1 
ATOM   9326  C  CD2   . LEU A 1  1248 ? -47.638 -4.903  -39.632 1.00 74.00  ? 1248 LEU A CD2   1 
ATOM   9327  N  N     . HIS A 1  1249 ? -47.733 0.014   -37.804 1.00 75.51  ? 1249 HIS A N     1 
ATOM   9328  C  CA    . HIS A 1  1249 ? -47.090 1.132   -38.489 1.00 75.53  ? 1249 HIS A CA    1 
ATOM   9329  C  C     . HIS A 1  1249 ? -45.608 0.831   -38.680 1.00 74.76  ? 1249 HIS A C     1 
ATOM   9330  O  O     . HIS A 1  1249 ? -44.929 0.442   -37.727 1.00 74.99  ? 1249 HIS A O     1 
ATOM   9331  C  CB    . HIS A 1  1249 ? -47.281 2.411   -37.687 1.00 76.67  ? 1249 HIS A CB    1 
ATOM   9332  C  CG    . HIS A 1  1249 ? -48.703 2.676   -37.317 1.00 76.64  ? 1249 HIS A CG    1 
ATOM   9333  N  ND1   . HIS A 1  1249 ? -49.561 3.390   -38.123 1.00 77.23  ? 1249 HIS A ND1   1 
ATOM   9334  C  CD2   . HIS A 1  1249 ? -49.424 2.304   -36.236 1.00 76.78  ? 1249 HIS A CD2   1 
ATOM   9335  C  CE1   . HIS A 1  1249 ? -50.748 3.457   -37.548 1.00 77.85  ? 1249 HIS A CE1   1 
ATOM   9336  N  NE2   . HIS A 1  1249 ? -50.691 2.805   -36.402 1.00 77.49  ? 1249 HIS A NE2   1 
ATOM   9337  N  N     . ILE A 1  1250 ? -45.119 0.981   -39.912 1.00 73.86  ? 1250 ILE A N     1 
ATOM   9338  C  CA    . ILE A 1  1250 ? -43.710 0.731   -40.228 1.00 73.88  ? 1250 ILE A CA    1 
ATOM   9339  C  C     . ILE A 1  1250 ? -43.130 1.908   -41.001 1.00 75.61  ? 1250 ILE A C     1 
ATOM   9340  O  O     . ILE A 1  1250 ? -43.632 2.275   -42.067 1.00 75.65  ? 1250 ILE A O     1 
ATOM   9341  C  CB    . ILE A 1  1250 ? -43.500 -0.579  -41.018 1.00 71.64  ? 1250 ILE A CB    1 
ATOM   9342  C  CG1   . ILE A 1  1250 ? -43.949 -1.774  -40.171 1.00 70.99  ? 1250 ILE A CG1   1 
ATOM   9343  C  CG2   . ILE A 1  1250 ? -42.030 -0.742  -41.398 1.00 71.35  ? 1250 ILE A CG2   1 
ATOM   9344  C  CD1   . ILE A 1  1250 ? -44.011 -3.083  -40.920 1.00 70.21  ? 1250 ILE A CD1   1 
ATOM   9345  N  N     . ALA A 1  1251 ? -42.060 2.478   -40.451 1.00 77.24  ? 1251 ALA A N     1 
ATOM   9346  C  CA    . ALA A 1  1251 ? -41.368 3.608   -41.051 1.00 78.94  ? 1251 ALA A CA    1 
ATOM   9347  C  C     . ALA A 1  1251 ? -39.915 3.243   -41.333 1.00 79.38  ? 1251 ALA A C     1 
ATOM   9348  O  O     . ALA A 1  1251 ? -39.271 2.578   -40.518 1.00 79.61  ? 1251 ALA A O     1 
ATOM   9349  C  CB    . ALA A 1  1251 ? -41.439 4.804   -40.118 1.00 80.60  ? 1251 ALA A CB    1 
ATOM   9350  N  N     . LEU A 1  1252 ? -39.413 3.666   -42.494 1.00 80.15  ? 1252 LEU A N     1 
ATOM   9351  C  CA    . LEU A 1  1252 ? -37.993 3.571   -42.817 1.00 81.13  ? 1252 LEU A CA    1 
ATOM   9352  C  C     . LEU A 1  1252 ? -37.348 4.936   -42.627 1.00 84.03  ? 1252 LEU A C     1 
ATOM   9353  O  O     . LEU A 1  1252 ? -37.865 5.944   -43.116 1.00 86.14  ? 1252 LEU A O     1 
ATOM   9354  C  CB    . LEU A 1  1252 ? -37.794 3.109   -44.257 1.00 80.40  ? 1252 LEU A CB    1 
ATOM   9355  C  CG    . LEU A 1  1252 ? -38.351 1.733   -44.617 1.00 79.18  ? 1252 LEU A CG    1 
ATOM   9356  C  CD1   . LEU A 1  1252 ? -38.039 1.440   -46.075 1.00 78.98  ? 1252 LEU A CD1   1 
ATOM   9357  C  CD2   . LEU A 1  1252 ? -37.799 0.637   -43.715 1.00 78.34  ? 1252 LEU A CD2   1 
ATOM   9358  N  N     . LEU A 1  1253 ? -36.217 4.962   -41.924 1.00 85.68  ? 1253 LEU A N     1 
ATOM   9359  C  CA    . LEU A 1  1253 ? -35.506 6.208   -41.629 1.00 87.74  ? 1253 LEU A CA    1 
ATOM   9360  C  C     . LEU A 1  1253 ? -34.916 6.751   -42.933 1.00 88.87  ? 1253 LEU A C     1 
ATOM   9361  O  O     . LEU A 1  1253 ? -34.422 5.964   -43.736 1.00 88.56  ? 1253 LEU A O     1 
ATOM   9362  C  CB    . LEU A 1  1253 ? -34.410 5.943   -40.596 1.00 87.94  ? 1253 LEU A CB    1 
ATOM   9363  C  CG    . LEU A 1  1253 ? -33.778 7.132   -39.868 1.00 89.81  ? 1253 LEU A CG    1 
ATOM   9364  C  CD1   . LEU A 1  1253 ? -33.240 6.684   -38.514 1.00 90.29  ? 1253 LEU A CD1   1 
ATOM   9365  C  CD2   . LEU A 1  1253 ? -32.682 7.800   -40.694 1.00 90.96  ? 1253 LEU A CD2   1 
ATOM   9366  N  N     . PRO A 1  1254 ? -34.990 8.079   -43.171 1.00 92.26  ? 1254 PRO A N     1 
ATOM   9367  C  CA    . PRO A 1  1254 ? -34.438 8.643   -44.415 1.00 94.60  ? 1254 PRO A CA    1 
ATOM   9368  C  C     . PRO A 1  1254 ? -32.965 8.277   -44.681 1.00 97.97  ? 1254 PRO A C     1 
ATOM   9369  O  O     . PRO A 1  1254 ? -32.197 8.141   -43.727 1.00 98.05  ? 1254 PRO A O     1 
ATOM   9370  C  CB    . PRO A 1  1254 ? -34.584 10.152  -44.207 1.00 94.85  ? 1254 PRO A CB    1 
ATOM   9371  C  CG    . PRO A 1  1254 ? -35.765 10.286  -43.319 1.00 94.03  ? 1254 PRO A CG    1 
ATOM   9372  C  CD    . PRO A 1  1254 ? -35.731 9.098   -42.401 1.00 92.99  ? 1254 PRO A CD    1 
ATOM   9373  N  N     . PRO A 1  1255 ? -32.572 8.142   -45.970 1.00 102.43 ? 1255 PRO A N     1 
ATOM   9374  C  CA    . PRO A 1  1255 ? -31.262 7.576   -46.358 1.00 104.44 ? 1255 PRO A CA    1 
ATOM   9375  C  C     . PRO A 1  1255 ? -30.051 8.253   -45.699 1.00 108.24 ? 1255 PRO A C     1 
ATOM   9376  O  O     . PRO A 1  1255 ? -30.067 9.467   -45.485 1.00 109.28 ? 1255 PRO A O     1 
ATOM   9377  C  CB    . PRO A 1  1255 ? -31.233 7.754   -47.887 1.00 104.08 ? 1255 PRO A CB    1 
ATOM   9378  C  CG    . PRO A 1  1255 ? -32.244 8.806   -48.186 1.00 104.09 ? 1255 PRO A CG    1 
ATOM   9379  C  CD    . PRO A 1  1255 ? -33.310 8.647   -47.146 1.00 103.35 ? 1255 PRO A CD    1 
ATOM   9380  N  N     . SER A 1  1256 ? -29.023 7.457   -45.396 1.00 111.71 ? 1256 SER A N     1 
ATOM   9381  C  CA    . SER A 1  1256 ? -27.903 7.878   -44.531 1.00 115.91 ? 1256 SER A CA    1 
ATOM   9382  C  C     . SER A 1  1256 ? -26.511 7.981   -45.195 1.00 118.09 ? 1256 SER A C     1 
ATOM   9383  O  O     . SER A 1  1256 ? -25.587 8.504   -44.563 1.00 120.29 ? 1256 SER A O     1 
ATOM   9384  C  CB    . SER A 1  1256 ? -27.809 6.923   -43.332 1.00 115.84 ? 1256 SER A CB    1 
ATOM   9385  O  OG    . SER A 1  1256 ? -29.083 6.699   -42.748 1.00 115.24 ? 1256 SER A OG    1 
ATOM   9386  N  N     . GLN A 1  1257 ? -26.364 7.491   -46.433 1.00 117.11 ? 1257 GLN A N     1 
ATOM   9387  C  CA    . GLN A 1  1257 ? -25.090 7.517   -47.191 1.00 117.70 ? 1257 GLN A CA    1 
ATOM   9388  C  C     . GLN A 1  1257 ? -23.931 6.721   -46.553 1.00 116.11 ? 1257 GLN A C     1 
ATOM   9389  O  O     . GLN A 1  1257 ? -23.260 7.195   -45.636 1.00 116.47 ? 1257 GLN A O     1 
ATOM   9390  C  CB    . GLN A 1  1257 ? -24.651 8.958   -47.511 1.00 121.10 ? 1257 GLN A CB    1 
ATOM   9391  C  CG    . GLN A 1  1257 ? -25.536 9.660   -48.535 1.00 122.02 ? 1257 GLN A CG    1 
ATOM   9392  C  CD    . GLN A 1  1257 ? -25.345 9.122   -49.944 1.00 121.53 ? 1257 GLN A CD    1 
ATOM   9393  O  OE1   . GLN A 1  1257 ? -24.236 9.129   -50.478 1.00 121.83 ? 1257 GLN A OE1   1 
ATOM   9394  N  NE2   . GLN A 1  1257 ? -26.428 8.654   -50.550 1.00 120.48 ? 1257 GLN A NE2   1 
ATOM   9395  N  N     . ASN A 1  1258 ? -23.695 5.527   -47.096 1.00 115.21 ? 1258 ASN A N     1 
ATOM   9396  C  CA    . ASN A 1  1258 ? -22.729 4.548   -46.586 1.00 114.11 ? 1258 ASN A CA    1 
ATOM   9397  C  C     . ASN A 1  1258 ? -21.915 3.996   -47.763 1.00 110.41 ? 1258 ASN A C     1 
ATOM   9398  O  O     . ASN A 1  1258 ? -22.234 2.933   -48.301 1.00 107.69 ? 1258 ASN A O     1 
ATOM   9399  C  CB    . ASN A 1  1258 ? -23.456 3.393   -45.868 1.00 114.47 ? 1258 ASN A CB    1 
ATOM   9400  C  CG    . ASN A 1  1258 ? -24.302 3.859   -44.690 1.00 116.31 ? 1258 ASN A CG    1 
ATOM   9401  O  OD1   . ASN A 1  1258 ? -23.861 4.669   -43.872 1.00 118.77 ? 1258 ASN A OD1   1 
ATOM   9402  N  ND2   . ASN A 1  1258 ? -25.525 3.337   -44.595 1.00 114.35 ? 1258 ASN A ND2   1 
ATOM   9403  N  N     . SER A 1  1259 ? -20.850 4.706   -48.140 1.00 108.75 ? 1259 SER A N     1 
ATOM   9404  C  CA    . SER A 1  1259 ? -20.066 4.404   -49.363 1.00 106.30 ? 1259 SER A CA    1 
ATOM   9405  C  C     . SER A 1  1259 ? -19.234 3.099   -49.342 1.00 102.47 ? 1259 SER A C     1 
ATOM   9406  O  O     . SER A 1  1259 ? -18.405 2.879   -50.229 1.00 101.17 ? 1259 SER A O     1 
ATOM   9407  C  CB    . SER A 1  1259 ? -19.145 5.594   -49.688 1.00 108.49 ? 1259 SER A CB    1 
ATOM   9408  O  OG    . SER A 1  1259 ? -18.511 5.440   -50.947 1.00 108.20 ? 1259 SER A OG    1 
ATOM   9409  N  N     . ASN A 1  1260 ? -19.467 2.249   -48.341 1.00 99.00  ? 1260 ASN A N     1 
ATOM   9410  C  CA    . ASN A 1  1260 ? -18.817 0.943   -48.203 1.00 96.02  ? 1260 ASN A CA    1 
ATOM   9411  C  C     . ASN A 1  1260 ? -19.709 -0.261  -48.589 1.00 91.59  ? 1260 ASN A C     1 
ATOM   9412  O  O     . ASN A 1  1260 ? -19.256 -1.404  -48.508 1.00 90.98  ? 1260 ASN A O     1 
ATOM   9413  C  CB    . ASN A 1  1260 ? -18.334 0.775   -46.755 1.00 97.05  ? 1260 ASN A CB    1 
ATOM   9414  C  CG    . ASN A 1  1260 ? -19.476 0.818   -45.744 1.00 97.25  ? 1260 ASN A CG    1 
ATOM   9415  O  OD1   . ASN A 1  1260 ? -20.428 1.590   -45.896 1.00 96.67  ? 1260 ASN A OD1   1 
ATOM   9416  N  ND2   . ASN A 1  1260 ? -19.386 -0.010  -44.709 1.00 97.54  ? 1260 ASN A ND2   1 
ATOM   9417  N  N     . THR A 1  1261 ? -20.959 -0.008  -48.991 1.00 87.36  ? 1261 THR A N     1 
ATOM   9418  C  CA    . THR A 1  1261 ? -21.920 -1.067  -49.333 1.00 83.34  ? 1261 THR A CA    1 
ATOM   9419  C  C     . THR A 1  1261 ? -22.574 -0.814  -50.686 1.00 81.73  ? 1261 THR A C     1 
ATOM   9420  O  O     . THR A 1  1261 ? -22.481 0.287   -51.236 1.00 83.66  ? 1261 THR A O     1 
ATOM   9421  C  CB    . THR A 1  1261 ? -23.039 -1.173  -48.280 1.00 82.30  ? 1261 THR A CB    1 
ATOM   9422  O  OG1   . THR A 1  1261 ? -23.785 0.047   -48.246 1.00 82.54  ? 1261 THR A OG1   1 
ATOM   9423  C  CG2   . THR A 1  1261 ? -22.459 -1.450  -46.899 1.00 82.97  ? 1261 THR A CG2   1 
ATOM   9424  N  N     . LEU A 1  1262 ? -23.247 -1.840  -51.206 1.00 77.73  ? 1262 LEU A N     1 
ATOM   9425  C  CA    . LEU A 1  1262 ? -23.909 -1.765  -52.509 1.00 75.81  ? 1262 LEU A CA    1 
ATOM   9426  C  C     . LEU A 1  1262 ? -25.045 -0.747  -52.489 1.00 75.39  ? 1262 LEU A C     1 
ATOM   9427  O  O     . LEU A 1  1262 ? -26.065 -0.970  -51.832 1.00 74.48  ? 1262 LEU A O     1 
ATOM   9428  C  CB    . LEU A 1  1262 ? -24.464 -3.135  -52.907 1.00 74.40  ? 1262 LEU A CB    1 
ATOM   9429  C  CG    . LEU A 1  1262 ? -25.260 -3.220  -54.214 1.00 73.56  ? 1262 LEU A CG    1 
ATOM   9430  C  CD1   . LEU A 1  1262 ? -24.363 -2.963  -55.416 1.00 73.88  ? 1262 LEU A CD1   1 
ATOM   9431  C  CD2   . LEU A 1  1262 ? -25.947 -4.571  -54.313 1.00 72.61  ? 1262 LEU A CD2   1 
ATOM   9432  N  N     . TYR A 1  1263 ? -24.859 0.354   -53.221 1.00 75.17  ? 1263 TYR A N     1 
ATOM   9433  C  CA    . TYR A 1  1263 ? -25.832 1.458   -53.292 1.00 74.95  ? 1263 TYR A CA    1 
ATOM   9434  C  C     . TYR A 1  1263 ? -26.272 1.976   -51.913 1.00 74.28  ? 1263 TYR A C     1 
ATOM   9435  O  O     . TYR A 1  1263 ? -27.442 2.301   -51.719 1.00 73.30  ? 1263 TYR A O     1 
ATOM   9436  C  CB    . TYR A 1  1263 ? -27.070 1.055   -54.122 1.00 74.05  ? 1263 TYR A CB    1 
ATOM   9437  C  CG    . TYR A 1  1263 ? -26.788 0.479   -55.499 1.00 72.69  ? 1263 TYR A CG    1 
ATOM   9438  C  CD1   . TYR A 1  1263 ? -25.813 1.035   -56.335 1.00 73.18  ? 1263 TYR A CD1   1 
ATOM   9439  C  CD2   . TYR A 1  1263 ? -27.525 -0.603  -55.982 1.00 70.79  ? 1263 TYR A CD2   1 
ATOM   9440  C  CE1   . TYR A 1  1263 ? -25.565 0.509   -57.596 1.00 72.65  ? 1263 TYR A CE1   1 
ATOM   9441  C  CE2   . TYR A 1  1263 ? -27.286 -1.133  -57.243 1.00 70.26  ? 1263 TYR A CE2   1 
ATOM   9442  C  CZ    . TYR A 1  1263 ? -26.305 -0.580  -58.047 1.00 71.11  ? 1263 TYR A CZ    1 
ATOM   9443  O  OH    . TYR A 1  1263 ? -26.069 -1.102  -59.301 1.00 70.18  ? 1263 TYR A OH    1 
ATOM   9444  N  N     . SER A 1  1264 ? -25.329 2.036   -50.969 1.00 74.89  ? 1264 SER A N     1 
ATOM   9445  C  CA    . SER A 1  1264 ? -25.575 2.520   -49.597 1.00 75.80  ? 1264 SER A CA    1 
ATOM   9446  C  C     . SER A 1  1264 ? -26.705 1.792   -48.843 1.00 74.38  ? 1264 SER A C     1 
ATOM   9447  O  O     . SER A 1  1264 ? -27.350 2.369   -47.960 1.00 74.32  ? 1264 SER A O     1 
ATOM   9448  C  CB    . SER A 1  1264 ? -25.834 4.031   -49.618 1.00 77.56  ? 1264 SER A CB    1 
ATOM   9449  O  OG    . SER A 1  1264 ? -24.700 4.719   -50.114 1.00 78.92  ? 1264 SER A OG    1 
ATOM   9450  N  N     . SER A 1  1265 ? -26.923 0.521   -49.180 1.00 72.59  ? 1265 SER A N     1 
ATOM   9451  C  CA    . SER A 1  1265 ? -27.990 -0.274  -48.583 1.00 71.81  ? 1265 SER A CA    1 
ATOM   9452  C  C     . SER A 1  1265 ? -27.473 -1.062  -47.383 1.00 71.97  ? 1265 SER A C     1 
ATOM   9453  O  O     . SER A 1  1265 ? -26.286 -1.368  -47.293 1.00 72.43  ? 1265 SER A O     1 
ATOM   9454  C  CB    . SER A 1  1265 ? -28.580 -1.232  -49.619 1.00 70.18  ? 1265 SER A CB    1 
ATOM   9455  O  OG    . SER A 1  1265 ? -27.633 -2.209  -50.007 1.00 69.50  ? 1265 SER A OG    1 
ATOM   9456  N  N     . LYS A 1  1266 ? -28.380 -1.379  -46.465 1.00 72.84  ? 1266 LYS A N     1 
ATOM   9457  C  CA    . LYS A 1  1266 ? -28.085 -2.256  -45.340 1.00 73.23  ? 1266 LYS A CA    1 
ATOM   9458  C  C     . LYS A 1  1266 ? -28.891 -3.541  -45.481 1.00 71.93  ? 1266 LYS A C     1 
ATOM   9459  O  O     . LYS A 1  1266 ? -30.103 -3.505  -45.711 1.00 71.24  ? 1266 LYS A O     1 
ATOM   9460  C  CB    . LYS A 1  1266 ? -28.409 -1.568  -44.012 1.00 74.58  ? 1266 LYS A CB    1 
ATOM   9461  C  CG    . LYS A 1  1266 ? -27.512 -0.377  -43.722 1.00 76.43  ? 1266 LYS A CG    1 
ATOM   9462  C  CD    . LYS A 1  1266 ? -27.587 0.059   -42.271 1.00 77.63  ? 1266 LYS A CD    1 
ATOM   9463  C  CE    . LYS A 1  1266 ? -26.837 1.362   -42.072 1.00 79.53  ? 1266 LYS A CE    1 
ATOM   9464  N  NZ    . LYS A 1  1266 ? -26.839 1.792   -40.650 1.00 81.25  ? 1266 LYS A NZ    1 
ATOM   9465  N  N     . GLY A 1  1267 ? -28.195 -4.669  -45.372 1.00 71.76  ? 1267 GLY A N     1 
ATOM   9466  C  CA    . GLY A 1  1267 ? -28.816 -5.978  -45.323 1.00 71.41  ? 1267 GLY A CA    1 
ATOM   9467  C  C     . GLY A 1  1267 ? -29.546 -6.252  -44.018 1.00 72.16  ? 1267 GLY A C     1 
ATOM   9468  O  O     . GLY A 1  1267 ? -28.935 -6.416  -42.957 1.00 71.45  ? 1267 GLY A O     1 
ATOM   9469  N  N     . LEU A 1  1268 ? -30.867 -6.289  -44.110 1.00 73.21  ? 1268 LEU A N     1 
ATOM   9470  C  CA    . LEU A 1  1268 ? -31.716 -6.747  -43.020 1.00 74.87  ? 1268 LEU A CA    1 
ATOM   9471  C  C     . LEU A 1  1268 ? -32.219 -8.132  -43.432 1.00 75.17  ? 1268 LEU A C     1 
ATOM   9472  O  O     . LEU A 1  1268 ? -31.718 -8.711  -44.405 1.00 76.04  ? 1268 LEU A O     1 
ATOM   9473  C  CB    . LEU A 1  1268 ? -32.852 -5.760  -42.762 1.00 75.37  ? 1268 LEU A CB    1 
ATOM   9474  C  CG    . LEU A 1  1268 ? -33.745 -5.397  -43.953 1.00 75.88  ? 1268 LEU A CG    1 
ATOM   9475  C  CD1   . LEU A 1  1268 ? -35.208 -5.358  -43.555 1.00 76.44  ? 1268 LEU A CD1   1 
ATOM   9476  C  CD2   . LEU A 1  1268 ? -33.332 -4.068  -44.552 1.00 76.20  ? 1268 LEU A CD2   1 
ATOM   9477  N  N     . GLY A 1  1269 ? -33.197 -8.666  -42.711 1.00 74.83  ? 1269 GLY A N     1 
ATOM   9478  C  CA    . GLY A 1  1269 ? -33.639 -10.036 -42.921 1.00 73.84  ? 1269 GLY A CA    1 
ATOM   9479  C  C     . GLY A 1  1269 ? -33.628 -10.699 -41.575 1.00 74.32  ? 1269 GLY A C     1 
ATOM   9480  O  O     . GLY A 1  1269 ? -34.646 -11.212 -41.130 1.00 75.74  ? 1269 GLY A O     1 
ATOM   9481  N  N     . GLU A 1  1270 ? -32.473 -10.666 -40.916 1.00 74.60  ? 1270 GLU A N     1 
ATOM   9482  C  CA    . GLU A 1  1270 ? -32.363 -11.126 -39.533 1.00 74.79  ? 1270 GLU A CA    1 
ATOM   9483  C  C     . GLU A 1  1270 ? -32.752 -10.064 -38.496 1.00 75.19  ? 1270 GLU A C     1 
ATOM   9484  O  O     . GLU A 1  1270 ? -33.062 -10.414 -37.356 1.00 77.83  ? 1270 GLU A O     1 
ATOM   9485  C  CB    . GLU A 1  1270 ? -30.944 -11.618 -39.254 1.00 75.00  ? 1270 GLU A CB    1 
ATOM   9486  C  CG    . GLU A 1  1270 ? -30.542 -12.824 -40.081 1.00 73.90  ? 1270 GLU A CG    1 
ATOM   9487  C  CD    . GLU A 1  1270 ? -29.164 -13.330 -39.716 1.00 74.26  ? 1270 GLU A CD    1 
ATOM   9488  O  OE1   . GLU A 1  1270 ? -28.176 -12.615 -39.976 1.00 75.48  ? 1270 GLU A OE1   1 
ATOM   9489  O  OE2   . GLU A 1  1270 ? -29.076 -14.444 -39.160 1.00 73.71  ? 1270 GLU A OE2   1 
ATOM   9490  N  N     . SER A 1  1271 ? -32.750 -8.788  -38.895 1.00 74.43  ? 1271 SER A N     1 
ATOM   9491  C  CA    . SER A 1  1271 ? -32.810 -7.650  -37.957 1.00 74.12  ? 1271 SER A CA    1 
ATOM   9492  C  C     . SER A 1  1271 ? -34.063 -7.611  -37.090 1.00 73.08  ? 1271 SER A C     1 
ATOM   9493  O  O     . SER A 1  1271 ? -33.974 -7.576  -35.855 1.00 73.20  ? 1271 SER A O     1 
ATOM   9494  C  CB    . SER A 1  1271 ? -32.709 -6.331  -38.726 1.00 74.20  ? 1271 SER A CB    1 
ATOM   9495  O  OG    . SER A 1  1271 ? -31.581 -6.337  -39.574 1.00 75.64  ? 1271 SER A OG    1 
ATOM   9496  N  N     . GLY A 1  1272 ? -35.219 -7.648  -37.752 1.00 70.54  ? 1272 GLY A N     1 
ATOM   9497  C  CA    . GLY A 1  1272 ? -36.517 -7.475  -37.103 1.00 69.26  ? 1272 GLY A CA    1 
ATOM   9498  C  C     . GLY A 1  1272 ? -36.982 -8.554  -36.134 1.00 67.95  ? 1272 GLY A C     1 
ATOM   9499  O  O     . GLY A 1  1272 ? -37.956 -8.335  -35.410 1.00 68.17  ? 1272 GLY A O     1 
ATOM   9500  N  N     . VAL A 1  1273 ? -36.301 -9.702  -36.100 1.00 65.79  ? 1273 VAL A N     1 
ATOM   9501  C  CA    . VAL A 1  1273 ? -36.684 -10.812 -35.218 1.00 64.66  ? 1273 VAL A CA    1 
ATOM   9502  C  C     . VAL A 1  1273 ? -36.754 -10.357 -33.755 1.00 65.93  ? 1273 VAL A C     1 
ATOM   9503  O  O     . VAL A 1  1273 ? -37.780 -10.529 -33.095 1.00 65.41  ? 1273 VAL A O     1 
ATOM   9504  C  CB    . VAL A 1  1273 ? -35.736 -12.025 -35.368 1.00 63.45  ? 1273 VAL A CB    1 
ATOM   9505  C  CG1   . VAL A 1  1273 ? -36.077 -13.112 -34.351 1.00 63.47  ? 1273 VAL A CG1   1 
ATOM   9506  C  CG2   . VAL A 1  1273 ? -35.805 -12.581 -36.786 1.00 62.56  ? 1273 VAL A CG2   1 
ATOM   9507  N  N     . PHE A 1  1274 ? -35.679 -9.747  -33.271 1.00 66.63  ? 1274 PHE A N     1 
ATOM   9508  C  CA    . PHE A 1  1274 ? -35.629 -9.262  -31.888 1.00 67.45  ? 1274 PHE A CA    1 
ATOM   9509  C  C     . PHE A 1  1274 ? -36.737 -8.250  -31.518 1.00 67.68  ? 1274 PHE A C     1 
ATOM   9510  O  O     . PHE A 1  1274 ? -37.200 -8.224  -30.372 1.00 67.61  ? 1274 PHE A O     1 
ATOM   9511  C  CB    . PHE A 1  1274 ? -34.258 -8.662  -31.593 1.00 68.62  ? 1274 PHE A CB    1 
ATOM   9512  C  CG    . PHE A 1  1274 ? -34.208 -7.919  -30.304 1.00 70.02  ? 1274 PHE A CG    1 
ATOM   9513  C  CD1   . PHE A 1  1274 ? -34.390 -8.593  -29.103 1.00 70.94  ? 1274 PHE A CD1   1 
ATOM   9514  C  CD2   . PHE A 1  1274 ? -34.036 -6.542  -30.285 1.00 70.79  ? 1274 PHE A CD2   1 
ATOM   9515  C  CE1   . PHE A 1  1274 ? -34.366 -7.914  -27.899 1.00 72.27  ? 1274 PHE A CE1   1 
ATOM   9516  C  CE2   . PHE A 1  1274 ? -34.004 -5.862  -29.086 1.00 72.09  ? 1274 PHE A CE2   1 
ATOM   9517  C  CZ    . PHE A 1  1274 ? -34.172 -6.545  -27.893 1.00 73.01  ? 1274 PHE A CZ    1 
ATOM   9518  N  N     . LEU A 1  1275 ? -37.178 -7.443  -32.485 1.00 66.94  ? 1275 LEU A N     1 
ATOM   9519  C  CA    . LEU A 1  1275 ? -38.227 -6.438  -32.239 1.00 67.10  ? 1275 LEU A CA    1 
ATOM   9520  C  C     . LEU A 1  1275 ? -39.555 -7.031  -31.755 1.00 66.39  ? 1275 LEU A C     1 
ATOM   9521  O  O     . LEU A 1  1275 ? -40.357 -6.334  -31.144 1.00 66.21  ? 1275 LEU A O     1 
ATOM   9522  C  CB    . LEU A 1  1275 ? -38.472 -5.593  -33.490 1.00 67.06  ? 1275 LEU A CB    1 
ATOM   9523  C  CG    . LEU A 1  1275 ? -37.272 -4.809  -34.036 1.00 67.95  ? 1275 LEU A CG    1 
ATOM   9524  C  CD1   . LEU A 1  1275 ? -37.677 -4.063  -35.300 1.00 67.65  ? 1275 LEU A CD1   1 
ATOM   9525  C  CD2   . LEU A 1  1275 ? -36.698 -3.864  -32.983 1.00 69.24  ? 1275 LEU A CD2   1 
ATOM   9526  N  N     . GLY A 1  1276 ? -39.780 -8.312  -32.043 1.00 65.88  ? 1276 GLY A N     1 
ATOM   9527  C  CA    . GLY A 1  1276 ? -40.904 -9.064  -31.499 1.00 65.37  ? 1276 GLY A CA    1 
ATOM   9528  C  C     . GLY A 1  1276 ? -40.935 -9.255  -29.990 1.00 66.19  ? 1276 GLY A C     1 
ATOM   9529  O  O     . GLY A 1  1276 ? -41.993 -9.569  -29.449 1.00 66.41  ? 1276 GLY A O     1 
ATOM   9530  N  N     . CYS A 1  1277 ? -39.802 -9.086  -29.302 1.00 66.57  ? 1277 CYS A N     1 
ATOM   9531  C  CA    . CYS A 1  1277 ? -39.806 -9.110  -27.829 1.00 68.09  ? 1277 CYS A CA    1 
ATOM   9532  C  C     . CYS A 1  1277 ? -40.481 -7.867  -27.221 1.00 68.58  ? 1277 CYS A C     1 
ATOM   9533  O  O     . CYS A 1  1277 ? -40.797 -7.858  -26.034 1.00 69.68  ? 1277 CYS A O     1 
ATOM   9534  C  CB    . CYS A 1  1277 ? -38.396 -9.297  -27.246 1.00 69.15  ? 1277 CYS A CB    1 
ATOM   9535  S  SG    . CYS A 1  1277 ? -37.405 -7.797  -27.133 1.00 71.04  ? 1277 CYS A SG    1 
ATOM   9536  N  N     . SER A 1  1278 ? -40.702 -6.824  -28.026 1.00 67.56  ? 1278 SER A N     1 
ATOM   9537  C  CA    . SER A 1  1278 ? -41.599 -5.733  -27.633 1.00 67.83  ? 1278 SER A CA    1 
ATOM   9538  C  C     . SER A 1  1278 ? -42.966 -6.264  -27.162 1.00 66.94  ? 1278 SER A C     1 
ATOM   9539  O  O     . SER A 1  1278 ? -43.548 -5.740  -26.215 1.00 67.92  ? 1278 SER A O     1 
ATOM   9540  C  CB    . SER A 1  1278 ? -41.780 -4.735  -28.786 1.00 67.34  ? 1278 SER A CB    1 
ATOM   9541  O  OG    . SER A 1  1278 ? -42.413 -5.335  -29.898 1.00 65.42  ? 1278 SER A OG    1 
ATOM   9542  N  N     . VAL A 1  1279 ? -43.456 -7.309  -27.821 1.00 64.80  ? 1279 VAL A N     1 
ATOM   9543  C  CA    . VAL A 1  1279 ? -44.703 -7.965  -27.430 1.00 64.27  ? 1279 VAL A CA    1 
ATOM   9544  C  C     . VAL A 1  1279 ? -44.528 -8.675  -26.078 1.00 64.53  ? 1279 VAL A C     1 
ATOM   9545  O  O     . VAL A 1  1279 ? -45.403 -8.600  -25.210 1.00 64.74  ? 1279 VAL A O     1 
ATOM   9546  C  CB    . VAL A 1  1279 ? -45.193 -8.954  -28.525 1.00 62.79  ? 1279 VAL A CB    1 
ATOM   9547  C  CG1   . VAL A 1  1279 ? -46.511 -9.605  -28.125 1.00 63.02  ? 1279 VAL A CG1   1 
ATOM   9548  C  CG2   . VAL A 1  1279 ? -45.351 -8.234  -29.859 1.00 62.33  ? 1279 VAL A CG2   1 
ATOM   9549  N  N     . PHE A 1  1280 ? -43.397 -9.362  -25.922 1.00 64.41  ? 1280 PHE A N     1 
ATOM   9550  C  CA    . PHE A 1  1280 ? -43.023 -10.051 -24.676 1.00 65.16  ? 1280 PHE A CA    1 
ATOM   9551  C  C     . PHE A 1  1280 ? -43.069 -9.106  -23.478 1.00 66.89  ? 1280 PHE A C     1 
ATOM   9552  O  O     . PHE A 1  1280 ? -43.706 -9.413  -22.466 1.00 67.39  ? 1280 PHE A O     1 
ATOM   9553  C  CB    . PHE A 1  1280 ? -41.619 -10.665 -24.827 1.00 64.73  ? 1280 PHE A CB    1 
ATOM   9554  C  CG    . PHE A 1  1280 ? -41.151 -11.472 -23.645 1.00 64.94  ? 1280 PHE A CG    1 
ATOM   9555  C  CD1   . PHE A 1  1280 ? -40.427 -10.873 -22.616 1.00 66.10  ? 1280 PHE A CD1   1 
ATOM   9556  C  CD2   . PHE A 1  1280 ? -41.385 -12.842 -23.586 1.00 63.98  ? 1280 PHE A CD2   1 
ATOM   9557  C  CE1   . PHE A 1  1280 ? -39.984 -11.620 -21.535 1.00 66.85  ? 1280 PHE A CE1   1 
ATOM   9558  C  CE2   . PHE A 1  1280 ? -40.936 -13.597 -22.511 1.00 64.56  ? 1280 PHE A CE2   1 
ATOM   9559  C  CZ    . PHE A 1  1280 ? -40.237 -12.986 -21.485 1.00 66.21  ? 1280 PHE A CZ    1 
ATOM   9560  N  N     . PHE A 1  1281 ? -42.409 -7.958  -23.608 1.00 67.94  ? 1281 PHE A N     1 
ATOM   9561  C  CA    . PHE A 1  1281 ? -42.320 -6.990  -22.511 1.00 69.63  ? 1281 PHE A CA    1 
ATOM   9562  C  C     . PHE A 1  1281 ? -43.594 -6.161  -22.322 1.00 70.13  ? 1281 PHE A C     1 
ATOM   9563  O  O     . PHE A 1  1281 ? -43.842 -5.642  -21.229 1.00 71.19  ? 1281 PHE A O     1 
ATOM   9564  C  CB    . PHE A 1  1281 ? -41.069 -6.115  -22.660 1.00 70.32  ? 1281 PHE A CB    1 
ATOM   9565  C  CG    . PHE A 1  1281 ? -39.793 -6.876  -22.435 1.00 70.53  ? 1281 PHE A CG    1 
ATOM   9566  C  CD1   . PHE A 1  1281 ? -39.434 -7.283  -21.153 1.00 71.71  ? 1281 PHE A CD1   1 
ATOM   9567  C  CD2   . PHE A 1  1281 ? -38.970 -7.229  -23.502 1.00 69.89  ? 1281 PHE A CD2   1 
ATOM   9568  C  CE1   . PHE A 1  1281 ? -38.272 -8.010  -20.935 1.00 72.06  ? 1281 PHE A CE1   1 
ATOM   9569  C  CE2   . PHE A 1  1281 ? -37.806 -7.955  -23.292 1.00 70.29  ? 1281 PHE A CE2   1 
ATOM   9570  C  CZ    . PHE A 1  1281 ? -37.456 -8.348  -22.007 1.00 71.41  ? 1281 PHE A CZ    1 
ATOM   9571  N  N     . ALA A 1  1282 ? -44.400 -6.049  -23.378 1.00 69.52  ? 1282 ALA A N     1 
ATOM   9572  C  CA    . ALA A 1  1282 ? -45.746 -5.486  -23.267 1.00 70.44  ? 1282 ALA A CA    1 
ATOM   9573  C  C     . ALA A 1  1282 ? -46.634 -6.390  -22.409 1.00 71.12  ? 1282 ALA A C     1 
ATOM   9574  O  O     . ALA A 1  1282 ? -47.369 -5.906  -21.555 1.00 71.71  ? 1282 ALA A O     1 
ATOM   9575  C  CB    . ALA A 1  1282 ? -46.360 -5.289  -24.645 1.00 69.39  ? 1282 ALA A CB    1 
ATOM   9576  N  N     . ILE A 1  1283 ? -46.549 -7.700  -22.634 1.00 71.05  ? 1283 ILE A N     1 
ATOM   9577  C  CA    . ILE A 1  1283 ? -47.256 -8.681  -21.804 1.00 72.18  ? 1283 ILE A CA    1 
ATOM   9578  C  C     . ILE A 1  1283 ? -46.688 -8.667  -20.376 1.00 74.84  ? 1283 ILE A C     1 
ATOM   9579  O  O     . ILE A 1  1283 ? -47.448 -8.709  -19.404 1.00 76.45  ? 1283 ILE A O     1 
ATOM   9580  C  CB    . ILE A 1  1283 ? -47.182 -10.109 -22.401 1.00 70.80  ? 1283 ILE A CB    1 
ATOM   9581  C  CG1   . ILE A 1  1283 ? -47.895 -10.165 -23.761 1.00 69.80  ? 1283 ILE A CG1   1 
ATOM   9582  C  CG2   . ILE A 1  1283 ? -47.823 -11.127 -21.456 1.00 71.05  ? 1283 ILE A CG2   1 
ATOM   9583  C  CD1   . ILE A 1  1283 ? -47.570 -11.387 -24.596 1.00 68.66  ? 1283 ILE A CD1   1 
ATOM   9584  N  N     . HIS A 1  1284 ? -45.358 -8.612  -20.266 1.00 76.27  ? 1284 HIS A N     1 
ATOM   9585  C  CA    . HIS A 1  1284 ? -44.655 -8.494  -18.977 1.00 78.41  ? 1284 HIS A CA    1 
ATOM   9586  C  C     . HIS A 1  1284 ? -45.159 -7.299  -18.165 1.00 79.61  ? 1284 HIS A C     1 
ATOM   9587  O  O     . HIS A 1  1284 ? -45.364 -7.417  -16.957 1.00 81.09  ? 1284 HIS A O     1 
ATOM   9588  C  CB    . HIS A 1  1284 ? -43.140 -8.365  -19.207 1.00 79.03  ? 1284 HIS A CB    1 
ATOM   9589  C  CG    . HIS A 1  1284 ? -42.314 -8.460  -17.960 1.00 80.78  ? 1284 HIS A CG    1 
ATOM   9590  N  ND1   . HIS A 1  1284 ? -42.142 -7.399  -17.096 1.00 82.61  ? 1284 HIS A ND1   1 
ATOM   9591  C  CD2   . HIS A 1  1284 ? -41.581 -9.480  -17.451 1.00 81.12  ? 1284 HIS A CD2   1 
ATOM   9592  C  CE1   . HIS A 1  1284 ? -41.356 -7.766  -16.099 1.00 83.82  ? 1284 HIS A CE1   1 
ATOM   9593  N  NE2   . HIS A 1  1284 ? -41.001 -9.024  -16.291 1.00 83.22  ? 1284 HIS A NE2   1 
ATOM   9594  N  N     . ASP A 1  1285 ? -45.353 -6.163  -18.838 1.00 79.62  ? 1285 ASP A N     1 
ATOM   9595  C  CA    . ASP A 1  1285 ? -45.897 -4.949  -18.211 1.00 80.76  ? 1285 ASP A CA    1 
ATOM   9596  C  C     . ASP A 1  1285 ? -47.324 -5.163  -17.703 1.00 80.77  ? 1285 ASP A C     1 
ATOM   9597  O  O     . ASP A 1  1285 ? -47.637 -4.840  -16.553 1.00 81.15  ? 1285 ASP A O     1 
ATOM   9598  C  CB    . ASP A 1  1285 ? -45.875 -3.780  -19.210 1.00 80.48  ? 1285 ASP A CB    1 
ATOM   9599  C  CG    . ASP A 1  1285 ? -46.288 -2.454  -18.583 1.00 81.97  ? 1285 ASP A CG    1 
ATOM   9600  O  OD1   . ASP A 1  1285 ? -45.930 -2.195  -17.413 1.00 83.70  ? 1285 ASP A OD1   1 
ATOM   9601  O  OD2   . ASP A 1  1285 ? -46.967 -1.661  -19.269 1.00 81.83  ? 1285 ASP A OD2   1 
ATOM   9602  N  N     . ALA A 1  1286 ? -48.171 -5.704  -18.577 1.00 79.91  ? 1286 ALA A N     1 
ATOM   9603  C  CA    . ALA A 1  1286 ? -49.573 -6.002  -18.263 1.00 80.21  ? 1286 ALA A CA    1 
ATOM   9604  C  C     . ALA A 1  1286 ? -49.729 -6.897  -17.029 1.00 80.89  ? 1286 ALA A C     1 
ATOM   9605  O  O     . ALA A 1  1286 ? -50.602 -6.661  -16.196 1.00 81.06  ? 1286 ALA A O     1 
ATOM   9606  C  CB    . ALA A 1  1286 ? -50.253 -6.649  -19.465 1.00 78.90  ? 1286 ALA A CB    1 
ATOM   9607  N  N     . VAL A 1  1287 ? -48.878 -7.916  -16.926 1.00 80.53  ? 1287 VAL A N     1 
ATOM   9608  C  CA    . VAL A 1  1287 ? -48.876 -8.818  -15.772 1.00 81.21  ? 1287 VAL A CA    1 
ATOM   9609  C  C     . VAL A 1  1287 ? -48.427 -8.079  -14.502 1.00 83.08  ? 1287 VAL A C     1 
ATOM   9610  O  O     . VAL A 1  1287 ? -48.988 -8.306  -13.433 1.00 84.11  ? 1287 VAL A O     1 
ATOM   9611  C  CB    . VAL A 1  1287 ? -47.996 -10.065 -16.028 1.00 80.49  ? 1287 VAL A CB    1 
ATOM   9612  C  CG1   . VAL A 1  1287 ? -47.827 -10.903 -14.765 1.00 81.41  ? 1287 VAL A CG1   1 
ATOM   9613  C  CG2   . VAL A 1  1287 ? -48.593 -10.919 -17.141 1.00 79.04  ? 1287 VAL A CG2   1 
ATOM   9614  N  N     . SER A 1  1288 ? -47.424 -7.205  -14.625 1.00 83.47  ? 1288 SER A N     1 
ATOM   9615  C  CA    . SER A 1  1288 ? -46.966 -6.375  -13.499 1.00 85.14  ? 1288 SER A CA    1 
ATOM   9616  C  C     . SER A 1  1288 ? -48.069 -5.469  -12.942 1.00 86.18  ? 1288 SER A C     1 
ATOM   9617  O  O     . SER A 1  1288 ? -48.128 -5.246  -11.732 1.00 87.42  ? 1288 SER A O     1 
ATOM   9618  C  CB    . SER A 1  1288 ? -45.762 -5.514  -13.897 1.00 85.43  ? 1288 SER A CB    1 
ATOM   9619  O  OG    . SER A 1  1288 ? -44.698 -6.310  -14.386 1.00 84.93  ? 1288 SER A OG    1 
ATOM   9620  N  N     . ALA A 1  1289 ? -48.937 -4.966  -13.824 1.00 85.04  ? 1289 ALA A N     1 
ATOM   9621  C  CA    . ALA A 1  1289 ? -50.079 -4.139  -13.418 1.00 85.38  ? 1289 ALA A CA    1 
ATOM   9622  C  C     . ALA A 1  1289 ? -51.061 -4.908  -12.530 1.00 86.03  ? 1289 ALA A C     1 
ATOM   9623  O  O     . ALA A 1  1289 ? -51.537 -4.378  -11.519 1.00 87.66  ? 1289 ALA A O     1 
ATOM   9624  C  CB    . ALA A 1  1289 ? -50.796 -3.583  -14.636 1.00 84.04  ? 1289 ALA A CB    1 
ATOM   9625  N  N     . ALA A 1  1290 ? -51.358 -6.150  -12.914 1.00 84.59  ? 1290 ALA A N     1 
ATOM   9626  C  CA    . ALA A 1  1290 ? -52.177 -7.046  -12.089 1.00 85.58  ? 1290 ALA A CA    1 
ATOM   9627  C  C     . ALA A 1  1290 ? -51.467 -7.463  -10.802 1.00 87.35  ? 1290 ALA A C     1 
ATOM   9628  O  O     . ALA A 1  1290 ? -52.120 -7.659  -9.780  1.00 89.08  ? 1290 ALA A O     1 
ATOM   9629  C  CB    . ALA A 1  1290 ? -52.594 -8.282  -12.878 1.00 84.11  ? 1290 ALA A CB    1 
ATOM   9630  N  N     . ARG A 1  1291 ? -50.143 -7.606  -10.856 1.00 87.74  ? 1291 ARG A N     1 
ATOM   9631  C  CA    . ARG A 1  1291 ? -49.348 -7.954  -9.670  1.00 89.40  ? 1291 ARG A CA    1 
ATOM   9632  C  C     . ARG A 1  1291 ? -49.226 -6.814  -8.650  1.00 91.97  ? 1291 ARG A C     1 
ATOM   9633  O  O     . ARG A 1  1291 ? -49.223 -7.079  -7.448  1.00 92.44  ? 1291 ARG A O     1 
ATOM   9634  C  CB    . ARG A 1  1291 ? -47.961 -8.486  -10.069 1.00 88.57  ? 1291 ARG A CB    1 
ATOM   9635  C  CG    . ARG A 1  1291 ? -47.998 -9.886  -10.674 1.00 86.73  ? 1291 ARG A CG    1 
ATOM   9636  C  CD    . ARG A 1  1291 ? -46.607 -10.441 -10.951 1.00 85.90  ? 1291 ARG A CD    1 
ATOM   9637  N  NE    . ARG A 1  1291 ? -45.982 -11.015 -9.756  1.00 86.80  ? 1291 ARG A NE    1 
ATOM   9638  C  CZ    . ARG A 1  1291 ? -46.295 -12.194 -9.204  1.00 86.35  ? 1291 ARG A CZ    1 
ATOM   9639  N  NH1   . ARG A 1  1291 ? -47.250 -12.970 -9.714  1.00 85.15  ? 1291 ARG A NH1   1 
ATOM   9640  N  NH2   . ARG A 1  1291 ? -45.648 -12.601 -8.117  1.00 87.47  ? 1291 ARG A NH2   1 
ATOM   9641  N  N     . GLN A 1  1292 ? -49.131 -5.564  -9.120  1.00 93.84  ? 1292 GLN A N     1 
ATOM   9642  C  CA    . GLN A 1  1292 ? -49.057 -4.392  -8.220  1.00 97.22  ? 1292 GLN A CA    1 
ATOM   9643  C  C     . GLN A 1  1292 ? -50.372 -4.149  -7.487  1.00 97.49  ? 1292 GLN A C     1 
ATOM   9644  O  O     . GLN A 1  1292 ? -50.386 -4.005  -6.265  1.00 97.92  ? 1292 GLN A O     1 
ATOM   9645  C  CB    . GLN A 1  1292 ? -48.667 -3.101  -8.969  1.00 98.65  ? 1292 GLN A CB    1 
ATOM   9646  C  CG    . GLN A 1  1292 ? -47.240 -3.015  -9.512  1.00 99.72  ? 1292 GLN A CG    1 
ATOM   9647  C  CD    . GLN A 1  1292 ? -46.181 -3.616  -8.601  1.00 101.30 ? 1292 GLN A CD    1 
ATOM   9648  O  OE1   . GLN A 1  1292 ? -45.452 -4.528  -9.001  1.00 101.14 ? 1292 GLN A OE1   1 
ATOM   9649  N  NE2   . GLN A 1  1292 ? -46.097 -3.116  -7.369  1.00 103.06 ? 1292 GLN A NE2   1 
ATOM   9650  N  N     . GLU A 1  1293 ? -51.463 -4.092  -8.247  1.00 96.55  ? 1293 GLU A N     1 
ATOM   9651  C  CA    . GLU A 1  1293 ? -52.809 -3.926  -7.695  1.00 97.15  ? 1293 GLU A CA    1 
ATOM   9652  C  C     . GLU A 1  1293 ? -53.110 -4.967  -6.615  1.00 98.35  ? 1293 GLU A C     1 
ATOM   9653  O  O     . GLU A 1  1293 ? -53.659 -4.634  -5.561  1.00 98.63  ? 1293 GLU A O     1 
ATOM   9654  C  CB    . GLU A 1  1293 ? -53.850 -4.032  -8.814  1.00 95.96  ? 1293 GLU A CB    1 
ATOM   9655  C  CG    . GLU A 1  1293 ? -55.286 -3.734  -8.396  1.00 96.99  ? 1293 GLU A CG    1 
ATOM   9656  C  CD    . GLU A 1  1293 ? -56.272 -3.887  -9.542  1.00 95.83  ? 1293 GLU A CD    1 
ATOM   9657  O  OE1   . GLU A 1  1293 ? -56.265 -4.950  -10.204 1.00 95.66  ? 1293 GLU A OE1   1 
ATOM   9658  O  OE2   . GLU A 1  1293 ? -57.057 -2.945  -9.780  1.00 95.74  ? 1293 GLU A OE2   1 
ATOM   9659  N  N     . ARG A 1  1294 ? -52.738 -6.217  -6.888  1.00 98.41  ? 1294 ARG A N     1 
ATOM   9660  C  CA    . ARG A 1  1294 ? -53.041 -7.352  -6.005  1.00 99.64  ? 1294 ARG A CA    1 
ATOM   9661  C  C     . ARG A 1  1294 ? -52.066 -7.531  -4.830  1.00 101.22 ? 1294 ARG A C     1 
ATOM   9662  O  O     . ARG A 1  1294 ? -52.330 -8.337  -3.934  1.00 100.63 ? 1294 ARG A O     1 
ATOM   9663  C  CB    . ARG A 1  1294 ? -53.129 -8.643  -6.830  1.00 98.00  ? 1294 ARG A CB    1 
ATOM   9664  C  CG    . ARG A 1  1294 ? -54.300 -8.640  -7.800  1.00 97.26  ? 1294 ARG A CG    1 
ATOM   9665  C  CD    . ARG A 1  1294 ? -54.281 -9.833  -8.738  1.00 96.59  ? 1294 ARG A CD    1 
ATOM   9666  N  NE    . ARG A 1  1294 ? -55.198 -9.678  -9.872  1.00 95.78  ? 1294 ARG A NE    1 
ATOM   9667  C  CZ    . ARG A 1  1294 ? -55.423 -10.608 -10.803 1.00 95.40  ? 1294 ARG A CZ    1 
ATOM   9668  N  NH1   . ARG A 1  1294 ? -54.803 -11.789 -10.766 1.00 94.84  ? 1294 ARG A NH1   1 
ATOM   9669  N  NH2   . ARG A 1  1294 ? -56.280 -10.358 -11.791 1.00 95.49  ? 1294 ARG A NH2   1 
ATOM   9670  N  N     . GLY A 1  1295 ? -50.953 -6.793  -4.843  1.00 102.72 ? 1295 GLY A N     1 
ATOM   9671  C  CA    . GLY A 1  1295 ? -50.001 -6.757  -3.726  1.00 105.45 ? 1295 GLY A CA    1 
ATOM   9672  C  C     . GLY A 1  1295 ? -48.958 -7.855  -3.784  1.00 106.58 ? 1295 GLY A C     1 
ATOM   9673  O  O     . GLY A 1  1295 ? -48.600 -8.430  -2.758  1.00 107.39 ? 1295 GLY A O     1 
ATOM   9674  N  N     . LEU A 1  1296 ? -48.457 -8.122  -4.988  1.00 107.71 ? 1296 LEU A N     1 
ATOM   9675  C  CA    . LEU A 1  1296 ? -47.537 -9.224  -5.244  1.00 108.72 ? 1296 LEU A CA    1 
ATOM   9676  C  C     . LEU A 1  1296 ? -46.209 -8.659  -5.735  1.00 110.39 ? 1296 LEU A C     1 
ATOM   9677  O  O     . LEU A 1  1296 ? -45.939 -8.610  -6.938  1.00 109.35 ? 1296 LEU A O     1 
ATOM   9678  C  CB    . LEU A 1  1296 ? -48.154 -10.177 -6.269  1.00 107.46 ? 1296 LEU A CB    1 
ATOM   9679  C  CG    . LEU A 1  1296 ? -49.412 -10.918 -5.791  1.00 107.42 ? 1296 LEU A CG    1 
ATOM   9680  C  CD1   . LEU A 1  1296 ? -50.299 -11.318 -6.961  1.00 105.49 ? 1296 LEU A CD1   1 
ATOM   9681  C  CD2   . LEU A 1  1296 ? -49.043 -12.131 -4.946  1.00 108.10 ? 1296 LEU A CD2   1 
ATOM   9682  N  N     . HIS A 1  1297 ? -45.386 -8.233  -4.781  1.00 114.73 ? 1297 HIS A N     1 
ATOM   9683  C  CA    . HIS A 1  1297 ? -44.109 -7.578  -5.068  1.00 117.66 ? 1297 HIS A CA    1 
ATOM   9684  C  C     . HIS A 1  1297 ? -43.006 -8.619  -5.269  1.00 119.15 ? 1297 HIS A C     1 
ATOM   9685  O  O     . HIS A 1  1297 ? -43.250 -9.826  -5.168  1.00 118.69 ? 1297 HIS A O     1 
ATOM   9686  C  CB    . HIS A 1  1297 ? -43.719 -6.633  -3.919  1.00 121.21 ? 1297 HIS A CB    1 
ATOM   9687  C  CG    . HIS A 1  1297 ? -44.802 -5.677  -3.514  1.00 123.03 ? 1297 HIS A CG    1 
ATOM   9688  N  ND1   . HIS A 1  1297 ? -45.680 -5.942  -2.484  1.00 124.22 ? 1297 HIS A ND1   1 
ATOM   9689  C  CD2   . HIS A 1  1297 ? -45.143 -4.457  -3.992  1.00 123.33 ? 1297 HIS A CD2   1 
ATOM   9690  C  CE1   . HIS A 1  1297 ? -46.517 -4.929  -2.349  1.00 124.51 ? 1297 HIS A CE1   1 
ATOM   9691  N  NE2   . HIS A 1  1297 ? -46.212 -4.014  -3.253  1.00 123.91 ? 1297 HIS A NE2   1 
ATOM   9692  N  N     . GLY A 1  1298 ? -41.800 -8.139  -5.571  1.00 121.67 ? 1298 GLY A N     1 
ATOM   9693  C  CA    . GLY A 1  1298 ? -40.588 -8.960  -5.536  1.00 123.60 ? 1298 GLY A CA    1 
ATOM   9694  C  C     . GLY A 1  1298 ? -40.256 -9.691  -6.831  1.00 123.98 ? 1298 GLY A C     1 
ATOM   9695  O  O     . GLY A 1  1298 ? -40.266 -9.072  -7.899  1.00 123.07 ? 1298 GLY A O     1 
ATOM   9696  N  N     . PRO A 1  1299 ? -39.965 -11.012 -6.751  1.00 125.86 ? 1299 PRO A N     1 
ATOM   9697  C  CA    . PRO A 1  1299 ? -39.359 -11.721 -7.887  1.00 124.37 ? 1299 PRO A CA    1 
ATOM   9698  C  C     . PRO A 1  1299 ? -40.329 -12.036 -9.040  1.00 120.62 ? 1299 PRO A C     1 
ATOM   9699  O  O     . PRO A 1  1299 ? -41.070 -13.021 -8.973  1.00 120.54 ? 1299 PRO A O     1 
ATOM   9700  C  CB    . PRO A 1  1299 ? -38.826 -13.007 -7.238  1.00 125.39 ? 1299 PRO A CB    1 
ATOM   9701  C  CG    . PRO A 1  1299 ? -39.778 -13.278 -6.121  1.00 125.95 ? 1299 PRO A CG    1 
ATOM   9702  C  CD    . PRO A 1  1299 ? -40.271 -11.939 -5.637  1.00 126.87 ? 1299 PRO A CD    1 
ATOM   9703  N  N     . LEU A 1  1300 ? -40.310 -11.198 -10.081 1.00 117.32 ? 1300 LEU A N     1 
ATOM   9704  C  CA    . LEU A 1  1300 ? -41.079 -11.435 -11.313 1.00 113.81 ? 1300 LEU A CA    1 
ATOM   9705  C  C     . LEU A 1  1300 ? -40.137 -11.752 -12.472 1.00 110.07 ? 1300 LEU A C     1 
ATOM   9706  O  O     . LEU A 1  1300 ? -39.662 -10.848 -13.168 1.00 110.85 ? 1300 LEU A O     1 
ATOM   9707  C  CB    . LEU A 1  1300 ? -41.960 -10.225 -11.660 1.00 113.60 ? 1300 LEU A CB    1 
ATOM   9708  C  CG    . LEU A 1  1300 ? -42.745 -10.259 -12.985 1.00 111.73 ? 1300 LEU A CG    1 
ATOM   9709  C  CD1   . LEU A 1  1300 ? -43.610 -11.508 -13.102 1.00 110.18 ? 1300 LEU A CD1   1 
ATOM   9710  C  CD2   . LEU A 1  1300 ? -43.583 -8.999  -13.125 1.00 112.71 ? 1300 LEU A CD2   1 
ATOM   9711  N  N     . THR A 1  1301 ? -39.862 -13.040 -12.658 1.00 105.42 ? 1301 THR A N     1 
ATOM   9712  C  CA    . THR A 1  1301 ? -39.115 -13.526 -13.822 1.00 101.07 ? 1301 THR A CA    1 
ATOM   9713  C  C     . THR A 1  1301 ? -40.040 -14.407 -14.660 1.00 94.84  ? 1301 THR A C     1 
ATOM   9714  O  O     . THR A 1  1301 ? -40.327 -15.551 -14.295 1.00 93.46  ? 1301 THR A O     1 
ATOM   9715  C  CB    . THR A 1  1301 ? -37.812 -14.279 -13.426 1.00 102.11 ? 1301 THR A CB    1 
ATOM   9716  O  OG1   . THR A 1  1301 ? -37.856 -14.663 -12.045 1.00 102.85 ? 1301 THR A OG1   1 
ATOM   9717  C  CG2   . THR A 1  1301 ? -36.587 -13.394 -13.646 1.00 102.51 ? 1301 THR A CG2   1 
ATOM   9718  N  N     . LEU A 1  1302 ? -40.538 -13.837 -15.757 1.00 89.25  ? 1302 LEU A N     1 
ATOM   9719  C  CA    . LEU A 1  1302 ? -41.301 -14.579 -16.755 1.00 84.86  ? 1302 LEU A CA    1 
ATOM   9720  C  C     . LEU A 1  1302 ? -40.343 -15.049 -17.841 1.00 81.28  ? 1302 LEU A C     1 
ATOM   9721  O  O     . LEU A 1  1302 ? -39.572 -14.254 -18.377 1.00 80.34  ? 1302 LEU A O     1 
ATOM   9722  C  CB    . LEU A 1  1302 ? -42.383 -13.694 -17.378 1.00 83.60  ? 1302 LEU A CB    1 
ATOM   9723  C  CG    . LEU A 1  1302 ? -43.441 -13.093 -16.455 1.00 84.10  ? 1302 LEU A CG    1 
ATOM   9724  C  CD1   . LEU A 1  1302 ? -44.460 -12.318 -17.276 1.00 83.21  ? 1302 LEU A CD1   1 
ATOM   9725  C  CD2   . LEU A 1  1302 ? -44.129 -14.167 -15.626 1.00 84.50  ? 1302 LEU A CD2   1 
ATOM   9726  N  N     . ASN A 1  1303 ? -40.394 -16.339 -18.156 1.00 78.30  ? 1303 ASN A N     1 
ATOM   9727  C  CA    . ASN A 1  1303 ? -39.537 -16.930 -19.182 1.00 76.03  ? 1303 ASN A CA    1 
ATOM   9728  C  C     . ASN A 1  1303 ? -40.176 -16.862 -20.563 1.00 73.27  ? 1303 ASN A C     1 
ATOM   9729  O  O     . ASN A 1  1303 ? -41.387 -16.659 -20.695 1.00 73.34  ? 1303 ASN A O     1 
ATOM   9730  C  CB    . ASN A 1  1303 ? -39.231 -18.387 -18.847 1.00 75.83  ? 1303 ASN A CB    1 
ATOM   9731  C  CG    . ASN A 1  1303 ? -38.596 -18.550 -17.481 1.00 77.48  ? 1303 ASN A CG    1 
ATOM   9732  O  OD1   . ASN A 1  1303 ? -37.506 -18.039 -17.218 1.00 77.29  ? 1303 ASN A OD1   1 
ATOM   9733  N  ND2   . ASN A 1  1303 ? -39.281 -19.267 -16.601 1.00 78.63  ? 1303 ASN A ND2   1 
ATOM   9734  N  N     . SER A 1  1304 ? -39.340 -17.032 -21.582 1.00 70.51  ? 1304 SER A N     1 
ATOM   9735  C  CA    . SER A 1  1304 ? -39.776 -17.125 -22.969 1.00 67.99  ? 1304 SER A CA    1 
ATOM   9736  C  C     . SER A 1  1304 ? -39.805 -18.610 -23.362 1.00 66.49  ? 1304 SER A C     1 
ATOM   9737  O  O     . SER A 1  1304 ? -38.917 -19.354 -22.935 1.00 66.57  ? 1304 SER A O     1 
ATOM   9738  C  CB    . SER A 1  1304 ? -38.804 -16.359 -23.857 1.00 67.83  ? 1304 SER A CB    1 
ATOM   9739  O  OG    . SER A 1  1304 ? -39.219 -16.388 -25.206 1.00 67.12  ? 1304 SER A OG    1 
ATOM   9740  N  N     . PRO A 1  1305 ? -40.786 -19.074 -24.148 1.00 63.97  ? 1305 PRO A N     1 
ATOM   9741  C  CA    . PRO A 1  1305 ? -41.893 -18.288 -24.700 1.00 63.05  ? 1305 PRO A CA    1 
ATOM   9742  C  C     . PRO A 1  1305 ? -42.971 -17.945 -23.666 1.00 63.49  ? 1305 PRO A C     1 
ATOM   9743  O  O     . PRO A 1  1305 ? -43.399 -18.816 -22.901 1.00 63.29  ? 1305 PRO A O     1 
ATOM   9744  C  CB    . PRO A 1  1305 ? -42.470 -19.231 -25.756 1.00 61.14  ? 1305 PRO A CB    1 
ATOM   9745  C  CG    . PRO A 1  1305 ? -42.248 -20.585 -25.182 1.00 61.42  ? 1305 PRO A CG    1 
ATOM   9746  C  CD    . PRO A 1  1305 ? -40.970 -20.515 -24.396 1.00 62.48  ? 1305 PRO A CD    1 
ATOM   9747  N  N     . LEU A 1  1306 ? -43.403 -16.685 -23.661 1.00 63.43  ? 1306 LEU A N     1 
ATOM   9748  C  CA    . LEU A 1  1306 ? -44.425 -16.214 -22.733 1.00 64.43  ? 1306 LEU A CA    1 
ATOM   9749  C  C     . LEU A 1  1306 ? -45.806 -16.700 -23.171 1.00 63.89  ? 1306 LEU A C     1 
ATOM   9750  O  O     . LEU A 1  1306 ? -46.576 -15.974 -23.801 1.00 62.09  ? 1306 LEU A O     1 
ATOM   9751  C  CB    . LEU A 1  1306 ? -44.367 -14.686 -22.606 1.00 64.94  ? 1306 LEU A CB    1 
ATOM   9752  C  CG    . LEU A 1  1306 ? -45.220 -13.977 -21.542 1.00 65.78  ? 1306 LEU A CG    1 
ATOM   9753  C  CD1   . LEU A 1  1306 ? -45.364 -14.793 -20.265 1.00 66.44  ? 1306 LEU A CD1   1 
ATOM   9754  C  CD2   . LEU A 1  1306 ? -44.632 -12.602 -21.238 1.00 66.57  ? 1306 LEU A CD2   1 
ATOM   9755  N  N     . THR A 1  1307 ? -46.095 -17.947 -22.806 1.00 65.40  ? 1307 THR A N     1 
ATOM   9756  C  CA    . THR A 1  1307 ? -47.306 -18.653 -23.223 1.00 66.36  ? 1307 THR A CA    1 
ATOM   9757  C  C     . THR A 1  1307 ? -48.511 -18.273 -22.350 1.00 68.57  ? 1307 THR A C     1 
ATOM   9758  O  O     . THR A 1  1307 ? -48.338 -17.687 -21.275 1.00 69.41  ? 1307 THR A O     1 
ATOM   9759  C  CB    . THR A 1  1307 ? -47.098 -20.186 -23.145 1.00 66.23  ? 1307 THR A CB    1 
ATOM   9760  O  OG1   . THR A 1  1307 ? -46.862 -20.575 -21.788 1.00 67.97  ? 1307 THR A OG1   1 
ATOM   9761  C  CG2   . THR A 1  1307 ? -45.908 -20.623 -23.995 1.00 65.41  ? 1307 THR A CG2   1 
ATOM   9762  N  N     . PRO A 1  1308 ? -49.738 -18.610 -22.802 1.00 69.70  ? 1308 PRO A N     1 
ATOM   9763  C  CA    . PRO A 1  1308 ? -50.926 -18.435 -21.950 1.00 70.84  ? 1308 PRO A CA    1 
ATOM   9764  C  C     . PRO A 1  1308 ? -50.866 -19.163 -20.598 1.00 72.40  ? 1308 PRO A C     1 
ATOM   9765  O  O     . PRO A 1  1308 ? -51.443 -18.680 -19.623 1.00 73.65  ? 1308 PRO A O     1 
ATOM   9766  C  CB    . PRO A 1  1308 ? -52.058 -19.006 -22.810 1.00 70.19  ? 1308 PRO A CB    1 
ATOM   9767  C  CG    . PRO A 1  1308 ? -51.598 -18.809 -24.210 1.00 69.04  ? 1308 PRO A CG    1 
ATOM   9768  C  CD    . PRO A 1  1308 ? -50.112 -19.019 -24.173 1.00 68.67  ? 1308 PRO A CD    1 
ATOM   9769  N  N     . GLU A 1  1309 ? -50.195 -20.314 -20.558 1.00 72.95  ? 1309 GLU A N     1 
ATOM   9770  C  CA    . GLU A 1  1309 ? -49.885 -21.005 -19.305 1.00 75.08  ? 1309 GLU A CA    1 
ATOM   9771  C  C     . GLU A 1  1309 ? -49.115 -20.085 -18.360 1.00 77.10  ? 1309 GLU A C     1 
ATOM   9772  O  O     . GLU A 1  1309 ? -49.524 -19.887 -17.212 1.00 79.14  ? 1309 GLU A O     1 
ATOM   9773  C  CB    . GLU A 1  1309 ? -49.065 -22.270 -19.589 1.00 75.25  ? 1309 GLU A CB    1 
ATOM   9774  C  CG    . GLU A 1  1309 ? -48.596 -23.052 -18.364 1.00 76.55  ? 1309 GLU A CG    1 
ATOM   9775  C  CD    . GLU A 1  1309 ? -47.824 -24.312 -18.724 1.00 76.72  ? 1309 GLU A CD    1 
ATOM   9776  O  OE1   . GLU A 1  1309 ? -47.206 -24.365 -19.809 1.00 75.70  ? 1309 GLU A OE1   1 
ATOM   9777  O  OE2   . GLU A 1  1309 ? -47.827 -25.261 -17.914 1.00 78.92  ? 1309 GLU A OE2   1 
ATOM   9778  N  N     . LYS A 1  1310 ? -48.010 -19.526 -18.852 1.00 76.68  ? 1310 LYS A N     1 
ATOM   9779  C  CA    . LYS A 1  1310 ? -47.144 -18.666 -18.034 1.00 76.94  ? 1310 LYS A CA    1 
ATOM   9780  C  C     . LYS A 1  1310 ? -47.822 -17.351 -17.643 1.00 76.84  ? 1310 LYS A C     1 
ATOM   9781  O  O     . LYS A 1  1310 ? -47.626 -16.870 -16.530 1.00 78.78  ? 1310 LYS A O     1 
ATOM   9782  C  CB    . LYS A 1  1310 ? -45.811 -18.388 -18.744 1.00 76.38  ? 1310 LYS A CB    1 
ATOM   9783  C  CG    . LYS A 1  1310 ? -44.949 -19.629 -18.945 1.00 76.18  ? 1310 LYS A CG    1 
ATOM   9784  C  CD    . LYS A 1  1310 ? -43.557 -19.275 -19.445 1.00 75.96  ? 1310 LYS A CD    1 
ATOM   9785  C  CE    . LYS A 1  1310 ? -42.772 -20.510 -19.871 1.00 75.60  ? 1310 LYS A CE    1 
ATOM   9786  N  NZ    . LYS A 1  1310 ? -43.115 -20.973 -21.248 1.00 74.20  ? 1310 LYS A NZ    1 
ATOM   9787  N  N     . ILE A 1  1311 ? -48.623 -16.788 -18.547 1.00 75.57  ? 1311 ILE A N     1 
ATOM   9788  C  CA    . ILE A 1  1311 ? -49.361 -15.544 -18.274 1.00 76.12  ? 1311 ILE A CA    1 
ATOM   9789  C  C     . ILE A 1  1311 ? -50.368 -15.722 -17.127 1.00 76.83  ? 1311 ILE A C     1 
ATOM   9790  O  O     . ILE A 1  1311 ? -50.308 -15.005 -16.133 1.00 77.52  ? 1311 ILE A O     1 
ATOM   9791  C  CB    . ILE A 1  1311 ? -50.079 -15.015 -19.548 1.00 75.13  ? 1311 ILE A CB    1 
ATOM   9792  C  CG1   . ILE A 1  1311 ? -49.049 -14.523 -20.572 1.00 74.59  ? 1311 ILE A CG1   1 
ATOM   9793  C  CG2   . ILE A 1  1311 ? -51.040 -13.874 -19.219 1.00 75.92  ? 1311 ILE A CG2   1 
ATOM   9794  C  CD1   . ILE A 1  1311 ? -49.598 -14.325 -21.970 1.00 73.36  ? 1311 ILE A CD1   1 
ATOM   9795  N  N     . ARG A 1  1312 ? -51.275 -16.684 -17.271 1.00 76.93  ? 1312 ARG A N     1 
ATOM   9796  C  CA    . ARG A 1  1312 ? -52.376 -16.872 -16.315 1.00 78.22  ? 1312 ARG A CA    1 
ATOM   9797  C  C     . ARG A 1  1312 ? -51.891 -17.213 -14.905 1.00 79.70  ? 1312 ARG A C     1 
ATOM   9798  O  O     . ARG A 1  1312 ? -52.428 -16.693 -13.922 1.00 81.48  ? 1312 ARG A O     1 
ATOM   9799  C  CB    . ARG A 1  1312 ? -53.343 -17.958 -16.805 1.00 77.94  ? 1312 ARG A CB    1 
ATOM   9800  C  CG    . ARG A 1  1312 ? -54.775 -17.808 -16.301 1.00 78.93  ? 1312 ARG A CG    1 
ATOM   9801  C  CD    . ARG A 1  1312 ? -55.048 -18.585 -15.024 1.00 80.20  ? 1312 ARG A CD    1 
ATOM   9802  N  NE    . ARG A 1  1312 ? -56.245 -18.113 -14.323 1.00 80.75  ? 1312 ARG A NE    1 
ATOM   9803  C  CZ    . ARG A 1  1312 ? -56.281 -17.159 -13.389 1.00 81.58  ? 1312 ARG A CZ    1 
ATOM   9804  N  NH1   . ARG A 1  1312 ? -55.182 -16.503 -13.005 1.00 81.68  ? 1312 ARG A NH1   1 
ATOM   9805  N  NH2   . ARG A 1  1312 ? -57.449 -16.846 -12.832 1.00 82.24  ? 1312 ARG A NH2   1 
ATOM   9806  N  N     . MET A 1  1313 ? -50.882 -18.077 -14.819 1.00 79.31  ? 1313 MET A N     1 
ATOM   9807  C  CA    . MET A 1  1313 ? -50.292 -18.472 -13.535 1.00 80.20  ? 1313 MET A CA    1 
ATOM   9808  C  C     . MET A 1  1313 ? -49.521 -17.338 -12.861 1.00 80.85  ? 1313 MET A C     1 
ATOM   9809  O  O     . MET A 1  1313 ? -49.363 -17.342 -11.638 1.00 82.60  ? 1313 MET A O     1 
ATOM   9810  C  CB    . MET A 1  1313 ? -49.378 -19.693 -13.708 1.00 80.14  ? 1313 MET A CB    1 
ATOM   9811  C  CG    . MET A 1  1313 ? -50.074 -20.967 -14.182 1.00 79.58  ? 1313 MET A CG    1 
ATOM   9812  S  SD    . MET A 1  1313 ? -51.298 -21.646 -13.037 1.00 80.93  ? 1313 MET A SD    1 
ATOM   9813  C  CE    . MET A 1  1313 ? -52.776 -20.780 -13.547 1.00 81.16  ? 1313 MET A CE    1 
ATOM   9814  N  N     . ALA A 1  1314 ? -49.039 -16.378 -13.649 1.00 80.00  ? 1314 ALA A N     1 
ATOM   9815  C  CA    . ALA A 1  1314 ? -48.427 -15.163 -13.106 1.00 81.02  ? 1314 ALA A CA    1 
ATOM   9816  C  C     . ALA A 1  1314 ? -49.464 -14.251 -12.448 1.00 82.03  ? 1314 ALA A C     1 
ATOM   9817  O  O     . ALA A 1  1314 ? -49.211 -13.698 -11.378 1.00 83.50  ? 1314 ALA A O     1 
ATOM   9818  C  CB    . ALA A 1  1314 ? -47.678 -14.412 -14.194 1.00 80.00  ? 1314 ALA A CB    1 
ATOM   9819  N  N     . CYS A 1  1315 ? -50.626 -14.099 -13.085 1.00 81.48  ? 1315 CYS A N     1 
ATOM   9820  C  CA    . CYS A 1  1315 ? -51.738 -13.322 -12.521 1.00 82.54  ? 1315 CYS A CA    1 
ATOM   9821  C  C     . CYS A 1  1315 ? -52.413 -14.095 -11.383 1.00 84.05  ? 1315 CYS A C     1 
ATOM   9822  O  O     . CYS A 1  1315 ? -53.513 -14.644 -11.547 1.00 84.39  ? 1315 CYS A O     1 
ATOM   9823  C  CB    . CYS A 1  1315 ? -52.761 -12.981 -13.606 1.00 81.16  ? 1315 CYS A CB    1 
ATOM   9824  S  SG    . CYS A 1  1315 ? -52.078 -12.027 -14.967 1.00 79.69  ? 1315 CYS A SG    1 
ATOM   9825  N  N     . GLU A 1  1316 ? -51.752 -14.121 -10.227 1.00 84.72  ? 1316 GLU A N     1 
ATOM   9826  C  CA    . GLU A 1  1316 ? -52.230 -14.892 -9.084  1.00 85.25  ? 1316 GLU A CA    1 
ATOM   9827  C  C     . GLU A 1  1316 ? -53.461 -14.225 -8.484  1.00 86.74  ? 1316 GLU A C     1 
ATOM   9828  O  O     . GLU A 1  1316 ? -53.630 -13.011 -8.591  1.00 87.81  ? 1316 GLU A O     1 
ATOM   9829  C  CB    . GLU A 1  1316 ? -51.127 -15.058 -8.040  1.00 86.01  ? 1316 GLU A CB    1 
ATOM   9830  C  CG    . GLU A 1  1316 ? -49.953 -15.886 -8.542  1.00 85.05  ? 1316 GLU A CG    1 
ATOM   9831  C  CD    . GLU A 1  1316 ? -48.853 -16.055 -7.513  1.00 86.10  ? 1316 GLU A CD    1 
ATOM   9832  O  OE1   . GLU A 1  1316 ? -48.448 -15.052 -6.895  1.00 87.80  ? 1316 GLU A OE1   1 
ATOM   9833  O  OE2   . GLU A 1  1316 ? -48.372 -17.192 -7.331  1.00 85.82  ? 1316 GLU A OE2   1 
ATOM   9834  N  N     . ASP A 1  1317 ? -54.323 -15.036 -7.880  1.00 87.39  ? 1317 ASP A N     1 
ATOM   9835  C  CA    . ASP A 1  1317 ? -55.627 -14.589 -7.375  1.00 88.04  ? 1317 ASP A CA    1 
ATOM   9836  C  C     . ASP A 1  1317 ? -56.188 -15.672 -6.448  1.00 88.93  ? 1317 ASP A C     1 
ATOM   9837  O  O     . ASP A 1  1317 ? -55.453 -16.595 -6.080  1.00 88.57  ? 1317 ASP A O     1 
ATOM   9838  C  CB    . ASP A 1  1317 ? -56.574 -14.277 -8.554  1.00 86.90  ? 1317 ASP A CB    1 
ATOM   9839  C  CG    . ASP A 1  1317 ? -56.604 -15.384 -9.616  1.00 85.44  ? 1317 ASP A CG    1 
ATOM   9840  O  OD1   . ASP A 1  1317 ? -56.365 -16.567 -9.288  1.00 84.86  ? 1317 ASP A OD1   1 
ATOM   9841  O  OD2   . ASP A 1  1317 ? -56.877 -15.058 -10.794 1.00 84.54  ? 1317 ASP A OD2   1 
ATOM   9842  N  N     . LYS A 1  1318 ? -57.463 -15.583 -6.064  1.00 89.87  ? 1318 LYS A N     1 
ATOM   9843  C  CA    . LYS A 1  1318 ? -58.075 -16.654 -5.263  1.00 91.69  ? 1318 LYS A CA    1 
ATOM   9844  C  C     . LYS A 1  1318 ? -58.125 -18.000 -5.997  1.00 90.87  ? 1318 LYS A C     1 
ATOM   9845  O  O     . LYS A 1  1318 ? -58.144 -19.039 -5.355  1.00 91.46  ? 1318 LYS A O     1 
ATOM   9846  C  CB    . LYS A 1  1318 ? -59.466 -16.263 -4.722  1.00 92.68  ? 1318 LYS A CB    1 
ATOM   9847  C  CG    . LYS A 1  1318 ? -60.588 -16.126 -5.745  1.00 91.87  ? 1318 LYS A CG    1 
ATOM   9848  C  CD    . LYS A 1  1318 ? -61.905 -15.810 -5.043  1.00 92.78  ? 1318 LYS A CD    1 
ATOM   9849  C  CE    . LYS A 1  1318 ? -62.991 -15.374 -6.014  1.00 91.97  ? 1318 LYS A CE    1 
ATOM   9850  N  NZ    . LYS A 1  1318 ? -64.176 -14.787 -5.326  1.00 93.16  ? 1318 LYS A NZ    1 
ATOM   9851  N  N     . PHE A 1  1319 ? -58.114 -17.980 -7.328  1.00 90.00  ? 1319 PHE A N     1 
ATOM   9852  C  CA    . PHE A 1  1319 ? -58.188 -19.209 -8.125  1.00 89.60  ? 1319 PHE A CA    1 
ATOM   9853  C  C     . PHE A 1  1319 ? -56.841 -19.943 -8.232  1.00 89.00  ? 1319 PHE A C     1 
ATOM   9854  O  O     . PHE A 1  1319 ? -56.815 -21.170 -8.166  1.00 88.67  ? 1319 PHE A O     1 
ATOM   9855  C  CB    . PHE A 1  1319 ? -58.801 -18.912 -9.503  1.00 88.61  ? 1319 PHE A CB    1 
ATOM   9856  C  CG    . PHE A 1  1319 ? -60.099 -18.150 -9.420  1.00 89.54  ? 1319 PHE A CG    1 
ATOM   9857  C  CD1   . PHE A 1  1319 ? -61.205 -18.712 -8.787  1.00 90.83  ? 1319 PHE A CD1   1 
ATOM   9858  C  CD2   . PHE A 1  1319 ? -60.204 -16.856 -9.926  1.00 89.59  ? 1319 PHE A CD2   1 
ATOM   9859  C  CE1   . PHE A 1  1319 ? -62.398 -18.009 -8.679  1.00 91.42  ? 1319 PHE A CE1   1 
ATOM   9860  C  CE2   . PHE A 1  1319 ? -61.397 -16.150 -9.825  1.00 90.67  ? 1319 PHE A CE2   1 
ATOM   9861  C  CZ    . PHE A 1  1319 ? -62.495 -16.728 -9.199  1.00 91.21  ? 1319 PHE A CZ    1 
ATOM   9862  N  N     . THR A 1  1320 ? -55.731 -19.213 -8.359  1.00 88.74  ? 1320 THR A N     1 
ATOM   9863  C  CA    . THR A 1  1320 ? -54.395 -19.842 -8.372  1.00 88.45  ? 1320 THR A CA    1 
ATOM   9864  C  C     . THR A 1  1320 ? -54.008 -20.413 -7.012  1.00 90.26  ? 1320 THR A C     1 
ATOM   9865  O  O     . THR A 1  1320 ? -53.437 -21.497 -6.933  1.00 90.08  ? 1320 THR A O     1 
ATOM   9866  C  CB    . THR A 1  1320 ? -53.278 -18.868 -8.794  1.00 87.95  ? 1320 THR A CB    1 
ATOM   9867  O  OG1   . THR A 1  1320 ? -53.214 -17.778 -7.868  1.00 89.21  ? 1320 THR A OG1   1 
ATOM   9868  C  CG2   . THR A 1  1320 ? -53.513 -18.346 -10.204 1.00 86.71  ? 1320 THR A CG2   1 
ATOM   9869  N  N     . LYS A 1  1321 ? -54.309 -19.672 -5.949  1.00 92.36  ? 1321 LYS A N     1 
ATOM   9870  C  CA    . LYS A 1  1321 ? -54.052 -20.138 -4.583  1.00 94.71  ? 1321 LYS A CA    1 
ATOM   9871  C  C     . LYS A 1  1321 ? -54.944 -21.323 -4.200  1.00 94.39  ? 1321 LYS A C     1 
ATOM   9872  O  O     . LYS A 1  1321 ? -54.543 -22.163 -3.397  1.00 94.79  ? 1321 LYS A O     1 
ATOM   9873  C  CB    . LYS A 1  1321 ? -54.228 -18.997 -3.572  1.00 97.45  ? 1321 LYS A CB    1 
ATOM   9874  C  CG    . LYS A 1  1321 ? -53.279 -17.824 -3.796  1.00 98.51  ? 1321 LYS A CG    1 
ATOM   9875  C  CD    . LYS A 1  1321 ? -53.094 -16.986 -2.539  1.00 101.79 ? 1321 LYS A CD    1 
ATOM   9876  C  CE    . LYS A 1  1321 ? -52.689 -15.552 -2.868  1.00 102.58 ? 1321 LYS A CE    1 
ATOM   9877  N  NZ    . LYS A 1  1321 ? -53.864 -14.682 -3.182  1.00 102.57 ? 1321 LYS A NZ    1 
ATOM   9878  N  N     . MET A 1  1322 ? -56.135 -21.395 -4.792  1.00 93.61  ? 1322 MET A N     1 
ATOM   9879  C  CA    . MET A 1  1322 ? -57.121 -22.436 -4.480  1.00 94.35  ? 1322 MET A CA    1 
ATOM   9880  C  C     . MET A 1  1322 ? -56.823 -23.831 -5.037  1.00 93.47  ? 1322 MET A C     1 
ATOM   9881  O  O     . MET A 1  1322 ? -57.168 -24.815 -4.384  1.00 94.56  ? 1322 MET A O     1 
ATOM   9882  C  CB    . MET A 1  1322 ? -58.496 -21.984 -4.975  1.00 94.46  ? 1322 MET A CB    1 
ATOM   9883  C  CG    . MET A 1  1322 ? -59.679 -22.860 -4.617  1.00 95.52  ? 1322 MET A CG    1 
ATOM   9884  S  SD    . MET A 1  1322 ? -61.161 -22.075 -5.278  1.00 95.75  ? 1322 MET A SD    1 
ATOM   9885  C  CE    . MET A 1  1322 ? -62.373 -22.482 -4.032  1.00 98.32  ? 1322 MET A CE    1 
ATOM   9886  N  N     . ILE A 1  1323 ? -56.214 -23.930 -6.225  1.00 91.58  ? 1323 ILE A N     1 
ATOM   9887  C  CA    . ILE A 1  1323 ? -56.088 -25.233 -6.917  1.00 90.63  ? 1323 ILE A CA    1 
ATOM   9888  C  C     . ILE A 1  1323 ? -55.358 -26.315 -6.102  1.00 92.32  ? 1323 ILE A C     1 
ATOM   9889  O  O     . ILE A 1  1323 ? -54.522 -25.985 -5.253  1.00 92.88  ? 1323 ILE A O     1 
ATOM   9890  C  CB    . ILE A 1  1323 ? -55.397 -25.143 -8.311  1.00 88.44  ? 1323 ILE A CB    1 
ATOM   9891  C  CG1   . ILE A 1  1323 ? -53.992 -24.524 -8.228  1.00 88.11  ? 1323 ILE A CG1   1 
ATOM   9892  C  CG2   . ILE A 1  1323 ? -56.263 -24.381 -9.304  1.00 87.22  ? 1323 ILE A CG2   1 
ATOM   9893  C  CD1   . ILE A 1  1323 ? -53.043 -25.056 -9.277  1.00 86.36  ? 1323 ILE A CD1   1 
ATOM   9894  N  N     . PRO A 1  1324 ? -55.677 -27.607 -6.355  1.00 93.19  ? 1324 PRO A N     1 
ATOM   9895  C  CA    . PRO A 1  1324 ? -54.879 -28.697 -5.785  1.00 94.65  ? 1324 PRO A CA    1 
ATOM   9896  C  C     . PRO A 1  1324 ? -53.470 -28.724 -6.365  1.00 94.34  ? 1324 PRO A C     1 
ATOM   9897  O  O     . PRO A 1  1324 ? -53.294 -28.388 -7.535  1.00 93.46  ? 1324 PRO A O     1 
ATOM   9898  C  CB    . PRO A 1  1324 ? -55.640 -29.964 -6.204  1.00 94.44  ? 1324 PRO A CB    1 
ATOM   9899  C  CG    . PRO A 1  1324 ? -57.011 -29.512 -6.543  1.00 94.10  ? 1324 PRO A CG    1 
ATOM   9900  C  CD    . PRO A 1  1324 ? -56.857 -28.123 -7.076  1.00 93.06  ? 1324 PRO A CD    1 
ATOM   9901  N  N     . ARG A 1  1325 ? -52.489 -29.106 -5.549  1.00 96.20  ? 1325 ARG A N     1 
ATOM   9902  C  CA    . ARG A 1  1325 ? -51.096 -29.216 -5.987  1.00 96.25  ? 1325 ARG A CA    1 
ATOM   9903  C  C     . ARG A 1  1325 ? -50.470 -30.518 -5.501  1.00 98.15  ? 1325 ARG A C     1 
ATOM   9904  O  O     . ARG A 1  1325 ? -50.765 -30.991 -4.401  1.00 100.02 ? 1325 ARG A O     1 
ATOM   9905  C  CB    . ARG A 1  1325 ? -50.272 -28.026 -5.492  1.00 96.60  ? 1325 ARG A CB    1 
ATOM   9906  C  CG    . ARG A 1  1325 ? -50.847 -26.670 -5.874  1.00 95.80  ? 1325 ARG A CG    1 
ATOM   9907  C  CD    . ARG A 1  1325 ? -49.778 -25.707 -6.348  1.00 95.45  ? 1325 ARG A CD    1 
ATOM   9908  N  NE    . ARG A 1  1325 ? -50.350 -24.388 -6.620  1.00 95.85  ? 1325 ARG A NE    1 
ATOM   9909  C  CZ    . ARG A 1  1325 ? -49.846 -23.476 -7.457  1.00 95.12  ? 1325 ARG A CZ    1 
ATOM   9910  N  NH1   . ARG A 1  1325 ? -48.730 -23.704 -8.156  1.00 94.32  ? 1325 ARG A NH1   1 
ATOM   9911  N  NH2   . ARG A 1  1325 ? -50.479 -22.313 -7.607  1.00 94.52  ? 1325 ARG A NH2   1 
ATOM   9912  N  N     . ASP A 1  1326 ? -49.598 -31.080 -6.334  1.00 98.42  ? 1326 ASP A N     1 
ATOM   9913  C  CA    . ASP A 1  1326 ? -48.936 -32.354 -6.066  1.00 100.02 ? 1326 ASP A CA    1 
ATOM   9914  C  C     . ASP A 1  1326 ? -47.522 -32.088 -5.554  1.00 102.21 ? 1326 ASP A C     1 
ATOM   9915  O  O     . ASP A 1  1326 ? -46.986 -30.989 -5.747  1.00 101.72 ? 1326 ASP A O     1 
ATOM   9916  C  CB    . ASP A 1  1326 ? -48.878 -33.183 -7.353  1.00 98.50  ? 1326 ASP A CB    1 
ATOM   9917  C  CG    . ASP A 1  1326 ? -50.228 -33.280 -8.060  1.00 97.31  ? 1326 ASP A CG    1 
ATOM   9918  O  OD1   . ASP A 1  1326 ? -51.201 -33.728 -7.418  1.00 97.94  ? 1326 ASP A OD1   1 
ATOM   9919  O  OD2   . ASP A 1  1326 ? -50.318 -32.911 -9.255  1.00 95.17  ? 1326 ASP A OD2   1 
ATOM   9920  N  N     . GLU A 1  1327 ? -46.915 -33.096 -4.922  1.00 104.81 ? 1327 GLU A N     1 
ATOM   9921  C  CA    . GLU A 1  1327 ? -45.529 -32.990 -4.431  1.00 106.27 ? 1327 GLU A CA    1 
ATOM   9922  C  C     . GLU A 1  1327 ? -44.588 -33.095 -5.634  1.00 104.47 ? 1327 GLU A C     1 
ATOM   9923  O  O     . GLU A 1  1327 ? -44.818 -33.944 -6.497  1.00 103.05 ? 1327 GLU A O     1 
ATOM   9924  C  CB    . GLU A 1  1327 ? -45.172 -34.093 -3.430  1.00 108.68 ? 1327 GLU A CB    1 
ATOM   9925  C  CG    . GLU A 1  1327 ? -46.058 -34.174 -2.198  1.00 111.00 ? 1327 GLU A CG    1 
ATOM   9926  C  CD    . GLU A 1  1327 ? -47.253 -35.086 -2.404  1.00 111.29 ? 1327 GLU A CD    1 
ATOM   9927  O  OE1   . GLU A 1  1327 ? -48.234 -34.645 -3.045  1.00 109.91 ? 1327 GLU A OE1   1 
ATOM   9928  O  OE2   . GLU A 1  1327 ? -47.200 -36.246 -1.942  1.00 112.18 ? 1327 GLU A OE2   1 
ATOM   9929  N  N     . PRO A 1  1328 ? -43.533 -32.250 -5.694  1.00 104.46 ? 1328 PRO A N     1 
ATOM   9930  C  CA    . PRO A 1  1328 ? -42.647 -32.162 -6.874  1.00 103.18 ? 1328 PRO A CA    1 
ATOM   9931  C  C     . PRO A 1  1328 ? -42.186 -33.494 -7.506  1.00 102.57 ? 1328 PRO A C     1 
ATOM   9932  O  O     . PRO A 1  1328 ? -42.261 -33.642 -8.731  1.00 101.78 ? 1328 PRO A O     1 
ATOM   9933  C  CB    . PRO A 1  1328 ? -41.445 -31.380 -6.342  1.00 104.17 ? 1328 PRO A CB    1 
ATOM   9934  C  CG    . PRO A 1  1328 ? -42.021 -30.495 -5.292  1.00 105.14 ? 1328 PRO A CG    1 
ATOM   9935  C  CD    . PRO A 1  1328 ? -43.147 -31.263 -4.661  1.00 105.70 ? 1328 PRO A CD    1 
ATOM   9936  N  N     . GLY A 1  1329 ? -41.736 -34.441 -6.681  1.00 102.71 ? 1329 GLY A N     1 
ATOM   9937  C  CA    . GLY A 1  1329 ? -41.207 -35.728 -7.162  1.00 101.29 ? 1329 GLY A CA    1 
ATOM   9938  C  C     . GLY A 1  1329 ? -42.124 -36.943 -7.068  1.00 100.76 ? 1329 GLY A C     1 
ATOM   9939  O  O     . GLY A 1  1329 ? -41.692 -38.056 -7.377  1.00 100.21 ? 1329 GLY A O     1 
ATOM   9940  N  N     . SER A 1  1330 ? -43.379 -36.745 -6.656  1.00 100.38 ? 1330 SER A N     1 
ATOM   9941  C  CA    . SER A 1  1330 ? -44.334 -37.856 -6.454  1.00 100.06 ? 1330 SER A CA    1 
ATOM   9942  C  C     . SER A 1  1330 ? -44.881 -38.477 -7.751  1.00 98.28  ? 1330 SER A C     1 
ATOM   9943  O  O     . SER A 1  1330 ? -45.375 -39.609 -7.733  1.00 98.15  ? 1330 SER A O     1 
ATOM   9944  C  CB    . SER A 1  1330 ? -45.508 -37.393 -5.585  1.00 100.32 ? 1330 SER A CB    1 
ATOM   9945  O  OG    . SER A 1  1330 ? -46.164 -36.278 -6.162  1.00 98.22  ? 1330 SER A OG    1 
ATOM   9946  N  N     . TYR A 1  1331 ? -44.795 -37.730 -8.855  1.00 95.78  ? 1331 TYR A N     1 
ATOM   9947  C  CA    . TYR A 1  1331 ? -45.301 -38.153 -10.164 1.00 93.32  ? 1331 TYR A CA    1 
ATOM   9948  C  C     . TYR A 1  1331 ? -44.249 -37.879 -11.233 1.00 90.92  ? 1331 TYR A C     1 
ATOM   9949  O  O     . TYR A 1  1331 ? -43.359 -37.050 -11.033 1.00 90.06  ? 1331 TYR A O     1 
ATOM   9950  C  CB    . TYR A 1  1331 ? -46.585 -37.381 -10.512 1.00 92.41  ? 1331 TYR A CB    1 
ATOM   9951  C  CG    . TYR A 1  1331 ? -46.372 -35.885 -10.684 1.00 91.70  ? 1331 TYR A CG    1 
ATOM   9952  C  CD1   . TYR A 1  1331 ? -46.359 -35.029 -9.581  1.00 92.84  ? 1331 TYR A CD1   1 
ATOM   9953  C  CD2   . TYR A 1  1331 ? -46.162 -35.327 -11.946 1.00 89.74  ? 1331 TYR A CD2   1 
ATOM   9954  C  CE1   . TYR A 1  1331 ? -46.150 -33.662 -9.733  1.00 91.94  ? 1331 TYR A CE1   1 
ATOM   9955  C  CE2   . TYR A 1  1331 ? -45.956 -33.964 -12.105 1.00 88.96  ? 1331 TYR A CE2   1 
ATOM   9956  C  CZ    . TYR A 1  1331 ? -45.951 -33.137 -10.997 1.00 89.90  ? 1331 TYR A CZ    1 
ATOM   9957  O  OH    . TYR A 1  1331 ? -45.747 -31.789 -11.152 1.00 89.04  ? 1331 TYR A OH    1 
ATOM   9958  N  N     . VAL A 1  1332 ? -44.377 -38.563 -12.367 1.00 89.35  ? 1332 VAL A N     1 
ATOM   9959  C  CA    . VAL A 1  1332 ? -43.553 -38.274 -13.551 1.00 88.16  ? 1332 VAL A CA    1 
ATOM   9960  C  C     . VAL A 1  1332 ? -44.376 -37.360 -14.491 1.00 86.30  ? 1332 VAL A C     1 
ATOM   9961  O  O     . VAL A 1  1332 ? -45.449 -37.752 -14.947 1.00 84.87  ? 1332 VAL A O     1 
ATOM   9962  C  CB    . VAL A 1  1332 ? -43.000 -39.561 -14.245 1.00 88.07  ? 1332 VAL A CB    1 
ATOM   9963  C  CG1   . VAL A 1  1332 ? -44.083 -40.589 -14.574 1.00 88.50  ? 1332 VAL A CG1   1 
ATOM   9964  C  CG2   . VAL A 1  1332 ? -42.198 -39.207 -15.496 1.00 86.12  ? 1332 VAL A CG2   1 
ATOM   9965  N  N     . PRO A 1  1333 ? -43.894 -36.125 -14.756 1.00 85.86  ? 1333 PRO A N     1 
ATOM   9966  C  CA    . PRO A 1  1333 ? -44.690 -35.187 -15.557 1.00 85.31  ? 1333 PRO A CA    1 
ATOM   9967  C  C     . PRO A 1  1333 ? -44.767 -35.557 -17.038 1.00 84.76  ? 1333 PRO A C     1 
ATOM   9968  O  O     . PRO A 1  1333 ? -43.959 -36.346 -17.526 1.00 84.31  ? 1333 PRO A O     1 
ATOM   9969  C  CB    . PRO A 1  1333 ? -43.942 -33.860 -15.384 1.00 84.84  ? 1333 PRO A CB    1 
ATOM   9970  C  CG    . PRO A 1  1333 ? -42.530 -34.257 -15.157 1.00 85.04  ? 1333 PRO A CG    1 
ATOM   9971  C  CD    . PRO A 1  1333 ? -42.587 -35.546 -14.388 1.00 86.38  ? 1333 PRO A CD    1 
ATOM   9972  N  N     . TRP A 1  1334 ? -45.746 -34.988 -17.733 1.00 85.75  ? 1334 TRP A N     1 
ATOM   9973  C  CA    . TRP A 1  1334 ? -45.866 -35.141 -19.186 1.00 85.87  ? 1334 TRP A CA    1 
ATOM   9974  C  C     . TRP A 1  1334 ? -44.777 -34.347 -19.924 1.00 86.65  ? 1334 TRP A C     1 
ATOM   9975  O  O     . TRP A 1  1334 ? -44.342 -34.763 -20.997 1.00 85.36  ? 1334 TRP A O     1 
ATOM   9976  C  CB    . TRP A 1  1334 ? -47.266 -34.708 -19.645 1.00 85.46  ? 1334 TRP A CB    1 
ATOM   9977  C  CG    . TRP A 1  1334 ? -47.542 -34.864 -21.127 1.00 84.52  ? 1334 TRP A CG    1 
ATOM   9978  C  CD1   . TRP A 1  1334 ? -47.536 -33.873 -22.074 1.00 82.96  ? 1334 TRP A CD1   1 
ATOM   9979  C  CD2   . TRP A 1  1334 ? -47.881 -36.073 -21.819 1.00 83.38  ? 1334 TRP A CD2   1 
ATOM   9980  N  NE1   . TRP A 1  1334 ? -47.843 -34.392 -23.308 1.00 81.00  ? 1334 TRP A NE1   1 
ATOM   9981  C  CE2   . TRP A 1  1334 ? -48.055 -35.740 -23.183 1.00 81.09  ? 1334 TRP A CE2   1 
ATOM   9982  C  CE3   . TRP A 1  1334 ? -48.050 -37.407 -21.423 1.00 84.03  ? 1334 TRP A CE3   1 
ATOM   9983  C  CZ2   . TRP A 1  1334 ? -48.401 -36.689 -24.150 1.00 80.01  ? 1334 TRP A CZ2   1 
ATOM   9984  C  CZ3   . TRP A 1  1334 ? -48.387 -38.355 -22.392 1.00 83.30  ? 1334 TRP A CZ3   1 
ATOM   9985  C  CH2   . TRP A 1  1334 ? -48.557 -37.986 -23.740 1.00 80.88  ? 1334 TRP A CH2   1 
ATOM   9986  N  N     . ASN A 1  1335 ? -44.340 -33.226 -19.334 1.00 89.78  ? 1335 ASN A N     1 
ATOM   9987  C  CA    . ASN A 1  1335 ? -43.363 -32.299 -19.938 1.00 90.42  ? 1335 ASN A CA    1 
ATOM   9988  C  C     . ASN A 1  1335 ? -42.197 -31.928 -18.993 1.00 92.64  ? 1335 ASN A C     1 
ATOM   9989  O  O     . ASN A 1  1335 ? -42.158 -32.386 -17.852 1.00 95.61  ? 1335 ASN A O     1 
ATOM   9990  C  CB    . ASN A 1  1335 ? -44.100 -31.028 -20.395 1.00 89.65  ? 1335 ASN A CB    1 
ATOM   9991  C  CG    . ASN A 1  1335 ? -45.085 -31.291 -21.523 1.00 88.81  ? 1335 ASN A CG    1 
ATOM   9992  O  OD1   . ASN A 1  1335 ? -44.871 -32.166 -22.352 1.00 88.08  ? 1335 ASN A OD1   1 
ATOM   9993  N  ND2   . ASN A 1  1335 ? -46.166 -30.522 -21.566 1.00 89.52  ? 1335 ASN A ND2   1 
ATOM   9994  N  N     . VAL A 1  1336 ? -41.258 -31.117 -19.494 1.00 93.26  ? 1336 VAL A N     1 
ATOM   9995  C  CA    . VAL A 1  1336 ? -40.061 -30.624 -18.762 1.00 94.77  ? 1336 VAL A CA    1 
ATOM   9996  C  C     . VAL A 1  1336 ? -39.215 -31.747 -18.160 1.00 95.78  ? 1336 VAL A C     1 
ATOM   9997  O  O     . VAL A 1  1336 ? -38.834 -32.684 -18.860 1.00 95.40  ? 1336 VAL A O     1 
ATOM   9998  C  CB    . VAL A 1  1336 ? -40.389 -29.506 -17.712 1.00 96.13  ? 1336 VAL A CB    1 
ATOM   9999  C  CG1   . VAL A 1  1336 ? -40.617 -30.044 -16.295 1.00 97.47  ? 1336 VAL A CG1   1 
ATOM   10000 C  CG2   . VAL A 1  1336 ? -39.275 -28.463 -17.682 1.00 96.08  ? 1336 VAL A CG2   1 
HETATM 10001 FE FE1   . FES B 2  .    ? -46.078 -17.593 -47.380 1.00 52.71  ? 3001 FES A FE1   1 
HETATM 10002 FE FE2   . FES B 2  .    ? -43.100 -18.216 -47.517 1.00 49.26  ? 3001 FES A FE2   1 
HETATM 10003 S  S1    . FES B 2  .    ? -44.425 -16.836 -48.664 1.00 49.85  ? 3001 FES A S1    1 
HETATM 10004 S  S2    . FES B 2  .    ? -44.818 -19.213 -46.534 1.00 47.52  ? 3001 FES A S2    1 
HETATM 10005 FE FE1   . FES C 2  .    ? -50.974 -28.391 -44.485 1.00 89.32  ? 3002 FES A FE1   1 
HETATM 10006 FE FE2   . FES C 2  .    ? -52.935 -30.169 -46.026 1.00 90.62  ? 3002 FES A FE2   1 
HETATM 10007 S  S1    . FES C 2  .    ? -53.186 -28.333 -44.767 1.00 90.58  ? 3002 FES A S1    1 
HETATM 10008 S  S2    . FES C 2  .    ? -50.796 -29.597 -46.359 1.00 92.65  ? 3002 FES A S2    1 
HETATM 10009 N  N1    . MTE D 3  .    ? -36.960 -14.480 -45.924 1.00 81.39  ? 3003 MTE A N1    1 
HETATM 10010 C  C2    . MTE D 3  .    ? -37.673 -15.521 -46.439 1.00 80.46  ? 3003 MTE A C2    1 
HETATM 10011 N  N2    . MTE D 3  .    ? -38.838 -15.236 -47.072 1.00 79.07  ? 3003 MTE A N2    1 
HETATM 10012 N  N3    . MTE D 3  .    ? -37.259 -16.810 -46.341 1.00 82.13  ? 3003 MTE A N3    1 
HETATM 10013 C  C4    . MTE D 3  .    ? -36.106 -17.149 -45.722 1.00 82.75  ? 3003 MTE A C4    1 
HETATM 10014 O  O4    . MTE D 3  .    ? -35.736 -18.341 -45.636 1.00 81.21  ? 3003 MTE A O4    1 
HETATM 10015 N  N5    . MTE D 3  .    ? -34.131 -16.304 -44.458 1.00 83.57  ? 3003 MTE A N5    1 
HETATM 10016 C  C6    . MTE D 3  .    ? -33.574 -15.248 -43.624 1.00 85.07  ? 3003 MTE A C6    1 
HETATM 10017 C  C7    . MTE D 3  .    ? -33.698 -13.888 -44.305 1.00 86.11  ? 3003 MTE A C7    1 
HETATM 10018 N  N8    . MTE D 3  .    ? -35.052 -13.664 -44.788 1.00 84.14  ? 3003 MTE A N8    1 
HETATM 10019 C  C9    . MTE D 3  .    ? -35.271 -16.069 -45.146 1.00 82.95  ? 3003 MTE A C9    1 
HETATM 10020 C  C10   . MTE D 3  .    ? -35.790 -14.686 -45.272 1.00 83.10  ? 3003 MTE A C10   1 
HETATM 10021 C  "C1'" . MTE D 3  .    ? -32.145 -15.501 -43.241 1.00 85.66  ? 3003 MTE A "C1'" 1 
HETATM 10022 S  "S1'" . MTE D 3  .    ? -31.795 -16.460 -41.844 1.00 86.93  ? 3003 MTE A "S1'" 1 
HETATM 10023 C  "C2'" . MTE D 3  .    ? -31.146 -14.800 -43.789 1.00 87.22  ? 3003 MTE A "C2'" 1 
HETATM 10024 S  "S2'" . MTE D 3  .    ? -29.581 -14.986 -43.184 1.00 88.38  ? 3003