data_4UIS
# 
_entry.id   4UIS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4UIS         
PDBE  EBI-63530    
WWPDB D_1290063530 
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.db_id          EMD-2974 
_pdbx_database_related.content_type   'associated EM volume' 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4UIS 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2015-04-03 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Sun, L.'  1  
'Zhao, L.' 2  
'Yang, G.' 3  
'Yan, C.'  4  
'Zhou, R.' 5  
'Zhou, X.' 6  
'Xie, T.'  7  
'Zhao, Y.' 8  
'Wu, S.'   9  
'Li, X.'   10 
'Shi, Y.'  11 
# 
_citation.id                        primary 
_citation.title                     'Structural Basis of Human Gamma-Secretase Assembly.' 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_volume            112 
_citation.page_first                6003 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           PNASA6 
_citation.country                   US 
_citation.journal_id_ISSN           0027-8424 
_citation.journal_id_CSD            0040 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25918421 
_citation.pdbx_database_id_DOI      10.1073/PNAS.1506242112 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sun, L.'  1  
primary 'Zhao, L.' 2  
primary 'Yang, G.' 3  
primary 'Yan, C.'  4  
primary 'Zhou, R.' 5  
primary 'Zhou, X.' 6  
primary 'Xie, T.'  7  
primary 'Zhao, Y.' 8  
primary 'Wu, S.'   9  
primary 'Li, X.'   10 
primary 'Shi, Y.'  11 
# 
_cell.entry_id           4UIS 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4UIS 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man GAMMA-SECRETASE 63331.977 1 ?        ? ? ? 
2 polymer man GAMMA-SECRETASE 23547.639 1 ?        ? ? ? 
3 polymer man GAMMA-SECRETASE 16698.539 1 ?        ? ? ? 
4 polymer man GAMMA-SECRETASE 5294.518  1 ?        ? ? ? 
5 polymer man LYSOZYME        18435.207 1 3.2.1.17 ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGL
AVSLTKPSPASGFSPSVQCPNDGFGVYHCREIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTF
PLCAMQLFSHMHAVISTATCMRRSSIAAVCDPLSDYNVWSMLKPIADDVVVAATRLDSRSFAWNVAPGAESAVASFVTQL
AAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVQKN
ESVRNQVEDLGAGVPAVILRSGVPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLAPEEDL
NFVTDTAKALADVATVLGRALYELAGGDTVQADPQTVTRLLYGFLIKLRQDLRSYLGDGPLQHYIAVSSPTNTTYVVQYA
LANLTGTVV(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)TARLARALSPAQWSSTEYSTWTESRWKAIRARIFLIAS
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
;IPLNKTAPCVRLLNATHQIGCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAGL
AVSLTKPSPASGFSPSVQCPNDGFGVYHCREIQWNSLGNGLAYEDFSFPIFLLEDENETKVIKQCYQDHNLSQNGSAPTF
PLCAMQLFSHMHAVISTATCMRRSSIAAVCDPLSDYNVWSMLKPIADDVVVAATRLDSRSFAWNVAPGAESAVASFVTQL
AAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVDSFVELGQVALRTSLELWMHTDPVQKN
ESVRNQVEDLGAGVPAVILRSGVPLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLAPEEDL
NFVTDTAKALADVATVLGRALYELAGGDTVQADPQTVTRLLYGFLIKLRQDLRSYLGDGPLQHYIAVSSPTNTTYVVQYA
LANLTGTVVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTARLARALSPAQWSSTEYSTWTESRWKAIRARI
FLIASXXXXXXXXXXXXXXXXXXXXXXX
;
A ? 
2 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)HVIMLFVPVTLCMVVVVATI
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)LLLFFFSFIYLGEVFKTY(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)LIWNFG(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)RLQQAYLIMISALM(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)D
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)D(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)WNTTIACFVAILIGLCLTLL(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)GLVFYFATDYLVQPFADQLA
FH(UNK)(UNK)
;
;XXXXXXXXXXXXHVIMLFVPVTLCMVVVVATIXXXXXXXXXXXXXXXXXXXXXXXXXXXLLLFFFSFIYLGEVFKTYXXX
XXXXXXXLIWNFGXXXXXXXXXXXXXRLQQAYLIMISALMXXXXXXXXXXXXXXXXXXXXDXXXXXXXXXXXXXXXXXXX
XDXXXXXXXXXXXXXXXXXXWNTTIACFVAILIGLCLTLLXXXXXXXXXXXXXXXXXGLVFYFATDYLVQPFADQLAFHX
X
;
B ? 
3 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)
;
;XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
;
C ? 
4 'polypeptide(L)' no no 
;(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)(UNK)
;
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX D ? 
5 'polypeptide(L)' no no 
;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YK
;
;MNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILR
NAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWDA
YK
;
G ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   PRO n 
1 3   LEU n 
1 4   ASN n 
1 5   LYS n 
1 6   THR n 
1 7   ALA n 
1 8   PRO n 
1 9   CYS n 
1 10  VAL n 
1 11  ARG n 
1 12  LEU n 
1 13  LEU n 
1 14  ASN n 
1 15  ALA n 
1 16  THR n 
1 17  HIS n 
1 18  GLN n 
1 19  ILE n 
1 20  GLY n 
1 21  CYS n 
1 22  GLN n 
1 23  SER n 
1 24  SER n 
1 25  ILE n 
1 26  SER n 
1 27  GLY n 
1 28  ASP n 
1 29  THR n 
1 30  GLY n 
1 31  VAL n 
1 32  ILE n 
1 33  HIS n 
1 34  VAL n 
1 35  VAL n 
1 36  GLU n 
1 37  LYS n 
1 38  GLU n 
1 39  GLU n 
1 40  ASP n 
1 41  LEU n 
1 42  GLN n 
1 43  TRP n 
1 44  VAL n 
1 45  LEU n 
1 46  THR n 
1 47  ASP n 
1 48  GLY n 
1 49  PRO n 
1 50  ASN n 
1 51  PRO n 
1 52  PRO n 
1 53  TYR n 
1 54  MET n 
1 55  VAL n 
1 56  LEU n 
1 57  LEU n 
1 58  GLU n 
1 59  SER n 
1 60  LYS n 
1 61  HIS n 
1 62  PHE n 
1 63  THR n 
1 64  ARG n 
1 65  ASP n 
1 66  LEU n 
1 67  MET n 
1 68  GLU n 
1 69  LYS n 
1 70  LEU n 
1 71  LYS n 
1 72  GLY n 
1 73  ARG n 
1 74  THR n 
1 75  SER n 
1 76  ARG n 
1 77  ILE n 
1 78  ALA n 
1 79  GLY n 
1 80  LEU n 
1 81  ALA n 
1 82  VAL n 
1 83  SER n 
1 84  LEU n 
1 85  THR n 
1 86  LYS n 
1 87  PRO n 
1 88  SER n 
1 89  PRO n 
1 90  ALA n 
1 91  SER n 
1 92  GLY n 
1 93  PHE n 
1 94  SER n 
1 95  PRO n 
1 96  SER n 
1 97  VAL n 
1 98  GLN n 
1 99  CYS n 
1 100 PRO n 
1 101 ASN n 
1 102 ASP n 
1 103 GLY n 
1 104 PHE n 
1 105 GLY n 
1 106 VAL n 
1 107 TYR n 
1 108 HIS n 
1 109 CYS n 
1 110 ARG n 
1 111 GLU n 
1 112 ILE n 
1 113 GLN n 
1 114 TRP n 
1 115 ASN n 
1 116 SER n 
1 117 LEU n 
1 118 GLY n 
1 119 ASN n 
1 120 GLY n 
1 121 LEU n 
1 122 ALA n 
1 123 TYR n 
1 124 GLU n 
1 125 ASP n 
1 126 PHE n 
1 127 SER n 
1 128 PHE n 
1 129 PRO n 
1 130 ILE n 
1 131 PHE n 
1 132 LEU n 
1 133 LEU n 
1 134 GLU n 
1 135 ASP n 
1 136 GLU n 
1 137 ASN n 
1 138 GLU n 
1 139 THR n 
1 140 LYS n 
1 141 VAL n 
1 142 ILE n 
1 143 LYS n 
1 144 GLN n 
1 145 CYS n 
1 146 TYR n 
1 147 GLN n 
1 148 ASP n 
1 149 HIS n 
1 150 ASN n 
1 151 LEU n 
1 152 SER n 
1 153 GLN n 
1 154 ASN n 
1 155 GLY n 
1 156 SER n 
1 157 ALA n 
1 158 PRO n 
1 159 THR n 
1 160 PHE n 
1 161 PRO n 
1 162 LEU n 
1 163 CYS n 
1 164 ALA n 
1 165 MET n 
1 166 GLN n 
1 167 LEU n 
1 168 PHE n 
1 169 SER n 
1 170 HIS n 
1 171 MET n 
1 172 HIS n 
1 173 ALA n 
1 174 VAL n 
1 175 ILE n 
1 176 SER n 
1 177 THR n 
1 178 ALA n 
1 179 THR n 
1 180 CYS n 
1 181 MET n 
1 182 ARG n 
1 183 ARG n 
1 184 SER n 
1 185 SER n 
1 186 ILE n 
1 187 ALA n 
1 188 ALA n 
1 189 VAL n 
1 190 CYS n 
1 191 ASP n 
1 192 PRO n 
1 193 LEU n 
1 194 SER n 
1 195 ASP n 
1 196 TYR n 
1 197 ASN n 
1 198 VAL n 
1 199 TRP n 
1 200 SER n 
1 201 MET n 
1 202 LEU n 
1 203 LYS n 
1 204 PRO n 
1 205 ILE n 
1 206 ALA n 
1 207 ASP n 
1 208 ASP n 
1 209 VAL n 
1 210 VAL n 
1 211 VAL n 
1 212 ALA n 
1 213 ALA n 
1 214 THR n 
1 215 ARG n 
1 216 LEU n 
1 217 ASP n 
1 218 SER n 
1 219 ARG n 
1 220 SER n 
1 221 PHE n 
1 222 ALA n 
1 223 TRP n 
1 224 ASN n 
1 225 VAL n 
1 226 ALA n 
1 227 PRO n 
1 228 GLY n 
1 229 ALA n 
1 230 GLU n 
1 231 SER n 
1 232 ALA n 
1 233 VAL n 
1 234 ALA n 
1 235 SER n 
1 236 PHE n 
1 237 VAL n 
1 238 THR n 
1 239 GLN n 
1 240 LEU n 
1 241 ALA n 
1 242 ALA n 
1 243 ALA n 
1 244 GLU n 
1 245 ALA n 
1 246 LEU n 
1 247 GLN n 
1 248 LYS n 
1 249 ALA n 
1 250 PRO n 
1 251 ASP n 
1 252 VAL n 
1 253 THR n 
1 254 THR n 
1 255 LEU n 
1 256 PRO n 
1 257 ARG n 
1 258 ASN n 
1 259 VAL n 
1 260 MET n 
1 261 PHE n 
1 262 VAL n 
1 263 PHE n 
1 264 PHE n 
1 265 GLN n 
1 266 GLY n 
1 267 GLU n 
1 268 THR n 
1 269 PHE n 
1 270 ASP n 
1 271 TYR n 
1 272 ILE n 
1 273 GLY n 
1 274 SER n 
1 275 SER n 
1 276 ARG n 
1 277 MET n 
1 278 VAL n 
1 279 TYR n 
1 280 ASP n 
1 281 MET n 
1 282 GLU n 
1 283 LYS n 
1 284 GLY n 
1 285 LYS n 
1 286 PHE n 
1 287 PRO n 
1 288 VAL n 
1 289 GLN n 
1 290 LEU n 
1 291 GLU n 
1 292 ASN n 
1 293 VAL n 
1 294 ASP n 
1 295 SER n 
1 296 PHE n 
1 297 VAL n 
1 298 GLU n 
1 299 LEU n 
1 300 GLY n 
1 301 GLN n 
1 302 VAL n 
1 303 ALA n 
1 304 LEU n 
1 305 ARG n 
1 306 THR n 
1 307 SER n 
1 308 LEU n 
1 309 GLU n 
1 310 LEU n 
1 311 TRP n 
1 312 MET n 
1 313 HIS n 
1 314 THR n 
1 315 ASP n 
1 316 PRO n 
1 317 VAL n 
1 318 GLN n 
1 319 LYS n 
1 320 ASN n 
1 321 GLU n 
1 322 SER n 
1 323 VAL n 
1 324 ARG n 
1 325 ASN n 
1 326 GLN n 
1 327 VAL n 
1 328 GLU n 
1 329 ASP n 
1 330 LEU n 
1 331 GLY n 
1 332 ALA n 
1 333 GLY n 
1 334 VAL n 
1 335 PRO n 
1 336 ALA n 
1 337 VAL n 
1 338 ILE n 
1 339 LEU n 
1 340 ARG n 
1 341 SER n 
1 342 GLY n 
1 343 VAL n 
1 344 PRO n 
1 345 LEU n 
1 346 PRO n 
1 347 PRO n 
1 348 SER n 
1 349 SER n 
1 350 LEU n 
1 351 GLN n 
1 352 ARG n 
1 353 PHE n 
1 354 LEU n 
1 355 ARG n 
1 356 ALA n 
1 357 ARG n 
1 358 ASN n 
1 359 ILE n 
1 360 SER n 
1 361 GLY n 
1 362 VAL n 
1 363 VAL n 
1 364 LEU n 
1 365 ALA n 
1 366 ASP n 
1 367 HIS n 
1 368 SER n 
1 369 GLY n 
1 370 ALA n 
1 371 PHE n 
1 372 HIS n 
1 373 ASN n 
1 374 LYS n 
1 375 TYR n 
1 376 TYR n 
1 377 GLN n 
1 378 SER n 
1 379 ILE n 
1 380 TYR n 
1 381 ASP n 
1 382 THR n 
1 383 ALA n 
1 384 GLU n 
1 385 ASN n 
1 386 ILE n 
1 387 ASN n 
1 388 VAL n 
1 389 SER n 
1 390 TYR n 
1 391 PRO n 
1 392 GLU n 
1 393 TRP n 
1 394 LEU n 
1 395 ALA n 
1 396 PRO n 
1 397 GLU n 
1 398 GLU n 
1 399 ASP n 
1 400 LEU n 
1 401 ASN n 
1 402 PHE n 
1 403 VAL n 
1 404 THR n 
1 405 ASP n 
1 406 THR n 
1 407 ALA n 
1 408 LYS n 
1 409 ALA n 
1 410 LEU n 
1 411 ALA n 
1 412 ASP n 
1 413 VAL n 
1 414 ALA n 
1 415 THR n 
1 416 VAL n 
1 417 LEU n 
1 418 GLY n 
1 419 ARG n 
1 420 ALA n 
1 421 LEU n 
1 422 TYR n 
1 423 GLU n 
1 424 LEU n 
1 425 ALA n 
1 426 GLY n 
1 427 GLY n 
1 428 ASP n 
1 429 THR n 
1 430 VAL n 
1 431 GLN n 
1 432 ALA n 
1 433 ASP n 
1 434 PRO n 
1 435 GLN n 
1 436 THR n 
1 437 VAL n 
1 438 THR n 
1 439 ARG n 
1 440 LEU n 
1 441 LEU n 
1 442 TYR n 
1 443 GLY n 
1 444 PHE n 
1 445 LEU n 
1 446 ILE n 
1 447 LYS n 
1 448 LEU n 
1 449 ARG n 
1 450 GLN n 
1 451 ASP n 
1 452 LEU n 
1 453 ARG n 
1 454 SER n 
1 455 TYR n 
1 456 LEU n 
1 457 GLY n 
1 458 ASP n 
1 459 GLY n 
1 460 PRO n 
1 461 LEU n 
1 462 GLN n 
1 463 HIS n 
1 464 TYR n 
1 465 ILE n 
1 466 ALA n 
1 467 VAL n 
1 468 SER n 
1 469 SER n 
1 470 PRO n 
1 471 THR n 
1 472 ASN n 
1 473 THR n 
1 474 THR n 
1 475 TYR n 
1 476 VAL n 
1 477 VAL n 
1 478 GLN n 
1 479 TYR n 
1 480 ALA n 
1 481 LEU n 
1 482 ALA n 
1 483 ASN n 
1 484 LEU n 
1 485 THR n 
1 486 GLY n 
1 487 THR n 
1 488 VAL n 
1 489 VAL n 
1 490 UNK n 
1 491 UNK n 
1 492 UNK n 
1 493 UNK n 
1 494 UNK n 
1 495 UNK n 
1 496 UNK n 
1 497 UNK n 
1 498 UNK n 
1 499 UNK n 
1 500 UNK n 
1 501 UNK n 
1 502 UNK n 
1 503 UNK n 
1 504 UNK n 
1 505 UNK n 
1 506 UNK n 
1 507 UNK n 
1 508 UNK n 
1 509 UNK n 
1 510 UNK n 
1 511 UNK n 
1 512 UNK n 
1 513 UNK n 
1 514 UNK n 
1 515 UNK n 
1 516 UNK n 
1 517 UNK n 
1 518 UNK n 
1 519 UNK n 
1 520 UNK n 
1 521 UNK n 
1 522 UNK n 
1 523 UNK n 
1 524 UNK n 
1 525 UNK n 
1 526 UNK n 
1 527 UNK n 
1 528 THR n 
1 529 ALA n 
1 530 ARG n 
1 531 LEU n 
1 532 ALA n 
1 533 ARG n 
1 534 ALA n 
1 535 LEU n 
1 536 SER n 
1 537 PRO n 
1 538 ALA n 
1 539 GLN n 
1 540 TRP n 
1 541 SER n 
1 542 SER n 
1 543 THR n 
1 544 GLU n 
1 545 TYR n 
1 546 SER n 
1 547 THR n 
1 548 TRP n 
1 549 THR n 
1 550 GLU n 
1 551 SER n 
1 552 ARG n 
1 553 TRP n 
1 554 LYS n 
1 555 ALA n 
1 556 ILE n 
1 557 ARG n 
1 558 ALA n 
1 559 ARG n 
1 560 ILE n 
1 561 PHE n 
1 562 LEU n 
1 563 ILE n 
1 564 ALA n 
1 565 SER n 
1 566 UNK n 
1 567 UNK n 
1 568 UNK n 
1 569 UNK n 
1 570 UNK n 
1 571 UNK n 
1 572 UNK n 
1 573 UNK n 
1 574 UNK n 
1 575 UNK n 
1 576 UNK n 
1 577 UNK n 
1 578 UNK n 
1 579 UNK n 
1 580 UNK n 
1 581 UNK n 
1 582 UNK n 
1 583 UNK n 
1 584 UNK n 
1 585 UNK n 
1 586 UNK n 
1 587 UNK n 
1 588 UNK n 
2 1   UNK n 
2 2   UNK n 
2 3   UNK n 
2 4   UNK n 
2 5   UNK n 
2 6   UNK n 
2 7   UNK n 
2 8   UNK n 
2 9   UNK n 
2 10  UNK n 
2 11  UNK n 
2 12  UNK n 
2 13  HIS n 
2 14  VAL n 
2 15  ILE n 
2 16  MET n 
2 17  LEU n 
2 18  PHE n 
2 19  VAL n 
2 20  PRO n 
2 21  VAL n 
2 22  THR n 
2 23  LEU n 
2 24  CYS n 
2 25  MET n 
2 26  VAL n 
2 27  VAL n 
2 28  VAL n 
2 29  VAL n 
2 30  ALA n 
2 31  THR n 
2 32  ILE n 
2 33  UNK n 
2 34  UNK n 
2 35  UNK n 
2 36  UNK n 
2 37  UNK n 
2 38  UNK n 
2 39  UNK n 
2 40  UNK n 
2 41  UNK n 
2 42  UNK n 
2 43  UNK n 
2 44  UNK n 
2 45  UNK n 
2 46  UNK n 
2 47  UNK n 
2 48  UNK n 
2 49  UNK n 
2 50  UNK n 
2 51  UNK n 
2 52  UNK n 
2 53  UNK n 
2 54  UNK n 
2 55  UNK n 
2 56  UNK n 
2 57  UNK n 
2 58  UNK n 
2 59  UNK n 
2 60  LEU n 
2 61  LEU n 
2 62  LEU n 
2 63  PHE n 
2 64  PHE n 
2 65  PHE n 
2 66  SER n 
2 67  PHE n 
2 68  ILE n 
2 69  TYR n 
2 70  LEU n 
2 71  GLY n 
2 72  GLU n 
2 73  VAL n 
2 74  PHE n 
2 75  LYS n 
2 76  THR n 
2 77  TYR n 
2 78  UNK n 
2 79  UNK n 
2 80  UNK n 
2 81  UNK n 
2 82  UNK n 
2 83  UNK n 
2 84  UNK n 
2 85  UNK n 
2 86  UNK n 
2 87  UNK n 
2 88  LEU n 
2 89  ILE n 
2 90  TRP n 
2 91  ASN n 
2 92  PHE n 
2 93  GLY n 
2 94  UNK n 
2 95  UNK n 
2 96  UNK n 
2 97  UNK n 
2 98  UNK n 
2 99  UNK n 
2 100 UNK n 
2 101 UNK n 
2 102 UNK n 
2 103 UNK n 
2 104 UNK n 
2 105 UNK n 
2 106 UNK n 
2 107 ARG n 
2 108 LEU n 
2 109 GLN n 
2 110 GLN n 
2 111 ALA n 
2 112 TYR n 
2 113 LEU n 
2 114 ILE n 
2 115 MET n 
2 116 ILE n 
2 117 SER n 
2 118 ALA n 
2 119 LEU n 
2 120 MET n 
2 121 UNK n 
2 122 UNK n 
2 123 UNK n 
2 124 UNK n 
2 125 UNK n 
2 126 UNK n 
2 127 UNK n 
2 128 UNK n 
2 129 UNK n 
2 130 UNK n 
2 131 UNK n 
2 132 UNK n 
2 133 UNK n 
2 134 UNK n 
2 135 UNK n 
2 136 UNK n 
2 137 UNK n 
2 138 UNK n 
2 139 UNK n 
2 140 UNK n 
2 141 ASP n 
2 142 UNK n 
2 143 UNK n 
2 144 UNK n 
2 145 UNK n 
2 146 UNK n 
2 147 UNK n 
2 148 UNK n 
2 149 UNK n 
2 150 UNK n 
2 151 UNK n 
2 152 UNK n 
2 153 UNK n 
2 154 UNK n 
2 155 UNK n 
2 156 UNK n 
2 157 UNK n 
2 158 UNK n 
2 159 UNK n 
2 160 UNK n 
2 161 UNK n 
2 162 ASP n 
2 163 UNK n 
2 164 UNK n 
2 165 UNK n 
2 166 UNK n 
2 167 UNK n 
2 168 UNK n 
2 169 UNK n 
2 170 UNK n 
2 171 UNK n 
2 172 UNK n 
2 173 UNK n 
2 174 UNK n 
2 175 UNK n 
2 176 UNK n 
2 177 UNK n 
2 178 UNK n 
2 179 UNK n 
2 180 UNK n 
2 181 TRP n 
2 182 ASN n 
2 183 THR n 
2 184 THR n 
2 185 ILE n 
2 186 ALA n 
2 187 CYS n 
2 188 PHE n 
2 189 VAL n 
2 190 ALA n 
2 191 ILE n 
2 192 LEU n 
2 193 ILE n 
2 194 GLY n 
2 195 LEU n 
2 196 CYS n 
2 197 LEU n 
2 198 THR n 
2 199 LEU n 
2 200 LEU n 
2 201 UNK n 
2 202 UNK n 
2 203 UNK n 
2 204 UNK n 
2 205 UNK n 
2 206 UNK n 
2 207 UNK n 
2 208 UNK n 
2 209 UNK n 
2 210 UNK n 
2 211 UNK n 
2 212 UNK n 
2 213 UNK n 
2 214 UNK n 
2 215 UNK n 
2 216 UNK n 
2 217 UNK n 
2 218 GLY n 
2 219 LEU n 
2 220 VAL n 
2 221 PHE n 
2 222 TYR n 
2 223 PHE n 
2 224 ALA n 
2 225 THR n 
2 226 ASP n 
2 227 TYR n 
2 228 LEU n 
2 229 VAL n 
2 230 GLN n 
2 231 PRO n 
2 232 PHE n 
2 233 ALA n 
2 234 ASP n 
2 235 GLN n 
2 236 LEU n 
2 237 ALA n 
2 238 PHE n 
2 239 HIS n 
2 240 UNK n 
2 241 UNK n 
3 1   UNK n 
3 2   UNK n 
3 3   UNK n 
3 4   UNK n 
3 5   UNK n 
3 6   UNK n 
3 7   UNK n 
3 8   UNK n 
3 9   UNK n 
3 10  UNK n 
3 11  UNK n 
3 12  UNK n 
3 13  UNK n 
3 14  UNK n 
3 15  UNK n 
3 16  UNK n 
3 17  UNK n 
3 18  UNK n 
3 19  UNK n 
3 20  UNK n 
3 21  UNK n 
3 22  UNK n 
3 23  UNK n 
3 24  UNK n 
3 25  UNK n 
3 26  UNK n 
3 27  UNK n 
3 28  UNK n 
3 29  UNK n 
3 30  UNK n 
3 31  UNK n 
3 32  UNK n 
3 33  UNK n 
3 34  UNK n 
3 35  UNK n 
3 36  UNK n 
3 37  UNK n 
3 38  UNK n 
3 39  UNK n 
3 40  UNK n 
3 41  UNK n 
3 42  UNK n 
3 43  UNK n 
3 44  UNK n 
3 45  UNK n 
3 46  UNK n 
3 47  UNK n 
3 48  UNK n 
3 49  UNK n 
3 50  UNK n 
3 51  UNK n 
3 52  UNK n 
3 53  UNK n 
3 54  UNK n 
3 55  UNK n 
3 56  UNK n 
3 57  UNK n 
3 58  UNK n 
3 59  UNK n 
3 60  UNK n 
3 61  UNK n 
3 62  UNK n 
3 63  UNK n 
3 64  UNK n 
3 65  UNK n 
3 66  UNK n 
3 67  UNK n 
3 68  UNK n 
3 69  UNK n 
3 70  UNK n 
3 71  UNK n 
3 72  UNK n 
3 73  UNK n 
3 74  UNK n 
3 75  UNK n 
3 76  UNK n 
3 77  UNK n 
3 78  UNK n 
3 79  UNK n 
3 80  UNK n 
3 81  UNK n 
3 82  UNK n 
3 83  UNK n 
3 84  UNK n 
3 85  UNK n 
3 86  UNK n 
3 87  UNK n 
3 88  UNK n 
3 89  UNK n 
3 90  UNK n 
3 91  UNK n 
3 92  UNK n 
3 93  UNK n 
3 94  UNK n 
3 95  UNK n 
3 96  UNK n 
3 97  UNK n 
3 98  UNK n 
3 99  UNK n 
3 100 UNK n 
3 101 UNK n 
3 102 UNK n 
3 103 UNK n 
3 104 UNK n 
3 105 UNK n 
3 106 UNK n 
3 107 UNK n 
3 108 UNK n 
3 109 UNK n 
3 110 UNK n 
3 111 UNK n 
3 112 UNK n 
3 113 UNK n 
3 114 UNK n 
3 115 UNK n 
3 116 UNK n 
3 117 UNK n 
3 118 UNK n 
3 119 UNK n 
3 120 UNK n 
3 121 UNK n 
3 122 UNK n 
3 123 UNK n 
3 124 UNK n 
3 125 UNK n 
3 126 UNK n 
3 127 UNK n 
3 128 UNK n 
3 129 UNK n 
3 130 UNK n 
3 131 UNK n 
3 132 UNK n 
3 133 UNK n 
3 134 UNK n 
3 135 UNK n 
3 136 UNK n 
3 137 UNK n 
3 138 UNK n 
3 139 UNK n 
3 140 UNK n 
3 141 UNK n 
3 142 UNK n 
3 143 UNK n 
3 144 UNK n 
3 145 UNK n 
3 146 UNK n 
3 147 UNK n 
3 148 UNK n 
3 149 UNK n 
3 150 UNK n 
3 151 UNK n 
3 152 UNK n 
3 153 UNK n 
3 154 UNK n 
3 155 UNK n 
3 156 UNK n 
3 157 UNK n 
3 158 UNK n 
3 159 UNK n 
3 160 UNK n 
3 161 UNK n 
3 162 UNK n 
3 163 UNK n 
3 164 UNK n 
3 165 UNK n 
3 166 UNK n 
3 167 UNK n 
3 168 UNK n 
3 169 UNK n 
3 170 UNK n 
3 171 UNK n 
3 172 UNK n 
3 173 UNK n 
3 174 UNK n 
3 175 UNK n 
3 176 UNK n 
3 177 UNK n 
3 178 UNK n 
3 179 UNK n 
3 180 UNK n 
3 181 UNK n 
3 182 UNK n 
3 183 UNK n 
3 184 UNK n 
3 185 UNK n 
3 186 UNK n 
3 187 UNK n 
3 188 UNK n 
3 189 UNK n 
3 190 UNK n 
3 191 UNK n 
3 192 UNK n 
3 193 UNK n 
3 194 UNK n 
3 195 UNK n 
3 196 UNK n 
4 1   UNK n 
4 2   UNK n 
4 3   UNK n 
4 4   UNK n 
4 5   UNK n 
4 6   UNK n 
4 7   UNK n 
4 8   UNK n 
4 9   UNK n 
4 10  UNK n 
4 11  UNK n 
4 12  UNK n 
4 13  UNK n 
4 14  UNK n 
4 15  UNK n 
4 16  UNK n 
4 17  UNK n 
4 18  UNK n 
4 19  UNK n 
4 20  UNK n 
4 21  UNK n 
4 22  UNK n 
4 23  UNK n 
4 24  UNK n 
4 25  UNK n 
4 26  UNK n 
4 27  UNK n 
4 28  UNK n 
4 29  UNK n 
4 30  UNK n 
4 31  UNK n 
4 32  UNK n 
4 33  UNK n 
4 34  UNK n 
4 35  UNK n 
4 36  UNK n 
4 37  UNK n 
4 38  UNK n 
4 39  UNK n 
4 40  UNK n 
4 41  UNK n 
4 42  UNK n 
4 43  UNK n 
4 44  UNK n 
4 45  UNK n 
4 46  UNK n 
4 47  UNK n 
4 48  UNK n 
4 49  UNK n 
4 50  UNK n 
4 51  UNK n 
4 52  UNK n 
4 53  UNK n 
4 54  UNK n 
4 55  UNK n 
4 56  UNK n 
4 57  UNK n 
4 58  UNK n 
4 59  UNK n 
4 60  UNK n 
4 61  UNK n 
4 62  UNK n 
5 1   MET n 
5 2   ASN n 
5 3   ILE n 
5 4   PHE n 
5 5   GLU n 
5 6   MET n 
5 7   LEU n 
5 8   ARG n 
5 9   ILE n 
5 10  ASP n 
5 11  GLU n 
5 12  GLY n 
5 13  LEU n 
5 14  ARG n 
5 15  LEU n 
5 16  LYS n 
5 17  ILE n 
5 18  TYR n 
5 19  LYS n 
5 20  ASP n 
5 21  THR n 
5 22  GLU n 
5 23  GLY n 
5 24  TYR n 
5 25  TYR n 
5 26  THR n 
5 27  ILE n 
5 28  GLY n 
5 29  ILE n 
5 30  GLY n 
5 31  HIS n 
5 32  LEU n 
5 33  LEU n 
5 34  THR n 
5 35  LYS n 
5 36  SER n 
5 37  PRO n 
5 38  SER n 
5 39  LEU n 
5 40  ASN n 
5 41  ALA n 
5 42  ALA n 
5 43  LYS n 
5 44  SER n 
5 45  GLU n 
5 46  LEU n 
5 47  ASP n 
5 48  LYS n 
5 49  ALA n 
5 50  ILE n 
5 51  GLY n 
5 52  ARG n 
5 53  ASN n 
5 54  CYS n 
5 55  ASN n 
5 56  GLY n 
5 57  VAL n 
5 58  ILE n 
5 59  THR n 
5 60  LYS n 
5 61  ASP n 
5 62  GLU n 
5 63  ALA n 
5 64  GLU n 
5 65  LYS n 
5 66  LEU n 
5 67  PHE n 
5 68  ASN n 
5 69  GLN n 
5 70  ASP n 
5 71  VAL n 
5 72  ASP n 
5 73  ALA n 
5 74  ALA n 
5 75  VAL n 
5 76  ARG n 
5 77  GLY n 
5 78  ILE n 
5 79  LEU n 
5 80  ARG n 
5 81  ASN n 
5 82  ALA n 
5 83  LYS n 
5 84  LEU n 
5 85  LYS n 
5 86  PRO n 
5 87  VAL n 
5 88  TYR n 
5 89  ASP n 
5 90  SER n 
5 91  LEU n 
5 92  ASP n 
5 93  ALA n 
5 94  VAL n 
5 95  ARG n 
5 96  ARG n 
5 97  CYS n 
5 98  ALA n 
5 99  LEU n 
5 100 ILE n 
5 101 ASN n 
5 102 MET n 
5 103 VAL n 
5 104 PHE n 
5 105 GLN n 
5 106 MET n 
5 107 GLY n 
5 108 GLU n 
5 109 THR n 
5 110 GLY n 
5 111 VAL n 
5 112 ALA n 
5 113 GLY n 
5 114 PHE n 
5 115 THR n 
5 116 ASN n 
5 117 SER n 
5 118 LEU n 
5 119 ARG n 
5 120 MET n 
5 121 LEU n 
5 122 GLN n 
5 123 GLN n 
5 124 LYS n 
5 125 ARG n 
5 126 TRP n 
5 127 ASP n 
5 128 GLU n 
5 129 ALA n 
5 130 ALA n 
5 131 VAL n 
5 132 ASN n 
5 133 LEU n 
5 134 ALA n 
5 135 LYS n 
5 136 SER n 
5 137 ARG n 
5 138 TRP n 
5 139 TYR n 
5 140 ASN n 
5 141 GLN n 
5 142 THR n 
5 143 PRO n 
5 144 ASN n 
5 145 ARG n 
5 146 ALA n 
5 147 LYS n 
5 148 ARG n 
5 149 VAL n 
5 150 ILE n 
5 151 THR n 
5 152 THR n 
5 153 PHE n 
5 154 ARG n 
5 155 THR n 
5 156 GLY n 
5 157 THR n 
5 158 TRP n 
5 159 ASP n 
5 160 ALA n 
5 161 TYR n 
5 162 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'HEK 293S' ? ? 
? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'HEK 293S' ? ? 
? ? ? ? ? ? ? ? ? ? 
3 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'HEK 293S' ? ? 
? ? ? ? ? ? ? ? ? ? 
4 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'HEK 293S' ? ? 
? ? ? ? ? ? ? ? ? ? 
5 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? HUMAN 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'HEK 293S' ? ? 
? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 PDB 4UIS            1 ? ? 4UIS       ? 
2 PDB 4UIS            2 ? ? 4UIS       ? 
3 PDB 4UIS            3 ? ? 4UIS       ? 
4 PDB 4UIS            4 ? ? 4UIS       ? 
5 UNP A0A097J809_BPT4 5 ? ? A0A097J809 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4UIS A 1 ? 588 ? 4UIS       42 ? 688 ? 42 688 
2 2 4UIS B 1 ? 241 ? 4UIS       69 ? 465 ? 69 465 
3 3 4UIS C 1 ? 196 ? 4UIS       1  ? 222 ? 1  222 
4 4 4UIS D 1 ? 62  ? 4UIS       5  ? 75  ? 5  75  
5 5 4UIS G 1 ? 162 ? A0A097J809 1  ? 162 ? 1  162 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
UNK 'L-peptide linking' . UNKNOWN         ? 'C4 H9 N O2'     103.120 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4UIS 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 4UIS 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            4.40 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8461 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               8461 
_refine_hist.d_res_high                       4.40 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  4UIS 
_struct.title                     'The cryoEM structure of human gamma-Secretase complex' 
_struct.pdbx_descriptor           'GAMMA-SECRETASE, LYSOZYME (E.C.3.2.1.17)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4UIS 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, GAMMA-SECRETASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 37  ? THR A 46  ? LYS A 78  THR A 87  1 ? 10 
HELX_P HELX_P2  2  THR A 63  ? GLY A 72  ? THR A 104 GLY A 113 1 ? 10 
HELX_P HELX_P3  3  ASP A 135 ? LEU A 151 ? ASP A 185 LEU A 201 1 ? 17 
HELX_P HELX_P4  4  SER A 176 ? ARG A 183 ? SER A 226 ARG A 233 1 ? 8  
HELX_P HELX_P5  5  ALA A 232 ? LYS A 248 ? ALA A 298 LYS A 314 1 ? 17 
HELX_P HELX_P6  6  ALA A 249 ? THR A 254 ? ALA A 315 THR A 320 5 ? 6  
HELX_P HELX_P7  7  TYR A 271 ? LYS A 283 ? TYR A 337 LYS A 349 1 ? 13 
HELX_P HELX_P8  8  GLN A 318 ? VAL A 334 ? GLN A 392 VAL A 408 1 ? 17 
HELX_P HELX_P9  9  SER A 349 ? ARG A 355 ? SER A 426 ARG A 432 1 ? 7  
HELX_P HELX_P10 10 THR A 382 ? ASN A 387 ? THR A 459 ASN A 464 1 ? 6  
HELX_P HELX_P11 11 PRO A 396 ? ASN A 401 ? PRO A 473 ASN A 478 1 ? 6  
HELX_P HELX_P12 12 THR A 406 ? GLY A 426 ? THR A 483 GLY A 503 1 ? 21 
HELX_P HELX_P13 13 ASP A 433 ? ILE A 446 ? ASP A 514 ILE A 527 1 ? 14 
HELX_P HELX_P14 14 LEU A 448 ? LEU A 452 ? LEU A 538 LEU A 542 5 ? 5  
HELX_P HELX_P15 15 THR A 471 ? THR A 485 ? THR A 561 THR A 575 1 ? 15 
HELX_P HELX_P16 16 UNK A 496 ? UNK A 503 ? UNK A 588 UNK A 595 1 ? 8  
HELX_P HELX_P17 17 SER A 565 ? UNK A 587 ? SER A 665 UNK A 687 1 ? 23 
HELX_P HELX_P18 18 UNK B 1   ? UNK B 33  ? UNK B 69  UNK B 101 1 ? 33 
HELX_P HELX_P19 19 UNK B 36  ? UNK B 54  ? UNK B 137 UNK B 155 1 ? 19 
HELX_P HELX_P20 20 UNK B 55  ? UNK B 78  ? UNK B 167 UNK B 190 1 ? 24 
HELX_P HELX_P21 21 UNK B 81  ? UNK B 103 ? UNK B 194 UNK B 216 1 ? 23 
HELX_P HELX_P22 22 UNK B 105 ? UNK B 128 ? UNK B 218 UNK B 241 1 ? 24 
HELX_P HELX_P23 23 UNK B 130 ? UNK B 155 ? UNK B 246 UNK B 271 1 ? 26 
HELX_P HELX_P24 24 UNK B 159 ? UNK B 177 ? UNK B 382 UNK B 400 1 ? 19 
HELX_P HELX_P25 25 TRP B 181 ? UNK B 204 ? TRP B 404 UNK B 427 1 ? 24 
HELX_P HELX_P26 26 UNK B 210 ? LEU B 228 ? UNK B 434 LEU B 452 1 ? 19 
HELX_P HELX_P27 27 LEU B 228 ? HIS B 239 ? LEU B 452 HIS B 463 1 ? 12 
HELX_P HELX_P28 28 UNK C 2   ? UNK C 22  ? UNK C 2   UNK C 22  1 ? 21 
HELX_P HELX_P29 29 UNK C 25  ? UNK C 34  ? UNK C 25  UNK C 34  1 ? 10 
HELX_P HELX_P30 30 UNK C 35  ? UNK C 55  ? UNK C 36  UNK C 56  1 ? 21 
HELX_P HELX_P31 31 UNK C 57  ? UNK C 87  ? UNK C 72  UNK C 102 1 ? 31 
HELX_P HELX_P32 32 UNK C 89  ? UNK C 102 ? UNK C 109 UNK C 122 1 ? 14 
HELX_P HELX_P33 33 UNK C 103 ? UNK C 115 ? UNK C 123 UNK C 135 1 ? 13 
HELX_P HELX_P34 34 UNK C 126 ? UNK C 152 ? UNK C 152 UNK C 178 1 ? 27 
HELX_P HELX_P35 35 UNK C 153 ? UNK C 158 ? UNK C 179 UNK C 184 1 ? 6  
HELX_P HELX_P36 36 UNK C 158 ? UNK C 172 ? UNK C 184 UNK C 198 1 ? 15 
HELX_P HELX_P37 37 UNK C 178 ? UNK C 194 ? UNK C 204 UNK C 220 1 ? 17 
HELX_P HELX_P38 38 UNK D 3   ? UNK D 13  ? UNK D 7   UNK D 17  1 ? 11 
HELX_P HELX_P39 39 UNK D 14  ? UNK D 16  ? UNK D 18  UNK D 20  5 ? 3  
HELX_P HELX_P40 40 UNK D 17  ? UNK D 27  ? UNK D 21  UNK D 31  1 ? 11 
HELX_P HELX_P41 41 UNK D 30  ? UNK D 59  ? UNK D 43  UNK D 72  1 ? 30 
HELX_P HELX_P42 42 UNK D 60  ? UNK D 62  ? UNK D 73  UNK D 75  5 ? 3  
HELX_P HELX_P43 43 MET E 6   ? GLY E 12  ? MET G 6   GLY G 12  1 ? 7  
HELX_P HELX_P44 44 SER E 38  ? GLY E 51  ? SER G 38  GLY G 51  1 ? 14 
HELX_P HELX_P45 45 THR E 59  ? VAL E 75  ? THR G 59  VAL G 75  1 ? 17 
HELX_P HELX_P46 46 GLY E 77  ? ASN E 81  ? GLY G 77  ASN G 81  5 ? 5  
HELX_P HELX_P47 47 LYS E 83  ? LEU E 91  ? LYS G 83  LEU G 91  1 ? 9  
HELX_P HELX_P48 48 ASP E 92  ? MET E 106 ? ASP G 92  MET G 106 1 ? 15 
HELX_P HELX_P49 49 GLY E 107 ? GLY E 113 ? GLY G 107 GLY G 113 1 ? 7  
HELX_P HELX_P50 50 PHE E 114 ? GLN E 123 ? PHE G 114 GLN G 123 1 ? 10 
HELX_P HELX_P51 51 ARG E 125 ? ALA E 134 ? ARG G 125 ALA G 134 1 ? 10 
HELX_P HELX_P52 52 THR E 142 ? GLY E 156 ? THR G 142 GLY G 156 1 ? 15 
HELX_P HELX_P53 53 TRP E 158 ? LYS E 162 ? TRP G 158 LYS G 162 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 9   SG ? ? ? 1_555 A CYS 21  SG ? ? A CYS 50  A CYS 62  1_555 ? ? ? ? ? ? ? 2.035 ? 
disulf2 disulf ? ? A CYS 145 SG ? ? ? 1_555 A CYS 163 SG ? ? A CYS 195 A CYS 213 1_555 ? ? ? ? ? ? ? 2.031 ? 
disulf3 disulf ? ? A CYS 180 SG ? ? ? 1_555 A CYS 190 SG ? ? A CYS 230 A CYS 248 1_555 ? ? ? ? ? ? ? 2.037 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 108 A . ? HIS 158 A CYS 109 A ? CYS 159 A 1 -10.37 
2 ASN 154 A . ? ASN 204 A GLY 155 A ? GLY 205 A 1 10.30  
3 GLY 155 A . ? GLY 205 A SER 156 A ? SER 206 A 1 3.37   
4 ALA 157 A . ? ALA 207 A PRO 158 A ? PRO 208 A 1 -23.66 
5 UNK 119 C . ? UNK 139 C UNK 120 C ? UNK 140 C 1 4.99   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3 ? 
AB ? 2 ? 
AC ? 4 ? 
AD ? 2 ? 
AE ? 2 ? 
AF ? 2 ? 
AG ? 2 ? 
AH ? 2 ? 
AI ? 2 ? 
GA ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? parallel      
AB 1 2 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? anti-parallel 
AC 3 4 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? parallel      
AG 1 2 ? parallel      
AH 1 2 ? parallel      
AI 1 2 ? anti-parallel 
GA 1 2 ? anti-parallel 
GA 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 6   ? ALA A 7   ? THR A 47  ALA A 48  
AA 2 ILE A 130 ? LEU A 133 ? ILE A 180 LEU A 183 
AA 3 LEU A 80  ? SER A 83  ? LEU A 121 SER A 124 
AB 1 LEU A 12  ? LEU A 13  ? LEU A 53  LEU A 54  
AB 2 GLN A 18  ? ILE A 19  ? GLN A 59  ILE A 60  
AC 1 TYR A 53  ? MET A 54  ? TYR A 94  MET A 95  
AC 2 ASP A 28  ? ILE A 32  ? ASP A 69  ILE A 73  
AC 3 CYS A 163 ? PHE A 168 ? CYS A 213 PHE A 218 
AC 4 ARG A 557 ? LEU A 562 ? ARG A 657 LEU A 662 
AD 1 CYS A 190 ? PRO A 192 ? CYS A 248 PRO A 250 
AD 2 THR A 549 ? SER A 551 ? THR A 649 SER A 651 
AE 1 ASP A 195 ? ASN A 197 ? ASP A 253 ASN A 255 
AE 2 ARG A 530 ? ALA A 532 ? ARG A 629 ALA A 631 
AF 1 VAL A 209 ? VAL A 211 ? VAL A 275 VAL A 277 
AF 2 ASN A 258 ? MET A 260 ? ASN A 324 MET A 326 
AG 1 THR A 214 ? ARG A 215 ? THR A 280 ARG A 281 
AG 2 PHE A 263 ? PHE A 264 ? PHE A 329 PHE A 330 
AH 1 LEU A 299 ? GLY A 300 ? LEU A 365 GLY A 366 
AH 2 LEU A 364 ? ALA A 365 ? LEU A 441 ALA A 442 
AI 1 UNK A 508 ? UNK A 509 ? UNK A 605 UNK A 606 
AI 2 UNK A 522 ? UNK A 523 ? UNK A 621 UNK A 622 
GA 1 ILE E 17  ? LYS E 19  ? ILE G 17  LYS G 19  
GA 2 TYR E 25  ? ILE E 27  ? TYR G 25  ILE G 27  
GA 3 HIS E 31  ? THR E 34  ? HIS G 31  THR G 34  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ALA A 7   ? N ALA A 48  O LEU A 132 ? O LEU A 182 
AA 2 3 N PHE A 131 ? N PHE A 181 O LEU A 80  ? O LEU A 121 
AB 1 2 N LEU A 12  ? N LEU A 53  O ILE A 19  ? O ILE A 60  
AC 1 2 N MET A 54  ? N MET A 95  O VAL A 31  ? O VAL A 72  
AC 2 3 N ILE A 32  ? N ILE A 73  O CYS A 163 ? O CYS A 213 
AC 3 4 N PHE A 168 ? N PHE A 218 O ARG A 557 ? O ARG A 657 
AD 1 2 N ASP A 191 ? N ASP A 249 O GLU A 550 ? O GLU A 650 
AE 1 2 N ASN A 197 ? N ASN A 255 O ARG A 530 ? O ARG A 629 
AF 1 2 N VAL A 210 ? N VAL A 276 O ASN A 258 ? O ASN A 324 
AG 1 2 O THR A 214 ? O THR A 280 N PHE A 264 ? N PHE A 330 
AH 1 2 N GLY A 300 ? N GLY A 366 O LEU A 364 ? O LEU A 441 
AI 1 2 N UNK A 508 ? N UNK A 605 O UNK A 523 ? O UNK A 622 
GA 1 2 N TYR E 18  ? N TYR G 18  O THR E 26  ? O THR G 26  
GA 2 3 N ILE E 27  ? N ILE G 27  O HIS E 31  ? O HIS G 31  
# 
_database_PDB_matrix.entry_id          4UIS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4UIS 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . ILE A 1 1   ? 146.612 114.792 128.210 1.00 96.01  ?  42  ILE A N   1 
ATOM 2    C CA  . ILE A 1 1   ? 146.194 113.816 129.207 1.00 81.65  ?  42  ILE A CA  1 
ATOM 3    C C   . ILE A 1 1   ? 146.494 114.274 130.615 1.00 90.03  ?  42  ILE A C   1 
ATOM 4    O O   . ILE A 1 1   ? 147.655 114.345 131.006 1.00 87.43  ?  42  ILE A O   1 
ATOM 5    C CB  . ILE A 1 1   ? 146.883 112.474 129.013 1.00 108.87 ?  42  ILE A CB  1 
ATOM 6    C CG1 . ILE A 1 1   ? 146.467 111.848 127.692 1.00 120.26 ?  42  ILE A CG1 1 
ATOM 7    C CG2 . ILE A 1 1   ? 146.531 111.543 130.147 1.00 91.50  ?  42  ILE A CG2 1 
ATOM 8    C CD1 . ILE A 1 1   ? 147.250 110.605 127.350 1.00 29.44  ?  42  ILE A CD1 1 
ATOM 9    N N   . PRO A 1 2   ? 145.457 114.628 131.376 1.00 123.77 ?  43  PRO A N   1 
ATOM 10   C CA  . PRO A 1 2   ? 145.741 114.800 132.794 1.00 132.42 ?  43  PRO A CA  1 
ATOM 11   C C   . PRO A 1 2   ? 146.183 113.488 133.405 1.00 133.14 ?  43  PRO A C   1 
ATOM 12   O O   . PRO A 1 2   ? 145.651 112.432 133.069 1.00 133.50 ?  43  PRO A O   1 
ATOM 13   C CB  . PRO A 1 2   ? 144.400 115.248 133.369 1.00 140.57 ?  43  PRO A CB  1 
ATOM 14   C CG  . PRO A 1 2   ? 143.403 114.671 132.453 1.00 148.22 ?  43  PRO A CG  1 
ATOM 15   C CD  . PRO A 1 2   ? 144.020 114.730 131.085 1.00 133.73 ?  43  PRO A CD  1 
ATOM 16   N N   . LEU A 1 3   ? 147.137 113.568 134.316 1.00 137.79 ?  44  LEU A N   1 
ATOM 17   C CA  . LEU A 1 3   ? 147.487 112.446 135.157 1.00 129.71 ?  44  LEU A CA  1 
ATOM 18   C C   . LEU A 1 3   ? 146.812 112.658 136.494 1.00 157.81 ?  44  LEU A C   1 
ATOM 19   O O   . LEU A 1 3   ? 146.588 113.791 136.904 1.00 155.26 ?  44  LEU A O   1 
ATOM 20   C CB  . LEU A 1 3   ? 148.998 112.318 135.259 1.00 101.83 ?  44  LEU A CB  1 
ATOM 21   C CG  . LEU A 1 3   ? 149.741 113.610 135.570 1.00 73.52  ?  44  LEU A CG  1 
ATOM 22   C CD1 . LEU A 1 3   ? 149.783 113.922 137.049 1.00 83.07  ?  44  LEU A CD1 1 
ATOM 23   C CD2 . LEU A 1 3   ? 151.129 113.529 134.973 1.00 40.06  ?  44  LEU A CD2 1 
ATOM 24   N N   . ASN A 1 4   ? 146.470 111.576 137.169 1.00 113.95 ?  45  ASN A N   1 
ATOM 25   C CA  . ASN A 1 4   ? 145.487 111.680 138.226 1.00 148.40 ?  45  ASN A CA  1 
ATOM 26   C C   . ASN A 1 4   ? 146.085 112.157 139.545 1.00 137.87 ?  45  ASN A C   1 
ATOM 27   O O   . ASN A 1 4   ? 146.286 113.353 139.741 1.00 142.37 ?  45  ASN A O   1 
ATOM 28   C CB  . ASN A 1 4   ? 144.792 110.336 138.401 1.00 187.44 ?  45  ASN A CB  1 
ATOM 29   C CG  . ASN A 1 4   ? 143.508 110.444 139.184 1.00 179.46 ?  45  ASN A CG  1 
ATOM 30   O OD1 . ASN A 1 4   ? 143.293 111.399 139.926 1.00 176.71 ?  45  ASN A OD1 1 
ATOM 31   N ND2 . ASN A 1 4   ? 142.629 109.467 139.005 1.00 175.38 ?  45  ASN A ND2 1 
ATOM 32   N N   . LYS A 1 5   ? 146.367 111.220 140.442 1.00 152.71 ?  46  LYS A N   1 
ATOM 33   C CA  . LYS A 1 5   ? 146.760 111.542 141.812 1.00 140.38 ?  46  LYS A CA  1 
ATOM 34   C C   . LYS A 1 5   ? 148.058 112.334 141.863 1.00 144.33 ?  46  LYS A C   1 
ATOM 35   O O   . LYS A 1 5   ? 149.021 111.998 141.181 1.00 147.92 ?  46  LYS A O   1 
ATOM 36   C CB  . LYS A 1 5   ? 146.887 110.249 142.610 1.00 143.36 ?  46  LYS A CB  1 
ATOM 37   C CG  . LYS A 1 5   ? 145.552 109.545 142.787 1.00 323.23 ?  46  LYS A CG  1 
ATOM 38   C CD  . LYS A 1 5   ? 145.722 108.063 143.061 1.00 147.52 ?  46  LYS A CD  1 
ATOM 39   C CE  . LYS A 1 5   ? 146.505 107.803 144.328 1.00 143.12 ?  46  LYS A CE  1 
ATOM 40   N NZ  . LYS A 1 5   ? 146.677 106.343 144.559 1.00 139.30 ?  46  LYS A NZ  1 
ATOM 41   N N   . THR A 1 6   ? 148.083 113.384 142.678 1.00 151.10 ?  47  THR A N   1 
ATOM 42   C CA  . THR A 1 6   ? 149.191 114.335 142.655 1.00 138.30 ?  47  THR A CA  1 
ATOM 43   C C   . THR A 1 6   ? 149.252 115.186 143.920 1.00 106.08 ?  47  THR A C   1 
ATOM 44   O O   . THR A 1 6   ? 148.224 115.533 144.488 1.00 101.06 ?  47  THR A O   1 
ATOM 45   C CB  . THR A 1 6   ? 149.075 115.261 141.431 1.00 158.89 ?  47  THR A CB  1 
ATOM 46   O OG1 . THR A 1 6   ? 149.137 114.478 140.235 1.00 168.83 ?  47  THR A OG1 1 
ATOM 47   C CG2 . THR A 1 6   ? 150.187 116.293 141.405 1.00 163.44 ?  47  THR A CG2 1 
ATOM 48   N N   . ALA A 1 7   ? 150.456 115.532 144.359 1.00 109.96 ?  48  ALA A N   1 
ATOM 49   C CA  . ALA A 1 7   ? 150.610 116.381 145.529 1.00 102.54 ?  48  ALA A CA  1 
ATOM 50   C C   . ALA A 1 7   ? 151.277 117.712 145.202 1.00 98.62  ?  48  ALA A C   1 
ATOM 51   O O   . ALA A 1 7   ? 152.466 117.759 144.899 1.00 100.85 ?  48  ALA A O   1 
ATOM 52   C CB  . ALA A 1 7   ? 151.394 115.662 146.590 1.00 111.19 ?  48  ALA A CB  1 
ATOM 53   N N   . PRO A 1 8   ? 150.500 118.798 145.250 1.00 77.06  ?  49  PRO A N   1 
ATOM 54   C CA  . PRO A 1 8   ? 150.928 120.185 145.054 1.00 62.20  ?  49  PRO A CA  1 
ATOM 55   C C   . PRO A 1 8   ? 151.886 120.724 146.096 1.00 63.94  ?  49  PRO A C   1 
ATOM 56   O O   . PRO A 1 8   ? 151.812 120.345 147.256 1.00 71.93  ?  49  PRO A O   1 
ATOM 57   C CB  . PRO A 1 8   ? 149.619 120.958 145.126 1.00 64.31  ?  49  PRO A CB  1 
ATOM 58   C CG  . PRO A 1 8   ? 148.758 120.120 145.979 1.00 70.18  ?  49  PRO A CG  1 
ATOM 59   C CD  . PRO A 1 8   ? 149.070 118.721 145.573 1.00 69.89  ?  49  PRO A CD  1 
ATOM 60   N N   . CYS A 1 9   ? 152.780 121.604 145.668 1.00 68.74  ?  50  CYS A N   1 
ATOM 61   C CA  . CYS A 1 9   ? 153.420 122.549 146.570 1.00 75.66  ?  50  CYS A CA  1 
ATOM 62   C C   . CYS A 1 9   ? 152.379 123.594 146.910 1.00 53.23  ?  50  CYS A C   1 
ATOM 63   O O   . CYS A 1 9   ? 151.439 123.773 146.148 1.00 51.18  ?  50  CYS A O   1 
ATOM 64   C CB  . CYS A 1 9   ? 154.643 123.189 145.925 1.00 92.53  ?  50  CYS A CB  1 
ATOM 65   S SG  . CYS A 1 9   ? 155.483 124.420 146.929 1.00 142.29 ?  50  CYS A SG  1 
ATOM 66   N N   . VAL A 1 10  ? 152.507 124.272 148.046 1.00 47.62  ?  51  VAL A N   1 
ATOM 67   C CA  . VAL A 1 10  ? 151.502 125.275 148.391 1.00 58.56  ?  51  VAL A CA  1 
ATOM 68   C C   . VAL A 1 10  ? 152.038 126.415 149.245 1.00 77.34  ?  51  VAL A C   1 
ATOM 69   O O   . VAL A 1 10  ? 152.886 126.224 150.108 1.00 73.64  ?  51  VAL A O   1 
ATOM 70   C CB  . VAL A 1 10  ? 150.311 124.626 149.115 1.00 41.78  ?  51  VAL A CB  1 
ATOM 71   C CG1 . VAL A 1 10  ? 150.740 124.053 150.441 1.00 46.37  ?  51  VAL A CG1 1 
ATOM 72   C CG2 . VAL A 1 10  ? 149.189 125.618 149.304 1.00 39.70  ?  51  VAL A CG2 1 
ATOM 73   N N   . ARG A 1 11  ? 151.542 127.612 148.968 1.00 71.25  ?  52  ARG A N   1 
ATOM 74   C CA  . ARG A 1 11  ? 151.963 128.827 149.642 1.00 94.27  ?  52  ARG A CA  1 
ATOM 75   C C   . ARG A 1 11  ? 151.590 128.908 151.115 1.00 97.17  ?  52  ARG A C   1 
ATOM 76   O O   . ARG A 1 11  ? 150.463 128.606 151.483 1.00 95.29  ?  52  ARG A O   1 
ATOM 77   C CB  . ARG A 1 11  ? 151.360 130.019 148.919 1.00 114.92 ?  52  ARG A CB  1 
ATOM 78   C CG  . ARG A 1 11  ? 151.633 131.324 149.578 1.00 119.80 ?  52  ARG A CG  1 
ATOM 79   C CD  . ARG A 1 11  ? 153.103 131.574 149.703 1.00 123.22 ?  52  ARG A CD  1 
ATOM 80   N NE  . ARG A 1 11  ? 153.767 131.616 148.413 1.00 130.45 ?  52  ARG A NE  1 
ATOM 81   C CZ  . ARG A 1 11  ? 153.782 132.690 147.636 1.00 133.14 ?  52  ARG A CZ  1 
ATOM 82   N NH1 . ARG A 1 11  ? 153.145 133.789 148.003 1.00 128.72 ?  52  ARG A NH1 1 
ATOM 83   N NH2 . ARG A 1 11  ? 154.422 132.667 146.486 1.00 139.08 ?  52  ARG A NH2 1 
ATOM 84   N N   . LEU A 1 12  ? 152.523 129.360 151.947 1.00 126.80 ?  53  LEU A N   1 
ATOM 85   C CA  . LEU A 1 12  ? 152.223 129.690 153.339 1.00 133.18 ?  53  LEU A CA  1 
ATOM 86   C C   . LEU A 1 12  ? 152.935 130.978 153.727 1.00 141.29 ?  53  LEU A C   1 
ATOM 87   O O   . LEU A 1 12  ? 153.816 131.447 153.007 1.00 130.58 ?  53  LEU A O   1 
ATOM 88   C CB  . LEU A 1 12  ? 152.637 128.581 154.295 1.00 134.86 ?  53  LEU A CB  1 
ATOM 89   C CG  . LEU A 1 12  ? 151.705 127.394 154.469 1.00 40.81  ?  53  LEU A CG  1 
ATOM 90   C CD1 . LEU A 1 12  ? 151.767 126.481 153.275 1.00 50.94  ?  53  LEU A CD1 1 
ATOM 91   C CD2 . LEU A 1 12  ? 152.049 126.641 155.730 1.00 42.40  ?  53  LEU A CD2 1 
ATOM 92   N N   . LEU A 1 13  ? 152.571 131.548 154.870 1.00 117.04 ?  54  LEU A N   1 
ATOM 93   C CA  . LEU A 1 13  ? 153.056 132.881 155.205 1.00 157.16 ?  54  LEU A CA  1 
ATOM 94   C C   . LEU A 1 13  ? 153.580 133.108 156.630 1.00 190.87 ?  54  LEU A C   1 
ATOM 95   O O   . LEU A 1 13  ? 152.810 133.145 157.586 1.00 191.36 ?  54  LEU A O   1 
ATOM 96   C CB  . LEU A 1 13  ? 151.941 133.878 154.941 1.00 162.88 ?  54  LEU A CB  1 
ATOM 97   C CG  . LEU A 1 13  ? 151.531 134.010 153.486 1.00 94.03  ?  54  LEU A CG  1 
ATOM 98   C CD1 . LEU A 1 13  ? 150.359 134.950 153.382 1.00 80.49  ?  54  LEU A CD1 1 
ATOM 99   C CD2 . LEU A 1 13  ? 152.697 134.523 152.700 1.00 100.04 ?  54  LEU A CD2 1 
ATOM 100  N N   . ASN A 1 14  ? 154.897 133.237 156.760 1.00 185.02 ?  55  ASN A N   1 
ATOM 101  C CA  . ASN A 1 14  ? 155.493 133.937 157.892 1.00 162.87 ?  55  ASN A CA  1 
ATOM 102  C C   . ASN A 1 14  ? 155.198 135.409 157.704 1.00 160.71 ?  55  ASN A C   1 
ATOM 103  O O   . ASN A 1 14  ? 155.221 135.900 156.582 1.00 164.51 ?  55  ASN A O   1 
ATOM 104  C CB  . ASN A 1 14  ? 157.003 133.677 157.979 1.00 137.82 ?  55  ASN A CB  1 
ATOM 105  C CG  . ASN A 1 14  ? 157.645 134.303 159.207 1.00 111.00 ?  55  ASN A CG  1 
ATOM 106  O OD1 . ASN A 1 14  ? 156.987 134.531 160.218 1.00 111.33 ?  55  ASN A OD1 1 
ATOM 107  N ND2 . ASN A 1 14  ? 158.948 134.556 159.130 1.00 85.56  ?  55  ASN A ND2 1 
ATOM 108  N N   . ALA A 1 15  ? 154.934 136.122 158.789 1.00 154.10 ?  56  ALA A N   1 
ATOM 109  C CA  . ALA A 1 15  ? 154.537 137.519 158.681 1.00 166.43 ?  56  ALA A CA  1 
ATOM 110  C C   . ALA A 1 15  ? 155.606 138.359 158.003 1.00 162.39 ?  56  ALA A C   1 
ATOM 111  O O   . ALA A 1 15  ? 155.306 139.336 157.327 1.00 175.51 ?  56  ALA A O   1 
ATOM 112  C CB  . ALA A 1 15  ? 154.232 138.079 160.050 1.00 187.73 ?  56  ALA A CB  1 
ATOM 113  N N   . THR A 1 16  ? 156.857 137.969 158.186 1.00 161.94 ?  57  THR A N   1 
ATOM 114  C CA  . THR A 1 16  ? 157.961 138.666 157.557 1.00 145.05 ?  57  THR A CA  1 
ATOM 115  C C   . THR A 1 16  ? 158.116 138.258 156.103 1.00 128.55 ?  57  THR A C   1 
ATOM 116  O O   . THR A 1 16  ? 158.522 139.055 155.265 1.00 133.46 ?  57  THR A O   1 
ATOM 117  C CB  . THR A 1 16  ? 159.281 138.390 158.300 1.00 167.65 ?  57  THR A CB  1 
ATOM 118  O OG1 . THR A 1 16  ? 159.160 138.822 159.659 1.00 166.91 ?  57  THR A OG1 1 
ATOM 119  C CG2 . THR A 1 16  ? 160.445 139.118 157.646 1.00 164.32 ?  57  THR A CG2 1 
ATOM 120  N N   . HIS A 1 17  ? 157.768 137.017 155.795 1.00 114.49 ?  58  HIS A N   1 
ATOM 121  C CA  . HIS A 1 17  ? 158.250 136.447 154.554 1.00 112.41 ?  58  HIS A CA  1 
ATOM 122  C C   . HIS A 1 17  ? 157.395 135.263 154.087 1.00 118.60 ?  58  HIS A C   1 
ATOM 123  O O   . HIS A 1 17  ? 156.914 134.485 154.905 1.00 121.48 ?  58  HIS A O   1 
ATOM 124  C CB  . HIS A 1 17  ? 159.704 136.033 154.769 1.00 142.50 ?  58  HIS A CB  1 
ATOM 125  C CG  . HIS A 1 17  ? 160.447 135.724 153.514 1.00 154.23 ?  58  HIS A CG  1 
ATOM 126  N ND1 . HIS A 1 17  ? 161.620 135.002 153.508 1.00 156.53 ?  58  HIS A ND1 1 
ATOM 127  C CD2 . HIS A 1 17  ? 160.209 136.067 152.228 1.00 160.37 ?  58  HIS A CD2 1 
ATOM 128  C CE1 . HIS A 1 17  ? 162.062 134.896 152.268 1.00 153.01 ?  58  HIS A CE1 1 
ATOM 129  N NE2 . HIS A 1 17  ? 161.225 135.535 151.472 1.00 155.31 ?  58  HIS A NE2 1 
ATOM 130  N N   . GLN A 1 18  ? 157.206 135.138 152.774 1.00 124.67 ?  59  GLN A N   1 
ATOM 131  C CA  . GLN A 1 18  ? 156.386 134.076 152.187 1.00 113.91 ?  59  GLN A CA  1 
ATOM 132  C C   . GLN A 1 18  ? 157.173 132.803 151.892 1.00 99.80  ?  59  GLN A C   1 
ATOM 133  O O   . GLN A 1 18  ? 158.386 132.852 151.716 1.00 98.71  ?  59  GLN A O   1 
ATOM 134  C CB  . GLN A 1 18  ? 155.746 134.561 150.896 1.00 124.59 ?  59  GLN A CB  1 
ATOM 135  C CG  . GLN A 1 18  ? 156.742 134.789 149.790 1.00 134.97 ?  59  GLN A CG  1 
ATOM 136  C CD  . GLN A 1 18  ? 156.084 135.214 148.497 1.00 144.49 ?  59  GLN A CD  1 
ATOM 137  O OE1 . GLN A 1 18  ? 154.964 135.726 148.494 1.00 143.63 ?  59  GLN A OE1 1 
ATOM 138  N NE2 . GLN A 1 18  ? 156.769 134.984 147.384 1.00 151.29 ?  59  GLN A NE2 1 
ATOM 139  N N   . ILE A 1 19  ? 156.481 131.666 151.813 1.00 110.23 ?  60  ILE A N   1 
ATOM 140  C CA  . ILE A 1 19  ? 157.135 130.390 151.505 1.00 105.28 ?  60  ILE A CA  1 
ATOM 141  C C   . ILE A 1 19  ? 156.355 129.476 150.561 1.00 99.00  ?  60  ILE A C   1 
ATOM 142  O O   . ILE A 1 19  ? 155.128 129.401 150.613 1.00 105.82 ?  60  ILE A O   1 
ATOM 143  C CB  . ILE A 1 19  ? 157.409 129.588 152.779 1.00 120.19 ?  60  ILE A CB  1 
ATOM 144  C CG1 . ILE A 1 19  ? 156.112 129.362 153.543 1.00 90.02  ?  60  ILE A CG1 1 
ATOM 145  C CG2 . ILE A 1 19  ? 158.422 130.288 153.649 1.00 135.14 ?  60  ILE A CG2 1 
ATOM 146  C CD1 . ILE A 1 19  ? 156.266 128.455 154.720 1.00 88.86  ?  60  ILE A CD1 1 
ATOM 147  N N   . GLY A 1 20  ? 157.083 128.756 149.716 1.00 81.22  ?  61  GLY A N   1 
ATOM 148  C CA  . GLY A 1 20  ? 156.475 127.775 148.840 1.00 84.50  ?  61  GLY A CA  1 
ATOM 149  C C   . GLY A 1 20  ? 156.436 128.115 147.362 1.00 90.70  ?  61  GLY A C   1 
ATOM 150  O O   . GLY A 1 20  ? 156.978 129.123 146.923 1.00 98.17  ?  61  GLY A O   1 
ATOM 151  N N   . CYS A 1 21  ? 155.796 127.236 146.599 1.00 89.05  ?  62  CYS A N   1 
ATOM 152  C CA  . CYS A 1 21  ? 155.629 127.381 145.159 1.00 111.53 ?  62  CYS A CA  1 
ATOM 153  C C   . CYS A 1 21  ? 154.649 128.500 144.874 1.00 128.82 ?  62  CYS A C   1 
ATOM 154  O O   . CYS A 1 21  ? 153.813 128.793 145.715 1.00 132.35 ?  62  CYS A O   1 
ATOM 155  C CB  . CYS A 1 21  ? 155.081 126.090 144.558 1.00 42.06  ?  62  CYS A CB  1 
ATOM 156  S SG  . CYS A 1 21  ? 155.985 124.591 144.964 1.00 182.23 ?  62  CYS A SG  1 
ATOM 157  N N   . GLN A 1 22  ? 154.729 129.132 143.709 1.00 130.93 ?  63  GLN A N   1 
ATOM 158  C CA  . GLN A 1 22  ? 153.603 129.950 143.262 1.00 128.34 ?  63  GLN A CA  1 
ATOM 159  C C   . GLN A 1 22  ? 153.504 130.046 141.755 1.00 127.75 ?  63  GLN A C   1 
ATOM 160  O O   . GLN A 1 22  ? 154.195 130.835 141.120 1.00 130.62 ?  63  GLN A O   1 
ATOM 161  C CB  . GLN A 1 22  ? 153.662 131.359 143.835 1.00 105.72 ?  63  GLN A CB  1 
ATOM 162  C CG  . GLN A 1 22  ? 152.390 132.148 143.543 1.00 84.90  ?  63  GLN A CG  1 
ATOM 163  C CD  . GLN A 1 22  ? 152.327 133.502 144.235 1.00 84.23  ?  63  GLN A CD  1 
ATOM 164  O OE1 . GLN A 1 22  ? 153.217 133.872 144.997 1.00 91.00  ?  63  GLN A OE1 1 
ATOM 165  N NE2 . GLN A 1 22  ? 151.257 134.245 143.972 1.00 85.47  ?  63  GLN A NE2 1 
ATOM 166  N N   . SER A 1 23  ? 152.624 129.230 141.196 1.00 125.36 ?  64  SER A N   1 
ATOM 167  C CA  . SER A 1 23  ? 152.407 129.175 139.763 1.00 116.74 ?  64  SER A CA  1 
ATOM 168  C C   . SER A 1 23  ? 151.787 130.436 139.189 1.00 118.73 ?  64  SER A C   1 
ATOM 169  O O   . SER A 1 23  ? 150.946 131.068 139.821 1.00 122.92 ?  64  SER A O   1 
ATOM 170  C CB  . SER A 1 23  ? 151.517 127.985 139.423 1.00 107.91 ?  64  SER A CB  1 
ATOM 171  O OG  . SER A 1 23  ? 151.238 127.952 138.038 1.00 108.52 ?  64  SER A OG  1 
ATOM 172  N N   . SER A 1 24  ? 152.203 130.789 137.979 1.00 125.39 ?  65  SER A N   1 
ATOM 173  C CA  . SER A 1 24  ? 151.545 131.843 137.220 1.00 123.11 ?  65  SER A CA  1 
ATOM 174  C C   . SER A 1 24  ? 150.225 131.335 136.650 1.00 114.03 ?  65  SER A C   1 
ATOM 175  O O   . SER A 1 24  ? 150.060 130.144 136.406 1.00 118.38 ?  65  SER A O   1 
ATOM 176  C CB  . SER A 1 24  ? 152.452 132.357 136.103 1.00 113.88 ?  65  SER A CB  1 
ATOM 177  O OG  . SER A 1 24  ? 151.804 133.358 135.341 1.00 108.34 ?  65  SER A OG  1 
ATOM 178  N N   . ILE A 1 25  ? 149.306 132.261 136.414 1.00 101.64 ?  66  ILE A N   1 
ATOM 179  C CA  . ILE A 1 25  ? 147.928 131.963 136.049 1.00 97.16  ?  66  ILE A CA  1 
ATOM 180  C C   . ILE A 1 25  ? 147.828 131.146 134.766 1.00 109.61 ?  66  ILE A C   1 
ATOM 181  O O   . ILE A 1 25  ? 148.807 130.988 134.042 1.00 112.27 ?  66  ILE A O   1 
ATOM 182  C CB  . ILE A 1 25  ? 147.137 133.274 135.885 1.00 99.56  ?  66  ILE A CB  1 
ATOM 183  C CG1 . ILE A 1 25  ? 145.629 133.029 135.810 1.00 94.69  ?  66  ILE A CG1 1 
ATOM 184  C CG2 . ILE A 1 25  ? 147.606 134.004 134.648 1.00 100.71 ?  66  ILE A CG2 1 
ATOM 185  C CD1 . ILE A 1 25  ? 145.046 132.420 137.047 1.00 95.89  ?  66  ILE A CD1 1 
ATOM 186  N N   . SER A 1 26  ? 146.647 130.583 134.532 1.00 112.35 ?  67  SER A N   1 
ATOM 187  C CA  . SER A 1 26  ? 146.307 129.884 133.299 1.00 110.77 ?  67  SER A CA  1 
ATOM 188  C C   . SER A 1 26  ? 147.143 128.640 133.137 1.00 103.42 ?  67  SER A C   1 
ATOM 189  O O   . SER A 1 26  ? 146.646 127.522 133.266 1.00 102.49 ?  67  SER A O   1 
ATOM 190  C CB  . SER A 1 26  ? 146.497 130.781 132.077 1.00 117.49 ?  67  SER A CB  1 
ATOM 191  O OG  . SER A 1 26  ? 147.870 131.056 131.857 1.00 118.25 ?  67  SER A OG  1 
ATOM 192  N N   . GLY A 1 27  ? 148.419 128.838 132.841 1.00 110.18 ?  68  GLY A N   1 
ATOM 193  C CA  . GLY A 1 27  ? 149.307 127.715 132.660 1.00 112.14 ?  68  GLY A CA  1 
ATOM 194  C C   . GLY A 1 27  ? 150.762 128.084 132.763 1.00 107.03 ?  68  GLY A C   1 
ATOM 195  O O   . GLY A 1 27  ? 151.182 129.132 132.281 1.00 99.30  ?  68  GLY A O   1 
ATOM 196  N N   . ASP A 1 28  ? 151.533 127.213 133.399 1.00 107.25 ?  69  ASP A N   1 
ATOM 197  C CA  . ASP A 1 28  ? 152.972 127.360 133.414 1.00 104.19 ?  69  ASP A CA  1 
ATOM 198  C C   . ASP A 1 28  ? 153.550 126.124 132.759 1.00 95.64  ?  69  ASP A C   1 
ATOM 199  O O   . ASP A 1 28  ? 153.756 125.089 133.395 1.00 92.78  ?  69  ASP A O   1 
ATOM 200  C CB  . ASP A 1 28  ? 153.485 127.553 134.832 1.00 120.42 ?  69  ASP A CB  1 
ATOM 201  C CG  . ASP A 1 28  ? 152.980 128.839 135.452 1.00 132.30 ?  69  ASP A CG  1 
ATOM 202  O OD1 . ASP A 1 28  ? 152.426 129.667 134.705 1.00 132.90 ?  69  ASP A OD1 1 
ATOM 203  O OD2 . ASP A 1 28  ? 153.141 129.030 136.675 1.00 137.96 ?  69  ASP A OD2 1 
ATOM 204  N N   . THR A 1 29  ? 153.743 126.235 131.452 1.00 102.66 ?  70  THR A N   1 
ATOM 205  C CA  . THR A 1 29  ? 154.199 125.130 130.629 1.00 116.26 ?  70  THR A CA  1 
ATOM 206  C C   . THR A 1 29  ? 155.685 124.892 130.735 1.00 129.19 ?  70  THR A C   1 
ATOM 207  O O   . THR A 1 29  ? 156.445 125.805 131.039 1.00 132.12 ?  70  THR A O   1 
ATOM 208  C CB  . THR A 1 29  ? 153.865 125.359 129.154 1.00 116.42 ?  70  THR A CB  1 
ATOM 209  O OG1 . THR A 1 29  ? 154.224 124.193 128.405 1.00 122.91 ?  70  THR A OG1 1 
ATOM 210  C CG2 . THR A 1 29  ? 154.620 126.564 128.614 1.00 111.01 ?  70  THR A CG2 1 
ATOM 211  N N   . GLY A 1 30  ? 156.094 123.660 130.467 1.00 139.18 ?  71  GLY A N   1 
ATOM 212  C CA  . GLY A 1 30  ? 157.503 123.344 130.375 1.00 147.29 ?  71  GLY A CA  1 
ATOM 213  C C   . GLY A 1 30  ? 157.720 122.008 129.713 1.00 150.34 ?  71  GLY A C   1 
ATOM 214  O O   . GLY A 1 30  ? 157.172 121.008 130.152 1.00 143.51 ?  71  GLY A O   1 
ATOM 215  N N   . VAL A 1 31  ? 158.515 121.989 128.653 1.00 151.60 ?  72  VAL A N   1 
ATOM 216  C CA  . VAL A 1 31  ? 158.864 120.741 127.997 1.00 164.27 ?  72  VAL A CA  1 
ATOM 217  C C   . VAL A 1 31  ? 159.642 119.830 128.932 1.00 177.38 ?  72  VAL A C   1 
ATOM 218  O O   . VAL A 1 31  ? 160.479 120.296 129.706 1.00 174.97 ?  72  VAL A O   1 
ATOM 219  C CB  . VAL A 1 31  ? 159.687 121.004 126.747 1.00 222.69 ?  72  VAL A CB  1 
ATOM 220  C CG1 . VAL A 1 31  ? 160.887 121.867 127.092 1.00 222.54 ?  72  VAL A CG1 1 
ATOM 221  C CG2 . VAL A 1 31  ? 160.144 119.697 126.150 1.00 221.43 ?  72  VAL A CG2 1 
ATOM 222  N N   . ILE A 1 32  ? 159.354 118.535 128.886 1.00 186.71 ?  73  ILE A N   1 
ATOM 223  C CA  . ILE A 1 32  ? 160.050 117.622 129.783 1.00 198.40 ?  73  ILE A CA  1 
ATOM 224  C C   . ILE A 1 32  ? 161.523 117.515 129.423 1.00 196.84 ?  73  ILE A C   1 
ATOM 225  O O   . ILE A 1 32  ? 161.873 117.523 128.250 1.00 197.25 ?  73  ILE A O   1 
ATOM 226  C CB  . ILE A 1 32  ? 159.422 116.232 129.754 1.00 208.34 ?  73  ILE A CB  1 
ATOM 227  C CG1 . ILE A 1 32  ? 158.009 116.301 130.308 1.00 210.47 ?  73  ILE A CG1 1 
ATOM 228  C CG2 . ILE A 1 32  ? 160.213 115.266 130.593 1.00 213.82 ?  73  ILE A CG2 1 
ATOM 229  C CD1 . ILE A 1 32  ? 156.971 116.434 129.246 1.00 213.28 ?  73  ILE A CD1 1 
ATOM 230  N N   . HIS A 1 33  ? 162.389 117.438 130.428 1.00 200.68 ?  74  HIS A N   1 
ATOM 231  C CA  . HIS A 1 33  ? 163.752 116.978 130.195 1.00 192.20 ?  74  HIS A CA  1 
ATOM 232  C C   . HIS A 1 33  ? 164.287 116.288 131.436 1.00 190.10 ?  74  HIS A C   1 
ATOM 233  O O   . HIS A 1 33  ? 164.796 116.926 132.354 1.00 191.39 ?  74  HIS A O   1 
ATOM 234  C CB  . HIS A 1 33  ? 164.667 118.123 129.789 1.00 186.20 ?  74  HIS A CB  1 
ATOM 235  C CG  . HIS A 1 33  ? 166.028 117.674 129.356 1.00 181.84 ?  74  HIS A CG  1 
ATOM 236  N ND1 . HIS A 1 33  ? 166.225 116.832 128.283 1.00 178.59 ?  74  HIS A ND1 1 
ATOM 237  C CD2 . HIS A 1 33  ? 167.258 117.961 129.838 1.00 183.93 ?  74  HIS A CD2 1 
ATOM 238  C CE1 . HIS A 1 33  ? 167.519 116.616 128.128 1.00 178.78 ?  74  HIS A CE1 1 
ATOM 239  N NE2 . HIS A 1 33  ? 168.169 117.290 129.059 1.00 181.75 ?  74  HIS A NE2 1 
ATOM 240  N N   . VAL A 1 34  ? 164.181 114.967 131.435 1.00 181.38 ?  75  VAL A N   1 
ATOM 241  C CA  . VAL A 1 34  ? 164.467 114.158 132.604 1.00 166.13 ?  75  VAL A CA  1 
ATOM 242  C C   . VAL A 1 34  ? 165.911 114.265 133.058 1.00 160.97 ?  75  VAL A C   1 
ATOM 243  O O   . VAL A 1 34  ? 166.812 114.495 132.257 1.00 159.87 ?  75  VAL A O   1 
ATOM 244  C CB  . VAL A 1 34  ? 164.153 112.685 132.331 1.00 165.49 ?  75  VAL A CB  1 
ATOM 245  C CG1 . VAL A 1 34  ? 162.684 112.514 132.033 1.00 164.30 ?  75  VAL A CG1 1 
ATOM 246  C CG2 . VAL A 1 34  ? 164.976 112.186 131.170 1.00 219.97 ?  75  VAL A CG2 1 
ATOM 247  N N   . VAL A 1 35  ? 166.120 114.135 134.359 1.00 161.71 ?  76  VAL A N   1 
ATOM 248  C CA  . VAL A 1 35  ? 167.459 113.963 134.881 1.00 170.70 ?  76  VAL A CA  1 
ATOM 249  C C   . VAL A 1 35  ? 167.643 112.564 135.421 1.00 183.31 ?  76  VAL A C   1 
ATOM 250  O O   . VAL A 1 35  ? 167.015 112.179 136.405 1.00 187.76 ?  76  VAL A O   1 
ATOM 251  C CB  . VAL A 1 35  ? 167.783 114.958 135.984 1.00 169.69 ?  76  VAL A CB  1 
ATOM 252  C CG1 . VAL A 1 35  ? 169.085 114.570 136.644 1.00 167.45 ?  76  VAL A CG1 1 
ATOM 253  C CG2 . VAL A 1 35  ? 167.887 116.350 135.408 1.00 167.45 ?  76  VAL A CG2 1 
ATOM 254  N N   . GLU A 1 36  ? 168.502 111.798 134.763 1.00 189.11 ?  77  GLU A N   1 
ATOM 255  C CA  . GLU A 1 36  ? 168.842 110.475 135.251 1.00 205.65 ?  77  GLU A CA  1 
ATOM 256  C C   . GLU A 1 36  ? 170.125 110.582 136.069 1.00 222.35 ?  77  GLU A C   1 
ATOM 257  O O   . GLU A 1 36  ? 170.386 109.768 136.951 1.00 224.69 ?  77  GLU A O   1 
ATOM 258  C CB  . GLU A 1 36  ? 169.008 109.494 134.086 1.00 205.83 ?  77  GLU A CB  1 
ATOM 259  C CG  . GLU A 1 36  ? 169.053 108.022 134.482 1.00 150.77 ?  77  GLU A CG  1 
ATOM 260  C CD  . GLU A 1 36  ? 170.382 107.592 135.057 1.00 146.24 ?  77  GLU A CD  1 
ATOM 261  O OE1 . GLU A 1 36  ? 171.402 108.246 134.760 1.00 144.51 ?  77  GLU A OE1 1 
ATOM 262  O OE2 . GLU A 1 36  ? 170.404 106.602 135.816 1.00 144.70 ?  77  GLU A OE2 1 
ATOM 263  N N   . LYS A 1 37  ? 170.915 111.610 135.783 1.00 212.41 ?  78  LYS A N   1 
ATOM 264  C CA  . LYS A 1 37  ? 172.231 111.746 136.385 1.00 231.75 ?  78  LYS A CA  1 
ATOM 265  C C   . LYS A 1 37  ? 172.751 113.163 136.313 1.00 247.13 ?  78  LYS A C   1 
ATOM 266  O O   . LYS A 1 37  ? 172.071 114.060 135.828 1.00 250.20 ?  78  LYS A O   1 
ATOM 267  C CB  . LYS A 1 37  ? 173.217 110.806 135.708 1.00 189.20 ?  78  LYS A CB  1 
ATOM 268  C CG  . LYS A 1 37  ? 173.331 111.026 134.212 1.00 190.08 ?  78  LYS A CG  1 
ATOM 269  C CD  . LYS A 1 37  ? 174.320 110.051 133.594 1.00 170.02 ?  78  LYS A CD  1 
ATOM 270  C CE  . LYS A 1 37  ? 174.344 110.155 132.078 1.00 168.98 ?  78  LYS A CE  1 
ATOM 271  N NZ  . LYS A 1 37  ? 173.056 109.714 131.477 1.00 169.32 ?  78  LYS A NZ  1 
ATOM 272  N N   . GLU A 1 38  ? 173.970 113.353 136.797 1.00 226.91 ?  79  GLU A N   1 
ATOM 273  C CA  . GLU A 1 38  ? 174.587 114.665 136.814 1.00 242.28 ?  79  GLU A CA  1 
ATOM 274  C C   . GLU A 1 38  ? 174.699 115.250 135.424 1.00 265.88 ?  79  GLU A C   1 
ATOM 275  O O   . GLU A 1 38  ? 174.597 116.463 135.241 1.00 266.13 ?  79  GLU A O   1 
ATOM 276  C CB  . GLU A 1 38  ? 175.975 114.587 137.444 1.00 236.09 ?  79  GLU A CB  1 
ATOM 277  C CG  . GLU A 1 38  ? 176.741 115.892 137.396 1.00 226.67 ?  79  GLU A CG  1 
ATOM 278  C CD  . GLU A 1 38  ? 176.117 116.982 138.238 1.00 221.39 ?  79  GLU A CD  1 
ATOM 279  O OE1 . GLU A 1 38  ? 175.314 116.659 139.136 1.00 219.50 ?  79  GLU A OE1 1 
ATOM 280  O OE2 . GLU A 1 38  ? 176.419 118.167 137.987 1.00 216.43 ?  79  GLU A OE2 1 
ATOM 281  N N   . GLU A 1 39  ? 174.880 114.382 134.440 1.00 252.97 ?  80  GLU A N   1 
ATOM 282  C CA  . GLU A 1 39  ? 175.087 114.845 133.083 1.00 247.81 ?  80  GLU A CA  1 
ATOM 283  C C   . GLU A 1 39  ? 173.896 115.670 132.633 1.00 228.53 ?  80  GLU A C   1 
ATOM 284  O O   . GLU A 1 39  ? 174.049 116.740 132.044 1.00 229.11 ?  80  GLU A O   1 
ATOM 285  C CB  . GLU A 1 39  ? 175.310 113.661 132.148 1.00 258.17 ?  80  GLU A CB  1 
ATOM 286  C CG  . GLU A 1 39  ? 176.553 112.863 132.479 1.00 258.16 ?  80  GLU A CG  1 
ATOM 287  C CD  . GLU A 1 39  ? 177.801 113.718 132.476 1.00 273.05 ?  80  GLU A CD  1 
ATOM 288  O OE1 . GLU A 1 39  ? 177.923 114.594 131.594 1.00 278.16 ?  80  GLU A OE1 1 
ATOM 289  O OE2 . GLU A 1 39  ? 178.657 113.520 133.363 1.00 277.39 ?  80  GLU A OE2 1 
ATOM 290  N N   . ASP A 1 40  ? 172.707 115.198 132.978 1.00 251.96 ?  81  ASP A N   1 
ATOM 291  C CA  . ASP A 1 40  ? 171.504 115.945 132.686 1.00 231.37 ?  81  ASP A CA  1 
ATOM 292  C C   . ASP A 1 40  ? 171.551 117.245 133.455 1.00 223.75 ?  81  ASP A C   1 
ATOM 293  O O   . ASP A 1 40  ? 171.093 118.273 132.986 1.00 207.66 ?  81  ASP A O   1 
ATOM 294  C CB  . ASP A 1 40  ? 170.266 115.143 133.074 1.00 225.62 ?  81  ASP A CB  1 
ATOM 295  C CG  . ASP A 1 40  ? 170.104 113.896 132.243 1.00 222.47 ?  81  ASP A CG  1 
ATOM 296  O OD1 . ASP A 1 40  ? 170.752 113.812 131.181 1.00 224.11 ?  81  ASP A OD1 1 
ATOM 297  O OD2 . ASP A 1 40  ? 169.340 112.996 132.650 1.00 222.34 ?  81  ASP A OD2 1 
ATOM 298  N N   . LEU A 1 41  ? 172.122 117.184 134.650 1.00 225.47 ?  82  LEU A N   1 
ATOM 299  C CA  . LEU A 1 41  ? 172.123 118.332 135.535 1.00 234.28 ?  82  LEU A CA  1 
ATOM 300  C C   . LEU A 1 41  ? 172.935 119.476 134.955 1.00 253.16 ?  82  LEU A C   1 
ATOM 301  O O   . LEU A 1 41  ? 172.575 120.637 135.133 1.00 258.27 ?  82  LEU A O   1 
ATOM 302  C CB  . LEU A 1 41  ? 172.634 117.927 136.918 1.00 214.51 ?  82  LEU A CB  1 
ATOM 303  C CG  . LEU A 1 41  ? 171.665 116.930 137.559 1.00 200.26 ?  82  LEU A CG  1 
ATOM 304  C CD1 . LEU A 1 41  ? 172.190 116.330 138.854 1.00 202.38 ?  82  LEU A CD1 1 
ATOM 305  C CD2 . LEU A 1 41  ? 170.340 117.634 137.795 1.00 186.30 ?  82  LEU A CD2 1 
ATOM 306  N N   . GLN A 1 42  ? 174.016 119.173 134.245 1.00 271.20 ?  83  GLN A N   1 
ATOM 307  C CA  . GLN A 1 42  ? 174.633 120.244 133.477 1.00 286.92 ?  83  GLN A CA  1 
ATOM 308  C C   . GLN A 1 42  ? 173.785 120.546 132.269 1.00 286.09 ?  83  GLN A C   1 
ATOM 309  O O   . GLN A 1 42  ? 173.653 121.693 131.879 1.00 283.30 ?  83  GLN A O   1 
ATOM 310  C CB  . GLN A 1 42  ? 176.050 119.912 133.008 1.00 283.00 ?  83  GLN A CB  1 
ATOM 311  C CG  . GLN A 1 42  ? 177.079 119.749 134.097 1.00 170.99 ?  83  GLN A CG  1 
ATOM 312  C CD  . GLN A 1 42  ? 177.231 118.315 134.523 1.00 172.18 ?  83  GLN A CD  1 
ATOM 313  O OE1 . GLN A 1 42  ? 176.604 117.423 133.960 1.00 170.20 ?  83  GLN A OE1 1 
ATOM 314  N NE2 . GLN A 1 42  ? 178.075 118.080 135.516 1.00 172.51 ?  83  GLN A NE2 1 
ATOM 315  N N   . TRP A 1 43  ? 173.191 119.509 131.691 1.00 282.51 ?  84  TRP A N   1 
ATOM 316  C CA  . TRP A 1 43  ? 172.643 119.624 130.345 1.00 286.22 ?  84  TRP A CA  1 
ATOM 317  C C   . TRP A 1 43  ? 171.153 119.909 130.258 1.00 213.26 ?  84  TRP A C   1 
ATOM 318  O O   . TRP A 1 43  ? 170.507 119.543 129.283 1.00 210.23 ?  84  TRP A O   1 
ATOM 319  C CB  . TRP A 1 43  ? 172.959 118.369 129.533 1.00 286.94 ?  84  TRP A CB  1 
ATOM 320  C CG  . TRP A 1 43  ? 174.386 118.315 129.087 1.00 285.16 ?  84  TRP A CG  1 
ATOM 321  C CD1 . TRP A 1 43  ? 175.388 117.540 129.595 1.00 286.81 ?  84  TRP A CD1 1 
ATOM 322  C CD2 . TRP A 1 43  ? 174.982 119.128 128.075 1.00 284.86 ?  84  TRP A CD2 1 
ATOM 323  N NE1 . TRP A 1 43  ? 176.564 117.793 128.931 1.00 283.57 ?  84  TRP A NE1 1 
ATOM 324  C CE2 . TRP A 1 43  ? 176.341 118.770 127.996 1.00 283.28 ?  84  TRP A CE2 1 
ATOM 325  C CE3 . TRP A 1 43  ? 174.493 120.117 127.216 1.00 280.72 ?  84  TRP A CE3 1 
ATOM 326  C CZ2 . TRP A 1 43  ? 177.216 119.365 127.092 1.00 282.80 ?  84  TRP A CZ2 1 
ATOM 327  C CZ3 . TRP A 1 43  ? 175.361 120.706 126.322 1.00 278.40 ?  84  TRP A CZ3 1 
ATOM 328  C CH2 . TRP A 1 43  ? 176.707 120.330 126.265 1.00 279.43 ?  84  TRP A CH2 1 
ATOM 329  N N   . VAL A 1 44  ? 170.600 120.517 131.295 1.00 232.66 ?  85  VAL A N   1 
ATOM 330  C CA  . VAL A 1 44  ? 169.302 121.148 131.176 1.00 236.37 ?  85  VAL A CA  1 
ATOM 331  C C   . VAL A 1 44  ? 169.606 122.617 131.108 1.00 243.44 ?  85  VAL A C   1 
ATOM 332  O O   . VAL A 1 44  ? 169.122 123.351 130.251 1.00 236.58 ?  85  VAL A O   1 
ATOM 333  C CB  . VAL A 1 44  ? 168.384 120.880 132.368 1.00 230.99 ?  85  VAL A CB  1 
ATOM 334  C CG1 . VAL A 1 44  ? 167.063 121.589 132.164 1.00 226.15 ?  85  VAL A CG1 1 
ATOM 335  C CG2 . VAL A 1 44  ? 168.186 119.394 132.583 1.00 231.57 ?  85  VAL A CG2 1 
ATOM 336  N N   . LEU A 1 45  ? 170.450 123.017 132.045 1.00 262.44 ?  86  LEU A N   1 
ATOM 337  C CA  . LEU A 1 45  ? 170.902 124.377 132.163 1.00 263.60 ?  86  LEU A CA  1 
ATOM 338  C C   . LEU A 1 45  ? 171.673 124.731 130.910 1.00 272.82 ?  86  LEU A C   1 
ATOM 339  O O   . LEU A 1 45  ? 171.626 125.852 130.421 1.00 267.72 ?  86  LEU A O   1 
ATOM 340  C CB  . LEU A 1 45  ? 171.797 124.510 133.384 1.00 255.31 ?  86  LEU A CB  1 
ATOM 341  C CG  . LEU A 1 45  ? 171.171 123.919 134.643 1.00 246.66 ?  86  LEU A CG  1 
ATOM 342  C CD1 . LEU A 1 45  ? 172.136 123.987 135.814 1.00 245.91 ?  86  LEU A CD1 1 
ATOM 343  C CD2 . LEU A 1 45  ? 169.854 124.588 134.969 1.00 243.02 ?  86  LEU A CD2 1 
ATOM 344  N N   . THR A 1 46  ? 172.367 123.737 130.377 1.00 288.61 ?  87  THR A N   1 
ATOM 345  C CA  . THR A 1 46  ? 173.223 123.931 129.225 1.00 289.51 ?  87  THR A CA  1 
ATOM 346  C C   . THR A 1 46  ? 172.696 123.182 128.018 1.00 209.94 ?  87  THR A C   1 
ATOM 347  O O   . THR A 1 46  ? 173.388 123.053 127.012 1.00 202.48 ?  87  THR A O   1 
ATOM 348  C CB  . THR A 1 46  ? 174.649 123.477 129.514 1.00 196.76 ?  87  THR A CB  1 
ATOM 349  O OG1 . THR A 1 46  ? 174.640 122.089 129.860 1.00 195.75 ?  87  THR A OG1 1 
ATOM 350  C CG2 . THR A 1 46  ? 175.217 124.268 130.674 1.00 198.13 ?  87  THR A CG2 1 
ATOM 351  N N   . ASP A 1 47  ? 171.477 122.667 128.127 1.00 228.46 ?  88  ASP A N   1 
ATOM 352  C CA  . ASP A 1 47  ? 170.819 122.105 126.962 1.00 234.06 ?  88  ASP A CA  1 
ATOM 353  C C   . ASP A 1 47  ? 170.632 123.270 126.010 1.00 237.58 ?  88  ASP A C   1 
ATOM 354  O O   . ASP A 1 47  ? 171.383 123.435 125.052 1.00 248.82 ?  88  ASP A O   1 
ATOM 355  C CB  . ASP A 1 47  ? 169.485 121.462 127.327 1.00 156.55 ?  88  ASP A CB  1 
ATOM 356  C CG  . ASP A 1 47  ? 168.931 120.594 126.219 1.00 157.67 ?  88  ASP A CG  1 
ATOM 357  O OD1 . ASP A 1 47  ? 169.532 120.545 125.128 1.00 159.36 ?  88  ASP A OD1 1 
ATOM 358  O OD2 . ASP A 1 47  ? 167.897 119.941 126.451 1.00 155.60 ?  88  ASP A OD2 1 
ATOM 359  N N   . GLY A 1 48  ? 169.623 124.085 126.287 1.00 214.64 ?  89  GLY A N   1 
ATOM 360  C CA  . GLY A 1 48  ? 169.498 125.383 125.654 1.00 211.61 ?  89  GLY A CA  1 
ATOM 361  C C   . GLY A 1 48  ? 168.839 125.582 124.297 1.00 211.45 ?  89  GLY A C   1 
ATOM 362  O O   . GLY A 1 48  ? 168.782 126.717 123.831 1.00 224.89 ?  89  GLY A O   1 
ATOM 363  N N   . PRO A 1 49  ? 168.356 124.518 123.631 1.00 197.42 ?  90  PRO A N   1 
ATOM 364  C CA  . PRO A 1 49  ? 167.609 124.971 122.458 1.00 167.16 ?  90  PRO A CA  1 
ATOM 365  C C   . PRO A 1 49  ? 166.239 125.535 122.813 1.00 147.13 ?  90  PRO A C   1 
ATOM 366  O O   . PRO A 1 49  ? 165.830 126.533 122.229 1.00 141.01 ?  90  PRO A O   1 
ATOM 367  C CB  . PRO A 1 49  ? 167.475 123.702 121.618 1.00 163.67 ?  90  PRO A CB  1 
ATOM 368  C CG  . PRO A 1 49  ? 167.578 122.599 122.597 1.00 199.46 ?  90  PRO A CG  1 
ATOM 369  C CD  . PRO A 1 49  ? 168.597 123.066 123.579 1.00 200.98 ?  90  PRO A CD  1 
ATOM 370  N N   . ASN A 1 50  ? 165.547 124.917 123.761 1.00 154.71 ?  91  ASN A N   1 
ATOM 371  C CA  . ASN A 1 50  ? 164.193 125.339 124.094 1.00 153.21 ?  91  ASN A CA  1 
ATOM 372  C C   . ASN A 1 50  ? 163.985 125.520 125.582 1.00 164.61 ?  91  ASN A C   1 
ATOM 373  O O   . ASN A 1 50  ? 163.328 124.716 126.220 1.00 166.85 ?  91  ASN A O   1 
ATOM 374  C CB  . ASN A 1 50  ? 163.197 124.335 123.543 1.00 150.55 ?  91  ASN A CB  1 
ATOM 375  C CG  . ASN A 1 50  ? 163.138 124.363 122.039 1.00 154.54 ?  91  ASN A CG  1 
ATOM 376  O OD1 . ASN A 1 50  ? 163.441 125.378 121.415 1.00 161.67 ?  91  ASN A OD1 1 
ATOM 377  N ND2 . ASN A 1 50  ? 162.767 123.243 121.442 1.00 151.11 ?  91  ASN A ND2 1 
ATOM 378  N N   . PRO A 1 51  ? 164.471 126.637 126.119 1.00 164.66 ?  92  PRO A N   1 
ATOM 379  C CA  . PRO A 1 51  ? 164.718 126.833 127.550 1.00 168.60 ?  92  PRO A CA  1 
ATOM 380  C C   . PRO A 1 51  ? 163.542 126.652 128.526 1.00 202.47 ?  92  PRO A C   1 
ATOM 381  O O   . PRO A 1 51  ? 163.817 126.253 129.656 1.00 203.12 ?  92  PRO A O   1 
ATOM 382  C CB  . PRO A 1 51  ? 165.236 128.278 127.605 1.00 171.72 ?  92  PRO A CB  1 
ATOM 383  C CG  . PRO A 1 51  ? 164.820 128.902 126.315 1.00 171.98 ?  92  PRO A CG  1 
ATOM 384  C CD  . PRO A 1 51  ? 164.904 127.797 125.329 1.00 167.90 ?  92  PRO A CD  1 
ATOM 385  N N   . PRO A 1 52  ? 162.283 126.928 128.142 1.00 194.58 ?  93  PRO A N   1 
ATOM 386  C CA  . PRO A 1 52  ? 161.261 126.664 129.166 1.00 183.75 ?  93  PRO A CA  1 
ATOM 387  C C   . PRO A 1 52  ? 161.145 125.181 129.515 1.00 187.22 ?  93  PRO A C   1 
ATOM 388  O O   . PRO A 1 52  ? 160.142 124.534 129.226 1.00 183.88 ?  93  PRO A O   1 
ATOM 389  C CB  . PRO A 1 52  ? 159.977 127.161 128.509 1.00 179.86 ?  93  PRO A CB  1 
ATOM 390  C CG  . PRO A 1 52  ? 160.434 128.159 127.514 1.00 170.70 ?  93  PRO A CG  1 
ATOM 391  C CD  . PRO A 1 52  ? 161.697 127.588 126.966 1.00 194.75 ?  93  PRO A CD  1 
ATOM 392  N N   . TYR A 1 53  ? 162.200 124.664 130.128 1.00 182.92 ?  94  TYR A N   1 
ATOM 393  C CA  . TYR A 1 53  ? 162.311 123.270 130.524 1.00 184.09 ?  94  TYR A CA  1 
ATOM 394  C C   . TYR A 1 53  ? 161.552 123.006 131.811 1.00 186.83 ?  94  TYR A C   1 
ATOM 395  O O   . TYR A 1 53  ? 161.225 123.941 132.533 1.00 185.30 ?  94  TYR A O   1 
ATOM 396  C CB  . TYR A 1 53  ? 163.782 122.908 130.697 1.00 194.20 ?  94  TYR A CB  1 
ATOM 397  C CG  . TYR A 1 53  ? 164.584 123.034 129.427 1.00 203.40 ?  94  TYR A CG  1 
ATOM 398  C CD1 . TYR A 1 53  ? 164.158 122.437 128.253 1.00 209.29 ?  94  TYR A CD1 1 
ATOM 399  C CD2 . TYR A 1 53  ? 165.733 123.807 129.387 1.00 204.29 ?  94  TYR A CD2 1 
ATOM 400  C CE1 . TYR A 1 53  ? 164.886 122.555 127.090 1.00 211.20 ?  94  TYR A CE1 1 
ATOM 401  C CE2 . TYR A 1 53  ? 166.458 123.943 128.226 1.00 205.64 ?  94  TYR A CE2 1 
ATOM 402  C CZ  . TYR A 1 53  ? 166.024 123.322 127.079 1.00 209.57 ?  94  TYR A CZ  1 
ATOM 403  O OH  . TYR A 1 53  ? 166.742 123.455 125.920 1.00 210.91 ?  94  TYR A OH  1 
ATOM 404  N N   . MET A 1 54  ? 161.235 121.743 132.078 1.00 189.51 ?  95  MET A N   1 
ATOM 405  C CA  . MET A 1 54  ? 160.861 121.352 133.432 1.00 185.18 ?  95  MET A CA  1 
ATOM 406  C C   . MET A 1 54  ? 161.250 119.907 133.733 1.00 181.49 ?  95  MET A C   1 
ATOM 407  O O   . MET A 1 54  ? 160.834 118.966 133.061 1.00 183.18 ?  95  MET A O   1 
ATOM 408  C CB  . MET A 1 54  ? 159.374 121.570 133.672 1.00 186.99 ?  95  MET A CB  1 
ATOM 409  C CG  . MET A 1 54  ? 158.460 120.690 132.881 1.00 197.72 ?  95  MET A CG  1 
ATOM 410  S SD  . MET A 1 54  ? 156.765 120.944 133.403 1.00 169.98 ?  95  MET A SD  1 
ATOM 411  C CE  . MET A 1 54  ? 156.779 120.086 134.973 1.00 96.70  ?  95  MET A CE  1 
ATOM 412  N N   . VAL A 1 55  ? 162.093 119.758 134.745 1.00 153.73 ?  96  VAL A N   1 
ATOM 413  C CA  . VAL A 1 55  ? 162.690 118.479 135.095 1.00 144.91 ?  96  VAL A CA  1 
ATOM 414  C C   . VAL A 1 55  ? 161.783 117.541 135.891 1.00 129.63 ?  96  VAL A C   1 
ATOM 415  O O   . VAL A 1 55  ? 160.910 117.987 136.631 1.00 128.64 ?  96  VAL A O   1 
ATOM 416  C CB  . VAL A 1 55  ? 163.965 118.725 135.890 1.00 155.34 ?  96  VAL A CB  1 
ATOM 417  C CG1 . VAL A 1 55  ? 163.635 119.454 137.167 1.00 162.25 ?  96  VAL A CG1 1 
ATOM 418  C CG2 . VAL A 1 55  ? 164.683 117.430 136.177 1.00 158.15 ?  96  VAL A CG2 1 
ATOM 419  N N   . LEU A 1 56  ? 161.995 116.239 135.730 1.00 136.76 ?  97  LEU A N   1 
ATOM 420  C CA  . LEU A 1 56  ? 161.357 115.235 136.569 1.00 127.39 ?  97  LEU A CA  1 
ATOM 421  C C   . LEU A 1 56  ? 162.365 114.564 137.479 1.00 130.97 ?  97  LEU A C   1 
ATOM 422  O O   . LEU A 1 56  ? 162.896 113.511 137.140 1.00 134.09 ?  97  LEU A O   1 
ATOM 423  C CB  . LEU A 1 56  ? 160.683 114.168 135.725 1.00 138.99 ?  97  LEU A CB  1 
ATOM 424  C CG  . LEU A 1 56  ? 159.288 114.460 135.193 1.00 161.21 ?  97  LEU A CG  1 
ATOM 425  C CD1 . LEU A 1 56  ? 159.319 115.584 134.168 1.00 169.36 ?  97  LEU A CD1 1 
ATOM 426  C CD2 . LEU A 1 56  ? 158.692 113.195 134.607 1.00 168.49 ?  97  LEU A CD2 1 
ATOM 427  N N   . LEU A 1 57  ? 162.636 115.155 138.630 1.00 143.37 ?  98  LEU A N   1 
ATOM 428  C CA  . LEU A 1 57  ? 163.655 114.595 139.501 1.00 140.49 ?  98  LEU A CA  1 
ATOM 429  C C   . LEU A 1 57  ? 163.267 113.314 140.214 1.00 148.98 ?  98  LEU A C   1 
ATOM 430  O O   . LEU A 1 57  ? 162.125 113.123 140.651 1.00 148.68 ?  98  LEU A O   1 
ATOM 431  C CB  . LEU A 1 57  ? 164.082 115.624 140.530 1.00 136.88 ?  98  LEU A CB  1 
ATOM 432  C CG  . LEU A 1 57  ? 164.841 116.752 139.851 1.00 130.79 ?  98  LEU A CG  1 
ATOM 433  C CD1 . LEU A 1 57  ? 165.214 117.822 140.853 1.00 130.89 ?  98  LEU A CD1 1 
ATOM 434  C CD2 . LEU A 1 57  ? 166.066 116.181 139.173 1.00 126.68 ?  98  LEU A CD2 1 
ATOM 435  N N   . GLU A 1 58  ? 164.256 112.443 140.337 1.00 154.94 ?  99  GLU A N   1 
ATOM 436  C CA  . GLU A 1 58  ? 164.178 111.319 141.239 1.00 161.65 ?  99  GLU A CA  1 
ATOM 437  C C   . GLU A 1 58  ? 164.260 111.787 142.666 1.00 152.38 ?  99  GLU A C   1 
ATOM 438  O O   . GLU A 1 58  ? 164.852 112.822 142.966 1.00 151.83 ?  99  GLU A O   1 
ATOM 439  C CB  . GLU A 1 58  ? 165.292 110.324 140.960 1.00 176.16 ?  99  GLU A CB  1 
ATOM 440  C CG  . GLU A 1 58  ? 165.075 109.560 139.699 1.00 186.27 ?  99  GLU A CG  1 
ATOM 441  C CD  . GLU A 1 58  ? 163.787 108.779 139.759 1.00 187.04 ?  99  GLU A CD  1 
ATOM 442  O OE1 . GLU A 1 58  ? 163.495 108.200 140.826 1.00 190.45 ?  99  GLU A OE1 1 
ATOM 443  O OE2 . GLU A 1 58  ? 163.058 108.759 138.749 1.00 186.81 ?  99  GLU A OE2 1 
ATOM 444  N N   . SER A 1 59  ? 163.667 111.000 143.545 1.00 139.22 ?  100 SER A N   1 
ATOM 445  C CA  . SER A 1 59  ? 163.652 111.321 144.951 1.00 126.06 ?  100 SER A CA  1 
ATOM 446  C C   . SER A 1 59  ? 165.065 111.424 145.497 1.00 139.56 ?  100 SER A C   1 
ATOM 447  O O   . SER A 1 59  ? 165.350 112.252 146.357 1.00 142.64 ?  100 SER A O   1 
ATOM 448  C CB  . SER A 1 59  ? 162.869 110.256 145.706 1.00 107.92 ?  100 SER A CB  1 
ATOM 449  O OG  . SER A 1 59  ? 162.911 110.494 147.093 1.00 103.78 ?  100 SER A OG  1 
ATOM 450  N N   . LYS A 1 60  ? 165.952 110.595 144.966 1.00 145.01 ?  101 LYS A N   1 
ATOM 451  C CA  . LYS A 1 60  ? 167.323 110.531 145.442 1.00 142.17 ?  101 LYS A CA  1 
ATOM 452  C C   . LYS A 1 60  ? 168.056 111.830 145.201 1.00 132.11 ?  101 LYS A C   1 
ATOM 453  O O   . LYS A 1 60  ? 168.676 112.393 146.099 1.00 120.91 ?  101 LYS A O   1 
ATOM 454  C CB  . LYS A 1 60  ? 168.080 109.419 144.727 1.00 154.23 ?  101 LYS A CB  1 
ATOM 455  C CG  . LYS A 1 60  ? 167.593 108.017 144.985 1.00 156.39 ?  101 LYS A CG  1 
ATOM 456  C CD  . LYS A 1 60  ? 168.527 107.050 144.289 1.00 167.00 ?  101 LYS A CD  1 
ATOM 457  C CE  . LYS A 1 60  ? 168.504 107.294 142.784 1.00 166.24 ?  101 LYS A CE  1 
ATOM 458  N NZ  . LYS A 1 60  ? 169.347 106.339 142.022 1.00 165.81 ?  101 LYS A NZ  1 
ATOM 459  N N   . HIS A 1 61  ? 167.965 112.296 143.965 1.00 146.17 ?  102 HIS A N   1 
ATOM 460  C CA  . HIS A 1 61  ? 168.853 113.332 143.475 1.00 151.69 ?  102 HIS A CA  1 
ATOM 461  C C   . HIS A 1 61  ? 168.535 114.662 144.113 1.00 156.34 ?  102 HIS A C   1 
ATOM 462  O O   . HIS A 1 61  ? 169.362 115.568 144.130 1.00 157.86 ?  102 HIS A O   1 
ATOM 463  C CB  . HIS A 1 61  ? 168.744 113.449 141.963 1.00 171.34 ?  102 HIS A CB  1 
ATOM 464  C CG  . HIS A 1 61  ? 168.915 112.149 141.247 1.00 169.87 ?  102 HIS A CG  1 
ATOM 465  N ND1 . HIS A 1 61  ? 168.662 112.007 139.900 1.00 166.26 ?  102 HIS A ND1 1 
ATOM 466  C CD2 . HIS A 1 61  ? 169.267 110.922 141.696 1.00 171.33 ?  102 HIS A CD2 1 
ATOM 467  C CE1 . HIS A 1 61  ? 168.876 110.754 139.545 1.00 166.70 ?  102 HIS A CE1 1 
ATOM 468  N NE2 . HIS A 1 61  ? 169.241 110.074 140.617 1.00 170.28 ?  102 HIS A NE2 1 
ATOM 469  N N   . PHE A 1 62  ? 167.317 114.779 144.623 1.00 153.41 ?  103 PHE A N   1 
ATOM 470  C CA  . PHE A 1 62  ? 166.852 116.046 145.150 1.00 152.61 ?  103 PHE A CA  1 
ATOM 471  C C   . PHE A 1 62  ? 167.692 116.478 146.335 1.00 150.98 ?  103 PHE A C   1 
ATOM 472  O O   . PHE A 1 62  ? 167.945 115.695 147.244 1.00 149.50 ?  103 PHE A O   1 
ATOM 473  C CB  . PHE A 1 62  ? 165.389 115.941 145.554 1.00 150.28 ?  103 PHE A CB  1 
ATOM 474  C CG  . PHE A 1 62  ? 164.820 117.212 146.099 1.00 146.56 ?  103 PHE A CG  1 
ATOM 475  C CD1 . PHE A 1 62  ? 164.422 118.221 145.244 1.00 143.81 ?  103 PHE A CD1 1 
ATOM 476  C CD2 . PHE A 1 62  ? 164.667 117.393 147.458 1.00 145.65 ?  103 PHE A CD2 1 
ATOM 477  C CE1 . PHE A 1 62  ? 163.891 119.388 145.732 1.00 139.83 ?  103 PHE A CE1 1 
ATOM 478  C CE2 . PHE A 1 62  ? 164.133 118.561 147.952 1.00 144.45 ?  103 PHE A CE2 1 
ATOM 479  C CZ  . PHE A 1 62  ? 163.746 119.559 147.087 1.00 141.72 ?  103 PHE A CZ  1 
ATOM 480  N N   . THR A 1 63  ? 168.100 117.739 146.322 1.00 156.79 ?  104 THR A N   1 
ATOM 481  C CA  . THR A 1 63  ? 168.947 118.291 147.366 1.00 157.58 ?  104 THR A CA  1 
ATOM 482  C C   . THR A 1 63  ? 169.033 119.790 147.242 1.00 175.92 ?  104 THR A C   1 
ATOM 483  O O   . THR A 1 63  ? 168.728 120.353 146.195 1.00 175.81 ?  104 THR A O   1 
ATOM 484  C CB  . THR A 1 63  ? 170.371 117.738 147.318 1.00 152.92 ?  104 THR A CB  1 
ATOM 485  O OG1 . THR A 1 63  ? 171.099 118.214 148.455 1.00 146.36 ?  104 THR A OG1 1 
ATOM 486  C CG2 . THR A 1 63  ? 171.070 118.209 146.067 1.00 148.92 ?  104 THR A CG2 1 
ATOM 487  N N   . ARG A 1 64  ? 169.472 120.436 148.310 1.00 165.79 ?  105 ARG A N   1 
ATOM 488  C CA  . ARG A 1 64  ? 169.603 121.877 148.293 1.00 165.66 ?  105 ARG A CA  1 
ATOM 489  C C   . ARG A 1 64  ? 170.647 122.327 147.299 1.00 168.51 ?  105 ARG A C   1 
ATOM 490  O O   . ARG A 1 64  ? 170.529 123.396 146.716 1.00 163.28 ?  105 ARG A O   1 
ATOM 491  C CB  . ARG A 1 64  ? 169.965 122.401 149.673 1.00 158.04 ?  105 ARG A CB  1 
ATOM 492  C CG  . ARG A 1 64  ? 170.033 123.905 149.743 1.00 150.02 ?  105 ARG A CG  1 
ATOM 493  C CD  . ARG A 1 64  ? 170.237 124.376 151.158 1.00 145.31 ?  105 ARG A CD  1 
ATOM 494  N NE  . ARG A 1 64  ? 170.164 125.827 151.238 1.00 145.63 ?  105 ARG A NE  1 
ATOM 495  C CZ  . ARG A 1 64  ? 170.087 126.505 152.376 1.00 142.23 ?  105 ARG A CZ  1 
ATOM 496  N NH1 . ARG A 1 64  ? 170.072 125.857 153.531 1.00 138.53 ?  105 ARG A NH1 1 
ATOM 497  N NH2 . ARG A 1 64  ? 170.019 127.827 152.358 1.00 142.80 ?  105 ARG A NH2 1 
ATOM 498  N N   . ASP A 1 65  ? 171.670 121.508 147.103 1.00 161.41 ?  106 ASP A N   1 
ATOM 499  C CA  . ASP A 1 65  ? 172.762 121.904 146.234 1.00 185.48 ?  106 ASP A CA  1 
ATOM 500  C C   . ASP A 1 65  ? 172.262 122.093 144.822 1.00 196.50 ?  106 ASP A C   1 
ATOM 501  O O   . ASP A 1 65  ? 172.482 123.130 144.200 1.00 195.96 ?  106 ASP A O   1 
ATOM 502  C CB  . ASP A 1 65  ? 173.874 120.862 146.255 1.00 203.98 ?  106 ASP A CB  1 
ATOM 503  C CG  . ASP A 1 65  ? 174.618 120.838 147.567 1.00 197.51 ?  106 ASP A CG  1 
ATOM 504  O OD1 . ASP A 1 65  ? 174.473 121.801 148.349 1.00 196.93 ?  106 ASP A OD1 1 
ATOM 505  O OD2 . ASP A 1 65  ? 175.353 119.862 147.817 1.00 194.67 ?  106 ASP A OD2 1 
ATOM 506  N N   . LEU A 1 66  ? 171.579 121.075 144.326 1.00 191.81 ?  107 LEU A N   1 
ATOM 507  C CA  . LEU A 1 66  ? 171.036 121.118 142.986 1.00 191.82 ?  107 LEU A CA  1 
ATOM 508  C C   . LEU A 1 66  ? 169.884 122.099 142.909 1.00 190.59 ?  107 LEU A C   1 
ATOM 509  O O   . LEU A 1 66  ? 169.672 122.745 141.889 1.00 193.05 ?  107 LEU A O   1 
ATOM 510  C CB  . LEU A 1 66  ? 170.588 119.725 142.566 1.00 198.12 ?  107 LEU A CB  1 
ATOM 511  C CG  . LEU A 1 66  ? 171.750 118.731 142.631 1.00 205.75 ?  107 LEU A CG  1 
ATOM 512  C CD1 . LEU A 1 66  ? 171.310 117.319 142.262 1.00 208.14 ?  107 LEU A CD1 1 
ATOM 513  C CD2 . LEU A 1 66  ? 172.922 119.197 141.780 1.00 211.17 ?  107 LEU A CD2 1 
ATOM 514  N N   . MET A 1 67  ? 169.143 122.210 144.001 1.00 189.54 ?  108 MET A N   1 
ATOM 515  C CA  . MET A 1 67  ? 167.989 123.081 144.025 1.00 186.06 ?  108 MET A CA  1 
ATOM 516  C C   . MET A 1 67  ? 168.414 124.524 143.867 1.00 174.12 ?  108 MET A C   1 
ATOM 517  O O   . MET A 1 67  ? 167.745 125.317 143.211 1.00 175.91 ?  108 MET A O   1 
ATOM 518  C CB  . MET A 1 67  ? 167.229 122.914 145.333 1.00 196.71 ?  108 MET A CB  1 
ATOM 519  C CG  . MET A 1 67  ? 165.976 123.749 145.435 1.00 196.26 ?  108 MET A CG  1 
ATOM 520  S SD  . MET A 1 67  ? 164.718 123.152 144.300 1.00 253.29 ?  108 MET A SD  1 
ATOM 521  C CE  . MET A 1 67  ? 163.363 124.273 144.637 1.00 210.82 ?  108 MET A CE  1 
ATOM 522  N N   . GLU A 1 68  ? 169.552 124.851 144.461 1.00 178.37 ?  109 GLU A N   1 
ATOM 523  C CA  . GLU A 1 68  ? 170.008 126.227 144.508 1.00 172.83 ?  109 GLU A CA  1 
ATOM 524  C C   . GLU A 1 68  ? 170.924 126.518 143.342 1.00 182.82 ?  109 GLU A C   1 
ATOM 525  O O   . GLU A 1 68  ? 171.083 127.664 142.923 1.00 182.50 ?  109 GLU A O   1 
ATOM 526  C CB  . GLU A 1 68  ? 170.710 126.518 145.830 1.00 160.17 ?  109 GLU A CB  1 
ATOM 527  C CG  . GLU A 1 68  ? 171.099 127.969 145.980 1.00 152.70 ?  109 GLU A CG  1 
ATOM 528  C CD  . GLU A 1 68  ? 169.896 128.894 146.006 1.00 153.82 ?  109 GLU A CD  1 
ATOM 529  O OE1 . GLU A 1 68  ? 168.764 128.413 146.230 1.00 154.02 ?  109 GLU A OE1 1 
ATOM 530  O OE2 . GLU A 1 68  ? 170.079 130.106 145.780 1.00 153.18 ?  109 GLU A OE2 1 
ATOM 531  N N   . LYS A 1 69  ? 171.525 125.467 142.811 1.00 191.75 ?  110 LYS A N   1 
ATOM 532  C CA  . LYS A 1 69  ? 172.160 125.582 141.523 1.00 192.79 ?  110 LYS A CA  1 
ATOM 533  C C   . LYS A 1 69  ? 171.077 125.909 140.517 1.00 207.93 ?  110 LYS A C   1 
ATOM 534  O O   . LYS A 1 69  ? 171.304 126.617 139.540 1.00 204.68 ?  110 LYS A O   1 
ATOM 535  C CB  . LYS A 1 69  ? 172.890 124.297 141.147 1.00 183.93 ?  110 LYS A CB  1 
ATOM 536  C CG  . LYS A 1 69  ? 173.416 124.315 139.727 1.00 177.19 ?  110 LYS A CG  1 
ATOM 537  C CD  . LYS A 1 69  ? 174.323 125.517 139.499 1.00 171.04 ?  110 LYS A CD  1 
ATOM 538  C CE  . LYS A 1 69  ? 174.912 125.526 138.096 1.00 163.58 ?  110 LYS A CE  1 
ATOM 539  N NZ  . LYS A 1 69  ? 175.601 126.814 137.797 1.00 160.67 ?  110 LYS A NZ  1 
ATOM 540  N N   . LEU A 1 70  ? 169.879 125.413 140.789 1.00 187.47 ?  111 LEU A N   1 
ATOM 541  C CA  . LEU A 1 70  ? 168.777 125.552 139.860 1.00 207.75 ?  111 LEU A CA  1 
ATOM 542  C C   . LEU A 1 70  ? 168.141 126.931 139.875 1.00 223.19 ?  111 LEU A C   1 
ATOM 543  O O   . LEU A 1 70  ? 167.798 127.461 138.826 1.00 224.44 ?  111 LEU A O   1 
ATOM 544  C CB  . LEU A 1 70  ? 167.719 124.495 140.154 1.00 213.69 ?  111 LEU A CB  1 
ATOM 545  C CG  . LEU A 1 70  ? 166.566 124.392 139.162 1.00 209.62 ?  111 LEU A CG  1 
ATOM 546  C CD1 . LEU A 1 70  ? 166.148 122.947 139.008 1.00 210.33 ?  111 LEU A CD1 1 
ATOM 547  C CD2 . LEU A 1 70  ? 165.394 125.225 139.633 1.00 210.08 ?  111 LEU A CD2 1 
ATOM 548  N N   . LYS A 1 71  ? 167.984 127.512 141.056 1.00 30.00  ?  112 LYS A N   1 
ATOM 549  C CA  . LYS A 1 71  ? 167.198 128.732 141.179 1.00 30.00  ?  112 LYS A CA  1 
ATOM 550  C C   . LYS A 1 71  ? 167.770 129.883 140.363 1.00 30.00  ?  112 LYS A C   1 
ATOM 551  O O   . LYS A 1 71  ? 167.033 130.731 139.866 1.00 30.00  ?  112 LYS A O   1 
ATOM 552  C CB  . LYS A 1 71  ? 167.096 129.145 142.640 1.00 20.00  ?  112 LYS A CB  1 
ATOM 553  C CG  . LYS A 1 71  ? 166.231 130.358 142.867 1.00 20.00  ?  112 LYS A CG  1 
ATOM 554  C CD  . LYS A 1 71  ? 166.190 130.689 144.335 1.00 20.00  ?  112 LYS A CD  1 
ATOM 555  C CE  . LYS A 1 71  ? 165.510 129.579 145.111 1.00 20.00  ?  112 LYS A CE  1 
ATOM 556  N NZ  . LYS A 1 71  ? 164.078 129.438 144.736 1.00 20.00  ?  112 LYS A NZ  1 
ATOM 557  N N   . GLY A 1 72  ? 169.086 129.893 140.206 1.00 30.00  ?  113 GLY A N   1 
ATOM 558  C CA  . GLY A 1 72  ? 169.748 130.990 139.531 1.00 30.00  ?  113 GLY A CA  1 
ATOM 559  C C   . GLY A 1 72  ? 169.710 130.915 138.019 1.00 30.00  ?  113 GLY A C   1 
ATOM 560  O O   . GLY A 1 72  ? 170.138 131.849 137.342 1.00 30.00  ?  113 GLY A O   1 
ATOM 561  N N   . ARG A 1 73  ? 169.221 129.805 137.478 1.00 60.47  ?  114 ARG A N   1 
ATOM 562  C CA  . ARG A 1 73  ? 169.235 129.642 136.033 1.00 66.00  ?  114 ARG A CA  1 
ATOM 563  C C   . ARG A 1 73  ? 168.327 130.685 135.397 1.00 70.08  ?  114 ARG A C   1 
ATOM 564  O O   . ARG A 1 73  ? 167.195 130.879 135.832 1.00 70.12  ?  114 ARG A O   1 
ATOM 565  C CB  . ARG A 1 73  ? 168.782 128.242 135.638 1.00 20.00  ?  114 ARG A CB  1 
ATOM 566  C CG  . ARG A 1 73  ? 168.977 127.938 134.173 1.00 20.00  ?  114 ARG A CG  1 
ATOM 567  C CD  . ARG A 1 73  ? 170.463 127.902 133.883 1.00 20.00  ?  114 ARG A CD  1 
ATOM 568  N NE  . ARG A 1 73  ? 170.770 127.547 132.504 1.00 20.00  ?  114 ARG A NE  1 
ATOM 569  C CZ  . ARG A 1 73  ? 170.880 128.422 131.513 1.00 20.00  ?  114 ARG A CZ  1 
ATOM 570  N NH1 . ARG A 1 73  ? 170.706 129.714 131.741 1.00 20.00  ?  114 ARG A NH1 1 
ATOM 571  N NH2 . ARG A 1 73  ? 171.169 128.002 130.290 1.00 20.00  ?  114 ARG A NH2 1 
ATOM 572  N N   . THR A 1 74  ? 168.818 131.337 134.352 1.00 70.79  ?  115 THR A N   1 
ATOM 573  C CA  . THR A 1 74  ? 168.029 132.348 133.666 1.00 72.36  ?  115 THR A CA  1 
ATOM 574  C C   . THR A 1 74  ? 167.162 131.727 132.576 1.00 69.76  ?  115 THR A C   1 
ATOM 575  O O   . THR A 1 74  ? 166.154 132.305 132.178 1.00 67.84  ?  115 THR A O   1 
ATOM 576  C CB  . THR A 1 74  ? 168.919 133.420 133.049 1.00 20.00  ?  115 THR A CB  1 
ATOM 577  O OG1 . THR A 1 74  ? 169.709 132.838 132.007 1.00 20.00  ?  115 THR A OG1 1 
ATOM 578  C CG2 . THR A 1 74  ? 169.841 133.993 134.112 1.00 20.00  ?  115 THR A CG2 1 
ATOM 579  N N   . SER A 1 75  ? 167.541 130.535 132.113 1.00 71.81  ?  116 SER A N   1 
ATOM 580  C CA  . SER A 1 75  ? 166.676 129.764 131.224 1.00 71.32  ?  116 SER A CA  1 
ATOM 581  C C   . SER A 1 75  ? 165.442 129.427 132.015 1.00 66.87  ?  116 SER A C   1 
ATOM 582  O O   . SER A 1 75  ? 164.384 129.143 131.458 1.00 67.17  ?  116 SER A O   1 
ATOM 583  C CB  . SER A 1 75  ? 167.350 128.488 130.712 1.00 68.27  ?  116 SER A CB  1 
ATOM 584  O OG  . SER A 1 75  ? 168.413 128.777 129.823 1.00 73.00  ?  116 SER A OG  1 
ATOM 585  N N   . ARG A 1 76  ? 165.614 129.447 133.332 1.00 65.20  ?  117 ARG A N   1 
ATOM 586  C CA  . ARG A 1 76  ? 164.539 129.224 134.268 1.00 62.67  ?  117 ARG A CA  1 
ATOM 587  C C   . ARG A 1 76  ? 163.990 127.832 134.065 1.00 57.20  ?  117 ARG A C   1 
ATOM 588  O O   . ARG A 1 76  ? 164.604 127.001 133.397 1.00 52.84  ?  117 ARG A O   1 
ATOM 589  C CB  . ARG A 1 76  ? 163.438 130.268 134.095 1.00 20.00  ?  117 ARG A CB  1 
ATOM 590  C CG  . ARG A 1 76  ? 163.898 131.686 134.323 1.00 20.00  ?  117 ARG A CG  1 
ATOM 591  C CD  . ARG A 1 76  ? 164.318 131.810 135.752 1.00 20.00  ?  117 ARG A CD  1 
ATOM 592  N NE  . ARG A 1 76  ? 163.223 131.495 136.654 1.00 20.00  ?  117 ARG A NE  1 
ATOM 593  C CZ  . ARG A 1 76  ? 163.392 131.238 137.942 1.00 20.00  ?  117 ARG A CZ  1 
ATOM 594  N NH1 . ARG A 1 76  ? 164.613 131.236 138.454 1.00 20.00  ?  117 ARG A NH1 1 
ATOM 595  N NH2 . ARG A 1 76  ? 162.351 130.958 138.712 1.00 20.00  ?  117 ARG A NH2 1 
ATOM 596  N N   . ILE A 1 77  ? 162.828 127.574 134.637 1.00 55.10  ?  118 ILE A N   1 
ATOM 597  C CA  . ILE A 1 77  ? 162.279 126.246 134.553 1.00 46.18  ?  118 ILE A CA  1 
ATOM 598  C C   . ILE A 1 77  ? 160.804 126.295 134.912 1.00 39.95  ?  118 ILE A C   1 
ATOM 599  O O   . ILE A 1 77  ? 160.355 127.198 135.613 1.00 41.93  ?  118 ILE A O   1 
ATOM 600  C CB  . ILE A 1 77  ? 163.059 125.296 135.483 1.00 46.24  ?  118 ILE A CB  1 
ATOM 601  C CG1 . ILE A 1 77  ? 162.724 123.829 135.209 1.00 41.52  ?  118 ILE A CG1 1 
ATOM 602  C CG2 . ILE A 1 77  ? 162.811 125.660 136.931 1.00 43.85  ?  118 ILE A CG2 1 
ATOM 603  C CD1 . ILE A 1 77  ? 163.695 122.856 135.852 1.00 44.31  ?  118 ILE A CD1 1 
ATOM 604  N N   . ALA A 1 78  ? 160.047 125.329 134.416 1.00 35.58  ?  119 ALA A N   1 
ATOM 605  C CA  . ALA A 1 78  ? 158.631 125.248 134.722 1.00 35.63  ?  119 ALA A CA  1 
ATOM 606  C C   . ALA A 1 78  ? 158.419 124.361 135.924 1.00 32.00  ?  119 ALA A C   1 
ATOM 607  O O   . ALA A 1 78  ? 157.315 123.897 136.177 1.00 30.02  ?  119 ALA A O   1 
ATOM 608  C CB  . ALA A 1 78  ? 157.858 124.735 133.552 1.00 20.00  ?  119 ALA A CB  1 
ATOM 609  N N   . GLY A 1 79  ? 159.492 124.091 136.647 1.00 35.67  ?  120 GLY A N   1 
ATOM 610  C CA  . GLY A 1 79  ? 159.344 123.462 137.936 1.00 30.65  ?  120 GLY A CA  1 
ATOM 611  C C   . GLY A 1 79  ? 159.672 121.996 138.053 1.00 30.91  ?  120 GLY A C   1 
ATOM 612  O O   . GLY A 1 79  ? 159.761 121.265 137.071 1.00 32.56  ?  120 GLY A O   1 
ATOM 613  N N   . LEU A 1 80  ? 159.859 121.586 139.298 1.00 61.58  ?  121 LEU A N   1 
ATOM 614  C CA  . LEU A 1 80  ? 160.294 120.250 139.624 1.00 70.61  ?  121 LEU A CA  1 
ATOM 615  C C   . LEU A 1 80  ? 159.174 119.248 139.502 1.00 124.42 ?  121 LEU A C   1 
ATOM 616  O O   . LEU A 1 80  ? 158.009 119.574 139.704 1.00 132.48 ?  121 LEU A O   1 
ATOM 617  C CB  . LEU A 1 80  ? 160.841 120.224 141.036 1.00 20.00  ?  121 LEU A CB  1 
ATOM 618  C CG  . LEU A 1 80  ? 161.946 121.250 141.227 1.00 20.00  ?  121 LEU A CG  1 
ATOM 619  C CD1 . LEU A 1 80  ? 162.453 121.185 142.646 1.00 20.00  ?  121 LEU A CD1 1 
ATOM 620  C CD2 . LEU A 1 80  ? 163.051 121.030 140.228 1.00 20.00  ?  121 LEU A CD2 1 
ATOM 621  N N   . ALA A 1 81  ? 159.540 118.016 139.189 1.00 141.47 ?  122 ALA A N   1 
ATOM 622  C CA  . ALA A 1 81  ? 158.610 116.908 139.262 1.00 152.59 ?  122 ALA A CA  1 
ATOM 623  C C   . ALA A 1 81  ? 159.295 115.780 140.001 1.00 161.30 ?  122 ALA A C   1 
ATOM 624  O O   . ALA A 1 81  ? 159.828 114.856 139.393 1.00 165.62 ?  122 ALA A O   1 
ATOM 625  C CB  . ALA A 1 81  ? 158.182 116.473 137.892 1.00 20.00  ?  122 ALA A CB  1 
ATOM 626  N N   . VAL A 1 82  ? 159.318 115.876 141.321 1.00 152.48 ?  123 VAL A N   1 
ATOM 627  C CA  . VAL A 1 82  ? 159.975 114.857 142.117 1.00 122.08 ?  123 VAL A CA  1 
ATOM 628  C C   . VAL A 1 82  ? 159.105 113.614 142.156 1.00 131.43 ?  123 VAL A C   1 
ATOM 629  O O   . VAL A 1 82  ? 157.886 113.708 142.065 1.00 137.20 ?  123 VAL A O   1 
ATOM 630  C CB  . VAL A 1 82  ? 160.257 115.359 143.534 1.00 20.00  ?  123 VAL A CB  1 
ATOM 631  C CG1 . VAL A 1 82  ? 160.939 114.289 144.363 1.00 20.00  ?  123 VAL A CG1 1 
ATOM 632  C CG2 . VAL A 1 82  ? 161.117 116.593 143.473 1.00 20.00  ?  123 VAL A CG2 1 
ATOM 633  N N   . SER A 1 83  ? 159.722 112.445 142.260 1.00 127.19 ?  124 SER A N   1 
ATOM 634  C CA  . SER A 1 83  ? 158.946 111.232 142.476 1.00 137.77 ?  124 SER A CA  1 
ATOM 635  C C   . SER A 1 83  ? 159.748 110.178 143.227 1.00 131.10 ?  124 SER A C   1 
ATOM 636  O O   . SER A 1 83  ? 160.954 110.043 143.032 1.00 123.35 ?  124 SER A O   1 
ATOM 637  C CB  . SER A 1 83  ? 158.455 110.679 141.145 1.00 20.00  ?  124 SER A CB  1 
ATOM 638  O OG  . SER A 1 83  ? 159.548 110.323 140.323 1.00 20.00  ?  124 SER A OG  1 
ATOM 639  N N   . LEU A 1 84  ? 159.069 109.430 144.088 1.00 30.00  ?  125 LEU A N   1 
ATOM 640  C CA  . LEU A 1 84  ? 159.741 108.474 144.959 1.00 30.00  ?  125 LEU A CA  1 
ATOM 641  C C   . LEU A 1 84  ? 159.793 107.065 144.407 1.00 30.00  ?  125 LEU A C   1 
ATOM 642  O O   . LEU A 1 84  ? 158.806 106.555 143.885 1.00 30.00  ?  125 LEU A O   1 
ATOM 643  C CB  . LEU A 1 84  ? 159.061 108.439 146.324 1.00 20.00  ?  125 LEU A CB  1 
ATOM 644  C CG  . LEU A 1 84  ? 159.566 109.441 147.359 1.00 20.00  ?  125 LEU A CG  1 
ATOM 645  C CD1 . LEU A 1 84  ? 159.321 110.866 146.907 1.00 20.00  ?  125 LEU A CD1 1 
ATOM 646  C CD2 . LEU A 1 84  ? 158.901 109.186 148.702 1.00 20.00  ?  125 LEU A CD2 1 
ATOM 647  N N   . THR A 1 85  ? 160.960 106.443 144.532 1.00 142.75 ?  126 THR A N   1 
ATOM 648  C CA  . THR A 1 85  ? 161.093 105.006 144.348 1.00 163.60 ?  126 THR A CA  1 
ATOM 649  C C   . THR A 1 85  ? 160.933 104.372 145.728 1.00 193.47 ?  126 THR A C   1 
ATOM 650  O O   . THR A 1 85  ? 161.131 105.039 146.741 1.00 191.84 ?  126 THR A O   1 
ATOM 651  C CB  . THR A 1 85  ? 162.441 104.632 143.698 1.00 139.81 ?  126 THR A CB  1 
ATOM 652  O OG1 . THR A 1 85  ? 162.572 105.337 142.460 1.00 139.44 ?  126 THR A OG1 1 
ATOM 653  C CG2 . THR A 1 85  ? 162.514 103.143 143.395 1.00 139.95 ?  126 THR A CG2 1 
ATOM 654  N N   . LYS A 1 86  ? 160.568 103.097 145.764 1.00 205.64 ?  127 LYS A N   1 
ATOM 655  C CA  . LYS A 1 86  ? 160.207 102.428 147.004 1.00 211.07 ?  127 LYS A CA  1 
ATOM 656  C C   . LYS A 1 86  ? 161.283 102.537 148.090 1.00 231.33 ?  127 LYS A C   1 
ATOM 657  O O   . LYS A 1 86  ? 160.968 102.906 149.217 1.00 230.10 ?  127 LYS A O   1 
ATOM 658  C CB  . LYS A 1 86  ? 159.908 100.955 146.717 1.00 277.58 ?  127 LYS A CB  1 
ATOM 659  C CG  . LYS A 1 86  ? 158.793 100.740 145.711 1.00 179.53 ?  127 LYS A CG  1 
ATOM 660  C CD  . LYS A 1 86  ? 158.678 99.274  145.308 1.00 162.75 ?  127 LYS A CD  1 
ATOM 661  C CE  . LYS A 1 86  ? 157.589 99.072  144.259 1.00 158.59 ?  127 LYS A CE  1 
ATOM 662  N NZ  . LYS A 1 86  ? 157.498 97.663  143.781 1.00 155.50 ?  127 LYS A NZ  1 
ATOM 663  N N   . PRO A 1 87  ? 162.552 102.212 147.771 1.00 222.90 ?  128 PRO A N   1 
ATOM 664  C CA  . PRO A 1 87  ? 163.559 102.371 148.822 1.00 218.62 ?  128 PRO A CA  1 
ATOM 665  C C   . PRO A 1 87  ? 163.745 103.806 149.282 1.00 214.19 ?  128 PRO A C   1 
ATOM 666  O O   . PRO A 1 87  ? 163.643 104.744 148.494 1.00 220.07 ?  128 PRO A O   1 
ATOM 667  C CB  . PRO A 1 87  ? 164.837 101.853 148.160 1.00 217.96 ?  128 PRO A CB  1 
ATOM 668  C CG  . PRO A 1 87  ? 164.615 102.066 146.719 1.00 218.63 ?  128 PRO A CG  1 
ATOM 669  C CD  . PRO A 1 87  ? 163.171 101.743 146.520 1.00 222.45 ?  128 PRO A CD  1 
ATOM 670  N N   . SER A 1 88  ? 164.017 103.955 150.568 1.00 215.20 ?  129 SER A N   1 
ATOM 671  C CA  . SER A 1 88  ? 164.421 105.224 151.133 1.00 203.08 ?  129 SER A CA  1 
ATOM 672  C C   . SER A 1 88  ? 165.861 105.520 150.759 1.00 202.01 ?  129 SER A C   1 
ATOM 673  O O   . SER A 1 88  ? 166.627 104.600 150.485 1.00 210.20 ?  129 SER A O   1 
ATOM 674  C CB  . SER A 1 88  ? 164.257 105.197 152.644 1.00 192.51 ?  129 SER A CB  1 
ATOM 675  O OG  . SER A 1 88  ? 162.895 105.053 152.994 1.00 187.89 ?  129 SER A OG  1 
ATOM 676  N N   . PRO A 1 89  ? 166.234 106.807 150.737 1.00 190.18 ?  130 PRO A N   1 
ATOM 677  C CA  . PRO A 1 89  ? 167.629 107.177 150.499 1.00 184.97 ?  130 PRO A CA  1 
ATOM 678  C C   . PRO A 1 89  ? 168.508 106.598 151.589 1.00 194.20 ?  130 PRO A C   1 
ATOM 679  O O   . PRO A 1 89  ? 168.073 106.549 152.740 1.00 192.76 ?  130 PRO A O   1 
ATOM 680  C CB  . PRO A 1 89  ? 167.606 108.703 150.571 1.00 175.67 ?  130 PRO A CB  1 
ATOM 681  C CG  . PRO A 1 89  ? 166.215 109.064 150.221 1.00 169.17 ?  130 PRO A CG  1 
ATOM 682  C CD  . PRO A 1 89  ? 165.366 107.989 150.818 1.00 175.60 ?  130 PRO A CD  1 
ATOM 683  N N   . ALA A 1 90  ? 169.715 106.165 151.238 1.00 195.19 ?  131 ALA A N   1 
ATOM 684  C CA  . ALA A 1 90  ? 170.583 105.520 152.211 1.00 194.09 ?  131 ALA A CA  1 
ATOM 685  C C   . ALA A 1 90  ? 170.839 106.477 153.358 1.00 197.00 ?  131 ALA A C   1 
ATOM 686  O O   . ALA A 1 90  ? 170.515 106.185 154.508 1.00 199.70 ?  131 ALA A O   1 
ATOM 687  C CB  . ALA A 1 90  ? 171.888 105.097 151.567 1.00 190.49 ?  131 ALA A CB  1 
ATOM 688  N N   . SER A 1 91  ? 171.367 107.647 153.027 1.00 186.45 ?  132 SER A N   1 
ATOM 689  C CA  . SER A 1 91  ? 171.444 108.728 153.988 1.00 171.58 ?  132 SER A CA  1 
ATOM 690  C C   . SER A 1 91  ? 170.032 109.220 154.204 1.00 164.61 ?  132 SER A C   1 
ATOM 691  O O   . SER A 1 91  ? 169.194 109.125 153.308 1.00 164.42 ?  132 SER A O   1 
ATOM 692  C CB  . SER A 1 91  ? 172.335 109.861 153.491 1.00 171.41 ?  132 SER A CB  1 
ATOM 693  O OG  . SER A 1 91  ? 171.765 110.479 152.353 1.00 170.31 ?  132 SER A OG  1 
ATOM 694  N N   . GLY A 1 92  ? 169.758 109.754 155.382 1.00 173.24 ?  133 GLY A N   1 
ATOM 695  C CA  . GLY A 1 92  ? 168.419 110.220 155.667 1.00 177.60 ?  133 GLY A CA  1 
ATOM 696  C C   . GLY A 1 92  ? 168.179 111.548 154.986 1.00 175.31 ?  133 GLY A C   1 
ATOM 697  O O   . GLY A 1 92  ? 169.076 112.092 154.347 1.00 175.56 ?  133 GLY A O   1 
ATOM 698  N N   . PHE A 1 93  ? 166.969 112.075 155.111 1.00 172.70 ?  134 PHE A N   1 
ATOM 699  C CA  . PHE A 1 93  ? 166.720 113.429 154.648 1.00 160.37 ?  134 PHE A CA  1 
ATOM 700  C C   . PHE A 1 93  ? 165.581 114.133 155.359 1.00 158.80 ?  134 PHE A C   1 
ATOM 701  O O   . PHE A 1 93  ? 164.435 113.698 155.301 1.00 165.60 ?  134 PHE A O   1 
ATOM 702  C CB  . PHE A 1 93  ? 166.437 113.446 153.156 1.00 152.97 ?  134 PHE A CB  1 
ATOM 703  C CG  . PHE A 1 93  ? 166.012 114.784 152.668 1.00 138.10 ?  134 PHE A CG  1 
ATOM 704  C CD1 . PHE A 1 93  ? 166.937 115.799 152.531 1.00 132.71 ?  134 PHE A CD1 1 
ATOM 705  C CD2 . PHE A 1 93  ? 164.688 115.039 152.362 1.00 126.33 ?  134 PHE A CD2 1 
ATOM 706  C CE1 . PHE A 1 93  ? 166.555 117.044 152.097 1.00 124.07 ?  134 PHE A CE1 1 
ATOM 707  C CE2 . PHE A 1 93  ? 164.298 116.282 151.921 1.00 116.15 ?  134 PHE A CE2 1 
ATOM 708  C CZ  . PHE A 1 93  ? 165.235 117.287 151.789 1.00 115.60 ?  134 PHE A CZ  1 
ATOM 709  N N   . SER A 1 94  ? 165.902 115.238 156.017 1.00 145.73 ?  135 SER A N   1 
ATOM 710  C CA  . SER A 1 94  ? 164.881 116.084 156.612 1.00 133.93 ?  135 SER A CA  1 
ATOM 711  C C   . SER A 1 94  ? 164.907 117.482 156.009 1.00 121.72 ?  135 SER A C   1 
ATOM 712  O O   . SER A 1 94  ? 165.793 118.278 156.306 1.00 117.36 ?  135 SER A O   1 
ATOM 713  C CB  . SER A 1 94  ? 165.054 116.156 158.124 1.00 136.02 ?  135 SER A CB  1 
ATOM 714  O OG  . SER A 1 94  ? 164.067 116.990 158.699 1.00 133.25 ?  135 SER A OG  1 
ATOM 715  N N   . PRO A 1 95  ? 163.918 117.784 155.164 1.00 124.86 ?  136 PRO A N   1 
ATOM 716  C CA  . PRO A 1 95  ? 163.763 119.053 154.455 1.00 131.85 ?  136 PRO A CA  1 
ATOM 717  C C   . PRO A 1 95  ? 163.651 120.227 155.407 1.00 141.04 ?  136 PRO A C   1 
ATOM 718  O O   . PRO A 1 95  ? 164.066 121.342 155.087 1.00 151.59 ?  136 PRO A O   1 
ATOM 719  C CB  . PRO A 1 95  ? 162.463 118.856 153.681 1.00 128.89 ?  136 PRO A CB  1 
ATOM 720  C CG  . PRO A 1 95  ? 161.723 117.844 154.454 1.00 127.47 ?  136 PRO A CG  1 
ATOM 721  C CD  . PRO A 1 95  ? 162.762 116.904 154.955 1.00 126.14 ?  136 PRO A CD  1 
ATOM 722  N N   . SER A 1 96  ? 163.092 119.957 156.576 1.00 123.48 ?  137 SER A N   1 
ATOM 723  C CA  . SER A 1 96  ? 162.809 120.980 157.561 1.00 118.65 ?  137 SER A CA  1 
ATOM 724  C C   . SER A 1 96  ? 164.079 121.629 158.083 1.00 121.99 ?  137 SER A C   1 
ATOM 725  O O   . SER A 1 96  ? 165.159 121.047 158.033 1.00 124.07 ?  137 SER A O   1 
ATOM 726  C CB  . SER A 1 96  ? 162.022 120.399 158.722 1.00 110.35 ?  137 SER A CB  1 
ATOM 727  O OG  . SER A 1 96  ? 161.819 121.391 159.708 1.00 109.56 ?  137 SER A OG  1 
ATOM 728  N N   . VAL A 1 97  ? 163.928 122.852 158.574 1.00 126.70 ?  138 VAL A N   1 
ATOM 729  C CA  . VAL A 1 97  ? 165.048 123.713 158.936 1.00 137.09 ?  138 VAL A CA  1 
ATOM 730  C C   . VAL A 1 97  ? 165.969 123.112 160.002 1.00 151.59 ?  138 VAL A C   1 
ATOM 731  O O   . VAL A 1 97  ? 165.539 122.366 160.880 1.00 156.43 ?  138 VAL A O   1 
ATOM 732  C CB  . VAL A 1 97  ? 164.524 125.083 159.409 1.00 135.74 ?  138 VAL A CB  1 
ATOM 733  C CG1 . VAL A 1 97  ? 163.638 124.906 160.602 1.00 132.96 ?  138 VAL A CG1 1 
ATOM 734  C CG2 . VAL A 1 97  ? 165.658 126.045 159.725 1.00 134.31 ?  138 VAL A CG2 1 
ATOM 735  N N   . GLN A 1 98  ? 167.250 123.447 159.880 1.00 164.42 ?  139 GLN A N   1 
ATOM 736  C CA  . GLN A 1 98  ? 168.344 122.860 160.641 1.00 166.49 ?  139 GLN A CA  1 
ATOM 737  C C   . GLN A 1 98  ? 168.188 123.043 162.155 1.00 160.33 ?  139 GLN A C   1 
ATOM 738  O O   . GLN A 1 98  ? 168.664 122.217 162.926 1.00 157.05 ?  139 GLN A O   1 
ATOM 739  C CB  . GLN A 1 98  ? 169.655 123.485 160.139 1.00 173.52 ?  139 GLN A CB  1 
ATOM 740  C CG  . GLN A 1 98  ? 170.984 122.941 160.664 1.00 178.33 ?  139 GLN A CG  1 
ATOM 741  C CD  . GLN A 1 98  ? 171.333 121.541 160.179 1.00 181.10 ?  139 GLN A CD  1 
ATOM 742  O OE1 . GLN A 1 98  ? 171.307 120.584 160.941 1.00 184.07 ?  139 GLN A OE1 1 
ATOM 743  N NE2 . GLN A 1 98  ? 171.655 121.421 158.898 1.00 177.01 ?  139 GLN A NE2 1 
ATOM 744  N N   . CYS A 1 99  ? 167.530 124.119 162.580 1.00 153.94 ?  140 CYS A N   1 
ATOM 745  C CA  . CYS A 1 99  ? 167.198 124.303 163.993 1.00 156.04 ?  140 CYS A CA  1 
ATOM 746  C C   . CYS A 1 99  ? 165.750 124.771 164.181 1.00 146.79 ?  140 CYS A C   1 
ATOM 747  O O   . CYS A 1 99  ? 165.505 125.940 164.476 1.00 149.17 ?  140 CYS A O   1 
ATOM 748  C CB  . CYS A 1 99  ? 168.153 125.297 164.646 1.00 160.99 ?  140 CYS A CB  1 
ATOM 749  S SG  . CYS A 1 99  ? 167.915 125.465 166.428 1.00 419.16 ?  140 CYS A SG  1 
ATOM 750  N N   . PRO A 1 100 ? 164.790 123.849 164.036 1.00 131.94 ?  141 PRO A N   1 
ATOM 751  C CA  . PRO A 1 100 ? 163.357 124.154 163.933 1.00 128.62 ?  141 PRO A CA  1 
ATOM 752  C C   . PRO A 1 100 ? 162.772 124.850 165.147 1.00 149.39 ?  141 PRO A C   1 
ATOM 753  O O   . PRO A 1 100 ? 163.137 124.530 166.275 1.00 141.86 ?  141 PRO A O   1 
ATOM 754  C CB  . PRO A 1 100 ? 162.723 122.774 163.768 1.00 126.97 ?  141 PRO A CB  1 
ATOM 755  C CG  . PRO A 1 100 ? 163.667 121.862 164.459 1.00 128.76 ?  141 PRO A CG  1 
ATOM 756  C CD  . PRO A 1 100 ? 165.030 122.403 164.150 1.00 130.39 ?  141 PRO A CD  1 
ATOM 757  N N   . ASN A 1 101 ? 161.851 125.774 164.897 1.00 123.44 ?  142 ASN A N   1 
ATOM 758  C CA  . ASN A 1 101 ? 161.137 126.487 165.946 1.00 162.11 ?  142 ASN A CA  1 
ATOM 759  C C   . ASN A 1 101 ? 162.040 127.078 167.003 1.00 189.55 ?  142 ASN A C   1 
ATOM 760  O O   . ASN A 1 101 ? 161.654 127.160 168.163 1.00 186.61 ?  142 ASN A O   1 
ATOM 761  C CB  . ASN A 1 101 ? 160.136 125.561 166.617 1.00 185.83 ?  142 ASN A CB  1 
ATOM 762  C CG  . ASN A 1 101 ? 159.062 125.110 165.681 1.00 182.19 ?  142 ASN A CG  1 
ATOM 763  O OD1 . ASN A 1 101 ? 158.775 123.920 165.579 1.00 180.19 ?  142 ASN A OD1 1 
ATOM 764  N ND2 . ASN A 1 101 ? 158.450 126.058 164.986 1.00 179.16 ?  142 ASN A ND2 1 
ATOM 765  N N   . ASP A 1 102 ? 163.239 127.489 166.608 1.00 248.49 ?  143 ASP A N   1 
ATOM 766  C CA  . ASP A 1 102 ? 164.223 127.982 167.568 1.00 247.64 ?  143 ASP A CA  1 
ATOM 767  C C   . ASP A 1 102 ? 163.751 129.265 168.240 1.00 244.69 ?  143 ASP A C   1 
ATOM 768  O O   . ASP A 1 102 ? 164.145 129.575 169.362 1.00 251.90 ?  143 ASP A O   1 
ATOM 769  C CB  . ASP A 1 102 ? 165.566 128.205 166.882 1.00 377.25 ?  143 ASP A CB  1 
ATOM 770  C CG  . ASP A 1 102 ? 165.469 129.175 165.731 1.00 161.92 ?  143 ASP A CG  1 
ATOM 771  O OD1 . ASP A 1 102 ? 164.336 129.575 165.390 1.00 162.20 ?  143 ASP A OD1 1 
ATOM 772  O OD2 . ASP A 1 102 ? 166.521 129.534 165.165 1.00 159.29 ?  143 ASP A OD2 1 
ATOM 773  N N   . GLY A 1 103 ? 162.887 129.998 167.552 1.00 237.32 ?  144 GLY A N   1 
ATOM 774  C CA  . GLY A 1 103 ? 162.284 131.173 168.137 1.00 214.74 ?  144 GLY A CA  1 
ATOM 775  C C   . GLY A 1 103 ? 161.169 130.723 169.050 1.00 193.10 ?  144 GLY A C   1 
ATOM 776  O O   . GLY A 1 103 ? 160.900 129.532 169.161 1.00 198.55 ?  144 GLY A O   1 
ATOM 777  N N   . PHE A 1 104 ? 160.536 131.680 169.715 1.00 180.66 ?  145 PHE A N   1 
ATOM 778  C CA  . PHE A 1 104 ? 159.384 131.410 170.563 1.00 164.53 ?  145 PHE A CA  1 
ATOM 779  C C   . PHE A 1 104 ? 159.697 130.488 171.734 1.00 144.44 ?  145 PHE A C   1 
ATOM 780  O O   . PHE A 1 104 ? 158.935 129.572 172.031 1.00 138.25 ?  145 PHE A O   1 
ATOM 781  C CB  . PHE A 1 104 ? 158.266 130.807 169.729 1.00 153.21 ?  145 PHE A CB  1 
ATOM 782  C CG  . PHE A 1 104 ? 157.872 131.651 168.571 1.00 164.06 ?  145 PHE A CG  1 
ATOM 783  C CD1 . PHE A 1 104 ? 157.017 132.720 168.735 1.00 169.99 ?  145 PHE A CD1 1 
ATOM 784  C CD2 . PHE A 1 104 ? 158.361 131.374 167.314 1.00 176.25 ?  145 PHE A CD2 1 
ATOM 785  C CE1 . PHE A 1 104 ? 156.661 133.500 167.663 1.00 175.00 ?  145 PHE A CE1 1 
ATOM 786  C CE2 . PHE A 1 104 ? 158.004 132.143 166.241 1.00 188.63 ?  145 PHE A CE2 1 
ATOM 787  C CZ  . PHE A 1 104 ? 157.151 133.208 166.412 1.00 184.03 ?  145 PHE A CZ  1 
ATOM 788  N N   . GLY A 1 105 ? 160.827 130.735 172.387 1.00 163.92 ?  146 GLY A N   1 
ATOM 789  C CA  . GLY A 1 105 ? 161.180 130.061 173.625 1.00 172.80 ?  146 GLY A CA  1 
ATOM 790  C C   . GLY A 1 105 ? 162.038 130.985 174.470 1.00 180.61 ?  146 GLY A C   1 
ATOM 791  O O   . GLY A 1 105 ? 162.707 131.867 173.932 1.00 178.20 ?  146 GLY A O   1 
ATOM 792  N N   . VAL A 1 106 ? 162.043 130.778 175.783 1.00 174.86 ?  147 VAL A N   1 
ATOM 793  C CA  . VAL A 1 106 ? 162.719 131.699 176.697 1.00 186.87 ?  147 VAL A CA  1 
ATOM 794  C C   . VAL A 1 106 ? 164.199 131.812 176.368 1.00 202.30 ?  147 VAL A C   1 
ATOM 795  O O   . VAL A 1 106 ? 164.812 132.875 176.464 1.00 201.37 ?  147 VAL A O   1 
ATOM 796  C CB  . VAL A 1 106 ? 162.550 131.246 178.168 1.00 193.68 ?  147 VAL A CB  1 
ATOM 797  C CG1 . VAL A 1 106 ? 163.074 129.826 178.367 1.00 194.87 ?  147 VAL A CG1 1 
ATOM 798  C CG2 . VAL A 1 106 ? 163.263 132.209 179.112 1.00 193.71 ?  147 VAL A CG2 1 
ATOM 799  N N   . TYR A 1 107 ? 164.740 130.696 175.921 1.00 180.03 ?  148 TYR A N   1 
ATOM 800  C CA  . TYR A 1 107 ? 166.127 130.571 175.553 1.00 201.08 ?  148 TYR A CA  1 
ATOM 801  C C   . TYR A 1 107 ? 166.404 131.249 174.218 1.00 194.38 ?  148 TYR A C   1 
ATOM 802  O O   . TYR A 1 107 ? 165.597 132.050 173.745 1.00 195.55 ?  148 TYR A O   1 
ATOM 803  C CB  . TYR A 1 107 ? 166.467 129.093 175.511 1.00 227.69 ?  148 TYR A CB  1 
ATOM 804  C CG  . TYR A 1 107 ? 165.448 128.350 174.698 1.00 256.61 ?  148 TYR A CG  1 
ATOM 805  C CD1 . TYR A 1 107 ? 165.585 128.247 173.329 1.00 265.14 ?  148 TYR A CD1 1 
ATOM 806  C CD2 . TYR A 1 107 ? 164.325 127.782 175.293 1.00 266.47 ?  148 TYR A CD2 1 
ATOM 807  C CE1 . TYR A 1 107 ? 164.657 127.592 172.567 1.00 273.09 ?  148 TYR A CE1 1 
ATOM 808  C CE2 . TYR A 1 107 ? 163.377 127.119 174.531 1.00 270.07 ?  148 TYR A CE2 1 
ATOM 809  C CZ  . TYR A 1 107 ? 163.560 127.029 173.162 1.00 273.68 ?  148 TYR A CZ  1 
ATOM 810  O OH  . TYR A 1 107 ? 162.670 126.383 172.346 1.00 275.39 ?  148 TYR A OH  1 
ATOM 811  N N   . HIS A 1 108 ? 169.924 129.937 169.062 1.00 30.00  ?  158 HIS A N   1 
ATOM 812  C CA  . HIS A 1 108 ? 169.937 131.282 169.623 1.00 30.00  ?  158 HIS A CA  1 
ATOM 813  C C   . HIS A 1 108 ? 168.933 131.536 170.753 1.00 30.00  ?  158 HIS A C   1 
ATOM 814  O O   . HIS A 1 108 ? 168.112 132.436 170.583 1.00 30.00  ?  158 HIS A O   1 
ATOM 815  C CB  . HIS A 1 108 ? 169.639 132.319 168.534 1.00 20.00  ?  158 HIS A CB  1 
ATOM 816  C CG  . HIS A 1 108 ? 170.633 132.360 167.417 1.00 20.00  ?  158 HIS A CG  1 
ATOM 817  N ND1 . HIS A 1 108 ? 171.918 132.831 167.577 1.00 20.00  ?  158 HIS A ND1 1 
ATOM 818  C CD2 . HIS A 1 108 ? 170.512 132.039 166.108 1.00 20.00  ?  158 HIS A CD2 1 
ATOM 819  C CE1 . HIS A 1 108 ? 172.554 132.773 166.421 1.00 20.00  ?  158 HIS A CE1 1 
ATOM 820  N NE2 . HIS A 1 108 ? 171.722 132.296 165.513 1.00 20.00  ?  158 HIS A NE2 1 
ATOM 821  N N   . CYS A 1 109 ? 168.919 130.828 171.891 1.00 30.00  ?  159 CYS A N   1 
ATOM 822  C CA  . CYS A 1 109 ? 169.622 129.594 172.288 1.00 30.00  ?  159 CYS A CA  1 
ATOM 823  C C   . CYS A 1 109 ? 171.065 129.349 171.877 1.00 30.00  ?  159 CYS A C   1 
ATOM 824  O O   . CYS A 1 109 ? 171.965 130.135 172.168 1.00 30.00  ?  159 CYS A O   1 
ATOM 825  C CB  . CYS A 1 109 ? 168.810 128.374 171.830 1.00 20.00  ?  159 CYS A CB  1 
ATOM 826  S SG  . CYS A 1 109 ? 168.510 128.195 170.061 1.00 20.00  ?  159 CYS A SG  1 
ATOM 827  N N   . ARG A 1 110 ? 171.256 128.221 171.208 1.00 30.00  ?  160 ARG A N   1 
ATOM 828  C CA  . ARG A 1 110 ? 172.565 127.638 171.017 1.00 30.00  ?  160 ARG A CA  1 
ATOM 829  C C   . ARG A 1 110 ? 172.493 126.688 169.824 1.00 30.00  ?  160 ARG A C   1 
ATOM 830  O O   . ARG A 1 110 ? 171.408 126.395 169.323 1.00 30.00  ?  160 ARG A O   1 
ATOM 831  C CB  . ARG A 1 110 ? 173.007 126.934 172.306 1.00 20.00  ?  160 ARG A CB  1 
ATOM 832  C CG  . ARG A 1 110 ? 174.348 126.243 172.252 1.00 20.00  ?  160 ARG A CG  1 
ATOM 833  C CD  . ARG A 1 110 ? 175.448 127.191 171.853 1.00 20.00  ?  160 ARG A CD  1 
ATOM 834  N NE  . ARG A 1 110 ? 176.729 126.499 171.789 1.00 20.00  ?  160 ARG A NE  1 
ATOM 835  C CZ  . ARG A 1 110 ? 177.807 126.983 171.186 1.00 20.00  ?  160 ARG A CZ  1 
ATOM 836  N NH1 . ARG A 1 110 ? 177.758 128.167 170.592 1.00 20.00  ?  160 ARG A NH1 1 
ATOM 837  N NH2 . ARG A 1 110 ? 178.934 126.285 171.175 1.00 20.00  ?  160 ARG A NH2 1 
ATOM 838  N N   . GLU A 1 111 ? 173.644 126.219 169.364 1.00 30.00  ?  161 GLU A N   1 
ATOM 839  C CA  . GLU A 1 111 ? 173.737 125.511 168.099 1.00 30.00  ?  161 GLU A CA  1 
ATOM 840  C C   . GLU A 1 111 ? 173.490 124.000 168.133 1.00 30.00  ?  161 GLU A C   1 
ATOM 841  O O   . GLU A 1 111 ? 173.616 123.358 167.091 1.00 30.00  ?  161 GLU A O   1 
ATOM 842  C CB  . GLU A 1 111 ? 175.116 125.757 167.482 1.00 20.00  ?  161 GLU A CB  1 
ATOM 843  C CG  . GLU A 1 111 ? 175.389 127.206 167.107 1.00 20.00  ?  161 GLU A CG  1 
ATOM 844  C CD  . GLU A 1 111 ? 176.741 127.386 166.439 1.00 20.00  ?  161 GLU A CD  1 
ATOM 845  O OE1 . GLU A 1 111 ? 177.533 126.421 166.434 1.00 20.00  ?  161 GLU A OE1 1 
ATOM 846  O OE2 . GLU A 1 111 ? 177.004 128.485 165.904 1.00 20.00  ?  161 GLU A OE2 1 
ATOM 847  N N   . ILE A 1 112 ? 173.164 123.424 169.293 1.00 155.30 ?  162 ILE A N   1 
ATOM 848  C CA  . ILE A 1 112 ? 173.049 121.965 169.369 1.00 153.69 ?  162 ILE A CA  1 
ATOM 849  C C   . ILE A 1 112 ? 172.059 121.491 168.326 1.00 158.65 ?  162 ILE A C   1 
ATOM 850  O O   . ILE A 1 112 ? 170.866 121.799 168.371 1.00 163.25 ?  162 ILE A O   1 
ATOM 851  C CB  . ILE A 1 112 ? 172.599 121.463 170.745 1.00 143.55 ?  162 ILE A CB  1 
ATOM 852  C CG1 . ILE A 1 112 ? 173.602 121.864 171.823 1.00 140.88 ?  162 ILE A CG1 1 
ATOM 853  C CG2 . ILE A 1 112 ? 172.411 119.950 170.716 1.00 143.89 ?  162 ILE A CG2 1 
ATOM 854  C CD1 . ILE A 1 112 ? 173.123 123.001 172.677 1.00 135.79 ?  162 ILE A CD1 1 
ATOM 855  N N   . GLN A 1 113 ? 172.578 120.716 167.390 1.00 157.99 ?  163 GLN A N   1 
ATOM 856  C CA  . GLN A 1 113 ? 171.913 120.570 166.120 1.00 164.01 ?  163 GLN A CA  1 
ATOM 857  C C   . GLN A 1 113 ? 170.903 119.440 166.206 1.00 178.49 ?  163 GLN A C   1 
ATOM 858  O O   . GLN A 1 113 ? 171.159 118.330 165.749 1.00 182.61 ?  163 GLN A O   1 
ATOM 859  C CB  . GLN A 1 113 ? 172.937 120.317 165.018 1.00 162.91 ?  163 GLN A CB  1 
ATOM 860  C CG  . GLN A 1 113 ? 172.445 120.721 163.661 1.00 158.47 ?  163 GLN A CG  1 
ATOM 861  C CD  . GLN A 1 113 ? 172.288 122.229 163.543 1.00 154.59 ?  163 GLN A CD  1 
ATOM 862  O OE1 . GLN A 1 113 ? 171.206 122.773 163.755 1.00 153.19 ?  163 GLN A OE1 1 
ATOM 863  N NE2 . GLN A 1 113 ? 173.366 122.907 163.175 1.00 151.96 ?  163 GLN A NE2 1 
ATOM 864  N N   . TRP A 1 114 ? 169.757 119.730 166.810 1.00 173.86 ?  164 TRP A N   1 
ATOM 865  C CA  . TRP A 1 114 ? 168.705 118.741 166.973 1.00 175.17 ?  164 TRP A CA  1 
ATOM 866  C C   . TRP A 1 114 ? 168.161 118.261 165.658 1.00 170.25 ?  164 TRP A C   1 
ATOM 867  O O   . TRP A 1 114 ? 167.865 117.087 165.497 1.00 170.96 ?  164 TRP A O   1 
ATOM 868  C CB  . TRP A 1 114 ? 167.608 119.334 167.838 1.00 180.80 ?  164 TRP A CB  1 
ATOM 869  C CG  . TRP A 1 114 ? 168.065 119.323 169.218 1.00 184.70 ?  164 TRP A CG  1 
ATOM 870  C CD1 . TRP A 1 114 ? 168.984 118.476 169.735 1.00 184.01 ?  164 TRP A CD1 1 
ATOM 871  C CD2 . TRP A 1 114 ? 167.783 120.277 170.238 1.00 192.17 ?  164 TRP A CD2 1 
ATOM 872  N NE1 . TRP A 1 114 ? 169.225 118.773 171.044 1.00 186.36 ?  164 TRP A NE1 1 
ATOM 873  C CE2 . TRP A 1 114 ? 168.510 119.889 171.376 1.00 194.36 ?  164 TRP A CE2 1 
ATOM 874  C CE3 . TRP A 1 114 ? 166.966 121.401 170.314 1.00 196.44 ?  164 TRP A CE3 1 
ATOM 875  C CZ2 . TRP A 1 114 ? 168.446 120.577 172.571 1.00 204.60 ?  164 TRP A CZ2 1 
ATOM 876  C CZ3 . TRP A 1 114 ? 166.910 122.088 171.501 1.00 203.49 ?  164 TRP A CZ3 1 
ATOM 877  C CH2 . TRP A 1 114 ? 167.650 121.676 172.613 1.00 208.98 ?  164 TRP A CH2 1 
ATOM 878  N N   . ASN A 1 115 ? 168.085 119.154 164.690 1.00 155.57 ?  165 ASN A N   1 
ATOM 879  C CA  . ASN A 1 115 ? 167.734 118.726 163.357 1.00 151.09 ?  165 ASN A CA  1 
ATOM 880  C C   . ASN A 1 115 ? 169.013 118.588 162.562 1.00 165.56 ?  165 ASN A C   1 
ATOM 881  O O   . ASN A 1 115 ? 169.183 119.251 161.550 1.00 168.85 ?  165 ASN A O   1 
ATOM 882  C CB  . ASN A 1 115 ? 166.794 119.721 162.689 1.00 142.95 ?  165 ASN A CB  1 
ATOM 883  C CG  . ASN A 1 115 ? 166.208 119.192 161.401 1.00 143.03 ?  165 ASN A CG  1 
ATOM 884  O OD1 . ASN A 1 115 ? 166.665 118.182 160.867 1.00 145.47 ?  165 ASN A OD1 1 
ATOM 885  N ND2 . ASN A 1 115 ? 165.217 119.898 160.869 1.00 146.07 ?  165 ASN A ND2 1 
ATOM 886  N N   . SER A 1 116 ? 169.900 117.709 163.012 1.00 166.76 ?  166 SER A N   1 
ATOM 887  C CA  . SER A 1 116 ? 171.274 117.688 162.524 1.00 169.53 ?  166 SER A CA  1 
ATOM 888  C C   . SER A 1 116 ? 171.377 117.471 161.023 1.00 167.25 ?  166 SER A C   1 
ATOM 889  O O   . SER A 1 116 ? 172.318 117.933 160.382 1.00 163.83 ?  166 SER A O   1 
ATOM 890  C CB  . SER A 1 116 ? 172.060 116.604 163.247 1.00 171.46 ?  166 SER A CB  1 
ATOM 891  O OG  . SER A 1 116 ? 171.497 115.335 162.977 1.00 174.62 ?  166 SER A OG  1 
ATOM 892  N N   . LEU A 1 117 ? 170.401 116.770 160.468 1.00 166.50 ?  167 LEU A N   1 
ATOM 893  C CA  . LEU A 1 117 ? 170.363 116.501 159.043 1.00 157.79 ?  167 LEU A CA  1 
ATOM 894  C C   . LEU A 1 117 ? 169.547 117.572 158.332 1.00 151.22 ?  167 LEU A C   1 
ATOM 895  O O   . LEU A 1 117 ? 169.339 117.518 157.121 1.00 152.29 ?  167 LEU A O   1 
ATOM 896  C CB  . LEU A 1 117 ? 169.792 115.111 158.809 1.00 160.47 ?  167 LEU A CB  1 
ATOM 897  C CG  . LEU A 1 117 ? 169.583 114.532 157.420 1.00 165.03 ?  167 LEU A CG  1 
ATOM 898  C CD1 . LEU A 1 117 ? 170.894 114.456 156.668 1.00 155.55 ?  167 LEU A CD1 1 
ATOM 899  C CD2 . LEU A 1 117 ? 169.000 113.164 157.630 1.00 176.79 ?  167 LEU A CD2 1 
ATOM 900  N N   . GLY A 1 118 ? 169.095 118.555 159.102 1.00 145.91 ?  168 GLY A N   1 
ATOM 901  C CA  . GLY A 1 118 ? 168.207 119.580 158.590 1.00 145.35 ?  168 GLY A CA  1 
ATOM 902  C C   . GLY A 1 118 ? 168.752 120.321 157.394 1.00 150.72 ?  168 GLY A C   1 
ATOM 903  O O   . GLY A 1 118 ? 169.675 121.125 157.505 1.00 158.12 ?  168 GLY A O   1 
ATOM 904  N N   . ASN A 1 119 ? 168.169 120.032 156.238 1.00 141.64 ?  169 ASN A N   1 
ATOM 905  C CA  . ASN A 1 119 ? 168.562 120.682 155.007 1.00 146.49 ?  169 ASN A CA  1 
ATOM 906  C C   . ASN A 1 119 ? 168.280 122.172 155.106 1.00 155.21 ?  169 ASN A C   1 
ATOM 907  O O   . ASN A 1 119 ? 169.019 122.994 154.574 1.00 153.57 ?  169 ASN A O   1 
ATOM 908  C CB  . ASN A 1 119 ? 167.809 120.075 153.825 1.00 88.54  ?  169 ASN A CB  1 
ATOM 909  C CG  . ASN A 1 119 ? 168.382 120.496 152.494 1.00 147.64 ?  169 ASN A CG  1 
ATOM 910  O OD1 . ASN A 1 119 ? 169.156 121.443 152.419 1.00 147.08 ?  169 ASN A OD1 1 
ATOM 911  N ND2 . ASN A 1 119 ? 167.988 119.807 151.430 1.00 146.77 ?  169 ASN A ND2 1 
ATOM 912  N N   . GLY A 1 120 ? 167.206 122.514 155.806 1.00 124.55 ?  170 GLY A N   1 
ATOM 913  C CA  . GLY A 1 120 ? 166.811 123.900 155.942 1.00 160.33 ?  170 GLY A CA  1 
ATOM 914  C C   . GLY A 1 120 ? 166.099 124.351 154.690 1.00 195.57 ?  170 GLY A C   1 
ATOM 915  O O   . GLY A 1 120 ? 165.836 125.536 154.500 1.00 204.29 ?  170 GLY A O   1 
ATOM 916  N N   . LEU A 1 121 ? 165.801 123.395 153.822 1.00 192.72 ?  171 LEU A N   1 
ATOM 917  C CA  . LEU A 1 121 ? 165.284 123.703 152.501 1.00 192.79 ?  171 LEU A CA  1 
ATOM 918  C C   . LEU A 1 121 ? 163.823 124.126 152.485 1.00 155.67 ?  171 LEU A C   1 
ATOM 919  O O   . LEU A 1 121 ? 163.412 124.925 151.647 1.00 159.95 ?  171 LEU A O   1 
ATOM 920  C CB  . LEU A 1 121 ? 165.478 122.495 151.593 1.00 178.59 ?  171 LEU A CB  1 
ATOM 921  C CG  . LEU A 1 121 ? 165.192 122.678 150.107 1.00 152.72 ?  171 LEU A CG  1 
ATOM 922  C CD1 . LEU A 1 121 ? 166.153 121.829 149.306 1.00 141.44 ?  171 LEU A CD1 1 
ATOM 923  C CD2 . LEU A 1 121 ? 163.766 122.289 149.782 1.00 147.18 ?  171 LEU A CD2 1 
ATOM 924  N N   . ALA A 1 122 ? 163.044 123.597 153.416 1.00 187.46 ?  172 ALA A N   1 
ATOM 925  C CA  . ALA A 1 122 ? 161.597 123.698 153.328 1.00 139.99 ?  172 ALA A CA  1 
ATOM 926  C C   . ALA A 1 122 ? 161.113 125.129 153.341 1.00 107.60 ?  172 ALA A C   1 
ATOM 927  O O   . ALA A 1 122 ? 160.097 125.447 152.740 1.00 108.44 ?  172 ALA A O   1 
ATOM 928  C CB  . ALA A 1 122 ? 160.959 122.934 154.454 1.00 144.31 ?  172 ALA A CB  1 
ATOM 929  N N   . TYR A 1 123 ? 161.831 125.994 154.035 1.00 111.49 ?  173 TYR A N   1 
ATOM 930  C CA  . TYR A 1 123 ? 161.395 127.373 154.128 1.00 110.26 ?  173 TYR A CA  1 
ATOM 931  C C   . TYR A 1 123 ? 161.890 128.271 153.010 1.00 125.72 ?  173 TYR A C   1 
ATOM 932  O O   . TYR A 1 123 ? 161.495 129.431 152.935 1.00 129.26 ?  173 TYR A O   1 
ATOM 933  C CB  . TYR A 1 123 ? 161.811 127.961 155.465 1.00 109.55 ?  173 TYR A CB  1 
ATOM 934  C CG  . TYR A 1 123 ? 161.073 127.345 156.616 1.00 105.86 ?  173 TYR A CG  1 
ATOM 935  C CD1 . TYR A 1 123 ? 159.760 126.941 156.470 1.00 104.94 ?  173 TYR A CD1 1 
ATOM 936  C CD2 . TYR A 1 123 ? 161.669 127.203 157.854 1.00 110.28 ?  173 TYR A CD2 1 
ATOM 937  C CE1 . TYR A 1 123 ? 159.069 126.392 157.516 1.00 109.47 ?  173 TYR A CE1 1 
ATOM 938  C CE2 . TYR A 1 123 ? 160.982 126.658 158.909 1.00 112.40 ?  173 TYR A CE2 1 
ATOM 939  C CZ  . TYR A 1 123 ? 159.681 126.254 158.735 1.00 114.61 ?  173 TYR A CZ  1 
ATOM 940  O OH  . TYR A 1 123 ? 158.988 125.704 159.786 1.00 117.98 ?  173 TYR A OH  1 
ATOM 941  N N   . GLU A 1 124 ? 162.768 127.766 152.158 1.00 113.11 ?  174 GLU A N   1 
ATOM 942  C CA  . GLU A 1 124 ? 163.275 128.601 151.086 1.00 140.13 ?  174 GLU A CA  1 
ATOM 943  C C   . GLU A 1 124 ? 162.137 128.906 150.125 1.00 138.68 ?  174 GLU A C   1 
ATOM 944  O O   . GLU A 1 124 ? 161.386 128.007 149.761 1.00 137.43 ?  174 GLU A O   1 
ATOM 945  C CB  . GLU A 1 124 ? 164.430 127.913 150.364 1.00 163.73 ?  174 GLU A CB  1 
ATOM 946  C CG  . GLU A 1 124 ? 165.165 128.804 149.382 1.00 181.09 ?  174 GLU A CG  1 
ATOM 947  C CD  . GLU A 1 124 ? 165.938 129.916 150.068 1.00 194.55 ?  174 GLU A CD  1 
ATOM 948  O OE1 . GLU A 1 124 ? 166.146 129.836 151.295 1.00 203.08 ?  174 GLU A OE1 1 
ATOM 949  O OE2 . GLU A 1 124 ? 166.335 130.876 149.378 1.00 204.16 ?  174 GLU A OE2 1 
ATOM 950  N N   . ASP A 1 125 ? 162.002 130.160 149.704 1.00 157.20 ?  175 ASP A N   1 
ATOM 951  C CA  . ASP A 1 125 ? 160.909 130.513 148.802 1.00 152.00 ?  175 ASP A CA  1 
ATOM 952  C C   . ASP A 1 125 ? 161.228 130.180 147.353 1.00 138.41 ?  175 ASP A C   1 
ATOM 953  O O   . ASP A 1 125 ? 162.360 130.333 146.905 1.00 145.89 ?  175 ASP A O   1 
ATOM 954  C CB  . ASP A 1 125 ? 160.555 131.990 148.911 1.00 153.04 ?  175 ASP A CB  1 
ATOM 955  C CG  . ASP A 1 125 ? 159.326 132.347 148.096 1.00 146.99 ?  175 ASP A CG  1 
ATOM 956  O OD1 . ASP A 1 125 ? 158.695 131.432 147.528 1.00 141.99 ?  175 ASP A OD1 1 
ATOM 957  O OD2 . ASP A 1 125 ? 158.988 133.543 148.015 1.00 145.45 ?  175 ASP A OD2 1 
ATOM 958  N N   . PHE A 1 126 ? 160.202 129.772 146.613 1.00 141.17 ?  176 PHE A N   1 
ATOM 959  C CA  . PHE A 1 126 ? 160.378 129.286 145.253 1.00 116.95 ?  176 PHE A CA  1 
ATOM 960  C C   . PHE A 1 126 ? 159.475 130.019 144.279 1.00 107.70 ?  176 PHE A C   1 
ATOM 961  O O   . PHE A 1 126 ? 158.260 130.067 144.456 1.00 108.09 ?  176 PHE A O   1 
ATOM 962  C CB  . PHE A 1 126 ? 160.079 127.796 145.190 1.00 121.62 ?  176 PHE A CB  1 
ATOM 963  C CG  . PHE A 1 126 ? 160.956 126.970 146.067 1.00 128.35 ?  176 PHE A CG  1 
ATOM 964  C CD1 . PHE A 1 126 ? 162.229 127.386 146.394 1.00 134.66 ?  176 PHE A CD1 1 
ATOM 965  C CD2 . PHE A 1 126 ? 160.483 125.797 146.610 1.00 134.47 ?  176 PHE A CD2 1 
ATOM 966  C CE1 . PHE A 1 126 ? 163.023 126.635 147.220 1.00 141.26 ?  176 PHE A CE1 1 
ATOM 967  C CE2 . PHE A 1 126 ? 161.269 125.038 147.434 1.00 136.34 ?  176 PHE A CE2 1 
ATOM 968  C CZ  . PHE A 1 126 ? 162.544 125.458 147.744 1.00 141.85 ?  176 PHE A CZ  1 
ATOM 969  N N   . SER A 1 127 ? 160.077 130.581 143.243 1.00 111.89 ?  177 SER A N   1 
ATOM 970  C CA  . SER A 1 127 ? 159.332 131.279 142.211 1.00 125.28 ?  177 SER A CA  1 
ATOM 971  C C   . SER A 1 127 ? 158.475 130.339 141.385 1.00 133.58 ?  177 SER A C   1 
ATOM 972  O O   . SER A 1 127 ? 157.463 130.741 140.826 1.00 137.41 ?  177 SER A O   1 
ATOM 973  C CB  . SER A 1 127 ? 160.292 132.019 141.292 1.00 130.31 ?  177 SER A CB  1 
ATOM 974  O OG  . SER A 1 127 ? 161.143 131.098 140.637 1.00 130.77 ?  177 SER A OG  1 
ATOM 975  N N   . PHE A 1 128 ? 158.875 129.077 141.332 1.00 132.77 ?  178 PHE A N   1 
ATOM 976  C CA  . PHE A 1 128 ? 158.311 128.145 140.374 1.00 132.08 ?  178 PHE A CA  1 
ATOM 977  C C   . PHE A 1 128 ? 157.716 126.948 141.085 1.00 128.38 ?  178 PHE A C   1 
ATOM 978  O O   . PHE A 1 128 ? 158.188 126.557 142.141 1.00 145.13 ?  178 PHE A O   1 
ATOM 979  C CB  . PHE A 1 128 ? 159.391 127.687 139.413 1.00 139.77 ?  178 PHE A CB  1 
ATOM 980  C CG  . PHE A 1 128 ? 160.499 126.956 140.085 1.00 143.60 ?  178 PHE A CG  1 
ATOM 981  C CD1 . PHE A 1 128 ? 161.549 127.640 140.658 1.00 146.34 ?  178 PHE A CD1 1 
ATOM 982  C CD2 . PHE A 1 128 ? 160.467 125.587 140.191 1.00 144.83 ?  178 PHE A CD2 1 
ATOM 983  C CE1 . PHE A 1 128 ? 162.559 126.963 141.291 1.00 146.78 ?  178 PHE A CE1 1 
ATOM 984  C CE2 . PHE A 1 128 ? 161.474 124.909 140.820 1.00 148.55 ?  178 PHE A CE2 1 
ATOM 985  C CZ  . PHE A 1 128 ? 162.518 125.596 141.374 1.00 148.89 ?  178 PHE A CZ  1 
ATOM 986  N N   . PRO A 1 129 ? 156.685 126.351 140.493 1.00 113.12 ?  179 PRO A N   1 
ATOM 987  C CA  . PRO A 1 129 ? 155.915 125.255 141.085 1.00 107.65 ?  179 PRO A CA  1 
ATOM 988  C C   . PRO A 1 129 ? 156.713 123.976 141.293 1.00 115.34 ?  179 PRO A C   1 
ATOM 989  O O   . PRO A 1 129 ? 157.636 123.711 140.534 1.00 120.28 ?  179 PRO A O   1 
ATOM 990  C CB  . PRO A 1 129 ? 154.813 125.027 140.060 1.00 100.25 ?  179 PRO A CB  1 
ATOM 991  C CG  . PRO A 1 129 ? 154.685 126.318 139.356 1.00 98.76  ?  179 PRO A CG  1 
ATOM 992  C CD  . PRO A 1 129 ? 156.077 126.818 139.240 1.00 105.15 ?  179 PRO A CD  1 
ATOM 993  N N   . ILE A 1 130 ? 156.369 123.205 142.320 1.00 92.72  ?  180 ILE A N   1 
ATOM 994  C CA  . ILE A 1 130 ? 156.945 121.878 142.508 1.00 100.05 ?  180 ILE A CA  1 
ATOM 995  C C   . ILE A 1 130 ? 155.897 120.828 142.845 1.00 102.47 ?  180 ILE A C   1 
ATOM 996  O O   . ILE A 1 130 ? 155.211 120.949 143.851 1.00 92.23  ?  180 ILE A O   1 
ATOM 997  C CB  . ILE A 1 130 ? 157.976 121.865 143.631 1.00 122.59 ?  180 ILE A CB  1 
ATOM 998  C CG1 . ILE A 1 130 ? 159.184 122.709 143.254 1.00 118.95 ?  180 ILE A CG1 1 
ATOM 999  C CG2 . ILE A 1 130 ? 158.402 120.449 143.928 1.00 159.35 ?  180 ILE A CG2 1 
ATOM 1000 C CD1 . ILE A 1 130 ? 159.181 124.071 143.871 1.00 119.96 ?  180 ILE A CD1 1 
ATOM 1001 N N   . PHE A 1 131 ? 155.773 119.790 142.025 1.00 126.53 ?  181 PHE A N   1 
ATOM 1002 C CA  . PHE A 1 131 ? 154.934 118.658 142.400 1.00 136.60 ?  181 PHE A CA  1 
ATOM 1003 C C   . PHE A 1 131 ? 155.740 117.415 142.659 1.00 144.18 ?  181 PHE A C   1 
ATOM 1004 O O   . PHE A 1 131 ? 156.773 117.178 142.030 1.00 145.67 ?  181 PHE A O   1 
ATOM 1005 C CB  . PHE A 1 131 ? 153.912 118.320 141.328 1.00 127.26 ?  181 PHE A CB  1 
ATOM 1006 C CG  . PHE A 1 131 ? 152.877 119.358 141.130 1.00 120.20 ?  181 PHE A CG  1 
ATOM 1007 C CD1 . PHE A 1 131 ? 152.712 120.369 142.043 1.00 121.91 ?  181 PHE A CD1 1 
ATOM 1008 C CD2 . PHE A 1 131 ? 152.032 119.295 140.043 1.00 119.57 ?  181 PHE A CD2 1 
ATOM 1009 C CE1 . PHE A 1 131 ? 151.749 121.323 141.855 1.00 125.55 ?  181 PHE A CE1 1 
ATOM 1010 C CE2 . PHE A 1 131 ? 151.067 120.238 139.854 1.00 125.02 ?  181 PHE A CE2 1 
ATOM 1011 C CZ  . PHE A 1 131 ? 150.922 121.255 140.761 1.00 129.83 ?  181 PHE A CZ  1 
ATOM 1012 N N   . LEU A 1 132 ? 155.249 116.602 143.580 1.00 147.70 ?  182 LEU A N   1 
ATOM 1013 C CA  . LEU A 1 132 ? 155.748 115.252 143.687 1.00 129.10 ?  182 LEU A CA  1 
ATOM 1014 C C   . LEU A 1 132 ? 154.657 114.334 143.174 1.00 115.26 ?  182 LEU A C   1 
ATOM 1015 O O   . LEU A 1 132 ? 153.526 114.369 143.649 1.00 116.01 ?  182 LEU A O   1 
ATOM 1016 C CB  . LEU A 1 132 ? 156.163 114.922 145.120 1.00 120.56 ?  182 LEU A CB  1 
ATOM 1017 C CG  . LEU A 1 132 ? 155.175 114.887 146.280 1.00 69.10  ?  182 LEU A CG  1 
ATOM 1018 C CD1 . LEU A 1 132 ? 154.516 113.521 146.402 1.00 70.34  ?  182 LEU A CD1 1 
ATOM 1019 C CD2 . LEU A 1 132 ? 155.893 115.262 147.554 1.00 65.99  ?  182 LEU A CD2 1 
ATOM 1020 N N   . LEU A 1 133 ? 154.976 113.566 142.144 1.00 100.43 ?  183 LEU A N   1 
ATOM 1021 C CA  . LEU A 1 133 ? 154.009 112.627 141.621 1.00 100.95 ?  183 LEU A CA  1 
ATOM 1022 C C   . LEU A 1 133 ? 153.824 111.451 142.549 1.00 306.24 ?  183 LEU A C   1 
ATOM 1023 O O   . LEU A 1 133 ? 154.768 110.973 143.172 1.00 309.53 ?  183 LEU A O   1 
ATOM 1024 C CB  . LEU A 1 133 ? 154.416 112.154 140.239 1.00 172.64 ?  183 LEU A CB  1 
ATOM 1025 C CG  . LEU A 1 133 ? 154.346 113.324 139.273 1.00 149.53 ?  183 LEU A CG  1 
ATOM 1026 C CD1 . LEU A 1 133 ? 154.762 112.896 137.883 1.00 150.85 ?  183 LEU A CD1 1 
ATOM 1027 C CD2 . LEU A 1 133 ? 152.938 113.871 139.286 1.00 150.06 ?  183 LEU A CD2 1 
ATOM 1028 N N   . GLU A 1 134 ? 152.590 110.989 142.636 1.00 248.33 ?  184 GLU A N   1 
ATOM 1029 C CA  . GLU A 1 134 ? 152.278 109.816 143.420 1.00 247.62 ?  184 GLU A CA  1 
ATOM 1030 C C   . GLU A 1 134 ? 152.211 108.628 142.475 1.00 227.30 ?  184 GLU A C   1 
ATOM 1031 O O   . GLU A 1 134 ? 151.860 108.795 141.309 1.00 228.31 ?  184 GLU A O   1 
ATOM 1032 C CB  . GLU A 1 134 ? 150.962 110.012 144.169 1.00 174.28 ?  184 GLU A CB  1 
ATOM 1033 C CG  . GLU A 1 134 ? 150.644 108.918 145.152 1.00 173.28 ?  184 GLU A CG  1 
ATOM 1034 C CD  . GLU A 1 134 ? 151.620 108.881 146.304 1.00 172.85 ?  184 GLU A CD  1 
ATOM 1035 O OE1 . GLU A 1 134 ? 152.366 109.865 146.488 1.00 174.53 ?  184 GLU A OE1 1 
ATOM 1036 O OE2 . GLU A 1 134 ? 151.647 107.863 147.024 1.00 170.39 ?  184 GLU A OE2 1 
ATOM 1037 N N   . ASP A 1 135 ? 152.551 107.445 142.978 1.00 211.43 ?  185 ASP A N   1 
ATOM 1038 C CA  . ASP A 1 135 ? 152.583 106.212 142.188 1.00 191.44 ?  185 ASP A CA  1 
ATOM 1039 C C   . ASP A 1 135 ? 153.629 106.258 141.079 1.00 176.55 ?  185 ASP A C   1 
ATOM 1040 O O   . ASP A 1 135 ? 153.683 107.181 140.273 1.00 178.68 ?  185 ASP A O   1 
ATOM 1041 C CB  . ASP A 1 135 ? 151.206 105.902 141.588 1.00 187.83 ?  185 ASP A CB  1 
ATOM 1042 C CG  . ASP A 1 135 ? 151.184 104.596 140.799 1.00 193.68 ?  185 ASP A CG  1 
ATOM 1043 O OD1 . ASP A 1 135 ? 152.193 103.858 140.795 1.00 196.15 ?  185 ASP A OD1 1 
ATOM 1044 O OD2 . ASP A 1 135 ? 150.148 104.311 140.163 1.00 195.46 ?  185 ASP A OD2 1 
ATOM 1045 N N   . GLU A 1 136 ? 154.461 105.229 141.058 1.00 30.00  ?  186 GLU A N   1 
ATOM 1046 C CA  . GLU A 1 136 ? 155.474 105.066 140.034 1.00 30.00  ?  186 GLU A CA  1 
ATOM 1047 C C   . GLU A 1 136 ? 154.890 104.849 138.644 1.00 30.00  ?  186 GLU A C   1 
ATOM 1048 O O   . GLU A 1 136 ? 155.473 105.268 137.645 1.00 30.00  ?  186 GLU A O   1 
ATOM 1049 C CB  . GLU A 1 136 ? 156.368 103.886 140.401 1.00 20.00  ?  186 GLU A CB  1 
ATOM 1050 C CG  . GLU A 1 136 ? 157.470 103.591 139.414 1.00 20.00  ?  186 GLU A CG  1 
ATOM 1051 C CD  . GLU A 1 136 ? 158.312 102.411 139.839 1.00 20.00  ?  186 GLU A CD  1 
ATOM 1052 O OE1 . GLU A 1 136 ? 158.023 101.831 140.906 1.00 20.00  ?  186 GLU A OE1 1 
ATOM 1053 O OE2 . GLU A 1 136 ? 159.252 102.053 139.101 1.00 20.00  ?  186 GLU A OE2 1 
ATOM 1054 N N   . ASN A 1 137 ? 153.724 104.218 138.588 1.00 193.33 ?  187 ASN A N   1 
ATOM 1055 C CA  . ASN A 1 137 ? 153.244 103.644 137.342 1.00 172.16 ?  187 ASN A CA  1 
ATOM 1056 C C   . ASN A 1 137 ? 153.048 104.679 136.240 1.00 165.69 ?  187 ASN A C   1 
ATOM 1057 O O   . ASN A 1 137 ? 153.281 104.398 135.069 1.00 163.60 ?  187 ASN A O   1 
ATOM 1058 C CB  . ASN A 1 137 ? 151.935 102.896 137.587 1.00 20.00  ?  187 ASN A CB  1 
ATOM 1059 C CG  . ASN A 1 137 ? 151.588 101.947 136.461 1.00 20.00  ?  187 ASN A CG  1 
ATOM 1060 O OD1 . ASN A 1 137 ? 152.472 101.376 135.825 1.00 20.00  ?  187 ASN A OD1 1 
ATOM 1061 N ND2 . ASN A 1 137 ? 150.296 101.771 136.207 1.00 20.00  ?  187 ASN A ND2 1 
ATOM 1062 N N   . GLU A 1 138 ? 152.643 105.883 136.621 1.00 159.63 ?  188 GLU A N   1 
ATOM 1063 C CA  . GLU A 1 138 ? 152.414 106.947 135.654 1.00 158.96 ?  188 GLU A CA  1 
ATOM 1064 C C   . GLU A 1 138 ? 153.729 107.614 135.325 1.00 167.42 ?  188 GLU A C   1 
ATOM 1065 O O   . GLU A 1 138 ? 153.954 108.104 134.211 1.00 153.68 ?  188 GLU A O   1 
ATOM 1066 C CB  . GLU A 1 138 ? 151.430 107.971 136.205 1.00 20.00  ?  188 GLU A CB  1 
ATOM 1067 C CG  . GLU A 1 138 ? 150.070 107.389 136.540 1.00 20.00  ?  188 GLU A CG  1 
ATOM 1068 C CD  . GLU A 1 138 ? 150.060 106.701 137.891 1.00 20.00  ?  188 GLU A CD  1 
ATOM 1069 O OE1 . GLU A 1 138 ? 151.139 106.616 138.513 1.00 20.00  ?  188 GLU A OE1 1 
ATOM 1070 O OE2 . GLU A 1 138 ? 148.985 106.247 138.333 1.00 20.00  ?  188 GLU A OE2 1 
ATOM 1071 N N   . THR A 1 139 ? 154.604 107.630 136.317 1.00 154.00 ?  189 THR A N   1 
ATOM 1072 C CA  . THR A 1 139 ? 155.904 108.227 136.136 1.00 180.31 ?  189 THR A CA  1 
ATOM 1073 C C   . THR A 1 139 ? 156.631 107.451 135.066 1.00 199.59 ?  189 THR A C   1 
ATOM 1074 O O   . THR A 1 139 ? 157.357 108.011 134.264 1.00 205.58 ?  189 THR A O   1 
ATOM 1075 C CB  . THR A 1 139 ? 156.724 108.200 137.415 1.00 20.00  ?  189 THR A CB  1 
ATOM 1076 O OG1 . THR A 1 139 ? 156.999 106.841 137.765 1.00 20.00  ?  189 THR A OG1 1 
ATOM 1077 C CG2 . THR A 1 139 ? 155.945 108.835 138.538 1.00 20.00  ?  189 THR A CG2 1 
ATOM 1078 N N   . LYS A 1 140 ? 156.399 106.150 135.034 1.00 244.08 ?  190 LYS A N   1 
ATOM 1079 C CA  . LYS A 1 140 ? 157.020 105.328 134.021 1.00 247.74 ?  190 LYS A CA  1 
ATOM 1080 C C   . LYS A 1 140 ? 156.502 105.755 132.658 1.00 198.14 ?  190 LYS A C   1 
ATOM 1081 O O   . LYS A 1 140 ? 157.234 105.770 131.668 1.00 200.22 ?  190 LYS A O   1 
ATOM 1082 C CB  . LYS A 1 140 ? 156.724 103.855 134.286 1.00 20.00  ?  190 LYS A CB  1 
ATOM 1083 C CG  . LYS A 1 140 ? 157.471 102.887 133.396 1.00 20.00  ?  190 LYS A CG  1 
ATOM 1084 C CD  . LYS A 1 140 ? 157.007 101.467 133.663 1.00 20.00  ?  190 LYS A CD  1 
ATOM 1085 C CE  . LYS A 1 140 ? 157.386 101.027 135.068 1.00 20.00  ?  190 LYS A CE  1 
ATOM 1086 N NZ  . LYS A 1 140 ? 156.903 99.652  135.375 1.00 20.00  ?  190 LYS A NZ  1 
ATOM 1087 N N   . VAL A 1 141 ? 155.235 106.145 132.630 1.00 175.95 ?  191 VAL A N   1 
ATOM 1088 C CA  . VAL A 1 141 ? 154.585 106.506 131.385 1.00 160.61 ?  191 VAL A CA  1 
ATOM 1089 C C   . VAL A 1 141 ? 155.182 107.769 130.819 1.00 147.83 ?  191 VAL A C   1 
ATOM 1090 O O   . VAL A 1 141 ? 155.540 107.830 129.639 1.00 136.34 ?  191 VAL A O   1 
ATOM 1091 C CB  . VAL A 1 141 ? 153.090 106.709 131.579 1.00 20.00  ?  191 VAL A CB  1 
ATOM 1092 C CG1 . VAL A 1 141 ? 152.457 107.166 130.289 1.00 20.00  ?  191 VAL A CG1 1 
ATOM 1093 C CG2 . VAL A 1 141 ? 152.456 105.429 132.072 1.00 20.00  ?  191 VAL A CG2 1 
ATOM 1094 N N   . ILE A 1 142 ? 155.309 108.781 131.665 1.00 172.42 ?  192 ILE A N   1 
ATOM 1095 C CA  . ILE A 1 142 ? 155.956 109.994 131.210 1.00 188.06 ?  192 ILE A CA  1 
ATOM 1096 C C   . ILE A 1 142 ? 157.418 109.726 130.869 1.00 211.89 ?  192 ILE A C   1 
ATOM 1097 O O   . ILE A 1 142 ? 157.969 110.338 129.948 1.00 217.82 ?  192 ILE A O   1 
ATOM 1098 C CB  . ILE A 1 142 ? 155.829 111.126 132.242 1.00 20.00  ?  192 ILE A CB  1 
ATOM 1099 C CG1 . ILE A 1 142 ? 156.598 112.359 131.776 1.00 20.00  ?  192 ILE A CG1 1 
ATOM 1100 C CG2 . ILE A 1 142 ? 156.274 110.688 133.598 1.00 20.00  ?  192 ILE A CG2 1 
ATOM 1101 C CD1 . ILE A 1 142 ? 156.085 112.935 130.492 1.00 20.00  ?  192 ILE A CD1 1 
ATOM 1102 N N   . LYS A 1 143 ? 158.033 108.775 131.561 1.00 202.80 ?  193 LYS A N   1 
ATOM 1103 C CA  . LYS A 1 143 ? 159.402 108.418 131.229 1.00 210.34 ?  193 LYS A CA  1 
ATOM 1104 C C   . LYS A 1 143 ? 159.485 107.866 129.821 1.00 215.89 ?  193 LYS A C   1 
ATOM 1105 O O   . LYS A 1 143 ? 160.458 108.105 129.111 1.00 216.69 ?  193 LYS A O   1 
ATOM 1106 C CB  . LYS A 1 143 ? 159.950 107.401 132.217 1.00 20.00  ?  193 LYS A CB  1 
ATOM 1107 C CG  . LYS A 1 143 ? 160.229 107.965 133.589 1.00 20.00  ?  193 LYS A CG  1 
ATOM 1108 C CD  . LYS A 1 143 ? 160.615 106.857 134.545 1.00 20.00  ?  193 LYS A CD  1 
ATOM 1109 C CE  . LYS A 1 143 ? 160.917 107.397 135.927 1.00 20.00  ?  193 LYS A CE  1 
ATOM 1110 N NZ  . LYS A 1 143 ? 161.247 106.298 136.872 1.00 20.00  ?  193 LYS A NZ  1 
ATOM 1111 N N   . GLN A 1 144 ? 158.454 107.141 129.406 1.00 212.17 ?  194 GLN A N   1 
ATOM 1112 C CA  . GLN A 1 144 ? 158.375 106.734 128.015 1.00 192.52 ?  194 GLN A CA  1 
ATOM 1113 C C   . GLN A 1 144 ? 158.159 107.922 127.108 1.00 167.46 ?  194 GLN A C   1 
ATOM 1114 O O   . GLN A 1 144 ? 158.705 107.979 126.011 1.00 167.51 ?  194 GLN A O   1 
ATOM 1115 C CB  . GLN A 1 144 ? 157.252 105.736 127.795 1.00 20.00  ?  194 GLN A CB  1 
ATOM 1116 C CG  . GLN A 1 144 ? 157.492 104.406 128.418 1.00 20.00  ?  194 GLN A CG  1 
ATOM 1117 C CD  . GLN A 1 144 ? 156.374 103.454 128.119 1.00 20.00  ?  194 GLN A CD  1 
ATOM 1118 O OE1 . GLN A 1 144 ? 155.254 103.871 127.829 1.00 20.00  ?  194 GLN A OE1 1 
ATOM 1119 N NE2 . GLN A 1 144 ? 156.665 102.164 128.179 1.00 20.00  ?  194 GLN A NE2 1 
ATOM 1120 N N   . CYS A 1 145 ? 157.361 108.873 127.576 1.00 176.45 ?  195 CYS A N   1 
ATOM 1121 C CA  . CYS A 1 145 ? 157.017 110.014 126.748 1.00 163.03 ?  195 CYS A CA  1 
ATOM 1122 C C   . CYS A 1 145 ? 158.234 110.834 126.396 1.00 162.42 ?  195 CYS A C   1 
ATOM 1123 O O   . CYS A 1 145 ? 158.346 111.345 125.285 1.00 165.30 ?  195 CYS A O   1 
ATOM 1124 C CB  . CYS A 1 145 ? 156.000 110.901 127.457 1.00 20.00  ?  195 CYS A CB  1 
ATOM 1125 S SG  . CYS A 1 145 ? 155.582 112.408 126.550 1.00 20.00  ?  195 CYS A SG  1 
ATOM 1126 N N   . TYR A 1 146 ? 159.162 110.949 127.334 1.00 159.79 ?  196 TYR A N   1 
ATOM 1127 C CA  . TYR A 1 146 ? 160.373 111.681 127.030 1.00 154.56 ?  196 TYR A CA  1 
ATOM 1128 C C   . TYR A 1 146 ? 161.224 110.912 126.053 1.00 179.44 ?  196 TYR A C   1 
ATOM 1129 O O   . TYR A 1 146 ? 161.671 111.442 125.043 1.00 184.77 ?  196 TYR A O   1 
ATOM 1130 C CB  . TYR A 1 146 ? 161.187 111.958 128.281 1.00 20.00  ?  196 TYR A CB  1 
ATOM 1131 C CG  . TYR A 1 146 ? 162.536 112.521 127.935 1.00 20.00  ?  196 TYR A CG  1 
ATOM 1132 C CD1 . TYR A 1 146 ? 162.679 113.851 127.584 1.00 20.00  ?  196 TYR A CD1 1 
ATOM 1133 C CD2 . TYR A 1 146 ? 163.662 111.716 127.922 1.00 20.00  ?  196 TYR A CD2 1 
ATOM 1134 C CE1 . TYR A 1 146 ? 163.912 114.371 127.252 1.00 20.00  ?  196 TYR A CE1 1 
ATOM 1135 C CE2 . TYR A 1 146 ? 164.895 112.223 127.587 1.00 20.00  ?  196 TYR A CE2 1 
ATOM 1136 C CZ  . TYR A 1 146 ? 165.016 113.552 127.253 1.00 20.00  ?  196 TYR A CZ  1 
ATOM 1137 O OH  . TYR A 1 146 ? 166.249 114.062 126.922 1.00 20.00  ?  196 TYR A OH  1 
ATOM 1138 N N   . GLN A 1 147 ? 161.424 109.642 126.373 1.00 168.44 ?  197 GLN A N   1 
ATOM 1139 C CA  . GLN A 1 147 ? 162.336 108.777 125.647 1.00 163.17 ?  197 GLN A CA  1 
ATOM 1140 C C   . GLN A 1 147 ? 162.119 108.838 124.150 1.00 154.49 ?  197 GLN A C   1 
ATOM 1141 O O   . GLN A 1 147 ? 162.908 109.415 123.411 1.00 156.71 ?  197 GLN A O   1 
ATOM 1142 C CB  . GLN A 1 147 ? 162.157 107.346 126.134 1.00 162.57 ?  197 GLN A CB  1 
ATOM 1143 C CG  . GLN A 1 147 ? 163.096 106.348 125.525 1.00 146.33 ?  197 GLN A CG  1 
ATOM 1144 C CD  . GLN A 1 147 ? 162.902 104.973 126.122 1.00 145.62 ?  197 GLN A CD  1 
ATOM 1145 O OE1 . GLN A 1 147 ? 162.134 104.803 127.067 1.00 153.45 ?  197 GLN A OE1 1 
ATOM 1146 N NE2 . GLN A 1 147 ? 163.582 103.981 125.565 1.00 141.61 ?  197 GLN A NE2 1 
ATOM 1147 N N   . ASP A 1 148 ? 160.996 108.288 123.724 1.00 144.08 ?  198 ASP A N   1 
ATOM 1148 C CA  . ASP A 1 148 ? 160.708 108.129 122.316 1.00 127.80 ?  198 ASP A CA  1 
ATOM 1149 C C   . ASP A 1 148 ? 160.693 109.439 121.532 1.00 132.53 ?  198 ASP A C   1 
ATOM 1150 O O   . ASP A 1 148 ? 161.087 109.472 120.372 1.00 136.06 ?  198 ASP A O   1 
ATOM 1151 C CB  . ASP A 1 148 ? 159.360 107.431 122.177 1.00 20.00  ?  198 ASP A CB  1 
ATOM 1152 C CG  . ASP A 1 148 ? 158.262 108.169 122.909 1.00 20.00  ?  198 ASP A CG  1 
ATOM 1153 O OD1 . ASP A 1 148 ? 158.588 109.138 123.623 1.00 20.00  ?  198 ASP A OD1 1 
ATOM 1154 O OD2 . ASP A 1 148 ? 157.080 107.793 122.773 1.00 20.00  ?  198 ASP A OD2 1 
ATOM 1155 N N   . HIS A 1 149 ? 160.261 110.522 122.161 1.00 133.79 ?  199 HIS A N   1 
ATOM 1156 C CA  . HIS A 1 149 ? 160.020 111.739 121.401 1.00 129.70 ?  199 HIS A CA  1 
ATOM 1157 C C   . HIS A 1 149 ? 161.043 112.838 121.603 1.00 137.73 ?  199 HIS A C   1 
ATOM 1158 O O   . HIS A 1 149 ? 160.890 113.921 121.043 1.00 127.48 ?  199 HIS A O   1 
ATOM 1159 C CB  . HIS A 1 149 ? 158.642 112.305 121.735 1.00 20.00  ?  199 HIS A CB  1 
ATOM 1160 C CG  . HIS A 1 149 ? 157.524 111.344 121.501 1.00 20.00  ?  199 HIS A CG  1 
ATOM 1161 N ND1 . HIS A 1 149 ? 157.226 110.843 120.254 1.00 20.00  ?  199 HIS A ND1 1 
ATOM 1162 C CD2 . HIS A 1 149 ? 156.604 110.824 122.347 1.00 20.00  ?  199 HIS A CD2 1 
ATOM 1163 C CE1 . HIS A 1 149 ? 156.189 110.030 120.347 1.00 20.00  ?  199 HIS A CE1 1 
ATOM 1164 N NE2 . HIS A 1 149 ? 155.793 110.001 121.606 1.00 20.00  ?  199 HIS A NE2 1 
ATOM 1165 N N   . ASN A 1 150 ? 162.076 112.601 122.399 1.00 125.38 ?  200 ASN A N   1 
ATOM 1166 C CA  . ASN A 1 150 ? 162.869 113.746 122.821 1.00 143.54 ?  200 ASN A CA  1 
ATOM 1167 C C   . ASN A 1 150 ? 164.381 113.584 122.813 1.00 173.29 ?  200 ASN A C   1 
ATOM 1168 O O   . ASN A 1 150 ? 165.091 114.514 122.434 1.00 180.23 ?  200 ASN A O   1 
ATOM 1169 C CB  . ASN A 1 150 ? 162.431 114.162 124.222 1.00 20.00  ?  200 ASN A CB  1 
ATOM 1170 C CG  . ASN A 1 150 ? 161.011 114.666 124.258 1.00 20.00  ?  200 ASN A CG  1 
ATOM 1171 O OD1 . ASN A 1 150 ? 160.742 115.808 123.911 1.00 20.00  ?  200 ASN A OD1 1 
ATOM 1172 N ND2 . ASN A 1 150 ? 160.087 113.803 124.656 1.00 20.00  ?  200 ASN A ND2 1 
ATOM 1173 N N   . LEU A 1 151 ? 164.873 112.418 123.221 1.00 30.00  ?  201 LEU A N   1 
ATOM 1174 C CA  . LEU A 1 151 ? 166.304 112.246 123.466 1.00 30.00  ?  201 LEU A CA  1 
ATOM 1175 C C   . LEU A 1 151 ? 167.156 112.553 122.240 1.00 30.00  ?  201 LEU A C   1 
ATOM 1176 O O   . LEU A 1 151 ? 168.282 113.033 122.362 1.00 30.00  ?  201 LEU A O   1 
ATOM 1177 C CB  . LEU A 1 151 ? 166.569 110.830 123.983 1.00 20.00  ?  201 LEU A CB  1 
ATOM 1178 C CG  . LEU A 1 151 ? 165.903 109.640 123.279 1.00 20.00  ?  201 LEU A CG  1 
ATOM 1179 C CD1 . LEU A 1 151 ? 166.530 109.236 121.947 1.00 20.00  ?  201 LEU A CD1 1 
ATOM 1180 C CD2 . LEU A 1 151 ? 165.851 108.450 124.242 1.00 20.00  ?  201 LEU A CD2 1 
ATOM 1181 N N   . SER A 1 152 ? 166.606 112.267 121.067 1.00 30.00  ?  202 SER A N   1 
ATOM 1182 C CA  . SER A 1 152 ? 167.060 112.839 119.801 1.00 30.00  ?  202 SER A CA  1 
ATOM 1183 C C   . SER A 1 152 ? 168.524 112.619 119.394 1.00 30.00  ?  202 SER A C   1 
ATOM 1184 O O   . SER A 1 152 ? 168.908 113.039 118.303 1.00 30.00  ?  202 SER A O   1 
ATOM 1185 C CB  . SER A 1 152 ? 166.786 114.347 119.817 1.00 20.00  ?  202 SER A CB  1 
ATOM 1186 O OG  . SER A 1 152 ? 165.397 114.615 119.940 1.00 20.00  ?  202 SER A OG  1 
ATOM 1187 N N   . GLN A 1 153 ? 169.335 111.968 120.230 1.00 30.00  ?  203 GLN A N   1 
ATOM 1188 C CA  . GLN A 1 153 ? 170.768 111.885 119.932 1.00 30.00  ?  203 GLN A CA  1 
ATOM 1189 C C   . GLN A 1 153 ? 171.041 111.172 118.606 1.00 30.00  ?  203 GLN A C   1 
ATOM 1190 O O   . GLN A 1 153 ? 170.501 110.102 118.325 1.00 30.00  ?  203 GLN A O   1 
ATOM 1191 C CB  . GLN A 1 153 ? 171.538 111.205 121.077 1.00 20.00  ?  203 GLN A CB  1 
ATOM 1192 C CG  . GLN A 1 153 ? 171.220 109.746 121.328 1.00 20.00  ?  203 GLN A CG  1 
ATOM 1193 C CD  . GLN A 1 153 ? 169.972 109.553 122.157 1.00 20.00  ?  203 GLN A CD  1 
ATOM 1194 O OE1 . GLN A 1 153 ? 169.342 110.517 122.585 1.00 20.00  ?  203 GLN A OE1 1 
ATOM 1195 N NE2 . GLN A 1 153 ? 169.616 108.300 122.403 1.00 20.00  ?  203 GLN A NE2 1 
ATOM 1196 N N   . ASN A 1 154 ? 171.909 111.794 117.813 1.00 30.00  ?  204 ASN A N   1 
ATOM 1197 C CA  . ASN A 1 154 ? 172.133 111.436 116.414 1.00 30.00  ?  204 ASN A CA  1 
ATOM 1198 C C   . ASN A 1 154 ? 173.216 112.305 115.723 1.00 30.00  ?  204 ASN A C   1 
ATOM 1199 O O   . ASN A 1 154 ? 174.129 111.750 115.112 1.00 30.00  ?  204 ASN A O   1 
ATOM 1200 C CB  . ASN A 1 154 ? 170.813 111.515 115.627 1.00 20.00  ?  204 ASN A CB  1 
ATOM 1201 C CG  . ASN A 1 154 ? 170.861 110.747 114.319 1.00 20.00  ?  204 ASN A CG  1 
ATOM 1202 O OD1 . ASN A 1 154 ? 171.561 109.744 114.205 1.00 20.00  ?  204 ASN A OD1 1 
ATOM 1203 N ND2 . ASN A 1 154 ? 170.100 111.204 113.330 1.00 20.00  ?  204 ASN A ND2 1 
ATOM 1204 N N   . GLY A 1 155 ? 173.157 113.642 115.810 1.00 30.00  ?  205 GLY A N   1 
ATOM 1205 C CA  . GLY A 1 155 ? 172.274 114.410 116.679 1.00 30.00  ?  205 GLY A CA  1 
ATOM 1206 C C   . GLY A 1 155 ? 172.893 114.651 118.046 1.00 30.00  ?  205 GLY A C   1 
ATOM 1207 O O   . GLY A 1 155 ? 174.068 114.343 118.246 1.00 30.00  ?  205 GLY A O   1 
ATOM 1208 N N   . SER A 1 156 ? 172.132 115.193 118.996 1.00 30.00  ?  206 SER A N   1 
ATOM 1209 C CA  . SER A 1 156 ? 170.712 115.516 118.851 1.00 30.00  ?  206 SER A CA  1 
ATOM 1210 C C   . SER A 1 156 ? 170.446 116.730 117.976 1.00 30.00  ?  206 SER A C   1 
ATOM 1211 O O   . SER A 1 156 ? 171.307 117.597 117.835 1.00 30.00  ?  206 SER A O   1 
ATOM 1212 C CB  . SER A 1 156 ? 170.088 115.773 120.223 1.00 20.00  ?  206 SER A CB  1 
ATOM 1213 O OG  . SER A 1 156 ? 170.142 114.635 121.056 1.00 20.00  ?  206 SER A OG  1 
ATOM 1214 N N   . ALA A 1 157 ? 169.259 116.784 117.376 1.00 30.00  ?  207 ALA A N   1 
ATOM 1215 C CA  . ALA A 1 157 ? 168.828 117.997 116.685 1.00 30.00  ?  207 ALA A CA  1 
ATOM 1216 C C   . ALA A 1 157 ? 168.447 119.089 117.698 1.00 30.00  ?  207 ALA A C   1 
ATOM 1217 O O   . ALA A 1 157 ? 168.923 120.216 117.583 1.00 30.00  ?  207 ALA A O   1 
ATOM 1218 C CB  . ALA A 1 157 ? 167.682 117.702 115.721 1.00 30.00  ?  207 ALA A CB  1 
ATOM 1219 N N   . PRO A 1 158 ? 167.590 118.779 118.694 1.00 167.46 ?  208 PRO A N   1 
ATOM 1220 C CA  . PRO A 1 158 ? 166.543 117.765 118.901 1.00 143.20 ?  208 PRO A CA  1 
ATOM 1221 C C   . PRO A 1 158 ? 165.329 118.005 118.005 1.00 148.75 ?  208 PRO A C   1 
ATOM 1222 O O   . PRO A 1 158 ? 165.079 119.152 117.636 1.00 140.52 ?  208 PRO A O   1 
ATOM 1223 C CB  . PRO A 1 158 ? 166.174 117.937 120.375 1.00 137.04 ?  208 PRO A CB  1 
ATOM 1224 C CG  . PRO A 1 158 ? 167.376 118.549 120.985 1.00 137.17 ?  208 PRO A CG  1 
ATOM 1225 C CD  . PRO A 1 158 ? 167.856 119.508 119.943 1.00 150.16 ?  208 PRO A CD  1 
ATOM 1226 N N   . THR A 1 159 ? 164.587 116.955 117.667 1.00 161.51 ?  209 THR A N   1 
ATOM 1227 C CA  . THR A 1 159 ? 163.425 117.110 116.795 1.00 169.41 ?  209 THR A CA  1 
ATOM 1228 C C   . THR A 1 159 ? 162.376 118.037 117.412 1.00 178.85 ?  209 THR A C   1 
ATOM 1229 O O   . THR A 1 159 ? 162.050 117.939 118.593 1.00 180.31 ?  209 THR A O   1 
ATOM 1230 C CB  . THR A 1 159 ? 162.788 115.740 116.460 1.00 140.60 ?  209 THR A CB  1 
ATOM 1231 O OG1 . THR A 1 159 ? 161.703 115.923 115.545 1.00 144.98 ?  209 THR A OG1 1 
ATOM 1232 C CG2 . THR A 1 159 ? 162.293 115.032 117.711 1.00 136.81 ?  209 THR A CG2 1 
ATOM 1233 N N   . PHE A 1 160 ? 161.874 118.961 116.603 1.00 180.57 ?  210 PHE A N   1 
ATOM 1234 C CA  . PHE A 1 160 ? 160.953 119.988 117.083 1.00 180.80 ?  210 PHE A CA  1 
ATOM 1235 C C   . PHE A 1 160 ? 159.644 119.468 117.673 1.00 175.89 ?  210 PHE A C   1 
ATOM 1236 O O   . PHE A 1 160 ? 159.228 119.939 118.728 1.00 179.36 ?  210 PHE A O   1 
ATOM 1237 C CB  . PHE A 1 160 ? 160.663 120.974 115.962 1.00 177.64 ?  210 PHE A CB  1 
ATOM 1238 C CG  . PHE A 1 160 ? 161.886 121.678 115.469 1.00 175.61 ?  210 PHE A CG  1 
ATOM 1239 C CD1 . PHE A 1 160 ? 162.397 122.764 116.154 1.00 176.67 ?  210 PHE A CD1 1 
ATOM 1240 C CD2 . PHE A 1 160 ? 162.538 121.242 114.330 1.00 170.44 ?  210 PHE A CD2 1 
ATOM 1241 C CE1 . PHE A 1 160 ? 163.530 123.408 115.706 1.00 172.48 ?  210 PHE A CE1 1 
ATOM 1242 C CE2 . PHE A 1 160 ? 163.672 121.885 113.876 1.00 171.06 ?  210 PHE A CE2 1 
ATOM 1243 C CZ  . PHE A 1 160 ? 164.168 122.969 114.565 1.00 169.77 ?  210 PHE A CZ  1 
ATOM 1244 N N   . PRO A 1 161 ? 158.960 118.536 116.986 1.00 159.55 ?  211 PRO A N   1 
ATOM 1245 C CA  . PRO A 1 161 ? 157.851 117.933 117.727 1.00 146.59 ?  211 PRO A CA  1 
ATOM 1246 C C   . PRO A 1 161 ? 158.382 117.188 118.935 1.00 136.73 ?  211 PRO A C   1 
ATOM 1247 O O   . PRO A 1 161 ? 159.428 116.549 118.821 1.00 128.61 ?  211 PRO A O   1 
ATOM 1248 C CB  . PRO A 1 161 ? 157.226 116.980 116.714 1.00 145.54 ?  211 PRO A CB  1 
ATOM 1249 C CG  . PRO A 1 161 ? 158.345 116.648 115.788 1.00 150.68 ?  211 PRO A CG  1 
ATOM 1250 C CD  . PRO A 1 161 ? 159.142 117.907 115.667 1.00 158.01 ?  211 PRO A CD  1 
ATOM 1251 N N   . LEU A 1 162 ? 157.659 117.231 120.047 1.00 156.91 ?  212 LEU A N   1 
ATOM 1252 C CA  . LEU A 1 162 ? 158.173 116.708 121.307 1.00 166.63 ?  212 LEU A CA  1 
ATOM 1253 C C   . LEU A 1 162 ? 157.165 116.821 122.458 1.00 178.48 ?  212 LEU A C   1 
ATOM 1254 O O   . LEU A 1 162 ? 156.021 117.238 122.262 1.00 172.15 ?  212 LEU A O   1 
ATOM 1255 C CB  . LEU A 1 162 ? 159.498 117.404 121.649 1.00 168.92 ?  212 LEU A CB  1 
ATOM 1256 C CG  . LEU A 1 162 ? 159.604 118.929 121.651 1.00 167.57 ?  212 LEU A CG  1 
ATOM 1257 C CD1 . LEU A 1 162 ? 159.084 119.517 122.931 1.00 165.26 ?  212 LEU A CD1 1 
ATOM 1258 C CD2 . LEU A 1 162 ? 161.035 119.369 121.396 1.00 168.26 ?  212 LEU A CD2 1 
ATOM 1259 N N   . CYS A 1 163 ? 157.591 116.424 123.653 1.00 180.80 ?  213 CYS A N   1 
ATOM 1260 C CA  . CYS A 1 163 ? 156.664 116.244 124.762 1.00 191.91 ?  213 CYS A CA  1 
ATOM 1261 C C   . CYS A 1 163 ? 156.733 117.363 125.804 1.00 185.39 ?  213 CYS A C   1 
ATOM 1262 O O   . CYS A 1 163 ? 157.757 117.586 126.483 1.00 183.54 ?  213 CYS A O   1 
ATOM 1263 C CB  . CYS A 1 163 ? 156.913 114.891 125.421 1.00 205.71 ?  213 CYS A CB  1 
ATOM 1264 S SG  . CYS A 1 163 ? 155.690 114.434 126.649 1.00 525.72 ?  213 CYS A SG  1 
ATOM 1265 N N   . ALA A 1 164 ? 155.613 118.059 125.937 1.00 171.01 ?  214 ALA A N   1 
ATOM 1266 C CA  . ALA A 1 164 ? 155.564 119.205 126.821 1.00 167.31 ?  214 ALA A CA  1 
ATOM 1267 C C   . ALA A 1 164 ? 154.605 118.981 127.971 1.00 153.10 ?  214 ALA A C   1 
ATOM 1268 O O   . ALA A 1 164 ? 153.527 118.413 127.809 1.00 141.04 ?  214 ALA A O   1 
ATOM 1269 C CB  . ALA A 1 164 ? 155.178 120.438 126.051 1.00 177.77 ?  214 ALA A CB  1 
ATOM 1270 N N   . MET A 1 165 ? 155.005 119.469 129.133 1.00 163.93 ?  215 MET A N   1 
ATOM 1271 C CA  . MET A 1 165 ? 154.264 119.266 130.355 1.00 164.44 ?  215 MET A CA  1 
ATOM 1272 C C   . MET A 1 165 ? 153.750 120.594 130.869 1.00 140.66 ?  215 MET A C   1 
ATOM 1273 O O   . MET A 1 165 ? 154.515 121.397 131.392 1.00 137.92 ?  215 MET A O   1 
ATOM 1274 C CB  . MET A 1 165 ? 155.157 118.606 131.397 1.00 183.65 ?  215 MET A CB  1 
ATOM 1275 C CG  . MET A 1 165 ? 154.466 118.221 132.672 1.00 182.75 ?  215 MET A CG  1 
ATOM 1276 S SD  . MET A 1 165 ? 153.317 116.868 132.395 1.00 187.86 ?  215 MET A SD  1 
ATOM 1277 C CE  . MET A 1 165 ? 152.738 116.590 134.063 1.00 161.94 ?  215 MET A CE  1 
ATOM 1278 N N   . GLN A 1 166 ? 152.463 120.853 130.689 1.00 145.47 ?  216 GLN A N   1 
ATOM 1279 C CA  . GLN A 1 166 ? 151.881 122.037 131.295 1.00 118.43 ?  216 GLN A CA  1 
ATOM 1280 C C   . GLN A 1 166 ? 151.717 121.782 132.771 1.00 115.36 ?  216 GLN A C   1 
ATOM 1281 O O   . GLN A 1 166 ? 151.417 120.663 133.182 1.00 115.14 ?  216 GLN A O   1 
ATOM 1282 C CB  . GLN A 1 166 ? 150.531 122.386 130.686 1.00 99.49  ?  216 GLN A CB  1 
ATOM 1283 C CG  . GLN A 1 166 ? 150.010 123.730 131.131 1.00 91.78  ?  216 GLN A CG  1 
ATOM 1284 C CD  . GLN A 1 166 ? 148.657 124.040 130.551 1.00 87.86  ?  216 GLN A CD  1 
ATOM 1285 O OE1 . GLN A 1 166 ? 148.091 123.241 129.809 1.00 85.58  ?  216 GLN A OE1 1 
ATOM 1286 N NE2 . GLN A 1 166 ? 148.132 125.211 130.872 1.00 84.80  ?  216 GLN A NE2 1 
ATOM 1287 N N   . LEU A 1 167 ? 151.877 122.825 133.569 1.00 113.59 ?  217 LEU A N   1 
ATOM 1288 C CA  . LEU A 1 167 ? 151.656 122.692 134.991 1.00 103.41 ?  217 LEU A CA  1 
ATOM 1289 C C   . LEU A 1 167 ? 151.096 124.001 135.499 1.00 79.94  ?  217 LEU A C   1 
ATOM 1290 O O   . LEU A 1 167 ? 151.722 125.040 135.325 1.00 65.26  ?  217 LEU A O   1 
ATOM 1291 C CB  . LEU A 1 167 ? 152.961 122.339 135.697 1.00 118.10 ?  217 LEU A CB  1 
ATOM 1292 C CG  . LEU A 1 167 ? 152.884 121.844 137.134 1.00 124.46 ?  217 LEU A CG  1 
ATOM 1293 C CD1 . LEU A 1 167 ? 154.056 120.931 137.409 1.00 127.71 ?  217 LEU A CD1 1 
ATOM 1294 C CD2 . LEU A 1 167 ? 152.874 122.997 138.094 1.00 125.55 ?  217 LEU A CD2 1 
ATOM 1295 N N   . PHE A 1 168 ? 149.920 123.978 136.111 1.00 91.27  ?  218 PHE A N   1 
ATOM 1296 C CA  . PHE A 1 168 ? 149.422 125.216 136.677 1.00 123.13 ?  218 PHE A CA  1 
ATOM 1297 C C   . PHE A 1 168 ? 148.589 125.062 137.924 1.00 46.84  ?  218 PHE A C   1 
ATOM 1298 O O   . PHE A 1 168 ? 147.866 124.081 138.110 1.00 47.08  ?  218 PHE A O   1 
ATOM 1299 C CB  . PHE A 1 168 ? 148.629 125.998 135.639 1.00 154.72 ?  218 PHE A CB  1 
ATOM 1300 C CG  . PHE A 1 168 ? 147.451 125.271 135.083 1.00 170.21 ?  218 PHE A CG  1 
ATOM 1301 C CD1 . PHE A 1 168 ? 146.221 125.343 135.702 1.00 184.54 ?  218 PHE A CD1 1 
ATOM 1302 C CD2 . PHE A 1 168 ? 147.558 124.559 133.909 1.00 178.83 ?  218 PHE A CD2 1 
ATOM 1303 C CE1 . PHE A 1 168 ? 145.129 124.692 135.173 1.00 193.11 ?  218 PHE A CE1 1 
ATOM 1304 C CE2 . PHE A 1 168 ? 146.468 123.912 133.375 1.00 187.83 ?  218 PHE A CE2 1 
ATOM 1305 C CZ  . PHE A 1 168 ? 145.254 123.974 134.010 1.00 194.12 ?  218 PHE A CZ  1 
ATOM 1306 N N   . SER A 1 169 ? 148.707 126.083 138.764 1.00 71.47  ?  219 SER A N   1 
ATOM 1307 C CA  . SER A 1 169 ? 148.069 126.142 140.062 1.00 71.89  ?  219 SER A CA  1 
ATOM 1308 C C   . SER A 1 169 ? 148.289 127.521 140.655 1.00 75.17  ?  219 SER A C   1 
ATOM 1309 O O   . SER A 1 169 ? 149.030 127.668 141.621 1.00 60.80  ?  219 SER A O   1 
ATOM 1310 C CB  . SER A 1 169 ? 148.644 125.080 140.990 1.00 73.15  ?  219 SER A CB  1 
ATOM 1311 O OG  . SER A 1 169 ? 150.020 125.323 141.219 1.00 75.50  ?  219 SER A OG  1 
ATOM 1312 N N   . HIS A 1 170 ? 147.672 128.533 140.063 1.00 77.36  ?  220 HIS A N   1 
ATOM 1313 C CA  . HIS A 1 170 ? 147.872 129.901 140.514 1.00 97.14  ?  220 HIS A CA  1 
ATOM 1314 C C   . HIS A 1 170 ? 147.385 130.102 141.937 1.00 101.08 ?  220 HIS A C   1 
ATOM 1315 O O   . HIS A 1 170 ? 146.284 129.687 142.286 1.00 100.81 ?  220 HIS A O   1 
ATOM 1316 C CB  . HIS A 1 170 ? 147.152 130.862 139.577 1.00 112.10 ?  220 HIS A CB  1 
ATOM 1317 C CG  . HIS A 1 170 ? 147.389 132.304 139.883 1.00 130.64 ?  220 HIS A CG  1 
ATOM 1318 N ND1 . HIS A 1 170 ? 146.695 132.978 140.863 1.00 138.23 ?  220 HIS A ND1 1 
ATOM 1319 C CD2 . HIS A 1 170 ? 148.225 133.208 139.323 1.00 135.44 ?  220 HIS A CD2 1 
ATOM 1320 C CE1 . HIS A 1 170 ? 147.100 134.234 140.899 1.00 144.83 ?  220 HIS A CE1 1 
ATOM 1321 N NE2 . HIS A 1 170 ? 148.029 134.399 139.976 1.00 142.92 ?  220 HIS A NE2 1 
ATOM 1322 N N   . MET A 1 171 ? 148.205 130.757 142.749 1.00 89.68  ?  221 MET A N   1 
ATOM 1323 C CA  . MET A 1 171 ? 147.851 131.050 144.129 1.00 104.79 ?  221 MET A CA  1 
ATOM 1324 C C   . MET A 1 171 ? 147.366 132.468 144.306 1.00 118.84 ?  221 MET A C   1 
ATOM 1325 O O   . MET A 1 171 ? 147.819 133.374 143.621 1.00 123.17 ?  221 MET A O   1 
ATOM 1326 C CB  . MET A 1 171 ? 149.036 130.787 145.043 1.00 114.06 ?  221 MET A CB  1 
ATOM 1327 C CG  . MET A 1 171 ? 149.303 129.324 145.256 1.00 111.01 ?  221 MET A CG  1 
ATOM 1328 S SD  . MET A 1 171 ? 147.980 128.577 146.223 1.00 321.36 ?  221 MET A SD  1 
ATOM 1329 C CE  . MET A 1 171 ? 147.018 127.763 144.958 1.00 255.24 ?  221 MET A CE  1 
ATOM 1330 N N   . HIS A 1 172 ? 146.455 132.659 145.248 1.00 139.11 ?  222 HIS A N   1 
ATOM 1331 C CA  . HIS A 1 172 ? 145.820 133.950 145.422 1.00 142.27 ?  222 HIS A CA  1 
ATOM 1332 C C   . HIS A 1 172 ? 146.177 134.570 146.750 1.00 101.84 ?  222 HIS A C   1 
ATOM 1333 O O   . HIS A 1 172 ? 145.301 134.910 147.540 1.00 96.24  ?  222 HIS A O   1 
ATOM 1334 C CB  . HIS A 1 172 ? 144.316 133.810 145.303 1.00 139.91 ?  222 HIS A CB  1 
ATOM 1335 C CG  . HIS A 1 172 ? 143.888 133.196 144.017 1.00 134.03 ?  222 HIS A CG  1 
ATOM 1336 N ND1 . HIS A 1 172 ? 144.054 133.826 142.806 1.00 128.96 ?  222 HIS A ND1 1 
ATOM 1337 C CD2 . HIS A 1 172 ? 143.324 131.997 143.746 1.00 133.78 ?  222 HIS A CD2 1 
ATOM 1338 C CE1 . HIS A 1 172 ? 143.603 133.045 141.841 1.00 133.54 ?  222 HIS A CE1 1 
ATOM 1339 N NE2 . HIS A 1 172 ? 143.152 131.930 142.386 1.00 136.16 ?  222 HIS A NE2 1 
ATOM 1340 N N   . ALA A 1 173 ? 147.472 134.698 146.996 1.00 111.11 ?  223 ALA A N   1 
ATOM 1341 C CA  . ALA A 1 173 ? 147.970 135.425 148.151 1.00 97.67  ?  223 ALA A CA  1 
ATOM 1342 C C   . ALA A 1 173 ? 149.416 135.788 147.899 1.00 93.64  ?  223 ALA A C   1 
ATOM 1343 O O   . ALA A 1 173 ? 150.107 135.094 147.159 1.00 87.87  ?  223 ALA A O   1 
ATOM 1344 C CB  . ALA A 1 173 ? 147.834 134.601 149.406 1.00 91.14  ?  223 ALA A CB  1 
ATOM 1345 N N   . VAL A 1 174 ? 149.889 136.863 148.511 1.00 93.11  ?  224 VAL A N   1 
ATOM 1346 C CA  . VAL A 1 174 ? 151.233 137.336 148.216 1.00 98.14  ?  224 VAL A CA  1 
ATOM 1347 C C   . VAL A 1 174 ? 151.961 137.921 149.412 1.00 107.49 ?  224 VAL A C   1 
ATOM 1348 O O   . VAL A 1 174 ? 151.349 138.390 150.371 1.00 101.50 ?  224 VAL A O   1 
ATOM 1349 C CB  . VAL A 1 174 ? 151.222 138.419 147.125 1.00 191.43 ?  224 VAL A CB  1 
ATOM 1350 C CG1 . VAL A 1 174 ? 150.782 137.852 145.782 1.00 182.46 ?  224 VAL A CG1 1 
ATOM 1351 C CG2 . VAL A 1 174 ? 150.319 139.559 147.540 1.00 195.12 ?  224 VAL A CG2 1 
ATOM 1352 N N   . ILE A 1 175 ? 153.285 137.879 149.328 1.00 92.86  ?  225 ILE A N   1 
ATOM 1353 C CA  . ILE A 1 175 ? 154.177 138.635 150.199 1.00 92.07  ?  225 ILE A CA  1 
ATOM 1354 C C   . ILE A 1 175 ? 154.159 138.214 151.666 1.00 92.03  ?  225 ILE A C   1 
ATOM 1355 O O   . ILE A 1 175 ? 155.012 137.448 152.102 1.00 94.63  ?  225 ILE A O   1 
ATOM 1356 C CB  . ILE A 1 175 ? 153.858 140.132 150.130 1.00 227.37 ?  225 ILE A CB  1 
ATOM 1357 C CG1 . ILE A 1 175 ? 153.791 140.586 148.669 1.00 236.84 ?  225 ILE A CG1 1 
ATOM 1358 C CG2 . ILE A 1 175 ? 154.899 140.928 150.898 1.00 220.66 ?  225 ILE A CG2 1 
ATOM 1359 C CD1 . ILE A 1 175 ? 155.045 140.304 147.874 1.00 241.09 ?  225 ILE A CD1 1 
ATOM 1360 N N   . SER A 1 176 ? 153.190 138.710 152.426 1.00 112.56 ?  226 SER A N   1 
ATOM 1361 C CA  . SER A 1 176 ? 153.220 138.537 153.872 1.00 116.37 ?  226 SER A CA  1 
ATOM 1362 C C   . SER A 1 176 ? 151.833 138.462 154.478 1.00 110.57 ?  226 SER A C   1 
ATOM 1363 O O   . SER A 1 176 ? 150.850 138.813 153.837 1.00 100.55 ?  226 SER A O   1 
ATOM 1364 C CB  . SER A 1 176 ? 153.981 139.677 154.520 1.00 122.00 ?  226 SER A CB  1 
ATOM 1365 O OG  . SER A 1 176 ? 153.273 140.885 154.341 1.00 132.54 ?  226 SER A OG  1 
ATOM 1366 N N   . THR A 1 177 ? 151.764 138.003 155.722 1.00 112.91 ?  227 THR A N   1 
ATOM 1367 C CA  . THR A 1 177 ? 150.487 137.776 156.380 1.00 119.38 ?  227 THR A CA  1 
ATOM 1368 C C   . THR A 1 177 ? 149.695 139.058 156.501 1.00 160.49 ?  227 THR A C   1 
ATOM 1369 O O   . THR A 1 177 ? 148.473 139.075 156.344 1.00 160.88 ?  227 THR A O   1 
ATOM 1370 C CB  . THR A 1 177 ? 150.679 137.217 157.782 1.00 97.63  ?  227 THR A CB  1 
ATOM 1371 O OG1 . THR A 1 177 ? 151.402 138.171 158.562 1.00 84.64  ?  227 THR A OG1 1 
ATOM 1372 C CG2 . THR A 1 177 ? 151.474 135.939 157.738 1.00 99.11  ?  227 THR A CG2 1 
ATOM 1373 N N   . ALA A 1 178 ? 150.415 140.142 156.745 1.00 154.00 ?  228 ALA A N   1 
ATOM 1374 C CA  . ALA A 1 178 ? 149.790 141.436 156.915 1.00 192.22 ?  228 ALA A CA  1 
ATOM 1375 C C   . ALA A 1 178 ? 149.090 141.848 155.639 1.00 226.39 ?  228 ALA A C   1 
ATOM 1376 O O   . ALA A 1 178 ? 148.086 142.546 155.673 1.00 229.42 ?  228 ALA A O   1 
ATOM 1377 C CB  . ALA A 1 178 ? 150.816 142.468 157.307 1.00 195.59 ?  228 ALA A CB  1 
ATOM 1378 N N   . THR A 1 179 ? 149.623 141.406 154.510 1.00 205.24 ?  229 THR A N   1 
ATOM 1379 C CA  . THR A 1 179 ? 149.055 141.772 153.227 1.00 212.58 ?  229 THR A CA  1 
ATOM 1380 C C   . THR A 1 179 ? 147.693 141.144 153.050 1.00 232.20 ?  229 THR A C   1 
ATOM 1381 O O   . THR A 1 179 ? 146.676 141.838 152.975 1.00 230.96 ?  229 THR A O   1 
ATOM 1382 C CB  . THR A 1 179 ? 149.948 141.332 152.068 1.00 217.10 ?  229 THR A CB  1 
ATOM 1383 O OG1 . THR A 1 179 ? 150.119 139.911 152.119 1.00 220.36 ?  229 THR A OG1 1 
ATOM 1384 C CG2 . THR A 1 179 ? 151.304 142.007 152.156 1.00 216.36 ?  229 THR A CG2 1 
ATOM 1385 N N   . CYS A 1 180 ? 147.667 139.820 153.000 1.00 224.17 ?  230 CYS A N   1 
ATOM 1386 C CA  . CYS A 1 180 ? 146.422 139.151 152.697 1.00 244.04 ?  230 CYS A CA  1 
ATOM 1387 C C   . CYS A 1 180 ? 145.439 139.472 153.797 1.00 230.84 ?  230 CYS A C   1 
ATOM 1388 O O   . CYS A 1 180 ? 144.245 139.473 153.570 1.00 239.95 ?  230 CYS A O   1 
ATOM 1389 C CB  . CYS A 1 180 ? 146.589 137.643 152.562 1.00 259.72 ?  230 CYS A CB  1 
ATOM 1390 S SG  . CYS A 1 180 ? 147.070 136.817 154.068 1.00 178.81 ?  230 CYS A SG  1 
ATOM 1391 N N   . MET A 1 181 ? 145.928 139.719 155.002 1.00 251.96 ?  231 MET A N   1 
ATOM 1392 C CA  . MET A 1 181 ? 145.010 140.162 156.032 1.00 208.02 ?  231 MET A CA  1 
ATOM 1393 C C   . MET A 1 181 ? 144.458 141.561 155.808 1.00 172.33 ?  231 MET A C   1 
ATOM 1394 O O   . MET A 1 181 ? 143.304 141.816 156.137 1.00 149.25 ?  231 MET A O   1 
ATOM 1395 C CB  . MET A 1 181 ? 145.666 140.056 157.401 1.00 190.69 ?  231 MET A CB  1 
ATOM 1396 C CG  . MET A 1 181 ? 145.724 138.624 157.899 1.00 180.39 ?  231 MET A CG  1 
ATOM 1397 S SD  . MET A 1 181 ? 144.061 138.005 158.251 1.00 118.22 ?  231 MET A SD  1 
ATOM 1398 C CE  . MET A 1 181 ? 143.680 137.073 156.773 1.00 119.47 ?  231 MET A CE  1 
ATOM 1399 N N   . ARG A 1 182 ? 145.246 142.472 155.251 1.00 176.74 ?  232 ARG A N   1 
ATOM 1400 C CA  . ARG A 1 182 ? 144.685 143.790 155.000 1.00 177.50 ?  232 ARG A CA  1 
ATOM 1401 C C   . ARG A 1 182 ? 143.679 143.718 153.869 1.00 190.68 ?  232 ARG A C   1 
ATOM 1402 O O   . ARG A 1 182 ? 142.715 144.476 153.852 1.00 194.61 ?  232 ARG A O   1 
ATOM 1403 C CB  . ARG A 1 182 ? 145.757 144.836 154.683 1.00 167.02 ?  232 ARG A CB  1 
ATOM 1404 C CG  . ARG A 1 182 ? 146.398 144.734 153.319 1.00 158.83 ?  232 ARG A CG  1 
ATOM 1405 C CD  . ARG A 1 182 ? 147.178 145.993 152.976 1.00 148.43 ?  232 ARG A CD  1 
ATOM 1406 N NE  . ARG A 1 182 ? 148.258 146.264 153.917 1.00 130.48 ?  232 ARG A NE  1 
ATOM 1407 C CZ  . ARG A 1 182 ? 148.893 147.428 154.003 1.00 117.19 ?  232 ARG A CZ  1 
ATOM 1408 N NH1 . ARG A 1 182 ? 148.568 148.428 153.196 1.00 114.71 ?  232 ARG A NH1 1 
ATOM 1409 N NH2 . ARG A 1 182 ? 149.861 147.589 154.891 1.00 119.41 ?  232 ARG A NH2 1 
ATOM 1410 N N   . ARG A 1 183 ? 143.880 142.794 152.934 1.00 161.89 ?  233 ARG A N   1 
ATOM 1411 C CA  . ARG A 1 183 ? 143.003 142.753 151.769 1.00 161.15 ?  233 ARG A CA  1 
ATOM 1412 C C   . ARG A 1 183 ? 141.974 141.641 151.846 1.00 158.14 ?  233 ARG A C   1 
ATOM 1413 O O   . ARG A 1 183 ? 141.264 141.376 150.885 1.00 154.18 ?  233 ARG A O   1 
ATOM 1414 C CB  . ARG A 1 183 ? 143.819 142.622 150.491 1.00 156.55 ?  233 ARG A CB  1 
ATOM 1415 C CG  . ARG A 1 183 ? 144.464 141.288 150.307 1.00 170.51 ?  233 ARG A CG  1 
ATOM 1416 C CD  . ARG A 1 183 ? 145.122 141.216 148.948 1.00 176.34 ?  233 ARG A CD  1 
ATOM 1417 N NE  . ARG A 1 183 ? 146.195 142.195 148.816 1.00 173.21 ?  233 ARG A NE  1 
ATOM 1418 C CZ  . ARG A 1 183 ? 146.749 142.538 147.660 1.00 169.80 ?  233 ARG A CZ  1 
ATOM 1419 N NH1 . ARG A 1 183 ? 146.337 141.975 146.535 1.00 165.37 ?  233 ARG A NH1 1 
ATOM 1420 N NH2 . ARG A 1 183 ? 147.721 143.438 147.629 1.00 173.06 ?  233 ARG A NH2 1 
ATOM 1421 N N   . SER A 1 184 ? 141.909 140.976 152.985 1.00 157.87 ?  234 SER A N   1 
ATOM 1422 C CA  . SER A 1 184 ? 140.820 140.057 153.241 1.00 135.61 ?  234 SER A CA  1 
ATOM 1423 C C   . SER A 1 184 ? 139.788 140.800 154.053 1.00 122.49 ?  234 SER A C   1 
ATOM 1424 O O   . SER A 1 184 ? 138.746 140.264 154.413 1.00 114.37 ?  234 SER A O   1 
ATOM 1425 C CB  . SER A 1 184 ? 141.291 138.815 153.981 1.00 127.00 ?  234 SER A CB  1 
ATOM 1426 O OG  . SER A 1 184 ? 140.201 137.951 154.240 1.00 121.31 ?  234 SER A OG  1 
ATOM 1427 N N   . SER A 1 185 ? 140.105 142.052 154.342 1.00 30.00  ?  235 SER A N   1 
ATOM 1428 C CA  . SER A 1 185 ? 139.251 142.898 155.145 1.00 30.00  ?  235 SER A CA  1 
ATOM 1429 C C   . SER A 1 185 ? 137.922 143.171 154.465 1.00 30.00  ?  235 SER A C   1 
ATOM 1430 O O   . SER A 1 185 ? 136.919 143.434 155.123 1.00 30.00  ?  235 SER A O   1 
ATOM 1431 C CB  . SER A 1 185 ? 139.958 144.215 155.428 1.00 20.00  ?  235 SER A CB  1 
ATOM 1432 O OG  . SER A 1 185 ? 140.199 144.907 154.216 1.00 20.00  ?  235 SER A OG  1 
ATOM 1433 N N   . ILE A 1 186 ? 137.921 143.107 153.141 1.00 30.00  ?  236 ILE A N   1 
ATOM 1434 C CA  . ILE A 1 186 ? 136.778 143.556 152.360 1.00 30.00  ?  236 ILE A CA  1 
ATOM 1435 C C   . ILE A 1 186 ? 135.912 142.399 151.877 1.00 30.00  ?  236 ILE A C   1 
ATOM 1436 O O   . ILE A 1 186 ? 134.685 142.478 151.901 1.00 30.00  ?  236 ILE A O   1 
ATOM 1437 C CB  . ILE A 1 186 ? 137.246 144.366 151.157 1.00 20.00  ?  236 ILE A CB  1 
ATOM 1438 C CG1 . ILE A 1 186 ? 138.040 145.579 151.636 1.00 20.00  ?  236 ILE A CG1 1 
ATOM 1439 C CG2 . ILE A 1 186 ? 136.060 144.818 150.335 1.00 20.00  ?  236 ILE A CG2 1 
ATOM 1440 C CD1 . ILE A 1 186 ? 138.757 146.302 150.534 1.00 20.00  ?  236 ILE A CD1 1 
ATOM 1441 N N   . ALA A 1 187 ? 135.371 139.498 148.360 1.00 30.00  ?  245 ALA A N   1 
ATOM 1442 C CA  . ALA A 1 187 ? 135.491 138.084 148.695 1.00 30.00  ?  245 ALA A CA  1 
ATOM 1443 C C   . ALA A 1 187 ? 136.921 137.596 148.506 1.00 30.00  ?  245 ALA A C   1 
ATOM 1444 O O   . ALA A 1 187 ? 137.153 136.419 148.238 1.00 30.00  ?  245 ALA A O   1 
ATOM 1445 C CB  . ALA A 1 187 ? 134.531 137.255 147.854 1.00 30.00  ?  245 ALA A CB  1 
ATOM 1446 N N   . ALA A 1 188 ? 137.877 138.507 148.639 1.00 30.00  ?  246 ALA A N   1 
ATOM 1447 C CA  . ALA A 1 188 ? 139.287 138.143 148.579 1.00 30.00  ?  246 ALA A CA  1 
ATOM 1448 C C   . ALA A 1 188 ? 139.640 137.240 149.758 1.00 30.00  ?  246 ALA A C   1 
ATOM 1449 O O   . ALA A 1 188 ? 139.063 137.376 150.838 1.00 30.00  ?  246 ALA A O   1 
ATOM 1450 C CB  . ALA A 1 188 ? 140.154 139.383 148.574 1.00 30.00  ?  246 ALA A CB  1 
ATOM 1451 N N   . VAL A 1 189 ? 140.571 136.310 149.558 1.00 69.80  ?  247 VAL A N   1 
ATOM 1452 C CA  . VAL A 1 189 ? 140.823 135.297 150.575 1.00 68.76  ?  247 VAL A CA  1 
ATOM 1453 C C   . VAL A 1 189 ? 142.291 134.898 150.759 1.00 69.74  ?  247 VAL A C   1 
ATOM 1454 O O   . VAL A 1 189 ? 143.031 134.745 149.792 1.00 52.22  ?  247 VAL A O   1 
ATOM 1455 C CB  . VAL A 1 189 ? 140.013 134.016 150.256 1.00 39.94  ?  247 VAL A CB  1 
ATOM 1456 C CG1 . VAL A 1 189 ? 140.395 132.900 151.185 1.00 10.20  ?  247 VAL A CG1 1 
ATOM 1457 C CG2 . VAL A 1 189 ? 138.514 134.271 150.354 1.00 60.41  ?  247 VAL A CG2 1 
ATOM 1458 N N   . CYS A 1 190 ? 142.696 134.757 152.021 1.00 98.77  ?  248 CYS A N   1 
ATOM 1459 C CA  . CYS A 1 190 ? 143.870 133.975 152.404 1.00 109.29 ?  248 CYS A CA  1 
ATOM 1460 C C   . CYS A 1 190 ? 143.705 133.550 153.865 1.00 120.61 ?  248 CYS A C   1 
ATOM 1461 O O   . CYS A 1 190 ? 143.848 134.352 154.779 1.00 126.05 ?  248 CYS A O   1 
ATOM 1462 C CB  . CYS A 1 190 ? 145.172 134.754 152.191 1.00 105.16 ?  248 CYS A CB  1 
ATOM 1463 S SG  . CYS A 1 190 ? 145.360 136.332 153.072 1.00 164.20 ?  248 CYS A SG  1 
ATOM 1464 N N   . ASP A 1 191 ? 143.395 132.277 154.071 1.00 121.26 ?  249 ASP A N   1 
ATOM 1465 C CA  . ASP A 1 191 ? 142.864 131.796 155.345 1.00 102.96 ?  249 ASP A CA  1 
ATOM 1466 C C   . ASP A 1 191 ? 143.845 131.709 156.500 1.00 94.65  ?  249 ASP A C   1 
ATOM 1467 O O   . ASP A 1 191 ? 145.009 131.381 156.303 1.00 84.54  ?  249 ASP A O   1 
ATOM 1468 C CB  . ASP A 1 191 ? 142.257 130.419 155.132 1.00 117.02 ?  249 ASP A CB  1 
ATOM 1469 C CG  . ASP A 1 191 ? 141.065 130.463 154.223 1.00 128.33 ?  249 ASP A CG  1 
ATOM 1470 O OD1 . ASP A 1 191 ? 140.514 131.565 154.037 1.00 135.26 ?  249 ASP A OD1 1 
ATOM 1471 O OD2 . ASP A 1 191 ? 140.685 129.412 153.670 1.00 132.29 ?  249 ASP A OD2 1 
ATOM 1472 N N   . PRO A 1 192 ? 143.362 132.003 157.715 1.00 112.66 ?  250 PRO A N   1 
ATOM 1473 C CA  . PRO A 1 192 ? 144.018 131.691 158.985 1.00 123.81 ?  250 PRO A CA  1 
ATOM 1474 C C   . PRO A 1 192 ? 144.152 130.198 159.157 1.00 123.01 ?  250 PRO A C   1 
ATOM 1475 O O   . PRO A 1 192 ? 143.255 129.466 158.755 1.00 129.43 ?  250 PRO A O   1 
ATOM 1476 C CB  . PRO A 1 192 ? 143.064 132.258 160.026 1.00 131.23 ?  250 PRO A CB  1 
ATOM 1477 C CG  . PRO A 1 192 ? 142.315 133.295 159.315 1.00 133.05 ?  250 PRO A CG  1 
ATOM 1478 C CD  . PRO A 1 192 ? 142.122 132.757 157.934 1.00 123.36 ?  250 PRO A CD  1 
ATOM 1479 N N   . LEU A 1 193 ? 145.236 129.749 159.770 1.00 115.15 ?  251 LEU A N   1 
ATOM 1480 C CA  . LEU A 1 193 ? 145.495 128.325 159.884 1.00 111.99 ?  251 LEU A CA  1 
ATOM 1481 C C   . LEU A 1 193 ? 145.090 127.804 161.246 1.00 110.78 ?  251 LEU A C   1 
ATOM 1482 O O   . LEU A 1 193 ? 145.672 128.203 162.246 1.00 122.85 ?  251 LEU A O   1 
ATOM 1483 C CB  . LEU A 1 193 ? 146.966 128.053 159.646 1.00 113.52 ?  251 LEU A CB  1 
ATOM 1484 C CG  . LEU A 1 193 ? 147.304 126.582 159.656 1.00 118.89 ?  251 LEU A CG  1 
ATOM 1485 C CD1 . LEU A 1 193 ? 146.569 125.986 158.514 1.00 126.13 ?  251 LEU A CD1 1 
ATOM 1486 C CD2 . LEU A 1 193 ? 148.774 126.404 159.468 1.00 118.19 ?  251 LEU A CD2 1 
ATOM 1487 N N   . SER A 1 194 ? 144.115 126.905 161.304 1.00 103.73 ?  252 SER A N   1 
ATOM 1488 C CA  . SER A 1 194 ? 143.594 126.498 162.605 1.00 114.00 ?  252 SER A CA  1 
ATOM 1489 C C   . SER A 1 194 ? 142.716 125.252 162.630 1.00 134.14 ?  252 SER A C   1 
ATOM 1490 O O   . SER A 1 194 ? 142.306 124.746 161.590 1.00 138.67 ?  252 SER A O   1 
ATOM 1491 C CB  . SER A 1 194 ? 142.791 127.646 163.201 1.00 118.25 ?  252 SER A CB  1 
ATOM 1492 O OG  . SER A 1 194 ? 141.662 127.922 162.393 1.00 120.79 ?  252 SER A OG  1 
ATOM 1493 N N   . ASP A 1 195 ? 142.454 124.776 163.847 1.00 115.59 ?  253 ASP A N   1 
ATOM 1494 C CA  . ASP A 1 195 ? 141.375 123.831 164.142 1.00 121.38 ?  253 ASP A CA  1 
ATOM 1495 C C   . ASP A 1 195 ? 141.203 123.574 165.645 1.00 128.20 ?  253 ASP A C   1 
ATOM 1496 O O   . ASP A 1 195 ? 140.925 124.500 166.403 1.00 129.25 ?  253 ASP A O   1 
ATOM 1497 C CB  . ASP A 1 195 ? 141.599 122.523 163.409 1.00 385.71 ?  253 ASP A CB  1 
ATOM 1498 C CG  . ASP A 1 195 ? 142.981 122.009 163.591 1.00 377.98 ?  253 ASP A CG  1 
ATOM 1499 O OD1 . ASP A 1 195 ? 143.804 122.755 164.155 1.00 374.82 ?  253 ASP A OD1 1 
ATOM 1500 O OD2 . ASP A 1 195 ? 143.248 120.871 163.164 1.00 373.38 ?  253 ASP A OD2 1 
ATOM 1501 N N   . TYR A 1 196 ? 141.356 122.328 166.082 1.00 151.74 ?  254 TYR A N   1 
ATOM 1502 C CA  . TYR A 1 196 ? 141.049 122.004 167.470 1.00 162.11 ?  254 TYR A CA  1 
ATOM 1503 C C   . TYR A 1 196 ? 142.057 121.145 168.202 1.00 130.49 ?  254 TYR A C   1 
ATOM 1504 O O   . TYR A 1 196 ? 142.746 120.319 167.613 1.00 119.23 ?  254 TYR A O   1 
ATOM 1505 C CB  . TYR A 1 196 ? 139.712 121.289 167.559 1.00 203.71 ?  254 TYR A CB  1 
ATOM 1506 C CG  . TYR A 1 196 ? 138.545 122.119 167.151 1.00 211.51 ?  254 TYR A CG  1 
ATOM 1507 C CD1 . TYR A 1 196 ? 137.980 123.012 168.032 1.00 217.15 ?  254 TYR A CD1 1 
ATOM 1508 C CD2 . TYR A 1 196 ? 137.978 121.979 165.902 1.00 218.32 ?  254 TYR A CD2 1 
ATOM 1509 C CE1 . TYR A 1 196 ? 136.903 123.772 167.678 1.00 216.24 ?  254 TYR A CE1 1 
ATOM 1510 C CE2 . TYR A 1 196 ? 136.896 122.731 165.534 1.00 219.65 ?  254 TYR A CE2 1 
ATOM 1511 C CZ  . TYR A 1 196 ? 136.359 123.627 166.428 1.00 219.40 ?  254 TYR A CZ  1 
ATOM 1512 O OH  . TYR A 1 196 ? 135.272 124.389 166.074 1.00 216.52 ?  254 TYR A OH  1 
ATOM 1513 N N   . ASN A 1 197 ? 142.115 121.353 169.511 1.00 142.53 ?  255 ASN A N   1 
ATOM 1514 C CA  . ASN A 1 197 ? 142.786 120.446 170.423 1.00 131.12 ?  255 ASN A CA  1 
ATOM 1515 C C   . ASN A 1 197 ? 141.795 119.455 170.978 1.00 131.99 ?  255 ASN A C   1 
ATOM 1516 O O   . ASN A 1 197 ? 140.592 119.638 170.832 1.00 143.60 ?  255 ASN A O   1 
ATOM 1517 C CB  . ASN A 1 197 ? 143.430 121.215 171.563 1.00 120.81 ?  255 ASN A CB  1 
ATOM 1518 C CG  . ASN A 1 197 ? 144.455 122.196 171.081 1.00 113.65 ?  255 ASN A CG  1 
ATOM 1519 O OD1 . ASN A 1 197 ? 144.449 123.359 171.475 1.00 108.78 ?  255 ASN A OD1 1 
ATOM 1520 N ND2 . ASN A 1 197 ? 145.343 121.739 170.210 1.00 112.38 ?  255 ASN A ND2 1 
ATOM 1521 N N   . VAL A 1 198 ? 142.284 118.402 171.613 1.00 114.59 ?  256 VAL A N   1 
ATOM 1522 C CA  . VAL A 1 198 ? 141.391 117.559 172.386 1.00 100.71 ?  256 VAL A CA  1 
ATOM 1523 C C   . VAL A 1 198 ? 141.552 117.843 173.853 1.00 110.10 ?  256 VAL A C   1 
ATOM 1524 O O   . VAL A 1 198 ? 142.034 118.898 174.245 1.00 99.81  ?  256 VAL A O   1 
ATOM 1525 C CB  . VAL A 1 198 ? 141.639 116.093 172.164 1.00 85.74  ?  256 VAL A CB  1 
ATOM 1526 C CG1 . VAL A 1 198 ? 141.322 115.729 170.740 1.00 81.78  ?  256 VAL A CG1 1 
ATOM 1527 C CG2 . VAL A 1 198 ? 143.066 115.785 172.493 1.00 72.82  ?  256 VAL A CG2 1 
ATOM 1528 N N   . TRP A 1 199 ? 141.165 116.878 174.664 1.00 115.22 ?  257 TRP A N   1 
ATOM 1529 C CA  . TRP A 1 199 ? 140.964 117.135 176.059 1.00 142.24 ?  257 TRP A CA  1 
ATOM 1530 C C   . TRP A 1 199 ? 140.811 115.816 176.761 1.00 179.88 ?  257 TRP A C   1 
ATOM 1531 O O   . TRP A 1 199 ? 140.418 114.850 176.120 1.00 181.13 ?  257 TRP A O   1 
ATOM 1532 C CB  . TRP A 1 199 ? 139.718 117.971 176.222 1.00 139.83 ?  257 TRP A CB  1 
ATOM 1533 C CG  . TRP A 1 199 ? 139.421 118.316 177.578 1.00 152.91 ?  257 TRP A CG  1 
ATOM 1534 C CD1 . TRP A 1 199 ? 138.524 117.716 178.399 1.00 154.15 ?  257 TRP A CD1 1 
ATOM 1535 C CD2 . TRP A 1 199 ? 139.991 119.386 178.306 1.00 169.85 ?  257 TRP A CD2 1 
ATOM 1536 N NE1 . TRP A 1 199 ? 138.510 118.343 179.617 1.00 165.41 ?  257 TRP A NE1 1 
ATOM 1537 C CE2 . TRP A 1 199 ? 139.409 119.375 179.584 1.00 178.95 ?  257 TRP A CE2 1 
ATOM 1538 C CE3 . TRP A 1 199 ? 140.940 120.360 178.002 1.00 179.65 ?  257 TRP A CE3 1 
ATOM 1539 C CZ2 . TRP A 1 199 ? 139.743 120.299 180.557 1.00 196.47 ?  257 TRP A CZ2 1 
ATOM 1540 C CZ3 . TRP A 1 199 ? 141.274 121.270 178.965 1.00 190.78 ?  257 TRP A CZ3 1 
ATOM 1541 C CH2 . TRP A 1 199 ? 140.680 121.235 180.232 1.00 199.28 ?  257 TRP A CH2 1 
ATOM 1542 N N   . SER A 1 200 ? 141.123 115.752 178.053 1.00 155.34 ?  258 SER A N   1 
ATOM 1543 C CA  . SER A 1 200 ? 140.798 114.563 178.845 1.00 152.59 ?  258 SER A CA  1 
ATOM 1544 C C   . SER A 1 200 ? 141.010 114.697 180.333 1.00 171.58 ?  258 SER A C   1 
ATOM 1545 O O   . SER A 1 200 ? 142.022 115.216 180.782 1.00 170.18 ?  258 SER A O   1 
ATOM 1546 C CB  . SER A 1 200 ? 141.599 113.363 178.369 1.00 147.70 ?  258 SER A CB  1 
ATOM 1547 O OG  . SER A 1 200 ? 141.198 112.987 177.071 1.00 140.87 ?  258 SER A OG  1 
ATOM 1548 N N   . MET A 1 201 ? 140.058 114.180 181.095 1.00 172.93 ?  259 MET A N   1 
ATOM 1549 C CA  . MET A 1 201 ? 140.224 114.070 182.529 1.00 200.33 ?  259 MET A CA  1 
ATOM 1550 C C   . MET A 1 201 ? 139.765 112.707 182.973 1.00 200.87 ?  259 MET A C   1 
ATOM 1551 O O   . MET A 1 201 ? 138.804 112.167 182.439 1.00 204.71 ?  259 MET A O   1 
ATOM 1552 C CB  . MET A 1 201 ? 139.444 115.148 183.268 1.00 236.32 ?  259 MET A CB  1 
ATOM 1553 C CG  . MET A 1 201 ? 139.925 116.551 182.993 1.00 264.51 ?  259 MET A CG  1 
ATOM 1554 S SD  . MET A 1 201 ? 141.666 116.773 183.382 1.00 230.71 ?  259 MET A SD  1 
ATOM 1555 C CE  . MET A 1 201 ? 141.691 116.521 185.150 1.00 129.23 ?  259 MET A CE  1 
ATOM 1556 N N   . LEU A 1 202 ? 140.457 112.149 183.953 1.00 212.85 ?  260 LEU A N   1 
ATOM 1557 C CA  . LEU A 1 202 ? 140.132 110.820 184.434 1.00 200.12 ?  260 LEU A CA  1 
ATOM 1558 C C   . LEU A 1 202 ? 138.971 110.880 185.419 1.00 159.44 ?  260 LEU A C   1 
ATOM 1559 O O   . LEU A 1 202 ? 138.384 109.861 185.772 1.00 162.60 ?  260 LEU A O   1 
ATOM 1560 C CB  . LEU A 1 202 ? 141.367 110.181 185.059 1.00 189.30 ?  260 LEU A CB  1 
ATOM 1561 C CG  . LEU A 1 202 ? 141.242 108.776 185.631 1.00 180.96 ?  260 LEU A CG  1 
ATOM 1562 C CD1 . LEU A 1 202 ? 140.801 107.824 184.547 1.00 175.67 ?  260 LEU A CD1 1 
ATOM 1563 C CD2 . LEU A 1 202 ? 142.573 108.344 186.197 1.00 176.15 ?  260 LEU A CD2 1 
ATOM 1564 N N   . LYS A 1 203 ? 138.622 112.087 185.840 1.00 180.19 ?  261 LYS A N   1 
ATOM 1565 C CA  . LYS A 1 203 ? 137.424 112.275 186.637 1.00 169.35 ?  261 LYS A CA  1 
ATOM 1566 C C   . LYS A 1 203 ? 136.567 113.376 186.047 1.00 169.80 ?  261 LYS A C   1 
ATOM 1567 O O   . LYS A 1 203 ? 137.082 114.362 185.528 1.00 171.86 ?  261 LYS A O   1 
ATOM 1568 C CB  . LYS A 1 203 ? 137.781 112.612 188.081 1.00 20.00  ?  261 LYS A CB  1 
ATOM 1569 C CG  . LYS A 1 203 ? 138.368 111.468 188.871 1.00 20.00  ?  261 LYS A CG  1 
ATOM 1570 C CD  . LYS A 1 203 ? 138.708 111.925 190.276 1.00 20.00  ?  261 LYS A CD  1 
ATOM 1571 C CE  . LYS A 1 203 ? 138.992 110.751 191.192 1.00 20.00  ?  261 LYS A CE  1 
ATOM 1572 N NZ  . LYS A 1 203 ? 140.263 110.049 190.885 1.00 20.00  ?  261 LYS A NZ  1 
ATOM 1573 N N   . PRO A 1 204 ? 135.246 113.212 186.144 1.00 30.00  ?  262 PRO A N   1 
ATOM 1574 C CA  . PRO A 1 204 ? 134.255 114.171 185.657 1.00 30.00  ?  262 PRO A CA  1 
ATOM 1575 C C   . PRO A 1 204 ? 134.364 115.494 186.389 1.00 30.00  ?  262 PRO A C   1 
ATOM 1576 O O   . PRO A 1 204 ? 134.725 115.511 187.562 1.00 30.00  ?  262 PRO A O   1 
ATOM 1577 C CB  . PRO A 1 204 ? 132.924 113.483 185.957 1.00 20.00  ?  262 PRO A CB  1 
ATOM 1578 C CG  . PRO A 1 204 ? 133.256 112.035 185.968 1.00 20.00  ?  262 PRO A CG  1 
ATOM 1579 C CD  . PRO A 1 204 ? 134.615 111.960 186.589 1.00 20.00  ?  262 PRO A CD  1 
ATOM 1580 N N   . ILE A 1 205 ? 134.080 116.589 185.698 1.00 30.00  ?  263 ILE A N   1 
ATOM 1581 C CA  . ILE A 1 205 ? 134.210 117.907 186.294 1.00 30.00  ?  263 ILE A CA  1 
ATOM 1582 C C   . ILE A 1 205 ? 133.007 118.795 185.994 1.00 30.00  ?  263 ILE A C   1 
ATOM 1583 O O   . ILE A 1 205 ? 132.797 119.217 184.857 1.00 30.00  ?  263 ILE A O   1 
ATOM 1584 C CB  . ILE A 1 205 ? 135.483 118.594 185.804 1.00 20.00  ?  263 ILE A CB  1 
ATOM 1585 C CG1 . ILE A 1 205 ? 136.703 117.805 186.274 1.00 20.00  ?  263 ILE A CG1 1 
ATOM 1586 C CG2 . ILE A 1 205 ? 135.542 120.023 186.306 1.00 20.00  ?  263 ILE A CG2 1 
ATOM 1587 C CD1 . ILE A 1 205 ? 137.987 118.241 185.644 1.00 20.00  ?  263 ILE A CD1 1 
ATOM 1588 N N   . ALA A 1 206 ? 142.015 121.586 193.701 1.00 30.00  ?  272 ALA A N   1 
ATOM 1589 C CA  . ALA A 1 206 ? 142.945 122.704 193.649 1.00 30.00  ?  272 ALA A CA  1 
ATOM 1590 C C   . ALA A 1 206 ? 144.164 122.353 192.803 1.00 30.00  ?  272 ALA A C   1 
ATOM 1591 O O   . ALA A 1 206 ? 144.056 122.126 191.597 1.00 30.00  ?  272 ALA A O   1 
ATOM 1592 C CB  . ALA A 1 206 ? 143.368 123.105 195.054 1.00 30.00  ?  272 ALA A CB  1 
ATOM 1593 N N   . ASP A 1 207 ? 145.323 122.311 193.449 1.00 30.00  ?  273 ASP A N   1 
ATOM 1594 C CA  . ASP A 1 207 ? 146.574 121.981 192.782 1.00 30.00  ?  273 ASP A CA  1 
ATOM 1595 C C   . ASP A 1 207 ? 146.781 120.478 192.752 1.00 30.00  ?  273 ASP A C   1 
ATOM 1596 O O   . ASP A 1 207 ? 147.484 119.929 193.598 1.00 30.00  ?  273 ASP A O   1 
ATOM 1597 C CB  . ASP A 1 207 ? 147.748 122.652 193.491 1.00 20.00  ?  273 ASP A CB  1 
ATOM 1598 C CG  . ASP A 1 207 ? 147.712 124.156 193.371 1.00 20.00  ?  273 ASP A CG  1 
ATOM 1599 O OD1 . ASP A 1 207 ? 146.955 124.662 192.520 1.00 20.00  ?  273 ASP A OD1 1 
ATOM 1600 O OD2 . ASP A 1 207 ? 148.439 124.831 194.128 1.00 20.00  ?  273 ASP A OD2 1 
ATOM 1601 N N   . ASP A 1 208 ? 146.173 119.813 191.779 1.00 30.00  ?  274 ASP A N   1 
ATOM 1602 C CA  . ASP A 1 208 ? 146.161 118.359 191.778 1.00 30.00  ?  274 ASP A CA  1 
ATOM 1603 C C   . ASP A 1 208 ? 145.867 117.757 190.414 1.00 30.00  ?  274 ASP A C   1 
ATOM 1604 O O   . ASP A 1 208 ? 145.048 116.851 190.288 1.00 30.00  ?  274 ASP A O   1 
ATOM 1605 C CB  . ASP A 1 208 ? 145.137 117.863 192.796 1.00 20.00  ?  274 ASP A CB  1 
ATOM 1606 C CG  . ASP A 1 208 ? 143.755 118.426 192.546 1.00 20.00  ?  274 ASP A CG  1 
ATOM 1607 O OD1 . ASP A 1 208 ? 143.618 119.294 191.657 1.00 20.00  ?  274 ASP A OD1 1 
ATOM 1608 O OD2 . ASP A 1 208 ? 142.808 118.007 193.244 1.00 20.00  ?  274 ASP A OD2 1 
ATOM 1609 N N   . VAL A 1 209 ? 146.541 118.261 189.390 1.00 152.01 ?  275 VAL A N   1 
ATOM 1610 C CA  . VAL A 1 209 ? 146.381 117.730 188.049 1.00 157.13 ?  275 VAL A CA  1 
ATOM 1611 C C   . VAL A 1 209 ? 147.705 117.728 187.323 1.00 156.93 ?  275 VAL A C   1 
ATOM 1612 O O   . VAL A 1 209 ? 148.623 118.457 187.683 1.00 161.30 ?  275 VAL A O   1 
ATOM 1613 C CB  . VAL A 1 209 ? 145.380 118.540 187.229 1.00 118.95 ?  275 VAL A CB  1 
ATOM 1614 C CG1 . VAL A 1 209 ? 143.980 118.402 187.792 1.00 116.49 ?  275 VAL A CG1 1 
ATOM 1615 C CG2 . VAL A 1 209 ? 145.798 119.988 187.204 1.00 122.63 ?  275 VAL A CG2 1 
ATOM 1616 N N   . VAL A 1 210 ? 147.798 116.908 186.288 1.00 141.80 ?  276 VAL A N   1 
ATOM 1617 C CA  . VAL A 1 210 ? 149.026 116.801 185.522 1.00 148.03 ?  276 VAL A CA  1 
ATOM 1618 C C   . VAL A 1 210 ? 148.715 116.710 184.036 1.00 162.60 ?  276 VAL A C   1 
ATOM 1619 O O   . VAL A 1 210 ? 147.786 116.022 183.630 1.00 158.78 ?  276 VAL A O   1 
ATOM 1620 C CB  . VAL A 1 210 ? 149.840 115.578 185.961 1.00 155.74 ?  276 VAL A CB  1 
ATOM 1621 C CG1 . VAL A 1 210 ? 151.035 115.377 185.058 1.00 158.61 ?  276 VAL A CG1 1 
ATOM 1622 C CG2 . VAL A 1 210 ? 150.292 115.731 187.401 1.00 158.60 ?  276 VAL A CG2 1 
ATOM 1623 N N   . VAL A 1 211 ? 149.478 117.431 183.229 1.00 177.87 ?  277 VAL A N   1 
ATOM 1624 C CA  . VAL A 1 211 ? 149.297 117.386 181.793 1.00 177.77 ?  277 VAL A CA  1 
ATOM 1625 C C   . VAL A 1 211 ? 149.883 116.083 181.269 1.00 157.94 ?  277 VAL A C   1 
ATOM 1626 O O   . VAL A 1 211 ? 150.716 115.465 181.923 1.00 161.20 ?  277 VAL A O   1 
ATOM 1627 C CB  . VAL A 1 211 ? 149.979 118.555 181.076 1.00 147.92 ?  277 VAL A CB  1 
ATOM 1628 C CG1 . VAL A 1 211 ? 151.457 118.285 180.913 1.00 150.02 ?  277 VAL A CG1 1 
ATOM 1629 C CG2 . VAL A 1 211 ? 149.346 118.799 179.737 1.00 146.75 ?  277 VAL A CG2 1 
ATOM 1630 N N   . ALA A 1 212 ? 149.419 115.646 180.108 1.00 143.50 ?  278 ALA A N   1 
ATOM 1631 C CA  . ALA A 1 212 ? 150.040 114.525 179.420 1.00 119.37 ?  278 ALA A CA  1 
ATOM 1632 C C   . ALA A 1 212 ? 150.263 114.884 177.962 1.00 123.56 ?  278 ALA A C   1 
ATOM 1633 O O   . ALA A 1 212 ? 150.218 114.030 177.084 1.00 125.56 ?  278 ALA A O   1 
ATOM 1634 C CB  . ALA A 1 212 ? 149.183 113.295 179.537 1.00 112.20 ?  278 ALA A CB  1 
ATOM 1635 N N   . ALA A 1 213 ? 150.545 116.155 177.722 1.00 128.67 ?  279 ALA A N   1 
ATOM 1636 C CA  . ALA A 1 213 ? 150.454 116.734 176.391 1.00 133.45 ?  279 ALA A CA  1 
ATOM 1637 C C   . ALA A 1 213 ? 151.413 116.113 175.396 1.00 138.26 ?  279 ALA A C   1 
ATOM 1638 O O   . ALA A 1 213 ? 152.448 115.580 175.771 1.00 140.33 ?  279 ALA A O   1 
ATOM 1639 C CB  . ALA A 1 213 ? 150.685 118.221 176.462 1.00 131.62 ?  279 ALA A CB  1 
ATOM 1640 N N   . THR A 1 214 ? 151.038 116.158 174.124 1.00 136.83 ?  280 THR A N   1 
ATOM 1641 C CA  . THR A 1 214 ? 151.858 115.584 173.070 1.00 127.78 ?  280 THR A CA  1 
ATOM 1642 C C   . THR A 1 214 ? 151.623 116.172 171.680 1.00 120.44 ?  280 THR A C   1 
ATOM 1643 O O   . THR A 1 214 ? 150.551 116.692 171.375 1.00 117.88 ?  280 THR A O   1 
ATOM 1644 C CB  . THR A 1 214 ? 151.648 114.072 172.995 1.00 125.11 ?  280 THR A CB  1 
ATOM 1645 O OG1 . THR A 1 214 ? 152.422 113.538 171.918 1.00 121.53 ?  280 THR A OG1 1 
ATOM 1646 C CG2 . THR A 1 214 ? 150.197 113.744 172.780 1.00 125.95 ?  280 THR A CG2 1 
ATOM 1647 N N   . ARG A 1 215 ? 152.643 116.063 170.838 1.00 120.25 ?  281 ARG A N   1 
ATOM 1648 C CA  . ARG A 1 215 ? 152.594 116.559 169.470 1.00 116.67 ?  281 ARG A CA  1 
ATOM 1649 C C   . ARG A 1 215 ? 151.611 115.789 168.627 1.00 119.47 ?  281 ARG A C   1 
ATOM 1650 O O   . ARG A 1 215 ? 151.325 114.636 168.909 1.00 117.84 ?  281 ARG A O   1 
ATOM 1651 C CB  . ARG A 1 215 ? 153.969 116.492 168.827 1.00 117.72 ?  281 ARG A CB  1 
ATOM 1652 C CG  . ARG A 1 215 ? 154.953 117.461 169.410 1.00 125.03 ?  281 ARG A CG  1 
ATOM 1653 C CD  . ARG A 1 215 ? 156.297 117.268 168.783 1.00 139.40 ?  281 ARG A CD  1 
ATOM 1654 N NE  . ARG A 1 215 ? 156.241 117.492 167.348 1.00 156.32 ?  281 ARG A NE  1 
ATOM 1655 C CZ  . ARG A 1 215 ? 157.261 117.274 166.529 1.00 163.80 ?  281 ARG A CZ  1 
ATOM 1656 N NH1 . ARG A 1 215 ? 158.407 116.825 167.013 1.00 167.81 ?  281 ARG A NH1 1 
ATOM 1657 N NH2 . ARG A 1 215 ? 157.138 117.499 165.231 1.00 162.26 ?  281 ARG A NH2 1 
ATOM 1658 N N   . LEU A 1 216 ? 151.085 116.435 167.595 1.00 107.64 ?  282 LEU A N   1 
ATOM 1659 C CA  . LEU A 1 216 ? 150.035 115.839 166.793 1.00 100.22 ?  282 LEU A CA  1 
ATOM 1660 C C   . LEU A 1 216 ? 150.117 116.322 165.351 1.00 125.43 ?  282 LEU A C   1 
ATOM 1661 O O   . LEU A 1 216 ? 149.254 116.039 164.529 1.00 126.62 ?  282 LEU A O   1 
ATOM 1662 C CB  . LEU A 1 216 ? 148.674 116.163 167.427 1.00 82.88  ?  282 LEU A CB  1 
ATOM 1663 C CG  . LEU A 1 216 ? 147.381 115.424 167.064 1.00 84.28  ?  282 LEU A CG  1 
ATOM 1664 C CD1 . LEU A 1 216 ? 146.542 115.255 168.311 1.00 92.22  ?  282 LEU A CD1 1 
ATOM 1665 C CD2 . LEU A 1 216 ? 146.575 116.105 165.987 1.00 92.03  ?  282 LEU A CD2 1 
ATOM 1666 N N   . ASP A 1 217 ? 151.184 117.040 165.042 1.00 117.53 ?  283 ASP A N   1 
ATOM 1667 C CA  . ASP A 1 217 ? 151.265 117.737 163.774 1.00 134.63 ?  283 ASP A CA  1 
ATOM 1668 C C   . ASP A 1 217 ? 152.128 117.036 162.752 1.00 130.57 ?  283 ASP A C   1 
ATOM 1669 O O   . ASP A 1 217 ? 151.654 116.177 162.016 1.00 131.43 ?  283 ASP A O   1 
ATOM 1670 C CB  . ASP A 1 217 ? 151.800 119.148 164.000 1.00 149.57 ?  283 ASP A CB  1 
ATOM 1671 C CG  . ASP A 1 217 ? 151.811 119.983 162.733 1.00 165.07 ?  283 ASP A CG  1 
ATOM 1672 O OD1 . ASP A 1 217 ? 151.482 119.457 161.650 1.00 168.43 ?  283 ASP A OD1 1 
ATOM 1673 O OD2 . ASP A 1 217 ? 152.129 121.186 162.821 1.00 171.83 ?  283 ASP A OD2 1 
ATOM 1674 N N   . SER A 1 218 ? 153.394 117.440 162.714 1.00 150.38 ?  284 SER A N   1 
ATOM 1675 C CA  . SER A 1 218 ? 154.337 117.075 161.663 1.00 134.07 ?  284 SER A CA  1 
ATOM 1676 C C   . SER A 1 218 ? 153.791 117.476 160.305 1.00 107.31 ?  284 SER A C   1 
ATOM 1677 O O   . SER A 1 218 ? 152.975 116.768 159.720 1.00 109.22 ?  284 SER A O   1 
ATOM 1678 C CB  . SER A 1 218 ? 154.645 115.580 161.678 1.00 149.90 ?  284 SER A CB  1 
ATOM 1679 O OG  . SER A 1 218 ? 153.503 114.830 161.316 1.00 158.77 ?  284 SER A OG  1 
ATOM 1680 N N   . ARG A 1 219 ? 154.253 118.612 159.802 1.00 87.37  ?  285 ARG A N   1 
ATOM 1681 C CA  . ARG A 1 219 ? 153.809 119.099 158.509 1.00 76.79  ?  285 ARG A CA  1 
ATOM 1682 C C   . ARG A 1 219 ? 154.404 118.274 157.386 1.00 86.38  ?  285 ARG A C   1 
ATOM 1683 O O   . ARG A 1 219 ? 154.605 117.073 157.524 1.00 92.02  ?  285 ARG A O   1 
ATOM 1684 C CB  . ARG A 1 219 ? 154.181 120.569 158.346 1.00 82.83  ?  285 ARG A CB  1 
ATOM 1685 C CG  . ARG A 1 219 ? 155.665 120.861 158.410 1.00 85.09  ?  285 ARG A CG  1 
ATOM 1686 C CD  . ARG A 1 219 ? 155.912 122.352 158.334 1.00 82.04  ?  285 ARG A CD  1 
ATOM 1687 N NE  . ARG A 1 219 ? 155.447 122.926 157.078 1.00 86.51  ?  285 ARG A NE  1 
ATOM 1688 C CZ  . ARG A 1 219 ? 156.181 123.006 155.977 1.00 95.02  ?  285 ARG A CZ  1 
ATOM 1689 N NH1 . ARG A 1 219 ? 157.423 122.559 155.976 1.00 87.15  ?  285 ARG A NH1 1 
ATOM 1690 N NH2 . ARG A 1 219 ? 155.677 123.546 154.879 1.00 101.81 ?  285 ARG A NH2 1 
ATOM 1691 N N   . SER A 1 220 ? 154.664 118.918 156.262 1.00 84.79  ?  286 SER A N   1 
ATOM 1692 C CA  . SER A 1 220 ? 155.349 118.267 155.164 1.00 88.13  ?  286 SER A CA  1 
ATOM 1693 C C   . SER A 1 220 ? 155.958 119.267 154.223 1.00 84.86  ?  286 SER A C   1 
ATOM 1694 O O   . SER A 1 220 ? 155.738 120.464 154.354 1.00 80.60  ?  286 SER A O   1 
ATOM 1695 C CB  . SER A 1 220 ? 154.407 117.374 154.382 1.00 99.03  ?  286 SER A CB  1 
ATOM 1696 O OG  . SER A 1 220 ? 155.069 116.911 153.221 1.00 101.87 ?  286 SER A OG  1 
ATOM 1697 N N   . PHE A 1 221 ? 156.757 118.780 153.288 1.00 92.94  ?  287 PHE A N   1 
ATOM 1698 C CA  . PHE A 1 221 ? 157.222 119.640 152.226 1.00 97.72  ?  287 PHE A CA  1 
ATOM 1699 C C   . PHE A 1 221 ? 156.161 119.814 151.153 1.00 119.59 ?  287 PHE A C   1 
ATOM 1700 O O   . PHE A 1 221 ? 156.247 120.719 150.330 1.00 120.95 ?  287 PHE A O   1 
ATOM 1701 C CB  . PHE A 1 221 ? 158.496 119.092 151.611 1.00 108.15 ?  287 PHE A CB  1 
ATOM 1702 C CG  . PHE A 1 221 ? 158.972 119.880 150.439 1.00 130.45 ?  287 PHE A CG  1 
ATOM 1703 C CD1 . PHE A 1 221 ? 159.626 121.081 150.621 1.00 142.61 ?  287 PHE A CD1 1 
ATOM 1704 C CD2 . PHE A 1 221 ? 158.757 119.425 149.153 1.00 132.68 ?  287 PHE A CD2 1 
ATOM 1705 C CE1 . PHE A 1 221 ? 160.059 121.809 149.547 1.00 148.32 ?  287 PHE A CE1 1 
ATOM 1706 C CE2 . PHE A 1 221 ? 159.191 120.150 148.077 1.00 134.15 ?  287 PHE A CE2 1 
ATOM 1707 C CZ  . PHE A 1 221 ? 159.843 121.345 148.274 1.00 139.69 ?  287 PHE A CZ  1 
ATOM 1708 N N   . ALA A 1 222 ? 155.146 118.962 151.163 1.00 110.47 ?  288 ALA A N   1 
ATOM 1709 C CA  . ALA A 1 222 ? 154.141 119.051 150.120 1.00 115.07 ?  288 ALA A CA  1 
ATOM 1710 C C   . ALA A 1 222 ? 152.740 118.674 150.575 1.00 100.62 ?  288 ALA A C   1 
ATOM 1711 O O   . ALA A 1 222 ? 152.355 117.515 150.494 1.00 104.35 ?  288 ALA A O   1 
ATOM 1712 C CB  . ALA A 1 222 ? 154.550 118.198 148.951 1.00 124.64 ?  288 ALA A CB  1 
ATOM 1713 N N   . TRP A 1 223 ? 152.023 119.672 151.086 1.00 102.32 ?  289 TRP A N   1 
ATOM 1714 C CA  . TRP A 1 223 ? 150.566 119.692 151.244 1.00 88.32  ?  289 TRP A CA  1 
ATOM 1715 C C   . TRP A 1 223 ? 149.857 118.348 151.233 1.00 95.89  ?  289 TRP A C   1 
ATOM 1716 O O   . TRP A 1 223 ? 149.710 117.749 150.180 1.00 94.10  ?  289 TRP A O   1 
ATOM 1717 C CB  . TRP A 1 223 ? 149.972 120.540 150.127 1.00 84.14  ?  289 TRP A CB  1 
ATOM 1718 C CG  . TRP A 1 223 ? 148.538 120.894 150.303 1.00 91.77  ?  289 TRP A CG  1 
ATOM 1719 C CD1 . TRP A 1 223 ? 148.054 122.002 150.915 1.00 97.50  ?  289 TRP A CD1 1 
ATOM 1720 C CD2 . TRP A 1 223 ? 147.397 120.157 149.852 1.00 99.18  ?  289 TRP A CD2 1 
ATOM 1721 N NE1 . TRP A 1 223 ? 146.685 122.005 150.884 1.00 102.86 ?  289 TRP A NE1 1 
ATOM 1722 C CE2 . TRP A 1 223 ? 146.258 120.881 150.235 1.00 103.77 ?  289 TRP A CE2 1 
ATOM 1723 C CE3 . TRP A 1 223 ? 147.228 118.962 149.159 1.00 93.62  ?  289 TRP A CE3 1 
ATOM 1724 C CZ2 . TRP A 1 223 ? 144.973 120.447 149.954 1.00 102.57 ?  289 TRP A CZ2 1 
ATOM 1725 C CZ3 . TRP A 1 223 ? 145.952 118.532 148.887 1.00 94.56  ?  289 TRP A CZ3 1 
ATOM 1726 C CH2 . TRP A 1 223 ? 144.842 119.272 149.280 1.00 99.54  ?  289 TRP A CH2 1 
ATOM 1727 N N   . ASN A 1 224 ? 149.418 117.875 152.391 1.00 102.06 ?  290 ASN A N   1 
ATOM 1728 C CA  . ASN A 1 224 ? 148.618 116.657 152.464 1.00 109.28 ?  290 ASN A CA  1 
ATOM 1729 C C   . ASN A 1 224 ? 149.204 115.436 151.787 1.00 115.97 ?  290 ASN A C   1 
ATOM 1730 O O   . ASN A 1 224 ? 148.525 114.776 151.007 1.00 119.85 ?  290 ASN A O   1 
ATOM 1731 C CB  . ASN A 1 224 ? 147.240 116.901 151.874 1.00 87.80  ?  290 ASN A CB  1 
ATOM 1732 C CG  . ASN A 1 224 ? 146.422 117.831 152.708 1.00 84.65  ?  290 ASN A CG  1 
ATOM 1733 O OD1 . ASN A 1 224 ? 145.860 118.797 152.210 1.00 84.37  ?  290 ASN A OD1 1 
ATOM 1734 N ND2 . ASN A 1 224 ? 146.340 117.544 153.996 1.00 81.95  ?  290 ASN A ND2 1 
ATOM 1735 N N   . VAL A 1 225 ? 150.461 115.136 152.072 1.00 110.62 ?  291 VAL A N   1 
ATOM 1736 C CA  . VAL A 1 225 ? 151.045 113.888 151.618 1.00 117.68 ?  291 VAL A CA  1 
ATOM 1737 C C   . VAL A 1 225 ? 150.657 112.815 152.652 1.00 264.57 ?  291 VAL A C   1 
ATOM 1738 O O   . VAL A 1 225 ? 149.485 112.713 152.991 1.00 270.98 ?  291 VAL A O   1 
ATOM 1739 C CB  . VAL A 1 225 ? 152.566 114.046 151.412 1.00 132.28 ?  291 VAL A CB  1 
ATOM 1740 C CG1 . VAL A 1 225 ? 153.272 114.417 152.713 1.00 133.77 ?  291 VAL A CG1 1 
ATOM 1741 C CG2 . VAL A 1 225 ? 153.174 112.823 150.724 1.00 128.21 ?  291 VAL A CG2 1 
ATOM 1742 N N   . ALA A 1 226 ? 151.593 112.004 153.139 1.00 216.54 ?  292 ALA A N   1 
ATOM 1743 C CA  . ALA A 1 226 ? 151.305 111.113 154.257 1.00 177.26 ?  292 ALA A CA  1 
ATOM 1744 C C   . ALA A 1 226 ? 152.391 111.187 155.321 1.00 142.66 ?  292 ALA A C   1 
ATOM 1745 O O   . ALA A 1 226 ? 153.104 110.218 155.569 1.00 142.21 ?  292 ALA A O   1 
ATOM 1746 C CB  . ALA A 1 226 ? 151.150 109.683 153.765 1.00 171.32 ?  292 ALA A CB  1 
ATOM 1747 N N   . PRO A 1 227 ? 152.490 112.337 155.983 1.00 146.11 ?  293 PRO A N   1 
ATOM 1748 C CA  . PRO A 1 227 ? 153.455 112.495 157.060 1.00 126.14 ?  293 PRO A CA  1 
ATOM 1749 C C   . PRO A 1 227 ? 153.125 111.632 158.261 1.00 110.91 ?  293 PRO A C   1 
ATOM 1750 O O   . PRO A 1 227 ? 151.972 111.268 158.459 1.00 99.29  ?  293 PRO A O   1 
ATOM 1751 C CB  . PRO A 1 227 ? 153.340 113.981 157.406 1.00 127.29 ?  293 PRO A CB  1 
ATOM 1752 C CG  . PRO A 1 227 ? 151.971 114.344 157.015 1.00 127.58 ?  293 PRO A CG  1 
ATOM 1753 C CD  . PRO A 1 227 ? 151.702 113.563 155.778 1.00 137.50 ?  293 PRO A CD  1 
ATOM 1754 N N   . GLY A 1 228 ? 154.144 111.267 159.025 1.00 124.65 ?  294 GLY A N   1 
ATOM 1755 C CA  . GLY A 1 228 ? 153.919 110.882 160.401 1.00 116.30 ?  294 GLY A CA  1 
ATOM 1756 C C   . GLY A 1 228 ? 154.224 109.465 160.814 1.00 104.86 ?  294 GLY A C   1 
ATOM 1757 O O   . GLY A 1 228 ? 153.445 108.555 160.560 1.00 96.22  ?  294 GLY A O   1 
ATOM 1758 N N   . ALA A 1 229 ? 155.367 109.278 161.457 1.00 94.00  ?  295 ALA A N   1 
ATOM 1759 C CA  . ALA A 1 229 ? 155.603 108.048 162.186 1.00 109.38 ?  295 ALA A CA  1 
ATOM 1760 C C   . ALA A 1 229 ? 155.931 108.406 163.615 1.00 130.02 ?  295 ALA A C   1 
ATOM 1761 O O   . ALA A 1 229 ? 155.066 108.835 164.375 1.00 128.59 ?  295 ALA A O   1 
ATOM 1762 C CB  . ALA A 1 229 ? 156.710 107.239 161.566 1.00 274.54 ?  295 ALA A CB  1 
ATOM 1763 N N   . GLU A 1 230 ? 157.196 108.266 163.974 1.00 123.82 ?  296 GLU A N   1 
ATOM 1764 C CA  . GLU A 1 230 ? 157.644 108.636 165.302 1.00 145.96 ?  296 GLU A CA  1 
ATOM 1765 C C   . GLU A 1 230 ? 157.496 110.139 165.437 1.00 139.47 ?  296 GLU A C   1 
ATOM 1766 O O   . GLU A 1 230 ? 157.447 110.676 166.540 1.00 141.55 ?  296 GLU A O   1 
ATOM 1767 C CB  . GLU A 1 230 ? 159.091 108.235 165.516 1.00 163.83 ?  296 GLU A CB  1 
ATOM 1768 C CG  . GLU A 1 230 ? 160.066 109.243 164.949 1.00 187.85 ?  296 GLU A CG  1 
ATOM 1769 C CD  . GLU A 1 230 ? 160.089 109.287 163.433 1.00 189.15 ?  296 GLU A CD  1 
ATOM 1770 O OE1 . GLU A 1 230 ? 159.263 108.608 162.789 1.00 189.42 ?  296 GLU A OE1 1 
ATOM 1771 O OE2 . GLU A 1 230 ? 160.940 110.015 162.880 1.00 190.58 ?  296 GLU A OE2 1 
ATOM 1772 N N   . SER A 1 231 ? 157.430 110.811 164.293 1.00 149.55 ?  297 SER A N   1 
ATOM 1773 C CA  . SER A 1 231 ? 157.289 112.254 164.254 1.00 153.34 ?  297 SER A CA  1 
ATOM 1774 C C   . SER A 1 231 ? 155.997 112.662 164.935 1.00 149.80 ?  297 SER A C   1 
ATOM 1775 O O   . SER A 1 231 ? 155.877 113.770 165.447 1.00 153.97 ?  297 SER A O   1 
ATOM 1776 C CB  . SER A 1 231 ? 157.313 112.758 162.816 1.00 162.51 ?  297 SER A CB  1 
ATOM 1777 O OG  . SER A 1 231 ? 156.205 112.253 162.094 1.00 168.37 ?  297 SER A OG  1 
ATOM 1778 N N   . ALA A 1 232 ? 155.029 111.758 164.940 1.00 139.74 ?  298 ALA A N   1 
ATOM 1779 C CA  . ALA A 1 232 ? 153.797 112.015 165.648 1.00 132.07 ?  298 ALA A CA  1 
ATOM 1780 C C   . ALA A 1 232 ? 153.076 110.742 166.039 1.00 126.12 ?  298 ALA A C   1 
ATOM 1781 O O   . ALA A 1 232 ? 152.769 110.550 167.211 1.00 128.85 ?  298 ALA A O   1 
ATOM 1782 C CB  . ALA A 1 232 ? 152.892 112.877 164.813 1.00 134.90 ?  298 ALA A CB  1 
ATOM 1783 N N   . VAL A 1 233 ? 152.830 109.865 165.070 1.00 125.14 ?  299 VAL A N   1 
ATOM 1784 C CA  . VAL A 1 233 ? 151.774 108.873 165.234 1.00 120.84 ?  299 VAL A CA  1 
ATOM 1785 C C   . VAL A 1 233 ? 152.040 107.975 166.431 1.00 126.76 ?  299 VAL A C   1 
ATOM 1786 O O   . VAL A 1 233 ? 151.108 107.545 167.100 1.00 125.64 ?  299 VAL A O   1 
ATOM 1787 C CB  . VAL A 1 233 ? 151.581 108.000 163.970 1.00 121.98 ?  299 VAL A CB  1 
ATOM 1788 C CG1 . VAL A 1 233 ? 152.721 107.042 163.775 1.00 119.06 ?  299 VAL A CG1 1 
ATOM 1789 C CG2 . VAL A 1 233 ? 150.274 107.234 164.047 1.00 129.13 ?  299 VAL A CG2 1 
ATOM 1790 N N   . ALA A 1 234 ? 153.308 107.734 166.731 1.00 128.05 ?  300 ALA A N   1 
ATOM 1791 C CA  . ALA A 1 234 ? 153.658 106.865 167.839 1.00 137.21 ?  300 ALA A CA  1 
ATOM 1792 C C   . ALA A 1 234 ? 153.224 107.454 169.173 1.00 137.12 ?  300 ALA A C   1 
ATOM 1793 O O   . ALA A 1 234 ? 152.747 106.747 170.070 1.00 141.37 ?  300 ALA A O   1 
ATOM 1794 C CB  . ALA A 1 234 ? 155.149 106.614 167.839 1.00 143.41 ?  300 ALA A CB  1 
ATOM 1795 N N   . SER A 1 235 ? 153.359 108.765 169.292 1.00 127.80 ?  301 SER A N   1 
ATOM 1796 C CA  . SER A 1 235 ? 153.137 109.395 170.575 1.00 124.39 ?  301 SER A CA  1 
ATOM 1797 C C   . SER A 1 235 ? 151.691 109.268 171.029 1.00 131.99 ?  301 SER A C   1 
ATOM 1798 O O   . SER A 1 235 ? 151.431 109.058 172.210 1.00 134.74 ?  301 SER A O   1 
ATOM 1799 C CB  . SER A 1 235 ? 153.521 110.864 170.512 1.00 114.00 ?  301 SER A CB  1 
ATOM 1800 O OG  . SER A 1 235 ? 152.619 111.564 169.683 1.00 107.02 ?  301 SER A OG  1 
ATOM 1801 N N   . PHE A 1 236 ? 150.756 109.364 170.089 1.00 135.24 ?  302 PHE A N   1 
ATOM 1802 C CA  . PHE A 1 236 ? 149.347 109.323 170.446 1.00 141.04 ?  302 PHE A CA  1 
ATOM 1803 C C   . PHE A 1 236 ? 149.109 107.981 171.027 1.00 136.87 ?  302 PHE A C   1 
ATOM 1804 O O   . PHE A 1 236 ? 148.508 107.820 172.087 1.00 129.91 ?  302 PHE A O   1 
ATOM 1805 C CB  . PHE A 1 236 ? 148.443 109.478 169.244 1.00 152.66 ?  302 PHE A CB  1 
ATOM 1806 C CG  . PHE A 1 236 ? 148.841 110.562 168.350 1.00 157.29 ?  302 PHE A CG  1 
ATOM 1807 C CD1 . PHE A 1 236 ? 148.723 111.861 168.747 1.00 162.65 ?  302 PHE A CD1 1 
ATOM 1808 C CD2 . PHE A 1 236 ? 149.285 110.283 167.078 1.00 161.04 ?  302 PHE A CD2 1 
ATOM 1809 C CE1 . PHE A 1 236 ? 149.094 112.858 167.916 1.00 166.14 ?  302 PHE A CE1 1 
ATOM 1810 C CE2 . PHE A 1 236 ? 149.645 111.290 166.229 1.00 164.01 ?  302 PHE A CE2 1 
ATOM 1811 C CZ  . PHE A 1 236 ? 149.546 112.581 166.646 1.00 167.07 ?  302 PHE A CZ  1 
ATOM 1812 N N   . VAL A 1 237 ? 149.642 107.020 170.295 1.00 130.77 ?  303 VAL A N   1 
ATOM 1813 C CA  . VAL A 1 237 ? 149.524 105.637 170.628 1.00 132.41 ?  303 VAL A CA  1 
ATOM 1814 C C   . VAL A 1 237 ? 149.923 105.454 172.068 1.00 132.92 ?  303 VAL A C   1 
ATOM 1815 O O   . VAL A 1 237 ? 149.076 105.158 172.907 1.00 135.53 ?  303 VAL A O   1 
ATOM 1816 C CB  . VAL A 1 237 ? 150.410 104.789 169.728 1.00 189.44 ?  303 VAL A CB  1 
ATOM 1817 C CG1 . VAL A 1 237 ? 150.359 103.353 170.154 1.00 188.87 ?  303 VAL A CG1 1 
ATOM 1818 C CG2 . VAL A 1 237 ? 149.982 104.937 168.289 1.00 190.41 ?  303 VAL A CG2 1 
ATOM 1819 N N   . THR A 1 238 ? 151.189 105.710 172.371 1.00 139.94 ?  304 THR A N   1 
ATOM 1820 C CA  . THR A 1 238 ? 151.689 105.402 173.701 1.00 136.46 ?  304 THR A CA  1 
ATOM 1821 C C   . THR A 1 238 ? 150.893 106.152 174.748 1.00 131.53 ?  304 THR A C   1 
ATOM 1822 O O   . THR A 1 238 ? 150.537 105.609 175.798 1.00 128.41 ?  304 THR A O   1 
ATOM 1823 C CB  . THR A 1 238 ? 153.161 105.773 173.840 1.00 139.63 ?  304 THR A CB  1 
ATOM 1824 O OG1 . THR A 1 238 ? 153.324 107.154 173.504 1.00 140.66 ?  304 THR A OG1 1 
ATOM 1825 C CG2 . THR A 1 238 ? 154.013 104.931 172.913 1.00 139.03 ?  304 THR A CG2 1 
ATOM 1826 N N   . GLN A 1 239 ? 150.553 107.382 174.406 1.00 131.15 ?  305 GLN A N   1 
ATOM 1827 C CA  . GLN A 1 239 ? 149.813 108.251 175.293 1.00 133.75 ?  305 GLN A CA  1 
ATOM 1828 C C   . GLN A 1 239 ? 148.525 107.612 175.757 1.00 133.97 ?  305 GLN A C   1 
ATOM 1829 O O   . GLN A 1 239 ? 148.396 107.154 176.896 1.00 142.17 ?  305 GLN A O   1 
ATOM 1830 C CB  . GLN A 1 239 ? 149.503 109.557 174.579 1.00 138.72 ?  305 GLN A CB  1 
ATOM 1831 C CG  . GLN A 1 239 ? 148.769 110.544 175.414 1.00 146.96 ?  305 GLN A CG  1 
ATOM 1832 C CD  . GLN A 1 239 ? 149.585 110.995 176.578 1.00 152.31 ?  305 GLN A CD  1 
ATOM 1833 O OE1 . GLN A 1 239 ? 149.388 110.534 177.695 1.00 146.22 ?  305 GLN A OE1 1 
ATOM 1834 N NE2 . GLN A 1 239 ? 150.526 111.894 176.327 1.00 159.51 ?  305 GLN A NE2 1 
ATOM 1835 N N   . LEU A 1 240 ? 147.566 107.572 174.851 1.00 132.13 ?  306 LEU A N   1 
ATOM 1836 C CA  . LEU A 1 240 ? 146.243 107.124 175.210 1.00 135.65 ?  306 LEU A CA  1 
ATOM 1837 C C   . LEU A 1 240 ? 146.239 105.666 175.617 1.00 123.63 ?  306 LEU A C   1 
ATOM 1838 O O   . LEU A 1 240 ? 145.371 105.235 176.366 1.00 125.84 ?  306 LEU A O   1 
ATOM 1839 C CB  . LEU A 1 240 ? 145.283 107.384 174.057 1.00 141.64 ?  306 LEU A CB  1 
ATOM 1840 C CG  . LEU A 1 240 ? 145.691 106.821 172.702 1.00 151.64 ?  306 LEU A CG  1 
ATOM 1841 C CD1 . LEU A 1 240 ? 145.299 105.374 172.549 1.00 161.99 ?  306 LEU A CD1 1 
ATOM 1842 C CD2 . LEU A 1 240 ? 145.117 107.668 171.588 1.00 150.07 ?  306 LEU A CD2 1 
ATOM 1843 N N   . ALA A 1 241 ? 147.202 104.900 175.122 1.00 120.34 ?  307 ALA A N   1 
ATOM 1844 C CA  . ALA A 1 241 ? 147.289 103.510 175.535 1.00 125.56 ?  307 ALA A CA  1 
ATOM 1845 C C   . ALA A 1 241 ? 147.563 103.470 177.021 1.00 142.52 ?  307 ALA A C   1 
ATOM 1846 O O   . ALA A 1 241 ? 146.965 102.682 177.765 1.00 150.96 ?  307 ALA A O   1 
ATOM 1847 C CB  . ALA A 1 241 ? 148.367 102.784 174.776 1.00 122.71 ?  307 ALA A CB  1 
ATOM 1848 N N   . ALA A 1 242 ? 148.444 104.357 177.461 1.00 136.79 ?  308 ALA A N   1 
ATOM 1849 C CA  . ALA A 1 242 ? 148.687 104.465 178.880 1.00 144.33 ?  308 ALA A CA  1 
ATOM 1850 C C   . ALA A 1 242 ? 147.401 104.906 179.553 1.00 148.61 ?  308 ALA A C   1 
ATOM 1851 O O   . ALA A 1 242 ? 147.052 104.421 180.633 1.00 150.59 ?  308 ALA A O   1 
ATOM 1852 C CB  . ALA A 1 242 ? 149.803 105.439 179.163 1.00 148.24 ?  308 ALA A CB  1 
ATOM 1853 N N   . ALA A 1 243 ? 146.662 105.779 178.875 1.00 129.80 ?  309 ALA A N   1 
ATOM 1854 C CA  . ALA A 1 243 ? 145.454 106.333 179.470 1.00 137.36 ?  309 ALA A CA  1 
ATOM 1855 C C   . ALA A 1 243 ? 144.459 105.231 179.752 1.00 137.92 ?  309 ALA A C   1 
ATOM 1856 O O   . ALA A 1 243 ? 143.740 105.262 180.745 1.00 140.86 ?  309 ALA A O   1 
ATOM 1857 C CB  . ALA A 1 243 ? 144.843 107.373 178.566 1.00 132.59 ?  309 ALA A CB  1 
ATOM 1858 N N   . GLU A 1 244 ? 144.440 104.228 178.894 1.00 165.06 ?  310 GLU A N   1 
ATOM 1859 C CA  . GLU A 1 244 ? 143.517 103.144 179.107 1.00 160.01 ?  310 GLU A CA  1 
ATOM 1860 C C   . GLU A 1 244 ? 144.030 102.181 180.134 1.00 157.84 ?  310 GLU A C   1 
ATOM 1861 O O   . GLU A 1 244 ? 143.259 101.634 180.921 1.00 154.46 ?  310 GLU A O   1 
ATOM 1862 C CB  . GLU A 1 244 ? 143.235 102.398 177.817 1.00 192.96 ?  310 GLU A CB  1 
ATOM 1863 C CG  . GLU A 1 244 ? 142.228 101.270 177.992 1.00 195.49 ?  310 GLU A CG  1 
ATOM 1864 C CD  . GLU A 1 244 ? 140.866 101.758 178.469 1.00 203.14 ?  310 GLU A CD  1 
ATOM 1865 O OE1 . GLU A 1 244 ? 140.630 102.983 178.466 1.00 203.35 ?  310 GLU A OE1 1 
ATOM 1866 O OE2 . GLU A 1 244 ? 140.025 100.913 178.845 1.00 208.07 ?  310 GLU A OE2 1 
ATOM 1867 N N   . ALA A 1 245 ? 145.336 101.963 180.127 1.00 158.34 ?  311 ALA A N   1 
ATOM 1868 C CA  . ALA A 1 245 ? 145.881 101.007 181.065 1.00 162.85 ?  311 ALA A CA  1 
ATOM 1869 C C   . ALA A 1 245 ? 145.575 101.500 182.463 1.00 173.66 ?  311 ALA A C   1 
ATOM 1870 O O   . ALA A 1 245 ? 145.214 100.720 183.342 1.00 177.10 ?  311 ALA A O   1 
ATOM 1871 C CB  . ALA A 1 245 ? 147.367 100.841 180.864 1.00 159.68 ?  311 ALA A CB  1 
ATOM 1872 N N   . LEU A 1 246 ? 145.653 102.809 182.651 1.00 182.25 ?  312 LEU A N   1 
ATOM 1873 C CA  . LEU A 1 246 ? 145.306 103.368 183.941 1.00 183.04 ?  312 LEU A CA  1 
ATOM 1874 C C   . LEU A 1 246 ? 143.805 103.509 184.073 1.00 179.60 ?  312 LEU A C   1 
ATOM 1875 O O   . LEU A 1 246 ? 143.283 103.660 185.173 1.00 180.90 ?  312 LEU A O   1 
ATOM 1876 C CB  . LEU A 1 246 ? 145.998 104.710 184.141 1.00 187.43 ?  312 LEU A CB  1 
ATOM 1877 C CG  . LEU A 1 246 ? 145.664 105.827 183.161 1.00 193.07 ?  312 LEU A CG  1 
ATOM 1878 C CD1 . LEU A 1 246 ? 144.425 106.598 183.579 1.00 194.25 ?  312 LEU A CD1 1 
ATOM 1879 C CD2 . LEU A 1 246 ? 146.857 106.743 183.018 1.00 196.58 ?  312 LEU A CD2 1 
ATOM 1880 N N   . GLN A 1 247 ? 143.105 103.459 182.949 1.00 186.94 ?  313 GLN A N   1 
ATOM 1881 C CA  . GLN A 1 247 ? 141.662 103.580 182.995 1.00 182.14 ?  313 GLN A CA  1 
ATOM 1882 C C   . GLN A 1 247 ? 141.075 102.402 183.742 1.00 187.29 ?  313 GLN A C   1 
ATOM 1883 O O   . GLN A 1 247 ? 140.037 102.509 184.386 1.00 185.20 ?  313 GLN A O   1 
ATOM 1884 C CB  . GLN A 1 247 ? 141.078 103.663 181.592 1.00 184.18 ?  313 GLN A CB  1 
ATOM 1885 C CG  . GLN A 1 247 ? 139.590 103.818 181.585 1.00 183.01 ?  313 GLN A CG  1 
ATOM 1886 C CD  . GLN A 1 247 ? 139.168 105.062 182.313 1.00 182.05 ?  313 GLN A CD  1 
ATOM 1887 O OE1 . GLN A 1 247 ? 138.733 105.004 183.461 1.00 181.01 ?  313 GLN A OE1 1 
ATOM 1888 N NE2 . GLN A 1 247 ? 139.316 106.205 181.660 1.00 178.76 ?  313 GLN A NE2 1 
ATOM 1889 N N   . LYS A 1 248 ? 141.777 101.281 183.675 1.00 184.51 ?  314 LYS A N   1 
ATOM 1890 C CA  . LYS A 1 248 ? 141.299 100.040 184.252 1.00 185.31 ?  314 LYS A CA  1 
ATOM 1891 C C   . LYS A 1 248 ? 141.561 99.961  185.745 1.00 192.42 ?  314 LYS A C   1 
ATOM 1892 O O   . LYS A 1 248 ? 141.154 99.004  186.402 1.00 194.81 ?  314 LYS A O   1 
ATOM 1893 C CB  . LYS A 1 248 ? 141.957 98.863  183.554 1.00 166.23 ?  314 LYS A CB  1 
ATOM 1894 C CG  . LYS A 1 248 ? 141.545 98.714  182.116 1.00 159.24 ?  314 LYS A CG  1 
ATOM 1895 C CD  . LYS A 1 248 ? 142.135 97.449  181.557 1.00 155.84 ?  314 LYS A CD  1 
ATOM 1896 C CE  . LYS A 1 248 ? 143.648 97.540  181.573 1.00 131.56 ?  314 LYS A CE  1 
ATOM 1897 N NZ  . LYS A 1 248 ? 144.288 96.356  180.943 1.00 127.88 ?  314 LYS A NZ  1 
ATOM 1898 N N   . ALA A 1 249 ? 142.252 100.959 186.280 1.00 192.12 ?  315 ALA A N   1 
ATOM 1899 C CA  . ALA A 1 249 ? 142.619 100.941 187.687 1.00 199.98 ?  315 ALA A CA  1 
ATOM 1900 C C   . ALA A 1 249 ? 141.379 100.954 188.573 1.00 204.39 ?  315 ALA A C   1 
ATOM 1901 O O   . ALA A 1 249 ? 140.394 101.615 188.260 1.00 202.21 ?  315 ALA A O   1 
ATOM 1902 C CB  . ALA A 1 249 ? 143.514 102.120 188.014 1.00 206.44 ?  315 ALA A CB  1 
ATOM 1903 N N   . PRO A 1 250 ? 141.416 100.191 189.670 1.00 187.44 ?  316 PRO A N   1 
ATOM 1904 C CA  . PRO A 1 250 ? 140.325 100.143 190.646 1.00 196.44 ?  316 PRO A CA  1 
ATOM 1905 C C   . PRO A 1 250 ? 139.994 101.498 191.267 1.00 219.03 ?  316 PRO A C   1 
ATOM 1906 O O   . PRO A 1 250 ? 138.836 101.773 191.574 1.00 222.57 ?  316 PRO A O   1 
ATOM 1907 C CB  . PRO A 1 250 ? 140.856 99.178  191.712 1.00 188.38 ?  316 PRO A CB  1 
ATOM 1908 C CG  . PRO A 1 250 ? 142.342 99.244  191.575 1.00 180.22 ?  316 PRO A CG  1 
ATOM 1909 C CD  . PRO A 1 250 ? 142.564 99.372  190.101 1.00 179.45 ?  316 PRO A CD  1 
ATOM 1910 N N   . ASP A 1 251 ? 141.008 102.337 191.437 1.00 222.73 ?  317 ASP A N   1 
ATOM 1911 C CA  . ASP A 1 251 ? 140.893 103.501 192.305 1.00 232.68 ?  317 ASP A CA  1 
ATOM 1912 C C   . ASP A 1 251 ? 140.584 104.773 191.516 1.00 230.13 ?  317 ASP A C   1 
ATOM 1913 O O   . ASP A 1 251 ? 140.849 105.883 191.979 1.00 235.63 ?  317 ASP A O   1 
ATOM 1914 C CB  . ASP A 1 251 ? 142.181 103.669 193.115 1.00 242.33 ?  317 ASP A CB  1 
ATOM 1915 C CG  . ASP A 1 251 ? 142.020 104.622 194.282 1.00 249.99 ?  317 ASP A CG  1 
ATOM 1916 O OD1 . ASP A 1 251 ? 140.881 105.058 194.544 1.00 253.83 ?  317 ASP A OD1 1 
ATOM 1917 O OD2 . ASP A 1 251 ? 143.036 104.931 194.938 1.00 253.01 ?  317 ASP A OD2 1 
ATOM 1918 N N   . VAL A 1 252 ? 140.037 104.612 190.316 1.00 230.26 ?  318 VAL A N   1 
ATOM 1919 C CA  . VAL A 1 252 ? 139.775 105.757 189.455 1.00 209.18 ?  318 VAL A CA  1 
ATOM 1920 C C   . VAL A 1 252 ? 138.813 106.754 190.096 1.00 206.90 ?  318 VAL A C   1 
ATOM 1921 O O   . VAL A 1 252 ? 138.959 107.963 189.931 1.00 204.17 ?  318 VAL A O   1 
ATOM 1922 C CB  . VAL A 1 252 ? 139.198 105.302 188.097 1.00 209.75 ?  318 VAL A CB  1 
ATOM 1923 C CG1 . VAL A 1 252 ? 138.743 106.493 187.275 1.00 205.25 ?  318 VAL A CG1 1 
ATOM 1924 C CG2 . VAL A 1 252 ? 140.239 104.511 187.330 1.00 205.76 ?  318 VAL A CG2 1 
ATOM 1925 N N   . THR A 1 253 ? 137.852 106.248 190.857 1.00 228.85 ?  319 THR A N   1 
ATOM 1926 C CA  . THR A 1 253 ? 136.855 107.112 191.477 1.00 219.72 ?  319 THR A CA  1 
ATOM 1927 C C   . THR A 1 253 ? 137.436 108.022 192.552 1.00 212.39 ?  319 THR A C   1 
ATOM 1928 O O   . THR A 1 253 ? 136.887 109.089 192.823 1.00 213.46 ?  319 THR A O   1 
ATOM 1929 C CB  . THR A 1 253 ? 135.713 106.294 192.112 1.00 145.35 ?  319 THR A CB  1 
ATOM 1930 O OG1 . THR A 1 253 ? 136.244 105.421 193.116 1.00 144.67 ?  319 THR A OG1 1 
ATOM 1931 C CG2 . THR A 1 253 ? 134.998 105.471 191.057 1.00 146.88 ?  319 THR A CG2 1 
ATOM 1932 N N   . THR A 1 254 ? 138.536 107.601 193.170 1.00 200.54 ?  320 THR A N   1 
ATOM 1933 C CA  . THR A 1 254 ? 139.006 108.262 194.385 1.00 190.60 ?  320 THR A CA  1 
ATOM 1934 C C   . THR A 1 254 ? 140.496 108.559 194.425 1.00 176.23 ?  320 THR A C   1 
ATOM 1935 O O   . THR A 1 254 ? 141.273 107.755 194.931 1.00 166.42 ?  320 THR A O   1 
ATOM 1936 C CB  . THR A 1 254 ? 138.694 107.415 195.624 1.00 179.47 ?  320 THR A CB  1 
ATOM 1937 O OG1 . THR A 1 254 ? 139.333 106.142 195.495 1.00 179.58 ?  320 THR A OG1 1 
ATOM 1938 C CG2 . THR A 1 254 ? 137.202 107.212 195.779 1.00 176.85 ?  320 THR A CG2 1 
ATOM 1939 N N   . LEU A 1 255 ? 140.895 109.718 193.914 1.00 156.15 ?  321 LEU A N   1 
ATOM 1940 C CA  . LEU A 1 255 ? 142.281 110.155 194.037 1.00 168.96 ?  321 LEU A CA  1 
ATOM 1941 C C   . LEU A 1 255 ? 142.406 111.620 194.437 1.00 184.38 ?  321 LEU A C   1 
ATOM 1942 O O   . LEU A 1 255 ? 141.535 112.427 194.124 1.00 176.71 ?  321 LEU A O   1 
ATOM 1943 C CB  . LEU A 1 255 ? 143.022 109.908 192.727 1.00 178.05 ?  321 LEU A CB  1 
ATOM 1944 C CG  . LEU A 1 255 ? 143.252 108.436 192.417 1.00 184.64 ?  321 LEU A CG  1 
ATOM 1945 C CD1 . LEU A 1 255 ? 143.844 108.279 191.040 1.00 184.28 ?  321 LEU A CD1 1 
ATOM 1946 C CD2 . LEU A 1 255 ? 144.180 107.855 193.464 1.00 191.86 ?  321 LEU A CD2 1 
ATOM 1947 N N   . PRO A 1 256 ? 143.498 111.964 195.135 1.00 188.16 ?  322 PRO A N   1 
ATOM 1948 C CA  . PRO A 1 256 ? 143.824 113.359 195.435 1.00 201.49 ?  322 PRO A CA  1 
ATOM 1949 C C   . PRO A 1 256 ? 143.976 114.160 194.160 1.00 217.18 ?  322 PRO A C   1 
ATOM 1950 O O   . PRO A 1 256 ? 143.683 115.350 194.121 1.00 247.94 ?  322 PRO A O   1 
ATOM 1951 C CB  . PRO A 1 256 ? 145.156 113.256 196.187 1.00 199.70 ?  322 PRO A CB  1 
ATOM 1952 C CG  . PRO A 1 256 ? 145.738 111.966 195.728 1.00 197.25 ?  322 PRO A CG  1 
ATOM 1953 C CD  . PRO A 1 256 ? 144.556 111.054 195.601 1.00 193.13 ?  322 PRO A CD  1 
ATOM 1954 N N   . ARG A 1 257 ? 144.451 113.494 193.122 1.00 215.53 ?  323 ARG A N   1 
ATOM 1955 C CA  . ARG A 1 257 ? 144.739 114.161 191.876 1.00 198.50 ?  323 ARG A CA  1 
ATOM 1956 C C   . ARG A 1 257 ? 143.924 113.594 190.735 1.00 184.32 ?  323 ARG A C   1 
ATOM 1957 O O   . ARG A 1 257 ? 143.463 112.459 190.796 1.00 179.98 ?  323 ARG A O   1 
ATOM 1958 C CB  . ARG A 1 257 ? 146.217 114.045 191.562 1.00 198.56 ?  323 ARG A CB  1 
ATOM 1959 C CG  . ARG A 1 257 ? 147.078 114.755 192.562 1.00 191.58 ?  323 ARG A CG  1 
ATOM 1960 C CD  . ARG A 1 257 ? 148.526 114.548 192.239 1.00 187.04 ?  323 ARG A CD  1 
ATOM 1961 N NE  . ARG A 1 257 ? 149.376 115.259 193.178 1.00 182.17 ?  323 ARG A NE  1 
ATOM 1962 C CZ  . ARG A 1 257 ? 149.698 114.792 194.376 1.00 177.29 ?  323 ARG A CZ  1 
ATOM 1963 N NH1 . ARG A 1 257 ? 149.232 113.617 194.776 1.00 175.25 ?  323 ARG A NH1 1 
ATOM 1964 N NH2 . ARG A 1 257 ? 150.480 115.502 195.175 1.00 176.23 ?  323 ARG A NH2 1 
ATOM 1965 N N   . ASN A 1 258 ? 143.747 114.394 189.694 1.00 182.62 ?  324 ASN A N   1 
ATOM 1966 C CA  . ASN A 1 258 ? 143.073 113.928 188.498 1.00 165.63 ?  324 ASN A CA  1 
ATOM 1967 C C   . ASN A 1 258 ? 143.912 114.287 187.284 1.00 151.13 ?  324 ASN A C   1 
ATOM 1968 O O   . ASN A 1 258 ? 144.550 115.333 187.249 1.00 143.88 ?  324 ASN A O   1 
ATOM 1969 C CB  . ASN A 1 258 ? 141.674 114.527 188.400 1.00 166.03 ?  324 ASN A CB  1 
ATOM 1970 C CG  . ASN A 1 258 ? 140.812 113.823 187.376 1.00 165.63 ?  324 ASN A CG  1 
ATOM 1971 O OD1 . ASN A 1 258 ? 140.974 112.632 187.124 1.00 161.95 ?  324 ASN A OD1 1 
ATOM 1972 N ND2 . ASN A 1 258 ? 139.878 114.557 186.790 1.00 169.78 ?  324 ASN A ND2 1 
ATOM 1973 N N   . VAL A 1 259 ? 143.918 113.407 186.294 1.00 151.74 ?  325 VAL A N   1 
ATOM 1974 C CA  . VAL A 1 259 ? 144.876 113.499 185.204 1.00 148.98 ?  325 VAL A CA  1 
ATOM 1975 C C   . VAL A 1 259 ? 144.325 114.240 184.000 1.00 155.93 ?  325 VAL A C   1 
ATOM 1976 O O   . VAL A 1 259 ? 143.161 114.089 183.652 1.00 160.23 ?  325 VAL A O   1 
ATOM 1977 C CB  . VAL A 1 259 ? 145.316 112.104 184.776 1.00 137.20 ?  325 VAL A CB  1 
ATOM 1978 C CG1 . VAL A 1 259 ? 146.283 112.171 183.613 1.00 127.53 ?  325 VAL A CG1 1 
ATOM 1979 C CG2 . VAL A 1 259 ? 145.937 111.392 185.950 1.00 141.49 ?  325 VAL A CG2 1 
ATOM 1980 N N   . MET A 1 260 ? 145.171 115.033 183.357 1.00 148.37 ?  326 MET A N   1 
ATOM 1981 C CA  . MET A 1 260 ? 144.760 115.743 182.162 1.00 146.60 ?  326 MET A CA  1 
ATOM 1982 C C   . MET A 1 260 ? 145.525 115.318 180.925 1.00 143.91 ?  326 MET A C   1 
ATOM 1983 O O   . MET A 1 260 ? 146.582 115.864 180.608 1.00 148.54 ?  326 MET A O   1 
ATOM 1984 C CB  . MET A 1 260 ? 144.912 117.244 182.355 1.00 143.28 ?  326 MET A CB  1 
ATOM 1985 C CG  . MET A 1 260 ? 144.616 118.033 181.098 1.00 143.22 ?  326 MET A CG  1 
ATOM 1986 S SD  . MET A 1 260 ? 144.512 119.802 181.374 1.00 328.73 ?  326 MET A SD  1 
ATOM 1987 C CE  . MET A 1 260 ? 144.613 120.392 179.691 1.00 248.20 ?  326 MET A CE  1 
ATOM 1988 N N   . PHE A 1 261 ? 145.010 114.313 180.239 1.00 146.49 ?  327 PHE A N   1 
ATOM 1989 C CA  . PHE A 1 261 ? 145.503 114.027 178.917 1.00 134.42 ?  327 PHE A CA  1 
ATOM 1990 C C   . PHE A 1 261 ? 145.020 115.134 178.031 1.00 126.61 ?  327 PHE A C   1 
ATOM 1991 O O   . PHE A 1 261 ? 143.900 115.606 178.188 1.00 119.19 ?  327 PHE A O   1 
ATOM 1992 C CB  . PHE A 1 261 ? 144.999 112.696 178.417 1.00 137.84 ?  327 PHE A CB  1 
ATOM 1993 C CG  . PHE A 1 261 ? 145.307 111.570 179.329 1.00 144.53 ?  327 PHE A CG  1 
ATOM 1994 C CD1 . PHE A 1 261 ? 146.535 110.949 179.290 1.00 144.24 ?  327 PHE A CD1 1 
ATOM 1995 C CD2 . PHE A 1 261 ? 144.372 111.137 180.240 1.00 151.68 ?  327 PHE A CD2 1 
ATOM 1996 C CE1 . PHE A 1 261 ? 146.818 109.908 180.137 1.00 149.66 ?  327 PHE A CE1 1 
ATOM 1997 C CE2 . PHE A 1 261 ? 144.649 110.096 181.086 1.00 155.60 ?  327 PHE A CE2 1 
ATOM 1998 C CZ  . PHE A 1 261 ? 145.873 109.483 181.037 1.00 154.78 ?  327 PHE A CZ  1 
ATOM 1999 N N   . VAL A 1 262 ? 145.855 115.555 177.100 1.00 125.53 ?  328 VAL A N   1 
ATOM 2000 C CA  . VAL A 1 262 ? 145.443 116.542 176.129 1.00 122.53 ?  328 VAL A CA  1 
ATOM 2001 C C   . VAL A 1 262 ? 146.447 116.526 175.004 1.00 125.41 ?  328 VAL A C   1 
ATOM 2002 O O   . VAL A 1 262 ? 147.619 116.258 175.221 1.00 127.96 ?  328 VAL A O   1 
ATOM 2003 C CB  . VAL A 1 262 ? 145.350 117.936 176.748 1.00 118.42 ?  328 VAL A CB  1 
ATOM 2004 C CG1 . VAL A 1 262 ? 146.695 118.368 177.253 1.00 113.50 ?  328 VAL A CG1 1 
ATOM 2005 C CG2 . VAL A 1 262 ? 144.828 118.928 175.740 1.00 118.08 ?  328 VAL A CG2 1 
ATOM 2006 N N   . PHE A 1 263 ? 145.990 116.773 173.788 1.00 113.09 ?  329 PHE A N   1 
ATOM 2007 C CA  . PHE A 1 263 ? 146.877 116.684 172.651 1.00 121.95 ?  329 PHE A CA  1 
ATOM 2008 C C   . PHE A 1 263 ? 146.847 118.029 171.956 1.00 129.34 ?  329 PHE A C   1 
ATOM 2009 O O   . PHE A 1 263 ? 145.806 118.678 171.916 1.00 137.14 ?  329 PHE A O   1 
ATOM 2010 C CB  . PHE A 1 263 ? 146.436 115.591 171.693 1.00 134.65 ?  329 PHE A CB  1 
ATOM 2011 C CG  . PHE A 1 263 ? 146.173 114.260 172.342 1.00 151.42 ?  329 PHE A CG  1 
ATOM 2012 C CD1 . PHE A 1 263 ? 146.734 113.908 173.546 1.00 156.84 ?  329 PHE A CD1 1 
ATOM 2013 C CD2 . PHE A 1 263 ? 145.319 113.366 171.738 1.00 160.36 ?  329 PHE A CD2 1 
ATOM 2014 C CE1 . PHE A 1 263 ? 146.457 112.700 174.126 1.00 163.86 ?  329 PHE A CE1 1 
ATOM 2015 C CE2 . PHE A 1 263 ? 145.045 112.154 172.313 1.00 166.86 ?  329 PHE A CE2 1 
ATOM 2016 C CZ  . PHE A 1 263 ? 145.615 111.820 173.507 1.00 167.48 ?  329 PHE A CZ  1 
ATOM 2017 N N   . PHE A 1 264 ? 147.970 118.459 171.401 1.00 30.00  ?  330 PHE A N   1 
ATOM 2018 C CA  . PHE A 1 264 ? 148.032 119.795 170.825 1.00 30.00  ?  330 PHE A CA  1 
ATOM 2019 C C   . PHE A 1 264 ? 148.207 119.806 169.320 1.00 30.00  ?  330 PHE A C   1 
ATOM 2020 O O   . PHE A 1 264 ? 149.320 119.679 168.823 1.00 30.00  ?  330 PHE A O   1 
ATOM 2021 C CB  . PHE A 1 264 ? 149.166 120.581 171.463 1.00 20.00  ?  330 PHE A CB  1 
ATOM 2022 C CG  . PHE A 1 264 ? 148.960 120.857 172.913 1.00 20.00  ?  330 PHE A CG  1 
ATOM 2023 C CD1 . PHE A 1 264 ? 147.709 120.744 173.475 1.00 20.00  ?  330 PHE A CD1 1 
ATOM 2024 C CD2 . PHE A 1 264 ? 150.010 121.244 173.713 1.00 20.00  ?  330 PHE A CD2 1 
ATOM 2025 C CE1 . PHE A 1 264 ? 147.514 120.996 174.809 1.00 20.00  ?  330 PHE A CE1 1 
ATOM 2026 C CE2 . PHE A 1 264 ? 149.819 121.503 175.050 1.00 20.00  ?  330 PHE A CE2 1 
ATOM 2027 C CZ  . PHE A 1 264 ? 148.567 121.380 175.599 1.00 20.00  ?  330 PHE A CZ  1 
ATOM 2028 N N   . GLN A 1 265 ? 147.110 119.991 168.597 1.00 121.82 ?  331 GLN A N   1 
ATOM 2029 C CA  . GLN A 1 265 ? 147.148 120.002 167.143 1.00 112.74 ?  331 GLN A CA  1 
ATOM 2030 C C   . GLN A 1 265 ? 148.012 121.114 166.575 1.00 102.15 ?  331 GLN A C   1 
ATOM 2031 O O   . GLN A 1 265 ? 147.962 122.237 167.043 1.00 87.20  ?  331 GLN A O   1 
ATOM 2032 C CB  . GLN A 1 265 ? 145.736 120.137 166.583 1.00 110.14 ?  331 GLN A CB  1 
ATOM 2033 C CG  . GLN A 1 265 ? 145.700 120.287 165.080 1.00 102.85 ?  331 GLN A CG  1 
ATOM 2034 C CD  . GLN A 1 265 ? 146.170 119.053 164.348 1.00 99.12  ?  331 GLN A CD  1 
ATOM 2035 O OE1 . GLN A 1 265 ? 147.349 118.916 164.032 1.00 104.04 ?  331 GLN A OE1 1 
ATOM 2036 N NE2 . GLN A 1 265 ? 145.236 118.172 164.021 1.00 94.33  ?  331 GLN A NE2 1 
ATOM 2037 N N   . GLY A 1 266 ? 148.782 120.778 165.545 1.00 94.94  ?  332 GLY A N   1 
ATOM 2038 C CA  . GLY A 1 266 ? 149.507 121.747 164.742 1.00 111.46 ?  332 GLY A CA  1 
ATOM 2039 C C   . GLY A 1 266 ? 150.847 122.246 165.246 1.00 128.90 ?  332 GLY A C   1 
ATOM 2040 O O   . GLY A 1 266 ? 151.388 123.211 164.711 1.00 131.71 ?  332 GLY A O   1 
ATOM 2041 N N   . GLU A 1 267 ? 151.396 121.591 166.257 1.00 97.60  ?  333 GLU A N   1 
ATOM 2042 C CA  . GLU A 1 267 ? 152.483 122.180 167.020 1.00 132.05 ?  333 GLU A CA  1 
ATOM 2043 C C   . GLU A 1 267 ? 153.737 122.545 166.224 1.00 135.52 ?  333 GLU A C   1 
ATOM 2044 O O   . GLU A 1 267 ? 154.388 123.534 166.542 1.00 138.74 ?  333 GLU A O   1 
ATOM 2045 C CB  . GLU A 1 267 ? 152.857 121.227 168.153 1.00 167.02 ?  333 GLU A CB  1 
ATOM 2046 C CG  . GLU A 1 267 ? 153.933 121.717 169.104 1.00 235.97 ?  333 GLU A CG  1 
ATOM 2047 C CD  . GLU A 1 267 ? 155.335 121.507 168.569 1.00 260.99 ?  333 GLU A CD  1 
ATOM 2048 O OE1 . GLU A 1 267 ? 155.517 120.641 167.689 1.00 266.55 ?  333 GLU A OE1 1 
ATOM 2049 O OE2 . GLU A 1 267 ? 156.259 122.206 169.030 1.00 269.10 ?  333 GLU A OE2 1 
ATOM 2050 N N   . THR A 1 268 ? 154.081 121.781 165.192 1.00 142.39 ?  334 THR A N   1 
ATOM 2051 C CA  . THR A 1 268 ? 155.424 121.906 164.618 1.00 145.60 ?  334 THR A CA  1 
ATOM 2052 C C   . THR A 1 268 ? 155.625 123.231 163.904 1.00 136.93 ?  334 THR A C   1 
ATOM 2053 O O   . THR A 1 268 ? 156.751 123.633 163.636 1.00 134.72 ?  334 THR A O   1 
ATOM 2054 C CB  . THR A 1 268 ? 155.762 120.775 163.632 1.00 250.68 ?  334 THR A CB  1 
ATOM 2055 O OG1 . THR A 1 268 ? 157.173 120.769 163.391 1.00 251.00 ?  334 THR A OG1 1 
ATOM 2056 C CG2 . THR A 1 268 ? 155.071 120.989 162.309 1.00 249.85 ?  334 THR A CG2 1 
ATOM 2057 N N   . PHE A 1 269 ? 154.533 123.902 163.580 1.00 146.22 ?  335 PHE A N   1 
ATOM 2058 C CA  . PHE A 1 269 ? 154.633 125.247 163.056 1.00 110.97 ?  335 PHE A CA  1 
ATOM 2059 C C   . PHE A 1 269 ? 155.018 126.228 164.137 1.00 100.80 ?  335 PHE A C   1 
ATOM 2060 O O   . PHE A 1 269 ? 156.179 126.344 164.513 1.00 105.99 ?  335 PHE A O   1 
ATOM 2061 C CB  . PHE A 1 269 ? 153.321 125.648 162.413 1.00 106.74 ?  335 PHE A CB  1 
ATOM 2062 C CG  . PHE A 1 269 ? 153.109 125.026 161.087 1.00 119.24 ?  335 PHE A CG  1 
ATOM 2063 C CD1 . PHE A 1 269 ? 152.558 123.773 160.975 1.00 129.41 ?  335 PHE A CD1 1 
ATOM 2064 C CD2 . PHE A 1 269 ? 153.532 125.673 159.948 1.00 122.61 ?  335 PHE A CD2 1 
ATOM 2065 C CE1 . PHE A 1 269 ? 152.390 123.200 159.743 1.00 130.36 ?  335 PHE A CE1 1 
ATOM 2066 C CE2 . PHE A 1 269 ? 153.362 125.109 158.718 1.00 126.15 ?  335 PHE A CE2 1 
ATOM 2067 C CZ  . PHE A 1 269 ? 152.794 123.870 158.613 1.00 126.93 ?  335 PHE A CZ  1 
ATOM 2068 N N   . ASP A 1 270 ? 154.025 126.942 164.630 1.00 113.39 ?  336 ASP A N   1 
ATOM 2069 C CA  . ASP A 1 270 ? 154.217 127.837 165.743 1.00 106.19 ?  336 ASP A CA  1 
ATOM 2070 C C   . ASP A 1 270 ? 154.330 127.005 166.993 1.00 90.37  ?  336 ASP A C   1 
ATOM 2071 O O   . ASP A 1 270 ? 155.227 126.183 167.126 1.00 85.22  ?  336 ASP A O   1 
ATOM 2072 C CB  . ASP A 1 270 ? 153.044 128.795 165.833 1.00 116.14 ?  336 ASP A CB  1 
ATOM 2073 C CG  . ASP A 1 270 ? 153.018 129.775 164.684 1.00 145.92 ?  336 ASP A CG  1 
ATOM 2074 O OD1 . ASP A 1 270 ? 154.087 129.976 164.073 1.00 138.73 ?  336 ASP A OD1 1 
ATOM 2075 O OD2 . ASP A 1 270 ? 151.942 130.341 164.388 1.00 146.87 ?  336 ASP A OD2 1 
ATOM 2076 N N   . TYR A 1 271 ? 153.408 127.240 167.912 1.00 81.33  ?  337 TYR A N   1 
ATOM 2077 C CA  . TYR A 1 271 ? 153.119 126.302 168.978 1.00 83.35  ?  337 TYR A CA  1 
ATOM 2078 C C   . TYR A 1 271 ? 151.624 126.315 169.156 1.00 75.78  ?  337 TYR A C   1 
ATOM 2079 O O   . TYR A 1 271 ? 151.072 125.673 170.046 1.00 73.34  ?  337 TYR A O   1 
ATOM 2080 C CB  . TYR A 1 271 ? 153.871 126.649 170.255 1.00 105.86 ?  337 TYR A CB  1 
ATOM 2081 C CG  . TYR A 1 271 ? 155.337 126.344 170.115 1.00 199.80 ?  337 TYR A CG  1 
ATOM 2082 C CD1 . TYR A 1 271 ? 155.816 125.075 170.376 1.00 192.79 ?  337 TYR A CD1 1 
ATOM 2083 C CD2 . TYR A 1 271 ? 156.236 127.306 169.687 1.00 197.82 ?  337 TYR A CD2 1 
ATOM 2084 C CE1 . TYR A 1 271 ? 157.146 124.773 170.236 1.00 177.11 ?  337 TYR A CE1 1 
ATOM 2085 C CE2 . TYR A 1 271 ? 157.574 127.010 169.537 1.00 190.09 ?  337 TYR A CE2 1 
ATOM 2086 C CZ  . TYR A 1 271 ? 158.021 125.739 169.813 1.00 170.69 ?  337 TYR A CZ  1 
ATOM 2087 O OH  . TYR A 1 271 ? 159.350 125.433 169.672 1.00 156.01 ?  337 TYR A OH  1 
ATOM 2088 N N   . ILE A 1 272 ? 150.996 127.058 168.250 1.00 89.47  ?  338 ILE A N   1 
ATOM 2089 C CA  . ILE A 1 272 ? 149.573 127.006 167.946 1.00 94.62  ?  338 ILE A CA  1 
ATOM 2090 C C   . ILE A 1 272 ? 148.696 126.753 169.178 1.00 96.56  ?  338 ILE A C   1 
ATOM 2091 O O   . ILE A 1 272 ? 148.793 127.506 170.142 1.00 92.78  ?  338 ILE A O   1 
ATOM 2092 C CB  . ILE A 1 272 ? 149.338 125.971 166.815 1.00 91.37  ?  338 ILE A CB  1 
ATOM 2093 C CG1 . ILE A 1 272 ? 147.913 126.037 166.268 1.00 103.71 ?  338 ILE A CG1 1 
ATOM 2094 C CG2 . ILE A 1 272 ? 149.795 124.590 167.214 1.00 87.43  ?  338 ILE A CG2 1 
ATOM 2095 C CD1 . ILE A 1 272 ? 147.620 127.320 165.587 1.00 110.74 ?  338 ILE A CD1 1 
ATOM 2096 N N   . GLY A 1 273 ? 147.888 125.697 169.186 1.00 106.54 ?  339 GLY A N   1 
ATOM 2097 C CA  . GLY A 1 273 ? 146.798 125.577 170.131 1.00 118.90 ?  339 GLY A CA  1 
ATOM 2098 C C   . GLY A 1 273 ? 147.271 125.564 171.563 1.00 130.16 ?  339 GLY A C   1 
ATOM 2099 O O   . GLY A 1 273 ? 146.547 125.974 172.475 1.00 129.63 ?  339 GLY A O   1 
ATOM 2100 N N   . SER A 1 274 ? 148.503 125.116 171.754 1.00 128.42 ?  340 SER A N   1 
ATOM 2101 C CA  . SER A 1 274 ? 149.082 125.081 173.075 1.00 141.98 ?  340 SER A CA  1 
ATOM 2102 C C   . SER A 1 274 ? 149.007 126.463 173.693 1.00 150.19 ?  340 SER A C   1 
ATOM 2103 O O   . SER A 1 274 ? 148.466 126.638 174.786 1.00 153.73 ?  340 SER A O   1 
ATOM 2104 C CB  . SER A 1 274 ? 150.527 124.612 172.999 1.00 144.58 ?  340 SER A CB  1 
ATOM 2105 O OG  . SER A 1 274 ? 151.292 125.513 172.221 1.00 142.09 ?  340 SER A OG  1 
ATOM 2106 N N   . SER A 1 275 ? 149.493 127.449 172.951 1.00 131.48 ?  341 SER A N   1 
ATOM 2107 C CA  . SER A 1 275 ? 149.488 128.819 173.422 1.00 128.26 ?  341 SER A CA  1 
ATOM 2108 C C   . SER A 1 275 ? 148.067 129.274 173.616 1.00 153.25 ?  341 SER A C   1 
ATOM 2109 O O   . SER A 1 275 ? 147.765 130.022 174.540 1.00 159.27 ?  341 SER A O   1 
ATOM 2110 C CB  . SER A 1 275 ? 150.190 129.734 172.434 1.00 107.68 ?  341 SER A CB  1 
ATOM 2111 O OG  . SER A 1 275 ? 149.462 129.777 171.224 1.00 103.32 ?  341 SER A OG  1 
ATOM 2112 N N   . ARG A 1 276 ? 147.182 128.799 172.754 1.00 152.71 ?  342 ARG A N   1 
ATOM 2113 C CA  . ARG A 1 276 ? 145.801 129.179 172.902 1.00 159.86 ?  342 ARG A CA  1 
ATOM 2114 C C   . ARG A 1 276 ? 145.311 128.689 174.247 1.00 160.44 ?  342 ARG A C   1 
ATOM 2115 O O   . ARG A 1 276 ? 144.661 129.438 174.973 1.00 160.73 ?  342 ARG A O   1 
ATOM 2116 C CB  . ARG A 1 276 ? 144.947 128.629 171.764 1.00 157.55 ?  342 ARG A CB  1 
ATOM 2117 C CG  . ARG A 1 276 ? 143.468 128.889 171.942 1.00 178.36 ?  342 ARG A CG  1 
ATOM 2118 C CD  . ARG A 1 276 ? 143.205 130.339 172.279 1.00 179.56 ?  342 ARG A CD  1 
ATOM 2119 N NE  . ARG A 1 276 ? 143.666 131.271 171.260 1.00 184.12 ?  342 ARG A NE  1 
ATOM 2120 C CZ  . ARG A 1 276 ? 142.911 131.692 170.254 1.00 190.84 ?  342 ARG A CZ  1 
ATOM 2121 N NH1 . ARG A 1 276 ? 141.661 131.268 170.146 1.00 189.06 ?  342 ARG A NH1 1 
ATOM 2122 N NH2 . ARG A 1 276 ? 143.393 132.548 169.370 1.00 197.47 ?  342 ARG A NH2 1 
ATOM 2123 N N   . MET A 1 277 ? 145.678 127.472 174.629 1.00 171.95 ?  343 MET A N   1 
ATOM 2124 C CA  . MET A 1 277 ? 145.251 127.006 175.939 1.00 173.87 ?  343 MET A CA  1 
ATOM 2125 C C   . MET A 1 277 ? 145.912 127.806 177.036 1.00 177.08 ?  343 MET A C   1 
ATOM 2126 O O   . MET A 1 277 ? 145.299 128.068 178.076 1.00 181.24 ?  343 MET A O   1 
ATOM 2127 C CB  . MET A 1 277 ? 145.537 125.529 176.133 1.00 169.53 ?  343 MET A CB  1 
ATOM 2128 C CG  . MET A 1 277 ? 144.671 124.657 175.274 1.00 168.44 ?  343 MET A CG  1 
ATOM 2129 S SD  . MET A 1 277 ? 144.894 122.931 175.689 1.00 262.18 ?  343 MET A SD  1 
ATOM 2130 C CE  . MET A 1 277 ? 144.057 122.897 177.267 1.00 118.67 ?  343 MET A CE  1 
ATOM 2131 N N   . VAL A 1 278 ? 147.143 128.234 176.777 1.00 181.74 ?  344 VAL A N   1 
ATOM 2132 C CA  . VAL A 1 278 ? 147.836 129.085 177.718 1.00 171.83 ?  344 VAL A CA  1 
ATOM 2133 C C   . VAL A 1 278 ? 146.916 130.252 177.941 1.00 172.68 ?  344 VAL A C   1 
ATOM 2134 O O   . VAL A 1 278 ? 146.518 130.567 179.061 1.00 167.39 ?  344 VAL A O   1 
ATOM 2135 C CB  . VAL A 1 278 ? 149.188 129.571 177.175 1.00 175.44 ?  344 VAL A CB  1 
ATOM 2136 C CG1 . VAL A 1 278 ? 149.829 130.553 178.134 1.00 171.49 ?  344 VAL A CG1 1 
ATOM 2137 C CG2 . VAL A 1 278 ? 150.104 128.403 176.902 1.00 172.48 ?  344 VAL A CG2 1 
ATOM 2138 N N   . TYR A 1 279 ? 146.494 130.813 176.823 1.00 175.29 ?  345 TYR A N   1 
ATOM 2139 C CA  . TYR A 1 279 ? 145.685 131.996 176.840 1.00 171.87 ?  345 TYR A CA  1 
ATOM 2140 C C   . TYR A 1 279 ? 144.364 131.725 177.526 1.00 179.63 ?  345 TYR A C   1 
ATOM 2141 O O   . TYR A 1 279 ? 143.864 132.572 178.264 1.00 184.03 ?  345 TYR A O   1 
ATOM 2142 C CB  . TYR A 1 279 ? 145.475 132.462 175.419 1.00 156.54 ?  345 TYR A CB  1 
ATOM 2143 C CG  . TYR A 1 279 ? 144.639 133.684 175.284 1.00 145.50 ?  345 TYR A CG  1 
ATOM 2144 C CD1 . TYR A 1 279 ? 145.172 134.938 175.523 1.00 140.24 ?  345 TYR A CD1 1 
ATOM 2145 C CD2 . TYR A 1 279 ? 143.320 133.591 174.891 1.00 143.57 ?  345 TYR A CD2 1 
ATOM 2146 C CE1 . TYR A 1 279 ? 144.406 136.070 175.378 1.00 140.10 ?  345 TYR A CE1 1 
ATOM 2147 C CE2 . TYR A 1 279 ? 142.546 134.709 174.745 1.00 144.14 ?  345 TYR A CE2 1 
ATOM 2148 C CZ  . TYR A 1 279 ? 143.089 135.948 174.988 1.00 144.91 ?  345 TYR A CZ  1 
ATOM 2149 O OH  . TYR A 1 279 ? 142.299 137.062 174.834 1.00 147.33 ?  345 TYR A OH  1 
ATOM 2150 N N   . ASP A 1 280 ? 143.837 130.517 177.348 1.00 165.00 ?  346 ASP A N   1 
ATOM 2151 C CA  . ASP A 1 280 ? 142.559 130.181 177.960 1.00 170.38 ?  346 ASP A CA  1 
ATOM 2152 C C   . ASP A 1 280 ? 142.647 130.268 179.459 1.00 222.00 ?  346 ASP A C   1 
ATOM 2153 O O   . ASP A 1 280 ? 141.687 130.646 180.124 1.00 225.56 ?  346 ASP A O   1 
ATOM 2154 C CB  . ASP A 1 280 ? 142.090 128.780 177.565 1.00 160.99 ?  346 ASP A CB  1 
ATOM 2155 C CG  . ASP A 1 280 ? 141.434 128.746 176.207 1.00 146.80 ?  346 ASP A CG  1 
ATOM 2156 O OD1 . ASP A 1 280 ? 141.042 129.820 175.707 1.00 144.66 ?  346 ASP A OD1 1 
ATOM 2157 O OD2 . ASP A 1 280 ? 141.297 127.643 175.645 1.00 137.61 ?  346 ASP A OD2 1 
ATOM 2158 N N   . MET A 1 281 ? 143.802 129.914 179.998 1.00 216.21 ?  347 MET A N   1 
ATOM 2159 C CA  . MET A 1 281 ? 143.954 130.026 181.427 1.00 207.59 ?  347 MET A CA  1 
ATOM 2160 C C   . MET A 1 281 ? 144.649 131.329 181.759 1.00 201.13 ?  347 MET A C   1 
ATOM 2161 O O   . MET A 1 281 ? 144.584 131.796 182.895 1.00 209.10 ?  347 MET A O   1 
ATOM 2162 C CB  . MET A 1 281 ? 144.713 128.828 181.988 1.00 163.91 ?  347 MET A CB  1 
ATOM 2163 C CG  . MET A 1 281 ? 146.147 128.727 181.547 1.00 131.40 ?  347 MET A CG  1 
ATOM 2164 S SD  . MET A 1 281 ? 146.845 127.118 181.952 1.00 108.94 ?  347 MET A SD  1 
ATOM 2165 C CE  . MET A 1 281 ? 146.357 126.186 180.508 1.00 86.88  ?  347 MET A CE  1 
ATOM 2166 N N   . GLU A 1 282 ? 145.303 131.925 180.766 1.00 178.90 ?  348 GLU A N   1 
ATOM 2167 C CA  . GLU A 1 282 ? 146.003 133.176 181.012 1.00 156.98 ?  348 GLU A CA  1 
ATOM 2168 C C   . GLU A 1 282 ? 144.975 134.235 181.360 1.00 154.53 ?  348 GLU A C   1 
ATOM 2169 O O   . GLU A 1 282 ? 145.224 135.118 182.176 1.00 165.93 ?  348 GLU A O   1 
ATOM 2170 C CB  . GLU A 1 282 ? 146.836 133.588 179.800 1.00 138.14 ?  348 GLU A CB  1 
ATOM 2171 C CG  . GLU A 1 282 ? 147.724 134.802 180.013 1.00 127.20 ?  348 GLU A CG  1 
ATOM 2172 C CD  . GLU A 1 282 ? 146.970 136.107 179.893 1.00 111.81 ?  348 GLU A CD  1 
ATOM 2173 O OE1 . GLU A 1 282 ? 145.915 136.119 179.226 1.00 108.37 ?  348 GLU A OE1 1 
ATOM 2174 O OE2 . GLU A 1 282 ? 147.427 137.116 180.467 1.00 111.16 ?  348 GLU A OE2 1 
ATOM 2175 N N   . LYS A 1 283 ? 143.810 134.131 180.738 1.00 155.68 ?  349 LYS A N   1 
ATOM 2176 C CA  . LYS A 1 283 ? 142.675 134.945 181.124 1.00 150.52 ?  349 LYS A CA  1 
ATOM 2177 C C   . LYS A 1 283 ? 141.709 134.134 181.956 1.00 151.01 ?  349 LYS A C   1 
ATOM 2178 O O   . LYS A 1 283 ? 140.721 134.659 182.461 1.00 151.86 ?  349 LYS A O   1 
ATOM 2179 C CB  . LYS A 1 283 ? 141.974 135.520 179.902 1.00 148.97 ?  349 LYS A CB  1 
ATOM 2180 C CG  . LYS A 1 283 ? 142.756 136.629 179.252 1.00 151.94 ?  349 LYS A CG  1 
ATOM 2181 C CD  . LYS A 1 283 ? 142.010 137.214 178.081 1.00 149.36 ?  349 LYS A CD  1 
ATOM 2182 C CE  . LYS A 1 283 ? 142.772 138.384 177.487 1.00 142.50 ?  349 LYS A CE  1 
ATOM 2183 N NZ  . LYS A 1 283 ? 142.885 139.526 178.428 1.00 137.96 ?  349 LYS A NZ  1 
ATOM 2184 N N   . GLY A 1 284 ? 142.000 132.847 182.097 1.00 153.13 ?  350 GLY A N   1 
ATOM 2185 C CA  . GLY A 1 284 ? 141.172 131.986 182.913 1.00 149.43 ?  350 GLY A CA  1 
ATOM 2186 C C   . GLY A 1 284 ? 139.817 131.809 182.267 1.00 152.58 ?  350 GLY A C   1 
ATOM 2187 O O   . GLY A 1 284 ? 138.819 131.579 182.944 1.00 159.13 ?  350 GLY A O   1 
ATOM 2188 N N   . LYS A 1 285 ? 139.782 131.931 180.947 1.00 30.00  ?  351 LYS A N   1 
ATOM 2189 C CA  . LYS A 1 285 ? 138.535 131.824 180.209 1.00 30.00  ?  351 LYS A CA  1 
ATOM 2190 C C   . LYS A 1 285 ? 137.939 130.422 180.289 1.00 30.00  ?  351 LYS A C   1 
ATOM 2191 O O   . LYS A 1 285 ? 136.746 130.239 180.065 1.00 30.00  ?  351 LYS A O   1 
ATOM 2192 C CB  . LYS A 1 285 ? 138.751 132.220 178.762 1.00 30.00  ?  351 LYS A CB  1 
ATOM 2193 N N   . PHE A 1 286 ? 138.770 129.433 180.603 1.00 30.00  ?  352 PHE A N   1 
ATOM 2194 C CA  . PHE A 1 286 ? 138.352 128.037 180.547 1.00 30.00  ?  352 PHE A CA  1 
ATOM 2195 C C   . PHE A 1 286 ? 138.714 127.290 181.828 1.00 30.00  ?  352 PHE A C   1 
ATOM 2196 O O   . PHE A 1 286 ? 139.649 127.680 182.526 1.00 30.00  ?  352 PHE A O   1 
ATOM 2197 C CB  . PHE A 1 286 ? 138.979 127.359 179.336 1.00 30.00  ?  352 PHE A CB  1 
ATOM 2198 N N   . PRO A 1 287 ? 137.982 126.207 182.147 1.00 30.00  ?  353 PRO A N   1 
ATOM 2199 C CA  . PRO A 1 287 ? 138.286 125.446 183.367 1.00 30.00  ?  353 PRO A CA  1 
ATOM 2200 C C   . PRO A 1 287 ? 139.598 124.685 183.257 1.00 30.00  ?  353 PRO A C   1 
ATOM 2201 O O   . PRO A 1 287 ? 139.683 123.513 183.613 1.00 30.00  ?  353 PRO A O   1 
ATOM 2202 C CB  . PRO A 1 287 ? 137.108 124.479 183.479 1.00 20.00  ?  353 PRO A CB  1 
ATOM 2203 C CG  . PRO A 1 287 ? 136.647 124.300 182.077 1.00 20.00  ?  353 PRO A CG  1 
ATOM 2204 C CD  . PRO A 1 287 ? 136.830 125.641 181.425 1.00 20.00  ?  353 PRO A CD  1 
ATOM 2205 N N   . VAL A 1 288 ? 140.616 125.384 182.774 1.00 30.00  ?  354 VAL A N   1 
ATOM 2206 C CA  . VAL A 1 288 ? 141.913 124.811 182.487 1.00 30.00  ?  354 VAL A CA  1 
ATOM 2207 C C   . VAL A 1 288 ? 142.893 125.633 183.312 1.00 30.00  ?  354 VAL A C   1 
ATOM 2208 O O   . VAL A 1 288 ? 144.022 125.898 182.908 1.00 30.00  ?  354 VAL A O   1 
ATOM 2209 C CB  . VAL A 1 288 ? 142.236 124.903 180.989 1.00 20.00  ?  354 VAL A CB  1 
ATOM 2210 C CG1 . VAL A 1 288 ? 143.449 124.051 180.631 1.00 20.00  ?  354 VAL A CG1 1 
ATOM 2211 C CG2 . VAL A 1 288 ? 141.014 124.552 180.153 1.00 20.00  ?  354 VAL A CG2 1 
ATOM 2212 N N   . GLN A 1 289 ? 142.422 126.038 184.484 1.00 30.00  ?  355 GLN A N   1 
ATOM 2213 C CA  . GLN A 1 289 ? 142.998 127.152 185.218 1.00 30.00  ?  355 GLN A CA  1 
ATOM 2214 C C   . GLN A 1 289 ? 144.455 126.920 185.595 1.00 30.00  ?  355 GLN A C   1 
ATOM 2215 O O   . GLN A 1 289 ? 144.817 125.877 186.133 1.00 30.00  ?  355 GLN A O   1 
ATOM 2216 C CB  . GLN A 1 289 ? 142.149 127.394 186.462 1.00 20.00  ?  355 GLN A CB  1 
ATOM 2217 C CG  . GLN A 1 289 ? 140.692 127.689 186.121 1.00 20.00  ?  355 GLN A CG  1 
ATOM 2218 C CD  . GLN A 1 289 ? 139.777 127.693 187.333 1.00 20.00  ?  355 GLN A CD  1 
ATOM 2219 O OE1 . GLN A 1 289 ? 140.102 127.121 188.374 1.00 20.00  ?  355 GLN A OE1 1 
ATOM 2220 N NE2 . GLN A 1 289 ? 138.608 128.302 187.187 1.00 20.00  ?  355 GLN A NE2 1 
ATOM 2221 N N   . LEU A 1 290 ? 145.280 127.924 185.321 1.00 30.00  ?  356 LEU A N   1 
ATOM 2222 C CA  . LEU A 1 290 ? 146.720 127.824 185.510 1.00 30.00  ?  356 LEU A CA  1 
ATOM 2223 C C   . LEU A 1 290 ? 147.108 127.820 186.975 1.00 30.00  ?  356 LEU A C   1 
ATOM 2224 O O   . LEU A 1 290 ? 148.175 127.335 187.348 1.00 30.00  ?  356 LEU A O   1 
ATOM 2225 C CB  . LEU A 1 290 ? 147.416 128.973 184.793 1.00 20.00  ?  356 LEU A CB  1 
ATOM 2226 C CG  . LEU A 1 290 ? 148.933 129.034 184.867 1.00 20.00  ?  356 LEU A CG  1 
ATOM 2227 C CD1 . LEU A 1 290 ? 149.517 127.779 184.274 1.00 20.00  ?  356 LEU A CD1 1 
ATOM 2228 C CD2 . LEU A 1 290 ? 149.418 130.249 184.110 1.00 20.00  ?  356 LEU A CD2 1 
ATOM 2229 N N   . GLU A 1 291 ? 146.230 128.367 187.803 1.00 219.22 ?  357 GLU A N   1 
ATOM 2230 C CA  . GLU A 1 291 ? 146.474 128.428 189.233 1.00 220.85 ?  357 GLU A CA  1 
ATOM 2231 C C   . GLU A 1 291 ? 146.525 127.025 189.789 1.00 231.22 ?  357 GLU A C   1 
ATOM 2232 O O   . GLU A 1 291 ? 147.172 126.768 190.799 1.00 231.29 ?  357 GLU A O   1 
ATOM 2233 C CB  . GLU A 1 291 ? 145.395 129.237 189.942 1.00 20.00  ?  357 GLU A CB  1 
ATOM 2234 C CG  . GLU A 1 291 ? 145.381 130.703 189.571 1.00 20.00  ?  357 GLU A CG  1 
ATOM 2235 C CD  . GLU A 1 291 ? 144.286 131.466 190.281 1.00 20.00  ?  357 GLU A CD  1 
ATOM 2236 O OE1 . GLU A 1 291 ? 143.438 130.821 190.932 1.00 20.00  ?  357 GLU A OE1 1 
ATOM 2237 O OE2 . GLU A 1 291 ? 144.274 132.710 190.192 1.00 20.00  ?  357 GLU A OE2 1 
ATOM 2238 N N   . ASN A 1 292 ? 145.836 126.115 189.116 1.00 226.83 ?  358 ASN A N   1 
ATOM 2239 C CA  . ASN A 1 292 ? 145.912 124.713 189.464 1.00 224.64 ?  358 ASN A CA  1 
ATOM 2240 C C   . ASN A 1 292 ? 147.228 124.158 188.970 1.00 214.08 ?  358 ASN A C   1 
ATOM 2241 O O   . ASN A 1 292 ? 148.205 124.900 188.864 1.00 207.06 ?  358 ASN A O   1 
ATOM 2242 C CB  . ASN A 1 292 ? 144.741 123.949 188.866 1.00 20.00  ?  358 ASN A CB  1 
ATOM 2243 C CG  . ASN A 1 292 ? 143.427 124.329 189.501 1.00 20.00  ?  358 ASN A CG  1 
ATOM 2244 O OD1 . ASN A 1 292 ? 143.394 124.823 190.627 1.00 20.00  ?  358 ASN A OD1 1 
ATOM 2245 N ND2 . ASN A 1 292 ? 142.333 124.106 188.784 1.00 20.00  ?  358 ASN A ND2 1 
ATOM 2246 N N   . VAL A 1 293 ? 147.252 122.859 188.684 1.00 189.68 ?  359 VAL A N   1 
ATOM 2247 C CA  . VAL A 1 293 ? 148.397 122.235 188.034 1.00 184.70 ?  359 VAL A CA  1 
ATOM 2248 C C   . VAL A 1 293 ? 149.632 122.151 188.928 1.00 203.46 ?  359 VAL A C   1 
ATOM 2249 O O   . VAL A 1 293 ? 149.937 123.081 189.668 1.00 205.57 ?  359 VAL A O   1 
ATOM 2250 C CB  . VAL A 1 293 ? 148.748 122.996 186.751 1.00 20.00  ?  359 VAL A CB  1 
ATOM 2251 C CG1 . VAL A 1 293 ? 150.046 122.523 186.189 1.00 20.00  ?  359 VAL A CG1 1 
ATOM 2252 C CG2 . VAL A 1 293 ? 147.622 122.863 185.748 1.00 20.00  ?  359 VAL A CG2 1 
ATOM 2253 N N   . ASP A 1 294 ? 150.340 121.028 188.865 1.00 219.59 ?  360 ASP A N   1 
ATOM 2254 C CA  . ASP A 1 294 ? 151.552 120.867 189.657 1.00 220.02 ?  360 ASP A CA  1 
ATOM 2255 C C   . ASP A 1 294 ? 152.765 120.557 188.799 1.00 203.55 ?  360 ASP A C   1 
ATOM 2256 O O   . ASP A 1 294 ? 153.750 121.291 188.815 1.00 204.36 ?  360 ASP A O   1 
ATOM 2257 C CB  . ASP A 1 294 ? 151.366 119.765 190.698 1.00 197.69 ?  360 ASP A CB  1 
ATOM 2258 C CG  . ASP A 1 294 ? 150.413 120.166 191.802 1.00 191.81 ?  360 ASP A CG  1 
ATOM 2259 O OD1 . ASP A 1 294 ? 150.124 121.373 191.919 1.00 189.55 ?  360 ASP A OD1 1 
ATOM 2260 O OD2 . ASP A 1 294 ? 149.959 119.280 192.556 1.00 190.47 ?  360 ASP A OD2 1 
ATOM 2261 N N   . SER A 1 295 ? 152.687 119.471 188.044 1.00 196.26 ?  361 SER A N   1 
ATOM 2262 C CA  . SER A 1 295 ? 153.836 118.994 187.296 1.00 200.81 ?  361 SER A CA  1 
ATOM 2263 C C   . SER A 1 295 ? 153.390 118.372 185.994 1.00 210.26 ?  361 SER A C   1 
ATOM 2264 O O   . SER A 1 295 ? 152.206 118.109 185.807 1.00 213.00 ?  361 SER A O   1 
ATOM 2265 C CB  . SER A 1 295 ? 154.629 117.985 188.115 1.00 20.00  ?  361 SER A CB  1 
ATOM 2266 O OG  . SER A 1 295 ? 153.839 116.842 188.382 1.00 20.00  ?  361 SER A OG  1 
ATOM 2267 N N   . PHE A 1 296 ? 154.340 118.137 185.097 1.00 203.23 ?  362 PHE A N   1 
ATOM 2268 C CA  . PHE A 1 296 ? 154.009 117.769 183.732 1.00 200.96 ?  362 PHE A CA  1 
ATOM 2269 C C   . PHE A 1 296 ? 154.655 116.519 183.201 1.00 190.29 ?  362 PHE A C   1 
ATOM 2270 O O   . PHE A 1 296 ? 155.524 115.924 183.824 1.00 191.04 ?  362 PHE A O   1 
ATOM 2271 C CB  . PHE A 1 296 ? 154.357 118.915 182.805 1.00 20.00  ?  362 PHE A CB  1 
ATOM 2272 C CG  . PHE A 1 296 ? 153.462 120.085 182.961 1.00 20.00  ?  362 PHE A CG  1 
ATOM 2273 C CD1 . PHE A 1 296 ? 152.222 119.938 183.539 1.00 20.00  ?  362 PHE A CD1 1 
ATOM 2274 C CD2 . PHE A 1 296 ? 153.849 121.329 182.542 1.00 20.00  ?  362 PHE A CD2 1 
ATOM 2275 C CE1 . PHE A 1 296 ? 151.384 120.994 183.676 1.00 20.00  ?  362 PHE A CE1 1 
ATOM 2276 C CE2 . PHE A 1 296 ? 153.013 122.406 182.683 1.00 20.00  ?  362 PHE A CE2 1 
ATOM 2277 C CZ  . PHE A 1 296 ? 151.777 122.240 183.256 1.00 20.00  ?  362 PHE A CZ  1 
ATOM 2278 N N   . VAL A 1 297 ? 154.205 116.145 182.015 1.00 181.94 ?  363 VAL A N   1 
ATOM 2279 C CA  . VAL A 1 297 ? 154.674 114.967 181.322 1.00 156.52 ?  363 VAL A CA  1 
ATOM 2280 C C   . VAL A 1 297 ? 154.828 115.368 179.874 1.00 141.89 ?  363 VAL A C   1 
ATOM 2281 O O   . VAL A 1 297 ? 154.195 116.314 179.425 1.00 142.55 ?  363 VAL A O   1 
ATOM 2282 C CB  . VAL A 1 297 ? 153.688 113.794 181.455 1.00 20.00  ?  363 VAL A CB  1 
ATOM 2283 C CG1 . VAL A 1 297 ? 154.178 112.580 180.687 1.00 20.00  ?  363 VAL A CG1 1 
ATOM 2284 C CG2 . VAL A 1 297 ? 153.465 113.447 182.914 1.00 20.00  ?  363 VAL A CG2 1 
ATOM 2285 N N   . GLU A 1 298 ? 155.684 114.674 179.145 1.00 151.32 ?  364 GLU A N   1 
ATOM 2286 C CA  . GLU A 1 298 ? 155.839 114.960 177.739 1.00 140.08 ?  364 GLU A CA  1 
ATOM 2287 C C   . GLU A 1 298 ? 156.427 113.805 176.954 1.00 138.13 ?  364 GLU A C   1 
ATOM 2288 O O   . GLU A 1 298 ? 157.276 113.077 177.454 1.00 141.11 ?  364 GLU A O   1 
ATOM 2289 C CB  . GLU A 1 298 ? 156.711 116.197 177.571 1.00 20.00  ?  364 GLU A CB  1 
ATOM 2290 C CG  . GLU A 1 298 ? 157.011 116.537 176.136 1.00 20.00  ?  364 GLU A CG  1 
ATOM 2291 C CD  . GLU A 1 298 ? 155.770 116.857 175.344 1.00 20.00  ?  364 GLU A CD  1 
ATOM 2292 O OE1 . GLU A 1 298 ? 154.713 117.109 175.955 1.00 20.00  ?  364 GLU A OE1 1 
ATOM 2293 O OE2 . GLU A 1 298 ? 155.850 116.846 174.101 1.00 20.00  ?  364 GLU A OE2 1 
ATOM 2294 N N   . LEU A 1 299 ? 155.985 113.650 175.712 1.00 129.77 ?  365 LEU A N   1 
ATOM 2295 C CA  . LEU A 1 299 ? 156.576 112.659 174.831 1.00 126.95 ?  365 LEU A CA  1 
ATOM 2296 C C   . LEU A 1 299 ? 157.177 113.300 173.595 1.00 137.46 ?  365 LEU A C   1 
ATOM 2297 O O   . LEU A 1 299 ? 156.740 114.360 173.164 1.00 141.32 ?  365 LEU A O   1 
ATOM 2298 C CB  . LEU A 1 299 ? 155.534 111.639 174.427 1.00 20.00  ?  365 LEU A CB  1 
ATOM 2299 C CG  . LEU A 1 299 ? 155.005 110.948 175.672 1.00 20.00  ?  365 LEU A CG  1 
ATOM 2300 C CD1 . LEU A 1 299 ? 153.915 109.966 175.323 1.00 20.00  ?  365 LEU A CD1 1 
ATOM 2301 C CD2 . LEU A 1 299 ? 156.149 110.270 176.373 1.00 20.00  ?  365 LEU A CD2 1 
ATOM 2302 N N   . GLY A 1 300 ? 158.188 112.657 173.026 1.00 143.77 ?  366 GLY A N   1 
ATOM 2303 C CA  . GLY A 1 300 ? 158.771 113.152 171.796 1.00 146.49 ?  366 GLY A CA  1 
ATOM 2304 C C   . GLY A 1 300 ? 159.677 112.136 171.144 1.00 155.34 ?  366 GLY A C   1 
ATOM 2305 O O   . GLY A 1 300 ? 160.648 111.690 171.748 1.00 160.11 ?  366 GLY A O   1 
ATOM 2306 N N   . GLN A 1 301 ? 159.340 111.759 169.916 1.00 163.64 ?  367 GLN A N   1 
ATOM 2307 C CA  . GLN A 1 301 ? 160.161 110.859 169.113 1.00 173.22 ?  367 GLN A CA  1 
ATOM 2308 C C   . GLN A 1 301 ? 160.445 109.551 169.831 1.00 156.43 ?  367 GLN A C   1 
ATOM 2309 O O   . GLN A 1 301 ? 161.438 108.880 169.559 1.00 158.63 ?  367 GLN A O   1 
ATOM 2310 C CB  . GLN A 1 301 ? 161.474 111.538 168.746 1.00 20.00  ?  367 GLN A CB  1 
ATOM 2311 C CG  . GLN A 1 301 ? 161.294 112.793 167.934 1.00 20.00  ?  367 GLN A CG  1 
ATOM 2312 C CD  . GLN A 1 301 ? 160.667 112.523 166.591 1.00 20.00  ?  367 GLN A CD  1 
ATOM 2313 O OE1 . GLN A 1 301 ? 159.467 112.697 166.414 1.00 20.00  ?  367 GLN A OE1 1 
ATOM 2314 N NE2 . GLN A 1 301 ? 161.479 112.105 165.630 1.00 20.00  ?  367 GLN A NE2 1 
ATOM 2315 N N   . VAL A 1 302 ? 159.558 109.190 170.745 1.00 147.70 ?  368 VAL A N   1 
ATOM 2316 C CA  . VAL A 1 302 ? 159.743 108.006 171.554 1.00 132.94 ?  368 VAL A CA  1 
ATOM 2317 C C   . VAL A 1 302 ? 159.210 106.805 170.805 1.00 152.53 ?  368 VAL A C   1 
ATOM 2318 O O   . VAL A 1 302 ? 158.065 106.405 170.983 1.00 151.19 ?  368 VAL A O   1 
ATOM 2319 C CB  . VAL A 1 302 ? 159.035 108.140 172.898 1.00 20.00  ?  368 VAL A CB  1 
ATOM 2320 C CG1 . VAL A 1 302 ? 159.222 106.886 173.721 1.00 20.00  ?  368 VAL A CG1 1 
ATOM 2321 C CG2 . VAL A 1 302 ? 159.559 109.351 173.637 1.00 20.00  ?  368 VAL A CG2 1 
ATOM 2322 N N   . ALA A 1 303 ? 160.039 106.241 169.944 1.00 148.83 ?  369 ALA A N   1 
ATOM 2323 C CA  . ALA A 1 303 ? 159.614 105.118 169.133 1.00 169.23 ?  369 ALA A CA  1 
ATOM 2324 C C   . ALA A 1 303 ? 160.815 104.383 168.584 1.00 188.95 ?  369 ALA A C   1 
ATOM 2325 O O   . ALA A 1 303 ? 160.913 103.165 168.684 1.00 195.81 ?  369 ALA A O   1 
ATOM 2326 C CB  . ALA A 1 303 ? 158.720 105.589 168.006 1.00 20.00  ?  369 ALA A CB  1 
ATOM 2327 N N   . LEU A 1 304 ? 161.733 105.139 168.002 1.00 200.07 ?  370 LEU A N   1 
ATOM 2328 C CA  . LEU A 1 304 ? 162.919 104.557 167.411 1.00 198.04 ?  370 LEU A CA  1 
ATOM 2329 C C   . LEU A 1 304 ? 163.794 103.853 168.443 1.00 205.99 ?  370 LEU A C   1 
ATOM 2330 O O   . LEU A 1 304 ? 164.389 102.815 168.160 1.00 202.75 ?  370 LEU A O   1 
ATOM 2331 C CB  . LEU A 1 304 ? 163.713 105.645 166.698 1.00 20.00  ?  370 LEU A CB  1 
ATOM 2332 C CG  . LEU A 1 304 ? 165.067 105.243 166.131 1.00 20.00  ?  370 LEU A CG  1 
ATOM 2333 C CD1 . LEU A 1 304 ? 164.903 104.144 165.104 1.00 20.00  ?  370 LEU A CD1 1 
ATOM 2334 C CD2 . LEU A 1 304 ? 165.719 106.449 165.506 1.00 20.00  ?  370 LEU A CD2 1 
ATOM 2335 N N   . ARG A 1 305 ? 163.832 104.407 169.649 1.00 217.38 ?  371 ARG A N   1 
ATOM 2336 C CA  . ARG A 1 305 ? 164.702 103.934 170.726 1.00 213.29 ?  371 ARG A CA  1 
ATOM 2337 C C   . ARG A 1 305 ? 166.129 103.655 170.278 1.00 207.58 ?  371 ARG A C   1 
ATOM 2338 O O   . ARG A 1 305 ? 166.592 104.177 169.267 1.00 196.75 ?  371 ARG A O   1 
ATOM 2339 C CB  . ARG A 1 305 ? 164.126 102.691 171.385 1.00 20.00  ?  371 ARG A CB  1 
ATOM 2340 C CG  . ARG A 1 305 ? 162.852 102.965 172.123 1.00 20.00  ?  371 ARG A CG  1 
ATOM 2341 C CD  . ARG A 1 305 ? 162.419 101.758 172.903 1.00 20.00  ?  371 ARG A CD  1 
ATOM 2342 N NE  . ARG A 1 305 ? 161.143 101.996 173.559 1.00 20.00  ?  371 ARG A NE  1 
ATOM 2343 C CZ  . ARG A 1 305 ? 160.481 101.076 174.247 1.00 20.00  ?  371 ARG A CZ  1 
ATOM 2344 N NH1 . ARG A 1 305 ? 160.987 99.858  174.375 1.00 20.00  ?  371 ARG A NH1 1 
ATOM 2345 N NH2 . ARG A 1 305 ? 159.319 101.372 174.810 1.00 20.00  ?  371 ARG A NH2 1 
ATOM 2346 N N   . THR A 1 306 ? 166.825 102.833 171.051 1.00 204.33 ?  372 THR A N   1 
ATOM 2347 C CA  . THR A 1 306 ? 168.208 102.501 170.757 1.00 201.01 ?  372 THR A CA  1 
ATOM 2348 C C   . THR A 1 306 ? 168.607 101.246 171.509 1.00 202.74 ?  372 THR A C   1 
ATOM 2349 O O   . THR A 1 306 ? 169.719 101.154 172.026 1.00 203.14 ?  372 THR A O   1 
ATOM 2350 C CB  . THR A 1 306 ? 169.122 103.654 171.124 1.00 197.99 ?  372 THR A CB  1 
ATOM 2351 N N   . SER A 1 307 ? 167.678 100.295 171.580 1.00 199.21 ?  373 SER A N   1 
ATOM 2352 C CA  . SER A 1 307 ? 167.872 99.053  172.324 1.00 191.66 ?  373 SER A CA  1 
ATOM 2353 C C   . SER A 1 307 ? 168.294 99.373  173.745 1.00 181.71 ?  373 SER A C   1 
ATOM 2354 O O   . SER A 1 307 ? 169.031 98.623  174.378 1.00 175.31 ?  373 SER A O   1 
ATOM 2355 C CB  . SER A 1 307 ? 168.900 98.173  171.641 1.00 194.30 ?  373 SER A CB  1 
ATOM 2356 N N   . LEU A 1 308 ? 167.800 100.499 174.233 1.00 183.80 ?  374 LEU A N   1 
ATOM 2357 C CA  . LEU A 1 308 ? 168.248 101.084 175.478 1.00 193.45 ?  374 LEU A CA  1 
ATOM 2358 C C   . LEU A 1 308 ? 167.330 102.244 175.758 1.00 199.17 ?  374 LEU A C   1 
ATOM 2359 O O   . LEU A 1 308 ? 167.680 103.398 175.524 1.00 196.89 ?  374 LEU A O   1 
ATOM 2360 C CB  . LEU A 1 308 ? 169.682 101.542 175.380 1.00 199.39 ?  374 LEU A CB  1 
ATOM 2361 N N   . GLU A 1 309 ? 166.147 101.923 176.261 1.00 200.52 ?  375 GLU A N   1 
ATOM 2362 C CA  . GLU A 1 309 ? 165.030 102.853 176.237 1.00 201.13 ?  375 GLU A CA  1 
ATOM 2363 C C   . GLU A 1 309 ? 165.279 104.150 177.009 1.00 202.52 ?  375 GLU A C   1 
ATOM 2364 O O   . GLU A 1 309 ? 165.958 104.166 178.038 1.00 194.50 ?  375 GLU A O   1 
ATOM 2365 C CB  . GLU A 1 309 ? 163.783 102.162 176.765 1.00 195.41 ?  375 GLU A CB  1 
ATOM 2366 N N   . LEU A 1 310 ? 164.751 105.233 176.444 1.00 212.53 ?  376 LEU A N   1 
ATOM 2367 C CA  . LEU A 1 310 ? 164.555 106.515 177.119 1.00 216.23 ?  376 LEU A CA  1 
ATOM 2368 C C   . LEU A 1 310 ? 165.766 107.376 177.412 1.00 213.12 ?  376 LEU A C   1 
ATOM 2369 O O   . LEU A 1 310 ? 166.861 106.897 177.699 1.00 212.41 ?  376 LEU A O   1 
ATOM 2370 C CB  . LEU A 1 310 ? 163.831 106.299 178.441 1.00 227.23 ?  376 LEU A CB  1 
ATOM 2371 C CG  . LEU A 1 310 ? 162.314 106.342 178.364 1.00 232.12 ?  376 LEU A CG  1 
ATOM 2372 C CD1 . LEU A 1 310 ? 161.784 105.190 177.545 1.00 235.07 ?  376 LEU A CD1 1 
ATOM 2373 C CD2 . LEU A 1 310 ? 161.756 106.316 179.764 1.00 232.09 ?  376 LEU A CD2 1 
ATOM 2374 N N   . TRP A 1 311 ? 165.512 108.676 177.337 1.00 212.06 ?  377 TRP A N   1 
ATOM 2375 C CA  . TRP A 1 311 ? 166.402 109.702 177.837 1.00 213.31 ?  377 TRP A CA  1 
ATOM 2376 C C   . TRP A 1 311 ? 165.570 110.805 178.448 1.00 200.00 ?  377 TRP A C   1 
ATOM 2377 O O   . TRP A 1 311 ? 165.473 111.899 177.904 1.00 196.46 ?  377 TRP A O   1 
ATOM 2378 C CB  . TRP A 1 311 ? 167.301 110.243 176.734 1.00 219.15 ?  377 TRP A CB  1 
ATOM 2379 C CG  . TRP A 1 311 ? 168.388 109.307 176.411 1.00 225.11 ?  377 TRP A CG  1 
ATOM 2380 C CD1 . TRP A 1 311 ? 168.372 108.328 175.471 1.00 228.13 ?  377 TRP A CD1 1 
ATOM 2381 C CD2 . TRP A 1 311 ? 169.665 109.243 177.041 1.00 228.67 ?  377 TRP A CD2 1 
ATOM 2382 N NE1 . TRP A 1 311 ? 169.564 107.652 175.474 1.00 229.20 ?  377 TRP A NE1 1 
ATOM 2383 C CE2 . TRP A 1 311 ? 170.378 108.199 176.429 1.00 229.24 ?  377 TRP A CE2 1 
ATOM 2384 C CE3 . TRP A 1 311 ? 170.279 109.972 178.062 1.00 229.42 ?  377 TRP A CE3 1 
ATOM 2385 C CZ2 . TRP A 1 311 ? 171.674 107.862 176.805 1.00 227.68 ?  377 TRP A CZ2 1 
ATOM 2386 C CZ3 . TRP A 1 311 ? 171.561 109.636 178.437 1.00 229.76 ?  377 TRP A CZ3 1 
ATOM 2387 C CH2 . TRP A 1 311 ? 172.247 108.591 177.809 1.00 228.33 ?  377 TRP A CH2 1 
ATOM 2388 N N   . MET A 1 312 ? 164.956 110.499 179.581 1.00 184.53 ?  378 MET A N   1 
ATOM 2389 C CA  . MET A 1 312 ? 164.145 111.475 180.282 1.00 179.45 ?  378 MET A CA  1 
ATOM 2390 C C   . MET A 1 312 ? 165.002 112.631 180.744 1.00 181.08 ?  378 MET A C   1 
ATOM 2391 O O   . MET A 1 312 ? 166.136 112.434 181.171 1.00 191.14 ?  378 MET A O   1 
ATOM 2392 C CB  . MET A 1 312 ? 163.440 110.838 181.474 1.00 176.50 ?  378 MET A CB  1 
ATOM 2393 C CG  . MET A 1 312 ? 164.338 110.423 182.615 1.00 173.76 ?  378 MET A CG  1 
ATOM 2394 S SD  . MET A 1 312 ? 163.447 109.444 183.842 1.00 179.25 ?  378 MET A SD  1 
ATOM 2395 C CE  . MET A 1 312 ? 163.615 107.801 183.156 1.00 185.94 ?  378 MET A CE  1 
ATOM 2396 N N   . HIS A 1 313 ? 164.470 113.842 180.654 1.00 179.79 ?  379 HIS A N   1 
ATOM 2397 C CA  . HIS A 1 313 ? 165.230 114.999 181.093 1.00 175.35 ?  379 HIS A CA  1 
ATOM 2398 C C   . HIS A 1 313 ? 164.397 116.243 181.295 1.00 183.00 ?  379 HIS A C   1 
ATOM 2399 O O   . HIS A 1 313 ? 163.248 116.325 180.866 1.00 192.25 ?  379 HIS A O   1 
ATOM 2400 C CB  . HIS A 1 313 ? 166.335 115.313 180.100 1.00 156.98 ?  379 HIS A CB  1 
ATOM 2401 C CG  . HIS A 1 313 ? 165.833 115.612 178.730 1.00 134.60 ?  379 HIS A CG  1 
ATOM 2402 N ND1 . HIS A 1 313 ? 165.210 116.797 178.412 1.00 127.20 ?  379 HIS A ND1 1 
ATOM 2403 C CD2 . HIS A 1 313 ? 165.866 114.883 177.591 1.00 123.80 ?  379 HIS A CD2 1 
ATOM 2404 C CE1 . HIS A 1 313 ? 164.876 116.785 177.136 1.00 124.49 ?  379 HIS A CE1 1 
ATOM 2405 N NE2 . HIS A 1 313 ? 165.265 115.636 176.614 1.00 125.17 ?  379 HIS A NE2 1 
ATOM 2406 N N   . THR A 1 314 ? 165.009 117.218 181.952 1.00 182.82 ?  380 THR A N   1 
ATOM 2407 C CA  . THR A 1 314 ? 164.350 118.466 182.270 1.00 183.56 ?  380 THR A CA  1 
ATOM 2408 C C   . THR A 1 314 ? 165.204 119.635 181.837 1.00 185.45 ?  380 THR A C   1 
ATOM 2409 O O   . THR A 1 314 ? 166.061 119.501 180.968 1.00 181.52 ?  380 THR A O   1 
ATOM 2410 C CB  . THR A 1 314 ? 164.078 118.596 183.765 1.00 186.73 ?  380 THR A CB  1 
ATOM 2411 O OG1 . THR A 1 314 ? 165.326 118.611 184.464 1.00 196.02 ?  380 THR A OG1 1 
ATOM 2412 C CG2 . THR A 1 314 ? 163.250 117.425 184.257 1.00 184.31 ?  380 THR A CG2 1 
ATOM 2413 N N   . ASP A 1 315 ? 164.979 120.775 182.481 1.00 202.86 ?  381 ASP A N   1 
ATOM 2414 C CA  . ASP A 1 315 ? 165.509 122.050 182.029 1.00 217.75 ?  381 ASP A CA  1 
ATOM 2415 C C   . ASP A 1 315 ? 166.037 122.916 183.164 1.00 222.92 ?  381 ASP A C   1 
ATOM 2416 O O   . ASP A 1 315 ? 165.632 122.749 184.310 1.00 221.71 ?  381 ASP A O   1 
ATOM 2417 C CB  . ASP A 1 315 ? 164.424 122.793 181.273 1.00 20.00  ?  381 ASP A CB  1 
ATOM 2418 C CG  . ASP A 1 315 ? 164.060 122.109 179.985 1.00 20.00  ?  381 ASP A CG  1 
ATOM 2419 O OD1 . ASP A 1 315 ? 164.869 121.308 179.476 1.00 20.00  ?  381 ASP A OD1 1 
ATOM 2420 O OD2 . ASP A 1 315 ? 162.947 122.352 179.492 1.00 20.00  ?  381 ASP A OD2 1 
ATOM 2421 N N   . PRO A 1 316 ? 166.940 123.852 182.846 1.00 227.43 ?  382 PRO A N   1 
ATOM 2422 C CA  . PRO A 1 316 ? 167.496 124.734 183.871 1.00 226.16 ?  382 PRO A CA  1 
ATOM 2423 C C   . PRO A 1 316 ? 166.428 125.574 184.543 1.00 218.00 ?  382 PRO A C   1 
ATOM 2424 O O   . PRO A 1 316 ? 165.454 125.972 183.904 1.00 219.56 ?  382 PRO A O   1 
ATOM 2425 C CB  . PRO A 1 316 ? 168.457 125.620 183.086 1.00 228.58 ?  382 PRO A CB  1 
ATOM 2426 C CG  . PRO A 1 316 ? 168.847 124.797 181.931 1.00 229.54 ?  382 PRO A CG  1 
ATOM 2427 C CD  . PRO A 1 316 ? 167.621 124.031 181.555 1.00 228.54 ?  382 PRO A CD  1 
ATOM 2428 N N   . VAL A 1 317 ? 166.620 125.816 185.835 1.00 203.51 ?  383 VAL A N   1 
ATOM 2429 C CA  . VAL A 1 317 ? 165.674 126.554 186.660 1.00 191.22 ?  383 VAL A CA  1 
ATOM 2430 C C   . VAL A 1 317 ? 165.322 127.921 186.082 1.00 188.76 ?  383 VAL A C   1 
ATOM 2431 O O   . VAL A 1 317 ? 165.964 128.397 185.146 1.00 184.76 ?  383 VAL A O   1 
ATOM 2432 C CB  . VAL A 1 317 ? 166.230 126.743 188.082 1.00 188.69 ?  383 VAL A CB  1 
ATOM 2433 C CG1 . VAL A 1 317 ? 165.298 127.608 188.908 1.00 186.56 ?  383 VAL A CG1 1 
ATOM 2434 C CG2 . VAL A 1 317 ? 166.445 125.396 188.746 1.00 189.07 ?  383 VAL A CG2 1 
ATOM 2435 N N   . GLN A 1 318 ? 163.093 121.003 191.553 1.00 205.00 ?  392 GLN A N   1 
ATOM 2436 C CA  . GLN A 1 318 ? 163.528 120.514 192.855 1.00 193.14 ?  392 GLN A CA  1 
ATOM 2437 C C   . GLN A 1 318 ? 162.676 119.322 193.245 1.00 175.54 ?  392 GLN A C   1 
ATOM 2438 O O   . GLN A 1 318 ? 163.175 118.277 193.651 1.00 166.57 ?  392 GLN A O   1 
ATOM 2439 C CB  . GLN A 1 318 ? 163.423 121.620 193.899 1.00 20.00  ?  392 GLN A CB  1 
ATOM 2440 C CG  . GLN A 1 318 ? 164.316 122.801 193.592 1.00 20.00  ?  392 GLN A CG  1 
ATOM 2441 C CD  . GLN A 1 318 ? 164.123 123.940 194.561 1.00 20.00  ?  392 GLN A CD  1 
ATOM 2442 O OE1 . GLN A 1 318 ? 163.081 124.052 195.203 1.00 20.00  ?  392 GLN A OE1 1 
ATOM 2443 N NE2 . GLN A 1 318 ? 165.124 124.804 194.663 1.00 20.00  ?  392 GLN A NE2 1 
ATOM 2444 N N   . LYS A 1 319 ? 161.373 119.511 193.105 1.00 167.95 ?  393 LYS A N   1 
ATOM 2445 C CA  . LYS A 1 319 ? 160.380 118.457 193.211 1.00 165.62 ?  393 LYS A CA  1 
ATOM 2446 C C   . LYS A 1 319 ? 160.651 117.472 192.103 1.00 174.87 ?  393 LYS A C   1 
ATOM 2447 O O   . LYS A 1 319 ? 160.418 116.262 192.196 1.00 173.19 ?  393 LYS A O   1 
ATOM 2448 C CB  . LYS A 1 319 ? 159.009 119.070 193.033 1.00 20.00  ?  393 LYS A CB  1 
ATOM 2449 C CG  . LYS A 1 319 ? 158.729 120.148 194.034 1.00 20.00  ?  393 LYS A CG  1 
ATOM 2450 C CD  . LYS A 1 319 ? 157.603 121.012 193.538 1.00 20.00  ?  393 LYS A CD  1 
ATOM 2451 C CE  . LYS A 1 319 ? 158.065 121.746 192.286 1.00 20.00  ?  393 LYS A CE  1 
ATOM 2452 N NZ  . LYS A 1 319 ? 159.238 122.624 192.576 1.00 20.00  ?  393 LYS A NZ  1 
ATOM 2453 N N   . ASN A 1 320 ? 161.169 118.056 191.038 1.00 190.60 ?  394 ASN A N   1 
ATOM 2454 C CA  . ASN A 1 320 ? 161.349 117.405 189.773 1.00 193.50 ?  394 ASN A CA  1 
ATOM 2455 C C   . ASN A 1 320 ? 162.310 116.253 189.920 1.00 188.03 ?  394 ASN A C   1 
ATOM 2456 O O   . ASN A 1 320 ? 162.215 115.245 189.223 1.00 170.50 ?  394 ASN A O   1 
ATOM 2457 C CB  . ASN A 1 320 ? 161.868 118.432 188.788 1.00 20.00  ?  394 ASN A CB  1 
ATOM 2458 C CG  . ASN A 1 320 ? 160.979 119.648 188.732 1.00 20.00  ?  394 ASN A CG  1 
ATOM 2459 O OD1 . ASN A 1 320 ? 159.796 119.574 189.063 1.00 20.00  ?  394 ASN A OD1 1 
ATOM 2460 N ND2 . ASN A 1 320 ? 161.550 120.786 188.359 1.00 20.00  ?  394 ASN A ND2 1 
ATOM 2461 N N   . GLU A 1 321 ? 163.234 116.413 190.856 1.00 200.99 ?  395 GLU A N   1 
ATOM 2462 C CA  . GLU A 1 321 ? 164.175 115.362 191.167 1.00 203.99 ?  395 GLU A CA  1 
ATOM 2463 C C   . GLU A 1 321 ? 163.408 114.156 191.646 1.00 202.18 ?  395 GLU A C   1 
ATOM 2464 O O   . GLU A 1 321 ? 163.626 113.036 191.181 1.00 206.16 ?  395 GLU A O   1 
ATOM 2465 C CB  . GLU A 1 321 ? 165.162 115.825 192.233 1.00 204.67 ?  395 GLU A CB  1 
ATOM 2466 C CG  . GLU A 1 321 ? 166.048 116.964 191.781 1.00 204.42 ?  395 GLU A CG  1 
ATOM 2467 C CD  . GLU A 1 321 ? 166.897 116.590 190.586 1.00 202.15 ?  395 GLU A CD  1 
ATOM 2468 O OE1 . GLU A 1 321 ? 167.423 115.457 190.561 1.00 202.86 ?  395 GLU A OE1 1 
ATOM 2469 O OE2 . GLU A 1 321 ? 167.031 117.425 189.667 1.00 195.67 ?  395 GLU A OE2 1 
ATOM 2470 N N   . SER A 1 322 ? 162.475 114.400 192.557 1.00 191.12 ?  396 SER A N   1 
ATOM 2471 C CA  . SER A 1 322 ? 161.666 113.320 193.079 1.00 176.26 ?  396 SER A CA  1 
ATOM 2472 C C   . SER A 1 322 ? 160.843 112.709 191.966 1.00 173.68 ?  396 SER A C   1 
ATOM 2473 O O   . SER A 1 322 ? 160.651 111.496 191.926 1.00 167.00 ?  396 SER A O   1 
ATOM 2474 C CB  . SER A 1 322 ? 160.754 113.816 194.197 1.00 20.00  ?  396 SER A CB  1 
ATOM 2475 O OG  . SER A 1 322 ? 159.909 112.775 194.650 1.00 20.00  ?  396 SER A OG  1 
ATOM 2476 N N   . VAL A 1 323 ? 160.403 113.547 191.035 1.00 185.01 ?  397 VAL A N   1 
ATOM 2477 C CA  . VAL A 1 323 ? 159.603 113.055 189.928 1.00 199.57 ?  397 VAL A CA  1 
ATOM 2478 C C   . VAL A 1 323 ? 160.400 112.043 189.141 1.00 206.29 ?  397 VAL A C   1 
ATOM 2479 O O   . VAL A 1 323 ? 159.953 110.916 188.892 1.00 210.04 ?  397 VAL A O   1 
ATOM 2480 C CB  . VAL A 1 323 ? 159.187 114.179 188.981 1.00 20.00  ?  397 VAL A CB  1 
ATOM 2481 C CG1 . VAL A 1 323 ? 158.424 113.610 187.802 1.00 20.00  ?  397 VAL A CG1 1 
ATOM 2482 C CG2 . VAL A 1 323 ? 158.369 115.215 189.717 1.00 20.00  ?  397 VAL A CG2 1 
ATOM 2483 N N   . ARG A 1 324 ? 161.611 112.452 188.791 1.00 208.77 ?  398 ARG A N   1 
ATOM 2484 C CA  . ARG A 1 324 ? 162.466 111.641 187.957 1.00 207.82 ?  398 ARG A CA  1 
ATOM 2485 C C   . ARG A 1 324 ? 162.817 110.366 188.695 1.00 188.56 ?  398 ARG A C   1 
ATOM 2486 O O   . ARG A 1 324 ? 162.989 109.321 188.084 1.00 172.31 ?  398 ARG A O   1 
ATOM 2487 C CB  . ARG A 1 324 ? 163.733 112.401 187.571 1.00 20.00  ?  398 ARG A CB  1 
ATOM 2488 C CG  . ARG A 1 324 ? 164.563 111.685 186.523 1.00 20.00  ?  398 ARG A CG  1 
ATOM 2489 C CD  . ARG A 1 324 ? 165.788 112.487 186.111 1.00 20.00  ?  398 ARG A CD  1 
ATOM 2490 N NE  . ARG A 1 324 ? 166.828 112.500 187.134 1.00 20.00  ?  398 ARG A NE  1 
ATOM 2491 C CZ  . ARG A 1 324 ? 167.788 111.585 187.222 1.00 20.00  ?  398 ARG A CZ  1 
ATOM 2492 N NH1 . ARG A 1 324 ? 167.848 110.599 186.338 1.00 20.00  ?  398 ARG A NH1 1 
ATOM 2493 N NH2 . ARG A 1 324 ? 168.700 111.666 188.182 1.00 20.00  ?  398 ARG A NH2 1 
ATOM 2494 N N   . ASN A 1 325 ? 162.912 110.453 190.016 1.00 184.91 ?  399 ASN A N   1 
ATOM 2495 C CA  . ASN A 1 325 ? 163.206 109.273 190.812 1.00 177.83 ?  399 ASN A CA  1 
ATOM 2496 C C   . ASN A 1 325 ? 162.074 108.276 190.738 1.00 177.45 ?  399 ASN A C   1 
ATOM 2497 O O   . ASN A 1 325 ? 162.289 107.079 190.565 1.00 167.87 ?  399 ASN A O   1 
ATOM 2498 C CB  . ASN A 1 325 ? 163.458 109.656 192.266 1.00 20.00  ?  399 ASN A CB  1 
ATOM 2499 C CG  . ASN A 1 325 ? 164.765 110.386 192.454 1.00 20.00  ?  399 ASN A CG  1 
ATOM 2500 O OD1 . ASN A 1 325 ? 165.692 110.236 191.659 1.00 20.00  ?  399 ASN A OD1 1 
ATOM 2501 N ND2 . ASN A 1 325 ? 164.849 111.190 193.507 1.00 20.00  ?  399 ASN A ND2 1 
ATOM 2502 N N   . GLN A 1 326 ? 160.862 108.798 190.853 1.00 191.31 ?  400 GLN A N   1 
ATOM 2503 C CA  . GLN A 1 326 ? 159.666 107.982 190.838 1.00 199.09 ?  400 GLN A CA  1 
ATOM 2504 C C   . GLN A 1 326 ? 159.616 107.231 189.539 1.00 210.19 ?  400 GLN A C   1 
ATOM 2505 O O   . GLN A 1 326 ? 159.475 105.998 189.489 1.00 203.08 ?  400 GLN A O   1 
ATOM 2506 C CB  . GLN A 1 326 ? 158.443 108.871 190.975 1.00 20.00  ?  400 GLN A CB  1 
ATOM 2507 C CG  . GLN A 1 326 ? 158.384 109.601 192.282 1.00 20.00  ?  400 GLN A CG  1 
ATOM 2508 C CD  . GLN A 1 326 ? 157.351 110.694 192.267 1.00 20.00  ?  400 GLN A CD  1 
ATOM 2509 O OE1 . GLN A 1 326 ? 156.986 111.196 191.206 1.00 20.00  ?  400 GLN A OE1 1 
ATOM 2510 N NE2 . GLN A 1 326 ? 156.883 111.086 193.443 1.00 20.00  ?  400 GLN A NE2 1 
ATOM 2511 N N   . VAL A 1 327 ? 159.788 108.005 188.481 1.00 227.58 ?  401 VAL A N   1 
ATOM 2512 C CA  . VAL A 1 327 ? 159.742 107.462 187.151 1.00 235.78 ?  401 VAL A CA  1 
ATOM 2513 C C   . VAL A 1 327 ? 160.838 106.432 186.999 1.00 240.67 ?  401 VAL A C   1 
ATOM 2514 O O   . VAL A 1 327 ? 160.655 105.397 186.363 1.00 237.17 ?  401 VAL A O   1 
ATOM 2515 C CB  . VAL A 1 327 ? 159.917 108.569 186.114 1.00 20.00  ?  401 VAL A CB  1 
ATOM 2516 C CG1 . VAL A 1 327 ? 160.015 107.989 184.720 1.00 20.00  ?  401 VAL A CG1 1 
ATOM 2517 C CG2 . VAL A 1 327 ? 158.768 109.553 186.213 1.00 20.00  ?  401 VAL A CG2 1 
ATOM 2518 N N   . GLU A 1 328 ? 161.967 106.700 187.635 1.00 248.37 ?  402 GLU A N   1 
ATOM 2519 C CA  . GLU A 1 328 ? 163.109 105.823 187.514 1.00 251.96 ?  402 GLU A CA  1 
ATOM 2520 C C   . GLU A 1 328 ? 162.798 104.492 188.162 1.00 250.58 ?  402 GLU A C   1 
ATOM 2521 O O   . GLU A 1 328 ? 163.252 103.448 187.705 1.00 246.36 ?  402 GLU A O   1 
ATOM 2522 C CB  . GLU A 1 328 ? 164.345 106.454 188.149 1.00 252.55 ?  402 GLU A CB  1 
ATOM 2523 C CG  . GLU A 1 328 ? 165.626 105.691 187.879 1.00 252.85 ?  402 GLU A CG  1 
ATOM 2524 C CD  . GLU A 1 328 ? 166.036 105.735 186.413 1.00 249.57 ?  402 GLU A CD  1 
ATOM 2525 O OE1 . GLU A 1 328 ? 165.496 106.570 185.654 1.00 244.20 ?  402 GLU A OE1 1 
ATOM 2526 O OE2 . GLU A 1 328 ? 166.904 104.931 186.013 1.00 249.00 ?  402 GLU A OE2 1 
ATOM 2527 N N   . ASP A 1 329 ? 161.999 104.536 189.220 1.00 250.19 ?  403 ASP A N   1 
ATOM 2528 C CA  . ASP A 1 329 ? 161.643 103.325 189.935 1.00 249.09 ?  403 ASP A CA  1 
ATOM 2529 C C   . ASP A 1 329 ? 160.663 102.493 189.135 1.00 248.48 ?  403 ASP A C   1 
ATOM 2530 O O   . ASP A 1 329 ? 160.879 101.296 188.898 1.00 249.77 ?  403 ASP A O   1 
ATOM 2531 C CB  . ASP A 1 329 ? 161.038 103.664 191.295 1.00 20.00  ?  403 ASP A CB  1 
ATOM 2532 C CG  . ASP A 1 329 ? 162.051 104.246 192.250 1.00 20.00  ?  403 ASP A CG  1 
ATOM 2533 O OD1 . ASP A 1 329 ? 163.262 104.132 191.972 1.00 20.00  ?  403 ASP A OD1 1 
ATOM 2534 O OD2 . ASP A 1 329 ? 161.635 104.811 193.282 1.00 20.00  ?  403 ASP A OD2 1 
ATOM 2535 N N   . LEU A 1 330 ? 159.585 103.134 188.703 1.00 240.09 ?  404 LEU A N   1 
ATOM 2536 C CA  . LEU A 1 330 ? 158.545 102.390 188.013 1.00 229.03 ?  404 LEU A CA  1 
ATOM 2537 C C   . LEU A 1 330 ? 159.038 101.875 186.678 1.00 214.48 ?  404 LEU A C   1 
ATOM 2538 O O   . LEU A 1 330 ? 158.591 100.836 186.197 1.00 209.57 ?  404 LEU A O   1 
ATOM 2539 C CB  . LEU A 1 330 ? 157.306 103.247 187.830 1.00 20.00  ?  404 LEU A CB  1 
ATOM 2540 C CG  . LEU A 1 330 ? 156.726 103.607 189.194 1.00 20.00  ?  404 LEU A CG  1 
ATOM 2541 C CD1 . LEU A 1 330 ? 155.489 104.457 189.041 1.00 20.00  ?  404 LEU A CD1 1 
ATOM 2542 C CD2 . LEU A 1 330 ? 156.436 102.356 190.008 1.00 20.00  ?  404 LEU A CD2 1 
ATOM 2543 N N   . GLY A 1 331 ? 159.975 102.600 186.088 1.00 203.57 ?  405 GLY A N   1 
ATOM 2544 C CA  . GLY A 1 331 ? 160.598 102.140 184.868 1.00 202.05 ?  405 GLY A CA  1 
ATOM 2545 C C   . GLY A 1 331 ? 161.574 101.027 185.176 1.00 205.38 ?  405 GLY A C   1 
ATOM 2546 O O   . GLY A 1 331 ? 161.761 100.112 184.374 1.00 205.02 ?  405 GLY A O   1 
ATOM 2547 N N   . ALA A 1 332 ? 162.188 101.096 186.353 1.00 213.54 ?  406 ALA A N   1 
ATOM 2548 C CA  . ALA A 1 332 ? 163.129 100.065 186.760 1.00 223.55 ?  406 ALA A CA  1 
ATOM 2549 C C   . ALA A 1 332 ? 162.398 98.749  186.924 1.00 233.23 ?  406 ALA A C   1 
ATOM 2550 O O   . ALA A 1 332 ? 162.967 97.683  186.697 1.00 240.03 ?  406 ALA A O   1 
ATOM 2551 C CB  . ALA A 1 332 ? 163.830 100.445 188.050 1.00 219.19 ?  406 ALA A CB  1 
ATOM 2552 N N   . GLY A 1 333 ? 161.126 98.828  187.297 1.00 233.15 ?  407 GLY A N   1 
ATOM 2553 C CA  . GLY A 1 333 ? 160.338 97.624  187.467 1.00 231.47 ?  407 GLY A CA  1 
ATOM 2554 C C   . GLY A 1 333 ? 160.165 96.902  186.146 1.00 231.56 ?  407 GLY A C   1 
ATOM 2555 O O   . GLY A 1 333 ? 160.163 95.674  186.087 1.00 225.33 ?  407 GLY A O   1 
ATOM 2556 N N   . VAL A 1 334 ? 160.023 97.675  185.080 1.00 234.41 ?  408 VAL A N   1 
ATOM 2557 C CA  . VAL A 1 334 ? 159.846 97.132  183.741 1.00 237.64 ?  408 VAL A CA  1 
ATOM 2558 C C   . VAL A 1 334 ? 161.182 96.905  183.030 1.00 233.49 ?  408 VAL A C   1 
ATOM 2559 O O   . VAL A 1 334 ? 162.151 97.619  183.282 1.00 229.45 ?  408 VAL A O   1 
ATOM 2560 C CB  . VAL A 1 334 ? 158.939 98.073  182.925 1.00 241.81 ?  408 VAL A CB  1 
ATOM 2561 C CG1 . VAL A 1 334 ? 158.806 97.639  181.474 1.00 245.50 ?  408 VAL A CG1 1 
ATOM 2562 C CG2 . VAL A 1 334 ? 157.573 98.150  183.585 1.00 238.15 ?  408 VAL A CG2 1 
ATOM 2563 N N   . PRO A 1 335 ? 161.244 95.885  182.157 1.00 227.29 ?  409 PRO A N   1 
ATOM 2564 C CA  . PRO A 1 335 ? 162.349 95.711  181.210 1.00 219.88 ?  409 PRO A CA  1 
ATOM 2565 C C   . PRO A 1 335 ? 162.410 96.828  180.166 1.00 219.83 ?  409 PRO A C   1 
ATOM 2566 O O   . PRO A 1 335 ? 161.880 97.915  180.404 1.00 216.86 ?  409 PRO A O   1 
ATOM 2567 C CB  . PRO A 1 335 ? 162.029 94.373  180.545 1.00 219.87 ?  409 PRO A CB  1 
ATOM 2568 C CG  . PRO A 1 335 ? 161.231 93.642  181.552 1.00 222.99 ?  409 PRO A CG  1 
ATOM 2569 C CD  . PRO A 1 335 ? 160.399 94.682  182.232 1.00 225.65 ?  409 PRO A CD  1 
ATOM 2570 N N   . ALA A 1 336 ? 163.030 96.544  179.020 1.00 228.38 ?  410 ALA A N   1 
ATOM 2571 C CA  . ALA A 1 336 ? 163.349 97.564  178.020 1.00 232.93 ?  410 ALA A CA  1 
ATOM 2572 C C   . ALA A 1 336 ? 164.091 98.699  178.705 1.00 231.12 ?  410 ALA A C   1 
ATOM 2573 O O   . ALA A 1 336 ? 163.490 99.701  179.080 1.00 226.22 ?  410 ALA A O   1 
ATOM 2574 C CB  . ALA A 1 336 ? 162.097 98.070  177.334 1.00 231.86 ?  410 ALA A CB  1 
ATOM 2575 N N   . VAL A 1 337 ? 165.404 98.538  178.842 1.00 227.66 ?  411 VAL A N   1 
ATOM 2576 C CA  . VAL A 1 337 ? 166.174 99.263  179.851 1.00 216.11 ?  411 VAL A CA  1 
ATOM 2577 C C   . VAL A 1 337 ? 166.081 100.782 179.770 1.00 202.31 ?  411 VAL A C   1 
ATOM 2578 O O   . VAL A 1 337 ? 166.185 101.386 178.707 1.00 187.87 ?  411 VAL A O   1 
ATOM 2579 C CB  . VAL A 1 337 ? 167.660 98.856  179.795 1.00 220.71 ?  411 VAL A CB  1 
ATOM 2580 C CG1 . VAL A 1 337 ? 167.810 97.400  180.189 1.00 223.03 ?  411 VAL A CG1 1 
ATOM 2581 C CG2 . VAL A 1 337 ? 168.228 99.082  178.410 1.00 219.47 ?  411 VAL A CG2 1 
ATOM 2582 N N   . ILE A 1 338 ? 165.895 101.378 180.939 1.00 199.98 ?  412 ILE A N   1 
ATOM 2583 C CA  . ILE A 1 338 ? 165.630 102.796 181.078 1.00 204.78 ?  412 ILE A CA  1 
ATOM 2584 C C   . ILE A 1 338 ? 166.932 103.540 181.351 1.00 202.94 ?  412 ILE A C   1 
ATOM 2585 O O   . ILE A 1 338 ? 167.848 102.976 181.938 1.00 206.03 ?  412 ILE A O   1 
ATOM 2586 C CB  . ILE A 1 338 ? 164.648 103.038 182.230 1.00 206.62 ?  412 ILE A CB  1 
ATOM 2587 C CG1 . ILE A 1 338 ? 163.496 102.031 182.162 1.00 217.47 ?  412 ILE A CG1 1 
ATOM 2588 C CG2 . ILE A 1 338 ? 164.113 104.451 182.196 1.00 197.49 ?  412 ILE A CG2 1 
ATOM 2589 C CD1 . ILE A 1 338 ? 162.720 102.056 180.876 1.00 221.32 ?  412 ILE A CD1 1 
ATOM 2590 N N   . LEU A 1 339 ? 167.025 104.800 180.940 1.00 193.16 ?  413 LEU A N   1 
ATOM 2591 C CA  . LEU A 1 339 ? 168.159 105.633 181.335 1.00 178.91 ?  413 LEU A CA  1 
ATOM 2592 C C   . LEU A 1 339 ? 167.710 107.014 181.763 1.00 168.98 ?  413 LEU A C   1 
ATOM 2593 O O   . LEU A 1 339 ? 166.519 107.270 181.902 1.00 166.49 ?  413 LEU A O   1 
ATOM 2594 C CB  . LEU A 1 339 ? 169.179 105.758 180.206 1.00 174.49 ?  413 LEU A CB  1 
ATOM 2595 C CG  . LEU A 1 339 ? 169.994 104.507 179.894 1.00 173.17 ?  413 LEU A CG  1 
ATOM 2596 C CD1 . LEU A 1 339 ? 170.921 104.742 178.712 1.00 170.21 ?  413 LEU A CD1 1 
ATOM 2597 C CD2 . LEU A 1 339 ? 170.787 104.104 181.124 1.00 176.11 ?  413 LEU A CD2 1 
ATOM 2598 N N   . ARG A 1 340 ? 168.670 107.900 181.994 1.00 170.85 ?  414 ARG A N   1 
ATOM 2599 C CA  . ARG A 1 340 ? 168.334 109.293 182.205 1.00 184.72 ?  414 ARG A CA  1 
ATOM 2600 C C   . ARG A 1 340 ? 167.640 109.849 180.978 1.00 191.82 ?  414 ARG A C   1 
ATOM 2601 O O   . ARG A 1 340 ? 168.275 110.475 180.131 1.00 192.15 ?  414 ARG A O   1 
ATOM 2602 C CB  . ARG A 1 340 ? 169.566 110.127 182.510 1.00 190.25 ?  414 ARG A CB  1 
ATOM 2603 C CG  . ARG A 1 340 ? 169.212 111.577 182.724 1.00 195.91 ?  414 ARG A CG  1 
ATOM 2604 C CD  . ARG A 1 340 ? 170.400 112.412 183.081 1.00 193.94 ?  414 ARG A CD  1 
ATOM 2605 N NE  . ARG A 1 340 ? 170.004 113.806 183.187 1.00 201.07 ?  414 ARG A NE  1 
ATOM 2606 C CZ  . ARG A 1 340 ? 169.375 114.314 184.239 1.00 210.86 ?  414 ARG A CZ  1 
ATOM 2607 N NH1 . ARG A 1 340 ? 169.061 113.536 185.262 1.00 219.00 ?  414 ARG A NH1 1 
ATOM 2608 N NH2 . ARG A 1 340 ? 169.047 115.595 184.263 1.00 209.60 ?  414 ARG A NH2 1 
ATOM 2609 N N   . SER A 1 341 ? 173.697 115.196 182.527 1.00 200.88 ?  418 SER A N   1 
ATOM 2610 C CA  . SER A 1 341 ? 174.813 115.829 181.841 1.00 207.21 ?  418 SER A CA  1 
ATOM 2611 C C   . SER A 1 341 ? 174.467 117.253 181.442 1.00 213.07 ?  418 SER A C   1 
ATOM 2612 O O   . SER A 1 341 ? 174.490 118.162 182.267 1.00 212.85 ?  418 SER A O   1 
ATOM 2613 C CB  . SER A 1 341 ? 175.209 115.024 180.604 1.00 206.50 ?  418 SER A CB  1 
ATOM 2614 O OG  . SER A 1 341 ? 175.671 113.735 180.961 1.00 208.00 ?  418 SER A OG  1 
ATOM 2615 N N   . GLY A 1 342 ? 174.125 117.437 180.173 1.00 199.51 ?  419 GLY A N   1 
ATOM 2616 C CA  . GLY A 1 342 ? 173.797 118.751 179.656 1.00 219.13 ?  419 GLY A CA  1 
ATOM 2617 C C   . GLY A 1 342 ? 172.396 119.143 180.079 1.00 243.64 ?  419 GLY A C   1 
ATOM 2618 O O   . GLY A 1 342 ? 171.761 118.438 180.859 1.00 247.17 ?  419 GLY A O   1 
ATOM 2619 N N   . VAL A 1 343 ? 171.916 120.277 179.583 1.00 278.65 ?  420 VAL A N   1 
ATOM 2620 C CA  . VAL A 1 343 ? 170.639 120.826 180.036 1.00 302.12 ?  420 VAL A CA  1 
ATOM 2621 C C   . VAL A 1 343 ? 169.625 121.354 178.995 1.00 165.79 ?  420 VAL A C   1 
ATOM 2622 O O   . VAL A 1 343 ? 168.426 121.313 179.264 1.00 168.83 ?  420 VAL A O   1 
ATOM 2623 C CB  . VAL A 1 343 ? 170.892 121.974 181.026 1.00 322.94 ?  420 VAL A CB  1 
ATOM 2624 C CG1 . VAL A 1 343 ? 171.539 121.448 182.297 1.00 333.30 ?  420 VAL A CG1 1 
ATOM 2625 C CG2 . VAL A 1 343 ? 171.765 123.038 180.384 1.00 322.71 ?  420 VAL A CG2 1 
ATOM 2626 N N   . PRO A 1 344 ? 170.077 121.865 177.830 1.00 186.60 ?  421 PRO A N   1 
ATOM 2627 C CA  . PRO A 1 344 ? 169.109 122.604 177.008 1.00 172.02 ?  421 PRO A CA  1 
ATOM 2628 C C   . PRO A 1 344 ? 167.946 121.748 176.523 1.00 179.40 ?  421 PRO A C   1 
ATOM 2629 O O   . PRO A 1 344 ? 168.141 120.564 176.272 1.00 182.81 ?  421 PRO A O   1 
ATOM 2630 C CB  . PRO A 1 344 ? 169.949 123.077 175.828 1.00 20.00  ?  421 PRO A CB  1 
ATOM 2631 C CG  . PRO A 1 344 ? 170.977 122.044 175.690 1.00 20.00  ?  421 PRO A CG  1 
ATOM 2632 C CD  . PRO A 1 344 ? 171.326 121.629 177.082 1.00 20.00  ?  421 PRO A CD  1 
ATOM 2633 N N   . LEU A 1 345 ? 166.765 122.345 176.395 1.00 177.70 ?  422 LEU A N   1 
ATOM 2634 C CA  . LEU A 1 345 ? 165.553 121.601 176.060 1.00 175.56 ?  422 LEU A CA  1 
ATOM 2635 C C   . LEU A 1 345 ? 165.252 121.474 174.573 1.00 169.96 ?  422 LEU A C   1 
ATOM 2636 O O   . LEU A 1 345 ? 165.049 122.476 173.897 1.00 173.24 ?  422 LEU A O   1 
ATOM 2637 C CB  . LEU A 1 345 ? 164.350 122.260 176.701 1.00 169.88 ?  422 LEU A CB  1 
ATOM 2638 C CG  . LEU A 1 345 ? 163.109 121.479 176.304 1.00 164.15 ?  422 LEU A CG  1 
ATOM 2639 C CD1 . LEU A 1 345 ? 163.161 120.097 176.930 1.00 164.29 ?  422 LEU A CD1 1 
ATOM 2640 C CD2 . LEU A 1 345 ? 161.829 122.221 176.650 1.00 162.13 ?  422 LEU A CD2 1 
ATOM 2641 N N   . PRO A 1 346 ? 165.194 120.235 174.066 1.00 167.04 ?  423 PRO A N   1 
ATOM 2642 C CA  . PRO A 1 346 ? 164.730 119.938 172.712 1.00 152.68 ?  423 PRO A CA  1 
ATOM 2643 C C   . PRO A 1 346 ? 163.275 120.340 172.556 1.00 149.21 ?  423 PRO A C   1 
ATOM 2644 O O   . PRO A 1 346 ? 162.507 120.208 173.505 1.00 149.89 ?  423 PRO A O   1 
ATOM 2645 C CB  . PRO A 1 346 ? 164.929 118.426 172.603 1.00 20.00  ?  423 PRO A CB  1 
ATOM 2646 C CG  . PRO A 1 346 ? 164.946 117.955 174.013 1.00 20.00  ?  423 PRO A CG  1 
ATOM 2647 C CD  . PRO A 1 346 ? 165.668 119.026 174.746 1.00 20.00  ?  423 PRO A CD  1 
ATOM 2648 N N   . PRO A 1 347 ? 162.901 120.820 171.363 1.00 147.76 ?  424 PRO A N   1 
ATOM 2649 C CA  . PRO A 1 347 ? 161.649 121.550 171.187 1.00 145.82 ?  424 PRO A CA  1 
ATOM 2650 C C   . PRO A 1 347 ? 160.434 120.732 171.517 1.00 147.59 ?  424 PRO A C   1 
ATOM 2651 O O   . PRO A 1 347 ? 160.363 119.546 171.225 1.00 145.05 ?  424 PRO A O   1 
ATOM 2652 C CB  . PRO A 1 347 ? 161.661 121.900 169.707 1.00 20.00  ?  424 PRO A CB  1 
ATOM 2653 C CG  . PRO A 1 347 ? 162.416 120.808 169.096 1.00 20.00  ?  424 PRO A CG  1 
ATOM 2654 C CD  . PRO A 1 347 ? 163.513 120.489 170.069 1.00 20.00  ?  424 PRO A CD  1 
ATOM 2655 N N   . SER A 1 348 ? 159.467 121.405 172.106 1.00 150.17 ?  425 SER A N   1 
ATOM 2656 C CA  . SER A 1 348 ? 158.239 120.778 172.514 1.00 147.33 ?  425 SER A CA  1 
ATOM 2657 C C   . SER A 1 348 ? 157.256 121.843 172.879 1.00 143.48 ?  425 SER A C   1 
ATOM 2658 O O   . SER A 1 348 ? 157.611 123.010 173.007 1.00 132.92 ?  425 SER A O   1 
ATOM 2659 C CB  . SER A 1 348 ? 158.447 119.852 173.699 1.00 20.00  ?  425 SER A CB  1 
ATOM 2660 O OG  . SER A 1 348 ? 157.198 119.361 174.151 1.00 20.00  ?  425 SER A OG  1 
ATOM 2661 N N   . SER A 1 349 ? 156.014 121.430 173.059 1.00 127.41 ?  426 SER A N   1 
ATOM 2662 C CA  . SER A 1 349 ? 154.982 122.332 173.515 1.00 160.40 ?  426 SER A CA  1 
ATOM 2663 C C   . SER A 1 349 ? 155.270 122.873 174.908 1.00 182.16 ?  426 SER A C   1 
ATOM 2664 O O   . SER A 1 349 ? 154.893 123.996 175.241 1.00 182.12 ?  426 SER A O   1 
ATOM 2665 C CB  . SER A 1 349 ? 153.639 121.620 173.514 1.00 20.00  ?  426 SER A CB  1 
ATOM 2666 O OG  . SER A 1 349 ? 152.648 122.473 174.042 1.00 20.00  ?  426 SER A OG  1 
ATOM 2667 N N   . LEU A 1 350 ? 155.956 122.073 175.711 1.00 30.00  ?  427 LEU A N   1 
ATOM 2668 C CA  . LEU A 1 350 ? 156.098 122.374 177.125 1.00 30.00  ?  427 LEU A CA  1 
ATOM 2669 C C   . LEU A 1 350 ? 156.801 123.687 177.373 1.00 30.00  ?  427 LEU A C   1 
ATOM 2670 O O   . LEU A 1 350 ? 156.462 124.422 178.298 1.00 30.00  ?  427 LEU A O   1 
ATOM 2671 C CB  . LEU A 1 350 ? 156.872 121.260 177.820 1.00 20.00  ?  427 LEU A CB  1 
ATOM 2672 C CG  . LEU A 1 350 ? 157.141 121.537 179.292 1.00 20.00  ?  427 LEU A CG  1 
ATOM 2673 C CD1 . LEU A 1 350 ? 155.822 121.660 179.989 1.00 20.00  ?  427 LEU A CD1 1 
ATOM 2674 C CD2 . LEU A 1 350 ? 157.978 120.441 179.912 1.00 20.00  ?  427 LEU A CD2 1 
ATOM 2675 N N   . GLN A 1 351 ? 157.757 124.003 176.518 1.00 30.00  ?  428 GLN A N   1 
ATOM 2676 C CA  . GLN A 1 351 ? 158.580 125.167 176.746 1.00 30.00  ?  428 GLN A CA  1 
ATOM 2677 C C   . GLN A 1 351 ? 157.743 126.415 176.651 1.00 30.00  ?  428 GLN A C   1 
ATOM 2678 O O   . GLN A 1 351 ? 158.124 127.458 177.164 1.00 30.00  ?  428 GLN A O   1 
ATOM 2679 C CB  . GLN A 1 351 ? 159.712 125.217 175.752 1.00 20.00  ?  428 GLN A CB  1 
ATOM 2680 C CG  . GLN A 1 351 ? 159.248 125.435 174.367 1.00 20.00  ?  428 GLN A CG  1 
ATOM 2681 C CD  . GLN A 1 351 ? 160.389 125.377 173.424 1.00 20.00  ?  428 GLN A CD  1 
ATOM 2682 O OE1 . GLN A 1 351 ? 161.400 124.737 173.706 1.00 20.00  ?  428 GLN A OE1 1 
ATOM 2683 N NE2 . GLN A 1 351 ? 160.282 126.094 172.316 1.00 20.00  ?  428 GLN A NE2 1 
ATOM 2684 N N   . ARG A 1 352 ? 156.616 126.320 175.963 1.00 202.61 ?  429 ARG A N   1 
ATOM 2685 C CA  . ARG A 1 352 ? 155.688 127.424 175.975 1.00 172.84 ?  429 ARG A CA  1 
ATOM 2686 C C   . ARG A 1 352 ? 155.112 127.599 177.367 1.00 147.28 ?  429 ARG A C   1 
ATOM 2687 O O   . ARG A 1 352 ? 154.929 128.721 177.827 1.00 144.39 ?  429 ARG A O   1 
ATOM 2688 C CB  . ARG A 1 352 ? 154.591 127.219 174.937 1.00 20.00  ?  429 ARG A CB  1 
ATOM 2689 C CG  . ARG A 1 352 ? 153.553 128.318 174.917 1.00 20.00  ?  429 ARG A CG  1 
ATOM 2690 C CD  . ARG A 1 352 ? 154.193 129.694 174.988 1.00 20.00  ?  429 ARG A CD  1 
ATOM 2691 N NE  . ARG A 1 352 ? 155.238 129.918 174.000 1.00 20.00  ?  429 ARG A NE  1 
ATOM 2692 C CZ  . ARG A 1 352 ? 155.031 130.401 172.785 1.00 20.00  ?  429 ARG A CZ  1 
ATOM 2693 N NH1 . ARG A 1 352 ? 153.804 130.703 172.395 1.00 20.00  ?  429 ARG A NH1 1 
ATOM 2694 N NH2 . ARG A 1 352 ? 156.053 130.582 171.964 1.00 20.00  ?  429 ARG A NH2 1 
ATOM 2695 N N   . PHE A 1 353 ? 154.865 126.501 178.063 1.00 161.26 ?  430 PHE A N   1 
ATOM 2696 C CA  . PHE A 1 353 ? 154.434 126.627 179.443 1.00 159.72 ?  430 PHE A CA  1 
ATOM 2697 C C   . PHE A 1 353 ? 155.548 127.180 180.308 1.00 203.31 ?  430 PHE A C   1 
ATOM 2698 O O   . PHE A 1 353 ? 155.330 128.080 181.110 1.00 198.31 ?  430 PHE A O   1 
ATOM 2699 C CB  . PHE A 1 353 ? 153.959 125.288 179.989 1.00 164.53 ?  430 PHE A CB  1 
ATOM 2700 C CG  . PHE A 1 353 ? 152.629 124.867 179.463 1.00 160.33 ?  430 PHE A CG  1 
ATOM 2701 C CD1 . PHE A 1 353 ? 151.756 125.799 178.944 1.00 148.91 ?  430 PHE A CD1 1 
ATOM 2702 C CD2 . PHE A 1 353 ? 152.244 123.543 179.496 1.00 159.10 ?  430 PHE A CD2 1 
ATOM 2703 C CE1 . PHE A 1 353 ? 150.526 125.417 178.466 1.00 140.87 ?  430 PHE A CE1 1 
ATOM 2704 C CE2 . PHE A 1 353 ? 151.013 123.157 179.017 1.00 147.81 ?  430 PHE A CE2 1 
ATOM 2705 C CZ  . PHE A 1 353 ? 150.154 124.096 178.501 1.00 140.15 ?  430 PHE A CZ  1 
ATOM 2706 N N   . LEU A 1 354 ? 156.754 126.672 180.112 1.00 185.05 ?  431 LEU A N   1 
ATOM 2707 C CA  . LEU A 1 354 ? 157.860 127.104 180.940 1.00 185.81 ?  431 LEU A CA  1 
ATOM 2708 C C   . LEU A 1 354 ? 158.122 128.584 180.737 1.00 186.16 ?  431 LEU A C   1 
ATOM 2709 O O   . LEU A 1 354 ? 158.494 129.284 181.672 1.00 186.05 ?  431 LEU A O   1 
ATOM 2710 C CB  . LEU A 1 354 ? 159.110 126.288 180.629 1.00 20.00  ?  431 LEU A CB  1 
ATOM 2711 C CG  . LEU A 1 354 ? 160.350 126.553 181.479 1.00 20.00  ?  431 LEU A CG  1 
ATOM 2712 C CD1 . LEU A 1 354 ? 161.101 125.265 181.735 1.00 20.00  ?  431 LEU A CD1 1 
ATOM 2713 C CD2 . LEU A 1 354 ? 161.263 127.538 180.774 1.00 20.00  ?  431 LEU A CD2 1 
ATOM 2714 N N   . ARG A 1 355 ? 157.900 129.074 179.526 1.00 185.59 ?  432 ARG A N   1 
ATOM 2715 C CA  . ARG A 1 355 ? 158.084 130.491 179.286 1.00 172.22 ?  432 ARG A CA  1 
ATOM 2716 C C   . ARG A 1 355 ? 156.816 131.219 179.679 1.00 179.57 ?  432 ARG A C   1 
ATOM 2717 O O   . ARG A 1 355 ? 156.770 132.444 179.683 1.00 176.45 ?  432 ARG A O   1 
ATOM 2718 C CB  . ARG A 1 355 ? 158.447 130.777 177.832 1.00 20.00  ?  432 ARG A CB  1 
ATOM 2719 C CG  . ARG A 1 355 ? 157.376 130.429 176.841 1.00 20.00  ?  432 ARG A CG  1 
ATOM 2720 C CD  . ARG A 1 355 ? 157.811 130.794 175.441 1.00 20.00  ?  432 ARG A CD  1 
ATOM 2721 N NE  . ARG A 1 355 ? 157.962 132.237 175.283 1.00 20.00  ?  432 ARG A NE  1 
ATOM 2722 C CZ  . ARG A 1 355 ? 156.959 133.074 175.036 1.00 20.00  ?  432 ARG A CZ  1 
ATOM 2723 N NH1 . ARG A 1 355 ? 155.718 132.622 174.933 1.00 20.00  ?  432 ARG A NH1 1 
ATOM 2724 N NH2 . ARG A 1 355 ? 157.195 134.370 174.904 1.00 20.00  ?  432 ARG A NH2 1 
ATOM 2725 N N   . ALA A 1 356 ? 155.775 130.460 179.993 1.00 161.92 ?  433 ALA A N   1 
ATOM 2726 C CA  . ALA A 1 356 ? 154.549 131.058 180.491 1.00 164.76 ?  433 ALA A CA  1 
ATOM 2727 C C   . ALA A 1 356 ? 154.559 131.187 182.006 1.00 172.86 ?  433 ALA A C   1 
ATOM 2728 O O   . ALA A 1 356 ? 153.928 132.084 182.557 1.00 168.42 ?  433 ALA A O   1 
ATOM 2729 C CB  . ALA A 1 356 ? 153.353 130.254 180.047 1.00 20.00  ?  433 ALA A CB  1 
ATOM 2730 N N   . ARG A 1 357 ? 155.274 130.289 182.675 1.00 184.17 ?  434 ARG A N   1 
ATOM 2731 C CA  . ARG A 1 357 ? 155.260 130.236 184.132 1.00 193.51 ?  434 ARG A CA  1 
ATOM 2732 C C   . ARG A 1 357 ? 156.389 129.340 184.614 1.00 210.24 ?  434 ARG A C   1 
ATOM 2733 O O   . ARG A 1 357 ? 156.900 128.529 183.844 1.00 209.68 ?  434 ARG A O   1 
ATOM 2734 C CB  . ARG A 1 357 ? 153.888 129.755 184.609 1.00 20.00  ?  434 ARG A CB  1 
ATOM 2735 C CG  . ARG A 1 357 ? 153.651 129.631 186.100 1.00 20.00  ?  434 ARG A CG  1 
ATOM 2736 C CD  . ARG A 1 357 ? 152.151 129.471 186.288 1.00 20.00  ?  434 ARG A CD  1 
ATOM 2737 N NE  . ARG A 1 357 ? 151.702 129.268 187.659 1.00 20.00  ?  434 ARG A NE  1 
ATOM 2738 C CZ  . ARG A 1 357 ? 151.454 128.077 188.191 1.00 20.00  ?  434 ARG A CZ  1 
ATOM 2739 N NH1 . ARG A 1 357 ? 151.589 126.983 187.457 1.00 20.00  ?  434 ARG A NH1 1 
ATOM 2740 N NH2 . ARG A 1 357 ? 151.043 127.983 189.446 1.00 20.00  ?  434 ARG A NH2 1 
ATOM 2741 N N   . ASN A 1 358 ? 156.786 129.492 185.873 1.00 204.50 ?  435 ASN A N   1 
ATOM 2742 C CA  . ASN A 1 358 ? 157.969 128.816 186.385 1.00 199.88 ?  435 ASN A CA  1 
ATOM 2743 C C   . ASN A 1 358 ? 157.902 127.302 186.201 1.00 217.74 ?  435 ASN A C   1 
ATOM 2744 O O   . ASN A 1 358 ? 158.749 126.734 185.520 1.00 219.57 ?  435 ASN A O   1 
ATOM 2745 C CB  . ASN A 1 358 ? 158.160 129.170 187.854 1.00 20.00  ?  435 ASN A CB  1 
ATOM 2746 C CG  . ASN A 1 358 ? 158.470 130.640 188.054 1.00 20.00  ?  435 ASN A CG  1 
ATOM 2747 O OD1 . ASN A 1 358 ? 158.949 131.312 187.139 1.00 20.00  ?  435 ASN A OD1 1 
ATOM 2748 N ND2 . ASN A 1 358 ? 158.192 131.152 189.251 1.00 20.00  ?  435 ASN A ND2 1 
ATOM 2749 N N   . ILE A 1 359 ? 156.894 126.669 186.802 1.00 187.45 ?  436 ILE A N   1 
ATOM 2750 C CA  . ILE A 1 359 ? 156.437 125.317 186.435 1.00 199.31 ?  436 ILE A CA  1 
ATOM 2751 C C   . ILE A 1 359 ? 157.448 124.171 186.621 1.00 204.66 ?  436 ILE A C   1 
ATOM 2752 O O   . ILE A 1 359 ? 158.655 124.377 186.559 1.00 218.29 ?  436 ILE A O   1 
ATOM 2753 C CB  . ILE A 1 359 ? 155.952 125.328 184.964 1.00 20.00  ?  436 ILE A CB  1 
ATOM 2754 C CG1 . ILE A 1 359 ? 154.747 126.248 184.829 1.00 20.00  ?  436 ILE A CG1 1 
ATOM 2755 C CG2 . ILE A 1 359 ? 155.554 123.954 184.474 1.00 20.00  ?  436 ILE A CG2 1 
ATOM 2756 C CD1 . ILE A 1 359 ? 154.296 126.419 183.418 1.00 20.00  ?  436 ILE A CD1 1 
ATOM 2757 N N   . SER A 1 360 ? 156.945 122.963 186.868 1.00 245.10 ?  437 SER A N   1 
ATOM 2758 C CA  . SER A 1 360 ? 157.773 121.763 186.836 1.00 218.72 ?  437 SER A CA  1 
ATOM 2759 C C   . SER A 1 360 ? 158.186 121.439 185.405 1.00 205.27 ?  437 SER A C   1 
ATOM 2760 O O   . SER A 1 360 ? 158.490 122.338 184.630 1.00 195.29 ?  437 SER A O   1 
ATOM 2761 C CB  . SER A 1 360 ? 157.031 120.579 187.445 1.00 214.74 ?  437 SER A CB  1 
ATOM 2762 O OG  . SER A 1 360 ? 156.759 120.799 188.815 1.00 212.05 ?  437 SER A OG  1 
ATOM 2763 N N   . GLY A 1 361 ? 158.196 120.160 185.048 1.00 193.53 ?  438 GLY A N   1 
ATOM 2764 C CA  . GLY A 1 361 ? 158.547 119.788 183.690 1.00 202.66 ?  438 GLY A CA  1 
ATOM 2765 C C   . GLY A 1 361 ? 158.574 118.306 183.373 1.00 174.00 ?  438 GLY A C   1 
ATOM 2766 O O   . GLY A 1 361 ? 157.529 117.665 183.294 1.00 164.80 ?  438 GLY A O   1 
ATOM 2767 N N   . VAL A 1 362 ? 159.784 117.786 183.181 1.00 186.41 ?  439 VAL A N   1 
ATOM 2768 C CA  . VAL A 1 362 ? 160.043 116.408 182.765 1.00 164.31 ?  439 VAL A CA  1 
ATOM 2769 C C   . VAL A 1 362 ? 159.577 116.107 181.354 1.00 134.58 ?  439 VAL A C   1 
ATOM 2770 O O   . VAL A 1 362 ? 158.391 116.158 181.048 1.00 117.80 ?  439 VAL A O   1 
ATOM 2771 C CB  . VAL A 1 362 ? 159.392 115.394 183.702 1.00 20.00  ?  439 VAL A CB  1 
ATOM 2772 C CG1 . VAL A 1 362 ? 159.608 113.994 183.172 1.00 20.00  ?  439 VAL A CG1 1 
ATOM 2773 C CG2 . VAL A 1 362 ? 159.951 115.536 185.101 1.00 20.00  ?  439 VAL A CG2 1 
ATOM 2774 N N   . VAL A 1 363 ? 160.536 115.771 180.506 1.00 149.03 ?  440 VAL A N   1 
ATOM 2775 C CA  . VAL A 1 363 ? 160.272 115.432 179.122 1.00 148.96 ?  440 VAL A CA  1 
ATOM 2776 C C   . VAL A 1 363 ? 160.827 114.061 178.792 1.00 155.24 ?  440 VAL A C   1 
ATOM 2777 O O   . VAL A 1 363 ? 161.904 113.705 179.258 1.00 161.64 ?  440 VAL A O   1 
ATOM 2778 C CB  . VAL A 1 363 ? 160.896 116.465 178.193 1.00 20.00  ?  440 VAL A CB  1 
ATOM 2779 C CG1 . VAL A 1 363 ? 160.821 116.012 176.754 1.00 20.00  ?  440 VAL A CG1 1 
ATOM 2780 C CG2 . VAL A 1 363 ? 160.198 117.794 178.372 1.00 20.00  ?  440 VAL A CG2 1 
ATOM 2781 N N   . LEU A 1 364 ? 160.101 113.288 177.994 1.00 140.56 ?  441 LEU A N   1 
ATOM 2782 C CA  . LEU A 1 364 ? 160.598 111.985 177.594 1.00 137.32 ?  441 LEU A CA  1 
ATOM 2783 C C   . LEU A 1 364 ? 160.911 111.942 176.110 1.00 139.64 ?  441 LEU A C   1 
ATOM 2784 O O   . LEU A 1 364 ? 160.091 112.342 175.278 1.00 138.40 ?  441 LEU A O   1 
ATOM 2785 C CB  . LEU A 1 364 ? 159.587 110.903 177.922 1.00 20.00  ?  441 LEU A CB  1 
ATOM 2786 C CG  . LEU A 1 364 ? 159.107 110.877 179.367 1.00 20.00  ?  441 LEU A CG  1 
ATOM 2787 C CD1 . LEU A 1 364 ? 158.144 109.731 179.564 1.00 20.00  ?  441 LEU A CD1 1 
ATOM 2788 C CD2 . LEU A 1 364 ? 160.238 110.799 180.336 1.00 20.00  ?  441 LEU A CD2 1 
ATOM 2789 N N   . ALA A 1 365 ? 162.081 111.420 175.773 1.00 132.90 ?  442 ALA A N   1 
ATOM 2790 C CA  . ALA A 1 365 ? 162.466 111.316 174.378 1.00 139.83 ?  442 ALA A CA  1 
ATOM 2791 C C   . ALA A 1 365 ? 163.540 110.279 174.161 1.00 145.93 ?  442 ALA A C   1 
ATOM 2792 O O   . ALA A 1 365 ? 164.362 110.027 175.038 1.00 149.75 ?  442 ALA A O   1 
ATOM 2793 C CB  . ALA A 1 365 ? 162.938 112.647 173.874 1.00 20.00  ?  442 ALA A CB  1 
ATOM 2794 N N   . ASP A 1 366 ? 163.531 109.682 172.977 1.00 167.56 ?  443 ASP A N   1 
ATOM 2795 C CA  . ASP A 1 366 ? 164.583 108.757 172.604 1.00 191.98 ?  443 ASP A CA  1 
ATOM 2796 C C   . ASP A 1 366 ? 165.925 109.413 172.345 1.00 226.81 ?  443 ASP A C   1 
ATOM 2797 O O   . ASP A 1 366 ? 166.952 108.916 172.796 1.00 233.90 ?  443 ASP A O   1 
ATOM 2798 C CB  . ASP A 1 366 ? 164.199 107.966 171.363 1.00 20.00  ?  443 ASP A CB  1 
ATOM 2799 C CG  . ASP A 1 366 ? 165.372 107.200 170.805 1.00 20.00  ?  443 ASP A CG  1 
ATOM 2800 O OD1 . ASP A 1 366 ? 165.997 106.448 171.580 1.00 20.00  ?  443 ASP A OD1 1 
ATOM 2801 O OD2 . ASP A 1 366 ? 165.674 107.345 169.602 1.00 20.00  ?  443 ASP A OD2 1 
ATOM 2802 N N   . HIS A 1 367 ? 165.927 110.519 171.615 1.00 263.78 ?  444 HIS A N   1 
ATOM 2803 C CA  . HIS A 1 367 ? 167.191 111.084 171.180 1.00 301.26 ?  444 HIS A CA  1 
ATOM 2804 C C   . HIS A 1 367 ? 168.031 111.546 172.356 1.00 341.24 ?  444 HIS A C   1 
ATOM 2805 O O   . HIS A 1 367 ? 167.531 112.193 173.272 1.00 340.71 ?  444 HIS A O   1 
ATOM 2806 C CB  . HIS A 1 367 ? 166.964 112.258 170.244 1.00 20.00  ?  444 HIS A CB  1 
ATOM 2807 C CG  . HIS A 1 367 ? 166.251 113.401 170.887 1.00 20.00  ?  444 HIS A CG  1 
ATOM 2808 N ND1 . HIS A 1 367 ? 164.883 113.436 171.037 1.00 20.00  ?  444 HIS A ND1 1 
ATOM 2809 C CD2 . HIS A 1 367 ? 166.721 114.530 171.464 1.00 20.00  ?  444 HIS A CD2 1 
ATOM 2810 C CE1 . HIS A 1 367 ? 164.538 114.558 171.642 1.00 20.00  ?  444 HIS A CE1 1 
ATOM 2811 N NE2 . HIS A 1 367 ? 165.635 115.238 171.915 1.00 20.00  ?  444 HIS A NE2 1 
ATOM 2812 N N   . SER A 1 368 ? 169.314 111.215 172.324 1.00 243.15 ?  445 SER A N   1 
ATOM 2813 C CA  . SER A 1 368 ? 170.249 111.770 173.283 1.00 255.22 ?  445 SER A CA  1 
ATOM 2814 C C   . SER A 1 368 ? 170.355 113.265 173.062 1.00 274.66 ?  445 SER A C   1 
ATOM 2815 O O   . SER A 1 368 ? 170.519 114.037 174.001 1.00 274.45 ?  445 SER A O   1 
ATOM 2816 C CB  . SER A 1 368 ? 171.619 111.124 173.132 1.00 20.00  ?  445 SER A CB  1 
ATOM 2817 O OG  . SER A 1 368 ? 172.165 111.429 171.860 1.00 20.00  ?  445 SER A OG  1 
ATOM 2818 N N   . GLY A 1 369 ? 170.235 113.661 171.802 1.00 404.24 ?  446 GLY A N   1 
ATOM 2819 C CA  . GLY A 1 369 ? 170.399 115.043 171.407 1.00 405.63 ?  446 GLY A CA  1 
ATOM 2820 C C   . GLY A 1 369 ? 169.852 115.236 170.013 1.00 233.99 ?  446 GLY A C   1 
ATOM 2821 O O   . GLY A 1 369 ? 168.716 115.650 169.837 1.00 231.72 ?  446 GLY A O   1 
ATOM 2822 N N   . ALA A 1 370 ? 170.660 114.948 169.006 1.00 217.01 ?  447 ALA A N   1 
ATOM 2823 C CA  . ALA A 1 370 ? 170.134 114.921 167.657 1.00 209.59 ?  447 ALA A CA  1 
ATOM 2824 C C   . ALA A 1 370 ? 169.137 113.787 167.571 1.00 200.69 ?  447 ALA A C   1 
ATOM 2825 O O   . ALA A 1 370 ? 169.342 112.731 168.161 1.00 202.41 ?  447 ALA A O   1 
ATOM 2826 C CB  . ALA A 1 370 ? 171.240 114.745 166.641 1.00 20.00  ?  447 ALA A CB  1 
ATOM 2827 N N   . PHE A 1 371 ? 168.048 114.006 166.853 1.00 201.67 ?  448 PHE A N   1 
ATOM 2828 C CA  . PHE A 1 371 ? 167.111 112.930 166.624 1.00 191.20 ?  448 PHE A CA  1 
ATOM 2829 C C   . PHE A 1 371 ? 167.844 111.882 165.817 1.00 189.55 ?  448 PHE A C   1 
ATOM 2830 O O   . PHE A 1 371 ? 168.646 112.212 164.950 1.00 190.02 ?  448 PHE A O   1 
ATOM 2831 C CB  . PHE A 1 371 ? 165.873 113.422 165.892 1.00 20.00  ?  448 PHE A CB  1 
ATOM 2832 C CG  . PHE A 1 371 ? 165.191 114.561 166.577 1.00 20.00  ?  448 PHE A CG  1 
ATOM 2833 C CD1 . PHE A 1 371 ? 164.376 114.348 167.669 1.00 20.00  ?  448 PHE A CD1 1 
ATOM 2834 C CD2 . PHE A 1 371 ? 165.359 115.850 166.120 1.00 20.00  ?  448 PHE A CD2 1 
ATOM 2835 C CE1 . PHE A 1 371 ? 163.751 115.406 168.297 1.00 20.00  ?  448 PHE A CE1 1 
ATOM 2836 C CE2 . PHE A 1 371 ? 164.741 116.908 166.740 1.00 20.00  ?  448 PHE A CE2 1 
ATOM 2837 C CZ  . PHE A 1 371 ? 163.933 116.686 167.829 1.00 20.00  ?  448 PHE A CZ  1 
ATOM 2838 N N   . HIS A 1 372 ? 167.596 110.619 166.116 1.00 182.50 ?  449 HIS A N   1 
ATOM 2839 C CA  . HIS A 1 372 ? 168.307 109.544 165.449 1.00 178.50 ?  449 HIS A CA  1 
ATOM 2840 C C   . HIS A 1 372 ? 167.547 109.153 164.195 1.00 182.24 ?  449 HIS A C   1 
ATOM 2841 O O   . HIS A 1 372 ? 167.888 108.195 163.509 1.00 182.77 ?  449 HIS A O   1 
ATOM 2842 C CB  . HIS A 1 372 ? 168.458 108.360 166.390 1.00 20.00  ?  449 HIS A CB  1 
ATOM 2843 C CG  . HIS A 1 372 ? 169.013 108.730 167.727 1.00 20.00  ?  449 HIS A CG  1 
ATOM 2844 N ND1 . HIS A 1 372 ? 170.316 109.139 167.906 1.00 20.00  ?  449 HIS A ND1 1 
ATOM 2845 C CD2 . HIS A 1 372 ? 168.433 108.775 168.949 1.00 20.00  ?  449 HIS A CD2 1 
ATOM 2846 C CE1 . HIS A 1 372 ? 170.519 109.409 169.183 1.00 20.00  ?  449 HIS A CE1 1 
ATOM 2847 N NE2 . HIS A 1 372 ? 169.393 109.195 169.838 1.00 20.00  ?  449 HIS A NE2 1 
ATOM 2848 N N   . ASN A 1 373 ? 166.500 109.915 163.914 1.00 171.22 ?  450 ASN A N   1 
ATOM 2849 C CA  . ASN A 1 373 ? 165.483 109.517 162.963 1.00 164.18 ?  450 ASN A CA  1 
ATOM 2850 C C   . ASN A 1 373 ? 165.755 109.812 161.508 1.00 157.45 ?  450 ASN A C   1 
ATOM 2851 O O   . ASN A 1 373 ? 164.941 109.451 160.658 1.00 150.66 ?  450 ASN A O   1 
ATOM 2852 C CB  . ASN A 1 373 ? 164.173 110.172 163.352 1.00 20.00  ?  450 ASN A CB  1 
ATOM 2853 C CG  . ASN A 1 373 ? 163.629 109.614 164.626 1.00 20.00  ?  450 ASN A CG  1 
ATOM 2854 O OD1 . ASN A 1 373 ? 163.052 108.529 164.640 1.00 20.00  ?  450 ASN A OD1 1 
ATOM 2855 N ND2 . ASN A 1 373 ? 163.847 110.326 165.725 1.00 20.00  ?  450 ASN A ND2 1 
ATOM 2856 N N   . LYS A 1 374 ? 166.861 110.488 161.214 1.00 150.61 ?  451 LYS A N   1 
ATOM 2857 C CA  . LYS A 1 374 ? 167.163 110.851 159.835 1.00 168.77 ?  451 LYS A CA  1 
ATOM 2858 C C   . LYS A 1 374 ? 166.020 111.662 159.268 1.00 157.05 ?  451 LYS A C   1 
ATOM 2859 O O   . LYS A 1 374 ? 166.059 112.884 159.211 1.00 157.21 ?  451 LYS A O   1 
ATOM 2860 C CB  . LYS A 1 374 ? 167.376 109.607 158.975 1.00 20.00  ?  451 LYS A CB  1 
ATOM 2861 C CG  . LYS A 1 374 ? 168.538 108.740 159.381 1.00 20.00  ?  451 LYS A CG  1 
ATOM 2862 C CD  . LYS A 1 374 ? 169.858 109.402 159.049 1.00 20.00  ?  451 LYS A CD  1 
ATOM 2863 C CE  . LYS A 1 374 ? 171.005 108.485 159.408 1.00 20.00  ?  451 LYS A CE  1 
ATOM 2864 N NZ  . LYS A 1 374 ? 170.940 107.234 158.605 1.00 20.00  ?  451 LYS A NZ  1 
ATOM 2865 N N   . TYR A 1 375 ? 164.997 110.936 158.845 1.00 161.03 ?  452 TYR A N   1 
ATOM 2866 C CA  . TYR A 1 375 ? 163.764 111.514 158.364 1.00 166.57 ?  452 TYR A CA  1 
ATOM 2867 C C   . TYR A 1 375 ? 163.085 112.235 159.515 1.00 194.05 ?  452 TYR A C   1 
ATOM 2868 O O   . TYR A 1 375 ? 163.100 111.749 160.644 1.00 199.19 ?  452 TYR A O   1 
ATOM 2869 C CB  . TYR A 1 375 ? 162.885 110.407 157.812 1.00 20.00  ?  452 TYR A CB  1 
ATOM 2870 C CG  . TYR A 1 375 ? 163.657 109.526 156.869 1.00 20.00  ?  452 TYR A CG  1 
ATOM 2871 C CD1 . TYR A 1 375 ? 164.521 110.069 155.939 1.00 20.00  ?  452 TYR A CD1 1 
ATOM 2872 C CD2 . TYR A 1 375 ? 163.571 108.150 156.948 1.00 20.00  ?  452 TYR A CD2 1 
ATOM 2873 C CE1 . TYR A 1 375 ? 165.244 109.268 155.090 1.00 20.00  ?  452 TYR A CE1 1 
ATOM 2874 C CE2 . TYR A 1 375 ? 164.291 107.339 156.104 1.00 20.00  ?  452 TYR A CE2 1 
ATOM 2875 C CZ  . TYR A 1 375 ? 165.129 107.905 155.176 1.00 20.00  ?  452 TYR A CZ  1 
ATOM 2876 O OH  . TYR A 1 375 ? 165.861 107.115 154.324 1.00 20.00  ?  452 TYR A OH  1 
ATOM 2877 N N   . TYR A 1 376 ? 162.494 113.391 159.241 1.00 174.28 ?  453 TYR A N   1 
ATOM 2878 C CA  . TYR A 1 376 ? 161.803 114.136 160.284 1.00 140.51 ?  453 TYR A CA  1 
ATOM 2879 C C   . TYR A 1 376 ? 160.773 115.085 159.699 1.00 126.77 ?  453 TYR A C   1 
ATOM 2880 O O   . TYR A 1 376 ? 161.114 116.104 159.109 1.00 130.42 ?  453 TYR A O   1 
ATOM 2881 C CB  . TYR A 1 376 ? 162.804 114.884 161.139 1.00 20.00  ?  453 TYR A CB  1 
ATOM 2882 C CG  . TYR A 1 376 ? 162.171 115.763 162.171 1.00 20.00  ?  453 TYR A CG  1 
ATOM 2883 C CD1 . TYR A 1 376 ? 161.459 115.220 163.225 1.00 20.00  ?  453 TYR A CD1 1 
ATOM 2884 C CD2 . TYR A 1 376 ? 162.336 117.130 162.128 1.00 20.00  ?  453 TYR A CD2 1 
ATOM 2885 C CE1 . TYR A 1 376 ? 160.891 116.024 164.183 1.00 20.00  ?  453 TYR A CE1 1 
ATOM 2886 C CE2 . TYR A 1 376 ? 161.782 117.940 163.085 1.00 20.00  ?  453 TYR A CE2 1 
ATOM 2887 C CZ  . TYR A 1 376 ? 161.057 117.385 164.107 1.00 20.00  ?  453 TYR A CZ  1 
ATOM 2888 O OH  . TYR A 1 376 ? 160.500 118.199 165.062 1.00 20.00  ?  453 TYR A OH  1 
ATOM 2889 N N   . GLN A 1 377 ? 159.509 114.724 159.903 1.00 141.87 ?  454 GLN A N   1 
ATOM 2890 C CA  . GLN A 1 377 ? 158.377 115.128 159.062 1.00 131.15 ?  454 GLN A CA  1 
ATOM 2891 C C   . GLN A 1 377 ? 158.808 115.249 157.612 1.00 115.36 ?  454 GLN A C   1 
ATOM 2892 O O   . GLN A 1 377 ? 158.409 116.152 156.889 1.00 113.94 ?  454 GLN A O   1 
ATOM 2893 C CB  . GLN A 1 377 ? 157.694 116.414 159.550 1.00 20.00  ?  454 GLN A CB  1 
ATOM 2894 C CG  . GLN A 1 377 ? 158.473 117.700 159.510 1.00 20.00  ?  454 GLN A CG  1 
ATOM 2895 C CD  . GLN A 1 377 ? 159.363 117.850 160.701 1.00 20.00  ?  454 GLN A CD  1 
ATOM 2896 O OE1 . GLN A 1 377 ? 159.417 116.974 161.560 1.00 20.00  ?  454 GLN A OE1 1 
ATOM 2897 N NE2 . GLN A 1 377 ? 160.053 118.973 160.780 1.00 20.00  ?  454 GLN A NE2 1 
ATOM 2898 N N   . SER A 1 378 ? 159.647 114.312 157.208 1.00 95.53  ?  455 SER A N   1 
ATOM 2899 C CA  . SER A 1 378 ? 159.980 114.115 155.822 1.00 123.52 ?  455 SER A CA  1 
ATOM 2900 C C   . SER A 1 378 ? 158.842 113.353 155.181 1.00 131.11 ?  455 SER A C   1 
ATOM 2901 O O   . SER A 1 378 ? 158.076 112.687 155.865 1.00 128.22 ?  455 SER A O   1 
ATOM 2902 C CB  . SER A 1 378 ? 161.295 113.356 155.691 1.00 20.00  ?  455 SER A CB  1 
ATOM 2903 O OG  . SER A 1 378 ? 162.351 114.081 156.299 1.00 20.00  ?  455 SER A OG  1 
ATOM 2904 N N   . ILE A 1 379 ? 158.717 113.468 153.873 1.00 170.41 ?  456 ILE A N   1 
ATOM 2905 C CA  . ILE A 1 379 ? 157.728 112.703 153.144 1.00 190.53 ?  456 ILE A CA  1 
ATOM 2906 C C   . ILE A 1 379 ? 157.977 111.212 153.289 1.00 220.00 ?  456 ILE A C   1 
ATOM 2907 O O   . ILE A 1 379 ? 157.043 110.417 153.352 1.00 226.81 ?  456 ILE A O   1 
ATOM 2908 C CB  . ILE A 1 379 ? 157.758 113.069 151.671 1.00 20.00  ?  456 ILE A CB  1 
ATOM 2909 C CG1 . ILE A 1 379 ? 157.401 114.541 151.507 1.00 20.00  ?  456 ILE A CG1 1 
ATOM 2910 C CG2 . ILE A 1 379 ? 156.807 112.195 150.888 1.00 20.00  ?  456 ILE A CG2 1 
ATOM 2911 C CD1 . ILE A 1 379 ? 158.603 115.446 151.421 1.00 20.00  ?  456 ILE A CD1 1 
ATOM 2912 N N   . TYR A 1 380 ? 159.249 110.849 153.389 1.00 188.79 ?  457 TYR A N   1 
ATOM 2913 C CA  . TYR A 1 380 ? 159.663 109.453 153.430 1.00 192.51 ?  457 TYR A CA  1 
ATOM 2914 C C   . TYR A 1 380 ? 159.136 108.730 154.646 1.00 189.76 ?  457 TYR A C   1 
ATOM 2915 O O   . TYR A 1 380 ? 158.984 107.511 154.635 1.00 188.40 ?  457 TYR A O   1 
ATOM 2916 C CB  . TYR A 1 380 ? 161.178 109.355 153.431 1.00 199.89 ?  457 TYR A CB  1 
ATOM 2917 C CG  . TYR A 1 380 ? 161.809 109.942 152.214 1.00 210.79 ?  457 TYR A CG  1 
ATOM 2918 C CD1 . TYR A 1 380 ? 161.996 109.183 151.078 1.00 209.88 ?  457 TYR A CD1 1 
ATOM 2919 C CD2 . TYR A 1 380 ? 162.213 111.263 152.199 1.00 222.73 ?  457 TYR A CD2 1 
ATOM 2920 C CE1 . TYR A 1 380 ? 162.572 109.718 149.961 1.00 208.84 ?  457 TYR A CE1 1 
ATOM 2921 C CE2 . TYR A 1 380 ? 162.792 111.811 151.087 1.00 225.46 ?  457 TYR A CE2 1 
ATOM 2922 C CZ  . TYR A 1 380 ? 162.972 111.033 149.969 1.00 218.07 ?  457 TYR A CZ  1 
ATOM 2923 O OH  . TYR A 1 380 ? 163.553 111.575 148.846 1.00 214.14 ?  457 TYR A OH  1 
ATOM 2924 N N   . ASP A 1 381 ? 158.877 109.490 155.701 1.00 191.62 ?  458 ASP A N   1 
ATOM 2925 C CA  . ASP A 1 381 ? 158.571 108.902 156.987 1.00 192.10 ?  458 ASP A CA  1 
ATOM 2926 C C   . ASP A 1 381 ? 157.328 108.050 156.886 1.00 185.54 ?  458 ASP A C   1 
ATOM 2927 O O   . ASP A 1 381 ? 156.316 108.481 156.350 1.00 185.52 ?  458 ASP A O   1 
ATOM 2928 C CB  . ASP A 1 381 ? 158.392 109.999 158.024 1.00 192.89 ?  458 ASP A CB  1 
ATOM 2929 C CG  . ASP A 1 381 ? 158.057 109.460 159.377 1.00 188.32 ?  458 ASP A CG  1 
ATOM 2930 O OD1 . ASP A 1 381 ? 158.904 108.755 159.951 1.00 188.58 ?  458 ASP A OD1 1 
ATOM 2931 O OD2 . ASP A 1 381 ? 156.955 109.755 159.872 1.00 181.75 ?  458 ASP A OD2 1 
ATOM 2932 N N   . THR A 1 382 ? 157.412 106.846 157.434 1.00 176.91 ?  459 THR A N   1 
ATOM 2933 C CA  . THR A 1 382 ? 156.449 105.787 157.170 1.00 173.72 ?  459 THR A CA  1 
ATOM 2934 C C   . THR A 1 382 ? 156.522 104.692 158.207 1.00 160.84 ?  459 THR A C   1 
ATOM 2935 O O   . THR A 1 382 ? 157.375 104.703 159.088 1.00 149.19 ?  459 THR A O   1 
ATOM 2936 C CB  . THR A 1 382 ? 156.664 105.120 155.791 1.00 182.09 ?  459 THR A CB  1 
ATOM 2937 O OG1 . THR A 1 382 ? 158.044 104.765 155.638 1.00 195.57 ?  459 THR A OG1 1 
ATOM 2938 C CG2 . THR A 1 382 ? 156.207 105.999 154.637 1.00 175.31 ?  459 THR A CG2 1 
ATOM 2939 N N   . ALA A 1 383 ? 155.613 103.739 158.086 1.00 157.00 ?  460 ALA A N   1 
ATOM 2940 C CA  . ALA A 1 383 ? 155.696 102.530 158.872 1.00 159.11 ?  460 ALA A CA  1 
ATOM 2941 C C   . ALA A 1 383 ? 156.987 101.807 158.545 1.00 166.03 ?  460 ALA A C   1 
ATOM 2942 O O   . ALA A 1 383 ? 157.616 101.201 159.410 1.00 175.59 ?  460 ALA A O   1 
ATOM 2943 C CB  . ALA A 1 383 ? 154.511 101.639 158.594 1.00 151.71 ?  460 ALA A CB  1 
ATOM 2944 N N   . GLU A 1 384 ? 157.397 101.896 157.290 1.00 162.05 ?  461 GLU A N   1 
ATOM 2945 C CA  . GLU A 1 384 ? 158.590 101.200 156.862 1.00 156.13 ?  461 GLU A CA  1 
ATOM 2946 C C   . GLU A 1 384 ? 159.803 101.721 157.601 1.00 150.40 ?  461 GLU A C   1 
ATOM 2947 O O   . GLU A 1 384 ? 160.697 100.960 157.959 1.00 150.02 ?  461 GLU A O   1 
ATOM 2948 C CB  . GLU A 1 384 ? 158.790 101.360 155.363 1.00 169.28 ?  461 GLU A CB  1 
ATOM 2949 C CG  . GLU A 1 384 ? 157.697 100.727 154.534 1.00 179.75 ?  461 GLU A CG  1 
ATOM 2950 C CD  . GLU A 1 384 ? 157.893 100.966 153.053 1.00 188.87 ?  461 GLU A CD  1 
ATOM 2951 O OE1 . GLU A 1 384 ? 158.795 101.756 152.701 1.00 187.08 ?  461 GLU A OE1 1 
ATOM 2952 O OE2 . GLU A 1 384 ? 157.147 100.372 152.244 1.00 186.33 ?  461 GLU A OE2 1 
ATOM 2953 N N   . ASN A 1 385 ? 159.816 103.020 157.855 1.00 147.39 ?  462 ASN A N   1 
ATOM 2954 C CA  . ASN A 1 385 ? 160.907 103.603 158.603 1.00 149.58 ?  462 ASN A CA  1 
ATOM 2955 C C   . ASN A 1 385 ? 160.898 103.048 160.007 1.00 150.76 ?  462 ASN A C   1 
ATOM 2956 O O   . ASN A 1 385 ? 161.935 102.714 160.564 1.00 152.24 ?  462 ASN A O   1 
ATOM 2957 C CB  . ASN A 1 385 ? 160.778 105.117 158.660 1.00 146.00 ?  462 ASN A CB  1 
ATOM 2958 C CG  . ASN A 1 385 ? 161.995 105.783 159.252 1.00 138.78 ?  462 ASN A CG  1 
ATOM 2959 O OD1 . ASN A 1 385 ? 162.887 105.124 159.772 1.00 131.89 ?  462 ASN A OD1 1 
ATOM 2960 N ND2 . ASN A 1 385 ? 162.003 107.106 159.238 1.00 138.58 ?  462 ASN A ND2 1 
ATOM 2961 N N   . ILE A 1 386 ? 159.703 102.907 160.560 1.00 149.16 ?  463 ILE A N   1 
ATOM 2962 C CA  . ILE A 1 386 ? 159.570 102.597 161.969 1.00 151.96 ?  463 ILE A CA  1 
ATOM 2963 C C   . ILE A 1 386 ? 159.605 101.090 162.120 1.00 157.26 ?  463 ILE A C   1 
ATOM 2964 O O   . ILE A 1 386 ? 159.481 100.547 163.215 1.00 145.36 ?  463 ILE A O   1 
ATOM 2965 C CB  . ILE A 1 386 ? 158.282 103.173 162.545 1.00 160.53 ?  463 ILE A CB  1 
ATOM 2966 C CG1 . ILE A 1 386 ? 158.317 103.172 164.064 1.00 181.88 ?  463 ILE A CG1 1 
ATOM 2967 C CG2 . ILE A 1 386 ? 157.101 102.362 162.118 1.00 158.61 ?  463 ILE A CG2 1 
ATOM 2968 C CD1 . ILE A 1 386 ? 157.182 103.945 164.662 1.00 198.53 ?  463 ILE A CD1 1 
ATOM 2969 N N   . ASN A 1 387 ? 159.768 100.427 160.984 1.00 174.67 ?  464 ASN A N   1 
ATOM 2970 C CA  . ASN A 1 387 ? 159.821 98.979  160.921 1.00 179.26 ?  464 ASN A CA  1 
ATOM 2971 C C   . ASN A 1 387 ? 158.527 98.349  161.392 1.00 183.04 ?  464 ASN A C   1 
ATOM 2972 O O   . ASN A 1 387 ? 158.463 97.752  162.463 1.00 183.66 ?  464 ASN A O   1 
ATOM 2973 C CB  . ASN A 1 387 ? 160.992 98.441  161.741 1.00 176.67 ?  464 ASN A CB  1 
ATOM 2974 C CG  . ASN A 1 387 ? 162.327 98.790  161.134 1.00 171.44 ?  464 ASN A CG  1 
ATOM 2975 O OD1 . ASN A 1 387 ? 162.422 99.074  159.941 1.00 160.22 ?  464 ASN A OD1 1 
ATOM 2976 N ND2 . ASN A 1 387 ? 163.374 98.758  161.948 1.00 168.72 ?  464 ASN A ND2 1 
ATOM 2977 N N   . VAL A 1 388 ? 157.491 98.510  160.582 1.00 189.51 ?  465 VAL A N   1 
ATOM 2978 C CA  . VAL A 1 388 ? 156.253 97.773  160.757 1.00 193.62 ?  465 VAL A CA  1 
ATOM 2979 C C   . VAL A 1 388 ? 155.799 97.232  159.414 1.00 206.61 ?  465 VAL A C   1 
ATOM 2980 O O   . VAL A 1 388 ? 155.554 97.995  158.483 1.00 211.12 ?  465 VAL A O   1 
ATOM 2981 C CB  . VAL A 1 388 ? 155.149 98.637  161.349 1.00 175.90 ?  465 VAL A CB  1 
ATOM 2982 C CG1 . VAL A 1 388 ? 153.843 97.866  161.353 1.00 164.16 ?  465 VAL A CG1 1 
ATOM 2983 C CG2 . VAL A 1 388 ? 155.523 99.069  162.750 1.00 172.64 ?  465 VAL A CG2 1 
ATOM 2984 N N   . SER A 1 389 ? 155.685 95.913  159.319 1.00 208.91 ?  466 SER A N   1 
ATOM 2985 C CA  . SER A 1 389 ? 155.370 95.266  158.054 1.00 204.21 ?  466 SER A CA  1 
ATOM 2986 C C   . SER A 1 389 ? 154.787 93.875  158.267 1.00 210.40 ?  466 SER A C   1 
ATOM 2987 O O   . SER A 1 389 ? 155.017 93.252  159.301 1.00 214.69 ?  466 SER A O   1 
ATOM 2988 C CB  . SER A 1 389 ? 156.622 95.195  157.182 1.00 201.74 ?  466 SER A CB  1 
ATOM 2989 O OG  . SER A 1 389 ? 157.646 94.462  157.829 1.00 201.30 ?  466 SER A OG  1 
ATOM 2990 N N   . TYR A 1 390 ? 154.025 93.394  157.289 1.00 216.02 ?  467 TYR A N   1 
ATOM 2991 C CA  . TYR A 1 390 ? 153.307 92.133  157.443 1.00 220.85 ?  467 TYR A CA  1 
ATOM 2992 C C   . TYR A 1 390 ? 153.576 91.083  156.365 1.00 222.80 ?  467 TYR A C   1 
ATOM 2993 O O   . TYR A 1 390 ? 153.008 91.148  155.277 1.00 219.35 ?  467 TYR A O   1 
ATOM 2994 C CB  . TYR A 1 390 ? 151.808 92.402  157.498 1.00 219.89 ?  467 TYR A CB  1 
ATOM 2995 C CG  . TYR A 1 390 ? 151.395 93.263  158.658 1.00 218.74 ?  467 TYR A CG  1 
ATOM 2996 C CD1 . TYR A 1 390 ? 152.003 93.132  159.895 1.00 217.92 ?  467 TYR A CD1 1 
ATOM 2997 C CD2 . TYR A 1 390 ? 150.384 94.195  158.521 1.00 217.91 ?  467 TYR A CD2 1 
ATOM 2998 C CE1 . TYR A 1 390 ? 151.626 93.917  160.957 1.00 215.20 ?  467 TYR A CE1 1 
ATOM 2999 C CE2 . TYR A 1 390 ? 149.998 94.980  159.576 1.00 213.01 ?  467 TYR A CE2 1 
ATOM 3000 C CZ  . TYR A 1 390 ? 150.620 94.840  160.792 1.00 211.37 ?  467 TYR A CZ  1 
ATOM 3001 O OH  . TYR A 1 390 ? 150.226 95.631  161.843 1.00 203.14 ?  467 TYR A OH  1 
ATOM 3002 N N   . PRO A 1 391 ? 154.444 90.107  156.672 1.00 217.24 ?  468 PRO A N   1 
ATOM 3003 C CA  . PRO A 1 391 ? 154.552 88.874  155.885 1.00 211.57 ?  468 PRO A CA  1 
ATOM 3004 C C   . PRO A 1 391 ? 153.222 88.131  155.872 1.00 218.37 ?  468 PRO A C   1 
ATOM 3005 O O   . PRO A 1 391 ? 152.912 87.416  154.934 1.00 218.21 ?  468 PRO A O   1 
ATOM 3006 C CB  . PRO A 1 391 ? 155.622 88.075  156.631 1.00 206.44 ?  468 PRO A CB  1 
ATOM 3007 C CG  . PRO A 1 391 ? 155.536 88.574  158.031 1.00 206.91 ?  468 PRO A CG  1 
ATOM 3008 C CD  . PRO A 1 391 ? 155.242 90.041  157.903 1.00 213.82 ?  468 PRO A CD  1 
ATOM 3009 N N   . GLU A 1 392 ? 152.464 88.284  156.949 1.00 230.25 ?  469 GLU A N   1 
ATOM 3010 C CA  . GLU A 1 392 ? 151.104 87.780  157.026 1.00 236.51 ?  469 GLU A CA  1 
ATOM 3011 C C   . GLU A 1 392 ? 150.243 88.566  156.047 1.00 238.37 ?  469 GLU A C   1 
ATOM 3012 O O   . GLU A 1 392 ? 150.579 89.695  155.697 1.00 238.93 ?  469 GLU A O   1 
ATOM 3013 C CB  . GLU A 1 392 ? 150.581 87.907  158.447 1.00 239.47 ?  469 GLU A CB  1 
ATOM 3014 C CG  . GLU A 1 392 ? 150.527 89.334  158.912 1.00 242.17 ?  469 GLU A CG  1 
ATOM 3015 C CD  . GLU A 1 392 ? 150.183 89.461  160.372 1.00 243.15 ?  469 GLU A CD  1 
ATOM 3016 O OE1 . GLU A 1 392 ? 149.717 88.467  160.967 1.00 245.08 ?  469 GLU A OE1 1 
ATOM 3017 O OE2 . GLU A 1 392 ? 150.368 90.568  160.917 1.00 240.00 ?  469 GLU A OE2 1 
ATOM 3018 N N   . TRP A 1 393 ? 149.147 87.975  155.587 1.00 238.95 ?  470 TRP A N   1 
ATOM 3019 C CA  . TRP A 1 393 ? 148.548 88.454  154.351 1.00 238.73 ?  470 TRP A CA  1 
ATOM 3020 C C   . TRP A 1 393 ? 147.133 89.059  154.389 1.00 238.17 ?  470 TRP A C   1 
ATOM 3021 O O   . TRP A 1 393 ? 146.913 90.093  153.762 1.00 239.96 ?  470 TRP A O   1 
ATOM 3022 C CB  . TRP A 1 393 ? 148.584 87.306  153.351 1.00 237.76 ?  470 TRP A CB  1 
ATOM 3023 C CG  . TRP A 1 393 ? 149.986 86.862  153.115 1.00 237.98 ?  470 TRP A CG  1 
ATOM 3024 C CD1 . TRP A 1 393 ? 150.599 85.770  153.652 1.00 236.57 ?  470 TRP A CD1 1 
ATOM 3025 C CD2 . TRP A 1 393 ? 150.979 87.541  152.343 1.00 239.67 ?  470 TRP A CD2 1 
ATOM 3026 N NE1 . TRP A 1 393 ? 151.903 85.704  153.227 1.00 238.70 ?  470 TRP A NE1 1 
ATOM 3027 C CE2 . TRP A 1 393 ? 152.157 86.777  152.414 1.00 240.24 ?  470 TRP A CE2 1 
ATOM 3028 C CE3 . TRP A 1 393 ? 150.979 88.707  151.575 1.00 236.35 ?  470 TRP A CE3 1 
ATOM 3029 C CZ2 . TRP A 1 393 ? 153.329 87.152  151.768 1.00 237.56 ?  470 TRP A CZ2 1 
ATOM 3030 C CZ3 . TRP A 1 393 ? 152.140 89.072  150.924 1.00 235.25 ?  470 TRP A CZ3 1 
ATOM 3031 C CH2 . TRP A 1 393 ? 153.299 88.298  151.025 1.00 235.85 ?  470 TRP A CH2 1 
ATOM 3032 N N   . LEU A 1 394 ? 146.175 88.445  155.082 1.00 230.87 ?  471 LEU A N   1 
ATOM 3033 C CA  . LEU A 1 394 ? 144.805 88.973  155.037 1.00 221.14 ?  471 LEU A CA  1 
ATOM 3034 C C   . LEU A 1 394 ? 144.725 90.392  155.586 1.00 206.16 ?  471 LEU A C   1 
ATOM 3035 O O   . LEU A 1 394 ? 145.134 90.652  156.717 1.00 196.41 ?  471 LEU A O   1 
ATOM 3036 C CB  . LEU A 1 394 ? 143.844 88.082  155.818 1.00 229.49 ?  471 LEU A CB  1 
ATOM 3037 C CG  . LEU A 1 394 ? 142.420 88.625  155.899 1.00 235.84 ?  471 LEU A CG  1 
ATOM 3038 C CD1 . LEU A 1 394 ? 141.768 88.600  154.526 1.00 239.95 ?  471 LEU A CD1 1 
ATOM 3039 C CD2 . LEU A 1 394 ? 141.586 87.882  156.927 1.00 233.66 ?  471 LEU A CD2 1 
ATOM 3040 N N   . ALA A 1 395 ? 144.175 91.298  154.783 1.00 198.79 ?  472 ALA A N   1 
ATOM 3041 C CA  . ALA A 1 395 ? 144.102 92.713  155.142 1.00 196.87 ?  472 ALA A CA  1 
ATOM 3042 C C   . ALA A 1 395 ? 143.294 92.984  156.416 1.00 186.49 ?  472 ALA A C   1 
ATOM 3043 O O   . ALA A 1 395 ? 143.738 93.753  157.264 1.00 182.43 ?  472 ALA A O   1 
ATOM 3044 C CB  . ALA A 1 395 ? 143.553 93.529  153.970 1.00 201.76 ?  472 ALA A CB  1 
ATOM 3045 N N   . PRO A 1 396 ? 142.098 92.383  156.550 1.00 178.62 ?  473 PRO A N   1 
ATOM 3046 C CA  . PRO A 1 396 ? 141.431 92.587  157.835 1.00 178.13 ?  473 PRO A CA  1 
ATOM 3047 C C   . PRO A 1 396 ? 142.101 91.860  158.989 1.00 190.85 ?  473 PRO A C   1 
ATOM 3048 O O   . PRO A 1 396 ? 143.174 92.256  159.431 1.00 182.93 ?  473 PRO A O   1 
ATOM 3049 C CB  . PRO A 1 396 ? 140.033 92.018  157.594 1.00 177.97 ?  473 PRO A CB  1 
ATOM 3050 C CG  . PRO A 1 396 ? 139.826 92.163  156.149 1.00 175.36 ?  473 PRO A CG  1 
ATOM 3051 C CD  . PRO A 1 396 ? 141.155 91.867  155.544 1.00 176.10 ?  473 PRO A CD  1 
ATOM 3052 N N   . GLU A 1 397 ? 141.478 90.778  159.438 1.00 216.97 ?  474 GLU A N   1 
ATOM 3053 C CA  . GLU A 1 397 ? 141.769 90.209  160.746 1.00 232.78 ?  474 GLU A CA  1 
ATOM 3054 C C   . GLU A 1 397 ? 143.214 89.792  160.926 1.00 234.71 ?  474 GLU A C   1 
ATOM 3055 O O   . GLU A 1 397 ? 143.767 89.927  162.016 1.00 233.14 ?  474 GLU A O   1 
ATOM 3056 C CB  . GLU A 1 397 ? 140.880 88.993  160.985 1.00 241.57 ?  474 GLU A CB  1 
ATOM 3057 C CG  . GLU A 1 397 ? 139.409 89.314  161.068 1.00 247.11 ?  474 GLU A CG  1 
ATOM 3058 C CD  . GLU A 1 397 ? 138.559 88.069  161.175 1.00 250.11 ?  474 GLU A CD  1 
ATOM 3059 O OE1 . GLU A 1 397 ? 139.103 86.962  160.979 1.00 252.26 ?  474 GLU A OE1 1 
ATOM 3060 O OE2 . GLU A 1 397 ? 137.349 88.194  161.455 1.00 248.89 ?  474 GLU A OE2 1 
ATOM 3061 N N   . GLU A 1 398 ? 143.830 89.304  159.857 1.00 239.51 ?  475 GLU A N   1 
ATOM 3062 C CA  . GLU A 1 398 ? 145.189 88.798  159.964 1.00 240.92 ?  475 GLU A CA  1 
ATOM 3063 C C   . GLU A 1 398 ? 146.122 89.945  160.294 1.00 237.19 ?  475 GLU A C   1 
ATOM 3064 O O   . GLU A 1 398 ? 147.132 89.763  160.967 1.00 237.10 ?  475 GLU A O   1 
ATOM 3065 C CB  . GLU A 1 398 ? 145.621 88.094  158.677 1.00 242.35 ?  475 GLU A CB  1 
ATOM 3066 C CG  . GLU A 1 398 ? 146.976 87.400  158.748 1.00 241.12 ?  475 GLU A CG  1 
ATOM 3067 C CD  . GLU A 1 398 ? 147.313 86.647  157.473 1.00 240.46 ?  475 GLU A CD  1 
ATOM 3068 O OE1 . GLU A 1 398 ? 146.518 86.709  156.517 1.00 238.55 ?  475 GLU A OE1 1 
ATOM 3069 O OE2 . GLU A 1 398 ? 148.373 85.989  157.419 1.00 240.77 ?  475 GLU A OE2 1 
ATOM 3070 N N   . ASP A 1 399 ? 145.773 91.135  159.831 1.00 232.85 ?  476 ASP A N   1 
ATOM 3071 C CA  . ASP A 1 399 ? 146.586 92.298  160.126 1.00 231.11 ?  476 ASP A CA  1 
ATOM 3072 C C   . ASP A 1 399 ? 146.154 92.970  161.416 1.00 217.78 ?  476 ASP A C   1 
ATOM 3073 O O   . ASP A 1 399 ? 146.983 93.409  162.208 1.00 212.02 ?  476 ASP A O   1 
ATOM 3074 C CB  . ASP A 1 399 ? 146.520 93.286  158.970 1.00 239.16 ?  476 ASP A CB  1 
ATOM 3075 C CG  . ASP A 1 399 ? 147.231 92.779  157.739 1.00 242.88 ?  476 ASP A CG  1 
ATOM 3076 O OD1 . ASP A 1 399 ? 148.025 91.826  157.869 1.00 244.80 ?  476 ASP A OD1 1 
ATOM 3077 O OD2 . ASP A 1 399 ? 146.996 93.328  156.643 1.00 242.06 ?  476 ASP A OD2 1 
ATOM 3078 N N   . LEU A 1 400 ? 144.846 93.023  161.628 1.00 213.07 ?  477 LEU A N   1 
ATOM 3079 C CA  . LEU A 1 400 ? 144.274 93.758  162.744 1.00 216.19 ?  477 LEU A CA  1 
ATOM 3080 C C   . LEU A 1 400 ? 144.708 93.170  164.068 1.00 214.87 ?  477 LEU A C   1 
ATOM 3081 O O   . LEU A 1 400 ? 144.766 93.863  165.080 1.00 212.55 ?  477 LEU A O   1 
ATOM 3082 C CB  . LEU A 1 400 ? 142.752 93.759  162.651 1.00 227.43 ?  477 LEU A CB  1 
ATOM 3083 C CG  . LEU A 1 400 ? 142.184 94.497  161.445 1.00 234.96 ?  477 LEU A CG  1 
ATOM 3084 C CD1 . LEU A 1 400 ? 140.688 94.283  161.363 1.00 238.32 ?  477 LEU A CD1 1 
ATOM 3085 C CD2 . LEU A 1 400 ? 142.511 95.974  161.534 1.00 232.89 ?  477 LEU A CD2 1 
ATOM 3086 N N   . ASN A 1 401 ? 145.017 91.884  164.050 1.00 221.05 ?  478 ASN A N   1 
ATOM 3087 C CA  . ASN A 1 401 ? 145.331 91.177  165.271 1.00 224.37 ?  478 ASN A CA  1 
ATOM 3088 C C   . ASN A 1 401 ? 146.685 90.504  165.183 1.00 212.89 ?  478 ASN A C   1 
ATOM 3089 O O   . ASN A 1 401 ? 146.777 89.324  164.859 1.00 204.89 ?  478 ASN A O   1 
ATOM 3090 C CB  . ASN A 1 401 ? 144.240 90.155  165.561 1.00 231.40 ?  478 ASN A CB  1 
ATOM 3091 C CG  . ASN A 1 401 ? 142.913 90.807  165.873 1.00 236.08 ?  478 ASN A CG  1 
ATOM 3092 O OD1 . ASN A 1 401 ? 142.691 91.280  166.984 1.00 237.42 ?  478 ASN A OD1 1 
ATOM 3093 N ND2 . ASN A 1 401 ? 142.029 90.854  164.885 1.00 238.93 ?  478 ASN A ND2 1 
ATOM 3094 N N   . PHE A 1 402 ? 147.739 91.254  165.474 1.00 203.87 ?  479 PHE A N   1 
ATOM 3095 C CA  . PHE A 1 402 ? 149.083 90.709  165.379 1.00 198.90 ?  479 PHE A CA  1 
ATOM 3096 C C   . PHE A 1 402 ? 150.080 91.461  166.249 1.00 179.26 ?  479 PHE A C   1 
ATOM 3097 O O   . PHE A 1 402 ? 149.936 92.652  166.480 1.00 171.52 ?  479 PHE A O   1 
ATOM 3098 C CB  . PHE A 1 402 ? 149.535 90.718  163.928 1.00 206.37 ?  479 PHE A CB  1 
ATOM 3099 C CG  . PHE A 1 402 ? 150.925 90.223  163.731 1.00 211.38 ?  479 PHE A CG  1 
ATOM 3100 C CD1 . PHE A 1 402 ? 151.210 88.878  163.829 1.00 215.16 ?  479 PHE A CD1 1 
ATOM 3101 C CD2 . PHE A 1 402 ? 151.941 91.094  163.403 1.00 205.66 ?  479 PHE A CD2 1 
ATOM 3102 C CE1 . PHE A 1 402 ? 152.491 88.414  163.639 1.00 208.49 ?  479 PHE A CE1 1 
ATOM 3103 C CE2 . PHE A 1 402 ? 153.223 90.634  163.203 1.00 203.81 ?  479 PHE A CE2 1 
ATOM 3104 C CZ  . PHE A 1 402 ? 153.499 89.294  163.325 1.00 204.90 ?  479 PHE A CZ  1 
ATOM 3105 N N   . VAL A 1 403 ? 151.094 90.748  166.724 1.00 175.35 ?  480 VAL A N   1 
ATOM 3106 C CA  . VAL A 1 403 ? 152.051 91.286  167.685 1.00 175.55 ?  480 VAL A CA  1 
ATOM 3107 C C   . VAL A 1 403 ? 152.893 92.432  167.127 1.00 175.48 ?  480 VAL A C   1 
ATOM 3108 O O   . VAL A 1 403 ? 153.257 93.363  167.849 1.00 183.79 ?  480 VAL A O   1 
ATOM 3109 C CB  . VAL A 1 403 ? 153.000 90.169  168.179 1.00 177.11 ?  480 VAL A CB  1 
ATOM 3110 C CG1 . VAL A 1 403 ? 154.044 90.716  169.136 1.00 171.96 ?  480 VAL A CG1 1 
ATOM 3111 C CG2 . VAL A 1 403 ? 152.207 89.055  168.833 1.00 181.89 ?  480 VAL A CG2 1 
ATOM 3112 N N   . THR A 1 404 ? 153.162 92.371  165.829 1.00 174.74 ?  481 THR A N   1 
ATOM 3113 C CA  . THR A 1 404 ? 154.159 93.217  165.176 1.00 182.23 ?  481 THR A CA  1 
ATOM 3114 C C   . THR A 1 404 ? 155.478 93.122  165.921 1.00 183.25 ?  481 THR A C   1 
ATOM 3115 O O   . THR A 1 404 ? 155.845 92.059  166.416 1.00 192.58 ?  481 THR A O   1 
ATOM 3116 C CB  . THR A 1 404 ? 153.732 94.681  165.102 1.00 182.35 ?  481 THR A CB  1 
ATOM 3117 O OG1 . THR A 1 404 ? 153.635 95.211  166.426 1.00 180.55 ?  481 THR A OG1 1 
ATOM 3118 C CG2 . THR A 1 404 ? 152.386 94.796  164.419 1.00 182.24 ?  481 THR A CG2 1 
ATOM 3119 N N   . ASP A 1 405 ? 156.183 94.240  166.008 1.00 170.08 ?  482 ASP A N   1 
ATOM 3120 C CA  . ASP A 1 405 ? 157.497 94.257  166.629 1.00 158.82 ?  482 ASP A CA  1 
ATOM 3121 C C   . ASP A 1 405 ? 157.535 95.295  167.730 1.00 150.57 ?  482 ASP A C   1 
ATOM 3122 O O   . ASP A 1 405 ? 157.593 94.982  168.918 1.00 140.25 ?  482 ASP A O   1 
ATOM 3123 C CB  . ASP A 1 405 ? 158.575 94.572  165.594 1.00 162.34 ?  482 ASP A CB  1 
ATOM 3124 C CG  . ASP A 1 405 ? 158.680 93.514  164.518 1.00 158.80 ?  482 ASP A CG  1 
ATOM 3125 O OD1 . ASP A 1 405 ? 158.130 92.409  164.709 1.00 153.99 ?  482 ASP A OD1 1 
ATOM 3126 O OD2 . ASP A 1 405 ? 159.313 93.791  163.477 1.00 153.03 ?  482 ASP A OD2 1 
ATOM 3127 N N   . THR A 1 406 ? 157.479 96.544  167.294 1.00 159.16 ?  483 THR A N   1 
ATOM 3128 C CA  . THR A 1 406 ? 157.614 97.702  168.152 1.00 174.25 ?  483 THR A CA  1 
ATOM 3129 C C   . THR A 1 406 ? 156.500 97.776  169.173 1.00 172.24 ?  483 THR A C   1 
ATOM 3130 O O   . THR A 1 406 ? 156.645 98.408  170.214 1.00 175.37 ?  483 THR A O   1 
ATOM 3131 C CB  . THR A 1 406 ? 157.604 98.977  167.324 1.00 185.55 ?  483 THR A CB  1 
ATOM 3132 O OG1 . THR A 1 406 ? 156.357 99.062  166.625 1.00 192.63 ?  483 THR A OG1 1 
ATOM 3133 C CG2 . THR A 1 406 ? 158.726 98.944  166.304 1.00 190.40 ?  483 THR A CG2 1 
ATOM 3134 N N   . ALA A 1 407 ? 155.381 97.133  168.868 1.00 165.18 ?  484 ALA A N   1 
ATOM 3135 C CA  . ALA A 1 407 ? 154.230 97.183  169.753 1.00 156.27 ?  484 ALA A CA  1 
ATOM 3136 C C   . ALA A 1 407 ? 154.595 96.626  171.108 1.00 156.01 ?  484 ALA A C   1 
ATOM 3137 O O   . ALA A 1 407 ? 154.073 97.055  172.129 1.00 148.48 ?  484 ALA A O   1 
ATOM 3138 C CB  . ALA A 1 407 ? 153.077 96.414  169.172 1.00 152.77 ?  484 ALA A CB  1 
ATOM 3139 N N   . LYS A 1 408 ? 155.517 95.681  171.111 1.00 166.46 ?  485 LYS A N   1 
ATOM 3140 C CA  . LYS A 1 408 ? 156.038 95.168  172.355 1.00 172.51 ?  485 LYS A CA  1 
ATOM 3141 C C   . LYS A 1 408 ? 156.812 96.248  173.090 1.00 168.70 ?  485 LYS A C   1 
ATOM 3142 O O   . LYS A 1 408 ? 156.929 96.205  174.304 1.00 165.88 ?  485 LYS A O   1 
ATOM 3143 C CB  . LYS A 1 408 ? 156.912 93.950  172.094 1.00 186.23 ?  485 LYS A CB  1 
ATOM 3144 C CG  . LYS A 1 408 ? 156.106 92.748  171.658 1.00 193.64 ?  485 LYS A CG  1 
ATOM 3145 C CD  . LYS A 1 408 ? 156.997 91.576  171.341 1.00 190.98 ?  485 LYS A CD  1 
ATOM 3146 C CE  . LYS A 1 408 ? 157.835 91.871  170.116 1.00 187.47 ?  485 LYS A CE  1 
ATOM 3147 N NZ  . LYS A 1 408 ? 156.979 92.063  168.916 1.00 184.81 ?  485 LYS A NZ  1 
ATOM 3148 N N   . ALA A 1 409 ? 157.331 97.224  172.357 1.00 168.57 ?  486 ALA A N   1 
ATOM 3149 C CA  . ALA A 1 409 ? 158.120 98.282  172.976 1.00 169.40 ?  486 ALA A CA  1 
ATOM 3150 C C   . ALA A 1 409 ? 157.243 99.423  173.471 1.00 162.58 ?  486 ALA A C   1 
ATOM 3151 O O   . ALA A 1 409 ? 157.333 99.861  174.629 1.00 151.57 ?  486 ALA A O   1 
ATOM 3152 C CB  . ALA A 1 409 ? 159.146 98.802  171.993 1.00 169.38 ?  486 ALA A CB  1 
ATOM 3153 N N   . LEU A 1 410 ? 156.392 99.908  172.580 1.00 165.48 ?  487 LEU A N   1 
ATOM 3154 C CA  . LEU A 1 410 ? 155.577 101.066 172.886 1.00 172.57 ?  487 LEU A CA  1 
ATOM 3155 C C   . LEU A 1 410 ? 154.605 100.758 174.001 1.00 181.89 ?  487 LEU A C   1 
ATOM 3156 O O   . LEU A 1 410 ? 154.282 101.625 174.810 1.00 181.10 ?  487 LEU A O   1 
ATOM 3157 C CB  . LEU A 1 410 ? 154.824 101.538 171.650 1.00 165.40 ?  487 LEU A CB  1 
ATOM 3158 C CG  . LEU A 1 410 ? 155.621 102.470 170.744 1.00 155.02 ?  487 LEU A CG  1 
ATOM 3159 C CD1 . LEU A 1 410 ? 156.792 101.753 170.105 1.00 152.60 ?  487 LEU A CD1 1 
ATOM 3160 C CD2 . LEU A 1 410 ? 154.712 103.049 169.688 1.00 149.21 ?  487 LEU A CD2 1 
ATOM 3161 N N   . ALA A 1 411 ? 154.146 99.515  174.054 1.00 177.42 ?  488 ALA A N   1 
ATOM 3162 C CA  . ALA A 1 411 ? 153.268 99.109  175.135 1.00 183.37 ?  488 ALA A CA  1 
ATOM 3163 C C   . ALA A 1 411 ? 154.020 99.223  176.442 1.00 185.81 ?  488 ALA A C   1 
ATOM 3164 O O   . ALA A 1 411 ? 153.452 99.586  177.473 1.00 185.18 ?  488 ALA A O   1 
ATOM 3165 C CB  . ALA A 1 411 ? 152.770 97.697  174.926 1.00 187.25 ?  488 ALA A CB  1 
ATOM 3166 N N   . ASP A 1 412 ? 155.317 98.941  176.385 1.00 187.76 ?  489 ASP A N   1 
ATOM 3167 C CA  . ASP A 1 412 ? 156.126 98.966  177.585 1.00 191.22 ?  489 ASP A CA  1 
ATOM 3168 C C   . ASP A 1 412 ? 156.268 100.384 178.079 1.00 169.55 ?  489 ASP A C   1 
ATOM 3169 O O   . ASP A 1 412 ? 155.973 100.686 179.238 1.00 172.97 ?  489 ASP A O   1 
ATOM 3170 C CB  . ASP A 1 412 ? 157.509 98.376  177.331 1.00 213.89 ?  489 ASP A CB  1 
ATOM 3171 C CG  . ASP A 1 412 ? 157.460 96.913  176.984 1.00 216.67 ?  489 ASP A CG  1 
ATOM 3172 O OD1 . ASP A 1 412 ? 156.388 96.297  177.148 1.00 217.40 ?  489 ASP A OD1 1 
ATOM 3173 O OD2 . ASP A 1 412 ? 158.498 96.374  176.547 1.00 216.74 ?  489 ASP A OD2 1 
ATOM 3174 N N   . VAL A 1 413 ? 156.702 101.267 177.192 1.00 163.18 ?  490 VAL A N   1 
ATOM 3175 C CA  . VAL A 1 413 ? 156.945 102.627 177.626 1.00 149.02 ?  490 VAL A CA  1 
ATOM 3176 C C   . VAL A 1 413 ? 155.638 103.278 178.053 1.00 141.35 ?  490 VAL A C   1 
ATOM 3177 O O   . VAL A 1 413 ? 155.601 104.106 178.969 1.00 141.45 ?  490 VAL A O   1 
ATOM 3178 C CB  . VAL A 1 413 ? 157.623 103.441 176.531 1.00 142.95 ?  490 VAL A CB  1 
ATOM 3179 C CG1 . VAL A 1 413 ? 156.777 103.456 175.281 1.00 146.20 ?  490 VAL A CG1 1 
ATOM 3180 C CG2 . VAL A 1 413 ? 157.889 104.848 177.009 1.00 133.81 ?  490 VAL A CG2 1 
ATOM 3181 N N   . ALA A 1 414 ? 154.552 102.874 177.414 1.00 142.48 ?  491 ALA A N   1 
ATOM 3182 C CA  . ALA A 1 414 ? 153.258 103.370 177.817 1.00 138.32 ?  491 ALA A CA  1 
ATOM 3183 C C   . ALA A 1 414 ? 152.952 102.886 179.216 1.00 139.52 ?  491 ALA A C   1 
ATOM 3184 O O   . ALA A 1 414 ? 152.374 103.609 180.024 1.00 137.15 ?  491 ALA A O   1 
ATOM 3185 C CB  . ALA A 1 414 ? 152.194 102.916 176.855 1.00 142.39 ?  491 ALA A CB  1 
ATOM 3186 N N   . THR A 1 415 ? 153.377 101.665 179.512 1.00 136.82 ?  492 THR A N   1 
ATOM 3187 C CA  . THR A 1 415 ? 153.083 101.090 180.808 1.00 161.98 ?  492 THR A CA  1 
ATOM 3188 C C   . THR A 1 415 ? 153.826 101.849 181.882 1.00 148.27 ?  492 THR A C   1 
ATOM 3189 O O   . THR A 1 415 ? 153.230 102.272 182.868 1.00 148.24 ?  492 THR A O   1 
ATOM 3190 C CB  . THR A 1 415 ? 153.461 99.607  180.879 1.00 196.54 ?  492 THR A CB  1 
ATOM 3191 O OG1 . THR A 1 415 ? 152.701 98.874  179.912 1.00 199.18 ?  492 THR A OG1 1 
ATOM 3192 C CG2 . THR A 1 415 ? 153.167 99.059  182.259 1.00 197.23 ?  492 THR A CG2 1 
ATOM 3193 N N   . VAL A 1 416 ? 155.120 102.059 181.671 1.00 152.14 ?  493 VAL A N   1 
ATOM 3194 C CA  . VAL A 1 416 ? 155.912 102.719 182.692 1.00 143.72 ?  493 VAL A CA  1 
ATOM 3195 C C   . VAL A 1 416 ? 155.407 104.129 182.866 1.00 140.47 ?  493 VAL A C   1 
ATOM 3196 O O   . VAL A 1 416 ? 155.416 104.667 183.969 1.00 139.19 ?  493 VAL A O   1 
ATOM 3197 C CB  . VAL A 1 416 ? 157.415 102.752 182.355 1.00 155.64 ?  493 VAL A CB  1 
ATOM 3198 C CG1 . VAL A 1 416 ? 157.935 101.357 182.166 1.00 152.62 ?  493 VAL A CG1 1 
ATOM 3199 C CG2 . VAL A 1 416 ? 157.696 103.592 181.132 1.00 157.95 ?  493 VAL A CG2 1 
ATOM 3200 N N   . LEU A 1 417 ? 154.929 104.716 181.779 1.00 139.92 ?  494 LEU A N   1 
ATOM 3201 C CA  . LEU A 1 417 ? 154.476 106.083 181.855 1.00 144.84 ?  494 LEU A CA  1 
ATOM 3202 C C   . LEU A 1 417 ? 153.219 106.160 182.687 1.00 155.17 ?  494 LEU A C   1 
ATOM 3203 O O   . LEU A 1 417 ? 153.112 106.979 183.593 1.00 153.65 ?  494 LEU A O   1 
ATOM 3204 C CB  . LEU A 1 417 ? 154.224 106.647 180.464 1.00 140.58 ?  494 LEU A CB  1 
ATOM 3205 C CG  . LEU A 1 417 ? 153.914 108.142 180.429 1.00 130.73 ?  494 LEU A CG  1 
ATOM 3206 C CD1 . LEU A 1 417 ? 154.443 108.736 179.152 1.00 132.72 ?  494 LEU A CD1 1 
ATOM 3207 C CD2 . LEU A 1 417 ? 152.427 108.402 180.537 1.00 128.29 ?  494 LEU A CD2 1 
ATOM 3208 N N   . GLY A 1 418 ? 152.267 105.295 182.378 1.00 160.57 ?  495 GLY A N   1 
ATOM 3209 C CA  . GLY A 1 418 ? 150.983 105.378 183.031 1.00 165.59 ?  495 GLY A CA  1 
ATOM 3210 C C   . GLY A 1 418 ? 151.143 105.041 184.490 1.00 166.35 ?  495 GLY A C   1 
ATOM 3211 O O   . GLY A 1 418 ? 150.505 105.636 185.356 1.00 153.73 ?  495 GLY A O   1 
ATOM 3212 N N   . ARG A 1 419 ? 152.018 104.085 184.762 1.00 169.65 ?  496 ARG A N   1 
ATOM 3213 C CA  . ARG A 1 419 ? 152.263 103.681 186.128 1.00 176.75 ?  496 ARG A CA  1 
ATOM 3214 C C   . ARG A 1 419 ? 152.885 104.864 186.852 1.00 183.48 ?  496 ARG A C   1 
ATOM 3215 O O   . ARG A 1 419 ? 152.588 105.128 188.022 1.00 186.05 ?  496 ARG A O   1 
ATOM 3216 C CB  . ARG A 1 419 ? 153.165 102.447 186.167 1.00 175.90 ?  496 ARG A CB  1 
ATOM 3217 C CG  . ARG A 1 419 ? 153.249 101.761 187.518 1.00 177.58 ?  496 ARG A CG  1 
ATOM 3218 C CD  . ARG A 1 419 ? 154.182 100.549 187.486 1.00 181.12 ?  496 ARG A CD  1 
ATOM 3219 N NE  . ARG A 1 419 ? 153.726 99.479  186.598 1.00 184.58 ?  496 ARG A NE  1 
ATOM 3220 C CZ  . ARG A 1 419 ? 152.843 98.545  186.935 1.00 184.84 ?  496 ARG A CZ  1 
ATOM 3221 N NH1 . ARG A 1 419 ? 152.291 98.548  188.139 1.00 183.37 ?  496 ARG A NH1 1 
ATOM 3222 N NH2 . ARG A 1 419 ? 152.499 97.612  186.061 1.00 185.29 ?  496 ARG A NH2 1 
ATOM 3223 N N   . ALA A 1 420 ? 153.704 105.615 186.122 1.00 191.82 ?  497 ALA A N   1 
ATOM 3224 C CA  . ALA A 1 420 ? 154.328 106.801 186.680 1.00 191.27 ?  497 ALA A CA  1 
ATOM 3225 C C   . ALA A 1 420 ? 153.267 107.826 187.007 1.00 180.21 ?  497 ALA A C   1 
ATOM 3226 O O   . ALA A 1 420 ? 153.392 108.581 187.964 1.00 175.76 ?  497 ALA A O   1 
ATOM 3227 C CB  . ALA A 1 420 ? 155.343 107.375 185.723 1.00 200.14 ?  497 ALA A CB  1 
ATOM 3228 N N   . LEU A 1 421 ? 152.209 107.837 186.210 1.00 183.21 ?  498 LEU A N   1 
ATOM 3229 C CA  . LEU A 1 421 ? 151.111 108.739 186.465 1.00 175.45 ?  498 LEU A CA  1 
ATOM 3230 C C   . LEU A 1 421 ? 150.428 108.331 187.745 1.00 180.65 ?  498 LEU A C   1 
ATOM 3231 O O   . LEU A 1 421 ? 150.155 109.159 188.606 1.00 180.17 ?  498 LEU A O   1 
ATOM 3232 C CB  . LEU A 1 421 ? 150.123 108.716 185.314 1.00 167.19 ?  498 LEU A CB  1 
ATOM 3233 C CG  . LEU A 1 421 ? 150.755 109.122 183.991 1.00 155.56 ?  498 LEU A CG  1 
ATOM 3234 C CD1 . LEU A 1 421 ? 149.752 109.000 182.863 1.00 150.26 ?  498 LEU A CD1 1 
ATOM 3235 C CD2 . LEU A 1 421 ? 151.304 110.527 184.096 1.00 156.37 ?  498 LEU A CD2 1 
ATOM 3236 N N   . TYR A 1 422 ? 150.193 107.032 187.875 1.00 180.74 ?  499 TYR A N   1 
ATOM 3237 C CA  . TYR A 1 422 ? 149.497 106.512 189.031 1.00 188.65 ?  499 TYR A CA  1 
ATOM 3238 C C   . TYR A 1 422 ? 150.246 106.810 190.305 1.00 196.61 ?  499 TYR A C   1 
ATOM 3239 O O   . TYR A 1 422 ? 149.636 107.086 191.334 1.00 195.04 ?  499 TYR A O   1 
ATOM 3240 C CB  . TYR A 1 422 ? 149.294 105.006 188.904 1.00 192.05 ?  499 TYR A CB  1 
ATOM 3241 C CG  . TYR A 1 422 ? 148.894 104.351 190.203 1.00 193.01 ?  499 TYR A CG  1 
ATOM 3242 C CD1 . TYR A 1 422 ? 147.598 104.440 190.685 1.00 191.51 ?  499 TYR A CD1 1 
ATOM 3243 C CD2 . TYR A 1 422 ? 149.823 103.647 190.955 1.00 195.10 ?  499 TYR A CD2 1 
ATOM 3244 C CE1 . TYR A 1 422 ? 147.238 103.841 191.881 1.00 191.71 ?  499 TYR A CE1 1 
ATOM 3245 C CE2 . TYR A 1 422 ? 149.474 103.046 192.145 1.00 195.13 ?  499 TYR A CE2 1 
ATOM 3246 C CZ  . TYR A 1 422 ? 148.182 103.142 192.605 1.00 196.34 ?  499 TYR A CZ  1 
ATOM 3247 O OH  . TYR A 1 422 ? 147.843 102.539 193.798 1.00 200.32 ?  499 TYR A OH  1 
ATOM 3248 N N   . GLU A 1 423 ? 151.570 106.773 190.246 1.00 186.78 ?  500 GLU A N   1 
ATOM 3249 C CA  . GLU A 1 423 ? 152.320 107.170 191.421 1.00 205.62 ?  500 GLU A CA  1 
ATOM 3250 C C   . GLU A 1 423 ? 152.134 108.656 191.606 1.00 202.28 ?  500 GLU A C   1 
ATOM 3251 O O   . GLU A 1 423 ? 151.817 109.130 192.694 1.00 206.22 ?  500 GLU A O   1 
ATOM 3252 C CB  . GLU A 1 423 ? 153.804 106.842 191.293 1.00 223.00 ?  500 GLU A CB  1 
ATOM 3253 C CG  . GLU A 1 423 ? 154.602 107.199 192.543 1.00 181.10 ?  500 GLU A CG  1 
ATOM 3254 C CD  . GLU A 1 423 ? 156.079 106.870 192.427 1.00 180.86 ?  500 GLU A CD  1 
ATOM 3255 O OE1 . GLU A 1 423 ? 156.509 106.418 191.348 1.00 180.92 ?  500 GLU A OE1 1 
ATOM 3256 O OE2 . GLU A 1 423 ? 156.813 107.060 193.418 1.00 176.99 ?  500 GLU A OE2 1 
ATOM 3257 N N   . LEU A 1 424 ? 152.307 109.385 190.513 1.00 204.89 ?  501 LEU A N   1 
ATOM 3258 C CA  . LEU A 1 424 ? 152.239 110.830 190.551 1.00 192.47 ?  501 LEU A CA  1 
ATOM 3259 C C   . LEU A 1 424 ? 150.823 111.264 190.870 1.00 189.72 ?  501 LEU A C   1 
ATOM 3260 O O   . LEU A 1 424 ? 150.598 112.348 191.400 1.00 188.90 ?  501 LEU A O   1 
ATOM 3261 C CB  . LEU A 1 424 ? 152.709 111.421 189.229 1.00 181.21 ?  501 LEU A CB  1 
ATOM 3262 C CG  . LEU A 1 424 ? 152.670 112.941 189.153 1.00 164.17 ?  501 LEU A CG  1 
ATOM 3263 C CD1 . LEU A 1 424 ? 153.557 113.536 190.221 1.00 157.57 ?  501 LEU A CD1 1 
ATOM 3264 C CD2 . LEU A 1 424 ? 153.119 113.391 187.788 1.00 159.54 ?  501 LEU A CD2 1 
ATOM 3265 N N   . ALA A 1 425 ? 149.870 110.394 190.570 1.00 191.68 ?  502 ALA A N   1 
ATOM 3266 C CA  . ALA A 1 425 ? 148.486 110.658 190.908 1.00 191.99 ?  502 ALA A CA  1 
ATOM 3267 C C   . ALA A 1 425 ? 148.341 110.746 192.415 1.00 198.61 ?  502 ALA A C   1 
ATOM 3268 O O   . ALA A 1 425 ? 147.439 111.405 192.928 1.00 200.26 ?  502 ALA A O   1 
ATOM 3269 C CB  . ALA A 1 425 ? 147.588 109.577 190.353 1.00 189.13 ?  502 ALA A CB  1 
ATOM 3270 N N   . GLY A 1 426 ? 149.261 110.099 193.121 1.00 196.40 ?  503 GLY A N   1 
ATOM 3271 C CA  . GLY A 1 426 ? 149.171 109.981 194.560 1.00 198.11 ?  503 GLY A CA  1 
ATOM 3272 C C   . GLY A 1 426 ? 148.686 108.598 194.930 1.00 200.93 ?  503 GLY A C   1 
ATOM 3273 O O   . GLY A 1 426 ? 148.437 108.304 196.096 1.00 202.14 ?  503 GLY A O   1 
ATOM 3274 N N   . GLY A 1 427 ? 148.543 107.746 193.922 1.00 205.42 ?  504 GLY A N   1 
ATOM 3275 C CA  . GLY A 1 427 ? 148.138 106.373 194.144 1.00 211.14 ?  504 GLY A CA  1 
ATOM 3276 C C   . GLY A 1 427 ? 149.340 105.474 194.336 1.00 215.84 ?  504 GLY A C   1 
ATOM 3277 O O   . GLY A 1 427 ? 150.342 105.611 193.635 1.00 220.60 ?  504 GLY A O   1 
ATOM 3278 N N   . ASP A 1 428 ? 149.997 100.017 192.611 1.00 172.89 ?  509 ASP A N   1 
ATOM 3279 C CA  . ASP A 1 428 ? 149.225 98.844  192.233 1.00 172.83 ?  509 ASP A CA  1 
ATOM 3280 C C   . ASP A 1 428 ? 149.644 98.385  190.843 1.00 171.97 ?  509 ASP A C   1 
ATOM 3281 O O   . ASP A 1 428 ? 150.309 99.119  190.119 1.00 168.09 ?  509 ASP A O   1 
ATOM 3282 C CB  . ASP A 1 428 ? 147.731 99.152  192.272 1.00 172.95 ?  509 ASP A CB  1 
ATOM 3283 C CG  . ASP A 1 428 ? 147.253 99.515  193.660 1.00 172.73 ?  509 ASP A CG  1 
ATOM 3284 O OD1 . ASP A 1 428 ? 148.005 99.273  194.624 1.00 171.39 ?  509 ASP A OD1 1 
ATOM 3285 O OD2 . ASP A 1 428 ? 146.133 100.049 193.790 1.00 174.04 ?  509 ASP A OD2 1 
ATOM 3286 N N   . THR A 1 429 ? 149.270 97.164  190.477 1.00 160.57 ?  510 THR A N   1 
ATOM 3287 C CA  . THR A 1 429 ? 149.613 96.620  189.165 1.00 159.68 ?  510 THR A CA  1 
ATOM 3288 C C   . THR A 1 429 ? 148.862 97.322  188.052 1.00 170.33 ?  510 THR A C   1 
ATOM 3289 O O   . THR A 1 429 ? 147.702 97.694  188.218 1.00 173.03 ?  510 THR A O   1 
ATOM 3290 C CB  . THR A 1 429 ? 149.300 95.128  189.068 1.00 146.78 ?  510 THR A CB  1 
ATOM 3291 O OG1 . THR A 1 429 ? 147.891 94.928  189.229 1.00 142.81 ?  510 THR A OG1 1 
ATOM 3292 C CG2 . THR A 1 429 ? 150.041 94.366  190.148 1.00 142.71 ?  510 THR A CG2 1 
ATOM 3293 N N   . VAL A 1 430 ? 149.521 97.487  186.912 1.00 177.54 ?  511 VAL A N   1 
ATOM 3294 C CA  . VAL A 1 430 ? 148.883 98.079  185.747 1.00 177.82 ?  511 VAL A CA  1 
ATOM 3295 C C   . VAL A 1 430 ? 149.690 97.774  184.490 1.00 164.81 ?  511 VAL A C   1 
ATOM 3296 O O   . VAL A 1 430 ? 150.914 97.674  184.541 1.00 163.01 ?  511 VAL A O   1 
ATOM 3297 C CB  . VAL A 1 430 ? 148.715 99.605  185.925 1.00 189.56 ?  511 VAL A CB  1 
ATOM 3298 C CG1 . VAL A 1 430 ? 150.064 100.280 186.072 1.00 194.36 ?  511 VAL A CG1 1 
ATOM 3299 C CG2 . VAL A 1 430 ? 147.936 100.204 184.773 1.00 189.32 ?  511 VAL A CG2 1 
ATOM 3300 N N   . GLN A 1 431 ? 149.000 97.613  183.366 1.00 173.05 ?  512 GLN A N   1 
ATOM 3301 C CA  . GLN A 1 431 ? 149.655 97.344  182.093 1.00 177.52 ?  512 GLN A CA  1 
ATOM 3302 C C   . GLN A 1 431 ? 148.700 97.550  180.927 1.00 191.34 ?  512 GLN A C   1 
ATOM 3303 O O   . GLN A 1 431 ? 147.500 97.718  181.127 1.00 192.74 ?  512 GLN A O   1 
ATOM 3304 C CB  . GLN A 1 431 ? 150.190 95.922  182.057 1.00 173.19 ?  512 GLN A CB  1 
ATOM 3305 C CG  . GLN A 1 431 ? 149.096 94.887  182.085 1.00 169.87 ?  512 GLN A CG  1 
ATOM 3306 C CD  . GLN A 1 431 ? 149.637 93.485  182.000 1.00 163.18 ?  512 GLN A CD  1 
ATOM 3307 O OE1 . GLN A 1 431 ? 150.805 93.242  182.299 1.00 161.63 ?  512 GLN A OE1 1 
ATOM 3308 N NE2 . GLN A 1 431 ? 148.798 92.552  181.573 1.00 159.44 ?  512 GLN A NE2 1 
ATOM 3309 N N   . ALA A 1 432 ? 149.232 97.524  179.709 1.00 180.17 ?  513 ALA A N   1 
ATOM 3310 C CA  . ALA A 1 432 ? 148.397 97.551  178.513 1.00 188.66 ?  513 ALA A CA  1 
ATOM 3311 C C   . ALA A 1 432 ? 148.905 96.554  177.479 1.00 206.92 ?  513 ALA A C   1 
ATOM 3312 O O   . ALA A 1 432 ? 150.105 96.465  177.235 1.00 202.56 ?  513 ALA A O   1 
ATOM 3313 C CB  . ALA A 1 432 ? 148.360 98.939  177.929 1.00 186.27 ?  513 ALA A CB  1 
ATOM 3314 N N   . ASP A 1 433 ? 147.988 95.813  176.866 1.00 190.42 ?  514 ASP A N   1 
ATOM 3315 C CA  . ASP A 1 433 ? 148.384 94.739  175.965 1.00 222.62 ?  514 ASP A CA  1 
ATOM 3316 C C   . ASP A 1 433 ? 148.873 95.277  174.636 1.00 192.67 ?  514 ASP A C   1 
ATOM 3317 O O   . ASP A 1 433 ? 148.507 96.376  174.228 1.00 192.06 ?  514 ASP A O   1 
ATOM 3318 C CB  . ASP A 1 433 ? 147.237 93.750  175.727 1.00 263.02 ?  514 ASP A CB  1 
ATOM 3319 C CG  . ASP A 1 433 ? 146.073 94.353  174.961 1.00 289.50 ?  514 ASP A CG  1 
ATOM 3320 O OD1 . ASP A 1 433 ? 146.060 95.571  174.700 1.00 300.62 ?  514 ASP A OD1 1 
ATOM 3321 O OD2 . ASP A 1 433 ? 145.154 93.586  174.613 1.00 300.69 ?  514 ASP A OD2 1 
ATOM 3322 N N   . PRO A 1 434 ? 149.721 94.503  173.961 1.00 207.74 ?  515 PRO A N   1 
ATOM 3323 C CA  . PRO A 1 434 ? 150.126 94.847  172.604 1.00 192.33 ?  515 PRO A CA  1 
ATOM 3324 C C   . PRO A 1 434 ? 148.936 94.948  171.677 1.00 187.05 ?  515 PRO A C   1 
ATOM 3325 O O   . PRO A 1 434 ? 148.964 95.759  170.755 1.00 189.32 ?  515 PRO A O   1 
ATOM 3326 C CB  . PRO A 1 434 ? 151.036 93.691  172.209 1.00 194.44 ?  515 PRO A CB  1 
ATOM 3327 C CG  . PRO A 1 434 ? 151.593 93.210  173.489 1.00 196.42 ?  515 PRO A CG  1 
ATOM 3328 C CD  . PRO A 1 434 ? 150.480 93.358  174.485 1.00 197.61 ?  515 PRO A CD  1 
ATOM 3329 N N   . GLN A 1 435 ? 147.908 94.139  171.918 1.00 194.30 ?  516 GLN A N   1 
ATOM 3330 C CA  . GLN A 1 435 ? 146.786 94.071  170.994 1.00 194.42 ?  516 GLN A CA  1 
ATOM 3331 C C   . GLN A 1 435 ? 146.214 95.435  170.715 1.00 179.93 ?  516 GLN A C   1 
ATOM 3332 O O   . GLN A 1 435 ? 146.031 95.809  169.567 1.00 186.18 ?  516 GLN A O   1 
ATOM 3333 C CB  . GLN A 1 435 ? 145.672 93.187  171.529 1.00 197.78 ?  516 GLN A CB  1 
ATOM 3334 C CG  . GLN A 1 435 ? 146.024 91.736  171.619 1.00 268.29 ?  516 GLN A CG  1 
ATOM 3335 C CD  . GLN A 1 435 ? 144.862 90.913  172.116 1.00 158.05 ?  516 GLN A CD  1 
ATOM 3336 O OE1 . GLN A 1 435 ? 143.957 91.432  172.770 1.00 155.37 ?  516 GLN A OE1 1 
ATOM 3337 N NE2 . GLN A 1 435 ? 144.874 89.621  171.806 1.00 157.35 ?  516 GLN A NE2 1 
ATOM 3338 N N   . THR A 1 436 ? 145.918 96.219  171.737 1.00 182.33 ?  517 THR A N   1 
ATOM 3339 C CA  . THR A 1 436 ? 145.273 97.496  171.463 1.00 165.69 ?  517 THR A CA  1 
ATOM 3340 C C   . THR A 1 436 ? 146.176 98.382  170.597 1.00 145.81 ?  517 THR A C   1 
ATOM 3341 O O   . THR A 1 436 ? 145.743 98.997  169.596 1.00 128.94 ?  517 THR A O   1 
ATOM 3342 C CB  . THR A 1 436 ? 144.934 98.215  172.782 1.00 157.84 ?  517 THR A CB  1 
ATOM 3343 O OG1 . THR A 1 436 ? 144.784 99.621  172.552 1.00 161.35 ?  517 THR A OG1 1 
ATOM 3344 C CG2 . THR A 1 436 ? 146.033 97.986  173.812 1.00 151.83 ?  517 THR A CG2 1 
ATOM 3345 N N   . VAL A 1 437 ? 147.450 98.401  170.959 1.00 125.67 ?  518 VAL A N   1 
ATOM 3346 C CA  . VAL A 1 437 ? 148.398 99.273  170.301 1.00 135.00 ?  518 VAL A CA  1 
ATOM 3347 C C   . VAL A 1 437 ? 148.492 98.893  168.841 1.00 104.77 ?  518 VAL A C   1 
ATOM 3348 O O   . VAL A 1 437 ? 148.537 99.755  167.970 1.00 109.42 ?  518 VAL A O   1 
ATOM 3349 C CB  . VAL A 1 437 ? 149.791 99.170  170.942 1.00 152.86 ?  518 VAL A CB  1 
ATOM 3350 C CG1 . VAL A 1 437 ? 150.818 99.936  170.123 1.00 157.15 ?  518 VAL A CG1 1 
ATOM 3351 C CG2 . VAL A 1 437 ? 149.747 99.696  172.367 1.00 185.19 ?  518 VAL A CG2 1 
ATOM 3352 N N   . THR A 1 438 ? 148.502 97.598  168.568 1.00 115.08 ?  519 THR A N   1 
ATOM 3353 C CA  . THR A 1 438 ? 148.687 97.167  167.202 1.00 101.39 ?  519 THR A CA  1 
ATOM 3354 C C   . THR A 1 438 ? 147.551 97.689  166.343 1.00 97.41  ?  519 THR A C   1 
ATOM 3355 O O   . THR A 1 438 ? 147.782 98.224  165.265 1.00 97.47  ?  519 THR A O   1 
ATOM 3356 C CB  . THR A 1 438 ? 148.710 95.635  167.106 1.00 20.00  ?  519 THR A CB  1 
ATOM 3357 O OG1 . THR A 1 438 ? 147.372 95.129  167.195 1.00 20.00  ?  519 THR A OG1 1 
ATOM 3358 C CG2 . THR A 1 438 ? 149.537 95.050  168.235 1.00 20.00  ?  519 THR A CG2 1 
ATOM 3359 N N   . ARG A 1 439 ? 146.326 97.571  166.837 1.00 116.84 ?  520 ARG A N   1 
ATOM 3360 C CA  . ARG A 1 439 ? 145.175 98.007  166.059 1.00 123.31 ?  520 ARG A CA  1 
ATOM 3361 C C   . ARG A 1 439 ? 145.229 99.505  165.815 1.00 120.02 ?  520 ARG A C   1 
ATOM 3362 O O   . ARG A 1 439 ? 144.990 99.993  164.682 1.00 121.31 ?  520 ARG A O   1 
ATOM 3363 C CB  . ARG A 1 439 ? 143.881 97.637  166.780 1.00 20.00  ?  520 ARG A CB  1 
ATOM 3364 C CG  . ARG A 1 439 ? 143.949 96.304  167.501 1.00 20.00  ?  520 ARG A CG  1 
ATOM 3365 C CD  . ARG A 1 439 ? 144.395 96.478  168.943 1.00 20.00  ?  520 ARG A CD  1 
ATOM 3366 N NE  . ARG A 1 439 ? 143.259 96.607  169.850 1.00 20.00  ?  520 ARG A NE  1 
ATOM 3367 C CZ  . ARG A 1 439 ? 142.167 95.852  169.797 1.00 20.00  ?  520 ARG A CZ  1 
ATOM 3368 N NH1 . ARG A 1 439 ? 142.054 94.903  168.878 1.00 20.00  ?  520 ARG A NH1 1 
ATOM 3369 N NH2 . ARG A 1 439 ? 141.185 96.045  170.665 1.00 20.00  ?  520 ARG A NH2 1 
ATOM 3370 N N   . LEU A 1 440 ? 145.583 100.241 166.865 1.00 102.81 ?  521 LEU A N   1 
ATOM 3371 C CA  . LEU A 1 440 ? 145.586 101.679 166.707 1.00 102.96 ?  521 LEU A CA  1 
ATOM 3372 C C   . LEU A 1 440 ? 146.595 102.014 165.623 1.00 103.97 ?  521 LEU A C   1 
ATOM 3373 O O   . LEU A 1 440 ? 146.304 102.769 164.698 1.00 108.07 ?  521 LEU A O   1 
ATOM 3374 C CB  . LEU A 1 440 ? 145.962 102.360 168.023 1.00 120.75 ?  521 LEU A CB  1 
ATOM 3375 C CG  . LEU A 1 440 ? 146.796 103.643 167.957 1.00 146.83 ?  521 LEU A CG  1 
ATOM 3376 C CD1 . LEU A 1 440 ? 146.762 104.371 169.291 1.00 181.32 ?  521 LEU A CD1 1 
ATOM 3377 C CD2 . LEU A 1 440 ? 148.231 103.343 167.549 1.00 139.47 ?  521 LEU A CD2 1 
ATOM 3378 N N   . LEU A 1 441 ? 147.764 101.393 165.697 1.00 133.86 ?  522 LEU A N   1 
ATOM 3379 C CA  . LEU A 1 441 ? 148.831 101.734 164.779 1.00 134.08 ?  522 LEU A CA  1 
ATOM 3380 C C   . LEU A 1 441 ? 148.414 101.401 163.364 1.00 145.31 ?  522 LEU A C   1 
ATOM 3381 O O   . LEU A 1 441 ? 148.652 102.162 162.431 1.00 141.07 ?  522 LEU A O   1 
ATOM 3382 C CB  . LEU A 1 441 ? 150.108 100.984 165.139 1.00 20.00  ?  522 LEU A CB  1 
ATOM 3383 C CG  . LEU A 1 441 ? 151.192 100.979 164.062 1.00 20.00  ?  522 LEU A CG  1 
ATOM 3384 C CD1 . LEU A 1 441 ? 151.209 102.294 163.301 1.00 20.00  ?  522 LEU A CD1 1 
ATOM 3385 C CD2 . LEU A 1 441 ? 152.552 100.704 164.682 1.00 20.00  ?  522 LEU A CD2 1 
ATOM 3386 N N   . TYR A 1 442 ? 147.765 100.259 163.218 1.00 81.32  ?  523 TYR A N   1 
ATOM 3387 C CA  . TYR A 1 442 ? 147.370 99.772  161.914 1.00 121.72 ?  523 TYR A CA  1 
ATOM 3388 C C   . TYR A 1 442 ? 146.398 100.713 161.231 1.00 159.63 ?  523 TYR A C   1 
ATOM 3389 O O   . TYR A 1 442 ? 146.508 100.939 160.025 1.00 176.11 ?  523 TYR A O   1 
ATOM 3390 C CB  . TYR A 1 442 ? 146.765 98.375  162.009 1.00 20.00  ?  523 TYR A CB  1 
ATOM 3391 C CG  . TYR A 1 442 ? 146.936 97.578  160.741 1.00 20.00  ?  523 TYR A CG  1 
ATOM 3392 C CD1 . TYR A 1 442 ? 146.179 97.865  159.615 1.00 20.00  ?  523 TYR A CD1 1 
ATOM 3393 C CD2 . TYR A 1 442 ? 147.864 96.552  160.664 1.00 20.00  ?  523 TYR A CD2 1 
ATOM 3394 C CE1 . TYR A 1 442 ? 146.336 97.144  158.449 1.00 20.00  ?  523 TYR A CE1 1 
ATOM 3395 C CE2 . TYR A 1 442 ? 148.028 95.824  159.502 1.00 20.00  ?  523 TYR A CE2 1 
ATOM 3396 C CZ  . TYR A 1 442 ? 147.262 96.125  158.398 1.00 20.00  ?  523 TYR A CZ  1 
ATOM 3397 O OH  . TYR A 1 442 ? 147.423 95.403  157.239 1.00 20.00  ?  523 TYR A OH  1 
ATOM 3398 N N   . GLY A 1 443 ? 145.460 101.282 161.985 1.00 160.21 ?  524 GLY A N   1 
ATOM 3399 C CA  . GLY A 1 443 ? 144.480 102.151 161.338 1.00 176.29 ?  524 GLY A CA  1 
ATOM 3400 C C   . GLY A 1 443 ? 145.175 103.332 160.674 1.00 129.67 ?  524 GLY A C   1 
ATOM 3401 O O   . GLY A 1 443 ? 144.831 103.780 159.583 1.00 138.43 ?  524 GLY A O   1 
ATOM 3402 N N   . PHE A 1 444 ? 146.188 103.796 161.383 1.00 191.03 ?  525 PHE A N   1 
ATOM 3403 C CA  . PHE A 1 444 ? 146.959 105.012 161.209 1.00 138.57 ?  525 PHE A CA  1 
ATOM 3404 C C   . PHE A 1 444 ? 148.030 104.852 160.176 1.00 108.93 ?  525 PHE A C   1 
ATOM 3405 O O   . PHE A 1 444 ? 148.439 105.822 159.549 1.00 101.75 ?  525 PHE A O   1 
ATOM 3406 C CB  . PHE A 1 444 ? 147.596 105.440 162.516 1.00 20.00  ?  525 PHE A CB  1 
ATOM 3407 C CG  . PHE A 1 444 ? 146.646 106.071 163.461 1.00 20.00  ?  525 PHE A CG  1 
ATOM 3408 C CD1 . PHE A 1 444 ? 145.900 105.313 164.327 1.00 20.00  ?  525 PHE A CD1 1 
ATOM 3409 C CD2 . PHE A 1 444 ? 146.470 107.432 163.454 1.00 20.00  ?  525 PHE A CD2 1 
ATOM 3410 C CE1 . PHE A 1 444 ? 145.019 105.912 165.190 1.00 20.00  ?  525 PHE A CE1 1 
ATOM 3411 C CE2 . PHE A 1 444 ? 145.596 108.031 164.318 1.00 20.00  ?  525 PHE A CE2 1 
ATOM 3412 C CZ  . PHE A 1 444 ? 144.868 107.271 165.182 1.00 20.00  ?  525 PHE A CZ  1 
ATOM 3413 N N   . LEU A 1 445 ? 148.521 103.637 160.009 1.00 99.34  ?  526 LEU A N   1 
ATOM 3414 C CA  . LEU A 1 445 ? 149.568 103.477 159.024 1.00 101.43 ?  526 LEU A CA  1 
ATOM 3415 C C   . LEU A 1 445 ? 149.111 102.808 157.748 1.00 111.68 ?  526 LEU A C   1 
ATOM 3416 O O   . LEU A 1 445 ? 149.880 102.721 156.795 1.00 96.27  ?  526 LEU A O   1 
ATOM 3417 C CB  . LEU A 1 445 ? 150.733 102.716 159.629 1.00 20.00  ?  526 LEU A CB  1 
ATOM 3418 C CG  . LEU A 1 445 ? 151.360 103.577 160.719 1.00 20.00  ?  526 LEU A CG  1 
ATOM 3419 C CD1 . LEU A 1 445 ? 152.476 102.835 161.422 1.00 20.00  ?  526 LEU A CD1 1 
ATOM 3420 C CD2 . LEU A 1 445 ? 151.859 104.876 160.113 1.00 20.00  ?  526 LEU A CD2 1 
ATOM 3421 N N   . ILE A 1 446 ? 147.865 102.351 157.704 1.00 106.77 ?  527 ILE A N   1 
ATOM 3422 C CA  . ILE A 1 446 ? 147.389 101.697 156.492 1.00 120.93 ?  527 ILE A CA  1 
ATOM 3423 C C   . ILE A 1 446 ? 145.928 101.988 156.144 1.00 137.96 ?  527 ILE A C   1 
ATOM 3424 O O   . ILE A 1 446 ? 145.644 102.575 155.105 1.00 141.36 ?  527 ILE A O   1 
ATOM 3425 C CB  . ILE A 1 446 ? 147.574 100.175 156.575 1.00 20.00  ?  527 ILE A CB  1 
ATOM 3426 C CG1 . ILE A 1 446 ? 149.062 99.820  156.594 1.00 20.00  ?  527 ILE A CG1 1 
ATOM 3427 C CG2 . ILE A 1 446 ? 146.924 99.512  155.383 1.00 20.00  ?  527 ILE A CG2 1 
ATOM 3428 C CD1 . ILE A 1 446 ? 149.358 98.379  156.860 1.00 20.00  ?  527 ILE A CD1 1 
ATOM 3429 N N   . LYS A 1 447 ? 144.998 101.575 156.993 1.00 149.63 ?  528 LYS A N   1 
ATOM 3430 C CA  . LYS A 1 447 ? 143.592 101.725 156.650 1.00 156.09 ?  528 LYS A CA  1 
ATOM 3431 C C   . LYS A 1 447 ? 142.974 102.934 157.332 1.00 140.34 ?  528 LYS A C   1 
ATOM 3432 O O   . LYS A 1 447 ? 141.766 103.145 157.251 1.00 138.05 ?  528 LYS A O   1 
ATOM 3433 C CB  . LYS A 1 447 ? 142.824 100.470 157.008 1.00 160.37 ?  528 LYS A CB  1 
ATOM 3434 N N   . LEU A 1 448 ? 138.406 99.199  161.051 1.00 146.59 ?  538 LEU A N   1 
ATOM 3435 C CA  . LEU A 1 448 ? 137.425 99.608  162.050 1.00 135.44 ?  538 LEU A CA  1 
ATOM 3436 C C   . LEU A 1 448 ? 136.600 100.801 161.612 1.00 159.88 ?  538 LEU A C   1 
ATOM 3437 O O   . LEU A 1 448 ? 136.738 101.880 162.169 1.00 153.00 ?  538 LEU A O   1 
ATOM 3438 C CB  . LEU A 1 448 ? 138.100 99.958  163.376 1.00 115.21 ?  538 LEU A CB  1 
ATOM 3439 C CG  . LEU A 1 448 ? 138.411 98.831  164.358 1.00 105.01 ?  538 LEU A CG  1 
ATOM 3440 C CD1 . LEU A 1 448 ? 139.545 97.969  163.849 1.00 96.76  ?  538 LEU A CD1 1 
ATOM 3441 C CD2 . LEU A 1 448 ? 138.687 99.342  165.772 1.00 42.27  ?  538 LEU A CD2 1 
ATOM 3442 N N   . ARG A 1 449 ? 135.728 100.613 160.633 1.00 165.03 ?  539 ARG A N   1 
ATOM 3443 C CA  . ARG A 1 449 ? 134.770 101.657 160.277 1.00 186.39 ?  539 ARG A CA  1 
ATOM 3444 C C   . ARG A 1 449 ? 133.649 101.639 161.304 1.00 190.00 ?  539 ARG A C   1 
ATOM 3445 O O   . ARG A 1 449 ? 132.792 102.519 161.356 1.00 192.06 ?  539 ARG A O   1 
ATOM 3446 C CB  . ARG A 1 449 ? 134.226 101.453 158.864 1.00 201.45 ?  539 ARG A CB  1 
ATOM 3447 C CG  . ARG A 1 449 ? 135.253 101.673 157.760 1.00 220.56 ?  539 ARG A CG  1 
ATOM 3448 C CD  . ARG A 1 449 ? 134.630 101.511 156.378 1.00 218.25 ?  539 ARG A CD  1 
ATOM 3449 N NE  . ARG A 1 449 ? 135.604 101.688 155.305 1.00 211.04 ?  539 ARG A NE  1 
ATOM 3450 C CZ  . ARG A 1 449 ? 135.339 101.493 154.018 1.00 205.33 ?  539 ARG A CZ  1 
ATOM 3451 N NH1 . ARG A 1 449 ? 134.129 101.109 153.635 1.00 206.21 ?  539 ARG A NH1 1 
ATOM 3452 N NH2 . ARG A 1 449 ? 136.287 101.679 153.114 1.00 200.18 ?  539 ARG A NH2 1 
ATOM 3453 N N   . GLN A 1 450 ? 133.699 100.609 162.132 1.00 211.73 ?  540 GLN A N   1 
ATOM 3454 C CA  . GLN A 1 450 ? 132.737 100.333 163.180 1.00 201.16 ?  540 GLN A CA  1 
ATOM 3455 C C   . GLN A 1 450 ? 132.756 101.400 164.250 1.00 193.74 ?  540 GLN A C   1 
ATOM 3456 O O   . GLN A 1 450 ? 131.849 101.503 165.072 1.00 197.52 ?  540 GLN A O   1 
ATOM 3457 C CB  . GLN A 1 450 ? 133.071 98.977  163.772 1.00 150.03 ?  540 GLN A CB  1 
ATOM 3458 C CG  . GLN A 1 450 ? 134.456 98.959  164.383 1.00 152.75 ?  540 GLN A CG  1 
ATOM 3459 C CD  . GLN A 1 450 ? 134.961 97.560  164.618 1.00 135.16 ?  540 GLN A CD  1 
ATOM 3460 O OE1 . GLN A 1 450 ? 134.539 96.620  163.947 1.00 132.70 ?  540 GLN A OE1 1 
ATOM 3461 N NE2 . GLN A 1 450 ? 135.862 97.407  165.577 1.00 133.59 ?  540 GLN A NE2 1 
ATOM 3462 N N   . ASP A 1 451 ? 133.825 102.177 164.234 1.00 194.23 ?  541 ASP A N   1 
ATOM 3463 C CA  . ASP A 1 451 ? 134.150 103.087 165.309 1.00 180.50 ?  541 ASP A CA  1 
ATOM 3464 C C   . ASP A 1 451 ? 133.132 104.198 165.553 1.00 182.66 ?  541 ASP A C   1 
ATOM 3465 O O   . ASP A 1 451 ? 132.959 104.623 166.692 1.00 180.29 ?  541 ASP A O   1 
ATOM 3466 C CB  . ASP A 1 451 ? 135.510 103.703 165.015 1.00 166.31 ?  541 ASP A CB  1 
ATOM 3467 C CG  . ASP A 1 451 ? 136.606 102.669 164.985 1.00 159.51 ?  541 ASP A CG  1 
ATOM 3468 O OD1 . ASP A 1 451 ? 136.371 101.551 165.487 1.00 162.83 ?  541 ASP A OD1 1 
ATOM 3469 O OD2 . ASP A 1 451 ? 137.692 102.962 164.446 1.00 155.50 ?  541 ASP A OD2 1 
ATOM 3470 N N   . LEU A 1 452 ? 132.447 104.656 164.506 1.00 187.04 ?  542 LEU A N   1 
ATOM 3471 C CA  . LEU A 1 452 ? 131.638 105.872 164.629 1.00 188.13 ?  542 LEU A CA  1 
ATOM 3472 C C   . LEU A 1 452 ? 130.592 106.137 163.537 1.00 200.23 ?  542 LEU A C   1 
ATOM 3473 O O   . LEU A 1 452 ? 130.235 105.248 162.766 1.00 199.26 ?  542 LEU A O   1 
ATOM 3474 C CB  . LEU A 1 452 ? 132.580 107.071 164.723 1.00 185.48 ?  542 LEU A CB  1 
ATOM 3475 C CG  . LEU A 1 452 ? 133.630 107.218 163.616 1.00 183.19 ?  542 LEU A CG  1 
ATOM 3476 C CD1 . LEU A 1 452 ? 133.100 107.860 162.341 1.00 183.19 ?  542 LEU A CD1 1 
ATOM 3477 C CD2 . LEU A 1 452 ? 134.819 107.991 164.144 1.00 182.10 ?  542 LEU A CD2 1 
ATOM 3478 N N   . ARG A 1 453 ? 130.107 107.378 163.495 1.00 200.05 ?  543 ARG A N   1 
ATOM 3479 C CA  . ARG A 1 453 ? 129.092 107.801 162.527 1.00 190.90 ?  543 ARG A CA  1 
ATOM 3480 C C   . ARG A 1 453 ? 129.507 109.019 161.693 1.00 176.43 ?  543 ARG A C   1 
ATOM 3481 O O   . ARG A 1 453 ? 129.220 110.161 162.062 1.00 168.75 ?  543 ARG A O   1 
ATOM 3482 C CB  . ARG A 1 453 ? 127.780 108.102 163.251 1.00 190.41 ?  543 ARG A CB  1 
ATOM 3483 C CG  . ARG A 1 453 ? 126.655 108.517 162.328 1.00 161.04 ?  543 ARG A CG  1 
ATOM 3484 C CD  . ARG A 1 453 ? 126.475 107.460 161.274 1.00 160.45 ?  543 ARG A CD  1 
ATOM 3485 N NE  . ARG A 1 453 ? 126.211 106.159 161.871 1.00 160.80 ?  543 ARG A NE  1 
ATOM 3486 C CZ  . ARG A 1 453 ? 126.157 105.031 161.178 1.00 159.95 ?  543 ARG A CZ  1 
ATOM 3487 N NH1 . ARG A 1 453 ? 126.352 105.056 159.868 1.00 161.56 ?  543 ARG A NH1 1 
ATOM 3488 N NH2 . ARG A 1 453 ? 125.917 103.882 161.792 1.00 158.56 ?  543 ARG A NH2 1 
ATOM 3489 N N   . SER A 1 454 ? 130.170 108.767 160.564 1.00 168.39 ?  544 SER A N   1 
ATOM 3490 C CA  . SER A 1 454 ? 130.657 109.842 159.705 1.00 159.44 ?  544 SER A CA  1 
ATOM 3491 C C   . SER A 1 454 ? 131.259 109.374 158.384 1.00 144.31 ?  544 SER A C   1 
ATOM 3492 O O   . SER A 1 454 ? 130.735 108.489 157.711 1.00 125.33 ?  544 SER A O   1 
ATOM 3493 C CB  . SER A 1 454 ? 131.708 110.671 160.445 1.00 164.92 ?  544 SER A CB  1 
ATOM 3494 O OG  . SER A 1 454 ? 132.254 111.659 159.596 1.00 164.97 ?  544 SER A OG  1 
ATOM 3495 N N   . TYR A 1 455 ? 132.385 109.997 158.049 1.00 142.04 ?  545 TYR A N   1 
ATOM 3496 C CA  . TYR A 1 455 ? 133.111 109.801 156.799 1.00 143.85 ?  545 TYR A CA  1 
ATOM 3497 C C   . TYR A 1 455 ? 134.569 110.223 156.933 1.00 143.10 ?  545 TYR A C   1 
ATOM 3498 O O   . TYR A 1 455 ? 134.904 111.076 157.749 1.00 136.68 ?  545 TYR A O   1 
ATOM 3499 C CB  . TYR A 1 455 ? 132.445 110.581 155.670 1.00 188.48 ?  545 TYR A CB  1 
ATOM 3500 C CG  . TYR A 1 455 ? 133.346 110.844 154.484 1.00 216.37 ?  545 TYR A CG  1 
ATOM 3501 C CD1 . TYR A 1 455 ? 133.689 109.835 153.595 1.00 228.34 ?  545 TYR A CD1 1 
ATOM 3502 C CD2 . TYR A 1 455 ? 133.848 112.116 154.251 1.00 226.56 ?  545 TYR A CD2 1 
ATOM 3503 C CE1 . TYR A 1 455 ? 134.522 110.090 152.507 1.00 236.32 ?  545 TYR A CE1 1 
ATOM 3504 C CE2 . TYR A 1 455 ? 134.668 112.383 153.168 1.00 237.56 ?  545 TYR A CE2 1 
ATOM 3505 C CZ  . TYR A 1 455 ? 135.003 111.369 152.296 1.00 240.61 ?  545 TYR A CZ  1 
ATOM 3506 O OH  . TYR A 1 455 ? 135.827 111.637 151.219 1.00 244.01 ?  545 TYR A OH  1 
ATOM 3507 N N   . LEU A 1 456 ? 135.430 109.627 156.117 1.00 138.18 ?  546 LEU A N   1 
ATOM 3508 C CA  . LEU A 1 456 ? 136.853 109.898 156.180 1.00 151.60 ?  546 LEU A CA  1 
ATOM 3509 C C   . LEU A 1 456 ? 137.222 111.177 155.429 1.00 299.77 ?  546 LEU A C   1 
ATOM 3510 O O   . LEU A 1 456 ? 137.278 112.254 156.015 1.00 299.46 ?  546 LEU A O   1 
ATOM 3511 C CB  . LEU A 1 456 ? 137.638 108.716 155.614 1.00 143.21 ?  546 LEU A CB  1 
ATOM 3512 C CG  . LEU A 1 456 ? 137.371 107.378 156.297 1.00 57.56  ?  546 LEU A CG  1 
ATOM 3513 C CD1 . LEU A 1 456 ? 138.245 106.296 155.692 1.00 57.60  ?  546 LEU A CD1 1 
ATOM 3514 C CD2 . LEU A 1 456 ? 137.564 107.486 157.793 1.00 58.00  ?  546 LEU A CD2 1 
ATOM 3515 N N   . GLY A 1 457 ? 137.444 111.056 154.124 1.00 243.16 ?  547 GLY A N   1 
ATOM 3516 C CA  . GLY A 1 457 ? 138.018 112.139 153.344 1.00 239.86 ?  547 GLY A CA  1 
ATOM 3517 C C   . GLY A 1 457 ? 139.475 111.854 153.076 1.00 251.22 ?  547 GLY A C   1 
ATOM 3518 O O   . GLY A 1 457 ? 140.195 112.686 152.531 1.00 250.96 ?  547 GLY A O   1 
ATOM 3519 N N   . ASP A 1 458 ? 139.897 110.661 153.483 1.00 343.11 ?  548 ASP A N   1 
ATOM 3520 C CA  . ASP A 1 458 ? 141.283 110.225 153.382 1.00 359.04 ?  548 ASP A CA  1 
ATOM 3521 C C   . ASP A 1 458 ? 141.463 108.735 153.714 1.00 134.01 ?  548 ASP A C   1 
ATOM 3522 O O   . ASP A 1 458 ? 140.605 108.127 154.361 1.00 126.12 ?  548 ASP A O   1 
ATOM 3523 C CB  . ASP A 1 458 ? 142.131 111.100 154.284 1.00 364.30 ?  548 ASP A CB  1 
ATOM 3524 C CG  . ASP A 1 458 ? 141.490 111.315 155.620 1.00 121.75 ?  548 ASP A CG  1 
ATOM 3525 O OD1 . ASP A 1 458 ? 140.351 110.844 155.808 1.00 122.65 ?  548 ASP A OD1 1 
ATOM 3526 O OD2 . ASP A 1 458 ? 142.100 111.993 156.464 1.00 122.25 ?  548 ASP A OD2 1 
ATOM 3527 N N   . GLY A 1 459 ? 142.578 108.158 153.257 1.00 139.79 ?  549 GLY A N   1 
ATOM 3528 C CA  . GLY A 1 459 ? 142.847 106.726 153.372 1.00 139.36 ?  549 GLY A CA  1 
ATOM 3529 C C   . GLY A 1 459 ? 143.729 106.362 154.555 1.00 138.31 ?  549 GLY A C   1 
ATOM 3530 O O   . GLY A 1 459 ? 143.286 106.456 155.698 1.00 141.32 ?  549 GLY A O   1 
ATOM 3531 N N   . PRO A 1 460 ? 144.968 105.905 154.297 1.00 113.42 ?  550 PRO A N   1 
ATOM 3532 C CA  . PRO A 1 460 ? 145.877 105.882 155.443 1.00 106.43 ?  550 PRO A CA  1 
ATOM 3533 C C   . PRO A 1 460 ? 146.022 107.305 155.925 1.00 105.99 ?  550 PRO A C   1 
ATOM 3534 O O   . PRO A 1 460 ? 146.165 108.191 155.095 1.00 109.15 ?  550 PRO A O   1 
ATOM 3535 C CB  . PRO A 1 460 ? 147.181 105.353 154.853 1.00 99.75  ?  550 PRO A CB  1 
ATOM 3536 C CG  . PRO A 1 460 ? 147.108 105.715 153.408 1.00 104.31 ?  550 PRO A CG  1 
ATOM 3537 C CD  . PRO A 1 460 ? 145.656 105.587 153.036 1.00 110.22 ?  550 PRO A CD  1 
ATOM 3538 N N   . LEU A 1 461 ? 146.022 107.534 157.226 1.00 107.58 ?  551 LEU A N   1 
ATOM 3539 C CA  . LEU A 1 461 ? 145.883 108.901 157.700 1.00 104.05 ?  551 LEU A CA  1 
ATOM 3540 C C   . LEU A 1 461 ? 147.140 109.719 157.533 1.00 116.17 ?  551 LEU A C   1 
ATOM 3541 O O   . LEU A 1 461 ? 148.245 109.189 157.555 1.00 123.96 ?  551 LEU A O   1 
ATOM 3542 C CB  . LEU A 1 461 ? 145.443 108.919 159.156 1.00 85.34  ?  551 LEU A CB  1 
ATOM 3543 C CG  . LEU A 1 461 ? 144.002 108.455 159.312 1.00 79.59  ?  551 LEU A CG  1 
ATOM 3544 C CD1 . LEU A 1 461 ? 143.621 108.369 160.768 1.00 91.12  ?  551 LEU A CD1 1 
ATOM 3545 C CD2 . LEU A 1 461 ? 143.102 109.424 158.584 1.00 76.18  ?  551 LEU A CD2 1 
ATOM 3546 N N   . GLN A 1 462 ? 146.949 111.019 157.349 1.00 110.42 ?  552 GLN A N   1 
ATOM 3547 C CA  . GLN A 1 462 ? 148.045 111.970 157.362 1.00 117.16 ?  552 GLN A CA  1 
ATOM 3548 C C   . GLN A 1 462 ? 147.631 113.196 158.140 1.00 124.52 ?  552 GLN A C   1 
ATOM 3549 O O   . GLN A 1 462 ? 146.464 113.568 158.158 1.00 133.65 ?  552 GLN A O   1 
ATOM 3550 C CB  . GLN A 1 462 ? 148.475 112.348 155.958 1.00 125.48 ?  552 GLN A CB  1 
ATOM 3551 C CG  . GLN A 1 462 ? 147.422 113.023 155.157 1.00 144.66 ?  552 GLN A CG  1 
ATOM 3552 C CD  . GLN A 1 462 ? 146.482 112.026 154.561 1.00 168.04 ?  552 GLN A CD  1 
ATOM 3553 O OE1 . GLN A 1 462 ? 146.618 110.829 154.790 1.00 179.61 ?  552 GLN A OE1 1 
ATOM 3554 N NE2 . GLN A 1 462 ? 145.540 112.498 153.763 1.00 179.75 ?  552 GLN A NE2 1 
ATOM 3555 N N   . HIS A 1 463 ? 148.606 113.823 158.774 1.00 132.54 ?  553 HIS A N   1 
ATOM 3556 C CA  . HIS A 1 463 ? 148.333 114.633 159.944 1.00 129.51 ?  553 HIS A CA  1 
ATOM 3557 C C   . HIS A 1 463 ? 148.459 116.113 159.720 1.00 131.43 ?  553 HIS A C   1 
ATOM 3558 O O   . HIS A 1 463 ? 148.429 116.891 160.669 1.00 127.39 ?  553 HIS A O   1 
ATOM 3559 C CB  . HIS A 1 463 ? 149.268 114.197 161.049 1.00 127.65 ?  553 HIS A CB  1 
ATOM 3560 C CG  . HIS A 1 463 ? 149.249 112.725 161.267 1.00 129.46 ?  553 HIS A CG  1 
ATOM 3561 N ND1 . HIS A 1 463 ? 148.163 112.070 161.802 1.00 134.88 ?  553 HIS A ND1 1 
ATOM 3562 C CD2 . HIS A 1 463 ? 150.159 111.771 160.971 1.00 138.26 ?  553 HIS A CD2 1 
ATOM 3563 C CE1 . HIS A 1 463 ? 148.418 110.776 161.852 1.00 142.08 ?  553 HIS A CE1 1 
ATOM 3564 N NE2 . HIS A 1 463 ? 149.622 110.569 161.352 1.00 141.98 ?  553 HIS A NE2 1 
ATOM 3565 N N   . TYR A 1 464 ? 148.611 116.504 158.468 1.00 132.97 ?  554 TYR A N   1 
ATOM 3566 C CA  . TYR A 1 464 ? 148.749 117.908 158.163 1.00 121.94 ?  554 TYR A CA  1 
ATOM 3567 C C   . TYR A 1 464 ? 147.483 118.626 158.593 1.00 117.52 ?  554 TYR A C   1 
ATOM 3568 O O   . TYR A 1 464 ? 146.395 118.078 158.477 1.00 117.10 ?  554 TYR A O   1 
ATOM 3569 C CB  . TYR A 1 464 ? 149.011 118.108 156.685 1.00 123.67 ?  554 TYR A CB  1 
ATOM 3570 C CG  . TYR A 1 464 ? 149.131 119.545 156.336 1.00 121.05 ?  554 TYR A CG  1 
ATOM 3571 C CD1 . TYR A 1 464 ? 150.293 120.235 156.594 1.00 111.45 ?  554 TYR A CD1 1 
ATOM 3572 C CD2 . TYR A 1 464 ? 148.078 120.221 155.771 1.00 119.64 ?  554 TYR A CD2 1 
ATOM 3573 C CE1 . TYR A 1 464 ? 150.408 121.555 156.282 1.00 108.75 ?  554 TYR A CE1 1 
ATOM 3574 C CE2 . TYR A 1 464 ? 148.178 121.544 155.464 1.00 116.43 ?  554 TYR A CE2 1 
ATOM 3575 C CZ  . TYR A 1 464 ? 149.346 122.206 155.719 1.00 112.81 ?  554 TYR A CZ  1 
ATOM 3576 O OH  . TYR A 1 464 ? 149.456 123.535 155.407 1.00 119.77 ?  554 TYR A OH  1 
ATOM 3577 N N   . ILE A 1 465 ? 147.624 119.839 159.110 1.00 103.67 ?  555 ILE A N   1 
ATOM 3578 C CA  . ILE A 1 465 ? 146.511 120.515 159.772 1.00 116.49 ?  555 ILE A CA  1 
ATOM 3579 C C   . ILE A 1 465 ? 145.403 120.890 158.797 1.00 151.36 ?  555 ILE A C   1 
ATOM 3580 O O   . ILE A 1 465 ? 144.245 121.060 159.186 1.00 161.25 ?  555 ILE A O   1 
ATOM 3581 C CB  . ILE A 1 465 ? 146.986 121.777 160.488 1.00 79.29  ?  555 ILE A CB  1 
ATOM 3582 C CG1 . ILE A 1 465 ? 148.077 121.429 161.480 1.00 85.66  ?  555 ILE A CG1 1 
ATOM 3583 C CG2 . ILE A 1 465 ? 145.864 122.423 161.262 1.00 69.87  ?  555 ILE A CG2 1 
ATOM 3584 C CD1 . ILE A 1 465 ? 149.443 121.717 160.960 1.00 86.86  ?  555 ILE A CD1 1 
ATOM 3585 N N   . ALA A 1 466 ? 145.770 120.995 157.526 1.00 167.35 ?  556 ALA A N   1 
ATOM 3586 C CA  . ALA A 1 466 ? 144.880 121.509 156.495 1.00 160.60 ?  556 ALA A CA  1 
ATOM 3587 C C   . ALA A 1 466 ? 144.338 122.829 156.982 1.00 151.89 ?  556 ALA A C   1 
ATOM 3588 O O   . ALA A 1 466 ? 145.081 123.642 157.496 1.00 147.61 ?  556 ALA A O   1 
ATOM 3589 C CB  . ALA A 1 466 ? 143.760 120.537 156.188 1.00 167.28 ?  556 ALA A CB  1 
ATOM 3590 N N   . VAL A 1 467 ? 143.043 123.036 156.855 1.00 141.86 ?  557 VAL A N   1 
ATOM 3591 C CA  . VAL A 1 467 ? 142.467 124.267 157.342 1.00 144.82 ?  557 VAL A CA  1 
ATOM 3592 C C   . VAL A 1 467 ? 141.003 124.010 157.585 1.00 166.67 ?  557 VAL A C   1 
ATOM 3593 O O   . VAL A 1 467 ? 140.433 123.080 157.018 1.00 162.16 ?  557 VAL A O   1 
ATOM 3594 C CB  . VAL A 1 467 ? 142.662 125.419 156.348 1.00 124.90 ?  557 VAL A CB  1 
ATOM 3595 C CG1 . VAL A 1 467 ? 141.840 125.181 155.105 1.00 128.93 ?  557 VAL A CG1 1 
ATOM 3596 C CG2 . VAL A 1 467 ? 142.328 126.754 156.982 1.00 116.73 ?  557 VAL A CG2 1 
ATOM 3597 N N   . SER A 1 468 ? 140.408 124.811 158.458 1.00 30.00  ?  558 SER A N   1 
ATOM 3598 C CA  . SER A 1 468 ? 139.007 124.669 158.804 1.00 30.00  ?  558 SER A CA  1 
ATOM 3599 C C   . SER A 1 468 ? 138.725 123.300 159.373 1.00 30.00  ?  558 SER A C   1 
ATOM 3600 O O   . SER A 1 468 ? 139.642 122.530 159.641 1.00 30.00  ?  558 SER A O   1 
ATOM 3601 C CB  . SER A 1 468 ? 138.120 124.910 157.582 1.00 20.00  ?  558 SER A CB  1 
ATOM 3602 O OG  . SER A 1 468 ? 136.760 124.672 157.892 1.00 20.00  ?  558 SER A OG  1 
ATOM 3603 N N   . SER A 1 469 ? 137.444 123.028 159.581 1.00 30.00  ?  559 SER A N   1 
ATOM 3604 C CA  . SER A 1 469 ? 136.972 121.682 159.822 1.00 30.00  ?  559 SER A CA  1 
ATOM 3605 C C   . SER A 1 469 ? 137.469 121.099 161.132 1.00 30.00  ?  559 SER A C   1 
ATOM 3606 O O   . SER A 1 469 ? 138.387 121.628 161.752 1.00 30.00  ?  559 SER A O   1 
ATOM 3607 C CB  . SER A 1 469 ? 137.393 120.785 158.660 1.00 20.00  ?  559 SER A CB  1 
ATOM 3608 O OG  . SER A 1 469 ? 136.834 121.249 157.446 1.00 20.00  ?  559 SER A OG  1 
ATOM 3609 N N   . PRO A 1 470 ? 136.828 120.018 161.578 1.00 30.00  ?  560 PRO A N   1 
ATOM 3610 C CA  . PRO A 1 470 ? 137.422 119.181 162.611 1.00 30.00  ?  560 PRO A CA  1 
ATOM 3611 C C   . PRO A 1 470 ? 138.759 118.645 162.136 1.00 30.00  ?  560 PRO A C   1 
ATOM 3612 O O   . PRO A 1 470 ? 139.658 118.442 162.947 1.00 30.00  ?  560 PRO A O   1 
ATOM 3613 C CB  . PRO A 1 470 ? 136.403 118.055 162.772 1.00 20.00  ?  560 PRO A CB  1 
ATOM 3614 C CG  . PRO A 1 470 ? 135.127 118.663 162.373 1.00 20.00  ?  560 PRO A CG  1 
ATOM 3615 C CD  . PRO A 1 470 ? 135.460 119.592 161.253 1.00 20.00  ?  560 PRO A CD  1 
ATOM 3616 N N   . THR A 1 471 ? 138.868 118.432 160.827 1.00 30.00  ?  561 THR A N   1 
ATOM 3617 C CA  . THR A 1 471 ? 139.979 117.721 160.183 1.00 30.00  ?  561 THR A CA  1 
ATOM 3618 C C   . THR A 1 471 ? 139.980 116.259 160.592 1.00 30.00  ?  561 THR A C   1 
ATOM 3619 O O   . THR A 1 471 ? 139.752 115.931 161.754 1.00 30.00  ?  561 THR A O   1 
ATOM 3620 C CB  . THR A 1 471 ? 141.344 118.330 160.506 1.00 20.00  ?  561 THR A CB  1 
ATOM 3621 O OG1 . THR A 1 471 ? 141.579 118.256 161.915 1.00 20.00  ?  561 THR A OG1 1 
ATOM 3622 C CG2 . THR A 1 471 ? 141.380 119.771 160.078 1.00 20.00  ?  561 THR A CG2 1 
ATOM 3623 N N   . ASN A 1 472 ? 140.266 115.379 159.639 1.00 30.00  ?  562 ASN A N   1 
ATOM 3624 C CA  . ASN A 1 472 ? 139.960 113.971 159.823 1.00 30.00  ?  562 ASN A CA  1 
ATOM 3625 C C   . ASN A 1 472 ? 140.641 113.358 161.024 1.00 30.00  ?  562 ASN A C   1 
ATOM 3626 O O   . ASN A 1 472 ? 140.059 112.515 161.696 1.00 30.00  ?  562 ASN A O   1 
ATOM 3627 C CB  . ASN A 1 472 ? 140.343 113.173 158.585 1.00 20.00  ?  562 ASN A CB  1 
ATOM 3628 C CG  . ASN A 1 472 ? 139.475 113.490 157.396 1.00 20.00  ?  562 ASN A CG  1 
ATOM 3629 O OD1 . ASN A 1 472 ? 139.956 113.658 156.278 1.00 20.00  ?  562 ASN A OD1 1 
ATOM 3630 N ND2 . ASN A 1 472 ? 138.175 113.576 157.632 1.00 20.00  ?  562 ASN A ND2 1 
ATOM 3631 N N   . THR A 1 473 ? 141.852 113.801 161.322 1.00 157.07 ?  563 THR A N   1 
ATOM 3632 C CA  . THR A 1 473 ? 142.590 113.201 162.416 1.00 128.56 ?  563 THR A CA  1 
ATOM 3633 C C   . THR A 1 473 ? 141.906 113.424 163.746 1.00 117.96 ?  563 THR A C   1 
ATOM 3634 O O   . THR A 1 473 ? 141.696 112.486 164.512 1.00 118.98 ?  563 THR A O   1 
ATOM 3635 C CB  . THR A 1 473 ? 144.004 113.754 162.510 1.00 20.00  ?  563 THR A CB  1 
ATOM 3636 O OG1 . THR A 1 473 ? 144.722 113.423 161.321 1.00 20.00  ?  563 THR A OG1 1 
ATOM 3637 C CG2 . THR A 1 473 ? 144.715 113.161 163.697 1.00 20.00  ?  563 THR A CG2 1 
ATOM 3638 N N   . THR A 1 474 ? 141.528 114.665 164.002 1.00 120.22 ?  564 THR A N   1 
ATOM 3639 C CA  . THR A 1 474 ? 141.068 115.041 165.322 1.00 126.37 ?  564 THR A CA  1 
ATOM 3640 C C   . THR A 1 474 ? 139.817 114.307 165.715 1.00 130.62 ?  564 THR A C   1 
ATOM 3641 O O   . THR A 1 474 ? 139.631 113.931 166.870 1.00 124.62 ?  564 THR A O   1 
ATOM 3642 C CB  . THR A 1 474 ? 140.761 116.512 165.380 1.00 20.00  ?  564 THR A CB  1 
ATOM 3643 O OG1 . THR A 1 474 ? 139.730 116.794 164.431 1.00 20.00  ?  564 THR A OG1 1 
ATOM 3644 C CG2 . THR A 1 474 ? 141.983 117.308 165.017 1.00 20.00  ?  564 THR A CG2 1 
ATOM 3645 N N   . TYR A 1 475 ? 138.970 114.089 164.727 1.00 129.66 ?  565 TYR A N   1 
ATOM 3646 C CA  . TYR A 1 475 ? 137.658 113.527 164.946 1.00 137.15 ?  565 TYR A CA  1 
ATOM 3647 C C   . TYR A 1 475 ? 137.864 112.081 165.381 1.00 139.52 ?  565 TYR A C   1 
ATOM 3648 O O   . TYR A 1 475 ? 137.255 111.574 166.349 1.00 144.04 ?  565 TYR A O   1 
ATOM 3649 C CB  . TYR A 1 475 ? 136.860 113.646 163.654 1.00 20.00  ?  565 TYR A CB  1 
ATOM 3650 C CG  . TYR A 1 475 ? 135.388 113.374 163.739 1.00 20.00  ?  565 TYR A CG  1 
ATOM 3651 C CD1 . TYR A 1 475 ? 134.519 114.332 164.238 1.00 20.00  ?  565 TYR A CD1 1 
ATOM 3652 C CD2 . TYR A 1 475 ? 134.854 112.185 163.270 1.00 20.00  ?  565 TYR A CD2 1 
ATOM 3653 C CE1 . TYR A 1 475 ? 133.156 114.101 164.297 1.00 20.00  ?  565 TYR A CE1 1 
ATOM 3654 C CE2 . TYR A 1 475 ? 133.492 111.939 163.322 1.00 20.00  ?  565 TYR A CE2 1 
ATOM 3655 C CZ  . TYR A 1 475 ? 132.645 112.902 163.838 1.00 20.00  ?  565 TYR A CZ  1 
ATOM 3656 O OH  . TYR A 1 475 ? 131.286 112.665 163.895 1.00 20.00  ?  565 TYR A OH  1 
ATOM 3657 N N   . VAL A 1 476 ? 138.801 111.448 164.685 1.00 129.29 ?  566 VAL A N   1 
ATOM 3658 C CA  . VAL A 1 476 ? 139.187 110.085 164.969 1.00 135.19 ?  566 VAL A CA  1 
ATOM 3659 C C   . VAL A 1 476 ? 139.774 109.986 166.348 1.00 141.06 ?  566 VAL A C   1 
ATOM 3660 O O   . VAL A 1 476 ? 139.513 109.045 167.074 1.00 145.82 ?  566 VAL A O   1 
ATOM 3661 C CB  . VAL A 1 476 ? 140.219 109.583 163.969 1.00 20.00  ?  566 VAL A CB  1 
ATOM 3662 C CG1 . VAL A 1 476 ? 140.715 108.215 164.367 1.00 20.00  ?  566 VAL A CG1 1 
ATOM 3663 C CG2 . VAL A 1 476 ? 139.632 109.545 162.591 1.00 20.00  ?  566 VAL A CG2 1 
ATOM 3664 N N   . VAL A 1 477 ? 140.550 110.985 166.725 1.00 104.67 ?  567 VAL A N   1 
ATOM 3665 C CA  . VAL A 1 477 ? 141.140 110.957 168.040 1.00 131.43 ?  567 VAL A CA  1 
ATOM 3666 C C   . VAL A 1 477 ? 140.059 111.030 169.093 1.00 111.15 ?  567 VAL A C   1 
ATOM 3667 O O   . VAL A 1 477 ? 140.116 110.314 170.088 1.00 107.25 ?  567 VAL A O   1 
ATOM 3668 C CB  . VAL A 1 477 ? 142.120 112.098 168.231 1.00 20.00  ?  567 VAL A CB  1 
ATOM 3669 C CG1 . VAL A 1 477 ? 142.593 112.142 169.659 1.00 20.00  ?  567 VAL A CG1 1 
ATOM 3670 C CG2 . VAL A 1 477 ? 143.290 111.911 167.299 1.00 20.00  ?  567 VAL A CG2 1 
ATOM 3671 N N   . GLN A 1 478 ? 139.047 111.856 168.854 1.00 154.54 ?  568 GLN A N   1 
ATOM 3672 C CA  . GLN A 1 478 ? 137.934 111.898 169.781 1.00 143.54 ?  568 GLN A CA  1 
ATOM 3673 C C   . GLN A 1 478 ? 137.357 110.530 169.952 1.00 164.23 ?  568 GLN A C   1 
ATOM 3674 O O   . GLN A 1 478 ? 137.492 109.920 171.007 1.00 165.49 ?  568 GLN A O   1 
ATOM 3675 C CB  . GLN A 1 478 ? 136.826 112.825 169.321 1.00 20.00  ?  568 GLN A CB  1 
ATOM 3676 C CG  . GLN A 1 478 ? 137.102 114.281 169.483 1.00 20.00  ?  568 GLN A CG  1 
ATOM 3677 C CD  . GLN A 1 478 ? 135.915 115.107 169.058 1.00 20.00  ?  568 GLN A CD  1 
ATOM 3678 O OE1 . GLN A 1 478 ? 135.105 114.667 168.244 1.00 20.00  ?  568 GLN A OE1 1 
ATOM 3679 N NE2 . GLN A 1 478 ? 135.785 116.296 169.622 1.00 20.00  ?  568 GLN A NE2 1 
ATOM 3680 N N   . TYR A 1 479 ? 136.716 110.034 168.906 1.00 148.21 ?  569 TYR A N   1 
ATOM 3681 C CA  . TYR A 1 479 ? 135.940 108.822 169.106 1.00 160.95 ?  569 TYR A CA  1 
ATOM 3682 C C   . TYR A 1 479 ? 136.780 107.607 169.469 1.00 184.38 ?  569 TYR A C   1 
ATOM 3683 O O   . TYR A 1 479 ? 136.301 106.715 170.159 1.00 179.67 ?  569 TYR A O   1 
ATOM 3684 C CB  . TYR A 1 479 ? 135.078 108.543 167.886 1.00 20.00  ?  569 TYR A CB  1 
ATOM 3685 C CG  . TYR A 1 479 ? 133.934 109.514 167.809 1.00 20.00  ?  569 TYR A CG  1 
ATOM 3686 C CD1 . TYR A 1 479 ? 133.302 109.940 168.966 1.00 20.00  ?  569 TYR A CD1 1 
ATOM 3687 C CD2 . TYR A 1 479 ? 133.475 109.994 166.599 1.00 20.00  ?  569 TYR A CD2 1 
ATOM 3688 C CE1 . TYR A 1 479 ? 132.251 110.825 168.921 1.00 20.00  ?  569 TYR A CE1 1 
ATOM 3689 C CE2 . TYR A 1 479 ? 132.421 110.878 166.542 1.00 20.00  ?  569 TYR A CE2 1 
ATOM 3690 C CZ  . TYR A 1 479 ? 131.812 111.290 167.706 1.00 20.00  ?  569 TYR A CZ  1 
ATOM 3691 O OH  . TYR A 1 479 ? 130.760 112.174 167.650 1.00 20.00  ?  569 TYR A OH  1 
ATOM 3692 N N   . ALA A 1 480 ? 138.029 107.567 169.031 1.00 158.74 ?  570 ALA A N   1 
ATOM 3693 C CA  . ALA A 1 480 ? 138.892 106.479 169.451 1.00 196.49 ?  570 ALA A CA  1 
ATOM 3694 C C   . ALA A 1 480 ? 139.158 106.595 170.931 1.00 154.23 ?  570 ALA A C   1 
ATOM 3695 O O   . ALA A 1 480 ? 139.181 105.602 171.649 1.00 152.05 ?  570 ALA A O   1 
ATOM 3696 C CB  . ALA A 1 480 ? 140.181 106.488 168.687 1.00 20.00  ?  570 ALA A CB  1 
ATOM 3697 N N   . LEU A 1 481 ? 139.336 107.823 171.390 1.00 174.16 ?  571 LEU A N   1 
ATOM 3698 C CA  . LEU A 1 481 ? 139.499 108.042 172.807 1.00 161.57 ?  571 LEU A CA  1 
ATOM 3699 C C   . LEU A 1 481 ? 138.225 107.643 173.513 1.00 180.81 ?  571 LEU A C   1 
ATOM 3700 O O   . LEU A 1 481 ? 138.244 107.144 174.637 1.00 188.56 ?  571 LEU A O   1 
ATOM 3701 C CB  . LEU A 1 481 ? 139.819 109.497 173.091 1.00 20.00  ?  571 LEU A CB  1 
ATOM 3702 C CG  . LEU A 1 481 ? 139.871 109.830 174.570 1.00 20.00  ?  571 LEU A CG  1 
ATOM 3703 C CD1 . LEU A 1 481 ? 141.010 109.097 175.222 1.00 20.00  ?  571 LEU A CD1 1 
ATOM 3704 C CD2 . LEU A 1 481 ? 140.007 111.314 174.750 1.00 20.00  ?  571 LEU A CD2 1 
ATOM 3705 N N   . ALA A 1 482 ? 137.110 107.850 172.829 1.00 199.26 ?  572 ALA A N   1 
ATOM 3706 C CA  . ALA A 1 482 ? 135.821 107.574 173.423 1.00 209.30 ?  572 ALA A CA  1 
ATOM 3707 C C   . ALA A 1 482 ? 135.640 106.084 173.653 1.00 189.48 ?  572 ALA A C   1 
ATOM 3708 O O   . ALA A 1 482 ? 135.263 105.674 174.740 1.00 190.59 ?  572 ALA A O   1 
ATOM 3709 C CB  . ALA A 1 482 ? 134.715 108.118 172.554 1.00 20.00  ?  572 ALA A CB  1 
ATOM 3710 N N   . ASN A 1 483 ? 135.922 105.270 172.639 1.00 211.27 ?  573 ASN A N   1 
ATOM 3711 C CA  . ASN A 1 483 ? 135.830 103.825 172.802 1.00 204.79 ?  573 ASN A CA  1 
ATOM 3712 C C   . ASN A 1 483 ? 136.827 103.434 173.842 1.00 199.88 ?  573 ASN A C   1 
ATOM 3713 O O   . ASN A 1 483 ? 136.602 102.530 174.639 1.00 202.21 ?  573 ASN A O   1 
ATOM 3714 C CB  . ASN A 1 483 ? 136.125 103.084 171.498 1.00 162.11 ?  573 ASN A CB  1 
ATOM 3715 C CG  . ASN A 1 483 ? 135.913 101.578 171.608 1.00 138.36 ?  573 ASN A CG  1 
ATOM 3716 O OD1 . ASN A 1 483 ? 135.844 101.015 172.698 1.00 135.95 ?  573 ASN A OD1 1 
ATOM 3717 N ND2 . ASN A 1 483 ? 135.833 100.918 170.463 1.00 137.99 ?  573 ASN A ND2 1 
ATOM 3718 N N   . LEU A 1 484 ? 137.931 104.157 173.845 1.00 190.82 ?  574 LEU A N   1 
ATOM 3719 C CA  . LEU A 1 484 ? 138.984 103.828 174.756 1.00 184.82 ?  574 LEU A CA  1 
ATOM 3720 C C   . LEU A 1 484 ? 138.459 104.066 176.153 1.00 182.17 ?  574 LEU A C   1 
ATOM 3721 O O   . LEU A 1 484 ? 138.492 103.180 176.996 1.00 182.90 ?  574 LEU A O   1 
ATOM 3722 C CB  . LEU A 1 484 ? 140.214 104.664 174.479 1.00 190.33 ?  574 LEU A CB  1 
ATOM 3723 C CG  . LEU A 1 484 ? 141.356 104.104 175.293 1.00 197.86 ?  574 LEU A CG  1 
ATOM 3724 C CD1 . LEU A 1 484 ? 141.528 102.682 174.823 1.00 221.63 ?  574 LEU A CD1 1 
ATOM 3725 C CD2 . LEU A 1 484 ? 142.600 104.894 175.026 1.00 198.52 ?  574 LEU A CD2 1 
ATOM 3726 N N   . THR A 1 485 ? 137.908 105.249 176.374 1.00 179.35 ?  575 THR A N   1 
ATOM 3727 C CA  . THR A 1 485 ? 137.247 105.532 177.632 1.00 183.78 ?  575 THR A CA  1 
ATOM 3728 C C   . THR A 1 485 ? 135.785 105.136 177.490 1.00 185.85 ?  575 THR A C   1 
ATOM 3729 O O   . THR A 1 485 ? 134.895 105.982 177.466 1.00 183.07 ?  575 THR A O   1 
ATOM 3730 C CB  . THR A 1 485 ? 137.385 107.006 178.016 1.00 210.25 ?  575 THR A CB  1 
ATOM 3731 O OG1 . THR A 1 485 ? 138.774 107.343 178.068 1.00 211.31 ?  575 THR A OG1 1 
ATOM 3732 C CG2 . THR A 1 485 ? 136.781 107.267 179.386 1.00 208.20 ?  575 THR A CG2 1 
ATOM 3733 N N   . GLY A 1 486 ? 135.545 103.836 177.370 1.00 194.42 ?  576 GLY A N   1 
ATOM 3734 C CA  . GLY A 1 486 ? 134.224 103.329 177.043 1.00 214.41 ?  576 GLY A CA  1 
ATOM 3735 C C   . GLY A 1 486 ? 133.397 102.933 178.246 1.00 241.16 ?  576 GLY A C   1 
ATOM 3736 O O   . GLY A 1 486 ? 132.436 102.174 178.127 1.00 244.83 ?  576 GLY A O   1 
ATOM 3737 N N   . THR A 1 487 ? 133.766 103.463 179.405 1.00 239.21 ?  577 THR A N   1 
ATOM 3738 C CA  . THR A 1 487 ? 133.249 102.979 180.677 1.00 257.49 ?  577 THR A CA  1 
ATOM 3739 C C   . THR A 1 487 ? 131.734 103.060 180.812 1.00 246.66 ?  577 THR A C   1 
ATOM 3740 O O   . THR A 1 487 ? 131.115 102.211 181.451 1.00 248.55 ?  577 THR A O   1 
ATOM 3741 C CB  . THR A 1 487 ? 133.863 103.768 181.833 1.00 20.00  ?  577 THR A CB  1 
ATOM 3742 O OG1 . THR A 1 487 ? 133.526 105.152 181.687 1.00 20.00  ?  577 THR A OG1 1 
ATOM 3743 C CG2 . THR A 1 487 ? 135.371 103.623 181.816 1.00 20.00  ?  577 THR A CG2 1 
ATOM 3744 N N   . VAL A 1 488 ? 131.135 104.075 180.206 1.00 242.35 ?  578 VAL A N   1 
ATOM 3745 C CA  . VAL A 1 488 ? 129.698 104.250 180.320 1.00 215.76 ?  578 VAL A CA  1 
ATOM 3746 C C   . VAL A 1 488 ? 129.024 103.881 179.008 1.00 189.22 ?  578 VAL A C   1 
ATOM 3747 O O   . VAL A 1 488 ? 129.570 104.127 177.935 1.00 191.36 ?  578 VAL A O   1 
ATOM 3748 C CB  . VAL A 1 488 ? 129.345 105.692 180.710 1.00 20.00  ?  578 VAL A CB  1 
ATOM 3749 C CG1 . VAL A 1 488 ? 127.839 105.879 180.794 1.00 20.00  ?  578 VAL A CG1 1 
ATOM 3750 C CG2 . VAL A 1 488 ? 130.008 106.063 182.024 1.00 20.00  ?  578 VAL A CG2 1 
ATOM 3751 N N   . VAL A 1 489 ? 127.850 103.267 179.096 1.00 174.41 ?  579 VAL A N   1 
ATOM 3752 C CA  . VAL A 1 489 ? 127.067 102.955 177.911 1.00 140.96 ?  579 VAL A CA  1 
ATOM 3753 C C   . VAL A 1 489 ? 125.619 103.389 178.080 1.00 128.41 ?  579 VAL A C   1 
ATOM 3754 O O   . VAL A 1 489 ? 125.107 104.177 177.289 1.00 118.20 ?  579 VAL A O   1 
ATOM 3755 C CB  . VAL A 1 489 ? 127.100 101.462 177.590 1.00 20.00  ?  579 VAL A CB  1 
ATOM 3756 C CG1 . VAL A 1 489 ? 126.197 101.169 176.414 1.00 20.00  ?  579 VAL A CG1 1 
ATOM 3757 C CG2 . VAL A 1 489 ? 128.518 101.018 177.299 1.00 20.00  ?  579 VAL A CG2 1 
ATOM 3758 N N   . UNK A 1 490 ? 121.695 101.486 178.423 1.00 162.96 ?  581 UNK A N   1 
ATOM 3759 C CA  . UNK A 1 490 ? 120.341 101.715 177.937 1.00 165.95 ?  581 UNK A CA  1 
ATOM 3760 C C   . UNK A 1 490 ? 120.234 103.084 177.283 1.00 175.22 ?  581 UNK A C   1 
ATOM 3761 O O   . UNK A 1 490 ? 120.051 104.093 177.962 1.00 181.29 ?  581 UNK A O   1 
ATOM 3762 C CB  . UNK A 1 490 ? 119.336 101.586 179.073 1.00 20.00  ?  581 UNK A CB  1 
ATOM 3763 N N   . UNK A 1 491 ? 120.371 103.117 175.964 1.00 178.78 ?  582 UNK A N   1 
ATOM 3764 C CA  . UNK A 1 491 ? 120.311 104.371 175.231 1.00 174.02 ?  582 UNK A CA  1 
ATOM 3765 C C   . UNK A 1 491 ? 118.926 104.997 175.277 1.00 176.23 ?  582 UNK A C   1 
ATOM 3766 O O   . UNK A 1 491 ? 117.921 104.309 175.117 1.00 175.40 ?  582 UNK A O   1 
ATOM 3767 C CB  . UNK A 1 491 ? 120.730 104.152 173.791 1.00 20.00  ?  582 UNK A CB  1 
ATOM 3768 N N   . UNK A 1 492 ? 118.876 106.306 175.484 1.00 174.29 ?  583 UNK A N   1 
ATOM 3769 C CA  . UNK A 1 492 ? 117.636 107.036 175.296 1.00 179.64 ?  583 UNK A CA  1 
ATOM 3770 C C   . UNK A 1 492 ? 117.443 107.285 173.814 1.00 195.88 ?  583 UNK A C   1 
ATOM 3771 O O   . UNK A 1 492 ? 116.346 107.615 173.369 1.00 197.76 ?  583 UNK A O   1 
ATOM 3772 C CB  . UNK A 1 492 ? 117.653 108.338 176.058 1.00 20.00  ?  583 UNK A CB  1 
ATOM 3773 N N   . UNK A 1 493 ? 118.532 107.134 173.063 1.00 187.48 ?  584 UNK A N   1 
ATOM 3774 C CA  . UNK A 1 493 ? 118.561 107.412 171.630 1.00 214.48 ?  584 UNK A CA  1 
ATOM 3775 C C   . UNK A 1 493 ? 118.007 108.797 171.342 1.00 249.63 ?  584 UNK A C   1 
ATOM 3776 O O   . UNK A 1 493 ? 117.490 109.056 170.260 1.00 255.13 ?  584 UNK A O   1 
ATOM 3777 C CB  . UNK A 1 493 ? 117.781 106.362 170.865 1.00 20.00  ?  584 UNK A CB  1 
ATOM 3778 N N   . UNK A 1 494 ? 118.125 109.683 172.322 1.00 293.67 ?  585 UNK A N   1 
ATOM 3779 C CA  . UNK A 1 494 ? 117.625 111.039 172.200 1.00 293.49 ?  585 UNK A CA  1 
ATOM 3780 C C   . UNK A 1 494 ? 118.523 111.831 171.267 1.00 267.37 ?  585 UNK A C   1 
ATOM 3781 O O   . UNK A 1 494 ? 119.676 111.464 171.047 1.00 267.86 ?  585 UNK A O   1 
ATOM 3782 C CB  . UNK A 1 494 ? 117.540 111.703 173.557 1.00 20.00  ?  585 UNK A CB  1 
ATOM 3783 N N   . UNK A 1 495 ? 117.978 112.892 170.684 1.00 236.08 ?  586 UNK A N   1 
ATOM 3784 C CA  . UNK A 1 495 ? 118.757 113.769 169.816 1.00 219.89 ?  586 UNK A CA  1 
ATOM 3785 C C   . UNK A 1 495 ? 118.991 115.127 170.475 1.00 266.07 ?  586 UNK A C   1 
ATOM 3786 O O   . UNK A 1 495 ? 118.892 116.171 169.828 1.00 265.41 ?  586 UNK A O   1 
ATOM 3787 C CB  . UNK A 1 495 ? 118.061 113.942 168.476 1.00 20.00  ?  586 UNK A CB  1 
ATOM 3788 N N   . UNK A 1 496 ? 121.481 113.858 171.822 1.00 1.00   ?  588 UNK A N   1 
ATOM 3789 C CA  . UNK A 1 496 ? 121.271 113.128 173.064 1.00 1.00   ?  588 UNK A CA  1 
ATOM 3790 C C   . UNK A 1 496 ? 121.306 114.053 174.272 1.00 1.00   ?  588 UNK A C   1 
ATOM 3791 O O   . UNK A 1 496 ? 121.237 113.600 175.410 1.00 1.00   ?  588 UNK A O   1 
ATOM 3792 C CB  . UNK A 1 496 ? 122.305 112.034 173.205 1.00 1.00   ?  588 UNK A CB  1 
ATOM 3793 N N   . UNK A 1 497 ? 121.422 115.352 174.021 1.00 1.00   ?  589 UNK A N   1 
ATOM 3794 C CA  . UNK A 1 497 ? 121.378 116.338 175.093 1.00 1.00   ?  589 UNK A CA  1 
ATOM 3795 C C   . UNK A 1 497 ? 120.006 116.340 175.743 1.00 1.00   ?  589 UNK A C   1 
ATOM 3796 O O   . UNK A 1 497 ? 119.858 116.698 176.911 1.00 1.00   ?  589 UNK A O   1 
ATOM 3797 C CB  . UNK A 1 497 ? 121.719 117.720 174.566 1.00 1.00   ?  589 UNK A CB  1 
ATOM 3798 N N   . UNK A 1 498 ? 118.995 115.955 174.971 1.00 1.00   ?  590 UNK A N   1 
ATOM 3799 C CA  . UNK A 1 498 ? 117.658 115.798 175.515 1.00 1.00   ?  590 UNK A CA  1 
ATOM 3800 C C   . UNK A 1 498 ? 117.664 114.673 176.537 1.00 1.00   ?  590 UNK A C   1 
ATOM 3801 O O   . UNK A 1 498 ? 116.989 114.747 177.570 1.00 1.00   ?  590 UNK A O   1 
ATOM 3802 C CB  . UNK A 1 498 ? 116.662 115.515 174.408 1.00 1.00   ?  590 UNK A CB  1 
ATOM 3803 N N   . UNK A 1 499 ? 118.453 113.639 176.261 1.00 1.00   ?  591 UNK A N   1 
ATOM 3804 C CA  . UNK A 1 499 ? 118.623 112.566 177.224 1.00 1.00   ?  591 UNK A CA  1 
ATOM 3805 C C   . UNK A 1 499 ? 119.318 113.108 178.462 1.00 1.00   ?  591 UNK A C   1 
ATOM 3806 O O   . UNK A 1 499 ? 119.028 112.682 179.575 1.00 1.00   ?  591 UNK A O   1 
ATOM 3807 C CB  . UNK A 1 499 ? 119.410 111.417 176.624 1.00 1.00   ?  591 UNK A CB  1 
ATOM 3808 N N   . UNK A 1 500 ? 120.224 114.063 178.262 1.00 1.00   ?  592 UNK A N   1 
ATOM 3809 C CA  . UNK A 1 500 ? 120.911 114.702 179.379 1.00 1.00   ?  592 UNK A CA  1 
ATOM 3810 C C   . UNK A 1 500 ? 119.922 115.484 180.230 1.00 1.00   ?  592 UNK A C   1 
ATOM 3811 O O   . UNK A 1 500 ? 120.071 115.573 181.448 1.00 1.00   ?  592 UNK A O   1 
ATOM 3812 C CB  . UNK A 1 500 ? 122.024 115.611 178.882 1.00 1.00   ?  592 UNK A CB  1 
ATOM 3813 N N   . UNK A 1 501 ? 118.911 116.052 179.581 1.00 1.00   ?  593 UNK A N   1 
ATOM 3814 C CA  . UNK A 1 501 ? 117.821 116.679 180.307 1.00 1.00   ?  593 UNK A CA  1 
ATOM 3815 C C   . UNK A 1 501 ? 117.031 115.620 181.062 1.00 1.00   ?  593 UNK A C   1 
ATOM 3816 O O   . UNK A 1 501 ? 116.507 115.877 182.144 1.00 1.00   ?  593 UNK A O   1 
ATOM 3817 C CB  . UNK A 1 501 ? 116.923 117.447 179.361 1.00 1.00   ?  593 UNK A CB  1 
ATOM 3818 N N   . UNK A 1 502 ? 116.951 114.425 180.485 1.00 1.00   ?  594 UNK A N   1 
ATOM 3819 C CA  . UNK A 1 502 ? 116.274 113.311 181.140 1.00 1.00   ?  594 UNK A CA  1 
ATOM 3820 C C   . UNK A 1 502 ? 117.212 112.525 182.049 1.00 1.00   ?  594 UNK A C   1 
ATOM 3821 O O   . UNK A 1 502 ? 116.775 111.665 182.812 1.00 1.00   ?  594 UNK A O   1 
ATOM 3822 C CB  . UNK A 1 502 ? 115.664 112.390 180.102 1.00 1.00   ?  594 UNK A CB  1 
ATOM 3823 N N   . UNK A 1 503 ? 118.501 112.835 181.968 1.00 30.00  ?  595 UNK A N   1 
ATOM 3824 C CA  . UNK A 1 503 ? 119.530 112.021 182.605 1.00 30.00  ?  595 UNK A CA  1 
ATOM 3825 C C   . UNK A 1 503 ? 119.478 112.045 184.119 1.00 30.00  ?  595 UNK A C   1 
ATOM 3826 O O   . UNK A 1 503 ? 119.120 113.049 184.729 1.00 30.00  ?  595 UNK A O   1 
ATOM 3827 C CB  . UNK A 1 503 ? 120.908 112.461 182.141 1.00 30.00  ?  595 UNK A CB  1 
ATOM 3828 N N   . UNK A 1 504 ? 119.841 110.918 184.716 1.00 30.00  ?  596 UNK A N   1 
ATOM 3829 C CA  . UNK A 1 504 ? 120.144 110.879 186.133 1.00 30.00  ?  596 UNK A CA  1 
ATOM 3830 C C   . UNK A 1 504 ? 121.395 111.711 186.383 1.00 30.00  ?  596 UNK A C   1 
ATOM 3831 O O   . UNK A 1 504 ? 121.609 112.215 187.482 1.00 30.00  ?  596 UNK A O   1 
ATOM 3832 C CB  . UNK A 1 504 ? 120.337 109.452 186.602 1.00 30.00  ?  596 UNK A CB  1 
ATOM 3833 N N   . UNK A 1 505 ? 122.220 111.849 185.351 1.00 30.00  ?  597 UNK A N   1 
ATOM 3834 C CA  . UNK A 1 505 ? 123.437 112.644 185.438 1.00 30.00  ?  597 UNK A CA  1 
ATOM 3835 C C   . UNK A 1 505 ? 123.261 113.999 184.764 1.00 30.00  ?  597 UNK A C   1 
ATOM 3836 O O   . UNK A 1 505 ? 124.232 114.722 184.542 1.00 30.00  ?  597 UNK A O   1 
ATOM 3837 C CB  . UNK A 1 505 ? 124.602 111.896 184.819 1.00 30.00  ?  597 UNK A CB  1 
ATOM 3838 N N   . UNK A 1 506 ? 130.606 115.062 177.152 1.00 215.88 ?  603 UNK A N   1 
ATOM 3839 C CA  . UNK A 1 506 ? 130.693 114.016 178.160 1.00 199.93 ?  603 UNK A CA  1 
ATOM 3840 C C   . UNK A 1 506 ? 129.670 112.925 177.893 1.00 187.63 ?  603 UNK A C   1 
ATOM 3841 O O   . UNK A 1 506 ? 129.430 112.076 178.747 1.00 183.82 ?  603 UNK A O   1 
ATOM 3842 C CB  . UNK A 1 506 ? 130.499 114.596 179.549 1.00 20.00  ?  603 UNK A CB  1 
ATOM 3843 N N   . UNK A 1 507 ? 129.063 112.965 176.708 1.00 193.49 ?  604 UNK A N   1 
ATOM 3844 C CA  . UNK A 1 507 ? 128.116 111.940 176.270 1.00 198.14 ?  604 UNK A CA  1 
ATOM 3845 C C   . UNK A 1 507 ? 127.861 112.028 174.767 1.00 217.72 ?  604 UNK A C   1 
ATOM 3846 O O   . UNK A 1 507 ? 127.473 113.079 174.263 1.00 210.70 ?  604 UNK A O   1 
ATOM 3847 C CB  . UNK A 1 507 ? 126.809 112.062 177.030 1.00 20.00  ?  604 UNK A CB  1 
ATOM 3848 N N   . UNK A 1 508 ? 128.064 110.922 174.058 1.00 201.28 ?  605 UNK A N   1 
ATOM 3849 C CA  . UNK A 1 508 ? 127.862 110.886 172.612 1.00 245.57 ?  605 UNK A CA  1 
ATOM 3850 C C   . UNK A 1 508 ? 127.601 109.471 172.118 1.00 244.86 ?  605 UNK A C   1 
ATOM 3851 O O   . UNK A 1 508 ? 128.023 108.502 172.744 1.00 241.28 ?  605 UNK A O   1 
ATOM 3852 C CB  . UNK A 1 508 ? 129.055 111.471 171.900 1.00 20.00  ?  605 UNK A CB  1 
ATOM 3853 N N   . UNK A 1 509 ? 126.912 109.357 170.987 1.00 259.64 ?  606 UNK A N   1 
ATOM 3854 C CA  . UNK A 1 509 ? 126.520 108.052 170.468 1.00 257.12 ?  606 UNK A CA  1 
ATOM 3855 C C   . UNK A 1 509 ? 127.096 107.783 169.088 1.00 252.69 ?  606 UNK A C   1 
ATOM 3856 O O   . UNK A 1 509 ? 127.196 108.684 168.261 1.00 253.25 ?  606 UNK A O   1 
ATOM 3857 C CB  . UNK A 1 509 ? 125.008 107.937 170.429 1.00 20.00  ?  606 UNK A CB  1 
ATOM 3858 N N   . UNK A 1 510 ? 127.467 106.529 168.850 1.00 250.93 ?  607 UNK A N   1 
ATOM 3859 C CA  . UNK A 1 510 ? 127.973 106.096 167.554 1.00 239.51 ?  607 UNK A CA  1 
ATOM 3860 C C   . UNK A 1 510 ? 127.771 104.597 167.411 1.00 251.16 ?  607 UNK A C   1 
ATOM 3861 O O   . UNK A 1 510 ? 128.203 103.828 168.261 1.00 255.24 ?  607 UNK A O   1 
ATOM 3862 C CB  . UNK A 1 510 ? 129.432 106.453 167.402 1.00 20.00  ?  607 UNK A CB  1 
ATOM 3863 N N   . UNK A 1 511 ? 127.101 104.184 166.343 1.00 292.24 ?  608 UNK A N   1 
ATOM 3864 C CA  . UNK A 1 511 ? 126.726 102.785 166.200 1.00 296.85 ?  608 UNK A CA  1 
ATOM 3865 C C   . UNK A 1 511 ? 127.919 101.856 166.061 1.00 328.92 ?  608 UNK A C   1 
ATOM 3866 O O   . UNK A 1 511 ? 128.824 102.107 165.271 1.00 332.87 ?  608 UNK A O   1 
ATOM 3867 C CB  . UNK A 1 511 ? 125.810 102.621 165.006 1.00 20.00  ?  608 UNK A CB  1 
ATOM 3868 N N   . UNK A 1 512 ? 127.898 100.766 166.820 1.00 30.00  ?  609 UNK A N   1 
ATOM 3869 C CA  . UNK A 1 512 ? 128.795 99.651  166.571 1.00 30.00  ?  609 UNK A CA  1 
ATOM 3870 C C   . UNK A 1 512 ? 128.338 98.967  165.297 1.00 30.00  ?  609 UNK A C   1 
ATOM 3871 O O   . UNK A 1 512 ? 127.141 98.790  165.092 1.00 30.00  ?  609 UNK A O   1 
ATOM 3872 C CB  . UNK A 1 512 ? 128.798 98.681  167.739 1.00 30.00  ?  609 UNK A CB  1 
ATOM 3873 N N   . UNK A 1 513 ? 129.277 98.562  164.452 1.00 30.00  ?  610 UNK A N   1 
ATOM 3874 C CA  . UNK A 1 513 ? 128.913 97.910  163.200 1.00 30.00  ?  610 UNK A CA  1 
ATOM 3875 C C   . UNK A 1 513 ? 129.237 96.423  163.238 1.00 30.00  ?  610 UNK A C   1 
ATOM 3876 O O   . UNK A 1 513 ? 130.341 96.009  162.885 1.00 30.00  ?  610 UNK A O   1 
ATOM 3877 C CB  . UNK A 1 513 ? 129.613 98.578  162.032 1.00 20.00  ?  610 UNK A CB  1 
ATOM 3878 N N   . UNK A 1 514 ? 128.267 95.624  163.666 1.00 30.00  ?  611 UNK A N   1 
ATOM 3879 C CA  . UNK A 1 514 ? 128.436 94.178  163.723 1.00 30.00  ?  611 UNK A CA  1 
ATOM 3880 C C   . UNK A 1 514 ? 127.083 93.473  163.667 1.00 30.00  ?  611 UNK A C   1 
ATOM 3881 O O   . UNK A 1 514 ? 126.064 94.034  164.070 1.00 30.00  ?  611 UNK A O   1 
ATOM 3882 C CB  . UNK A 1 514 ? 129.193 93.784  164.977 1.00 30.00  ?  611 UNK A CB  1 
ATOM 3883 N N   . UNK A 1 515 ? 127.081 92.241  163.169 1.00 30.00  ?  612 UNK A N   1 
ATOM 3884 C CA  . UNK A 1 515 ? 125.844 91.485  162.998 1.00 30.00  ?  612 UNK A CA  1 
ATOM 3885 C C   . UNK A 1 515 ? 125.762 90.310  163.964 1.00 30.00  ?  612 UNK A C   1 
ATOM 3886 O O   . UNK A 1 515 ? 125.061 89.332  163.704 1.00 30.00  ?  612 UNK A O   1 
ATOM 3887 C CB  . UNK A 1 515 ? 125.721 90.995  161.563 1.00 30.00  ?  612 UNK A CB  1 
ATOM 3888 N N   . UNK A 1 516 ? 125.786 93.442  157.766 1.00 30.00  ?  615 UNK A N   1 
ATOM 3889 C CA  . UNK A 1 516 ? 124.839 94.499  157.437 1.00 30.00  ?  615 UNK A CA  1 
ATOM 3890 C C   . UNK A 1 516 ? 124.256 95.095  158.706 1.00 30.00  ?  615 UNK A C   1 
ATOM 3891 O O   . UNK A 1 516 ? 124.032 96.300  158.794 1.00 30.00  ?  615 UNK A O   1 
ATOM 3892 C CB  . UNK A 1 516 ? 123.735 93.965  156.542 1.00 30.00  ?  615 UNK A CB  1 
ATOM 3893 N N   . UNK A 1 517 ? 124.010 94.237  159.687 1.00 30.00  ?  616 UNK A N   1 
ATOM 3894 C CA  . UNK A 1 517 ? 123.500 94.678  160.975 1.00 30.00  ?  616 UNK A CA  1 
ATOM 3895 C C   . UNK A 1 517 ? 124.541 95.512  161.708 1.00 30.00  ?  616 UNK A C   1 
ATOM 3896 O O   . UNK A 1 517 ? 125.740 95.268  161.588 1.00 30.00  ?  616 UNK A O   1 
ATOM 3897 C CB  . UNK A 1 517 ? 123.083 93.486  161.817 1.00 30.00  ?  616 UNK A CB  1 
ATOM 3898 N N   . UNK A 1 518 ? 124.076 96.507  162.454 1.00 30.00  ?  617 UNK A N   1 
ATOM 3899 C CA  . UNK A 1 518 ? 124.960 97.350  163.244 1.00 30.00  ?  617 UNK A CA  1 
ATOM 3900 C C   . UNK A 1 518 ? 124.242 97.842  164.495 1.00 30.00  ?  617 UNK A C   1 
ATOM 3901 O O   . UNK A 1 518 ? 123.104 98.303  164.427 1.00 30.00  ?  617 UNK A O   1 
ATOM 3902 C CB  . UNK A 1 518 ? 125.451 98.519  162.414 1.00 20.00  ?  617 UNK A CB  1 
ATOM 3903 N N   . UNK A 1 519 ? 124.915 97.761  165.636 1.00 30.00  ?  618 UNK A N   1 
ATOM 3904 C CA  . UNK A 1 519 ? 124.280 98.082  166.907 1.00 30.00  ?  618 UNK A CA  1 
ATOM 3905 C C   . UNK A 1 519 ? 124.644 99.472  167.401 1.00 30.00  ?  618 UNK A C   1 
ATOM 3906 O O   . UNK A 1 519 ? 125.801 99.745  167.709 1.00 30.00  ?  618 UNK A O   1 
ATOM 3907 C CB  . UNK A 1 519 ? 124.651 97.049  167.947 1.00 30.00  ?  618 UNK A CB  1 
ATOM 3908 N N   . UNK A 1 520 ? 123.650 100.346 167.483 1.00 30.00  ?  619 UNK A N   1 
ATOM 3909 C CA  . UNK A 1 520 ? 123.860 101.678 168.028 1.00 30.00  ?  619 UNK A CA  1 
ATOM 3910 C C   . UNK A 1 520 ? 124.228 101.572 169.497 1.00 30.00  ?  619 UNK A C   1 
ATOM 3911 O O   . UNK A 1 520 ? 123.786 100.657 170.186 1.00 30.00  ?  619 UNK A O   1 
ATOM 3912 C CB  . UNK A 1 520 ? 122.628 102.535 167.845 1.00 30.00  ?  619 UNK A CB  1 
ATOM 3913 N N   . UNK A 1 521 ? 125.061 102.490 169.970 1.00 229.28 ?  620 UNK A N   1 
ATOM 3914 C CA  . UNK A 1 521 ? 125.460 102.485 171.368 1.00 238.49 ?  620 UNK A CA  1 
ATOM 3915 C C   . UNK A 1 521 ? 125.888 103.866 171.823 1.00 244.87 ?  620 UNK A C   1 
ATOM 3916 O O   . UNK A 1 521 ? 126.843 104.433 171.302 1.00 252.22 ?  620 UNK A O   1 
ATOM 3917 C CB  . UNK A 1 521 ? 126.581 101.485 171.595 1.00 20.00  ?  620 UNK A CB  1 
ATOM 3918 N N   . UNK A 1 522 ? 125.162 104.416 172.785 1.00 266.42 ?  621 UNK A N   1 
ATOM 3919 C CA  . UNK A 1 522 ? 125.575 105.651 173.425 1.00 260.22 ?  621 UNK A CA  1 
ATOM 3920 C C   . UNK A 1 522 ? 126.700 105.361 174.403 1.00 239.63 ?  621 UNK A C   1 
ATOM 3921 O O   . UNK A 1 522 ? 126.782 104.264 174.952 1.00 244.92 ?  621 UNK A O   1 
ATOM 3922 C CB  . UNK A 1 522 ? 124.410 106.305 174.132 1.00 20.00  ?  621 UNK A CB  1 
ATOM 3923 N N   . UNK A 1 523 ? 127.566 106.344 174.614 1.00 232.43 ?  622 UNK A N   1 
ATOM 3924 C CA  . UNK A 1 523 ? 128.614 106.242 175.622 1.00 201.62 ?  622 UNK A CA  1 
ATOM 3925 C C   . UNK A 1 523 ? 128.925 107.620 176.175 1.00 204.53 ?  622 UNK A C   1 
ATOM 3926 O O   . UNK A 1 523 ? 129.030 108.581 175.420 1.00 211.72 ?  622 UNK A O   1 
ATOM 3927 C CB  . UNK A 1 523 ? 129.864 105.610 175.037 1.00 20.00  ?  622 UNK A CB  1 
ATOM 3928 N N   . UNK A 1 524 ? 129.086 107.718 177.489 1.00 208.99 ?  623 UNK A N   1 
ATOM 3929 C CA  . UNK A 1 524 ? 129.355 109.011 178.093 1.00 208.84 ?  623 UNK A CA  1 
ATOM 3930 C C   . UNK A 1 524 ? 130.731 109.467 177.678 1.00 209.20 ?  623 UNK A C   1 
ATOM 3931 O O   . UNK A 1 524 ? 130.862 110.332 176.818 1.00 204.45 ?  623 UNK A O   1 
ATOM 3932 C CB  . UNK A 1 524 ? 129.249 108.953 179.601 1.00 20.00  ?  623 UNK A CB  1 
ATOM 3933 N N   . UNK A 1 525 ? 131.745 108.857 178.284 1.00 206.47 ?  624 UNK A N   1 
ATOM 3934 C CA  . UNK A 1 525 ? 133.149 109.169 178.025 1.00 205.06 ?  624 UNK A CA  1 
ATOM 3935 C C   . UNK A 1 525 ? 133.497 110.612 178.361 1.00 205.92 ?  624 UNK A C   1 
ATOM 3936 O O   . UNK A 1 525 ? 132.822 111.555 177.952 1.00 201.88 ?  624 UNK A O   1 
ATOM 3937 C CB  . UNK A 1 525 ? 133.509 108.866 176.577 1.00 20.00  ?  624 UNK A CB  1 
ATOM 3938 N N   . UNK A 1 526 ? 134.566 110.778 179.120 1.00 187.49 ?  625 UNK A N   1 
ATOM 3939 C CA  . UNK A 1 526 ? 135.025 112.103 179.474 1.00 196.52 ?  625 UNK A CA  1 
ATOM 3940 C C   . UNK A 1 526 ? 135.586 112.794 178.248 1.00 209.93 ?  625 UNK A C   1 
ATOM 3941 O O   . UNK A 1 526 ? 135.924 112.141 177.260 1.00 215.65 ?  625 UNK A O   1 
ATOM 3942 C CB  . UNK A 1 526 ? 136.066 112.035 180.566 1.00 20.00  ?  625 UNK A CB  1 
ATOM 3943 N N   . UNK A 1 527 ? 135.588 114.122 178.301 1.00 213.80 ?  626 UNK A N   1 
ATOM 3944 C CA  . UNK A 1 527 ? 136.416 114.966 177.439 1.00 211.37 ?  626 UNK A CA  1 
ATOM 3945 C C   . UNK A 1 527 ? 135.884 115.230 176.046 1.00 210.62 ?  626 UNK A C   1 
ATOM 3946 O O   . UNK A 1 527 ? 135.176 114.419 175.460 1.00 212.61 ?  626 UNK A O   1 
ATOM 3947 C CB  . UNK A 1 527 ? 137.779 114.376 177.331 1.00 20.00  ?  626 UNK A CB  1 
ATOM 3948 N N   . THR A 1 528 ? 136.284 116.378 175.519 1.00 238.09 ?  627 THR A N   1 
ATOM 3949 C CA  . THR A 1 528 ? 135.735 116.893 174.288 1.00 238.72 ?  627 THR A CA  1 
ATOM 3950 C C   . THR A 1 528 ? 136.646 117.933 173.665 1.00 217.60 ?  627 THR A C   1 
ATOM 3951 O O   . THR A 1 528 ? 137.449 118.544 174.353 1.00 207.02 ?  627 THR A O   1 
ATOM 3952 C CB  . THR A 1 528 ? 134.371 117.509 174.541 1.00 20.00  ?  627 THR A CB  1 
ATOM 3953 O OG1 . THR A 1 528 ? 133.802 117.927 173.297 1.00 20.00  ?  627 THR A OG1 1 
ATOM 3954 C CG2 . THR A 1 528 ? 134.495 118.696 175.481 1.00 20.00  ?  627 THR A CG2 1 
ATOM 3955 N N   . ALA A 1 529 ? 136.497 118.156 172.366 1.00 261.42 ?  628 ALA A N   1 
ATOM 3956 C CA  . ALA A 1 529 ? 137.409 119.033 171.646 1.00 224.88 ?  628 ALA A CA  1 
ATOM 3957 C C   . ALA A 1 529 ? 137.351 120.441 172.189 1.00 192.46 ?  628 ALA A C   1 
ATOM 3958 O O   . ALA A 1 529 ? 136.331 120.879 172.707 1.00 188.61 ?  628 ALA A O   1 
ATOM 3959 C CB  . ALA A 1 529 ? 137.099 119.040 170.175 1.00 20.00  ?  628 ALA A CB  1 
ATOM 3960 N N   . ARG A 1 530 ? 138.471 121.140 172.092 1.00 162.07 ?  629 ARG A N   1 
ATOM 3961 C CA  . ARG A 1 530 ? 138.571 122.493 172.599 1.00 148.06 ?  629 ARG A CA  1 
ATOM 3962 C C   . ARG A 1 530 ? 139.108 123.356 171.465 1.00 130.88 ?  629 ARG A C   1 
ATOM 3963 O O   . ARG A 1 530 ? 139.936 122.895 170.678 1.00 124.78 ?  629 ARG A O   1 
ATOM 3964 C CB  . ARG A 1 530 ? 139.481 122.523 173.823 1.00 150.00 ?  629 ARG A CB  1 
ATOM 3965 C CG  . ARG A 1 530 ? 139.058 121.498 174.873 1.00 153.29 ?  629 ARG A CG  1 
ATOM 3966 C CD  . ARG A 1 530 ? 137.701 121.825 175.473 1.00 156.34 ?  629 ARG A CD  1 
ATOM 3967 N NE  . ARG A 1 530 ? 137.759 122.911 176.450 1.00 147.18 ?  629 ARG A NE  1 
ATOM 3968 C CZ  . ARG A 1 530 ? 137.937 122.713 177.753 1.00 141.19 ?  629 ARG A CZ  1 
ATOM 3969 N NH1 . ARG A 1 530 ? 138.028 121.482 178.211 1.00 141.71 ?  629 ARG A NH1 1 
ATOM 3970 N NH2 . ARG A 1 530 ? 137.986 123.732 178.599 1.00 142.36 ?  629 ARG A NH2 1 
ATOM 3971 N N   . LEU A 1 531 ? 138.637 124.595 171.368 1.00 141.29 ?  630 LEU A N   1 
ATOM 3972 C CA  . LEU A 1 531 ? 138.964 125.438 170.220 1.00 158.76 ?  630 LEU A CA  1 
ATOM 3973 C C   . LEU A 1 531 ? 140.448 125.740 170.167 1.00 190.92 ?  630 LEU A C   1 
ATOM 3974 O O   . LEU A 1 531 ? 141.094 125.851 171.202 1.00 190.29 ?  630 LEU A O   1 
ATOM 3975 C CB  . LEU A 1 531 ? 138.157 126.734 170.256 1.00 20.00  ?  630 LEU A CB  1 
ATOM 3976 C CG  . LEU A 1 531 ? 138.286 127.701 171.437 1.00 20.00  ?  630 LEU A CG  1 
ATOM 3977 C CD1 . LEU A 1 531 ? 139.510 128.604 171.335 1.00 20.00  ?  630 LEU A CD1 1 
ATOM 3978 C CD2 . LEU A 1 531 ? 137.027 128.543 171.538 1.00 20.00  ?  630 LEU A CD2 1 
ATOM 3979 N N   . ALA A 1 532 ? 140.996 125.868 168.965 1.00 163.87 ?  631 ALA A N   1 
ATOM 3980 C CA  . ALA A 1 532 ? 142.430 126.082 168.847 1.00 174.70 ?  631 ALA A CA  1 
ATOM 3981 C C   . ALA A 1 532 ? 142.820 126.974 167.680 1.00 164.84 ?  631 ALA A C   1 
ATOM 3982 O O   . ALA A 1 532 ? 143.725 126.641 166.920 1.00 159.29 ?  631 ALA A O   1 
ATOM 3983 C CB  . ALA A 1 532 ? 143.137 124.752 168.736 1.00 20.00  ?  631 ALA A CB  1 
ATOM 3984 N N   . ARG A 1 533 ? 142.154 128.114 167.548 1.00 153.74 ?  632 ARG A N   1 
ATOM 3985 C CA  . ARG A 1 533 ? 142.545 129.098 166.548 1.00 153.83 ?  632 ARG A CA  1 
ATOM 3986 C C   . ARG A 1 533 ? 143.890 129.636 166.973 1.00 161.09 ?  632 ARG A C   1 
ATOM 3987 O O   . ARG A 1 533 ? 144.165 129.705 168.165 1.00 162.91 ?  632 ARG A O   1 
ATOM 3988 C CB  . ARG A 1 533 ? 141.532 130.231 166.446 1.00 20.00  ?  632 ARG A CB  1 
ATOM 3989 C CG  . ARG A 1 533 ? 140.102 129.752 166.408 1.00 20.00  ?  632 ARG A CG  1 
ATOM 3990 C CD  . ARG A 1 533 ? 139.857 128.811 165.251 1.00 20.00  ?  632 ARG A CD  1 
ATOM 3991 N NE  . ARG A 1 533 ? 138.457 128.415 165.186 1.00 20.00  ?  632 ARG A NE  1 
ATOM 3992 C CZ  . ARG A 1 533 ? 137.927 127.418 165.886 1.00 20.00  ?  632 ARG A CZ  1 
ATOM 3993 N NH1 . ARG A 1 533 ? 138.670 126.723 166.737 1.00 20.00  ?  632 ARG A NH1 1 
ATOM 3994 N NH2 . ARG A 1 533 ? 136.642 127.134 165.754 1.00 20.00  ?  632 ARG A NH2 1 
ATOM 3995 N N   . ALA A 1 534 ? 144.744 129.997 166.028 1.00 136.94 ?  633 ALA A N   1 
ATOM 3996 C CA  . ALA A 1 534 ? 146.011 130.597 166.409 1.00 151.93 ?  633 ALA A CA  1 
ATOM 3997 C C   . ALA A 1 534 ? 145.722 131.922 167.085 1.00 133.36 ?  633 ALA A C   1 
ATOM 3998 O O   . ALA A 1 534 ? 144.820 132.638 166.662 1.00 137.10 ?  633 ALA A O   1 
ATOM 3999 C CB  . ALA A 1 534 ? 146.901 130.791 165.207 1.00 20.00  ?  633 ALA A CB  1 
ATOM 4000 N N   . LEU A 1 535 ? 146.464 132.255 168.134 1.00 167.40 ?  634 LEU A N   1 
ATOM 4001 C CA  . LEU A 1 535 ? 146.216 133.523 168.796 1.00 151.95 ?  634 LEU A CA  1 
ATOM 4002 C C   . LEU A 1 535 ? 146.645 134.636 167.869 1.00 150.34 ?  634 LEU A C   1 
ATOM 4003 O O   . LEU A 1 535 ? 147.825 134.774 167.566 1.00 149.48 ?  634 LEU A O   1 
ATOM 4004 C CB  . LEU A 1 535 ? 146.951 133.619 170.129 1.00 144.57 ?  634 LEU A CB  1 
ATOM 4005 C CG  . LEU A 1 535 ? 146.517 134.802 171.001 1.00 145.72 ?  634 LEU A CG  1 
ATOM 4006 C CD1 . LEU A 1 535 ? 146.683 134.474 172.470 1.00 152.46 ?  634 LEU A CD1 1 
ATOM 4007 C CD2 . LEU A 1 535 ? 147.264 136.082 170.668 1.00 145.39 ?  634 LEU A CD2 1 
ATOM 4008 N N   . SER A 1 536 ? 145.685 135.444 167.440 1.00 138.93 ?  635 SER A N   1 
ATOM 4009 C CA  . SER A 1 536 ? 145.972 136.558 166.549 1.00 151.67 ?  635 SER A CA  1 
ATOM 4010 C C   . SER A 1 536 ? 144.814 137.551 166.439 1.00 154.66 ?  635 SER A C   1 
ATOM 4011 O O   . SER A 1 536 ? 145.058 138.758 166.410 1.00 158.81 ?  635 SER A O   1 
ATOM 4012 C CB  . SER A 1 536 ? 146.368 136.063 165.148 1.00 20.00  ?  635 SER A CB  1 
ATOM 4013 O OG  . SER A 1 536 ? 145.309 135.422 164.465 1.00 20.00  ?  635 SER A OG  1 
ATOM 4014 N N   . PRO A 1 537 ? 143.557 137.066 166.357 1.00 162.68 ?  636 PRO A N   1 
ATOM 4015 C CA  . PRO A 1 537 ? 142.503 138.084 166.356 1.00 147.53 ?  636 PRO A CA  1 
ATOM 4016 C C   . PRO A 1 537 ? 142.532 138.949 167.606 1.00 135.36 ?  636 PRO A C   1 
ATOM 4017 O O   . PRO A 1 537 ? 142.249 140.143 167.530 1.00 131.48 ?  636 PRO A O   1 
ATOM 4018 C CB  . PRO A 1 537 ? 141.220 137.253 166.316 1.00 20.00  ?  636 PRO A CB  1 
ATOM 4019 C CG  . PRO A 1 537 ? 141.625 135.976 165.692 1.00 20.00  ?  636 PRO A CG  1 
ATOM 4020 C CD  . PRO A 1 537 ? 142.985 135.714 166.237 1.00 20.00  ?  636 PRO A CD  1 
ATOM 4021 N N   . ALA A 1 538 ? 142.893 138.337 168.730 1.00 152.91 ?  637 ALA A N   1 
ATOM 4022 C CA  . ALA A 1 538 ? 142.971 139.008 170.025 1.00 153.83 ?  637 ALA A CA  1 
ATOM 4023 C C   . ALA A 1 538 ? 141.619 139.553 170.478 1.00 153.71 ?  637 ALA A C   1 
ATOM 4024 O O   . ALA A 1 538 ? 140.649 139.559 169.720 1.00 151.81 ?  637 ALA A O   1 
ATOM 4025 C CB  . ALA A 1 538 ? 144.005 140.127 169.987 1.00 154.32 ?  637 ALA A CB  1 
ATOM 4026 N N   . GLN A 1 539 ? 143.346 138.763 161.580 1.00 170.75 ?  639 GLN A N   1 
ATOM 4027 C CA  . GLN A 1 539 ? 144.187 139.914 161.285 1.00 172.57 ?  639 GLN A CA  1 
ATOM 4028 C C   . GLN A 1 539 ? 145.397 139.983 162.201 1.00 164.86 ?  639 GLN A C   1 
ATOM 4029 O O   . GLN A 1 539 ? 145.314 139.659 163.384 1.00 168.69 ?  639 GLN A O   1 
ATOM 4030 C CB  . GLN A 1 539 ? 143.381 141.204 161.395 1.00 181.61 ?  639 GLN A CB  1 
ATOM 4031 C CG  . GLN A 1 539 ? 144.183 142.442 161.079 1.00 201.18 ?  639 GLN A CG  1 
ATOM 4032 C CD  . GLN A 1 539 ? 144.708 142.441 159.665 1.00 195.23 ?  639 GLN A CD  1 
ATOM 4033 O OE1 . GLN A 1 539 ? 143.938 142.415 158.707 1.00 195.66 ?  639 GLN A OE1 1 
ATOM 4034 N NE2 . GLN A 1 539 ? 146.027 142.459 159.524 1.00 195.37 ?  639 GLN A NE2 1 
ATOM 4035 N N   . TRP A 1 540 ? 146.508 140.451 161.645 1.00 162.16 ?  640 TRP A N   1 
ATOM 4036 C CA  . TRP A 1 540 ? 147.754 140.586 162.379 1.00 148.83 ?  640 TRP A CA  1 
ATOM 4037 C C   . TRP A 1 540 ? 147.574 141.425 163.631 1.00 143.41 ?  640 TRP A C   1 
ATOM 4038 O O   . TRP A 1 540 ? 146.797 142.374 163.648 1.00 152.13 ?  640 TRP A O   1 
ATOM 4039 C CB  . TRP A 1 540 ? 148.817 141.226 161.491 1.00 141.54 ?  640 TRP A CB  1 
ATOM 4040 C CG  . TRP A 1 540 ? 150.004 141.688 162.257 1.00 147.12 ?  640 TRP A CG  1 
ATOM 4041 C CD1 . TRP A 1 540 ? 150.237 142.955 162.692 1.00 153.77 ?  640 TRP A CD1 1 
ATOM 4042 C CD2 . TRP A 1 540 ? 151.131 140.912 162.663 1.00 153.16 ?  640 TRP A CD2 1 
ATOM 4043 N NE1 . TRP A 1 540 ? 151.428 143.015 163.362 1.00 157.02 ?  640 TRP A NE1 1 
ATOM 4044 C CE2 . TRP A 1 540 ? 152.000 141.772 163.355 1.00 154.35 ?  640 TRP A CE2 1 
ATOM 4045 C CE3 . TRP A 1 540 ? 151.489 139.576 162.515 1.00 164.61 ?  640 TRP A CE3 1 
ATOM 4046 C CZ2 . TRP A 1 540 ? 153.203 141.339 163.895 1.00 150.24 ?  640 TRP A CZ2 1 
ATOM 4047 C CZ3 . TRP A 1 540 ? 152.684 139.148 163.054 1.00 168.82 ?  640 TRP A CZ3 1 
ATOM 4048 C CH2 . TRP A 1 540 ? 153.526 140.025 163.733 1.00 160.81 ?  640 TRP A CH2 1 
ATOM 4049 N N   . SER A 1 541 ? 148.269 141.045 164.693 1.00 133.44 ?  641 SER A N   1 
ATOM 4050 C CA  . SER A 1 541 ? 148.199 141.796 165.932 1.00 122.14 ?  641 SER A CA  1 
ATOM 4051 C C   . SER A 1 541 ? 149.555 141.859 166.629 1.00 137.33 ?  641 SER A C   1 
ATOM 4052 O O   . SER A 1 541 ? 149.953 142.916 167.113 1.00 140.66 ?  641 SER A O   1 
ATOM 4053 C CB  . SER A 1 541 ? 147.146 141.189 166.858 1.00 113.11 ?  641 SER A CB  1 
ATOM 4054 O OG  . SER A 1 541 ? 145.852 141.281 166.287 1.00 104.93 ?  641 SER A OG  1 
ATOM 4055 N N   . SER A 1 542 ? 150.268 140.734 166.676 1.00 126.96 ?  642 SER A N   1 
ATOM 4056 C CA  . SER A 1 542 ? 151.547 140.671 167.390 1.00 132.53 ?  642 SER A CA  1 
ATOM 4057 C C   . SER A 1 542 ? 152.467 139.552 166.897 1.00 214.14 ?  642 SER A C   1 
ATOM 4058 O O   . SER A 1 542 ? 152.023 138.611 166.248 1.00 208.84 ?  642 SER A O   1 
ATOM 4059 C CB  . SER A 1 542 ? 151.307 140.500 168.891 1.00 131.67 ?  642 SER A CB  1 
ATOM 4060 O OG  . SER A 1 542 ? 150.651 141.628 169.440 1.00 129.02 ?  642 SER A OG  1 
ATOM 4061 N N   . THR A 1 543 ? 153.752 139.664 167.218 1.00 190.68 ?  643 THR A N   1 
ATOM 4062 C CA  . THR A 1 543 ? 154.757 138.711 166.753 1.00 193.05 ?  643 THR A CA  1 
ATOM 4063 C C   . THR A 1 543 ? 154.959 137.502 167.664 1.00 180.53 ?  643 THR A C   1 
ATOM 4064 O O   . THR A 1 543 ? 155.124 136.378 167.198 1.00 178.87 ?  643 THR A O   1 
ATOM 4065 C CB  . THR A 1 543 ? 156.108 139.413 166.586 1.00 143.53 ?  643 THR A CB  1 
ATOM 4066 O OG1 . THR A 1 543 ? 155.989 140.435 165.592 1.00 143.82 ?  643 THR A OG1 1 
ATOM 4067 C CG2 . THR A 1 543 ? 157.182 138.428 166.174 1.00 141.22 ?  643 THR A CG2 1 
ATOM 4068 N N   . GLU A 1 544 ? 154.928 137.742 168.967 1.00 175.93 ?  644 GLU A N   1 
ATOM 4069 C CA  . GLU A 1 544 ? 155.268 136.722 169.945 1.00 155.41 ?  644 GLU A CA  1 
ATOM 4070 C C   . GLU A 1 544 ? 154.310 135.552 169.881 1.00 131.39 ?  644 GLU A C   1 
ATOM 4071 O O   . GLU A 1 544 ? 154.681 134.418 170.166 1.00 128.75 ?  644 GLU A O   1 
ATOM 4072 C CB  . GLU A 1 544 ? 155.242 137.321 171.339 1.00 160.58 ?  644 GLU A CB  1 
ATOM 4073 C CG  . GLU A 1 544 ? 156.209 138.457 171.521 1.00 145.28 ?  644 GLU A CG  1 
ATOM 4074 C CD  . GLU A 1 544 ? 156.003 139.165 172.837 1.00 142.93 ?  644 GLU A CD  1 
ATOM 4075 O OE1 . GLU A 1 544 ? 155.009 138.849 173.525 1.00 142.37 ?  644 GLU A OE1 1 
ATOM 4076 O OE2 . GLU A 1 544 ? 156.818 140.047 173.175 1.00 141.70 ?  644 GLU A OE2 1 
ATOM 4077 N N   . TYR A 1 545 ? 153.069 135.834 169.508 1.00 128.64 ?  645 TYR A N   1 
ATOM 4078 C CA  . TYR A 1 545 ? 152.040 134.807 169.482 1.00 123.33 ?  645 TYR A CA  1 
ATOM 4079 C C   . TYR A 1 545 ? 151.978 134.020 168.198 1.00 117.31 ?  645 TYR A C   1 
ATOM 4080 O O   . TYR A 1 545 ? 151.198 133.078 168.091 1.00 126.99 ?  645 TYR A O   1 
ATOM 4081 C CB  . TYR A 1 545 ? 150.688 135.418 169.775 1.00 122.37 ?  645 TYR A CB  1 
ATOM 4082 C CG  . TYR A 1 545 ? 150.582 135.778 171.216 1.00 137.94 ?  645 TYR A CG  1 
ATOM 4083 C CD1 . TYR A 1 545 ? 150.162 134.842 172.142 1.00 153.88 ?  645 TYR A CD1 1 
ATOM 4084 C CD2 . TYR A 1 545 ? 150.941 137.032 171.661 1.00 143.14 ?  645 TYR A CD2 1 
ATOM 4085 C CE1 . TYR A 1 545 ? 150.073 135.155 173.465 1.00 162.35 ?  645 TYR A CE1 1 
ATOM 4086 C CE2 . TYR A 1 545 ? 150.858 137.359 172.985 1.00 153.77 ?  645 TYR A CE2 1 
ATOM 4087 C CZ  . TYR A 1 545 ? 150.423 136.416 173.886 1.00 162.66 ?  645 TYR A CZ  1 
ATOM 4088 O OH  . TYR A 1 545 ? 150.338 136.740 175.218 1.00 165.17 ?  645 TYR A OH  1 
ATOM 4089 N N   . SER A 1 546 ? 152.789 134.414 167.227 1.00 131.58 ?  646 SER A N   1 
ATOM 4090 C CA  . SER A 1 546 ? 153.100 133.563 166.083 1.00 117.64 ?  646 SER A CA  1 
ATOM 4091 C C   . SER A 1 546 ? 151.933 133.305 165.131 1.00 112.18 ?  646 SER A C   1 
ATOM 4092 O O   . SER A 1 546 ? 150.781 133.186 165.541 1.00 98.96  ?  646 SER A O   1 
ATOM 4093 C CB  . SER A 1 546 ? 153.654 132.231 166.582 1.00 107.04 ?  646 SER A CB  1 
ATOM 4094 O OG  . SER A 1 546 ? 152.667 131.491 167.280 1.00 97.43  ?  646 SER A OG  1 
ATOM 4095 N N   . THR A 1 547 ? 152.256 133.208 163.846 1.00 122.52 ?  647 THR A N   1 
ATOM 4096 C CA  . THR A 1 547 ? 151.246 133.097 162.801 1.00 129.91 ?  647 THR A CA  1 
ATOM 4097 C C   . THR A 1 547 ? 151.637 132.153 161.675 1.00 127.26 ?  647 THR A C   1 
ATOM 4098 O O   . THR A 1 547 ? 152.809 132.040 161.330 1.00 119.20 ?  647 THR A O   1 
ATOM 4099 C CB  . THR A 1 547 ? 150.962 134.457 162.141 1.00 159.66 ?  647 THR A CB  1 
ATOM 4100 O OG1 . THR A 1 547 ? 152.164 134.955 161.541 1.00 166.89 ?  647 THR A OG1 1 
ATOM 4101 C CG2 . THR A 1 547 ? 150.448 135.459 163.148 1.00 167.38 ?  647 THR A CG2 1 
ATOM 4102 N N   . TRP A 1 548 ? 150.638 131.499 161.094 1.00 117.48 ?  648 TRP A N   1 
ATOM 4103 C CA  . TRP A 1 548 ? 150.779 130.887 159.783 1.00 129.05 ?  648 TRP A CA  1 
ATOM 4104 C C   . TRP A 1 548 ? 149.436 130.890 159.098 1.00 128.17 ?  648 TRP A C   1 
ATOM 4105 O O   . TRP A 1 548 ? 148.399 130.862 159.749 1.00 128.51 ?  648 TRP A O   1 
ATOM 4106 C CB  . TRP A 1 548 ? 151.312 129.468 159.864 1.00 133.96 ?  648 TRP A CB  1 
ATOM 4107 C CG  . TRP A 1 548 ? 152.707 129.384 160.310 1.00 140.32 ?  648 TRP A CG  1 
ATOM 4108 C CD1 . TRP A 1 548 ? 153.138 129.077 161.550 1.00 148.70 ?  648 TRP A CD1 1 
ATOM 4109 C CD2 . TRP A 1 548 ? 153.873 129.647 159.530 1.00 136.95 ?  648 TRP A CD2 1 
ATOM 4110 N NE1 . TRP A 1 548 ? 154.507 129.110 161.598 1.00 151.74 ?  648 TRP A NE1 1 
ATOM 4111 C CE2 . TRP A 1 548 ? 154.981 129.460 160.364 1.00 146.57 ?  648 TRP A CE2 1 
ATOM 4112 C CE3 . TRP A 1 548 ? 154.085 130.015 158.205 1.00 143.25 ?  648 TRP A CE3 1 
ATOM 4113 C CZ2 . TRP A 1 548 ? 156.281 129.624 159.919 1.00 151.51 ?  648 TRP A CZ2 1 
ATOM 4114 C CZ3 . TRP A 1 548 ? 155.374 130.178 157.767 1.00 150.07 ?  648 TRP A CZ3 1 
ATOM 4115 C CH2 . TRP A 1 548 ? 156.455 129.984 158.618 1.00 152.93 ?  648 TRP A CH2 1 
ATOM 4116 N N   . THR A 1 549 ? 149.463 130.920 157.775 1.00 110.64 ?  649 THR A N   1 
ATOM 4117 C CA  . THR A 1 549 ? 148.255 131.027 156.976 1.00 124.22 ?  649 THR A CA  1 
ATOM 4118 C C   . THR A 1 549 ? 148.427 130.309 155.664 1.00 106.71 ?  649 THR A C   1 
ATOM 4119 O O   . THR A 1 549 ? 149.542 129.987 155.258 1.00 108.87 ?  649 THR A O   1 
ATOM 4120 C CB  . THR A 1 549 ? 147.897 132.474 156.665 1.00 163.48 ?  649 THR A CB  1 
ATOM 4121 O OG1 . THR A 1 549 ? 149.017 133.105 156.034 1.00 163.56 ?  649 THR A OG1 1 
ATOM 4122 C CG2 . THR A 1 549 ? 147.515 133.235 157.921 1.00 166.43 ?  649 THR A CG2 1 
ATOM 4123 N N   . GLU A 1 550 ? 147.316 130.069 154.990 1.00 118.12 ?  650 GLU A N   1 
ATOM 4124 C CA  . GLU A 1 550 ? 147.364 129.353 153.737 1.00 104.37 ?  650 GLU A CA  1 
ATOM 4125 C C   . GLU A 1 550 ? 146.686 130.146 152.637 1.00 82.74  ?  650 GLU A C   1 
ATOM 4126 O O   . GLU A 1 550 ? 145.628 130.730 152.845 1.00 78.06  ?  650 GLU A O   1 
ATOM 4127 C CB  . GLU A 1 550 ? 146.706 127.991 153.889 1.00 108.51 ?  650 GLU A CB  1 
ATOM 4128 C CG  . GLU A 1 550 ? 146.831 127.127 152.667 1.00 128.36 ?  650 GLU A CG  1 
ATOM 4129 C CD  . GLU A 1 550 ? 146.256 125.750 152.877 1.00 147.89 ?  650 GLU A CD  1 
ATOM 4130 O OE1 . GLU A 1 550 ? 145.673 125.511 153.952 1.00 154.13 ?  650 GLU A OE1 1 
ATOM 4131 O OE2 . GLU A 1 550 ? 146.398 124.900 151.974 1.00 154.91 ?  650 GLU A OE2 1 
ATOM 4132 N N   . SER A 1 551 ? 147.311 130.191 151.469 1.00 85.70  ?  651 SER A N   1 
ATOM 4133 C CA  . SER A 1 551 ? 146.684 130.825 150.328 1.00 78.77  ?  651 SER A CA  1 
ATOM 4134 C C   . SER A 1 551 ? 145.513 129.999 149.850 1.00 82.53  ?  651 SER A C   1 
ATOM 4135 O O   . SER A 1 551 ? 145.577 128.776 149.827 1.00 81.88  ?  651 SER A O   1 
ATOM 4136 C CB  . SER A 1 551 ? 147.674 131.010 149.192 1.00 83.92  ?  651 SER A CB  1 
ATOM 4137 O OG  . SER A 1 551 ? 147.019 131.587 148.079 1.00 96.04  ?  651 SER A OG  1 
ATOM 4138 N N   . ARG A 1 552 ? 144.446 130.667 149.451 1.00 70.14  ?  652 ARG A N   1 
ATOM 4139 C CA  . ARG A 1 552 ? 143.297 129.967 148.923 1.00 104.13 ?  652 ARG A CA  1 
ATOM 4140 C C   . ARG A 1 552 ? 143.625 129.422 147.539 1.00 161.43 ?  652 ARG A C   1 
ATOM 4141 O O   . ARG A 1 552 ? 144.482 129.953 146.843 1.00 167.21 ?  652 ARG A O   1 
ATOM 4142 C CB  . ARG A 1 552 ? 142.090 130.887 148.869 1.00 85.87  ?  652 ARG A CB  1 
ATOM 4143 C CG  . ARG A 1 552 ? 140.841 130.185 148.446 1.00 83.35  ?  652 ARG A CG  1 
ATOM 4144 C CD  . ARG A 1 552 ? 140.544 129.055 149.401 1.00 83.62  ?  652 ARG A CD  1 
ATOM 4145 N NE  . ARG A 1 552 ? 140.232 129.537 150.741 1.00 90.89  ?  652 ARG A NE  1 
ATOM 4146 C CZ  . ARG A 1 552 ? 139.006 129.875 151.131 1.00 100.53 ?  652 ARG A CZ  1 
ATOM 4147 N NH1 . ARG A 1 552 ? 137.993 129.780 150.282 1.00 103.77 ?  652 ARG A NH1 1 
ATOM 4148 N NH2 . ARG A 1 552 ? 138.784 130.308 152.363 1.00 103.44 ?  652 ARG A NH2 1 
ATOM 4149 N N   . TRP A 1 553 ? 142.951 128.350 147.154 1.00 175.24 ?  653 TRP A N   1 
ATOM 4150 C CA  . TRP A 1 553 ? 143.205 127.681 145.889 1.00 174.68 ?  653 TRP A CA  1 
ATOM 4151 C C   . TRP A 1 553 ? 142.541 128.314 144.696 1.00 147.52 ?  653 TRP A C   1 
ATOM 4152 O O   . TRP A 1 553 ? 142.119 129.464 144.734 1.00 148.69 ?  653 TRP A O   1 
ATOM 4153 C CB  . TRP A 1 553 ? 142.721 126.248 145.968 1.00 149.35 ?  653 TRP A CB  1 
ATOM 4154 C CG  . TRP A 1 553 ? 143.490 125.478 146.900 1.00 126.81 ?  653 TRP A CG  1 
ATOM 4155 C CD1 . TRP A 1 553 ? 143.194 125.234 148.196 1.00 120.07 ?  653 TRP A CD1 1 
ATOM 4156 C CD2 . TRP A 1 553 ? 144.727 124.852 146.637 1.00 120.39 ?  653 TRP A CD2 1 
ATOM 4157 N NE1 . TRP A 1 553 ? 144.173 124.472 148.764 1.00 125.39 ?  653 TRP A NE1 1 
ATOM 4158 C CE2 . TRP A 1 553 ? 145.131 124.223 147.820 1.00 129.24 ?  653 TRP A CE2 1 
ATOM 4159 C CE3 . TRP A 1 553 ? 145.527 124.748 145.508 1.00 135.30 ?  653 TRP A CE3 1 
ATOM 4160 C CZ2 . TRP A 1 553 ? 146.304 123.507 147.911 1.00 143.92 ?  653 TRP A CZ2 1 
ATOM 4161 C CZ3 . TRP A 1 553 ? 146.687 124.043 145.595 1.00 150.96 ?  653 TRP A CZ3 1 
ATOM 4162 C CH2 . TRP A 1 553 ? 147.071 123.426 146.788 1.00 155.82 ?  653 TRP A CH2 1 
ATOM 4163 N N   . LYS A 1 554 ? 142.435 127.515 143.644 1.00 134.45 ?  654 LYS A N   1 
ATOM 4164 C CA  . LYS A 1 554 ? 141.751 127.891 142.423 1.00 111.45 ?  654 LYS A CA  1 
ATOM 4165 C C   . LYS A 1 554 ? 141.607 126.651 141.547 1.00 89.45  ?  654 LYS A C   1 
ATOM 4166 O O   . LYS A 1 554 ? 141.326 126.750 140.356 1.00 87.97  ?  654 LYS A O   1 
ATOM 4167 C CB  . LYS A 1 554 ? 142.533 128.978 141.688 1.00 141.63 ?  654 LYS A CB  1 
ATOM 4168 C CG  . LYS A 1 554 ? 141.683 129.859 140.787 1.00 172.61 ?  654 LYS A CG  1 
ATOM 4169 C CD  . LYS A 1 554 ? 140.326 130.148 141.407 1.00 201.74 ?  654 LYS A CD  1 
ATOM 4170 C CE  . LYS A 1 554 ? 139.357 129.003 141.171 1.00 223.89 ?  654 LYS A CE  1 
ATOM 4171 N NZ  . LYS A 1 554 ? 138.324 129.352 140.158 1.00 221.48 ?  654 LYS A NZ  1 
ATOM 4172 N N   . ALA A 1 555 ? 141.803 125.481 142.148 1.00 30.00  ?  655 ALA A N   1 
ATOM 4173 C CA  . ALA A 1 555 ? 141.757 124.220 141.420 1.00 30.00  ?  655 ALA A CA  1 
ATOM 4174 C C   . ALA A 1 555 ? 143.027 124.055 140.598 1.00 30.00  ?  655 ALA A C   1 
ATOM 4175 O O   . ALA A 1 555 ? 143.173 124.668 139.545 1.00 30.00  ?  655 ALA A O   1 
ATOM 4176 C CB  . ALA A 1 555 ? 140.532 124.170 140.524 1.00 30.00  ?  655 ALA A CB  1 
ATOM 4177 N N   . ILE A 1 556 ? 143.947 123.229 141.085 1.00 82.21  ?  656 ILE A N   1 
ATOM 4178 C CA  . ILE A 1 556 ? 145.251 123.085 140.448 1.00 81.92  ?  656 ILE A CA  1 
ATOM 4179 C C   . ILE A 1 556 ? 145.478 121.735 139.789 1.00 90.70  ?  656 ILE A C   1 
ATOM 4180 O O   . ILE A 1 556 ? 145.092 120.696 140.317 1.00 93.44  ?  656 ILE A O   1 
ATOM 4181 C CB  . ILE A 1 556 ? 146.398 123.315 141.447 1.00 70.60  ?  656 ILE A CB  1 
ATOM 4182 C CG1 . ILE A 1 556 ? 145.994 122.856 142.850 1.00 67.42  ?  656 ILE A CG1 1 
ATOM 4183 C CG2 . ILE A 1 556 ? 146.816 124.776 141.448 1.00 68.90  ?  656 ILE A CG2 1 
ATOM 4184 C CD1 . ILE A 1 556 ? 145.187 121.577 142.871 1.00 66.28  ?  656 ILE A CD1 1 
ATOM 4185 N N   . ARG A 1 557 ? 146.128 121.767 138.632 1.00 64.82  ?  657 ARG A N   1 
ATOM 4186 C CA  . ARG A 1 557 ? 146.521 120.563 137.930 1.00 59.02  ?  657 ARG A CA  1 
ATOM 4187 C C   . ARG A 1 557 ? 147.655 120.784 136.964 1.00 70.51  ?  657 ARG A C   1 
ATOM 4188 O O   . ARG A 1 557 ? 147.962 121.911 136.586 1.00 64.84  ?  657 ARG A O   1 
ATOM 4189 C CB  . ARG A 1 557 ? 145.328 120.006 137.176 1.00 202.07 ?  657 ARG A CB  1 
ATOM 4190 C CG  . ARG A 1 557 ? 144.803 120.982 136.158 1.00 195.35 ?  657 ARG A CG  1 
ATOM 4191 C CD  . ARG A 1 557 ? 143.539 120.473 135.519 1.00 229.32 ?  657 ARG A CD  1 
ATOM 4192 N NE  . ARG A 1 557 ? 142.993 121.436 134.573 1.00 225.45 ?  657 ARG A NE  1 
ATOM 4193 C CZ  . ARG A 1 557 ? 142.215 122.451 134.926 1.00 219.37 ?  657 ARG A CZ  1 
ATOM 4194 N NH1 . ARG A 1 557 ? 141.898 122.627 136.200 1.00 217.96 ?  657 ARG A NH1 1 
ATOM 4195 N NH2 . ARG A 1 557 ? 141.752 123.289 134.010 1.00 217.10 ?  657 ARG A NH2 1 
ATOM 4196 N N   . ALA A 1 558 ? 148.266 119.683 136.561 1.00 98.55  ?  658 ALA A N   1 
ATOM 4197 C CA  . ALA A 1 558 ? 149.221 119.686 135.473 1.00 116.05 ?  658 ALA A CA  1 
ATOM 4198 C C   . ALA A 1 558 ? 148.695 118.734 134.428 1.00 112.65 ?  658 ALA A C   1 
ATOM 4199 O O   . ALA A 1 558 ? 147.917 117.839 134.747 1.00 112.35 ?  658 ALA A O   1 
ATOM 4200 C CB  . ALA A 1 558 ? 150.590 119.268 135.949 1.00 129.84 ?  658 ALA A CB  1 
ATOM 4201 N N   . ARG A 1 559 ? 149.089 118.919 133.179 1.00 113.00 ?  659 ARG A N   1 
ATOM 4202 C CA  . ARG A 1 559 ? 148.643 117.984 132.173 1.00 126.16 ?  659 ARG A CA  1 
ATOM 4203 C C   . ARG A 1 559 ? 149.667 117.882 131.074 1.00 132.84 ?  659 ARG A C   1 
ATOM 4204 O O   . ARG A 1 559 ? 150.308 118.864 130.706 1.00 132.43 ?  659 ARG A O   1 
ATOM 4205 C CB  . ARG A 1 559 ? 147.272 118.395 131.626 1.00 133.84 ?  659 ARG A CB  1 
ATOM 4206 C CG  . ARG A 1 559 ? 147.218 119.630 130.731 1.00 132.57 ?  659 ARG A CG  1 
ATOM 4207 C CD  . ARG A 1 559 ? 145.757 120.001 130.438 1.00 113.01 ?  659 ARG A CD  1 
ATOM 4208 N NE  . ARG A 1 559 ? 145.611 121.028 129.410 1.00 108.89 ?  659 ARG A NE  1 
ATOM 4209 C CZ  . ARG A 1 559 ? 145.404 120.766 128.122 1.00 107.21 ?  659 ARG A CZ  1 
ATOM 4210 N NH1 . ARG A 1 559 ? 145.295 119.513 127.705 1.00 112.61 ?  659 ARG A NH1 1 
ATOM 4211 N NH2 . ARG A 1 559 ? 145.286 121.759 127.252 1.00 104.48 ?  659 ARG A NH2 1 
ATOM 4212 N N   . ILE A 1 560 ? 149.856 116.663 130.595 1.00 115.75 ?  660 ILE A N   1 
ATOM 4213 C CA  . ILE A 1 560 ? 150.789 116.408 129.522 1.00 127.20 ?  660 ILE A CA  1 
ATOM 4214 C C   . ILE A 1 560 ? 150.165 116.746 128.180 1.00 151.27 ?  660 ILE A C   1 
ATOM 4215 O O   . ILE A 1 560 ? 148.948 116.672 128.027 1.00 156.19 ?  660 ILE A O   1 
ATOM 4216 C CB  . ILE A 1 560 ? 151.244 114.951 129.529 1.00 133.18 ?  660 ILE A CB  1 
ATOM 4217 C CG1 . ILE A 1 560 ? 152.448 114.789 128.618 1.00 131.93 ?  660 ILE A CG1 1 
ATOM 4218 C CG2 . ILE A 1 560 ? 150.117 114.033 129.113 1.00 140.86 ?  660 ILE A CG2 1 
ATOM 4219 C CD1 . ILE A 1 560 ? 153.600 115.595 129.092 1.00 129.55 ?  660 ILE A CD1 1 
ATOM 4220 N N   . PHE A 1 561 ? 150.989 117.127 127.211 1.00 159.21 ?  661 PHE A N   1 
ATOM 4221 C CA  . PHE A 1 561 ? 150.512 117.270 125.845 1.00 173.47 ?  661 PHE A CA  1 
ATOM 4222 C C   . PHE A 1 561 ? 151.663 117.241 124.854 1.00 192.39 ?  661 PHE A C   1 
ATOM 4223 O O   . PHE A 1 561 ? 152.769 117.710 125.149 1.00 214.36 ?  661 PHE A O   1 
ATOM 4224 C CB  . PHE A 1 561 ? 149.736 118.563 125.686 1.00 175.03 ?  661 PHE A CB  1 
ATOM 4225 C CG  . PHE A 1 561 ? 150.557 119.768 125.933 1.00 164.01 ?  661 PHE A CG  1 
ATOM 4226 C CD1 . PHE A 1 561 ? 150.741 120.233 127.208 1.00 157.01 ?  661 PHE A CD1 1 
ATOM 4227 C CD2 . PHE A 1 561 ? 151.185 120.413 124.894 1.00 164.22 ?  661 PHE A CD2 1 
ATOM 4228 C CE1 . PHE A 1 561 ? 151.514 121.337 127.442 1.00 162.77 ?  661 PHE A CE1 1 
ATOM 4229 C CE2 . PHE A 1 561 ? 151.954 121.520 125.124 1.00 161.24 ?  661 PHE A CE2 1 
ATOM 4230 C CZ  . PHE A 1 561 ? 152.119 121.984 126.401 1.00 162.70 ?  661 PHE A CZ  1 
ATOM 4231 N N   . LEU A 1 562 ? 151.401 116.673 123.683 1.00 172.52 ?  662 LEU A N   1 
ATOM 4232 C CA  . LEU A 1 562 ? 152.365 116.683 122.598 1.00 123.04 ?  662 LEU A CA  1 
ATOM 4233 C C   . LEU A 1 562 ? 152.547 118.135 122.161 1.00 117.55 ?  662 LEU A C   1 
ATOM 4234 O O   . LEU A 1 562 ? 151.560 118.840 121.963 1.00 119.23 ?  662 LEU A O   1 
ATOM 4235 C CB  . LEU A 1 562 ? 151.875 115.811 121.436 1.00 89.65  ?  662 LEU A CB  1 
ATOM 4236 C CG  . LEU A 1 562 ? 151.911 114.278 121.555 1.00 75.46  ?  662 LEU A CG  1 
ATOM 4237 C CD1 . LEU A 1 562 ? 150.889 113.748 122.565 1.00 65.03  ?  662 LEU A CD1 1 
ATOM 4238 C CD2 . LEU A 1 562 ? 151.704 113.618 120.202 1.00 78.67  ?  662 LEU A CD2 1 
ATOM 4239 N N   . ILE A 1 563 ? 153.785 118.588 121.992 1.00 30.00  ?  663 ILE A N   1 
ATOM 4240 C CA  . ILE A 1 563 ? 153.998 120.001 121.687 1.00 30.00  ?  663 ILE A CA  1 
ATOM 4241 C C   . ILE A 1 563 ? 153.713 120.309 120.231 1.00 30.00  ?  663 ILE A C   1 
ATOM 4242 O O   . ILE A 1 563 ? 153.804 119.436 119.371 1.00 30.00  ?  663 ILE A O   1 
ATOM 4243 C CB  . ILE A 1 563 ? 155.422 120.464 121.999 1.00 20.00  ?  663 ILE A CB  1 
ATOM 4244 C CG1 . ILE A 1 563 ? 155.480 121.990 122.035 1.00 20.00  ?  663 ILE A CG1 1 
ATOM 4245 C CG2 . ILE A 1 563 ? 156.350 120.021 120.907 1.00 20.00  ?  663 ILE A CG2 1 
ATOM 4246 C CD1 . ILE A 1 563 ? 154.566 122.611 123.052 1.00 20.00  ?  663 ILE A CD1 1 
ATOM 4247 N N   . ALA A 1 564 ? 153.335 121.551 119.968 1.00 30.00  ?  664 ALA A N   1 
ATOM 4248 C CA  . ALA A 1 564 ? 153.353 122.082 118.621 1.00 30.00  ?  664 ALA A CA  1 
ATOM 4249 C C   . ALA A 1 564 ? 154.515 123.055 118.501 1.00 30.00  ?  664 ALA A C   1 
ATOM 4250 O O   . ALA A 1 564 ? 154.541 124.069 119.191 1.00 30.00  ?  664 ALA A O   1 
ATOM 4251 C CB  . ALA A 1 564 ? 152.049 122.764 118.301 1.00 30.00  ?  664 ALA A CB  1 
ATOM 4252 N N   . SER A 1 565 ? 155.479 122.748 117.639 1.00 30.00  ?  665 SER A N   1 
ATOM 4253 C CA  . SER A 1 565 ? 156.622 123.635 117.454 1.00 30.00  ?  665 SER A CA  1 
ATOM 4254 C C   . SER A 1 565 ? 156.159 124.972 116.881 1.00 30.00  ?  665 SER A C   1 
ATOM 4255 O O   . SER A 1 565 ? 155.354 125.009 115.950 1.00 30.00  ?  665 SER A O   1 
ATOM 4256 C CB  . SER A 1 565 ? 157.662 122.990 116.543 1.00 20.00  ?  665 SER A CB  1 
ATOM 4257 O OG  . SER A 1 565 ? 158.755 123.863 116.341 1.00 20.00  ?  665 SER A OG  1 
ATOM 4258 N N   . UNK A 1 566 ? 156.686 126.063 117.427 1.00 30.00  ?  666 UNK A N   1 
ATOM 4259 C CA  . UNK A 1 566 ? 156.141 127.395 117.175 1.00 30.00  ?  666 UNK A CA  1 
ATOM 4260 C C   . UNK A 1 566 ? 156.227 127.829 115.715 1.00 30.00  ?  666 UNK A C   1 
ATOM 4261 O O   . UNK A 1 566 ? 155.362 128.558 115.216 1.00 30.00  ?  666 UNK A O   1 
ATOM 4262 C CB  . UNK A 1 566 ? 156.849 128.407 118.054 1.00 20.00  ?  666 UNK A CB  1 
ATOM 4263 N N   . UNK A 1 567 ? 157.261 127.364 115.028 1.00 30.00  ?  667 UNK A N   1 
ATOM 4264 C CA  . UNK A 1 567 ? 157.504 127.791 113.663 1.00 30.00  ?  667 UNK A CA  1 
ATOM 4265 C C   . UNK A 1 567 ? 156.359 127.384 112.754 1.00 30.00  ?  667 UNK A C   1 
ATOM 4266 O O   . UNK A 1 567 ? 155.829 128.202 112.001 1.00 30.00  ?  667 UNK A O   1 
ATOM 4267 C CB  . UNK A 1 567 ? 158.806 127.209 113.159 1.00 20.00  ?  667 UNK A CB  1 
ATOM 4268 N N   . UNK A 1 568 ? 155.963 126.122 112.846 1.00 30.00  ?  668 UNK A N   1 
ATOM 4269 C CA  . UNK A 1 568 ? 154.914 125.613 111.982 1.00 30.00  ?  668 UNK A CA  1 
ATOM 4270 C C   . UNK A 1 568 ? 153.602 126.335 112.240 1.00 30.00  ?  668 UNK A C   1 
ATOM 4271 O O   . UNK A 1 568 ? 152.838 126.604 111.315 1.00 30.00  ?  668 UNK A O   1 
ATOM 4272 C CB  . UNK A 1 568 ? 154.745 124.123 112.186 1.00 20.00  ?  668 UNK A CB  1 
ATOM 4273 N N   . UNK A 1 569 ? 153.354 126.674 113.497 1.00 30.00  ?  669 UNK A N   1 
ATOM 4274 C CA  . UNK A 1 569 ? 152.132 127.377 113.838 1.00 30.00  ?  669 UNK A CA  1 
ATOM 4275 C C   . UNK A 1 569 ? 152.150 128.767 113.234 1.00 30.00  ?  669 UNK A C   1 
ATOM 4276 O O   . UNK A 1 569 ? 151.136 129.257 112.726 1.00 30.00  ?  669 UNK A O   1 
ATOM 4277 C CB  . UNK A 1 569 ? 151.965 127.452 115.341 1.00 20.00  ?  669 UNK A CB  1 
ATOM 4278 N N   . UNK A 1 570 ? 153.317 129.397 113.270 1.00 20.00  ?  670 UNK A N   1 
ATOM 4279 C CA  . UNK A 1 570 ? 153.440 130.720 112.692 1.00 20.00  ?  670 UNK A CA  1 
ATOM 4280 C C   . UNK A 1 570 ? 153.182 130.621 111.206 1.00 20.00  ?  670 UNK A C   1 
ATOM 4281 O O   . UNK A 1 570 ? 152.574 131.505 110.602 1.00 20.00  ?  670 UNK A O   1 
ATOM 4282 C CB  . UNK A 1 570 ? 154.805 131.300 112.967 1.00 20.00  ?  670 UNK A CB  1 
ATOM 4283 N N   . UNK A 1 571 ? 153.612 129.508 110.629 1.00 20.00  ?  671 UNK A N   1 
ATOM 4284 C CA  . UNK A 1 571 ? 153.372 129.277 109.222 1.00 20.00  ?  671 UNK A CA  1 
ATOM 4285 C C   . UNK A 1 571 ? 151.883 129.148 108.992 1.00 20.00  ?  671 UNK A C   1 
ATOM 4286 O O   . UNK A 1 571 ? 151.366 129.560 107.955 1.00 20.00  ?  671 UNK A O   1 
ATOM 4287 C CB  . UNK A 1 571 ? 154.096 128.035 108.754 1.00 20.00  ?  671 UNK A CB  1 
ATOM 4288 N N   . UNK A 1 572 ? 151.190 128.597 109.980 1.00 20.00  ?  672 UNK A N   1 
ATOM 4289 C CA  . UNK A 1 572 ? 149.756 128.409 109.860 1.00 20.00  ?  672 UNK A CA  1 
ATOM 4290 C C   . UNK A 1 572 ? 149.053 129.752 109.833 1.00 20.00  ?  672 UNK A C   1 
ATOM 4291 O O   . UNK A 1 572 ? 148.224 130.012 108.960 1.00 20.00  ?  672 UNK A O   1 
ATOM 4292 C CB  . UNK A 1 572 ? 149.229 127.557 110.995 1.00 20.00  ?  672 UNK A CB  1 
ATOM 4293 N N   . UNK A 1 573 ? 149.396 130.615 110.781 1.00 20.00  ?  673 UNK A N   1 
ATOM 4294 C CA  . UNK A 1 573 ? 148.763 131.922 110.834 1.00 20.00  ?  673 UNK A CA  1 
ATOM 4295 C C   . UNK A 1 573 ? 149.086 132.734 109.587 1.00 20.00  ?  673 UNK A C   1 
ATOM 4296 O O   . UNK A 1 573 ? 148.241 133.477 109.076 1.00 20.00  ?  673 UNK A O   1 
ATOM 4297 C CB  . UNK A 1 573 ? 149.199 132.666 112.076 1.00 20.00  ?  673 UNK A CB  1 
ATOM 4298 N N   . UNK A 1 574 ? 150.299 132.559 109.074 1.00 20.00  ?  674 UNK A N   1 
ATOM 4299 C CA  . UNK A 1 574 ? 150.719 133.298 107.893 1.00 20.00  ?  674 UNK A CA  1 
ATOM 4300 C C   . UNK A 1 574 ? 149.923 132.858 106.676 1.00 20.00  ?  674 UNK A C   1 
ATOM 4301 O O   . UNK A 1 574 ? 149.422 133.685 105.908 1.00 20.00  ?  674 UNK A O   1 
ATOM 4302 C CB  . UNK A 1 574 ? 152.203 133.109 107.649 1.00 20.00  ?  674 UNK A CB  1 
ATOM 4303 N N   . UNK A 1 575 ? 149.790 131.546 106.520 1.00 20.00  ?  675 UNK A N   1 
ATOM 4304 C CA  . UNK A 1 575 ? 149.035 131.001 105.406 1.00 20.00  ?  675 UNK A CA  1 
ATOM 4305 C C   . UNK A 1 575 ? 147.592 131.438 105.526 1.00 20.00  ?  675 UNK A C   1 
ATOM 4306 O O   . UNK A 1 575 ? 146.900 131.639 104.529 1.00 20.00  ?  675 UNK A O   1 
ATOM 4307 C CB  . UNK A 1 575 ? 149.134 129.495 105.381 1.00 20.00  ?  675 UNK A CB  1 
ATOM 4308 N N   . UNK A 1 576 ? 147.154 131.607 106.766 1.00 20.00  ?  676 UNK A N   1 
ATOM 4309 C CA  . UNK A 1 576 ? 145.787 132.002 107.044 1.00 20.00  ?  676 UNK A CA  1 
ATOM 4310 C C   . UNK A 1 576 ? 145.516 133.419 106.563 1.00 20.00  ?  676 UNK A C   1 
ATOM 4311 O O   . UNK A 1 576 ? 144.534 133.679 105.853 1.00 20.00  ?  676 UNK A O   1 
ATOM 4312 C CB  . UNK A 1 576 ? 145.519 131.889 108.518 1.00 20.00  ?  676 UNK A CB  1 
ATOM 4313 N N   . UNK A 1 577 ? 146.411 134.330 106.929 1.00 20.00  ?  677 UNK A N   1 
ATOM 4314 C CA  . UNK A 1 577 ? 146.278 135.710 106.492 1.00 20.00  ?  677 UNK A CA  1 
ATOM 4315 C C   . UNK A 1 577 ? 146.381 135.769 104.978 1.00 20.00  ?  677 UNK A C   1 
ATOM 4316 O O   . UNK A 1 577 ? 145.734 136.594 104.331 1.00 20.00  ?  677 UNK A O   1 
ATOM 4317 C CB  . UNK A 1 577 ? 147.335 136.586 107.137 1.00 20.00  ?  677 UNK A CB  1 
ATOM 4318 N N   . UNK A 1 578 ? 147.182 134.868 104.417 1.00 20.00  ?  678 UNK A N   1 
ATOM 4319 C CA  . UNK A 1 578 ? 147.355 134.814 102.974 1.00 20.00  ?  678 UNK A CA  1 
ATOM 4320 C C   . UNK A 1 578 ? 146.062 134.425 102.270 1.00 20.00  ?  678 UNK A C   1 
ATOM 4321 O O   . UNK A 1 578 ? 145.681 135.035 101.269 1.00 20.00  ?  678 UNK A O   1 
ATOM 4322 C CB  . UNK A 1 578 ? 148.461 133.841 102.614 1.00 20.00  ?  678 UNK A CB  1 
ATOM 4323 N N   . UNK A 1 579 ? 145.385 133.409 102.791 1.00 20.00  ?  679 UNK A N   1 
ATOM 4324 C CA  . UNK A 1 579 ? 144.130 132.987 102.195 1.00 20.00  ?  679 UNK A CA  1 
ATOM 4325 C C   . UNK A 1 579 ? 143.106 134.092 102.336 1.00 20.00  ?  679 UNK A C   1 
ATOM 4326 O O   . UNK A 1 579 ? 142.288 134.321 101.440 1.00 20.00  ?  679 UNK A O   1 
ATOM 4327 C CB  . UNK A 1 579 ? 143.634 131.714 102.840 1.00 20.00  ?  679 UNK A CB  1 
ATOM 4328 N N   . UNK A 1 580 ? 143.181 134.805 103.452 1.00 20.00  ?  680 UNK A N   1 
ATOM 4329 C CA  . UNK A 1 580 ? 142.280 135.925 103.654 1.00 20.00  ?  680 UNK A CA  1 
ATOM 4330 C C   . UNK A 1 580 ? 142.542 136.975 102.591 1.00 20.00  ?  680 UNK A C   1 
ATOM 4331 O O   . UNK A 1 580 ? 141.620 137.624 102.094 1.00 20.00  ?  680 UNK A O   1 
ATOM 4332 C CB  . UNK A 1 580 ? 142.455 136.508 105.034 1.00 20.00  ?  680 UNK A CB  1 
ATOM 4333 N N   . UNK A 1 581 ? 143.808 137.105 102.214 1.00 20.00  ?  681 UNK A N   1 
ATOM 4334 C CA  . UNK A 1 581 ? 144.197 138.088 101.218 1.00 20.00  ?  681 UNK A CA  1 
ATOM 4335 C C   . UNK A 1 581 ? 143.700 137.706 99.833  1.00 20.00  ?  681 UNK A C   1 
ATOM 4336 O O   . UNK A 1 581 ? 143.146 138.539 99.122  1.00 20.00  ?  681 UNK A O   1 
ATOM 4337 C CB  . UNK A 1 581 ? 145.702 138.261 101.204 1.00 20.00  ?  681 UNK A CB  1 
ATOM 4338 N N   . UNK A 1 582 ? 143.899 136.450 99.446  1.00 20.00  ?  682 UNK A N   1 
ATOM 4339 C CA  . UNK A 1 582 ? 143.464 136.018 98.127  1.00 20.00  ?  682 UNK A CA  1 
ATOM 4340 C C   . UNK A 1 582 ? 141.949 136.101 98.020  1.00 20.00  ?  682 UNK A C   1 
ATOM 4341 O O   . UNK A 1 582 ? 141.405 136.438 96.966  1.00 20.00  ?  682 UNK A O   1 
ATOM 4342 C CB  . UNK A 1 582 ? 143.941 134.609 97.842  1.00 20.00  ?  682 UNK A CB  1 
ATOM 4343 N N   . UNK A 1 583 ? 141.267 135.819 99.124  1.00 20.00  ?  683 UNK A N   1 
ATOM 4344 C CA  . UNK A 1 583 ? 139.820 135.951 99.142  1.00 20.00  ?  683 UNK A CA  1 
ATOM 4345 C C   . UNK A 1 583 ? 139.424 137.416 99.002  1.00 20.00  ?  683 UNK A C   1 
ATOM 4346 O O   . UNK A 1 583 ? 138.440 137.756 98.331  1.00 20.00  ?  683 UNK A O   1 
ATOM 4347 C CB  . UNK A 1 583 ? 139.254 135.366 100.415 1.00 20.00  ?  683 UNK A CB  1 
ATOM 4348 N N   . UNK A 1 584 ? 140.216 138.287 99.617  1.00 20.00  ?  684 UNK A N   1 
ATOM 4349 C CA  . UNK A 1 584 ? 139.968 139.714 99.512  1.00 20.00  ?  684 UNK A CA  1 
ATOM 4350 C C   . UNK A 1 584 ? 140.155 140.178 98.073  1.00 20.00  ?  684 UNK A C   1 
ATOM 4351 O O   . UNK A 1 584 ? 139.456 141.074 97.604  1.00 20.00  ?  684 UNK A O   1 
ATOM 4352 C CB  . UNK A 1 584 ? 140.883 140.476 100.439 1.00 20.00  ?  684 UNK A CB  1 
ATOM 4353 N N   . UNK A 1 585 ? 141.103 139.564 97.374  1.00 20.00  ?  685 UNK A N   1 
ATOM 4354 C CA  . UNK A 1 585 ? 141.290 139.834 95.957  1.00 20.00  ?  685 UNK A CA  1 
ATOM 4355 C C   . UNK A 1 585 ? 140.097 139.333 95.162  1.00 20.00  ?  685 UNK A C   1 
ATOM 4356 O O   . UNK A 1 585 ? 139.711 139.923 94.154  1.00 20.00  ?  685 UNK A O   1 
ATOM 4357 C CB  . UNK A 1 585 ? 142.568 139.186 95.459  1.00 20.00  ?  685 UNK A CB  1 
ATOM 4358 N N   . UNK A 1 586 ? 139.508 138.242 95.632  1.00 20.00  ?  686 UNK A N   1 
ATOM 4359 C CA  . UNK A 1 586 ? 138.333 137.686 94.984  1.00 20.00  ?  686 UNK A CA  1 
ATOM 4360 C C   . UNK A 1 586 ? 137.136 138.603 95.164  1.00 20.00  ?  686 UNK A C   1 
ATOM 4361 O O   . UNK A 1 586 ? 136.207 138.591 94.358  1.00 20.00  ?  686 UNK A O   1 
ATOM 4362 C CB  . UNK A 1 586 ? 138.031 136.309 95.530  1.00 20.00  ?  686 UNK A CB  1 
ATOM 4363 N N   . UNK A 1 587 ? 137.167 139.404 96.222  1.00 20.00  ?  687 UNK A N   1 
ATOM 4364 C CA  . UNK A 1 587 ? 136.041 140.273 96.543  1.00 20.00  ?  687 UNK A CA  1 
ATOM 4365 C C   . UNK A 1 587 ? 135.761 141.318 95.465  1.00 20.00  ?  687 UNK A C   1 
ATOM 4366 O O   . UNK A 1 587 ? 134.638 141.805 95.347  1.00 20.00  ?  687 UNK A O   1 
ATOM 4367 C CB  . UNK A 1 587 ? 136.277 140.955 97.869  1.00 20.00  ?  687 UNK A CB  1 
ATOM 4368 N N   . UNK A 1 588 ? 136.774 141.672 94.686  1.00 20.00  ?  688 UNK A N   1 
ATOM 4369 C CA  . UNK A 1 588 ? 136.593 142.662 93.631  1.00 20.00  ?  688 UNK A CA  1 
ATOM 4370 C C   . UNK A 1 588 ? 135.717 142.123 92.507  1.00 20.00  ?  688 UNK A C   1 
ATOM 4371 O O   . UNK A 1 588 ? 134.565 142.528 92.361  1.00 20.00  ?  688 UNK A O   1 
ATOM 4372 C CB  . UNK A 1 588 ? 137.933 143.100 93.086  1.00 20.00  ?  688 UNK A CB  1 
ATOM 4373 N N   . UNK B 2 1   ? 92.483  147.924 101.838 1.00 30.00  ?  69  UNK B N   1 
ATOM 4374 C CA  . UNK B 2 1   ? 92.987  149.157 101.250 1.00 30.00  ?  69  UNK B CA  1 
ATOM 4375 C C   . UNK B 2 1   ? 94.058  149.783 102.134 1.00 30.00  ?  69  UNK B C   1 
ATOM 4376 O O   . UNK B 2 1   ? 95.250  149.572 101.924 1.00 30.00  ?  69  UNK B O   1 
ATOM 4377 C CB  . UNK B 2 1   ? 91.850  150.138 101.017 1.00 30.00  ?  69  UNK B CB  1 
ATOM 4378 N N   . UNK B 2 2   ? 93.623  150.549 103.129 1.00 30.00  ?  70  UNK B N   1 
ATOM 4379 C CA  . UNK B 2 2   ? 94.539  151.222 104.044 1.00 30.00  ?  70  UNK B CA  1 
ATOM 4380 C C   . UNK B 2 2   ? 95.358  150.210 104.833 1.00 30.00  ?  70  UNK B C   1 
ATOM 4381 O O   . UNK B 2 2   ? 96.469  150.501 105.284 1.00 30.00  ?  70  UNK B O   1 
ATOM 4382 C CB  . UNK B 2 2   ? 93.772  152.132 104.986 1.00 30.00  ?  70  UNK B CB  1 
ATOM 4383 N N   . UNK B 2 3   ? 94.798  149.018 104.997 1.00 30.00  ?  71  UNK B N   1 
ATOM 4384 C CA  . UNK B 2 3   ? 95.483  147.955 105.707 1.00 30.00  ?  71  UNK B CA  1 
ATOM 4385 C C   . UNK B 2 3   ? 96.779  147.606 104.999 1.00 30.00  ?  71  UNK B C   1 
ATOM 4386 O O   . UNK B 2 3   ? 97.739  147.186 105.634 1.00 30.00  ?  71  UNK B O   1 
ATOM 4387 C CB  . UNK B 2 3   ? 94.597  146.737 105.821 1.00 30.00  ?  71  UNK B CB  1 
ATOM 4388 N N   . UNK B 2 4   ? 96.793  147.765 103.679 1.00 30.00  ?  72  UNK B N   1 
ATOM 4389 C CA  . UNK B 2 4   ? 98.014  147.568 102.909 1.00 30.00  ?  72  UNK B CA  1 
ATOM 4390 C C   . UNK B 2 4   ? 99.058  148.612 103.271 1.00 30.00  ?  72  UNK B C   1 
ATOM 4391 O O   . UNK B 2 4   ? 100.254 148.321 103.315 1.00 30.00  ?  72  UNK B O   1 
ATOM 4392 C CB  . UNK B 2 4   ? 97.715  147.616 101.421 1.00 30.00  ?  72  UNK B CB  1 
ATOM 4393 N N   . UNK B 2 5   ? 98.596  149.830 103.535 1.00 30.00  ?  73  UNK B N   1 
ATOM 4394 C CA  . UNK B 2 5   ? 99.488  150.905 103.946 1.00 30.00  ?  73  UNK B CA  1 
ATOM 4395 C C   . UNK B 2 5   ? 100.065 150.599 105.315 1.00 30.00  ?  73  UNK B C   1 
ATOM 4396 O O   . UNK B 2 5   ? 101.246 150.836 105.579 1.00 30.00  ?  73  UNK B O   1 
ATOM 4397 C CB  . UNK B 2 5   ? 98.755  152.234 103.958 1.00 30.00  ?  73  UNK B CB  1 
ATOM 4398 N N   . UNK B 2 6   ? 99.222  150.046 106.179 1.00 30.00  ?  74  UNK B N   1 
ATOM 4399 C CA  . UNK B 2 6   ? 99.666  149.608 107.490 1.00 30.00  ?  74  UNK B CA  1 
ATOM 4400 C C   . UNK B 2 6   ? 100.657 148.466 107.341 1.00 30.00  ?  74  UNK B C   1 
ATOM 4401 O O   . UNK B 2 6   ? 101.563 148.302 108.156 1.00 30.00  ?  74  UNK B O   1 
ATOM 4402 C CB  . UNK B 2 6   ? 98.483  149.183 108.337 1.00 30.00  ?  74  UNK B CB  1 
ATOM 4403 N N   . UNK B 2 7   ? 100.477 147.681 106.285 1.00 30.00  ?  75  UNK B N   1 
ATOM 4404 C CA  . UNK B 2 7   ? 101.301 146.508 106.052 1.00 30.00  ?  75  UNK B CA  1 
ATOM 4405 C C   . UNK B 2 7   ? 102.702 146.914 105.633 1.00 30.00  ?  75  UNK B C   1 
ATOM 4406 O O   . UNK B 2 7   ? 103.693 146.463 106.214 1.00 30.00  ?  75  UNK B O   1 
ATOM 4407 C CB  . UNK B 2 7   ? 100.665 145.617 104.999 1.00 30.00  ?  75  UNK B CB  1 
ATOM 4408 N N   . UNK B 2 8   ? 102.787 147.784 104.636 1.00 30.00  ?  76  UNK B N   1 
ATOM 4409 C CA  . UNK B 2 8   ? 104.082 148.265 104.200 1.00 30.00  ?  76  UNK B CA  1 
ATOM 4410 C C   . UNK B 2 8   ? 104.718 149.046 105.332 1.00 30.00  ?  76  UNK B C   1 
ATOM 4411 O O   . UNK B 2 8   ? 105.937 149.042 105.491 1.00 30.00  ?  76  UNK B O   1 
ATOM 4412 C CB  . UNK B 2 8   ? 103.951 149.123 102.962 1.00 30.00  ?  76  UNK B CB  1 
ATOM 4413 N N   . UNK B 2 9   ? 103.882 149.701 106.131 1.00 30.00  ?  77  UNK B N   1 
ATOM 4414 C CA  . UNK B 2 9   ? 104.374 150.423 107.294 1.00 30.00  ?  77  UNK B CA  1 
ATOM 4415 C C   . UNK B 2 9   ? 105.010 149.457 108.280 1.00 30.00  ?  77  UNK B C   1 
ATOM 4416 O O   . UNK B 2 9   ? 106.004 149.777 108.934 1.00 30.00  ?  77  UNK B O   1 
ATOM 4417 C CB  . UNK B 2 9   ? 103.249 151.195 107.960 1.00 30.00  ?  77  UNK B CB  1 
ATOM 4418 N N   . UNK B 2 10  ? 104.441 148.260 108.361 1.00 162.01 ?  78  UNK B N   1 
ATOM 4419 C CA  . UNK B 2 10  ? 104.917 147.258 109.299 1.00 156.14 ?  78  UNK B CA  1 
ATOM 4420 C C   . UNK B 2 10  ? 106.231 146.666 108.826 1.00 149.40 ?  78  UNK B C   1 
ATOM 4421 O O   . UNK B 2 10  ? 107.174 146.498 109.606 1.00 139.69 ?  78  UNK B O   1 
ATOM 4422 C CB  . UNK B 2 10  ? 103.880 146.172 109.479 1.00 20.00  ?  78  UNK B CB  1 
ATOM 4423 N N   . UNK B 2 11  ? 106.292 146.360 107.536 1.00 152.74 ?  79  UNK B N   1 
ATOM 4424 C CA  . UNK B 2 11  ? 107.509 145.807 106.978 1.00 148.73 ?  79  UNK B CA  1 
ATOM 4425 C C   . UNK B 2 11  ? 108.628 146.815 107.142 1.00 142.62 ?  79  UNK B C   1 
ATOM 4426 O O   . UNK B 2 11  ? 109.685 146.489 107.661 1.00 140.83 ?  79  UNK B O   1 
ATOM 4427 C CB  . UNK B 2 11  ? 107.319 145.449 105.522 1.00 148.73 ?  79  UNK B CB  1 
ATOM 4428 N N   . UNK B 2 12  ? 108.360 148.057 106.755 1.00 143.43 ?  80  UNK B N   1 
ATOM 4429 C CA  . UNK B 2 12  ? 109.366 149.107 106.826 1.00 146.37 ?  80  UNK B CA  1 
ATOM 4430 C C   . UNK B 2 12  ? 109.775 149.349 108.270 1.00 146.91 ?  80  UNK B C   1 
ATOM 4431 O O   . UNK B 2 12  ? 110.912 149.724 108.553 1.00 151.34 ?  80  UNK B O   1 
ATOM 4432 C CB  . UNK B 2 12  ? 108.843 150.385 106.197 1.00 20.00  ?  80  UNK B CB  1 
ATOM 4433 N N   . HIS B 2 13  ? 108.839 149.126 109.182 1.00 140.98 ?  81  HIS B N   1 
ATOM 4434 C CA  . HIS B 2 13  ? 109.138 149.176 110.601 1.00 138.96 ?  81  HIS B CA  1 
ATOM 4435 C C   . HIS B 2 13  ? 110.183 148.141 110.980 1.00 139.47 ?  81  HIS B C   1 
ATOM 4436 O O   . HIS B 2 13  ? 111.241 148.463 111.533 1.00 138.77 ?  81  HIS B O   1 
ATOM 4437 C CB  . HIS B 2 13  ? 107.855 148.943 111.394 1.00 20.00  ?  81  HIS B CB  1 
ATOM 4438 C CG  . HIS B 2 13  ? 108.064 148.784 112.865 1.00 20.00  ?  81  HIS B CG  1 
ATOM 4439 N ND1 . HIS B 2 13  ? 108.574 149.785 113.662 1.00 20.00  ?  81  HIS B ND1 1 
ATOM 4440 C CD2 . HIS B 2 13  ? 107.825 147.734 113.685 1.00 20.00  ?  81  HIS B CD2 1 
ATOM 4441 C CE1 . HIS B 2 13  ? 108.639 149.358 114.911 1.00 20.00  ?  81  HIS B CE1 1 
ATOM 4442 N NE2 . HIS B 2 13  ? 108.191 148.116 114.952 1.00 20.00  ?  81  HIS B NE2 1 
ATOM 4443 N N   . VAL B 2 14  ? 109.887 146.892 110.654 1.00 138.96 ?  82  VAL B N   1 
ATOM 4444 C CA  . VAL B 2 14  ? 110.740 145.799 111.078 1.00 132.46 ?  82  VAL B CA  1 
ATOM 4445 C C   . VAL B 2 14  ? 112.099 145.824 110.391 1.00 125.28 ?  82  VAL B C   1 
ATOM 4446 O O   . VAL B 2 14  ? 113.111 145.439 110.976 1.00 131.79 ?  82  VAL B O   1 
ATOM 4447 C CB  . VAL B 2 14  ? 110.058 144.462 110.821 1.00 20.00  ?  82  VAL B CB  1 
ATOM 4448 C CG1 . VAL B 2 14  ? 110.938 143.321 111.280 1.00 20.00  ?  82  VAL B CG1 1 
ATOM 4449 C CG2 . VAL B 2 14  ? 108.719 144.424 111.530 1.00 20.00  ?  82  VAL B CG2 1 
ATOM 4450 N N   . ILE B 2 15  ? 112.123 146.301 109.155 1.00 115.53 ?  83  ILE B N   1 
ATOM 4451 C CA  . ILE B 2 15  ? 113.357 146.329 108.392 1.00 116.82 ?  83  ILE B CA  1 
ATOM 4452 C C   . ILE B 2 15  ? 114.351 147.215 109.104 1.00 114.73 ?  83  ILE B C   1 
ATOM 4453 O O   . ILE B 2 15  ? 115.518 146.866 109.264 1.00 111.32 ?  83  ILE B O   1 
ATOM 4454 C CB  . ILE B 2 15  ? 113.136 146.865 106.976 1.00 20.00  ?  83  ILE B CB  1 
ATOM 4455 C CG1 . ILE B 2 15  ? 112.228 145.933 106.179 1.00 20.00  ?  83  ILE B CG1 1 
ATOM 4456 C CG2 . ILE B 2 15  ? 114.466 147.026 106.265 1.00 20.00  ?  83  ILE B CG2 1 
ATOM 4457 C CD1 . ILE B 2 15  ? 111.720 146.540 104.888 1.00 20.00  ?  83  ILE B CD1 1 
ATOM 4458 N N   . MET B 2 16  ? 113.861 148.364 109.547 1.00 114.67 ?  84  MET B N   1 
ATOM 4459 C CA  . MET B 2 16  ? 114.664 149.269 110.339 1.00 112.27 ?  84  MET B CA  1 
ATOM 4460 C C   . MET B 2 16  ? 114.994 148.601 111.654 1.00 119.92 ?  84  MET B C   1 
ATOM 4461 O O   . MET B 2 16  ? 116.086 148.769 112.193 1.00 127.36 ?  84  MET B O   1 
ATOM 4462 C CB  . MET B 2 16  ? 113.913 150.581 110.578 1.00 20.00  ?  84  MET B CB  1 
ATOM 4463 C CG  . MET B 2 16  ? 114.663 151.611 111.419 1.00 20.00  ?  84  MET B CG  1 
ATOM 4464 S SD  . MET B 2 16  ? 113.808 153.207 111.466 1.00 20.00  ?  84  MET B SD  1 
ATOM 4465 C CE  . MET B 2 16  ? 114.839 154.156 112.584 1.00 20.00  ?  84  MET B CE  1 
ATOM 4466 N N   . LEU B 2 17  ? 114.048 147.814 112.153 1.00 116.51 ?  85  LEU B N   1 
ATOM 4467 C CA  . LEU B 2 17  ? 114.207 147.190 113.457 1.00 117.94 ?  85  LEU B CA  1 
ATOM 4468 C C   . LEU B 2 17  ? 115.251 146.075 113.484 1.00 119.52 ?  85  LEU B C   1 
ATOM 4469 O O   . LEU B 2 17  ? 115.849 145.803 114.523 1.00 124.65 ?  85  LEU B O   1 
ATOM 4470 C CB  . LEU B 2 17  ? 112.858 146.656 113.935 1.00 127.05 ?  85  LEU B CB  1 
ATOM 4471 C CG  . LEU B 2 17  ? 112.792 146.108 115.360 1.00 136.93 ?  85  LEU B CG  1 
ATOM 4472 C CD1 . LEU B 2 17  ? 111.460 146.457 115.987 1.00 138.68 ?  85  LEU B CD1 1 
ATOM 4473 C CD2 . LEU B 2 17  ? 112.986 144.601 115.360 1.00 142.79 ?  85  LEU B CD2 1 
ATOM 4474 N N   . PHE B 2 18  ? 115.482 145.445 112.343 1.00 119.85 ?  86  PHE B N   1 
ATOM 4475 C CA  . PHE B 2 18  ? 116.240 144.203 112.322 1.00 129.82 ?  86  PHE B CA  1 
ATOM 4476 C C   . PHE B 2 18  ? 117.672 144.328 112.806 1.00 135.66 ?  86  PHE B C   1 
ATOM 4477 O O   . PHE B 2 18  ? 118.028 143.809 113.860 1.00 140.67 ?  86  PHE B O   1 
ATOM 4478 C CB  . PHE B 2 18  ? 116.258 143.631 110.915 1.00 138.19 ?  86  PHE B CB  1 
ATOM 4479 C CG  . PHE B 2 18  ? 117.061 142.377 110.795 1.00 150.93 ?  86  PHE B CG  1 
ATOM 4480 C CD1 . PHE B 2 18  ? 116.518 141.165 111.168 1.00 154.93 ?  86  PHE B CD1 1 
ATOM 4481 C CD2 . PHE B 2 18  ? 118.354 142.408 110.308 1.00 157.43 ?  86  PHE B CD2 1 
ATOM 4482 C CE1 . PHE B 2 18  ? 117.247 140.010 111.061 1.00 160.96 ?  86  PHE B CE1 1 
ATOM 4483 C CE2 . PHE B 2 18  ? 119.087 141.254 110.199 1.00 164.36 ?  86  PHE B CE2 1 
ATOM 4484 C CZ  . PHE B 2 18  ? 118.534 140.052 110.575 1.00 165.92 ?  86  PHE B CZ  1 
ATOM 4485 N N   . VAL B 2 19  ? 118.481 145.032 112.026 1.00 132.61 ?  87  VAL B N   1 
ATOM 4486 C CA  . VAL B 2 19  ? 119.930 145.033 112.196 1.00 127.57 ?  87  VAL B CA  1 
ATOM 4487 C C   . VAL B 2 19  ? 120.426 145.414 113.593 1.00 120.97 ?  87  VAL B C   1 
ATOM 4488 O O   . VAL B 2 19  ? 121.272 144.708 114.155 1.00 115.80 ?  87  VAL B O   1 
ATOM 4489 C CB  . VAL B 2 19  ? 120.587 145.971 111.168 1.00 122.99 ?  87  VAL B CB  1 
ATOM 4490 C CG1 . VAL B 2 19  ? 122.072 146.106 111.436 1.00 119.87 ?  87  VAL B CG1 1 
ATOM 4491 C CG2 . VAL B 2 19  ? 120.346 145.449 109.768 1.00 120.62 ?  87  VAL B CG2 1 
ATOM 4492 N N   . PRO B 2 20  ? 119.912 146.517 114.166 1.00 120.58 ?  88  PRO B N   1 
ATOM 4493 C CA  . PRO B 2 20  ? 120.421 146.856 115.497 1.00 125.16 ?  88  PRO B CA  1 
ATOM 4494 C C   . PRO B 2 20  ? 120.200 145.763 116.535 1.00 133.81 ?  88  PRO B C   1 
ATOM 4495 O O   . PRO B 2 20  ? 121.023 145.610 117.428 1.00 144.45 ?  88  PRO B O   1 
ATOM 4496 C CB  . PRO B 2 20  ? 119.621 148.105 115.860 1.00 20.00  ?  88  PRO B CB  1 
ATOM 4497 C CG  . PRO B 2 20  ? 118.373 147.983 115.071 1.00 20.00  ?  88  PRO B CG  1 
ATOM 4498 C CD  . PRO B 2 20  ? 118.822 147.421 113.765 1.00 20.00  ?  88  PRO B CD  1 
ATOM 4499 N N   . VAL B 2 21  ? 119.107 145.019 116.418 1.00 126.60 ?  89  VAL B N   1 
ATOM 4500 C CA  . VAL B 2 21  ? 118.858 143.906 117.321 1.00 121.10 ?  89  VAL B CA  1 
ATOM 4501 C C   . VAL B 2 21  ? 119.888 142.812 117.126 1.00 121.29 ?  89  VAL B C   1 
ATOM 4502 O O   . VAL B 2 21  ? 120.330 142.173 118.078 1.00 122.77 ?  89  VAL B O   1 
ATOM 4503 C CB  . VAL B 2 21  ? 117.463 143.331 117.102 1.00 20.00  ?  89  VAL B CB  1 
ATOM 4504 C CG1 . VAL B 2 21  ? 117.261 142.088 117.941 1.00 20.00  ?  89  VAL B CG1 1 
ATOM 4505 C CG2 . VAL B 2 21  ? 116.426 144.379 117.436 1.00 20.00  ?  89  VAL B CG2 1 
ATOM 4506 N N   . THR B 2 22  ? 120.294 142.629 115.880 1.00 117.93 ?  90  THR B N   1 
ATOM 4507 C CA  . THR B 2 22  ? 121.298 141.636 115.558 1.00 119.30 ?  90  THR B CA  1 
ATOM 4508 C C   . THR B 2 22  ? 122.592 142.000 116.242 1.00 118.36 ?  90  THR B C   1 
ATOM 4509 O O   . THR B 2 22  ? 123.192 141.197 116.969 1.00 116.08 ?  90  THR B O   1 
ATOM 4510 C CB  . THR B 2 22  ? 121.546 141.560 114.053 1.00 20.00  ?  90  THR B CB  1 
ATOM 4511 O OG1 . THR B 2 22  ? 120.331 141.209 113.384 1.00 20.00  ?  90  THR B OG1 1 
ATOM 4512 C CG2 . THR B 2 22  ? 122.618 140.534 113.743 1.00 20.00  ?  90  THR B CG2 1 
ATOM 4513 N N   . LEU B 2 23  ? 122.991 143.247 116.041 1.00 118.49 ?  91  LEU B N   1 
ATOM 4514 C CA  . LEU B 2 23  ? 124.234 143.726 116.603 1.00 114.46 ?  91  LEU B CA  1 
ATOM 4515 C C   . LEU B 2 23  ? 124.134 143.669 118.119 1.00 108.85 ?  91  LEU B C   1 
ATOM 4516 O O   . LEU B 2 23  ? 125.126 143.453 118.820 1.00 116.95 ?  91  LEU B O   1 
ATOM 4517 C CB  . LEU B 2 23  ? 124.525 145.140 116.114 1.00 20.00  ?  91  LEU B CB  1 
ATOM 4518 C CG  . LEU B 2 23  ? 125.923 145.687 116.381 1.00 20.00  ?  91  LEU B CG  1 
ATOM 4519 C CD1 . LEU B 2 23  ? 126.345 146.599 115.248 1.00 20.00  ?  91  LEU B CD1 1 
ATOM 4520 C CD2 . LEU B 2 23  ? 125.964 146.436 117.687 1.00 20.00  ?  91  LEU B CD2 1 
ATOM 4521 N N   . CYS B 2 24  ? 122.912 143.826 118.612 1.00 100.79 ?  92  CYS B N   1 
ATOM 4522 C CA  . CYS B 2 24  ? 122.654 143.787 120.038 1.00 105.01 ?  92  CYS B CA  1 
ATOM 4523 C C   . CYS B 2 24  ? 122.949 142.411 120.597 1.00 102.93 ?  92  CYS B C   1 
ATOM 4524 O O   . CYS B 2 24  ? 123.674 142.282 121.576 1.00 100.86 ?  92  CYS B O   1 
ATOM 4525 C CB  . CYS B 2 24  ? 121.208 144.172 120.327 1.00 109.97 ?  92  CYS B CB  1 
ATOM 4526 S SG  . CYS B 2 24  ? 120.784 144.203 122.076 1.00 114.14 ?  92  CYS B SG  1 
ATOM 4527 N N   . MET B 2 25  ? 122.425 141.378 119.949 1.00 102.13 ?  93  MET B N   1 
ATOM 4528 C CA  . MET B 2 25  ? 122.687 140.028 120.408 1.00 105.03 ?  93  MET B CA  1 
ATOM 4529 C C   . MET B 2 25  ? 124.171 139.757 120.323 1.00 107.67 ?  93  MET B C   1 
ATOM 4530 O O   . MET B 2 25  ? 124.740 139.090 121.190 1.00 114.21 ?  93  MET B O   1 
ATOM 4531 C CB  . MET B 2 25  ? 121.920 139.001 119.579 1.00 20.00  ?  93  MET B CB  1 
ATOM 4532 C CG  . MET B 2 25  ? 120.415 139.062 119.728 1.00 20.00  ?  93  MET B CG  1 
ATOM 4533 S SD  . MET B 2 25  ? 119.855 138.751 121.410 1.00 20.00  ?  93  MET B SD  1 
ATOM 4534 C CE  . MET B 2 25  ? 120.348 137.041 121.614 1.00 20.00  ?  93  MET B CE  1 
ATOM 4535 N N   . VAL B 2 26  ? 124.807 140.323 119.304 1.00 107.27 ?  94  VAL B N   1 
ATOM 4536 C CA  . VAL B 2 26  ? 126.239 140.133 119.142 1.00 109.30 ?  94  VAL B CA  1 
ATOM 4537 C C   . VAL B 2 26  ? 127.001 140.633 120.360 1.00 106.66 ?  94  VAL B C   1 
ATOM 4538 O O   . VAL B 2 26  ? 127.727 139.877 121.022 1.00 108.77 ?  94  VAL B O   1 
ATOM 4539 C CB  . VAL B 2 26  ? 126.765 140.869 117.899 1.00 20.00  ?  94  VAL B CB  1 
ATOM 4540 C CG1 . VAL B 2 26  ? 128.285 140.804 117.845 1.00 20.00  ?  94  VAL B CG1 1 
ATOM 4541 C CG2 . VAL B 2 26  ? 126.151 140.292 116.636 1.00 20.00  ?  94  VAL B CG2 1 
ATOM 4542 N N   . VAL B 2 27  ? 126.798 141.903 120.679 1.00 106.06 ?  95  VAL B N   1 
ATOM 4543 C CA  . VAL B 2 27  ? 127.527 142.507 121.778 1.00 110.98 ?  95  VAL B CA  1 
ATOM 4544 C C   . VAL B 2 27  ? 127.173 141.835 123.093 1.00 117.85 ?  95  VAL B C   1 
ATOM 4545 O O   . VAL B 2 27  ? 128.030 141.647 123.957 1.00 111.41 ?  95  VAL B O   1 
ATOM 4546 C CB  . VAL B 2 27  ? 127.237 144.007 121.871 1.00 98.21  ?  95  VAL B CB  1 
ATOM 4547 C CG1 . VAL B 2 27  ? 127.892 144.606 123.100 1.00 96.16  ?  95  VAL B CG1 1 
ATOM 4548 C CG2 . VAL B 2 27  ? 127.727 144.699 120.617 1.00 98.95  ?  95  VAL B CG2 1 
ATOM 4549 N N   . VAL B 2 28  ? 125.919 141.427 123.222 1.00 130.34 ?  96  VAL B N   1 
ATOM 4550 C CA  . VAL B 2 28  ? 125.477 140.809 124.458 1.00 141.04 ?  96  VAL B CA  1 
ATOM 4551 C C   . VAL B 2 28  ? 126.186 139.502 124.706 1.00 146.94 ?  96  VAL B C   1 
ATOM 4552 O O   . VAL B 2 28  ? 126.684 139.250 125.801 1.00 147.30 ?  96  VAL B O   1 
ATOM 4553 C CB  . VAL B 2 28  ? 123.987 140.540 124.456 1.00 20.00  ?  96  VAL B CB  1 
ATOM 4554 C CG1 . VAL B 2 28  ? 123.649 139.694 125.631 1.00 20.00  ?  96  VAL B CG1 1 
ATOM 4555 C CG2 . VAL B 2 28  ? 123.226 141.835 124.536 1.00 20.00  ?  96  VAL B CG2 1 
ATOM 4556 N N   . VAL B 2 29  ? 126.239 138.665 123.684 1.00 145.74 ?  97  VAL B N   1 
ATOM 4557 C CA  . VAL B 2 29  ? 126.936 137.408 123.838 1.00 142.87 ?  97  VAL B CA  1 
ATOM 4558 C C   . VAL B 2 29  ? 128.400 137.687 124.111 1.00 134.67 ?  97  VAL B C   1 
ATOM 4559 O O   . VAL B 2 29  ? 129.041 137.004 124.916 1.00 130.00 ?  97  VAL B O   1 
ATOM 4560 C CB  . VAL B 2 29  ? 126.801 136.541 122.596 1.00 20.00  ?  97  VAL B CB  1 
ATOM 4561 C CG1 . VAL B 2 29  ? 127.653 135.301 122.732 1.00 20.00  ?  97  VAL B CG1 1 
ATOM 4562 C CG2 . VAL B 2 29  ? 125.351 136.170 122.383 1.00 20.00  ?  97  VAL B CG2 1 
ATOM 4563 N N   . ALA B 2 30  ? 128.910 138.741 123.485 1.00 134.39 ?  98  ALA B N   1 
ATOM 4564 C CA  . ALA B 2 30  ? 130.313 139.089 123.645 1.00 140.75 ?  98  ALA B CA  1 
ATOM 4565 C C   . ALA B 2 30  ? 130.634 139.495 125.075 1.00 145.39 ?  98  ALA B C   1 
ATOM 4566 O O   . ALA B 2 30  ? 131.755 139.311 125.540 1.00 150.74 ?  98  ALA B O   1 
ATOM 4567 C CB  . ALA B 2 30  ? 130.688 140.195 122.692 1.00 141.50 ?  98  ALA B CB  1 
ATOM 4568 N N   . THR B 2 31  ? 129.653 140.051 125.773 1.00 30.00  ?  99  THR B N   1 
ATOM 4569 C CA  . THR B 2 31  ? 129.899 140.478 127.140 1.00 30.00  ?  99  THR B CA  1 
ATOM 4570 C C   . THR B 2 31  ? 129.606 139.344 128.107 1.00 30.00  ?  99  THR B C   1 
ATOM 4571 O O   . THR B 2 31  ? 130.174 139.285 129.192 1.00 30.00  ?  99  THR B O   1 
ATOM 4572 C CB  . THR B 2 31  ? 129.071 141.721 127.519 1.00 20.00  ?  99  THR B CB  1 
ATOM 4573 O OG1 . THR B 2 31  ? 129.565 142.256 128.748 1.00 20.00  ?  99  THR B OG1 1 
ATOM 4574 C CG2 . THR B 2 31  ? 127.605 141.382 127.692 1.00 20.00  ?  99  THR B CG2 1 
ATOM 4575 N N   . ILE B 2 32  ? 128.728 138.434 127.711 1.00 30.00  ?  100 ILE B N   1 
ATOM 4576 C CA  . ILE B 2 32  ? 128.512 137.234 128.495 1.00 30.00  ?  100 ILE B CA  1 
ATOM 4577 C C   . ILE B 2 32  ? 129.774 136.393 128.444 1.00 30.00  ?  100 ILE B C   1 
ATOM 4578 O O   . ILE B 2 32  ? 130.074 135.636 129.367 1.00 30.00  ?  100 ILE B O   1 
ATOM 4579 C CB  . ILE B 2 32  ? 127.310 136.433 127.986 1.00 20.00  ?  100 ILE B CB  1 
ATOM 4580 C CG1 . ILE B 2 32  ? 126.023 137.223 128.213 1.00 20.00  ?  100 ILE B CG1 1 
ATOM 4581 C CG2 . ILE B 2 32  ? 127.211 135.095 128.691 1.00 20.00  ?  100 ILE B CG2 1 
ATOM 4582 C CD1 . ILE B 2 32  ? 124.801 136.603 127.565 1.00 20.00  ?  100 ILE B CD1 1 
ATOM 4583 N N   . UNK B 2 33  ? 130.546 136.577 127.379 1.00 30.00  ?  101 UNK B N   1 
ATOM 4584 C CA  . UNK B 2 33  ? 131.761 135.803 127.176 1.00 30.00  ?  101 UNK B CA  1 
ATOM 4585 C C   . UNK B 2 33  ? 132.732 135.995 128.328 1.00 30.00  ?  101 UNK B C   1 
ATOM 4586 O O   . UNK B 2 33  ? 133.550 135.122 128.607 1.00 30.00  ?  101 UNK B O   1 
ATOM 4587 C CB  . UNK B 2 33  ? 132.420 136.187 125.871 1.00 20.00  ?  101 UNK B CB  1 
ATOM 4588 N N   . UNK B 2 34  ? 132.640 137.143 128.989 1.00 30.00  ?  102 UNK B N   1 
ATOM 4589 C CA  . UNK B 2 34  ? 133.457 137.413 130.163 1.00 30.00  ?  102 UNK B CA  1 
ATOM 4590 C C   . UNK B 2 34  ? 132.624 137.371 131.437 1.00 30.00  ?  102 UNK B C   1 
ATOM 4591 O O   . UNK B 2 34  ? 133.056 137.851 132.483 1.00 30.00  ?  102 UNK B O   1 
ATOM 4592 C CB  . UNK B 2 34  ? 134.143 138.751 130.030 1.00 20.00  ?  102 UNK B CB  1 
ATOM 4593 N N   . UNK B 2 35  ? 108.891 130.324 145.603 1.00 106.72 ?  136 UNK B N   1 
ATOM 4594 C CA  . UNK B 2 35  ? 109.846 130.528 144.522 1.00 110.62 ?  136 UNK B CA  1 
ATOM 4595 C C   . UNK B 2 35  ? 109.346 131.574 143.532 1.00 107.20 ?  136 UNK B C   1 
ATOM 4596 O O   . UNK B 2 35  ? 110.138 132.217 142.842 1.00 105.04 ?  136 UNK B O   1 
ATOM 4597 C CB  . UNK B 2 35  ? 110.125 129.215 143.809 1.00 20.00  ?  136 UNK B CB  1 
ATOM 4598 N N   . UNK B 2 36  ? 108.028 131.735 143.458 1.00 100.59 ?  137 UNK B N   1 
ATOM 4599 C CA  . UNK B 2 36  ? 107.429 132.688 142.531 1.00 97.02  ?  137 UNK B CA  1 
ATOM 4600 C C   . UNK B 2 36  ? 106.872 133.931 143.228 1.00 101.59 ?  137 UNK B C   1 
ATOM 4601 O O   . UNK B 2 36  ? 106.347 134.831 142.570 1.00 114.16 ?  137 UNK B O   1 
ATOM 4602 C CB  . UNK B 2 36  ? 106.334 132.008 141.721 1.00 20.00  ?  137 UNK B CB  1 
ATOM 4603 N N   . UNK B 2 37  ? 106.978 133.982 144.554 1.00 97.50  ?  138 UNK B N   1 
ATOM 4604 C CA  . UNK B 2 37  ? 106.381 135.075 145.323 1.00 100.67 ?  138 UNK B CA  1 
ATOM 4605 C C   . UNK B 2 37  ? 106.988 136.443 144.998 1.00 101.71 ?  138 UNK B C   1 
ATOM 4606 O O   . UNK B 2 37  ? 106.284 137.458 144.995 1.00 101.69 ?  138 UNK B O   1 
ATOM 4607 C CB  . UNK B 2 37  ? 106.507 134.791 146.812 1.00 20.00  ?  138 UNK B CB  1 
ATOM 4608 N N   . UNK B 2 38  ? 108.288 136.471 144.719 1.00 101.11 ?  139 UNK B N   1 
ATOM 4609 C CA  . UNK B 2 38  ? 108.940 137.712 144.318 1.00 103.51 ?  139 UNK B CA  1 
ATOM 4610 C C   . UNK B 2 38  ? 108.408 138.173 142.965 1.00 107.15 ?  139 UNK B C   1 
ATOM 4611 O O   . UNK B 2 38  ? 108.243 139.373 142.721 1.00 106.00 ?  139 UNK B O   1 
ATOM 4612 C CB  . UNK B 2 38  ? 110.446 137.531 144.268 1.00 20.00  ?  139 UNK B CB  1 
ATOM 4613 N N   . UNK B 2 39  ? 108.121 137.211 142.091 1.00 109.16 ?  140 UNK B N   1 
ATOM 4614 C CA  . UNK B 2 39  ? 107.515 137.516 140.801 1.00 106.66 ?  140 UNK B CA  1 
ATOM 4615 C C   . UNK B 2 39  ? 106.098 138.043 140.998 1.00 98.68  ?  140 UNK B C   1 
ATOM 4616 O O   . UNK B 2 39  ? 105.621 138.884 140.234 1.00 95.63  ?  140 UNK B O   1 
ATOM 4617 C CB  . UNK B 2 39  ? 107.510 136.285 139.907 1.00 20.00  ?  140 UNK B CB  1 
ATOM 4618 N N   . UNK B 2 40  ? 105.427 137.544 142.032 1.00 95.32  ?  141 UNK B N   1 
ATOM 4619 C CA  . UNK B 2 40  ? 104.122 138.073 142.389 1.00 99.98  ?  141 UNK B CA  1 
ATOM 4620 C C   . UNK B 2 40  ? 104.261 139.520 142.840 1.00 109.37 ?  141 UNK B C   1 
ATOM 4621 O O   . UNK B 2 40  ? 103.392 140.353 142.570 1.00 114.56 ?  141 UNK B O   1 
ATOM 4622 C CB  . UNK B 2 40  ? 103.483 137.230 143.474 1.00 20.00  ?  141 UNK B CB  1 
ATOM 4623 N N   . UNK B 2 41  ? 105.371 139.824 143.510 1.00 115.28 ?  142 UNK B N   1 
ATOM 4624 C CA  . UNK B 2 41  ? 105.651 141.204 143.883 1.00 120.93 ?  142 UNK B CA  1 
ATOM 4625 C C   . UNK B 2 41  ? 105.861 142.042 142.629 1.00 118.02 ?  142 UNK B C   1 
ATOM 4626 O O   . UNK B 2 41  ? 105.488 143.217 142.581 1.00 118.40 ?  142 UNK B O   1 
ATOM 4627 C CB  . UNK B 2 41  ? 106.865 141.283 144.794 1.00 20.00  ?  142 UNK B CB  1 
ATOM 4628 N N   . UNK B 2 42  ? 106.453 141.432 141.608 1.00 112.89 ?  143 UNK B N   1 
ATOM 4629 C CA  . UNK B 2 42  ? 106.596 142.107 140.323 1.00 109.53 ?  143 UNK B CA  1 
ATOM 4630 C C   . UNK B 2 42  ? 105.236 142.372 139.678 1.00 110.22 ?  143 UNK B C   1 
ATOM 4631 O O   . UNK B 2 42  ? 105.038 143.394 139.015 1.00 110.86 ?  143 UNK B O   1 
ATOM 4632 C CB  . UNK B 2 42  ? 107.473 141.293 139.393 1.00 20.00  ?  143 UNK B CB  1 
ATOM 4633 N N   . UNK B 2 43  ? 104.296 141.451 139.870 1.00 110.15 ?  144 UNK B N   1 
ATOM 4634 C CA  . UNK B 2 43  ? 102.941 141.662 139.374 1.00 111.33 ?  144 UNK B CA  1 
ATOM 4635 C C   . UNK B 2 43  ? 102.276 142.809 140.128 1.00 111.76 ?  144 UNK B C   1 
ATOM 4636 O O   . UNK B 2 43  ? 101.487 143.576 139.564 1.00 111.40 ?  144 UNK B O   1 
ATOM 4637 C CB  . UNK B 2 43  ? 102.122 140.389 139.501 1.00 20.00  ?  144 UNK B CB  1 
ATOM 4638 N N   . UNK B 2 44  ? 102.617 142.931 141.407 1.00 111.93 ?  145 UNK B N   1 
ATOM 4639 C CA  . UNK B 2 44  ? 102.145 144.054 142.201 1.00 111.81 ?  145 UNK B CA  1 
ATOM 4640 C C   . UNK B 2 44  ? 102.731 145.344 141.652 1.00 106.08 ?  145 UNK B C   1 
ATOM 4641 O O   . UNK B 2 44  ? 102.094 146.396 141.691 1.00 97.28  ?  145 UNK B O   1 
ATOM 4642 C CB  . UNK B 2 44  ? 102.518 143.875 143.663 1.00 20.00  ?  145 UNK B CB  1 
ATOM 4643 N N   . UNK B 2 45  ? 103.950 145.258 141.131 1.00 113.06 ?  146 UNK B N   1 
ATOM 4644 C CA  . UNK B 2 45  ? 104.544 146.399 140.449 1.00 122.06 ?  146 UNK B CA  1 
ATOM 4645 C C   . UNK B 2 45  ? 103.787 146.711 139.161 1.00 120.62 ?  146 UNK B C   1 
ATOM 4646 O O   . UNK B 2 45  ? 103.683 147.874 138.764 1.00 121.51 ?  146 UNK B O   1 
ATOM 4647 C CB  . UNK B 2 45  ? 106.013 146.143 140.154 1.00 20.00  ?  146 UNK B CB  1 
ATOM 4648 N N   . UNK B 2 46  ? 103.255 145.676 138.513 1.00 114.03 ?  147 UNK B N   1 
ATOM 4649 C CA  . UNK B 2 46  ? 102.487 145.876 137.285 1.00 105.94 ?  147 UNK B CA  1 
ATOM 4650 C C   . UNK B 2 46  ? 101.177 146.602 137.573 1.00 101.07 ?  147 UNK B C   1 
ATOM 4651 O O   . UNK B 2 46  ? 100.794 147.537 136.859 1.00 98.12  ?  147 UNK B O   1 
ATOM 4652 C CB  . UNK B 2 46  ? 102.219 144.547 136.603 1.00 20.00  ?  147 UNK B CB  1 
ATOM 4653 N N   . UNK B 2 47  ? 100.499 146.181 138.634 1.00 98.18  ?  148 UNK B N   1 
ATOM 4654 C CA  . UNK B 2 47  ? 99.278  146.857 139.053 1.00 104.48 ?  148 UNK B CA  1 
ATOM 4655 C C   . UNK B 2 47  ? 99.576  148.272 139.548 1.00 111.43 ?  148 UNK B C   1 
ATOM 4656 O O   . UNK B 2 47  ? 98.751  149.176 139.407 1.00 105.71 ?  148 UNK B O   1 
ATOM 4657 C CB  . UNK B 2 47  ? 98.570  146.052 140.130 1.00 20.00  ?  148 UNK B CB  1 
ATOM 4658 N N   . UNK B 2 48  ? 100.763 148.458 140.122 1.00 123.20 ?  149 UNK B N   1 
ATOM 4659 C CA  . UNK B 2 48  ? 101.166 149.763 140.635 1.00 131.48 ?  149 UNK B CA  1 
ATOM 4660 C C   . UNK B 2 48  ? 101.393 150.755 139.500 1.00 125.34 ?  149 UNK B C   1 
ATOM 4661 O O   . UNK B 2 48  ? 100.927 151.896 139.555 1.00 119.71 ?  149 UNK B O   1 
ATOM 4662 C CB  . UNK B 2 48  ? 102.421 149.635 141.482 1.00 20.00  ?  149 UNK B CB  1 
ATOM 4663 N N   . UNK B 2 49  ? 102.115 150.316 138.473 1.00 123.30 ?  150 UNK B N   1 
ATOM 4664 C CA  . UNK B 2 49  ? 102.324 151.143 137.291 1.00 128.67 ?  150 UNK B CA  1 
ATOM 4665 C C   . UNK B 2 49  ? 100.999 151.385 136.571 1.00 130.83 ?  150 UNK B C   1 
ATOM 4666 O O   . UNK B 2 49  ? 100.783 152.451 135.984 1.00 129.20 ?  150 UNK B O   1 
ATOM 4667 C CB  . UNK B 2 49  ? 103.331 150.493 136.356 1.00 20.00  ?  150 UNK B CB  1 
ATOM 4668 N N   . UNK B 2 50  ? 100.108 150.397 136.626 1.00 132.12 ?  151 UNK B N   1 
ATOM 4669 C CA  . UNK B 2 50  ? 98.778  150.573 136.055 1.00 130.78 ?  151 UNK B CA  1 
ATOM 4670 C C   . UNK B 2 50  ? 98.020  151.671 136.798 1.00 136.62 ?  151 UNK B C   1 
ATOM 4671 O O   . UNK B 2 50  ? 97.286  152.451 136.190 1.00 144.46 ?  151 UNK B O   1 
ATOM 4672 C CB  . UNK B 2 50  ? 98.002  149.264 136.098 1.00 20.00  ?  151 UNK B CB  1 
ATOM 4673 N N   . UNK B 2 51  ? 98.211  151.734 138.113 1.00 137.32 ?  152 UNK B N   1 
ATOM 4674 C CA  . UNK B 2 51  ? 97.642  152.816 138.909 1.00 138.37 ?  152 UNK B CA  1 
ATOM 4675 C C   . UNK B 2 51  ? 98.293  154.148 138.554 1.00 139.13 ?  152 UNK B C   1 
ATOM 4676 O O   . UNK B 2 51  ? 97.646  155.194 138.593 1.00 132.31 ?  152 UNK B O   1 
ATOM 4677 C CB  . UNK B 2 51  ? 97.793  152.525 140.397 1.00 20.00  ?  152 UNK B CB  1 
ATOM 4678 N N   . UNK B 2 52  ? 99.575  154.103 138.202 1.00 142.79 ?  153 UNK B N   1 
ATOM 4679 C CA  . UNK B 2 52  ? 100.283 155.308 137.795 1.00 139.93 ?  153 UNK B CA  1 
ATOM 4680 C C   . UNK B 2 52  ? 99.721  155.823 136.480 1.00 140.54 ?  153 UNK B C   1 
ATOM 4681 O O   . UNK B 2 52  ? 99.740  157.024 136.216 1.00 145.02 ?  153 UNK B O   1 
ATOM 4682 C CB  . UNK B 2 52  ? 101.772 155.040 137.670 1.00 20.00  ?  153 UNK B CB  1 
ATOM 4683 N N   . UNK B 2 53  ? 99.217  154.903 135.661 1.00 134.10 ?  154 UNK B N   1 
ATOM 4684 C CA  . UNK B 2 53  ? 98.599  155.263 134.388 1.00 133.59 ?  154 UNK B CA  1 
ATOM 4685 C C   . UNK B 2 53  ? 97.288  156.010 134.601 1.00 134.56 ?  154 UNK B C   1 
ATOM 4686 O O   . UNK B 2 53  ? 96.831  156.743 133.724 1.00 135.44 ?  154 UNK B O   1 
ATOM 4687 C CB  . UNK B 2 53  ? 98.369  154.022 133.545 1.00 20.00  ?  154 UNK B CB  1 
ATOM 4688 N N   . UNK B 2 54  ? 96.686  155.811 135.769 1.00 131.51 ?  155 UNK B N   1 
ATOM 4689 C CA  . UNK B 2 54  ? 95.417  156.448 136.102 1.00 141.30 ?  155 UNK B CA  1 
ATOM 4690 C C   . UNK B 2 54  ? 95.633  157.799 136.774 1.00 150.01 ?  155 UNK B C   1 
ATOM 4691 O O   . UNK B 2 54  ? 94.677  158.451 137.193 1.00 159.91 ?  155 UNK B O   1 
ATOM 4692 C CB  . UNK B 2 54  ? 94.587  155.538 136.999 1.00 20.00  ?  155 UNK B CB  1 
ATOM 4693 N N   . UNK B 2 55  ? 113.011 159.663 136.674 1.00 151.85 ?  167 UNK B N   1 
ATOM 4694 C CA  . UNK B 2 55  ? 113.923 159.738 135.540 1.00 151.73 ?  167 UNK B CA  1 
ATOM 4695 C C   . UNK B 2 55  ? 115.371 159.639 135.999 1.00 151.18 ?  167 UNK B C   1 
ATOM 4696 O O   . UNK B 2 55  ? 116.170 158.919 135.403 1.00 149.60 ?  167 UNK B O   1 
ATOM 4697 C CB  . UNK B 2 55  ? 113.701 161.026 134.763 1.00 20.00  ?  167 UNK B CB  1 
ATOM 4698 N N   . UNK B 2 56  ? 115.703 160.369 137.058 1.00 149.53 ?  168 UNK B N   1 
ATOM 4699 C CA  . UNK B 2 56  ? 117.052 160.348 137.612 1.00 142.49 ?  168 UNK B CA  1 
ATOM 4700 C C   . UNK B 2 56  ? 117.388 158.971 138.175 1.00 131.05 ?  168 UNK B C   1 
ATOM 4701 O O   . UNK B 2 56  ? 118.556 158.570 138.230 1.00 125.52 ?  168 UNK B O   1 
ATOM 4702 C CB  . UNK B 2 56  ? 117.197 161.409 138.685 1.00 20.00  ?  168 UNK B CB  1 
ATOM 4703 N N   . UNK B 2 57  ? 116.356 158.244 138.587 1.00 126.35 ?  169 UNK B N   1 
ATOM 4704 C CA  . UNK B 2 57  ? 116.542 156.899 139.107 1.00 113.72 ?  169 UNK B CA  1 
ATOM 4705 C C   . UNK B 2 57  ? 117.115 155.990 138.025 1.00 105.44 ?  169 UNK B C   1 
ATOM 4706 O O   . UNK B 2 57  ? 117.862 155.052 138.314 1.00 98.77  ?  169 UNK B O   1 
ATOM 4707 C CB  . UNK B 2 57  ? 115.230 156.346 139.628 1.00 20.00  ?  169 UNK B CB  1 
ATOM 4708 N N   . UNK B 2 58  ? 116.772 156.277 136.775 1.00 100.93 ?  170 UNK B N   1 
ATOM 4709 C CA  . UNK B 2 58  ? 117.348 155.533 135.670 1.00 98.62  ?  170 UNK B CA  1 
ATOM 4710 C C   . UNK B 2 58  ? 118.848 155.760 135.634 1.00 96.79  ?  170 UNK B C   1 
ATOM 4711 O O   . UNK B 2 58  ? 119.622 154.836 135.376 1.00 94.09  ?  170 UNK B O   1 
ATOM 4712 C CB  . UNK B 2 58  ? 116.715 155.948 134.361 1.00 20.00  ?  170 UNK B CB  1 
ATOM 4713 N N   . UNK B 2 59  ? 119.257 156.988 135.930 1.00 104.26 ?  171 UNK B N   1 
ATOM 4714 C CA  . UNK B 2 59  ? 120.673 157.301 136.017 1.00 113.27 ?  171 UNK B CA  1 
ATOM 4715 C C   . UNK B 2 59  ? 121.291 156.533 137.176 1.00 118.41 ?  171 UNK B C   1 
ATOM 4716 O O   . UNK B 2 59  ? 122.439 156.080 137.106 1.00 114.48 ?  171 UNK B O   1 
ATOM 4717 C CB  . UNK B 2 59  ? 120.886 158.798 136.184 1.00 20.00  ?  171 UNK B CB  1 
ATOM 4718 N N   . LEU B 2 60  ? 120.505 156.354 138.231 1.00 122.93 ?  172 LEU B N   1 
ATOM 4719 C CA  . LEU B 2 60  ? 120.982 155.622 139.392 1.00 122.49 ?  172 LEU B CA  1 
ATOM 4720 C C   . LEU B 2 60  ? 121.302 154.185 139.002 1.00 123.52 ?  172 LEU B C   1 
ATOM 4721 O O   . LEU B 2 60  ? 122.377 153.663 139.323 1.00 123.54 ?  172 LEU B O   1 
ATOM 4722 C CB  . LEU B 2 60  ? 119.941 155.667 140.512 1.00 20.00  ?  172 LEU B CB  1 
ATOM 4723 C CG  . LEU B 2 60  ? 120.301 155.090 141.880 1.00 20.00  ?  172 LEU B CG  1 
ATOM 4724 C CD1 . LEU B 2 60  ? 119.612 155.885 142.972 1.00 20.00  ?  172 LEU B CD1 1 
ATOM 4725 C CD2 . LEU B 2 60  ? 119.910 153.623 141.975 1.00 20.00  ?  172 LEU B CD2 1 
ATOM 4726 N N   . LEU B 2 61  ? 120.383 153.559 138.276 1.00 124.25 ?  173 LEU B N   1 
ATOM 4727 C CA  . LEU B 2 61  ? 120.623 152.201 137.822 1.00 121.76 ?  173 LEU B CA  1 
ATOM 4728 C C   . LEU B 2 61  ? 121.819 152.182 136.898 1.00 106.88 ?  173 LEU B C   1 
ATOM 4729 O O   . LEU B 2 61  ? 122.616 151.238 136.908 1.00 109.15 ?  173 LEU B O   1 
ATOM 4730 C CB  . LEU B 2 61  ? 119.393 151.638 137.109 1.00 20.00  ?  173 LEU B CB  1 
ATOM 4731 C CG  . LEU B 2 61  ? 119.462 150.180 136.639 1.00 20.00  ?  173 LEU B CG  1 
ATOM 4732 C CD1 . LEU B 2 61  ? 118.112 149.490 136.767 1.00 20.00  ?  173 LEU B CD1 1 
ATOM 4733 C CD2 . LEU B 2 61  ? 119.963 150.076 135.199 1.00 20.00  ?  173 LEU B CD2 1 
ATOM 4734 N N   . LEU B 2 62  ? 121.958 153.251 136.126 1.00 97.01  ?  174 LEU B N   1 
ATOM 4735 C CA  . LEU B 2 62  ? 123.026 153.330 135.152 1.00 98.05  ?  174 LEU B CA  1 
ATOM 4736 C C   . LEU B 2 62  ? 124.373 153.228 135.836 1.00 108.29 ?  174 LEU B C   1 
ATOM 4737 O O   . LEU B 2 62  ? 125.167 152.341 135.516 1.00 114.88 ?  174 LEU B O   1 
ATOM 4738 C CB  . LEU B 2 62  ? 122.923 154.632 134.366 1.00 20.00  ?  174 LEU B CB  1 
ATOM 4739 C CG  . LEU B 2 62  ? 123.889 154.858 133.209 1.00 20.00  ?  174 LEU B CG  1 
ATOM 4740 C CD1 . LEU B 2 62  ? 123.217 155.693 132.138 1.00 20.00  ?  174 LEU B CD1 1 
ATOM 4741 C CD2 . LEU B 2 62  ? 125.129 155.553 133.708 1.00 20.00  ?  174 LEU B CD2 1 
ATOM 4742 N N   . PHE B 2 63  ? 124.617 154.106 136.804 1.00 113.95 ?  175 PHE B N   1 
ATOM 4743 C CA  . PHE B 2 63  ? 125.886 154.061 137.518 1.00 119.00 ?  175 PHE B CA  1 
ATOM 4744 C C   . PHE B 2 63  ? 126.024 152.754 138.283 1.00 121.72 ?  175 PHE B C   1 
ATOM 4745 O O   . PHE B 2 63  ? 127.127 152.232 138.458 1.00 120.85 ?  175 PHE B O   1 
ATOM 4746 C CB  . PHE B 2 63  ? 126.024 155.236 138.483 1.00 20.00  ?  175 PHE B CB  1 
ATOM 4747 C CG  . PHE B 2 63  ? 126.117 156.571 137.812 1.00 20.00  ?  175 PHE B CG  1 
ATOM 4748 C CD1 . PHE B 2 63  ? 127.309 156.996 137.254 1.00 20.00  ?  175 PHE B CD1 1 
ATOM 4749 C CD2 . PHE B 2 63  ? 125.029 157.421 137.779 1.00 20.00  ?  175 PHE B CD2 1 
ATOM 4750 C CE1 . PHE B 2 63  ? 127.407 158.232 136.646 1.00 20.00  ?  175 PHE B CE1 1 
ATOM 4751 C CE2 . PHE B 2 63  ? 125.116 158.660 137.176 1.00 20.00  ?  175 PHE B CE2 1 
ATOM 4752 C CZ  . PHE B 2 63  ? 126.308 159.067 136.608 1.00 20.00  ?  175 PHE B CZ  1 
ATOM 4753 N N   . PHE B 2 64  ? 124.891 152.223 138.719 1.00 120.05 ?  176 PHE B N   1 
ATOM 4754 C CA  . PHE B 2 64  ? 124.894 151.031 139.544 1.00 118.11 ?  176 PHE B CA  1 
ATOM 4755 C C   . PHE B 2 64  ? 125.470 149.843 138.786 1.00 115.84 ?  176 PHE B C   1 
ATOM 4756 O O   . PHE B 2 64  ? 126.542 149.320 139.128 1.00 114.27 ?  176 PHE B O   1 
ATOM 4757 C CB  . PHE B 2 64  ? 123.476 150.743 140.004 1.00 119.61 ?  176 PHE B CB  1 
ATOM 4758 C CG  . PHE B 2 64  ? 123.359 149.585 140.937 1.00 127.21 ?  176 PHE B CG  1 
ATOM 4759 C CD1 . PHE B 2 64  ? 123.682 149.730 142.272 1.00 132.29 ?  176 PHE B CD1 1 
ATOM 4760 C CD2 . PHE B 2 64  ? 122.881 148.367 140.498 1.00 131.10 ?  176 PHE B CD2 1 
ATOM 4761 C CE1 . PHE B 2 64  ? 123.557 148.674 143.148 1.00 135.28 ?  176 PHE B CE1 1 
ATOM 4762 C CE2 . PHE B 2 64  ? 122.748 147.307 141.370 1.00 136.63 ?  176 PHE B CE2 1 
ATOM 4763 C CZ  . PHE B 2 64  ? 123.090 147.461 142.697 1.00 138.22 ?  176 PHE B CZ  1 
ATOM 4764 N N   . PHE B 2 65  ? 124.771 149.424 137.739 1.00 115.45 ?  177 PHE B N   1 
ATOM 4765 C CA  . PHE B 2 65  ? 125.263 148.308 136.947 1.00 119.82 ?  177 PHE B CA  1 
ATOM 4766 C C   . PHE B 2 65  ? 126.533 148.629 136.196 1.00 121.34 ?  177 PHE B C   1 
ATOM 4767 O O   . PHE B 2 65  ? 127.305 147.726 135.909 1.00 131.03 ?  177 PHE B O   1 
ATOM 4768 C CB  . PHE B 2 65  ? 124.211 147.822 135.959 1.00 20.00  ?  177 PHE B CB  1 
ATOM 4769 C CG  . PHE B 2 65  ? 123.064 147.129 136.607 1.00 20.00  ?  177 PHE B CG  1 
ATOM 4770 C CD1 . PHE B 2 65  ? 123.166 145.802 136.984 1.00 20.00  ?  177 PHE B CD1 1 
ATOM 4771 C CD2 . PHE B 2 65  ? 121.884 147.797 136.844 1.00 20.00  ?  177 PHE B CD2 1 
ATOM 4772 C CE1 . PHE B 2 65  ? 122.107 145.157 137.592 1.00 20.00  ?  177 PHE B CE1 1 
ATOM 4773 C CE2 . PHE B 2 65  ? 120.818 147.158 137.445 1.00 20.00  ?  177 PHE B CE2 1 
ATOM 4774 C CZ  . PHE B 2 65  ? 120.929 145.838 137.821 1.00 20.00  ?  177 PHE B CZ  1 
ATOM 4775 N N   . SER B 2 66  ? 126.757 149.892 135.856 1.00 112.23 ?  178 SER B N   1 
ATOM 4776 C CA  . SER B 2 66  ? 127.999 150.210 135.174 1.00 115.34 ?  178 SER B CA  1 
ATOM 4777 C C   . SER B 2 66  ? 129.146 149.840 136.099 1.00 119.01 ?  178 SER B C   1 
ATOM 4778 O O   . SER B 2 66  ? 130.064 149.092 135.724 1.00 116.68 ?  178 SER B O   1 
ATOM 4779 C CB  . SER B 2 66  ? 128.066 151.682 134.791 1.00 119.48 ?  178 SER B CB  1 
ATOM 4780 O OG  . SER B 2 66  ? 129.296 151.972 134.157 1.00 124.97 ?  178 SER B OG  1 
ATOM 4781 N N   . PHE B 2 67  ? 129.040 150.319 137.333 1.00 124.74 ?  179 PHE B N   1 
ATOM 4782 C CA  . PHE B 2 67  ? 130.003 149.994 138.368 1.00 128.13 ?  179 PHE B CA  1 
ATOM 4783 C C   . PHE B 2 67  ? 130.187 148.502 138.511 1.00 119.54 ?  179 PHE B C   1 
ATOM 4784 O O   . PHE B 2 67  ? 131.298 147.983 138.385 1.00 114.47 ?  179 PHE B O   1 
ATOM 4785 C CB  . PHE B 2 67  ? 129.547 150.583 139.703 1.00 136.35 ?  179 PHE B CB  1 
ATOM 4786 C CG  . PHE B 2 67  ? 130.239 149.993 140.897 1.00 138.03 ?  179 PHE B CG  1 
ATOM 4787 C CD1 . PHE B 2 67  ? 131.516 150.385 141.247 1.00 136.87 ?  179 PHE B CD1 1 
ATOM 4788 C CD2 . PHE B 2 67  ? 129.594 149.055 141.685 1.00 139.72 ?  179 PHE B CD2 1 
ATOM 4789 C CE1 . PHE B 2 67  ? 132.146 149.839 142.353 1.00 139.08 ?  179 PHE B CE1 1 
ATOM 4790 C CE2 . PHE B 2 67  ? 130.217 148.509 142.788 1.00 142.28 ?  179 PHE B CE2 1 
ATOM 4791 C CZ  . PHE B 2 67  ? 131.493 148.902 143.124 1.00 143.98 ?  179 PHE B CZ  1 
ATOM 4792 N N   . ILE B 2 68  ? 129.083 147.806 138.726 1.00 116.59 ?  180 ILE B N   1 
ATOM 4793 C CA  . ILE B 2 68  ? 129.187 146.399 139.050 1.00 116.48 ?  180 ILE B CA  1 
ATOM 4794 C C   . ILE B 2 68  ? 129.784 145.600 137.913 1.00 114.34 ?  180 ILE B C   1 
ATOM 4795 O O   . ILE B 2 68  ? 130.701 144.803 138.111 1.00 115.19 ?  180 ILE B O   1 
ATOM 4796 C CB  . ILE B 2 68  ? 127.824 145.830 139.411 1.00 20.00  ?  180 ILE B CB  1 
ATOM 4797 C CG1 . ILE B 2 68  ? 127.364 146.459 140.724 1.00 20.00  ?  180 ILE B CG1 1 
ATOM 4798 C CG2 . ILE B 2 68  ? 127.886 144.315 139.508 1.00 20.00  ?  180 ILE B CG2 1 
ATOM 4799 C CD1 . ILE B 2 68  ? 125.962 146.136 141.102 1.00 20.00  ?  180 ILE B CD1 1 
ATOM 4800 N N   . TYR B 2 69  ? 129.291 145.847 136.713 1.00 110.46 ?  181 TYR B N   1 
ATOM 4801 C CA  . TYR B 2 69  ? 129.740 145.083 135.574 1.00 107.48 ?  181 TYR B CA  1 
ATOM 4802 C C   . TYR B 2 69  ? 131.200 145.323 135.289 1.00 102.43 ?  181 TYR B C   1 
ATOM 4803 O O   . TYR B 2 69  ? 131.959 144.386 135.018 1.00 104.01 ?  181 TYR B O   1 
ATOM 4804 C CB  . TYR B 2 69  ? 128.925 145.425 134.341 1.00 114.21 ?  181 TYR B CB  1 
ATOM 4805 C CG  . TYR B 2 69  ? 129.562 144.885 133.099 1.00 122.39 ?  181 TYR B CG  1 
ATOM 4806 C CD1 . TYR B 2 69  ? 129.487 143.541 132.791 1.00 126.86 ?  181 TYR B CD1 1 
ATOM 4807 C CD2 . TYR B 2 69  ? 130.269 145.717 132.249 1.00 125.95 ?  181 TYR B CD2 1 
ATOM 4808 C CE1 . TYR B 2 69  ? 130.086 143.042 131.662 1.00 132.04 ?  181 TYR B CE1 1 
ATOM 4809 C CE2 . TYR B 2 69  ? 130.869 145.230 131.120 1.00 132.09 ?  181 TYR B CE2 1 
ATOM 4810 C CZ  . TYR B 2 69  ? 130.776 143.892 130.828 1.00 134.77 ?  181 TYR B CZ  1 
ATOM 4811 O OH  . TYR B 2 69  ? 131.376 143.400 129.692 1.00 136.59 ?  181 TYR B OH  1 
ATOM 4812 N N   . LEU B 2 70  ? 131.604 146.581 135.353 1.00 106.23 ?  182 LEU B N   1 
ATOM 4813 C CA  . LEU B 2 70  ? 132.985 146.874 135.054 1.00 112.61 ?  182 LEU B CA  1 
ATOM 4814 C C   . LEU B 2 70  ? 133.855 146.227 136.131 1.00 119.85 ?  182 LEU B C   1 
ATOM 4815 O O   . LEU B 2 70  ? 134.971 145.766 135.862 1.00 121.27 ?  182 LEU B O   1 
ATOM 4816 C CB  . LEU B 2 70  ? 133.194 148.378 134.962 1.00 20.00  ?  182 LEU B CB  1 
ATOM 4817 C CG  . LEU B 2 70  ? 134.507 148.819 134.332 1.00 20.00  ?  182 LEU B CG  1 
ATOM 4818 C CD1 . LEU B 2 70  ? 134.296 150.094 133.530 1.00 20.00  ?  182 LEU B CD1 1 
ATOM 4819 C CD2 . LEU B 2 70  ? 135.565 149.006 135.400 1.00 20.00  ?  182 LEU B CD2 1 
ATOM 4820 N N   . GLY B 2 71  ? 133.309 146.132 137.340 1.00 122.65 ?  183 GLY B N   1 
ATOM 4821 C CA  . GLY B 2 71  ? 134.027 145.483 138.417 1.00 122.30 ?  183 GLY B CA  1 
ATOM 4822 C C   . GLY B 2 71  ? 134.202 144.022 138.079 1.00 110.71 ?  183 GLY B C   1 
ATOM 4823 O O   . GLY B 2 71  ? 135.255 143.438 138.336 1.00 96.96  ?  183 GLY B O   1 
ATOM 4824 N N   . GLU B 2 72  ? 133.187 143.442 137.450 1.00 113.23 ?  184 GLU B N   1 
ATOM 4825 C CA  . GLU B 2 72  ? 133.273 142.055 137.036 1.00 118.39 ?  184 GLU B CA  1 
ATOM 4826 C C   . GLU B 2 72  ? 134.396 141.931 136.034 1.00 121.75 ?  184 GLU B C   1 
ATOM 4827 O O   . GLU B 2 72  ? 135.165 140.969 136.051 1.00 128.40 ?  184 GLU B O   1 
ATOM 4828 C CB  . GLU B 2 72  ? 131.958 141.584 136.414 1.00 20.00  ?  184 GLU B CB  1 
ATOM 4829 C CG  . GLU B 2 72  ? 131.900 140.106 136.039 1.00 20.00  ?  184 GLU B CG  1 
ATOM 4830 C CD  . GLU B 2 72  ? 131.833 139.184 137.247 1.00 20.00  ?  184 GLU B CD  1 
ATOM 4831 O OE1 . GLU B 2 72  ? 131.609 139.687 138.367 1.00 20.00  ?  184 GLU B OE1 1 
ATOM 4832 O OE2 . GLU B 2 72  ? 131.980 137.953 137.077 1.00 20.00  ?  184 GLU B OE2 1 
ATOM 4833 N N   . VAL B 2 73  ? 134.526 142.947 135.194 1.00 121.15 ?  185 VAL B N   1 
ATOM 4834 C CA  . VAL B 2 73  ? 135.542 142.903 134.164 1.00 123.16 ?  185 VAL B CA  1 
ATOM 4835 C C   . VAL B 2 73  ? 136.916 142.882 134.782 1.00 139.81 ?  185 VAL B C   1 
ATOM 4836 O O   . VAL B 2 73  ? 137.746 142.042 134.440 1.00 144.52 ?  185 VAL B O   1 
ATOM 4837 C CB  . VAL B 2 73  ? 135.453 144.098 133.232 1.00 20.00  ?  185 VAL B CB  1 
ATOM 4838 C CG1 . VAL B 2 73  ? 136.578 144.047 132.221 1.00 20.00  ?  185 VAL B CG1 1 
ATOM 4839 C CG2 . VAL B 2 73  ? 134.104 144.127 132.549 1.00 20.00  ?  185 VAL B CG2 1 
ATOM 4840 N N   . PHE B 2 74  ? 137.147 143.795 135.716 1.00 146.58 ?  186 PHE B N   1 
ATOM 4841 C CA  . PHE B 2 74  ? 138.432 143.835 136.396 1.00 156.12 ?  186 PHE B CA  1 
ATOM 4842 C C   . PHE B 2 74  ? 138.729 142.582 137.206 1.00 167.59 ?  186 PHE B C   1 
ATOM 4843 O O   . PHE B 2 74  ? 139.888 142.192 137.334 1.00 168.18 ?  186 PHE B O   1 
ATOM 4844 C CB  . PHE B 2 74  ? 138.524 145.076 137.279 1.00 20.00  ?  186 PHE B CB  1 
ATOM 4845 C CG  . PHE B 2 74  ? 138.870 146.318 136.519 1.00 20.00  ?  186 PHE B CG  1 
ATOM 4846 C CD1 . PHE B 2 74  ? 139.535 146.224 135.308 1.00 20.00  ?  186 PHE B CD1 1 
ATOM 4847 C CD2 . PHE B 2 74  ? 138.548 147.569 137.007 1.00 20.00  ?  186 PHE B CD2 1 
ATOM 4848 C CE1 . PHE B 2 74  ? 139.875 147.353 134.596 1.00 20.00  ?  186 PHE B CE1 1 
ATOM 4849 C CE2 . PHE B 2 74  ? 138.883 148.706 136.295 1.00 20.00  ?  186 PHE B CE2 1 
ATOM 4850 C CZ  . PHE B 2 74  ? 139.547 148.596 135.086 1.00 20.00  ?  186 PHE B CZ  1 
ATOM 4851 N N   . LYS B 2 75  ? 137.700 141.935 137.736 1.00 176.14 ?  187 LYS B N   1 
ATOM 4852 C CA  . LYS B 2 75  ? 137.942 140.658 138.381 1.00 186.45 ?  187 LYS B CA  1 
ATOM 4853 C C   . LYS B 2 75  ? 138.472 139.692 137.349 1.00 192.93 ?  187 LYS B C   1 
ATOM 4854 O O   . LYS B 2 75  ? 139.519 139.082 137.540 1.00 197.60 ?  187 LYS B O   1 
ATOM 4855 C CB  . LYS B 2 75  ? 136.673 140.096 139.018 1.00 20.00  ?  187 LYS B CB  1 
ATOM 4856 C CG  . LYS B 2 75  ? 136.153 140.883 140.200 1.00 20.00  ?  187 LYS B CG  1 
ATOM 4857 C CD  . LYS B 2 75  ? 137.075 140.738 141.395 1.00 20.00  ?  187 LYS B CD  1 
ATOM 4858 C CE  . LYS B 2 75  ? 136.537 141.503 142.592 1.00 20.00  ?  187 LYS B CE  1 
ATOM 4859 N NZ  . LYS B 2 75  ? 135.228 140.964 143.053 1.00 20.00  ?  187 LYS B NZ  1 
ATOM 4860 N N   . THR B 2 76  ? 137.772 139.606 136.226 1.00 195.42 ?  188 THR B N   1 
ATOM 4861 C CA  . THR B 2 76  ? 138.027 138.545 135.265 1.00 203.23 ?  188 THR B CA  1 
ATOM 4862 C C   . THR B 2 76  ? 139.420 138.574 134.670 1.00 206.00 ?  188 THR B C   1 
ATOM 4863 O O   . THR B 2 76  ? 139.953 137.538 134.295 1.00 206.70 ?  188 THR B O   1 
ATOM 4864 C CB  . THR B 2 76  ? 137.027 138.598 134.125 1.00 20.00  ?  188 THR B CB  1 
ATOM 4865 O OG1 . THR B 2 76  ? 137.029 139.916 133.564 1.00 20.00  ?  188 THR B OG1 1 
ATOM 4866 C CG2 . THR B 2 76  ? 135.637 138.252 134.622 1.00 20.00  ?  188 THR B CG2 1 
ATOM 4867 N N   . TYR B 2 77  ? 140.011 139.754 134.573 1.00 205.90 ?  189 TYR B N   1 
ATOM 4868 C CA  . TYR B 2 77  ? 141.369 139.839 134.062 1.00 207.81 ?  189 TYR B CA  1 
ATOM 4869 C C   . TYR B 2 77  ? 142.377 140.098 135.162 1.00 206.25 ?  189 TYR B C   1 
ATOM 4870 O O   . TYR B 2 77  ? 143.569 139.840 134.992 1.00 204.65 ?  189 TYR B O   1 
ATOM 4871 C CB  . TYR B 2 77  ? 141.453 140.913 132.992 1.00 20.00  ?  189 TYR B CB  1 
ATOM 4872 C CG  . TYR B 2 77  ? 140.688 140.530 131.759 1.00 20.00  ?  189 TYR B CG  1 
ATOM 4873 C CD1 . TYR B 2 77  ? 139.336 140.801 131.649 1.00 20.00  ?  189 TYR B CD1 1 
ATOM 4874 C CD2 . TYR B 2 77  ? 141.307 139.854 130.723 1.00 20.00  ?  189 TYR B CD2 1 
ATOM 4875 C CE1 . TYR B 2 77  ? 138.628 140.436 130.529 1.00 20.00  ?  189 TYR B CE1 1 
ATOM 4876 C CE2 . TYR B 2 77  ? 140.609 139.489 129.595 1.00 20.00  ?  189 TYR B CE2 1 
ATOM 4877 C CZ  . TYR B 2 77  ? 139.269 139.781 129.504 1.00 20.00  ?  189 TYR B CZ  1 
ATOM 4878 O OH  . TYR B 2 77  ? 138.565 139.415 128.382 1.00 20.00  ?  189 TYR B OH  1 
ATOM 4879 N N   . UNK B 2 78  ? 141.888 140.610 136.287 1.00 210.27 ?  190 UNK B N   1 
ATOM 4880 C CA  . UNK B 2 78  ? 142.711 140.822 137.469 1.00 214.78 ?  190 UNK B CA  1 
ATOM 4881 C C   . UNK B 2 78  ? 143.984 141.590 137.156 1.00 210.41 ?  190 UNK B C   1 
ATOM 4882 O O   . UNK B 2 78  ? 145.043 141.286 137.699 1.00 217.82 ?  190 UNK B O   1 
ATOM 4883 C CB  . UNK B 2 78  ? 143.052 139.497 138.115 1.00 20.00  ?  190 UNK B CB  1 
ATOM 4884 N N   . UNK B 2 79  ? 143.884 142.576 136.272 1.00 30.00  ?  191 UNK B N   1 
ATOM 4885 C CA  . UNK B 2 79  ? 145.039 143.387 135.916 1.00 30.00  ?  191 UNK B CA  1 
ATOM 4886 C C   . UNK B 2 79  ? 144.684 144.867 135.921 1.00 30.00  ?  191 UNK B C   1 
ATOM 4887 O O   . UNK B 2 79  ? 143.899 145.318 136.753 1.00 30.00  ?  191 UNK B O   1 
ATOM 4888 C CB  . UNK B 2 79  ? 145.577 142.973 134.564 1.00 20.00  ?  191 UNK B CB  1 
ATOM 4889 N N   . UNK B 2 80  ? 141.086 147.403 140.635 1.00 30.00  ?  193 UNK B N   1 
ATOM 4890 C CA  . UNK B 2 80  ? 141.910 148.473 140.087 1.00 30.00  ?  193 UNK B CA  1 
ATOM 4891 C C   . UNK B 2 80  ? 141.784 149.733 140.926 1.00 30.00  ?  193 UNK B C   1 
ATOM 4892 O O   . UNK B 2 80  ? 141.063 149.752 141.922 1.00 30.00  ?  193 UNK B O   1 
ATOM 4893 C CB  . UNK B 2 80  ? 141.525 148.758 138.658 1.00 20.00  ?  193 UNK B CB  1 
ATOM 4894 N N   . UNK B 2 81  ? 142.502 150.778 140.523 1.00 30.00  ?  194 UNK B N   1 
ATOM 4895 C CA  . UNK B 2 81  ? 142.469 152.048 141.239 1.00 30.00  ?  194 UNK B CA  1 
ATOM 4896 C C   . UNK B 2 81  ? 141.076 152.651 141.197 1.00 30.00  ?  194 UNK B C   1 
ATOM 4897 O O   . UNK B 2 81  ? 140.457 152.722 140.137 1.00 30.00  ?  194 UNK B O   1 
ATOM 4898 C CB  . UNK B 2 81  ? 143.480 153.013 140.652 1.00 20.00  ?  194 UNK B CB  1 
ATOM 4899 N N   . UNK B 2 82  ? 140.591 153.100 142.348 1.00 30.00  ?  195 UNK B N   1 
ATOM 4900 C CA  . UNK B 2 82  ? 139.235 153.618 142.440 1.00 30.00  ?  195 UNK B CA  1 
ATOM 4901 C C   . UNK B 2 82  ? 139.043 154.913 141.663 1.00 30.00  ?  195 UNK B C   1 
ATOM 4902 O O   . UNK B 2 82  ? 137.970 155.164 141.128 1.00 30.00  ?  195 UNK B O   1 
ATOM 4903 C CB  . UNK B 2 82  ? 138.853 153.824 143.895 1.00 20.00  ?  195 UNK B CB  1 
ATOM 4904 N N   . UNK B 2 83  ? 140.087 155.730 141.589 1.00 30.00  ?  196 UNK B N   1 
ATOM 4905 C CA  . UNK B 2 83  ? 139.942 157.070 141.034 1.00 30.00  ?  196 UNK B CA  1 
ATOM 4906 C C   . UNK B 2 83  ? 139.632 157.038 139.549 1.00 30.00  ?  196 UNK B C   1 
ATOM 4907 O O   . UNK B 2 83  ? 138.667 157.654 139.089 1.00 30.00  ?  196 UNK B O   1 
ATOM 4908 C CB  . UNK B 2 83  ? 141.201 157.887 141.286 1.00 20.00  ?  196 UNK B CB  1 
ATOM 4909 N N   . UNK B 2 84  ? 140.444 156.307 138.799 1.00 164.61 ?  197 UNK B N   1 
ATOM 4910 C CA  . UNK B 2 84  ? 140.271 156.265 137.359 1.00 164.12 ?  197 UNK B CA  1 
ATOM 4911 C C   . UNK B 2 84  ? 138.943 155.623 137.016 1.00 163.27 ?  197 UNK B C   1 
ATOM 4912 O O   . UNK B 2 84  ? 138.282 156.013 136.053 1.00 162.32 ?  197 UNK B O   1 
ATOM 4913 C CB  . UNK B 2 84  ? 141.410 155.517 136.711 1.00 20.00  ?  197 UNK B CB  1 
ATOM 4914 N N   . UNK B 2 85  ? 138.542 154.647 137.819 1.00 162.02 ?  198 UNK B N   1 
ATOM 4915 C CA  . UNK B 2 85  ? 137.253 154.020 137.613 1.00 159.76 ?  198 UNK B CA  1 
ATOM 4916 C C   . UNK B 2 85  ? 136.175 155.047 137.853 1.00 151.30 ?  198 UNK B C   1 
ATOM 4917 O O   . UNK B 2 85  ? 135.167 155.088 137.153 1.00 149.16 ?  198 UNK B O   1 
ATOM 4918 C CB  . UNK B 2 85  ? 137.077 152.835 138.537 1.00 20.00  ?  198 UNK B CB  1 
ATOM 4919 N N   . UNK B 2 86  ? 136.424 155.919 138.819 1.00 146.77 ?  199 UNK B N   1 
ATOM 4920 C CA  . UNK B 2 86  ? 135.434 156.910 139.184 1.00 138.66 ?  199 UNK B CA  1 
ATOM 4921 C C   . UNK B 2 86  ? 135.228 157.874 138.029 1.00 135.36 ?  199 UNK B C   1 
ATOM 4922 O O   . UNK B 2 86  ? 134.094 158.133 137.628 1.00 139.83 ?  199 UNK B O   1 
ATOM 4923 C CB  . UNK B 2 86  ? 135.852 157.652 140.443 1.00 20.00  ?  199 UNK B CB  1 
ATOM 4924 N N   . UNK B 2 87  ? 136.323 158.381 137.474 1.00 130.52 ?  200 UNK B N   1 
ATOM 4925 C CA  . UNK B 2 87  ? 136.214 159.322 136.371 1.00 126.17 ?  200 UNK B CA  1 
ATOM 4926 C C   . UNK B 2 87  ? 135.604 158.641 135.166 1.00 122.67 ?  200 UNK B C   1 
ATOM 4927 O O   . UNK B 2 87  ? 134.863 159.252 134.398 1.00 122.38 ?  200 UNK B O   1 
ATOM 4928 C CB  . UNK B 2 87  ? 137.563 159.893 136.025 1.00 20.00  ?  200 UNK B CB  1 
ATOM 4929 N N   . LEU B 2 88  ? 135.900 157.359 135.021 1.00 121.68 ?  201 LEU B N   1 
ATOM 4930 C CA  . LEU B 2 88  ? 135.445 156.625 133.858 1.00 126.16 ?  201 LEU B CA  1 
ATOM 4931 C C   . LEU B 2 88  ? 133.937 156.440 133.866 1.00 127.96 ?  201 LEU B C   1 
ATOM 4932 O O   . LEU B 2 88  ? 133.252 156.789 132.903 1.00 124.46 ?  201 LEU B O   1 
ATOM 4933 C CB  . LEU B 2 88  ? 136.139 155.274 133.797 1.00 20.00  ?  201 LEU B CB  1 
ATOM 4934 C CG  . LEU B 2 88  ? 135.699 154.382 132.650 1.00 20.00  ?  201 LEU B CG  1 
ATOM 4935 C CD1 . LEU B 2 88  ? 136.013 155.058 131.339 1.00 20.00  ?  201 LEU B CD1 1 
ATOM 4936 C CD2 . LEU B 2 88  ? 136.413 153.055 132.751 1.00 20.00  ?  201 LEU B CD2 1 
ATOM 4937 N N   . ILE B 2 89  ? 133.418 155.908 134.964 1.00 129.39 ?  202 ILE B N   1 
ATOM 4938 C CA  . ILE B 2 89  ? 131.980 155.749 135.098 1.00 129.84 ?  202 ILE B CA  1 
ATOM 4939 C C   . ILE B 2 89  ? 131.277 157.102 135.118 1.00 126.49 ?  202 ILE B C   1 
ATOM 4940 O O   . ILE B 2 89  ? 130.163 157.244 134.600 1.00 129.72 ?  202 ILE B O   1 
ATOM 4941 C CB  . ILE B 2 89  ? 131.628 154.932 136.358 1.00 20.00  ?  202 ILE B CB  1 
ATOM 4942 C CG1 . ILE B 2 89  ? 131.862 153.440 136.103 1.00 20.00  ?  202 ILE B CG1 1 
ATOM 4943 C CG2 . ILE B 2 89  ? 130.201 155.176 136.804 1.00 20.00  ?  202 ILE B CG2 1 
ATOM 4944 C CD1 . ILE B 2 89  ? 133.117 152.889 136.705 1.00 20.00  ?  202 ILE B CD1 1 
ATOM 4945 N N   . TRP B 2 90  ? 131.944 158.105 135.673 1.00 117.99 ?  203 TRP B N   1 
ATOM 4946 C CA  . TRP B 2 90  ? 131.391 159.449 135.670 1.00 117.46 ?  203 TRP B CA  1 
ATOM 4947 C C   . TRP B 2 90  ? 131.158 159.921 134.254 1.00 117.57 ?  203 TRP B C   1 
ATOM 4948 O O   . TRP B 2 90  ? 130.094 160.443 133.914 1.00 118.40 ?  203 TRP B O   1 
ATOM 4949 C CB  . TRP B 2 90  ? 132.336 160.421 136.365 1.00 20.00  ?  203 TRP B CB  1 
ATOM 4950 C CG  . TRP B 2 90  ? 131.868 161.829 136.316 1.00 20.00  ?  203 TRP B CG  1 
ATOM 4951 C CD1 . TRP B 2 90  ? 132.289 162.803 135.462 1.00 20.00  ?  203 TRP B CD1 1 
ATOM 4952 C CD2 . TRP B 2 90  ? 130.904 162.435 137.176 1.00 20.00  ?  203 TRP B CD2 1 
ATOM 4953 N NE1 . TRP B 2 90  ? 131.636 163.979 135.730 1.00 20.00  ?  203 TRP B NE1 1 
ATOM 4954 C CE2 . TRP B 2 90  ? 130.780 163.779 136.780 1.00 20.00  ?  203 TRP B CE2 1 
ATOM 4955 C CE3 . TRP B 2 90  ? 130.130 161.971 138.242 1.00 20.00  ?  203 TRP B CE3 1 
ATOM 4956 C CZ2 . TRP B 2 90  ? 129.911 164.663 137.412 1.00 20.00  ?  203 TRP B CZ2 1 
ATOM 4957 C CZ3 . TRP B 2 90  ? 129.270 162.848 138.867 1.00 20.00  ?  203 TRP B CZ3 1 
ATOM 4958 C CH2 . TRP B 2 90  ? 129.168 164.179 138.452 1.00 20.00  ?  203 TRP B CH2 1 
ATOM 4959 N N   . ASN B 2 91  ? 132.165 159.701 133.422 1.00 119.37 ?  204 ASN B N   1 
ATOM 4960 C CA  . ASN B 2 91  ? 132.152 160.231 132.080 1.00 118.92 ?  204 ASN B CA  1 
ATOM 4961 C C   . ASN B 2 91  ? 131.154 159.473 131.229 1.00 128.32 ?  204 ASN B C   1 
ATOM 4962 O O   . ASN B 2 91  ? 130.348 160.077 130.510 1.00 132.09 ?  204 ASN B O   1 
ATOM 4963 C CB  . ASN B 2 91  ? 133.551 160.161 131.475 1.00 20.00  ?  204 ASN B CB  1 
ATOM 4964 C CG  . ASN B 2 91  ? 133.673 160.960 130.196 1.00 20.00  ?  204 ASN B CG  1 
ATOM 4965 O OD1 . ASN B 2 91  ? 132.683 161.234 129.523 1.00 20.00  ?  204 ASN B OD1 1 
ATOM 4966 N ND2 . ASN B 2 91  ? 134.893 161.370 129.872 1.00 20.00  ?  204 ASN B ND2 1 
ATOM 4967 N N   . PHE B 2 92  ? 131.184 158.150 131.329 1.00 131.16 ?  205 PHE B N   1 
ATOM 4968 C CA  . PHE B 2 92  ? 130.264 157.359 130.535 1.00 131.48 ?  205 PHE B CA  1 
ATOM 4969 C C   . PHE B 2 92  ? 128.834 157.654 130.909 1.00 128.63 ?  205 PHE B C   1 
ATOM 4970 O O   . PHE B 2 92  ? 127.973 157.791 130.041 1.00 129.09 ?  205 PHE B O   1 
ATOM 4971 C CB  . PHE B 2 92  ? 130.510 155.871 130.705 1.00 20.00  ?  205 PHE B CB  1 
ATOM 4972 C CG  . PHE B 2 92  ? 129.491 155.029 130.012 1.00 20.00  ?  205 PHE B CG  1 
ATOM 4973 C CD1 . PHE B 2 92  ? 129.574 154.816 128.651 1.00 20.00  ?  205 PHE B CD1 1 
ATOM 4974 C CD2 . PHE B 2 92  ? 128.435 154.470 130.709 1.00 20.00  ?  205 PHE B CD2 1 
ATOM 4975 C CE1 . PHE B 2 92  ? 128.636 154.050 127.998 1.00 20.00  ?  205 PHE B CE1 1 
ATOM 4976 C CE2 . PHE B 2 92  ? 127.494 153.704 130.059 1.00 20.00  ?  205 PHE B CE2 1 
ATOM 4977 C CZ  . PHE B 2 92  ? 127.594 153.495 128.702 1.00 20.00  ?  205 PHE B CZ  1 
ATOM 4978 N N   . GLY B 2 93  ? 128.581 157.770 132.204 1.00 125.17 ?  206 GLY B N   1 
ATOM 4979 C CA  . GLY B 2 93  ? 127.226 157.997 132.647 1.00 122.03 ?  206 GLY B CA  1 
ATOM 4980 C C   . GLY B 2 93  ? 126.728 159.369 132.265 1.00 120.54 ?  206 GLY B C   1 
ATOM 4981 O O   . GLY B 2 93  ? 125.573 159.539 131.865 1.00 126.38 ?  206 GLY B O   1 
ATOM 4982 N N   . UNK B 2 94  ? 127.612 160.354 132.356 1.00 116.14 ?  207 UNK B N   1 
ATOM 4983 C CA  . UNK B 2 94  ? 127.227 161.700 131.987 1.00 119.31 ?  207 UNK B CA  1 
ATOM 4984 C C   . UNK B 2 94  ? 126.897 161.730 130.506 1.00 128.80 ?  207 UNK B C   1 
ATOM 4985 O O   . UNK B 2 94  ? 125.952 162.393 130.075 1.00 132.37 ?  207 UNK B O   1 
ATOM 4986 C CB  . UNK B 2 94  ? 128.337 162.684 132.317 1.00 20.00  ?  207 UNK B CB  1 
ATOM 4987 N N   . UNK B 2 95  ? 127.650 160.960 129.734 1.00 131.67 ?  208 UNK B N   1 
ATOM 4988 C CA  . UNK B 2 95  ? 127.463 160.956 128.296 1.00 135.57 ?  208 UNK B CA  1 
ATOM 4989 C C   . UNK B 2 95  ? 126.144 160.299 127.926 1.00 142.15 ?  208 UNK B C   1 
ATOM 4990 O O   . UNK B 2 95  ? 125.376 160.824 127.108 1.00 148.04 ?  208 UNK B O   1 
ATOM 4991 C CB  . UNK B 2 95  ? 128.612 160.252 127.622 1.00 20.00  ?  208 UNK B CB  1 
ATOM 4992 N N   . UNK B 2 96  ? 125.870 159.158 128.543 1.00 30.00  ?  209 UNK B N   1 
ATOM 4993 C CA  . UNK B 2 96  ? 124.628 158.465 128.261 1.00 30.00  ?  209 UNK B CA  1 
ATOM 4994 C C   . UNK B 2 96  ? 123.466 159.351 128.654 1.00 30.00  ?  209 UNK B C   1 
ATOM 4995 O O   . UNK B 2 96  ? 122.449 159.414 127.961 1.00 30.00  ?  209 UNK B O   1 
ATOM 4996 C CB  . UNK B 2 96  ? 124.566 157.151 129.010 1.00 20.00  ?  209 UNK B CB  1 
ATOM 4997 N N   . UNK B 2 97  ? 123.645 160.075 129.752 1.00 133.92 ?  210 UNK B N   1 
ATOM 4998 C CA  . UNK B 2 97  ? 122.594 160.942 130.249 1.00 131.85 ?  210 UNK B CA  1 
ATOM 4999 C C   . UNK B 2 97  ? 122.329 162.050 129.250 1.00 129.10 ?  210 UNK B C   1 
ATOM 5000 O O   . UNK B 2 97  ? 121.182 162.431 129.011 1.00 124.09 ?  210 UNK B O   1 
ATOM 5001 C CB  . UNK B 2 97  ? 122.977 161.516 131.597 1.00 20.00  ?  210 UNK B CB  1 
ATOM 5002 N N   . UNK B 2 98  ? 123.398 162.543 128.638 1.00 128.71 ?  211 UNK B N   1 
ATOM 5003 C CA  . UNK B 2 98  ? 123.242 163.581 127.640 1.00 129.77 ?  211 UNK B CA  1 
ATOM 5004 C C   . UNK B 2 98  ? 122.478 163.020 126.461 1.00 127.23 ?  211 UNK B C   1 
ATOM 5005 O O   . UNK B 2 98  ? 121.662 163.712 125.852 1.00 123.80 ?  211 UNK B O   1 
ATOM 5006 C CB  . UNK B 2 98  ? 124.588 164.113 127.203 1.00 20.00  ?  211 UNK B CB  1 
ATOM 5007 N N   . UNK B 2 99  ? 122.717 161.750 126.155 1.00 129.53 ?  212 UNK B N   1 
ATOM 5008 C CA  . UNK B 2 99  ? 121.960 161.115 125.091 1.00 137.49 ?  212 UNK B CA  1 
ATOM 5009 C C   . UNK B 2 99  ? 120.498 161.029 125.492 1.00 146.64 ?  212 UNK B C   1 
ATOM 5010 O O   . UNK B 2 99  ? 119.609 161.077 124.647 1.00 144.16 ?  212 UNK B O   1 
ATOM 5011 C CB  . UNK B 2 99  ? 122.512 159.743 124.779 1.00 20.00  ?  212 UNK B CB  1 
ATOM 5012 N N   . UNK B 2 100 ? 120.254 160.913 126.792 1.00 149.21 ?  213 UNK B N   1 
ATOM 5013 C CA  . UNK B 2 100 ? 118.892 160.813 127.292 1.00 143.84 ?  213 UNK B CA  1 
ATOM 5014 C C   . UNK B 2 100 ? 118.142 162.144 127.231 1.00 129.93 ?  213 UNK B C   1 
ATOM 5015 O O   . UNK B 2 100 ? 116.938 162.172 126.973 1.00 125.35 ?  213 UNK B O   1 
ATOM 5016 C CB  . UNK B 2 100 ? 118.897 160.279 128.713 1.00 20.00  ?  213 UNK B CB  1 
ATOM 5017 N N   . UNK B 2 101 ? 118.847 163.247 127.462 1.00 122.94 ?  214 UNK B N   1 
ATOM 5018 C CA  . UNK B 2 101 ? 118.169 164.534 127.592 1.00 113.45 ?  214 UNK B CA  1 
ATOM 5019 C C   . UNK B 2 101 ? 118.434 165.533 126.469 1.00 111.23 ?  214 UNK B C   1 
ATOM 5020 O O   . UNK B 2 101 ? 117.798 166.582 126.421 1.00 116.40 ?  214 UNK B O   1 
ATOM 5021 C CB  . UNK B 2 101 ? 118.537 165.166 128.923 1.00 20.00  ?  214 UNK B CB  1 
ATOM 5022 N N   . UNK B 2 102 ? 119.353 165.225 125.562 1.00 111.54 ?  215 UNK B N   1 
ATOM 5023 C CA  . UNK B 2 102 ? 119.731 166.217 124.559 1.00 120.26 ?  215 UNK B CA  1 
ATOM 5024 C C   . UNK B 2 102 ? 119.913 165.631 123.167 1.00 133.78 ?  215 UNK B C   1 
ATOM 5025 O O   . UNK B 2 102 ? 120.353 166.327 122.253 1.00 135.82 ?  215 UNK B O   1 
ATOM 5026 C CB  . UNK B 2 102 ? 120.997 166.931 124.990 1.00 20.00  ?  215 UNK B CB  1 
ATOM 5027 N N   . UNK B 2 103 ? 119.584 164.352 123.018 1.00 30.00  ?  216 UNK B N   1 
ATOM 5028 C CA  . UNK B 2 103 ? 119.597 163.681 121.720 1.00 30.00  ?  216 UNK B CA  1 
ATOM 5029 C C   . UNK B 2 103 ? 120.967 163.705 121.036 1.00 30.00  ?  216 UNK B C   1 
ATOM 5030 O O   . UNK B 2 103 ? 121.644 162.681 120.976 1.00 30.00  ?  216 UNK B O   1 
ATOM 5031 C CB  . UNK B 2 103 ? 118.544 164.289 120.805 1.00 20.00  ?  216 UNK B CB  1 
ATOM 5032 N N   . UNK B 2 104 ? 121.360 164.869 120.521 1.00 141.26 ?  217 UNK B N   1 
ATOM 5033 C CA  . UNK B 2 104 ? 122.588 165.012 119.733 1.00 135.73 ?  217 UNK B CA  1 
ATOM 5034 C C   . UNK B 2 104 ? 122.603 164.032 118.561 1.00 146.39 ?  217 UNK B C   1 
ATOM 5035 O O   . UNK B 2 104 ? 121.546 163.630 118.082 1.00 149.02 ?  217 UNK B O   1 
ATOM 5036 C CB  . UNK B 2 104 ? 123.811 164.820 120.607 1.00 20.00  ?  217 UNK B CB  1 
ATOM 5037 N N   . UNK B 2 105 ? 123.792 163.642 118.106 1.00 30.00  ?  218 UNK B N   1 
ATOM 5038 C CA  . UNK B 2 105 ? 123.896 162.716 116.982 1.00 30.00  ?  218 UNK B CA  1 
ATOM 5039 C C   . UNK B 2 105 ? 123.178 161.422 117.333 1.00 30.00  ?  218 UNK B C   1 
ATOM 5040 O O   . UNK B 2 105 ? 123.296 160.926 118.446 1.00 30.00  ?  218 UNK B O   1 
ATOM 5041 C CB  . UNK B 2 105 ? 125.346 162.452 116.634 1.00 20.00  ?  218 UNK B CB  1 
ATOM 5042 N N   . UNK B 2 106 ? 122.414 160.890 116.388 1.00 183.45 ?  219 UNK B N   1 
ATOM 5043 C CA  . UNK B 2 106 ? 121.488 159.807 116.702 1.00 187.47 ?  219 UNK B CA  1 
ATOM 5044 C C   . UNK B 2 106 ? 122.160 158.446 116.819 1.00 180.69 ?  219 UNK B C   1 
ATOM 5045 O O   . UNK B 2 106 ? 121.849 157.673 117.727 1.00 181.68 ?  219 UNK B O   1 
ATOM 5046 C CB  . UNK B 2 106 ? 120.387 159.748 115.657 1.00 20.00  ?  219 UNK B CB  1 
ATOM 5047 N N   . ARG B 2 107 ? 123.082 158.164 115.906 1.00 174.79 ?  220 ARG B N   1 
ATOM 5048 C CA  . ARG B 2 107 ? 123.620 156.819 115.765 1.00 170.48 ?  220 ARG B CA  1 
ATOM 5049 C C   . ARG B 2 107 ? 124.236 156.363 117.065 1.00 158.45 ?  220 ARG B C   1 
ATOM 5050 O O   . ARG B 2 107 ? 123.928 155.293 117.607 1.00 150.60 ?  220 ARG B O   1 
ATOM 5051 C CB  . ARG B 2 107 ? 124.659 156.775 114.652 1.00 20.00  ?  220 ARG B CB  1 
ATOM 5052 C CG  . ARG B 2 107 ? 124.093 157.068 113.286 1.00 20.00  ?  220 ARG B CG  1 
ATOM 5053 C CD  . ARG B 2 107 ? 125.153 156.920 112.221 1.00 20.00  ?  220 ARG B CD  1 
ATOM 5054 N NE  . ARG B 2 107 ? 125.591 155.533 112.121 1.00 20.00  ?  220 ARG B NE  1 
ATOM 5055 C CZ  . ARG B 2 107 ? 124.969 154.606 111.399 1.00 20.00  ?  220 ARG B CZ  1 
ATOM 5056 N NH1 . ARG B 2 107 ? 123.883 154.919 110.707 1.00 20.00  ?  220 ARG B NH1 1 
ATOM 5057 N NH2 . ARG B 2 107 ? 125.435 153.366 111.367 1.00 20.00  ?  220 ARG B NH2 1 
ATOM 5058 N N   . LEU B 2 108 ? 125.077 157.240 117.581 1.00 157.50 ?  221 LEU B N   1 
ATOM 5059 C CA  . LEU B 2 108 ? 125.798 157.011 118.808 1.00 152.10 ?  221 LEU B CA  1 
ATOM 5060 C C   . LEU B 2 108 ? 124.809 156.877 119.954 1.00 147.77 ?  221 LEU B C   1 
ATOM 5061 O O   . LEU B 2 108 ? 125.057 156.182 120.945 1.00 148.07 ?  221 LEU B O   1 
ATOM 5062 C CB  . LEU B 2 108 ? 126.773 158.162 119.039 1.00 20.00  ?  221 LEU B CB  1 
ATOM 5063 C CG  . LEU B 2 108 ? 127.691 158.119 120.248 1.00 20.00  ?  221 LEU B CG  1 
ATOM 5064 C CD1 . LEU B 2 108 ? 128.586 156.902 120.144 1.00 20.00  ?  221 LEU B CD1 1 
ATOM 5065 C CD2 . LEU B 2 108 ? 128.517 159.386 120.279 1.00 20.00  ?  221 LEU B CD2 1 
ATOM 5066 N N   . GLN B 2 109 ? 123.670 157.538 119.808 1.00 141.22 ?  222 GLN B N   1 
ATOM 5067 C CA  . GLN B 2 109 ? 122.660 157.448 120.834 1.00 129.62 ?  222 GLN B CA  1 
ATOM 5068 C C   . GLN B 2 109 ? 122.061 156.046 120.825 1.00 124.28 ?  222 GLN B C   1 
ATOM 5069 O O   . GLN B 2 109 ? 121.915 155.441 121.886 1.00 121.50 ?  222 GLN B O   1 
ATOM 5070 C CB  . GLN B 2 109 ? 121.591 158.514 120.641 1.00 20.00  ?  222 GLN B CB  1 
ATOM 5071 C CG  . GLN B 2 109 ? 120.695 158.677 121.840 1.00 20.00  ?  222 GLN B CG  1 
ATOM 5072 C CD  . GLN B 2 109 ? 119.795 159.882 121.728 1.00 20.00  ?  222 GLN B CD  1 
ATOM 5073 O OE1 . GLN B 2 109 ? 119.851 160.620 120.747 1.00 20.00  ?  222 GLN B OE1 1 
ATOM 5074 N NE2 . GLN B 2 109 ? 118.973 160.103 122.745 1.00 20.00  ?  222 GLN B NE2 1 
ATOM 5075 N N   . GLN B 2 110 ? 121.775 155.491 119.647 1.00 123.49 ?  223 GLN B N   1 
ATOM 5076 C CA  . GLN B 2 110 ? 121.311 154.105 119.619 1.00 128.92 ?  223 GLN B CA  1 
ATOM 5077 C C   . GLN B 2 110 ? 122.383 153.176 120.163 1.00 128.21 ?  223 GLN B C   1 
ATOM 5078 O O   . GLN B 2 110 ? 122.072 152.124 120.733 1.00 127.35 ?  223 GLN B O   1 
ATOM 5079 C CB  . GLN B 2 110 ? 120.907 153.623 118.219 1.00 20.00  ?  223 GLN B CB  1 
ATOM 5080 C CG  . GLN B 2 110 ? 119.604 154.178 117.660 1.00 20.00  ?  223 GLN B CG  1 
ATOM 5081 C CD  . GLN B 2 110 ? 119.812 155.278 116.654 1.00 20.00  ?  223 GLN B CD  1 
ATOM 5082 O OE1 . GLN B 2 110 ? 120.939 155.601 116.310 1.00 20.00  ?  223 GLN B OE1 1 
ATOM 5083 N NE2 . GLN B 2 110 ? 118.720 155.850 116.160 1.00 20.00  ?  223 GLN B NE2 1 
ATOM 5084 N N   . ALA B 2 111 ? 123.644 153.556 119.990 1.00 129.40 ?  224 ALA B N   1 
ATOM 5085 C CA  . ALA B 2 111 ? 124.712 152.762 120.577 1.00 131.86 ?  224 ALA B CA  1 
ATOM 5086 C C   . ALA B 2 111 ? 124.567 152.763 122.092 1.00 134.42 ?  224 ALA B C   1 
ATOM 5087 O O   . ALA B 2 111 ? 124.715 151.724 122.741 1.00 143.56 ?  224 ALA B O   1 
ATOM 5088 C CB  . ALA B 2 111 ? 126.070 153.293 120.165 1.00 140.69 ?  224 ALA B CB  1 
ATOM 5089 N N   . TYR B 2 112 ? 124.225 153.912 122.662 1.00 131.19 ?  225 TYR B N   1 
ATOM 5090 C CA  . TYR B 2 112 ? 123.938 153.908 124.085 1.00 131.14 ?  225 TYR B CA  1 
ATOM 5091 C C   . TYR B 2 112 ? 122.746 153.049 124.411 1.00 117.53 ?  225 TYR B C   1 
ATOM 5092 O O   . TYR B 2 112 ? 122.733 152.382 125.443 1.00 104.06 ?  225 TYR B O   1 
ATOM 5093 C CB  . TYR B 2 112 ? 123.726 155.315 124.618 1.00 20.00  ?  225 TYR B CB  1 
ATOM 5094 C CG  . TYR B 2 112 ? 125.028 155.990 124.912 1.00 20.00  ?  225 TYR B CG  1 
ATOM 5095 C CD1 . TYR B 2 112 ? 125.656 155.784 126.126 1.00 20.00  ?  225 TYR B CD1 1 
ATOM 5096 C CD2 . TYR B 2 112 ? 125.646 156.809 123.983 1.00 20.00  ?  225 TYR B CD2 1 
ATOM 5097 C CE1 . TYR B 2 112 ? 126.851 156.381 126.419 1.00 20.00  ?  225 TYR B CE1 1 
ATOM 5098 C CE2 . TYR B 2 112 ? 126.853 157.414 124.269 1.00 20.00  ?  225 TYR B CE2 1 
ATOM 5099 C CZ  . TYR B 2 112 ? 127.449 157.193 125.491 1.00 20.00  ?  225 TYR B CZ  1 
ATOM 5100 O OH  . TYR B 2 112 ? 128.650 157.783 125.792 1.00 20.00  ?  225 TYR B OH  1 
ATOM 5101 N N   . LEU B 2 113 ? 121.766 153.019 123.519 1.00 125.35 ?  226 LEU B N   1 
ATOM 5102 C CA  . LEU B 2 113 ? 120.608 152.177 123.762 1.00 123.97 ?  226 LEU B CA  1 
ATOM 5103 C C   . LEU B 2 113 ? 121.018 150.723 123.917 1.00 124.12 ?  226 LEU B C   1 
ATOM 5104 O O   . LEU B 2 113 ? 120.722 150.091 124.932 1.00 128.10 ?  226 LEU B O   1 
ATOM 5105 C CB  . LEU B 2 113 ? 119.593 152.304 122.633 1.00 121.58 ?  226 LEU B CB  1 
ATOM 5106 C CG  . LEU B 2 113 ? 118.524 153.384 122.754 1.00 119.42 ?  226 LEU B CG  1 
ATOM 5107 C CD1 . LEU B 2 113 ? 119.114 154.776 122.733 1.00 115.13 ?  226 LEU B CD1 1 
ATOM 5108 C CD2 . LEU B 2 113 ? 117.517 153.211 121.634 1.00 118.88 ?  226 LEU B CD2 1 
ATOM 5109 N N   . ILE B 2 114 ? 121.726 150.199 122.924 1.00 118.60 ?  227 ILE B N   1 
ATOM 5110 C CA  . ILE B 2 114 ? 122.090 148.794 122.968 1.00 116.73 ?  227 ILE B CA  1 
ATOM 5111 C C   . ILE B 2 114 ? 123.044 148.492 124.117 1.00 121.86 ?  227 ILE B C   1 
ATOM 5112 O O   . ILE B 2 114 ? 122.971 147.417 124.712 1.00 124.89 ?  227 ILE B O   1 
ATOM 5113 C CB  . ILE B 2 114 ? 122.711 148.330 121.645 1.00 20.00  ?  227 ILE B CB  1 
ATOM 5114 C CG1 . ILE B 2 114 ? 123.963 149.137 121.330 1.00 20.00  ?  227 ILE B CG1 1 
ATOM 5115 C CG2 . ILE B 2 114 ? 121.708 148.466 120.520 1.00 20.00  ?  227 ILE B CG2 1 
ATOM 5116 C CD1 . ILE B 2 114 ? 124.731 148.623 120.156 1.00 20.00  ?  227 ILE B CD1 1 
ATOM 5117 N N   . MET B 2 115 ? 123.911 149.439 124.460 1.00 123.08 ?  228 MET B N   1 
ATOM 5118 C CA  . MET B 2 115 ? 124.784 149.209 125.599 1.00 121.54 ?  228 MET B CA  1 
ATOM 5119 C C   . MET B 2 115 ? 123.925 149.032 126.834 1.00 114.73 ?  228 MET B C   1 
ATOM 5120 O O   . MET B 2 115 ? 124.169 148.149 127.673 1.00 114.18 ?  228 MET B O   1 
ATOM 5121 C CB  . MET B 2 115 ? 125.760 150.364 125.797 1.00 20.00  ?  228 MET B CB  1 
ATOM 5122 C CG  . MET B 2 115 ? 126.761 150.522 124.681 1.00 20.00  ?  228 MET B CG  1 
ATOM 5123 S SD  . MET B 2 115 ? 127.715 149.022 124.416 1.00 20.00  ?  228 MET B SD  1 
ATOM 5124 C CE  . MET B 2 115 ? 128.594 148.905 125.969 1.00 20.00  ?  228 MET B CE  1 
ATOM 5125 N N   . ILE B 2 116 ? 122.879 149.844 126.914 1.00 105.94 ?  229 ILE B N   1 
ATOM 5126 C CA  . ILE B 2 116 ? 121.957 149.725 128.020 1.00 101.12 ?  229 ILE B CA  1 
ATOM 5127 C C   . ILE B 2 116 ? 121.282 148.380 127.990 1.00 104.67 ?  229 ILE B C   1 
ATOM 5128 O O   . ILE B 2 116 ? 121.042 147.779 129.032 1.00 108.05 ?  229 ILE B O   1 
ATOM 5129 C CB  . ILE B 2 116 ? 120.904 150.824 127.996 1.00 98.10  ?  229 ILE B CB  1 
ATOM 5130 C CG1 . ILE B 2 116 ? 121.574 152.176 128.191 1.00 99.28  ?  229 ILE B CG1 1 
ATOM 5131 C CG2 . ILE B 2 116 ? 119.875 150.597 129.072 1.00 96.28  ?  229 ILE B CG2 1 
ATOM 5132 C CD1 . ILE B 2 116 ? 122.370 152.259 129.466 1.00 100.91 ?  229 ILE B CD1 1 
ATOM 5133 N N   . SER B 2 117 ? 121.022 147.878 126.792 1.00 107.51 ?  230 SER B N   1 
ATOM 5134 C CA  . SER B 2 117 ? 120.374 146.586 126.688 1.00 114.10 ?  230 SER B CA  1 
ATOM 5135 C C   . SER B 2 117 ? 121.290 145.520 127.255 1.00 112.39 ?  230 SER B C   1 
ATOM 5136 O O   . SER B 2 117 ? 120.842 144.569 127.899 1.00 113.69 ?  230 SER B O   1 
ATOM 5137 C CB  . SER B 2 117 ? 120.030 146.269 125.241 1.00 123.39 ?  230 SER B CB  1 
ATOM 5138 O OG  . SER B 2 117 ? 121.213 146.142 124.480 1.00 131.56 ?  230 SER B OG  1 
ATOM 5139 N N   . ALA B 2 118 ? 122.586 145.708 127.053 1.00 111.09 ?  231 ALA B N   1 
ATOM 5140 C CA  . ALA B 2 118 ? 123.544 144.741 127.549 1.00 111.16 ?  231 ALA B CA  1 
ATOM 5141 C C   . ALA B 2 118 ? 123.578 144.752 129.063 1.00 110.50 ?  231 ALA B C   1 
ATOM 5142 O O   . ALA B 2 118 ? 123.477 143.705 129.706 1.00 111.84 ?  231 ALA B O   1 
ATOM 5143 C CB  . ALA B 2 118 ? 124.916 145.025 126.991 1.00 111.85 ?  231 ALA B CB  1 
ATOM 5144 N N   . LEU B 2 119 ? 123.699 145.939 129.643 1.00 104.47 ?  232 LEU B N   1 
ATOM 5145 C CA  . LEU B 2 119 ? 123.795 145.993 131.093 1.00 101.16 ?  232 LEU B CA  1 
ATOM 5146 C C   . LEU B 2 119 ? 122.511 145.505 131.752 1.00 102.51 ?  232 LEU B C   1 
ATOM 5147 O O   . LEU B 2 119 ? 122.544 144.809 132.772 1.00 104.61 ?  232 LEU B O   1 
ATOM 5148 C CB  . LEU B 2 119 ? 124.131 147.406 131.558 1.00 20.00  ?  232 LEU B CB  1 
ATOM 5149 C CG  . LEU B 2 119 ? 125.631 147.714 131.623 1.00 20.00  ?  232 LEU B CG  1 
ATOM 5150 C CD1 . LEU B 2 119 ? 126.295 147.709 130.248 1.00 20.00  ?  232 LEU B CD1 1 
ATOM 5151 C CD2 . LEU B 2 119 ? 125.876 149.032 132.354 1.00 20.00  ?  232 LEU B CD2 1 
ATOM 5152 N N   . MET B 2 120 ? 121.383 145.820 131.131 1.00 100.93 ?  233 MET B N   1 
ATOM 5153 C CA  . MET B 2 120 ? 120.102 145.334 131.614 1.00 101.10 ?  233 MET B CA  1 
ATOM 5154 C C   . MET B 2 120 ? 120.044 143.824 131.521 1.00 103.75 ?  233 MET B C   1 
ATOM 5155 O O   . MET B 2 120 ? 119.368 143.168 132.308 1.00 106.73 ?  233 MET B O   1 
ATOM 5156 C CB  . MET B 2 120 ? 118.956 145.953 130.820 1.00 20.00  ?  233 MET B CB  1 
ATOM 5157 C CG  . MET B 2 120 ? 118.759 147.423 131.087 1.00 20.00  ?  233 MET B CG  1 
ATOM 5158 S SD  . MET B 2 120 ? 118.371 147.700 132.820 1.00 20.00  ?  233 MET B SD  1 
ATOM 5159 C CE  . MET B 2 120 ? 116.785 146.871 132.934 1.00 20.00  ?  233 MET B CE  1 
ATOM 5160 N N   . UNK B 2 121 ? 120.742 143.272 130.539 1.00 99.17  ?  234 UNK B N   1 
ATOM 5161 C CA  . UNK B 2 121 ? 120.807 141.826 130.424 1.00 95.29  ?  234 UNK B CA  1 
ATOM 5162 C C   . UNK B 2 121 ? 121.620 141.235 131.569 1.00 100.92 ?  234 UNK B C   1 
ATOM 5163 O O   . UNK B 2 121 ? 121.234 140.225 132.164 1.00 93.79  ?  234 UNK B O   1 
ATOM 5164 C CB  . UNK B 2 121 ? 121.395 141.428 129.088 1.00 20.00  ?  234 UNK B CB  1 
ATOM 5165 N N   . UNK B 2 122 ? 122.727 141.888 131.903 1.00 109.32 ?  235 UNK B N   1 
ATOM 5166 C CA  . UNK B 2 122 ? 123.555 141.404 132.996 1.00 115.61 ?  235 UNK B CA  1 
ATOM 5167 C C   . UNK B 2 122 ? 122.753 141.449 134.280 1.00 114.79 ?  235 UNK B C   1 
ATOM 5168 O O   . UNK B 2 122 ? 122.933 140.618 135.171 1.00 122.81 ?  235 UNK B O   1 
ATOM 5169 C CB  . UNK B 2 122 ? 124.810 142.229 133.122 1.00 20.00  ?  235 UNK B CB  1 
ATOM 5170 N N   . UNK B 2 123 ? 121.844 142.416 134.346 1.00 105.91 ?  236 UNK B N   1 
ATOM 5171 C CA  . UNK B 2 123 ? 120.970 142.567 135.498 1.00 100.28 ?  236 UNK B CA  1 
ATOM 5172 C C   . UNK B 2 123 ? 120.247 141.274 135.817 1.00 100.07 ?  236 UNK B C   1 
ATOM 5173 O O   . UNK B 2 123 ? 120.576 140.591 136.785 1.00 97.19  ?  236 UNK B O   1 
ATOM 5174 C CB  . UNK B 2 123 ? 119.965 143.668 135.255 1.00 20.00  ?  236 UNK B CB  1 
ATOM 5175 N N   . UNK B 2 124 ? 119.271 140.937 134.984 1.00 104.18 ?  237 UNK B N   1 
ATOM 5176 C CA  . UNK B 2 124 ? 118.450 139.763 135.224 1.00 107.98 ?  237 UNK B CA  1 
ATOM 5177 C C   . UNK B 2 124 ? 119.287 138.497 135.187 1.00 105.33 ?  237 UNK B C   1 
ATOM 5178 O O   . UNK B 2 124 ? 118.960 137.514 135.845 1.00 106.81 ?  237 UNK B O   1 
ATOM 5179 C CB  . UNK B 2 124 ? 117.333 139.686 134.210 1.00 20.00  ?  237 UNK B CB  1 
ATOM 5180 N N   . UNK B 2 125 ? 120.369 138.518 134.419 1.00 100.91 ?  238 UNK B N   1 
ATOM 5181 C CA  . UNK B 2 125 ? 121.230 137.351 134.357 1.00 102.67 ?  238 UNK B CA  1 
ATOM 5182 C C   . UNK B 2 125 ? 121.859 137.056 135.707 1.00 103.11 ?  238 UNK B C   1 
ATOM 5183 O O   . UNK B 2 125 ? 122.045 135.897 136.065 1.00 99.23  ?  238 UNK B O   1 
ATOM 5184 C CB  . UNK B 2 125 ? 122.304 137.540 133.313 1.00 20.00  ?  238 UNK B CB  1 
ATOM 5185 N N   . UNK B 2 126 ? 122.175 138.099 136.466 1.00 30.00  ?  239 UNK B N   1 
ATOM 5186 C CA  . UNK B 2 126 ? 122.874 137.897 137.730 1.00 30.00  ?  239 UNK B CA  1 
ATOM 5187 C C   . UNK B 2 126 ? 121.941 137.874 138.929 1.00 30.00  ?  239 UNK B C   1 
ATOM 5188 O O   . UNK B 2 126 ? 122.252 137.263 139.947 1.00 30.00  ?  239 UNK B O   1 
ATOM 5189 C CB  . UNK B 2 126 ? 123.929 138.965 137.921 1.00 20.00  ?  239 UNK B CB  1 
ATOM 5190 N N   . UNK B 2 127 ? 120.799 138.539 138.815 1.00 30.00  ?  240 UNK B N   1 
ATOM 5191 C CA  . UNK B 2 127 ? 119.916 138.700 139.961 1.00 30.00  ?  240 UNK B CA  1 
ATOM 5192 C C   . UNK B 2 127 ? 119.209 137.411 140.374 1.00 30.00  ?  240 UNK B C   1 
ATOM 5193 O O   . UNK B 2 127 ? 119.194 137.064 141.552 1.00 30.00  ?  240 UNK B O   1 
ATOM 5194 C CB  . UNK B 2 127 ? 118.895 139.780 139.678 1.00 20.00  ?  240 UNK B CB  1 
ATOM 5195 N N   . UNK B 2 128 ? 118.640 136.693 139.411 1.00 30.00  ?  241 UNK B N   1 
ATOM 5196 C CA  . UNK B 2 128 ? 117.842 135.509 139.722 1.00 30.00  ?  241 UNK B CA  1 
ATOM 5197 C C   . UNK B 2 128 ? 117.755 134.557 138.537 1.00 30.00  ?  241 UNK B C   1 
ATOM 5198 O O   . UNK B 2 128 ? 117.199 133.466 138.645 1.00 30.00  ?  241 UNK B O   1 
ATOM 5199 C CB  . UNK B 2 128 ? 116.450 135.917 140.166 1.00 20.00  ?  241 UNK B CB  1 
ATOM 5200 N N   . UNK B 2 129 ? 116.577 125.975 138.359 1.00 100.67 ?  245 UNK B N   1 
ATOM 5201 C CA  . UNK B 2 129 ? 115.156 126.138 138.640 1.00 104.32 ?  245 UNK B CA  1 
ATOM 5202 C C   . UNK B 2 129 ? 114.778 127.612 138.763 1.00 112.86 ?  245 UNK B C   1 
ATOM 5203 O O   . UNK B 2 129 ? 113.795 128.059 138.176 1.00 112.71 ?  245 UNK B O   1 
ATOM 5204 C CB  . UNK B 2 129 ? 114.778 125.386 139.910 1.00 20.00  ?  245 UNK B CB  1 
ATOM 5205 N N   . UNK B 2 130 ? 115.565 128.361 139.529 1.00 109.53 ?  246 UNK B N   1 
ATOM 5206 C CA  . UNK B 2 130 ? 115.274 129.766 139.786 1.00 103.18 ?  246 UNK B CA  1 
ATOM 5207 C C   . UNK B 2 130 ? 115.357 130.598 138.515 1.00 106.51 ?  246 UNK B C   1 
ATOM 5208 O O   . UNK B 2 130 ? 114.735 131.653 138.411 1.00 116.37 ?  246 UNK B O   1 
ATOM 5209 C CB  . UNK B 2 130 ? 116.222 130.316 140.836 1.00 20.00  ?  246 UNK B CB  1 
ATOM 5210 N N   . UNK B 2 131 ? 116.138 130.119 137.553 1.00 103.96 ?  247 UNK B N   1 
ATOM 5211 C CA  . UNK B 2 131 ? 116.334 130.832 136.297 1.00 108.95 ?  247 UNK B CA  1 
ATOM 5212 C C   . UNK B 2 131 ? 115.049 130.934 135.483 1.00 111.09 ?  247 UNK B C   1 
ATOM 5213 O O   . UNK B 2 131 ? 114.842 131.907 134.757 1.00 114.54 ?  247 UNK B O   1 
ATOM 5214 C CB  . UNK B 2 131 ? 117.419 130.152 135.475 1.00 20.00  ?  247 UNK B CB  1 
ATOM 5215 N N   . UNK B 2 132 ? 114.184 129.935 135.613 1.00 109.65 ?  248 UNK B N   1 
ATOM 5216 C CA  . UNK B 2 132 ? 112.937 129.923 134.864 1.00 112.76 ?  248 UNK B CA  1 
ATOM 5217 C C   . UNK B 2 132 ? 112.050 131.078 135.305 1.00 115.34 ?  248 UNK B C   1 
ATOM 5218 O O   . UNK B 2 132 ? 111.214 131.553 134.535 1.00 120.26 ?  248 UNK B O   1 
ATOM 5219 C CB  . UNK B 2 132 ? 112.220 128.599 135.038 1.00 20.00  ?  248 UNK B CB  1 
ATOM 5220 N N   . UNK B 2 133 ? 112.239 131.532 136.543 1.00 109.14 ?  249 UNK B N   1 
ATOM 5221 C CA  . UNK B 2 133 ? 111.517 132.698 137.031 1.00 102.53 ?  249 UNK B CA  1 
ATOM 5222 C C   . UNK B 2 133 ? 111.869 133.899 136.169 1.00 90.85  ?  249 UNK B C   1 
ATOM 5223 O O   . UNK B 2 133 ? 110.998 134.681 135.789 1.00 92.96  ?  249 UNK B O   1 
ATOM 5224 C CB  . UNK B 2 133 ? 111.848 132.970 138.492 1.00 20.00  ?  249 UNK B CB  1 
ATOM 5225 N N   . UNK B 2 134 ? 113.144 134.015 135.818 1.00 82.72  ?  250 UNK B N   1 
ATOM 5226 C CA  . UNK B 2 134 ? 113.554 135.061 134.902 1.00 97.15  ?  250 UNK B CA  1 
ATOM 5227 C C   . UNK B 2 134 ? 112.919 134.813 133.547 1.00 107.14 ?  250 UNK B C   1 
ATOM 5228 O O   . UNK B 2 134 ? 112.475 135.745 132.882 1.00 121.37 ?  250 UNK B O   1 
ATOM 5229 C CB  . UNK B 2 134 ? 115.059 135.111 134.787 1.00 20.00  ?  250 UNK B CB  1 
ATOM 5230 N N   . UNK B 2 135 ? 112.846 133.546 133.155 1.00 101.72 ?  251 UNK B N   1 
ATOM 5231 C CA  . UNK B 2 135 ? 112.161 133.200 131.922 1.00 106.54 ?  251 UNK B CA  1 
ATOM 5232 C C   . UNK B 2 135 ? 110.690 133.536 132.083 1.00 111.74 ?  251 UNK B C   1 
ATOM 5233 O O   . UNK B 2 135 ? 110.032 133.976 131.140 1.00 112.90 ?  251 UNK B O   1 
ATOM 5234 C CB  . UNK B 2 135 ? 112.352 131.731 131.583 1.00 20.00  ?  251 UNK B CB  1 
ATOM 5235 N N   . UNK B 2 136 ? 110.181 133.352 133.295 1.00 108.41 ?  252 UNK B N   1 
ATOM 5236 C CA  . UNK B 2 136 ? 108.805 133.714 133.567 1.00 107.32 ?  252 UNK B CA  1 
ATOM 5237 C C   . UNK B 2 136 ? 108.664 135.220 133.473 1.00 113.29 ?  252 UNK B C   1 
ATOM 5238 O O   . UNK B 2 136 ? 107.635 135.733 133.038 1.00 115.44 ?  252 UNK B O   1 
ATOM 5239 C CB  . UNK B 2 136 ? 108.372 133.210 134.930 1.00 20.00  ?  252 UNK B CB  1 
ATOM 5240 N N   . UNK B 2 137 ? 109.722 135.927 133.853 1.00 111.51 ?  253 UNK B N   1 
ATOM 5241 C CA  . UNK B 2 137 ? 109.719 137.375 133.759 1.00 105.07 ?  253 UNK B CA  1 
ATOM 5242 C C   . UNK B 2 137 ? 109.642 137.758 132.297 1.00 106.68 ?  253 UNK B C   1 
ATOM 5243 O O   . UNK B 2 137 ? 109.154 138.827 131.943 1.00 110.87 ?  253 UNK B O   1 
ATOM 5244 C CB  . UNK B 2 137 ? 110.949 137.966 134.412 1.00 20.00  ?  253 UNK B CB  1 
ATOM 5245 N N   . UNK B 2 138 ? 110.139 136.871 131.448 1.00 108.63 ?  254 UNK B N   1 
ATOM 5246 C CA  . UNK B 2 138 ? 110.017 137.059 130.017 1.00 121.29 ?  254 UNK B CA  1 
ATOM 5247 C C   . UNK B 2 138 ? 108.677 136.542 129.534 1.00 131.88 ?  254 UNK B C   1 
ATOM 5248 O O   . UNK B 2 138 ? 108.105 137.069 128.584 1.00 141.21 ?  254 UNK B O   1 
ATOM 5249 C CB  . UNK B 2 138 ? 111.143 136.360 129.293 1.00 20.00  ?  254 UNK B CB  1 
ATOM 5250 N N   . UNK B 2 139 ? 108.174 135.509 130.199 1.00 127.75 ?  255 UNK B N   1 
ATOM 5251 C CA  . UNK B 2 139 ? 106.983 134.834 129.712 1.00 124.92 ?  255 UNK B CA  1 
ATOM 5252 C C   . UNK B 2 139 ? 105.786 135.772 129.698 1.00 121.80 ?  255 UNK B C   1 
ATOM 5253 O O   . UNK B 2 139 ? 104.983 135.749 128.765 1.00 123.74 ?  255 UNK B O   1 
ATOM 5254 C CB  . UNK B 2 139 ? 106.689 133.614 130.561 1.00 20.00  ?  255 UNK B CB  1 
ATOM 5255 N N   . UNK B 2 140 ? 105.699 136.636 130.704 1.00 116.66 ?  256 UNK B N   1 
ATOM 5256 C CA  . UNK B 2 140 ? 104.594 137.580 130.779 1.00 114.65 ?  256 UNK B CA  1 
ATOM 5257 C C   . UNK B 2 140 ? 104.648 138.512 129.587 1.00 108.56 ?  256 UNK B C   1 
ATOM 5258 O O   . UNK B 2 140 ? 103.620 138.899 129.034 1.00 116.74 ?  256 UNK B O   1 
ATOM 5259 C CB  . UNK B 2 140 ? 104.644 138.365 132.074 1.00 20.00  ?  256 UNK B CB  1 
ATOM 5260 N N   . ASP B 2 141 ? 105.869 138.864 129.196 1.00 99.02  ?  257 ASP B N   1 
ATOM 5261 C CA  . ASP B 2 141 ? 106.094 139.727 128.047 1.00 100.67 ?  257 ASP B CA  1 
ATOM 5262 C C   . ASP B 2 141 ? 105.540 139.087 126.782 1.00 104.51 ?  257 ASP B C   1 
ATOM 5263 O O   . ASP B 2 141 ? 105.075 139.784 125.880 1.00 112.72 ?  257 ASP B O   1 
ATOM 5264 C CB  . ASP B 2 141 ? 107.586 140.018 127.880 1.00 20.00  ?  257 ASP B CB  1 
ATOM 5265 C CG  . ASP B 2 141 ? 107.848 141.363 127.231 1.00 20.00  ?  257 ASP B CG  1 
ATOM 5266 O OD1 . ASP B 2 141 ? 107.186 142.350 127.617 1.00 20.00  ?  257 ASP B OD1 1 
ATOM 5267 O OD2 . ASP B 2 141 ? 108.716 141.435 126.336 1.00 20.00  ?  257 ASP B OD2 1 
ATOM 5268 N N   . UNK B 2 142 ? 105.586 137.759 126.715 1.00 100.52 ?  258 UNK B N   1 
ATOM 5269 C CA  . UNK B 2 142 ? 105.059 137.068 125.555 1.00 105.83 ?  258 UNK B CA  1 
ATOM 5270 C C   . UNK B 2 142 ? 103.554 137.245 125.517 1.00 113.77 ?  258 UNK B C   1 
ATOM 5271 O O   . UNK B 2 142 ? 102.965 137.403 124.448 1.00 114.59 ?  258 UNK B O   1 
ATOM 5272 C CB  . UNK B 2 142 ? 105.428 135.600 125.588 1.00 20.00  ?  258 UNK B CB  1 
ATOM 5273 N N   . UNK B 2 143 ? 102.938 137.266 126.694 1.00 116.37 ?  259 UNK B N   1 
ATOM 5274 C CA  . UNK B 2 143 ? 101.503 137.482 126.766 1.00 122.37 ?  259 UNK B CA  1 
ATOM 5275 C C   . UNK B 2 143 ? 101.181 138.879 126.266 1.00 123.30 ?  259 UNK B C   1 
ATOM 5276 O O   . UNK B 2 143 ? 100.153 139.101 125.631 1.00 125.85 ?  259 UNK B O   1 
ATOM 5277 C CB  . UNK B 2 143 ? 100.997 137.282 128.183 1.00 20.00  ?  259 UNK B CB  1 
ATOM 5278 N N   . UNK B 2 144 ? 102.079 139.818 126.549 1.00 124.03 ?  260 UNK B N   1 
ATOM 5279 C CA  . UNK B 2 144 ? 101.918 141.176 126.058 1.00 131.50 ?  260 UNK B CA  1 
ATOM 5280 C C   . UNK B 2 144 ? 102.053 141.199 124.546 1.00 137.72 ?  260 UNK B C   1 
ATOM 5281 O O   . UNK B 2 144 ? 101.431 142.014 123.873 1.00 148.73 ?  260 UNK B O   1 
ATOM 5282 C CB  . UNK B 2 144 ? 102.929 142.104 126.702 1.00 20.00  ?  260 UNK B CB  1 
ATOM 5283 N N   . UNK B 2 145 ? 102.873 140.298 124.012 1.00 129.73 ?  261 UNK B N   1 
ATOM 5284 C CA  . UNK B 2 145 ? 102.999 140.170 122.568 1.00 129.90 ?  261 UNK B CA  1 
ATOM 5285 C C   . UNK B 2 145 ? 101.845 139.343 122.039 1.00 128.32 ?  261 UNK B C   1 
ATOM 5286 O O   . UNK B 2 145 ? 101.565 139.328 120.843 1.00 131.96 ?  261 UNK B O   1 
ATOM 5287 C CB  . UNK B 2 145 ? 104.327 139.538 122.195 1.00 20.00  ?  261 UNK B CB  1 
ATOM 5288 N N   . UNK B 2 146 ? 101.169 138.662 122.953 1.00 125.36 ?  262 UNK B N   1 
ATOM 5289 C CA  . UNK B 2 146 ? 100.033 137.841 122.590 1.00 125.41 ?  262 UNK B CA  1 
ATOM 5290 C C   . UNK B 2 146 ? 98.748  138.640 122.732 1.00 131.57 ?  262 UNK B C   1 
ATOM 5291 O O   . UNK B 2 146 ? 98.032  138.861 121.754 1.00 135.60 ?  262 UNK B O   1 
ATOM 5292 C CB  . UNK B 2 146 ? 99.986  136.593 123.449 1.00 20.00  ?  262 UNK B CB  1 
ATOM 5293 N N   . UNK B 2 147 ? 98.472  139.090 123.952 1.00 133.54 ?  263 UNK B N   1 
ATOM 5294 C CA  . UNK B 2 147 ? 97.197  139.727 124.253 1.00 135.93 ?  263 UNK B CA  1 
ATOM 5295 C C   . UNK B 2 147 ? 96.988  141.006 123.453 1.00 132.17 ?  263 UNK B C   1 
ATOM 5296 O O   . UNK B 2 147 ? 95.880  141.282 122.997 1.00 134.09 ?  263 UNK B O   1 
ATOM 5297 C CB  . UNK B 2 147 ? 97.100  140.018 125.741 1.00 20.00  ?  263 UNK B CB  1 
ATOM 5298 N N   . UNK B 2 148 ? 98.052  141.776 123.259 1.00 126.41 ?  264 UNK B N   1 
ATOM 5299 C CA  . UNK B 2 148 ? 97.938  142.983 122.456 1.00 127.11 ?  264 UNK B CA  1 
ATOM 5300 C C   . UNK B 2 148 ? 97.625  142.617 121.017 1.00 123.32 ?  264 UNK B C   1 
ATOM 5301 O O   . UNK B 2 148 ? 96.863  143.308 120.344 1.00 125.22 ?  264 UNK B O   1 
ATOM 5302 C CB  . UNK B 2 148 ? 99.206  143.806 122.534 1.00 20.00  ?  264 UNK B CB  1 
ATOM 5303 N N   . UNK B 2 149 ? 98.191  141.511 120.552 1.00 111.05 ?  265 UNK B N   1 
ATOM 5304 C CA  . UNK B 2 149 ? 97.865  141.036 119.222 1.00 112.95 ?  265 UNK B CA  1 
ATOM 5305 C C   . UNK B 2 149 ? 96.399  140.642 119.194 1.00 116.95 ?  265 UNK B C   1 
ATOM 5306 O O   . UNK B 2 149 ? 95.711  140.830 118.193 1.00 120.64 ?  265 UNK B O   1 
ATOM 5307 C CB  . UNK B 2 149 ? 98.748  139.873 118.832 1.00 20.00  ?  265 UNK B CB  1 
ATOM 5308 N N   . UNK B 2 150 ? 95.917  140.116 120.314 1.00 118.22 ?  266 UNK B N   1 
ATOM 5309 C CA  . UNK B 2 150 ? 94.510  139.770 120.429 1.00 127.07 ?  266 UNK B CA  1 
ATOM 5310 C C   . UNK B 2 150 ? 93.653  141.028 120.452 1.00 133.15 ?  266 UNK B C   1 
ATOM 5311 O O   . UNK B 2 150 ? 92.478  140.989 120.096 1.00 128.70 ?  266 UNK B O   1 
ATOM 5312 C CB  . UNK B 2 150 ? 94.266  138.929 121.667 1.00 20.00  ?  266 UNK B CB  1 
ATOM 5313 N N   . UNK B 2 151 ? 94.226  142.142 120.899 1.00 133.27 ?  267 UNK B N   1 
ATOM 5314 C CA  . UNK B 2 151 ? 93.508  143.403 120.800 1.00 139.73 ?  267 UNK B CA  1 
ATOM 5315 C C   . UNK B 2 151 ? 93.326  143.741 119.329 1.00 142.23 ?  267 UNK B C   1 
ATOM 5316 O O   . UNK B 2 151 ? 92.298  144.282 118.928 1.00 146.78 ?  267 UNK B O   1 
ATOM 5317 C CB  . UNK B 2 151 ? 94.241  144.514 121.527 1.00 20.00  ?  267 UNK B CB  1 
ATOM 5318 N N   . UNK B 2 152 ? 94.319  143.388 118.519 1.00 138.97 ?  268 UNK B N   1 
ATOM 5319 C CA  . UNK B 2 152 ? 94.187  143.549 117.080 1.00 139.40 ?  268 UNK B CA  1 
ATOM 5320 C C   . UNK B 2 152 ? 93.117  142.590 116.579 1.00 144.08 ?  268 UNK B C   1 
ATOM 5321 O O   . UNK B 2 152 ? 92.429  142.869 115.597 1.00 144.27 ?  268 UNK B O   1 
ATOM 5322 C CB  . UNK B 2 152 ? 95.514  143.306 116.375 1.00 20.00  ?  268 UNK B CB  1 
ATOM 5323 N N   . UNK B 2 153 ? 92.970  141.462 117.269 1.00 151.03 ?  269 UNK B N   1 
ATOM 5324 C CA  . UNK B 2 153 ? 91.917  140.510 116.944 1.00 157.18 ?  269 UNK B CA  1 
ATOM 5325 C C   . UNK B 2 153 ? 90.552  141.104 117.272 1.00 153.44 ?  269 UNK B C   1 
ATOM 5326 O O   . UNK B 2 153 ? 89.541  140.699 116.701 1.00 142.46 ?  269 UNK B O   1 
ATOM 5327 C CB  . UNK B 2 153 ? 92.127  139.192 117.681 1.00 20.00  ?  269 UNK B CB  1 
ATOM 5328 N N   . UNK B 2 154 ? 90.520  142.060 118.198 1.00 147.24 ?  270 UNK B N   1 
ATOM 5329 C CA  . UNK B 2 154 ? 89.280  142.773 118.474 1.00 148.36 ?  270 UNK B CA  1 
ATOM 5330 C C   . UNK B 2 154 ? 88.901  143.612 117.262 1.00 151.51 ?  270 UNK B C   1 
ATOM 5331 O O   . UNK B 2 154 ? 87.730  143.911 117.040 1.00 152.91 ?  270 UNK B O   1 
ATOM 5332 C CB  . UNK B 2 154 ? 89.412  143.643 119.713 1.00 20.00  ?  270 UNK B CB  1 
ATOM 5333 N N   . UNK B 2 155 ? 89.906  143.984 116.478 1.00 151.01 ?  271 UNK B N   1 
ATOM 5334 C CA  . UNK B 2 155 ? 89.693  144.770 115.271 1.00 158.96 ?  271 UNK B CA  1 
ATOM 5335 C C   . UNK B 2 155 ? 89.846  143.917 114.014 1.00 161.37 ?  271 UNK B C   1 
ATOM 5336 O O   . UNK B 2 155 ? 90.025  144.446 112.919 1.00 156.18 ?  271 UNK B O   1 
ATOM 5337 C CB  . UNK B 2 155 ? 90.655  145.947 115.235 1.00 20.00  ?  271 UNK B CB  1 
ATOM 5338 N N   . UNK B 2 156 ? 89.777  142.599 114.176 1.00 159.69 ?  272 UNK B N   1 
ATOM 5339 C CA  . UNK B 2 156 ? 90.037  141.671 113.075 1.00 167.02 ?  272 UNK B CA  1 
ATOM 5340 C C   . UNK B 2 156 ? 89.047  141.810 111.918 1.00 174.16 ?  272 UNK B C   1 
ATOM 5341 O O   . UNK B 2 156 ? 89.374  141.496 110.774 1.00 180.87 ?  272 UNK B O   1 
ATOM 5342 C CB  . UNK B 2 156 ? 90.036  140.239 113.587 1.00 20.00  ?  272 UNK B CB  1 
ATOM 5343 N N   . UNK B 2 157 ? 87.838  142.271 112.215 1.00 163.08 ?  273 UNK B N   1 
ATOM 5344 C CA  . UNK B 2 157 ? 86.831  142.461 111.179 1.00 168.41 ?  273 UNK B CA  1 
ATOM 5345 C C   . UNK B 2 157 ? 85.813  143.514 111.599 1.00 167.06 ?  273 UNK B C   1 
ATOM 5346 O O   . UNK B 2 157 ? 86.108  144.385 112.418 1.00 171.70 ?  273 UNK B O   1 
ATOM 5347 C CB  . UNK B 2 157 ? 86.137  141.145 110.863 1.00 20.00  ?  273 UNK B CB  1 
ATOM 5348 N N   . UNK B 2 158 ? 113.588 148.657 123.914 1.00 138.76 ?  381 UNK B N   1 
ATOM 5349 C CA  . UNK B 2 158 ? 112.232 148.139 124.046 1.00 142.34 ?  381 UNK B CA  1 
ATOM 5350 C C   . UNK B 2 158 ? 112.196 146.628 123.828 1.00 130.12 ?  381 UNK B C   1 
ATOM 5351 O O   . UNK B 2 158 ? 112.207 145.852 124.783 1.00 119.31 ?  381 UNK B O   1 
ATOM 5352 C CB  . UNK B 2 158 ? 111.304 148.839 123.070 1.00 20.00  ?  381 UNK B CB  1 
ATOM 5353 N N   . UNK B 2 159 ? 112.158 146.217 122.565 1.00 129.17 ?  382 UNK B N   1 
ATOM 5354 C CA  . UNK B 2 159 ? 112.180 144.802 122.213 1.00 130.01 ?  382 UNK B CA  1 
ATOM 5355 C C   . UNK B 2 159 ? 113.509 144.187 122.626 1.00 122.63 ?  382 UNK B C   1 
ATOM 5356 O O   . UNK B 2 159 ? 113.629 142.970 122.831 1.00 125.46 ?  382 UNK B O   1 
ATOM 5357 C CB  . UNK B 2 159 ? 111.947 144.621 120.728 1.00 20.00  ?  382 UNK B CB  1 
ATOM 5358 N N   . UNK B 2 160 ? 114.504 145.054 122.765 1.00 112.93 ?  383 UNK B N   1 
ATOM 5359 C CA  . UNK B 2 160 ? 115.844 144.638 123.129 1.00 110.92 ?  383 UNK B CA  1 
ATOM 5360 C C   . UNK B 2 160 ? 115.815 143.966 124.491 1.00 111.36 ?  383 UNK B C   1 
ATOM 5361 O O   . UNK B 2 160 ? 116.706 143.197 124.827 1.00 108.02 ?  383 UNK B O   1 
ATOM 5362 C CB  . UNK B 2 160 ? 116.788 145.826 123.131 1.00 20.00  ?  383 UNK B CB  1 
ATOM 5363 N N   . UNK B 2 161 ? 114.796 144.275 125.281 1.00 114.63 ?  384 UNK B N   1 
ATOM 5364 C CA  . UNK B 2 161 ? 114.584 143.562 126.523 1.00 117.59 ?  384 UNK B CA  1 
ATOM 5365 C C   . UNK B 2 161 ? 114.274 142.101 126.243 1.00 112.00 ?  384 UNK B C   1 
ATOM 5366 O O   . UNK B 2 161 ? 114.797 141.212 126.907 1.00 111.58 ?  384 UNK B O   1 
ATOM 5367 C CB  . UNK B 2 161 ? 113.464 144.195 127.304 1.00 20.00  ?  384 UNK B CB  1 
ATOM 5368 N N   . ASP B 2 162 ? 113.427 141.846 125.254 1.00 106.37 ?  385 ASP B N   1 
ATOM 5369 C CA  . ASP B 2 162 ? 113.120 140.470 124.902 1.00 105.21 ?  385 ASP B CA  1 
ATOM 5370 C C   . ASP B 2 162 ? 114.373 139.808 124.374 1.00 106.53 ?  385 ASP B C   1 
ATOM 5371 O O   . ASP B 2 162 ? 114.636 138.628 124.632 1.00 107.23 ?  385 ASP B O   1 
ATOM 5372 C CB  . ASP B 2 162 ? 111.995 140.405 123.867 1.00 20.00  ?  385 ASP B CB  1 
ATOM 5373 C CG  . ASP B 2 162 ? 110.644 140.763 124.452 1.00 20.00  ?  385 ASP B CG  1 
ATOM 5374 O OD1 . ASP B 2 162 ? 110.519 140.783 125.694 1.00 20.00  ?  385 ASP B OD1 1 
ATOM 5375 O OD2 . ASP B 2 162 ? 109.649 141.039 123.748 1.00 20.00  ?  385 ASP B OD2 1 
ATOM 5376 N N   . UNK B 2 163 ? 115.175 140.598 123.674 1.00 105.15 ?  386 UNK B N   1 
ATOM 5377 C CA  . UNK B 2 163 ? 116.452 140.110 123.186 1.00 100.74 ?  386 UNK B CA  1 
ATOM 5378 C C   . UNK B 2 163 ? 117.365 139.790 124.362 1.00 110.64 ?  386 UNK B C   1 
ATOM 5379 O O   . UNK B 2 163 ? 118.285 138.987 124.252 1.00 111.43 ?  386 UNK B O   1 
ATOM 5380 C CB  . UNK B 2 163 ? 117.091 141.126 122.271 1.00 20.00  ?  386 UNK B CB  1 
ATOM 5381 N N   . UNK B 2 164 ? 117.113 140.444 125.489 1.00 119.15 ?  387 UNK B N   1 
ATOM 5382 C CA  . UNK B 2 164 ? 117.899 140.218 126.689 1.00 121.91 ?  387 UNK B CA  1 
ATOM 5383 C C   . UNK B 2 164 ? 117.415 138.990 127.439 1.00 114.97 ?  387 UNK B C   1 
ATOM 5384 O O   . UNK B 2 164 ? 118.172 138.375 128.175 1.00 103.96 ?  387 UNK B O   1 
ATOM 5385 C CB  . UNK B 2 164 ? 117.858 141.437 127.590 1.00 20.00  ?  387 UNK B CB  1 
ATOM 5386 N N   . UNK B 2 165 ? 116.142 138.654 127.296 1.00 123.10 ?  388 UNK B N   1 
ATOM 5387 C CA  . UNK B 2 165 ? 115.687 137.374 127.806 1.00 129.26 ?  388 UNK B CA  1 
ATOM 5388 C C   . UNK B 2 165 ? 116.352 136.298 126.977 1.00 132.67 ?  388 UNK B C   1 
ATOM 5389 O O   . UNK B 2 165 ? 116.741 135.238 127.478 1.00 132.20 ?  388 UNK B O   1 
ATOM 5390 C CB  . UNK B 2 165 ? 114.194 137.266 127.734 1.00 20.00  ?  388 UNK B CB  1 
ATOM 5391 N N   . UNK B 2 166 ? 116.518 136.605 125.697 1.00 132.41 ?  389 UNK B N   1 
ATOM 5392 C CA  . UNK B 2 166 ? 117.267 135.733 124.818 1.00 127.66 ?  389 UNK B CA  1 
ATOM 5393 C C   . UNK B 2 166 ? 118.703 135.665 125.290 1.00 119.70 ?  389 UNK B C   1 
ATOM 5394 O O   . UNK B 2 166 ? 119.383 134.653 125.135 1.00 120.50 ?  389 UNK B O   1 
ATOM 5395 C CB  . UNK B 2 166 ? 117.201 136.233 123.404 1.00 20.00  ?  389 UNK B CB  1 
ATOM 5396 N N   . UNK B 2 167 ? 119.162 136.762 125.867 1.00 114.81 ?  390 UNK B N   1 
ATOM 5397 C CA  . UNK B 2 167 ? 120.497 136.807 126.417 1.00 113.40 ?  390 UNK B CA  1 
ATOM 5398 C C   . UNK B 2 167 ? 120.626 135.914 127.644 1.00 114.42 ?  390 UNK B C   1 
ATOM 5399 O O   . UNK B 2 167 ? 121.644 135.261 127.830 1.00 117.15 ?  390 UNK B O   1 
ATOM 5400 C CB  . UNK B 2 167 ? 120.858 138.216 126.764 1.00 20.00  ?  390 UNK B CB  1 
ATOM 5401 N N   . UNK B 2 168 ? 119.604 135.909 128.494 1.00 111.28 ?  391 UNK B N   1 
ATOM 5402 C CA  . UNK B 2 168 ? 119.627 135.076 129.688 1.00 109.93 ?  391 UNK B CA  1 
ATOM 5403 C C   . UNK B 2 168 ? 119.586 133.616 129.302 1.00 118.02 ?  391 UNK B C   1 
ATOM 5404 O O   . UNK B 2 168 ? 120.186 132.776 129.960 1.00 122.31 ?  391 UNK B O   1 
ATOM 5405 C CB  . UNK B 2 168 ? 118.474 135.414 130.600 1.00 20.00  ?  391 UNK B CB  1 
ATOM 5406 N N   . UNK B 2 169 ? 118.871 133.320 128.223 1.00 116.57 ?  392 UNK B N   1 
ATOM 5407 C CA  . UNK B 2 169 ? 118.899 131.980 127.665 1.00 112.22 ?  392 UNK B CA  1 
ATOM 5408 C C   . UNK B 2 169 ? 120.280 131.685 127.106 1.00 111.00 ?  392 UNK B C   1 
ATOM 5409 O O   . UNK B 2 169 ? 120.736 130.544 127.109 1.00 116.64 ?  392 UNK B O   1 
ATOM 5410 C CB  . UNK B 2 169 ? 117.847 131.827 126.590 1.00 20.00  ?  392 UNK B CB  1 
ATOM 5411 N N   . UNK B 2 170 ? 120.945 132.729 126.628 1.00 106.16 ?  393 UNK B N   1 
ATOM 5412 C CA  . UNK B 2 170 ? 122.248 132.568 126.012 1.00 103.97 ?  393 UNK B CA  1 
ATOM 5413 C C   . UNK B 2 170 ? 123.286 132.202 127.057 1.00 98.89  ?  393 UNK B C   1 
ATOM 5414 O O   . UNK B 2 170 ? 124.043 131.251 126.891 1.00 107.99 ?  393 UNK B O   1 
ATOM 5415 C CB  . UNK B 2 170 ? 122.647 133.841 125.282 1.00 20.00  ?  393 UNK B CB  1 
ATOM 5416 N N   . UNK B 2 171 ? 123.311 132.970 128.137 1.00 1.00   ?  394 UNK B N   1 
ATOM 5417 C CA  . UNK B 2 171 ? 124.223 132.714 129.235 1.00 1.00   ?  394 UNK B CA  1 
ATOM 5418 C C   . UNK B 2 171 ? 123.860 131.415 129.925 1.00 1.00   ?  394 UNK B C   1 
ATOM 5419 O O   . UNK B 2 171 ? 124.727 130.697 130.421 1.00 1.00   ?  394 UNK B O   1 
ATOM 5420 C CB  . UNK B 2 171 ? 124.198 133.862 130.222 1.00 20.00  ?  394 UNK B CB  1 
ATOM 5421 N N   . UNK B 2 172 ? 122.568 131.115 129.952 1.00 1.00   ?  395 UNK B N   1 
ATOM 5422 C CA  . UNK B 2 172 ? 122.116 129.873 130.545 1.00 1.00   ?  395 UNK B CA  1 
ATOM 5423 C C   . UNK B 2 172 ? 122.655 128.730 129.719 1.00 1.00   ?  395 UNK B C   1 
ATOM 5424 O O   . UNK B 2 172 ? 122.962 127.660 130.241 1.00 1.00   ?  395 UNK B O   1 
ATOM 5425 C CB  . UNK B 2 172 ? 120.608 129.820 130.617 1.00 20.00  ?  395 UNK B CB  1 
ATOM 5426 N N   . UNK B 2 173 ? 122.777 128.967 128.419 1.00 1.00   ?  396 UNK B N   1 
ATOM 5427 C CA  . UNK B 2 173 ? 123.396 127.988 127.552 1.00 1.00   ?  396 UNK B CA  1 
ATOM 5428 C C   . UNK B 2 173 ? 124.871 127.893 127.902 1.00 1.00   ?  396 UNK B C   1 
ATOM 5429 O O   . UNK B 2 173 ? 125.419 126.803 128.049 1.00 1.00   ?  396 UNK B O   1 
ATOM 5430 C CB  . UNK B 2 173 ? 123.204 128.363 126.091 1.00 20.00  ?  396 UNK B CB  1 
ATOM 5431 N N   . UNK B 2 174 ? 125.493 129.053 128.083 1.00 1.00   ?  397 UNK B N   1 
ATOM 5432 C CA  . UNK B 2 174 ? 126.919 129.124 128.358 1.00 1.00   ?  397 UNK B CA  1 
ATOM 5433 C C   . UNK B 2 174 ? 127.249 128.502 129.709 1.00 1.00   ?  397 UNK B C   1 
ATOM 5434 O O   . UNK B 2 174 ? 128.365 128.039 129.931 1.00 1.00   ?  397 UNK B O   1 
ATOM 5435 C CB  . UNK B 2 174 ? 127.398 130.568 128.300 1.00 20.00  ?  397 UNK B CB  1 
ATOM 5436 N N   . UNK B 2 175 ? 126.218 128.437 130.547 1.00 1.00   ?  398 UNK B N   1 
ATOM 5437 C CA  . UNK B 2 175 ? 126.312 127.962 131.916 1.00 1.00   ?  398 UNK B CA  1 
ATOM 5438 C C   . UNK B 2 175 ? 126.788 126.525 131.916 1.00 1.00   ?  398 UNK B C   1 
ATOM 5439 O O   . UNK B 2 175 ? 127.564 126.122 132.779 1.00 1.00   ?  398 UNK B O   1 
ATOM 5440 C CB  . UNK B 2 175 ? 124.963 128.074 132.607 1.00 20.00  ?  398 UNK B CB  1 
ATOM 5441 N N   . UNK B 2 176 ? 126.333 125.744 130.944 1.00 30.00  ?  399 UNK B N   1 
ATOM 5442 C CA  . UNK B 2 176 ? 126.807 124.378 130.847 1.00 30.00  ?  399 UNK B CA  1 
ATOM 5443 C C   . UNK B 2 176 ? 128.309 124.475 130.642 1.00 30.00  ?  399 UNK B C   1 
ATOM 5444 O O   . UNK B 2 176 ? 129.079 123.749 131.266 1.00 30.00  ?  399 UNK B O   1 
ATOM 5445 C CB  . UNK B 2 176 ? 126.153 123.675 129.670 1.00 20.00  ?  399 UNK B CB  1 
ATOM 5446 N N   . UNK B 2 177 ? 128.719 125.399 129.781 1.00 30.00  ?  400 UNK B N   1 
ATOM 5447 C CA  . UNK B 2 177 ? 130.122 125.758 129.650 1.00 30.00  ?  400 UNK B CA  1 
ATOM 5448 C C   . UNK B 2 177 ? 130.909 124.601 129.059 1.00 30.00  ?  400 UNK B C   1 
ATOM 5449 O O   . UNK B 2 177 ? 130.333 123.670 128.499 1.00 30.00  ?  400 UNK B O   1 
ATOM 5450 C CB  . UNK B 2 177 ? 130.695 126.160 130.998 1.00 30.00  ?  400 UNK B CB  1 
ATOM 5451 N N   . UNK B 2 178 ? 132.230 124.661 129.189 1.00 30.00  ?  401 UNK B N   1 
ATOM 5452 C CA  . UNK B 2 178 ? 133.074 123.526 128.848 1.00 30.00  ?  401 UNK B CA  1 
ATOM 5453 C C   . UNK B 2 178 ? 132.748 123.075 127.438 1.00 30.00  ?  401 UNK B C   1 
ATOM 5454 O O   . UNK B 2 178 ? 132.714 121.873 127.173 1.00 30.00  ?  401 UNK B O   1 
ATOM 5455 C CB  . UNK B 2 178 ? 132.866 122.388 129.835 1.00 30.00  ?  401 UNK B CB  1 
ATOM 5456 N N   . UNK B 2 179 ? 132.542 124.064 126.563 1.00 30.00  ?  402 UNK B N   1 
ATOM 5457 C CA  . UNK B 2 179 ? 131.969 123.959 125.210 1.00 30.00  ?  402 UNK B CA  1 
ATOM 5458 C C   . UNK B 2 179 ? 130.736 124.859 125.097 1.00 30.00  ?  402 UNK B C   1 
ATOM 5459 O O   . UNK B 2 179 ? 130.861 126.081 125.082 1.00 30.00  ?  402 UNK B O   1 
ATOM 5460 C CB  . UNK B 2 179 ? 131.643 122.528 124.791 1.00 20.00  ?  402 UNK B CB  1 
ATOM 5461 N N   . UNK B 2 180 ? 129.551 124.266 125.000 1.00 103.63 ?  403 UNK B N   1 
ATOM 5462 C CA  . UNK B 2 180 ? 128.350 125.050 124.780 1.00 112.35 ?  403 UNK B CA  1 
ATOM 5463 C C   . UNK B 2 180 ? 128.577 125.809 123.481 1.00 121.06 ?  403 UNK B C   1 
ATOM 5464 O O   . UNK B 2 180 ? 128.970 125.206 122.487 1.00 119.85 ?  403 UNK B O   1 
ATOM 5465 C CB  . UNK B 2 180 ? 128.108 125.997 125.945 1.00 20.00  ?  403 UNK B CB  1 
ATOM 5466 N N   . TRP B 2 181 ? 128.327 127.115 123.468 1.00 119.60 ?  404 TRP B N   1 
ATOM 5467 C CA  . TRP B 2 181 ? 128.603 127.896 122.275 1.00 111.88 ?  404 TRP B CA  1 
ATOM 5468 C C   . TRP B 2 181 ? 127.568 127.467 121.254 1.00 108.47 ?  404 TRP B C   1 
ATOM 5469 O O   . TRP B 2 181 ? 126.796 128.274 120.734 1.00 115.50 ?  404 TRP B O   1 
ATOM 5470 C CB  . TRP B 2 181 ? 130.007 127.590 121.751 1.00 20.00  ?  404 TRP B CB  1 
ATOM 5471 C CG  . TRP B 2 181 ? 130.947 128.760 121.697 1.00 20.00  ?  404 TRP B CG  1 
ATOM 5472 C CD1 . TRP B 2 181 ? 132.250 128.778 122.099 1.00 20.00  ?  404 TRP B CD1 1 
ATOM 5473 C CD2 . TRP B 2 181 ? 130.667 130.071 121.195 1.00 20.00  ?  404 TRP B CD2 1 
ATOM 5474 N NE1 . TRP B 2 181 ? 132.796 130.018 121.886 1.00 20.00  ?  404 TRP B NE1 1 
ATOM 5475 C CE2 . TRP B 2 181 ? 131.843 130.831 121.332 1.00 20.00  ?  404 TRP B CE2 1 
ATOM 5476 C CE3 . TRP B 2 181 ? 129.534 130.676 120.646 1.00 20.00  ?  404 TRP B CE3 1 
ATOM 5477 C CZ2 . TRP B 2 181 ? 131.919 132.163 120.941 1.00 20.00  ?  404 TRP B CZ2 1 
ATOM 5478 C CZ3 . TRP B 2 181 ? 129.612 132.000 120.258 1.00 20.00  ?  404 TRP B CZ3 1 
ATOM 5479 C CH2 . TRP B 2 181 ? 130.795 132.729 120.408 1.00 20.00  ?  404 TRP B CH2 1 
ATOM 5480 N N   . ASN B 2 182 ? 127.564 126.166 120.985 1.00 104.56 ?  405 ASN B N   1 
ATOM 5481 C CA  . ASN B 2 182 ? 126.662 125.571 120.008 1.00 103.65 ?  405 ASN B CA  1 
ATOM 5482 C C   . ASN B 2 182 ? 125.226 125.911 120.327 1.00 119.93 ?  405 ASN B C   1 
ATOM 5483 O O   . ASN B 2 182 ? 124.460 126.381 119.475 1.00 108.34 ?  405 ASN B O   1 
ATOM 5484 C CB  . ASN B 2 182 ? 126.833 124.060 119.981 1.00 20.00  ?  405 ASN B CB  1 
ATOM 5485 C CG  . ASN B 2 182 ? 128.185 123.645 119.464 1.00 20.00  ?  405 ASN B CG  1 
ATOM 5486 O OD1 . ASN B 2 182 ? 128.443 123.691 118.264 1.00 20.00  ?  405 ASN B OD1 1 
ATOM 5487 N ND2 . ASN B 2 182 ? 129.062 123.237 120.368 1.00 20.00  ?  405 ASN B ND2 1 
ATOM 5488 N N   . THR B 2 183 ? 124.884 125.718 121.588 1.00 131.18 ?  406 THR B N   1 
ATOM 5489 C CA  . THR B 2 183 ? 123.532 125.948 122.029 1.00 134.46 ?  406 THR B CA  1 
ATOM 5490 C C   . THR B 2 183 ? 123.142 127.412 121.921 1.00 133.90 ?  406 THR B C   1 
ATOM 5491 O O   . THR B 2 183 ? 122.053 127.735 121.436 1.00 137.98 ?  406 THR B O   1 
ATOM 5492 C CB  . THR B 2 183 ? 123.352 125.483 123.467 1.00 20.00  ?  406 THR B CB  1 
ATOM 5493 O OG1 . THR B 2 183 ? 123.671 124.090 123.548 1.00 20.00  ?  406 THR B OG1 1 
ATOM 5494 C CG2 . THR B 2 183 ? 121.920 125.686 123.911 1.00 20.00  ?  406 THR B CG2 1 
ATOM 5495 N N   . THR B 2 184 ? 124.029 128.305 122.344 1.00 129.31 ?  407 THR B N   1 
ATOM 5496 C CA  . THR B 2 184 ? 123.677 129.714 122.319 1.00 123.81 ?  407 THR B CA  1 
ATOM 5497 C C   . THR B 2 184 ? 123.489 130.190 120.877 1.00 124.60 ?  407 THR B C   1 
ATOM 5498 O O   . THR B 2 184 ? 122.626 131.027 120.597 1.00 123.70 ?  407 THR B O   1 
ATOM 5499 C CB  . THR B 2 184 ? 124.722 130.585 123.038 1.00 122.63 ?  407 THR B CB  1 
ATOM 5500 O OG1 . THR B 2 184 ? 124.202 131.908 123.198 1.00 122.34 ?  407 THR B OG1 1 
ATOM 5501 C CG2 . THR B 2 184 ? 126.007 130.667 122.261 1.00 124.16 ?  407 THR B CG2 1 
ATOM 5502 N N   . ILE B 2 185 ? 124.255 129.615 119.958 1.00 128.38 ?  408 ILE B N   1 
ATOM 5503 C CA  . ILE B 2 185 ? 124.106 129.940 118.551 1.00 129.70 ?  408 ILE B CA  1 
ATOM 5504 C C   . ILE B 2 185 ? 122.757 129.471 118.069 1.00 132.55 ?  408 ILE B C   1 
ATOM 5505 O O   . ILE B 2 185 ? 122.053 130.173 117.327 1.00 131.75 ?  408 ILE B O   1 
ATOM 5506 C CB  . ILE B 2 185 ? 125.195 129.284 117.713 1.00 20.00  ?  408 ILE B CB  1 
ATOM 5507 C CG1 . ILE B 2 185 ? 126.548 129.888 118.065 1.00 20.00  ?  408 ILE B CG1 1 
ATOM 5508 C CG2 . ILE B 2 185 ? 124.902 129.447 116.240 1.00 20.00  ?  408 ILE B CG2 1 
ATOM 5509 C CD1 . ILE B 2 185 ? 127.700 129.138 117.482 1.00 20.00  ?  408 ILE B CD1 1 
ATOM 5510 N N   . ALA B 2 186 ? 122.381 128.292 118.544 1.00 134.89 ?  409 ALA B N   1 
ATOM 5511 C CA  . ALA B 2 186 ? 121.113 127.726 118.148 1.00 135.42 ?  409 ALA B CA  1 
ATOM 5512 C C   . ALA B 2 186 ? 119.986 128.651 118.563 1.00 135.11 ?  409 ALA B C   1 
ATOM 5513 O O   . ALA B 2 186 ? 119.161 129.032 117.734 1.00 135.62 ?  409 ALA B O   1 
ATOM 5514 C CB  . ALA B 2 186 ? 120.929 126.356 118.756 1.00 135.42 ?  409 ALA B CB  1 
ATOM 5515 N N   . CYS B 2 187 ? 119.978 129.055 119.828 1.00 132.59 ?  410 CYS B N   1 
ATOM 5516 C CA  . CYS B 2 187 ? 118.890 129.892 120.320 1.00 124.99 ?  410 CYS B CA  1 
ATOM 5517 C C   . CYS B 2 187 ? 118.884 131.217 119.581 1.00 127.62 ?  410 CYS B C   1 
ATOM 5518 O O   . CYS B 2 187 ? 117.828 131.787 119.268 1.00 135.29 ?  410 CYS B O   1 
ATOM 5519 C CB  . CYS B 2 187 ? 119.032 130.119 121.820 1.00 20.00  ?  410 CYS B CB  1 
ATOM 5520 S SG  . CYS B 2 187 ? 118.918 128.600 122.787 1.00 20.00  ?  410 CYS B SG  1 
ATOM 5521 N N   . PHE B 2 188 ? 120.086 131.668 119.263 1.00 123.74 ?  411 PHE B N   1 
ATOM 5522 C CA  . PHE B 2 188 ? 120.279 132.894 118.520 1.00 123.91 ?  411 PHE B CA  1 
ATOM 5523 C C   . PHE B 2 188 ? 119.537 132.897 117.191 1.00 124.46 ?  411 PHE B C   1 
ATOM 5524 O O   . PHE B 2 188 ? 118.539 133.627 117.007 1.00 131.23 ?  411 PHE B O   1 
ATOM 5525 C CB  . PHE B 2 188 ? 121.772 133.101 118.315 1.00 20.00  ?  411 PHE B CB  1 
ATOM 5526 C CG  . PHE B 2 188 ? 122.103 134.131 117.307 1.00 20.00  ?  411 PHE B CG  1 
ATOM 5527 C CD1 . PHE B 2 188 ? 121.942 135.468 117.585 1.00 20.00  ?  411 PHE B CD1 1 
ATOM 5528 C CD2 . PHE B 2 188 ? 122.624 133.760 116.087 1.00 20.00  ?  411 PHE B CD2 1 
ATOM 5529 C CE1 . PHE B 2 188 ? 122.262 136.415 116.648 1.00 20.00  ?  411 PHE B CE1 1 
ATOM 5530 C CE2 . PHE B 2 188 ? 122.949 134.698 115.148 1.00 20.00  ?  411 PHE B CE2 1 
ATOM 5531 C CZ  . PHE B 2 188 ? 122.770 136.030 115.427 1.00 20.00  ?  411 PHE B CZ  1 
ATOM 5532 N N   . VAL B 2 189 ? 119.992 132.052 116.274 1.00 120.45 ?  412 VAL B N   1 
ATOM 5533 C CA  . VAL B 2 189 ? 119.375 132.035 114.960 1.00 126.25 ?  412 VAL B CA  1 
ATOM 5534 C C   . VAL B 2 189 ? 117.917 131.654 115.081 1.00 129.84 ?  412 VAL B C   1 
ATOM 5535 O O   . VAL B 2 189 ? 117.101 132.074 114.272 1.00 136.10 ?  412 VAL B O   1 
ATOM 5536 C CB  . VAL B 2 189 ? 120.072 131.069 113.994 1.00 132.66 ?  412 VAL B CB  1 
ATOM 5537 C CG1 . VAL B 2 189 ? 121.477 131.546 113.696 1.00 137.76 ?  412 VAL B CG1 1 
ATOM 5538 C CG2 . VAL B 2 189 ? 120.089 129.669 114.564 1.00 132.85 ?  412 VAL B CG2 1 
ATOM 5539 N N   . ALA B 2 190 ? 117.586 130.880 116.107 1.00 124.77 ?  413 ALA B N   1 
ATOM 5540 C CA  . ALA B 2 190 ? 116.210 130.463 116.286 1.00 122.41 ?  413 ALA B CA  1 
ATOM 5541 C C   . ALA B 2 190 ? 115.313 131.670 116.452 1.00 114.45 ?  413 ALA B C   1 
ATOM 5542 O O   . ALA B 2 190 ? 114.349 131.846 115.706 1.00 111.77 ?  413 ALA B O   1 
ATOM 5543 C CB  . ALA B 2 190 ? 116.081 129.557 117.477 1.00 122.41 ?  413 ALA B CB  1 
ATOM 5544 N N   . ILE B 2 191 ? 115.647 132.522 117.410 1.00 107.93 ?  414 ILE B N   1 
ATOM 5545 C CA  . ILE B 2 191 ? 114.791 133.667 117.671 1.00 105.95 ?  414 ILE B CA  1 
ATOM 5546 C C   . ILE B 2 191 ? 114.793 134.648 116.509 1.00 109.43 ?  414 ILE B C   1 
ATOM 5547 O O   . ILE B 2 191 ? 113.727 135.145 116.088 1.00 117.80 ?  414 ILE B O   1 
ATOM 5548 C CB  . ILE B 2 191 ? 115.214 134.378 118.950 1.00 20.00  ?  414 ILE B CB  1 
ATOM 5549 C CG1 . ILE B 2 191 ? 114.936 133.465 120.138 1.00 20.00  ?  414 ILE B CG1 1 
ATOM 5550 C CG2 . ILE B 2 191 ? 114.472 135.686 119.111 1.00 20.00  ?  414 ILE B CG2 1 
ATOM 5551 C CD1 . ILE B 2 191 ? 115.494 133.964 121.424 1.00 20.00  ?  414 ILE B CD1 1 
ATOM 5552 N N   . LEU B 2 192 ? 115.976 134.890 115.952 1.00 106.98 ?  415 LEU B N   1 
ATOM 5553 C CA  . LEU B 2 192 ? 116.046 135.867 114.876 1.00 116.52 ?  415 LEU B CA  1 
ATOM 5554 C C   . LEU B 2 192 ? 115.204 135.415 113.694 1.00 120.30 ?  415 LEU B C   1 
ATOM 5555 O O   . LEU B 2 192 ? 114.533 136.220 113.047 1.00 127.07 ?  415 LEU B O   1 
ATOM 5556 C CB  . LEU B 2 192 ? 117.490 136.093 114.447 1.00 128.40 ?  415 LEU B CB  1 
ATOM 5557 C CG  . LEU B 2 192 ? 118.271 137.141 115.242 1.00 136.75 ?  415 LEU B CG  1 
ATOM 5558 C CD1 . LEU B 2 192 ? 118.470 136.733 116.694 1.00 139.82 ?  415 LEU B CD1 1 
ATOM 5559 C CD2 . LEU B 2 192 ? 119.608 137.409 114.574 1.00 138.71 ?  415 LEU B CD2 1 
ATOM 5560 N N   . ILE B 2 193 ? 115.207 134.113 113.442 1.00 117.34 ?  416 ILE B N   1 
ATOM 5561 C CA  . ILE B 2 193 ? 114.368 133.551 112.398 1.00 120.97 ?  416 ILE B CA  1 
ATOM 5562 C C   . ILE B 2 193 ? 112.897 133.588 112.798 1.00 130.78 ?  416 ILE B C   1 
ATOM 5563 O O   . ILE B 2 193 ? 112.022 133.680 111.940 1.00 135.49 ?  416 ILE B O   1 
ATOM 5564 C CB  . ILE B 2 193 ? 114.814 132.118 112.042 1.00 20.00  ?  416 ILE B CB  1 
ATOM 5565 C CG1 . ILE B 2 193 ? 116.151 132.176 111.307 1.00 20.00  ?  416 ILE B CG1 1 
ATOM 5566 C CG2 . ILE B 2 193 ? 113.798 131.406 111.171 1.00 20.00  ?  416 ILE B CG2 1 
ATOM 5567 C CD1 . ILE B 2 193 ? 116.799 130.840 111.104 1.00 20.00  ?  416 ILE B CD1 1 
ATOM 5568 N N   . GLY B 2 194 ? 112.615 133.564 114.095 1.00 134.37 ?  417 GLY B N   1 
ATOM 5569 C CA  . GLY B 2 194 ? 111.234 133.672 114.523 1.00 133.45 ?  417 GLY B CA  1 
ATOM 5570 C C   . GLY B 2 194 ? 110.702 135.006 114.040 1.00 129.73 ?  417 GLY B C   1 
ATOM 5571 O O   . GLY B 2 194 ? 109.653 135.095 113.380 1.00 124.97 ?  417 GLY B O   1 
ATOM 5572 N N   . LEU B 2 195 ? 111.469 136.052 114.304 1.00 128.39 ?  418 LEU B N   1 
ATOM 5573 C CA  . LEU B 2 195 ? 111.055 137.367 113.848 1.00 122.63 ?  418 LEU B CA  1 
ATOM 5574 C C   . LEU B 2 195 ? 111.017 137.457 112.318 1.00 127.91 ?  418 LEU B C   1 
ATOM 5575 O O   . LEU B 2 195 ? 110.025 137.888 111.729 1.00 135.79 ?  418 LEU B O   1 
ATOM 5576 C CB  . LEU B 2 195 ? 111.991 138.424 114.424 1.00 116.96 ?  418 LEU B CB  1 
ATOM 5577 C CG  . LEU B 2 195 ? 111.652 139.897 114.223 1.00 114.37 ?  418 LEU B CG  1 
ATOM 5578 C CD1 . LEU B 2 195 ? 112.130 140.680 115.423 1.00 112.04 ?  418 LEU B CD1 1 
ATOM 5579 C CD2 . LEU B 2 195 ? 112.308 140.430 112.967 1.00 114.69 ?  418 LEU B CD2 1 
ATOM 5580 N N   . CYS B 2 196 ? 112.079 137.020 111.657 1.00 125.33 ?  419 CYS B N   1 
ATOM 5581 C CA  . CYS B 2 196 ? 112.130 137.207 110.214 1.00 125.82 ?  419 CYS B CA  1 
ATOM 5582 C C   . CYS B 2 196 ? 110.979 136.489 109.529 1.00 126.84 ?  419 CYS B C   1 
ATOM 5583 O O   . CYS B 2 196 ? 110.457 136.949 108.517 1.00 130.59 ?  419 CYS B O   1 
ATOM 5584 C CB  . CYS B 2 196 ? 113.459 136.717 109.653 1.00 20.00  ?  419 CYS B CB  1 
ATOM 5585 S SG  . CYS B 2 196 ? 114.869 137.681 110.209 1.00 20.00  ?  419 CYS B SG  1 
ATOM 5586 N N   . LEU B 2 197 ? 110.570 135.363 110.090 1.00 123.86 ?  420 LEU B N   1 
ATOM 5587 C CA  . LEU B 2 197 ? 109.395 134.692 109.574 1.00 125.80 ?  420 LEU B CA  1 
ATOM 5588 C C   . LEU B 2 197 ? 108.121 135.431 109.950 1.00 133.45 ?  420 LEU B C   1 
ATOM 5589 O O   . LEU B 2 197 ? 107.123 135.306 109.244 1.00 137.43 ?  420 LEU B O   1 
ATOM 5590 C CB  . LEU B 2 197 ? 109.333 133.243 110.050 1.00 20.00  ?  420 LEU B CB  1 
ATOM 5591 C CG  . LEU B 2 197 ? 110.438 132.347 109.485 1.00 20.00  ?  420 LEU B CG  1 
ATOM 5592 C CD1 . LEU B 2 197 ? 110.330 130.944 110.057 1.00 20.00  ?  420 LEU B CD1 1 
ATOM 5593 C CD2 . LEU B 2 197 ? 110.401 132.323 107.965 1.00 20.00  ?  420 LEU B CD2 1 
ATOM 5594 N N   . THR B 2 198 ? 108.126 136.209 111.035 1.00 132.73 ?  421 THR B N   1 
ATOM 5595 C CA  . THR B 2 198 ? 106.920 137.004 111.279 1.00 129.73 ?  421 THR B CA  1 
ATOM 5596 C C   . THR B 2 198 ? 106.855 138.048 110.181 1.00 134.12 ?  421 THR B C   1 
ATOM 5597 O O   . THR B 2 198 ? 105.793 138.607 109.917 1.00 141.74 ?  421 THR B O   1 
ATOM 5598 C CB  . THR B 2 198 ? 106.847 137.700 112.663 1.00 20.00  ?  421 THR B CB  1 
ATOM 5599 O OG1 . THR B 2 198 ? 105.480 138.025 112.939 1.00 20.00  ?  421 THR B OG1 1 
ATOM 5600 C CG2 . THR B 2 198 ? 107.595 139.008 112.671 1.00 20.00  ?  421 THR B CG2 1 
ATOM 5601 N N   . LEU B 2 199 ? 107.990 138.325 109.545 1.00 133.59 ?  422 LEU B N   1 
ATOM 5602 C CA  . LEU B 2 199 ? 107.930 139.091 108.302 1.00 137.27 ?  422 LEU B CA  1 
ATOM 5603 C C   . LEU B 2 199 ? 107.460 138.282 107.104 1.00 141.33 ?  422 LEU B C   1 
ATOM 5604 O O   . LEU B 2 199 ? 106.617 138.732 106.338 1.00 141.37 ?  422 LEU B O   1 
ATOM 5605 C CB  . LEU B 2 199 ? 109.281 139.702 107.961 1.00 140.30 ?  422 LEU B CB  1 
ATOM 5606 C CG  . LEU B 2 199 ? 109.732 140.853 108.836 1.00 141.84 ?  422 LEU B CG  1 
ATOM 5607 C CD1 . LEU B 2 199 ? 111.096 141.318 108.375 1.00 140.99 ?  422 LEU B CD1 1 
ATOM 5608 C CD2 . LEU B 2 199 ? 108.714 141.961 108.726 1.00 142.25 ?  422 LEU B CD2 1 
ATOM 5609 N N   . LEU B 2 200 ? 108.029 137.104 106.908 1.00 145.62 ?  423 LEU B N   1 
ATOM 5610 C CA  . LEU B 2 200 ? 107.676 136.341 105.721 1.00 154.68 ?  423 LEU B CA  1 
ATOM 5611 C C   . LEU B 2 200 ? 106.246 135.827 105.775 1.00 152.39 ?  423 LEU B C   1 
ATOM 5612 O O   . LEU B 2 200 ? 105.600 135.657 104.746 1.00 153.51 ?  423 LEU B O   1 
ATOM 5613 C CB  . LEU B 2 200 ? 108.652 135.195 105.526 1.00 20.00  ?  423 LEU B CB  1 
ATOM 5614 C CG  . LEU B 2 200 ? 110.040 135.768 105.266 1.00 20.00  ?  423 LEU B CG  1 
ATOM 5615 C CD1 . LEU B 2 200 ? 111.065 134.665 105.095 1.00 20.00  ?  423 LEU B CD1 1 
ATOM 5616 C CD2 . LEU B 2 200 ? 110.010 136.696 104.062 1.00 20.00  ?  423 LEU B CD2 1 
ATOM 5617 N N   . UNK B 2 201 ? 105.750 135.577 106.977 1.00 150.48 ?  424 UNK B N   1 
ATOM 5618 C CA  . UNK B 2 201 ? 104.340 135.274 107.128 1.00 151.46 ?  424 UNK B CA  1 
ATOM 5619 C C   . UNK B 2 201 ? 103.546 136.517 106.783 1.00 147.34 ?  424 UNK B C   1 
ATOM 5620 O O   . UNK B 2 201 ? 102.415 136.438 106.309 1.00 145.27 ?  424 UNK B O   1 
ATOM 5621 C CB  . UNK B 2 201 ? 104.032 134.808 108.529 1.00 20.00  ?  424 UNK B CB  1 
ATOM 5622 N N   . UNK B 2 202 ? 104.152 137.672 107.028 1.00 146.05 ?  425 UNK B N   1 
ATOM 5623 C CA  . UNK B 2 202 ? 103.523 138.935 106.690 1.00 147.75 ?  425 UNK B CA  1 
ATOM 5624 C C   . UNK B 2 202 ? 103.628 139.195 105.195 1.00 152.36 ?  425 UNK B C   1 
ATOM 5625 O O   . UNK B 2 202 ? 102.921 140.048 104.664 1.00 153.60 ?  425 UNK B O   1 
ATOM 5626 C CB  . UNK B 2 202 ? 104.145 140.073 107.476 1.00 20.00  ?  425 UNK B CB  1 
ATOM 5627 N N   . UNK B 2 203 ? 104.516 138.477 104.515 1.00 158.60 ?  426 UNK B N   1 
ATOM 5628 C CA  . UNK B 2 203 ? 104.540 138.533 103.058 1.00 169.74 ?  426 UNK B CA  1 
ATOM 5629 C C   . UNK B 2 203 ? 103.236 137.951 102.525 1.00 170.93 ?  426 UNK B C   1 
ATOM 5630 O O   . UNK B 2 203 ? 102.720 138.386 101.498 1.00 170.30 ?  426 UNK B O   1 
ATOM 5631 C CB  . UNK B 2 203 ? 105.735 137.792 102.503 1.00 20.00  ?  426 UNK B CB  1 
ATOM 5632 N N   . UNK B 2 204 ? 102.715 136.957 103.238 1.00 171.96 ?  427 UNK B N   1 
ATOM 5633 C CA  . UNK B 2 204 ? 101.335 136.523 103.077 1.00 176.23 ?  427 UNK B CA  1 
ATOM 5634 C C   . UNK B 2 204 ? 100.436 137.529 103.782 1.00 178.84 ?  427 UNK B C   1 
ATOM 5635 O O   . UNK B 2 204 ? 100.884 138.243 104.673 1.00 174.57 ?  427 UNK B O   1 
ATOM 5636 C CB  . UNK B 2 204 ? 101.130 135.124 103.631 1.00 20.00  ?  427 UNK B CB  1 
ATOM 5637 N N   . UNK B 2 205 ? 99.174  137.596 103.380 1.00 185.39 ?  428 UNK B N   1 
ATOM 5638 C CA  . UNK B 2 205 ? 98.244  138.565 103.952 1.00 188.06 ?  428 UNK B CA  1 
ATOM 5639 C C   . UNK B 2 205 ? 98.036  138.394 105.458 1.00 183.50 ?  428 UNK B C   1 
ATOM 5640 O O   . UNK B 2 205 ? 98.686  137.569 106.102 1.00 182.35 ?  428 UNK B O   1 
ATOM 5641 C CB  . UNK B 2 205 ? 96.907  138.482 103.238 1.00 20.00  ?  428 UNK B CB  1 
ATOM 5642 N N   . UNK B 2 206 ? 97.121  139.195 105.999 1.00 182.06 ?  429 UNK B N   1 
ATOM 5643 C CA  . UNK B 2 206 ? 96.790  139.189 107.421 1.00 180.20 ?  429 UNK B CA  1 
ATOM 5644 C C   . UNK B 2 206 ? 98.010  139.495 108.277 1.00 166.40 ?  429 UNK B C   1 
ATOM 5645 O O   . UNK B 2 206 ? 99.011  140.005 107.780 1.00 159.26 ?  429 UNK B O   1 
ATOM 5646 C CB  . UNK B 2 206 ? 96.180  137.856 107.824 1.00 20.00  ?  429 UNK B CB  1 
ATOM 5647 N N   . UNK B 2 207 ? 99.733  138.717 110.773 1.00 30.00  ?  431 UNK B N   1 
ATOM 5648 C CA  . UNK B 2 207 ? 100.939 139.476 111.071 1.00 30.00  ?  431 UNK B CA  1 
ATOM 5649 C C   . UNK B 2 207 ? 100.675 140.526 112.142 1.00 30.00  ?  431 UNK B C   1 
ATOM 5650 O O   . UNK B 2 207 ? 100.240 141.637 111.842 1.00 30.00  ?  431 UNK B O   1 
ATOM 5651 C CB  . UNK B 2 207 ? 101.474 140.128 109.816 1.00 20.00  ?  431 UNK B CB  1 
ATOM 5652 N N   . UNK B 2 208 ? 100.942 140.162 113.392 1.00 30.00  ?  432 UNK B N   1 
ATOM 5653 C CA  . UNK B 2 208 ? 100.788 141.075 114.518 1.00 30.00  ?  432 UNK B CA  1 
ATOM 5654 C C   . UNK B 2 208 ? 101.719 140.666 115.653 1.00 30.00  ?  432 UNK B C   1 
ATOM 5655 O O   . UNK B 2 208 ? 102.695 141.353 115.950 1.00 30.00  ?  432 UNK B O   1 
ATOM 5656 C CB  . UNK B 2 208 ? 99.347  141.100 114.993 1.00 20.00  ?  432 UNK B CB  1 
ATOM 5657 N N   . UNK B 2 209 ? 101.410 139.538 116.281 1.00 164.92 ?  433 UNK B N   1 
ATOM 5658 C CA  . UNK B 2 209 ? 102.262 138.978 117.322 1.00 154.34 ?  433 UNK B CA  1 
ATOM 5659 C C   . UNK B 2 209 ? 103.577 138.524 116.713 1.00 146.61 ?  433 UNK B C   1 
ATOM 5660 O O   . UNK B 2 209 ? 103.635 138.203 115.529 1.00 141.57 ?  433 UNK B O   1 
ATOM 5661 C CB  . UNK B 2 209 ? 101.570 137.825 118.016 1.00 20.00  ?  433 UNK B CB  1 
ATOM 5662 N N   . UNK B 2 210 ? 104.637 138.512 117.511 1.00 146.00 ?  434 UNK B N   1 
ATOM 5663 C CA  . UNK B 2 210 ? 105.937 138.111 116.993 1.00 137.06 ?  434 UNK B CA  1 
ATOM 5664 C C   . UNK B 2 210 ? 106.757 137.312 117.997 1.00 128.07 ?  434 UNK B C   1 
ATOM 5665 O O   . UNK B 2 210 ? 107.169 136.187 117.717 1.00 122.23 ?  434 UNK B O   1 
ATOM 5666 C CB  . UNK B 2 210 ? 106.712 139.334 116.544 1.00 20.00  ?  434 UNK B CB  1 
ATOM 5667 N N   . UNK B 2 211 ? 106.984 137.898 119.166 1.00 126.34 ?  435 UNK B N   1 
ATOM 5668 C CA  . UNK B 2 211 ? 107.903 137.330 120.140 1.00 131.63 ?  435 UNK B CA  1 
ATOM 5669 C C   . UNK B 2 211 ? 107.465 135.951 120.600 1.00 136.23 ?  435 UNK B C   1 
ATOM 5670 O O   . UNK B 2 211 ? 108.295 135.104 120.927 1.00 137.71 ?  435 UNK B O   1 
ATOM 5671 C CB  . UNK B 2 211 ? 108.036 138.256 121.331 1.00 20.00  ?  435 UNK B CB  1 
ATOM 5672 N N   . UNK B 2 212 ? 106.158 135.727 120.612 1.00 132.74 ?  436 UNK B N   1 
ATOM 5673 C CA  . UNK B 2 212 ? 105.616 134.468 121.101 1.00 123.79 ?  436 UNK B CA  1 
ATOM 5674 C C   . UNK B 2 212 ? 106.067 133.276 120.259 1.00 126.09 ?  436 UNK B C   1 
ATOM 5675 O O   . UNK B 2 212 ? 106.255 132.180 120.784 1.00 125.79 ?  436 UNK B O   1 
ATOM 5676 C CB  . UNK B 2 212 ? 104.104 134.534 121.145 1.00 20.00  ?  436 UNK B CB  1 
ATOM 5677 N N   . UNK B 2 213 ? 106.250 133.488 118.959 1.00 131.29 ?  437 UNK B N   1 
ATOM 5678 C CA  . UNK B 2 213 ? 106.681 132.409 118.081 1.00 134.43 ?  437 UNK B CA  1 
ATOM 5679 C C   . UNK B 2 213 ? 108.129 132.038 118.360 1.00 130.00 ?  437 UNK B C   1 
ATOM 5680 O O   . UNK B 2 213 ? 108.464 130.868 118.589 1.00 127.56 ?  437 UNK B O   1 
ATOM 5681 C CB  . UNK B 2 213 ? 106.509 132.811 116.630 1.00 20.00  ?  437 UNK B CB  1 
ATOM 5682 N N   . UNK B 2 214 ? 108.978 133.059 118.371 1.00 129.19 ?  438 UNK B N   1 
ATOM 5683 C CA  . UNK B 2 214 ? 110.405 132.862 118.549 1.00 130.85 ?  438 UNK B CA  1 
ATOM 5684 C C   . UNK B 2 214 ? 110.698 132.298 119.923 1.00 130.19 ?  438 UNK B C   1 
ATOM 5685 O O   . UNK B 2 214 ? 111.656 131.557 120.102 1.00 131.14 ?  438 UNK B O   1 
ATOM 5686 C CB  . UNK B 2 214 ? 111.149 134.166 118.341 1.00 20.00  ?  438 UNK B CB  1 
ATOM 5687 N N   . UNK B 2 215 ? 109.867 132.650 120.895 1.00 125.25 ?  439 UNK B N   1 
ATOM 5688 C CA  . UNK B 2 215 ? 110.042 132.109 122.228 1.00 115.74 ?  439 UNK B CA  1 
ATOM 5689 C C   . UNK B 2 215 ? 109.665 130.641 122.231 1.00 100.99 ?  439 UNK B C   1 
ATOM 5690 O O   . UNK B 2 215 ? 110.408 129.791 122.739 1.00 99.08  ?  439 UNK B O   1 
ATOM 5691 C CB  . UNK B 2 215 ? 109.209 132.875 123.228 1.00 20.00  ?  439 UNK B CB  1 
ATOM 5692 N N   . UNK B 2 216 ? 108.520 130.350 121.626 1.00 92.83  ?  440 UNK B N   1 
ATOM 5693 C CA  . UNK B 2 216 ? 107.967 129.008 121.659 1.00 97.84  ?  440 UNK B CA  1 
ATOM 5694 C C   . UNK B 2 216 ? 108.899 128.032 120.973 1.00 105.22 ?  440 UNK B C   1 
ATOM 5695 O O   . UNK B 2 216 ? 109.012 126.878 121.377 1.00 114.77 ?  440 UNK B O   1 
ATOM 5696 C CB  . UNK B 2 216 ? 106.595 128.981 121.008 1.00 20.00  ?  440 UNK B CB  1 
ATOM 5697 N N   . UNK B 2 217 ? 109.584 128.496 119.940 1.00 105.45 ?  441 UNK B N   1 
ATOM 5698 C CA  . UNK B 2 217 ? 110.602 127.660 119.341 1.00 108.01 ?  441 UNK B CA  1 
ATOM 5699 C C   . UNK B 2 217 ? 111.829 127.642 120.241 1.00 108.62 ?  441 UNK B C   1 
ATOM 5700 O O   . UNK B 2 217 ? 112.448 126.597 120.466 1.00 108.18 ?  441 UNK B O   1 
ATOM 5701 C CB  . UNK B 2 217 ? 110.955 128.158 117.958 1.00 20.00  ?  441 UNK B CB  1 
ATOM 5702 N N   . GLY B 2 218 ? 112.145 128.806 120.795 1.00 111.70 ?  442 GLY B N   1 
ATOM 5703 C CA  . GLY B 2 218 ? 113.435 129.023 121.416 1.00 116.96 ?  442 GLY B CA  1 
ATOM 5704 C C   . GLY B 2 218 ? 113.687 128.202 122.657 1.00 115.58 ?  442 GLY B C   1 
ATOM 5705 O O   . GLY B 2 218 ? 114.801 127.716 122.865 1.00 111.29 ?  442 GLY B O   1 
ATOM 5706 N N   . LEU B 2 219 ? 112.658 128.017 123.473 1.00 119.77 ?  443 LEU B N   1 
ATOM 5707 C CA  . LEU B 2 219 ? 112.826 127.178 124.647 1.00 126.02 ?  443 LEU B CA  1 
ATOM 5708 C C   . LEU B 2 219 ? 113.131 125.758 124.203 1.00 128.53 ?  443 LEU B C   1 
ATOM 5709 O O   . LEU B 2 219 ? 113.962 125.052 124.796 1.00 133.98 ?  443 LEU B O   1 
ATOM 5710 C CB  . LEU B 2 219 ? 111.570 127.204 125.512 1.00 20.00  ?  443 LEU B CB  1 
ATOM 5711 C CG  . LEU B 2 219 ? 111.178 128.544 126.130 1.00 20.00  ?  443 LEU B CG  1 
ATOM 5712 C CD1 . LEU B 2 219 ? 109.817 128.436 126.794 1.00 20.00  ?  443 LEU B CD1 1 
ATOM 5713 C CD2 . LEU B 2 219 ? 112.223 129.002 127.134 1.00 20.00  ?  443 LEU B CD2 1 
ATOM 5714 N N   . VAL B 2 220 ? 112.473 125.364 123.119 1.00 122.25 ?  444 VAL B N   1 
ATOM 5715 C CA  . VAL B 2 220 ? 112.610 124.019 122.605 1.00 125.27 ?  444 VAL B CA  1 
ATOM 5716 C C   . VAL B 2 220 ? 114.028 123.810 122.131 1.00 135.69 ?  444 VAL B C   1 
ATOM 5717 O O   . VAL B 2 220 ? 114.632 122.771 122.398 1.00 141.72 ?  444 VAL B O   1 
ATOM 5718 C CB  . VAL B 2 220 ? 111.638 123.753 121.455 1.00 20.00  ?  444 VAL B CB  1 
ATOM 5719 C CG1 . VAL B 2 220 ? 111.861 122.363 120.889 1.00 20.00  ?  444 VAL B CG1 1 
ATOM 5720 C CG2 . VAL B 2 220 ? 110.204 123.929 121.925 1.00 20.00  ?  444 VAL B CG2 1 
ATOM 5721 N N   . PHE B 2 221 ? 114.577 124.815 121.457 1.00 137.32 ?  445 PHE B N   1 
ATOM 5722 C CA  . PHE B 2 221 ? 115.972 124.730 121.063 1.00 138.00 ?  445 PHE B CA  1 
ATOM 5723 C C   . PHE B 2 221 ? 116.884 124.665 122.260 1.00 134.76 ?  445 PHE B C   1 
ATOM 5724 O O   . PHE B 2 221 ? 117.874 123.948 122.245 1.00 132.91 ?  445 PHE B O   1 
ATOM 5725 C CB  . PHE B 2 221 ? 116.379 125.917 120.209 1.00 20.00  ?  445 PHE B CB  1 
ATOM 5726 C CG  . PHE B 2 221 ? 115.823 125.883 118.839 1.00 20.00  ?  445 PHE B CG  1 
ATOM 5727 C CD1 . PHE B 2 221 ? 116.444 125.140 117.859 1.00 20.00  ?  445 PHE B CD1 1 
ATOM 5728 C CD2 . PHE B 2 221 ? 114.690 126.598 118.521 1.00 20.00  ?  445 PHE B CD2 1 
ATOM 5729 C CE1 . PHE B 2 221 ? 115.943 125.106 116.583 1.00 20.00  ?  445 PHE B CE1 1 
ATOM 5730 C CE2 . PHE B 2 221 ? 114.179 126.574 117.244 1.00 20.00  ?  445 PHE B CE2 1 
ATOM 5731 C CZ  . PHE B 2 221 ? 114.806 125.826 116.272 1.00 20.00  ?  445 PHE B CZ  1 
ATOM 5732 N N   . TYR B 2 222 ? 116.535 125.393 123.309 1.00 133.23 ?  446 TYR B N   1 
ATOM 5733 C CA  . TYR B 2 222 ? 117.395 125.435 124.474 1.00 132.59 ?  446 TYR B CA  1 
ATOM 5734 C C   . TYR B 2 222 ? 117.529 124.031 125.046 1.00 126.45 ?  446 TYR B C   1 
ATOM 5735 O O   . TYR B 2 222 ? 118.634 123.459 125.115 1.00 122.43 ?  446 TYR B O   1 
ATOM 5736 C CB  . TYR B 2 222 ? 116.823 126.411 125.503 1.00 20.00  ?  446 TYR B CB  1 
ATOM 5737 C CG  . TYR B 2 222 ? 117.597 126.495 126.789 1.00 20.00  ?  446 TYR B CG  1 
ATOM 5738 C CD1 . TYR B 2 222 ? 118.798 127.178 126.856 1.00 20.00  ?  446 TYR B CD1 1 
ATOM 5739 C CD2 . TYR B 2 222 ? 117.113 125.913 127.944 1.00 20.00  ?  446 TYR B CD2 1 
ATOM 5740 C CE1 . TYR B 2 222 ? 119.507 127.259 128.038 1.00 20.00  ?  446 TYR B CE1 1 
ATOM 5741 C CE2 . TYR B 2 222 ? 117.810 125.988 129.129 1.00 20.00  ?  446 TYR B CE2 1 
ATOM 5742 C CZ  . TYR B 2 222 ? 119.007 126.661 129.174 1.00 20.00  ?  446 TYR B CZ  1 
ATOM 5743 O OH  . TYR B 2 222 ? 119.704 126.735 130.359 1.00 20.00  ?  446 TYR B OH  1 
ATOM 5744 N N   . PHE B 2 223 ? 116.387 123.437 125.361 1.00 123.34 ?  447 PHE B N   1 
ATOM 5745 C CA  . PHE B 2 223 ? 116.393 122.121 125.975 1.00 120.89 ?  447 PHE B CA  1 
ATOM 5746 C C   . PHE B 2 223 ? 116.951 121.046 125.054 1.00 124.95 ?  447 PHE B C   1 
ATOM 5747 O O   . PHE B 2 223 ? 117.867 120.301 125.428 1.00 132.62 ?  447 PHE B O   1 
ATOM 5748 C CB  . PHE B 2 223 ? 114.981 121.751 126.413 1.00 113.38 ?  447 PHE B CB  1 
ATOM 5749 C CG  . PHE B 2 223 ? 114.469 122.580 127.548 1.00 112.26 ?  447 PHE B CG  1 
ATOM 5750 C CD1 . PHE B 2 223 ? 115.347 123.191 128.422 1.00 112.52 ?  447 PHE B CD1 1 
ATOM 5751 C CD2 . PHE B 2 223 ? 113.112 122.762 127.735 1.00 114.60 ?  447 PHE B CD2 1 
ATOM 5752 C CE1 . PHE B 2 223 ? 114.882 123.959 129.471 1.00 115.73 ?  447 PHE B CE1 1 
ATOM 5753 C CE2 . PHE B 2 223 ? 112.641 123.530 128.782 1.00 119.81 ?  447 PHE B CE2 1 
ATOM 5754 C CZ  . PHE B 2 223 ? 113.529 124.131 129.650 1.00 121.04 ?  447 PHE B CZ  1 
ATOM 5755 N N   . ALA B 2 224 ? 116.412 120.970 123.844 1.00 122.76 ?  448 ALA B N   1 
ATOM 5756 C CA  . ALA B 2 224 ? 116.793 119.891 122.947 1.00 121.44 ?  448 ALA B CA  1 
ATOM 5757 C C   . ALA B 2 224 ? 118.266 119.964 122.594 1.00 126.74 ?  448 ALA B C   1 
ATOM 5758 O O   . ALA B 2 224 ? 118.943 118.942 122.526 1.00 134.97 ?  448 ALA B O   1 
ATOM 5759 C CB  . ALA B 2 224 ? 115.948 119.925 121.693 1.00 117.41 ?  448 ALA B CB  1 
ATOM 5760 N N   . THR B 2 225 ? 118.770 121.175 122.393 1.00 121.64 ?  449 THR B N   1 
ATOM 5761 C CA  . THR B 2 225 ? 120.174 121.323 122.062 1.00 124.63 ?  449 THR B CA  1 
ATOM 5762 C C   . THR B 2 225 ? 121.012 120.918 123.256 1.00 134.60 ?  449 THR B C   1 
ATOM 5763 O O   . THR B 2 225 ? 122.107 120.377 123.100 1.00 143.28 ?  449 THR B O   1 
ATOM 5764 C CB  . THR B 2 225 ? 120.524 122.747 121.646 1.00 20.00  ?  449 THR B CB  1 
ATOM 5765 O OG1 . THR B 2 225 ? 119.678 123.139 120.560 1.00 20.00  ?  449 THR B OG1 1 
ATOM 5766 C CG2 . THR B 2 225 ? 121.962 122.821 121.184 1.00 20.00  ?  449 THR B CG2 1 
ATOM 5767 N N   . ASP B 2 226 ? 120.492 121.161 124.456 1.00 132.89 ?  450 ASP B N   1 
ATOM 5768 C CA  . ASP B 2 226 ? 121.213 120.693 125.632 1.00 129.57 ?  450 ASP B CA  1 
ATOM 5769 C C   . ASP B 2 226 ? 121.340 119.170 125.599 1.00 119.22 ?  450 ASP B C   1 
ATOM 5770 O O   . ASP B 2 226 ? 122.449 118.639 125.628 1.00 103.71 ?  450 ASP B O   1 
ATOM 5771 C CB  . ASP B 2 226 ? 120.516 121.144 126.920 1.00 20.00  ?  450 ASP B CB  1 
ATOM 5772 C CG  . ASP B 2 226 ? 121.289 120.765 128.178 1.00 20.00  ?  450 ASP B CG  1 
ATOM 5773 O OD1 . ASP B 2 226 ? 122.400 120.207 128.067 1.00 20.00  ?  450 ASP B OD1 1 
ATOM 5774 O OD2 . ASP B 2 226 ? 120.781 121.032 129.286 1.00 20.00  ?  450 ASP B OD2 1 
ATOM 5775 N N   . TYR B 2 227 ? 120.215 118.468 125.492 1.00 125.19 ?  451 TYR B N   1 
ATOM 5776 C CA  . TYR B 2 227 ? 120.268 117.009 125.561 1.00 128.72 ?  451 TYR B CA  1 
ATOM 5777 C C   . TYR B 2 227 ? 120.911 116.366 124.348 1.00 141.23 ?  451 TYR B C   1 
ATOM 5778 O O   . TYR B 2 227 ? 121.775 115.505 124.476 1.00 143.27 ?  451 TYR B O   1 
ATOM 5779 C CB  . TYR B 2 227 ? 118.866 116.414 125.729 1.00 20.00  ?  451 TYR B CB  1 
ATOM 5780 C CG  . TYR B 2 227 ? 118.233 116.643 127.078 1.00 20.00  ?  451 TYR B CG  1 
ATOM 5781 C CD1 . TYR B 2 227 ? 118.962 116.478 128.244 1.00 20.00  ?  451 TYR B CD1 1 
ATOM 5782 C CD2 . TYR B 2 227 ? 116.904 117.023 127.184 1.00 20.00  ?  451 TYR B CD2 1 
ATOM 5783 C CE1 . TYR B 2 227 ? 118.386 116.686 129.482 1.00 20.00  ?  451 TYR B CE1 1 
ATOM 5784 C CE2 . TYR B 2 227 ? 116.319 117.236 128.415 1.00 20.00  ?  451 TYR B CE2 1 
ATOM 5785 C CZ  . TYR B 2 227 ? 117.063 117.066 129.562 1.00 20.00  ?  451 TYR B CZ  1 
ATOM 5786 O OH  . TYR B 2 227 ? 116.482 117.276 130.792 1.00 20.00  ?  451 TYR B OH  1 
ATOM 5787 N N   . LEU B 2 228 ? 120.501 116.808 123.170 1.00 155.56 ?  452 LEU B N   1 
ATOM 5788 C CA  . LEU B 2 228 ? 120.579 115.956 121.995 1.00 174.94 ?  452 LEU B CA  1 
ATOM 5789 C C   . LEU B 2 228 ? 121.774 116.204 121.099 1.00 193.36 ?  452 LEU B C   1 
ATOM 5790 O O   . LEU B 2 228 ? 122.703 115.401 121.033 1.00 193.88 ?  452 LEU B O   1 
ATOM 5791 C CB  . LEU B 2 228 ? 119.307 116.132 121.176 1.00 20.00  ?  452 LEU B CB  1 
ATOM 5792 C CG  . LEU B 2 228 ? 118.047 115.843 121.986 1.00 20.00  ?  452 LEU B CG  1 
ATOM 5793 C CD1 . LEU B 2 228 ? 116.811 116.140 121.165 1.00 20.00  ?  452 LEU B CD1 1 
ATOM 5794 C CD2 . LEU B 2 228 ? 118.047 114.410 122.493 1.00 20.00  ?  452 LEU B CD2 1 
ATOM 5795 N N   . VAL B 2 229 ? 121.723 117.326 120.400 1.00 1.00   ?  453 VAL B N   1 
ATOM 5796 C CA  . VAL B 2 229 ? 122.631 117.583 119.305 1.00 1.00   ?  453 VAL B CA  1 
ATOM 5797 C C   . VAL B 2 229 ? 124.079 117.602 119.723 1.00 1.00   ?  453 VAL B C   1 
ATOM 5798 O O   . VAL B 2 229 ? 124.923 117.003 119.074 1.00 1.00   ?  453 VAL B O   1 
ATOM 5799 C CB  . VAL B 2 229 ? 122.317 118.925 118.658 1.00 20.00  ?  453 VAL B CB  1 
ATOM 5800 C CG1 . VAL B 2 229 ? 123.331 119.235 117.578 1.00 20.00  ?  453 VAL B CG1 1 
ATOM 5801 C CG2 . VAL B 2 229 ? 120.910 118.917 118.101 1.00 20.00  ?  453 VAL B CG2 1 
ATOM 5802 N N   . GLN B 2 230 ? 124.356 118.284 120.821 1.00 1.00   ?  454 GLN B N   1 
ATOM 5803 C CA  . GLN B 2 230 ? 125.728 118.574 121.181 1.00 1.00   ?  454 GLN B CA  1 
ATOM 5804 C C   . GLN B 2 230 ? 126.586 117.313 121.359 1.00 1.00   ?  454 GLN B C   1 
ATOM 5805 O O   . GLN B 2 230 ? 127.629 117.204 120.725 1.00 1.00   ?  454 GLN B O   1 
ATOM 5806 C CB  . GLN B 2 230 ? 125.741 119.445 122.439 1.00 20.00  ?  454 GLN B CB  1 
ATOM 5807 C CG  . GLN B 2 230 ? 127.076 120.024 122.828 1.00 20.00  ?  454 GLN B CG  1 
ATOM 5808 C CD  . GLN B 2 230 ? 126.927 121.033 123.946 1.00 20.00  ?  454 GLN B CD  1 
ATOM 5809 O OE1 . GLN B 2 230 ? 125.810 121.352 124.356 1.00 20.00  ?  454 GLN B OE1 1 
ATOM 5810 N NE2 . GLN B 2 230 ? 128.046 121.544 124.445 1.00 20.00  ?  454 GLN B NE2 1 
ATOM 5811 N N   . PRO B 2 231 ? 126.145 116.341 122.182 1.00 1.00   ?  455 PRO B N   1 
ATOM 5812 C CA  . PRO B 2 231 ? 126.954 115.121 122.289 1.00 1.00   ?  455 PRO B CA  1 
ATOM 5813 C C   . PRO B 2 231 ? 127.143 114.400 120.962 1.00 1.00   ?  455 PRO B C   1 
ATOM 5814 O O   . PRO B 2 231 ? 128.195 113.822 120.682 1.00 1.00   ?  455 PRO B O   1 
ATOM 5815 C CB  . PRO B 2 231 ? 126.145 114.254 123.250 1.00 20.00  ?  455 PRO B CB  1 
ATOM 5816 C CG  . PRO B 2 231 ? 125.346 115.219 124.038 1.00 20.00  ?  455 PRO B CG  1 
ATOM 5817 C CD  . PRO B 2 231 ? 124.961 116.267 123.055 1.00 20.00  ?  455 PRO B CD  1 
ATOM 5818 N N   . PHE B 2 232 ? 126.107 114.450 120.142 1.00 1.00   ?  456 PHE B N   1 
ATOM 5819 C CA  . PHE B 2 232 ? 126.123 113.763 118.868 1.00 1.00   ?  456 PHE B CA  1 
ATOM 5820 C C   . PHE B 2 232 ? 127.126 114.359 117.899 1.00 1.00   ?  456 PHE B C   1 
ATOM 5821 O O   . PHE B 2 232 ? 127.954 113.654 117.326 1.00 1.00   ?  456 PHE B O   1 
ATOM 5822 C CB  . PHE B 2 232 ? 124.724 113.792 118.267 1.00 20.00  ?  456 PHE B CB  1 
ATOM 5823 C CG  . PHE B 2 232 ? 124.695 113.483 116.816 1.00 20.00  ?  456 PHE B CG  1 
ATOM 5824 C CD1 . PHE B 2 232 ? 124.837 112.189 116.364 1.00 20.00  ?  456 PHE B CD1 1 
ATOM 5825 C CD2 . PHE B 2 232 ? 124.516 114.497 115.898 1.00 20.00  ?  456 PHE B CD2 1 
ATOM 5826 C CE1 . PHE B 2 232 ? 124.808 111.913 115.016 1.00 20.00  ?  456 PHE B CE1 1 
ATOM 5827 C CE2 . PHE B 2 232 ? 124.484 114.231 114.554 1.00 20.00  ?  456 PHE B CE2 1 
ATOM 5828 C CZ  . PHE B 2 232 ? 124.631 112.939 114.109 1.00 20.00  ?  456 PHE B CZ  1 
ATOM 5829 N N   . ALA B 2 233 ? 127.053 115.670 117.736 1.00 1.00   ?  457 ALA B N   1 
ATOM 5830 C CA  . ALA B 2 233 ? 127.964 116.380 116.869 1.00 1.00   ?  457 ALA B CA  1 
ATOM 5831 C C   . ALA B 2 233 ? 129.366 116.276 117.422 1.00 1.00   ?  457 ALA B C   1 
ATOM 5832 O O   . ALA B 2 233 ? 130.337 116.312 116.676 1.00 1.00   ?  457 ALA B O   1 
ATOM 5833 C CB  . ALA B 2 233 ? 127.549 117.825 116.733 1.00 20.00  ?  457 ALA B CB  1 
ATOM 5834 N N   . ASP B 2 234 ? 129.471 116.148 118.740 1.00 1.00   ?  458 ASP B N   1 
ATOM 5835 C CA  . ASP B 2 234 ? 130.773 115.971 119.359 1.00 1.00   ?  458 ASP B CA  1 
ATOM 5836 C C   . ASP B 2 234 ? 131.386 114.659 118.932 1.00 1.00   ?  458 ASP B C   1 
ATOM 5837 O O   . ASP B 2 234 ? 132.544 114.610 118.515 1.00 1.00   ?  458 ASP B O   1 
ATOM 5838 C CB  . ASP B 2 234 ? 130.674 116.004 120.881 1.00 20.00  ?  458 ASP B CB  1 
ATOM 5839 C CG  . ASP B 2 234 ? 130.431 117.387 121.414 1.00 20.00  ?  458 ASP B CG  1 
ATOM 5840 O OD1 . ASP B 2 234 ? 130.647 118.354 120.657 1.00 20.00  ?  458 ASP B OD1 1 
ATOM 5841 O OD2 . ASP B 2 234 ? 130.023 117.509 122.588 1.00 20.00  ?  458 ASP B OD2 1 
ATOM 5842 N N   . GLN B 2 235 ? 130.603 113.592 119.028 1.00 1.00   ?  459 GLN B N   1 
ATOM 5843 C CA  . GLN B 2 235 ? 131.121 112.284 118.679 1.00 1.00   ?  459 GLN B CA  1 
ATOM 5844 C C   . GLN B 2 235 ? 131.411 112.241 117.189 1.00 1.00   ?  459 GLN B C   1 
ATOM 5845 O O   . GLN B 2 235 ? 132.318 111.542 116.736 1.00 1.00   ?  459 GLN B O   1 
ATOM 5846 C CB  . GLN B 2 235 ? 130.146 111.189 119.078 1.00 20.00  ?  459 GLN B CB  1 
ATOM 5847 C CG  . GLN B 2 235 ? 130.718 109.807 118.908 1.00 20.00  ?  459 GLN B CG  1 
ATOM 5848 C CD  . GLN B 2 235 ? 129.845 108.753 119.529 1.00 20.00  ?  459 GLN B CD  1 
ATOM 5849 O OE1 . GLN B 2 235 ? 128.849 109.064 120.179 1.00 20.00  ?  459 GLN B OE1 1 
ATOM 5850 N NE2 . GLN B 2 235 ? 130.211 107.492 119.336 1.00 20.00  ?  459 GLN B NE2 1 
ATOM 5851 N N   . LEU B 2 236 ? 130.643 113.021 116.437 1.00 1.00   ?  460 LEU B N   1 
ATOM 5852 C CA  . LEU B 2 236 ? 130.931 113.249 115.034 1.00 1.00   ?  460 LEU B CA  1 
ATOM 5853 C C   . LEU B 2 236 ? 132.339 113.769 114.866 1.00 1.00   ?  460 LEU B C   1 
ATOM 5854 O O   . LEU B 2 236 ? 133.212 113.076 114.359 1.00 1.00   ?  460 LEU B O   1 
ATOM 5855 C CB  . LEU B 2 236 ? 129.950 114.251 114.439 1.00 20.00  ?  460 LEU B CB  1 
ATOM 5856 C CG  . LEU B 2 236 ? 130.338 114.736 113.042 1.00 20.00  ?  460 LEU B CG  1 
ATOM 5857 C CD1 . LEU B 2 236 ? 130.251 113.616 112.018 1.00 20.00  ?  460 LEU B CD1 1 
ATOM 5858 C CD2 . LEU B 2 236 ? 129.506 115.935 112.632 1.00 20.00  ?  460 LEU B CD2 1 
ATOM 5859 N N   . ALA B 2 237 ? 132.559 114.977 115.369 1.00 1.00   ?  461 ALA B N   1 
ATOM 5860 C CA  . ALA B 2 237 ? 133.783 115.716 115.117 1.00 1.00   ?  461 ALA B CA  1 
ATOM 5861 C C   . ALA B 2 237 ? 134.966 114.979 115.682 1.00 1.00   ?  461 ALA B C   1 
ATOM 5862 O O   . ALA B 2 237 ? 136.097 115.195 115.259 1.00 1.00   ?  461 ALA B O   1 
ATOM 5863 C CB  . ALA B 2 237 ? 133.699 117.105 115.712 1.00 20.00  ?  461 ALA B CB  1 
ATOM 5864 N N   . PHE B 2 238 ? 134.703 114.096 116.633 1.00 1.00   ?  462 PHE B N   1 
ATOM 5865 C CA  . PHE B 2 238 ? 135.771 113.319 117.221 1.00 1.00   ?  462 PHE B CA  1 
ATOM 5866 C C   . PHE B 2 238 ? 136.451 112.524 116.124 1.00 1.00   ?  462 PHE B C   1 
ATOM 5867 O O   . PHE B 2 238 ? 137.637 112.211 116.208 1.00 1.00   ?  462 PHE B O   1 
ATOM 5868 C CB  . PHE B 2 238 ? 135.239 112.394 118.303 1.00 20.00  ?  462 PHE B CB  1 
ATOM 5869 C CG  . PHE B 2 238 ? 136.297 111.562 118.943 1.00 20.00  ?  462 PHE B CG  1 
ATOM 5870 C CD1 . PHE B 2 238 ? 137.112 112.096 119.922 1.00 20.00  ?  462 PHE B CD1 1 
ATOM 5871 C CD2 . PHE B 2 238 ? 136.486 110.248 118.561 1.00 20.00  ?  462 PHE B CD2 1 
ATOM 5872 C CE1 . PHE B 2 238 ? 138.088 111.335 120.512 1.00 20.00  ?  462 PHE B CE1 1 
ATOM 5873 C CE2 . PHE B 2 238 ? 137.462 109.482 119.149 1.00 20.00  ?  462 PHE B CE2 1 
ATOM 5874 C CZ  . PHE B 2 238 ? 138.266 110.027 120.127 1.00 20.00  ?  462 PHE B CZ  1 
ATOM 5875 N N   . HIS B 2 239 ? 135.684 112.195 115.095 1.00 1.00   ?  463 HIS B N   1 
ATOM 5876 C CA  . HIS B 2 239 ? 136.254 111.703 113.857 1.00 1.00   ?  463 HIS B CA  1 
ATOM 5877 C C   . HIS B 2 239 ? 136.102 112.798 112.814 1.00 1.00   ?  463 HIS B C   1 
ATOM 5878 O O   . HIS B 2 239 ? 135.301 113.707 112.980 1.00 1.00   ?  463 HIS B O   1 
ATOM 5879 C CB  . HIS B 2 239 ? 135.580 110.407 113.428 1.00 20.00  ?  463 HIS B CB  1 
ATOM 5880 C CG  . HIS B 2 239 ? 135.727 109.306 114.431 1.00 20.00  ?  463 HIS B CG  1 
ATOM 5881 N ND1 . HIS B 2 239 ? 134.883 109.170 115.511 1.00 20.00  ?  463 HIS B ND1 1 
ATOM 5882 C CD2 . HIS B 2 239 ? 136.641 108.314 114.541 1.00 20.00  ?  463 HIS B CD2 1 
ATOM 5883 C CE1 . HIS B 2 239 ? 135.256 108.128 116.231 1.00 20.00  ?  463 HIS B CE1 1 
ATOM 5884 N NE2 . HIS B 2 239 ? 136.321 107.591 115.664 1.00 20.00  ?  463 HIS B NE2 1 
ATOM 5885 N N   . UNK B 2 240 ? 136.878 112.725 111.744 1.00 1.00   ?  464 UNK B N   1 
ATOM 5886 C CA  . UNK B 2 240 ? 136.919 113.821 110.788 1.00 1.00   ?  464 UNK B CA  1 
ATOM 5887 C C   . UNK B 2 240 ? 135.583 114.021 110.079 1.00 1.00   ?  464 UNK B C   1 
ATOM 5888 O O   . UNK B 2 240 ? 135.320 115.095 109.544 1.00 1.00   ?  464 UNK B O   1 
ATOM 5889 C CB  . UNK B 2 240 ? 138.018 113.589 109.776 1.00 20.00  ?  464 UNK B CB  1 
ATOM 5890 N N   . UNK B 2 241 ? 134.755 112.982 110.079 1.00 30.00  ?  465 UNK B N   1 
ATOM 5891 C CA  . UNK B 2 241 ? 133.484 112.983 109.359 1.00 30.00  ?  465 UNK B CA  1 
ATOM 5892 C C   . UNK B 2 241 ? 132.651 114.237 109.600 1.00 30.00  ?  465 UNK B C   1 
ATOM 5893 O O   . UNK B 2 241 ? 132.156 114.850 108.655 1.00 30.00  ?  465 UNK B O   1 
ATOM 5894 C CB  . UNK B 2 241 ? 132.684 111.755 109.733 1.00 20.00  ?  465 UNK B CB  1 
ATOM 5895 N N   . UNK C 3 1   ? 149.302 130.953 122.292 1.00 30.00  ?  1   UNK C N   1 
ATOM 5896 C CA  . UNK C 3 1   ? 149.084 129.956 121.252 1.00 30.00  ?  1   UNK C CA  1 
ATOM 5897 C C   . UNK C 3 1   ? 147.759 130.196 120.548 1.00 30.00  ?  1   UNK C C   1 
ATOM 5898 O O   . UNK C 3 1   ? 147.066 129.256 120.170 1.00 30.00  ?  1   UNK C O   1 
ATOM 5899 N N   . UNK C 3 2   ? 147.404 131.464 120.392 1.00 30.00  ?  2   UNK C N   1 
ATOM 5900 C CA  . UNK C 3 2   ? 146.162 131.830 119.730 1.00 30.00  ?  2   UNK C CA  1 
ATOM 5901 C C   . UNK C 3 2   ? 146.304 131.842 118.213 1.00 30.00  ?  2   UNK C C   1 
ATOM 5902 O O   . UNK C 3 2   ? 145.309 131.924 117.490 1.00 30.00  ?  2   UNK C O   1 
ATOM 5903 C CB  . UNK C 3 2   ? 145.692 133.183 120.222 1.00 30.00  ?  2   UNK C CB  1 
ATOM 5904 N N   . UNK C 3 3   ? 147.540 131.751 117.734 1.00 30.00  ?  3   UNK C N   1 
ATOM 5905 C CA  . UNK C 3 3   ? 147.813 131.900 116.310 1.00 30.00  ?  3   UNK C CA  1 
ATOM 5906 C C   . UNK C 3 3   ? 147.138 130.821 115.475 1.00 30.00  ?  3   UNK C C   1 
ATOM 5907 O O   . UNK C 3 3   ? 146.689 131.079 114.359 1.00 30.00  ?  3   UNK C O   1 
ATOM 5908 C CB  . UNK C 3 3   ? 149.308 131.889 116.064 1.00 30.00  ?  3   UNK C CB  1 
ATOM 5909 N N   . UNK C 3 4   ? 147.048 129.616 116.017 1.00 20.00  ?  4   UNK C N   1 
ATOM 5910 C CA  . UNK C 3 4   ? 146.345 128.564 115.316 1.00 20.00  ?  4   UNK C CA  1 
ATOM 5911 C C   . UNK C 3 4   ? 144.876 128.923 115.264 1.00 20.00  ?  4   UNK C C   1 
ATOM 5912 O O   . UNK C 3 4   ? 144.228 128.814 114.218 1.00 20.00  ?  4   UNK C O   1 
ATOM 5913 C CB  . UNK C 3 4   ? 146.546 127.239 116.001 1.00 20.00  ?  4   UNK C CB  1 
ATOM 5914 N N   . UNK C 3 5   ? 144.362 129.383 116.398 1.00 20.00  ?  5   UNK C N   1 
ATOM 5915 C CA  . UNK C 3 5   ? 142.958 129.739 116.495 1.00 20.00  ?  5   UNK C CA  1 
ATOM 5916 C C   . UNK C 3 5   ? 142.667 130.915 115.589 1.00 20.00  ?  5   UNK C C   1 
ATOM 5917 O O   . UNK C 3 5   ? 141.604 130.993 114.968 1.00 20.00  ?  5   UNK C O   1 
ATOM 5918 C CB  . UNK C 3 5   ? 142.588 130.063 117.923 1.00 20.00  ?  5   UNK C CB  1 
ATOM 5919 N N   . UNK C 3 6   ? 143.637 131.814 115.485 1.00 20.00  ?  6   UNK C N   1 
ATOM 5920 C CA  . UNK C 3 6   ? 143.512 132.926 114.566 1.00 20.00  ?  6   UNK C CA  1 
ATOM 5921 C C   . UNK C 3 6   ? 143.481 132.397 113.143 1.00 20.00  ?  6   UNK C C   1 
ATOM 5922 O O   . UNK C 3 6   ? 142.834 132.971 112.273 1.00 20.00  ?  6   UNK C O   1 
ATOM 5923 C CB  . UNK C 3 6   ? 144.643 133.903 114.754 1.00 20.00  ?  6   UNK C CB  1 
ATOM 5924 N N   . UNK C 3 7   ? 144.164 131.283 112.915 1.00 20.00  ?  7   UNK C N   1 
ATOM 5925 C CA  . UNK C 3 7   ? 144.224 130.711 111.579 1.00 20.00  ?  7   UNK C CA  1 
ATOM 5926 C C   . UNK C 3 7   ? 142.886 130.121 111.159 1.00 20.00  ?  7   UNK C C   1 
ATOM 5927 O O   . UNK C 3 7   ? 142.358 130.428 110.080 1.00 20.00  ?  7   UNK C O   1 
ATOM 5928 N N   . UNK C 3 8   ? 142.322 129.286 112.022 1.00 20.00  ?  8   UNK C N   1 
ATOM 5929 C CA  . UNK C 3 8   ? 141.046 128.674 111.694 1.00 20.00  ?  8   UNK C CA  1 
ATOM 5930 C C   . UNK C 3 8   ? 140.008 129.773 111.564 1.00 20.00  ?  8   UNK C C   1 
ATOM 5931 O O   . UNK C 3 8   ? 139.101 129.720 110.714 1.00 20.00  ?  8   UNK C O   1 
ATOM 5932 C CB  . UNK C 3 8   ? 140.645 127.671 112.748 1.00 20.00  ?  8   UNK C CB  1 
ATOM 5933 N N   . UNK C 3 9   ? 140.183 130.804 112.382 1.00 20.00  ?  9   UNK C N   1 
ATOM 5934 C CA  . UNK C 3 9   ? 139.311 131.955 112.302 1.00 20.00  ?  9   UNK C CA  1 
ATOM 5935 C C   . UNK C 3 9   ? 139.467 132.610 110.944 1.00 20.00  ?  9   UNK C C   1 
ATOM 5936 O O   . UNK C 3 9   ? 138.514 133.158 110.411 1.00 20.00  ?  9   UNK C O   1 
ATOM 5937 C CB  . UNK C 3 9   ? 139.614 132.939 113.408 1.00 20.00  ?  9   UNK C CB  1 
ATOM 5938 N N   . UNK C 3 10  ? 140.671 132.555 110.385 1.00 20.00  ?  10  UNK C N   1 
ATOM 5939 C CA  . UNK C 3 10  ? 140.887 133.091 109.049 1.00 20.00  ?  10  UNK C CA  1 
ATOM 5940 C C   . UNK C 3 10  ? 140.225 132.222 107.997 1.00 20.00  ?  10  UNK C C   1 
ATOM 5941 O O   . UNK C 3 10  ? 139.930 132.695 106.905 1.00 20.00  ?  10  UNK C O   1 
ATOM 5942 C CB  . UNK C 3 10  ? 142.359 133.238 108.758 1.00 20.00  ?  10  UNK C CB  1 
ATOM 5943 N N   . UNK C 3 11  ? 140.005 130.949 108.301 1.00 20.00  ?  11  UNK C N   1 
ATOM 5944 C CA  . UNK C 3 11  ? 139.256 130.118 107.361 1.00 20.00  ?  11  UNK C CA  1 
ATOM 5945 C C   . UNK C 3 11  ? 137.775 130.501 107.361 1.00 20.00  ?  11  UNK C C   1 
ATOM 5946 O O   . UNK C 3 11  ? 137.164 130.777 106.304 1.00 20.00  ?  11  UNK C O   1 
ATOM 5947 C CB  . UNK C 3 11  ? 139.424 128.651 107.698 1.00 20.00  ?  11  UNK C CB  1 
ATOM 5948 N N   . UNK C 3 12  ? 137.202 130.554 108.558 1.00 20.00  ?  12  UNK C N   1 
ATOM 5949 C CA  . UNK C 3 12  ? 135.791 130.894 108.666 1.00 20.00  ?  12  UNK C CA  1 
ATOM 5950 C C   . UNK C 3 12  ? 135.567 132.298 108.123 1.00 20.00  ?  12  UNK C C   1 
ATOM 5951 O O   . UNK C 3 12  ? 134.527 132.601 107.538 1.00 20.00  ?  12  UNK C O   1 
ATOM 5952 C CB  . UNK C 3 12  ? 135.323 130.792 110.101 1.00 20.00  ?  12  UNK C CB  1 
ATOM 5953 N N   . UNK C 3 13  ? 136.566 133.150 108.308 1.00 20.00  ?  13  UNK C N   1 
ATOM 5954 C CA  . UNK C 3 13  ? 136.548 134.484 107.732 1.00 20.00  ?  13  UNK C CA  1 
ATOM 5955 C C   . UNK C 3 13  ? 136.724 134.407 106.228 1.00 20.00  ?  13  UNK C C   1 
ATOM 5956 O O   . UNK C 3 13  ? 136.298 135.298 105.498 1.00 20.00  ?  13  UNK C O   1 
ATOM 5957 C CB  . UNK C 3 13  ? 137.628 135.349 108.350 1.00 20.00  ?  13  UNK C CB  1 
ATOM 5958 N N   . UNK C 3 14  ? 137.352 133.331 105.769 1.00 20.00  ?  14  UNK C N   1 
ATOM 5959 C CA  . UNK C 3 14  ? 137.502 133.095 104.344 1.00 20.00  ?  14  UNK C CA  1 
ATOM 5960 C C   . UNK C 3 14  ? 136.104 132.933 103.790 1.00 20.00  ?  14  UNK C C   1 
ATOM 5961 O O   . UNK C 3 14  ? 135.849 133.241 102.630 1.00 20.00  ?  14  UNK C O   1 
ATOM 5962 N N   . UNK C 3 15  ? 135.195 132.444 104.628 1.00 20.00  ?  15  UNK C N   1 
ATOM 5963 C CA  . UNK C 3 15  ? 133.770 132.502 104.268 1.00 20.00  ?  15  UNK C CA  1 
ATOM 5964 C C   . UNK C 3 15  ? 133.132 133.884 104.521 1.00 20.00  ?  15  UNK C C   1 
ATOM 5965 O O   . UNK C 3 15  ? 132.249 134.340 103.768 1.00 20.00  ?  15  UNK C O   1 
ATOM 5966 C CB  . UNK C 3 15  ? 132.998 131.437 105.016 1.00 20.00  ?  15  UNK C CB  1 
ATOM 5967 N N   . UNK C 3 16  ? 133.585 134.555 105.576 1.00 20.00  ?  16  UNK C N   1 
ATOM 5968 C CA  . UNK C 3 16  ? 133.005 135.841 105.950 1.00 20.00  ?  16  UNK C CA  1 
ATOM 5969 C C   . UNK C 3 16  ? 133.215 136.886 104.864 1.00 20.00  ?  16  UNK C C   1 
ATOM 5970 O O   . UNK C 3 16  ? 132.477 137.861 104.791 1.00 20.00  ?  16  UNK C O   1 
ATOM 5971 C CB  . UNK C 3 16  ? 133.585 136.326 107.260 1.00 20.00  ?  16  UNK C CB  1 
ATOM 5972 N N   . UNK C 3 17  ? 134.233 136.689 104.034 1.00 20.00  ?  17  UNK C N   1 
ATOM 5973 C CA  . UNK C 3 17  ? 134.477 137.594 102.922 1.00 20.00  ?  17  UNK C CA  1 
ATOM 5974 C C   . UNK C 3 17  ? 133.300 137.542 101.974 1.00 20.00  ?  17  UNK C C   1 
ATOM 5975 O O   . UNK C 3 17  ? 132.758 138.574 101.566 1.00 20.00  ?  17  UNK C O   1 
ATOM 5976 C CB  . UNK C 3 17  ? 135.756 137.227 102.201 1.00 20.00  ?  17  UNK C CB  1 
ATOM 5977 N N   . UNK C 3 18  ? 132.883 136.326 101.657 1.00 20.00  ?  18  UNK C N   1 
ATOM 5978 C CA  . UNK C 3 18  ? 131.719 136.146 100.822 1.00 20.00  ?  18  UNK C CA  1 
ATOM 5979 C C   . UNK C 3 18  ? 130.514 136.717 101.544 1.00 20.00  ?  18  UNK C C   1 
ATOM 5980 O O   . UNK C 3 18  ? 129.597 137.234 100.912 1.00 20.00  ?  18  UNK C O   1 
ATOM 5981 C CB  . UNK C 3 18  ? 131.511 134.684 100.496 1.00 20.00  ?  18  UNK C CB  1 
ATOM 5982 N N   . UNK C 3 19  ? 130.524 136.645 102.872 1.00 20.00  ?  19  UNK C N   1 
ATOM 5983 C CA  . UNK C 3 19  ? 129.429 137.235 103.637 1.00 20.00  ?  19  UNK C CA  1 
ATOM 5984 C C   . UNK C 3 19  ? 129.385 138.750 103.476 1.00 20.00  ?  19  UNK C C   1 
ATOM 5985 O O   . UNK C 3 19  ? 128.321 139.361 103.554 1.00 20.00  ?  19  UNK C O   1 
ATOM 5986 C CB  . UNK C 3 19  ? 129.543 136.872 105.101 1.00 20.00  ?  19  UNK C CB  1 
ATOM 5987 N N   . UNK C 3 20  ? 130.548 139.349 103.257 1.00 20.00  ?  20  UNK C N   1 
ATOM 5988 C CA  . UNK C 3 20  ? 130.654 140.799 103.193 1.00 20.00  ?  20  UNK C CA  1 
ATOM 5989 C C   . UNK C 3 20  ? 130.340 141.341 101.814 1.00 20.00  ?  20  UNK C C   1 
ATOM 5990 O O   . UNK C 3 20  ? 129.609 142.317 101.675 1.00 20.00  ?  20  UNK C O   1 
ATOM 5991 C CB  . UNK C 3 20  ? 132.040 141.238 103.612 1.00 20.00  ?  20  UNK C CB  1 
ATOM 5992 N N   . UNK C 3 21  ? 130.889 140.703 100.790 1.00 20.00  ?  21  UNK C N   1 
ATOM 5993 C CA  . UNK C 3 21  ? 130.762 141.237 99.440  1.00 20.00  ?  21  UNK C CA  1 
ATOM 5994 C C   . UNK C 3 21  ? 129.412 140.911 98.815  1.00 20.00  ?  21  UNK C C   1 
ATOM 5995 O O   . UNK C 3 21  ? 129.058 141.452 97.771  1.00 20.00  ?  21  UNK C O   1 
ATOM 5996 C CB  . UNK C 3 21  ? 131.886 140.718 98.562  1.00 20.00  ?  21  UNK C CB  1 
ATOM 5997 N N   . UNK C 3 22  ? 128.655 140.025 99.447  1.00 20.00  ?  22  UNK C N   1 
ATOM 5998 C CA  . UNK C 3 22  ? 127.368 139.637 98.897  1.00 20.00  ?  22  UNK C CA  1 
ATOM 5999 C C   . UNK C 3 22  ? 126.265 140.525 99.437  1.00 20.00  ?  22  UNK C C   1 
ATOM 6000 O O   . UNK C 3 22  ? 126.153 141.687 99.057  1.00 20.00  ?  22  UNK C O   1 
ATOM 6001 C CB  . UNK C 3 22  ? 127.075 138.187 99.203  1.00 20.00  ?  22  UNK C CB  1 
ATOM 6002 N N   . UNK C 3 23  ? 125.461 139.971 100.337 1.00 20.00  ?  23  UNK C N   1 
ATOM 6003 C CA  . UNK C 3 23  ? 124.326 140.687 100.902 1.00 20.00  ?  23  UNK C CA  1 
ATOM 6004 C C   . UNK C 3 23  ? 124.776 141.909 101.687 1.00 20.00  ?  23  UNK C C   1 
ATOM 6005 O O   . UNK C 3 23  ? 124.052 142.900 101.780 1.00 20.00  ?  23  UNK C O   1 
ATOM 6006 C CB  . UNK C 3 23  ? 123.515 139.766 101.789 1.00 20.00  ?  23  UNK C CB  1 
ATOM 6007 N N   . UNK C 3 24  ? 125.977 141.841 102.245 1.00 30.00  ?  24  UNK C N   1 
ATOM 6008 C CA  . UNK C 3 24  ? 126.496 142.951 103.023 1.00 30.00  ?  24  UNK C CA  1 
ATOM 6009 C C   . UNK C 3 24  ? 127.070 144.014 102.100 1.00 30.00  ?  24  UNK C C   1 
ATOM 6010 O O   . UNK C 3 24  ? 126.450 144.377 101.102 1.00 30.00  ?  24  UNK C O   1 
ATOM 6011 C CB  . UNK C 3 24  ? 127.545 142.468 104.005 1.00 30.00  ?  24  UNK C CB  1 
ATOM 6012 N N   . UNK C 3 25  ? 121.884 144.618 101.228 1.00 30.00  ?  25  UNK C N   1 
ATOM 6013 C CA  . UNK C 3 25  ? 120.481 144.973 101.391 1.00 30.00  ?  25  UNK C CA  1 
ATOM 6014 C C   . UNK C 3 25  ? 119.883 144.228 102.569 1.00 30.00  ?  25  UNK C C   1 
ATOM 6015 O O   . UNK C 3 25  ? 120.147 143.044 102.764 1.00 30.00  ?  25  UNK C O   1 
ATOM 6016 C CB  . UNK C 3 25  ? 119.705 144.660 100.123 1.00 20.00  ?  25  UNK C CB  1 
ATOM 6017 N N   . UNK C 3 26  ? 119.064 144.923 103.347 1.00 1.00   ?  26  UNK C N   1 
ATOM 6018 C CA  . UNK C 3 26  ? 118.464 144.316 104.522 1.00 1.00   ?  26  UNK C CA  1 
ATOM 6019 C C   . UNK C 3 26  ? 117.544 143.182 104.124 1.00 1.00   ?  26  UNK C C   1 
ATOM 6020 O O   . UNK C 3 26  ? 117.421 142.193 104.843 1.00 1.00   ?  26  UNK C O   1 
ATOM 6021 C CB  . UNK C 3 26  ? 117.705 145.350 105.326 1.00 20.00  ?  26  UNK C CB  1 
ATOM 6022 N N   . UNK C 3 27  ? 116.903 143.319 102.970 1.00 1.00   ?  27  UNK C N   1 
ATOM 6023 C CA  . UNK C 3 27  ? 116.025 142.266 102.493 1.00 1.00   ?  27  UNK C CA  1 
ATOM 6024 C C   . UNK C 3 27  ? 116.836 141.007 102.248 1.00 1.00   ?  27  UNK C C   1 
ATOM 6025 O O   . UNK C 3 27  ? 116.399 139.896 102.551 1.00 1.00   ?  27  UNK C O   1 
ATOM 6026 C CB  . UNK C 3 27  ? 115.308 142.695 101.228 1.00 20.00  ?  27  UNK C CB  1 
ATOM 6027 N N   . UNK C 3 28  ? 118.039 141.189 101.722 1.00 1.00   ?  28  UNK C N   1 
ATOM 6028 C CA  . UNK C 3 28  ? 118.930 140.066 101.534 1.00 1.00   ?  28  UNK C CA  1 
ATOM 6029 C C   . UNK C 3 28  ? 119.316 139.496 102.886 1.00 1.00   ?  28  UNK C C   1 
ATOM 6030 O O   . UNK C 3 28  ? 119.468 138.286 103.039 1.00 1.00   ?  28  UNK C O   1 
ATOM 6031 C CB  . UNK C 3 28  ? 120.158 140.488 100.757 1.00 20.00  ?  28  UNK C CB  1 
ATOM 6032 N N   . UNK C 3 29  ? 119.451 140.370 103.876 1.00 1.00   ?  29  UNK C N   1 
ATOM 6033 C CA  . UNK C 3 29  ? 119.858 139.923 105.196 1.00 1.00   ?  29  UNK C CA  1 
ATOM 6034 C C   . UNK C 3 29  ? 118.789 139.026 105.775 1.00 1.00   ?  29  UNK C C   1 
ATOM 6035 O O   . UNK C 3 29  ? 119.086 138.031 106.426 1.00 1.00   ?  29  UNK C O   1 
ATOM 6036 C CB  . UNK C 3 29  ? 120.114 141.100 106.106 1.00 20.00  ?  29  UNK C CB  1 
ATOM 6037 N N   . UNK C 3 30  ? 117.537 139.373 105.516 1.00 1.00   ?  30  UNK C N   1 
ATOM 6038 C CA  . UNK C 3 30  ? 116.443 138.511 105.913 1.00 1.00   ?  30  UNK C CA  1 
ATOM 6039 C C   . UNK C 3 30  ? 116.501 137.234 105.106 1.00 1.00   ?  30  UNK C C   1 
ATOM 6040 O O   . UNK C 3 30  ? 116.170 136.162 105.593 1.00 1.00   ?  30  UNK C O   1 
ATOM 6041 C CB  . UNK C 3 30  ? 115.120 139.204 105.717 1.00 20.00  ?  30  UNK C CB  1 
ATOM 6042 N N   . UNK C 3 31  ? 116.950 137.360 103.865 1.00 1.00   ?  31  UNK C N   1 
ATOM 6043 C CA  . UNK C 3 31  ? 116.976 136.227 102.956 1.00 1.00   ?  31  UNK C CA  1 
ATOM 6044 C C   . UNK C 3 31  ? 117.969 135.160 103.389 1.00 1.00   ?  31  UNK C C   1 
ATOM 6045 O O   . UNK C 3 31  ? 117.769 133.977 103.128 1.00 1.00   ?  31  UNK C O   1 
ATOM 6046 C CB  . UNK C 3 31  ? 117.291 136.695 101.554 1.00 20.00  ?  31  UNK C CB  1 
ATOM 6047 N N   . UNK C 3 32  ? 119.038 135.580 104.055 1.00 1.00   ?  32  UNK C N   1 
ATOM 6048 C CA  . UNK C 3 32  ? 120.098 134.648 104.425 1.00 1.00   ?  32  UNK C CA  1 
ATOM 6049 C C   . UNK C 3 32  ? 120.032 134.256 105.888 1.00 1.00   ?  32  UNK C C   1 
ATOM 6050 O O   . UNK C 3 32  ? 120.208 133.090 106.232 1.00 1.00   ?  32  UNK C O   1 
ATOM 6051 C CB  . UNK C 3 32  ? 121.452 135.240 104.110 1.00 20.00  ?  32  UNK C CB  1 
ATOM 6052 N N   . UNK C 3 33  ? 119.789 135.230 106.753 1.00 1.00   ?  33  UNK C N   1 
ATOM 6053 C CA  . UNK C 3 33  ? 119.705 134.953 108.176 1.00 1.00   ?  33  UNK C CA  1 
ATOM 6054 C C   . UNK C 3 33  ? 118.505 134.081 108.479 1.00 1.00   ?  33  UNK C C   1 
ATOM 6055 O O   . UNK C 3 33  ? 118.479 133.380 109.483 1.00 1.00   ?  33  UNK C O   1 
ATOM 6056 C CB  . UNK C 3 33  ? 119.633 136.234 108.964 1.00 20.00  ?  33  UNK C CB  1 
ATOM 6057 N N   . UNK C 3 34  ? 117.502 134.133 107.613 1.00 1.00   ?  34  UNK C N   1 
ATOM 6058 C CA  . UNK C 3 34  ? 116.327 133.297 107.789 1.00 1.00   ?  34  UNK C CA  1 
ATOM 6059 C C   . UNK C 3 34  ? 116.324 132.157 106.785 1.00 1.00   ?  34  UNK C C   1 
ATOM 6060 O O   . UNK C 3 34  ? 115.518 132.124 105.859 1.00 1.00   ?  34  UNK C O   1 
ATOM 6061 C CB  . UNK C 3 34  ? 115.065 134.117 107.661 1.00 20.00  ?  34  UNK C CB  1 
ATOM 6062 N N   . UNK C 3 35  ? 117.245 131.225 106.971 1.00 1.00   ?  36  UNK C N   1 
ATOM 6063 C CA  . UNK C 3 35  ? 117.298 130.038 106.143 1.00 1.00   ?  36  UNK C CA  1 
ATOM 6064 C C   . UNK C 3 35  ? 118.015 128.964 106.924 1.00 1.00   ?  36  UNK C C   1 
ATOM 6065 O O   . UNK C 3 35  ? 117.971 127.783 106.586 1.00 1.00   ?  36  UNK C O   1 
ATOM 6066 C CB  . UNK C 3 35  ? 117.997 130.320 104.838 1.00 20.00  ?  36  UNK C CB  1 
ATOM 6067 N N   . UNK C 3 36  ? 118.669 129.393 107.991 1.00 1.00   ?  37  UNK C N   1 
ATOM 6068 C CA  . UNK C 3 36  ? 119.352 128.476 108.873 1.00 1.00   ?  37  UNK C CA  1 
ATOM 6069 C C   . UNK C 3 36  ? 118.362 127.529 109.525 1.00 1.00   ?  37  UNK C C   1 
ATOM 6070 O O   . UNK C 3 36  ? 118.715 126.409 109.870 1.00 1.00   ?  37  UNK C O   1 
ATOM 6071 C CB  . UNK C 3 36  ? 120.127 129.238 109.927 1.00 20.00  ?  37  UNK C CB  1 
ATOM 6072 N N   . UNK C 3 37  ? 117.119 127.975 109.670 1.00 1.00   ?  38  UNK C N   1 
ATOM 6073 C CA  . UNK C 3 37  ? 116.127 127.224 110.428 1.00 1.00   ?  38  UNK C CA  1 
ATOM 6074 C C   . UNK C 3 37  ? 115.934 125.850 109.830 1.00 1.00   ?  38  UNK C C   1 
ATOM 6075 O O   . UNK C 3 37  ? 115.646 124.887 110.540 1.00 1.00   ?  38  UNK C O   1 
ATOM 6076 C CB  . UNK C 3 37  ? 114.810 127.965 110.470 1.00 20.00  ?  38  UNK C CB  1 
ATOM 6077 N N   . UNK C 3 38  ? 116.109 125.757 108.522 1.00 30.00  ?  39  UNK C N   1 
ATOM 6078 C CA  . UNK C 3 38  ? 116.043 124.471 107.874 1.00 30.00  ?  39  UNK C CA  1 
ATOM 6079 C C   . UNK C 3 38  ? 117.160 123.583 108.403 1.00 30.00  ?  39  UNK C C   1 
ATOM 6080 O O   . UNK C 3 38  ? 116.923 122.436 108.781 1.00 30.00  ?  39  UNK C O   1 
ATOM 6081 C CB  . UNK C 3 38  ? 116.142 124.631 106.378 1.00 20.00  ?  39  UNK C CB  1 
ATOM 6082 N N   . UNK C 3 39  ? 118.371 124.125 108.468 1.00 20.00  ?  40  UNK C N   1 
ATOM 6083 C CA  . UNK C 3 39  ? 119.497 123.353 108.970 1.00 20.00  ?  40  UNK C CA  1 
ATOM 6084 C C   . UNK C 3 39  ? 119.272 122.986 110.425 1.00 20.00  ?  40  UNK C C   1 
ATOM 6085 O O   . UNK C 3 39  ? 119.688 121.924 110.876 1.00 20.00  ?  40  UNK C O   1 
ATOM 6086 C CB  . UNK C 3 39  ? 120.790 124.124 108.811 1.00 20.00  ?  40  UNK C CB  1 
ATOM 6087 N N   . UNK C 3 40  ? 118.595 123.865 111.153 1.00 20.00  ?  41  UNK C N   1 
ATOM 6088 C CA  . UNK C 3 40  ? 118.310 123.621 112.554 1.00 20.00  ?  41  UNK C CA  1 
ATOM 6089 C C   . UNK C 3 40  ? 117.386 122.429 112.689 1.00 20.00  ?  41  UNK C C   1 
ATOM 6090 O O   . UNK C 3 40  ? 117.605 121.545 113.515 1.00 20.00  ?  41  UNK C O   1 
ATOM 6091 C CB  . UNK C 3 40  ? 117.693 124.846 113.192 1.00 20.00  ?  41  UNK C CB  1 
ATOM 6092 N N   . UNK C 3 41  ? 116.360 122.396 111.852 1.00 20.00  ?  42  UNK C N   1 
ATOM 6093 C CA  . UNK C 3 41  ? 115.446 121.275 111.860 1.00 20.00  ?  42  UNK C CA  1 
ATOM 6094 C C   . UNK C 3 41  ? 116.191 120.014 111.473 1.00 20.00  ?  42  UNK C C   1 
ATOM 6095 O O   . UNK C 3 41  ? 115.917 118.933 111.992 1.00 20.00  ?  42  UNK C O   1 
ATOM 6096 C CB  . UNK C 3 41  ? 114.296 121.524 110.916 1.00 20.00  ?  42  UNK C CB  1 
ATOM 6097 N N   . UNK C 3 42  ? 117.158 120.167 110.578 1.00 20.00  ?  43  UNK C N   1 
ATOM 6098 C CA  . UNK C 3 42  ? 117.893 119.022 110.074 1.00 20.00  ?  43  UNK C CA  1 
ATOM 6099 C C   . UNK C 3 42  ? 118.684 118.392 111.197 1.00 20.00  ?  43  UNK C C   1 
ATOM 6100 O O   . UNK C 3 42  ? 118.584 117.188 111.447 1.00 20.00  ?  43  UNK C O   1 
ATOM 6101 C CB  . UNK C 3 42  ? 118.810 119.434 108.943 1.00 20.00  ?  43  UNK C CB  1 
ATOM 6102 N N   . UNK C 3 43  ? 119.437 119.225 111.903 1.00 20.00  ?  44  UNK C N   1 
ATOM 6103 C CA  . UNK C 3 43  ? 120.239 118.760 113.017 1.00 20.00  ?  44  UNK C CA  1 
ATOM 6104 C C   . UNK C 3 43  ? 119.336 118.203 114.100 1.00 20.00  ?  44  UNK C C   1 
ATOM 6105 O O   . UNK C 3 43  ? 119.705 117.271 114.812 1.00 20.00  ?  44  UNK C O   1 
ATOM 6106 C CB  . UNK C 3 43  ? 121.100 119.879 113.557 1.00 20.00  ?  44  UNK C CB  1 
ATOM 6107 N N   . UNK C 3 44  ? 118.134 118.759 114.200 1.00 20.00  ?  45  UNK C N   1 
ATOM 6108 C CA  . UNK C 3 44  ? 117.194 118.316 115.216 1.00 20.00  ?  45  UNK C CA  1 
ATOM 6109 C C   . UNK C 3 44  ? 116.732 116.891 114.958 1.00 20.00  ?  45  UNK C C   1 
ATOM 6110 O O   . UNK C 3 44  ? 116.978 115.995 115.766 1.00 20.00  ?  45  UNK C O   1 
ATOM 6111 C CB  . UNK C 3 44  ? 116.007 119.248 115.277 1.00 20.00  ?  45  UNK C CB  1 
ATOM 6112 N N   . UNK C 3 45  ? 116.076 116.678 113.824 1.00 20.00  ?  46  UNK C N   1 
ATOM 6113 C CA  . UNK C 3 45  ? 115.522 115.367 113.537 1.00 20.00  ?  46  UNK C CA  1 
ATOM 6114 C C   . UNK C 3 45  ? 116.633 114.340 113.436 1.00 20.00  ?  46  UNK C C   1 
ATOM 6115 O O   . UNK C 3 45  ? 116.478 113.191 113.862 1.00 20.00  ?  46  UNK C O   1 
ATOM 6116 C CB  . UNK C 3 45  ? 114.716 115.403 112.258 1.00 20.00  ?  46  UNK C CB  1 
ATOM 6117 N N   . UNK C 3 46  ? 117.774 114.765 112.910 1.00 20.00  ?  47  UNK C N   1 
ATOM 6118 C CA  . UNK C 3 46  ? 118.884 113.843 112.764 1.00 20.00  ?  47  UNK C CA  1 
ATOM 6119 C C   . UNK C 3 46  ? 119.396 113.403 114.126 1.00 20.00  ?  47  UNK C C   1 
ATOM 6120 O O   . UNK C 3 46  ? 119.636 112.213 114.358 1.00 20.00  ?  47  UNK C O   1 
ATOM 6121 C CB  . UNK C 3 46  ? 119.993 114.476 111.960 1.00 20.00  ?  47  UNK C CB  1 
ATOM 6122 N N   . UNK C 3 47  ? 119.542 114.357 115.038 1.00 20.00  ?  48  UNK C N   1 
ATOM 6123 C CA  . UNK C 3 47  ? 120.016 114.022 116.370 1.00 20.00  ?  48  UNK C CA  1 
ATOM 6124 C C   . UNK C 3 47  ? 119.000 113.138 117.069 1.00 20.00  ?  48  UNK C C   1 
ATOM 6125 O O   . UNK C 3 47  ? 119.363 112.253 117.842 1.00 20.00  ?  48  UNK C O   1 
ATOM 6126 C CB  . UNK C 3 47  ? 120.277 115.272 117.182 1.00 20.00  ?  48  UNK C CB  1 
ATOM 6127 N N   . UNK C 3 48  ? 117.724 113.364 116.782 1.00 30.00  ?  49  UNK C N   1 
ATOM 6128 C CA  . UNK C 3 48  ? 116.696 112.529 117.371 1.00 30.00  ?  49  UNK C CA  1 
ATOM 6129 C C   . UNK C 3 48  ? 116.873 111.112 116.872 1.00 30.00  ?  49  UNK C C   1 
ATOM 6130 O O   . UNK C 3 48  ? 116.641 110.156 117.606 1.00 30.00  ?  49  UNK C O   1 
ATOM 6131 C CB  . UNK C 3 48  ? 115.319 113.049 117.033 1.00 20.00  ?  49  UNK C CB  1 
ATOM 6132 N N   . UNK C 3 49  ? 117.318 110.980 115.628 1.00 20.00  ?  50  UNK C N   1 
ATOM 6133 C CA  . UNK C 3 49  ? 117.528 109.657 115.062 1.00 20.00  ?  50  UNK C CA  1 
ATOM 6134 C C   . UNK C 3 49  ? 118.711 108.964 115.713 1.00 20.00  ?  50  UNK C C   1 
ATOM 6135 O O   . UNK C 3 49  ? 118.617 107.799 116.106 1.00 20.00  ?  50  UNK C O   1 
ATOM 6136 C CB  . UNK C 3 49  ? 117.734 109.746 113.570 1.00 20.00  ?  50  UNK C CB  1 
ATOM 6137 N N   . UNK C 3 50  ? 119.822 109.681 115.840 1.00 20.00  ?  51  UNK C N   1 
ATOM 6138 C CA  . UNK C 3 50  ? 121.004 109.083 116.439 1.00 20.00  ?  51  UNK C CA  1 
ATOM 6139 C C   . UNK C 3 50  ? 120.726 108.704 117.887 1.00 20.00  ?  51  UNK C C   1 
ATOM 6140 O O   . UNK C 3 50  ? 121.258 107.720 118.395 1.00 20.00  ?  51  UNK C O   1 
ATOM 6141 C CB  . UNK C 3 50  ? 122.183 110.024 116.352 1.00 20.00  ?  51  UNK C CB  1 
ATOM 6142 N N   . UNK C 3 51  ? 119.885 109.491 118.548 1.00 20.00  ?  52  UNK C N   1 
ATOM 6143 C CA  . UNK C 3 51  ? 119.454 109.166 119.899 1.00 20.00  ?  52  UNK C CA  1 
ATOM 6144 C C   . UNK C 3 51  ? 118.553 107.939 119.909 1.00 20.00  ?  52  UNK C C   1 
ATOM 6145 O O   . UNK C 3 51  ? 118.585 107.135 120.842 1.00 20.00  ?  52  UNK C O   1 
ATOM 6146 C CB  . UNK C 3 51  ? 118.744 110.347 120.520 1.00 20.00  ?  52  UNK C CB  1 
ATOM 6147 N N   . UNK C 3 52  ? 117.744 107.795 118.864 1.00 20.00  ?  53  UNK C N   1 
ATOM 6148 C CA  . UNK C 3 52  ? 116.860 106.645 118.770 1.00 20.00  ?  53  UNK C CA  1 
ATOM 6149 C C   . UNK C 3 52  ? 117.699 105.393 118.641 1.00 20.00  ?  53  UNK C C   1 
ATOM 6150 O O   . UNK C 3 52  ? 117.358 104.343 119.178 1.00 20.00  ?  53  UNK C O   1 
ATOM 6151 C CB  . UNK C 3 52  ? 115.919 106.782 117.594 1.00 20.00  ?  53  UNK C CB  1 
ATOM 6152 N N   . UNK C 3 53  ? 118.811 105.516 117.928 1.00 30.00  ?  54  UNK C N   1 
ATOM 6153 C CA  . UNK C 3 53  ? 119.797 104.450 117.895 1.00 30.00  ?  54  UNK C CA  1 
ATOM 6154 C C   . UNK C 3 53  ? 120.458 104.287 119.260 1.00 30.00  ?  54  UNK C C   1 
ATOM 6155 O O   . UNK C 3 53  ? 120.844 103.185 119.644 1.00 30.00  ?  54  UNK C O   1 
ATOM 6156 C CB  . UNK C 3 53  ? 120.838 104.722 116.827 1.00 20.00  ?  54  UNK C CB  1 
ATOM 6157 N N   . UNK C 3 54  ? 120.582 105.388 119.995 1.00 30.00  ?  55  UNK C N   1 
ATOM 6158 C CA  . UNK C 3 54  ? 121.214 105.338 121.308 1.00 30.00  ?  55  UNK C CA  1 
ATOM 6159 C C   . UNK C 3 54  ? 120.358 104.537 122.266 1.00 30.00  ?  55  UNK C C   1 
ATOM 6160 O O   . UNK C 3 54  ? 120.857 103.979 123.238 1.00 30.00  ?  55  UNK C O   1 
ATOM 6161 C CB  . UNK C 3 54  ? 121.452 106.731 121.847 1.00 20.00  ?  55  UNK C CB  1 
ATOM 6162 N N   . UNK C 3 55  ? 119.063 104.487 121.988 1.00 30.00  ?  56  UNK C N   1 
ATOM 6163 C CA  . UNK C 3 55  ? 118.172 103.631 122.754 1.00 30.00  ?  56  UNK C CA  1 
ATOM 6164 C C   . UNK C 3 55  ? 118.573 102.175 122.567 1.00 30.00  ?  56  UNK C C   1 
ATOM 6165 O O   . UNK C 3 55  ? 118.370 101.344 123.449 1.00 30.00  ?  56  UNK C O   1 
ATOM 6166 C CB  . UNK C 3 55  ? 116.735 103.846 122.337 1.00 20.00  ?  56  UNK C CB  1 
ATOM 6167 N N   . UNK C 3 56  ? 119.152 101.877 121.409 1.00 30.00  ?  57  UNK C N   1 
ATOM 6168 C CA  . UNK C 3 56  ? 119.606 100.527 121.103 1.00 30.00  ?  57  UNK C CA  1 
ATOM 6169 C C   . UNK C 3 56  ? 121.099 100.374 121.382 1.00 30.00  ?  57  UNK C C   1 
ATOM 6170 O O   . UNK C 3 56  ? 121.628 99.262  121.399 1.00 30.00  ?  57  UNK C O   1 
ATOM 6171 C CB  . UNK C 3 56  ? 119.299 100.182 119.654 1.00 20.00  ?  57  UNK C CB  1 
ATOM 6172 N N   . UNK C 3 57  ? 130.568 97.560  114.761 1.00 30.00  ?  72  UNK C N   1 
ATOM 6173 C CA  . UNK C 3 57  ? 129.360 97.524  115.573 1.00 30.00  ?  72  UNK C CA  1 
ATOM 6174 C C   . UNK C 3 57  ? 128.713 98.900  115.662 1.00 30.00  ?  72  UNK C C   1 
ATOM 6175 O O   . UNK C 3 57  ? 128.108 99.372  114.703 1.00 30.00  ?  72  UNK C O   1 
ATOM 6176 C CB  . UNK C 3 57  ? 129.670 96.997  116.961 1.00 20.00  ?  72  UNK C CB  1 
ATOM 6177 N N   . UNK C 3 58  ? 128.841 99.537  116.819 1.00 30.00  ?  73  UNK C N   1 
ATOM 6178 C CA  . UNK C 3 58  ? 128.186 100.816 117.062 1.00 30.00  ?  73  UNK C CA  1 
ATOM 6179 C C   . UNK C 3 58  ? 128.705 101.940 116.166 1.00 30.00  ?  73  UNK C C   1 
ATOM 6180 O O   . UNK C 3 58  ? 127.959 102.861 115.818 1.00 30.00  ?  73  UNK C O   1 
ATOM 6181 C CB  . UNK C 3 58  ? 128.338 101.203 118.520 1.00 20.00  ?  73  UNK C CB  1 
ATOM 6182 N N   . UNK C 3 59  ? 129.978 101.871 115.793 1.00 30.00  ?  74  UNK C N   1 
ATOM 6183 C CA  . UNK C 3 59  ? 130.559 102.915 114.959 1.00 30.00  ?  74  UNK C CA  1 
ATOM 6184 C C   . UNK C 3 59  ? 129.848 102.938 113.624 1.00 30.00  ?  74  UNK C C   1 
ATOM 6185 O O   . UNK C 3 59  ? 129.628 103.995 113.031 1.00 30.00  ?  74  UNK C O   1 
ATOM 6186 C CB  . UNK C 3 59  ? 132.043 102.689 114.770 1.00 20.00  ?  74  UNK C CB  1 
ATOM 6187 N N   . UNK C 3 60  ? 129.462 101.755 113.169 1.00 30.00  ?  75  UNK C N   1 
ATOM 6188 C CA  . UNK C 3 60  ? 128.687 101.646 111.953 1.00 30.00  ?  75  UNK C CA  1 
ATOM 6189 C C   . UNK C 3 60  ? 127.326 102.283 112.163 1.00 30.00  ?  75  UNK C C   1 
ATOM 6190 O O   . UNK C 3 60  ? 126.758 102.855 111.240 1.00 30.00  ?  75  UNK C O   1 
ATOM 6191 N N   . UNK C 3 61  ? 126.807 102.192 113.383 1.00 30.00  ?  76  UNK C N   1 
ATOM 6192 C CA  . UNK C 3 61  ? 125.493 102.748 113.664 1.00 30.00  ?  76  UNK C CA  1 
ATOM 6193 C C   . UNK C 3 61  ? 125.551 104.253 113.546 1.00 30.00  ?  76  UNK C C   1 
ATOM 6194 O O   . UNK C 3 61  ? 124.681 104.877 112.933 1.00 30.00  ?  76  UNK C O   1 
ATOM 6195 C CB  . UNK C 3 61  ? 125.016 102.339 115.041 1.00 20.00  ?  76  UNK C CB  1 
ATOM 6196 N N   . UNK C 3 62  ? 126.606 104.834 114.106 1.00 20.00  ?  77  UNK C N   1 
ATOM 6197 C CA  . UNK C 3 62  ? 126.789 106.272 114.007 1.00 20.00  ?  77  UNK C CA  1 
ATOM 6198 C C   . UNK C 3 62  ? 127.012 106.653 112.554 1.00 20.00  ?  77  UNK C C   1 
ATOM 6199 O O   . UNK C 3 62  ? 126.608 107.727 112.114 1.00 20.00  ?  77  UNK C O   1 
ATOM 6200 C CB  . UNK C 3 62  ? 127.952 106.728 114.866 1.00 20.00  ?  77  UNK C CB  1 
ATOM 6201 N N   . UNK C 3 63  ? 127.638 105.752 111.805 1.00 20.00  ?  78  UNK C N   1 
ATOM 6202 C CA  . UNK C 3 63  ? 127.931 106.019 110.407 1.00 20.00  ?  78  UNK C CA  1 
ATOM 6203 C C   . UNK C 3 63  ? 126.648 106.116 109.602 1.00 20.00  ?  78  UNK C C   1 
ATOM 6204 O O   . UNK C 3 63  ? 126.440 107.064 108.844 1.00 20.00  ?  78  UNK C O   1 
ATOM 6205 C CB  . UNK C 3 63  ? 128.826 104.940 109.843 1.00 20.00  ?  78  UNK C CB  1 
ATOM 6206 N N   . UNK C 3 64  ? 125.782 105.131 109.786 1.00 20.00  ?  79  UNK C N   1 
ATOM 6207 C CA  . UNK C 3 64  ? 124.524 105.095 109.070 1.00 20.00  ?  79  UNK C CA  1 
ATOM 6208 C C   . UNK C 3 64  ? 123.672 106.265 109.494 1.00 20.00  ?  79  UNK C C   1 
ATOM 6209 O O   . UNK C 3 64  ? 122.947 106.840 108.683 1.00 20.00  ?  79  UNK C O   1 
ATOM 6210 C CB  . UNK C 3 64  ? 123.802 103.791 109.325 1.00 20.00  ?  79  UNK C CB  1 
ATOM 6211 N N   . UNK C 3 65  ? 123.779 106.631 110.766 1.00 30.00  ?  80  UNK C N   1 
ATOM 6212 C CA  . UNK C 3 65  ? 123.023 107.766 111.267 1.00 30.00  ?  80  UNK C CA  1 
ATOM 6213 C C   . UNK C 3 65  ? 123.506 109.018 110.558 1.00 30.00  ?  80  UNK C C   1 
ATOM 6214 O O   . UNK C 3 65  ? 122.722 109.915 110.240 1.00 30.00  ?  80  UNK C O   1 
ATOM 6215 N N   . UNK C 3 66  ? 124.802 109.048 110.273 1.00 20.00  ?  81  UNK C N   1 
ATOM 6216 C CA  . UNK C 3 66  ? 125.396 110.200 109.623 1.00 20.00  ?  81  UNK C CA  1 
ATOM 6217 C C   . UNK C 3 66  ? 124.909 110.308 108.194 1.00 20.00  ?  81  UNK C C   1 
ATOM 6218 O O   . UNK C 3 66  ? 124.464 111.367 107.755 1.00 20.00  ?  81  UNK C O   1 
ATOM 6219 C CB  . UNK C 3 66  ? 126.910 110.109 109.662 1.00 20.00  ?  81  UNK C CB  1 
ATOM 6220 N N   . UNK C 3 67  ? 124.978 109.197 107.473 1.00 20.00  ?  82  UNK C N   1 
ATOM 6221 C CA  . UNK C 3 67  ? 124.584 109.209 106.080 1.00 20.00  ?  82  UNK C CA  1 
ATOM 6222 C C   . UNK C 3 67  ? 123.114 109.552 105.952 1.00 20.00  ?  82  UNK C C   1 
ATOM 6223 O O   . UNK C 3 67  ? 122.714 110.284 105.051 1.00 20.00  ?  82  UNK C O   1 
ATOM 6224 C CB  . UNK C 3 67  ? 124.872 107.873 105.443 1.00 20.00  ?  82  UNK C CB  1 
ATOM 6225 N N   . UNK C 3 68  ? 122.313 109.038 106.874 1.00 20.00  ?  83  UNK C N   1 
ATOM 6226 C CA  . UNK C 3 68  ? 120.890 109.327 106.863 1.00 20.00  ?  83  UNK C CA  1 
ATOM 6227 C C   . UNK C 3 68  ? 120.644 110.789 107.165 1.00 20.00  ?  83  UNK C C   1 
ATOM 6228 O O   . UNK C 3 68  ? 119.707 111.394 106.650 1.00 20.00  ?  83  UNK C O   1 
ATOM 6229 C CB  . UNK C 3 68  ? 120.163 108.455 107.862 1.00 20.00  ?  83  UNK C CB  1 
ATOM 6230 N N   . UNK C 3 69  ? 121.506 111.357 107.997 1.00 20.00  ?  84  UNK C N   1 
ATOM 6231 C CA  . UNK C 3 69  ? 121.273 112.699 108.491 1.00 20.00  ?  84  UNK C CA  1 
ATOM 6232 C C   . UNK C 3 69  ? 121.327 113.747 107.391 1.00 20.00  ?  84  UNK C C   1 
ATOM 6233 O O   . UNK C 3 69  ? 120.409 114.554 107.251 1.00 20.00  ?  84  UNK C O   1 
ATOM 6234 C CB  . UNK C 3 69  ? 122.276 113.029 109.568 1.00 20.00  ?  84  UNK C CB  1 
ATOM 6235 N N   . UNK C 3 70  ? 122.391 113.720 106.599 1.00 20.00  ?  85  UNK C N   1 
ATOM 6236 C CA  . UNK C 3 70  ? 122.623 114.770 105.616 1.00 20.00  ?  85  UNK C CA  1 
ATOM 6237 C C   . UNK C 3 70  ? 121.519 114.805 104.575 1.00 20.00  ?  85  UNK C C   1 
ATOM 6238 O O   . UNK C 3 70  ? 121.153 115.869 104.073 1.00 20.00  ?  85  UNK C O   1 
ATOM 6239 C CB  . UNK C 3 70  ? 123.969 114.576 104.948 1.00 20.00  ?  85  UNK C CB  1 
ATOM 6240 N N   . UNK C 3 71  ? 120.980 113.633 104.270 1.00 20.00  ?  86  UNK C N   1 
ATOM 6241 C CA  . UNK C 3 71  ? 119.943 113.535 103.266 1.00 20.00  ?  86  UNK C CA  1 
ATOM 6242 C C   . UNK C 3 71  ? 118.726 114.313 103.716 1.00 20.00  ?  86  UNK C C   1 
ATOM 6243 O O   . UNK C 3 71  ? 118.061 114.967 102.911 1.00 20.00  ?  86  UNK C O   1 
ATOM 6244 C CB  . UNK C 3 71  ? 119.585 112.085 103.014 1.00 20.00  ?  86  UNK C CB  1 
ATOM 6245 N N   . UNK C 3 72  ? 118.459 114.272 105.015 1.00 20.00  ?  87  UNK C N   1 
ATOM 6246 C CA  . UNK C 3 72  ? 117.311 114.980 105.547 1.00 20.00  ?  87  UNK C CA  1 
ATOM 6247 C C   . UNK C 3 72  ? 117.521 116.464 105.356 1.00 20.00  ?  87  UNK C C   1 
ATOM 6248 O O   . UNK C 3 72  ? 116.590 117.200 105.026 1.00 20.00  ?  87  UNK C O   1 
ATOM 6249 C CB  . UNK C 3 72  ? 117.108 114.655 107.010 1.00 20.00  ?  87  UNK C CB  1 
ATOM 6250 N N   . UNK C 3 73  ? 118.765 116.892 105.527 1.00 30.00  ?  88  UNK C N   1 
ATOM 6251 C CA  . UNK C 3 73  ? 119.101 118.291 105.347 1.00 30.00  ?  88  UNK C CA  1 
ATOM 6252 C C   . UNK C 3 73  ? 118.916 118.671 103.894 1.00 30.00  ?  88  UNK C C   1 
ATOM 6253 O O   . UNK C 3 73  ? 118.531 119.794 103.579 1.00 30.00  ?  88  UNK C O   1 
ATOM 6254 C CB  . UNK C 3 73  ? 120.523 118.562 105.795 1.00 20.00  ?  88  UNK C CB  1 
ATOM 6255 N N   . UNK C 3 74  ? 119.174 117.718 103.009 1.00 30.00  ?  89  UNK C N   1 
ATOM 6256 C CA  . UNK C 3 74  ? 119.048 117.981 101.590 1.00 30.00  ?  89  UNK C CA  1 
ATOM 6257 C C   . UNK C 3 74  ? 117.591 118.173 101.208 1.00 30.00  ?  89  UNK C C   1 
ATOM 6258 O O   . UNK C 3 74  ? 117.236 119.142 100.536 1.00 30.00  ?  89  UNK C O   1 
ATOM 6259 C CB  . UNK C 3 74  ? 119.662 116.852 100.790 1.00 20.00  ?  89  UNK C CB  1 
ATOM 6260 N N   . UNK C 3 75  ? 116.744 117.251 101.649 1.00 20.00  ?  90  UNK C N   1 
ATOM 6261 C CA  . UNK C 3 75  ? 115.335 117.326 101.307 1.00 20.00  ?  90  UNK C CA  1 
ATOM 6262 C C   . UNK C 3 75  ? 114.711 118.564 101.923 1.00 20.00  ?  90  UNK C C   1 
ATOM 6263 O O   . UNK C 3 75  ? 113.873 119.225 101.306 1.00 20.00  ?  90  UNK C O   1 
ATOM 6264 C CB  . UNK C 3 75  ? 114.616 116.084 101.769 1.00 20.00  ?  90  UNK C CB  1 
ATOM 6265 N N   . UNK C 3 76  ? 115.150 118.892 103.134 1.00 20.00  ?  91  UNK C N   1 
ATOM 6266 C CA  . UNK C 3 76  ? 114.668 120.089 103.803 1.00 20.00  ?  91  UNK C CA  1 
ATOM 6267 C C   . UNK C 3 76  ? 115.148 121.320 103.058 1.00 20.00  ?  91  UNK C C   1 
ATOM 6268 O O   . UNK C 3 76  ? 114.494 122.358 103.064 1.00 20.00  ?  91  UNK C O   1 
ATOM 6269 C CB  . UNK C 3 76  ? 115.127 120.121 105.243 1.00 20.00  ?  91  UNK C CB  1 
ATOM 6270 N N   . UNK C 3 77  ? 116.298 121.193 102.410 1.00 20.00  ?  92  UNK C N   1 
ATOM 6271 C CA  . UNK C 3 77  ? 116.843 122.294 101.641 1.00 20.00  ?  92  UNK C CA  1 
ATOM 6272 C C   . UNK C 3 77  ? 115.999 122.528 100.402 1.00 20.00  ?  92  UNK C C   1 
ATOM 6273 O O   . UNK C 3 77  ? 115.658 123.664 100.074 1.00 20.00  ?  92  UNK C O   1 
ATOM 6274 C CB  . UNK C 3 77  ? 118.284 122.017 101.263 1.00 20.00  ?  92  UNK C CB  1 
ATOM 6275 N N   . UNK C 3 78  ? 115.646 121.444 99.723  1.00 20.00  ?  93  UNK C N   1 
ATOM 6276 C CA  . UNK C 3 78  ? 114.814 121.559 98.538  1.00 20.00  ?  93  UNK C CA  1 
ATOM 6277 C C   . UNK C 3 78  ? 113.469 122.132 98.936  1.00 20.00  ?  93  UNK C C   1 
ATOM 6278 O O   . UNK C 3 78  ? 112.860 122.908 98.197  1.00 20.00  ?  93  UNK C O   1 
ATOM 6279 C CB  . UNK C 3 78  ? 114.648 120.214 97.865  1.00 20.00  ?  93  UNK C CB  1 
ATOM 6280 N N   . UNK C 3 79  ? 113.017 121.760 100.126 1.00 20.00  ?  94  UNK C N   1 
ATOM 6281 C CA  . UNK C 3 79  ? 111.784 122.318 100.644 1.00 20.00  ?  94  UNK C CA  1 
ATOM 6282 C C   . UNK C 3 79  ? 111.944 123.808 100.884 1.00 20.00  ?  94  UNK C C   1 
ATOM 6283 O O   . UNK C 3 79  ? 111.014 124.585 100.670 1.00 20.00  ?  94  UNK C O   1 
ATOM 6284 C CB  . UNK C 3 79  ? 111.385 121.616 101.917 1.00 20.00  ?  94  UNK C CB  1 
ATOM 6285 N N   . UNK C 3 80  ? 113.137 124.208 101.309 1.00 20.00  ?  95  UNK C N   1 
ATOM 6286 C CA  . UNK C 3 80  ? 113.403 125.617 101.524 1.00 20.00  ?  95  UNK C CA  1 
ATOM 6287 C C   . UNK C 3 80  ? 113.327 126.336 100.197 1.00 20.00  ?  95  UNK C C   1 
ATOM 6288 O O   . UNK C 3 80  ? 112.907 127.486 100.124 1.00 20.00  ?  95  UNK C O   1 
ATOM 6289 C CB  . UNK C 3 80  ? 114.756 125.823 102.168 1.00 20.00  ?  95  UNK C CB  1 
ATOM 6290 N N   . UNK C 3 81  ? 113.730 125.641 99.140  1.00 20.00  ?  96  UNK C N   1 
ATOM 6291 C CA  . UNK C 3 81  ? 113.626 126.201 97.806  1.00 20.00  ?  96  UNK C CA  1 
ATOM 6292 C C   . UNK C 3 81  ? 112.168 126.355 97.417  1.00 20.00  ?  96  UNK C C   1 
ATOM 6293 O O   . UNK C 3 81  ? 111.793 127.331 96.774  1.00 20.00  ?  96  UNK C O   1 
ATOM 6294 C CB  . UNK C 3 81  ? 114.353 125.329 96.800  1.00 20.00  ?  96  UNK C CB  1 
ATOM 6295 N N   . UNK C 3 82  ? 111.346 125.389 97.811  1.00 20.00  ?  97  UNK C N   1 
ATOM 6296 C CA  . UNK C 3 82  ? 109.924 125.468 97.515  1.00 20.00  ?  97  UNK C CA  1 
ATOM 6297 C C   . UNK C 3 82  ? 109.294 126.642 98.244  1.00 20.00  ?  97  UNK C C   1 
ATOM 6298 O O   . UNK C 3 82  ? 108.399 127.305 97.722  1.00 20.00  ?  97  UNK C O   1 
ATOM 6299 C CB  . UNK C 3 82  ? 109.230 124.177 97.891  1.00 20.00  ?  97  UNK C CB  1 
ATOM 6300 N N   . UNK C 3 83  ? 109.786 126.912 99.446  1.00 20.00  ?  98  UNK C N   1 
ATOM 6301 C CA  . UNK C 3 83  ? 109.230 127.982 100.253 1.00 20.00  ?  98  UNK C CA  1 
ATOM 6302 C C   . UNK C 3 83  ? 109.654 129.325 99.701  1.00 20.00  ?  98  UNK C C   1 
ATOM 6303 O O   . UNK C 3 83  ? 108.856 130.255 99.613  1.00 20.00  ?  98  UNK C O   1 
ATOM 6304 C CB  . UNK C 3 83  ? 109.661 127.841 101.692 1.00 20.00  ?  98  UNK C CB  1 
ATOM 6305 N N   . UNK C 3 84  ? 110.923 129.424 99.335  1.00 30.00  ?  99  UNK C N   1 
ATOM 6306 C CA  . UNK C 3 84  ? 111.438 130.659 98.784  1.00 30.00  ?  99  UNK C CA  1 
ATOM 6307 C C   . UNK C 3 84  ? 110.756 130.944 97.460  1.00 30.00  ?  99  UNK C C   1 
ATOM 6308 O O   . UNK C 3 84  ? 110.500 132.094 97.117  1.00 30.00  ?  99  UNK C O   1 
ATOM 6309 C CB  . UNK C 3 84  ? 112.937 130.581 98.611  1.00 20.00  ?  99  UNK C CB  1 
ATOM 6310 N N   . UNK C 3 85  ? 110.457 129.887 96.716  1.00 30.00  ?  100 UNK C N   1 
ATOM 6311 C CA  . UNK C 3 85  ? 109.709 130.037 95.480  1.00 30.00  ?  100 UNK C CA  1 
ATOM 6312 C C   . UNK C 3 85  ? 108.297 130.493 95.793  1.00 30.00  ?  100 UNK C C   1 
ATOM 6313 O O   . UNK C 3 85  ? 107.689 131.244 95.033  1.00 30.00  ?  100 UNK C O   1 
ATOM 6314 C CB  . UNK C 3 85  ? 109.689 128.735 94.704  1.00 20.00  ?  100 UNK C CB  1 
ATOM 6315 N N   . UNK C 3 86  ? 107.785 130.041 96.932  1.00 30.00  ?  101 UNK C N   1 
ATOM 6316 C CA  . UNK C 3 86  ? 106.455 130.429 97.367  1.00 30.00  ?  101 UNK C CA  1 
ATOM 6317 C C   . UNK C 3 86  ? 106.436 131.892 97.775  1.00 30.00  ?  101 UNK C C   1 
ATOM 6318 O O   . UNK C 3 86  ? 105.390 132.535 97.765  1.00 30.00  ?  101 UNK C O   1 
ATOM 6319 C CB  . UNK C 3 86  ? 105.991 129.551 98.510  1.00 20.00  ?  101 UNK C CB  1 
ATOM 6320 N N   . UNK C 3 87  ? 107.604 132.416 98.128  1.00 30.00  ?  102 UNK C N   1 
ATOM 6321 C CA  . UNK C 3 87  ? 107.709 133.790 98.595  1.00 30.00  ?  102 UNK C CA  1 
ATOM 6322 C C   . UNK C 3 87  ? 107.333 134.770 97.497  1.00 30.00  ?  102 UNK C C   1 
ATOM 6323 O O   . UNK C 3 87  ? 106.922 135.894 97.775  1.00 30.00  ?  102 UNK C O   1 
ATOM 6324 C CB  . UNK C 3 87  ? 109.104 134.072 99.093  1.00 30.00  ?  102 UNK C CB  1 
ATOM 6325 N N   . UNK C 3 88  ? 107.482 134.336 96.251  1.00 30.00  ?  103 UNK C N   1 
ATOM 6326 C CA  . UNK C 3 88  ? 107.164 135.170 95.099  1.00 30.00  ?  103 UNK C CA  1 
ATOM 6327 C C   . UNK C 3 88  ? 105.692 135.571 95.080  1.00 30.00  ?  103 UNK C C   1 
ATOM 6328 O O   . UNK C 3 88  ? 105.365 136.757 95.045  1.00 30.00  ?  103 UNK C O   1 
ATOM 6329 C CB  . UNK C 3 88  ? 107.530 134.449 93.815  1.00 20.00  ?  103 UNK C CB  1 
ATOM 6330 N N   . UNK C 3 89  ? 117.486 139.579 92.642  1.00 20.00  ?  109 UNK C N   1 
ATOM 6331 C CA  . UNK C 3 89  ? 117.334 138.499 91.675  1.00 20.00  ?  109 UNK C CA  1 
ATOM 6332 C C   . UNK C 3 89  ? 116.991 137.199 92.376  1.00 20.00  ?  109 UNK C C   1 
ATOM 6333 O O   . UNK C 3 89  ? 117.386 136.980 93.519  1.00 20.00  ?  109 UNK C O   1 
ATOM 6334 C CB  . UNK C 3 89  ? 118.602 138.335 90.855  1.00 20.00  ?  109 UNK C CB  1 
ATOM 6335 N N   . UNK C 3 90  ? 116.250 136.337 91.692  1.00 20.00  ?  110 UNK C N   1 
ATOM 6336 C CA  . UNK C 3 90  ? 115.990 135.014 92.224  1.00 20.00  ?  110 UNK C CA  1 
ATOM 6337 C C   . UNK C 3 90  ? 117.321 134.302 92.336  1.00 20.00  ?  110 UNK C C   1 
ATOM 6338 O O   . UNK C 3 90  ? 117.542 133.499 93.241  1.00 20.00  ?  110 UNK C O   1 
ATOM 6339 C CB  . UNK C 3 90  ? 115.035 134.249 91.337  1.00 20.00  ?  110 UNK C CB  1 
ATOM 6340 N N   . UNK C 3 91  ? 118.217 134.617 91.408  1.00 20.00  ?  111 UNK C N   1 
ATOM 6341 C CA  . UNK C 3 91  ? 119.568 134.095 91.465  1.00 20.00  ?  111 UNK C CA  1 
ATOM 6342 C C   . UNK C 3 91  ? 120.269 134.617 92.703  1.00 20.00  ?  111 UNK C C   1 
ATOM 6343 O O   . UNK C 3 91  ? 121.014 133.893 93.366  1.00 20.00  ?  111 UNK C O   1 
ATOM 6344 C CB  . UNK C 3 91  ? 120.338 134.481 90.219  1.00 20.00  ?  111 UNK C CB  1 
ATOM 6345 N N   . UNK C 3 92  ? 120.007 135.876 93.028  1.00 20.00  ?  112 UNK C N   1 
ATOM 6346 C CA  . UNK C 3 92  ? 120.592 136.460 94.218  1.00 20.00  ?  112 UNK C CA  1 
ATOM 6347 C C   . UNK C 3 92  ? 120.047 135.741 95.437  1.00 20.00  ?  112 UNK C C   1 
ATOM 6348 O O   . UNK C 3 92  ? 120.758 135.527 96.418  1.00 20.00  ?  112 UNK C O   1 
ATOM 6349 C CB  . UNK C 3 92  ? 120.297 137.945 94.290  1.00 20.00  ?  112 UNK C CB  1 
ATOM 6350 N N   . UNK C 3 93  ? 118.785 135.339 95.355  1.00 20.00  ?  113 UNK C N   1 
ATOM 6351 C CA  . UNK C 3 93  ? 118.180 134.583 96.435  1.00 20.00  ?  113 UNK C CA  1 
ATOM 6352 C C   . UNK C 3 93  ? 118.875 133.238 96.564  1.00 20.00  ?  113 UNK C C   1 
ATOM 6353 O O   . UNK C 3 93  ? 119.064 132.721 97.668  1.00 20.00  ?  113 UNK C O   1 
ATOM 6354 C CB  . UNK C 3 93  ? 116.694 134.398 96.191  1.00 20.00  ?  113 UNK C CB  1 
ATOM 6355 N N   . UNK C 3 94  ? 119.287 132.690 95.429  1.00 20.00  ?  114 UNK C N   1 
ATOM 6356 C CA  . UNK C 3 94  ? 119.975 131.414 95.438  1.00 20.00  ?  114 UNK C CA  1 
ATOM 6357 C C   . UNK C 3 94  ? 121.322 131.554 96.117  1.00 20.00  ?  114 UNK C C   1 
ATOM 6358 O O   . UNK C 3 94  ? 121.710 130.706 96.917  1.00 20.00  ?  114 UNK C O   1 
ATOM 6359 C CB  . UNK C 3 94  ? 120.142 130.890 94.032  1.00 20.00  ?  114 UNK C CB  1 
ATOM 6360 N N   . UNK C 3 95  ? 122.022 132.641 95.816  1.00 20.00  ?  115 UNK C N   1 
ATOM 6361 C CA  . UNK C 3 95  ? 123.313 132.879 96.441  1.00 20.00  ?  115 UNK C CA  1 
ATOM 6362 C C   . UNK C 3 95  ? 123.114 133.086 97.925  1.00 20.00  ?  115 UNK C C   1 
ATOM 6363 O O   . UNK C 3 95  ? 123.967 132.727 98.734  1.00 20.00  ?  115 UNK C O   1 
ATOM 6364 C CB  . UNK C 3 95  ? 124.004 134.077 95.825  1.00 20.00  ?  115 UNK C CB  1 
ATOM 6365 N N   . UNK C 3 96  ? 121.964 133.642 98.283  1.00 20.00  ?  116 UNK C N   1 
ATOM 6366 C CA  . UNK C 3 96  ? 121.686 133.937 99.676  1.00 20.00  ?  116 UNK C CA  1 
ATOM 6367 C C   . UNK C 3 96  ? 121.473 132.667 100.479 1.00 20.00  ?  116 UNK C C   1 
ATOM 6368 O O   . UNK C 3 96  ? 122.168 132.419 101.468 1.00 20.00  ?  116 UNK C O   1 
ATOM 6369 C CB  . UNK C 3 96  ? 120.472 134.836 99.790  1.00 20.00  ?  116 UNK C CB  1 
ATOM 6370 N N   . UNK C 3 97  ? 120.520 131.852 100.047 1.00 30.00  ?  117 UNK C N   1 
ATOM 6371 C CA  . UNK C 3 97  ? 120.225 130.637 100.783 1.00 30.00  ?  117 UNK C CA  1 
ATOM 6372 C C   . UNK C 3 97  ? 121.417 129.699 100.740 1.00 30.00  ?  117 UNK C C   1 
ATOM 6373 O O   . UNK C 3 97  ? 121.728 129.023 101.724 1.00 30.00  ?  117 UNK C O   1 
ATOM 6374 C CB  . UNK C 3 97  ? 118.998 129.964 100.221 1.00 20.00  ?  117 UNK C CB  1 
ATOM 6375 N N   . UNK C 3 98  ? 122.107 129.697 99.607  1.00 20.00  ?  118 UNK C N   1 
ATOM 6376 C CA  . UNK C 3 98  ? 123.258 128.830 99.440  1.00 20.00  ?  118 UNK C CA  1 
ATOM 6377 C C   . UNK C 3 98  ? 124.348 129.246 100.410 1.00 20.00  ?  118 UNK C C   1 
ATOM 6378 O O   . UNK C 3 98  ? 125.044 128.405 100.973 1.00 20.00  ?  118 UNK C O   1 
ATOM 6379 N N   . UNK C 3 99  ? 124.489 130.548 100.617 1.00 20.00  ?  119 UNK C N   1 
ATOM 6380 C CA  . UNK C 3 99  ? 125.424 131.020 101.620 1.00 20.00  ?  119 UNK C CA  1 
ATOM 6381 C C   . UNK C 3 99  ? 124.960 130.630 103.012 1.00 20.00  ?  119 UNK C C   1 
ATOM 6382 O O   . UNK C 3 99  ? 125.775 130.361 103.885 1.00 20.00  ?  119 UNK C O   1 
ATOM 6383 C CB  . UNK C 3 99  ? 125.599 132.517 101.521 1.00 20.00  ?  119 UNK C CB  1 
ATOM 6384 N N   . UNK C 3 100 ? 123.648 130.586 103.218 1.00 20.00  ?  120 UNK C N   1 
ATOM 6385 C CA  . UNK C 3 100 ? 123.126 130.304 104.550 1.00 20.00  ?  120 UNK C CA  1 
ATOM 6386 C C   . UNK C 3 100 ? 123.433 128.874 104.965 1.00 20.00  ?  120 UNK C C   1 
ATOM 6387 O O   . UNK C 3 100 ? 124.021 128.627 106.025 1.00 20.00  ?  120 UNK C O   1 
ATOM 6388 C CB  . UNK C 3 100 ? 121.636 130.557 104.601 1.00 20.00  ?  120 UNK C CB  1 
ATOM 6389 N N   . UNK C 3 101 ? 123.064 127.933 104.106 1.00 20.00  ?  121 UNK C N   1 
ATOM 6390 C CA  . UNK C 3 101 ? 123.373 126.534 104.354 1.00 20.00  ?  121 UNK C CA  1 
ATOM 6391 C C   . UNK C 3 101 ? 124.875 126.349 104.275 1.00 20.00  ?  121 UNK C C   1 
ATOM 6392 O O   . UNK C 3 101 ? 125.423 125.381 104.789 1.00 20.00  ?  121 UNK C O   1 
ATOM 6393 C CB  . UNK C 3 101 ? 122.666 125.633 103.365 1.00 20.00  ?  121 UNK C CB  1 
ATOM 6394 N N   . UNK C 3 102 ? 125.531 127.290 103.610 1.00 20.00  ?  122 UNK C N   1 
ATOM 6395 C CA  . UNK C 3 102 ? 126.977 127.273 103.482 1.00 20.00  ?  122 UNK C CA  1 
ATOM 6396 C C   . UNK C 3 102 ? 127.646 127.830 104.729 1.00 20.00  ?  122 UNK C C   1 
ATOM 6397 O O   . UNK C 3 102 ? 128.870 127.800 104.854 1.00 20.00  ?  122 UNK C O   1 
ATOM 6398 N N   . UNK C 3 103 ? 126.847 128.351 105.649 1.00 20.00  ?  123 UNK C N   1 
ATOM 6399 C CA  . UNK C 3 103 ? 127.410 129.000 106.818 1.00 20.00  ?  123 UNK C CA  1 
ATOM 6400 C C   . UNK C 3 103 ? 127.079 128.250 108.084 1.00 20.00  ?  123 UNK C C   1 
ATOM 6401 O O   . UNK C 3 103 ? 127.972 127.839 108.812 1.00 20.00  ?  123 UNK C O   1 
ATOM 6402 C CB  . UNK C 3 103 ? 126.916 130.426 106.918 1.00 20.00  ?  123 UNK C CB  1 
ATOM 6403 N N   . UNK C 3 104 ? 125.789 128.063 108.329 1.00 20.00  ?  124 UNK C N   1 
ATOM 6404 C CA  . UNK C 3 104 ? 125.319 127.649 109.644 1.00 20.00  ?  124 UNK C CA  1 
ATOM 6405 C C   . UNK C 3 104 ? 125.974 126.377 110.172 1.00 20.00  ?  124 UNK C C   1 
ATOM 6406 O O   . UNK C 3 104 ? 126.814 126.434 111.077 1.00 20.00  ?  124 UNK C O   1 
ATOM 6407 C CB  . UNK C 3 104 ? 123.821 127.475 109.616 1.00 20.00  ?  124 UNK C CB  1 
ATOM 6408 N N   . UNK C 3 105 ? 125.598 125.233 109.611 1.00 20.00  ?  125 UNK C N   1 
ATOM 6409 C CA  . UNK C 3 105 ? 125.994 123.956 110.190 1.00 20.00  ?  125 UNK C CA  1 
ATOM 6410 C C   . UNK C 3 105 ? 127.506 123.781 110.172 1.00 20.00  ?  125 UNK C C   1 
ATOM 6411 O O   . UNK C 3 105 ? 128.104 123.246 111.122 1.00 20.00  ?  125 UNK C O   1 
ATOM 6412 C CB  . UNK C 3 105 ? 125.317 122.814 109.454 1.00 20.00  ?  125 UNK C CB  1 
ATOM 6413 N N   . UNK C 3 106 ? 128.132 124.280 109.117 1.00 20.00  ?  126 UNK C N   1 
ATOM 6414 C CA  . UNK C 3 106 ? 129.573 124.189 109.024 1.00 20.00  ?  126 UNK C CA  1 
ATOM 6415 C C   . UNK C 3 106 ? 130.186 124.980 110.166 1.00 20.00  ?  126 UNK C C   1 
ATOM 6416 O O   . UNK C 3 106 ? 131.164 124.551 110.773 1.00 20.00  ?  126 UNK C O   1 
ATOM 6417 N N   . UNK C 3 107 ? 129.583 126.120 110.482 1.00 30.00  ?  127 UNK C N   1 
ATOM 6418 C CA  . UNK C 3 107 ? 130.076 126.943 111.573 1.00 30.00  ?  127 UNK C CA  1 
ATOM 6419 C C   . UNK C 3 107 ? 129.886 126.220 112.883 1.00 30.00  ?  127 UNK C C   1 
ATOM 6420 O O   . UNK C 3 107 ? 130.682 126.378 113.802 1.00 30.00  ?  127 UNK C O   1 
ATOM 6421 C CB  . UNK C 3 107 ? 129.376 128.284 111.603 1.00 20.00  ?  127 UNK C CB  1 
ATOM 6422 N N   . UNK C 3 108 ? 128.836 125.413 112.964 1.00 20.00  ?  128 UNK C N   1 
ATOM 6423 C CA  . UNK C 3 108 ? 128.606 124.656 114.179 1.00 20.00  ?  128 UNK C CA  1 
ATOM 6424 C C   . UNK C 3 108 ? 129.755 123.683 114.382 1.00 20.00  ?  128 UNK C C   1 
ATOM 6425 O O   . UNK C 3 108 ? 130.355 123.621 115.462 1.00 20.00  ?  128 UNK C O   1 
ATOM 6426 C CB  . UNK C 3 108 ? 127.281 123.924 114.119 1.00 20.00  ?  128 UNK C CB  1 
ATOM 6427 N N   . UNK C 3 109 ? 130.099 122.956 113.327 1.00 20.00  ?  129 UNK C N   1 
ATOM 6428 C CA  . UNK C 3 109 ? 131.167 121.974 113.446 1.00 20.00  ?  129 UNK C CA  1 
ATOM 6429 C C   . UNK C 3 109 ? 132.509 122.637 113.742 1.00 20.00  ?  129 UNK C C   1 
ATOM 6430 O O   . UNK C 3 109 ? 133.234 122.247 114.671 1.00 20.00  ?  129 UNK C O   1 
ATOM 6431 C CB  . UNK C 3 109 ? 131.260 121.151 112.183 1.00 20.00  ?  129 UNK C CB  1 
ATOM 6432 N N   . UNK C 3 110 ? 132.824 123.659 112.959 1.00 30.00  ?  130 UNK C N   1 
ATOM 6433 C CA  . UNK C 3 110 ? 134.114 124.319 113.063 1.00 30.00  ?  130 UNK C CA  1 
ATOM 6434 C C   . UNK C 3 110 ? 134.277 124.983 114.414 1.00 30.00  ?  130 UNK C C   1 
ATOM 6435 O O   . UNK C 3 110 ? 135.378 125.060 114.936 1.00 30.00  ?  130 UNK C O   1 
ATOM 6436 C CB  . UNK C 3 110 ? 134.277 125.334 111.957 1.00 20.00  ?  130 UNK C CB  1 
ATOM 6437 N N   . UNK C 3 111 ? 133.179 125.468 114.978 1.00 30.00  ?  131 UNK C N   1 
ATOM 6438 C CA  . UNK C 3 111 ? 133.232 125.995 116.328 1.00 30.00  ?  131 UNK C CA  1 
ATOM 6439 C C   . UNK C 3 111 ? 133.510 124.858 117.281 1.00 30.00  ?  131 UNK C C   1 
ATOM 6440 O O   . UNK C 3 111 ? 134.310 124.987 118.212 1.00 30.00  ?  131 UNK C O   1 
ATOM 6441 C CB  . UNK C 3 111 ? 131.939 126.686 116.692 1.00 20.00  ?  131 UNK C CB  1 
ATOM 6442 N N   . UNK C 3 112 ? 132.878 123.722 117.008 1.00 30.00  ?  132 UNK C N   1 
ATOM 6443 C CA  . UNK C 3 112 ? 132.982 122.588 117.905 1.00 30.00  ?  132 UNK C CA  1 
ATOM 6444 C C   . UNK C 3 112 ? 134.414 122.086 118.000 1.00 30.00  ?  132 UNK C C   1 
ATOM 6445 O O   . UNK C 3 112 ? 134.821 121.579 119.040 1.00 30.00  ?  132 UNK C O   1 
ATOM 6446 C CB  . UNK C 3 112 ? 132.062 121.477 117.459 1.00 20.00  ?  132 UNK C CB  1 
ATOM 6447 N N   . UNK C 3 113 ? 135.185 122.224 116.928 1.00 30.00  ?  133 UNK C N   1 
ATOM 6448 C CA  . UNK C 3 113 ? 136.593 121.831 116.999 1.00 30.00  ?  133 UNK C CA  1 
ATOM 6449 C C   . UNK C 3 113 ? 137.501 122.972 117.455 1.00 30.00  ?  133 UNK C C   1 
ATOM 6450 O O   . UNK C 3 113 ? 138.449 122.773 118.227 1.00 30.00  ?  133 UNK C O   1 
ATOM 6451 C CB  . UNK C 3 113 ? 137.058 121.311 115.660 1.00 20.00  ?  133 UNK C CB  1 
ATOM 6452 N N   . UNK C 3 114 ? 137.203 124.173 116.976 1.00 30.00  ?  134 UNK C N   1 
ATOM 6453 C CA  . UNK C 3 114 ? 138.059 125.320 117.231 1.00 30.00  ?  134 UNK C CA  1 
ATOM 6454 C C   . UNK C 3 114 ? 138.072 125.646 118.705 1.00 30.00  ?  134 UNK C C   1 
ATOM 6455 O O   . UNK C 3 114 ? 139.037 126.208 119.214 1.00 30.00  ?  134 UNK C O   1 
ATOM 6456 C CB  . UNK C 3 114 ? 137.607 126.524 116.431 1.00 20.00  ?  134 UNK C CB  1 
ATOM 6457 N N   . UNK C 3 115 ? 136.994 125.299 119.395 1.00 30.00  ?  135 UNK C N   1 
ATOM 6458 C CA  . UNK C 3 115 ? 136.964 125.505 120.830 1.00 30.00  ?  135 UNK C CA  1 
ATOM 6459 C C   . UNK C 3 115 ? 138.048 124.657 121.474 1.00 30.00  ?  135 UNK C C   1 
ATOM 6460 O O   . UNK C 3 115 ? 138.647 125.046 122.474 1.00 30.00  ?  135 UNK C O   1 
ATOM 6461 C CB  . UNK C 3 115 ? 135.601 125.160 121.393 1.00 30.00  ?  135 UNK C CB  1 
ATOM 6462 N N   . UNK C 3 116 ? 138.307 123.500 120.880 1.00 30.00  ?  136 UNK C N   1 
ATOM 6463 C CA  . UNK C 3 116 ? 139.354 122.620 121.367 1.00 30.00  ?  136 UNK C CA  1 
ATOM 6464 C C   . UNK C 3 116 ? 140.694 122.991 120.752 1.00 30.00  ?  136 UNK C C   1 
ATOM 6465 O O   . UNK C 3 116 ? 141.728 122.452 121.134 1.00 30.00  ?  136 UNK C O   1 
ATOM 6466 C CB  . UNK C 3 116 ? 139.012 121.172 121.070 1.00 20.00  ?  136 UNK C CB  1 
ATOM 6467 N N   . UNK C 3 117 ? 140.679 123.929 119.813 1.00 30.00  ?  137 UNK C N   1 
ATOM 6468 C CA  . UNK C 3 117 ? 141.902 124.291 119.101 1.00 30.00  ?  137 UNK C CA  1 
ATOM 6469 C C   . UNK C 3 117 ? 142.841 125.134 119.954 1.00 30.00  ?  137 UNK C C   1 
ATOM 6470 O O   . UNK C 3 117 ? 143.964 125.416 119.551 1.00 30.00  ?  137 UNK C O   1 
ATOM 6471 C CB  . UNK C 3 117 ? 141.572 125.023 117.825 1.00 30.00  ?  137 UNK C CB  1 
ATOM 6472 N N   . UNK C 3 118 ? 142.378 125.537 121.127 1.00 30.00  ?  138 UNK C N   1 
ATOM 6473 C CA  . UNK C 3 118 ? 143.166 126.391 121.999 1.00 30.00  ?  138 UNK C CA  1 
ATOM 6474 C C   . UNK C 3 118 ? 144.443 125.687 122.440 1.00 30.00  ?  138 UNK C C   1 
ATOM 6475 O O   . UNK C 3 118 ? 144.496 124.463 122.497 1.00 30.00  ?  138 UNK C O   1 
ATOM 6476 C CB  . UNK C 3 118 ? 142.348 126.817 123.201 1.00 30.00  ?  138 UNK C CB  1 
ATOM 6477 N N   . UNK C 3 119 ? 145.466 126.481 122.739 1.00 30.00  ?  139 UNK C N   1 
ATOM 6478 C CA  . UNK C 3 119 ? 146.827 126.001 122.980 1.00 30.00  ?  139 UNK C CA  1 
ATOM 6479 C C   . UNK C 3 119 ? 146.926 124.962 124.101 1.00 30.00  ?  139 UNK C C   1 
ATOM 6480 O O   . UNK C 3 119 ? 146.193 125.038 125.083 1.00 30.00  ?  139 UNK C O   1 
ATOM 6481 C CB  . UNK C 3 119 ? 147.727 127.192 123.295 1.00 30.00  ?  139 UNK C CB  1 
ATOM 6482 N N   . UNK C 3 120 ? 147.828 123.992 123.953 1.00 30.00  ?  140 UNK C N   1 
ATOM 6483 C CA  . UNK C 3 120 ? 148.773 123.949 122.841 1.00 30.00  ?  140 UNK C CA  1 
ATOM 6484 C C   . UNK C 3 120 ? 148.961 122.546 122.277 1.00 30.00  ?  140 UNK C C   1 
ATOM 6485 O O   . UNK C 3 120 ? 150.019 122.227 121.742 1.00 30.00  ?  140 UNK C O   1 
ATOM 6486 C CB  . UNK C 3 120 ? 150.110 124.512 123.280 1.00 30.00  ?  140 UNK C CB  1 
ATOM 6487 N N   . UNK C 3 121 ? 147.933 121.713 122.383 1.00 30.00  ?  141 UNK C N   1 
ATOM 6488 C CA  . UNK C 3 121 ? 148.026 120.327 121.934 1.00 30.00  ?  141 UNK C CA  1 
ATOM 6489 C C   . UNK C 3 121 ? 148.273 120.230 120.436 1.00 30.00  ?  141 UNK C C   1 
ATOM 6490 O O   . UNK C 3 121 ? 147.765 121.034 119.664 1.00 30.00  ?  141 UNK C O   1 
ATOM 6491 C CB  . UNK C 3 121 ? 146.764 119.569 122.304 1.00 30.00  ?  141 UNK C CB  1 
ATOM 6492 N N   . UNK C 3 122 ? 149.073 119.254 120.028 1.00 30.00  ?  142 UNK C N   1 
ATOM 6493 C CA  . UNK C 3 122 ? 149.320 119.035 118.612 1.00 30.00  ?  142 UNK C CA  1 
ATOM 6494 C C   . UNK C 3 122 ? 148.764 117.702 118.145 1.00 30.00  ?  142 UNK C C   1 
ATOM 6495 O O   . UNK C 3 122 ? 149.012 117.288 117.017 1.00 30.00  ?  142 UNK C O   1 
ATOM 6496 C CB  . UNK C 3 122 ? 150.796 119.112 118.323 1.00 30.00  ?  142 UNK C CB  1 
ATOM 6497 N N   . UNK C 3 123 ? 148.017 117.042 119.022 1.00 30.00  ?  143 UNK C N   1 
ATOM 6498 C CA  . UNK C 3 123 ? 147.478 115.714 118.756 1.00 30.00  ?  143 UNK C CA  1 
ATOM 6499 C C   . UNK C 3 123 ? 148.579 114.737 118.358 1.00 30.00  ?  143 UNK C C   1 
ATOM 6500 O O   . UNK C 3 123 ? 148.744 113.687 118.975 1.00 30.00  ?  143 UNK C O   1 
ATOM 6501 C CB  . UNK C 3 123 ? 146.411 115.780 117.680 1.00 30.00  ?  143 UNK C CB  1 
ATOM 6502 N N   . UNK C 3 124 ? 148.544 118.762 112.135 1.00 20.00  ?  150 UNK C N   1 
ATOM 6503 C CA  . UNK C 3 124 ? 147.736 117.568 111.937 1.00 20.00  ?  150 UNK C CA  1 
ATOM 6504 C C   . UNK C 3 124 ? 146.245 117.886 112.026 1.00 20.00  ?  150 UNK C C   1 
ATOM 6505 O O   . UNK C 3 124 ? 145.482 117.543 111.129 1.00 20.00  ?  150 UNK C O   1 
ATOM 6506 C CB  . UNK C 3 124 ? 148.115 116.501 112.946 1.00 20.00  ?  150 UNK C CB  1 
ATOM 6507 N N   . UNK C 3 125 ? 145.828 118.549 113.097 1.00 20.00  ?  151 UNK C N   1 
ATOM 6508 C CA  . UNK C 3 125 ? 144.420 118.887 113.267 1.00 20.00  ?  151 UNK C CA  1 
ATOM 6509 C C   . UNK C 3 125 ? 144.034 120.034 112.353 1.00 20.00  ?  151 UNK C C   1 
ATOM 6510 O O   . UNK C 3 125 ? 142.856 120.319 112.163 1.00 20.00  ?  151 UNK C O   1 
ATOM 6511 C CB  . UNK C 3 125 ? 144.126 119.241 114.704 1.00 20.00  ?  151 UNK C CB  1 
ATOM 6512 N N   . UNK C 3 126 ? 145.038 120.682 111.779 1.00 20.00  ?  152 UNK C N   1 
ATOM 6513 C CA  . UNK C 3 126 ? 144.834 121.876 110.970 1.00 20.00  ?  152 UNK C CA  1 
ATOM 6514 C C   . UNK C 3 126 ? 143.960 121.616 109.752 1.00 20.00  ?  152 UNK C C   1 
ATOM 6515 O O   . UNK C 3 126 ? 143.313 122.525 109.234 1.00 20.00  ?  152 UNK C O   1 
ATOM 6516 C CB  . UNK C 3 126 ? 146.168 122.437 110.533 1.00 20.00  ?  152 UNK C CB  1 
ATOM 6517 N N   . UNK C 3 127 ? 143.937 120.368 109.308 1.00 20.00  ?  153 UNK C N   1 
ATOM 6518 C CA  . UNK C 3 127 ? 143.251 120.008 108.079 1.00 20.00  ?  153 UNK C CA  1 
ATOM 6519 C C   . UNK C 3 127 ? 141.772 120.320 108.169 1.00 20.00  ?  153 UNK C C   1 
ATOM 6520 O O   . UNK C 3 127 ? 141.113 120.581 107.158 1.00 20.00  ?  153 UNK C O   1 
ATOM 6521 C CB  . UNK C 3 127 ? 143.459 118.538 107.777 1.00 20.00  ?  153 UNK C CB  1 
ATOM 6522 N N   . UNK C 3 128 ? 141.260 120.316 109.391 1.00 20.00  ?  154 UNK C N   1 
ATOM 6523 C CA  . UNK C 3 128 ? 139.842 120.503 109.602 1.00 20.00  ?  154 UNK C CA  1 
ATOM 6524 C C   . UNK C 3 128 ? 139.391 121.833 109.032 1.00 20.00  ?  154 UNK C C   1 
ATOM 6525 O O   . UNK C 3 128 ? 138.261 121.964 108.575 1.00 20.00  ?  154 UNK C O   1 
ATOM 6526 C CB  . UNK C 3 128 ? 139.514 120.421 111.073 1.00 20.00  ?  154 UNK C CB  1 
ATOM 6527 N N   . UNK C 3 129 ? 140.281 122.815 109.042 1.00 20.00  ?  155 UNK C N   1 
ATOM 6528 C CA  . UNK C 3 129 ? 139.943 124.124 108.506 1.00 20.00  ?  155 UNK C CA  1 
ATOM 6529 C C   . UNK C 3 129 ? 139.732 124.067 107.003 1.00 20.00  ?  155 UNK C C   1 
ATOM 6530 O O   . UNK C 3 129 ? 138.686 124.485 106.487 1.00 20.00  ?  155 UNK C O   1 
ATOM 6531 C CB  . UNK C 3 129 ? 141.029 125.119 108.840 1.00 20.00  ?  155 UNK C CB  1 
ATOM 6532 N N   . UNK C 3 130 ? 140.723 123.519 106.308 1.00 20.00  ?  156 UNK C N   1 
ATOM 6533 C CA  . UNK C 3 130 ? 140.683 123.476 104.860 1.00 20.00  ?  156 UNK C CA  1 
ATOM 6534 C C   . UNK C 3 130 ? 139.482 122.665 104.433 1.00 20.00  ?  156 UNK C C   1 
ATOM 6535 O O   . UNK C 3 130 ? 138.837 122.973 103.437 1.00 20.00  ?  156 UNK C O   1 
ATOM 6536 C CB  . UNK C 3 130 ? 141.961 122.881 104.304 1.00 20.00  ?  156 UNK C CB  1 
ATOM 6537 N N   . UNK C 3 131 ? 139.163 121.640 105.210 1.00 20.00  ?  157 UNK C N   1 
ATOM 6538 C CA  . UNK C 3 131 ? 137.955 120.893 104.937 1.00 20.00  ?  157 UNK C CA  1 
ATOM 6539 C C   . UNK C 3 131 ? 136.738 121.768 105.172 1.00 20.00  ?  157 UNK C C   1 
ATOM 6540 O O   . UNK C 3 131 ? 135.751 121.688 104.439 1.00 20.00  ?  157 UNK C O   1 
ATOM 6541 C CB  . UNK C 3 131 ? 137.890 119.660 105.796 1.00 20.00  ?  157 UNK C CB  1 
ATOM 6542 N N   . UNK C 3 132 ? 136.825 122.639 106.168 1.00 20.00  ?  158 UNK C N   1 
ATOM 6543 C CA  . UNK C 3 132 ? 135.644 123.361 106.617 1.00 20.00  ?  158 UNK C CA  1 
ATOM 6544 C C   . UNK C 3 132 ? 135.207 124.382 105.588 1.00 20.00  ?  158 UNK C C   1 
ATOM 6545 O O   . UNK C 3 132 ? 134.038 124.416 105.175 1.00 20.00  ?  158 UNK C O   1 
ATOM 6546 C CB  . UNK C 3 132 ? 135.908 124.033 107.941 1.00 20.00  ?  158 UNK C CB  1 
ATOM 6547 N N   . UNK C 3 133 ? 136.153 125.202 105.150 1.00 20.00  ?  159 UNK C N   1 
ATOM 6548 C CA  . UNK C 3 133 ? 135.816 126.249 104.200 1.00 20.00  ?  159 UNK C CA  1 
ATOM 6549 C C   . UNK C 3 133 ? 135.324 125.619 102.910 1.00 20.00  ?  159 UNK C C   1 
ATOM 6550 O O   . UNK C 3 133 ? 134.430 126.143 102.237 1.00 20.00  ?  159 UNK C O   1 
ATOM 6551 C CB  . UNK C 3 133 ? 137.011 127.139 103.943 1.00 20.00  ?  159 UNK C CB  1 
ATOM 6552 N N   . UNK C 3 134 ? 135.894 124.467 102.588 1.00 20.00  ?  160 UNK C N   1 
ATOM 6553 C CA  . UNK C 3 134 ? 135.469 123.747 101.412 1.00 20.00  ?  160 UNK C CA  1 
ATOM 6554 C C   . UNK C 3 134 ? 134.034 123.292 101.580 1.00 20.00  ?  160 UNK C C   1 
ATOM 6555 O O   . UNK C 3 134 ? 133.272 123.282 100.621 1.00 20.00  ?  160 UNK C O   1 
ATOM 6556 C CB  . UNK C 3 134 ? 136.373 122.569 101.156 1.00 20.00  ?  160 UNK C CB  1 
ATOM 6557 N N   . UNK C 3 135 ? 133.655 122.939 102.804 1.00 20.00  ?  161 UNK C N   1 
ATOM 6558 C CA  . UNK C 3 135 ? 132.267 122.587 103.054 1.00 20.00  ?  161 UNK C CA  1 
ATOM 6559 C C   . UNK C 3 135 ? 131.384 123.800 102.840 1.00 20.00  ?  161 UNK C C   1 
ATOM 6560 O O   . UNK C 3 135 ? 130.257 123.680 102.350 1.00 20.00  ?  161 UNK C O   1 
ATOM 6561 C CB  . UNK C 3 135 ? 132.091 122.046 104.450 1.00 20.00  ?  161 UNK C CB  1 
ATOM 6562 N N   . UNK C 3 136 ? 131.907 124.974 103.176 1.00 20.00  ?  162 UNK C N   1 
ATOM 6563 C CA  . UNK C 3 136 ? 131.126 126.192 103.007 1.00 20.00  ?  162 UNK C CA  1 
ATOM 6564 C C   . UNK C 3 136 ? 130.851 126.450 101.536 1.00 20.00  ?  162 UNK C C   1 
ATOM 6565 O O   . UNK C 3 136 ? 129.701 126.618 101.119 1.00 20.00  ?  162 UNK C O   1 
ATOM 6566 C CB  . UNK C 3 136 ? 131.841 127.369 103.622 1.00 20.00  ?  162 UNK C CB  1 
ATOM 6567 N N   . UNK C 3 137 ? 131.913 126.443 100.742 1.00 20.00  ?  163 UNK C N   1 
ATOM 6568 C CA  . UNK C 3 137 ? 131.770 126.700 99.318  1.00 20.00  ?  163 UNK C CA  1 
ATOM 6569 C C   . UNK C 3 137 ? 130.921 125.630 98.660  1.00 20.00  ?  163 UNK C C   1 
ATOM 6570 O O   . UNK C 3 137 ? 130.155 125.911 97.743  1.00 20.00  ?  163 UNK C O   1 
ATOM 6571 C CB  . UNK C 3 137 ? 133.127 126.777 98.656  1.00 20.00  ?  163 UNK C CB  1 
ATOM 6572 N N   . UNK C 3 138 ? 131.049 124.403 99.141  1.00 20.00  ?  164 UNK C N   1 
ATOM 6573 C CA  . UNK C 3 138 ? 130.333 123.302 98.532  1.00 20.00  ?  164 UNK C CA  1 
ATOM 6574 C C   . UNK C 3 138 ? 128.852 123.460 98.766  1.00 20.00  ?  164 UNK C C   1 
ATOM 6575 O O   . UNK C 3 138 ? 128.065 123.377 97.826  1.00 20.00  ?  164 UNK C O   1 
ATOM 6576 C CB  . UNK C 3 138 ? 130.813 121.986 99.075  1.00 20.00  ?  164 UNK C CB  1 
ATOM 6577 N N   . UNK C 3 139 ? 128.468 123.716 100.011 1.00 20.00  ?  165 UNK C N   1 
ATOM 6578 C CA  . UNK C 3 139 ? 127.055 123.873 100.306 1.00 20.00  ?  165 UNK C CA  1 
ATOM 6579 C C   . UNK C 3 139 ? 126.530 125.076 99.548  1.00 20.00  ?  165 UNK C C   1 
ATOM 6580 O O   . UNK C 3 139 ? 125.387 125.087 99.082  1.00 20.00  ?  165 UNK C O   1 
ATOM 6581 C CB  . UNK C 3 139 ? 126.824 124.029 101.791 1.00 20.00  ?  165 UNK C CB  1 
ATOM 6582 N N   . UNK C 3 140 ? 127.393 126.070 99.379  1.00 30.00  ?  166 UNK C N   1 
ATOM 6583 C CA  . UNK C 3 140 ? 127.001 127.278 98.678  1.00 30.00  ?  166 UNK C CA  1 
ATOM 6584 C C   . UNK C 3 140 ? 126.643 126.973 97.230  1.00 30.00  ?  166 UNK C C   1 
ATOM 6585 O O   . UNK C 3 140 ? 125.473 127.035 96.834  1.00 30.00  ?  166 UNK C O   1 
ATOM 6586 C CB  . UNK C 3 140 ? 128.107 128.303 98.742  1.00 20.00  ?  166 UNK C CB  1 
ATOM 6587 N N   . UNK C 3 141 ? 127.655 126.612 96.452  1.00 20.00  ?  167 UNK C N   1 
ATOM 6588 C CA  . UNK C 3 141 ? 127.469 126.436 95.025  1.00 20.00  ?  167 UNK C CA  1 
ATOM 6589 C C   . UNK C 3 141 ? 126.454 125.344 94.744  1.00 20.00  ?  167 UNK C C   1 
ATOM 6590 O O   . UNK C 3 141 ? 125.675 125.456 93.798  1.00 20.00  ?  167 UNK C O   1 
ATOM 6591 C CB  . UNK C 3 141 ? 128.792 126.112 94.356  1.00 20.00  ?  167 UNK C CB  1 
ATOM 6592 N N   . UNK C 3 142 ? 126.433 124.307 95.576  1.00 20.00  ?  168 UNK C N   1 
ATOM 6593 C CA  . UNK C 3 142 ? 125.451 123.252 95.382  1.00 20.00  ?  168 UNK C CA  1 
ATOM 6594 C C   . UNK C 3 142 ? 124.064 123.818 95.586  1.00 20.00  ?  168 UNK C C   1 
ATOM 6595 O O   . UNK C 3 142 ? 123.128 123.465 94.866  1.00 20.00  ?  168 UNK C O   1 
ATOM 6596 C CB  . UNK C 3 142 ? 125.691 122.098 96.329  1.00 20.00  ?  168 UNK C CB  1 
ATOM 6597 N N   . UNK C 3 143 ? 123.942 124.731 96.543  1.00 20.00  ?  169 UNK C N   1 
ATOM 6598 C CA  . UNK C 3 143 ? 122.649 125.342 96.807  1.00 20.00  ?  169 UNK C CA  1 
ATOM 6599 C C   . UNK C 3 143 ? 122.213 126.168 95.605  1.00 20.00  ?  169 UNK C C   1 
ATOM 6600 O O   . UNK C 3 143 ? 121.042 126.144 95.201  1.00 20.00  ?  169 UNK C O   1 
ATOM 6601 N N   . UNK C 3 144 ? 123.171 126.862 95.004  1.00 20.00  ?  170 UNK C N   1 
ATOM 6602 C CA  . UNK C 3 144 ? 122.849 127.728 93.885  1.00 20.00  ?  170 UNK C CA  1 
ATOM 6603 C C   . UNK C 3 144 ? 122.380 126.901 92.707  1.00 20.00  ?  170 UNK C C   1 
ATOM 6604 O O   . UNK C 3 144 ? 121.293 127.118 92.172  1.00 20.00  ?  170 UNK C O   1 
ATOM 6605 C CB  . UNK C 3 144 ? 124.048 128.563 93.501  1.00 20.00  ?  170 UNK C CB  1 
ATOM 6606 N N   . UNK C 3 145 ? 123.189 125.919 92.339  1.00 20.00  ?  171 UNK C N   1 
ATOM 6607 C CA  . UNK C 3 145 ? 122.893 125.117 91.171  1.00 20.00  ?  171 UNK C CA  1 
ATOM 6608 C C   . UNK C 3 145 ? 121.599 124.356 91.359  1.00 20.00  ?  171 UNK C C   1 
ATOM 6609 O O   . UNK C 3 145 ? 120.855 124.155 90.407  1.00 20.00  ?  171 UNK C O   1 
ATOM 6610 C CB  . UNK C 3 145 ? 124.026 124.161 90.886  1.00 20.00  ?  171 UNK C CB  1 
ATOM 6611 N N   . UNK C 3 146 ? 121.321 123.939 92.587  1.00 20.00  ?  172 UNK C N   1 
ATOM 6612 C CA  . UNK C 3 146 ? 120.071 123.244 92.837  1.00 20.00  ?  172 UNK C CA  1 
ATOM 6613 C C   . UNK C 3 146 ? 118.911 124.196 92.645  1.00 20.00  ?  172 UNK C C   1 
ATOM 6614 O O   . UNK C 3 146 ? 117.880 123.839 92.066  1.00 20.00  ?  172 UNK C O   1 
ATOM 6615 C CB  . UNK C 3 146 ? 120.050 122.663 94.228  1.00 20.00  ?  172 UNK C CB  1 
ATOM 6616 N N   . UNK C 3 147 ? 119.094 125.426 93.108  1.00 30.00  ?  173 UNK C N   1 
ATOM 6617 C CA  . UNK C 3 147 ? 118.030 126.407 92.994  1.00 30.00  ?  173 UNK C CA  1 
ATOM 6618 C C   . UNK C 3 147 ? 117.727 126.692 91.532  1.00 30.00  ?  173 UNK C C   1 
ATOM 6619 O O   . UNK C 3 147 ? 116.569 126.819 91.140  1.00 30.00  ?  173 UNK C O   1 
ATOM 6620 C CB  . UNK C 3 147 ? 118.408 127.681 93.717  1.00 20.00  ?  173 UNK C CB  1 
ATOM 6621 N N   . UNK C 3 148 ? 118.777 126.771 90.723  1.00 30.00  ?  174 UNK C N   1 
ATOM 6622 C CA  . UNK C 3 148 ? 118.600 126.971 89.294  1.00 30.00  ?  174 UNK C CA  1 
ATOM 6623 C C   . UNK C 3 148 ? 117.955 125.755 88.651  1.00 30.00  ?  174 UNK C C   1 
ATOM 6624 O O   . UNK C 3 148 ? 117.173 125.872 87.712  1.00 30.00  ?  174 UNK C O   1 
ATOM 6625 C CB  . UNK C 3 148 ? 119.928 127.270 88.635  1.00 20.00  ?  174 UNK C CB  1 
ATOM 6626 N N   . UNK C 3 149 ? 118.289 124.583 89.172  1.00 30.00  ?  175 UNK C N   1 
ATOM 6627 C CA  . UNK C 3 149 ? 117.770 123.341 88.630  1.00 30.00  ?  175 UNK C CA  1 
ATOM 6628 C C   . UNK C 3 149 ? 116.280 123.261 88.871  1.00 30.00  ?  175 UNK C C   1 
ATOM 6629 O O   . UNK C 3 149 ? 115.544 122.640 88.105  1.00 30.00  ?  175 UNK C O   1 
ATOM 6630 C CB  . UNK C 3 149 ? 118.474 122.156 89.250  1.00 20.00  ?  175 UNK C CB  1 
ATOM 6631 N N   . UNK C 3 150 ? 115.838 123.899 89.945  1.00 30.00  ?  176 UNK C N   1 
ATOM 6632 C CA  . UNK C 3 150 ? 114.424 123.913 90.264  1.00 30.00  ?  176 UNK C CA  1 
ATOM 6633 C C   . UNK C 3 150 ? 113.632 124.620 89.174  1.00 30.00  ?  176 UNK C C   1 
ATOM 6634 O O   . UNK C 3 150 ? 112.466 124.311 88.940  1.00 30.00  ?  176 UNK C O   1 
ATOM 6635 C CB  . UNK C 3 150 ? 114.196 124.577 91.599  1.00 20.00  ?  176 UNK C CB  1 
ATOM 6636 N N   . UNK C 3 151 ? 114.280 125.568 88.507  1.00 30.00  ?  177 UNK C N   1 
ATOM 6637 C CA  . UNK C 3 151 ? 113.618 126.392 87.503  1.00 30.00  ?  177 UNK C CA  1 
ATOM 6638 C C   . UNK C 3 151 ? 113.189 125.616 86.262  1.00 30.00  ?  177 UNK C C   1 
ATOM 6639 O O   . UNK C 3 151 ? 112.212 125.980 85.613  1.00 30.00  ?  177 UNK C O   1 
ATOM 6640 C CB  . UNK C 3 151 ? 114.523 127.540 87.100  1.00 20.00  ?  177 UNK C CB  1 
ATOM 6641 N N   . UNK C 3 152 ? 113.904 124.548 85.930  1.00 30.00  ?  178 UNK C N   1 
ATOM 6642 C CA  . UNK C 3 152 ? 113.643 123.856 84.674  1.00 30.00  ?  178 UNK C CA  1 
ATOM 6643 C C   . UNK C 3 152 ? 113.836 122.350 84.769  1.00 30.00  ?  178 UNK C C   1 
ATOM 6644 O O   . UNK C 3 152 ? 113.007 121.644 85.341  1.00 30.00  ?  178 UNK C O   1 
ATOM 6645 C CB  . UNK C 3 152 ? 114.529 124.422 83.580  1.00 20.00  ?  178 UNK C CB  1 
ATOM 6646 N N   . UNK C 3 153 ? 114.945 121.870 84.216  1.00 20.00  ?  179 UNK C N   1 
ATOM 6647 C CA  . UNK C 3 153 ? 115.165 120.440 84.031  1.00 20.00  ?  179 UNK C CA  1 
ATOM 6648 C C   . UNK C 3 153 ? 115.247 119.706 85.355  1.00 20.00  ?  179 UNK C C   1 
ATOM 6649 O O   . UNK C 3 153 ? 116.329 119.475 85.888  1.00 20.00  ?  179 UNK C O   1 
ATOM 6650 C CB  . UNK C 3 153 ? 116.427 120.202 83.223  1.00 20.00  ?  179 UNK C CB  1 
ATOM 6651 N N   . UNK C 3 154 ? 114.083 119.328 85.866  1.00 20.00  ?  180 UNK C N   1 
ATOM 6652 C CA  . UNK C 3 154 ? 113.979 118.671 87.158  1.00 20.00  ?  180 UNK C CA  1 
ATOM 6653 C C   . UNK C 3 154 ? 114.667 117.307 87.189  1.00 20.00  ?  180 UNK C C   1 
ATOM 6654 O O   . UNK C 3 154 ? 115.132 116.868 88.240  1.00 20.00  ?  180 UNK C O   1 
ATOM 6655 C CB  . UNK C 3 154 ? 112.514 118.526 87.544  1.00 20.00  ?  180 UNK C CB  1 
ATOM 6656 N N   . UNK C 3 155 ? 114.729 116.632 86.046  1.00 20.00  ?  181 UNK C N   1 
ATOM 6657 C CA  . UNK C 3 155 ? 115.254 115.272 86.018  1.00 20.00  ?  181 UNK C CA  1 
ATOM 6658 C C   . UNK C 3 155 ? 116.730 115.211 86.388  1.00 20.00  ?  181 UNK C C   1 
ATOM 6659 O O   . UNK C 3 155 ? 117.174 114.262 87.032  1.00 20.00  ?  181 UNK C O   1 
ATOM 6660 C CB  . UNK C 3 155 ? 115.036 114.656 84.650  1.00 20.00  ?  181 UNK C CB  1 
ATOM 6661 N N   . UNK C 3 156 ? 117.482 116.232 85.996  1.00 20.00  ?  182 UNK C N   1 
ATOM 6662 C CA  . UNK C 3 156 ? 118.915 116.261 86.265  1.00 20.00  ?  182 UNK C CA  1 
ATOM 6663 C C   . UNK C 3 156 ? 119.227 116.770 87.671  1.00 20.00  ?  182 UNK C C   1 
ATOM 6664 O O   . UNK C 3 156 ? 120.347 116.630 88.161  1.00 20.00  ?  182 UNK C O   1 
ATOM 6665 C CB  . UNK C 3 156 ? 119.624 117.117 85.223  1.00 20.00  ?  182 UNK C CB  1 
ATOM 6666 N N   . UNK C 3 157 ? 118.223 117.349 88.319  1.00 20.00  ?  183 UNK C N   1 
ATOM 6667 C CA  . UNK C 3 157 ? 118.417 118.044 89.589  1.00 20.00  ?  183 UNK C CA  1 
ATOM 6668 C C   . UNK C 3 157 ? 118.811 117.127 90.745  1.00 20.00  ?  183 UNK C C   1 
ATOM 6669 O O   . UNK C 3 157 ? 119.480 117.558 91.683  1.00 20.00  ?  183 UNK C O   1 
ATOM 6670 C CB  . UNK C 3 157 ? 117.157 118.811 89.951  1.00 20.00  ?  183 UNK C CB  1 
ATOM 6671 N N   . UNK C 3 158 ? 118.402 115.866 90.675  1.00 20.00  ?  184 UNK C N   1 
ATOM 6672 C CA  . UNK C 3 158 ? 118.582 114.946 91.792  1.00 20.00  ?  184 UNK C CA  1 
ATOM 6673 C C   . UNK C 3 158 ? 120.052 114.683 92.074  1.00 20.00  ?  184 UNK C C   1 
ATOM 6674 O O   . UNK C 3 158 ? 120.423 114.304 93.182  1.00 20.00  ?  184 UNK C O   1 
ATOM 6675 C CB  . UNK C 3 158 ? 117.860 113.641 91.519  1.00 20.00  ?  184 UNK C CB  1 
ATOM 6676 N N   . UNK C 3 159 ? 120.881 114.892 91.060  1.00 20.00  ?  185 UNK C N   1 
ATOM 6677 C CA  . UNK C 3 159 ? 122.285 114.520 91.125  1.00 20.00  ?  185 UNK C CA  1 
ATOM 6678 C C   . UNK C 3 159 ? 123.062 115.259 92.210  1.00 20.00  ?  185 UNK C C   1 
ATOM 6679 O O   . UNK C 3 159 ? 124.011 114.718 92.772  1.00 20.00  ?  185 UNK C O   1 
ATOM 6680 C CB  . UNK C 3 159 ? 122.935 114.753 89.773  1.00 20.00  ?  185 UNK C CB  1 
ATOM 6681 N N   . UNK C 3 160 ? 122.664 116.489 92.508  1.00 20.00  ?  186 UNK C N   1 
ATOM 6682 C CA  . UNK C 3 160 ? 123.412 117.295 93.461  1.00 20.00  ?  186 UNK C CA  1 
ATOM 6683 C C   . UNK C 3 160 ? 123.387 116.693 94.854  1.00 20.00  ?  186 UNK C C   1 
ATOM 6684 O O   . UNK C 3 160 ? 124.361 116.784 95.591  1.00 20.00  ?  186 UNK C O   1 
ATOM 6685 C CB  . UNK C 3 160 ? 122.863 118.703 93.496  1.00 20.00  ?  186 UNK C CB  1 
ATOM 6686 N N   . UNK C 3 161 ? 122.269 116.078 95.216  1.00 20.00  ?  187 UNK C N   1 
ATOM 6687 C CA  . UNK C 3 161 ? 122.174 115.427 96.514  1.00 20.00  ?  187 UNK C CA  1 
ATOM 6688 C C   . UNK C 3 161 ? 123.111 114.241 96.540  1.00 20.00  ?  187 UNK C C   1 
ATOM 6689 O O   . UNK C 3 161 ? 123.730 113.940 97.561  1.00 20.00  ?  187 UNK C O   1 
ATOM 6690 C CB  . UNK C 3 161 ? 120.753 114.992 96.800  1.00 20.00  ?  187 UNK C CB  1 
ATOM 6691 N N   . UNK C 3 162 ? 123.230 113.587 95.391  1.00 20.00  ?  188 UNK C N   1 
ATOM 6692 C CA  . UNK C 3 162 ? 124.151 112.478 95.247  1.00 20.00  ?  188 UNK C CA  1 
ATOM 6693 C C   . UNK C 3 162 ? 125.556 113.023 95.407  1.00 20.00  ?  188 UNK C C   1 
ATOM 6694 O O   . UNK C 3 162 ? 126.455 112.324 95.861  1.00 20.00  ?  188 UNK C O   1 
ATOM 6695 N N   . UNK C 3 163 ? 125.733 114.287 95.043  1.00 20.00  ?  189 UNK C N   1 
ATOM 6696 C CA  . UNK C 3 163 ? 127.044 114.904 95.102  1.00 20.00  ?  189 UNK C CA  1 
ATOM 6697 C C   . UNK C 3 163 ? 127.433 115.239 96.530  1.00 20.00  ?  189 UNK C C   1 
ATOM 6698 O O   . UNK C 3 163 ? 128.530 114.918 96.962  1.00 20.00  ?  189 UNK C O   1 
ATOM 6699 C CB  . UNK C 3 163 ? 127.079 116.149 94.237  1.00 20.00  ?  189 UNK C CB  1 
ATOM 6700 N N   . UNK C 3 164 ? 126.535 115.891 97.259  1.00 20.00  ?  190 UNK C N   1 
ATOM 6701 C CA  . UNK C 3 164 ? 126.819 116.244 98.640  1.00 20.00  ?  190 UNK C CA  1 
ATOM 6702 C C   . UNK C 3 164 ? 126.966 114.986 99.487  1.00 20.00  ?  190 UNK C C   1 
ATOM 6703 O O   . UNK C 3 164 ? 127.805 114.919 100.390 1.00 20.00  ?  190 UNK C O   1 
ATOM 6704 C CB  . UNK C 3 164 ? 125.726 117.143 99.196  1.00 20.00  ?  190 UNK C CB  1 
ATOM 6705 N N   . UNK C 3 165 ? 126.157 113.978 99.181  1.00 20.00  ?  191 UNK C N   1 
ATOM 6706 C CA  . UNK C 3 165 ? 126.270 112.705 99.874  1.00 20.00  ?  191 UNK C CA  1 
ATOM 6707 C C   . UNK C 3 165 ? 127.587 112.050 99.516  1.00 20.00  ?  191 UNK C C   1 
ATOM 6708 O O   . UNK C 3 165 ? 128.207 111.377 100.339 1.00 20.00  ?  191 UNK C O   1 
ATOM 6709 C CB  . UNK C 3 165 ? 125.113 111.804 99.522  1.00 20.00  ?  191 UNK C CB  1 
ATOM 6710 N N   . UNK C 3 166 ? 128.020 112.267 98.282  1.00 20.00  ?  192 UNK C N   1 
ATOM 6711 C CA  . UNK C 3 166 ? 129.311 111.776 97.851  1.00 20.00  ?  192 UNK C CA  1 
ATOM 6712 C C   . UNK C 3 166 ? 130.388 112.483 98.646  1.00 20.00  ?  192 UNK C C   1 
ATOM 6713 O O   . UNK C 3 166 ? 131.445 111.922 98.929  1.00 20.00  ?  192 UNK C O   1 
ATOM 6714 C CB  . UNK C 3 166 ? 129.504 111.998 96.370  1.00 20.00  ?  192 UNK C CB  1 
ATOM 6715 N N   . UNK C 3 167 ? 130.101 113.723 99.021  1.00 20.00  ?  193 UNK C N   1 
ATOM 6716 C CA  . UNK C 3 167 ? 131.076 114.539 99.715  1.00 20.00  ?  193 UNK C CA  1 
ATOM 6717 C C   . UNK C 3 167 ? 131.252 114.053 101.134 1.00 20.00  ?  193 UNK C C   1 
ATOM 6718 O O   . UNK C 3 167 ? 132.369 113.812 101.574 1.00 20.00  ?  193 UNK C O   1 
ATOM 6719 C CB  . UNK C 3 167 ? 130.659 115.992 99.703  1.00 20.00  ?  193 UNK C CB  1 
ATOM 6720 N N   . UNK C 3 168 ? 130.146 113.893 101.847 1.00 20.00  ?  194 UNK C N   1 
ATOM 6721 C CA  . UNK C 3 168 ? 130.238 113.421 103.218 1.00 20.00  ?  194 UNK C CA  1 
ATOM 6722 C C   . UNK C 3 168 ? 130.782 112.002 103.244 1.00 20.00  ?  194 UNK C C   1 
ATOM 6723 O O   . UNK C 3 168 ? 131.524 111.622 104.156 1.00 20.00  ?  194 UNK C O   1 
ATOM 6724 C CB  . UNK C 3 168 ? 128.891 113.488 103.895 1.00 20.00  ?  194 UNK C CB  1 
ATOM 6725 N N   . UNK C 3 169 ? 130.433 111.225 102.224 1.00 20.00  ?  195 UNK C N   1 
ATOM 6726 C CA  . UNK C 3 169 ? 130.932 109.865 102.135 1.00 20.00  ?  195 UNK C CA  1 
ATOM 6727 C C   . UNK C 3 169 ? 132.438 109.909 101.949 1.00 20.00  ?  195 UNK C C   1 
ATOM 6728 O O   . UNK C 3 169 ? 133.161 109.061 102.466 1.00 20.00  ?  195 UNK C O   1 
ATOM 6729 N N   . UNK C 3 170 ? 132.907 110.914 101.220 1.00 20.00  ?  196 UNK C N   1 
ATOM 6730 C CA  . UNK C 3 170 ? 134.337 111.105 101.046 1.00 20.00  ?  196 UNK C CA  1 
ATOM 6731 C C   . UNK C 3 170 ? 134.981 111.517 102.361 1.00 20.00  ?  196 UNK C C   1 
ATOM 6732 O O   . UNK C 3 170 ? 136.109 111.133 102.663 1.00 20.00  ?  196 UNK C O   1 
ATOM 6733 C CB  . UNK C 3 170 ? 134.605 112.142 99.973  1.00 20.00  ?  196 UNK C CB  1 
ATOM 6734 N N   . UNK C 3 171 ? 134.245 112.294 103.145 1.00 20.00  ?  197 UNK C N   1 
ATOM 6735 C CA  . UNK C 3 171 ? 134.737 112.784 104.421 1.00 20.00  ?  197 UNK C CA  1 
ATOM 6736 C C   . UNK C 3 171 ? 134.864 111.649 105.412 1.00 20.00  ?  197 UNK C C   1 
ATOM 6737 O O   . UNK C 3 171 ? 135.667 111.709 106.338 1.00 20.00  ?  197 UNK C O   1 
ATOM 6738 C CB  . UNK C 3 171 ? 133.820 113.856 104.966 1.00 20.00  ?  197 UNK C CB  1 
ATOM 6739 N N   . UNK C 3 172 ? 134.080 110.602 105.192 1.00 30.00  ?  198 UNK C N   1 
ATOM 6740 C CA  . UNK C 3 172 ? 134.019 109.493 106.126 1.00 30.00  ?  198 UNK C CA  1 
ATOM 6741 C C   . UNK C 3 172 ? 135.374 108.821 106.279 1.00 30.00  ?  198 UNK C C   1 
ATOM 6742 O O   . UNK C 3 172 ? 135.668 108.236 107.315 1.00 30.00  ?  198 UNK C O   1 
ATOM 6743 C CB  . UNK C 3 172 ? 132.978 108.483 105.677 1.00 20.00  ?  198 UNK C CB  1 
ATOM 6744 N N   . UNK C 3 173 ? 136.198 108.907 105.243 1.00 30.00  ?  199 UNK C N   1 
ATOM 6745 C CA  . UNK C 3 173 ? 137.467 108.191 105.228 1.00 30.00  ?  199 UNK C CA  1 
ATOM 6746 C C   . UNK C 3 173 ? 138.451 108.663 106.299 1.00 30.00  ?  199 UNK C C   1 
ATOM 6747 O O   . UNK C 3 173 ? 139.137 107.847 106.911 1.00 30.00  ?  199 UNK C O   1 
ATOM 6748 C CB  . UNK C 3 173 ? 138.105 108.307 103.851 1.00 20.00  ?  199 UNK C CB  1 
ATOM 6749 N N   . UNK C 3 174 ? 138.512 109.973 106.522 1.00 20.00  ?  200 UNK C N   1 
ATOM 6750 C CA  . UNK C 3 174 ? 139.428 110.567 107.499 1.00 20.00  ?  200 UNK C CA  1 
ATOM 6751 C C   . UNK C 3 174 ? 140.870 110.101 107.323 1.00 20.00  ?  200 UNK C C   1 
ATOM 6752 O O   . UNK C 3 174 ? 141.632 110.057 108.285 1.00 20.00  ?  200 UNK C O   1 
ATOM 6753 C CB  . UNK C 3 174 ? 138.961 110.262 108.906 1.00 20.00  ?  200 UNK C CB  1 
ATOM 6754 N N   . UNK C 3 175 ? 141.238 109.748 106.097 1.00 30.00  ?  201 UNK C N   1 
ATOM 6755 C CA  . UNK C 3 175 ? 142.591 109.294 105.815 1.00 30.00  ?  201 UNK C CA  1 
ATOM 6756 C C   . UNK C 3 175 ? 143.513 110.486 105.651 1.00 30.00  ?  201 UNK C C   1 
ATOM 6757 O O   . UNK C 3 175 ? 144.730 110.334 105.554 1.00 30.00  ?  201 UNK C O   1 
ATOM 6758 C CB  . UNK C 3 175 ? 142.617 108.424 104.576 1.00 20.00  ?  201 UNK C CB  1 
ATOM 6759 N N   . UNK C 3 176 ? 142.912 111.671 105.601 1.00 20.00  ?  202 UNK C N   1 
ATOM 6760 C CA  . UNK C 3 176 ? 143.639 112.930 105.499 1.00 20.00  ?  202 UNK C CA  1 
ATOM 6761 C C   . UNK C 3 176 ? 144.538 112.973 104.273 1.00 20.00  ?  202 UNK C C   1 
ATOM 6762 O O   . UNK C 3 176 ? 144.299 113.740 103.344 1.00 20.00  ?  202 UNK C O   1 
ATOM 6763 C CB  . UNK C 3 176 ? 144.452 113.177 106.760 1.00 20.00  ?  202 UNK C CB  1 
ATOM 6764 N N   . UNK C 3 177 ? 145.563 112.129 104.275 1.00 20.00  ?  203 UNK C N   1 
ATOM 6765 C CA  . UNK C 3 177 ? 146.586 112.144 103.239 1.00 20.00  ?  203 UNK C CA  1 
ATOM 6766 C C   . UNK C 3 177 ? 146.021 111.829 101.862 1.00 20.00  ?  203 UNK C C   1 
ATOM 6767 O O   . UNK C 3 177 ? 146.564 112.256 100.847 1.00 20.00  ?  203 UNK C O   1 
ATOM 6768 C CB  . UNK C 3 177 ? 147.688 111.161 103.586 1.00 20.00  ?  203 UNK C CB  1 
ATOM 6769 N N   . UNK C 3 178 ? 144.928 111.081 101.825 1.00 20.00  ?  204 UNK C N   1 
ATOM 6770 C CA  . UNK C 3 178 ? 144.347 110.685 100.555 1.00 20.00  ?  204 UNK C CA  1 
ATOM 6771 C C   . UNK C 3 178 ? 143.108 111.498 100.208 1.00 20.00  ?  204 UNK C C   1 
ATOM 6772 O O   . UNK C 3 178 ? 143.103 112.261 99.243  1.00 20.00  ?  204 UNK C O   1 
ATOM 6773 C CB  . UNK C 3 178 ? 144.013 109.207 100.578 1.00 20.00  ?  204 UNK C CB  1 
ATOM 6774 N N   . UNK C 3 179 ? 142.062 111.323 101.006 1.00 20.00  ?  205 UNK C N   1 
ATOM 6775 C CA  . UNK C 3 179 ? 140.729 111.816 100.671 1.00 20.00  ?  205 UNK C CA  1 
ATOM 6776 C C   . UNK C 3 179 ? 140.589 113.338 100.591 1.00 20.00  ?  205 UNK C C   1 
ATOM 6777 O O   . UNK C 3 179 ? 139.781 113.842 99.810  1.00 20.00  ?  205 UNK C O   1 
ATOM 6778 C CB  . UNK C 3 179 ? 139.722 111.267 101.675 1.00 20.00  ?  205 UNK C CB  1 
ATOM 6779 N N   . UNK C 3 180 ? 141.371 114.064 101.382 1.00 20.00  ?  206 UNK C N   1 
ATOM 6780 C CA  . UNK C 3 180 ? 141.155 115.500 101.542 1.00 20.00  ?  206 UNK C CA  1 
ATOM 6781 C C   . UNK C 3 180 ? 141.266 116.263 100.229 1.00 20.00  ?  206 UNK C C   1 
ATOM 6782 O O   . UNK C 3 180 ? 140.387 117.055 99.881  1.00 20.00  ?  206 UNK C O   1 
ATOM 6783 C CB  . UNK C 3 180 ? 142.136 116.063 102.550 1.00 20.00  ?  206 UNK C CB  1 
ATOM 6784 N N   . UNK C 3 181 ? 142.339 116.006 99.490  1.00 20.00  ?  207 UNK C N   1 
ATOM 6785 C CA  . UNK C 3 181 ? 142.582 116.729 98.252  1.00 20.00  ?  207 UNK C CA  1 
ATOM 6786 C C   . UNK C 3 181 ? 141.513 116.427 97.220  1.00 20.00  ?  207 UNK C C   1 
ATOM 6787 O O   . UNK C 3 181 ? 141.124 117.298 96.448  1.00 20.00  ?  207 UNK C O   1 
ATOM 6788 C CB  . UNK C 3 181 ? 143.951 116.385 97.703  1.00 20.00  ?  207 UNK C CB  1 
ATOM 6789 N N   . UNK C 3 182 ? 141.029 115.192 97.216  1.00 20.00  ?  208 UNK C N   1 
ATOM 6790 C CA  . UNK C 3 182 ? 139.963 114.828 96.303  1.00 20.00  ?  208 UNK C CA  1 
ATOM 6791 C C   . UNK C 3 182 ? 138.699 115.570 96.686  1.00 20.00  ?  208 UNK C C   1 
ATOM 6792 O O   . UNK C 3 182 ? 137.948 116.051 95.830  1.00 20.00  ?  208 UNK C O   1 
ATOM 6793 C CB  . UNK C 3 182 ? 139.736 113.336 96.323  1.00 20.00  ?  208 UNK C CB  1 
ATOM 6794 N N   . UNK C 3 183 ? 138.488 115.685 97.992  1.00 30.00  ?  209 UNK C N   1 
ATOM 6795 C CA  . UNK C 3 183 ? 137.298 116.332 98.506  1.00 30.00  ?  209 UNK C CA  1 
ATOM 6796 C C   . UNK C 3 183 ? 137.297 117.788 98.096  1.00 30.00  ?  209 UNK C C   1 
ATOM 6797 O O   . UNK C 3 183 ? 136.263 118.335 97.721  1.00 30.00  ?  209 UNK C O   1 
ATOM 6798 C CB  . UNK C 3 183 ? 137.229 116.201 100.011 1.00 20.00  ?  209 UNK C CB  1 
ATOM 6799 N N   . UNK C 3 184 ? 138.469 118.410 98.142  1.00 20.00  ?  210 UNK C N   1 
ATOM 6800 C CA  . UNK C 3 184 ? 138.593 119.777 97.670  1.00 20.00  ?  210 UNK C CA  1 
ATOM 6801 C C   . UNK C 3 184 ? 138.375 119.824 96.168  1.00 20.00  ?  210 UNK C C   1 
ATOM 6802 O O   . UNK C 3 184 ? 137.799 120.772 95.638  1.00 20.00  ?  210 UNK C O   1 
ATOM 6803 C CB  . UNK C 3 184 ? 139.950 120.344 98.029  1.00 20.00  ?  210 UNK C CB  1 
ATOM 6804 N N   . UNK C 3 185 ? 138.828 118.777 95.490  1.00 20.00  ?  211 UNK C N   1 
ATOM 6805 C CA  . UNK C 3 185 ? 138.800 118.747 94.038  1.00 20.00  ?  211 UNK C CA  1 
ATOM 6806 C C   . UNK C 3 185 ? 137.389 118.703 93.492  1.00 20.00  ?  211 UNK C C   1 
ATOM 6807 O O   . UNK C 3 185 ? 137.108 119.272 92.441  1.00 20.00  ?  211 UNK C O   1 
ATOM 6808 C CB  . UNK C 3 185 ? 139.591 117.562 93.526  1.00 20.00  ?  211 UNK C CB  1 
ATOM 6809 N N   . UNK C 3 186 ? 136.496 118.034 94.208  1.00 20.00  ?  212 UNK C N   1 
ATOM 6810 C CA  . UNK C 3 186 ? 135.127 117.909 93.733  1.00 20.00  ?  212 UNK C CA  1 
ATOM 6811 C C   . UNK C 3 186 ? 134.454 119.273 93.689  1.00 20.00  ?  212 UNK C C   1 
ATOM 6812 O O   . UNK C 3 186 ? 133.591 119.543 92.841  1.00 20.00  ?  212 UNK C O   1 
ATOM 6813 C CB  . UNK C 3 186 ? 134.352 116.960 94.611  1.00 20.00  ?  212 UNK C CB  1 
ATOM 6814 N N   . UNK C 3 187 ? 134.871 120.140 94.604  1.00 20.00  ?  213 UNK C N   1 
ATOM 6815 C CA  . UNK C 3 187 ? 134.266 121.453 94.734  1.00 20.00  ?  213 UNK C CA  1 
ATOM 6816 C C   . UNK C 3 187 ? 134.469 122.278 93.478  1.00 20.00  ?  213 UNK C C   1 
ATOM 6817 O O   . UNK C 3 187 ? 133.597 123.052 93.088  1.00 20.00  ?  213 UNK C O   1 
ATOM 6818 C CB  . UNK C 3 187 ? 134.836 122.177 95.937  1.00 20.00  ?  213 UNK C CB  1 
ATOM 6819 N N   . UNK C 3 188 ? 135.618 122.107 92.838  1.00 20.00  ?  214 UNK C N   1 
ATOM 6820 C CA  . UNK C 3 188 ? 135.870 122.799 91.587  1.00 20.00  ?  214 UNK C CA  1 
ATOM 6821 C C   . UNK C 3 188 ? 134.912 122.300 90.521  1.00 20.00  ?  214 UNK C C   1 
ATOM 6822 O O   . UNK C 3 188 ? 134.459 123.066 89.673  1.00 20.00  ?  214 UNK C O   1 
ATOM 6823 C CB  . UNK C 3 188 ? 137.306 122.603 91.150  1.00 20.00  ?  214 UNK C CB  1 
ATOM 6824 N N   . UNK C 3 189 ? 134.593 121.011 90.584  1.00 20.00  ?  215 UNK C N   1 
ATOM 6825 C CA  . UNK C 3 189 ? 133.682 120.419 89.618  1.00 20.00  ?  215 UNK C CA  1 
ATOM 6826 C C   . UNK C 3 189 ? 132.291 120.993 89.804  1.00 20.00  ?  215 UNK C C   1 
ATOM 6827 O O   . UNK C 3 189 ? 131.568 121.240 88.833  1.00 20.00  ?  215 UNK C O   1 
ATOM 6828 C CB  . UNK C 3 189 ? 133.660 118.908 89.759  1.00 20.00  ?  215 UNK C CB  1 
ATOM 6829 N N   . UNK C 3 190 ? 131.924 121.221 91.060  1.00 20.00  ?  216 UNK C N   1 
ATOM 6830 C CA  . UNK C 3 190 ? 130.650 121.864 91.340  1.00 20.00  ?  216 UNK C CA  1 
ATOM 6831 C C   . UNK C 3 190 ? 130.658 123.308 90.856  1.00 20.00  ?  216 UNK C C   1 
ATOM 6832 O O   . UNK C 3 190 ? 129.664 123.802 90.320  1.00 20.00  ?  216 UNK C O   1 
ATOM 6833 C CB  . UNK C 3 190 ? 130.342 121.805 92.820  1.00 20.00  ?  216 UNK C CB  1 
ATOM 6834 N N   . UNK C 3 191 ? 131.795 123.973 91.030  1.00 20.00  ?  217 UNK C N   1 
ATOM 6835 C CA  . UNK C 3 191 ? 131.921 125.371 90.649  1.00 20.00  ?  217 UNK C CA  1 
ATOM 6836 C C   . UNK C 3 191 ? 131.778 125.517 89.147  1.00 20.00  ?  217 UNK C C   1 
ATOM 6837 O O   . UNK C 3 191 ? 131.217 126.493 88.651  1.00 20.00  ?  217 UNK C O   1 
ATOM 6838 C CB  . UNK C 3 191 ? 133.252 125.930 91.116  1.00 20.00  ?  217 UNK C CB  1 
ATOM 6839 N N   . UNK C 3 192 ? 132.278 124.525 88.425  1.00 20.00  ?  218 UNK C N   1 
ATOM 6840 C CA  . UNK C 3 192 ? 132.106 124.504 86.990  1.00 20.00  ?  218 UNK C CA  1 
ATOM 6841 C C   . UNK C 3 192 ? 130.651 124.231 86.667  1.00 20.00  ?  218 UNK C C   1 
ATOM 6842 O O   . UNK C 3 192 ? 130.067 124.873 85.796  1.00 20.00  ?  218 UNK C O   1 
ATOM 6843 C CB  . UNK C 3 192 ? 133.001 123.458 86.362  1.00 20.00  ?  218 UNK C CB  1 
ATOM 6844 N N   . UNK C 3 193 ? 130.061 123.297 87.404  1.00 20.00  ?  219 UNK C N   1 
ATOM 6845 C CA  . UNK C 3 193 ? 128.704 122.860 87.120  1.00 20.00  ?  219 UNK C CA  1 
ATOM 6846 C C   . UNK C 3 193 ? 127.719 124.005 87.294  1.00 20.00  ?  219 UNK C C   1 
ATOM 6847 O O   . UNK C 3 193 ? 126.682 124.047 86.636  1.00 20.00  ?  219 UNK C O   1 
ATOM 6848 C CB  . UNK C 3 193 ? 128.327 121.693 88.011  1.00 20.00  ?  219 UNK C CB  1 
ATOM 6849 N N   . UNK C 3 194 ? 128.050 124.938 88.178  1.00 20.00  ?  220 UNK C N   1 
ATOM 6850 C CA  . UNK C 3 194 ? 127.177 126.074 88.431  1.00 20.00  ?  220 UNK C CA  1 
ATOM 6851 C C   . UNK C 3 194 ? 127.744 127.381 87.895  1.00 20.00  ?  220 UNK C C   1 
ATOM 6852 O O   . UNK C 3 194 ? 127.176 128.445 88.130  1.00 20.00  ?  220 UNK C O   1 
ATOM 6853 C CB  . UNK C 3 194 ? 126.904 126.201 89.915  1.00 20.00  ?  220 UNK C CB  1 
ATOM 6854 N N   . UNK C 3 195 ? 128.857 127.307 87.176  1.00 20.00  ?  221 UNK C N   1 
ATOM 6855 C CA  . UNK C 3 195 ? 129.495 128.516 86.672  1.00 20.00  ?  221 UNK C CA  1 
ATOM 6856 C C   . UNK C 3 195 ? 128.573 129.253 85.711  1.00 20.00  ?  221 UNK C C   1 
ATOM 6857 O O   . UNK C 3 195 ? 128.631 130.475 85.592  1.00 20.00  ?  221 UNK C O   1 
ATOM 6858 C CB  . UNK C 3 195 ? 130.805 128.183 85.996  1.00 20.00  ?  221 UNK C CB  1 
ATOM 6859 N N   . UNK C 3 196 ? 127.712 128.502 85.036  1.00 30.00  ?  222 UNK C N   1 
ATOM 6860 C CA  . UNK C 3 196 ? 126.760 129.088 84.109  1.00 30.00  ?  222 UNK C CA  1 
ATOM 6861 C C   . UNK C 3 196 ? 125.453 129.422 84.815  1.00 30.00  ?  222 UNK C C   1 
ATOM 6862 O O   . UNK C 3 196 ? 125.370 130.401 85.555  1.00 30.00  ?  222 UNK C O   1 
ATOM 6863 C CB  . UNK C 3 196 ? 126.513 128.150 82.947  1.00 20.00  ?  222 UNK C CB  1 
ATOM 6864 N N   . UNK D 4 1   ? 121.855 176.401 110.332 1.00 124.23 ?  5   UNK D N   1 
ATOM 6865 C CA  . UNK D 4 1   ? 122.879 176.916 111.232 1.00 121.55 ?  5   UNK D CA  1 
ATOM 6866 C C   . UNK D 4 1   ? 122.338 177.040 112.648 1.00 120.45 ?  5   UNK D C   1 
ATOM 6867 O O   . UNK D 4 1   ? 122.931 177.707 113.493 1.00 117.90 ?  5   UNK D O   1 
ATOM 6868 C CB  . UNK D 4 1   ? 123.392 178.259 110.741 1.00 20.00  ?  5   UNK D CB  1 
ATOM 6869 N N   . UNK D 4 2   ? 121.202 176.401 112.898 1.00 80.50  ?  6   UNK D N   1 
ATOM 6870 C CA  . UNK D 4 2   ? 120.591 176.398 114.220 1.00 79.78  ?  6   UNK D CA  1 
ATOM 6871 C C   . UNK D 4 2   ? 121.420 175.594 115.219 1.00 78.68  ?  6   UNK D C   1 
ATOM 6872 O O   . UNK D 4 2   ? 121.300 175.769 116.430 1.00 76.69  ?  6   UNK D O   1 
ATOM 6873 C CB  . UNK D 4 2   ? 119.183 175.845 114.142 1.00 20.00  ?  6   UNK D CB  1 
ATOM 6874 N N   . UNK D 4 3   ? 122.256 174.708 114.694 1.00 80.04  ?  7   UNK D N   1 
ATOM 6875 C CA  . UNK D 4 3   ? 122.957 173.725 115.510 1.00 79.25  ?  7   UNK D CA  1 
ATOM 6876 C C   . UNK D 4 3   ? 123.918 174.317 116.532 1.00 76.25  ?  7   UNK D C   1 
ATOM 6877 O O   . UNK D 4 3   ? 124.104 173.748 117.606 1.00 74.57  ?  7   UNK D O   1 
ATOM 6878 C CB  . UNK D 4 3   ? 123.711 172.762 114.607 1.00 20.00  ?  7   UNK D CB  1 
ATOM 6879 N N   . UNK D 4 4   ? 124.517 175.457 116.208 1.00 101.16 ?  8   UNK D N   1 
ATOM 6880 C CA  . UNK D 4 4   ? 125.619 175.978 117.011 1.00 98.40  ?  8   UNK D CA  1 
ATOM 6881 C C   . UNK D 4 4   ? 125.177 176.306 118.427 1.00 96.13  ?  8   UNK D C   1 
ATOM 6882 O O   . UNK D 4 4   ? 125.952 176.170 119.375 1.00 93.86  ?  8   UNK D O   1 
ATOM 6883 C CB  . UNK D 4 4   ? 126.218 177.201 116.351 1.00 20.00  ?  8   UNK D CB  1 
ATOM 6884 N N   . UNK D 4 5   ? 123.913 176.691 118.564 1.00 169.09 ?  9   UNK D N   1 
ATOM 6885 C CA  . UNK D 4 5   ? 123.360 177.045 119.860 1.00 167.23 ?  9   UNK D CA  1 
ATOM 6886 C C   . UNK D 4 5   ? 123.462 175.864 120.808 1.00 166.67 ?  9   UNK D C   1 
ATOM 6887 O O   . UNK D 4 5   ? 123.650 176.036 122.011 1.00 164.35 ?  9   UNK D O   1 
ATOM 6888 C CB  . UNK D 4 5   ? 121.916 177.486 119.719 1.00 20.00  ?  9   UNK D CB  1 
ATOM 6889 N N   . UNK D 4 6   ? 123.346 174.662 120.252 1.00 71.06  ?  10  UNK D N   1 
ATOM 6890 C CA  . UNK D 4 6   ? 123.550 173.443 121.020 1.00 70.83  ?  10  UNK D CA  1 
ATOM 6891 C C   . UNK D 4 6   ? 125.032 173.131 121.150 1.00 68.96  ?  10  UNK D C   1 
ATOM 6892 O O   . UNK D 4 6   ? 125.504 172.751 122.220 1.00 67.25  ?  10  UNK D O   1 
ATOM 6893 C CB  . UNK D 4 6   ? 122.821 172.280 120.374 1.00 20.00  ?  10  UNK D CB  1 
ATOM 6894 N N   . UNK D 4 7   ? 125.767 173.310 120.058 1.00 81.79  ?  11  UNK D N   1 
ATOM 6895 C CA  . UNK D 4 7   ? 127.170 172.933 120.036 1.00 80.16  ?  11  UNK D CA  1 
ATOM 6896 C C   . UNK D 4 7   ? 127.965 173.780 121.009 1.00 77.16  ?  11  UNK D C   1 
ATOM 6897 O O   . UNK D 4 7   ? 128.945 173.320 121.590 1.00 75.37  ?  11  UNK D O   1 
ATOM 6898 C CB  . UNK D 4 7   ? 127.733 173.059 118.642 1.00 20.00  ?  11  UNK D CB  1 
ATOM 6899 N N   . UNK D 4 8   ? 127.523 175.017 121.202 1.00 64.23  ?  12  UNK D N   1 
ATOM 6900 C CA  . UNK D 4 8   ? 128.192 175.908 122.131 1.00 61.52  ?  12  UNK D CA  1 
ATOM 6901 C C   . UNK D 4 8   ? 128.108 175.341 123.538 1.00 60.17  ?  12  UNK D C   1 
ATOM 6902 O O   . UNK D 4 8   ? 129.025 175.511 124.340 1.00 57.85  ?  12  UNK D O   1 
ATOM 6903 C CB  . UNK D 4 8   ? 127.579 177.295 122.075 1.00 20.00  ?  12  UNK D CB  1 
ATOM 6904 N N   . UNK D 4 9   ? 127.005 174.657 123.829 1.00 402.02 ?  13  UNK D N   1 
ATOM 6905 C CA  . UNK D 4 9   ? 126.843 174.010 125.121 1.00 401.09 ?  13  UNK D CA  1 
ATOM 6906 C C   . UNK D 4 9   ? 127.833 172.870 125.280 1.00 400.38 ?  13  UNK D C   1 
ATOM 6907 O O   . UNK D 4 9   ? 128.303 172.595 126.379 1.00 398.38 ?  13  UNK D O   1 
ATOM 6908 C CB  . UNK D 4 9   ? 125.424 173.503 125.288 1.00 20.00  ?  13  UNK D CB  1 
ATOM 6909 N N   . UNK D 4 10  ? 128.152 172.212 124.171 1.00 106.47 ?  14  UNK D N   1 
ATOM 6910 C CA  . UNK D 4 10  ? 129.085 171.095 124.208 1.00 106.03 ?  14  UNK D CA  1 
ATOM 6911 C C   . UNK D 4 10  ? 130.475 171.586 124.572 1.00 103.52 ?  14  UNK D C   1 
ATOM 6912 O O   . UNK D 4 10  ? 131.272 170.850 125.147 1.00 101.99 ?  14  UNK D O   1 
ATOM 6913 C CB  . UNK D 4 10  ? 129.107 170.366 122.877 1.00 20.00  ?  14  UNK D CB  1 
ATOM 6914 N N   . UNK D 4 11  ? 130.766 172.832 124.221 1.00 99.65  ?  15  UNK D N   1 
ATOM 6915 C CA  . UNK D 4 11  ? 132.028 173.438 124.606 1.00 97.33  ?  15  UNK D CA  1 
ATOM 6916 C C   . UNK D 4 11  ? 132.091 173.582 126.117 1.00 94.89  ?  15  UNK D C   1 
ATOM 6917 O O   . UNK D 4 11  ? 133.165 173.529 126.708 1.00 92.94  ?  15  UNK D O   1 
ATOM 6918 C CB  . UNK D 4 11  ? 132.201 174.782 123.935 1.00 20.00  ?  15  UNK D CB  1 
ATOM 6919 N N   . UNK D 4 12  ? 130.932 173.779 126.737 1.00 424.23 ?  16  UNK D N   1 
ATOM 6920 C CA  . UNK D 4 12  ? 130.844 173.800 128.191 1.00 422.21 ?  16  UNK D CA  1 
ATOM 6921 C C   . UNK D 4 12  ? 131.044 172.401 128.759 1.00 421.56 ?  16  UNK D C   1 
ATOM 6922 O O   . UNK D 4 12  ? 131.448 172.235 129.911 1.00 419.35 ?  16  UNK D O   1 
ATOM 6923 C CB  . UNK D 4 12  ? 129.511 174.370 128.637 1.00 20.00  ?  16  UNK D CB  1 
ATOM 6924 N N   . UNK D 4 13  ? 130.770 171.397 127.932 1.00 53.20  ?  17  UNK D N   1 
ATOM 6925 C CA  . UNK D 4 13  ? 130.840 170.000 128.346 1.00 52.89  ?  17  UNK D CA  1 
ATOM 6926 C C   . UNK D 4 13  ? 132.260 169.543 128.659 1.00 51.72  ?  17  UNK D C   1 
ATOM 6927 O O   . UNK D 4 13  ? 132.461 168.558 129.369 1.00 50.50  ?  17  UNK D O   1 
ATOM 6928 N N   . UNK D 4 14  ? 133.242 170.262 128.128 1.00 118.37 ?  18  UNK D N   1 
ATOM 6929 C CA  . UNK D 4 14  ? 134.646 169.929 128.335 1.00 117.45 ?  18  UNK D CA  1 
ATOM 6930 C C   . UNK D 4 14  ? 135.049 170.074 129.799 1.00 114.61 ?  18  UNK D C   1 
ATOM 6931 O O   . UNK D 4 14  ? 136.066 169.535 130.225 1.00 113.18 ?  18  UNK D O   1 
ATOM 6932 N N   . UNK D 4 15  ? 134.255 170.818 130.559 1.00 201.56 ?  19  UNK D N   1 
ATOM 6933 C CA  . UNK D 4 15  ? 134.567 171.097 131.955 1.00 198.93 ?  19  UNK D CA  1 
ATOM 6934 C C   . UNK D 4 15  ? 134.561 169.857 132.855 1.00 197.71 ?  19  UNK D C   1 
ATOM 6935 O O   . UNK D 4 15  ? 135.293 169.813 133.843 1.00 195.59 ?  19  UNK D O   1 
ATOM 6936 C CB  . UNK D 4 15  ? 133.593 172.132 132.498 1.00 20.00  ?  19  UNK D CB  1 
ATOM 6937 N N   . UNK D 4 16  ? 133.757 168.850 132.515 1.00 136.00 ?  20  UNK D N   1 
ATOM 6938 C CA  . UNK D 4 16  ? 133.558 167.709 133.415 1.00 135.63 ?  20  UNK D CA  1 
ATOM 6939 C C   . UNK D 4 16  ? 133.882 166.338 132.808 1.00 133.52 ?  20  UNK D C   1 
ATOM 6940 O O   . UNK D 4 16  ? 134.326 165.437 133.518 1.00 131.93 ?  20  UNK D O   1 
ATOM 6941 C CB  . UNK D 4 16  ? 132.129 167.711 133.932 1.00 20.00  ?  20  UNK D CB  1 
ATOM 6942 N N   . UNK D 4 17  ? 133.656 166.175 131.508 1.00 154.21 ?  21  UNK D N   1 
ATOM 6943 C CA  . UNK D 4 17  ? 133.859 164.877 130.872 1.00 156.22 ?  21  UNK D CA  1 
ATOM 6944 C C   . UNK D 4 17  ? 134.387 164.993 129.448 1.00 158.42 ?  21  UNK D C   1 
ATOM 6945 O O   . UNK D 4 17  ? 133.743 165.590 128.589 1.00 160.36 ?  21  UNK D O   1 
ATOM 6946 C CB  . UNK D 4 17  ? 132.570 164.098 130.882 1.00 20.00  ?  21  UNK D CB  1 
ATOM 6947 N N   . UNK D 4 18  ? 135.553 164.402 129.203 1.00 36.05  ?  22  UNK D N   1 
ATOM 6948 C CA  . UNK D 4 18  ? 136.229 164.503 127.908 1.00 37.95  ?  22  UNK D CA  1 
ATOM 6949 C C   . UNK D 4 18  ? 135.470 163.849 126.755 1.00 38.19  ?  22  UNK D C   1 
ATOM 6950 O O   . UNK D 4 18  ? 135.562 164.291 125.602 1.00 40.12  ?  22  UNK D O   1 
ATOM 6951 C CB  . UNK D 4 18  ? 137.619 163.898 128.009 1.00 20.00  ?  22  UNK D CB  1 
ATOM 6952 N N   . UNK D 4 19  ? 134.724 162.794 127.059 1.00 198.55 ?  23  UNK D N   1 
ATOM 6953 C CA  . UNK D 4 19  ? 134.004 162.078 126.018 1.00 198.61 ?  23  UNK D CA  1 
ATOM 6954 C C   . UNK D 4 19  ? 132.937 162.967 125.397 1.00 199.66 ?  23  UNK D C   1 
ATOM 6955 O O   . UNK D 4 19  ? 132.614 162.817 124.226 1.00 201.10 ?  23  UNK D O   1 
ATOM 6956 C CB  . UNK D 4 19  ? 133.384 160.808 126.568 1.00 20.00  ?  23  UNK D CB  1 
ATOM 6957 N N   . UNK D 4 20  ? 132.387 163.888 126.181 1.00 36.63  ?  24  UNK D N   1 
ATOM 6958 C CA  . UNK D 4 20  ? 131.414 164.823 125.642 1.00 37.71  ?  24  UNK D CA  1 
ATOM 6959 C C   . UNK D 4 20  ? 132.081 165.715 124.614 1.00 40.36  ?  24  UNK D C   1 
ATOM 6960 O O   . UNK D 4 20  ? 131.497 166.041 123.580 1.00 41.85  ?  24  UNK D O   1 
ATOM 6961 C CB  . UNK D 4 20  ? 130.800 165.652 126.747 1.00 20.00  ?  24  UNK D CB  1 
ATOM 6962 N N   . UNK D 4 21  ? 133.321 166.093 124.894 1.00 40.95  ?  25  UNK D N   1 
ATOM 6963 C CA  . UNK D 4 21  ? 134.084 166.873 123.941 1.00 43.41  ?  25  UNK D CA  1 
ATOM 6964 C C   . UNK D 4 21  ? 134.338 166.046 122.691 1.00 44.69  ?  25  UNK D C   1 
ATOM 6965 O O   . UNK D 4 21  ? 134.341 166.570 121.575 1.00 46.51  ?  25  UNK D O   1 
ATOM 6966 C CB  . UNK D 4 21  ? 135.390 167.340 124.554 1.00 20.00  ?  25  UNK D CB  1 
ATOM 6967 N N   . UNK D 4 22  ? 134.531 164.745 122.877 1.00 43.77  ?  26  UNK D N   1 
ATOM 6968 C CA  . UNK D 4 22  ? 134.706 163.865 121.731 1.00 44.80  ?  26  UNK D CA  1 
ATOM 6969 C C   . UNK D 4 22  ? 133.430 163.824 120.905 1.00 45.14  ?  26  UNK D C   1 
ATOM 6970 O O   . UNK D 4 22  ? 133.466 163.763 119.672 1.00 46.86  ?  26  UNK D O   1 
ATOM 6971 C CB  . UNK D 4 22  ? 135.093 162.475 122.183 1.00 20.00  ?  26  UNK D CB  1 
ATOM 6972 N N   . UNK D 4 23  ? 132.300 163.885 121.596 1.00 43.51  ?  27  UNK D N   1 
ATOM 6973 C CA  . UNK D 4 23  ? 131.008 163.889 120.938 1.00 43.66  ?  27  UNK D CA  1 
ATOM 6974 C C   . UNK D 4 23  ? 130.858 165.169 120.146 1.00 45.83  ?  27  UNK D C   1 
ATOM 6975 O O   . UNK D 4 23  ? 130.224 165.192 119.092 1.00 47.13  ?  27  UNK D O   1 
ATOM 6976 C CB  . UNK D 4 23  ? 129.892 163.750 121.948 1.00 20.00  ?  27  UNK D CB  1 
ATOM 6977 N N   . UNK D 4 24  ? 131.448 166.239 120.664 1.00 120.13 ?  28  UNK D N   1 
ATOM 6978 C CA  . UNK D 4 24  ? 131.471 167.489 119.931 1.00 122.29 ?  28  UNK D CA  1 
ATOM 6979 C C   . UNK D 4 24  ? 132.318 167.330 118.682 1.00 124.71 ?  28  UNK D C   1 
ATOM 6980 O O   . UNK D 4 24  ? 131.983 167.856 117.623 1.00 126.77 ?  28  UNK D O   1 
ATOM 6981 C CB  . UNK D 4 24  ? 132.001 168.610 120.802 1.00 20.00  ?  28  UNK D CB  1 
ATOM 6982 N N   . UNK D 4 25  ? 133.402 166.571 118.799 1.00 75.24  ?  29  UNK D N   1 
ATOM 6983 C CA  . UNK D 4 25  ? 134.270 166.349 117.654 1.00 77.40  ?  29  UNK D CA  1 
ATOM 6984 C C   . UNK D 4 25  ? 133.523 165.577 116.588 1.00 78.88  ?  29  UNK D C   1 
ATOM 6985 O O   . UNK D 4 25  ? 133.742 165.773 115.397 1.00 81.11  ?  29  UNK D O   1 
ATOM 6986 C CB  . UNK D 4 25  ? 135.524 165.610 118.063 1.00 20.00  ?  29  UNK D CB  1 
ATOM 6987 N N   . UNK D 4 26  ? 132.618 164.712 117.026 1.00 260.10 ?  30  UNK D N   1 
ATOM 6988 C CA  . UNK D 4 26  ? 131.862 163.892 116.094 1.00 261.38 ?  30  UNK D CA  1 
ATOM 6989 C C   . UNK D 4 26  ? 130.779 164.694 115.375 1.00 263.43 ?  30  UNK D C   1 
ATOM 6990 O O   . UNK D 4 26  ? 130.237 164.242 114.369 1.00 265.72 ?  30  UNK D O   1 
ATOM 6991 C CB  . UNK D 4 26  ? 131.251 162.709 116.813 1.00 20.00  ?  30  UNK D CB  1 
ATOM 6992 N N   . UNK D 4 27  ? 130.463 165.879 115.885 1.00 55.50  ?  31  UNK D N   1 
ATOM 6993 C CA  . UNK D 4 27  ? 129.458 166.721 115.245 1.00 57.26  ?  31  UNK D CA  1 
ATOM 6994 C C   . UNK D 4 27  ? 130.111 167.876 114.498 1.00 59.25  ?  31  UNK D C   1 
ATOM 6995 O O   . UNK D 4 27  ? 130.797 167.671 113.496 1.00 61.58  ?  31  UNK D O   1 
ATOM 6996 C CB  . UNK D 4 27  ? 128.467 167.245 116.269 1.00 20.00  ?  31  UNK D CB  1 
ATOM 6997 N N   . UNK D 4 28  ? 131.851 178.133 105.661 1.00 30.00  ?  41  UNK D N   1 
ATOM 6998 C CA  . UNK D 4 28  ? 131.162 178.872 104.609 1.00 30.00  ?  41  UNK D CA  1 
ATOM 6999 C C   . UNK D 4 28  ? 129.994 179.666 105.177 1.00 30.00  ?  41  UNK D C   1 
ATOM 7000 O O   . UNK D 4 28  ? 130.013 180.896 105.188 1.00 30.00  ?  41  UNK D O   1 
ATOM 7001 C CB  . UNK D 4 28  ? 130.679 177.923 103.525 1.00 30.00  ?  41  UNK D CB  1 
ATOM 7002 N N   . UNK D 4 29  ? 128.977 178.955 105.648 1.00 30.00  ?  42  UNK D N   1 
ATOM 7003 C CA  . UNK D 4 29  ? 127.802 179.594 106.223 1.00 30.00  ?  42  UNK D CA  1 
ATOM 7004 C C   . UNK D 4 29  ? 128.099 180.140 107.615 1.00 30.00  ?  42  UNK D C   1 
ATOM 7005 O O   . UNK D 4 29  ? 127.779 179.506 108.620 1.00 30.00  ?  42  UNK D O   1 
ATOM 7006 C CB  . UNK D 4 29  ? 126.639 178.616 106.273 1.00 30.00  ?  42  UNK D CB  1 
ATOM 7007 N N   . UNK D 4 30  ? 128.713 181.318 107.669 1.00 30.00  ?  43  UNK D N   1 
ATOM 7008 C CA  . UNK D 4 30  ? 129.019 181.954 108.949 1.00 30.00  ?  43  UNK D CA  1 
ATOM 7009 C C   . UNK D 4 30  ? 129.303 180.904 110.013 1.00 30.00  ?  43  UNK D C   1 
ATOM 7010 O O   . UNK D 4 30  ? 129.991 181.162 111.003 1.00 30.00  ?  43  UNK D O   1 
ATOM 7011 C CB  . UNK D 4 30  ? 127.875 182.855 109.383 1.00 30.00  ?  43  UNK D CB  1 
ATOM 7012 N N   . UNK D 4 31  ? 128.781 179.707 109.780 1.00 30.00  ?  44  UNK D N   1 
ATOM 7013 C CA  . UNK D 4 31  ? 128.978 178.591 110.684 1.00 30.00  ?  44  UNK D CA  1 
ATOM 7014 C C   . UNK D 4 31  ? 130.458 178.254 110.806 1.00 30.00  ?  44  UNK D C   1 
ATOM 7015 O O   . UNK D 4 31  ? 130.883 177.656 111.793 1.00 30.00  ?  44  UNK D O   1 
ATOM 7016 C CB  . UNK D 4 31  ? 128.195 177.385 110.205 1.00 30.00  ?  44  UNK D CB  1 
ATOM 7017 N N   . UNK D 4 32  ? 131.240 178.635 109.802 1.00 30.00  ?  45  UNK D N   1 
ATOM 7018 C CA  . UNK D 4 32  ? 132.675 178.395 109.839 1.00 30.00  ?  45  UNK D CA  1 
ATOM 7019 C C   . UNK D 4 32  ? 133.321 179.116 111.021 1.00 30.00  ?  45  UNK D C   1 
ATOM 7020 O O   . UNK D 4 32  ? 134.368 178.693 111.509 1.00 30.00  ?  45  UNK D O   1 
ATOM 7021 C CB  . UNK D 4 32  ? 133.322 178.824 108.537 1.00 20.00  ?  45  UNK D CB  1 
ATOM 7022 N N   . UNK D 4 33  ? 132.714 180.209 111.474 1.00 30.00  ?  46  UNK D N   1 
ATOM 7023 C CA  . UNK D 4 33  ? 133.213 180.886 112.667 1.00 30.00  ?  46  UNK D CA  1 
ATOM 7024 C C   . UNK D 4 33  ? 133.068 179.997 113.900 1.00 30.00  ?  46  UNK D C   1 
ATOM 7025 O O   . UNK D 4 33  ? 133.953 179.951 114.761 1.00 30.00  ?  46  UNK D O   1 
ATOM 7026 C CB  . UNK D 4 33  ? 132.479 182.196 112.876 1.00 20.00  ?  46  UNK D CB  1 
ATOM 7027 N N   . UNK D 4 34  ? 131.968 179.252 113.947 1.00 30.00  ?  47  UNK D N   1 
ATOM 7028 C CA  . UNK D 4 34  ? 131.686 178.359 115.062 1.00 30.00  ?  47  UNK D CA  1 
ATOM 7029 C C   . UNK D 4 34  ? 132.717 177.247 115.122 1.00 30.00  ?  47  UNK D C   1 
ATOM 7030 O O   . UNK D 4 34  ? 132.989 176.695 116.185 1.00 30.00  ?  47  UNK D O   1 
ATOM 7031 C CB  . UNK D 4 34  ? 130.286 177.781 114.943 1.00 20.00  ?  47  UNK D CB  1 
ATOM 7032 N N   . UNK D 4 35  ? 133.306 176.943 113.972 1.00 20.00  ?  48  UNK D N   1 
ATOM 7033 C CA  . UNK D 4 35  ? 134.319 175.906 113.881 1.00 20.00  ?  48  UNK D CA  1 
ATOM 7034 C C   . UNK D 4 35  ? 135.534 176.287 114.712 1.00 20.00  ?  48  UNK D C   1 
ATOM 7035 O O   . UNK D 4 35  ? 136.346 175.431 115.059 1.00 20.00  ?  48  UNK D O   1 
ATOM 7036 C CB  . UNK D 4 35  ? 134.713 175.663 112.435 1.00 20.00  ?  48  UNK D CB  1 
ATOM 7037 N N   . UNK D 4 36  ? 135.662 177.573 115.031 1.00 20.00  ?  49  UNK D N   1 
ATOM 7038 C CA  . UNK D 4 36  ? 136.757 178.018 115.882 1.00 20.00  ?  49  UNK D CA  1 
ATOM 7039 C C   . UNK D 4 36  ? 136.665 177.342 117.247 1.00 20.00  ?  49  UNK D C   1 
ATOM 7040 O O   . UNK D 4 36  ? 137.682 177.055 117.878 1.00 20.00  ?  49  UNK D O   1 
ATOM 7041 N N   . UNK D 4 37  ? 135.441 177.076 117.691 1.00 20.00  ?  50  UNK D N   1 
ATOM 7042 C CA  . UNK D 4 37  ? 135.224 176.374 118.949 1.00 20.00  ?  50  UNK D CA  1 
ATOM 7043 C C   . UNK D 4 37  ? 135.751 174.945 118.879 1.00 20.00  ?  50  UNK D C   1 
ATOM 7044 O O   . UNK D 4 37  ? 136.180 174.383 119.887 1.00 20.00  ?  50  UNK D O   1 
ATOM 7045 C CB  . UNK D 4 37  ? 133.744 176.378 119.312 1.00 20.00  ?  50  UNK D CB  1 
ATOM 7046 N N   . UNK D 4 38  ? 135.708 174.357 117.687 1.00 20.00  ?  51  UNK D N   1 
ATOM 7047 C CA  . UNK D 4 38  ? 136.183 172.990 117.499 1.00 20.00  ?  51  UNK D CA  1 
ATOM 7048 C C   . UNK D 4 38  ? 137.686 172.894 117.713 1.00 20.00  ?  51  UNK D C   1 
ATOM 7049 O O   . UNK D 4 38  ? 138.192 171.885 118.199 1.00 20.00  ?  51  UNK D O   1 
ATOM 7050 C CB  . UNK D 4 38  ? 135.817 172.487 116.116 1.00 20.00  ?  51  UNK D CB  1 
ATOM 7051 N N   . UNK D 4 39  ? 138.395 173.958 117.357 1.00 30.00  ?  52  UNK D N   1 
ATOM 7052 C CA  . UNK D 4 39  ? 139.824 174.021 117.605 1.00 30.00  ?  52  UNK D CA  1 
ATOM 7053 C C   . UNK D 4 39  ? 140.062 174.425 119.049 1.00 30.00  ?  52  UNK D C   1 
ATOM 7054 O O   . UNK D 4 39  ? 141.171 174.307 119.565 1.00 30.00  ?  52  UNK D O   1 
ATOM 7055 C CB  . UNK D 4 39  ? 140.492 174.998 116.655 1.00 20.00  ?  52  UNK D CB  1 
ATOM 7056 N N   . UNK D 4 40  ? 139.003 174.892 119.701 1.00 20.00  ?  53  UNK D N   1 
ATOM 7057 C CA  . UNK D 4 40  ? 139.118 175.394 121.059 1.00 20.00  ?  53  UNK D CA  1 
ATOM 7058 C C   . UNK D 4 40  ? 139.087 174.268 122.078 1.00 20.00  ?  53  UNK D C   1 
ATOM 7059 O O   . UNK D 4 40  ? 140.116 173.666 122.381 1.00 20.00  ?  53  UNK D O   1 
ATOM 7060 C CB  . UNK D 4 40  ? 138.015 176.395 121.350 1.00 20.00  ?  53  UNK D CB  1 
ATOM 7061 N N   . UNK D 4 41  ? 137.898 173.977 122.590 1.00 30.00  ?  54  UNK D N   1 
ATOM 7062 C CA  . UNK D 4 41  ? 137.759 173.124 123.765 1.00 30.00  ?  54  UNK D CA  1 
ATOM 7063 C C   . UNK D 4 41  ? 138.261 171.693 123.571 1.00 30.00  ?  54  UNK D C   1 
ATOM 7064 O O   . UNK D 4 41  ? 138.816 171.099 124.495 1.00 30.00  ?  54  UNK D O   1 
ATOM 7065 C CB  . UNK D 4 41  ? 136.305 173.101 124.201 1.00 20.00  ?  54  UNK D CB  1 
ATOM 7066 N N   . UNK D 4 42  ? 138.088 171.151 122.371 1.00 20.00  ?  55  UNK D N   1 
ATOM 7067 C CA  . UNK D 4 42  ? 138.377 169.740 122.132 1.00 20.00  ?  55  UNK D CA  1 
ATOM 7068 C C   . UNK D 4 42  ? 139.853 169.396 122.295 1.00 20.00  ?  55  UNK D C   1 
ATOM 7069 O O   . UNK D 4 42  ? 140.198 168.315 122.776 1.00 20.00  ?  55  UNK D O   1 
ATOM 7070 C CB  . UNK D 4 42  ? 137.903 169.343 120.744 1.00 20.00  ?  55  UNK D CB  1 
ATOM 7071 N N   . UNK D 4 43  ? 140.721 170.325 121.915 1.00 30.00  ?  56  UNK D N   1 
ATOM 7072 C CA  . UNK D 4 43  ? 142.152 170.066 121.949 1.00 30.00  ?  56  UNK D CA  1 
ATOM 7073 C C   . UNK D 4 43  ? 142.669 170.027 123.378 1.00 30.00  ?  56  UNK D C   1 
ATOM 7074 O O   . UNK D 4 43  ? 143.336 169.072 123.790 1.00 30.00  ?  56  UNK D O   1 
ATOM 7075 C CB  . UNK D 4 43  ? 142.890 171.118 121.154 1.00 20.00  ?  56  UNK D CB  1 
ATOM 7076 N N   . UNK D 4 44  ? 142.336 171.061 124.140 1.00 20.00  ?  57  UNK D N   1 
ATOM 7077 C CA  . UNK D 4 44  ? 142.759 171.134 125.529 1.00 20.00  ?  57  UNK D CA  1 
ATOM 7078 C C   . UNK D 4 44  ? 142.118 169.999 126.312 1.00 20.00  ?  57  UNK D C   1 
ATOM 7079 O O   . UNK D 4 44  ? 142.710 169.466 127.250 1.00 20.00  ?  57  UNK D O   1 
ATOM 7080 N N   . UNK D 4 45  ? 140.906 169.627 125.915 1.00 20.00  ?  58  UNK D N   1 
ATOM 7081 C CA  . UNK D 4 45  ? 140.239 168.509 126.556 1.00 20.00  ?  58  UNK D CA  1 
ATOM 7082 C C   . UNK D 4 45  ? 141.015 167.237 126.280 1.00 20.00  ?  58  UNK D C   1 
ATOM 7083 O O   . UNK D 4 45  ? 141.137 166.372 127.147 1.00 20.00  ?  58  UNK D O   1 
ATOM 7084 C CB  . UNK D 4 45  ? 138.811 168.382 126.063 1.00 20.00  ?  58  UNK D CB  1 
ATOM 7085 N N   . UNK D 4 46  ? 141.560 167.135 125.072 1.00 20.00  ?  59  UNK D N   1 
ATOM 7086 C CA  . UNK D 4 46  ? 142.367 165.978 124.726 1.00 20.00  ?  59  UNK D CA  1 
ATOM 7087 C C   . UNK D 4 46  ? 143.613 165.965 125.587 1.00 20.00  ?  59  UNK D C   1 
ATOM 7088 O O   . UNK D 4 46  ? 144.081 164.904 126.013 1.00 20.00  ?  59  UNK D O   1 
ATOM 7089 C CB  . UNK D 4 46  ? 142.731 165.994 123.256 1.00 20.00  ?  59  UNK D CB  1 
ATOM 7090 N N   . UNK D 4 47  ? 144.125 167.154 125.876 1.00 20.00  ?  60  UNK D N   1 
ATOM 7091 C CA  . UNK D 4 47  ? 145.274 167.250 126.754 1.00 20.00  ?  60  UNK D CA  1 
ATOM 7092 C C   . UNK D 4 47  ? 144.892 166.775 128.145 1.00 20.00  ?  60  UNK D C   1 
ATOM 7093 O O   . UNK D 4 47  ? 145.693 166.155 128.839 1.00 20.00  ?  60  UNK D O   1 
ATOM 7094 C CB  . UNK D 4 47  ? 145.794 168.666 126.799 1.00 20.00  ?  60  UNK D CB  1 
ATOM 7095 N N   . UNK D 4 48  ? 143.655 167.057 128.538 1.00 20.00  ?  61  UNK D N   1 
ATOM 7096 C CA  . UNK D 4 48  ? 143.143 166.620 129.830 1.00 20.00  ?  61  UNK D CA  1 
ATOM 7097 C C   . UNK D 4 48  ? 143.015 165.113 129.875 1.00 20.00  ?  61  UNK D C   1 
ATOM 7098 O O   . UNK D 4 48  ? 143.162 164.494 130.925 1.00 20.00  ?  61  UNK D O   1 
ATOM 7099 C CB  . UNK D 4 48  ? 141.806 167.269 130.118 1.00 20.00  ?  61  UNK D CB  1 
ATOM 7100 N N   . UNK D 4 49  ? 142.737 164.528 128.718 1.00 20.00  ?  62  UNK D N   1 
ATOM 7101 C CA  . UNK D 4 49  ? 142.550 163.092 128.625 1.00 20.00  ?  62  UNK D CA  1 
ATOM 7102 C C   . UNK D 4 49  ? 143.881 162.375 128.714 1.00 20.00  ?  62  UNK D C   1 
ATOM 7103 O O   . UNK D 4 49  ? 144.021 161.393 129.438 1.00 20.00  ?  62  UNK D O   1 
ATOM 7104 C CB  . UNK D 4 49  ? 141.846 162.734 127.335 1.00 20.00  ?  62  UNK D CB  1 
ATOM 7105 N N   . UNK D 4 50  ? 144.867 162.883 127.988 1.00 20.00  ?  63  UNK D N   1 
ATOM 7106 C CA  . UNK D 4 50  ? 146.184 162.274 128.007 1.00 20.00  ?  63  UNK D CA  1 
ATOM 7107 C C   . UNK D 4 50  ? 146.901 162.630 129.299 1.00 20.00  ?  63  UNK D C   1 
ATOM 7108 O O   . UNK D 4 50  ? 147.927 162.042 129.634 1.00 20.00  ?  63  UNK D O   1 
ATOM 7109 C CB  . UNK D 4 50  ? 146.990 162.710 126.811 1.00 20.00  ?  63  UNK D CB  1 
ATOM 7110 N N   . UNK D 4 51  ? 146.351 163.600 130.019 1.00 20.00  ?  64  UNK D N   1 
ATOM 7111 C CA  . UNK D 4 51  ? 146.943 164.064 131.263 1.00 20.00  ?  64  UNK D CA  1 
ATOM 7112 C C   . UNK D 4 51  ? 147.039 162.956 132.303 1.00 20.00  ?  64  UNK D C   1 
ATOM 7113 O O   . UNK D 4 51  ? 148.106 162.382 132.515 1.00 20.00  ?  64  UNK D O   1 
ATOM 7114 C CB  . UNK D 4 51  ? 146.145 165.225 131.820 1.00 20.00  ?  64  UNK D CB  1 
ATOM 7115 N N   . UNK D 4 52  ? 145.907 162.640 132.922 1.00 20.00  ?  65  UNK D N   1 
ATOM 7116 C CA  . UNK D 4 52  ? 145.881 161.784 134.103 1.00 20.00  ?  65  UNK D CA  1 
ATOM 7117 C C   . UNK D 4 52  ? 146.385 160.386 133.807 1.00 20.00  ?  65  UNK D C   1 
ATOM 7118 O O   . UNK D 4 52  ? 146.812 159.672 134.716 1.00 20.00  ?  65  UNK D O   1 
ATOM 7119 C CB  . UNK D 4 52  ? 144.476 161.720 134.668 1.00 20.00  ?  65  UNK D CB  1 
ATOM 7120 N N   . UNK D 4 53  ? 146.318 160.016 132.532 1.00 20.00  ?  66  UNK D N   1 
ATOM 7121 C CA  . UNK D 4 53  ? 146.642 158.677 132.058 1.00 20.00  ?  66  UNK D CA  1 
ATOM 7122 C C   . UNK D 4 53  ? 147.867 158.066 132.721 1.00 20.00  ?  66  UNK D C   1 
ATOM 7123 O O   . UNK D 4 53  ? 147.751 157.291 133.673 1.00 20.00  ?  66  UNK D O   1 
ATOM 7124 C CB  . UNK D 4 53  ? 146.840 158.707 130.554 1.00 20.00  ?  66  UNK D CB  1 
ATOM 7125 N N   . UNK D 4 54  ? 149.040 158.442 132.227 1.00 20.00  ?  67  UNK D N   1 
ATOM 7126 C CA  . UNK D 4 54  ? 150.280 157.783 132.614 1.00 20.00  ?  67  UNK D CA  1 
ATOM 7127 C C   . UNK D 4 54  ? 150.589 157.931 134.099 1.00 20.00  ?  67  UNK D C   1 
ATOM 7128 O O   . UNK D 4 54  ? 151.234 157.070 134.694 1.00 20.00  ?  67  UNK D O   1 
ATOM 7129 C CB  . UNK D 4 54  ? 151.431 158.327 131.784 1.00 20.00  ?  67  UNK D CB  1 
ATOM 7130 N N   . UNK D 4 55  ? 150.129 159.025 134.693 1.00 20.00  ?  68  UNK D N   1 
ATOM 7131 C CA  . UNK D 4 55  ? 150.384 159.277 136.105 1.00 20.00  ?  68  UNK D CA  1 
ATOM 7132 C C   . UNK D 4 55  ? 149.608 158.306 136.974 1.00 20.00  ?  68  UNK D C   1 
ATOM 7133 O O   . UNK D 4 55  ? 150.193 157.509 137.708 1.00 20.00  ?  68  UNK D O   1 
ATOM 7134 C CB  . UNK D 4 55  ? 150.025 160.707 136.461 1.00 20.00  ?  68  UNK D CB  1 
ATOM 7135 N N   . UNK D 4 56  ? 148.285 158.361 136.861 1.00 20.00  ?  69  UNK D N   1 
ATOM 7136 C CA  . UNK D 4 56  ? 147.425 157.506 137.654 1.00 20.00  ?  69  UNK D CA  1 
ATOM 7137 C C   . UNK D 4 56  ? 147.718 156.048 137.341 1.00 20.00  ?  69  UNK D C   1 
ATOM 7138 O O   . UNK D 4 56  ? 147.539 155.175 138.186 1.00 20.00  ?  69  UNK D O   1 
ATOM 7139 C CB  . UNK D 4 56  ? 145.972 157.829 137.396 1.00 20.00  ?  69  UNK D CB  1 
ATOM 7140 N N   . UNK D 4 57  ? 148.189 155.788 136.128 1.00 20.00  ?  70  UNK D N   1 
ATOM 7141 C CA  . UNK D 4 57  ? 148.577 154.439 135.755 1.00 20.00  ?  70  UNK D CA  1 
ATOM 7142 C C   . UNK D 4 57  ? 149.825 153.991 136.510 1.00 20.00  ?  70  UNK D C   1 
ATOM 7143 O O   . UNK D 4 57  ? 149.768 153.103 137.364 1.00 20.00  ?  70  UNK D O   1 
ATOM 7144 C CB  . UNK D 4 57  ? 148.811 154.356 134.260 1.00 20.00  ?  70  UNK D CB  1 
ATOM 7145 N N   . UNK D 4 58  ? 150.945 154.634 136.200 1.00 30.00  ?  71  UNK D N   1 
ATOM 7146 C CA  . UNK D 4 58  ? 152.254 154.212 136.682 1.00 30.00  ?  71  UNK D CA  1 
ATOM 7147 C C   . UNK D 4 58  ? 152.351 154.291 138.195 1.00 30.00  ?  71  UNK D C   1 
ATOM 7148 O O   . UNK D 4 58  ? 153.130 153.566 138.821 1.00 30.00  ?  71  UNK D O   1 
ATOM 7149 C CB  . UNK D 4 58  ? 153.339 155.055 136.045 1.00 20.00  ?  71  UNK D CB  1 
ATOM 7150 N N   . UNK D 4 59  ? 151.528 155.153 138.780 1.00 20.00  ?  72  UNK D N   1 
ATOM 7151 C CA  . UNK D 4 59  ? 151.550 155.383 140.216 1.00 20.00  ?  72  UNK D CA  1 
ATOM 7152 C C   . UNK D 4 59  ? 151.184 154.109 140.958 1.00 20.00  ?  72  UNK D C   1 
ATOM 7153 O O   . UNK D 4 59  ? 151.473 153.959 142.144 1.00 20.00  ?  72  UNK D O   1 
ATOM 7154 C CB  . UNK D 4 59  ? 150.604 156.509 140.592 1.00 20.00  ?  72  UNK D CB  1 
ATOM 7155 N N   . UNK D 4 60  ? 150.563 153.180 140.243 1.00 20.00  ?  73  UNK D N   1 
ATOM 7156 C CA  . UNK D 4 60  ? 150.079 151.952 140.841 1.00 20.00  ?  73  UNK D CA  1 
ATOM 7157 C C   . UNK D 4 60  ? 151.231 151.005 141.180 1.00 20.00  ?  73  UNK D C   1 
ATOM 7158 O O   . UNK D 4 60  ? 151.011 149.842 141.516 1.00 20.00  ?  73  UNK D O   1 
ATOM 7159 C CB  . UNK D 4 60  ? 149.093 151.280 139.914 1.00 20.00  ?  73  UNK D CB  1 
ATOM 7160 N N   . UNK D 4 61  ? 152.456 151.517 141.098 1.00 30.00  ?  74  UNK D N   1 
ATOM 7161 C CA  . UNK D 4 61  ? 153.653 150.726 141.349 1.00 30.00  ?  74  UNK D CA  1 
ATOM 7162 C C   . UNK D 4 61  ? 153.697 150.116 142.756 1.00 30.00  ?  74  UNK D C   1 
ATOM 7163 O O   . UNK D 4 61  ? 154.234 149.027 142.947 1.00 30.00  ?  74  UNK D O   1 
ATOM 7164 C CB  . UNK D 4 61  ? 154.881 151.583 141.116 1.00 20.00  ?  74  UNK D CB  1 
ATOM 7165 N N   . UNK D 4 62  ? 153.124 150.801 143.736 1.00 30.00  ?  75  UNK D N   1 
ATOM 7166 C CA  . UNK D 4 62  ? 153.105 150.274 145.095 1.00 30.00  ?  75  UNK D CA  1 
ATOM 7167 C C   . UNK D 4 62  ? 151.766 150.538 145.762 1.00 30.00  ?  75  UNK D C   1 
ATOM 7168 O O   . UNK D 4 62  ? 151.674 150.580 146.986 1.00 30.00  ?  75  UNK D O   1 
ATOM 7169 C CB  . UNK D 4 62  ? 154.233 150.874 145.915 1.00 20.00  ?  75  UNK D CB  1 
ATOM 7170 N N   . MET E 5 1   ? 82.992  151.717 96.384  1.00 24.69  ?  1   MET G N   1 
ATOM 7171 C CA  . MET E 5 1   ? 84.276  152.355 96.137  1.00 18.08  ?  1   MET G CA  1 
ATOM 7172 C C   . MET E 5 1   ? 84.109  153.439 95.076  1.00 19.41  ?  1   MET G C   1 
ATOM 7173 O O   . MET E 5 1   ? 83.924  153.135 93.897  1.00 20.23  ?  1   MET G O   1 
ATOM 7174 C CB  . MET E 5 1   ? 85.312  151.321 95.696  1.00 19.92  ?  1   MET G CB  1 
ATOM 7175 C CG  . MET E 5 1   ? 86.717  151.870 95.541  1.00 19.44  ?  1   MET G CG  1 
ATOM 7176 S SD  . MET E 5 1   ? 87.436  152.377 97.115  1.00 23.87  ?  1   MET G SD  1 
ATOM 7177 C CE  . MET E 5 1   ? 87.814  150.786 97.845  1.00 24.53  ?  1   MET G CE  1 
ATOM 7178 N N   . ASN E 5 2   ? 84.167  154.700 95.497  1.00 18.42  ?  2   ASN G N   1 
ATOM 7179 C CA  . ASN E 5 2   ? 83.890  155.810 94.589  1.00 17.48  ?  2   ASN G CA  1 
ATOM 7180 C C   . ASN E 5 2   ? 84.649  157.113 94.884  1.00 15.61  ?  2   ASN G C   1 
ATOM 7181 O O   . ASN E 5 2   ? 85.853  157.097 95.134  1.00 15.02  ?  2   ASN G O   1 
ATOM 7182 C CB  . ASN E 5 2   ? 82.375  156.063 94.559  1.00 18.53  ?  2   ASN G CB  1 
ATOM 7183 C CG  . ASN E 5 2   ? 81.803  156.412 95.925  1.00 18.42  ?  2   ASN G CG  1 
ATOM 7184 O OD1 . ASN E 5 2   ? 82.446  157.073 96.737  1.00 17.07  ?  2   ASN G OD1 1 
ATOM 7185 N ND2 . ASN E 5 2   ? 80.588  155.947 96.186  1.00 20.57  ?  2   ASN G ND2 1 
ATOM 7186 N N   . ILE E 5 3   ? 83.935  158.236 94.832  1.00 14.37  ?  3   ILE G N   1 
ATOM 7187 C CA  . ILE E 5 3   ? 84.551  159.565 94.843  1.00 14.77  ?  3   ILE G CA  1 
ATOM 7188 C C   . ILE E 5 3   ? 85.305  159.954 96.120  1.00 14.41  ?  3   ILE G C   1 
ATOM 7189 O O   . ILE E 5 3   ? 86.290  160.696 96.054  1.00 13.87  ?  3   ILE G O   1 
ATOM 7190 C CB  . ILE E 5 3   ? 83.477  160.658 94.557  1.00 16.27  ?  3   ILE G CB  1 
ATOM 7191 C CG1 . ILE E 5 3   ? 84.127  162.032 94.381  1.00 13.06  ?  3   ILE G CG1 1 
ATOM 7192 C CG2 . ILE E 5 3   ? 82.421  160.695 95.657  1.00 17.22  ?  3   ILE G CG2 1 
ATOM 7193 C CD1 . ILE E 5 3   ? 85.053  162.124 93.207  1.00 11.37  ?  3   ILE G CD1 1 
ATOM 7194 N N   . PHE E 5 4   ? 84.890  159.424 97.265  1.00 15.00  ?  4   PHE G N   1 
ATOM 7195 C CA  . PHE E 5 4   ? 85.409  159.908 98.541  1.00 14.69  ?  4   PHE G CA  1 
ATOM 7196 C C   . PHE E 5 4   ? 86.867  159.511 98.754  1.00 14.82  ?  4   PHE G C   1 
ATOM 7197 O O   . PHE E 5 4   ? 87.779  160.286 98.457  1.00 14.30  ?  4   PHE G O   1 
ATOM 7198 C CB  . PHE E 5 4   ? 84.550  159.390 99.695  1.00 15.95  ?  4   PHE G CB  1 
ATOM 7199 C CG  . PHE E 5 4   ? 83.124  159.860 99.646  1.00 16.97  ?  4   PHE G CG  1 
ATOM 7200 C CD1 . PHE E 5 4   ? 82.774  161.108 100.131 1.00 19.68  ?  4   PHE G CD1 1 
ATOM 7201 C CD2 . PHE E 5 4   ? 82.133  159.049 99.118  1.00 17.08  ?  4   PHE G CD2 1 
ATOM 7202 C CE1 . PHE E 5 4   ? 81.465  161.542 100.086 1.00 18.97  ?  4   PHE G CE1 1 
ATOM 7203 C CE2 . PHE E 5 4   ? 80.821  159.476 99.072  1.00 19.55  ?  4   PHE G CE2 1 
ATOM 7204 C CZ  . PHE E 5 4   ? 80.487  160.725 99.557  1.00 19.67  ?  4   PHE G CZ  1 
ATOM 7205 N N   A GLU E 5 5   ? 83.332  155.689 99.782  0.32 15.47  ?  5   GLU G N   1 
ATOM 7206 N N   B GLU E 5 5   ? 83.478  155.754 99.924  0.68 15.37  ?  5   GLU G N   1 
ATOM 7207 C CA  A GLU E 5 5   ? 84.768  155.854 99.588  0.32 15.94  ?  5   GLU G CA  1 
ATOM 7208 C CA  B GLU E 5 5   ? 84.868  155.624 99.503  0.68 15.94  ?  5   GLU G CA  1 
ATOM 7209 C C   A GLU E 5 5   ? 85.097  156.268 98.157  0.32 14.80  ?  5   GLU G C   1 
ATOM 7210 C C   B GLU E 5 5   ? 85.112  156.302 98.160  0.68 14.78  ?  5   GLU G C   1 
ATOM 7211 O O   A GLU E 5 5   ? 86.224  156.094 97.694  0.32 14.62  ?  5   GLU G O   1 
ATOM 7212 O O   B GLU E 5 5   ? 86.252  156.605 97.807  0.68 14.52  ?  5   GLU G O   1 
ATOM 7213 C CB  A GLU E 5 5   ? 85.512  154.566 99.940  0.32 17.14  ?  5   GLU G CB  1 
ATOM 7214 C CB  B GLU E 5 5   ? 85.264  154.147 99.413  0.68 17.19  ?  5   GLU G CB  1 
ATOM 7215 C CG  A GLU E 5 5   ? 85.413  154.169 101.400 0.32 18.05  ?  5   GLU G CG  1 
ATOM 7216 C CG  B GLU E 5 5   ? 85.206  153.389 100.731 0.68 18.04  ?  5   GLU G CG  1 
ATOM 7217 C CD  A GLU E 5 5   ? 86.201  152.913 101.709 0.32 19.43  ?  5   GLU G CD  1 
ATOM 7218 C CD  B GLU E 5 5   ? 86.280  153.815 101.713 0.68 19.81  ?  5   GLU G CD  1 
ATOM 7219 O OE1 A GLU E 5 5   ? 86.932  152.435 100.817 0.32 18.46  ?  5   GLU G OE1 1 
ATOM 7220 O OE1 B GLU E 5 5   ? 87.241  154.496 101.299 0.68 19.63  ?  5   GLU G OE1 1 
ATOM 7221 O OE2 A GLU E 5 5   ? 86.092  152.405 102.844 0.32 20.11  -1 5   GLU G OE2 1 
ATOM 7222 O OE2 B GLU E 5 5   ? 86.166  153.457 102.903 0.68 22.09  -1 5   GLU G OE2 1 
ATOM 7223 N N   . MET E 5 6   ? 88.021  158.835 95.747  1.00 14.00  ?  6   MET G N   1 
ATOM 7224 C CA  . MET E 5 6   ? 88.860  159.256 94.635  1.00 13.11  ?  6   MET G CA  1 
ATOM 7225 C C   . MET E 5 6   ? 89.699  160.465 95.028  1.00 12.74  ?  6   MET G C   1 
ATOM 7226 O O   . MET E 5 6   ? 90.926  160.453 94.902  1.00 12.76  ?  6   MET G O   1 
ATOM 7227 C CB  . MET E 5 6   ? 88.005  159.584 93.411  1.00 13.08  ?  6   MET G CB  1 
ATOM 7228 C CG  . MET E 5 6   ? 88.808  159.968 92.185  1.00 11.89  ?  6   MET G CG  1 
ATOM 7229 S SD  . MET E 5 6   ? 87.801  160.091 90.694  1.00 8.05   ?  6   MET G SD  1 
ATOM 7230 C CE  . MET E 5 6   ? 89.032  160.589 89.497  1.00 9.87   ?  6   MET G CE  1 
ATOM 7231 N N   . LEU E 5 7   ? 89.029  161.510 95.503  1.00 12.38  ?  7   LEU G N   1 
ATOM 7232 C CA  . LEU E 5 7   ? 89.721  162.733 95.895  1.00 12.16  ?  7   LEU G CA  1 
ATOM 7233 C C   . LEU E 5 7   ? 90.687  162.508 97.050  1.00 12.87  ?  7   LEU G C   1 
ATOM 7234 O O   . LEU E 5 7   ? 91.738  163.151 97.124  1.00 12.54  ?  7   LEU G O   1 
ATOM 7235 C CB  . LEU E 5 7   ? 88.718  163.814 96.293  1.00 11.85  ?  7   LEU G CB  1 
ATOM 7236 C CG  . LEU E 5 7   ? 87.762  164.359 95.236  1.00 10.09  ?  7   LEU G CG  1 
ATOM 7237 C CD1 . LEU E 5 7   ? 86.777  165.321 95.879  1.00 9.97   ?  7   LEU G CD1 1 
ATOM 7238 C CD2 . LEU E 5 7   ? 88.538  165.039 94.130  1.00 9.08   ?  7   LEU G CD2 1 
ATOM 7239 N N   . ARG E 5 8   ? 90.333  161.588 97.945  1.00 13.92  ?  8   ARG G N   1 
ATOM 7240 C CA  . ARG E 5 8   ? 91.169  161.321 99.107  1.00 15.01  ?  8   ARG G CA  1 
ATOM 7241 C C   . ARG E 5 8   ? 92.484  160.703 98.653  1.00 14.92  ?  8   ARG G C   1 
ATOM 7242 O O   . ARG E 5 8   ? 93.523  160.876 99.288  1.00 14.50  ?  8   ARG G O   1 
ATOM 7243 C CB  . ARG E 5 8   ? 90.439  160.414 100.095 1.00 17.19  ?  8   ARG G CB  1 
ATOM 7244 C CG  . ARG E 5 8   ? 91.179  160.166 101.389 1.00 20.07  ?  8   ARG G CG  1 
ATOM 7245 C CD  . ARG E 5 8   ? 90.307  159.371 102.339 1.00 25.08  ?  8   ARG G CD  1 
ATOM 7246 N NE  . ARG E 5 8   ? 90.936  159.170 103.639 1.00 29.47  ?  8   ARG G NE  1 
ATOM 7247 C CZ  . ARG E 5 8   ? 90.309  158.660 104.693 1.00 28.46  ?  8   ARG G CZ  1 
ATOM 7248 N NH1 . ARG E 5 8   ? 89.039  158.295 104.596 1.00 26.31  1  8   ARG G NH1 1 
ATOM 7249 N NH2 . ARG E 5 8   ? 90.952  158.510 105.842 1.00 27.43  ?  8   ARG G NH2 1 
ATOM 7250 N N   . ILE E 5 9   ? 92.426  159.974 97.544  1.00 14.90  ?  9   ILE G N   1 
ATOM 7251 C CA  . ILE E 5 9   ? 93.628  159.541 96.851  1.00 15.06  ?  9   ILE G CA  1 
ATOM 7252 C C   . ILE E 5 9   ? 94.316  160.730 96.187  1.00 14.38  ?  9   ILE G C   1 
ATOM 7253 O O   . ILE E 5 9   ? 95.544  160.849 96.191  1.00 14.06  ?  9   ILE G O   1 
ATOM 7254 C CB  . ILE E 5 9   ? 93.302  158.495 95.771  1.00 16.26  ?  9   ILE G CB  1 
ATOM 7255 C CG1 . ILE E 5 9   ? 92.728  157.229 96.403  1.00 16.40  ?  9   ILE G CG1 1 
ATOM 7256 C CG2 . ILE E 5 9   ? 94.536  158.157 94.958  1.00 16.32  ?  9   ILE G CG2 1 
ATOM 7257 C CD1 . ILE E 5 9   ? 92.173  156.261 95.391  1.00 16.60  ?  9   ILE G CD1 1 
ATOM 7258 N N   . ASP E 5 10  ? 93.497  161.617 95.631  1.00 14.17  ?  10  ASP G N   1 
ATOM 7259 C CA  . ASP E 5 10  ? 93.992  162.708 94.799  1.00 14.20  ?  10  ASP G CA  1 
ATOM 7260 C C   . ASP E 5 10  ? 94.823  163.747 95.539  1.00 14.71  ?  10  ASP G C   1 
ATOM 7261 O O   . ASP E 5 10  ? 95.740  164.332 94.965  1.00 15.93  ?  10  ASP G O   1 
ATOM 7262 C CB  . ASP E 5 10  ? 92.815  163.413 94.125  1.00 12.67  ?  10  ASP G CB  1 
ATOM 7263 C CG  . ASP E 5 10  ? 92.143  162.550 93.088  1.00 12.33  ?  10  ASP G CG  1 
ATOM 7264 O OD1 . ASP E 5 10  ? 92.746  161.541 92.674  1.00 11.42  ?  10  ASP G OD1 1 
ATOM 7265 O OD2 . ASP E 5 10  ? 91.005  162.874 92.693  1.00 10.12  -1 10  ASP G OD2 1 
ATOM 7266 N N   . GLU E 5 11  ? 94.519  163.967 96.813  1.00 14.94  ?  11  GLU G N   1 
ATOM 7267 C CA  . GLU E 5 11  ? 95.097  165.110 97.517  1.00 14.52  ?  11  GLU G CA  1 
ATOM 7268 C C   . GLU E 5 11  ? 95.697  164.806 98.888  1.00 14.19  ?  11  GLU G C   1 
ATOM 7269 O O   . GLU E 5 11  ? 96.150  165.722 99.571  1.00 14.94  ?  11  GLU G O   1 
ATOM 7270 C CB  . GLU E 5 11  ? 94.036  166.205 97.680  1.00 13.37  ?  11  GLU G CB  1 
ATOM 7271 C CG  . GLU E 5 11  ? 93.575  166.869 96.389  1.00 12.39  ?  11  GLU G CG  1 
ATOM 7272 C CD  . GLU E 5 11  ? 94.700  167.559 95.642  1.00 12.00  ?  11  GLU G CD  1 
ATOM 7273 O OE1 . GLU E 5 11  ? 95.567  168.173 96.298  1.00 12.76  ?  11  GLU G OE1 1 
ATOM 7274 O OE2 . GLU E 5 11  ? 94.706  167.504 94.394  1.00 10.81  -1 11  GLU G OE2 1 
ATOM 7275 N N   . GLY E 5 12  ? 95.718  163.541 99.294  1.00 14.29  ?  12  GLY G N   1 
ATOM 7276 C CA  . GLY E 5 12  ? 96.155  163.214 100.642 1.00 14.13  ?  12  GLY G CA  1 
ATOM 7277 C C   . GLY E 5 12  ? 95.103  163.614 101.663 1.00 15.66  ?  12  GLY G C   1 
ATOM 7278 O O   . GLY E 5 12  ? 93.932  163.755 101.316 1.00 13.65  ?  12  GLY G O   1 
ATOM 7279 N N   . LEU E 5 13  ? 95.509  163.787 102.919 1.00 13.98  ?  13  LEU G N   1 
ATOM 7280 C CA  . LEU E 5 13  ? 94.562  164.108 103.987 1.00 15.87  ?  13  LEU G CA  1 
ATOM 7281 C C   . LEU E 5 13  ? 95.201  164.736 105.230 1.00 16.94  ?  13  LEU G C   1 
ATOM 7282 O O   . LEU E 5 13  ? 95.793  164.037 106.051 1.00 16.82  ?  13  LEU G O   1 
ATOM 7283 C CB  . LEU E 5 13  ? 93.800  162.842 104.387 1.00 17.48  ?  13  LEU G CB  1 
ATOM 7284 C CG  . LEU E 5 13  ? 92.840  162.907 105.574 1.00 16.88  ?  13  LEU G CG  1 
ATOM 7285 C CD1 . LEU E 5 13  ? 91.721  163.893 105.320 1.00 15.07  ?  13  LEU G CD1 1 
ATOM 7286 C CD2 . LEU E 5 13  ? 92.279  161.525 105.855 1.00 19.58  ?  13  LEU G CD2 1 
ATOM 7287 N N   . ARG E 5 14  ? 95.086  166.056 105.361 1.00 16.35  ?  14  ARG G N   1 
ATOM 7288 C CA  . ARG E 5 14  ? 95.481  166.738 106.593 1.00 17.24  ?  14  ARG G CA  1 
ATOM 7289 C C   . ARG E 5 14  ? 94.334  167.469 107.275 1.00 15.76  ?  14  ARG G C   1 
ATOM 7290 O O   . ARG E 5 14  ? 93.625  168.256 106.648 1.00 14.98  ?  14  ARG G O   1 
ATOM 7291 C CB  . ARG E 5 14  ? 96.603  167.744 106.336 1.00 19.77  ?  14  ARG G CB  1 
ATOM 7292 C CG  . ARG E 5 14  ? 97.951  167.150 106.007 1.00 20.48  ?  14  ARG G CG  1 
ATOM 7293 C CD  . ARG E 5 14  ? 98.944  168.265 105.729 1.00 21.74  ?  14  ARG G CD  1 
ATOM 7294 N NE  . ARG E 5 14  ? 99.093  169.147 106.885 1.00 26.62  ?  14  ARG G NE  1 
ATOM 7295 C CZ  . ARG E 5 14  ? 99.841  170.245 106.897 1.00 25.76  ?  14  ARG G CZ  1 
ATOM 7296 N NH1 . ARG E 5 14  ? 100.537 170.585 105.822 1.00 27.82  1  14  ARG G NH1 1 
ATOM 7297 N NH2 . ARG E 5 14  ? 99.910  170.994 107.988 1.00 35.25  ?  14  ARG G NH2 1 
ATOM 7298 N N   . LEU E 5 15  ? 94.165  167.209 108.567 1.00 15.90  ?  15  LEU G N   1 
ATOM 7299 C CA  . LEU E 5 15  ? 93.216  167.958 109.377 1.00 16.36  ?  15  LEU G CA  1 
ATOM 7300 C C   . LEU E 5 15  ? 93.648  169.419 109.480 1.00 14.79  ?  15  LEU G C   1 
ATOM 7301 O O   . LEU E 5 15  ? 92.819  170.319 109.595 1.00 14.31  ?  15  LEU G O   1 
ATOM 7302 C CB  . LEU E 5 15  ? 93.092  167.343 110.774 1.00 17.73  ?  15  LEU G CB  1 
ATOM 7303 C CG  . LEU E 5 15  ? 92.580  165.900 110.878 1.00 16.60  ?  15  LEU G CG  1 
ATOM 7304 C CD1 . LEU E 5 15  ? 92.605  165.406 112.322 1.00 20.32  ?  15  LEU G CD1 1 
ATOM 7305 C CD2 . LEU E 5 15  ? 91.198  165.753 110.282 1.00 17.68  ?  15  LEU G CD2 1 
ATOM 7306 N N   . LYS E 5 16  ? 94.959  169.641 109.445 1.00 16.40  ?  16  LYS G N   1 
ATOM 7307 C CA  . LYS E 5 16  ? 95.528  170.983 109.501 1.00 15.72  ?  16  LYS G CA  1 
ATOM 7308 C C   . LYS E 5 16  ? 95.373  171.741 108.186 1.00 13.75  ?  16  LYS G C   1 
ATOM 7309 O O   . LYS E 5 16  ? 95.328  171.139 107.114 1.00 12.45  ?  16  LYS G O   1 
ATOM 7310 C CB  . LYS E 5 16  ? 97.008  170.921 109.888 1.00 17.20  ?  16  LYS G CB  1 
ATOM 7311 C CG  . LYS E 5 16  ? 97.254  170.489 111.327 1.00 24.04  ?  16  LYS G CG  1 
ATOM 7312 C CD  . LYS E 5 16  ? 98.708  170.698 111.725 1.00 26.58  ?  16  LYS G CD  1 
ATOM 7313 C CE  . LYS E 5 16  ? 99.644  169.801 110.936 1.00 23.07  ?  16  LYS G CE  1 
ATOM 7314 N NZ  . LYS E 5 16  ? 101.055 169.950 111.389 1.00 28.24  1  16  LYS G NZ  1 
ATOM 7315 N N   . ILE E 5 17  ? 95.291  173.064 108.280 1.00 12.82  ?  17  ILE G N   1 
ATOM 7316 C CA  . ILE E 5 17  ? 95.345  173.918 107.102 1.00 12.99  ?  17  ILE G CA  1 
ATOM 7317 C C   . ILE E 5 17  ? 96.728  173.774 106.468 1.00 14.57  ?  17  ILE G C   1 
ATOM 7318 O O   . ILE E 5 17  ? 97.719  173.633 107.186 1.00 15.21  ?  17  ILE G O   1 
ATOM 7319 C CB  . ILE E 5 17  ? 95.081  175.397 107.458 1.00 14.11  ?  17  ILE G CB  1 
ATOM 7320 C CG1 . ILE E 5 17  ? 93.668  175.576 108.004 1.00 13.05  ?  17  ILE G CG1 1 
ATOM 7321 C CG2 . ILE E 5 17  ? 95.249  176.285 106.244 1.00 14.66  ?  17  ILE G CG2 1 
ATOM 7322 C CD1 . ILE E 5 17  ? 93.417  176.939 108.588 1.00 13.30  ?  17  ILE G CD1 1 
ATOM 7323 N N   . TYR E 5 18  ? 96.806  173.790 105.139 1.00 14.92  ?  18  TYR G N   1 
ATOM 7324 C CA  . TYR E 5 18  ? 98.105  173.698 104.477 1.00 14.60  ?  18  TYR G CA  1 
ATOM 7325 C C   . TYR E 5 18  ? 98.110  174.256 103.053 1.00 13.82  ?  18  TYR G C   1 
ATOM 7326 O O   . TYR E 5 18  ? 97.073  174.329 102.397 1.00 12.21  ?  18  TYR G O   1 
ATOM 7327 C CB  . TYR E 5 18  ? 98.579  172.243 104.456 1.00 15.73  ?  18  TYR G CB  1 
ATOM 7328 C CG  . TYR E 5 18  ? 97.701  171.321 103.648 1.00 16.21  ?  18  TYR G CG  1 
ATOM 7329 C CD1 . TYR E 5 18  ? 96.624  170.669 104.229 1.00 16.81  ?  18  TYR G CD1 1 
ATOM 7330 C CD2 . TYR E 5 18  ? 97.946  171.108 102.297 1.00 15.29  ?  18  TYR G CD2 1 
ATOM 7331 C CE1 . TYR E 5 18  ? 95.818  169.828 103.487 1.00 16.43  ?  18  TYR G CE1 1 
ATOM 7332 C CE2 . TYR E 5 18  ? 97.149  170.272 101.548 1.00 15.68  ?  18  TYR G CE2 1 
ATOM 7333 C CZ  . TYR E 5 18  ? 96.086  169.634 102.146 1.00 15.85  ?  18  TYR G CZ  1 
ATOM 7334 O OH  . TYR E 5 18  ? 95.290  168.800 101.397 1.00 13.91  ?  18  TYR G OH  1 
ATOM 7335 N N   . LYS E 5 19  ? 99.293  174.649 102.588 1.00 13.80  ?  19  LYS G N   1 
ATOM 7336 C CA  . LYS E 5 19  ? 99.484  175.105 101.215 1.00 15.24  ?  19  LYS G CA  1 
ATOM 7337 C C   . LYS E 5 19  ? 99.230  173.981 100.215 1.00 16.47  ?  19  LYS G C   1 
ATOM 7338 O O   . LYS E 5 19  ? 99.653  172.847 100.434 1.00 15.42  ?  19  LYS G O   1 
ATOM 7339 C CB  . LYS E 5 19  ? 100.904 175.638 101.030 1.00 15.86  ?  19  LYS G CB  1 
ATOM 7340 C CG  . LYS E 5 19  ? 101.220 176.872 101.844 1.00 15.71  ?  19  LYS G CG  1 
ATOM 7341 C CD  . LYS E 5 19  ? 102.678 177.251 101.697 1.00 22.35  ?  19  LYS G CD  1 
ATOM 7342 C CE  . LYS E 5 19  ? 103.008 178.484 102.512 1.00 22.95  ?  19  LYS G CE  1 
ATOM 7343 N NZ  . LYS E 5 19  ? 104.455 178.817 102.438 1.00 23.97  1  19  LYS G NZ  1 
ATOM 7344 N N   . ASP E 5 20  ? 98.565  174.296 99.108  1.00 14.95  ?  20  ASP G N   1 
ATOM 7345 C CA  . ASP E 5 20  ? 98.446  173.340 98.014  1.00 18.34  ?  20  ASP G CA  1 
ATOM 7346 C C   . ASP E 5 20  ? 99.704  173.450 97.160  1.00 19.00  ?  20  ASP G C   1 
ATOM 7347 O O   . ASP E 5 20  ? 100.520 174.347 97.371  1.00 18.36  ?  20  ASP G O   1 
ATOM 7348 C CB  . ASP E 5 20  ? 97.174  173.566 97.181  1.00 15.08  ?  20  ASP G CB  1 
ATOM 7349 C CG  . ASP E 5 20  ? 97.149  174.912 96.474  1.00 15.78  ?  20  ASP G CG  1 
ATOM 7350 O OD1 . ASP E 5 20  ? 98.070  175.726 96.669  1.00 17.13  ?  20  ASP G OD1 1 
ATOM 7351 O OD2 . ASP E 5 20  ? 96.189  175.157 95.714  1.00 17.56  -1 20  ASP G OD2 1 
ATOM 7352 N N   . THR E 5 21  ? 99.871  172.532 96.217  1.00 18.33  ?  21  THR G N   1 
ATOM 7353 C CA  . THR E 5 21  ? 101.053 172.525 95.364  1.00 22.33  ?  21  THR G CA  1 
ATOM 7354 C C   . THR E 5 21  ? 101.171 173.802 94.527  1.00 24.33  ?  21  THR G C   1 
ATOM 7355 O O   . THR E 5 21  ? 102.272 174.202 94.148  1.00 30.75  ?  21  THR G O   1 
ATOM 7356 C CB  . THR E 5 21  ? 101.049 171.309 94.432  1.00 21.18  ?  21  THR G CB  1 
ATOM 7357 O OG1 . THR E 5 21  ? 99.866  171.335 93.624  1.00 29.35  ?  21  THR G OG1 1 
ATOM 7358 C CG2 . THR E 5 21  ? 101.078 170.024 95.246  1.00 18.77  ?  21  THR G CG2 1 
ATOM 7359 N N   . GLU E 5 22  ? 100.038 174.436 94.238  1.00 23.02  ?  22  GLU G N   1 
ATOM 7360 C CA  . GLU E 5 22  ? 100.028 175.740 93.574  1.00 22.26  ?  22  GLU G CA  1 
ATOM 7361 C C   . GLU E 5 22  ? 100.238 176.892 94.561  1.00 21.80  ?  22  GLU G C   1 
ATOM 7362 O O   . GLU E 5 22  ? 100.341 178.052 94.161  1.00 22.72  ?  22  GLU G O   1 
ATOM 7363 C CB  . GLU E 5 22  ? 98.730  175.940 92.790  1.00 24.77  ?  22  GLU G CB  1 
ATOM 7364 C CG  . GLU E 5 22  ? 98.599  175.046 91.562  1.00 25.77  ?  22  GLU G CG  1 
ATOM 7365 C CD  . GLU E 5 22  ? 99.715  175.271 90.552  1.00 34.62  ?  22  GLU G CD  1 
ATOM 7366 O OE1 . GLU E 5 22  ? 100.104 176.439 90.338  1.00 37.16  ?  22  GLU G OE1 1 
ATOM 7367 O OE2 . GLU E 5 22  ? 100.203 174.282 89.968  1.00 34.50  -1 22  GLU G OE2 1 
ATOM 7368 N N   . GLY E 5 23  ? 100.290 176.567 95.848  1.00 18.94  ?  23  GLY G N   1 
ATOM 7369 C CA  . GLY E 5 23  ? 100.589 177.546 96.878  1.00 18.45  ?  23  GLY G CA  1 
ATOM 7370 C C   . GLY E 5 23  ? 99.392  178.309 97.413  1.00 17.61  ?  23  GLY G C   1 
ATOM 7371 O O   . GLY E 5 23  ? 99.536  179.155 98.294  1.00 17.35  ?  23  GLY G O   1 
ATOM 7372 N N   . TYR E 5 24  ? 98.209  178.026 96.882  1.00 18.44  ?  24  TYR G N   1 
ATOM 7373 C CA  . TYR E 5 24  ? 96.986  178.529 97.491  1.00 16.27  ?  24  TYR G CA  1 
ATOM 7374 C C   . TYR E 5 24  ? 96.748  177.855 98.841  1.00 13.89  ?  24  TYR G C   1 
ATOM 7375 O O   . TYR E 5 24  ? 96.947  176.650 98.982  1.00 13.47  ?  24  TYR G O   1 
ATOM 7376 C CB  . TYR E 5 24  ? 95.802  178.307 96.555  1.00 15.51  ?  24  TYR G CB  1 
ATOM 7377 C CG  . TYR E 5 24  ? 95.916  179.086 95.268  1.00 16.79  ?  24  TYR G CG  1 
ATOM 7378 C CD1 . TYR E 5 24  ? 96.385  180.391 95.271  1.00 15.67  ?  24  TYR G CD1 1 
ATOM 7379 C CD2 . TYR E 5 24  ? 95.556  178.523 94.054  1.00 18.85  ?  24  TYR G CD2 1 
ATOM 7380 C CE1 . TYR E 5 24  ? 96.493  181.116 94.101  1.00 15.62  ?  24  TYR G CE1 1 
ATOM 7381 C CE2 . TYR E 5 24  ? 95.662  179.241 92.877  1.00 20.34  ?  24  TYR G CE2 1 
ATOM 7382 C CZ  . TYR E 5 24  ? 96.131  180.538 92.907  1.00 16.51  ?  24  TYR G CZ  1 
ATOM 7383 O OH  . TYR E 5 24  ? 96.241  181.261 91.742  1.00 19.57  ?  24  TYR G OH  1 
ATOM 7384 N N   . TYR E 5 25  ? 96.315  178.630 99.831  1.00 12.86  ?  25  TYR G N   1 
ATOM 7385 C CA  . TYR E 5 25  ? 96.042  178.087 101.162 1.00 12.43  ?  25  TYR G CA  1 
ATOM 7386 C C   . TYR E 5 25  ? 94.832  177.153 101.171 1.00 11.25  ?  25  TYR G C   1 
ATOM 7387 O O   . TYR E 5 25  ? 93.849  177.390 100.472 1.00 10.38  ?  25  TYR G O   1 
ATOM 7388 C CB  . TYR E 5 25  ? 95.865  179.228 102.163 1.00 11.23  ?  25  TYR G CB  1 
ATOM 7389 C CG  . TYR E 5 25  ? 97.149  179.987 102.412 1.00 12.85  ?  25  TYR G CG  1 
ATOM 7390 C CD1 . TYR E 5 25  ? 98.032  179.586 103.407 1.00 14.97  ?  25  TYR G CD1 1 
ATOM 7391 C CD2 . TYR E 5 25  ? 97.498  181.079 101.633 1.00 12.78  ?  25  TYR G CD2 1 
ATOM 7392 C CE1 . TYR E 5 25  ? 99.212  180.270 103.636 1.00 17.62  ?  25  TYR G CE1 1 
ATOM 7393 C CE2 . TYR E 5 25  ? 98.678  181.766 101.852 1.00 14.69  ?  25  TYR G CE2 1 
ATOM 7394 C CZ  . TYR E 5 25  ? 99.530  181.357 102.855 1.00 16.60  ?  25  TYR G CZ  1 
ATOM 7395 O OH  . TYR E 5 25  ? 100.702 182.040 103.074 1.00 15.36  ?  25  TYR G OH  1 
ATOM 7396 N N   . THR E 5 26  ? 94.913  176.092 101.973 1.00 11.00  ?  26  THR G N   1 
ATOM 7397 C CA  . THR E 5 26  ? 93.941  175.002 101.912 1.00 11.77  ?  26  THR G CA  1 
ATOM 7398 C C   . THR E 5 26  ? 93.880  174.206 103.224 1.00 11.36  ?  26  THR G C   1 
ATOM 7399 O O   . THR E 5 26  ? 94.864  174.119 103.953 1.00 11.55  ?  26  THR G O   1 
ATOM 7400 C CB  . THR E 5 26  ? 94.286  174.050 100.723 1.00 12.18  ?  26  THR G CB  1 
ATOM 7401 O OG1 . THR E 5 26  ? 94.211  174.773 99.487  1.00 13.25  ?  26  THR G OG1 1 
ATOM 7402 C CG2 . THR E 5 26  ? 93.354  172.847 100.650 1.00 11.38  ?  26  THR G CG2 1 
ATOM 7403 N N   . ILE E 5 27  ? 92.715  173.633 103.518 1.00 11.22  ?  27  ILE G N   1 
ATOM 7404 C CA  . ILE E 5 27  ? 92.568  172.673 104.605 1.00 12.53  ?  27  ILE G CA  1 
ATOM 7405 C C   . ILE E 5 27  ? 91.755  171.499 104.071 1.00 11.12  ?  27  ILE G C   1 
ATOM 7406 O O   . ILE E 5 27  ? 90.968  171.667 103.147 1.00 10.49  ?  27  ILE G O   1 
ATOM 7407 C CB  . ILE E 5 27  ? 91.862  173.281 105.834 1.00 11.54  ?  27  ILE G CB  1 
ATOM 7408 C CG1 . ILE E 5 27  ? 91.890  172.306 107.011 1.00 11.97  ?  27  ILE G CG1 1 
ATOM 7409 C CG2 . ILE E 5 27  ? 90.422  173.633 105.509 1.00 12.56  ?  27  ILE G CG2 1 
ATOM 7410 C CD1 . ILE E 5 27  ? 91.439  172.909 108.315 1.00 12.50  ?  27  ILE G CD1 1 
ATOM 7411 N N   . GLY E 5 28  ? 91.960  170.309 104.621 1.00 10.84  ?  28  GLY G N   1 
ATOM 7412 C CA  . GLY E 5 28  ? 91.179  169.156 104.212 1.00 11.71  ?  28  GLY G CA  1 
ATOM 7413 C C   . GLY E 5 28  ? 91.620  168.636 102.858 1.00 12.16  ?  28  GLY G C   1 
ATOM 7414 O O   . GLY E 5 28  ? 92.688  169.000 102.367 1.00 13.04  ?  28  GLY G O   1 
ATOM 7415 N N   . ILE E 5 29  ? 90.793  167.791 102.249 1.00 11.41  ?  29  ILE G N   1 
ATOM 7416 C CA  . ILE E 5 29  ? 91.128  167.184 100.963 1.00 11.15  ?  29  ILE G CA  1 
ATOM 7417 C C   . ILE E 5 29  ? 90.663  168.050 99.787  1.00 10.55  ?  29  ILE G C   1 
ATOM 7418 O O   . ILE E 5 29  ? 89.519  167.944 99.339  1.00 9.91   ?  29  ILE G O   1 
ATOM 7419 C CB  . ILE E 5 29  ? 90.508  165.782 100.833 1.00 12.94  ?  29  ILE G CB  1 
ATOM 7420 C CG1 . ILE E 5 29  ? 91.058  164.862 101.920 1.00 13.22  ?  29  ILE G CG1 1 
ATOM 7421 C CG2 . ILE E 5 29  ? 90.833  165.177 99.473  1.00 14.01  ?  29  ILE G CG2 1 
ATOM 7422 C CD1 . ILE E 5 29  ? 90.325  163.546 102.033 1.00 17.04  ?  29  ILE G CD1 1 
ATOM 7423 N N   . GLY E 5 30  ? 91.542  168.926 99.308  1.00 10.54  ?  30  GLY G N   1 
ATOM 7424 C CA  . GLY E 5 30  ? 91.270  169.699 98.107  1.00 10.84  ?  30  GLY G CA  1 
ATOM 7425 C C   . GLY E 5 30  ? 90.395  170.908 98.364  1.00 10.16  ?  30  GLY G C   1 
ATOM 7426 O O   . GLY E 5 30  ? 90.001  171.611 97.434  1.00 10.48  ?  30  GLY G O   1 
ATOM 7427 N N   . HIS E 5 31  ? 90.094  171.149 99.635  1.00 9.95   ?  31  HIS G N   1 
ATOM 7428 C CA  . HIS E 5 31  ? 89.210  172.239 100.035 1.00 9.86   ?  31  HIS G CA  1 
ATOM 7429 C C   . HIS E 5 31  ? 89.921  173.579 100.129 1.00 10.01  ?  31  HIS G C   1 
ATOM 7430 O O   . HIS E 5 31  ? 90.468  173.933 101.175 1.00 9.18   ?  31  HIS G O   1 
ATOM 7431 C CB  . HIS E 5 31  ? 88.548  171.921 101.376 1.00 9.56   ?  31  HIS G CB  1 
ATOM 7432 C CG  . HIS E 5 31  ? 87.719  173.042 101.918 1.00 10.19  ?  31  HIS G CG  1 
ATOM 7433 N ND1 . HIS E 5 31  ? 86.614  173.541 101.262 1.00 9.48   ?  31  HIS G ND1 1 
ATOM 7434 C CD2 . HIS E 5 31  ? 87.853  173.780 103.044 1.00 10.06  ?  31  HIS G CD2 1 
ATOM 7435 C CE1 . HIS E 5 31  ? 86.095  174.528 101.970 1.00 10.67  ?  31  HIS G CE1 1 
ATOM 7436 N NE2 . HIS E 5 31  ? 86.826  174.691 103.057 1.00 11.03  ?  31  HIS G NE2 1 
ATOM 7437 N N   . LEU E 5 32  ? 89.897  174.325 99.031  1.00 10.79  ?  32  LEU G N   1 
ATOM 7438 C CA  . LEU E 5 32  ? 90.466  175.661 99.016  1.00 10.41  ?  32  LEU G CA  1 
ATOM 7439 C C   . LEU E 5 32  ? 89.704  176.547 99.995  1.00 10.09  ?  32  LEU G C   1 
ATOM 7440 O O   . LEU E 5 32  ? 88.476  176.486 100.074 1.00 9.42   ?  32  LEU G O   1 
ATOM 7441 C CB  . LEU E 5 32  ? 90.415  176.247 97.602  1.00 11.95  ?  32  LEU G CB  1 
ATOM 7442 C CG  . LEU E 5 32  ? 90.913  177.678 97.385  1.00 11.99  ?  32  LEU G CG  1 
ATOM 7443 C CD1 . LEU E 5 32  ? 92.391  177.781 97.701  1.00 11.23  ?  32  LEU G CD1 1 
ATOM 7444 C CD2 . LEU E 5 32  ? 90.635  178.137 95.962  1.00 15.10  ?  32  LEU G CD2 1 
ATOM 7445 N N   . LEU E 5 33  ? 90.441  177.367 100.737 1.00 9.61   ?  33  LEU G N   1 
ATOM 7446 C CA  . LEU E 5 33  ? 89.848  178.319 101.672 1.00 9.93   ?  33  LEU G CA  1 
ATOM 7447 C C   . LEU E 5 33  ? 89.931  179.724 101.089 1.00 9.52   ?  33  LEU G C   1 
ATOM 7448 O O   . LEU E 5 33  ? 88.928  180.435 101.003 1.00 9.65   ?  33  LEU G O   1 
ATOM 7449 C CB  . LEU E 5 33  ? 90.552  178.255 103.032 1.00 9.37   ?  33  LEU G CB  1 
ATOM 7450 C CG  . LEU E 5 33  ? 90.401  176.977 103.860 1.00 9.90   ?  33  LEU G CG  1 
ATOM 7451 C CD1 . LEU E 5 33  ? 91.319  177.005 105.062 1.00 11.58  ?  33  LEU G CD1 1 
ATOM 7452 C CD2 . LEU E 5 33  ? 88.963  176.833 104.317 1.00 9.30   ?  33  LEU G CD2 1 
ATOM 7453 N N   . THR E 5 34  ? 91.140  180.112 100.691 1.00 9.34   ?  34  THR G N   1 
ATOM 7454 C CA  . THR E 5 34  ? 91.360  181.366 99.982  1.00 8.84   ?  34  THR G CA  1 
ATOM 7455 C C   . THR E 5 34  ? 92.656  181.319 99.175  1.00 9.21   ?  34  THR G C   1 
ATOM 7456 O O   . THR E 5 34  ? 93.601  180.611 99.528  1.00 9.88   ?  34  THR G O   1 
ATOM 7457 C CB  . THR E 5 34  ? 91.400  182.570 100.956 1.00 8.79   ?  34  THR G CB  1 
ATOM 7458 O OG1 . THR E 5 34  ? 91.433  183.795 100.213 1.00 8.24   ?  34  THR G OG1 1 
ATOM 7459 C CG2 . THR E 5 34  ? 92.613  182.494 101.878 1.00 9.48   ?  34  THR G CG2 1 
ATOM 7460 N N   . LYS E 5 35  ? 92.684  182.070 98.081  1.00 8.68   ?  35  LYS G N   1 
ATOM 7461 C CA  . LYS E 5 35  ? 93.901  182.248 97.305  1.00 9.88   ?  35  LYS G CA  1 
ATOM 7462 C C   . LYS E 5 35  ? 94.752  183.347 97.930  1.00 9.28   ?  35  LYS G C   1 
ATOM 7463 O O   . LYS E 5 35  ? 95.894  183.572 97.529  1.00 10.30  ?  35  LYS G O   1 
ATOM 7464 C CB  . LYS E 5 35  ? 93.566  182.588 95.856  1.00 10.26  ?  35  LYS G CB  1 
ATOM 7465 C CG  . LYS E 5 35  ? 92.940  181.442 95.090  1.00 11.48  ?  35  LYS G CG  1 
ATOM 7466 C CD  . LYS E 5 35  ? 92.812  181.795 93.628  1.00 12.77  ?  35  LYS G CD  1 
ATOM 7467 C CE  . LYS E 5 35  ? 91.837  182.946 93.451  1.00 12.60  ?  35  LYS G CE  1 
ATOM 7468 N NZ  . LYS E 5 35  ? 91.593  183.262 92.020  1.00 12.33  1  35  LYS G NZ  1 
ATOM 7469 N N   . SER E 5 36  ? 94.177  184.025 98.921  1.00 8.42   ?  36  SER G N   1 
ATOM 7470 C CA  . SER E 5 36  ? 94.807  185.180 99.552  1.00 9.35   ?  36  SER G CA  1 
ATOM 7471 C C   . SER E 5 36  ? 96.059  184.786 100.326 1.00 10.05  ?  36  SER G C   1 
ATOM 7472 O O   . SER E 5 36  ? 96.087  183.738 100.967 1.00 8.60   ?  36  SER G O   1 
ATOM 7473 C CB  . SER E 5 36  ? 93.814  185.882 100.484 1.00 9.40   ?  36  SER G CB  1 
ATOM 7474 O OG  . SER E 5 36  ? 92.726  186.427 99.758  1.00 8.96   ?  36  SER G OG  1 
ATOM 7475 N N   . PRO E 5 37  ? 97.093  185.639 100.277 1.00 11.10  ?  37  PRO G N   1 
ATOM 7476 C CA  . PRO E 5 37  ? 98.350  185.407 100.995 1.00 11.68  ?  37  PRO G CA  1 
ATOM 7477 C C   . PRO E 5 37  ? 98.131  185.287 102.497 1.00 12.53  ?  37  PRO G C   1 
ATOM 7478 O O   . PRO E 5 37  ? 98.857  184.550 103.163 1.00 16.21  ?  37  PRO G O   1 
ATOM 7479 C CB  . PRO E 5 37  ? 99.177  186.652 100.662 1.00 13.31  ?  37  PRO G CB  1 
ATOM 7480 C CG  . PRO E 5 37  ? 98.166  187.699 100.359 1.00 15.81  ?  37  PRO G CG  1 
ATOM 7481 C CD  . PRO E 5 37  ? 97.073  186.967 99.637  1.00 12.66  ?  37  PRO G CD  1 
ATOM 7482 N N   . SER E 5 38  ? 97.151  186.014 103.020 1.00 11.25  ?  38  SER G N   1 
ATOM 7483 C CA  . SER E 5 38  ? 96.832  185.933 104.435 1.00 12.01  ?  38  SER G CA  1 
ATOM 7484 C C   . SER E 5 38  ? 96.224  184.579 104.773 1.00 12.04  ?  38  SER G C   1 
ATOM 7485 O O   . SER E 5 38  ? 95.170  184.211 104.254 1.00 10.71  ?  38  SER G O   1 
ATOM 7486 C CB  . SER E 5 38  ? 95.871  187.056 104.829 1.00 12.48  ?  38  SER G CB  1 
ATOM 7487 O OG  . SER E 5 38  ? 95.512  186.969 106.196 1.00 12.32  ?  38  SER G OG  1 
ATOM 7488 N N   . LEU E 5 39  ? 96.899  183.841 105.647 1.00 13.57  ?  39  LEU G N   1 
ATOM 7489 C CA  . LEU E 5 39  ? 96.377  182.577 106.145 1.00 13.95  ?  39  LEU G CA  1 
ATOM 7490 C C   . LEU E 5 39  ? 95.138  182.797 107.003 1.00 11.95  ?  39  LEU G C   1 
ATOM 7491 O O   . LEU E 5 39  ? 94.261  181.936 107.080 1.00 11.43  ?  39  LEU G O   1 
ATOM 7492 C CB  . LEU E 5 39  ? 97.452  181.834 106.940 1.00 14.39  ?  39  LEU G CB  1 
ATOM 7493 C CG  . LEU E 5 39  ? 97.026  180.526 107.606 1.00 18.05  ?  39  LEU G CG  1 
ATOM 7494 C CD1 . LEU E 5 39  ? 96.577  179.532 106.562 1.00 15.11  ?  39  LEU G CD1 1 
ATOM 7495 C CD2 . LEU E 5 39  ? 98.166  179.959 108.428 1.00 16.56  ?  39  LEU G CD2 1 
ATOM 7496 N N   . ASN E 5 40  ? 95.066  183.961 107.639 1.00 12.26  ?  40  ASN G N   1 
ATOM 7497 C CA  . ASN E 5 40  ? 93.949  184.266 108.522 1.00 11.70  ?  40  ASN G CA  1 
ATOM 7498 C C   . ASN E 5 40  ? 92.629  184.314 107.767 1.00 11.67  ?  40  ASN G C   1 
ATOM 7499 O O   . ASN E 5 40  ? 91.578  184.047 108.342 1.00 11.25  ?  40  ASN G O   1 
ATOM 7500 C CB  . ASN E 5 40  ? 94.179  185.591 109.253 1.00 14.52  ?  40  ASN G CB  1 
ATOM 7501 C CG  . ASN E 5 40  ? 95.258  185.497 110.312 1.00 14.75  ?  40  ASN G CG  1 
ATOM 7502 O OD1 . ASN E 5 40  ? 95.552  184.416 110.819 1.00 15.51  ?  40  ASN G OD1 1 
ATOM 7503 N ND2 . ASN E 5 40  ? 95.850  186.634 110.657 1.00 14.82  ?  40  ASN G ND2 1 
ATOM 7504 N N   . ALA E 5 41  ? 92.676  184.678 106.488 1.00 11.27  ?  41  ALA G N   1 
ATOM 7505 C CA  . ALA E 5 41  ? 91.481  184.608 105.655 1.00 11.04  ?  41  ALA G CA  1 
ATOM 7506 C C   . ALA E 5 41  ? 91.037  183.162 105.490 1.00 10.95  ?  41  ALA G C   1 
ATOM 7507 O O   . ALA E 5 41  ? 89.841  182.865 105.450 1.00 10.99  ?  41  ALA G O   1 
ATOM 7508 C CB  . ALA E 5 41  ? 91.737  185.244 104.299 1.00 11.87  ?  41  ALA G CB  1 
ATOM 7509 N N   . ALA E 5 42  ? 92.015  182.263 105.424 1.00 10.51  ?  42  ALA G N   1 
ATOM 7510 C CA  . ALA E 5 42  ? 91.725  180.844 105.307 1.00 9.98   ?  42  ALA G CA  1 
ATOM 7511 C C   . ALA E 5 42  ? 91.124  180.313 106.602 1.00 10.29  ?  42  ALA G C   1 
ATOM 7512 O O   . ALA E 5 42  ? 90.154  179.552 106.583 1.00 9.92   ?  42  ALA G O   1 
ATOM 7513 C CB  . ALA E 5 42  ? 92.986  180.077 104.942 1.00 11.02  ?  42  ALA G CB  1 
ATOM 7514 N N   . LYS E 5 43  ? 91.687  180.745 107.729 1.00 10.28  ?  43  LYS G N   1 
ATOM 7515 C CA  . LYS E 5 43  ? 91.144  180.379 109.032 1.00 10.77  ?  43  LYS G CA  1 
ATOM 7516 C C   . LYS E 5 43  ? 89.756  180.949 109.272 1.00 10.61  ?  43  LYS G C   1 
ATOM 7517 O O   . LYS E 5 43  ? 88.974  180.354 109.993 1.00 9.83   ?  43  LYS G O   1 
ATOM 7518 C CB  . LYS E 5 43  ? 92.068  180.829 110.166 1.00 10.61  ?  43  LYS G CB  1 
ATOM 7519 C CG  . LYS E 5 43  ? 93.384  180.083 110.266 1.00 11.41  ?  43  LYS G CG  1 
ATOM 7520 C CD  . LYS E 5 43  ? 94.234  180.647 111.396 1.00 12.79  ?  43  LYS G CD  1 
ATOM 7521 C CE  . LYS E 5 43  ? 95.541  179.888 111.551 1.00 12.45  ?  43  LYS G CE  1 
ATOM 7522 N NZ  . LYS E 5 43  ? 96.396  180.485 112.614 1.00 13.30  1  43  LYS G NZ  1 
ATOM 7523 N N   . SER E 5 44  ? 89.469  182.114 108.694 1.00 11.13  ?  44  SER G N   1 
ATOM 7524 C CA  . SER E 5 44  ? 88.179  182.776 108.882 1.00 11.89  ?  44  SER G CA  1 
ATOM 7525 C C   . SER E 5 44  ? 87.084  182.168 108.015 1.00 13.28  ?  44  SER G C   1 
ATOM 7526 O O   . SER E 5 44  ? 85.952  181.953 108.469 1.00 12.23  ?  44  SER G O   1 
ATOM 7527 C CB  . SER E 5 44  ? 88.301  184.270 108.578 1.00 12.98  ?  44  SER G CB  1 
ATOM 7528 O OG  . SER E 5 44  ? 87.048  184.913 108.711 1.00 17.50  ?  44  SER G OG  1 
ATOM 7529 N N   . GLU E 5 45  ? 87.426  181.889 106.762 1.00 13.52  ?  45  GLU G N   1 
ATOM 7530 C CA  . GLU E 5 45  ? 86.498  181.191 105.892 1.00 14.07  ?  45  GLU G CA  1 
ATOM 7531 C C   . GLU E 5 45  ? 86.260  179.802 106.453 1.00 12.86  ?  45  GLU G C   1 
ATOM 7532 O O   . GLU E 5 45  ? 85.169  179.246 106.328 1.00 13.11  ?  45  GLU G O   1 
ATOM 7533 C CB  . GLU E 5 45  ? 87.039  181.120 104.467 1.00 14.16  ?  45  GLU G CB  1 
ATOM 7534 C CG  . GLU E 5 45  ? 87.161  182.478 103.810 1.00 16.92  ?  45  GLU G CG  1 
ATOM 7535 C CD  . GLU E 5 45  ? 85.837  183.210 103.757 1.00 18.38  ?  45  GLU G CD  1 
ATOM 7536 O OE1 . GLU E 5 45  ? 84.811  182.554 103.479 1.00 17.45  ?  45  GLU G OE1 1 
ATOM 7537 O OE2 . GLU E 5 45  ? 85.820  184.434 104.001 1.00 20.10  -1 45  GLU G OE2 1 
ATOM 7538 N N   . LEU E 5 46  ? 87.295  179.247 107.076 1.00 10.91  ?  46  LEU G N   1 
ATOM 7539 C CA  . LEU E 5 46  ? 87.145  178.015 107.833 1.00 10.92  ?  46  LEU G CA  1 
ATOM 7540 C C   . LEU E 5 46  ? 86.231  178.221 109.043 1.00 12.08  ?  46  LEU G C   1 
ATOM 7541 O O   . LEU E 5 46  ? 85.493  177.317 109.434 1.00 12.82  ?  46  LEU G O   1 
ATOM 7542 C CB  . LEU E 5 46  ? 88.516  177.505 108.283 1.00 10.05  ?  46  LEU G CB  1 
ATOM 7543 C CG  . LEU E 5 46  ? 88.586  176.219 109.105 1.00 11.82  ?  46  LEU G CG  1 
ATOM 7544 C CD1 . LEU E 5 46  ? 88.094  175.038 108.280 1.00 10.63  ?  46  LEU G CD1 1 
ATOM 7545 C CD2 . LEU E 5 46  ? 90.003  175.985 109.604 1.00 12.32  ?  46  LEU G CD2 1 
ATOM 7546 N N   . ASP E 5 47  ? 86.286  179.416 109.631 1.00 11.69  ?  47  ASP G N   1 
ATOM 7547 C CA  . ASP E 5 47  ? 85.461  179.740 110.792 1.00 12.31  ?  47  ASP G CA  1 
ATOM 7548 C C   . ASP E 5 47  ? 83.992  179.788 110.419 1.00 13.33  ?  47  ASP G C   1 
ATOM 7549 O O   . ASP E 5 47  ? 83.130  179.443 111.225 1.00 12.27  ?  47  ASP G O   1 
ATOM 7550 C CB  . ASP E 5 47  ? 85.877  181.079 111.417 1.00 11.67  ?  47  ASP G CB  1 
ATOM 7551 C CG  . ASP E 5 47  ? 87.201  181.000 112.147 1.00 11.42  ?  47  ASP G CG  1 
ATOM 7552 O OD1 . ASP E 5 47  ? 87.659  179.876 112.439 1.00 11.11  ?  47  ASP G OD1 1 
ATOM 7553 O OD2 . ASP E 5 47  ? 87.791  182.066 112.420 1.00 10.63  -1 47  ASP G OD2 1 
ATOM 7554 N N   . LYS E 5 48  ? 83.706  180.211 109.194 1.00 13.80  ?  48  LYS G N   1 
ATOM 7555 C CA  . LYS E 5 48  ? 82.323  180.207 108.743 1.00 15.51  ?  48  LYS G CA  1 
ATOM 7556 C C   . LYS E 5 48  ? 81.905  178.815 108.286 1.00 14.60  ?  48  LYS G C   1 
ATOM 7557 O O   . LYS E 5 48  ? 80.788  178.375 108.557 1.00 15.78  ?  48  LYS G O   1 
ATOM 7558 C CB  . LYS E 5 48  ? 82.112  181.219 107.618 1.00 17.83  ?  48  LYS G CB  1 
ATOM 7559 C CG  . LYS E 5 48  ? 82.210  182.665 108.068 1.00 20.26  ?  48  LYS G CG  1 
ATOM 7560 C CD  . LYS E 5 48  ? 81.942  183.617 106.917 1.00 20.89  ?  48  LYS G CD  1 
ATOM 7561 C CE  . LYS E 5 48  ? 83.003  183.492 105.838 1.00 23.00  ?  48  LYS G CE  1 
ATOM 7562 N NZ  . LYS E 5 48  ? 84.361  183.874 106.318 1.00 32.76  1  48  LYS G NZ  1 
ATOM 7563 N N   . ALA E 5 49  ? 82.811  178.124 107.596 1.00 15.59  ?  49  ALA G N   1 
ATOM 7564 C CA  . ALA E 5 49  ? 82.517  176.795 107.067 1.00 14.17  ?  49  ALA G CA  1 
ATOM 7565 C C   . ALA E 5 49  ? 82.278  175.762 108.167 1.00 14.00  ?  49  ALA G C   1 
ATOM 7566 O O   . ALA E 5 49  ? 81.500  174.825 107.988 1.00 15.05  ?  49  ALA G O   1 
ATOM 7567 C CB  . ALA E 5 49  ? 83.650  176.333 106.152 1.00 13.83  ?  49  ALA G CB  1 
ATOM 7568 N N   . ILE E 5 50  ? 82.951  175.932 109.301 1.00 14.42  ?  50  ILE G N   1 
ATOM 7569 C CA  . ILE E 5 50  ? 82.812  175.000 110.417 1.00 14.10  ?  50  ILE G CA  1 
ATOM 7570 C C   . ILE E 5 50  ? 81.885  175.549 111.505 1.00 14.29  ?  50  ILE G C   1 
ATOM 7571 O O   . ILE E 5 50  ? 81.282  174.793 112.271 1.00 13.31  ?  50  ILE G O   1 
ATOM 7572 C CB  . ILE E 5 50  ? 84.190  174.661 111.019 1.00 13.45  ?  50  ILE G CB  1 
ATOM 7573 C CG1 . ILE E 5 50  ? 85.112  174.113 109.932 1.00 13.89  ?  50  ILE G CG1 1 
ATOM 7574 C CG2 . ILE E 5 50  ? 84.066  173.627 112.121 1.00 14.34  ?  50  ILE G CG2 1 
ATOM 7575 C CD1 . ILE E 5 50  ? 84.584  172.865 109.255 1.00 12.09  ?  50  ILE G CD1 1 
ATOM 7576 N N   . GLY E 5 51  ? 81.741  176.868 111.548 1.00 14.47  ?  51  GLY G N   1 
ATOM 7577 C CA  . GLY E 5 51  ? 80.947  177.496 112.585 1.00 16.00  ?  51  GLY G CA  1 
ATOM 7578 C C   . GLY E 5 51  ? 81.680  177.667 113.903 1.00 15.49  ?  51  GLY G C   1 
ATOM 7579 O O   . GLY E 5 51  ? 81.062  177.994 114.915 1.00 14.70  ?  51  GLY G O   1 
ATOM 7580 N N   . ARG E 5 52  ? 82.992  177.442 113.903 1.00 13.81  ?  52  ARG G N   1 
ATOM 7581 C CA  . ARG E 5 52  ? 83.794  177.674 115.103 1.00 14.75  ?  52  ARG G CA  1 
ATOM 7582 C C   . ARG E 5 52  ? 85.224  178.098 114.774 1.00 14.26  ?  52  ARG G C   1 
ATOM 7583 O O   . ARG E 5 52  ? 85.702  177.915 113.655 1.00 13.89  ?  52  ARG G O   1 
ATOM 7584 C CB  . ARG E 5 52  ? 83.829  176.429 115.994 1.00 15.50  ?  52  ARG G CB  1 
ATOM 7585 C CG  . ARG E 5 52  ? 84.561  175.244 115.400 1.00 15.33  ?  52  ARG G CG  1 
ATOM 7586 C CD  . ARG E 5 52  ? 84.543  174.059 116.354 1.00 17.98  ?  52  ARG G CD  1 
ATOM 7587 N NE  . ARG E 5 52  ? 85.274  172.914 115.820 1.00 15.99  ?  52  ARG G NE  1 
ATOM 7588 C CZ  . ARG E 5 52  ? 86.579  172.717 115.982 1.00 15.73  ?  52  ARG G CZ  1 
ATOM 7589 N NH1 . ARG E 5 52  ? 87.308  173.590 116.662 1.00 14.97  1  52  ARG G NH1 1 
ATOM 7590 N NH2 . ARG E 5 52  ? 87.157  171.646 115.460 1.00 16.40  ?  52  ARG G NH2 1 
ATOM 7591 N N   . ASN E 5 53  ? 85.899  178.660 115.773 1.00 12.80  ?  53  ASN G N   1 
ATOM 7592 C CA  . ASN E 5 53  ? 87.238  179.212 115.603 1.00 12.67  ?  53  ASN G CA  1 
ATOM 7593 C C   . ASN E 5 53  ? 88.284  178.110 115.630 1.00 12.00  ?  53  ASN G C   1 
ATOM 7594 O O   . ASN E 5 53  ? 88.965  177.907 116.634 1.00 11.53  ?  53  ASN G O   1 
ATOM 7595 C CB  . ASN E 5 53  ? 87.531  180.241 116.697 1.00 13.68  ?  53  ASN G CB  1 
ATOM 7596 C CG  . ASN E 5 53  ? 86.580  181.427 116.655 1.00 14.07  ?  53  ASN G CG  1 
ATOM 7597 O OD1 . ASN E 5 53  ? 86.024  181.827 117.679 1.00 20.53  ?  53  ASN G OD1 1 
ATOM 7598 N ND2 . ASN E 5 53  ? 86.383  181.989 115.467 1.00 13.23  ?  53  ASN G ND2 1 
ATOM 7599 N N   . CYS E 5 54  ? 88.403  177.406 114.510 1.00 11.37  ?  54  CYS G N   1 
ATOM 7600 C CA  . CYS E 5 54  ? 89.179  176.174 114.430 1.00 11.75  ?  54  CYS G CA  1 
ATOM 7601 C C   . CYS E 5 54  ? 90.676  176.359 114.668 1.00 11.58  ?  54  CYS G C   1 
ATOM 7602 O O   . CYS E 5 54  ? 91.344  175.458 115.177 1.00 10.47  ?  54  CYS G O   1 
ATOM 7603 C CB  . CYS E 5 54  ? 88.955  175.538 113.065 1.00 12.55  ?  54  CYS G CB  1 
ATOM 7604 S SG  . CYS E 5 54  ? 87.232  175.112 112.776 1.00 10.58  ?  54  CYS G SG  1 
ATOM 7605 N N   . ASN E 5 55  ? 91.188  177.530 114.297 1.00 12.37  ?  55  ASN G N   1 
ATOM 7606 C CA  . ASN E 5 55  ? 92.603  177.871 114.449 1.00 11.88  ?  55  ASN G CA  1 
ATOM 7607 C C   . ASN E 5 55  ? 93.530  176.801 113.867 1.00 12.20  ?  55  ASN G C   1 
ATOM 7608 O O   . ASN E 5 55  ? 94.553  176.456 114.455 1.00 11.81  ?  55  ASN G O   1 
ATOM 7609 C CB  . ASN E 5 55  ? 92.937  178.119 115.922 1.00 12.09  ?  55  ASN G CB  1 
ATOM 7610 C CG  . ASN E 5 55  ? 94.286  178.787 116.109 1.00 13.11  ?  55  ASN G CG  1 
ATOM 7611 O OD1 . ASN E 5 55  ? 94.738  179.550 115.255 1.00 14.97  ?  55  ASN G OD1 1 
ATOM 7612 N ND2 . ASN E 5 55  ? 94.938  178.501 117.229 1.00 14.14  ?  55  ASN G ND2 1 
ATOM 7613 N N   . GLY E 5 56  ? 93.151  176.269 112.710 1.00 12.12  ?  56  GLY G N   1 
ATOM 7614 C CA  . GLY E 5 56  ? 93.989  175.331 111.984 1.00 12.56  ?  56  GLY G CA  1 
ATOM 7615 C C   . GLY E 5 56  ? 93.891  173.868 112.382 1.00 12.35  ?  56  GLY G C   1 
ATOM 7616 O O   . GLY E 5 56  ? 94.587  173.029 111.810 1.00 11.97  ?  56  GLY G O   1 
ATOM 7617 N N   . VAL E 5 57  ? 93.033  173.550 113.350 1.00 12.26  ?  57  VAL G N   1 
ATOM 7618 C CA  . VAL E 5 57  ? 92.816  172.158 113.752 1.00 13.04  ?  57  VAL G CA  1 
ATOM 7619 C C   . VAL E 5 57  ? 91.326  171.891 113.961 1.00 12.77  ?  57  VAL G C   1 
ATOM 7620 O O   . VAL E 5 57  ? 90.606  172.721 114.520 1.00 12.25  ?  57  VAL G O   1 
ATOM 7621 C CB  . VAL E 5 57  ? 93.591  171.801 115.052 1.00 13.73  ?  57  VAL G CB  1 
ATOM 7622 C CG1 . VAL E 5 57  ? 93.256  170.389 115.526 1.00 15.55  ?  57  VAL G CG1 1 
ATOM 7623 C CG2 . VAL E 5 57  ? 95.090  171.941 114.845 1.00 14.42  ?  57  VAL G CG2 1 
ATOM 7624 N N   . ILE E 5 58  ? 90.872  170.723 113.517 1.00 13.41  ?  58  ILE G N   1 
ATOM 7625 C CA  . ILE E 5 58  ? 89.472  170.341 113.641 1.00 13.02  ?  58  ILE G CA  1 
ATOM 7626 C C   . ILE E 5 58  ? 89.342  168.868 113.992 1.00 13.74  ?  58  ILE G C   1 
ATOM 7627 O O   . ILE E 5 58  ? 90.248  168.075 113.733 1.00 14.01  ?  58  ILE G O   1 
ATOM 7628 C CB  . ILE E 5 58  ? 88.677  170.604 112.340 1.00 12.02  ?  58  ILE G CB  1 
ATOM 7629 C CG1 . ILE E 5 58  ? 89.257  169.802 111.177 1.00 10.97  ?  58  ILE G CG1 1 
ATOM 7630 C CG2 . ILE E 5 58  ? 88.662  172.073 111.996 1.00 12.07  ?  58  ILE G CG2 1 
ATOM 7631 C CD1 . ILE E 5 58  ? 88.424  169.882 109.922 1.00 11.82  ?  58  ILE G CD1 1 
ATOM 7632 N N   . THR E 5 59  ? 88.216  168.512 114.602 1.00 12.94  ?  59  THR G N   1 
ATOM 7633 C CA  . THR E 5 59  ? 87.892  167.114 114.842 1.00 15.14  ?  59  THR G CA  1 
ATOM 7634 C C   . THR E 5 59  ? 87.702  166.435 113.491 1.00 14.62  ?  59  THR G C   1 
ATOM 7635 O O   . THR E 5 59  ? 87.171  167.036 112.556 1.00 12.99  ?  59  THR G O   1 
ATOM 7636 C CB  . THR E 5 59  ? 86.630  166.951 115.714 1.00 15.01  ?  59  THR G CB  1 
ATOM 7637 O OG1 . THR E 5 59  ? 85.513  167.581 115.075 1.00 14.75  ?  59  THR G OG1 1 
ATOM 7638 C CG2 . THR E 5 59  ? 86.843  167.583 117.085 1.00 17.09  ?  59  THR G CG2 1 
ATOM 7639 N N   . LYS E 5 60  ? 88.142  165.186 113.394 1.00 16.45  ?  60  LYS G N   1 
ATOM 7640 C CA  . LYS E 5 60  ? 88.222  164.503 112.110 1.00 17.54  ?  60  LYS G CA  1 
ATOM 7641 C C   . LYS E 5 60  ? 86.842  164.390 111.477 1.00 15.77  ?  60  LYS G C   1 
ATOM 7642 O O   . LYS E 5 60  ? 86.696  164.396 110.250 1.00 15.66  ?  60  LYS G O   1 
ATOM 7643 C CB  . LYS E 5 60  ? 88.856  163.121 112.298 1.00 19.12  ?  60  LYS G CB  1 
ATOM 7644 C CG  . LYS E 5 60  ? 89.098  162.337 111.025 1.00 21.88  ?  60  LYS G CG  1 
ATOM 7645 C CD  . LYS E 5 60  ? 89.732  160.998 111.349 1.00 23.03  ?  60  LYS G CD  1 
ATOM 7646 C CE  . LYS E 5 60  ? 89.813  160.112 110.123 1.00 32.13  ?  60  LYS G CE  1 
ATOM 7647 N NZ  . LYS E 5 60  ? 90.687  160.704 109.073 1.00 33.34  1  60  LYS G NZ  1 
ATOM 7648 N N   . ASP E 5 61  ? 85.826  164.307 112.327 1.00 17.12  ?  61  ASP G N   1 
ATOM 7649 C CA  . ASP E 5 61  ? 84.460  164.247 111.849 1.00 17.74  ?  61  ASP G CA  1 
ATOM 7650 C C   . ASP E 5 61  ? 84.069  165.535 111.135 1.00 16.15  ?  61  ASP G C   1 
ATOM 7651 O O   . ASP E 5 61  ? 83.284  165.508 110.190 1.00 14.32  ?  61  ASP G O   1 
ATOM 7652 C CB  . ASP E 5 61  ? 83.511  163.972 113.012 1.00 18.00  ?  61  ASP G CB  1 
ATOM 7653 C CG  . ASP E 5 61  ? 83.674  162.575 113.572 1.00 22.92  ?  61  ASP G CG  1 
ATOM 7654 O OD1 . ASP E 5 61  ? 84.286  161.729 112.887 1.00 23.52  ?  61  ASP G OD1 1 
ATOM 7655 O OD2 . ASP E 5 61  ? 83.202  162.323 114.700 1.00 24.60  -1 61  ASP G OD2 1 
ATOM 7656 N N   . GLU E 5 62  ? 84.608  166.665 111.588 1.00 14.17  ?  62  GLU G N   1 
ATOM 7657 C CA  . GLU E 5 62  ? 84.418  167.915 110.859 1.00 13.54  ?  62  GLU G CA  1 
ATOM 7658 C C   . GLU E 5 62  ? 85.154  167.921 109.530 1.00 12.72  ?  62  GLU G C   1 
ATOM 7659 O O   . GLU E 5 62  ? 84.731  168.592 108.592 1.00 12.88  ?  62  GLU G O   1 
ATOM 7660 C CB  . GLU E 5 62  ? 84.856  169.123 111.693 1.00 12.72  ?  62  GLU G CB  1 
ATOM 7661 C CG  . GLU E 5 62  ? 83.960  169.425 112.878 1.00 15.42  ?  62  GLU G CG  1 
ATOM 7662 C CD  . GLU E 5 62  ? 84.450  170.609 113.688 1.00 14.48  ?  62  GLU G CD  1 
ATOM 7663 O OE1 . GLU E 5 62  ? 85.584  171.071 113.444 1.00 12.52  ?  62  GLU G OE1 1 
ATOM 7664 O OE2 . GLU E 5 62  ? 83.697  171.088 114.562 1.00 16.32  -1 62  GLU G OE2 1 
ATOM 7665 N N   . ALA E 5 63  ? 86.265  167.194 109.450 1.00 13.67  ?  63  ALA G N   1 
ATOM 7666 C CA  . ALA E 5 63  ? 86.986  167.111 108.187 1.00 12.49  ?  63  ALA G CA  1 
ATOM 7667 C C   . ALA E 5 63  ? 86.164  166.320 107.196 1.00 13.02  ?  63  ALA G C   1 
ATOM 7668 O O   . ALA E 5 63  ? 86.036  166.701 106.032 1.00 12.34  ?  63  ALA G O   1 
ATOM 7669 C CB  . ALA E 5 63  ? 88.344  166.472 108.377 1.00 11.93  ?  63  ALA G CB  1 
ATOM 7670 N N   . GLU E 5 64  ? 85.589  165.224 107.678 1.00 14.27  ?  64  GLU G N   1 
ATOM 7671 C CA  . GLU E 5 64  ? 84.720  164.408 106.851 1.00 15.81  ?  64  GLU G CA  1 
ATOM 7672 C C   . GLU E 5 64  ? 83.463  165.175 106.462 1.00 14.53  ?  64  GLU G C   1 
ATOM 7673 O O   . GLU E 5 64  ? 82.936  165.015 105.358 1.00 14.76  ?  64  GLU G O   1 
ATOM 7674 C CB  . GLU E 5 64  ? 84.348  163.126 107.596 1.00 17.50  ?  64  GLU G CB  1 
ATOM 7675 C CG  . GLU E 5 64  ? 85.532  162.210 107.862 1.00 21.49  ?  64  GLU G CG  1 
ATOM 7676 C CD  . GLU E 5 64  ? 85.153  160.999 108.687 1.00 25.51  ?  64  GLU G CD  1 
ATOM 7677 O OE1 . GLU E 5 64  ? 84.016  160.962 109.202 1.00 25.89  ?  64  GLU G OE1 1 
ATOM 7678 O OE2 . GLU E 5 64  ? 85.992  160.087 108.827 1.00 29.01  -1 64  GLU G OE2 1 
ATOM 7679 N N   . LYS E 5 65  ? 83.008  166.043 107.360 1.00 14.10  ?  65  LYS G N   1 
ATOM 7680 C CA  . LYS E 5 65  ? 81.777  166.775 107.117 1.00 15.03  ?  65  LYS G CA  1 
ATOM 7681 C C   . LYS E 5 65  ? 81.985  167.866 106.092 1.00 14.73  ?  65  LYS G C   1 
ATOM 7682 O O   . LYS E 5 65  ? 81.165  168.043 105.205 1.00 14.91  ?  65  LYS G O   1 
ATOM 7683 C CB  . LYS E 5 65  ? 81.226  167.386 108.403 1.00 17.09  ?  65  LYS G CB  1 
ATOM 7684 C CG  . LYS E 5 65  ? 79.907  168.113 108.178 1.00 20.81  ?  65  LYS G CG  1 
ATOM 7685 C CD  . LYS E 5 65  ? 79.341  168.704 109.452 1.00 26.25  ?  65  LYS G CD  1 
ATOM 7686 C CE  . LYS E 5 65  ? 78.040  169.435 109.163 1.00 31.81  ?  65  LYS G CE  1 
ATOM 7687 N NZ  . LYS E 5 65  ? 77.453  170.040 110.388 1.00 46.99  1  65  LYS G NZ  1 
ATOM 7688 N N   . LEU E 5 66  ? 83.073  168.611 106.233 1.00 13.91  ?  66  LEU G N   1 
ATOM 7689 C CA  . LEU E 5 66  ? 83.409  169.652 105.277 1.00 13.50  ?  66  LEU G CA  1 
ATOM 7690 C C   . LEU E 5 66  ? 83.757  169.046 103.922 1.00 13.21  ?  66  LEU G C   1 
ATOM 7691 O O   . LEU E 5 66  ? 83.467  169.624 102.865 1.00 12.02  ?  66  LEU G O   1 
ATOM 7692 C CB  . LEU E 5 66  ? 84.571  170.488 105.809 1.00 13.04  ?  66  LEU G CB  1 
ATOM 7693 C CG  . LEU E 5 66  ? 85.109  171.616 104.933 1.00 12.63  ?  66  LEU G CG  1 
ATOM 7694 C CD1 . LEU E 5 66  ? 84.037  172.673 104.692 1.00 15.01  ?  66  LEU G CD1 1 
ATOM 7695 C CD2 . LEU E 5 66  ? 86.334  172.225 105.594 1.00 12.51  ?  66  LEU G CD2 1 
ATOM 7696 N N   . PHE E 5 67  ? 84.352  167.857 103.962 1.00 13.21  ?  67  PHE G N   1 
ATOM 7697 C CA  . PHE E 5 67  ? 84.691  167.133 102.747 1.00 12.43  ?  67  PHE G CA  1 
ATOM 7698 C C   . PHE E 5 67  ? 83.400  166.766 102.028 1.00 13.07  ?  67  PHE G C   1 
ATOM 7699 O O   . PHE E 5 67  ? 83.280  166.923 100.805 1.00 12.64  ?  67  PHE G O   1 
ATOM 7700 C CB  . PHE E 5 67  ? 85.530  165.894 103.103 1.00 12.74  ?  67  PHE G CB  1 
ATOM 7701 C CG  . PHE E 5 67  ? 85.898  165.025 101.933 1.00 13.49  ?  67  PHE G CG  1 
ATOM 7702 C CD1 . PHE E 5 67  ? 86.922  165.388 101.074 1.00 12.32  ?  67  PHE G CD1 1 
ATOM 7703 C CD2 . PHE E 5 67  ? 85.267  163.809 101.733 1.00 15.03  ?  67  PHE G CD2 1 
ATOM 7704 C CE1 . PHE E 5 67  ? 87.273  164.579 100.007 1.00 12.12  ?  67  PHE G CE1 1 
ATOM 7705 C CE2 . PHE E 5 67  ? 85.618  162.994 100.673 1.00 20.71  ?  67  PHE G CE2 1 
ATOM 7706 C CZ  . PHE E 5 67  ? 86.623  163.380 99.809  1.00 15.39  ?  67  PHE G CZ  1 
ATOM 7707 N N   . ASN E 5 68  ? 82.411  166.330 102.803 1.00 13.90  ?  68  ASN G N   1 
ATOM 7708 C CA  . ASN E 5 68  ? 81.090  166.074 102.248 1.00 15.59  ?  68  ASN G CA  1 
ATOM 7709 C C   . ASN E 5 68  ? 80.372  167.331 101.764 1.00 14.52  ?  68  ASN G C   1 
ATOM 7710 O O   . ASN E 5 68  ? 79.607  167.270 100.813 1.00 14.34  ?  68  ASN G O   1 
ATOM 7711 C CB  . ASN E 5 68  ? 80.212  165.351 103.271 1.00 16.69  ?  68  ASN G CB  1 
ATOM 7712 C CG  . ASN E 5 68  ? 80.621  163.903 103.476 1.00 24.24  ?  68  ASN G CG  1 
ATOM 7713 O OD1 . ASN E 5 68  ? 81.236  163.290 102.605 1.00 30.77  ?  68  ASN G OD1 1 
ATOM 7714 N ND2 . ASN E 5 68  ? 80.275  163.350 104.631 1.00 28.57  ?  68  ASN G ND2 1 
ATOM 7715 N N   . GLN E 5 69  ? 80.602  168.462 102.426 1.00 14.05  ?  69  GLN G N   1 
ATOM 7716 C CA  . GLN E 5 69  ? 80.005  169.727 102.005 1.00 14.14  ?  69  GLN G CA  1 
ATOM 7717 C C   . GLN E 5 69  ? 80.567  170.191 100.672 1.00 12.95  ?  69  GLN G C   1 
ATOM 7718 O O   . GLN E 5 69  ? 79.865  170.801 99.858  1.00 12.37  ?  69  GLN G O   1 
ATOM 7719 C CB  . GLN E 5 69  ? 80.233  170.804 103.069 1.00 15.14  ?  69  GLN G CB  1 
ATOM 7720 C CG  . GLN E 5 69  ? 79.501  170.549 104.373 1.00 16.94  ?  69  GLN G CG  1 
ATOM 7721 C CD  . GLN E 5 69  ? 79.821  171.585 105.431 1.00 19.62  ?  69  GLN G CD  1 
ATOM 7722 O OE1 . GLN E 5 69  ? 80.874  172.224 105.393 1.00 20.62  ?  69  GLN G OE1 1 
ATOM 7723 N NE2 . GLN E 5 69  ? 78.914  171.755 106.386 1.00 22.02  ?  69  GLN G NE2 1 
ATOM 7724 N N   . ASP E 5 70  ? 81.838  169.875 100.446 1.00 12.17  ?  70  ASP G N   1 
ATOM 7725 C CA  . ASP E 5 70  ? 82.490  170.258 99.205  1.00 11.23  ?  70  ASP G CA  1 
ATOM 7726 C C   . ASP E 5 70  ? 82.099  169.315 98.078  1.00 10.97  ?  70  ASP G C   1 
ATOM 7727 O O   . ASP E 5 70  ? 81.831  169.755 96.956  1.00 10.89  ?  70  ASP G O   1 
ATOM 7728 C CB  . ASP E 5 70  ? 84.008  170.283 99.387  1.00 11.54  ?  70  ASP G CB  1 
ATOM 7729 C CG  . ASP E 5 70  ? 84.462  171.421 100.277 1.00 11.18  ?  70  ASP G CG  1 
ATOM 7730 O OD1 . ASP E 5 70  ? 83.661  172.355 100.500 1.00 9.17   ?  70  ASP G OD1 1 
ATOM 7731 O OD2 . ASP E 5 70  ? 85.611  171.379 100.764 1.00 11.19  -1 70  ASP G OD2 1 
ATOM 7732 N N   . VAL E 5 71  ? 82.062  168.018 98.374  1.00 10.67  ?  71  VAL G N   1 
ATOM 7733 C CA  . VAL E 5 71  ? 81.631  167.063 97.363  1.00 11.12  ?  71  VAL G CA  1 
ATOM 7734 C C   . VAL E 5 71  ? 80.164  167.282 96.992  1.00 11.74  ?  71  VAL G C   1 
ATOM 7735 O O   . VAL E 5 71  ? 79.779  167.123 95.834  1.00 10.83  ?  71  VAL G O   1 
ATOM 7736 C CB  . VAL E 5 71  ? 81.838  165.610 97.847  1.00 11.58  ?  71  VAL G CB  1 
ATOM 7737 C CG1 . VAL E 5 71  ? 81.259  164.616 96.852  1.00 13.72  ?  71  VAL G CG1 1 
ATOM 7738 C CG2 . VAL E 5 71  ? 83.318  165.335 98.062  1.00 12.32  ?  71  VAL G CG2 1 
ATOM 7739 N N   . ASP E 5 72  ? 79.351  167.665 97.972  1.00 12.70  ?  72  ASP G N   1 
ATOM 7740 C CA  . ASP E 5 72  ? 77.973  168.065 97.711  1.00 13.15  ?  72  ASP G CA  1 
ATOM 7741 C C   . ASP E 5 72  ? 77.888  169.386 96.962  1.00 12.86  ?  72  ASP G C   1 
ATOM 7742 O O   . ASP E 5 72  ? 76.940  169.618 96.213  1.00 13.29  ?  72  ASP G O   1 
ATOM 7743 C CB  . ASP E 5 72  ? 77.174  168.150 99.011  1.00 15.22  ?  72  ASP G CB  1 
ATOM 7744 C CG  . ASP E 5 72  ? 76.885  166.784 99.605  1.00 17.32  ?  72  ASP G CG  1 
ATOM 7745 O OD1 . ASP E 5 72  ? 77.048  165.775 98.885  1.00 19.46  ?  72  ASP G OD1 1 
ATOM 7746 O OD2 . ASP E 5 72  ? 76.484  166.719 100.786 1.00 18.65  -1 72  ASP G OD2 1 
ATOM 7747 N N   . ALA E 5 73  ? 78.871  170.259 97.172  1.00 11.65  ?  73  ALA G N   1 
ATOM 7748 C CA  . ALA E 5 73  ? 78.956  171.466 96.363  1.00 12.64  ?  73  ALA G CA  1 
ATOM 7749 C C   . ALA E 5 73  ? 79.234  171.087 94.911  1.00 11.24  ?  73  ALA G C   1 
ATOM 7750 O O   . ALA E 5 73  ? 78.783  171.763 93.984  1.00 11.35  ?  73  ALA G O   1 
ATOM 7751 C CB  . ALA E 5 73  ? 80.030  172.395 96.892  1.00 12.36  ?  73  ALA G CB  1 
ATOM 7752 N N   . ALA E 5 74  ? 79.976  169.997 94.718  1.00 10.63  ?  74  ALA G N   1 
ATOM 7753 C CA  . ALA E 5 74  ? 80.222  169.475 93.375  1.00 10.67  ?  74  ALA G CA  1 
ATOM 7754 C C   . ALA E 5 74  ? 78.979  168.825 92.764  1.00 10.92  ?  74  ALA G C   1 
ATOM 7755 O O   . ALA E 5 74  ? 78.701  168.994 91.577  1.00 10.62  ?  74  ALA G O   1 
ATOM 7756 C CB  . ALA E 5 74  ? 81.374  168.483 93.401  1.00 9.89   ?  74  ALA G CB  1 
ATOM 7757 N N   . VAL E 5 75  ? 78.231  168.094 93.586  1.00 10.93  ?  75  VAL G N   1 
ATOM 7758 C CA  . VAL E 5 75  ? 77.002  167.441 93.141  1.00 11.54  ?  75  VAL G CA  1 
ATOM 7759 C C   . VAL E 5 75  ? 75.807  168.384 93.177  1.00 12.12  ?  75  VAL G C   1 
ATOM 7760 O O   . VAL E 5 75  ? 75.140  168.595 92.167  1.00 11.85  ?  75  VAL G O   1 
ATOM 7761 C CB  . VAL E 5 75  ? 76.681  166.197 93.992  1.00 11.20  ?  75  VAL G CB  1 
ATOM 7762 C CG1 . VAL E 5 75  ? 75.334  165.616 93.592  1.00 11.85  ?  75  VAL G CG1 1 
ATOM 7763 C CG2 . VAL E 5 75  ? 77.779  165.154 93.847  1.00 11.46  ?  75  VAL G CG2 1 
ATOM 7764 N N   A ARG E 5 76  ? 73.326  170.526 93.330  0.57 12.79  ?  76  ARG G N   1 
ATOM 7765 N N   B ARG E 5 76  ? 73.895  171.188 93.793  0.43 12.35  ?  76  ARG G N   1 
ATOM 7766 C CA  A ARG E 5 76  ? 72.143  171.370 93.211  0.57 13.50  ?  76  ARG G CA  1 
ATOM 7767 C CA  B ARG E 5 76  ? 72.520  171.415 93.364  0.43 13.53  ?  76  ARG G CA  1 
ATOM 7768 C C   A ARG E 5 76  ? 72.163  172.184 91.922  0.57 13.87  ?  76  ARG G C   1 
ATOM 7769 C C   B ARG E 5 76  ? 72.459  172.167 92.040  0.43 13.83  ?  76  ARG G C   1 
ATOM 7770 O O   A ARG E 5 76  ? 71.244  172.098 91.109  0.57 14.00  ?  76  ARG G O   1 
ATOM 7771 O O   B ARG E 5 76  ? 71.421  172.190 91.377  0.43 14.01  ?  76  ARG G O   1 
ATOM 7772 C CB  A ARG E 5 76  ? 72.028  172.303 94.418  0.57 14.79  ?  76  ARG G CB  1 
ATOM 7773 C CB  B ARG E 5 76  ? 71.745  172.182 94.436  0.43 14.79  ?  76  ARG G CB  1 
ATOM 7774 C CG  A ARG E 5 76  ? 71.596  171.610 95.699  0.57 15.92  ?  76  ARG G CG  1 
ATOM 7775 C CG  B ARG E 5 76  ? 71.457  171.368 95.681  0.43 15.85  ?  76  ARG G CG  1 
ATOM 7776 C CD  A ARG E 5 76  ? 71.419  172.605 96.833  0.57 17.25  ?  76  ARG G CD  1 
ATOM 7777 C CD  B ARG E 5 76  ? 70.534  172.106 96.629  0.43 17.15  ?  76  ARG G CD  1 
ATOM 7778 N NE  A ARG E 5 76  ? 72.694  172.975 97.439  0.57 17.23  ?  76  ARG G NE  1 
ATOM 7779 N NE  B ARG E 5 76  ? 70.198  171.289 97.790  0.43 18.37  ?  76  ARG G NE  1 
ATOM 7780 C CZ  A ARG E 5 76  ? 73.441  174.000 97.044  0.57 17.04  ?  76  ARG G CZ  1 
ATOM 7781 C CZ  B ARG E 5 76  ? 69.280  170.327 97.782  0.43 19.70  ?  76  ARG G CZ  1 
ATOM 7782 N NH1 A ARG E 5 76  ? 73.044  174.762 96.035  0.57 19.50  1  76  ARG G NH1 1 
ATOM 7783 N NH1 B ARG E 5 76  ? 68.610  170.056 96.671  0.43 18.33  1  76  ARG G NH1 1 
ATOM 7784 N NH2 A ARG E 5 76  ? 74.588  174.262 97.655  0.57 14.52  ?  76  ARG G NH2 1 
ATOM 7785 N NH2 B ARG E 5 76  ? 69.036  169.630 98.883  0.43 21.39  ?  76  ARG G NH2 1 
ATOM 7786 N N   . GLY E 5 77  ? 76.976  170.978 91.849  1.00 12.46  ?  77  GLY G N   1 
ATOM 7787 C CA  . GLY E 5 77  ? 77.338  172.104 91.008  1.00 13.55  ?  77  GLY G CA  1 
ATOM 7788 C C   . GLY E 5 77  ? 77.460  171.743 89.540  1.00 12.22  ?  77  GLY G C   1 
ATOM 7789 O O   . GLY E 5 77  ? 77.281  172.591 88.667  1.00 12.80  ?  77  GLY G O   1 
ATOM 7790 N N   . ILE E 5 78  ? 77.790  170.485 89.268  1.00 11.32  ?  78  ILE G N   1 
ATOM 7791 C CA  . ILE E 5 78  ? 77.935  170.002 87.900  1.00 11.96  ?  78  ILE G CA  1 
ATOM 7792 C C   . ILE E 5 78  ? 76.612  170.091 87.142  1.00 12.84  ?  78  ILE G C   1 
ATOM 7793 O O   . ILE E 5 78  ? 76.581  170.356 85.938  1.00 12.77  ?  78  ILE G O   1 
ATOM 7794 C CB  . ILE E 5 78  ? 78.428  168.537 87.888  1.00 11.10  ?  78  ILE G CB  1 
ATOM 7795 C CG1 . ILE E 5 78  ? 79.808  168.438 88.530  1.00 10.42  ?  78  ILE G CG1 1 
ATOM 7796 C CG2 . ILE E 5 78  ? 78.482  167.985 86.473  1.00 12.13  ?  78  ILE G CG2 1 
ATOM 7797 C CD1 . ILE E 5 78  ? 80.255  167.021 88.781  1.00 9.38   ?  78  ILE G CD1 1 
ATOM 7798 N N   . LEU E 5 79  ? 75.518  169.890 87.870  1.00 12.86  ?  79  LEU G N   1 
ATOM 7799 C CA  . LEU E 5 79  ? 74.193  169.819 87.269  1.00 14.10  ?  79  LEU G CA  1 
ATOM 7800 C C   . LEU E 5 79  ? 73.730  171.127 86.624  1.00 15.13  ?  79  LEU G C   1 
ATOM 7801 O O   . LEU E 5 79  ? 73.006  171.098 85.629  1.00 16.95  ?  79  LEU G O   1 
ATOM 7802 C CB  . LEU E 5 79  ? 73.174  169.367 88.319  1.00 14.29  ?  79  LEU G CB  1 
ATOM 7803 C CG  . LEU E 5 79  ? 73.369  167.956 88.886  1.00 13.66  ?  79  LEU G CG  1 
ATOM 7804 C CD1 . LEU E 5 79  ? 72.384  167.690 90.012  1.00 14.69  ?  79  LEU G CD1 1 
ATOM 7805 C CD2 . LEU E 5 79  ? 73.236  166.904 87.800  1.00 16.35  ?  79  LEU G CD2 1 
ATOM 7806 N N   . ARG E 5 80  ? 74.132  172.271 87.179  1.00 14.46  ?  80  ARG G N   1 
ATOM 7807 C CA  . ARG E 5 80  ? 73.681  173.547 86.625  1.00 15.04  ?  80  ARG G CA  1 
ATOM 7808 C C   . ARG E 5 80  ? 74.239  173.811 85.228  1.00 15.13  ?  80  ARG G C   1 
ATOM 7809 O O   . ARG E 5 80  ? 73.598  174.484 84.420  1.00 14.60  ?  80  ARG G O   1 
ATOM 7810 C CB  . ARG E 5 80  ? 74.046  174.728 87.535  1.00 15.16  ?  80  ARG G CB  1 
ATOM 7811 C CG  . ARG E 5 80  ? 75.536  174.996 87.718  1.00 16.64  ?  80  ARG G CG  1 
ATOM 7812 C CD  . ARG E 5 80  ? 75.757  176.261 88.545  1.00 19.13  ?  80  ARG G CD  1 
ATOM 7813 N NE  . ARG E 5 80  ? 75.286  176.136 89.920  1.00 25.45  ?  80  ARG G NE  1 
ATOM 7814 C CZ  . ARG E 5 80  ? 76.024  175.679 90.926  1.00 22.29  ?  80  ARG G CZ  1 
ATOM 7815 N NH1 . ARG E 5 80  ? 77.285  175.324 90.721  1.00 22.92  ?  80  ARG G NH1 1 
ATOM 7816 N NH2 . ARG E 5 80  ? 75.507  175.598 92.144  1.00 23.18  1  80  ARG G NH2 1 
ATOM 7817 N N   . ASN E 5 81  ? 75.430  173.285 84.947  1.00 15.01  ?  81  ASN G N   1 
ATOM 7818 C CA  . ASN E 5 81  ? 76.115  173.586 83.691  1.00 14.88  ?  81  ASN G CA  1 
ATOM 7819 C C   . ASN E 5 81  ? 75.366  173.005 82.498  1.00 15.95  ?  81  ASN G C   1 
ATOM 7820 O O   . ASN E 5 81  ? 74.860  171.884 82.554  1.00 15.30  ?  81  ASN G O   1 
ATOM 7821 C CB  . ASN E 5 81  ? 77.556  173.062 83.727  1.00 15.00  ?  81  ASN G CB  1 
ATOM 7822 C CG  . ASN E 5 81  ? 78.384  173.518 82.533  1.00 15.84  ?  81  ASN G CG  1 
ATOM 7823 O OD1 . ASN E 5 81  ? 77.850  173.892 81.490  1.00 14.93  ?  81  ASN G OD1 1 
ATOM 7824 N ND2 . ASN E 5 81  ? 79.701  173.501 82.693  1.00 14.16  ?  81  ASN G ND2 1 
ATOM 7825 N N   . ALA E 5 82  ? 75.290  173.780 81.422  1.00 16.66  ?  82  ALA G N   1 
ATOM 7826 C CA  . ALA E 5 82  ? 74.635  173.315 80.209  1.00 15.96  ?  82  ALA G CA  1 
ATOM 7827 C C   . ALA E 5 82  ? 75.383  172.164 79.539  1.00 15.29  ?  82  ALA G C   1 
ATOM 7828 O O   . ALA E 5 82  ? 74.765  171.285 78.936  1.00 15.69  ?  82  ALA G O   1 
ATOM 7829 C CB  . ALA E 5 82  ? 74.469  174.471 79.232  1.00 21.98  ?  82  ALA G CB  1 
ATOM 7830 N N   . LYS E 5 83  ? 76.708  172.164 79.646  1.00 15.79  ?  83  LYS G N   1 
ATOM 7831 C CA  . LYS E 5 83  ? 77.513  171.157 78.960  1.00 15.03  ?  83  LYS G CA  1 
ATOM 7832 C C   . LYS E 5 83  ? 77.764  169.886 79.756  1.00 14.04  ?  83  LYS G C   1 
ATOM 7833 O O   . LYS E 5 83  ? 77.756  168.789 79.202  1.00 14.96  ?  83  LYS G O   1 
ATOM 7834 C CB  . LYS E 5 83  ? 78.860  171.752 78.554  1.00 16.31  ?  83  LYS G CB  1 
ATOM 7835 C CG  . LYS E 5 83  ? 78.773  172.761 77.434  1.00 20.80  ?  83  LYS G CG  1 
ATOM 7836 C CD  . LYS E 5 83  ? 80.148  173.285 77.089  1.00 31.39  ?  83  LYS G CD  1 
ATOM 7837 C CE  . LYS E 5 83  ? 80.720  174.084 78.242  1.00 23.69  ?  83  LYS G CE  1 
ATOM 7838 N NZ  . LYS E 5 83  ? 79.909  175.301 78.518  1.00 26.15  1  83  LYS G NZ  1 
ATOM 7839 N N   . LEU E 5 84  ? 78.033  170.042 81.046  1.00 13.39  ?  84  LEU G N   1 
ATOM 7840 C CA  . LEU E 5 84  ? 78.454  168.908 81.854  1.00 12.86  ?  84  LEU G CA  1 
ATOM 7841 C C   . LEU E 5 84  ? 77.402  167.830 82.068  1.00 11.81  ?  84  LEU G C   1 
ATOM 7842 O O   . LEU E 5 84  ? 77.738  166.651 82.161  1.00 11.29  ?  84  LEU G O   1 
ATOM 7843 C CB  . LEU E 5 84  ? 78.943  169.401 83.213  1.00 15.11  ?  84  LEU G CB  1 
ATOM 7844 C CG  . LEU E 5 84  ? 80.196  170.259 83.091  1.00 12.33  ?  84  LEU G CG  1 
ATOM 7845 C CD1 . LEU E 5 84  ? 80.650  170.799 84.440  1.00 11.41  ?  84  LEU G CD1 1 
ATOM 7846 C CD2 . LEU E 5 84  ? 81.273  169.445 82.417  1.00 10.55  ?  84  LEU G CD2 1 
ATOM 7847 N N   . LYS E 5 85  ? 76.137  168.225 82.147  1.00 12.31  ?  85  LYS G N   1 
ATOM 7848 C CA  . LYS E 5 85  ? 75.086  167.274 82.507  1.00 12.77  ?  85  LYS G CA  1 
ATOM 7849 C C   . LYS E 5 85  ? 74.937  166.081 81.540  1.00 12.61  ?  85  LYS G C   1 
ATOM 7850 O O   . LYS E 5 85  ? 74.923  164.928 81.991  1.00 12.19  ?  85  LYS G O   1 
ATOM 7851 C CB  . LYS E 5 85  ? 73.749  168.015 82.647  1.00 15.08  ?  85  LYS G CB  1 
ATOM 7852 C CG  . LYS E 5 85  ? 72.593  167.151 83.113  1.00 15.90  ?  85  LYS G CG  1 
ATOM 7853 C CD  . LYS E 5 85  ? 71.370  168.005 83.408  1.00 19.33  ?  85  LYS G CD  1 
ATOM 7854 C CE  . LYS E 5 85  ? 70.191  167.153 83.838  1.00 18.93  ?  85  LYS G CE  1 
ATOM 7855 N NZ  . LYS E 5 85  ? 69.642  166.372 82.698  1.00 14.66  1  85  LYS G NZ  1 
ATOM 7856 N N   . PRO E 5 86  ? 74.835  166.338 80.215  1.00 12.79  ?  86  PRO G N   1 
ATOM 7857 C CA  . PRO E 5 86  ? 74.820  165.178 79.314  1.00 13.34  ?  86  PRO G CA  1 
ATOM 7858 C C   . PRO E 5 86  ? 76.075  164.305 79.388  1.00 11.78  ?  86  PRO G C   1 
ATOM 7859 O O   . PRO E 5 86  ? 75.984  163.086 79.237  1.00 11.62  ?  86  PRO G O   1 
ATOM 7860 C CB  . PRO E 5 86  ? 74.694  165.823 77.926  1.00 15.78  ?  86  PRO G CB  1 
ATOM 7861 C CG  . PRO E 5 86  ? 75.260  167.187 78.092  1.00 16.18  ?  86  PRO G CG  1 
ATOM 7862 C CD  . PRO E 5 86  ? 74.805  167.604 79.459  1.00 14.33  ?  86  PRO G CD  1 
ATOM 7863 N N   . VAL E 5 87  ? 77.225  164.925 79.633  1.00 11.86  ?  87  VAL G N   1 
ATOM 7864 C CA  . VAL E 5 87  ? 78.481  164.192 79.762  1.00 11.24  ?  87  VAL G CA  1 
ATOM 7865 C C   . VAL E 5 87  ? 78.511  163.371 81.046  1.00 10.68  ?  87  VAL G C   1 
ATOM 7866 O O   . VAL E 5 87  ? 79.011  162.246 81.073  1.00 10.52  ?  87  VAL G O   1 
ATOM 7867 C CB  . VAL E 5 87  ? 79.688  165.152 79.733  1.00 11.20  ?  87  VAL G CB  1 
ATOM 7868 C CG1 . VAL E 5 87  ? 80.985  164.395 79.974  1.00 10.30  ?  87  VAL G CG1 1 
ATOM 7869 C CG2 . VAL E 5 87  ? 79.736  165.906 78.413  1.00 12.22  ?  87  VAL G CG2 1 
ATOM 7870 N N   . TYR E 5 88  ? 77.939  163.944 82.101  1.00 11.15  ?  88  TYR G N   1 
ATOM 7871 C CA  . TYR E 5 88  ? 77.808  163.274 83.387  1.00 10.99  ?  88  TYR G CA  1 
ATOM 7872 C C   . TYR E 5 88  ? 76.865  162.091 83.233  1.00 11.34  ?  88  TYR G C   1 
ATOM 7873 O O   . TYR E 5 88  ? 76.962  161.102 83.959  1.00 11.43  ?  88  TYR G O   1 
ATOM 7874 C CB  . TYR E 5 88  ? 77.300  164.254 84.450  1.00 11.22  ?  88  TYR G CB  1 
ATOM 7875 C CG  . TYR E 5 88  ? 77.075  163.663 85.827  1.00 12.14  ?  88  TYR G CG  1 
ATOM 7876 C CD1 . TYR E 5 88  ? 78.144  163.393 86.670  1.00 11.40  ?  88  TYR G CD1 1 
ATOM 7877 C CD2 . TYR E 5 88  ? 75.791  163.409 86.296  1.00 12.75  ?  88  TYR G CD2 1 
ATOM 7878 C CE1 . TYR E 5 88  ? 77.944  162.866 87.935  1.00 12.82  ?  88  TYR G CE1 1 
ATOM 7879 C CE2 . TYR E 5 88  ? 75.582  162.883 87.561  1.00 13.02  ?  88  TYR G CE2 1 
ATOM 7880 C CZ  . TYR E 5 88  ? 76.661  162.613 88.375  1.00 13.58  ?  88  TYR G CZ  1 
ATOM 7881 O OH  . TYR E 5 88  ? 76.460  162.089 89.633  1.00 15.01  ?  88  TYR G OH  1 
ATOM 7882 N N   . ASP E 5 89  ? 75.944  162.210 82.281  1.00 11.77  ?  89  ASP G N   1 
ATOM 7883 C CA  . ASP E 5 89  ? 75.053  161.110 81.936  1.00 12.33  ?  89  ASP G CA  1 
ATOM 7884 C C   . ASP E 5 89  ? 75.784  160.009 81.165  1.00 11.73  ?  89  ASP G C   1 
ATOM 7885 O O   . ASP E 5 89  ? 75.599  158.822 81.436  1.00 11.33  ?  89  ASP G O   1 
ATOM 7886 C CB  . ASP E 5 89  ? 73.875  161.628 81.107  1.00 11.83  ?  89  ASP G CB  1 
ATOM 7887 C CG  . ASP E 5 89  ? 72.944  162.517 81.907  1.00 12.95  ?  89  ASP G CG  1 
ATOM 7888 O OD1 . ASP E 5 89  ? 73.028  162.505 83.153  1.00 13.09  ?  89  ASP G OD1 1 
ATOM 7889 O OD2 . ASP E 5 89  ? 72.127  163.232 81.288  1.00 13.58  -1 89  ASP G OD2 1 
ATOM 7890 N N   . SER E 5 90  ? 76.602  160.415 80.194  1.00 11.28  ?  90  SER G N   1 
ATOM 7891 C CA  . SER E 5 90  ? 77.321  159.474 79.330  1.00 11.86  ?  90  SER G CA  1 
ATOM 7892 C C   . SER E 5 90  ? 78.380  158.647 80.051  1.00 12.42  ?  90  SER G C   1 
ATOM 7893 O O   . SER E 5 90  ? 78.654  157.508 79.674  1.00 13.03  ?  90  SER G O   1 
ATOM 7894 C CB  . SER E 5 90  ? 77.980  160.226 78.174  1.00 12.90  ?  90  SER G CB  1 
ATOM 7895 O OG  . SER E 5 90  ? 78.971  161.121 78.647  1.00 13.11  ?  90  SER G OG  1 
ATOM 7896 N N   . LEU E 5 91  ? 78.978  159.230 81.083  1.00 12.01  ?  91  LEU G N   1 
ATOM 7897 C CA  . LEU E 5 91  ? 80.005  158.546 81.854  1.00 12.54  ?  91  LEU G CA  1 
ATOM 7898 C C   . LEU E 5 91  ? 79.418  157.390 82.647  1.00 13.26  ?  91  LEU G C   1 
ATOM 7899 O O   . LEU E 5 91  ? 78.282  157.464 83.110  1.00 12.25  ?  91  LEU G O   1 
ATOM 7900 C CB  . LEU E 5 91  ? 80.702  159.525 82.798  1.00 12.36  ?  91  LEU G CB  1 
ATOM 7901 C CG  . LEU E 5 91  ? 81.477  160.651 82.117  1.00 11.44  ?  91  LEU G CG  1 
ATOM 7902 C CD1 . LEU E 5 91  ? 82.022  161.623 83.140  1.00 12.01  ?  91  LEU G CD1 1 
ATOM 7903 C CD2 . LEU E 5 91  ? 82.591  160.098 81.268  1.00 12.66  ?  91  LEU G CD2 1 
ATOM 7904 N N   . ASP E 5 92  ? 80.188  156.317 82.797  1.00 13.71  ?  92  ASP G N   1 
ATOM 7905 C CA  . ASP E 5 92  ? 79.858  155.303 83.789  1.00 14.11  ?  92  ASP G CA  1 
ATOM 7906 C C   . ASP E 5 92  ? 80.142  155.969 85.132  1.00 13.74  ?  92  ASP G C   1 
ATOM 7907 O O   . ASP E 5 92  ? 80.932  156.912 85.186  1.00 12.02  ?  92  ASP G O   1 
ATOM 7908 C CB  . ASP E 5 92  ? 80.674  154.019 83.607  1.00 14.04  ?  92  ASP G CB  1 
ATOM 7909 C CG  . ASP E 5 92  ? 82.153  154.226 83.848  1.00 14.95  ?  92  ASP G CG  1 
ATOM 7910 O OD1 . ASP E 5 92  ? 82.559  155.377 84.082  1.00 18.72  -1 92  ASP G OD1 1 
ATOM 7911 O OD2 . ASP E 5 92  ? 82.910  153.235 83.813  1.00 13.56  ?  92  ASP G OD2 1 
ATOM 7912 N N   . ALA E 5 93  ? 79.489  155.522 86.202  1.00 13.24  ?  93  ALA G N   1 
ATOM 7913 C CA  . ALA E 5 93  ? 79.584  156.222 87.483  1.00 14.33  ?  93  ALA G CA  1 
ATOM 7914 C C   . ALA E 5 93  ? 81.028  156.280 87.956  1.00 13.55  ?  93  ALA G C   1 
ATOM 7915 O O   . ALA E 5 93  ? 81.449  157.234 88.630  1.00 13.55  ?  93  ALA G O   1 
ATOM 7916 C CB  . ALA E 5 93  ? 78.715  155.541 88.526  1.00 17.19  ?  93  ALA G CB  1 
ATOM 7917 N N   . VAL E 5 94  ? 81.788  155.268 87.559  1.00 13.54  ?  94  VAL G N   1 
ATOM 7918 C CA  . VAL E 5 94  ? 83.209  155.224 87.839  1.00 13.10  ?  94  VAL G CA  1 
ATOM 7919 C C   . VAL E 5 94  ? 83.948  156.381 87.153  1.00 11.71  ?  94  VAL G C   1 
ATOM 7920 O O   . VAL E 5 94  ? 84.952  156.874 87.669  1.00 10.31  ?  94  VAL G O   1 
ATOM 7921 C CB  . VAL E 5 94  ? 83.807  153.878 87.403  1.00 13.57  ?  94  VAL G CB  1 
ATOM 7922 C CG1 . VAL E 5 94  ? 85.303  153.875 87.612  1.00 12.59  ?  94  VAL G CG1 1 
ATOM 7923 C CG2 . VAL E 5 94  ? 83.159  152.743 88.184  1.00 16.24  ?  94  VAL G CG2 1 
ATOM 7924 N N   . ARG E 5 95  ? 83.446  156.824 86.002  1.00 11.40  ?  95  ARG G N   1 
ATOM 7925 C CA  . ARG E 5 95  ? 83.964  158.040 85.378  1.00 11.66  ?  95  ARG G CA  1 
ATOM 7926 C C   . ARG E 5 95  ? 83.242  159.291 85.863  1.00 10.36  ?  95  ARG G C   1 
ATOM 7927 O O   . ARG E 5 95  ? 83.775  160.396 85.775  1.00 9.46   ?  95  ARG G O   1 
ATOM 7928 C CB  . ARG E 5 95  ? 83.850  157.962 83.863  1.00 10.77  ?  95  ARG G CB  1 
ATOM 7929 C CG  . ARG E 5 95  ? 84.724  156.912 83.212  1.00 10.16  ?  95  ARG G CG  1 
ATOM 7930 C CD  . ARG E 5 95  ? 84.456  156.935 81.727  1.00 11.65  ?  95  ARG G CD  1 
ATOM 7931 N NE  . ARG E 5 95  ? 85.230  155.972 80.952  1.00 11.21  ?  95  ARG G NE  1 
ATOM 7932 C CZ  . ARG E 5 95  ? 84.866  154.710 80.763  1.00 12.55  ?  95  ARG G CZ  1 
ATOM 7933 N NH1 . ARG E 5 95  ? 83.743  154.258 81.303  1.00 12.44  1  95  ARG G NH1 1 
ATOM 7934 N NH2 . ARG E 5 95  ? 85.626  153.900 80.041  1.00 12.24  ?  95  ARG G NH2 1 
ATOM 7935 N N   . ARG E 5 96  ? 82.006  159.124 86.324  1.00 11.37  ?  96  ARG G N   1 
ATOM 7936 C CA  . ARG E 5 96  ? 81.231  160.259 86.814  1.00 11.57  ?  96  ARG G CA  1 
ATOM 7937 C C   . ARG E 5 96  ? 81.873  160.853 88.058  1.00 10.13  ?  96  ARG G C   1 
ATOM 7938 O O   . ARG E 5 96  ? 81.858  162.077 88.265  1.00 9.71   ?  96  ARG G O   1 
ATOM 7939 C CB  . ARG E 5 96  ? 79.794  159.831 87.120  1.00 12.42  ?  96  ARG G CB  1 
ATOM 7940 C CG  . ARG E 5 96  ? 78.989  159.425 85.897  1.00 12.92  ?  96  ARG G CG  1 
ATOM 7941 C CD  . ARG E 5 96  ? 77.572  158.988 86.253  1.00 14.16  ?  96  ARG G CD  1 
ATOM 7942 N NE  . ARG E 5 96  ? 76.871  158.520 85.061  1.00 15.50  ?  96  ARG G NE  1 
ATOM 7943 C CZ  . ARG E 5 96  ? 75.689  157.917 85.068  1.00 13.97  ?  96  ARG G CZ  1 
ATOM 7944 N NH1 . ARG E 5 96  ? 75.063  157.681 86.212  1.00 11.38  1  96  ARG G NH1 1 
ATOM 7945 N NH2 . ARG E 5 96  ? 75.143  157.527 83.924  1.00 13.22  ?  96  ARG G NH2 1 
ATOM 7946 N N   . CYS E 5 97  ? 82.461  159.982 88.874  1.00 10.19  ?  97  CYS G N   1 
ATOM 7947 C CA  . CYS E 5 97  ? 83.238  160.450 90.011  1.00 10.42  ?  97  CYS G CA  1 
ATOM 7948 C C   . CYS E 5 97  ? 84.493  161.171 89.526  1.00 9.37   ?  97  CYS G C   1 
ATOM 7949 O O   . CYS E 5 97  ? 85.007  162.057 90.200  1.00 8.83   ?  97  CYS G O   1 
ATOM 7950 C CB  . CYS E 5 97  ? 83.603  159.286 90.932  1.00 11.09  ?  97  CYS G CB  1 
ATOM 7951 S SG  . CYS E 5 97  ? 82.177  158.487 91.705  1.00 12.13  ?  97  CYS G SG  1 
ATOM 7952 N N   . ALA E 5 98  ? 84.996  160.782 88.359  1.00 8.94   ?  98  ALA G N   1 
ATOM 7953 C CA  . ALA E 5 98  ? 86.125  161.490 87.773  1.00 8.77   ?  98  ALA G CA  1 
ATOM 7954 C C   . ALA E 5 98  ? 85.738  162.892 87.317  1.00 8.48   ?  98  ALA G C   1 
ATOM 7955 O O   . ALA E 5 98  ? 86.505  163.842 87.484  1.00 8.04   ?  98  ALA G O   1 
ATOM 7956 C CB  . ALA E 5 98  ? 86.707  160.697 86.615  1.00 9.42   ?  98  ALA G CB  1 
ATOM 7957 N N   . LEU E 5 99  ? 84.547  163.023 86.741  1.00 8.40   ?  99  LEU G N   1 
ATOM 7958 C CA  . LEU E 5 99  ? 84.056  164.340 86.362  1.00 8.50   ?  99  LEU G CA  1 
ATOM 7959 C C   . LEU E 5 99  ? 83.844  165.184 87.609  1.00 8.51   ?  99  LEU G C   1 
ATOM 7960 O O   . LEU E 5 99  ? 84.086  166.399 87.609  1.00 8.03   ?  99  LEU G O   1 
ATOM 7961 C CB  . LEU E 5 99  ? 82.761  164.226 85.558  1.00 8.98   ?  99  LEU G CB  1 
ATOM 7962 C CG  . LEU E 5 99  ? 82.112  165.541 85.124  1.00 8.21   ?  99  LEU G CG  1 
ATOM 7963 C CD1 . LEU E 5 99  ? 83.034  166.291 84.187  1.00 8.65   ?  99  LEU G CD1 1 
ATOM 7964 C CD2 . LEU E 5 99  ? 80.771  165.286 84.462  1.00 8.83   ?  99  LEU G CD2 1 
ATOM 7965 N N   . ILE E 5 100 ? 83.415  164.526 88.686  1.00 8.57   ?  100 ILE G N   1 
ATOM 7966 C CA  . ILE E 5 100 ? 83.276  165.216 89.962  1.00 8.76   ?  100 ILE G CA  1 
ATOM 7967 C C   . ILE E 5 100 ? 84.643  165.673 90.467  1.00 8.51   ?  100 ILE G C   1 
ATOM 7968 O O   . ILE E 5 100 ? 84.769  166.748 91.055  1.00 8.02   ?  100 ILE G O   1 
ATOM 7969 C CB  . ILE E 5 100 ? 82.602  164.310 91.022  1.00 9.61   ?  100 ILE G CB  1 
ATOM 7970 C CG1 . ILE E 5 100 ? 81.153  164.016 90.629  1.00 9.82   ?  100 ILE G CG1 1 
ATOM 7971 C CG2 . ILE E 5 100 ? 82.646  164.955 92.399  1.00 10.78  ?  100 ILE G CG2 1 
ATOM 7972 C CD1 . ILE E 5 100 ? 80.501  162.944 91.472  1.00 9.44   ?  100 ILE G CD1 1 
ATOM 7973 N N   . ASN E 5 101 ? 85.670  164.870 90.196  1.00 8.38   ?  101 ASN G N   1 
ATOM 7974 C CA  . ASN E 5 101 ? 87.033  165.241 90.542  1.00 8.44   ?  101 ASN G CA  1 
ATOM 7975 C C   . ASN E 5 101 ? 87.460  166.454 89.737  1.00 7.87   ?  101 ASN G C   1 
ATOM 7976 O O   . ASN E 5 101 ? 88.168  167.329 90.233  1.00 7.40   ?  101 ASN G O   1 
ATOM 7977 C CB  . ASN E 5 101 ? 87.988  164.074 90.275  1.00 7.95   ?  101 ASN G CB  1 
ATOM 7978 C CG  . ASN E 5 101 ? 89.396  164.324 90.797  1.00 8.20   ?  101 ASN G CG  1 
ATOM 7979 O OD1 . ASN E 5 101 ? 89.792  165.454 91.074  1.00 7.87   ?  101 ASN G OD1 1 
ATOM 7980 N ND2 . ASN E 5 101 ? 90.167  163.254 90.911  1.00 8.96   ?  101 ASN G ND2 1 
ATOM 7981 N N   . MET E 5 102 ? 86.984  166.526 88.501  1.00 8.34   ?  102 MET G N   1 
ATOM 7982 C CA  . MET E 5 102 ? 87.386  167.613 87.626  1.00 8.07   ?  102 MET G CA  1 
ATOM 7983 C C   . MET E 5 102 ? 86.769  168.923 88.085  1.00 8.30   ?  102 MET G C   1 
ATOM 7984 O O   . MET E 5 102 ? 87.471  169.930 88.272  1.00 8.52   ?  102 MET G O   1 
ATOM 7985 C CB  . MET E 5 102 ? 86.977  167.317 86.182  1.00 7.91   ?  102 MET G CB  1 
ATOM 7986 C CG  . MET E 5 102 ? 87.735  166.172 85.532  1.00 8.32   ?  102 MET G CG  1 
ATOM 7987 S SD  . MET E 5 102 ? 87.135  165.811 83.866  1.00 5.96   ?  102 MET G SD  1 
ATOM 7988 C CE  . MET E 5 102 ? 87.726  167.235 82.956  1.00 8.65   ?  102 MET G CE  1 
ATOM 7989 N N   . VAL E 5 103 ? 85.454  168.893 88.285  1.00 8.33   ?  103 VAL G N   1 
ATOM 7990 C CA  . VAL E 5 103 ? 84.732  170.090 88.688  1.00 8.72   ?  103 VAL G CA  1 
ATOM 7991 C C   . VAL E 5 103 ? 85.144  170.533 90.088  1.00 8.14   ?  103 VAL G C   1 
ATOM 7992 O O   . VAL E 5 103 ? 85.187  171.729 90.384  1.00 9.35   ?  103 VAL G O   1 
ATOM 7993 C CB  . VAL E 5 103 ? 83.214  169.856 88.615  1.00 8.52   ?  103 VAL G CB  1 
ATOM 7994 C CG1 . VAL E 5 103 ? 82.448  171.068 89.129  1.00 8.77   ?  103 VAL G CG1 1 
ATOM 7995 C CG2 . VAL E 5 103 ? 82.814  169.535 87.184  1.00 8.82   ?  103 VAL G CG2 1 
ATOM 7996 N N   . PHE E 5 104 ? 85.471  169.567 90.940  1.00 7.73   ?  104 PHE G N   1 
ATOM 7997 C CA  . PHE E 5 104 ? 86.034  169.877 92.249  1.00 8.46   ?  104 PHE G CA  1 
ATOM 7998 C C   . PHE E 5 104 ? 87.435  170.472 92.165  1.00 9.32   ?  104 PHE G C   1 
ATOM 7999 O O   . PHE E 5 104 ? 87.835  171.256 93.026  1.00 9.66   ?  104 PHE G O   1 
ATOM 8000 C CB  . PHE E 5 104 ? 86.068  168.628 93.125  1.00 8.12   ?  104 PHE G CB  1 
ATOM 8001 C CG  . PHE E 5 104 ? 86.735  168.843 94.447  1.00 8.95   ?  104 PHE G CG  1 
ATOM 8002 C CD1 . PHE E 5 104 ? 86.054  169.447 95.489  1.00 8.97   ?  104 PHE G CD1 1 
ATOM 8003 C CD2 . PHE E 5 104 ? 88.049  168.451 94.645  1.00 9.51   ?  104 PHE G CD2 1 
ATOM 8004 C CE1 . PHE E 5 104 ? 86.668  169.650 96.709  1.00 9.88   ?  104 PHE G CE1 1 
ATOM 8005 C CE2 . PHE E 5 104 ? 88.669  168.652 95.860  1.00 10.56  ?  104 PHE G CE2 1 
ATOM 8006 C CZ  . PHE E 5 104 ? 87.976  169.252 96.895  1.00 9.48   ?  104 PHE G CZ  1 
ATOM 8007 N N   . GLN E 5 105 ? 88.176  170.105 91.123  1.00 8.50   ?  105 GLN G N   1 
ATOM 8008 C CA  . GLN E 5 105 ? 89.573  170.511 91.022  1.00 9.07   ?  105 GLN G CA  1 
ATOM 8009 C C   . GLN E 5 105 ? 89.736  171.855 90.332  1.00 10.31  ?  105 GLN G C   1 
ATOM 8010 O O   . GLN E 5 105 ? 90.035  172.858 90.981  1.00 10.38  ?  105 GLN G O   1 
ATOM 8011 C CB  . GLN E 5 105 ? 90.390  169.456 90.278  1.00 9.38   ?  105 GLN G CB  1 
ATOM 8012 C CG  . GLN E 5 105 ? 91.876  169.746 90.238  1.00 9.61   ?  105 GLN G CG  1 
ATOM 8013 C CD  . GLN E 5 105 ? 92.663  168.610 89.632  1.00 9.68   ?  105 GLN G CD  1 
ATOM 8014 O OE1 . GLN E 5 105 ? 92.107  167.556 89.322  1.00 9.55   ?  105 GLN G OE1 1 
ATOM 8015 N NE2 . GLN E 5 105 ? 93.964  168.814 89.455  1.00 9.17   ?  105 GLN G NE2 1 
ATOM 8016 N N   . MET E 5 106 ? 89.532  171.877 89.018  1.00 10.80  ?  106 MET G N   1 
ATOM 8017 C CA  . MET E 5 106 ? 89.825  173.076 88.235  1.00 13.43  ?  106 MET G CA  1 
ATOM 8018 C C   . MET E 5 106 ? 88.699  174.092 88.377  1.00 12.38  ?  106 MET G C   1 
ATOM 8019 O O   . MET E 5 106 ? 88.816  175.234 87.934  1.00 12.94  ?  106 MET G O   1 
ATOM 8020 C CB  . MET E 5 106 ? 90.031  172.734 86.757  1.00 15.83  ?  106 MET G CB  1 
ATOM 8021 C CG  . MET E 5 106 ? 88.755  172.372 86.023  1.00 16.14  ?  106 MET G CG  1 
ATOM 8022 S SD  . MET E 5 106 ? 89.020  171.589 84.422  1.00 26.56  ?  106 MET G SD  1 
ATOM 8023 C CE  . MET E 5 106 ? 89.084  169.870 84.897  1.00 15.03  ?  106 MET G CE  1 
ATOM 8024 N N   . GLY E 5 107 ? 87.606  173.657 88.994  1.00 12.02  ?  107 GLY G N   1 
ATOM 8025 C CA  . GLY E 5 107 ? 86.393  174.448 89.084  1.00 12.60  ?  107 GLY G CA  1 
ATOM 8026 C C   . GLY E 5 107 ? 85.477  174.096 87.930  1.00 11.58  ?  107 GLY G C   1 
ATOM 8027 O O   . GLY E 5 107 ? 85.917  173.505 86.946  1.00 9.94   ?  107 GLY G O   1 
ATOM 8028 N N   . GLU E 5 108 ? 84.203  174.453 88.045  1.00 11.40  ?  108 GLU G N   1 
ATOM 8029 C CA  . GLU E 5 108 ? 83.227  174.095 87.022  1.00 11.57  ?  108 GLU G CA  1 
ATOM 8030 C C   . GLU E 5 108 ? 83.498  174.758 85.666  1.00 11.24  ?  108 GLU G C   1 
ATOM 8031 O O   . GLU E 5 108 ? 83.236  174.169 84.611  1.00 10.52  ?  108 GLU G O   1 
ATOM 8032 C CB  . GLU E 5 108 ? 81.822  174.457 87.511  1.00 12.88  ?  108 GLU G CB  1 
ATOM 8033 C CG  . GLU E 5 108 ? 80.698  174.053 86.578  1.00 14.06  ?  108 GLU G CG  1 
ATOM 8034 C CD  . GLU E 5 108 ? 79.335  174.387 87.147  1.00 16.49  ?  108 GLU G CD  1 
ATOM 8035 O OE1 . GLU E 5 108 ? 79.282  174.960 88.255  1.00 15.26  ?  108 GLU G OE1 1 
ATOM 8036 O OE2 . GLU E 5 108 ? 78.319  174.079 86.491  1.00 14.64  -1 108 GLU G OE2 1 
ATOM 8037 N N   . THR E 5 109 ? 84.038  175.974 85.697  1.00 12.12  ?  109 THR G N   1 
ATOM 8038 C CA  . THR E 5 109 ? 84.296  176.731 84.474  1.00 13.06  ?  109 THR G CA  1 
ATOM 8039 C C   . THR E 5 109 ? 85.376  176.104 83.593  1.00 12.48  ?  109 THR G C   1 
ATOM 8040 O O   . THR E 5 109 ? 85.276  176.110 82.362  1.00 12.33  ?  109 THR G O   1 
ATOM 8041 C CB  . THR E 5 109 ? 84.713  178.178 84.809  1.00 15.22  ?  109 THR G CB  1 
ATOM 8042 O OG1 . THR E 5 109 ? 83.660  178.823 85.538  1.00 19.71  ?  109 THR G OG1 1 
ATOM 8043 C CG2 . THR E 5 109 ? 85.001  178.970 83.541  1.00 19.09  ?  109 THR G CG2 1 
ATOM 8044 N N   . GLY E 5 110 ? 86.395  175.534 84.226  1.00 12.55  ?  110 GLY G N   1 
ATOM 8045 C CA  . GLY E 5 110 ? 87.467  174.913 83.475  1.00 12.86  ?  110 GLY G CA  1 
ATOM 8046 C C   . GLY E 5 110 ? 87.047  173.582 82.894  1.00 11.05  ?  110 GLY G C   1 
ATOM 8047 O O   . GLY E 5 110 ? 87.478  173.206 81.804  1.00 10.45  ?  110 GLY G O   1 
ATOM 8048 N N   . VAL E 5 111 ? 86.207  172.860 83.631  1.00 9.99   ?  111 VAL G N   1 
ATOM 8049 C CA  . VAL E 5 111 ? 85.669  171.601 83.145  1.00 10.39  ?  111 VAL G CA  1 
ATOM 8050 C C   . VAL E 5 111 ? 84.755  171.915 81.973  1.00 9.62   ?  111 VAL G C   1 
ATOM 8051 O O   . VAL E 5 111 ? 84.650  171.148 81.016  1.00 9.20   ?  111 VAL G O   1 
ATOM 8052 C CB  . VAL E 5 111 ? 84.888  170.856 84.239  1.00 9.88   ?  111 VAL G CB  1 
ATOM 8053 C CG1 . VAL E 5 111 ? 84.379  169.535 83.724  1.00 9.29   ?  111 VAL G CG1 1 
ATOM 8054 C CG2 . VAL E 5 111 ? 85.746  170.652 85.441  1.00 8.95   ?  111 VAL G CG2 1 
ATOM 8055 N N   . ALA E 5 112 ? 84.112  173.077 82.054  1.00 10.09  ?  112 ALA G N   1 
ATOM 8056 C CA  . ALA E 5 112 ? 83.338  173.601 80.940  1.00 10.48  ?  112 ALA G CA  1 
ATOM 8057 C C   . ALA E 5 112 ? 84.259  173.998 79.791  1.00 10.25  ?  112 ALA G C   1 
ATOM 8058 O O   . ALA E 5 112 ? 83.840  174.046 78.637  1.00 10.06  ?  112 ALA G O   1 
ATOM 8059 C CB  . ALA E 5 112 ? 82.497  174.788 81.385  1.00 11.39  ?  112 ALA G CB  1 
ATOM 8060 N N   . GLY E 5 113 ? 85.520  174.274 80.112  1.00 9.99   ?  113 GLY G N   1 
ATOM 8061 C CA  . GLY E 5 113 ? 86.454  174.767 79.118  1.00 11.15  ?  113 GLY G CA  1 
ATOM 8062 C C   . GLY E 5 113 ? 87.036  173.712 78.194  1.00 9.43   ?  113 GLY G C   1 
ATOM 8063 O O   . GLY E 5 113 ? 87.641  174.045 77.176  1.00 9.47   ?  113 GLY G O   1 
ATOM 8064 N N   . PHE E 5 114 ? 86.855  172.441 78.538  1.00 9.33   ?  114 PHE G N   1 
ATOM 8065 C CA  . PHE E 5 114 ? 87.289  171.345 77.673  1.00 8.66   ?  114 PHE G CA  1 
ATOM 8066 C C   . PHE E 5 114 ? 86.125  170.771 76.872  1.00 8.51   ?  114 PHE G C   1 
ATOM 8067 O O   . PHE E 5 114 ? 85.808  169.588 76.991  1.00 8.42   ?  114 PHE G O   1 
ATOM 8068 C CB  . PHE E 5 114 ? 87.952  170.241 78.501  1.00 8.42   ?  114 PHE G CB  1 
ATOM 8069 C CG  . PHE E 5 114 ? 89.241  170.659 79.145  1.00 9.07   ?  114 PHE G CG  1 
ATOM 8070 C CD1 . PHE E 5 114 ? 90.434  170.586 78.446  1.00 8.35   ?  114 PHE G CD1 1 
ATOM 8071 C CD2 . PHE E 5 114 ? 89.260  171.139 80.442  1.00 8.96   ?  114 PHE G CD2 1 
ATOM 8072 C CE1 . PHE E 5 114 ? 91.623  170.971 79.034  1.00 8.39   ?  114 PHE G CE1 1 
ATOM 8073 C CE2 . PHE E 5 114 ? 90.446  171.529 81.035  1.00 9.19   ?  114 PHE G CE2 1 
ATOM 8074 C CZ  . PHE E 5 114 ? 91.628  171.444 80.330  1.00 9.07   ?  114 PHE G CZ  1 
ATOM 8075 N N   . THR E 5 115 ? 85.497  171.610 76.053  1.00 9.39   ?  115 THR G N   1 
ATOM 8076 C CA  . THR E 5 115 ? 84.268  171.221 75.368  1.00 9.16   ?  115 THR G CA  1 
ATOM 8077 C C   . THR E 5 115 ? 84.438  170.060 74.391  1.00 9.27   ?  115 THR G C   1 
ATOM 8078 O O   . THR E 5 115 ? 83.541  169.224 74.248  1.00 8.43   ?  115 THR G O   1 
ATOM 8079 C CB  . THR E 5 115 ? 83.682  172.411 74.579  1.00 9.56   ?  115 THR G CB  1 
ATOM 8080 O OG1 . THR E 5 115 ? 84.633  172.849 73.601  1.00 8.66   ?  115 THR G OG1 1 
ATOM 8081 C CG2 . THR E 5 115 ? 83.368  173.565 75.511  1.00 11.69  ?  115 THR G CG2 1 
ATOM 8082 N N   . ASN E 5 116 ? 85.588  169.997 73.731  1.00 8.64   ?  116 ASN G N   1 
ATOM 8083 C CA  . ASN E 5 116 ? 85.824  168.939 72.759  1.00 9.43   ?  116 ASN G CA  1 
ATOM 8084 C C   . ASN E 5 116 ? 86.025  167.583 73.415  1.00 9.68   ?  116 ASN G C   1 
ATOM 8085 O O   . ASN E 5 116 ? 85.534  166.564 72.922  1.00 9.18   ?  116 ASN G O   1 
ATOM 8086 C CB  . ASN E 5 116 ? 87.031  169.279 71.885  1.00 9.52   ?  116 ASN G CB  1 
ATOM 8087 C CG  . ASN E 5 116 ? 87.177  168.340 70.705  1.00 11.24  ?  116 ASN G CG  1 
ATOM 8088 O OD1 . ASN E 5 116 ? 86.192  167.800 70.199  1.00 12.18  ?  116 ASN G OD1 1 
ATOM 8089 N ND2 . ASN E 5 116 ? 88.410  168.149 70.253  1.00 12.65  ?  116 ASN G ND2 1 
ATOM 8090 N N   . SER E 5 117 ? 86.735  167.580 74.539  1.00 9.18   ?  117 SER G N   1 
ATOM 8091 C CA  . SER E 5 117 ? 87.003  166.345 75.251  1.00 9.18   ?  117 SER G CA  1 
ATOM 8092 C C   . SER E 5 117 ? 85.702  165.770 75.765  1.00 9.42   ?  117 SER G C   1 
ATOM 8093 O O   . SER E 5 117 ? 85.468  164.565 75.688  1.00 9.15   ?  117 SER G O   1 
ATOM 8094 C CB  . SER E 5 117 ? 87.950  166.593 76.420  1.00 8.21   ?  117 SER G CB  1 
ATOM 8095 O OG  . SER E 5 117 ? 89.201  167.073 75.980  1.00 7.99   ?  117 SER G OG  1 
ATOM 8096 N N   . LEU E 5 118 ? 84.851  166.656 76.275  1.00 9.42   ?  118 LEU G N   1 
ATOM 8097 C CA  . LEU E 5 118 ? 83.540  166.269 76.771  1.00 9.63   ?  118 LEU G CA  1 
ATOM 8098 C C   . LEU E 5 118 ? 82.640  165.786 75.645  1.00 10.54  ?  118 LEU G C   1 
ATOM 8099 O O   . LEU E 5 118 ? 81.857  164.848 75.820  1.00 10.02  ?  118 LEU G O   1 
ATOM 8100 C CB  . LEU E 5 118 ? 82.879  167.447 77.486  1.00 10.40  ?  118 LEU G CB  1 
ATOM 8101 C CG  . LEU E 5 118 ? 83.535  167.986 78.755  1.00 9.20   ?  118 LEU G CG  1 
ATOM 8102 C CD1 . LEU E 5 118 ? 82.825  169.245 79.205  1.00 9.63   ?  118 LEU G CD1 1 
ATOM 8103 C CD2 . LEU E 5 118 ? 83.516  166.947 79.858  1.00 11.21  ?  118 LEU G CD2 1 
ATOM 8104 N N   . ARG E 5 119 ? 82.758  166.432 74.487  1.00 11.01  ?  119 ARG G N   1 
ATOM 8105 C CA  . ARG E 5 119 ? 81.960  166.037 73.337  1.00 12.33  ?  119 ARG G CA  1 
ATOM 8106 C C   . ARG E 5 119 ? 82.353  164.643 72.889  1.00 11.92  ?  119 ARG G C   1 
ATOM 8107 O O   . ARG E 5 119 ? 81.514  163.848 72.475  1.00 11.84  ?  119 ARG G O   1 
ATOM 8108 C CB  . ARG E 5 119 ? 82.137  167.033 72.191  1.00 13.06  ?  119 ARG G CB  1 
ATOM 8109 C CG  . ARG E 5 119 ? 81.305  166.715 70.958  1.00 14.81  ?  119 ARG G CG  1 
ATOM 8110 C CD  . ARG E 5 119 ? 81.480  167.776 69.880  1.00 16.10  ?  119 ARG G CD  1 
ATOM 8111 N NE  . ARG E 5 119 ? 82.843  167.804 69.358  1.00 14.13  ?  119 ARG G NE  1 
ATOM 8112 C CZ  . ARG E 5 119 ? 83.292  167.001 68.398  1.00 14.58  ?  119 ARG G CZ  1 
ATOM 8113 N NH1 . ARG E 5 119 ? 82.485  166.104 67.850  1.00 15.02  1  119 ARG G NH1 1 
ATOM 8114 N NH2 . ARG E 5 119 ? 84.548  167.096 67.986  1.00 13.30  ?  119 ARG G NH2 1 
ATOM 8115 N N   . MET E 5 120 ? 83.645  164.354 72.989  1.00 11.46  ?  120 MET G N   1 
ATOM 8116 C CA  . MET E 5 120 ? 84.152  163.018 72.725  1.00 11.74  ?  120 MET G CA  1 
ATOM 8117 C C   . MET E 5 120 ? 83.763  162.012 73.806  1.00 11.36  ?  120 MET G C   1 
ATOM 8118 O O   . MET E 5 120 ? 83.669  160.816 73.539  1.00 11.50  ?  120 MET G O   1 
ATOM 8119 C CB  . MET E 5 120 ? 85.667  163.070 72.561  1.00 10.58  ?  120 MET G CB  1 
ATOM 8120 C CG  . MET E 5 120 ? 86.103  163.836 71.327  1.00 10.79  ?  120 MET G CG  1 
ATOM 8121 S SD  . MET E 5 120 ? 87.888  163.996 71.178  1.00 9.18   ?  120 MET G SD  1 
ATOM 8122 C CE  . MET E 5 120 ? 88.002  164.954 69.669  1.00 10.17  ?  120 MET G CE  1 
ATOM 8123 N N   . LEU E 5 121 ? 83.544  162.496 75.027  1.00 9.84   ?  121 LEU G N   1 
ATOM 8124 C CA  . LEU E 5 121 ? 83.121  161.620 76.117  1.00 11.11  ?  121 LEU G CA  1 
ATOM 8125 C C   . LEU E 5 121 ? 81.666  161.190 75.971  1.00 11.59  ?  121 LEU G C   1 
ATOM 8126 O O   . LEU E 5 121 ? 81.339  160.019 76.163  1.00 10.99  ?  121 LEU G O   1 
ATOM 8127 C CB  . LEU E 5 121 ? 83.319  162.301 77.475  1.00 10.47  ?  121 LEU G CB  1 
ATOM 8128 C CG  . LEU E 5 121 ? 84.741  162.582 77.961  1.00 9.97   ?  121 LEU G CG  1 
ATOM 8129 C CD1 . LEU E 5 121 ? 84.719  163.393 79.243  1.00 10.03  ?  121 LEU G CD1 1 
ATOM 8130 C CD2 . LEU E 5 121 ? 85.488  161.288 78.183  1.00 10.40  ?  121 LEU G CD2 1 
ATOM 8131 N N   . GLN E 5 122 ? 80.791  162.140 75.647  1.00 12.07  ?  122 GLN G N   1 
ATOM 8132 C CA  . GLN E 5 122 ? 79.385  161.810 75.429  1.00 14.18  ?  122 GLN G CA  1 
ATOM 8133 C C   . GLN E 5 122 ? 79.210  160.938 74.193  1.00 14.03  ?  122 GLN G C   1 
ATOM 8134 O O   . GLN E 5 122 ? 78.320  160.090 74.135  1.00 14.11  ?  122 GLN G O   1 
ATOM 8135 C CB  . GLN E 5 122 ? 78.544  163.081 75.302  1.00 14.03  ?  122 GLN G CB  1 
ATOM 8136 C CG  . GLN E 5 122 ? 77.046  162.823 75.227  1.00 16.78  ?  122 GLN G CG  1 
ATOM 8137 C CD  . GLN E 5 122 ? 76.232  164.101 75.279  1.00 17.49  ?  122 GLN G CD  1 
ATOM 8138 O OE1 . GLN E 5 122 ? 76.777  165.190 75.457  1.00 19.93  ?  122 GLN G OE1 1 
ATOM 8139 N NE2 . GLN E 5 122 ? 74.919  163.972 75.129  1.00 23.57  ?  122 GLN G NE2 1 
ATOM 8140 N N   . GLN E 5 123 ? 80.079  161.151 73.211  1.00 12.30  ?  123 GLN G N   1 
ATOM 8141 C CA  . GLN E 5 123 ? 80.126  160.320 72.015  1.00 12.69  ?  123 GLN G CA  1 
ATOM 8142 C C   . GLN E 5 123 ? 80.944  159.069 72.290  1.00 12.62  ?  123 GLN G C   1 
ATOM 8143 O O   . GLN E 5 123 ? 81.019  158.161 71.462  1.00 11.42  ?  123 GLN G O   1 
ATOM 8144 C CB  . GLN E 5 123 ? 80.711  161.098 70.840  1.00 13.96  ?  123 GLN G CB  1 
ATOM 8145 C CG  . GLN E 5 123 ? 79.828  162.235 70.362  1.00 14.48  ?  123 GLN G CG  1 
ATOM 8146 C CD  . GLN E 5 123 ? 80.473  163.042 69.257  1.00 15.83  ?  123 GLN G CD  1 
ATOM 8147 O OE1 . GLN E 5 123 ? 81.697  163.086 69.141  1.00 16.04  ?  123 GLN G OE1 1 
ATOM 8148 N NE2 . GLN E 5 123 ? 79.652  163.683 68.435  1.00 17.66  ?  123 GLN G NE2 1 
ATOM 8149 N N   . LYS E 5 124 ? 81.558  159.048 73.467  1.00 11.86  ?  124 LYS G N   1 
ATOM 8150 C CA  . LYS E 5 124 ? 82.343  157.915 73.932  1.00 11.68  ?  124 LYS G CA  1 
ATOM 8151 C C   . LYS E 5 124 ? 83.480  157.544 72.984  1.00 12.04  ?  124 LYS G C   1 
ATOM 8152 O O   . LYS E 5 124 ? 83.827  156.371 72.843  1.00 10.84  ?  124 LYS G O   1 
ATOM 8153 C CB  . LYS E 5 124 ? 81.428  156.714 74.164  1.00 12.71  ?  124 LYS G CB  1 
ATOM 8154 C CG  . LYS E 5 124 ? 80.449  156.941 75.297  1.00 14.81  ?  124 LYS G CG  1 
ATOM 8155 C CD  . LYS E 5 124 ? 79.588  155.729 75.566  1.00 17.96  ?  124 LYS G CD  1 
ATOM 8156 C CE  . LYS E 5 124 ? 78.653  156.005 76.726  1.00 30.41  ?  124 LYS G CE  1 
ATOM 8157 N NZ  . LYS E 5 124 ? 79.430  156.266 77.972  1.00 25.22  1  124 LYS G NZ  1 
ATOM 8158 N N   . ARG E 5 125 ? 84.063  158.553 72.343  1.00 12.06  ?  125 ARG G N   1 
ATOM 8159 C CA  . ARG E 5 125 ? 85.368  158.392 71.717  1.00 12.26  ?  125 ARG G CA  1 
ATOM 8160 C C   . ARG E 5 125 ? 86.400  158.557 72.814  1.00 11.79  ?  125 ARG G C   1 
ATOM 8161 O O   . ARG E 5 125 ? 87.120  159.554 72.853  1.00 10.89  ?  125 ARG G O   1 
ATOM 8162 C CB  . ARG E 5 125 ? 85.611  159.415 70.606  1.00 12.84  ?  125 ARG G CB  1 
ATOM 8163 C CG  . ARG E 5 125 ? 84.765  159.251 69.360  1.00 14.02  ?  125 ARG G CG  1 
ATOM 8164 C CD  . ARG E 5 125 ? 85.118  160.334 68.354  1.00 15.22  ?  125 ARG G CD  1 
ATOM 8165 N NE  . ARG E 5 125 ? 84.375  160.208 67.106  1.00 20.19  ?  125 ARG G NE  1 
ATOM 8166 C CZ  . ARG E 5 125 ? 83.150  160.682 66.916  1.00 15.45  ?  125 ARG G CZ  1 
ATOM 8167 N NH1 . ARG E 5 125 ? 82.521  161.316 67.896  1.00 14.06  1  125 ARG G NH1 1 
ATOM 8168 N NH2 . ARG E 5 125 ? 82.552  160.523 65.744  1.00 13.13  ?  125 ARG G NH2 1 
ATOM 8169 N N   . TRP E 5 126 ? 86.464  157.571 73.702  1.00 11.86  ?  126 TRP G N   1 
ATOM 8170 C CA  . TRP E 5 126 ? 87.152  157.738 74.968  1.00 11.89  ?  126 TRP G CA  1 
ATOM 8171 C C   . TRP E 5 126 ? 88.634  157.999 74.752  1.00 12.21  ?  126 TRP G C   1 
ATOM 8172 O O   . TRP E 5 126 ? 89.272  158.684 75.548  1.00 10.62  ?  126 TRP G O   1 
ATOM 8173 C CB  . TRP E 5 126 ? 86.981  156.498 75.842  1.00 11.83  ?  126 TRP G CB  1 
ATOM 8174 C CG  . TRP E 5 126 ? 85.565  156.160 76.183  1.00 12.03  ?  126 TRP G CG  1 
ATOM 8175 C CD1 . TRP E 5 126 ? 84.794  155.196 75.604  1.00 12.81  ?  126 TRP G CD1 1 
ATOM 8176 C CD2 . TRP E 5 126 ? 84.731  156.817 77.138  1.00 11.09  ?  126 TRP G CD2 1 
ATOM 8177 N NE1 . TRP E 5 126 ? 83.543  155.184 76.170  1.00 12.35  ?  126 TRP G NE1 1 
ATOM 8178 C CE2 . TRP E 5 126 ? 83.477  156.177 77.111  1.00 12.00  ?  126 TRP G CE2 1 
ATOM 8179 C CE3 . TRP E 5 126 ? 84.927  157.873 78.024  1.00 11.23  ?  126 TRP G CE3 1 
ATOM 8180 C CZ2 . TRP E 5 126 ? 82.429  156.560 77.937  1.00 12.52  ?  126 TRP G CZ2 1 
ATOM 8181 C CZ3 . TRP E 5 126 ? 83.889  158.255 78.827  1.00 11.19  ?  126 TRP G CZ3 1 
ATOM 8182 C CH2 . TRP E 5 126 ? 82.654  157.599 78.787  1.00 12.28  ?  126 TRP G CH2 1 
ATOM 8183 N N   . ASP E 5 127 ? 89.179  157.441 73.675  1.00 13.12  ?  127 ASP G N   1 
ATOM 8184 C CA  . ASP E 5 127 ? 90.609  157.547 73.417  1.00 13.81  ?  127 ASP G CA  1 
ATOM 8185 C C   . ASP E 5 127 ? 91.033  158.969 73.068  1.00 11.50  ?  127 ASP G C   1 
ATOM 8186 O O   . ASP E 5 127 ? 91.940  159.522 73.692  1.00 10.84  ?  127 ASP G O   1 
ATOM 8187 C CB  . ASP E 5 127 ? 91.013  156.598 72.283  1.00 17.49  ?  127 ASP G CB  1 
ATOM 8188 C CG  . ASP E 5 127 ? 90.955  155.134 72.689  1.00 23.97  ?  127 ASP G CG  1 
ATOM 8189 O OD1 . ASP E 5 127 ? 90.907  154.850 73.904  1.00 23.28  ?  127 ASP G OD1 1 
ATOM 8190 O OD2 . ASP E 5 127 ? 90.958  154.264 71.791  1.00 22.82  -1 127 ASP G OD2 1 
ATOM 8191 N N   . GLU E 5 128 ? 90.378  159.563 72.074  1.00 10.42  ?  128 GLU G N   1 
ATOM 8192 C CA  . GLU E 5 128 ? 90.637  160.960 71.742  1.00 10.27  ?  128 GLU G CA  1 
ATOM 8193 C C   . GLU E 5 128 ? 90.100  161.914 72.800  1.00 9.48   ?  128 GLU G C   1 
ATOM 8194 O O   . GLU E 5 128 ? 90.589  163.035 72.931  1.00 8.88   ?  128 GLU G O   1 
ATOM 8195 C CB  . GLU E 5 128 ? 90.065  161.318 70.369  1.00 10.71  ?  128 GLU G CB  1 
ATOM 8196 C CG  . GLU E 5 128 ? 90.787  160.655 69.211  1.00 12.74  ?  128 GLU G CG  1 
ATOM 8197 C CD  . GLU E 5 128 ? 90.190  161.022 67.871  1.00 13.04  ?  128 GLU G CD  1 
ATOM 8198 O OE1 . GLU E 5 128 ? 89.106  161.641 67.853  1.00 13.95  ?  128 GLU G OE1 1 
ATOM 8199 O OE2 . GLU E 5 128 ? 90.809  160.701 66.835  1.00 10.78  -1 128 GLU G OE2 1 
ATOM 8200 N N   . ALA E 5 129 ? 89.087  161.483 73.546  1.00 9.35   ?  129 ALA G N   1 
ATOM 8201 C CA  . ALA E 5 129 ? 88.607  162.285 74.661  1.00 9.29   ?  129 ALA G CA  1 
ATOM 8202 C C   . ALA E 5 129 ? 89.705  162.386 75.705  1.00 8.64   ?  129 ALA G C   1 
ATOM 8203 O O   . ALA E 5 129 ? 89.877  163.417 76.356  1.00 7.53   ?  129 ALA G O   1 
ATOM 8204 C CB  . ALA E 5 129 ? 87.361  161.677 75.260  1.00 9.97   ?  129 ALA G CB  1 
ATOM 8205 N N   . ALA E 5 130 ? 90.469  161.304 75.821  1.00 9.41   ?  130 ALA G N   1 
ATOM 8206 C CA  . ALA E 5 130 ? 91.592  161.225 76.742  1.00 8.90   ?  130 ALA G CA  1 
ATOM 8207 C C   . ALA E 5 130 ? 92.796  162.003 76.227  1.00 8.85   ?  130 ALA G C   1 
ATOM 8208 O O   . ALA E 5 130 ? 93.502  162.655 76.997  1.00 7.67   ?  130 ALA G O   1 
ATOM 8209 C CB  . ALA E 5 130 ? 91.965  159.768 76.981  1.00 10.14  ?  130 ALA G CB  1 
ATOM 8210 N N   . VAL E 5 131 ? 93.030  161.919 74.920  1.00 8.90   ?  131 VAL G N   1 
ATOM 8211 C CA  . VAL E 5 131 ? 94.111  162.661 74.284  1.00 8.87   ?  131 VAL G CA  1 
ATOM 8212 C C   . VAL E 5 131 ? 93.862  164.168 74.378  1.00 8.95   ?  131 VAL G C   1 
ATOM 8213 O O   . VAL E 5 131 ? 94.799  164.963 74.467  1.00 8.28   ?  131 VAL G O   1 
ATOM 8214 C CB  . VAL E 5 131 ? 94.279  162.236 72.803  1.00 9.87   ?  131 VAL G CB  1 
ATOM 8215 C CG1 . VAL E 5 131 ? 95.306  163.101 72.097  1.00 10.79  ?  131 VAL G CG1 1 
ATOM 8216 C CG2 . VAL E 5 131 ? 94.684  160.772 72.717  1.00 12.80  ?  131 VAL G CG2 1 
ATOM 8217 N N   . ASN E 5 132 ? 92.589  164.553 74.382  1.00 8.37   ?  132 ASN G N   1 
ATOM 8218 C CA  . ASN E 5 132 ? 92.217  165.962 74.466  1.00 8.74   ?  132 ASN G CA  1 
ATOM 8219 C C   . ASN E 5 132 ? 92.109  166.483 75.901  1.00 8.68   ?  132 ASN G C   1 
ATOM 8220 O O   . ASN E 5 132 ? 92.368  167.659 76.158  1.00 9.13   ?  132 ASN G O   1 
ATOM 8221 C CB  . ASN E 5 132 ? 90.905  166.195 73.718  1.00 8.69   ?  132 ASN G CB  1 
ATOM 8222 C CG  . ASN E 5 132 ? 91.069  166.088 72.219  1.00 10.40  ?  132 ASN G CG  1 
ATOM 8223 O OD1 . ASN E 5 132 ? 91.574  167.004 71.572  1.00 9.73   ?  132 ASN G OD1 1 
ATOM 8224 N ND2 . ASN E 5 132 ? 90.650  164.961 71.657  1.00 9.65   ?  132 ASN G ND2 1 
ATOM 8225 N N   . LEU E 5 133 ? 91.722  165.618 76.834  1.00 7.58   ?  133 LEU G N   1 
ATOM 8226 C CA  . LEU E 5 133 ? 91.835  165.954 78.250  1.00 7.82   ?  133 LEU G CA  1 
ATOM 8227 C C   . LEU E 5 133 ? 93.301  166.074 78.648  1.00 8.41   ?  133 LEU G C   1 
ATOM 8228 O O   . LEU E 5 133 ? 93.645  166.773 79.602  1.00 7.06   ?  133 LEU G O   1 
ATOM 8229 C CB  . LEU E 5 133 ? 91.130  164.913 79.124  1.00 7.41   ?  133 LEU G CB  1 
ATOM 8230 C CG  . LEU E 5 133 ? 89.603  164.833 79.102  1.00 7.14   ?  133 LEU G CG  1 
ATOM 8231 C CD1 . LEU E 5 133 ? 89.145  163.605 79.855  1.00 7.47   ?  133 LEU G CD1 1 
ATOM 8232 C CD2 . LEU E 5 133 ? 89.014  166.081 79.739  1.00 7.70   ?  133 LEU G CD2 1 
ATOM 8233 N N   . ALA E 5 134 ? 94.159  165.379 77.906  1.00 7.72   ?  134 ALA G N   1 
ATOM 8234 C CA  . ALA E 5 134 ? 95.594  165.366 78.169  1.00 8.89   ?  134 ALA G CA  1 
ATOM 8235 C C   . ALA E 5 134 ? 96.231  166.735 77.964  1.00 8.75   ?  134 ALA G C   1 
ATOM 8236 O O   . ALA E 5 134 ? 97.254  166.854 77.288  1.00 8.93   ?  134 ALA G O   1 
ATOM 8237 C CB  . ALA E 5 134 ? 96.278  164.333 77.283  1.00 8.32   ?  134 ALA G CB  1 
ATOM 8238 N N   A LYS E 5 135 ? 94.825  168.628 75.976  0.29 8.70   ?  135 LYS G N   1 
ATOM 8239 N N   B LYS E 5 135 ? 94.826  168.651 75.936  0.71 8.67   ?  135 LYS G N   1 
ATOM 8240 C CA  A LYS E 5 135 ? 96.077  169.221 75.524  0.29 9.26   ?  135 LYS G CA  1 
ATOM 8241 C CA  B LYS E 5 135 ? 96.020  169.343 75.465  0.71 9.53   ?  135 LYS G CA  1 
ATOM 8242 C C   A LYS E 5 135 ? 96.420  170.467 76.335  0.29 9.89   ?  135 LYS G C   1 
ATOM 8243 C C   B LYS E 5 135 ? 96.365  170.526 76.360  0.71 10.31  ?  135 LYS G C   1 
ATOM 8244 O O   A LYS E 5 135 ? 96.411  171.584 75.819  0.29 9.32   ?  135 LYS G O   1 
ATOM 8245 O O   B LYS E 5 135 ? 96.308  171.675 75.922  0.71 9.34   ?  135 LYS G O   1 
ATOM 8246 C CB  A LYS E 5 135 ? 95.997  169.544 74.035  0.29 9.37   ?  135 LYS G CB  1 
ATOM 8247 C CB  B LYS E 5 135 ? 95.825  169.826 74.027  0.71 10.26  ?  135 LYS G CB  1 
ATOM 8248 C CG  A LYS E 5 135 ? 95.658  168.327 73.193  0.29 9.38   ?  135 LYS G CG  1 
ATOM 8249 C CG  B LYS E 5 135 ? 95.249  168.785 73.080  0.71 10.02  ?  135 LYS G CG  1 
ATOM 8250 C CD  A LYS E 5 135 ? 95.234  168.706 71.792  0.29 9.95   ?  135 LYS G CD  1 
ATOM 8251 C CD  B LYS E 5 135 ? 96.238  167.669 72.801  0.71 9.60   ?  135 LYS G CD  1 
ATOM 8252 C CE  A LYS E 5 135 ? 94.769  167.484 71.022  0.29 10.28  ?  135 LYS G CE  1 
ATOM 8253 C CE  B LYS E 5 135 ? 95.734  166.761 71.693  0.71 9.80   ?  135 LYS G CE  1 
ATOM 8254 N NZ  A LYS E 5 135 ? 94.184  167.860 69.705  0.29 10.76  1  135 LYS G NZ  1 
ATOM 8255 N NZ  B LYS E 5 135 ? 96.701  165.673 71.392  0.71 9.84   1  135 LYS G NZ  1 
ATOM 8256 N N   . SER E 5 136 ? 96.723  170.251 77.611  1.00 8.92   ?  136 SER G N   1 
ATOM 8257 C CA  . SER E 5 136 ? 97.093  171.320 78.534  1.00 9.67   ?  136 SER G CA  1 
ATOM 8258 C C   . SER E 5 136 ? 98.110  170.820 79.553  1.00 10.59  ?  136 SER G C   1 
ATOM 8259 O O   . SER E 5 136 ? 99.206  170.394 79.191  1.00 10.25  ?  136 SER G O   1 
ATOM 8260 C CB  . SER E 5 136 ? 95.861  171.872 79.255  1.00 8.89   ?  136 SER G CB  1 
ATOM 8261 O OG  . SER E 5 136 ? 95.267  170.892 80.086  1.00 8.75   ?  136 SER G OG  1 
ATOM 8262 N N   A ARG E 5 137 ? 92.552  174.282 81.358  0.41 12.05  ?  137 ARG G N   1 
ATOM 8263 N N   B ARG E 5 137 ? 92.299  174.579 81.689  0.59 10.86  ?  137 ARG G N   1 
ATOM 8264 C CA  A ARG E 5 137 ? 93.181  174.703 82.604  0.41 12.05  ?  137 ARG G CA  1 
ATOM 8265 C CA  B ARG E 5 137 ? 93.257  174.788 82.769  0.59 12.03  ?  137 ARG G CA  1 
ATOM 8266 C C   A ARG E 5 137 ? 93.074  173.597 83.647  0.41 11.91  ?  137 ARG G C   1 
ATOM 8267 C C   B ARG E 5 137 ? 93.199  173.652 83.779  0.59 11.94  ?  137 ARG G C   1 
ATOM 8268 O O   A ARG E 5 137 ? 92.276  173.687 84.579  0.41 12.28  ?  137 ARG G O   1 
ATOM 8269 O O   B ARG E 5 137 ? 92.546  173.770 84.816  0.59 12.25  ?  137 ARG G O   1 
ATOM 8270 C CB  A ARG E 5 137 ? 92.538  175.993 83.120  0.41 13.14  ?  137 ARG G CB  1 
ATOM 8271 C CB  B ARG E 5 137 ? 92.999  176.121 83.474  0.59 13.16  ?  137 ARG G CB  1 
ATOM 8272 C CG  A ARG E 5 137 ? 93.316  176.693 84.224  0.41 15.05  ?  137 ARG G CG  1 
ATOM 8273 C CG  B ARG E 5 137 ? 93.341  177.350 82.652  0.59 14.68  ?  137 ARG G CG  1 
ATOM 8274 C CD  A ARG E 5 137 ? 94.622  177.274 83.708  0.41 15.37  ?  137 ARG G CD  1 
ATOM 8275 C CD  B ARG E 5 137 ? 93.329  178.593 83.525  0.59 16.36  ?  137 ARG G CD  1 
ATOM 8276 N NE  A ARG E 5 137 ? 95.334  178.030 84.736  0.41 16.29  ?  137 ARG G NE  1 
ATOM 8277 N NE  B ARG E 5 137 ? 93.878  179.760 82.843  0.59 21.77  ?  137 ARG G NE  1 
ATOM 8278 C CZ  A ARG E 5 137 ? 96.308  177.532 85.491  0.41 16.39  ?  137 ARG G CZ  1 
ATOM 8279 C CZ  B ARG E 5 137 ? 94.098  180.930 83.433  0.59 27.71  ?  137 ARG G CZ  1 
ATOM 8280 N NH1 A ARG E 5 137 ? 96.694  176.275 85.330  0.41 15.35  1  137 ARG G NH1 1 
ATOM 8281 N NH1 B ARG E 5 137 ? 93.819  181.087 84.719  0.59 27.82  1  137 ARG G NH1 1 
ATOM 8282 N NH2 A ARG E 5 137 ? 96.902  178.292 86.401  0.41 16.22  ?  137 ARG G NH2 1 
ATOM 8283 N NH2 B ARG E 5 137 ? 94.600  181.943 82.740  0.59 28.62  ?  137 ARG G NH2 1 
ATOM 8284 N N   . TRP E 5 138 ? 93.884  172.554 83.476  1.00 11.50  ?  138 TRP G N   1 
ATOM 8285 C CA  . TRP E 5 138 ? 93.838  171.385 84.345  1.00 11.27  ?  138 TRP G CA  1 
ATOM 8286 C C   . TRP E 5 138 ? 94.997  170.405 84.217  1.00 10.89  ?  138 TRP G C   1 
ATOM 8287 O O   . TRP E 5 138 ? 95.698  170.160 85.198  1.00 10.33  ?  138 TRP G O   1 
ATOM 8288 C CB  . TRP E 5 138 ? 92.517  170.650 84.122  1.00 10.63  ?  138 TRP G CB  1 
ATOM 8289 C CG  . TRP E 5 138 ? 92.377  169.372 84.870  1.00 10.59  ?  138 TRP G CG  1 
ATOM 8290 C CD1 . TRP E 5 138 ? 92.072  169.220 86.192  1.00 10.30  ?  138 TRP G CD1 1 
ATOM 8291 C CD2 . TRP E 5 138 ? 92.392  168.056 84.311  1.00 9.94   ?  138 TRP G CD2 1 
ATOM 8292 N NE1 . TRP E 5 138 ? 91.971  167.886 86.504  1.00 11.03  ?  138 TRP G NE1 1 
ATOM 8293 C CE2 . TRP E 5 138 ? 92.156  167.151 85.363  1.00 9.33   ?  138 TRP G CE2 1 
ATOM 8294 C CE3 . TRP E 5 138 ? 92.613  167.554 83.026  1.00 9.23   ?  138 TRP G CE3 1 
ATOM 8295 C CZ2 . TRP E 5 138 ? 92.131  165.773 85.170  1.00 8.98   ?  138 TRP G CZ2 1 
ATOM 8296 C CZ3 . TRP E 5 138 ? 92.591  166.190 82.838  1.00 7.94   ?  138 TRP G CZ3 1 
ATOM 8297 C CH2 . TRP E 5 138 ? 92.353  165.314 83.904  1.00 8.48   ?  138 TRP G CH2 1 
ATOM 8298 N N   . TYR E 5 139 ? 95.194  169.824 83.038  1.00 10.96  ?  139 TYR G N   1 
ATOM 8299 C CA  . TYR E 5 139 ? 96.158  168.733 82.928  1.00 10.30  ?  139 TYR G CA  1 
ATOM 8300 C C   . TYR E 5 139 ? 97.585  169.168 83.249  1.00 11.26  ?  139 TYR G C   1 
ATOM 8301 O O   . TYR E 5 139 ? 98.354  168.402 83.828  1.00 10.07  ?  139 TYR G O   1 
ATOM 8302 C CB  . TYR E 5 139 ? 96.116  168.130 81.522  1.00 9.89   ?  139 TYR G CB  1 
ATOM 8303 C CG  . TYR E 5 139 ? 97.137  167.038 81.291  1.00 10.02  ?  139 TYR G CG  1 
ATOM 8304 C CD1 . TYR E 5 139 ? 96.929  165.758 81.777  1.00 9.95   ?  139 TYR G CD1 1 
ATOM 8305 C CD2 . TYR E 5 139 ? 98.306  167.288 80.587  1.00 10.38  ?  139 TYR G CD2 1 
ATOM 8306 C CE1 . TYR E 5 139 ? 97.851  164.757 81.575  1.00 9.89   ?  139 TYR G CE1 1 
ATOM 8307 C CE2 . TYR E 5 139 ? 99.238  166.290 80.375  1.00 9.70   ?  139 TYR G CE2 1 
ATOM 8308 C CZ  . TYR E 5 139 ? 99.003  165.025 80.872  1.00 9.98   ?  139 TYR G CZ  1 
ATOM 8309 O OH  . TYR E 5 139 ? 99.920  164.019 80.671  1.00 10.16  ?  139 TYR G OH  1 
ATOM 8310 N N   A ASN E 5 140 ? 97.934  170.396 82.876  0.46 11.34  ?  140 ASN G N   1 
ATOM 8311 N N   B ASN E 5 140 ? 97.932  170.399 82.886  0.54 11.38  ?  140 ASN G N   1 
ATOM 8312 C CA  A ASN E 5 140 ? 99.249  170.940 83.199  0.46 11.95  ?  140 ASN G CA  1 
ATOM 8313 C CA  B ASN E 5 140 ? 99.252  170.930 83.204  0.54 11.96  ?  140 ASN G CA  1 
ATOM 8314 C C   A ASN E 5 140 ? 99.418  171.205 84.695  0.46 12.40  ?  140 ASN G C   1 
ATOM 8315 C C   B ASN E 5 140 ? 99.405  171.214 84.694  0.54 12.41  ?  140 ASN G C   1 
ATOM 8316 O O   A ASN E 5 140 ? 100.529 171.138 85.224  0.46 12.32  ?  140 ASN G O   1 
ATOM 8317 O O   B ASN E 5 140 ? 100.514 171.179 85.230  0.54 12.29  ?  140 ASN G O   1 
ATOM 8318 C CB  A ASN E 5 140 ? 99.505  172.226 82.409  0.46 12.15  ?  140 ASN G CB  1 
ATOM 8319 C CB  B ASN E 5 140 ? 99.533  172.200 82.399  0.54 12.16  ?  140 ASN G CB  1 
ATOM 8320 C CG  A ASN E 5 140 ? 100.988 172.490 82.185  0.46 12.13  ?  140 ASN G CG  1 
ATOM 8321 C CG  B ASN E 5 140 ? 100.978 172.656 82.515  0.54 12.47  ?  140 ASN G CG  1 
ATOM 8322 O OD1 A ASN E 5 140 ? 101.837 172.028 82.949  0.46 12.19  ?  140 ASN G OD1 1 
ATOM 8323 O OD1 B ASN E 5 140 ? 101.835 172.243 81.733  0.54 12.16  ?  140 ASN G OD1 1 
ATOM 8324 N ND2 A ASN E 5 140 ? 101.303 173.237 81.133  0.46 12.34  ?  140 ASN G ND2 1 
ATOM 8325 N ND2 B ASN E 5 140 ? 101.257 173.504 83.498  0.54 13.22  ?  140 ASN G ND2 1 
ATOM 8326 N N   A GLN E 5 141 ? 98.311  171.498 85.372  0.46 12.63  ?  141 GLN G N   1 
ATOM 8327 N N   B GLN E 5 141 ? 98.286  171.489 85.359  0.54 12.64  ?  141 GLN G N   1 
ATOM 8328 C CA  A GLN E 5 141 ? 98.361  171.869 86.780  0.46 13.29  ?  141 GLN G CA  1 
ATOM 8329 C CA  B GLN E 5 141 ? 98.311  171.876 86.764  0.54 13.30  ?  141 GLN G CA  1 
ATOM 8330 C C   A GLN E 5 141 ? 98.807  170.698 87.640  0.46 12.88  ?  141 GLN G C   1 
ATOM 8331 C C   B GLN E 5 141 ? 98.773  170.717 87.643  0.54 12.90  ?  141 GLN G C   1 
ATOM 8332 O O   A GLN E 5 141 ? 99.720  170.821 88.455  0.46 13.03  ?  141 GLN G O   1 
ATOM 8333 O O   B GLN E 5 141 ? 99.670  170.870 88.471  0.54 12.82  ?  141 GLN G O   1 
ATOM 8334 C CB  A GLN E 5 141 ? 96.992  172.358 87.253  0.46 14.33  ?  141 GLN G CB  1 
ATOM 8335 C CB  B GLN E 5 141 ? 96.923  172.351 87.212  0.54 14.35  ?  141 GLN G CB  1 
ATOM 8336 C CG  A GLN E 5 141 ? 96.477  173.578 86.527  0.46 16.01  ?  141 GLN G CG  1 
ATOM 8337 C CG  B GLN E 5 141 ? 96.318  173.462 86.359  0.54 15.99  ?  141 GLN G CG  1 
ATOM 8338 C CD  A GLN E 5 141 ? 95.092  173.970 86.984  0.46 18.20  ?  141 GLN G CD  1 
ATOM 8339 C CD  B GLN E 5 141 ? 97.006  174.801 86.544  0.54 18.10  ?  141 GLN G CD  1 
ATOM 8340 O OE1 A GLN E 5 141 ? 94.342  174.600 86.246  0.46 19.14  ?  141 GLN G OE1 1 
ATOM 8341 O OE1 B GLN E 5 141 ? 97.846  174.969 87.429  0.54 19.91  ?  141 GLN G OE1 1 
ATOM 8342 N NE2 A GLN E 5 141 ? 94.745  173.601 88.210  0.46 20.57  ?  141 GLN G NE2 1 
ATOM 8343 N NE2 B GLN E 5 141 ? 96.639  175.769 85.714  0.54 20.49  ?  141 GLN G NE2 1 
ATOM 8344 N N   . THR E 5 142 ? 98.161  169.556 87.438  1.00 12.03  ?  142 THR G N   1 
ATOM 8345 C CA  . THR E 5 142 ? 98.470  168.357 88.202  1.00 11.70  ?  142 THR G CA  1 
ATOM 8346 C C   . THR E 5 142 ? 98.638  167.189 87.249  1.00 11.30  ?  142 THR G C   1 
ATOM 8347 O O   . THR E 5 142 ? 97.753  166.342 87.149  1.00 10.51  ?  142 THR G O   1 
ATOM 8348 C CB  . THR E 5 142 ? 97.366  168.036 89.240  1.00 11.46  ?  142 THR G CB  1 
ATOM 8349 O OG1 . THR E 5 142 ? 96.098  167.925 88.579  1.00 11.18  ?  142 THR G OG1 1 
ATOM 8350 C CG2 . THR E 5 142 ? 97.292  169.116 90.317  1.00 12.07  ?  142 THR G CG2 1 
ATOM 8351 N N   . PRO E 5 143 ? 99.774  167.148 86.535  1.00 10.98  ?  143 PRO G N   1 
ATOM 8352 C CA  . PRO E 5 143 ? 99.913  166.153 85.470  1.00 10.65  ?  143 PRO G CA  1 
ATOM 8353 C C   . PRO E 5 143 ? 99.775  164.706 85.934  1.00 10.46  ?  143 PRO G C   1 
ATOM 8354 O O   . PRO E 5 143 ? 99.191  163.927 85.200  1.00 9.98   ?  143 PRO G O   1 
ATOM 8355 C CB  . PRO E 5 143 ? 101.328 166.416 84.939  1.00 10.62  ?  143 PRO G CB  1 
ATOM 8356 C CG  . PRO E 5 143 ? 102.054 167.011 86.094  1.00 11.23  ?  143 PRO G CG  1 
ATOM 8357 C CD  . PRO E 5 143 ? 101.033 167.863 86.796  1.00 11.56  ?  143 PRO G CD  1 
ATOM 8358 N N   . ASN E 5 144 ? 100.230 164.361 87.135  1.00 11.20  ?  144 ASN G N   1 
ATOM 8359 C CA  . ASN E 5 144 ? 100.077 162.985 87.592  1.00 11.60  ?  144 ASN G CA  1 
ATOM 8360 C C   . ASN E 5 144 ? 98.630  162.686 87.959  1.00 10.93  ?  144 ASN G C   1 
ATOM 8361 O O   . ASN E 5 144 ? 98.073  161.660 87.557  1.00 10.12  ?  144 ASN G O   1 
ATOM 8362 C CB  . ASN E 5 144 ? 100.990 162.698 88.785  1.00 13.78  ?  144 ASN G CB  1 
ATOM 8363 C CG  . ASN E 5 144 ? 102.454 162.645 88.399  1.00 15.92  ?  144 ASN G CG  1 
ATOM 8364 O OD1 . ASN E 5 144 ? 102.927 161.661 87.829  1.00 17.01  ?  144 ASN G OD1 1 
ATOM 8365 N ND2 . ASN E 5 144 ? 103.181 163.712 88.706  1.00 16.29  ?  144 ASN G ND2 1 
ATOM 8366 N N   . ARG E 5 145 ? 98.015  163.596 88.708  1.00 10.58  ?  145 ARG G N   1 
ATOM 8367 C CA  . ARG E 5 145 ? 96.611  163.444 89.065  1.00 10.56  ?  145 ARG G CA  1 
ATOM 8368 C C   . ARG E 5 145 ? 95.716  163.469 87.835  1.00 9.31   ?  145 ARG G C   1 
ATOM 8369 O O   . ARG E 5 145 ? 94.781  162.671 87.711  1.00 9.53   ?  145 ARG G O   1 
ATOM 8370 C CB  . ARG E 5 145 ? 96.194  164.553 90.033  1.00 10.17  ?  145 ARG G CB  1 
ATOM 8371 C CG  . ARG E 5 145 ? 94.725  164.542 90.403  1.00 10.58  ?  145 ARG G CG  1 
ATOM 8372 C CD  . ARG E 5 145 ? 94.402  165.654 91.382  1.00 13.00  ?  145 ARG G CD  1 
ATOM 8373 N NE  . ARG E 5 145 ? 92.977  165.696 91.695  1.00 11.11  ?  145 ARG G NE  1 
ATOM 8374 C CZ  . ARG E 5 145 ? 92.438  166.462 92.637  1.00 10.20  ?  145 ARG G CZ  1 
ATOM 8375 N NH1 . ARG E 5 145 ? 93.203  167.254 93.371  1.00 10.62  1  145 ARG G NH1 1 
ATOM 8376 N NH2 . ARG E 5 145 ? 91.130  166.437 92.841  1.00 9.37   ?  145 ARG G NH2 1 
ATOM 8377 N N   . ALA E 5 146 ? 96.029  164.373 86.911  1.00 9.06   ?  146 ALA G N   1 
ATOM 8378 C CA  . ALA E 5 146 ? 95.275  164.464 85.676  1.00 9.21   ?  146 ALA G CA  1 
ATOM 8379 C C   . ALA E 5 146 ? 95.443  163.213 84.835  1.00 9.07   ?  146 ALA G C   1 
ATOM 8380 O O   . ALA E 5 146 ? 94.510  162.786 84.166  1.00 8.96   ?  146 ALA G O   1 
ATOM 8381 C CB  . ALA E 5 146 ? 95.696  165.687 84.892  1.00 9.67   ?  146 ALA G CB  1 
ATOM 8382 N N   . LYS E 5 147 ? 96.632  162.617 84.874  1.00 9.07   ?  147 LYS G N   1 
ATOM 8383 C CA  . LYS E 5 147 ? 96.824  161.343 84.200  1.00 9.32   ?  147 LYS G CA  1 
ATOM 8384 C C   . LYS E 5 147 ? 96.002  160.254 84.861  1.00 9.68   ?  147 LYS G C   1 
ATOM 8385 O O   . LYS E 5 147 ? 95.478  159.373 84.183  1.00 9.06   ?  147 LYS G O   1 
ATOM 8386 C CB  . LYS E 5 147 ? 98.303  160.937 84.179  1.00 9.78   ?  147 LYS G CB  1 
ATOM 8387 C CG  . LYS E 5 147 ? 99.165  161.744 83.226  1.00 10.76  ?  147 LYS G CG  1 
ATOM 8388 C CD  . LYS E 5 147 ? 100.643 161.557 83.521  1.00 10.44  ?  147 LYS G CD  1 
ATOM 8389 C CE  . LYS E 5 147 ? 101.065 160.112 83.338  1.00 13.55  ?  147 LYS G CE  1 
ATOM 8390 N NZ  . LYS E 5 147 ? 102.513 159.925 83.629  1.00 15.45  1  147 LYS G NZ  1 
ATOM 8391 N N   . ARG E 5 148 ? 95.880  160.313 86.184  1.00 9.56   ?  148 ARG G N   1 
ATOM 8392 C CA  . ARG E 5 148 ? 95.112  159.289 86.877  1.00 10.48  ?  148 ARG G CA  1 
ATOM 8393 C C   . ARG E 5 148 ? 93.622  159.405 86.554  1.00 9.16   ?  148 ARG G C   1 
ATOM 8394 O O   . ARG E 5 148 ? 92.916  158.398 86.432  1.00 9.20   ?  148 ARG G O   1 
ATOM 8395 C CB  . ARG E 5 148 ? 95.336  159.371 88.388  1.00 10.65  ?  148 ARG G CB  1 
ATOM 8396 C CG  . ARG E 5 148 ? 96.766  159.084 88.820  1.00 11.11  ?  148 ARG G CG  1 
ATOM 8397 C CD  . ARG E 5 148 ? 96.858  158.753 90.302  1.00 11.68  ?  148 ARG G CD  1 
ATOM 8398 N NE  . ARG E 5 148 ? 96.367  159.817 91.173  1.00 12.06  ?  148 ARG G NE  1 
ATOM 8399 C CZ  . ARG E 5 148 ? 97.096  160.832 91.618  1.00 13.82  ?  148 ARG G CZ  1 
ATOM 8400 N NH1 . ARG E 5 148 ? 98.370  160.939 91.273  1.00 12.95  1  148 ARG G NH1 1 
ATOM 8401 N NH2 . ARG E 5 148 ? 96.547  161.739 92.413  1.00 13.07  ?  148 ARG G NH2 1 
ATOM 8402 N N   . VAL E 5 149 ? 93.155  160.639 86.381  1.00 8.96   ?  149 VAL G N   1 
ATOM 8403 C CA  . VAL E 5 149 ? 91.738  160.879 86.120  1.00 8.90   ?  149 VAL G CA  1 
ATOM 8404 C C   . VAL E 5 149 ? 91.390  160.584 84.664  1.00 8.69   ?  149 VAL G C   1 
ATOM 8405 O O   . VAL E 5 149 ? 90.363  159.973 84.370  1.00 7.76   ?  149 VAL G O   1 
ATOM 8406 C CB  . VAL E 5 149 ? 91.342  162.331 86.460  1.00 8.51   ?  149 VAL G CB  1 
ATOM 8407 C CG1 . VAL E 5 149 ? 89.890  162.591 86.099  1.00 9.02   ?  149 VAL G CG1 1 
ATOM 8408 C CG2 . VAL E 5 149 ? 91.592  162.621 87.935  1.00 9.06   ?  149 VAL G CG2 1 
ATOM 8409 N N   . ILE E 5 150 ? 92.253  161.018 83.754  1.00 8.64   ?  150 ILE G N   1 
ATOM 8410 C CA  . ILE E 5 150 ? 92.080  160.717 82.340  1.00 8.20   ?  150 ILE G CA  1 
ATOM 8411 C C   . ILE E 5 150 ? 92.180  159.219 82.085  1.00 9.40   ?  150 ILE G C   1 
ATOM 8412 O O   . ILE E 5 150 ? 91.474  158.676 81.234  1.00 8.47   ?  150 ILE G O   1 
ATOM 8413 C CB  . ILE E 5 150 ? 93.135  161.447 81.493  1.00 8.81   ?  150 ILE G CB  1 
ATOM 8414 C CG1 . ILE E 5 150 ? 92.911  162.952 81.544  1.00 8.20   ?  150 ILE G CG1 1 
ATOM 8415 C CG2 . ILE E 5 150 ? 93.104  160.988 80.057  1.00 9.55   ?  150 ILE G CG2 1 
ATOM 8416 C CD1 . ILE E 5 150 ? 94.058  163.724 80.977  1.00 8.48   ?  150 ILE G CD1 1 
ATOM 8417 N N   . THR E 5 151 ? 93.047  158.548 82.836  1.00 9.18   ?  151 THR G N   1 
ATOM 8418 C CA  . THR E 5 151 ? 93.096  157.096 82.787  1.00 10.19  ?  151 THR G CA  1 
ATOM 8419 C C   . THR E 5 151 ? 91.807  156.529 83.363  1.00 10.21  ?  151 THR G C   1 
ATOM 8420 O O   . THR E 5 151 ? 91.326  155.489 82.926  1.00 11.19  ?  151 THR G O   1 
ATOM 8421 C CB  . THR E 5 151 ? 94.298  156.531 83.557  1.00 10.66  ?  151 THR G CB  1 
ATOM 8422 O OG1 . THR E 5 151 ? 95.509  157.067 83.013  1.00 12.53  ?  151 THR G OG1 1 
ATOM 8423 C CG2 . THR E 5 151 ? 94.338  155.014 83.441  1.00 13.72  ?  151 THR G CG2 1 
ATOM 8424 N N   . THR E 5 152 ? 91.243  157.229 84.344  1.00 8.92   ?  152 THR G N   1 
ATOM 8425 C CA  . THR E 5 152 ? 89.984  156.794 84.932  1.00 9.90   ?  152 THR G CA  1 
ATOM 8426 C C   . THR E 5 152 ? 88.860  156.863 83.895  1.00 9.75   ?  152 THR G C   1 
ATOM 8427 O O   . THR E 5 152 ? 87.952  156.031 83.899  1.00 10.50  ?  152 THR G O   1 
ATOM 8428 C CB  . THR E 5 152 ? 89.621  157.647 86.167  1.00 9.86   ?  152 THR G CB  1 
ATOM 8429 O OG1 . THR E 5 152 ? 90.654  157.523 87.154  1.00 10.90  ?  152 THR G OG1 1 
ATOM 8430 C CG2 . THR E 5 152 ? 88.297  157.201 86.769  1.00 11.05  ?  152 THR G CG2 1 
ATOM 8431 N N   . PHE E 5 153 ? 88.934  157.841 82.995  1.00 8.69   ?  153 PHE G N   1 
ATOM 8432 C CA  . PHE E 5 153 ? 88.029  157.871 81.847  1.00 9.39   ?  153 PHE G CA  1 
ATOM 8433 C C   . PHE E 5 153 ? 88.340  156.789 80.830  1.00 10.19  ?  153 PHE G C   1 
ATOM 8434 O O   . PHE E 5 153 ? 87.436  156.199 80.243  1.00 10.33  ?  153 PHE G O   1 
ATOM 8435 C CB  . PHE E 5 153 ? 88.065  159.235 81.157  1.00 8.62   ?  153 PHE G CB  1 
ATOM 8436 C CG  . PHE E 5 153 ? 87.459  160.341 81.969  1.00 9.28   ?  153 PHE G CG  1 
ATOM 8437 C CD1 . PHE E 5 153 ? 86.089  160.553 81.950  1.00 9.00   ?  153 PHE G CD1 1 
ATOM 8438 C CD2 . PHE E 5 153 ? 88.248  161.166 82.747  1.00 9.00   ?  153 PHE G CD2 1 
ATOM 8439 C CE1 . PHE E 5 153 ? 85.519  161.569 82.693  1.00 8.78   ?  153 PHE G CE1 1 
ATOM 8440 C CE2 . PHE E 5 153 ? 87.685  162.181 83.495  1.00 8.27   ?  153 PHE G CE2 1 
ATOM 8441 C CZ  . PHE E 5 153 ? 86.318  162.383 83.468  1.00 8.60   ?  153 PHE G CZ  1 
ATOM 8442 N N   . ARG E 5 154 ? 89.625  156.540 80.620  1.00 10.72  ?  154 ARG G N   1 
ATOM 8443 C CA  . ARG E 5 154 ? 90.048  155.565 79.630  1.00 11.52  ?  154 ARG G CA  1 
ATOM 8444 C C   . ARG E 5 154 ? 89.617  154.144 79.990  1.00 12.87  ?  154 ARG G C   1 
ATOM 8445 O O   . ARG E 5 154 ? 89.296  153.337 79.115  1.00 14.13  ?  154 ARG G O   1 
ATOM 8446 C CB  . ARG E 5 154 ? 91.570  155.608 79.479  1.00 13.67  ?  154 ARG G CB  1 
ATOM 8447 C CG  . ARG E 5 154 ? 92.104  154.653 78.427  1.00 16.68  ?  154 ARG G CG  1 
ATOM 8448 C CD  . ARG E 5 154 ? 93.618  154.711 78.313  1.00 19.66  ?  154 ARG G CD  1 
ATOM 8449 N NE  . ARG E 5 154 ? 94.271  154.221 79.525  1.00 25.86  ?  154 ARG G NE  1 
ATOM 8450 C CZ  . ARG E 5 154 ? 94.478  152.935 79.797  1.00 25.22  ?  154 ARG G CZ  1 
ATOM 8451 N NH1 . ARG E 5 154 ? 94.071  151.998 78.950  1.00 20.67  1  154 ARG G NH1 1 
ATOM 8452 N NH2 . ARG E 5 154 ? 95.081  152.584 80.923  1.00 29.07  ?  154 ARG G NH2 1 
ATOM 8453 N N   . THR E 5 155 ? 89.602  153.856 81.286  1.00 11.96  ?  155 THR G N   1 
ATOM 8454 C CA  . THR E 5 155 ? 89.430  152.492 81.768  1.00 12.73  ?  155 THR G CA  1 
ATOM 8455 C C   . THR E 5 155 ? 88.006  152.128 82.163  1.00 14.35  ?  155 THR G C   1 
ATOM 8456 O O   . THR E 5 155 ? 87.577  150.988 81.981  1.00 14.82  ?  155 THR G O   1 
ATOM 8457 C CB  . THR E 5 155 ? 90.342  152.236 82.986  1.00 14.87  ?  155 THR G CB  1 
ATOM 8458 O OG1 . THR E 5 155 ? 90.035  153.178 84.022  1.00 14.48  ?  155 THR G OG1 1 
ATOM 8459 C CG2 . THR E 5 155 ? 91.803  152.377 82.596  1.00 14.40  ?  155 THR G CG2 1 
ATOM 8460 N N   . GLY E 5 156 ? 87.277  153.095 82.709  1.00 12.63  ?  156 GLY G N   1 
ATOM 8461 C CA  . GLY E 5 156 ? 85.979  152.809 83.289  1.00 13.01  ?  156 GLY G CA  1 
ATOM 8462 C C   . GLY E 5 156 ? 86.144  152.201 84.670  1.00 13.70  ?  156 GLY G C   1 
ATOM 8463 O O   . GLY E 5 156 ? 85.184  151.711 85.263  1.00 13.99  ?  156 GLY G O   1 
ATOM 8464 N N   . THR E 5 157 ? 87.376  152.228 85.174  1.00 13.74  ?  157 THR G N   1 
ATOM 8465 C CA  . THR E 5 157 ? 87.730  151.624 86.456  1.00 15.07  ?  157 THR G CA  1 
ATOM 8466 C C   . THR E 5 157 ? 88.792  152.465 87.148  1.00 13.88  ?  157 THR G C   1 
ATOM 8467 O O   . THR E 5 157 ? 89.346  153.396 86.566  1.00 11.72  ?  157 THR G O   1 
ATOM 8468 C CB  . THR E 5 157 ? 88.254  150.175 86.318  1.00 14.99  ?  157 THR G CB  1 
ATOM 8469 O OG1 . THR E 5 157 ? 89.400  150.151 85.458  1.00 15.41  ?  157 THR G OG1 1 
ATOM 8470 C CG2 . THR E 5 157 ? 87.178  149.242 85.775  1.00 17.37  ?  157 THR G CG2 1 
ATOM 8471 N N   . TRP E 5 158 ? 89.061  152.123 88.400  1.00 14.18  ?  158 TRP G N   1 
ATOM 8472 C CA  . TRP E 5 158 ? 89.868  152.948 89.286  1.00 15.63  ?  158 TRP G CA  1 
ATOM 8473 C C   . TRP E 5 158 ? 91.350  152.596 89.164  1.00 15.62  ?  158 TRP G C   1 
ATOM 8474 O O   . TRP E 5 158 ? 92.157  152.965 90.017  1.00 14.99  ?  158 TRP G O   1 
ATOM 8475 C CB  . TRP E 5 158 ? 89.394  152.775 90.728  1.00 15.35  ?  158 TRP G CB  1 
ATOM 8476 C CG  . TRP E 5 158 ? 87.955  153.148 90.896  1.00 14.66  ?  158 TRP G CG  1 
ATOM 8477 C CD1 . TRP E 5 158 ? 86.891  152.293 90.968  1.00 15.03  ?  158 TRP G CD1 1 
ATOM 8478 C CD2 . TRP E 5 158 ? 87.407  154.467 90.914  1.00 13.72  ?  158 TRP G CD2 1 
ATOM 8479 N NE1 . TRP E 5 158 ? 85.721  153.000 91.086  1.00 15.00  ?  158 TRP G NE1 1 
ATOM 8480 C CE2 . TRP E 5 158 ? 86.010  154.338 91.049  1.00 14.47  ?  158 TRP G CE2 1 
ATOM 8481 C CE3 . TRP E 5 158 ? 87.962  155.746 90.853  1.00 13.52  ?  158 TRP G CE3 1 
ATOM 8482 C CZ2 . TRP E 5 158 ? 85.166  155.437 91.121  1.00 15.03  ?  158 TRP G CZ2 1 
ATOM 8483 C CZ3 . TRP E 5 158 ? 87.123  156.832 90.924  1.00 12.84  ?  158 TRP G CZ3 1 
ATOM 8484 C CH2 . TRP E 5 158 ? 85.742  156.673 91.057  1.00 13.10  ?  158 TRP G CH2 1 
ATOM 8485 N N   . ASP E 5 159 ? 91.694  151.874 88.099  1.00 16.17  ?  159 ASP G N   1 
ATOM 8486 C CA  . ASP E 5 159 ? 92.991  151.210 87.971  1.00 16.63  ?  159 ASP G CA  1 
ATOM 8487 C C   . ASP E 5 159 ? 94.183  152.157 88.036  1.00 15.79  ?  159 ASP G C   1 
ATOM 8488 O O   . ASP E 5 159 ? 95.260  151.767 88.484  1.00 18.15  ?  159 ASP G O   1 
ATOM 8489 C CB  . ASP E 5 159 ? 93.051  150.443 86.644  1.00 19.78  ?  159 ASP G CB  1 
ATOM 8490 C CG  . ASP E 5 159 ? 92.128  149.241 86.618  1.00 19.59  ?  159 ASP G CG  1 
ATOM 8491 O OD1 . ASP E 5 159 ? 91.669  148.816 87.699  1.00 22.11  ?  159 ASP G OD1 1 
ATOM 8492 O OD2 . ASP E 5 159 ? 91.859  148.724 85.514  1.00 23.57  -1 159 ASP G OD2 1 
ATOM 8493 N N   . ALA E 5 160 ? 93.999  153.393 87.586  1.00 15.76  ?  160 ALA G N   1 
ATOM 8494 C CA  . ALA E 5 160 ? 95.076  154.372 87.644  1.00 15.20  ?  160 ALA G CA  1 
ATOM 8495 C C   . ALA E 5 160 ? 95.464  154.646 89.086  1.00 15.92  ?  160 ALA G C   1 
ATOM 8496 O O   . ALA E 5 160 ? 96.628  154.889 89.398  1.00 15.16  ?  160 ALA G O   1 
ATOM 8497 C CB  . ALA E 5 160 ? 94.663  155.653 86.964  1.00 13.79  ?  160 ALA G CB  1 
ATOM 8498 N N   . TYR E 5 161 ? 94.474  154.578 89.965  1.00 15.37  ?  161 TYR G N   1 
ATOM 8499 C CA  . TYR E 5 161 ? 94.701  154.732 91.391  1.00 17.62  ?  161 TYR G CA  1 
ATOM 8500 C C   . TYR E 5 161 ? 95.225  153.442 91.994  1.00 23.59  ?  161 TYR G C   1 
ATOM 8501 O O   . TYR E 5 161 ? 95.680  153.430 93.136  1.00 24.30  ?  161 TYR G O   1 
ATOM 8502 C CB  . TYR E 5 161 ? 93.414  155.170 92.082  1.00 16.38  ?  161 TYR G CB  1 
ATOM 8503 C CG  . TYR E 5 161 ? 92.985  156.553 91.674  1.00 14.01  ?  161 TYR G CG  1 
ATOM 8504 C CD1 . TYR E 5 161 ? 93.908  157.577 91.597  1.00 12.62  ?  161 TYR G CD1 1 
ATOM 8505 C CD2 . TYR E 5 161 ? 91.671  156.828 91.327  1.00 12.89  ?  161 TYR G CD2 1 
ATOM 8506 C CE1 . TYR E 5 161 ? 93.535  158.842 91.224  1.00 11.84  ?  161 TYR G CE1 1 
ATOM 8507 C CE2 . TYR E 5 161 ? 91.291  158.098 90.938  1.00 11.72  ?  161 TYR G CE2 1 
ATOM 8508 C CZ  . TYR E 5 161 ? 92.234  159.102 90.889  1.00 12.05  ?  161 TYR G CZ  1 
ATOM 8509 O OH  . TYR E 5 161 ? 91.896  160.381 90.512  1.00 11.07  ?  161 TYR G OH  1 
ATOM 8510 N N   . LYS E 5 162 ? 95.162  152.375 91.198  1.00 25.63  ?  162 LYS G N   1 
ATOM 8511 C CA  . LYS E 5 162 ? 95.567  151.019 91.583  1.00 28.17  ?  162 LYS G CA  1 
ATOM 8512 C C   . LYS E 5 162 ? 95.256  150.680 93.038  1.00 33.76  ?  162 LYS G C   1 
ATOM 8513 O O   . LYS E 5 162 ? 95.842  149.762 93.610  1.00 27.10  ?  162 LYS G O   1 
ATOM 8514 C CB  . LYS E 5 162 ? 97.063  150.804 91.310  1.00 24.71  ?  162 LYS G CB  1 
ATOM 8515 C CG  . LYS E 5 162 ? 98.017  151.690 92.103  1.00 27.66  ?  162 LYS G CG  1 
ATOM 8516 C CD  . LYS E 5 162 ? 99.466  151.388 91.756  1.00 23.39  ?  162 LYS G CD  1 
ATOM 8517 C CE  . LYS E 5 162 ? 100.421 152.267 92.543  1.00 24.28  ?  162 LYS G CE  1 
ATOM 8518 N NZ  . LYS E 5 162 ? 100.267 153.703 92.186  1.00 25.15  1  162 LYS G NZ  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ILE A 1   ? 1.2072 1.2349 1.2060 0.0002  0.0000  0.0066  42  ILE A N   
2    C CA  . ILE A 1   ? 1.0255 1.0526 1.0243 0.0005  0.0001  0.0065  42  ILE A CA  
3    C C   . ILE A 1   ? 1.1315 1.1590 1.1304 0.0001  0.0000  0.0066  42  ILE A C   
4    O O   . ILE A 1   ? 1.0985 1.1264 1.0971 -0.0002 0.0000  0.0063  42  ILE A O   
5    C CB  . ILE A 1   ? 1.3703 1.3973 1.3688 0.0008  0.0002  0.0059  42  ILE A CB  
6    C CG1 . ILE A 1   ? 1.5122 1.5413 1.5157 0.0015  0.0003  0.0052  42  ILE A CG1 
7    C CG2 . ILE A 1   ? 1.1503 1.1772 1.1489 0.0010  0.0002  0.0058  42  ILE A CG2 
8    C CD1 . ILE A 1   ? 0.3620 0.3914 0.3653 0.0017  0.0003  0.0047  42  ILE A CD1 
9    N N   . PRO A 2   ? 1.5588 1.5860 1.5579 0.0000  0.0000  0.0072  43  PRO A N   
10   C CA  . PRO A 2   ? 1.6655 1.6959 1.6699 -0.0005 -0.0001 0.0069  43  PRO A CA  
11   C C   . PRO A 2   ? 1.6775 1.7047 1.6767 -0.0002 -0.0001 0.0075  43  PRO A C   
12   O O   . PRO A 2   ? 1.6821 1.7088 1.6814 0.0003  0.0001  0.0074  43  PRO A O   
13   C CB  . PRO A 2   ? 1.7714 1.7989 1.7709 -0.0006 -0.0002 0.0082  43  PRO A CB  
14   C CG  . PRO A 2   ? 1.8683 1.8953 1.8679 -0.0001 0.0000  0.0082  43  PRO A CG  
15   C CD  . PRO A 2   ? 1.6850 1.7118 1.6843 0.0003  0.0001  0.0076  43  PRO A CD  
16   N N   . LEU A 3   ? 1.7335 1.7639 1.7379 -0.0007 -0.0002 0.0070  44  LEU A N   
17   C CA  . LEU A 3   ? 1.6340 1.6612 1.6332 -0.0005 -0.0001 0.0076  44  LEU A CA  
18   C C   . LEU A 3   ? 1.9870 2.0171 1.9918 -0.0008 -0.0002 0.0077  44  LEU A C   
19   O O   . LEU A 3   ? 1.9573 1.9849 1.9570 -0.0013 -0.0004 0.0088  44  LEU A O   
20   C CB  . LEU A 3   ? 1.2782 1.3086 1.2822 -0.0008 -0.0002 0.0063  44  LEU A CB  
21   C CG  . LEU A 3   ? 0.9221 0.9505 0.9207 -0.0016 -0.0003 0.0069  44  LEU A CG  
22   C CD1 . LEU A 3   ? 1.0402 1.0716 1.0443 -0.0021 -0.0005 0.0065  44  LEU A CD1 
23   C CD2 . LEU A 3   ? 0.4954 0.5275 0.4992 -0.0020 -0.0004 0.0056  44  LEU A CD2 
24   N N   . ASN A 4   ? 1.4316 1.4611 1.4367 -0.0003 -0.0001 0.0080  45  ASN A N   
25   C CA  . ASN A 4   ? 1.8705 1.8969 1.8710 -0.0003 -0.0001 0.0097  45  ASN A CA  
26   C C   . ASN A 4   ? 1.7370 1.7636 1.7377 -0.0009 -0.0003 0.0100  45  ASN A C   
27   O O   . ASN A 4   ? 1.7939 1.8208 1.7949 -0.0014 -0.0005 0.0108  45  ASN A O   
28   C CB  . ASN A 4   ? 2.3651 2.3908 2.3659 0.0004  0.0002  0.0100  45  ASN A CB  
29   C CG  . ASN A 4   ? 2.2611 2.2899 2.2677 0.0004  0.0002  0.0101  45  ASN A CG  
30   O OD1 . ASN A 4   ? 2.2261 2.2549 2.2333 0.0002  0.0001  0.0108  45  ASN A OD1 
31   N ND2 . ASN A 4   ? 2.2121 2.2379 2.2137 0.0006  0.0002  0.0111  45  ASN A ND2 
32   N N   . LYS A 5   ? 1.9224 1.9519 1.9279 -0.0008 -0.0003 0.0087  46  LYS A N   
33   C CA  . LYS A 5   ? 1.7679 1.7966 1.7695 -0.0012 -0.0014 0.0097  46  LYS A CA  
34   C C   . LYS A 5   ? 1.8177 1.8474 1.8187 -0.0022 -0.0016 0.0092  46  LYS A C   
35   O O   . LYS A 5   ? 1.8629 1.8938 1.8635 -0.0026 -0.0016 0.0084  46  LYS A O   
36   C CB  . LYS A 5   ? 1.8046 1.8357 1.8067 -0.0010 -0.0009 0.0100  46  LYS A CB  
37   C CG  . LYS A 5   ? 4.0810 4.1162 4.0841 -0.0023 -0.0009 0.0113  46  LYS A CG  
38   C CD  . LYS A 5   ? 1.8552 1.8908 1.8591 -0.0032 -0.0013 0.0127  46  LYS A CD  
39   C CE  . LYS A 5   ? 1.7985 1.8361 1.8033 -0.0052 -0.0012 0.0132  46  LYS A CE  
40   N NZ  . LYS A 5   ? 1.7499 1.7877 1.7552 -0.0057 -0.0020 0.0149  46  LYS A NZ  
41   N N   . THR A 6   ? 1.9036 1.9329 1.9047 -0.0026 -0.0020 0.0095  47  THR A N   
42   C CA  . THR A 6   ? 1.7413 1.7716 1.7418 -0.0037 -0.0022 0.0091  47  THR A CA  
43   C C   . THR A 6   ? 1.3320 1.3653 1.3332 -0.0052 -0.0025 0.0105  47  THR A C   
44   O O   . THR A 6   ? 1.2679 1.3018 1.2701 -0.0054 -0.0026 0.0119  47  THR A O   
45   C CB  . THR A 6   ? 2.0000 2.0323 2.0049 -0.0042 -0.0012 0.0085  47  THR A CB  
46   O OG1 . THR A 6   ? 2.1260 2.1578 2.1309 -0.0031 -0.0009 0.0082  47  THR A OG1 
47   C CG2 . THR A 6   ? 2.0575 2.0906 2.0619 -0.0049 -0.0011 0.0079  47  THR A CG2 
48   N N   . ALA A 7   ? 1.3808 1.4159 1.3814 -0.0065 -0.0025 0.0101  48  ALA A N   
49   C CA  . ALA A 7   ? 1.2857 1.3238 1.2864 -0.0086 -0.0028 0.0111  48  ALA A CA  
50   C C   . ALA A 7   ? 1.2363 1.2749 1.2359 -0.0099 -0.0031 0.0106  48  ALA A C   
51   O O   . ALA A 7   ? 1.2648 1.3035 1.2636 -0.0102 -0.0029 0.0094  48  ALA A O   
52   C CB  . ALA A 7   ? 1.3945 1.4351 1.3952 -0.0096 -0.0025 0.0111  48  ALA A CB  
53   N N   . PRO A 8   ? 0.9632 1.0017 0.9629 -0.0105 -0.0035 0.0115  49  PRO A N   
54   C CA  . PRO A 8   ? 0.7752 0.8139 0.7741 -0.0116 -0.0038 0.0111  49  PRO A CA  
55   C C   . PRO A 8   ? 0.7968 0.8380 0.7947 -0.0143 -0.0040 0.0115  49  PRO A C   
56   O O   . PRO A 8   ? 0.8974 0.9401 0.8955 -0.0158 -0.0043 0.0128  49  PRO A O   
57   C CB  . PRO A 8   ? 0.8021 0.8400 0.8015 -0.0113 -0.0042 0.0120  49  PRO A CB  
58   C CG  . PRO A 8   ? 0.8758 0.9145 0.8762 -0.0115 -0.0043 0.0135  49  PRO A CG  
59   C CD  . PRO A 8   ? 0.8721 0.9105 0.8730 -0.0103 -0.0038 0.0130  49  PRO A CD  
60   N N   . CYS A 9   ? 0.8579 0.8993 0.8548 -0.0151 -0.0040 0.0106  50  CYS A N   
61   C CA  . CYS A 9   ? 0.9454 0.9885 0.9410 -0.0178 -0.0042 0.0109  50  CYS A CA  
62   C C   . CYS A 9   ? 0.6613 0.7043 0.6570 -0.0184 -0.0048 0.0121  50  CYS A C   
63   O O   . CYS A 9   ? 0.6357 0.6771 0.6320 -0.0166 -0.0048 0.0119  50  CYS A O   
64   C CB  . CYS A 9   ? 1.1593 1.2025 1.1539 -0.0181 -0.0040 0.0097  50  CYS A CB  
65   S SG  . CYS A 9   ? 1.7897 1.8326 1.7841 -0.0170 -0.0034 0.0079  50  CYS A SG  
66   N N   . VAL A 10  ? 0.5900 0.6340 0.5852 -0.0208 -0.0054 0.0134  51  VAL A N   
67   C CA  . VAL A 10  ? 0.7286 0.7721 0.7241 -0.0207 -0.0059 0.0143  51  VAL A CA  
68   C C   . VAL A 10  ? 0.9669 1.0111 0.9607 -0.0231 -0.0062 0.0144  51  VAL A C   
69   O O   . VAL A 10  ? 0.9201 0.9650 0.9127 -0.0246 -0.0059 0.0136  51  VAL A O   
70   C CB  . VAL A 10  ? 0.5158 0.5588 0.5127 -0.0209 -0.0061 0.0160  51  VAL A CB  
71   C CG1 . VAL A 10  ? 0.5742 0.6146 0.5730 -0.0221 -0.0042 0.0158  51  VAL A CG1 
72   C CG2 . VAL A 10  ? 0.4894 0.5328 0.4862 -0.0215 -0.0071 0.0172  51  VAL A CG2 
73   N N   . ARG A 11  ? 0.8898 0.9337 0.8837 -0.0231 -0.0067 0.0149  52  ARG A N   
74   C CA  . ARG A 11  ? 1.1817 1.2262 1.1740 -0.0253 -0.0070 0.0150  52  ARG A CA  
75   C C   . ARG A 11  ? 1.2186 1.2626 1.2107 -0.0276 -0.0073 0.0164  52  ARG A C   
76   O O   . ARG A 11  ? 1.1946 1.2380 1.1880 -0.0270 -0.0076 0.0175  52  ARG A O   
77   C CB  . ARG A 11  ? 1.4433 1.4873 1.4360 -0.0241 -0.0070 0.0146  52  ARG A CB  
78   C CG  . ARG A 11  ? 1.5053 1.5500 1.4964 -0.0258 -0.0071 0.0142  52  ARG A CG  
79   C CD  . ARG A 11  ? 1.5487 1.5930 1.5401 -0.0242 -0.0068 0.0133  52  ARG A CD  
80   N NE  . ARG A 11  ? 1.6403 1.6850 1.6311 -0.0243 -0.0063 0.0122  52  ARG A NE  
81   C CZ  . ARG A 11  ? 1.6745 1.7193 1.6650 -0.0239 -0.0062 0.0115  52  ARG A CZ  
82   N NH1 . ARG A 11  ? 1.6185 1.6630 1.6093 -0.0233 -0.0064 0.0117  52  ARG A NH1 
83   N NH2 . ARG A 11  ? 1.7497 1.7950 1.7397 -0.0240 -0.0058 0.0106  52  ARG A NH2 
84   N N   . LEU A 12  ? 1.5945 1.6371 1.5862 -0.0297 -0.0063 0.0160  53  LEU A N   
85   C CA  . LEU A 12  ? 1.6759 1.7161 1.6682 -0.0317 -0.0057 0.0170  53  LEU A CA  
86   C C   . LEU A 12  ? 1.7792 1.8200 1.7693 -0.0337 -0.0060 0.0167  53  LEU A C   
87   O O   . LEU A 12  ? 1.6436 1.6850 1.6327 -0.0344 -0.0056 0.0156  53  LEU A O   
88   C CB  . LEU A 12  ? 1.6976 1.7349 1.6915 -0.0324 -0.0040 0.0168  53  LEU A CB  
89   C CG  . LEU A 12  ? 0.5057 0.5436 0.5012 -0.0298 -0.0042 0.0169  53  LEU A CG  
90   C CD1 . LEU A 12  ? 0.6337 0.6727 0.6293 -0.0286 -0.0037 0.0156  53  LEU A CD1 
91   C CD2 . LEU A 12  ? 0.5258 0.5616 0.5234 -0.0293 -0.0035 0.0179  53  LEU A CD2 
92   N N   . LEU A 13  ? 1.4722 1.5127 1.4619 -0.0347 -0.0067 0.0177  54  LEU A N   
93   C CA  . LEU A 13  ? 1.9808 2.0219 1.9686 -0.0365 -0.0070 0.0176  54  LEU A CA  
94   C C   . LEU A 13  ? 2.4088 2.4469 2.3964 -0.0391 -0.0061 0.0180  54  LEU A C   
95   O O   . LEU A 13  ? 2.4153 2.4509 2.4044 -0.0394 -0.0055 0.0189  54  LEU A O   
96   C CB  . LEU A 13  ? 2.0529 2.0959 2.0400 -0.0360 -0.0085 0.0183  54  LEU A CB  
97   C CG  . LEU A 13  ? 1.1803 1.2261 1.1665 -0.0344 -0.0093 0.0173  54  LEU A CG  
98   C CD1 . LEU A 13  ? 1.0082 1.0539 0.9961 -0.0322 -0.0094 0.0174  54  LEU A CD1 
99   C CD2 . LEU A 13  ? 1.2565 1.3030 1.2413 -0.0354 -0.0089 0.0163  54  LEU A CD2 
100  N N   . ASN A 14  ? 2.3352 2.3736 2.3210 -0.0409 -0.0059 0.0174  55  ASN A N   
101  C CA  . ASN A 14  ? 2.0558 2.0914 2.0412 -0.0434 -0.0052 0.0179  55  ASN A CA  
102  C C   . ASN A 14  ? 2.0287 2.0653 2.0122 -0.0449 -0.0060 0.0183  55  ASN A C   
103  O O   . ASN A 14  ? 2.0762 2.1157 2.0588 -0.0440 -0.0071 0.0181  55  ASN A O   
104  C CB  . ASN A 14  ? 1.7388 1.7735 1.7240 -0.0446 -0.0040 0.0168  55  ASN A CB  
105  C CG  . ASN A 14  ? 1.4004 1.4313 1.3859 -0.0469 -0.0029 0.0173  55  ASN A CG  
106  O OD1 . ASN A 14  ? 1.4051 1.4340 1.3909 -0.0477 -0.0031 0.0186  55  ASN A OD1 
107  N ND2 . ASN A 14  ? 1.0785 1.1083 1.0641 -0.0481 -0.0019 0.0164  55  ASN A ND2 
108  N N   . ALA A 15  ? 1.9461 1.9801 1.9290 -0.0472 -0.0054 0.0188  56  ALA A N   
109  C CA  . ALA A 15  ? 2.1027 2.1372 2.0837 -0.0489 -0.0060 0.0190  56  ALA A CA  
110  C C   . ALA A 15  ? 2.0511 2.0886 2.0305 -0.0491 -0.0063 0.0179  56  ALA A C   
111  O O   . ALA A 15  ? 2.2168 2.2566 2.1951 -0.0489 -0.0073 0.0179  56  ALA A O   
112  C CB  . ALA A 15  ? 2.3738 2.4048 2.3545 -0.0514 -0.0051 0.0196  56  ALA A CB  
113  N N   . THR A 16  ? 2.0454 2.0826 2.0248 -0.0494 -0.0054 0.0168  57  THR A N   
114  C CA  . THR A 16  ? 1.8313 1.8709 1.8090 -0.0500 -0.0055 0.0158  57  THR A CA  
115  C C   . THR A 16  ? 1.6214 1.6638 1.5993 -0.0478 -0.0059 0.0148  57  THR A C   
116  O O   . THR A 16  ? 1.6832 1.7280 1.6596 -0.0479 -0.0063 0.0140  57  THR A O   
117  C CB  . THR A 16  ? 2.1184 2.1561 2.0956 -0.0522 -0.0043 0.0151  57  THR A CB  
118  O OG1 . THR A 16  ? 2.1100 2.1450 2.0869 -0.0543 -0.0041 0.0161  57  THR A OG1 
119  C CG2 . THR A 16  ? 2.0760 2.1162 2.0513 -0.0531 -0.0044 0.0141  57  THR A CG2 
120  N N   . HIS A 17  ? 1.4428 1.4851 1.4223 -0.0457 -0.0061 0.0151  58  HIS A N   
121  C CA  . HIS A 17  ? 1.4155 1.4602 1.3952 -0.0437 -0.0064 0.0142  58  HIS A CA  
122  C C   . HIS A 17  ? 1.4934 1.5379 1.4749 -0.0414 -0.0065 0.0144  58  HIS A C   
123  O O   . HIS A 17  ? 1.5299 1.5734 1.5124 -0.0408 -0.0069 0.0155  58  HIS A O   
124  C CB  . HIS A 17  ? 1.7968 1.8413 1.7762 -0.0444 -0.0053 0.0129  58  HIS A CB  
125  C CG  . HIS A 17  ? 1.9461 1.9872 1.9267 -0.0459 -0.0039 0.0130  58  HIS A CG  
126  N ND1 . HIS A 17  ? 1.9755 2.0141 1.9581 -0.0454 -0.0034 0.0139  58  HIS A ND1 
127  C CD2 . HIS A 17  ? 2.0243 2.0643 2.0046 -0.0477 -0.0028 0.0123  58  HIS A CD2 
128  C CE1 . HIS A 17  ? 1.9315 1.9672 1.9149 -0.0470 -0.0022 0.0138  58  HIS A CE1 
129  N NE2 . HIS A 17  ? 1.9609 1.9975 1.9429 -0.0485 -0.0018 0.0128  58  HIS A NE2 
130  N N   . GLN A 18  ? 1.5699 1.6152 1.5518 -0.0401 -0.0061 0.0134  59  GLN A N   
131  C CA  . GLN A 18  ? 1.4330 1.4786 1.4164 -0.0376 -0.0064 0.0135  59  GLN A CA  
132  C C   . GLN A 18  ? 1.2540 1.2995 1.2382 -0.0368 -0.0055 0.0124  59  GLN A C   
133  O O   . GLN A 18  ? 1.2403 1.2867 1.2234 -0.0377 -0.0051 0.0114  59  GLN A O   
134  C CB  . GLN A 18  ? 1.5676 1.6151 1.5512 -0.0355 -0.0073 0.0135  59  GLN A CB  
135  C CG  . GLN A 18  ? 1.6988 1.7471 1.6825 -0.0345 -0.0067 0.0122  59  GLN A CG  
136  C CD  . GLN A 18  ? 1.8188 1.8669 1.8041 -0.0320 -0.0067 0.0120  59  GLN A CD  
137  O OE1 . GLN A 18  ? 1.8078 1.8551 1.7942 -0.0306 -0.0070 0.0126  59  GLN A OE1 
138  N NE2 . GLN A 18  ? 1.9049 1.9535 1.8900 -0.0316 -0.0064 0.0112  59  GLN A NE2 
139  N N   . ILE A 19  ? 1.3858 1.4305 1.3718 -0.0351 -0.0052 0.0127  60  ILE A N   
140  C CA  . ILE A 19  ? 1.3228 1.3674 1.3098 -0.0339 -0.0045 0.0118  60  ILE A CA  
141  C C   . ILE A 19  ? 1.2428 1.2879 1.2309 -0.0315 -0.0050 0.0121  60  ILE A C   
142  O O   . ILE A 19  ? 1.3291 1.3743 1.3175 -0.0307 -0.0059 0.0132  60  ILE A O   
143  C CB  . ILE A 19  ? 1.5120 1.5539 1.5008 -0.0348 -0.0029 0.0117  60  ILE A CB  
144  C CG1 . ILE A 19  ? 1.1301 1.1696 1.1206 -0.0348 -0.0027 0.0131  60  ILE A CG1 
145  C CG2 . ILE A 19  ? 1.7019 1.7432 1.6897 -0.0372 -0.0021 0.0110  60  ILE A CG2 
146  C CD1 . ILE A 19  ? 1.1158 1.1520 1.1084 -0.0358 -0.0012 0.0133  60  ILE A CD1 
147  N N   . GLY A 20  ? 1.0174 1.0626 1.0061 -0.0304 -0.0044 0.0112  61  GLY A N   
148  C CA  . GLY A 20  ? 1.0585 1.1043 1.0480 -0.0280 -0.0050 0.0114  61  GLY A CA  
149  C C   . GLY A 20  ? 1.1367 1.1826 1.1267 -0.0256 -0.0050 0.0105  61  GLY A C   
150  O O   . GLY A 20  ? 1.2315 1.2778 1.2208 -0.0260 -0.0048 0.0097  61  GLY A O   
151  N N   . CYS A 21  ? 1.1157 1.1605 1.1074 -0.0230 -0.0050 0.0107  62  CYS A N   
152  C CA  . CYS A 21  ? 1.4005 1.4443 1.3930 -0.0205 -0.0046 0.0096  62  CYS A CA  
153  C C   . CYS A 21  ? 1.6196 1.6617 1.6131 -0.0184 -0.0048 0.0099  62  CYS A C   
154  O O   . CYS A 21  ? 1.6643 1.7062 1.6583 -0.0185 -0.0052 0.0108  62  CYS A O   
155  C CB  . CYS A 21  ? 0.5205 0.5642 0.5134 -0.0197 -0.0042 0.0090  62  CYS A CB  
156  S SG  . CYS A 21  ? 2.2960 2.3377 2.2902 -0.0164 -0.0038 0.0081  62  CYS A SG  
157  N N   . GLN A 22  ? 1.6467 1.6877 1.6404 -0.0168 -0.0047 0.0090  63  GLN A N   
158  C CA  . GLN A 22  ? 1.6142 1.6533 1.6088 -0.0148 -0.0048 0.0090  63  GLN A CA  
159  C C   . GLN A 22  ? 1.6039 1.6449 1.6052 -0.0146 -0.0026 0.0083  63  GLN A C   
160  O O   . GLN A 22  ? 1.6400 1.6818 1.6411 -0.0149 -0.0025 0.0078  63  GLN A O   
161  C CB  . GLN A 22  ? 1.3276 1.3674 1.3217 -0.0158 -0.0051 0.0094  63  GLN A CB  
162  C CG  . GLN A 22  ? 1.0652 1.1028 1.0579 -0.0146 -0.0035 0.0102  63  GLN A CG  
163  C CD  . GLN A 22  ? 1.0526 1.0939 1.0537 -0.0167 -0.0035 0.0100  63  GLN A CD  
164  O OE1 . GLN A 22  ? 1.1411 1.1814 1.1350 -0.0171 -0.0058 0.0107  63  GLN A OE1 
165  N NE2 . GLN A 22  ? 1.0682 1.1094 1.0699 -0.0158 -0.0035 0.0103  63  GLN A NE2 
166  N N   . SER A 23  ? 1.5774 1.6142 1.5716 -0.0122 -0.0028 0.0093  64  SER A N   
167  C CA  . SER A 23  ? 1.4680 1.5050 1.4626 -0.0113 -0.0026 0.0092  64  SER A CA  
168  C C   . SER A 23  ? 1.4892 1.5305 1.4916 -0.0127 -0.0025 0.0088  64  SER A C   
169  O O   . SER A 23  ? 1.5462 1.5837 1.5405 -0.0122 -0.0030 0.0101  64  SER A O   
170  C CB  . SER A 23  ? 1.3506 1.4001 1.3495 -0.0137 -0.0030 0.0115  64  SER A CB  
171  O OG  . SER A 23  ? 1.3637 1.3999 1.3595 -0.0094 -0.0022 0.0092  64  SER A OG  
172  N N   . SER A 24  ? 1.5771 1.6151 1.5719 -0.0111 -0.0025 0.0094  65  SER A N   
173  C CA  . SER A 24  ? 1.5442 1.5864 1.5471 -0.0123 -0.0024 0.0090  65  SER A CA  
174  C C   . SER A 24  ? 1.4332 1.4707 1.4287 -0.0105 -0.0027 0.0102  65  SER A C   
175  O O   . SER A 24  ? 1.4883 1.5251 1.4843 -0.0097 -0.0025 0.0100  65  SER A O   
176  C CB  . SER A 24  ? 1.4309 1.4700 1.4259 -0.0108 -0.0025 0.0096  65  SER A CB  
177  O OG  . SER A 24  ? 1.3566 1.3999 1.3598 -0.0121 -0.0024 0.0092  65  SER A OG  
178  N N   . ILE A 25  ? 1.2703 1.3219 1.2696 -0.0148 -0.0035 0.0133  66  ILE A N   
179  C CA  . ILE A 25  ? 1.2157 1.2565 1.2195 -0.0111 -0.0026 0.0100  66  ILE A CA  
180  C C   . ILE A 25  ? 1.3714 1.4216 1.3718 -0.0123 -0.0031 0.0132  66  ILE A C   
181  O O   . ILE A 25  ? 1.4107 1.4479 1.4072 -0.0089 -0.0023 0.0103  66  ILE A O   
182  C CB  . ILE A 25  ? 1.2498 1.2872 1.2458 -0.0106 -0.0030 0.0114  66  ILE A CB  
183  C CG1 . ILE A 25  ? 1.1822 1.2326 1.1828 -0.0135 -0.0036 0.0145  66  ILE A CG1 
184  C CG2 . ILE A 25  ? 1.2582 1.3106 1.2578 -0.0150 -0.0037 0.0141  66  ILE A CG2 
185  C CD1 . ILE A 25  ? 1.1997 1.2395 1.2041 -0.0106 -0.0027 0.0109  66  ILE A CD1 
186  N N   . SER A 26  ? 1.4084 1.4478 1.4127 -0.0090 -0.0021 0.0096  67  SER A N   
187  C CA  . SER A 26  ? 1.3864 1.4347 1.3877 -0.0099 -0.0025 0.0127  67  SER A CA  
188  C C   . SER A 26  ? 1.2955 1.3341 1.2998 -0.0075 -0.0017 0.0088  67  SER A C   
189  O O   . SER A 26  ? 1.2839 1.3220 1.2883 -0.0067 -0.0015 0.0085  67  SER A O   
190  C CB  . SER A 26  ? 1.4734 1.5127 1.4779 -0.0078 -0.0018 0.0092  67  SER A CB  
191  O OG  . SER A 26  ? 1.4829 1.5229 1.4872 -0.0081 -0.0017 0.0090  67  SER A OG  
192  N N   . GLY A 27  ? 1.3846 1.4200 1.3817 -0.0074 -0.0019 0.0096  68  GLY A N   
193  C CA  . GLY A 27  ? 1.4060 1.4449 1.4100 -0.0080 -0.0016 0.0083  68  GLY A CA  
194  C C   . GLY A 27  ? 1.3390 1.3885 1.3393 -0.0101 -0.0021 0.0109  68  GLY A C   
195  O O   . GLY A 27  ? 1.2429 1.2833 1.2467 -0.0083 -0.0016 0.0081  68  GLY A O   
196  N N   . ASP A 28  ? 1.3417 1.3914 1.3418 -0.0101 -0.0020 0.0103  69  ASP A N   
197  C CA  . ASP A 28  ? 1.3049 1.3455 1.3083 -0.0083 -0.0014 0.0072  69  ASP A CA  
198  C C   . ASP A 28  ? 1.1947 1.2446 1.1947 -0.0092 -0.0016 0.0092  69  ASP A C   
199  O O   . ASP A 28  ? 1.1608 1.2000 1.1643 -0.0070 -0.0012 0.0067  69  ASP A O   
200  C CB  . ASP A 28  ? 1.5103 1.5518 1.5134 -0.0094 -0.0015 0.0070  69  ASP A CB  
201  C CG  . ASP A 28  ? 1.6605 1.7027 1.6635 -0.0104 -0.0017 0.0074  69  ASP A CG  
202  O OD1 . ASP A 28  ? 1.6719 1.7103 1.6673 -0.0093 -0.0019 0.0085  69  ASP A OD1 
203  O OD2 . ASP A 28  ? 1.7322 1.7749 1.7348 -0.0114 -0.0018 0.0073  69  ASP A OD2 
204  N N   . THR A 29  ? 1.2891 1.3261 1.2855 -0.0064 -0.0012 0.0072  70  THR A N   
205  C CA  . THR A 29  ? 1.4579 1.4980 1.4615 -0.0062 -0.0009 0.0062  70  THR A CA  
206  C C   . THR A 29  ? 1.6191 1.6704 1.6191 -0.0078 -0.0012 0.0079  70  THR A C   
207  O O   . THR A 29  ? 1.6581 1.7004 1.6616 -0.0069 -0.0009 0.0059  70  THR A O   
208  C CB  . THR A 29  ? 1.4579 1.5070 1.4585 -0.0068 -0.0012 0.0087  70  THR A CB  
209  O OG1 . THR A 29  ? 1.5424 1.5815 1.5462 -0.0047 -0.0007 0.0060  70  THR A OG1 
210  C CG2 . THR A 29  ? 1.3890 1.4392 1.3896 -0.0071 -0.0012 0.0090  70  THR A CG2 
211  N N   . GLY A 30  ? 1.7516 1.7887 1.7481 -0.0052 -0.0008 0.0059  71  GLY A N   
212  C CA  . GLY A 30  ? 1.8540 1.8920 1.8504 -0.0052 -0.0007 0.0054  71  GLY A CA  
213  C C   . GLY A 30  ? 1.8870 1.9382 1.8870 -0.0062 -0.0007 0.0062  71  GLY A C   
214  O O   . GLY A 30  ? 1.8065 1.8429 1.8032 -0.0042 -0.0006 0.0049  71  GLY A O   
215  N N   . VAL A 31  ? 1.9049 1.9468 1.9084 -0.0049 -0.0005 0.0042  72  VAL A N   
216  C CA  . VAL A 31  ? 2.0655 2.1072 2.0690 -0.0044 -0.0004 0.0037  72  VAL A CA  
217  C C   . VAL A 31  ? 2.2350 2.2733 2.2312 -0.0043 -0.0004 0.0036  72  VAL A C   
218  O O   . VAL A 31  ? 2.1984 2.2517 2.1978 -0.0070 -0.0006 0.0043  72  VAL A O   
219  C CB  . VAL A 31  ? 2.8085 2.8478 2.8048 -0.0039 -0.0004 0.0038  72  VAL A CB  
220  C CG1 . VAL A 31  ? 2.8000 2.8558 2.7997 -0.0063 -0.0005 0.0047  72  VAL A CG1 
221  C CG2 . VAL A 31  ? 2.7889 2.8318 2.7925 -0.0038 -0.0003 0.0029  72  VAL A CG2 
222  N N   . ILE A 32  ? 2.3478 2.3987 2.3476 -0.0052 -0.0004 0.0041  73  ILE A N   
223  C CA  . ILE A 32  ? 2.4959 2.5468 2.4955 -0.0055 -0.0004 0.0035  73  ILE A CA  
224  C C   . ILE A 32  ? 2.4779 2.5200 2.4811 -0.0046 -0.0002 0.0019  73  ILE A C   
225  O O   . ILE A 32  ? 2.4866 2.5254 2.4828 -0.0037 -0.0002 0.0019  73  ILE A O   
226  C CB  . ILE A 32  ? 2.6245 2.6638 2.6277 -0.0037 -0.0002 0.0024  73  ILE A CB  
227  C CG1 . ILE A 32  ? 2.6551 2.6900 2.6519 -0.0032 -0.0003 0.0034  73  ILE A CG1 
228  C CG2 . ILE A 32  ? 2.6939 2.7333 2.6970 -0.0040 -0.0002 0.0019  73  ILE A CG2 
229  C CD1 . ILE A 32  ? 2.6908 2.7253 2.6877 -0.0029 -0.0003 0.0039  73  ILE A CD1 
230  N N   . HIS A 33  ? 2.5263 2.5694 2.5293 -0.0055 -0.0002 0.0016  74  HIS A N   
231  C CA  . HIS A 33  ? 2.4222 2.4631 2.4176 -0.0054 -0.0001 0.0010  74  HIS A CA  
232  C C   . HIS A 33  ? 2.3955 2.4365 2.3909 -0.0059 0.0000  0.0003  74  HIS A C   
233  O O   . HIS A 33  ? 2.4083 2.4525 2.4111 -0.0070 -0.0001 0.0004  74  HIS A O   
234  C CB  . HIS A 33  ? 2.3457 2.3882 2.3409 -0.0061 -0.0002 0.0012  74  HIS A CB  
235  C CG  . HIS A 33  ? 2.2860 2.3341 2.2892 -0.0071 -0.0001 0.0004  74  HIS A CG  
236  N ND1 . HIS A 33  ? 2.2446 2.2932 2.2480 -0.0064 0.0000  0.0000  74  HIS A ND1 
237  C CD2 . HIS A 33  ? 2.3120 2.3616 2.3151 -0.0082 0.0000  0.0000  74  HIS A CD2 
238  C CE1 . HIS A 33  ? 2.2506 2.2967 2.2454 -0.0065 0.0001  -0.0007 74  HIS A CE1 
239  N NE2 . HIS A 33  ? 2.2838 2.3348 2.2870 -0.0081 0.0001  -0.0006 74  HIS A NE2 
240  N N   . VAL A 34  ? 2.2812 2.3261 2.2843 -0.0060 0.0001  -0.0005 75  VAL A N   
241  C CA  . VAL A 34  ? 2.0920 2.1330 2.0874 -0.0058 0.0002  -0.0013 75  VAL A CA  
242  C C   . VAL A 34  ? 2.0263 2.0686 2.0213 -0.0068 0.0004  -0.0023 75  VAL A C   
243  O O   . VAL A 34  ? 2.0119 2.0557 2.0067 -0.0071 0.0004  -0.0026 75  VAL A O   
244  C CB  . VAL A 34  ? 2.0802 2.1244 2.0834 -0.0054 0.0002  -0.0017 75  VAL A CB  
245  C CG1 . VAL A 34  ? 2.0692 2.1083 2.0651 -0.0041 0.0001  -0.0010 75  VAL A CG1 
246  C CG2 . VAL A 34  ? 2.7734 2.8154 2.7691 -0.0049 0.0003  -0.0024 75  VAL A CG2 
247  N N   . VAL A 35  ? 2.0295 2.0865 2.0280 -0.0099 0.0006  -0.0034 76  VAL A N   
248  C CA  . VAL A 35  ? 2.1454 2.1921 2.1482 -0.0089 0.0007  -0.0036 76  VAL A CA  
249  C C   . VAL A 35  ? 2.3051 2.3514 2.3083 -0.0085 0.0008  -0.0046 76  VAL A C   
250  O O   . VAL A 35  ? 2.3621 2.4070 2.3651 -0.0083 0.0008  -0.0046 76  VAL A O   
251  C CB  . VAL A 35  ? 2.1369 2.1795 2.1310 -0.0093 0.0008  -0.0038 76  VAL A CB  
252  C CG1 . VAL A 35  ? 2.1079 2.1515 2.1030 -0.0105 -0.0003 -0.0054 76  VAL A CG1 
253  C CG2 . VAL A 35  ? 2.1041 2.1520 2.1063 -0.0110 0.0007  -0.0031 76  VAL A CG2 
254  N N   . GLU A 36  ? 2.3822 2.4256 2.3774 -0.0075 0.0010  -0.0059 77  GLU A N   
255  C CA  . GLU A 36  ? 2.5917 2.6346 2.5873 -0.0072 0.0011  -0.0069 77  GLU A CA  
256  C C   . GLU A 36  ? 2.7984 2.8472 2.8027 -0.0086 0.0013  -0.0076 77  GLU A C   
257  O O   . GLU A 36  ? 2.8323 2.8767 2.8284 -0.0078 0.0016  -0.0096 77  GLU A O   
258  C CB  . GLU A 36  ? 2.5902 2.6363 2.5942 -0.0065 0.0008  -0.0061 77  GLU A CB  
259  C CG  . GLU A 36  ? 1.8910 1.9463 1.8913 -0.0072 0.0011  -0.0083 77  GLU A CG  
260  C CD  . GLU A 36  ? 1.8358 1.8803 1.8404 -0.0057 0.0009  -0.0075 77  GLU A CD  
261  O OE1 . GLU A 36  ? 1.8173 1.8590 1.8143 -0.0053 0.0011  -0.0091 77  GLU A OE1 
262  O OE2 . GLU A 36  ? 1.8193 1.8608 1.8179 -0.0055 -0.0001 -0.0087 77  GLU A OE2 
263  N N   . LYS A 37  ? 2.6695 2.7322 2.6690 -0.0117 0.0019  -0.0103 78  LYS A N   
264  C CA  . LYS A 37  ? 2.9163 2.9685 2.9206 -0.0103 0.0017  -0.0087 78  LYS A CA  
265  C C   . LYS A 37  ? 3.1108 3.1644 3.1147 -0.0115 0.0017  -0.0084 78  LYS A C   
266  O O   . LYS A 37  ? 3.1498 3.2031 3.1534 -0.0114 0.0015  -0.0072 78  LYS A O   
267  C CB  . LYS A 37  ? 2.3768 2.4301 2.3817 -0.0095 0.0016  -0.0092 78  LYS A CB  
268  C CG  . LYS A 37  ? 2.3880 2.4415 2.3928 -0.0084 0.0013  -0.0082 78  LYS A CG  
269  C CD  . LYS A 37  ? 2.1345 2.1860 2.1393 -0.0071 0.0010  -0.0077 78  LYS A CD  
270  C CE  . LYS A 37  ? 2.1213 2.1730 2.1262 -0.0060 0.0008  -0.0071 78  LYS A CE  
271  N NZ  . LYS A 37  ? 2.1305 2.1760 2.1268 -0.0045 0.0007  -0.0073 78  LYS A NZ  
272  N N   . GLU A 38  ? 2.8590 2.9095 2.8532 -0.0114 0.0022  -0.0103 79  GLU A N   
273  C CA  . GLU A 38  ? 3.0533 3.1053 3.0468 -0.0126 0.0023  -0.0101 79  GLU A CA  
274  C C   . GLU A 38  ? 3.3467 3.4049 3.3505 -0.0133 0.0018  -0.0083 79  GLU A C   
275  O O   . GLU A 38  ? 3.3499 3.4087 3.3533 -0.0140 0.0017  -0.0077 79  GLU A O   
276  C CB  . GLU A 38  ? 2.9664 3.0394 2.9647 -0.0186 0.0035  -0.0146 79  GLU A CB  
277  C CG  . GLU A 38  ? 2.8546 2.9092 2.8485 -0.0160 0.0016  -0.0128 79  GLU A CG  
278  C CD  . GLU A 38  ? 2.7878 2.8433 2.7808 -0.0168 0.0014  -0.0119 79  GLU A CD  
279  O OE1 . GLU A 38  ? 2.7642 2.8201 2.7559 -0.0158 0.0029  -0.0110 79  GLU A OE1 
280  O OE2 . GLU A 38  ? 2.7248 2.7813 2.7173 -0.0185 0.0019  -0.0120 79  GLU A OE2 
281  N N   . GLU A 39  ? 3.1800 3.2530 3.1786 -0.0151 0.0022  -0.0113 80  GLU A N   
282  C CA  . GLU A 39  ? 3.1172 3.1769 3.1214 -0.0116 0.0014  -0.0075 80  GLU A CA  
283  C C   . GLU A 39  ? 2.8787 2.9321 2.8723 -0.0102 0.0012  -0.0067 80  GLU A C   
284  O O   . GLU A 39  ? 2.8777 2.9518 2.8757 -0.0146 0.0014  -0.0075 80  GLU A O   
285  C CB  . GLU A 39  ? 3.2534 3.3082 3.2476 -0.0094 0.0014  -0.0084 80  GLU A CB  
286  C CG  . GLU A 39  ? 3.2471 3.3096 3.2521 -0.0107 0.0014  -0.0086 80  GLU A CG  
287  C CD  . GLU A 39  ? 3.4407 3.4998 3.4343 -0.0108 0.0016  -0.0092 80  GLU A CD  
288  O OE1 . GLU A 39  ? 3.4964 3.5772 3.4951 -0.0146 0.0018  -0.0101 80  GLU A OE1 
289  O OE2 . GLU A 39  ? 3.4894 3.5557 3.4944 -0.0129 0.0018  -0.0095 80  GLU A OE2 
290  N N   . ASP A 40  ? 3.1710 3.2273 3.1749 -0.0103 0.0010  -0.0058 81  ASP A N   
291  C CA  . ASP A 40  ? 2.9156 2.9657 2.9096 -0.0090 0.0009  -0.0050 81  ASP A CA  
292  C C   . ASP A 40  ? 2.8145 2.8691 2.8177 -0.0109 0.0008  -0.0043 81  ASP A C   
293  O O   . ASP A 40  ? 2.6158 2.6653 2.6092 -0.0100 0.0007  -0.0037 81  ASP A O   
294  C CB  . ASP A 40  ? 2.8432 2.8914 2.8377 -0.0079 0.0008  -0.0048 81  ASP A CB  
295  C CG  . ASP A 40  ? 2.8032 2.8515 2.7981 -0.0069 0.0007  -0.0050 81  ASP A CG  
296  O OD1 . ASP A 40  ? 2.8237 2.8727 2.8185 -0.0065 0.0006  -0.0044 81  ASP A OD1 
297  O OD2 . ASP A 40  ? 2.7945 2.8595 2.7940 -0.0089 0.0009  -0.0071 81  ASP A OD2 
298  N N   . LEU A 41  ? 2.8412 2.8912 2.8344 -0.0109 0.0012  -0.0057 82  LEU A N   
299  C CA  . LEU A 41  ? 2.9481 3.0027 2.9507 -0.0132 0.0011  -0.0050 82  LEU A CA  
300  C C   . LEU A 41  ? 3.1867 3.2431 3.1891 -0.0140 0.0011  -0.0046 82  LEU A C   
301  O O   . LEU A 41  ? 3.2566 3.3079 3.2485 -0.0129 0.0009  -0.0040 82  LEU A O   
302  C CB  . LEU A 41  ? 2.6978 2.7524 2.7002 -0.0144 0.0015  -0.0061 82  LEU A CB  
303  C CG  . LEU A 41  ? 2.5154 2.5815 2.5122 -0.0175 0.0023  -0.0092 82  LEU A CG  
304  C CD1 . LEU A 41  ? 2.5486 2.5989 2.5422 -0.0151 0.0008  -0.0085 82  LEU A CD1 
305  C CD2 . LEU A 41  ? 2.3461 2.3929 2.3393 -0.0117 0.0015  -0.0063 82  LEU A CD2 
306  N N   . GLN A 42  ? 3.4197 3.4732 3.4116 -0.0132 0.0013  -0.0058 83  GLN A N   
307  C CA  . GLN A 42  ? 3.6129 3.6733 3.6154 -0.0152 0.0012  -0.0049 83  GLN A CA  
308  C C   . GLN A 42  ? 3.6024 3.6628 3.6051 -0.0141 0.0008  -0.0038 83  GLN A C   
309  O O   . GLN A 42  ? 3.5723 3.6283 3.5638 -0.0133 0.0008  -0.0034 83  GLN A O   
310  C CB  . GLN A 42  ? 3.5680 3.6255 3.5593 -0.0146 0.0015  -0.0064 83  GLN A CB  
311  C CG  . GLN A 42  ? 2.1437 2.2069 2.1461 -0.0175 0.0018  -0.0070 83  GLN A CG  
312  C CD  . GLN A 42  ? 2.1568 2.2331 2.1522 -0.0219 0.0027  -0.0102 83  GLN A CD  
313  O OE1 . GLN A 42  ? 2.1351 2.1944 2.1375 -0.0164 0.0018  -0.0071 83  GLN A OE1 
314  N NE2 . GLN A 42  ? 2.1694 2.2254 2.1596 -0.0173 0.0026  -0.0092 83  GLN A NE2 
315  N N   . TRP A 43  ? 3.5571 3.6169 3.5602 -0.0127 0.0008  -0.0037 84  TRP A N   
316  C CA  . TRP A 43  ? 3.6092 3.6638 3.6020 -0.0107 0.0006  -0.0031 84  TRP A CA  
317  C C   . TRP A 43  ? 2.6857 2.7385 2.6787 -0.0103 0.0004  -0.0020 84  TRP A C   
318  O O   . TRP A 43  ? 2.6473 2.6998 2.6406 -0.0095 0.0002  -0.0013 84  TRP A O   
319  C CB  . TRP A 43  ? 3.6131 3.6728 3.6167 -0.0105 0.0005  -0.0031 84  TRP A CB  
320  C CG  . TRP A 43  ? 3.5896 3.6518 3.5934 -0.0110 0.0007  -0.0038 84  TRP A CG  
321  C CD1 . TRP A 43  ? 3.6156 3.6735 3.6085 -0.0107 0.0010  -0.0054 84  TRP A CD1 
322  C CD2 . TRP A 43  ? 3.5851 3.6493 3.5891 -0.0109 0.0006  -0.0034 84  TRP A CD2 
323  N NE1 . TRP A 43  ? 3.5682 3.6339 3.5724 -0.0119 0.0009  -0.0053 84  TRP A NE1 
324  C CE2 . TRP A 43  ? 3.5700 3.6307 3.5627 -0.0105 0.0008  -0.0047 84  TRP A CE2 
325  C CE3 . TRP A 43  ? 3.5325 3.5969 3.5366 -0.0104 0.0004  -0.0025 84  TRP A CE3 
326  C CZ2 . TRP A 43  ? 3.5538 3.6396 3.5518 -0.0144 0.0009  -0.0057 84  TRP A CZ2 
327  C CZ3 . TRP A 43  ? 3.5081 3.5691 3.5009 -0.0096 0.0004  -0.0026 84  TRP A CZ3 
328  C CH2 . TRP A 43  ? 3.5205 3.5835 3.5131 -0.0101 0.0005  -0.0035 84  TRP A CH2 
329  N N   . VAL A 44  ? 2.9269 2.9832 2.9297 -0.0118 0.0004  -0.0019 85  VAL A N   
330  C CA  . VAL A 44  ? 2.9746 3.0292 2.9772 -0.0115 0.0002  -0.0010 85  VAL A CA  
331  C C   . VAL A 44  ? 3.0686 3.1198 3.0611 -0.0112 0.0001  -0.0005 85  VAL A C   
332  O O   . VAL A 44  ? 2.9769 3.0323 2.9795 -0.0118 -0.0001 0.0003  85  VAL A O   
333  C CB  . VAL A 44  ? 2.9070 2.9602 2.9093 -0.0120 0.0003  -0.0012 85  VAL A CB  
334  C CG1 . VAL A 44  ? 2.8506 2.8988 2.8432 -0.0115 0.0001  -0.0004 85  VAL A CG1 
335  C CG2 . VAL A 44  ? 2.9149 2.9663 2.9173 -0.0109 0.0003  -0.0013 85  VAL A CG2 
336  N N   . LEU A 45  ? 3.3090 3.3617 3.3010 -0.0123 0.0002  -0.0011 86  LEU A N   
337  C CA  . LEU A 45  ? 3.3234 3.3774 3.3148 -0.0133 0.0002  -0.0007 86  LEU A CA  
338  C C   . LEU A 45  ? 3.4343 3.4946 3.4368 -0.0138 0.0001  -0.0002 86  LEU A C   
339  O O   . LEU A 45  ? 3.3751 3.4297 3.3672 -0.0119 -0.0001 0.0006  86  LEU A O   
340  C CB  . LEU A 45  ? 3.2182 3.2735 3.2089 -0.0146 0.0004  -0.0016 86  LEU A CB  
341  C CG  . LEU A 45  ? 3.1038 3.1630 3.1051 -0.0168 0.0005  -0.0020 86  LEU A CG  
342  C CD1 . LEU A 45  ? 3.0940 3.1547 3.0949 -0.0184 0.0008  -0.0028 86  LEU A CD1 
343  C CD2 . LEU A 45  ? 3.0584 3.1158 3.0594 -0.0168 0.0003  -0.0013 86  LEU A CD2 
344  N N   . THR A 46  ? 3.6391 3.6962 3.6306 -0.0129 0.0002  -0.0009 87  THR A N   
345  C CA  . THR A 46  ? 3.6498 3.7086 3.6414 -0.0126 0.0001  -0.0005 87  THR A CA  
346  C C   . THR A 46  ? 2.6421 2.7002 2.6343 -0.0112 0.0000  0.0001  87  THR A C   
347  O O   . THR A 46  ? 2.5417 2.6061 2.5453 -0.0120 -0.0001 0.0007  87  THR A O   
348  C CB  . THR A 46  ? 2.4746 2.5355 2.4659 -0.0131 0.0003  -0.0014 87  THR A CB  
349  O OG1 . THR A 46  ? 2.4619 2.5221 2.4535 -0.0126 0.0004  -0.0022 87  THR A OG1 
350  C CG2 . THR A 46  ? 2.4859 2.5536 2.4886 -0.0160 0.0004  -0.0017 87  THR A CG2 
351  N N   . ASP A 47  ? 2.8770 2.9336 2.8697 -0.0103 0.0000  -0.0002 88  ASP A N   
352  C CA  . ASP A 47  ? 2.9481 3.0039 2.9413 -0.0091 0.0000  0.0003  88  ASP A CA  
353  C C   . ASP A 47  ? 2.9879 3.0473 2.9916 -0.0095 -0.0002 0.0011  88  ASP A C   
354  O O   . ASP A 47  ? 3.1310 3.1885 3.1347 -0.0090 -0.0002 0.0013  88  ASP A O   
355  C CB  . ASP A 47  ? 1.9616 2.0211 1.9654 -0.0092 0.0000  -0.0003 88  ASP A CB  
356  C CG  . ASP A 47  ? 1.9811 2.0344 1.9751 -0.0072 0.0000  0.0001  88  ASP A CG  
357  O OD1 . ASP A 47  ? 2.0026 2.0556 1.9967 -0.0068 -0.0001 0.0009  88  ASP A OD1 
358  O OD2 . ASP A 47  ? 1.9552 2.0076 1.9494 -0.0067 0.0000  -0.0004 88  ASP A OD2 
359  N N   . GLY A 48  ? 2.7021 2.7576 2.6955 -0.0087 -0.0003 0.0019  89  GLY A N   
360  C CA  . GLY A 48  ? 2.6641 2.7184 2.6578 -0.0085 -0.0004 0.0027  89  GLY A CA  
361  C C   . GLY A 48  ? 2.6541 2.7273 2.6529 -0.0101 -0.0006 0.0041  89  GLY A C   
362  O O   . GLY A 48  ? 2.8269 2.8869 2.8312 -0.0080 -0.0004 0.0032  89  GLY A O   
363  N N   . PRO A 49  ? 2.4849 2.5366 2.4794 -0.0068 -0.0004 0.0034  90  PRO A N   
364  C CA  . PRO A 49  ? 2.0942 2.1636 2.0937 -0.0080 -0.0005 0.0048  90  PRO A CA  
365  C C   . PRO A 49  ? 1.8486 1.8977 1.8437 -0.0056 -0.0005 0.0044  90  PRO A C   
366  O O   . PRO A 49  ? 1.7666 1.8204 1.7710 -0.0060 -0.0005 0.0045  90  PRO A O   
367  C CB  . PRO A 49  ? 2.0532 2.1080 2.0575 -0.0057 -0.0003 0.0030  90  PRO A CB  
368  C CG  . PRO A 49  ? 2.5067 2.5611 2.5108 -0.0062 -0.0003 0.0024  90  PRO A CG  
369  C CD  . PRO A 49  ? 2.5258 2.5810 2.5297 -0.0073 -0.0003 0.0026  90  PRO A CD  
370  N N   . ASN A 50  ? 1.9451 1.9927 1.9403 -0.0055 -0.0005 0.0041  91  ASN A N   
371  C CA  . ASN A 50  ? 1.9265 1.9729 1.9219 -0.0056 -0.0005 0.0046  91  ASN A CA  
372  C C   . ASN A 50  ? 2.0663 2.1178 2.0702 -0.0072 -0.0006 0.0042  91  ASN A C   
373  O O   . ASN A 50  ? 2.0945 2.1468 2.0982 -0.0078 -0.0005 0.0037  91  ASN A O   
374  C CB  . ASN A 50  ? 1.8934 1.9379 1.8890 -0.0051 -0.0005 0.0044  91  ASN A CB  
375  C CG  . ASN A 50  ? 1.9373 1.9974 1.9372 -0.0059 -0.0005 0.0053  91  ASN A CG  
376  O OD1 . ASN A 50  ? 2.0273 2.0878 2.0274 -0.0053 -0.0005 0.0056  91  ASN A OD1 
377  N ND2 . ASN A 50  ? 1.8968 1.9441 1.9007 -0.0044 -0.0003 0.0034  91  ASN A ND2 
378  N N   . PRO A 51  ? 2.0672 2.1183 2.0710 -0.0075 -0.0007 0.0047  92  PRO A N   
379  C CA  . PRO A 51  ? 2.1214 2.1685 2.1161 -0.0078 -0.0008 0.0052  92  PRO A CA  
380  C C   . PRO A 51  ? 2.5509 2.5965 2.5456 -0.0078 -0.0008 0.0050  92  PRO A C   
381  O O   . PRO A 51  ? 2.5547 2.6050 2.5579 -0.0092 -0.0007 0.0042  92  PRO A O   
382  C CB  . PRO A 51  ? 2.1609 2.2080 2.1557 -0.0078 -0.0010 0.0059  92  PRO A CB  
383  C CG  . PRO A 51  ? 2.1642 2.2110 2.1594 -0.0069 -0.0009 0.0061  92  PRO A CG  
384  C CD  . PRO A 51  ? 2.1126 2.1587 2.1080 -0.0063 -0.0008 0.0057  92  PRO A CD  
385  N N   . PRO A 52  ? 2.4471 2.4953 2.4507 -0.0080 -0.0008 0.0049  93  PRO A N   
386  C CA  . PRO A 52  ? 2.3105 2.3575 2.3138 -0.0082 -0.0008 0.0048  93  PRO A CA  
387  C C   . PRO A 52  ? 2.3587 2.4010 2.3539 -0.0071 -0.0008 0.0047  93  PRO A C   
388  O O   . PRO A 52  ? 2.3125 2.3580 2.3159 -0.0068 -0.0006 0.0042  93  PRO A O   
389  C CB  . PRO A 52  ? 2.2591 2.3162 2.2585 -0.0095 -0.0012 0.0072  93  PRO A CB  
390  C CG  . PRO A 52  ? 2.1452 2.1918 2.1487 -0.0080 -0.0009 0.0057  93  PRO A CG  
391  C CD  . PRO A 52  ? 2.4494 2.4970 2.4531 -0.0076 -0.0008 0.0054  93  PRO A CD  
392  N N   . TYR A 53  ? 2.3001 2.3467 2.3032 -0.0085 -0.0007 0.0039  94  TYR A N   
393  C CA  . TYR A 53  ? 2.3153 2.3612 2.3182 -0.0082 -0.0006 0.0034  94  TYR A CA  
394  C C   . TYR A 53  ? 2.3543 2.3953 2.3492 -0.0078 -0.0007 0.0038  94  TYR A C   
395  O O   . TYR A 53  ? 2.3349 2.3762 2.3294 -0.0087 -0.0008 0.0039  94  TYR A O   
396  C CB  . TYR A 53  ? 2.4429 2.4902 2.4457 -0.0088 -0.0005 0.0027  94  TYR A CB  
397  C CG  . TYR A 53  ? 2.5589 2.6077 2.5618 -0.0086 -0.0004 0.0025  94  TYR A CG  
398  C CD1 . TYR A 53  ? 2.6375 2.6823 2.6322 -0.0073 -0.0005 0.0031  94  TYR A CD1 
399  C CD2 . TYR A 53  ? 2.5697 2.6199 2.5726 -0.0093 -0.0003 0.0018  94  TYR A CD2 
400  C CE1 . TYR A 53  ? 2.6570 2.7074 2.6604 -0.0078 -0.0004 0.0027  94  TYR A CE1 
401  C CE2 . TYR A 53  ? 2.5862 2.6379 2.5892 -0.0092 -0.0003 0.0016  94  TYR A CE2 
402  C CZ  . TYR A 53  ? 2.6403 2.6878 2.6346 -0.0077 -0.0004 0.0023  94  TYR A CZ  
403  O OH  . TYR A 53  ? 2.6522 2.7057 2.6557 -0.0084 -0.0003 0.0019  94  TYR A OH  
404  N N   . MET A 54  ? 2.3885 2.4283 2.3838 -0.0070 -0.0006 0.0037  95  MET A N   
405  C CA  . MET A 54  ? 2.3339 2.3728 2.3292 -0.0072 -0.0007 0.0037  95  MET A CA  
406  C C   . MET A 54  ? 2.2836 2.3262 2.2861 -0.0078 -0.0005 0.0026  95  MET A C   
407  O O   . MET A 54  ? 2.3050 2.3473 2.3078 -0.0069 -0.0004 0.0023  95  MET A O   
408  C CB  . MET A 54  ? 2.3537 2.3945 2.3565 -0.0070 -0.0006 0.0039  95  MET A CB  
409  C CG  . MET A 54  ? 2.4933 2.5301 2.4889 -0.0069 -0.0009 0.0047  95  MET A CG  
410  S SD  . MET A 54  ? 2.1382 2.1795 2.1408 -0.0088 -0.0010 0.0048  95  MET A SD  
411  C CE  . MET A 54  ? 1.2101 1.2509 1.2130 -0.0081 -0.0010 0.0054  95  MET A CE  
412  N N   . VAL A 55  ? 1.9355 1.9753 1.9302 -0.0081 -0.0005 0.0024  96  VAL A N   
413  C CA  . VAL A 55  ? 1.8237 1.8638 1.8182 -0.0082 -0.0003 0.0014  96  VAL A CA  
414  C C   . VAL A 55  ? 1.6306 1.6694 1.6253 -0.0079 -0.0002 0.0013  96  VAL A C   
415  O O   . VAL A 55  ? 1.6148 1.6563 1.6168 -0.0089 -0.0003 0.0017  96  VAL A O   
416  C CB  . VAL A 55  ? 1.9518 1.9969 1.9537 -0.0103 -0.0002 0.0008  96  VAL A CB  
417  C CG1 . VAL A 55  ? 2.0435 2.0844 2.0369 -0.0104 -0.0002 0.0009  96  VAL A CG1 
418  C CG2 . VAL A 55  ? 1.9910 2.0332 1.9847 -0.0094 0.0000  -0.0002 96  VAL A CG2 
419  N N   . LEU A 56  ? 1.7210 1.7595 1.7160 -0.0071 -0.0001 0.0007  97  LEU A N   
420  C CA  . LEU A 56  ? 1.6026 1.6400 1.5977 -0.0069 -0.0001 0.0005  97  LEU A CA  
421  C C   . LEU A 56  ? 1.6478 1.6859 1.6426 -0.0076 0.0001  -0.0007 97  LEU A C   
422  O O   . LEU A 56  ? 1.6833 1.7260 1.6856 -0.0083 0.0003  -0.0013 97  LEU A O   
423  C CB  . LEU A 56  ? 1.7495 1.7861 1.7452 -0.0056 -0.0001 0.0005  97  LEU A CB  
424  C CG  . LEU A 56  ? 2.0273 2.0677 2.0300 -0.0056 0.0000  -0.0003 97  LEU A CG  
425  C CD1 . LEU A 56  ? 2.1308 2.1705 2.1337 -0.0045 0.0000  0.0001  97  LEU A CD1 
426  C CD2 . LEU A 56  ? 2.1230 2.1598 2.1188 -0.0052 0.0002  -0.0013 97  LEU A CD2 
427  N N   . LEU A 57  ? 1.8042 1.8432 1.8000 -0.0087 -0.0011 -0.0011 98  LEU A N   
428  C CA  . LEU A 57  ? 1.7668 1.8087 1.7625 -0.0102 -0.0005 -0.0024 98  LEU A CA  
429  C C   . LEU A 57  ? 1.8737 1.9169 1.8699 -0.0105 0.0000  -0.0031 98  LEU A C   
430  O O   . LEU A 57  ? 1.8698 1.9133 1.8663 -0.0106 0.0000  -0.0025 98  LEU A O   
431  C CB  . LEU A 57  ? 1.7206 1.7644 1.7157 -0.0122 -0.0003 -0.0023 98  LEU A CB  
432  C CG  . LEU A 57  ? 1.6438 1.6873 1.6383 -0.0125 -0.0006 -0.0019 98  LEU A CG  
433  C CD1 . LEU A 57  ? 1.6447 1.6899 1.6385 -0.0146 -0.0005 -0.0017 98  LEU A CD1 
434  C CD2 . LEU A 57  ? 1.5917 1.6357 1.5860 -0.0125 -0.0005 -0.0031 98  LEU A CD2 
435  N N   . GLU A 58  ? 1.9488 1.9929 1.9453 -0.0105 0.0003  -0.0046 99  GLU A N   
436  C CA  . GLU A 58  ? 2.0329 2.0789 2.0300 -0.0113 0.0010  -0.0061 99  GLU A CA  
437  C C   . GLU A 58  ? 1.9150 1.9631 1.9117 -0.0138 0.0016  -0.0067 99  GLU A C   
438  O O   . GLU A 58  ? 1.9082 1.9567 1.9041 -0.0149 0.0016  -0.0066 99  GLU A O   
439  C CB  . GLU A 58  ? 2.2165 2.2629 2.2141 -0.0110 0.0012  -0.0078 99  GLU A CB  
440  C CG  . GLU A 58  ? 2.3451 2.3894 2.3429 -0.0089 0.0006  -0.0072 99  GLU A CG  
441  C CD  . GLU A 58  ? 2.3555 2.3978 2.3533 -0.0075 0.0002  -0.0057 99  GLU A CD  
442  O OE1 . GLU A 58  ? 2.3982 2.4415 2.3964 -0.0078 0.0004  -0.0056 99  GLU A OE1 
443  O OE2 . GLU A 58  ? 2.3537 2.3933 2.3511 -0.0063 -0.0004 -0.0046 99  GLU A OE2 
444  N N   . SER A 59  ? 1.7477 1.7961 1.7458 -0.0144 0.0024  -0.0069 100 SER A N   
445  C CA  . SER A 59  ? 1.5809 1.6283 1.5806 -0.0161 0.0035  -0.0062 100 SER A CA  
446  C C   . SER A 59  ? 1.7516 1.7999 1.7513 -0.0180 0.0045  -0.0079 100 SER A C   
447  O O   . SER A 59  ? 1.7906 1.8387 1.7904 -0.0199 0.0049  -0.0074 100 SER A O   
448  C CB  . SER A 59  ? 1.3506 1.3958 1.3541 -0.0156 0.0048  -0.0052 100 SER A CB  
449  O OG  . SER A 59  ? 1.2983 1.3431 1.3019 -0.0134 0.0042  -0.0046 100 SER A OG  
450  N N   . LYS A 60  ? 1.8203 1.8697 1.8199 -0.0177 0.0045  -0.0100 101 LYS A N   
451  C CA  . LYS A 60  ? 1.7840 1.8346 1.7833 -0.0194 0.0053  -0.0119 101 LYS A CA  
452  C C   . LYS A 60  ? 1.6571 1.7096 1.6529 -0.0207 0.0044  -0.0120 101 LYS A C   
453  O O   . LYS A 60  ? 1.5152 1.5684 1.5106 -0.0226 0.0051  -0.0130 101 LYS A O   
454  C CB  . LYS A 60  ? 1.9364 1.9880 1.9357 -0.0183 0.0051  -0.0140 101 LYS A CB  
455  C CG  . LYS A 60  ? 1.9629 2.0133 1.9659 -0.0181 0.0066  -0.0152 101 LYS A CG  
456  C CD  . LYS A 60  ? 2.0971 2.1479 2.1003 -0.0160 0.0058  -0.0163 101 LYS A CD  
457  C CE  . LYS A 60  ? 2.0879 2.1400 2.0884 -0.0154 0.0045  -0.0168 101 LYS A CE  
458  N NZ  . LYS A 60  ? 2.0826 2.1338 2.0838 -0.0132 0.0038  -0.0166 101 LYS A NZ  
459  N N   . HIS A 61  ? 1.8357 1.8875 1.8308 -0.0190 0.0031  -0.0101 102 HIS A N   
460  C CA  . HIS A 61  ? 1.9059 1.9575 1.9000 -0.0192 0.0027  -0.0092 102 HIS A CA  
461  C C   . HIS A 61  ? 1.9652 2.0166 1.9585 -0.0201 0.0023  -0.0076 102 HIS A C   
462  O O   . HIS A 61  ? 1.9847 2.0360 1.9773 -0.0203 0.0018  -0.0066 102 HIS A O   
463  C CB  . HIS A 61  ? 2.1552 2.2053 2.1497 -0.0167 0.0018  -0.0082 102 HIS A CB  
464  C CG  . HIS A 61  ? 2.1362 2.1866 2.1313 -0.0159 0.0019  -0.0095 102 HIS A CG  
465  N ND1 . HIS A 61  ? 2.0911 2.1397 2.0864 -0.0139 0.0012  -0.0088 102 HIS A ND1 
466  C CD2 . HIS A 61  ? 2.1541 2.2060 2.1495 -0.0170 0.0027  -0.0115 102 HIS A CD2 
467  C CE1 . HIS A 61  ? 2.0963 2.1456 2.0920 -0.0137 0.0014  -0.0101 102 HIS A CE1 
468  N NE2 . HIS A 61  ? 2.1408 2.1921 2.1367 -0.0155 0.0023  -0.0118 102 HIS A NE2 
469  N N   . PHE A 62  ? 1.9280 1.9794 1.9213 -0.0209 0.0025  -0.0072 103 PHE A N   
470  C CA  . PHE A 62  ? 1.9183 1.9695 1.9107 -0.0219 0.0021  -0.0056 103 PHE A CA  
471  C C   . PHE A 62  ? 1.8976 1.9479 1.8913 -0.0242 0.0034  -0.0058 103 PHE A C   
472  O O   . PHE A 62  ? 1.8785 1.9266 1.8752 -0.0245 0.0046  -0.0052 103 PHE A O   
473  C CB  . PHE A 62  ? 1.8889 1.9383 1.8828 -0.0205 0.0019  -0.0038 103 PHE A CB  
474  C CG  . PHE A 62  ? 1.8421 1.8909 1.8357 -0.0214 0.0015  -0.0021 103 PHE A CG  
475  C CD1 . PHE A 62  ? 1.8076 1.8570 1.7995 -0.0212 0.0004  -0.0014 103 PHE A CD1 
476  C CD2 . PHE A 62  ? 1.8304 1.8770 1.8266 -0.0220 0.0025  -0.0009 103 PHE A CD2 
477  C CE1 . PHE A 62  ? 1.7575 1.8067 1.7488 -0.0222 -0.0001 0.0001  103 PHE A CE1 
478  C CE2 . PHE A 62  ? 1.8155 1.8616 1.8112 -0.0229 0.0020  0.0006  103 PHE A CE2 
479  C CZ  . PHE A 62  ? 1.7814 1.8291 1.7742 -0.0232 0.0006  0.0010  103 PHE A CZ  
480  N N   . THR A 63  ? 1.9713 2.0232 1.9628 -0.0258 0.0032  -0.0064 104 THR A N   
481  C CA  . THR A 63  ? 1.9814 2.0323 1.9737 -0.0282 0.0044  -0.0065 104 THR A CA  
482  C C   . THR A 63  ? 2.2140 2.2669 2.2032 -0.0296 0.0035  -0.0064 104 THR A C   
483  O O   . THR A 63  ? 2.2126 2.2665 2.2009 -0.0280 0.0025  -0.0063 104 THR A O   
484  C CB  . THR A 63  ? 1.9218 1.9727 1.9158 -0.0290 0.0058  -0.0084 104 THR A CB  
485  O OG1 . THR A 63  ? 1.8388 1.8878 1.8345 -0.0312 0.0069  -0.0081 104 THR A OG1 
486  C CG2 . THR A 63  ? 1.8711 1.9247 1.8624 -0.0292 0.0054  -0.0102 104 THR A CG2 
487  N N   . ARG A 64  ? 2.0860 2.1379 2.0753 -0.0318 0.0042  -0.0060 105 ARG A N   
488  C CA  . ARG A 64  ? 2.0848 2.1381 2.0715 -0.0334 0.0035  -0.0057 105 ARG A CA  
489  C C   . ARG A 64  ? 2.1206 2.1764 2.1057 -0.0332 0.0032  -0.0070 105 ARG A C   
490  O O   . ARG A 64  ? 2.0541 2.1100 2.0396 -0.0315 0.0024  -0.0059 105 ARG A O   
491  C CB  . ARG A 64  ? 1.9885 2.0400 1.9763 -0.0359 0.0047  -0.0054 105 ARG A CB  
492  C CG  . ARG A 64  ? 1.8873 1.9403 1.8726 -0.0379 0.0043  -0.0054 105 ARG A CG  
493  C CD  . ARG A 64  ? 1.8282 1.8787 1.8143 -0.0400 0.0048  -0.0042 105 ARG A CD  
494  N NE  . ARG A 64  ? 1.8325 1.8821 1.8186 -0.0390 0.0038  -0.0023 105 ARG A NE  
495  C CZ  . ARG A 64  ? 1.7900 1.8380 1.7760 -0.0405 0.0037  -0.0010 105 ARG A CZ  
496  N NH1 . ARG A 64  ? 1.7435 1.7906 1.7293 -0.0431 0.0045  -0.0013 105 ARG A NH1 
497  N NH2 . ARG A 64  ? 1.7975 1.8449 1.7835 -0.0395 0.0028  0.0006  105 ARG A NH2 
498  N N   . ASP A 65  ? 2.0304 2.0870 2.0155 -0.0341 0.0042  -0.0089 106 ASP A N   
499  C CA  . ASP A 65  ? 2.3347 2.3926 2.3201 -0.0334 0.0042  -0.0096 106 ASP A CA  
500  C C   . ASP A 65  ? 2.4740 2.5312 2.4610 -0.0299 0.0032  -0.0086 106 ASP A C   
501  O O   . ASP A 65  ? 2.4670 2.5245 2.4540 -0.0289 0.0026  -0.0079 106 ASP A O   
502  C CB  . ASP A 65  ? 2.5687 2.6274 2.5543 -0.0345 0.0054  -0.0119 106 ASP A CB  
503  C CG  . ASP A 65  ? 2.4871 2.5456 2.4719 -0.0379 0.0067  -0.0129 106 ASP A CG  
504  O OD1 . ASP A 65  ? 2.4794 2.5387 2.4644 -0.0389 0.0076  -0.0147 106 ASP A OD1 
505  O OD2 . ASP A 65  ? 2.4516 2.5081 2.4371 -0.0391 0.0068  -0.0113 106 ASP A OD2 
506  N N   . LEU A 66  ? 2.4146 2.4707 2.4028 -0.0281 0.0031  -0.0086 107 LEU A N   
507  C CA  . LEU A 66  ? 2.4146 2.4696 2.4041 -0.0250 0.0023  -0.0078 107 LEU A CA  
508  C C   . LEU A 66  ? 2.3994 2.4531 2.3891 -0.0236 0.0014  -0.0058 107 LEU A C   
509  O O   . LEU A 66  ? 2.4307 2.4835 2.4208 -0.0217 0.0008  -0.0052 107 LEU A O   
510  C CB  . LEU A 66  ? 2.4942 2.5485 2.4849 -0.0238 0.0026  -0.0084 107 LEU A CB  
511  C CG  . LEU A 66  ? 2.5903 2.6457 2.5814 -0.0243 0.0034  -0.0105 107 LEU A CG  
512  C CD1 . LEU A 66  ? 2.6205 2.6754 2.6127 -0.0237 0.0039  -0.0116 107 LEU A CD1 
513  C CD2 . LEU A 66  ? 2.6589 2.7143 2.6503 -0.0227 0.0029  -0.0105 107 LEU A CD2 
514  N N   . MET A 67  ? 2.3864 2.4397 2.3756 -0.0246 0.0013  -0.0050 108 MET A N   
515  C CA  . MET A 67  ? 2.3427 2.3947 2.3320 -0.0234 0.0005  -0.0032 108 MET A CA  
516  C C   . MET A 67  ? 2.1916 2.2440 2.1802 -0.0241 0.0001  -0.0025 108 MET A C   
517  O O   . MET A 67  ? 2.2145 2.2657 2.2037 -0.0224 -0.0006 -0.0015 108 MET A O   
518  C CB  . MET A 67  ? 2.4777 2.5293 2.4670 -0.0242 0.0005  -0.0026 108 MET A CB  
519  C CG  . MET A 67  ? 2.4724 2.5230 2.4617 -0.0236 -0.0003 -0.0009 108 MET A CG  
520  S SD  . MET A 67  ? 3.1949 3.2457 3.1834 -0.0259 -0.0002 -0.0002 108 MET A SD  
521  C CE  . MET A 67  ? 2.6571 2.7094 2.6436 -0.0295 0.0005  -0.0014 108 MET A CE  
522  N N   . GLU A 68  ? 2.2454 2.2993 2.2326 -0.0268 0.0004  -0.0029 109 GLU A N   
523  C CA  . GLU A 68  ? 2.1753 2.2295 2.1620 -0.0272 -0.0001 -0.0020 109 GLU A CA  
524  C C   . GLU A 68  ? 2.3016 2.3560 2.2887 -0.0258 -0.0004 -0.0020 109 GLU A C   
525  O O   . GLU A 68  ? 2.2976 2.3517 2.2848 -0.0252 -0.0009 -0.0011 109 GLU A O   
526  C CB  . GLU A 68  ? 2.0151 2.0706 2.0000 -0.0305 0.0004  -0.0024 109 GLU A CB  
527  C CG  . GLU A 68  ? 1.9208 1.9764 1.9047 -0.0329 0.0010  -0.0031 109 GLU A CG  
528  C CD  . GLU A 68  ? 1.9355 1.9919 1.9172 -0.0363 0.0014  -0.0033 109 GLU A CD  
529  O OE1 . GLU A 68  ? 1.9381 1.9947 1.9194 -0.0365 0.0008  -0.0023 109 GLU A OE1 
530  O OE2 . GLU A 68  ? 1.9276 1.9844 1.9080 -0.0388 0.0023  -0.0045 109 GLU A OE2 
531  N N   . LYS A 69  ? 2.4144 2.4693 2.4019 -0.0252 0.0000  -0.0031 110 LYS A N   
532  C CA  . LYS A 69  ? 2.4275 2.4826 2.4153 -0.0239 -0.0003 -0.0032 110 LYS A CA  
533  C C   . LYS A 69  ? 2.6195 2.6724 2.6084 -0.0211 -0.0009 -0.0024 110 LYS A C   
534  O O   . LYS A 69  ? 2.5784 2.6311 2.5675 -0.0200 -0.0012 -0.0023 110 LYS A O   
535  C CB  . LYS A 69  ? 2.3147 2.3713 2.3024 -0.0245 0.0002  -0.0046 110 LYS A CB  
536  C CG  . LYS A 69  ? 2.2293 2.2871 2.2162 -0.0269 0.0011  -0.0058 110 LYS A CG  
537  C CD  . LYS A 69  ? 2.1514 2.2108 2.1367 -0.0297 0.0014  -0.0059 110 LYS A CD  
538  C CE  . LYS A 69  ? 2.0569 2.1171 2.0411 -0.0325 0.0024  -0.0073 110 LYS A CE  
539  N NZ  . LYS A 69  ? 2.0201 2.0819 2.0027 -0.0353 0.0028  -0.0076 110 LYS A NZ  
540  N N   . LEU A 70  ? 2.3608 2.4120 2.3503 -0.0200 -0.0010 -0.0020 111 LEU A N   
541  C CA  . LEU A 70  ? 2.6180 2.6669 2.6085 -0.0175 -0.0015 -0.0013 111 LEU A CA  
542  C C   . LEU A 70  ? 2.8142 2.8627 2.8035 -0.0170 -0.0001 0.0004  111 LEU A C   
543  O O   . LEU A 70  ? 2.8303 2.8776 2.8198 -0.0166 -0.0004 0.0012  111 LEU A O   
544  C CB  . LEU A 70  ? 2.6936 2.7410 2.6848 -0.0166 -0.0014 -0.0012 111 LEU A CB  
545  C CG  . LEU A 70  ? 2.6421 2.6893 2.6333 -0.0172 -0.0014 -0.0006 111 LEU A CG  
546  C CD1 . LEU A 70  ? 2.6509 2.6979 2.6426 -0.0170 -0.0010 -0.0011 111 LEU A CD1 
547  C CD2 . LEU A 70  ? 2.6483 2.6936 2.6400 -0.0159 -0.0019 0.0006  111 LEU A CD2 
561  N N   . ARG A 73  ? 0.8897 0.5845 0.8235 -0.0064 0.0109  0.0953  114 ARG A N   
562  C CA  . ARG A 73  ? 0.9576 0.6453 0.9047 -0.0147 0.0132  0.0952  114 ARG A CA  
563  C C   . ARG A 73  ? 1.0100 0.6886 0.9641 -0.0146 0.0098  0.0964  114 ARG A C   
564  O O   . ARG A 73  ? 1.0086 0.6897 0.9659 -0.0084 0.0050  0.0920  114 ARG A O   
572  N N   . THR A 74  ? 1.0219 0.6898 0.9781 -0.0215 0.0133  0.1020  115 THR A N   
573  C CA  . THR A 74  ? 1.0431 0.7000 1.0063 -0.0228 0.0103  0.1035  115 THR A CA  
574  C C   . THR A 74  ? 1.0041 0.6634 0.9830 -0.0229 0.0052  0.0933  115 THR A C   
575  O O   . THR A 74  ? 0.9791 0.6342 0.9641 -0.0199 0.0032  0.0918  115 THR A O   
579  N N   . SER A 75  ? 1.0253 0.6931 1.0101 -0.0257 0.0046  0.0856  116 SER A N   
580  C CA  . SER A 75  ? 1.0120 0.6858 1.0119 -0.0256 0.0031  0.0747  116 SER A CA  
581  C C   . SER A 75  ? 0.9557 0.6345 0.9506 -0.0151 0.0051  0.0684  116 SER A C   
582  O O   . SER A 75  ? 0.9607 0.6355 0.9558 -0.0138 0.0057  0.0600  116 SER A O   
583  C CB  . SER A 75  ? 0.9761 0.6495 0.9683 -0.0342 -0.0014 0.0682  116 SER A CB  
584  O OG  . SER A 75  ? 1.0422 0.7018 1.0296 -0.0446 0.0062  0.0707  116 SER A OG  
585  N N   . ARG A 76  ? 0.9362 0.6206 0.9206 -0.0093 0.0022  0.0723  117 ARG A N   
586  C CA  . ARG A 76  ? 0.9043 0.5962 0.8806 -0.0009 -0.0020 0.0671  117 ARG A CA  
587  C C   . ARG A 76  ? 0.8314 0.5324 0.8095 -0.0009 -0.0046 0.0567  117 ARG A C   
588  O O   . ARG A 76  ? 0.7749 0.4730 0.7598 -0.0052 -0.0041 0.0498  117 ARG A O   
596  N N   . ILE A 77  ? 0.8038 0.5158 0.7740 0.0037  -0.0082 0.0556  118 ILE A N   
597  C CA  . ILE A 77  ? 0.6870 0.4096 0.6582 0.0041  -0.0118 0.0475  118 ILE A CA  
598  C C   . ILE A 77  ? 0.6065 0.3337 0.5778 0.0087  -0.0171 0.0401  118 ILE A C   
599  O O   . ILE A 77  ? 0.6330 0.3611 0.5990 0.0143  -0.0190 0.0420  118 ILE A O   
600  C CB  . ILE A 77  ? 0.6877 0.4192 0.6501 0.0070  -0.0128 0.0500  118 ILE A CB  
601  C CG1 . ILE A 77  ? 0.6235 0.3663 0.5876 0.0077  -0.0169 0.0423  118 ILE A CG1 
602  C CG2 . ILE A 77  ? 0.6601 0.3939 0.6121 0.0137  -0.0150 0.0539  118 ILE A CG2 
603  C CD1 . ILE A 77  ? 0.6591 0.4089 0.6155 0.0097  -0.0166 0.0447  118 ILE A CD1 
604  N N   . ALA A 78  ? 0.5480 0.2783 0.5257 0.0059  -0.0197 0.0320  119 ALA A N   
605  C CA  . ALA A 78  ? 0.5472 0.2814 0.5254 0.0097  -0.0244 0.0251  119 ALA A CA  
606  C C   . ALA A 78  ? 0.4971 0.2458 0.4730 0.0130  -0.0297 0.0198  119 ALA A C   
607  O O   . ALA A 78  ? 0.4705 0.2246 0.4455 0.0167  -0.0335 0.0149  119 ALA A O   
609  N N   . GLY A 79  ? 0.5418 0.2967 0.5167 0.0116  -0.0294 0.0210  120 GLY A N   
610  C CA  . GLY A 79  ? 0.4745 0.2427 0.4474 0.0146  -0.0339 0.0165  120 GLY A CA  
611  C C   . GLY A 79  ? 0.4761 0.2485 0.4497 0.0121  -0.0329 0.0178  120 GLY A C   
612  O O   . GLY A 79  ? 0.4980 0.2636 0.4754 0.0071  -0.0291 0.0211  120 GLY A O   
613  N N   . LEU A 80  ? 0.7694 0.8071 0.7634 -0.0101 -0.0010 0.0041  121 LEU A N   
614  C CA  . LEU A 80  ? 0.8801 0.9213 0.8815 -0.0109 -0.0007 0.0030  121 LEU A CA  
615  C C   . LEU A 80  ? 1.5621 1.6019 1.5636 -0.0102 -0.0007 0.0030  121 LEU A C   
616  O O   . LEU A 80  ? 1.6669 1.7040 1.6626 -0.0097 -0.0023 0.0037  121 LEU A O   
621  N N   . ALA A 81  ? 1.7780 1.8175 1.7798 -0.0093 -0.0006 0.0025  122 ALA A N   
622  C CA  . ALA A 81  ? 1.9216 1.9582 1.9178 -0.0083 -0.0018 0.0025  122 ALA A CA  
623  C C   . ALA A 81  ? 2.0311 2.0702 2.0273 -0.0092 -0.0013 0.0015  122 ALA A C   
624  O O   . ALA A 81  ? 2.0859 2.1247 2.0821 -0.0087 -0.0012 0.0006  122 ALA A O   
626  N N   . VAL A 82  ? 1.9186 1.9600 1.9148 -0.0108 -0.0010 0.0017  123 VAL A N   
627  C CA  . VAL A 82  ? 1.5327 1.5767 1.5290 -0.0121 -0.0005 0.0005  123 VAL A CA  
628  C C   . VAL A 82  ? 1.6508 1.6953 1.6477 -0.0115 -0.0003 0.0005  123 VAL A C   
629  O O   . VAL A 82  ? 1.7238 1.7682 1.7211 -0.0114 -0.0005 0.0020  123 VAL A O   
633  N N   . SER A 83  ? 1.5968 1.6418 1.5942 -0.0108 0.0001  -0.0008 124 SER A N   
634  C CA  . SER A 83  ? 1.7304 1.7745 1.7297 -0.0098 0.0008  -0.0004 124 SER A CA  
635  C C   . SER A 83  ? 1.6451 1.6885 1.6478 -0.0100 0.0026  -0.0018 124 SER A C   
636  O O   . SER A 83  ? 1.5467 1.5910 1.5491 -0.0103 0.0028  -0.0036 124 SER A O   
647  N N   . THR A 85  ? 1.7921 1.8337 1.7979 -0.0098 0.0038  -0.0007 126 THR A N   
648  C CA  . THR A 85  ? 2.0552 2.0956 2.0654 -0.0097 0.0056  -0.0012 126 THR A CA  
649  C C   . THR A 85  ? 2.4330 2.4730 2.4451 -0.0081 0.0062  -0.0022 126 THR A C   
650  O O   . THR A 85  ? 2.4114 2.4503 2.4275 -0.0078 0.0076  -0.0020 126 THR A O   
651  C CB  . THR A 85  ? 1.7534 1.7922 1.7664 -0.0101 0.0065  0.0007  126 THR A CB  
652  O OG1 . THR A 85  ? 1.7476 1.7855 1.7650 -0.0110 0.0082  0.0003  126 THR A OG1 
653  C CG2 . THR A 85  ? 1.7555 1.7934 1.7685 -0.0082 0.0060  0.0019  126 THR A CG2 
654  N N   . LYS A 86  ? 2.5876 2.6286 2.5970 -0.0070 0.0050  -0.0032 127 LYS A N   
655  C CA  . LYS A 86  ? 2.6562 2.6968 2.6669 -0.0055 0.0053  -0.0043 127 LYS A CA  
656  C C   . LYS A 86  ? 2.9118 2.9531 2.9246 -0.0062 0.0063  -0.0064 127 LYS A C   
657  O O   . LYS A 86  ? 2.8956 2.9365 2.9107 -0.0051 0.0070  -0.0072 127 LYS A O   
658  C CB  . LYS A 86  ? 3.4995 3.5410 3.5064 -0.0044 0.0035  -0.0046 127 LYS A CB  
659  C CG  . LYS A 86  ? 2.2576 2.2986 2.2653 -0.0028 0.0036  -0.0054 127 LYS A CG  
660  C CD  . LYS A 86  ? 2.0461 2.0879 2.0498 -0.0021 0.0017  -0.0055 127 LYS A CD  
661  C CE  . LYS A 86  ? 1.9936 2.0374 1.9947 -0.0030 0.0005  -0.0070 127 LYS A CE  
662  N NZ  . LYS A 86  ? 1.9536 1.9982 1.9565 -0.0042 0.0015  -0.0089 127 LYS A NZ  
663  N N   . PRO A 87  ? 2.8050 2.8473 2.8171 -0.0081 0.0065  -0.0073 128 PRO A N   
664  C CA  . PRO A 87  ? 2.7498 2.7927 2.7641 -0.0090 0.0076  -0.0091 128 PRO A CA  
665  C C   . PRO A 87  ? 2.6932 2.7355 2.7097 -0.0111 0.0087  -0.0083 128 PRO A C   
666  O O   . PRO A 87  ? 2.7682 2.8099 2.7837 -0.0118 0.0084  -0.0065 128 PRO A O   
667  C CB  . PRO A 87  ? 2.7421 2.7867 2.7528 -0.0096 0.0064  -0.0110 128 PRO A CB  
668  C CG  . PRO A 87  ? 2.7513 2.7964 2.7593 -0.0108 0.0057  -0.0097 128 PRO A CG  
669  C CD  . PRO A 87  ? 2.8001 2.8438 2.8082 -0.0093 0.0052  -0.0074 128 PRO A CD  
670  N N   . SER A 88  ? 2.7050 2.7472 2.7244 -0.0121 0.0099  -0.0094 129 SER A N   
671  C CA  . SER A 88  ? 2.5512 2.5926 2.5724 -0.0144 0.0106  -0.0084 129 SER A CA  
672  C C   . SER A 88  ? 2.5381 2.5806 2.5569 -0.0166 0.0106  -0.0101 129 SER A C   
673  O O   . SER A 88  ? 2.6420 2.6861 2.6584 -0.0162 0.0101  -0.0122 129 SER A O   
674  C CB  . SER A 88  ? 2.4161 2.4564 2.4420 -0.0146 0.0117  -0.0082 129 SER A CB  
675  O OG  . SER A 88  ? 2.3571 2.3966 2.3851 -0.0128 0.0117  -0.0060 129 SER A OG  
676  N N   . PRO A 89  ? 2.3884 2.4300 2.4075 -0.0191 0.0109  -0.0092 130 PRO A N   
677  C CA  . PRO A 89  ? 2.3228 2.3657 2.3396 -0.0209 0.0109  -0.0112 130 PRO A CA  
678  C C   . PRO A 89  ? 2.4389 2.4820 2.4579 -0.0217 0.0118  -0.0135 130 PRO A C   
679  O O   . PRO A 89  ? 2.4200 2.4613 2.4427 -0.0224 0.0123  -0.0131 130 PRO A O   
680  C CB  . PRO A 89  ? 2.2055 2.2473 2.2218 -0.0234 0.0109  -0.0096 130 PRO A CB  
681  C CG  . PRO A 89  ? 2.1235 2.1639 2.1404 -0.0224 0.0105  -0.0070 130 PRO A CG  
682  C CD  . PRO A 89  ? 2.2041 2.2440 2.2238 -0.0201 0.0107  -0.0066 130 PRO A CD  
683  N N   . ALA A 90  ? 2.4516 2.4966 2.4681 -0.0219 0.0117  -0.0160 131 ALA A N   
684  C CA  . ALA A 90  ? 2.4371 2.4824 2.4552 -0.0227 0.0125  -0.0185 131 ALA A CA  
685  C C   . ALA A 90  ? 2.4741 2.5190 2.4919 -0.0259 0.0129  -0.0188 131 ALA A C   
686  O O   . ALA A 90  ? 2.5080 2.5532 2.5263 -0.0274 0.0135  -0.0211 131 ALA A O   
687  C CB  . ALA A 90  ? 2.3916 2.4392 2.4072 -0.0212 0.0120  -0.0210 131 ALA A CB  
688  N N   . SER A 91  ? 2.3412 2.3851 2.3578 -0.0271 0.0125  -0.0166 132 SER A N   
689  C CA  . SER A 91  ? 2.1534 2.1965 2.1692 -0.0301 0.0126  -0.0164 132 SER A CA  
690  C C   . SER A 91  ? 2.0656 2.1059 2.0830 -0.0310 0.0123  -0.0137 132 SER A C   
691  O O   . SER A 91  ? 2.0631 2.1031 2.0810 -0.0292 0.0120  -0.0119 132 SER A O   
692  C CB  . SER A 91  ? 2.1519 2.1976 2.1632 -0.0304 0.0123  -0.0170 132 SER A CB  
693  O OG  . SER A 91  ? 2.1385 2.1849 2.1476 -0.0287 0.0114  -0.0153 132 SER A OG  
694  N N   . GLY A 92  ? 2.1755 2.2135 2.1933 -0.0339 0.0123  -0.0133 133 GLY A N   
695  C CA  . GLY A 92  ? 2.2315 2.2664 2.2502 -0.0350 0.0118  -0.0108 133 GLY A CA  
696  C C   . GLY A 92  ? 2.2029 2.2395 2.2184 -0.0343 0.0115  -0.0092 133 GLY A C   
697  O O   . GLY A 92  ? 2.2064 2.2458 2.2185 -0.0343 0.0114  -0.0102 133 GLY A O   
698  N N   . PHE A 93  ? 2.1702 2.2050 2.1868 -0.0336 0.0111  -0.0069 134 PHE A N   
699  C CA  . PHE A 93  ? 2.0145 2.0505 2.0283 -0.0328 0.0105  -0.0053 134 PHE A CA  
700  C C   . PHE A 93  ? 1.9951 2.0283 2.0101 -0.0333 0.0103  -0.0028 134 PHE A C   
701  O O   . PHE A 93  ? 2.0810 2.1119 2.0992 -0.0326 0.0104  -0.0017 134 PHE A O   
702  C CB  . PHE A 93  ? 1.9204 1.9590 1.9329 -0.0297 0.0101  -0.0054 134 PHE A CB  
703  C CG  . PHE A 93  ? 1.7328 1.7720 1.7425 -0.0289 0.0092  -0.0038 134 PHE A CG  
704  C CD1 . PHE A 93  ? 1.6652 1.7057 1.6715 -0.0302 0.0086  -0.0039 134 PHE A CD1 
705  C CD2 . PHE A 93  ? 1.5836 1.6222 1.5941 -0.0268 0.0088  -0.0023 134 PHE A CD2 
706  C CE1 . PHE A 93  ? 1.5563 1.5975 1.5602 -0.0295 0.0076  -0.0025 134 PHE A CE1 
707  C CE2 . PHE A 93  ? 1.4553 1.4946 1.4634 -0.0262 0.0078  -0.0010 134 PHE A CE2 
708  C CZ  . PHE A 93  ? 1.4490 1.4895 1.4538 -0.0275 0.0071  -0.0011 134 PHE A CZ  
709  N N   . SER A 94  ? 1.8305 1.8637 1.8429 -0.0348 0.0099  -0.0021 135 SER A N   
710  C CA  . SER A 94  ? 1.6818 1.7128 1.6942 -0.0351 0.0095  0.0001  135 SER A CA  
711  C C   . SER A 94  ? 1.5277 1.5612 1.5360 -0.0347 0.0087  0.0005  135 SER A C   
712  O O   . SER A 94  ? 1.4727 1.5078 1.4785 -0.0360 0.0085  -0.0004 135 SER A O   
713  C CB  . SER A 94  ? 1.7091 1.7363 1.7228 -0.0379 0.0096  0.0008  135 SER A CB  
714  O OG  . SER A 94  ? 1.6747 1.7004 1.6876 -0.0380 0.0092  0.0028  135 SER A OG  
715  N N   . PRO A 95  ? 1.5674 1.6013 1.5753 -0.0329 0.0081  0.0018  136 PRO A N   
716  C CA  . PRO A 95  ? 1.6565 1.6923 1.6610 -0.0324 0.0069  0.0025  136 PRO A CA  
717  C C   . PRO A 95  ? 1.7737 1.8073 1.7778 -0.0344 0.0068  0.0040  136 PRO A C   
718  O O   . PRO A 95  ? 1.9078 1.9425 1.9096 -0.0341 0.0058  0.0049  136 PRO A O   
719  C CB  . PRO A 95  ? 1.6186 1.6552 1.6235 -0.0297 0.0064  0.0033  136 PRO A CB  
720  C CG  . PRO A 95  ? 1.6003 1.6341 1.6089 -0.0294 0.0073  0.0040  136 PRO A CG  
721  C CD  . PRO A 95  ? 1.5832 1.6156 1.5940 -0.0311 0.0083  0.0029  136 PRO A CD  
722  N N   . SER A 96  ? 1.5516 1.5821 1.5579 -0.0363 0.0075  0.0043  137 SER A N   
723  C CA  . SER A 96  ? 1.4914 1.5195 1.4971 -0.0381 0.0073  0.0058  137 SER A CA  
724  C C   . SER A 96  ? 1.5344 1.5630 1.5378 -0.0406 0.0072  0.0050  137 SER A C   
725  O O   . SER A 96  ? 1.5604 1.5913 1.5626 -0.0407 0.0073  0.0034  137 SER A O   
726  C CB  . SER A 96  ? 1.3867 1.4103 1.3957 -0.0390 0.0079  0.0067  137 SER A CB  
727  O OG  . SER A 96  ? 1.3778 1.3989 1.3859 -0.0414 0.0078  0.0076  137 SER A OG  
728  N N   . VAL A 97  ? 1.5950 1.6209 1.5981 -0.0426 0.0071  0.0061  138 VAL A N   
729  C CA  . VAL A 97  ? 1.7273 1.7533 1.7281 -0.0450 0.0070  0.0056  138 VAL A CA  
730  C C   . VAL A 97  ? 1.9111 1.9353 1.9132 -0.0470 0.0078  0.0043  138 VAL A C   
731  O O   . VAL A 97  ? 1.9724 1.9937 1.9775 -0.0471 0.0083  0.0042  138 VAL A O   
732  C CB  . VAL A 97  ? 1.7112 1.7349 1.7112 -0.0464 0.0065  0.0073  138 VAL A CB  
733  C CG1 . VAL A 97  ? 1.6765 1.6957 1.6794 -0.0467 0.0070  0.0084  138 VAL A CG1 
734  C CG2 . VAL A 97  ? 1.6940 1.7174 1.6918 -0.0491 0.0065  0.0069  138 VAL A CG2 
735  N N   . GLN A 98  ? 2.0738 2.0996 2.0737 -0.0487 0.0078  0.0032  139 GLN A N   
736  C CA  . GLN A 98  ? 2.1004 2.1244 2.1011 -0.0509 0.0085  0.0018  139 GLN A CA  
737  C C   . GLN A 98  ? 2.0236 2.0425 2.0258 -0.0532 0.0086  0.0027  139 GLN A C   
738  O O   . GLN A 98  ? 1.9824 1.9984 1.9865 -0.0545 0.0090  0.0018  139 GLN A O   
739  C CB  . GLN A 98  ? 2.1894 2.2166 2.1869 -0.0522 0.0084  0.0007  139 GLN A CB  
740  C CG  . GLN A 98  ? 2.2494 2.2796 2.2465 -0.0519 0.0088  -0.0014 139 GLN A CG  
741  C CD  . GLN A 98  ? 2.2849 2.3131 2.2830 -0.0543 0.0095  -0.0028 139 GLN A CD  
742  O OE1 . GLN A 98  ? 2.3235 2.3479 2.3223 -0.0564 0.0095  -0.0022 139 GLN A OE1 
743  N NE2 . GLN A 98  ? 2.2324 2.2630 2.2303 -0.0542 0.0100  -0.0048 139 GLN A NE2 
744  N N   . CYS A 99  ? 1.9435 1.9610 1.9446 -0.0537 0.0081  0.0044  140 CYS A N   
745  C CA  . CYS A 99  ? 1.9715 1.9838 1.9737 -0.0556 0.0082  0.0054  140 CYS A CA  
746  C C   . CYS A 99  ? 1.8548 1.8659 1.8569 -0.0546 0.0077  0.0076  140 CYS A C   
747  O O   . CYS A 99  ? 1.8854 1.8973 1.8850 -0.0553 0.0072  0.0084  140 CYS A O   
748  C CB  . CYS A 99  ? 2.0350 2.0466 2.0352 -0.0585 0.0082  0.0048  140 CYS A CB  
749  S SG  . CYS A 99  ? 5.3067 5.3113 5.3081 -0.0611 0.0083  0.0056  140 CYS A SG  
750  N N   . PRO A 100 ? 1.6665 1.6756 1.6710 -0.0529 0.0078  0.0085  141 PRO A N   
751  C CA  . PRO A 100 ? 1.6249 1.6331 1.6291 -0.0519 0.0074  0.0105  141 PRO A CA  
752  C C   . PRO A 100 ? 1.8895 1.8940 1.8926 -0.0540 0.0072  0.0117  141 PRO A C   
753  O O   . PRO A 100 ? 1.7952 1.7953 1.7995 -0.0558 0.0075  0.0117  141 PRO A O   
754  C CB  . PRO A 100 ? 1.6037 1.6093 1.6111 -0.0504 0.0078  0.0111  141 PRO A CB  
755  C CG  . PRO A 100 ? 1.6268 1.6292 1.6363 -0.0519 0.0082  0.0099  141 PRO A CG  
756  C CD  . PRO A 100 ? 1.6467 1.6529 1.6546 -0.0527 0.0083  0.0079  141 PRO A CD  
757  N N   . ASN A 101 ? 1.5609 1.5674 1.5618 -0.0537 0.0065  0.0128  142 ASN A N   
758  C CA  . ASN A 101 ? 2.0521 2.0558 2.0516 -0.0553 0.0061  0.0142  142 ASN A CA  
759  C C   . ASN A 101 ? 2.4006 2.4026 2.3988 -0.0583 0.0063  0.0134  142 ASN A C   
760  O O   . ASN A 101 ? 2.3647 2.3633 2.3623 -0.0599 0.0062  0.0145  142 ASN A O   
761  C CB  . ASN A 101 ? 2.3534 2.3521 2.3551 -0.0551 0.0065  0.0156  142 ASN A CB  
762  C CG  . ASN A 101 ? 2.3068 2.3068 2.3090 -0.0525 0.0061  0.0168  142 ASN A CG  
763  O OD1 . ASN A 101 ? 2.2821 2.2810 2.2833 -0.0525 0.0057  0.0183  142 ASN A OD1 
764  N ND2 . ASN A 101 ? 2.2671 2.2694 2.2709 -0.0504 0.0064  0.0161  142 ASN A ND2 
765  N N   . ASP A 102 ? 3.1465 3.1509 3.1442 -0.0589 0.0066  0.0117  143 ASP A N   
766  C CA  . ASP A 102 ? 3.1366 3.1394 3.1332 -0.0617 0.0069  0.0108  143 ASP A CA  
767  C C   . ASP A 102 ? 3.1003 3.1022 3.0946 -0.0634 0.0064  0.0118  143 ASP A C   
768  O O   . ASP A 102 ? 3.1931 3.1907 3.1874 -0.0654 0.0066  0.0123  143 ASP A O   
769  C CB  . ASP A 102 ? 4.7772 4.7840 4.7727 -0.0621 0.0071  0.0088  143 ASP A CB  
770  C CG  . ASP A 102 ? 2.0496 2.0609 2.0418 -0.0621 0.0065  0.0087  143 ASP A CG  
771  O OD1 . ASP A 102 ? 2.0527 2.0659 2.0441 -0.0604 0.0059  0.0098  143 ASP A OD1 
772  O OD2 . ASP A 102 ? 2.0162 2.0292 2.0068 -0.0638 0.0067  0.0075  143 ASP A OD2 
773  N N   . GLY A 103 ? 3.0063 3.0122 2.9984 -0.0624 0.0058  0.0122  144 GLY A N   
774  C CA  . GLY A 103 ? 2.7211 2.7271 2.7108 -0.0641 0.0053  0.0129  144 GLY A CA  
775  C C   . GLY A 103 ? 2.4480 2.4506 2.4382 -0.0639 0.0050  0.0148  144 GLY A C   
776  O O   . GLY A 103 ? 2.5181 2.5193 2.5067 -0.0655 0.0047  0.0157  144 GLY A O   
777  N N   . PHE A 104 ? 2.2901 2.2917 2.2825 -0.0619 0.0051  0.0155  145 PHE A N   
778  C CA  . PHE A 104 ? 2.0867 2.0851 2.0795 -0.0617 0.0048  0.0173  145 PHE A CA  
779  C C   . PHE A 104 ? 1.8338 1.8257 1.8284 -0.0627 0.0054  0.0182  145 PHE A C   
780  O O   . PHE A 104 ? 1.7563 1.7456 1.7511 -0.0624 0.0052  0.0198  145 PHE A O   
781  C CB  . PHE A 104 ? 1.9423 1.9435 1.9356 -0.0589 0.0043  0.0180  145 PHE A CB  
782  C CG  . PHE A 104 ? 2.0805 2.0798 2.0734 -0.0588 0.0038  0.0197  145 PHE A CG  
783  C CD1 . PHE A 104 ? 2.1567 2.1543 2.1477 -0.0609 0.0035  0.0204  145 PHE A CD1 
784  C CD2 . PHE A 104 ? 2.2345 2.2335 2.2288 -0.0568 0.0037  0.0207  145 PHE A CD2 
785  C CE1 . PHE A 104 ? 2.2211 2.2166 2.2116 -0.0611 0.0030  0.0221  145 PHE A CE1 
786  C CE2 . PHE A 104 ? 2.3922 2.3892 2.3859 -0.0570 0.0032  0.0224  145 PHE A CE2 
787  C CZ  . PHE A 104 ? 2.3352 2.3304 2.3269 -0.0591 0.0029  0.0231  145 PHE A CZ  
788  N N   . GLY A 105 ? 2.0810 2.0703 2.0771 -0.0639 0.0061  0.0170  146 GLY A N   
789  C CA  . GLY A 105 ? 2.1949 2.1778 2.1928 -0.0649 0.0066  0.0175  146 GLY A CA  
790  C C   . GLY A 105 ? 2.2955 2.2746 2.2923 -0.0679 0.0067  0.0174  146 GLY A C   
791  O O   . GLY A 105 ? 2.2652 2.2460 2.2596 -0.0693 0.0064  0.0174  146 GLY A O   
792  N N   . VAL A 106 ? 2.2238 2.1974 2.2225 -0.0687 0.0072  0.0173  147 VAL A N   
793  C CA  . VAL A 106 ? 2.3777 2.3468 2.3758 -0.0715 0.0074  0.0171  147 VAL A CA  
794  C C   . VAL A 106 ? 2.5727 2.5441 2.5697 -0.0734 0.0075  0.0151  147 VAL A C   
795  O O   . VAL A 106 ? 2.5621 2.5315 2.5576 -0.0758 0.0075  0.0149  147 VAL A O   
796  C CB  . VAL A 106 ? 2.4652 2.4277 2.4659 -0.0717 0.0078  0.0172  147 VAL A CB  
797  C CG1 . VAL A 106 ? 2.4795 2.4423 2.4823 -0.0715 0.0080  0.0151  147 VAL A CG1 
798  C CG2 . VAL A 106 ? 2.4677 2.4249 2.4673 -0.0743 0.0079  0.0175  147 VAL A CG2 
799  N N   . TYR A 107 ? 2.2891 2.2647 2.2867 -0.0724 0.0076  0.0136  148 TYR A N   
800  C CA  . TYR A 107 ? 2.5552 2.5331 2.5520 -0.0739 0.0078  0.0115  148 TYR A CA  
801  C C   . TYR A 107 ? 2.4686 2.4535 2.4635 -0.0728 0.0076  0.0110  148 TYR A C   
802  O O   . TYR A 107 ? 2.4825 2.4701 2.4774 -0.0706 0.0073  0.0120  148 TYR A O   
803  C CB  . TYR A 107 ? 2.8918 2.8681 2.8913 -0.0734 0.0081  0.0099  148 TYR A CB  
804  C CG  . TYR A 107 ? 3.2563 3.2361 3.2574 -0.0705 0.0080  0.0099  148 TYR A CG  
805  C CD1 . TYR A 107 ? 3.3645 3.3423 3.3674 -0.0684 0.0080  0.0115  148 TYR A CD1 
806  C CD2 . TYR A 107 ? 3.3795 3.3646 3.3803 -0.0697 0.0081  0.0083  148 TYR A CD2 
807  C CE1 . TYR A 107 ? 3.4636 3.4447 3.4679 -0.0658 0.0080  0.0114  148 TYR A CE1 
808  C CE2 . TYR A 107 ? 3.4237 3.4119 3.4258 -0.0670 0.0081  0.0083  148 TYR A CE2 
809  C CZ  . TYR A 107 ? 3.4695 3.4558 3.4734 -0.0651 0.0081  0.0098  148 TYR A CZ  
810  O OH  . TYR A 107 ? 3.4896 3.4792 3.4949 -0.0625 0.0081  0.0097  148 TYR A OH  
847  N N   . ILE A 112 ? 1.9679 1.9610 1.9717 -0.0721 0.0093  -0.0036 162 ILE A N   
848  C CA  . ILE A 112 ? 1.9469 1.9395 1.9531 -0.0705 0.0092  -0.0048 162 ILE A CA  
849  C C   . ILE A 112 ? 2.0079 2.0057 2.0143 -0.0676 0.0094  -0.0040 162 ILE A C   
850  O O   . ILE A 112 ? 2.0659 2.0662 2.0707 -0.0669 0.0094  -0.0024 162 ILE A O   
851  C CB  . ILE A 112 ? 1.8198 1.8054 1.8288 -0.0705 0.0087  -0.0043 162 ILE A CB  
852  C CG1 . ILE A 112 ? 1.7883 1.7683 1.7964 -0.0731 0.0086  -0.0039 162 ILE A CG1 
853  C CG2 . ILE A 112 ? 1.8250 1.8086 1.8337 -0.0715 0.0089  -0.0069 162 ILE A CG2 
854  C CD1 . ILE A 112 ? 1.7243 1.7034 1.7317 -0.0729 0.0085  -0.0014 162 ILE A CD1 
855  N N   . GLN A 113 ? 1.9985 1.9978 2.0066 -0.0659 0.0094  -0.0051 163 GLN A N   
856  C CA  . GLN A 113 ? 2.0731 2.0771 2.0814 -0.0630 0.0095  -0.0043 163 GLN A CA  
857  C C   . GLN A 113 ? 2.2566 2.2575 2.2678 -0.0610 0.0091  -0.0030 163 GLN A C   
858  O O   . GLN A 113 ? 2.3086 2.3084 2.3214 -0.0607 0.0091  -0.0044 163 GLN A O   
859  C CB  . GLN A 113 ? 2.0578 2.0664 2.0657 -0.0621 0.0099  -0.0064 163 GLN A CB  
860  C CG  . GLN A 113 ? 2.0002 2.0152 2.0057 -0.0605 0.0103  -0.0062 163 GLN A CG  
861  C CD  . GLN A 113 ? 1.9517 1.9681 1.9541 -0.0618 0.0103  -0.0054 163 GLN A CD  
862  O OE1 . GLN A 113 ? 1.9349 1.9491 1.9364 -0.0645 0.0103  -0.0058 163 GLN A OE1 
863  N NE2 . GLN A 113 ? 1.9177 1.9377 1.9183 -0.0601 0.0101  -0.0042 163 GLN A NE2 
864  N N   . TRP A 114 ? 2.1983 2.1981 2.2097 -0.0601 0.0090  -0.0007 164 TRP A N   
865  C CA  . TRP A 114 ? 2.2149 2.2116 2.2293 -0.0584 0.0087  0.0003  164 TRP A CA  
866  C C   . TRP A 114 ? 2.1507 2.1517 2.1661 -0.0556 0.0089  0.0001  164 TRP A C   
867  O O   . TRP A 114 ? 2.1600 2.1590 2.1766 -0.0551 0.0089  -0.0002 164 TRP A O   
868  C CB  . TRP A 114 ? 2.2871 2.2810 2.3015 -0.0580 0.0086  0.0029  164 TRP A CB  
869  C CG  . TRP A 114 ? 2.3383 2.3269 2.3525 -0.0604 0.0084  0.0032  164 TRP A CG  
870  C CD1 . TRP A 114 ? 2.3318 2.3135 2.3463 -0.0621 0.0082  0.0030  164 TRP A CD1 
871  C CD2 . TRP A 114 ? 2.4338 2.4228 2.4452 -0.0624 0.0085  0.0033  164 TRP A CD2 
872  N NE1 . TRP A 114 ? 2.3630 2.3411 2.3765 -0.0643 0.0081  0.0033  164 TRP A NE1 
873  C CE2 . TRP A 114 ? 2.4634 2.4461 2.4754 -0.0644 0.0083  0.0035  164 TRP A CE2 
874  C CE3 . TRP A 114 ? 2.4872 2.4812 2.4955 -0.0628 0.0087  0.0033  164 TRP A CE3 
875  C CZ2 . TRP A 114 ? 2.5942 2.5757 2.6040 -0.0668 0.0083  0.0037  164 TRP A CZ2 
876  C CZ3 . TRP A 114 ? 2.5776 2.5703 2.5837 -0.0651 0.0087  0.0036  164 TRP A CZ3 
877  C CH2 . TRP A 114 ? 2.6490 2.6356 2.6558 -0.0672 0.0085  0.0038  164 TRP A CH2 
878  N N   . ASN A 115 ? 1.9638 1.9705 1.9768 -0.0546 0.0092  0.0000  165 ASN A N   
879  C CA  . ASN A 115 ? 1.9054 1.9162 1.9190 -0.0519 0.0094  -0.0002 165 ASN A CA  
880  C C   . ASN A 115 ? 2.0877 2.1035 2.0994 -0.0516 0.0098  -0.0023 165 ASN A C   
881  O O   . ASN A 115 ? 2.1287 2.1489 2.1381 -0.0501 0.0098  -0.0020 165 ASN A O   
882  C CB  . ASN A 115 ? 1.8022 1.8146 1.8149 -0.0501 0.0093  0.0018  165 ASN A CB  
883  C CG  . ASN A 115 ? 1.8018 1.8176 1.8153 -0.0471 0.0094  0.0017  165 ASN A CG  
884  O OD1 . ASN A 115 ? 1.8320 1.8521 1.8431 -0.0457 0.0094  0.0016  165 ASN A OD1 
885  N ND2 . ASN A 115 ? 1.8398 1.8536 1.8565 -0.0462 0.0095  0.0015  165 ASN A ND2 
886  N N   . SER A 116 ? 2.1029 2.1179 2.1152 -0.0529 0.0099  -0.0043 166 SER A N   
887  C CA  . SER A 116 ? 2.1374 2.1568 2.1473 -0.0534 0.0104  -0.0062 166 SER A CA  
888  C C   . SER A 116 ? 2.1070 2.1312 2.1166 -0.0506 0.0107  -0.0068 166 SER A C   
889  O O   . SER A 116 ? 2.0632 2.0916 2.0702 -0.0502 0.0109  -0.0079 166 SER A O   
890  C CB  . SER A 116 ? 2.1622 2.1795 2.1731 -0.0554 0.0105  -0.0085 166 SER A CB  
891  O OG  . SER A 116 ? 2.2012 2.2200 2.2137 -0.0539 0.0106  -0.0100 166 SER A OG  
892  N N   . LEU A 117 ? 2.0970 2.1202 2.1091 -0.0486 0.0105  -0.0060 167 LEU A N   
893  C CA  . LEU A 117 ? 1.9854 2.0126 1.9974 -0.0457 0.0107  -0.0065 167 LEU A CA  
894  C C   . LEU A 117 ? 1.9022 1.9319 1.9117 -0.0442 0.0104  -0.0050 167 LEU A C   
895  O O   . LEU A 117 ? 1.9151 1.9482 1.9231 -0.0419 0.0104  -0.0054 167 LEU A O   
896  C CB  . LEU A 117 ? 2.0188 2.0439 2.0344 -0.0442 0.0106  -0.0063 167 LEU A CB  
897  C CG  . LEU A 117 ? 2.0753 2.1042 2.0910 -0.0413 0.0110  -0.0072 167 LEU A CG  
898  C CD1 . LEU A 117 ? 1.9547 1.9866 1.9688 -0.0417 0.0114  -0.0098 167 LEU A CD1 
899  C CD2 . LEU A 117 ? 2.2238 2.2501 2.2432 -0.0405 0.0108  -0.0069 167 LEU A CD2 
900  N N   . GLY A 118 ? 1.8359 1.8636 1.8444 -0.0455 0.0101  -0.0033 168 GLY A N   
901  C CA  . GLY A 118 ? 1.8290 1.8583 1.8354 -0.0441 0.0095  -0.0017 168 GLY A CA  
902  C C   . GLY A 118 ? 1.8968 1.9304 1.8995 -0.0433 0.0092  -0.0024 168 GLY A C   
903  O O   . GLY A 118 ? 1.9905 2.0257 1.9914 -0.0448 0.0093  -0.0037 168 GLY A O   
904  N N   . ASN A 119 ? 1.7815 1.8171 1.7831 -0.0410 0.0085  -0.0015 169 ASN A N   
905  C CA  . ASN A 119 ? 1.8429 1.8821 1.8409 -0.0403 0.0078  -0.0021 169 ASN A CA  
906  C C   . ASN A 119 ? 1.9540 1.9934 1.9498 -0.0405 0.0068  -0.0005 169 ASN A C   
907  O O   . ASN A 119 ? 1.9334 1.9754 1.9262 -0.0405 0.0060  -0.0009 169 ASN A O   
908  C CB  . ASN A 119 ? 1.1082 1.1494 1.1065 -0.0374 0.0075  -0.0028 169 ASN A CB  
909  C CG  . ASN A 119 ? 1.8568 1.9009 1.8520 -0.0357 0.0062  -0.0025 169 ASN A CG  
910  O OD1 . ASN A 119 ? 1.8502 1.8948 1.8433 -0.0361 0.0053  -0.0015 169 ASN A OD1 
911  N ND2 . ASN A 119 ? 1.8453 1.8910 1.8403 -0.0336 0.0060  -0.0035 169 ASN A ND2 
912  N N   . GLY A 120 ? 1.5663 1.6027 1.5635 -0.0413 0.0068  0.0011  170 GLY A N   
913  C CA  . GLY A 120 ? 2.0201 2.0564 2.0155 -0.0418 0.0059  0.0026  170 GLY A CA  
914  C C   . GLY A 120 ? 2.4661 2.5049 2.4599 -0.0394 0.0048  0.0030  170 GLY A C   
915  O O   . GLY A 120 ? 2.5768 2.6166 2.5687 -0.0396 0.0038  0.0039  170 GLY A O   
916  N N   . LEU A 121 ? 2.4292 2.4692 2.4240 -0.0372 0.0048  0.0024  171 LEU A N   
917  C CA  . LEU A 121 ? 2.4299 2.4721 2.4233 -0.0348 0.0036  0.0027  171 LEU A CA  
918  C C   . LEU A 121 ? 1.9599 2.0016 1.9532 -0.0338 0.0026  0.0045  171 LEU A C   
919  O O   . LEU A 121 ? 2.0141 2.0579 2.0054 -0.0328 0.0013  0.0048  171 LEU A O   
920  C CB  . LEU A 121 ? 2.2494 2.2919 2.2444 -0.0328 0.0040  0.0019  171 LEU A CB  
921  C CG  . LEU A 121 ? 1.9214 1.9664 1.9147 -0.0305 0.0028  0.0016  171 LEU A CG  
922  C CD1 . LEU A 121 ? 1.7784 1.8251 1.7707 -0.0303 0.0030  -0.0003 171 LEU A CD1 
923  C CD2 . LEU A 121 ? 1.8510 1.8949 1.8462 -0.0283 0.0027  0.0026  171 LEU A CD2 
924  N N   . ALA A 122 ? 2.3628 2.4016 2.3584 -0.0342 0.0032  0.0056  172 ALA A N   
925  C CA  . ALA A 122 ? 1.7616 1.7997 1.7575 -0.0333 0.0025  0.0073  172 ALA A CA  
926  C C   . ALA A 122 ? 1.3520 1.3909 1.3456 -0.0345 0.0014  0.0080  172 ALA A C   
927  O O   . ALA A 122 ? 1.3625 1.4022 1.3555 -0.0335 0.0003  0.0091  172 ALA A O   
928  C CB  . ALA A 122 ? 1.8166 1.8514 1.8152 -0.0338 0.0034  0.0083  172 ALA A CB  
929  N N   . TYR A 123 ? 1.4016 1.4402 1.3942 -0.0368 0.0018  0.0076  173 TYR A N   
930  C CA  . TYR A 123 ? 1.3866 1.4256 1.3772 -0.0379 0.0009  0.0085  173 TYR A CA  
931  C C   . TYR A 123 ? 1.5822 1.6245 1.5701 -0.0377 -0.0001 0.0077  173 TYR A C   
932  O O   . TYR A 123 ? 1.6275 1.6703 1.6136 -0.0393 -0.0005 0.0079  173 TYR A O   
933  C CB  . TYR A 123 ? 1.3784 1.4149 1.3692 -0.0405 0.0016  0.0089  173 TYR A CB  
934  C CG  . TYR A 123 ? 1.3320 1.3648 1.3255 -0.0409 0.0024  0.0099  173 TYR A CG  
935  C CD1 . TYR A 123 ? 1.3199 1.3516 1.3159 -0.0396 0.0033  0.0096  173 TYR A CD1 
936  C CD2 . TYR A 123 ? 1.3888 1.4191 1.3821 -0.0425 0.0023  0.0112  173 TYR A CD2 
937  C CE1 . TYR A 123 ? 1.3775 1.4058 1.3760 -0.0400 0.0040  0.0105  173 TYR A CE1 
938  C CE2 . TYR A 123 ? 1.4161 1.4429 1.4117 -0.0430 0.0030  0.0121  173 TYR A CE2 
939  C CZ  . TYR A 123 ? 1.4437 1.4693 1.4418 -0.0417 0.0038  0.0119  173 TYR A CZ  
940  O OH  . TYR A 123 ? 1.4868 1.5085 1.4872 -0.0422 0.0045  0.0129  173 TYR A OH  
941  N N   . GLU A 124 ? 1.4219 1.4663 1.4095 -0.0358 -0.0005 0.0069  174 GLU A N   
942  C CA  . GLU A 124 ? 1.7640 1.8114 1.7490 -0.0355 -0.0017 0.0064  174 GLU A CA  
943  C C   . GLU A 124 ? 1.7453 1.7939 1.7300 -0.0335 -0.0032 0.0073  174 GLU A C   
944  O O   . GLU A 124 ? 1.7293 1.7768 1.7156 -0.0319 -0.0032 0.0079  174 GLU A O   
945  C CB  . GLU A 124 ? 2.0625 2.1115 2.0468 -0.0352 -0.0013 0.0047  174 GLU A CB  
946  C CG  . GLU A 124 ? 2.2821 2.3333 2.2653 -0.0338 -0.0022 0.0042  174 GLU A CG  
947  C CD  . GLU A 124 ? 2.4526 2.5044 2.4351 -0.0346 -0.0025 0.0045  174 GLU A CD  
948  O OE1 . GLU A 124 ? 2.5612 2.6133 2.5416 -0.0376 -0.0024 0.0044  174 GLU A OE1 
949  O OE2 . GLU A 124 ? 2.5739 2.6255 2.5577 -0.0322 -0.0028 0.0047  174 GLU A OE2 
950  N N   . ASP A 125 ? 1.9797 2.0292 1.9638 -0.0329 -0.0038 0.0074  175 ASP A N   
951  C CA  . ASP A 125 ? 1.9136 1.9623 1.8995 -0.0301 -0.0043 0.0080  175 ASP A CA  
952  C C   . ASP A 125 ? 1.7411 1.7894 1.7285 -0.0272 -0.0040 0.0072  175 ASP A C   
953  O O   . ASP A 125 ? 1.8358 1.8847 1.8228 -0.0273 -0.0038 0.0066  175 ASP A O   
954  C CB  . ASP A 125 ? 1.9269 1.9757 1.9123 -0.0310 -0.0048 0.0089  175 ASP A CB  
955  C CG  . ASP A 125 ? 1.8501 1.8979 1.8372 -0.0283 -0.0051 0.0094  175 ASP A CG  
956  O OD1 . ASP A 125 ? 1.7865 1.8338 1.7747 -0.0260 -0.0049 0.0087  175 ASP A OD1 
957  O OD2 . ASP A 125 ? 1.8307 1.8780 1.8180 -0.0285 -0.0056 0.0104  175 ASP A OD2 
958  N N   . PHE A 126 ? 1.7759 1.8231 1.7647 -0.0249 -0.0039 0.0072  176 PHE A N   
959  C CA  . PHE A 126 ? 1.4692 1.5154 1.4591 -0.0223 -0.0037 0.0065  176 PHE A CA  
960  C C   . PHE A 126 ? 1.3522 1.3969 1.3432 -0.0202 -0.0041 0.0069  176 PHE A C   
961  O O   . PHE A 126 ? 1.3571 1.4010 1.3486 -0.0197 -0.0043 0.0077  176 PHE A O   
962  C CB  . PHE A 126 ? 1.5282 1.5740 1.5189 -0.0210 -0.0033 0.0059  176 PHE A CB  
963  C CG  . PHE A 126 ? 1.6132 1.6604 1.6030 -0.0228 -0.0029 0.0051  176 PHE A CG  
964  C CD1 . PHE A 126 ? 1.6933 1.7418 1.6815 -0.0256 -0.0028 0.0049  176 PHE A CD1 
965  C CD2 . PHE A 126 ? 1.6907 1.7376 1.6811 -0.0217 -0.0025 0.0042  176 PHE A CD2 
966  C CE1 . PHE A 126 ? 1.7768 1.8264 1.7641 -0.0273 -0.0022 0.0039  176 PHE A CE1 
967  C CE2 . PHE A 126 ? 1.7142 1.7624 1.7038 -0.0233 -0.0019 0.0032  176 PHE A CE2 
968  C CZ  . PHE A 126 ? 1.7840 1.8335 1.7721 -0.0261 -0.0017 0.0030  176 PHE A CZ  
969  N N   . SER A 127 ? 1.4054 1.4496 1.3965 -0.0192 -0.0041 0.0065  177 SER A N   
970  C CA  . SER A 127 ? 1.5753 1.6179 1.5671 -0.0174 -0.0043 0.0068  177 SER A CA  
971  C C   . SER A 127 ? 1.6771 1.7213 1.6771 -0.0168 -0.0022 0.0067  177 SER A C   
972  O O   . SER A 127 ? 1.7253 1.7696 1.7259 -0.0160 -0.0023 0.0070  177 SER A O   
973  C CB  . SER A 127 ? 1.6354 1.6814 1.6345 -0.0191 -0.0024 0.0067  177 SER A CB  
974  O OG  . SER A 127 ? 1.6407 1.6877 1.6401 -0.0186 -0.0022 0.0062  177 SER A OG  
975  N N   . PHE A 128 ? 1.6670 1.7107 1.6671 -0.0163 -0.0021 0.0062  178 PHE A N   
976  C CA  . PHE A 128 ? 1.6582 1.7013 1.6589 -0.0147 -0.0019 0.0061  178 PHE A CA  
977  C C   . PHE A 128 ? 1.6156 1.6539 1.6082 -0.0131 -0.0021 0.0067  178 PHE A C   
978  O O   . PHE A 128 ? 1.8267 1.8670 1.8204 -0.0146 -0.0036 0.0061  178 PHE A O   
979  C CB  . PHE A 128 ? 1.7534 1.8083 1.7490 -0.0179 -0.0022 0.0074  178 PHE A CB  
980  C CG  . PHE A 128 ? 1.8038 1.8482 1.8041 -0.0153 -0.0015 0.0047  178 PHE A CG  
981  C CD1 . PHE A 128 ? 1.8426 1.8842 1.8333 -0.0153 -0.0016 0.0050  178 PHE A CD1 
982  C CD2 . PHE A 128 ? 1.8237 1.8636 1.8155 -0.0137 -0.0015 0.0047  178 PHE A CD2 
983  C CE1 . PHE A 128 ? 1.8471 1.8910 1.8387 -0.0168 -0.0030 0.0038  178 PHE A CE1 
984  C CE2 . PHE A 128 ? 1.8697 1.9121 1.8623 -0.0153 -0.0027 0.0035  178 PHE A CE2 
985  C CZ  . PHE A 128 ? 1.8738 1.9180 1.8655 -0.0169 -0.0027 0.0033  178 PHE A CZ  
986  N N   . PRO A 129 ? 1.4185 1.4596 1.4198 -0.0130 -0.0018 0.0063  179 PRO A N   
987  C CA  . PRO A 129 ? 1.3496 1.3895 1.3510 -0.0127 -0.0019 0.0064  179 PRO A CA  
988  C C   . PRO A 129 ? 1.4499 1.4874 1.4450 -0.0115 -0.0032 0.0057  179 PRO A C   
989  O O   . PRO A 129 ? 1.5094 1.5500 1.5106 -0.0122 -0.0014 0.0050  179 PRO A O   
990  C CB  . PRO A 129 ? 1.2595 1.2953 1.2542 -0.0103 -0.0020 0.0075  179 PRO A CB  
991  C CG  . PRO A 129 ? 1.2367 1.2766 1.2389 -0.0114 -0.0019 0.0071  179 PRO A CG  
992  C CD  . PRO A 129 ? 1.3212 1.3587 1.3154 -0.0109 -0.0019 0.0072  179 PRO A CD  
993  N N   . ILE A 130 ? 1.1629 1.2019 1.1581 -0.0126 -0.0030 0.0061  180 ILE A N   
994  C CA  . ILE A 130 ? 1.2554 1.2953 1.2507 -0.0127 -0.0026 0.0054  180 ILE A CA  
995  C C   . ILE A 130 ? 1.2859 1.3254 1.2819 -0.0120 -0.0026 0.0060  180 ILE A C   
996  O O   . ILE A 130 ? 1.1560 1.1961 1.1522 -0.0128 -0.0029 0.0072  180 ILE A O   
997  C CB  . ILE A 130 ? 1.5403 1.5827 1.5347 -0.0149 -0.0024 0.0049  180 ILE A CB  
998  C CG1 . ILE A 130 ? 1.4943 1.5371 1.4880 -0.0155 -0.0024 0.0043  180 ILE A CG1 
999  C CG2 . ILE A 130 ? 2.0057 2.0487 2.0002 -0.0147 -0.0019 0.0038  180 ILE A CG2 
1000 C CD1 . ILE A 130 ? 1.5067 1.5518 1.4994 -0.0179 -0.0020 0.0036  180 ILE A CD1 
1001 N N   . PHE A 131 ? 1.5910 1.6291 1.5874 -0.0104 -0.0024 0.0055  181 PHE A N   
1002 C CA  . PHE A 131 ? 1.7184 1.7562 1.7155 -0.0095 -0.0023 0.0060  181 PHE A CA  
1003 C C   . PHE A 131 ? 1.8139 1.8531 1.8112 -0.0097 -0.0019 0.0053  181 PHE A C   
1004 O O   . PHE A 131 ? 1.8329 1.8718 1.8299 -0.0093 -0.0016 0.0041  181 PHE A O   
1005 C CB  . PHE A 131 ? 1.6010 1.6355 1.5986 -0.0075 -0.0024 0.0060  181 PHE A CB  
1006 C CG  . PHE A 131 ? 1.5118 1.5456 1.5095 -0.0075 -0.0028 0.0069  181 PHE A CG  
1007 C CD1 . PHE A 131 ? 1.5313 1.5662 1.5346 -0.0074 -0.0015 0.0072  181 PHE A CD1 
1008 C CD2 . PHE A 131 ? 1.5038 1.5384 1.5011 -0.0086 -0.0030 0.0070  181 PHE A CD2 
1009 C CE1 . PHE A 131 ? 1.5805 1.6122 1.5777 -0.0070 -0.0018 0.0087  181 PHE A CE1 
1010 C CE2 . PHE A 131 ? 1.5728 1.6071 1.5703 -0.0087 -0.0033 0.0077  181 PHE A CE2 
1011 C CZ  . PHE A 131 ? 1.6345 1.6670 1.6313 -0.0080 -0.0021 0.0088  181 PHE A CZ  
1012 N N   . LEU A 132 ? 1.8578 1.8984 1.8557 -0.0101 -0.0018 0.0062  182 LEU A N   
1013 C CA  . LEU A 132 ? 1.6217 1.6633 1.6200 -0.0097 -0.0014 0.0057  182 LEU A CA  
1014 C C   . LEU A 132 ? 1.4471 1.4861 1.4461 -0.0074 -0.0015 0.0062  182 LEU A C   
1015 O O   . LEU A 132 ? 1.4572 1.4942 1.4564 -0.0067 -0.0018 0.0070  182 LEU A O   
1016 C CB  . LEU A 132 ? 1.5129 1.5546 1.5135 -0.0111 -0.0002 0.0062  182 LEU A CB  
1017 C CG  . LEU A 132 ? 0.8611 0.9028 0.8617 -0.0132 -0.0001 0.0068  182 LEU A CG  
1018 C CD1 . LEU A 132 ? 0.8767 0.9194 0.8763 -0.0148 0.0002  0.0054  182 LEU A CD1 
1019 C CD2 . LEU A 132 ? 0.8213 0.8611 0.8250 -0.0140 0.0014  0.0074  182 LEU A CD2 
1020 N N   . LEU A 133 ? 1.2592 1.2983 1.2583 -0.0066 -0.0012 0.0054  183 LEU A N   
1021 C CA  . LEU A 133 ? 1.2665 1.3030 1.2660 -0.0047 -0.0012 0.0056  183 LEU A CA  
1022 C C   . LEU A 133 ? 3.8658 3.9039 3.8659 -0.0041 -0.0008 0.0058  183 LEU A C   
1023 O O   . LEU A 133 ? 3.9066 3.9463 3.9080 -0.0050 0.0001  0.0051  183 LEU A O   
1024 C CB  . LEU A 133 ? 2.1757 2.2093 2.1744 -0.0039 -0.0013 0.0044  183 LEU A CB  
1025 C CG  . LEU A 133 ? 1.8840 1.9154 1.8822 -0.0039 -0.0017 0.0044  183 LEU A CG  
1026 C CD1 . LEU A 133 ? 1.8964 1.9388 1.8966 -0.0047 -0.0006 0.0053  183 LEU A CD1 
1027 C CD2 . LEU A 133 ? 1.8883 1.9217 1.8916 -0.0043 -0.0007 0.0053  183 LEU A CD2 
1028 N N   . GLU A 134 ? 3.1330 3.1688 3.1334 -0.0026 -0.0008 0.0064  184 GLU A N   
1029 C CA  . GLU A 134 ? 3.1233 3.1606 3.1244 -0.0018 -0.0004 0.0069  184 GLU A CA  
1030 C C   . GLU A 134 ? 2.8658 2.9041 2.8664 -0.0015 -0.0002 0.0050  184 GLU A C   
1031 O O   . GLU A 134 ? 2.8793 2.9163 2.8792 -0.0018 -0.0004 0.0037  184 GLU A O   
1032 C CB  . GLU A 134 ? 2.1956 2.2296 2.1968 -0.0005 -0.0004 0.0077  184 GLU A CB  
1033 C CG  . GLU A 134 ? 2.1826 2.2170 2.1844 0.0008  0.0001  0.0084  184 GLU A CG  
1034 C CD  . GLU A 134 ? 2.1760 2.2106 2.1810 0.0007  0.0013  0.0094  184 GLU A CD  
1035 O OE1 . GLU A 134 ? 2.1968 2.2316 2.2030 -0.0004 0.0014  0.0102  184 GLU A OE1 
1036 O OE2 . GLU A 134 ? 2.1445 2.1782 2.1514 0.0015  0.0023  0.0090  184 GLU A OE2 
1037 N N   . ASP A 135 ? 2.6644 2.7016 2.6673 -0.0007 0.0010  0.0044  185 ASP A N   
1038 C CA  . ASP A 135 ? 2.4109 2.4486 2.4143 -0.0004 0.0014  0.0024  185 ASP A CA  
1039 C C   . ASP A 135 ? 2.2235 2.2613 2.2235 0.0003  0.0000  0.0021  185 ASP A C   
1040 O O   . ASP A 135 ? 2.2507 2.2880 2.2503 -0.0002 -0.0002 0.0008  185 ASP A O   
1041 C CB  . ASP A 135 ? 2.3643 2.4008 2.3715 0.0004  0.0030  0.0020  185 ASP A CB  
1042 C CG  . ASP A 135 ? 2.4389 2.4741 2.4460 0.0015  0.0030  0.0038  185 ASP A CG  
1043 O OD1 . ASP A 135 ? 2.4714 2.5065 2.4750 0.0023  0.0016  0.0049  185 ASP A OD1 
1044 O OD2 . ASP A 135 ? 2.4606 2.4949 2.4713 0.0015  0.0043  0.0041  185 ASP A OD2 
1054 N N   . ASN A 137 ? 2.4369 2.4721 2.4367 0.0014  -0.0001 0.0031  187 ASN A N   
1055 C CA  . ASN A 137 ? 2.1703 2.2019 2.1693 0.0019  -0.0003 0.0027  187 ASN A CA  
1056 C C   . ASN A 137 ? 2.0895 2.1182 2.0879 0.0012  -0.0007 0.0024  187 ASN A C   
1057 O O   . ASN A 137 ? 2.0609 2.0916 2.0635 0.0013  0.0001  0.0015  187 ASN A O   
1062 N N   . GLU A 138 ? 2.0129 2.0410 2.0114 0.0008  -0.0008 0.0032  188 GLU A N   
1063 C CA  . GLU A 138 ? 2.0046 2.0327 2.0024 0.0002  0.0000  0.0033  188 GLU A CA  
1064 C C   . GLU A 138 ? 2.1115 2.1406 2.1090 -0.0004 0.0000  0.0024  188 GLU A C   
1065 O O   . GLU A 138 ? 1.9348 1.9669 1.9376 -0.0004 0.0000  0.0021  188 GLU A O   
1071 N N   . THR A 139 ? 1.9408 1.9714 1.9391 -0.0008 -0.0010 0.0017  189 THR A N   
1072 C CA  . THR A 139 ? 2.2739 2.3052 2.2719 -0.0015 -0.0010 0.0007  189 THR A CA  
1073 C C   . THR A 139 ? 2.5184 2.5494 2.5156 -0.0009 0.0000  0.0001  189 THR A C   
1074 O O   . THR A 139 ? 2.5941 2.6258 2.5912 -0.0011 0.0000  -0.0001 189 THR A O   
1078 N N   . LYS A 140 ? 3.0821 3.1125 3.0794 -0.0002 0.0000  -0.0002 190 LYS A N   
1079 C CA  . LYS A 140 ? 3.1256 3.1590 3.1284 0.0003  0.0000  -0.0007 190 LYS A CA  
1080 C C   . LYS A 140 ? 2.5002 2.5307 2.4975 0.0005  0.0000  0.0000  190 LYS A C   
1081 O O   . LYS A 140 ? 2.5235 2.5575 2.5264 0.0005  0.0000  -0.0004 190 LYS A O   
1087 N N   . VAL A 141 ? 2.2150 2.2554 2.2150 0.0009  0.0000  0.0012  191 VAL A N   
1088 C CA  . VAL A 141 ? 2.0225 2.0546 2.0252 0.0009  0.0000  0.0014  191 VAL A CA  
1089 C C   . VAL A 141 ? 1.8631 1.8933 1.8605 0.0002  0.0000  0.0017  191 VAL A C   
1090 O O   . VAL A 141 ? 1.7147 1.7480 1.7176 0.0004  0.0000  0.0016  191 VAL A O   
1094 N N   . ILE A 142 ? 2.1716 2.2050 2.1745 -0.0004 0.0000  0.0017  192 ILE A N   
1095 C CA  . ILE A 142 ? 2.3722 2.4036 2.3695 -0.0009 -0.0001 0.0020  192 ILE A CA  
1096 C C   . ILE A 142 ? 2.6738 2.7063 2.6708 -0.0012 0.0000  0.0012  192 ILE A C   
1097 O O   . ILE A 142 ? 2.7456 2.7818 2.7486 -0.0014 0.0000  0.0012  192 ILE A O   
1102 N N   . LYS A 143 ? 2.5586 2.5915 2.5555 -0.0012 0.0000  0.0004  193 LYS A N   
1103 C CA  . LYS A 143 ? 2.6506 2.6878 2.6536 -0.0016 0.0000  -0.0004 193 LYS A CA  
1104 C C   . LYS A 143 ? 2.7209 2.7582 2.7240 -0.0009 0.0000  -0.0004 193 LYS A C   
1105 O O   . LYS A 143 ? 2.7285 2.7765 2.7284 -0.0014 0.0000  -0.0008 193 LYS A O   
1111 N N   . GLN A 144 ? 2.6741 2.7103 2.6771 -0.0002 0.0000  -0.0002 194 GLN A N   
1112 C CA  . GLN A 144 ? 2.4283 2.4615 2.4253 0.0004  0.0000  -0.0002 194 GLN A CA  
1113 C C   . GLN A 144 ? 2.1077 2.1441 2.1108 0.0003  0.0000  0.0003  194 GLN A C   
1114 O O   . GLN A 144 ? 2.1112 2.1454 2.1080 0.0003  0.0000  0.0002  194 GLN A O   
1120 N N   . CYS A 145 ? 2.2249 2.2575 2.2219 0.0003  0.0000  0.0011  195 CYS A N   
1121 C CA  . CYS A 145 ? 2.0548 2.0878 2.0519 0.0000  0.0000  0.0016  195 CYS A CA  
1122 C C   . CYS A 145 ? 2.0467 2.0808 2.0437 -0.0006 0.0000  0.0014  195 CYS A C   
1123 O O   . CYS A 145 ? 2.0832 2.1173 2.0801 -0.0011 -0.0001 0.0017  195 CYS A O   
1126 N N   . TYR A 146 ? 2.0131 2.0484 2.0099 -0.0007 0.0000  0.0011  196 TYR A N   
1127 C CA  . TYR A 146 ? 1.9431 1.9831 1.9464 -0.0015 0.0000  0.0007  196 TYR A CA  
1128 C C   . TYR A 146 ? 2.2612 2.2990 2.2577 -0.0013 0.0000  0.0003  196 TYR A C   
1129 O O   . TYR A 146 ? 2.3248 2.3673 2.3283 -0.0017 0.0000  0.0004  196 TYR A O   
1138 N N   . GLN A 147 ? 2.1184 2.1595 2.1219 -0.0008 0.0000  -0.0002 197 GLN A N   
1139 C CA  . GLN A 147 ? 2.0549 2.0935 2.0514 -0.0005 0.0000  -0.0005 197 GLN A CA  
1140 C C   . GLN A 147 ? 1.9393 1.9913 1.9393 -0.0001 0.0000  0.0002  197 GLN A C   
1141 O O   . GLN A 147 ? 1.9693 2.0120 1.9729 0.0000  0.0000  0.0002  197 GLN A O   
1142 C CB  . GLN A 147 ? 2.0474 2.0857 2.0439 0.0000  0.0000  -0.0012 197 GLN A CB  
1143 C CG  . GLN A 147 ? 1.8414 1.8803 1.8380 -0.0003 0.0000  -0.0021 197 GLN A CG  
1144 C CD  . GLN A 147 ? 1.8293 1.8705 1.8329 -0.0003 0.0000  -0.0020 197 GLN A CD  
1145 O OE1 . GLN A 147 ? 1.9324 1.9688 1.9291 0.0000  0.0000  -0.0015 197 GLN A OE1 
1146 N NE2 . GLN A 147 ? 1.7783 1.8201 1.7820 -0.0007 0.0000  -0.0028 197 GLN A NE2 
1147 N N   . ASP A 148 ? 1.8137 1.8505 1.8104 0.0001  0.0000  0.0007  198 ASP A N   
1148 C CA  . ASP A 148 ? 1.6043 1.6438 1.6076 0.0004  0.0000  0.0012  198 ASP A CA  
1149 C C   . ASP A 148 ? 1.6639 1.7043 1.6673 -0.0002 0.0000  0.0016  198 ASP A C   
1150 O O   . ASP A 148 ? 1.7087 1.7489 1.7122 -0.0001 0.0000  0.0021  198 ASP A O   
1155 N N   . HIS A 149 ? 1.6830 1.7209 1.6796 -0.0007 0.0000  0.0015  199 HIS A N   
1156 C CA  . HIS A 149 ? 1.6309 1.6697 1.6274 -0.0013 -0.0001 0.0018  199 HIS A CA  
1157 C C   . HIS A 149 ? 1.7320 1.7727 1.7283 -0.0017 -0.0001 0.0014  199 HIS A C   
1158 O O   . HIS A 149 ? 1.6019 1.6435 1.5981 -0.0021 -0.0001 0.0018  199 HIS A O   
1165 N N   . ASN A 150 ? 1.5754 1.6167 1.5716 -0.0016 0.0000  0.0007  200 ASN A N   
1166 C CA  . ASN A 150 ? 1.8010 1.8480 1.8048 -0.0022 0.0000  0.0002  200 ASN A CA  
1167 C C   . ASN A 150 ? 2.1773 2.2257 2.1813 -0.0020 0.0000  0.0003  200 ASN A C   
1168 O O   . ASN A 150 ? 2.2646 2.3148 2.2687 -0.0025 0.0000  0.0001  200 ASN A O   
1219 N N   . PRO A 158 ? 2.1028 2.1529 2.1070 -0.0020 -0.0001 0.0019  208 PRO A N   
1220 C CA  . PRO A 158 ? 1.7998 1.8456 1.7957 -0.0021 -0.0001 0.0028  208 PRO A CA  
1221 C C   . PRO A 158 ? 1.8702 1.9153 1.8663 -0.0016 -0.0001 0.0034  208 PRO A C   
1222 O O   . PRO A 158 ? 1.7658 1.8114 1.7618 -0.0018 -0.0001 0.0039  208 PRO A O   
1223 C CB  . PRO A 158 ? 1.7211 1.7690 1.7167 -0.0027 -0.0002 0.0027  208 PRO A CB  
1224 C CG  . PRO A 158 ? 1.7226 1.7713 1.7180 -0.0029 -0.0001 0.0020  208 PRO A CG  
1225 C CD  . PRO A 158 ? 1.8873 1.9351 1.8829 -0.0021 -0.0001 0.0017  208 PRO A CD  
1226 N N   . THR A 159 ? 2.0322 2.0760 2.0284 -0.0010 -0.0001 0.0033  209 THR A N   
1227 C CA  . THR A 159 ? 2.1286 2.1755 2.1328 -0.0006 0.0000  0.0035  209 THR A CA  
1228 C C   . THR A 159 ? 2.2525 2.2939 2.2491 -0.0007 -0.0001 0.0040  209 THR A C   
1229 O O   . THR A 159 ? 2.2674 2.3120 2.2714 -0.0009 -0.0001 0.0034  209 THR A O   
1230 C CB  . THR A 159 ? 1.7640 1.8102 1.7681 0.0001  0.0000  0.0033  209 THR A CB  
1231 O OG1 . THR A 159 ? 1.8198 1.8650 1.8239 0.0005  0.0000  0.0037  209 THR A OG1 
1232 C CG2 . THR A 159 ? 1.7201 1.7614 1.7166 0.0002  0.0000  0.0031  209 THR A CG2 
1233 N N   . PHE A 160 ? 2.2707 2.3153 2.2749 -0.0006 -0.0001 0.0042  210 PHE A N   
1234 C CA  . PHE A 160 ? 2.2777 2.3175 2.2745 -0.0008 -0.0001 0.0048  210 PHE A CA  
1235 C C   . PHE A 160 ? 2.2159 2.2541 2.2130 -0.0004 0.0000  0.0049  210 PHE A C   
1236 O O   . PHE A 160 ? 2.2566 2.2975 2.2607 -0.0005 -0.0001 0.0048  210 PHE A O   
1237 C CB  . PHE A 160 ? 2.2374 2.2780 2.2342 -0.0012 -0.0001 0.0053  210 PHE A CB  
1238 C CG  . PHE A 160 ? 2.2082 2.2518 2.2125 -0.0016 -0.0002 0.0051  210 PHE A CG  
1239 C CD1 . PHE A 160 ? 2.2255 2.2645 2.2226 -0.0013 -0.0002 0.0060  210 PHE A CD1 
1240 C CD2 . PHE A 160 ? 2.1463 2.1865 2.1432 -0.0021 -0.0003 0.0055  210 PHE A CD2 
1241 C CE1 . PHE A 160 ? 2.1691 2.2111 2.1734 -0.0017 -0.0003 0.0057  210 PHE A CE1 
1242 C CE2 . PHE A 160 ? 2.1506 2.1939 2.1549 -0.0026 -0.0003 0.0053  210 PHE A CE2 
1243 C CZ  . PHE A 160 ? 2.1346 2.1770 2.1389 -0.0023 -0.0003 0.0057  210 PHE A CZ  
1244 N N   . PRO A 161 ? 2.0092 2.0468 2.0062 0.0000  0.0000  0.0045  211 PRO A N   
1245 C CA  . PRO A 161 ? 1.8455 1.8817 1.8427 0.0002  0.0000  0.0045  211 PRO A CA  
1246 C C   . PRO A 161 ? 1.7207 1.7568 1.7178 0.0000  0.0000  0.0041  211 PRO A C   
1247 O O   . PRO A 161 ? 1.6179 1.6537 1.6149 0.0002  0.0000  0.0037  211 PRO A O   
1248 C CB  . PRO A 161 ? 1.8291 1.8681 1.8328 0.0008  0.0001  0.0039  211 PRO A CB  
1249 C CG  . PRO A 161 ? 1.8937 1.9341 1.8975 0.0009  0.0001  0.0037  211 PRO A CG  
1250 C CD  . PRO A 161 ? 1.9861 2.0277 1.9900 0.0005  0.0000  0.0040  211 PRO A CD  
1251 N N   . LEU A 162 ? 1.9727 2.0125 1.9765 -0.0006 -0.0001 0.0039  212 LEU A N   
1252 C CA  . LEU A 162 ? 2.0992 2.1358 2.0962 -0.0009 -0.0001 0.0040  212 LEU A CA  
1253 C C   . LEU A 162 ? 2.2463 2.2851 2.2500 -0.0010 -0.0001 0.0037  212 LEU A C   
1254 O O   . LEU A 162 ? 2.1696 2.2041 2.1670 -0.0007 -0.0001 0.0044  212 LEU A O   
1255 C CB  . LEU A 162 ? 2.1278 2.1657 2.1247 -0.0015 -0.0001 0.0040  212 LEU A CB  
1256 C CG  . LEU A 162 ? 2.1066 2.1498 2.1105 -0.0019 -0.0002 0.0037  212 LEU A CG  
1257 C CD1 . LEU A 162 ? 2.0770 2.1212 2.0809 -0.0026 -0.0002 0.0039  212 LEU A CD1 
1258 C CD2 . LEU A 162 ? 2.1188 2.1591 2.1153 -0.0018 -0.0001 0.0033  212 LEU A CD2 
1259 N N   . CYS A 163 ? 2.2789 2.3145 2.2760 -0.0011 -0.0001 0.0037  213 CYS A N   
1260 C CA  . CYS A 163 ? 2.4200 2.4547 2.4172 -0.0012 -0.0001 0.0038  213 CYS A CA  
1261 C C   . CYS A 163 ? 2.3373 2.3722 2.3344 -0.0018 -0.0002 0.0041  213 CYS A C   
1262 O O   . CYS A 163 ? 2.3137 2.3496 2.3106 -0.0023 -0.0002 0.0039  213 CYS A O   
1263 C CB  . CYS A 163 ? 2.5917 2.6295 2.5951 -0.0011 -0.0001 0.0029  213 CYS A CB  
1264 S SG  . CYS A 163 ? 6.6449 6.6820 6.6482 -0.0015 -0.0001 0.0030  213 CYS A SG  
1265 N N   . ALA A 164 ? 2.1554 2.1894 2.1527 -0.0017 -0.0002 0.0045  214 ALA A N   
1266 C CA  . ALA A 164 ? 2.1085 2.1428 2.1058 -0.0023 -0.0003 0.0048  214 ALA A CA  
1267 C C   . ALA A 164 ? 1.9257 1.9622 1.9293 -0.0026 -0.0004 0.0046  214 ALA A C   
1268 O O   . ALA A 164 ? 1.7733 1.8087 1.7768 -0.0020 -0.0003 0.0046  214 ALA A O   
1269 C CB  . ALA A 164 ? 2.2408 2.2755 2.2381 -0.0026 -0.0004 0.0052  214 ALA A CB  
1270 N N   . MET A 165 ? 2.0606 2.1067 2.0612 -0.0041 -0.0006 0.0066  215 MET A N   
1271 C CA  . MET A 165 ? 2.0673 2.1127 2.0680 -0.0043 -0.0007 0.0071  215 MET A CA  
1272 C C   . MET A 165 ? 1.7680 1.8048 1.7717 -0.0041 -0.0006 0.0056  215 MET A C   
1273 O O   . MET A 165 ? 1.7330 1.7708 1.7367 -0.0046 -0.0007 0.0056  215 MET A O   
1274 C CB  . MET A 165 ? 2.3126 2.3494 2.3160 -0.0040 -0.0005 0.0049  215 MET A CB  
1275 C CG  . MET A 165 ? 2.2992 2.3448 2.2996 -0.0056 -0.0008 0.0070  215 MET A CG  
1276 S SD  . MET A 165 ? 2.3694 2.4016 2.3668 -0.0034 -0.0006 0.0054  215 MET A SD  
1277 C CE  . MET A 165 ? 2.0362 2.0803 2.0366 -0.0056 -0.0009 0.0069  215 MET A CE  
1278 N N   . GLN A 166 ? 1.8322 1.8651 1.8298 -0.0037 -0.0007 0.0066  216 GLN A N   
1279 C CA  . GLN A 166 ? 1.4864 1.5230 1.4904 -0.0047 -0.0008 0.0065  216 GLN A CA  
1280 C C   . GLN A 166 ? 1.4477 1.4839 1.4517 -0.0049 -0.0009 0.0067  216 GLN A C   
1281 O O   . GLN A 166 ? 1.4433 1.4872 1.4445 -0.0054 -0.0011 0.0092  216 GLN A O   
1282 C CB  . GLN A 166 ? 1.2465 1.2828 1.2506 -0.0045 -0.0008 0.0069  216 GLN A CB  
1283 C CG  . GLN A 166 ? 1.1488 1.1855 1.1529 -0.0052 -0.0010 0.0074  216 GLN A CG  
1284 C CD  . GLN A 166 ? 1.1023 1.1354 1.1004 -0.0045 -0.0011 0.0084  216 GLN A CD  
1285 O OE1 . GLN A 166 ? 1.0736 1.1064 1.0717 -0.0041 -0.0009 0.0083  216 GLN A OE1 
1286 N NE2 . GLN A 166 ? 1.0637 1.0967 1.0618 -0.0049 -0.0013 0.0089  216 GLN A NE2 
1287 N N   . LEU A 167 ? 1.4231 1.4689 1.4238 -0.0073 -0.0015 0.0094  217 LEU A N   
1288 C CA  . LEU A 167 ? 1.2963 1.3328 1.3001 -0.0063 -0.0012 0.0072  217 LEU A CA  
1289 C C   . LEU A 167 ? 0.9989 1.0357 1.0028 -0.0069 -0.0014 0.0078  217 LEU A C   
1290 O O   . LEU A 167 ? 0.8161 0.8504 0.8131 -0.0068 -0.0016 0.0085  217 LEU A O   
1291 C CB  . LEU A 167 ? 1.4856 1.5193 1.4824 -0.0064 -0.0014 0.0074  217 LEU A CB  
1292 C CG  . LEU A 167 ? 1.5629 1.5995 1.5664 -0.0073 -0.0014 0.0071  217 LEU A CG  
1293 C CD1 . LEU A 167 ? 1.6022 1.6481 1.6020 -0.0094 -0.0017 0.0088  217 LEU A CD1 
1294 C CD2 . LEU A 167 ? 1.5766 1.6137 1.5800 -0.0084 -0.0016 0.0076  217 LEU A CD2 
1295 N N   . PHE A 168 ? 1.1425 1.1787 1.1467 -0.0066 -0.0014 0.0082  218 PHE A N   
1296 C CA  . PHE A 168 ? 1.5458 1.5825 1.5501 -0.0072 -0.0017 0.0088  218 PHE A CA  
1297 C C   . PHE A 168 ? 0.5830 0.6161 0.5806 -0.0072 -0.0021 0.0101  218 PHE A C   
1298 O O   . PHE A 168 ? 0.5828 0.6187 0.5874 -0.0075 -0.0019 0.0095  218 PHE A O   
1299 C CB  . PHE A 168 ? 1.9459 1.9822 1.9505 -0.0066 -0.0016 0.0089  218 PHE A CB  
1300 C CG  . PHE A 168 ? 2.1401 2.1846 2.1424 -0.0079 -0.0022 0.0128  218 PHE A CG  
1301 C CD1 . PHE A 168 ? 2.3270 2.3587 2.3259 -0.0051 -0.0016 0.0103  218 PHE A CD1 
1302 C CD2 . PHE A 168 ? 2.2545 2.2872 2.2531 -0.0061 -0.0019 0.0108  218 PHE A CD2 
1303 C CE1 . PHE A 168 ? 2.4323 2.4671 2.4378 -0.0054 -0.0017 0.0099  218 PHE A CE1 
1304 C CE2 . PHE A 168 ? 2.3631 2.4076 2.3660 -0.0080 -0.0025 0.0141  218 PHE A CE2 
1305 C CZ  . PHE A 168 ? 2.4450 2.4801 2.4506 -0.0058 -0.0018 0.0103  218 PHE A CZ  
1306 N N   . SER A 169 ? 0.8894 0.9358 0.8901 -0.0113 -0.0030 0.0128  219 SER A N   
1307 C CA  . SER A 169 ? 0.8968 0.9341 0.9007 -0.0101 -0.0025 0.0099  219 SER A CA  
1308 C C   . SER A 169 ? 0.9418 0.9764 0.9381 -0.0103 -0.0031 0.0111  219 SER A C   
1309 O O   . SER A 169 ? 0.7599 0.7948 0.7555 -0.0112 -0.0032 0.0110  219 SER A O   
1310 C CB  . SER A 169 ? 0.9129 0.9500 0.9165 -0.0103 -0.0025 0.0096  219 SER A CB  
1311 O OG  . SER A 169 ? 0.9407 0.9877 0.9401 -0.0135 -0.0033 0.0123  219 SER A OG  
1312 N N   . HIS A 170 ? 0.9638 1.0116 0.9639 -0.0141 -0.0039 0.0143  220 HIS A N   
1313 C CA  . HIS A 170 ? 1.2142 1.2629 1.2137 -0.0156 -0.0043 0.0147  220 HIS A CA  
1314 C C   . HIS A 170 ? 1.2660 1.3051 1.2694 -0.0135 -0.0036 0.0114  220 HIS A C   
1315 O O   . HIS A 170 ? 1.2664 1.3013 1.2625 -0.0118 -0.0040 0.0130  220 HIS A O   
1316 C CB  . HIS A 170 ? 1.4091 1.4450 1.4052 -0.0110 -0.0034 0.0119  220 HIS A CB  
1317 C CG  . HIS A 170 ? 1.6400 1.6803 1.6433 -0.0134 -0.0034 0.0112  220 HIS A CG  
1318 N ND1 . HIS A 170 ? 1.7401 1.7766 1.7354 -0.0128 -0.0041 0.0129  220 HIS A ND1 
1319 C CD2 . HIS A 170 ? 1.7006 1.7418 1.7036 -0.0140 -0.0034 0.0110  220 HIS A CD2 
1320 C CE1 . HIS A 170 ? 1.8197 1.8607 1.8226 -0.0152 -0.0040 0.0120  220 HIS A CE1 
1321 N NE2 . HIS A 170 ? 1.7953 1.8369 1.7981 -0.0152 -0.0037 0.0115  220 HIS A NE2 
1322 N N   . MET A 171 ? 1.1218 1.1611 1.1245 -0.0148 -0.0038 0.0115  221 MET A N   
1323 C CA  . MET A 171 ? 1.3155 1.3537 1.3122 -0.0150 -0.0063 0.0128  221 MET A CA  
1324 C C   . MET A 171 ? 1.4935 1.5323 1.4898 -0.0159 -0.0067 0.0133  221 MET A C   
1325 O O   . MET A 171 ? 1.5484 1.5876 1.5440 -0.0164 -0.0067 0.0129  221 MET A O   
1326 C CB  . MET A 171 ? 1.4327 1.4727 1.4284 -0.0171 -0.0064 0.0131  221 MET A CB  
1327 C CG  . MET A 171 ? 1.3940 1.4340 1.3899 -0.0168 -0.0061 0.0128  221 MET A CG  
1328 S SD  . MET A 171 ? 4.0578 4.0979 4.0546 -0.0166 -0.0061 0.0136  221 MET A SD  
1329 C CE  . MET A 171 ? 3.2209 3.2593 3.2179 -0.0143 -0.0054 0.0120  221 MET A CE  
1330 N N   . HIS A 172 ? 1.7499 1.7887 1.7468 -0.0160 -0.0070 0.0140  222 HIS A N   
1331 C CA  . HIS A 172 ? 1.7899 1.8293 1.7865 -0.0169 -0.0074 0.0146  222 HIS A CA  
1332 C C   . HIS A 172 ? 1.2776 1.3189 1.2730 -0.0198 -0.0080 0.0156  222 HIS A C   
1333 O O   . HIS A 172 ? 1.2064 1.2485 1.2016 -0.0211 -0.0085 0.0166  222 HIS A O   
1334 C CB  . HIS A 172 ? 1.7598 1.7988 1.7573 -0.0163 -0.0076 0.0152  222 HIS A CB  
1335 C CG  . HIS A 172 ? 1.6830 1.7227 1.6870 -0.0157 -0.0049 0.0140  222 HIS A CG  
1336 N ND1 . HIS A 172 ? 1.6227 1.6587 1.6184 -0.0136 -0.0049 0.0146  222 HIS A ND1 
1337 C CD2 . HIS A 172 ? 1.6778 1.7266 1.6786 -0.0183 -0.0065 0.0195  222 HIS A CD2 
1338 C CE1 . HIS A 172 ? 1.6767 1.7163 1.6811 -0.0138 -0.0041 0.0132  222 HIS A CE1 
1339 N NE2 . HIS A 172 ? 1.7137 1.7491 1.7107 -0.0122 -0.0047 0.0150  222 HIS A NE2 
1340 N N   . ALA A 173 ? 1.3950 1.4370 1.3895 -0.0208 -0.0079 0.0152  223 ALA A N   
1341 C CA  . ALA A 173 ? 1.2249 1.2682 1.2179 -0.0236 -0.0084 0.0160  223 ALA A CA  
1342 C C   . ALA A 173 ? 1.1740 1.2178 1.1660 -0.0243 -0.0080 0.0152  223 ALA A C   
1343 O O   . ALA A 173 ? 1.1009 1.1443 1.0933 -0.0233 -0.0076 0.0145  223 ALA A O   
1344 C CB  . ALA A 173 ? 1.1420 1.1859 1.1349 -0.0254 -0.0089 0.0173  223 ALA A CB  
1345 N N   . VAL A 174 ? 1.1675 1.2121 1.1582 -0.0261 -0.0083 0.0153  224 VAL A N   
1346 C CA  . VAL A 174 ? 1.2313 1.2766 1.2212 -0.0267 -0.0079 0.0145  224 VAL A CA  
1347 C C   . VAL A 174 ? 1.3499 1.3963 1.3379 -0.0296 -0.0084 0.0150  224 VAL A C   
1348 O O   . VAL A 174 ? 1.2742 1.3206 1.2616 -0.0311 -0.0090 0.0160  224 VAL A O   
1349 C CB  . VAL A 174 ? 2.4128 2.4573 2.4035 -0.0243 -0.0075 0.0133  224 VAL A CB  
1350 C CG1 . VAL A 174 ? 2.2991 2.3425 2.2910 -0.0220 -0.0070 0.0126  224 VAL A CG1 
1351 C CG2 . VAL A 174 ? 2.4595 2.5036 2.4507 -0.0234 -0.0076 0.0134  224 VAL A CG2 
1352 N N   . ILE A 175 ? 1.1648 1.2118 1.1517 -0.0307 -0.0081 0.0143  225 ILE A N   
1353 C CA  . ILE A 175 ? 1.1551 1.2030 1.1402 -0.0332 -0.0083 0.0144  225 ILE A CA  
1354 C C   . ILE A 175 ? 1.1552 1.2031 1.1385 -0.0363 -0.0088 0.0154  225 ILE A C   
1355 O O   . ILE A 175 ? 1.1885 1.2365 1.1705 -0.0380 -0.0087 0.0151  225 ILE A O   
1356 C CB  . ILE A 175 ? 2.8685 2.9168 2.8537 -0.0329 -0.0085 0.0145  225 ILE A CB  
1357 C CG1 . ILE A 175 ? 2.9883 3.0373 2.9732 -0.0327 -0.0081 0.0136  225 ILE A CG1 
1358 C CG2 . ILE A 175 ? 2.7840 2.8326 2.7675 -0.0357 -0.0091 0.0154  225 ILE A CG2 
1359 C CD1 . ILE A 175 ? 3.0418 3.0904 3.0280 -0.0301 -0.0075 0.0126  225 ILE A CD1 
1360 N N   . SER A 176 ? 1.4153 1.4628 1.3985 -0.0370 -0.0095 0.0165  226 SER A N   
1361 C CA  . SER A 176 ? 1.4644 1.5114 1.4458 -0.0400 -0.0102 0.0176  226 SER A CA  
1362 C C   . SER A 176 ? 1.3909 1.4373 1.3730 -0.0400 -0.0109 0.0189  226 SER A C   
1363 O O   . SER A 176 ? 1.2634 1.3099 1.2472 -0.0378 -0.0108 0.0189  226 SER A O   
1364 C CB  . SER A 176 ? 1.5365 1.5832 1.5157 -0.0429 -0.0102 0.0177  226 SER A CB  
1365 O OG  . SER A 176 ? 1.6697 1.7173 1.6487 -0.0430 -0.0107 0.0179  226 SER A OG  
1366 N N   . THR A 177 ? 1.4212 1.4650 1.4038 -0.0414 -0.0101 0.0196  227 THR A N   
1367 C CA  . THR A 177 ? 1.5032 1.5455 1.4870 -0.0413 -0.0103 0.0208  227 THR A CA  
1368 C C   . THR A 177 ? 2.0239 2.0670 2.0069 -0.0421 -0.0113 0.0215  227 THR A C   
1369 O O   . THR A 177 ? 2.0284 2.0720 2.0123 -0.0410 -0.0120 0.0222  227 THR A O   
1370 C CB  . THR A 177 ? 1.2288 1.2676 1.2132 -0.0428 -0.0091 0.0213  227 THR A CB  
1371 O OG1 . THR A 177 ? 1.0650 1.1030 1.0478 -0.0449 -0.0085 0.0207  227 THR A OG1 
1372 C CG2 . THR A 177 ? 1.2473 1.2850 1.2334 -0.0415 -0.0082 0.0209  227 THR A CG2 
1373 N N   . ALA A 178 ? 1.9423 1.9854 1.9235 -0.0440 -0.0113 0.0214  228 ALA A N   
1374 C CA  . ALA A 178 ? 2.4264 2.4703 2.4067 -0.0449 -0.0122 0.0220  228 ALA A CA  
1375 C C   . ALA A 178 ? 2.8581 2.9045 2.8390 -0.0430 -0.0131 0.0219  228 ALA A C   
1376 O O   . ALA A 178 ? 2.8963 2.9427 2.8778 -0.0428 -0.0136 0.0226  228 ALA A O   
1377 C CB  . ALA A 178 ? 2.4698 2.5138 2.4481 -0.0470 -0.0120 0.0216  228 ALA A CB  
1378 N N   . THR A 179 ? 2.5897 2.6366 2.5717 -0.0408 -0.0122 0.0205  229 THR A N   
1379 C CA  . THR A 179 ? 2.6819 2.7292 2.6659 -0.0380 -0.0117 0.0198  229 THR A CA  
1380 C C   . THR A 179 ? 2.9300 2.9767 2.9159 -0.0358 -0.0116 0.0200  229 THR A C   
1381 O O   . THR A 179 ? 2.9139 2.9607 2.9008 -0.0348 -0.0117 0.0202  229 THR A O   
1382 C CB  . THR A 179 ? 2.7389 2.7866 2.7233 -0.0364 -0.0108 0.0184  229 THR A CB  
1383 O OG1 . THR A 179 ? 2.7801 2.8273 2.7652 -0.0353 -0.0104 0.0179  229 THR A OG1 
1384 C CG2 . THR A 179 ? 2.7300 2.7783 2.7123 -0.0388 -0.0109 0.0182  229 THR A CG2 
1385 N N   . CYS A 180 ? 2.8282 2.8746 2.8148 -0.0350 -0.0114 0.0200  230 CYS A N   
1386 C CA  . CYS A 180 ? 3.0793 3.1252 3.0679 -0.0329 -0.0113 0.0202  230 CYS A CA  
1387 C C   . CYS A 180 ? 2.9123 2.9581 2.9006 -0.0346 -0.0123 0.0218  230 CYS A C   
1388 O O   . CYS A 180 ? 3.0273 3.0731 3.0166 -0.0334 -0.0123 0.0220  230 CYS A O   
1389 C CB  . CYS A 180 ? 3.2777 3.3232 3.2673 -0.0314 -0.0108 0.0197  230 CYS A CB  
1390 S SG  . CYS A 180 ? 2.2534 2.2988 2.2418 -0.0337 -0.0113 0.0206  230 CYS A SG  
1391 N N   . MET A 181 ? 3.1804 3.2261 3.1668 -0.0376 -0.0131 0.0228  231 MET A N   
1392 C CA  . MET A 181 ? 2.6240 2.6695 2.6102 -0.0392 -0.0141 0.0245  231 MET A CA  
1393 C C   . MET A 181 ? 2.1719 2.2177 2.1581 -0.0393 -0.0144 0.0247  231 MET A C   
1394 O O   . MET A 181 ? 1.8792 1.9251 1.8666 -0.0385 -0.0146 0.0253  231 MET A O   
1395 C CB  . MET A 181 ? 2.4058 2.4481 2.3913 -0.0415 -0.0131 0.0249  231 MET A CB  
1396 C CG  . MET A 181 ? 2.2758 2.3157 2.2625 -0.0413 -0.0119 0.0249  231 MET A CG  
1397 S SD  . MET A 181 ? 1.4877 1.5274 1.4768 -0.0395 -0.0121 0.0259  231 MET A SD  
1398 C CE  . MET A 181 ? 1.5026 1.5441 1.4928 -0.0369 -0.0120 0.0247  231 MET A CE  
1399 N N   . ARG A 182 ? 2.2281 2.2743 2.2129 -0.0403 -0.0142 0.0240  232 ARG A N   
1400 C CA  . ARG A 182 ? 2.2377 2.2843 2.2222 -0.0406 -0.0144 0.0241  232 ARG A CA  
1401 C C   . ARG A 182 ? 2.4039 2.4507 2.3905 -0.0376 -0.0137 0.0234  232 ARG A C   
1402 O O   . ARG A 182 ? 2.4535 2.5004 2.4406 -0.0376 -0.0141 0.0240  232 ARG A O   
1403 C CB  . ARG A 182 ? 2.1054 2.1524 2.0882 -0.0418 -0.0141 0.0234  232 ARG A CB  
1404 C CG  . ARG A 182 ? 2.0012 2.0486 1.9851 -0.0394 -0.0131 0.0218  232 ARG A CG  
1405 C CD  . ARG A 182 ? 1.8698 1.9177 1.8521 -0.0408 -0.0130 0.0214  232 ARG A CD  
1406 N NE  . ARG A 182 ? 1.6431 1.6910 1.6235 -0.0437 -0.0138 0.0224  232 ARG A NE  
1407 C CZ  . ARG A 182 ? 1.4756 1.5233 1.4537 -0.0464 -0.0142 0.0227  232 ARG A CZ  
1408 N NH1 . ARG A 182 ? 1.4443 1.4921 1.4219 -0.0466 -0.0137 0.0220  232 ARG A NH1 
1409 N NH2 . ARG A 182 ? 1.5045 1.5519 1.4807 -0.0491 -0.0150 0.0237  232 ARG A NH2 
1410 N N   . ARG A 183 ? 2.0388 2.0854 2.0268 -0.0350 -0.0128 0.0221  233 ARG A N   
1411 C CA  . ARG A 183 ? 2.0289 2.0754 2.0186 -0.0323 -0.0122 0.0213  233 ARG A CA  
1412 C C   . ARG A 183 ? 1.9904 2.0368 1.9812 -0.0317 -0.0126 0.0221  233 ARG A C   
1413 O O   . ARG A 183 ? 1.9401 1.9862 1.9318 -0.0301 -0.0122 0.0215  233 ARG A O   
1414 C CB  . ARG A 183 ? 1.9705 2.0163 1.9613 -0.0299 -0.0114 0.0201  233 ARG A CB  
1415 C CG  . ARG A 183 ? 2.1470 2.1922 2.1395 -0.0279 -0.0112 0.0201  233 ARG A CG  
1416 C CD  . ARG A 183 ? 2.2208 2.2657 2.2137 -0.0280 -0.0113 0.0207  233 ARG A CD  
1417 N NE  . ARG A 183 ? 2.1810 2.2263 2.1739 -0.0298 -0.0122 0.0224  233 ARG A NE  
1418 C CZ  . ARG A 183 ? 2.1379 2.1832 2.1306 -0.0311 -0.0127 0.0235  233 ARG A CZ  
1419 N NH1 . ARG A 183 ? 2.0818 2.1272 2.0744 -0.0327 -0.0136 0.0251  233 ARG A NH1 
1420 N NH2 . ARG A 183 ? 2.1793 2.2243 2.1719 -0.0308 -0.0123 0.0230  233 ARG A NH2 
1421 N N   . SER A 184 ? 1.9872 2.0336 1.9776 -0.0336 -0.0134 0.0236  234 SER A N   
1422 C CA  . SER A 184 ? 1.7048 1.7513 1.6964 -0.0332 -0.0138 0.0245  234 SER A CA  
1423 C C   . SER A 184 ? 1.5388 1.5857 1.5295 -0.0347 -0.0144 0.0252  234 SER A C   
1424 O O   . SER A 184 ? 1.4357 1.4827 1.4273 -0.0332 -0.0141 0.0248  234 SER A O   
1425 C CB  . SER A 184 ? 1.5958 1.6420 1.5874 -0.0345 -0.0145 0.0259  234 SER A CB  
1426 O OG  . SER A 184 ? 1.5232 1.5695 1.5164 -0.0336 -0.0148 0.0268  234 SER A OG  
1451 N N   . VAL A 189 ? 0.8711 0.9129 0.8680 -0.0205 -0.0093 0.0183  247 VAL A N   
1452 C CA  . VAL A 189 ? 0.8577 0.9007 0.8542 -0.0230 -0.0101 0.0200  247 VAL A CA  
1453 C C   . VAL A 189 ? 0.8702 0.9136 0.8660 -0.0243 -0.0102 0.0202  247 VAL A C   
1454 O O   . VAL A 189 ? 0.6485 0.6916 0.6439 -0.0236 -0.0097 0.0191  247 VAL A O   
1455 C CB  . VAL A 189 ? 0.4922 0.5351 0.4901 -0.0224 -0.0104 0.0209  247 VAL A CB  
1456 C CG1 . VAL A 189 ? 0.1156 0.1584 0.1137 -0.0217 -0.0104 0.0207  247 VAL A CG1 
1457 C CG2 . VAL A 189 ? 0.7513 0.7951 0.7490 -0.0248 -0.0114 0.0229  247 VAL A CG2 
1458 N N   . CYS A 190 ? 1.2378 1.2818 1.2332 -0.0265 -0.0110 0.0218  248 CYS A N   
1459 C CA  . CYS A 190 ? 1.3712 1.4154 1.3657 -0.0280 -0.0111 0.0220  248 CYS A CA  
1460 C C   . CYS A 190 ? 1.5145 1.5588 1.5094 -0.0294 -0.0121 0.0239  248 CYS A C   
1461 O O   . CYS A 190 ? 1.5832 1.6276 1.5786 -0.0298 -0.0126 0.0249  248 CYS A O   
1462 C CB  . CYS A 190 ? 1.3196 1.3642 1.3118 -0.0306 -0.0115 0.0221  248 CYS A CB  
1463 S SG  . CYS A 190 ? 2.0675 2.1123 2.0590 -0.0297 -0.0107 0.0202  248 CYS A SG  
1464 N N   . ASP A 191 ? 1.5230 1.5657 1.5185 -0.0300 -0.0112 0.0241  249 ASP A N   
1465 C CA  . ASP A 191 ? 1.2916 1.3318 1.2884 -0.0306 -0.0107 0.0253  249 ASP A CA  
1466 C C   . ASP A 191 ? 1.1876 1.2245 1.1843 -0.0324 -0.0093 0.0253  249 ASP A C   
1467 O O   . ASP A 191 ? 1.0598 1.0962 1.0561 -0.0325 -0.0084 0.0243  249 ASP A O   
1468 C CB  . ASP A 191 ? 1.4689 1.5095 1.4679 -0.0284 -0.0105 0.0257  249 ASP A CB  
1469 C CG  . ASP A 191 ? 1.6113 1.6533 1.6114 -0.0276 -0.0117 0.0268  249 ASP A CG  
1470 O OD1 . ASP A 191 ? 1.6994 1.7411 1.6989 -0.0291 -0.0121 0.0276  249 ASP A OD1 
1471 O OD2 . ASP A 191 ? 1.6605 1.7040 1.6620 -0.0255 -0.0120 0.0268  249 ASP A OD2 
1472 N N   . PRO A 192 ? 1.4164 1.4509 1.4134 -0.0339 -0.0090 0.0265  250 PRO A N   
1473 C CA  . PRO A 192 ? 1.5589 1.5894 1.5557 -0.0356 -0.0076 0.0267  250 PRO A CA  
1474 C C   . PRO A 192 ? 1.5488 1.5779 1.5473 -0.0344 -0.0064 0.0264  250 PRO A C   
1475 O O   . PRO A 192 ? 1.6292 1.6590 1.6294 -0.0326 -0.0066 0.0269  250 PRO A O   
1476 C CB  . PRO A 192 ? 1.6536 1.6819 1.6507 -0.0368 -0.0078 0.0284  250 PRO A CB  
1477 C CG  . PRO A 192 ? 1.6758 1.7072 1.6722 -0.0366 -0.0093 0.0287  250 PRO A CG  
1478 C CD  . PRO A 192 ? 1.5516 1.5867 1.5487 -0.0342 -0.0100 0.0278  250 PRO A CD  
1479 N N   . LEU A 193 ? 1.4499 1.4770 1.4482 -0.0353 -0.0052 0.0256  251 LEU A N   
1480 C CA  . LEU A 193 ? 1.4100 1.4350 1.4099 -0.0347 -0.0039 0.0252  251 LEU A CA  
1481 C C   . LEU A 193 ? 1.3958 1.4165 1.3966 -0.0356 -0.0031 0.0266  251 LEU A C   
1482 O O   . LEU A 193 ? 1.5500 1.5681 1.5497 -0.0378 -0.0028 0.0271  251 LEU A O   
1483 C CB  . LEU A 193 ? 1.4300 1.4542 1.4293 -0.0356 -0.0029 0.0239  251 LEU A CB  
1484 C CG  . LEU A 193 ? 1.4982 1.5197 1.4993 -0.0353 -0.0014 0.0236  251 LEU A CG  
1485 C CD1 . LEU A 193 ? 1.5889 1.6122 1.5915 -0.0328 -0.0016 0.0235  251 LEU A CD1 
1486 C CD2 . LEU A 193 ? 1.4895 1.5112 1.4900 -0.0361 -0.0006 0.0220  251 LEU A CD2 
1487 N N   . SER A 194 ? 1.3063 1.3260 1.3089 -0.0342 -0.0027 0.0272  252 SER A N   
1488 C CA  . SER A 194 ? 1.4378 1.4529 1.4408 -0.0353 -0.0020 0.0286  252 SER A CA  
1489 C C   . SER A 194 ? 1.6927 1.7064 1.6975 -0.0337 -0.0015 0.0293  252 SER A C   
1490 O O   . SER A 194 ? 1.7490 1.7650 1.7550 -0.0318 -0.0015 0.0285  252 SER A O   
1491 C CB  . SER A 194 ? 1.4922 1.5068 1.4940 -0.0365 -0.0030 0.0299  252 SER A CB  
1492 O OG  . SER A 194 ? 1.5260 1.5355 1.5279 -0.0377 -0.0022 0.0313  252 SER A OG  
1493 N N   . ASP A 195 ? 1.4592 1.4688 1.4639 -0.0346 -0.0013 0.0308  253 ASP A N   
1494 C CA  . ASP A 195 ? 1.5327 1.5403 1.5387 -0.0332 -0.0009 0.0318  253 ASP A CA  
1495 C C   . ASP A 195 ? 1.6214 1.6233 1.6265 -0.0346 -0.0005 0.0336  253 ASP A C   
1496 O O   . ASP A 195 ? 1.6354 1.6363 1.6392 -0.0363 -0.0010 0.0343  253 ASP A O   
1497 C CB  . ASP A 195 ? 4.8804 4.8870 4.8876 -0.0322 0.0004  0.0306  253 ASP A CB  
1498 C CG  . ASP A 195 ? 4.7829 4.7873 4.7913 -0.0307 0.0009  0.0315  253 ASP A CG  
1499 O OD1 . ASP A 195 ? 4.7441 4.7445 4.7528 -0.0308 0.0022  0.0311  253 ASP A OD1 
1500 O OD2 . ASP A 195 ? 4.7239 4.7302 4.7328 -0.0295 -0.0002 0.0326  253 ASP A OD2 
1501 N N   . TYR A 196 ? 1.9206 1.9185 1.9264 -0.0338 0.0004  0.0342  254 TYR A N   
1502 C CA  . TYR A 196 ? 2.0543 2.0460 2.0591 -0.0345 0.0008  0.0360  254 TYR A CA  
1503 C C   . TYR A 196 ? 1.6560 1.6414 1.6606 -0.0351 0.0024  0.0357  254 TYR A C   
1504 O O   . TYR A 196 ? 1.5131 1.4984 1.5188 -0.0341 0.0033  0.0345  254 TYR A O   
1505 C CB  . TYR A 196 ? 2.5807 2.5734 2.5861 -0.0328 -0.0001 0.0375  254 TYR A CB  
1506 C CG  . TYR A 196 ? 2.6777 2.6755 2.6831 -0.0330 -0.0017 0.0379  254 TYR A CG  
1507 C CD1 . TYR A 196 ? 2.7503 2.7465 2.7541 -0.0350 -0.0022 0.0388  254 TYR A CD1 
1508 C CD2 . TYR A 196 ? 2.7614 2.7656 2.7683 -0.0314 -0.0027 0.0372  254 TYR A CD2 
1509 C CE1 . TYR A 196 ? 2.7372 2.7380 2.7409 -0.0353 -0.0036 0.0391  254 TYR A CE1 
1510 C CE2 . TYR A 196 ? 2.7768 2.7854 2.7837 -0.0316 -0.0041 0.0374  254 TYR A CE2 
1511 C CZ  . TYR A 196 ? 2.7748 2.7815 2.7799 -0.0336 -0.0045 0.0383  254 TYR A CZ  
1512 O OH  . TYR A 196 ? 2.7369 2.7479 2.7419 -0.0339 -0.0060 0.0385  254 TYR A OH  
1513 N N   . ASN A 197 ? 1.8107 1.7910 1.8138 -0.0369 0.0027  0.0367  255 ASN A N   
1514 C CA  . ASN A 197 ? 1.6689 1.6417 1.6715 -0.0376 0.0040  0.0370  255 ASN A CA  
1515 C C   . ASN A 197 ? 1.6818 1.6497 1.6836 -0.0361 0.0040  0.0388  255 ASN A C   
1516 O O   . ASN A 197 ? 1.8280 1.7985 1.8297 -0.0348 0.0029  0.0400  255 ASN A O   
1517 C CB  . ASN A 197 ? 1.5396 1.5094 1.5411 -0.0401 0.0042  0.0373  255 ASN A CB  
1518 C CG  . ASN A 197 ? 1.4489 1.4183 1.4512 -0.0415 0.0052  0.0355  255 ASN A CG  
1519 O OD1 . ASN A 197 ? 1.3878 1.3557 1.3896 -0.0436 0.0054  0.0353  255 ASN A OD1 
1520 N ND2 . ASN A 197 ? 1.4318 1.4027 1.4355 -0.0404 0.0059  0.0340  255 ASN A ND2 
1521 N N   . VAL A 198 ? 1.4639 1.4248 1.4651 -0.0363 0.0052  0.0390  256 VAL A N   
1522 C CA  . VAL A 198 ? 1.2905 1.2456 1.2904 -0.0347 0.0051  0.0407  256 VAL A CA  
1523 C C   . VAL A 198 ? 1.4125 1.3597 1.4110 -0.0358 0.0059  0.0417  256 VAL A C   
1524 O O   . VAL A 198 ? 1.2832 1.2269 1.2821 -0.0373 0.0068  0.0408  256 VAL A O   
1525 C CB  . VAL A 198 ? 1.1010 1.0549 1.1016 -0.0330 0.0051  0.0403  256 VAL A CB  
1526 C CG1 . VAL A 198 ? 1.0485 1.0088 1.0500 -0.0308 0.0044  0.0401  256 VAL A CG1 
1527 C CG2 . VAL A 198 ? 0.9370 0.8911 0.9390 -0.0343 0.0059  0.0384  256 VAL A CG2 
1528 N N   . TRP A 199 ? 1.4789 1.4231 1.4759 -0.0350 0.0052  0.0439  257 TRP A N   
1529 C CA  . TRP A 199 ? 1.8241 1.7606 1.8197 -0.0358 0.0057  0.0452  257 TRP A CA  
1530 C C   . TRP A 199 ? 2.3032 2.2337 2.2977 -0.0340 0.0046  0.0475  257 TRP A C   
1531 O O   . TRP A 199 ? 2.3184 2.2511 2.3127 -0.0318 0.0035  0.0486  257 TRP A O   
1532 C CB  . TRP A 199 ? 1.7934 1.7314 1.7881 -0.0370 0.0049  0.0467  257 TRP A CB  
1533 C CG  . TRP A 199 ? 1.9615 1.8932 1.9550 -0.0381 0.0054  0.0479  257 TRP A CG  
1534 C CD1 . TRP A 199 ? 1.9799 1.9054 1.9717 -0.0369 0.0053  0.0500  257 TRP A CD1 
1535 C CD2 . TRP A 199 ? 2.1762 2.1075 2.1699 -0.0408 0.0058  0.0475  257 TRP A CD2 
1536 N NE1 . TRP A 199 ? 2.1244 2.0449 2.1155 -0.0387 0.0060  0.0507  257 TRP A NE1 
1537 C CE2 . TRP A 199 ? 2.2944 2.2184 2.2866 -0.0412 0.0062  0.0492  257 TRP A CE2 
1538 C CE3 . TRP A 199 ? 2.2983 2.2344 2.2931 -0.0429 0.0058  0.0458  257 TRP A CE3 
1539 C CZ2 . TRP A 199 ? 2.5170 2.4386 2.5091 -0.0437 0.0066  0.0493  257 TRP A CZ2 
1540 C CZ3 . TRP A 199 ? 2.4402 2.3739 2.4347 -0.0453 0.0061  0.0458  257 TRP A CZ3 
1541 C CH2 . TRP A 199 ? 2.5506 2.4772 2.5438 -0.0458 0.0065  0.0475  257 TRP A CH2 
1542 N N   . SER A 200 ? 1.9952 1.9180 1.9890 -0.0348 0.0049  0.0483  258 SER A N   
1543 C CA  . SER A 200 ? 1.9630 1.8786 1.9559 -0.0331 0.0040  0.0501  258 SER A CA  
1544 C C   . SER A 200 ? 2.2065 2.1145 2.1984 -0.0345 0.0048  0.0509  258 SER A C   
1545 O O   . SER A 200 ? 2.1887 2.0961 2.1813 -0.0369 0.0060  0.0495  258 SER A O   
1546 C CB  . SER A 200 ? 1.9011 1.8153 1.8955 -0.0318 0.0035  0.0492  258 SER A CB  
1547 O OG  . SER A 200 ? 1.8118 1.7330 1.8076 -0.0304 0.0027  0.0485  258 SER A OG  
1548 N N   . MET A 201 ? 2.2260 2.1280 2.2164 -0.0329 0.0042  0.0531  259 MET A N   
1549 C CA  . MET A 201 ? 2.5761 2.4700 2.5656 -0.0339 0.0050  0.0538  259 MET A CA  
1550 C C   . MET A 201 ? 2.5853 2.4727 2.5742 -0.0311 0.0041  0.0551  259 MET A C   
1551 O O   . MET A 201 ? 2.6334 2.5226 2.6219 -0.0285 0.0028  0.0564  259 MET A O   
1552 C CB  . MET A 201 ? 3.0325 2.9260 3.0205 -0.0349 0.0055  0.0554  259 MET A CB  
1553 C CG  . MET A 201 ? 3.3928 3.2775 3.3797 -0.0354 0.0061  0.0568  259 MET A CG  
1554 S SD  . MET A 201 ? 2.9660 2.8453 2.9547 -0.0374 0.0073  0.0547  259 MET A SD  
1555 C CE  . MET A 201 ? 1.6848 1.5534 1.6722 -0.0351 0.0071  0.0565  259 MET A CE  
1556 N N   . LEU A 202 ? 2.7394 2.6194 2.7284 -0.0315 0.0047  0.0546  260 LEU A N   
1557 C CA  . LEU A 202 ? 2.5810 2.4534 2.5692 -0.0288 0.0040  0.0557  260 LEU A CA  
1558 C C   . LEU A 202 ? 2.0682 1.9355 2.0543 -0.0276 0.0040  0.0585  260 LEU A C   
1559 O O   . LEU A 202 ? 2.1111 1.9706 2.0965 -0.0278 0.0048  0.0589  260 LEU A O   
1560 C CB  . LEU A 202 ? 2.4454 2.3123 2.4349 -0.0300 0.0049  0.0536  260 LEU A CB  
1561 C CG  . LEU A 202 ? 2.3429 2.2009 2.3320 -0.0279 0.0049  0.0535  260 LEU A CG  
1562 C CD1 . LEU A 202 ? 2.2751 2.1346 2.2649 -0.0246 0.0033  0.0532  260 LEU A CD1 
1563 C CD2 . LEU A 202 ? 2.2823 2.1376 2.2731 -0.0307 0.0062  0.0508  260 LEU A CD2 
1564 N N   . LYS A 203 ? 2.3299 2.2015 2.3149 -0.0264 0.0031  0.0603  261 LYS A N   
1565 C CA  . LYS A 203 ? 2.1949 2.0618 2.1778 -0.0253 0.0030  0.0630  261 LYS A CA  
1566 C C   . LYS A 203 ? 2.2029 2.0636 2.1851 -0.0218 0.0021  0.0642  261 LYS A C   
1567 O O   . LYS A 203 ? 2.2297 2.0871 2.2130 -0.0208 0.0020  0.0628  261 LYS A O   
1609 N N   . VAL A 209 ? 1.9662 1.8484 1.9611 -0.0484 0.0107  0.0487  275 VAL A N   
1610 C CA  . VAL A 209 ? 2.0303 1.9131 2.0268 -0.0513 0.0113  0.0474  275 VAL A CA  
1611 C C   . VAL A 209 ? 2.0270 1.9098 2.0257 -0.0524 0.0112  0.0448  275 VAL A C   
1612 O O   . VAL A 209 ? 2.0810 1.9664 2.0812 -0.0548 0.0114  0.0430  275 VAL A O   
1613 C CB  . VAL A 209 ? 1.5493 1.4249 1.5452 -0.0523 0.0118  0.0491  275 VAL A CB  
1614 C CG1 . VAL A 209 ? 1.5189 1.3948 1.5126 -0.0512 0.0118  0.0516  275 VAL A CG1 
1615 C CG2 . VAL A 209 ? 1.5988 1.4658 1.5948 -0.0513 0.0119  0.0495  275 VAL A CG2 
1616 N N   . VAL A 210 ? 1.8363 1.7166 1.8348 -0.0506 0.0108  0.0445  276 VAL A N   
1617 C CA  . VAL A 210 ? 1.9142 1.7957 1.9147 -0.0512 0.0106  0.0419  276 VAL A CA  
1618 C C   . VAL A 210 ? 2.0958 1.9857 2.0966 -0.0505 0.0103  0.0408  276 VAL A C   
1619 O O   . VAL A 210 ? 2.0474 1.9388 2.0468 -0.0481 0.0098  0.0421  276 VAL A O   
1620 C CB  . VAL A 210 ? 2.0143 1.8884 2.0149 -0.0497 0.0104  0.0417  276 VAL A CB  
1621 C CG1 . VAL A 210 ? 2.0493 1.9250 2.0521 -0.0508 0.0102  0.0386  276 VAL A CG1 
1622 C CG2 . VAL A 210 ? 2.0534 1.9188 2.0538 -0.0501 0.0109  0.0427  276 VAL A CG2 
1623 N N   . VAL A 211 ? 2.2867 2.1823 2.2893 -0.0524 0.0103  0.0386  277 VAL A N   
1624 C CA  . VAL A 211 ? 2.2825 2.1864 2.2856 -0.0516 0.0101  0.0375  277 VAL A CA  
1625 C C   . VAL A 211 ? 2.0308 1.9347 2.0354 -0.0514 0.0098  0.0354  277 VAL A C   
1626 O O   . VAL A 211 ? 2.0720 1.9748 2.0781 -0.0533 0.0098  0.0334  277 VAL A O   
1627 C CB  . VAL A 211 ? 1.9016 1.8129 1.9057 -0.0533 0.0104  0.0364  277 VAL A CB  
1628 C CG1 . VAL A 211 ? 1.9283 1.8379 1.9338 -0.0560 0.0105  0.0347  277 VAL A CG1 
1629 C CG2 . VAL A 211 ? 1.8838 1.8033 1.8888 -0.0524 0.0103  0.0349  277 VAL A CG2 
1630 N N   . ALA A 212 ? 1.8478 1.7531 1.8516 -0.0491 0.0094  0.0359  278 ALA A N   
1631 C CA  . ALA A 212 ? 1.5416 1.4474 1.5464 -0.0483 0.0090  0.0343  278 ALA A CA  
1632 C C   . ALA A 212 ? 1.5915 1.5066 1.5966 -0.0475 0.0090  0.0339  278 ALA A C   
1633 O O   . ALA A 212 ? 1.6164 1.5340 1.6201 -0.0459 0.0088  0.0356  278 ALA A O   
1634 C CB  . ALA A 212 ? 1.4535 1.3527 1.4570 -0.0458 0.0085  0.0355  278 ALA A CB  
1635 N N   . ALA A 213 ? 1.6537 1.5744 1.6608 -0.0486 0.0091  0.0316  279 ALA A N   
1636 C CA  . ALA A 213 ? 1.7110 1.6409 1.7186 -0.0480 0.0093  0.0311  279 ALA A CA  
1637 C C   . ALA A 213 ? 1.7698 1.7044 1.7791 -0.0477 0.0092  0.0290  279 ALA A C   
1638 O O   . ALA A 213 ? 1.7970 1.7278 1.8072 -0.0484 0.0090  0.0277  279 ALA A O   
1639 C CB  . ALA A 213 ? 1.6864 1.6201 1.6946 -0.0497 0.0098  0.0305  279 ALA A CB  
1640 N N   . THR A 214 ? 1.7489 1.6915 1.7586 -0.0465 0.0094  0.0287  280 THR A N   
1641 C CA  . THR A 214 ? 1.6319 1.5798 1.6434 -0.0461 0.0095  0.0267  280 THR A CA  
1642 C C   . THR A 214 ? 1.5356 1.4927 1.5479 -0.0449 0.0099  0.0260  280 THR A C   
1643 O O   . THR A 214 ? 1.5029 1.4622 1.5139 -0.0438 0.0100  0.0271  280 THR A O   
1644 C CB  . THR A 214 ? 1.5989 1.5446 1.6101 -0.0444 0.0089  0.0272  280 THR A CB  
1645 O OG1 . THR A 214 ? 1.5508 1.5029 1.5638 -0.0439 0.0091  0.0254  280 THR A OG1 
1646 C CG2 . THR A 214 ? 1.6101 1.5563 1.6193 -0.0421 0.0084  0.0296  280 THR A CG2 
1647 N N   . ARG A 215 ? 1.5309 1.4930 1.5451 -0.0450 0.0100  0.0239  281 ARG A N   
1648 C CA  . ARG A 215 ? 1.4826 1.4529 1.4974 -0.0433 0.0104  0.0231  281 ARG A CA  
1649 C C   . ARG A 215 ? 1.5173 1.4900 1.5319 -0.0411 0.0103  0.0233  281 ARG A C   
1650 O O   . ARG A 215 ? 1.4964 1.4688 1.5121 -0.0411 0.0102  0.0225  281 ARG A O   
1651 C CB  . ARG A 215 ? 1.4937 1.4685 1.5104 -0.0441 0.0105  0.0209  281 ARG A CB  
1652 C CG  . ARG A 215 ? 1.5850 1.5619 1.6035 -0.0441 0.0104  0.0192  281 ARG A CG  
1653 C CD  . ARG A 215 ? 1.7657 1.7459 1.7852 -0.0453 0.0101  0.0173  281 ARG A CD  
1654 N NE  . ARG A 215 ? 1.9773 1.9639 1.9982 -0.0437 0.0102  0.0157  281 ARG A NE  
1655 C CZ  . ARG A 215 ? 2.0707 2.0608 2.0922 -0.0443 0.0099  0.0141  281 ARG A CZ  
1656 N NH1 . ARG A 215 ? 2.1225 2.1103 2.1431 -0.0466 0.0096  0.0136  281 ARG A NH1 
1657 N NH2 . ARG A 215 ? 2.0490 2.0446 2.0713 -0.0426 0.0099  0.0128  281 ARG A NH2 
1658 N N   . LEU A 216 ? 1.3671 1.3423 1.3804 -0.0393 0.0103  0.0243  282 LEU A N   
1659 C CA  . LEU A 216 ? 1.2724 1.2504 1.2852 -0.0370 0.0099  0.0248  282 LEU A CA  
1660 C C   . LEU A 216 ? 1.5887 1.5746 1.6023 -0.0355 0.0099  0.0232  282 LEU A C   
1661 O O   . LEU A 216 ? 1.6033 1.5921 1.6154 -0.0350 0.0087  0.0244  282 LEU A O   
1662 C CB  . LEU A 216 ? 1.0542 1.0299 1.0649 -0.0361 0.0093  0.0270  282 LEU A CB  
1663 C CG  . LEU A 216 ? 1.0713 1.0493 1.0815 -0.0337 0.0084  0.0281  282 LEU A CG  
1664 C CD1 . LEU A 216 ? 1.1740 1.1477 1.1823 -0.0337 0.0078  0.0304  282 LEU A CD1 
1665 C CD2 . LEU A 216 ? 1.1665 1.1525 1.1775 -0.0316 0.0080  0.0271  282 LEU A CD2 
1666 N N   . ASP A 217 ? 1.4868 1.4765 1.5023 -0.0352 0.0103  0.0213  283 ASP A N   
1667 C CA  . ASP A 217 ? 1.7013 1.6980 1.7161 -0.0341 0.0092  0.0209  283 ASP A CA  
1668 C C   . ASP A 217 ? 1.6476 1.6494 1.6639 -0.0328 0.0094  0.0190  283 ASP A C   
1669 O O   . ASP A 217 ? 1.6575 1.6625 1.6739 -0.0307 0.0091  0.0188  283 ASP A O   
1670 C CB  . ASP A 217 ? 1.8905 1.8885 1.9038 -0.0358 0.0083  0.0212  283 ASP A CB  
1671 C CG  . ASP A 217 ? 2.0853 2.0894 2.0972 -0.0348 0.0070  0.0210  283 ASP A CG  
1672 O OD1 . ASP A 217 ? 2.1269 2.1337 2.1388 -0.0327 0.0063  0.0215  283 ASP A OD1 
1673 O OD2 . ASP A 217 ? 2.1706 2.1767 2.1814 -0.0360 0.0065  0.0204  283 ASP A OD2 
1674 N N   . SER A 218 ? 1.8981 1.9005 1.9152 -0.0342 0.0096  0.0177  284 SER A N   
1675 C CA  . SER A 218 ? 1.6897 1.6969 1.7076 -0.0333 0.0095  0.0160  284 SER A CA  
1676 C C   . SER A 218 ? 1.3499 1.3622 1.3653 -0.0320 0.0082  0.0161  284 SER A C   
1677 O O   . SER A 218 ? 1.3745 1.3871 1.3883 -0.0315 0.0073  0.0175  284 SER A O   
1678 C CB  . SER A 218 ? 1.8891 1.8968 1.9095 -0.0317 0.0105  0.0149  284 SER A CB  
1679 O OG  . SER A 218 ? 2.0017 2.0094 2.0214 -0.0299 0.0105  0.0157  284 SER A OG  
1680 N N   . ARG A 219 ? 1.0962 1.1124 1.1112 -0.0313 0.0079  0.0146  285 ARG A N   
1681 C CA  . ARG A 219 ? 0.9615 0.9820 0.9740 -0.0300 0.0066  0.0146  285 ARG A CA  
1682 C C   . ARG A 219 ? 1.0821 1.1056 1.0943 -0.0293 0.0066  0.0128  285 ARG A C   
1683 O O   . ARG A 219 ? 1.1534 1.1759 1.1672 -0.0301 0.0075  0.0117  285 ARG A O   
1684 C CB  . ARG A 219 ? 1.0389 1.0598 1.0487 -0.0314 0.0055  0.0154  285 ARG A CB  
1685 C CG  . ARG A 219 ? 1.0671 1.0912 1.0746 -0.0318 0.0047  0.0143  285 ARG A CG  
1686 C CD  . ARG A 219 ? 1.0287 1.0550 1.0335 -0.0317 0.0032  0.0150  285 ARG A CD  
1687 N NE  . ARG A 219 ? 1.0854 1.1138 1.0879 -0.0328 0.0026  0.0141  285 ARG A NE  
1688 C CZ  . ARG A 219 ? 1.1938 1.2206 1.1958 -0.0352 0.0032  0.0138  285 ARG A CZ  
1689 N NH1 . ARG A 219 ? 1.0949 1.1178 1.0987 -0.0366 0.0042  0.0143  285 ARG A NH1 
1690 N NH2 . ARG A 219 ? 1.2800 1.3088 1.2797 -0.0361 0.0027  0.0129  285 ARG A NH2 
1691 N N   . SER A 220 ? 1.0616 1.0886 1.0716 -0.0277 0.0054  0.0126  286 SER A N   
1692 C CA  . SER A 220 ? 1.1032 1.1331 1.1121 -0.0269 0.0052  0.0110  286 SER A CA  
1693 C C   . SER A 220 ? 1.0618 1.0947 1.0676 -0.0258 0.0036  0.0109  286 SER A C   
1694 O O   . SER A 220 ? 1.0081 1.0416 1.0128 -0.0254 0.0025  0.0120  286 SER A O   
1695 C CB  . SER A 220 ? 1.2405 1.2706 1.2515 -0.0250 0.0060  0.0101  286 SER A CB  
1696 O OG  . SER A 220 ? 1.2762 1.3094 1.2852 -0.0236 0.0052  0.0089  286 SER A OG  
1697 N N   . PHE A 221 ? 1.1640 1.1989 1.1684 -0.0258 0.0035  0.0094  287 PHE A N   
1698 C CA  . PHE A 221 ? 1.2245 1.2622 1.2261 -0.0246 0.0020  0.0091  287 PHE A CA  
1699 C C   . PHE A 221 ? 1.5012 1.5396 1.5032 -0.0218 0.0014  0.0094  287 PHE A C   
1700 O O   . PHE A 221 ? 1.5184 1.5589 1.5184 -0.0204 0.0001  0.0091  287 PHE A O   
1701 C CB  . PHE A 221 ? 1.3567 1.3960 1.3566 -0.0253 0.0021  0.0073  287 PHE A CB  
1702 C CG  . PHE A 221 ? 1.6387 1.6801 1.6376 -0.0232 0.0014  0.0064  287 PHE A CG  
1703 C CD1 . PHE A 221 ? 1.7930 1.8366 1.7890 -0.0226 -0.0001 0.0064  287 PHE A CD1 
1704 C CD2 . PHE A 221 ? 1.6666 1.7073 1.6674 -0.0217 0.0022  0.0059  287 PHE A CD2 
1705 C CE1 . PHE A 221 ? 1.8652 1.9101 1.8602 -0.0207 -0.0009 0.0057  287 PHE A CE1 
1706 C CE2 . PHE A 221 ? 1.6851 1.7272 1.6849 -0.0198 0.0015  0.0053  287 PHE A CE2 
1707 C CZ  . PHE A 221 ? 1.7556 1.7997 1.7523 -0.0193 -0.0001 0.0052  287 PHE A CZ  
1708 N N   . ALA A 222 ? 1.3854 1.4221 1.3900 -0.0211 0.0022  0.0101  288 ALA A N   
1709 C CA  . ALA A 222 ? 1.4433 1.4808 1.4479 -0.0186 0.0015  0.0105  288 ALA A CA  
1710 C C   . ALA A 222 ? 1.2604 1.2979 1.2647 -0.0179 0.0003  0.0123  288 ALA A C   
1711 O O   . ALA A 222 ? 1.3076 1.3466 1.3107 -0.0162 -0.0010 0.0126  288 ALA A O   
1712 C CB  . ALA A 222 ? 1.5641 1.6004 1.5715 -0.0176 0.0028  0.0100  288 ALA A CB  
1713 N N   . TRP A 223 ? 1.2821 1.3179 1.2877 -0.0194 0.0008  0.0134  289 TRP A N   
1714 C CA  . TRP A 223 ? 1.1048 1.1403 1.1107 -0.0189 0.0000  0.0151  289 TRP A CA  
1715 C C   . TRP A 223 ? 1.2002 1.2352 1.2079 -0.0169 0.0002  0.0156  289 TRP A C   
1716 O O   . TRP A 223 ? 1.1773 1.2137 1.1844 -0.0149 -0.0004 0.0152  289 TRP A O   
1717 C CB  . TRP A 223 ? 1.0519 1.0898 1.0554 -0.0184 -0.0020 0.0155  289 TRP A CB  
1718 C CG  . TRP A 223 ? 1.1483 1.1864 1.1519 -0.0181 -0.0031 0.0170  289 TRP A CG  
1719 C CD1 . TRP A 223 ? 1.2211 1.2586 1.2248 -0.0197 -0.0033 0.0180  289 TRP A CD1 
1720 C CD2 . TRP A 223 ? 1.2418 1.2813 1.2454 -0.0159 -0.0043 0.0178  289 TRP A CD2 
1721 N NE1 . TRP A 223 ? 1.2886 1.3271 1.2925 -0.0188 -0.0045 0.0193  289 TRP A NE1 
1722 C CE2 . TRP A 223 ? 1.2996 1.3394 1.3036 -0.0164 -0.0052 0.0192  289 TRP A CE2 
1723 C CE3 . TRP A 223 ? 1.1711 1.2116 1.1745 -0.0136 -0.0047 0.0175  289 TRP A CE3 
1724 C CZ2 . TRP A 223 ? 1.2840 1.3251 1.2882 -0.0146 -0.0065 0.0202  289 TRP A CZ2 
1725 C CZ3 . TRP A 223 ? 1.1831 1.2227 1.1869 -0.0117 -0.0051 0.0177  289 TRP A CZ3 
1726 C CH2 . TRP A 223 ? 1.2461 1.2856 1.2505 -0.0121 -0.0056 0.0187  289 TRP A CH2 
1727 N N   . ASN A 224 ? 1.2784 1.3113 1.2881 -0.0174 0.0009  0.0167  290 ASN A N   
1728 C CA  . ASN A 224 ? 1.3694 1.4018 1.3808 -0.0156 0.0011  0.0176  290 ASN A CA  
1729 C C   . ASN A 224 ? 1.4538 1.4861 1.4663 -0.0143 0.0022  0.0162  290 ASN A C   
1730 O O   . ASN A 224 ? 1.5026 1.5362 1.5148 -0.0121 0.0015  0.0163  290 ASN A O   
1731 C CB  . ASN A 224 ? 1.0969 1.1315 1.1075 -0.0136 -0.0008 0.0187  290 ASN A CB  
1732 C CG  . ASN A 224 ? 1.0571 1.0920 1.0673 -0.0145 -0.0019 0.0203  290 ASN A CG  
1733 O OD1 . ASN A 224 ? 1.0530 1.0898 1.0628 -0.0131 -0.0034 0.0212  290 ASN A OD1 
1734 N ND2 . ASN A 224 ? 1.0234 1.0561 1.0341 -0.0168 -0.0011 0.0206  290 ASN A ND2 
1735 N N   . VAL A 225 ? 1.3862 1.4170 1.4000 -0.0158 0.0038  0.0150  291 VAL A N   
1736 C CA  . VAL A 225 ? 1.4751 1.5061 1.4902 -0.0145 0.0048  0.0135  291 VAL A CA  
1737 C C   . VAL A 225 ? 3.3353 3.3638 3.3535 -0.0149 0.0065  0.0135  291 VAL A C   
1738 O O   . VAL A 225 ? 3.4161 3.4446 3.4352 -0.0134 0.0063  0.0143  291 VAL A O   
1739 C CB  . VAL A 225 ? 1.6600 1.6920 1.6742 -0.0154 0.0051  0.0118  291 VAL A CB  
1740 C CG1 . VAL A 225 ? 1.6792 1.7097 1.6938 -0.0182 0.0058  0.0117  291 VAL A CG1 
1741 C CG2 . VAL A 225 ? 1.6077 1.6403 1.6232 -0.0142 0.0060  0.0100  291 VAL A CG2 
1742 N N   . ALA A 226 ? 2.7271 2.7536 2.7470 -0.0170 0.0080  0.0124  292 ALA A N   
1743 C CA  . ALA A 226 ? 2.2298 2.2532 2.2522 -0.0181 0.0096  0.0123  292 ALA A CA  
1744 C C   . ALA A 226 ? 1.7919 1.8130 1.8154 -0.0206 0.0108  0.0113  292 ALA A C   
1745 O O   . ALA A 226 ? 1.7853 1.8070 1.8110 -0.0207 0.0117  0.0096  292 ALA A O   
1746 C CB  . ALA A 226 ? 2.1534 2.1782 2.1778 -0.0163 0.0102  0.0109  292 ALA A CB  
1747 N N   . PRO A 227 ? 1.8369 1.8558 1.8590 -0.0225 0.0104  0.0126  293 PRO A N   
1748 C CA  . PRO A 227 ? 1.5838 1.6013 1.6075 -0.0244 0.0112  0.0116  293 PRO A CA  
1749 C C   . PRO A 227 ? 1.3924 1.4042 1.4174 -0.0267 0.0123  0.0121  293 PRO A C   
1750 O O   . PRO A 227 ? 1.2467 1.2559 1.2700 -0.0273 0.0118  0.0140  293 PRO A O   
1751 C CB  . PRO A 227 ? 1.5988 1.6180 1.6196 -0.0253 0.0099  0.0122  293 PRO A CB  
1752 C CG  . PRO A 227 ? 1.6022 1.6245 1.6207 -0.0234 0.0085  0.0131  293 PRO A CG  
1753 C CD  . PRO A 227 ? 1.7282 1.7485 1.7476 -0.0226 0.0088  0.0141  293 PRO A CD  
1754 N N   . GLY A 228 ? 1.5659 1.5770 1.5931 -0.0287 0.0123  0.0116  294 GLY A N   
1755 C CA  . GLY A 228 ? 1.4619 1.4679 1.4889 -0.0323 0.0119  0.0127  294 GLY A CA  
1756 C C   . GLY A 228 ? 1.3192 1.3189 1.3462 -0.0349 0.0115  0.0137  294 GLY A C   
1757 O O   . GLY A 228 ? 1.2124 1.2063 1.2372 -0.0361 0.0111  0.0156  294 GLY A O   
1758 N N   . ALA A 229 ? 1.1807 1.1811 1.2098 -0.0353 0.0114  0.0127  295 ALA A N   
1759 C CA  . ALA A 229 ? 1.3780 1.3709 1.4069 -0.0372 0.0105  0.0137  295 ALA A CA  
1760 C C   . ALA A 229 ? 1.6429 1.6272 1.6700 -0.0402 0.0099  0.0135  295 ALA A C   
1761 O O   . ALA A 229 ? 1.6278 1.6053 1.6529 -0.0405 0.0093  0.0157  295 ALA A O   
1762 C CB  . ALA A 229 ? 3.4684 3.4631 3.4997 -0.0346 0.0107  0.0108  295 ALA A CB  
1763 N N   . GLU A 230 ? 1.5637 1.5501 1.5909 -0.0417 0.0099  0.0109  296 GLU A N   
1764 C CA  . GLU A 230 ? 1.8471 1.8265 1.8723 -0.0445 0.0094  0.0099  296 GLU A CA  
1765 C C   . GLU A 230 ? 1.7648 1.7450 1.7895 -0.0448 0.0093  0.0116  296 GLU A C   
1766 O O   . GLU A 230 ? 1.7939 1.7673 1.8171 -0.0466 0.0089  0.0121  296 GLU A O   
1767 C CB  . GLU A 230 ? 2.0727 2.0542 2.0977 -0.0460 0.0098  0.0060  296 GLU A CB  
1768 C CG  . GLU A 230 ? 2.3733 2.3648 2.3993 -0.0447 0.0100  0.0053  296 GLU A CG  
1769 C CD  . GLU A 230 ? 2.3865 2.3858 2.4145 -0.0416 0.0105  0.0054  296 GLU A CD  
1770 O OE1 . GLU A 230 ? 2.3897 2.3888 2.4188 -0.0401 0.0106  0.0072  296 GLU A OE1 
1771 O OE2 . GLU A 230 ? 2.4024 2.4080 2.4307 -0.0405 0.0107  0.0036  296 GLU A OE2 
1772 N N   . SER A 231 ? 1.8895 1.8776 1.9151 -0.0428 0.0098  0.0120  297 SER A N   
1773 C CA  . SER A 231 ? 1.9375 1.9266 1.9620 -0.0426 0.0100  0.0130  297 SER A CA  
1774 C C   . SER A 231 ? 1.8953 1.8782 1.9183 -0.0428 0.0101  0.0153  297 SER A C   
1775 O O   . SER A 231 ? 1.9498 1.9286 1.9716 -0.0443 0.0099  0.0160  297 SER A O   
1776 C CB  . SER A 231 ? 2.0511 2.0476 2.0761 -0.0395 0.0105  0.0130  297 SER A CB  
1777 O OG  . SER A 231 ? 2.1255 2.1218 2.1499 -0.0375 0.0110  0.0144  297 SER A OG  
1778 N N   . ALA A 232 ? 1.7681 1.7504 1.7909 -0.0412 0.0103  0.0164  298 ALA A N   
1779 C CA  . ALA A 232 ? 1.6736 1.6506 1.6940 -0.0409 0.0101  0.0187  298 ALA A CA  
1780 C C   . ALA A 232 ? 1.6002 1.5720 1.6198 -0.0402 0.0093  0.0202  298 ALA A C   
1781 O O   . ALA A 232 ? 1.6380 1.6015 1.6560 -0.0407 0.0085  0.0217  298 ALA A O   
1782 C CB  . ALA A 232 ? 1.7079 1.6902 1.7273 -0.0388 0.0105  0.0195  298 ALA A CB  
1783 N N   . VAL A 233 ? 1.5859 1.5621 1.6069 -0.0385 0.0091  0.0200  299 VAL A N   
1784 C CA  . VAL A 233 ? 1.5322 1.5054 1.5536 -0.0362 0.0078  0.0227  299 VAL A CA  
1785 C C   . VAL A 233 ? 1.6098 1.5736 1.6329 -0.0361 0.0066  0.0233  299 VAL A C   
1786 O O   . VAL A 233 ? 1.5975 1.5559 1.6206 -0.0339 0.0055  0.0257  299 VAL A O   
1787 C CB  . VAL A 233 ? 1.5430 1.5245 1.5672 -0.0336 0.0079  0.0227  299 VAL A CB  
1788 C CG1 . VAL A 233 ? 1.5044 1.4861 1.5332 -0.0326 0.0079  0.0214  299 VAL A CG1 
1789 C CG2 . VAL A 233 ? 1.6335 1.6151 1.6576 -0.0308 0.0070  0.0256  299 VAL A CG2 
1790 N N   . ALA A 234 ? 1.6268 1.5880 1.6507 -0.0378 0.0069  0.0205  300 ALA A N   
1791 C CA  . ALA A 234 ? 1.7460 1.6980 1.7692 -0.0362 0.0064  0.0188  300 ALA A CA  
1792 C C   . ALA A 234 ? 1.7488 1.6915 1.7696 -0.0382 0.0056  0.0216  300 ALA A C   
1793 O O   . ALA A 234 ? 1.8049 1.7410 1.8255 -0.0354 0.0048  0.0228  300 ALA A O   
1794 C CB  . ALA A 234 ? 1.8248 1.7764 1.8478 -0.0379 0.0072  0.0145  300 ALA A CB  
1795 N N   . SER A 235 ? 1.6312 1.5756 1.6491 -0.0413 0.0065  0.0214  301 SER A N   
1796 C CA  . SER A 235 ? 1.5908 1.5294 1.6061 -0.0421 0.0067  0.0228  301 SER A CA  
1797 C C   . SER A 235 ? 1.6881 1.6252 1.7019 -0.0397 0.0060  0.0261  301 SER A C   
1798 O O   . SER A 235 ? 1.7259 1.6558 1.7378 -0.0397 0.0058  0.0274  301 SER A O   
1799 C CB  . SER A 235 ? 1.4573 1.4013 1.4729 -0.0444 0.0080  0.0218  301 SER A CB  
1800 O OG  . SER A 235 ? 1.3651 1.3191 1.3820 -0.0436 0.0085  0.0214  301 SER A OG  
1801 N N   . PHE A 236 ? 1.7265 1.6709 1.7410 -0.0378 0.0058  0.0275  302 PHE A N   
1802 C CA  . PHE A 236 ? 1.8010 1.7435 1.8143 -0.0355 0.0049  0.0305  302 PHE A CA  
1803 C C   . PHE A 236 ? 1.7505 1.6851 1.7648 -0.0330 0.0036  0.0316  302 PHE A C   
1804 O O   . PHE A 236 ? 1.6654 1.5931 1.6776 -0.0324 0.0031  0.0330  302 PHE A O   
1805 C CB  . PHE A 236 ? 1.9452 1.8957 1.9597 -0.0331 0.0046  0.0317  302 PHE A CB  
1806 C CG  . PHE A 236 ? 2.0011 1.9600 2.0151 -0.0343 0.0058  0.0303  302 PHE A CG  
1807 C CD1 . PHE A 236 ? 2.0693 2.0295 2.0812 -0.0349 0.0063  0.0308  302 PHE A CD1 
1808 C CD2 . PHE A 236 ? 2.0456 2.0114 2.0618 -0.0343 0.0064  0.0283  302 PHE A CD2 
1809 C CE1 . PHE A 236 ? 2.1112 2.0784 2.1231 -0.0352 0.0073  0.0293  302 PHE A CE1 
1810 C CE2 . PHE A 236 ? 2.0808 2.0541 2.0967 -0.0346 0.0076  0.0267  302 PHE A CE2 
1811 C CZ  . PHE A 236 ? 2.1201 2.0939 2.1339 -0.0348 0.0080  0.0271  302 PHE A CZ  
1812 N N   . VAL A 237 ? 1.6717 1.6072 1.6896 -0.0314 0.0032  0.0303  303 VAL A N   
1813 C CA  . VAL A 237 ? 1.6942 1.6226 1.7143 -0.0281 0.0024  0.0305  303 VAL A CA  
1814 C C   . VAL A 237 ? 1.7048 1.6233 1.7222 -0.0297 0.0024  0.0294  303 VAL A C   
1815 O O   . VAL A 237 ? 1.7405 1.6522 1.7567 -0.0275 0.0017  0.0309  303 VAL A O   
1816 C CB  . VAL A 237 ? 2.4138 2.3469 2.4370 -0.0252 0.0030  0.0270  303 VAL A CB  
1817 C CG1 . VAL A 237 ? 2.4090 2.3353 2.4318 -0.0249 0.0033  0.0235  303 VAL A CG1 
1818 C CG2 . VAL A 237 ? 2.4244 2.3607 2.4498 -0.0199 0.0024  0.0281  303 VAL A CG2 
1819 N N   . THR A 238 ? 1.7942 1.7123 1.8105 -0.0336 0.0033  0.0269  304 THR A N   
1820 C CA  . THR A 238 ? 1.7541 1.6629 1.7679 -0.0352 0.0036  0.0258  304 THR A CA  
1821 C C   . THR A 238 ? 1.6940 1.5990 1.7046 -0.0351 0.0036  0.0286  304 THR A C   
1822 O O   . THR A 238 ? 1.6574 1.5547 1.6671 -0.0329 0.0031  0.0296  304 THR A O   
1823 C CB  . THR A 238 ? 1.7941 1.7042 1.8071 -0.0397 0.0049  0.0227  304 THR A CB  
1824 O OG1 . THR A 238 ? 1.8053 1.7218 1.8174 -0.0420 0.0060  0.0237  304 THR A OG1 
1825 C CG2 . THR A 238 ? 1.7839 1.6988 1.8000 -0.0401 0.0049  0.0198  304 THR A CG2 
1826 N N   . GLN A 239 ? 1.6876 1.5985 1.6969 -0.0369 0.0044  0.0298  305 GLN A N   
1827 C CA  . GLN A 239 ? 1.7225 1.6301 1.7295 -0.0370 0.0047  0.0320  305 GLN A CA  
1828 C C   . GLN A 239 ? 1.7262 1.6317 1.7323 -0.0337 0.0035  0.0350  305 GLN A C   
1829 O O   . GLN A 239 ? 1.8330 1.7316 1.8373 -0.0331 0.0035  0.0363  305 GLN A O   
1830 C CB  . GLN A 239 ? 1.7829 1.6982 1.7896 -0.0390 0.0057  0.0323  305 GLN A CB  
1831 C CG  . GLN A 239 ? 1.8871 1.8023 1.8943 -0.0423 0.0069  0.0306  305 GLN A CG  
1832 C CD  . GLN A 239 ? 1.9551 1.8708 1.9610 -0.0430 0.0074  0.0324  305 GLN A CD  
1833 O OE1 . GLN A 239 ? 1.8808 1.7896 1.8854 -0.0428 0.0074  0.0338  305 GLN A OE1 
1834 N NE2 . GLN A 239 ? 2.0435 1.9674 2.0497 -0.0433 0.0078  0.0325  305 GLN A NE2 
1835 N N   . LEU A 240 ? 1.7004 1.6121 1.7079 -0.0314 0.0027  0.0360  306 LEU A N   
1836 C CA  . LEU A 240 ? 1.7453 1.6560 1.7527 -0.0278 0.0015  0.0386  306 LEU A CA  
1837 C C   . LEU A 240 ? 1.5954 1.4980 1.6038 -0.0246 0.0006  0.0385  306 LEU A C   
1838 O O   . LEU A 240 ? 1.6253 1.5236 1.6324 -0.0224 0.0000  0.0405  306 LEU A O   
1839 C CB  . LEU A 240 ? 1.8173 1.7377 1.8265 -0.0264 0.0010  0.0393  306 LEU A CB  
1840 C CG  . LEU A 240 ? 1.9409 1.8668 1.9540 -0.0245 0.0007  0.0383  306 LEU A CG  
1841 C CD1 . LEU A 240 ? 2.0728 1.9945 2.0874 -0.0201 -0.0005 0.0396  306 LEU A CD1 
1842 C CD2 . LEU A 240 ? 1.9173 1.8536 1.9312 -0.0246 0.0010  0.0387  306 LEU A CD2 
1843 N N   . ALA A 241 ? 1.5535 1.4543 1.5644 -0.0242 0.0006  0.0360  307 ALA A N   
1844 C CA  . ALA A 241 ? 1.6217 1.5152 1.6337 -0.0206 0.0000  0.0355  307 ALA A CA  
1845 C C   . ALA A 241 ? 1.8407 1.7248 1.8495 -0.0222 0.0005  0.0351  307 ALA A C   
1846 O O   . ALA A 241 ? 1.9500 1.8277 1.9580 -0.0194 0.0001  0.0360  307 ALA A O   
1847 C CB  . ALA A 241 ? 1.5839 1.4784 1.6000 -0.0193 0.0002  0.0325  307 ALA A CB  
1848 N N   . ALA A 242 ? 1.7688 1.6526 1.7759 -0.0267 0.0017  0.0339  308 ALA A N   
1849 C CA  . ALA A 242 ? 1.8678 1.7438 1.8721 -0.0286 0.0027  0.0338  308 ALA A CA  
1850 C C   . ALA A 242 ? 1.9234 1.7976 1.9255 -0.0275 0.0026  0.0372  308 ALA A C   
1851 O O   . ALA A 242 ? 1.9516 1.8180 1.9522 -0.0260 0.0026  0.0381  308 ALA A O   
1852 C CB  . ALA A 242 ? 1.9166 1.7952 1.9206 -0.0334 0.0042  0.0320  308 ALA A CB  
1853 N N   . ALA A 243 ? 1.6828 1.5644 1.6847 -0.0280 0.0024  0.0390  309 ALA A N   
1854 C CA  . ALA A 243 ? 1.7793 1.6606 1.7792 -0.0271 0.0022  0.0420  309 ALA A CA  
1855 C C   . ALA A 243 ? 1.7874 1.6653 1.7875 -0.0226 0.0008  0.0437  309 ALA A C   
1856 O O   . ALA A 243 ? 1.8272 1.6995 1.8254 -0.0215 0.0008  0.0454  309 ALA A O   
1857 C CB  . ALA A 243 ? 1.7157 1.6065 1.7158 -0.0282 0.0022  0.0430  309 ALA A CB  
1858 N N   . GLU A 244 ? 2.1290 2.0107 2.1318 -0.0198 -0.0002 0.0430  310 GLU A N   
1859 C CA  . GLU A 244 ? 2.0655 1.9450 2.0692 -0.0151 -0.0014 0.0442  310 GLU A CA  
1860 C C   . GLU A 244 ? 2.0417 1.9110 2.0444 -0.0138 -0.0012 0.0434  310 GLU A C   
1861 O O   . GLU A 244 ? 2.0008 1.8658 2.0021 -0.0112 -0.0017 0.0452  310 GLU A O   
1862 C CB  . GLU A 244 ? 2.4793 2.3655 2.4869 -0.0125 -0.0022 0.0432  310 GLU A CB  
1863 C CG  . GLU A 244 ? 2.5109 2.3966 2.5203 -0.0072 -0.0033 0.0438  310 GLU A CG  
1864 C CD  . GLU A 244 ? 2.6105 2.4907 2.6173 -0.0051 -0.0038 0.0461  310 GLU A CD  
1865 O OE1 . GLU A 244 ? 2.6133 2.4953 2.6179 -0.0061 -0.0040 0.0485  310 GLU A OE1 
1866 O OE2 . GLU A 244 ? 2.6751 2.5487 2.6820 -0.0025 -0.0039 0.0454  310 GLU A OE2 
1867 N N   . ALA A 245 ? 2.0494 1.9146 2.0524 -0.0158 -0.0003 0.0406  311 ALA A N   
1868 C CA  . ALA A 245 ? 2.1100 1.9656 2.1119 -0.0145 0.0000  0.0396  311 ALA A CA  
1869 C C   . ALA A 245 ? 2.2502 2.0995 2.2485 -0.0161 0.0009  0.0415  311 ALA A C   
1870 O O   . ALA A 245 ? 2.2965 2.1392 2.2935 -0.0136 0.0007  0.0425  311 ALA A O   
1871 C CB  . ALA A 245 ? 2.0705 1.9233 2.0733 -0.0164 0.0007  0.0358  311 ALA A CB  
1872 N N   . LEU A 246 ? 2.3585 2.2102 2.3557 -0.0202 0.0020  0.0419  312 LEU A N   
1873 C CA  . LEU A 246 ? 2.3711 2.2179 2.3658 -0.0217 0.0031  0.0438  312 LEU A CA  
1874 C C   . LEU A 246 ? 2.3274 2.1759 2.3208 -0.0194 0.0022  0.0473  312 LEU A C   
1875 O O   . LEU A 246 ? 2.3462 2.1895 2.3377 -0.0194 0.0028  0.0491  312 LEU A O   
1876 C CB  . LEU A 246 ? 2.4257 2.2752 2.4207 -0.0264 0.0047  0.0429  312 LEU A CB  
1877 C CG  . LEU A 246 ? 2.4936 2.3530 2.4894 -0.0285 0.0045  0.0432  312 LEU A CG  
1878 C CD1 . LEU A 246 ? 2.5078 2.3705 2.5021 -0.0279 0.0041  0.0463  312 LEU A CD1 
1879 C CD2 . LEU A 246 ? 2.5373 2.3977 2.5341 -0.0328 0.0061  0.0413  312 LEU A CD2 
1880 N N   . GLN A 247 ? 2.4174 2.2735 2.4120 -0.0177 0.0008  0.0482  313 GLN A N   
1881 C CA  . GLN A 247 ? 2.3563 2.2146 2.3498 -0.0155 -0.0001 0.0513  313 GLN A CA  
1882 C C   . GLN A 247 ? 2.4240 2.2757 2.4166 -0.0116 -0.0007 0.0526  313 GLN A C   
1883 O O   . GLN A 247 ? 2.3987 2.2487 2.3894 -0.0108 -0.0009 0.0551  313 GLN A O   
1884 C CB  . GLN A 247 ? 2.3782 2.2461 2.3736 -0.0142 -0.0013 0.0515  313 GLN A CB  
1885 C CG  . GLN A 247 ? 2.3622 2.2348 2.3565 -0.0133 -0.0020 0.0542  313 GLN A CG  
1886 C CD  . GLN A 247 ? 2.3514 2.2227 2.3431 -0.0163 -0.0009 0.0556  313 GLN A CD  
1887 O OE1 . GLN A 247 ? 2.3412 2.2050 2.3311 -0.0164 -0.0003 0.0565  313 GLN A OE1 
1888 N NE2 . GLN A 247 ? 2.3072 2.1859 2.2989 -0.0184 -0.0007 0.0558  313 GLN A NE2 
1889 N N   . LYS A 248 ? 2.3898 2.2372 2.3836 -0.0095 -0.0010 0.0507  314 LYS A N   
1890 C CA  . LYS A 248 ? 2.4021 2.2436 2.3954 -0.0054 -0.0017 0.0515  314 LYS A CA  
1891 C C   . LYS A 248 ? 2.4963 2.3276 2.4872 -0.0065 -0.0004 0.0513  314 LYS A C   
1892 O O   . LYS A 248 ? 2.5288 2.3539 2.5190 -0.0034 -0.0007 0.0514  314 LYS A O   
1893 C CB  . LYS A 248 ? 2.1587 2.0021 2.1551 -0.0021 -0.0026 0.0494  314 LYS A CB  
1894 C CG  . LYS A 248 ? 2.0711 1.9111 2.0684 -0.0039 -0.0017 0.0460  314 LYS A CG  
1895 C CD  . LYS A 248 ? 2.0270 1.8671 2.0273 -0.0004 -0.0023 0.0435  314 LYS A CD  
1896 C CE  . LYS A 248 ? 1.7210 1.5562 1.7216 -0.0026 -0.0013 0.0399  314 LYS A CE  
1897 N NZ  . LYS A 248 ? 1.6779 1.5057 1.6751 -0.0064 0.0000  0.0398  314 LYS A NZ  
1898 N N   . ALA A 249 ? 2.4934 2.3233 2.4831 -0.0108 0.0012  0.0509  315 ALA A N   
1899 C CA  . ALA A 249 ? 2.5966 2.4174 2.5844 -0.0124 0.0028  0.0505  315 ALA A CA  
1900 C C   . ALA A 249 ? 2.6549 2.4707 2.6403 -0.0106 0.0029  0.0536  315 ALA A C   
1901 O O   . ALA A 249 ? 2.6263 2.4460 2.6109 -0.0114 0.0027  0.0561  315 ALA A O   
1902 C CB  . ALA A 249 ? 2.6778 2.5000 2.6660 -0.0173 0.0046  0.0495  315 ALA A CB  
1903 N N   . PRO A 250 ? 2.4431 2.2513 2.4275 -0.0081 0.0028  0.0534  316 PRO A N   
1904 C CA  . PRO A 250 ? 2.5591 2.3634 2.5413 -0.0064 0.0026  0.0564  316 PRO A CA  
1905 C C   . PRO A 250 ? 2.8464 2.6482 2.8274 -0.0097 0.0044  0.0578  316 PRO A C   
1906 O O   . PRO A 250 ? 2.8921 2.6930 2.8715 -0.0088 0.0042  0.0607  316 PRO A O   
1907 C CB  . PRO A 250 ? 2.4598 2.2564 2.4413 -0.0033 0.0022  0.0554  316 PRO A CB  
1908 C CG  . PRO A 250 ? 2.3560 2.1524 2.3393 -0.0036 0.0022  0.0516  316 PRO A CG  
1909 C CD  . PRO A 250 ? 2.3428 2.1475 2.3281 -0.0057 0.0021  0.0507  316 PRO A CD  
1910 N N   . ASP A 251 ? 2.8931 2.6942 2.8754 -0.0136 0.0062  0.0557  317 ASP A N   
1911 C CA  . ASP A 251 ? 3.0197 2.8192 3.0021 -0.0167 0.0079  0.0569  317 ASP A CA  
1912 C C   . ASP A 251 ? 2.9846 2.7918 2.9675 -0.0193 0.0079  0.0582  317 ASP A C   
1913 O O   . ASP A 251 ? 3.0545 2.8614 3.0371 -0.0212 0.0088  0.0599  317 ASP A O   
1914 C CB  . ASP A 251 ? 3.1422 2.9384 3.1269 -0.0196 0.0098  0.0540  317 ASP A CB  
1915 C CG  . ASP A 251 ? 3.2410 3.0313 3.2261 -0.0209 0.0114  0.0553  317 ASP A CG  
1916 O OD1 . ASP A 251 ? 3.2915 3.0789 3.2741 -0.0190 0.0112  0.0582  317 ASP A OD1 
1917 O OD2 . ASP A 251 ? 3.2785 3.0676 3.2672 -0.0237 0.0129  0.0533  317 ASP A OD2 
1918 N N   . VAL A 252 ? 2.9838 2.7978 2.9674 -0.0191 0.0068  0.0573  318 VAL A N   
1919 C CA  . VAL A 252 ? 2.7139 2.5361 2.6980 -0.0215 0.0067  0.0579  318 VAL A CA  
1920 C C   . VAL A 252 ? 2.6845 2.5101 2.6668 -0.0206 0.0058  0.0611  318 VAL A C   
1921 O O   . VAL A 252 ? 2.6477 2.4793 2.6303 -0.0230 0.0060  0.0615  318 VAL A O   
1922 C CB  . VAL A 252 ? 2.7183 2.5473 2.7040 -0.0212 0.0055  0.0559  318 VAL A CB  
1923 C CG1 . VAL A 252 ? 2.6589 2.4954 2.6442 -0.0193 0.0038  0.0576  318 VAL A CG1 
1924 C CG2 . VAL A 252 ? 2.6658 2.4987 2.6535 -0.0253 0.0067  0.0535  318 VAL A CG2 
1925 N N   . THR A 253 ? 2.9645 2.7859 2.9450 -0.0172 0.0050  0.0632  319 THR A N   
1926 C CA  . THR A 253 ? 2.8483 2.6727 2.8272 -0.0161 0.0041  0.0661  319 THR A CA  
1927 C C   . THR A 253 ? 2.7583 2.5762 2.7354 -0.0168 0.0053  0.0682  319 THR A C   
1928 O O   . THR A 253 ? 2.7725 2.5902 2.7478 -0.0150 0.0046  0.0708  319 THR A O   
1929 C CB  . THR A 253 ? 1.9063 1.7317 1.8848 -0.0117 0.0021  0.0672  319 THR A CB  
1930 O OG1 . THR A 253 ? 1.9011 1.7178 1.8780 -0.0090 0.0022  0.0683  319 THR A OG1 
1931 C CG2 . THR A 253 ? 1.9235 1.7529 1.9043 -0.0105 0.0011  0.0647  319 THR A CG2 
1932 N N   . THR A 254 ? 2.6094 2.4228 2.5874 -0.0193 0.0071  0.0670  320 THR A N   
1933 C CA  . THR A 254 ? 2.4854 2.2939 2.4625 -0.0206 0.0084  0.0687  320 THR A CA  
1934 C C   . THR A 254 ? 2.3017 2.1141 2.2803 -0.0248 0.0096  0.0680  320 THR A C   
1935 O O   . THR A 254 ? 2.1746 1.9946 2.1542 -0.0264 0.0091  0.0670  320 THR A O   
1936 C CB  . THR A 254 ? 2.3473 2.1468 2.3248 -0.0197 0.0094  0.0679  320 THR A CB  
1937 O OG1 . THR A 254 ? 2.3479 2.1470 2.3284 -0.0230 0.0108  0.0653  320 THR A OG1 
1938 C CG2 . THR A 254 ? 2.3155 2.1119 2.2922 -0.0159 0.0082  0.0671  320 THR A CG2 
1939 N N   . LEU A 255 ? 2.0426 1.8641 2.0264 -0.0309 0.0107  0.0627  321 LEU A N   
1940 C CA  . LEU A 255 ? 2.2043 2.0243 2.1911 -0.0334 0.0116  0.0599  321 LEU A CA  
1941 C C   . LEU A 255 ? 2.3979 2.2215 2.3864 -0.0373 0.0124  0.0593  321 LEU A C   
1942 O O   . LEU A 255 ? 2.2986 2.1291 2.2865 -0.0384 0.0120  0.0598  321 LEU A O   
1943 C CB  . LEU A 255 ? 2.3180 2.1412 2.3060 -0.0329 0.0110  0.0572  321 LEU A CB  
1944 C CG  . LEU A 255 ? 2.4027 2.2203 2.3926 -0.0325 0.0114  0.0549  321 LEU A CG  
1945 C CD1 . LEU A 255 ? 2.3970 2.2173 2.3874 -0.0313 0.0106  0.0525  321 LEU A CD1 
1946 C CD2 . LEU A 255 ? 2.4974 2.3066 2.4859 -0.0298 0.0117  0.0564  321 LEU A CD2 
1947 N N   . PRO A 256 ? 2.4462 2.2657 2.4372 -0.0394 0.0133  0.0582  322 PRO A N   
1948 C CA  . PRO A 256 ? 2.6136 2.4355 2.6066 -0.0432 0.0138  0.0574  322 PRO A CA  
1949 C C   . PRO A 256 ? 2.8091 2.6400 2.8026 -0.0451 0.0134  0.0558  322 PRO A C   
1950 O O   . PRO A 256 ? 3.1975 3.0325 3.1905 -0.0469 0.0135  0.0566  322 PRO A O   
1951 C CB  . PRO A 256 ? 2.5915 2.4087 2.5876 -0.0446 0.0141  0.0550  322 PRO A CB  
1952 C CG  . PRO A 256 ? 2.5626 2.3739 2.5582 -0.0412 0.0140  0.0551  322 PRO A CG  
1953 C CD  . PRO A 256 ? 2.5116 2.3231 2.5034 -0.0379 0.0136  0.0578  322 PRO A CD  
1954 N N   . ARG A 257 ? 2.7868 2.6212 2.7813 -0.0447 0.0128  0.0536  323 ARG A N   
1955 C CA  . ARG A 257 ? 2.5679 2.4114 2.5628 -0.0463 0.0123  0.0522  323 ARG A CA  
1956 C C   . ARG A 257 ? 2.3873 2.2356 2.3802 -0.0438 0.0115  0.0529  323 ARG A C   
1957 O O   . ARG A 257 ? 2.3340 2.1788 2.3257 -0.0409 0.0110  0.0537  323 ARG A O   
1958 C CB  . ARG A 257 ? 2.5672 2.4124 2.5649 -0.0483 0.0122  0.0488  323 ARG A CB  
1959 C CG  . ARG A 257 ? 2.4767 2.3263 2.4761 -0.0518 0.0123  0.0473  323 ARG A CG  
1960 C CD  . ARG A 257 ? 2.4195 2.2657 2.4214 -0.0538 0.0122  0.0447  323 ARG A CD  
1961 N NE  . ARG A 257 ? 2.3607 2.1978 2.3631 -0.0533 0.0126  0.0456  323 ARG A NE  
1962 C CZ  . ARG A 257 ? 2.2998 2.1323 2.3043 -0.0548 0.0124  0.0436  323 ARG A CZ  
1963 N NH1 . ARG A 257 ? 2.2721 2.1084 2.2780 -0.0569 0.0117  0.0406  323 ARG A NH1 
1964 N NH2 . ARG A 257 ? 2.2888 2.1132 2.2939 -0.0541 0.0127  0.0446  323 ARG A NH2 
1965 N N   . ASN A 258 ? 2.3632 2.2196 2.3559 -0.0448 0.0112  0.0527  324 ASN A N   
1966 C CA  . ASN A 258 ? 2.1463 2.0091 2.1378 -0.0430 0.0102  0.0529  324 ASN A CA  
1967 C C   . ASN A 258 ? 1.9607 1.8273 1.9541 -0.0434 0.0100  0.0502  324 ASN A C   
1968 O O   . ASN A 258 ? 1.8677 1.7358 1.8632 -0.0460 0.0105  0.0482  324 ASN A O   
1969 C CB  . ASN A 258 ? 2.1492 2.0189 2.1401 -0.0441 0.0102  0.0536  324 ASN A CB  
1970 C CG  . ASN A 258 ? 2.1452 2.0145 2.1336 -0.0420 0.0097  0.0564  324 ASN A CG  
1971 O OD1 . ASN A 258 ? 2.1001 1.9659 2.0872 -0.0394 0.0090  0.0578  324 ASN A OD1 
1972 N ND2 . ASN A 258 ? 2.1966 2.0698 2.1844 -0.0432 0.0099  0.0571  324 ASN A ND2 
1973 N N   . VAL A 259 ? 1.9679 1.8370 1.9607 -0.0411 0.0091  0.0501  325 VAL A N   
1974 C CA  . VAL A 259 ? 1.9307 1.8046 1.9253 -0.0418 0.0089  0.0475  325 VAL A CA  
1975 C C   . VAL A 259 ? 2.0158 1.8988 2.0101 -0.0412 0.0083  0.0476  325 VAL A C   
1976 O O   . VAL A 259 ? 2.0703 1.9545 2.0631 -0.0389 0.0074  0.0493  325 VAL A O   
1977 C CB  . VAL A 259 ? 1.7829 1.6523 1.7776 -0.0396 0.0083  0.0468  325 VAL A CB  
1978 C CG1 . VAL A 259 ? 1.6582 1.5325 1.6550 -0.0406 0.0082  0.0440  325 VAL A CG1 
1979 C CG2 . VAL A 259 ? 1.8402 1.7006 1.8354 -0.0399 0.0090  0.0465  325 VAL A CG2 
1980 N N   . MET A 260 ? 1.9174 1.8069 1.9133 -0.0433 0.0087  0.0456  326 MET A N   
1981 C CA  . MET A 260 ? 1.8919 1.7902 1.8879 -0.0427 0.0083  0.0453  326 MET A CA  
1982 C C   . MET A 260 ? 1.8554 1.7593 1.8531 -0.0427 0.0081  0.0431  326 MET A C   
1983 O O   . MET A 260 ? 1.9130 1.8183 1.9125 -0.0447 0.0087  0.0409  326 MET A O   
1984 C CB  . MET A 260 ? 1.8483 1.7514 1.8445 -0.0446 0.0090  0.0452  326 MET A CB  
1985 C CG  . MET A 260 ? 1.8443 1.7563 1.8410 -0.0441 0.0088  0.0441  326 MET A CG  
1986 S SD  . MET A 260 ? 4.1916 4.1099 4.1888 -0.0459 0.0095  0.0434  326 MET A SD  
1987 C CE  . MET A 260 ? 3.1686 3.0957 3.1663 -0.0442 0.0090  0.0423  326 MET A CE  
1988 N N   . PHE A 261 ? 1.8870 1.7945 1.8843 -0.0404 0.0072  0.0436  327 PHE A N   
1989 C CA  . PHE A 261 ? 1.7317 1.6451 1.7305 -0.0402 0.0070  0.0417  327 PHE A CA  
1990 C C   . PHE A 261 ? 1.6295 1.5522 1.6288 -0.0402 0.0072  0.0410  327 PHE A C   
1991 O O   . PHE A 261 ? 1.5349 1.4605 1.5331 -0.0390 0.0068  0.0424  327 PHE A O   
1992 C CB  . PHE A 261 ? 1.7758 1.6870 1.7745 -0.0375 0.0059  0.0422  327 PHE A CB  
1993 C CG  . PHE A 261 ? 1.8637 1.7657 1.8622 -0.0370 0.0057  0.0424  327 PHE A CG  
1994 C CD1 . PHE A 261 ? 1.8602 1.7599 1.8602 -0.0382 0.0061  0.0400  327 PHE A CD1 
1995 C CD2 . PHE A 261 ? 1.9570 1.8524 1.9537 -0.0354 0.0052  0.0446  327 PHE A CD2 
1996 C CE1 . PHE A 261 ? 1.9319 1.8229 1.9317 -0.0376 0.0060  0.0397  327 PHE A CE1 
1997 C CE2 . PHE A 261 ? 2.0097 1.8963 2.0061 -0.0346 0.0052  0.0446  327 PHE A CE2 
1998 C CZ  . PHE A 261 ? 1.9996 1.8837 1.9975 -0.0357 0.0056  0.0420  327 PHE A CZ  
1999 N N   . VAL A 262 ? 1.6138 1.5411 1.6149 -0.0417 0.0079  0.0387  328 VAL A N   
2000 C CA  . VAL A 262 ? 1.5726 1.5085 1.5745 -0.0416 0.0082  0.0375  328 VAL A CA  
2001 C C   . VAL A 262 ? 1.6071 1.5473 1.6107 -0.0411 0.0081  0.0357  328 VAL A C   
2002 O O   . VAL A 262 ? 1.6397 1.5775 1.6445 -0.0423 0.0084  0.0343  328 VAL A O   
2003 C CB  . VAL A 262 ? 1.5195 1.4577 1.5223 -0.0437 0.0091  0.0363  328 VAL A CB  
2004 C CG1 . VAL A 262 ? 1.4540 1.3997 1.4586 -0.0438 0.0095  0.0340  328 VAL A CG1 
2005 C CG2 . VAL A 262 ? 1.5153 1.4545 1.5167 -0.0436 0.0092  0.0376  328 VAL A CG2 
2006 N N   . PHE A 263 ? 1.4490 1.3953 1.4527 -0.0394 0.0078  0.0356  329 PHE A N   
2007 C CA  . PHE A 263 ? 1.5592 1.5099 1.5646 -0.0390 0.0079  0.0338  329 PHE A CA  
2008 C C   . PHE A 263 ? 1.6498 1.6084 1.6561 -0.0390 0.0086  0.0321  329 PHE A C   
2009 O O   . PHE A 263 ? 1.7484 1.7087 1.7536 -0.0386 0.0086  0.0329  329 PHE A O   
2010 C CB  . PHE A 263 ? 1.7198 1.6711 1.7253 -0.0366 0.0067  0.0348  329 PHE A CB  
2011 C CG  . PHE A 263 ? 1.9352 1.8782 1.9401 -0.0360 0.0058  0.0364  329 PHE A CG  
2012 C CD1 . PHE A 263 ? 2.0064 1.9419 2.0108 -0.0377 0.0062  0.0363  329 PHE A CD1 
2013 C CD2 . PHE A 263 ? 2.0483 1.9909 2.0536 -0.0332 0.0044  0.0380  329 PHE A CD2 
2014 C CE1 . PHE A 263 ? 2.0983 2.0255 2.1021 -0.0366 0.0053  0.0375  329 PHE A CE1 
2015 C CE2 . PHE A 263 ? 2.1333 2.0680 2.1384 -0.0318 0.0034  0.0394  329 PHE A CE2 
2016 C CZ  . PHE A 263 ? 2.1443 2.0709 2.1484 -0.0334 0.0039  0.0390  329 PHE A CZ  
2028 N N   . GLN A 265 ? 1.5488 1.5246 1.5552 -0.0409 0.0071  0.0302  331 GLN A N   
2029 C CA  . GLN A 265 ? 1.4315 1.4133 1.4387 -0.0391 0.0067  0.0291  331 GLN A CA  
2030 C C   . GLN A 265 ? 1.2956 1.2827 1.3029 -0.0400 0.0062  0.0276  331 GLN A C   
2031 O O   . GLN A 265 ? 1.1067 1.0938 1.1128 -0.0418 0.0057  0.0279  331 GLN A O   
2032 C CB  . GLN A 265 ? 1.3979 1.3825 1.4044 -0.0375 0.0054  0.0306  331 GLN A CB  
2033 C CG  . GLN A 265 ? 1.3038 1.2927 1.3114 -0.0352 0.0052  0.0300  331 GLN A CG  
2034 C CD  . GLN A 265 ? 1.2542 1.2496 1.2624 -0.0347 0.0046  0.0284  331 GLN A CD  
2035 O OE1 . GLN A 265 ? 1.3162 1.3134 1.3235 -0.0361 0.0042  0.0280  331 GLN A OE1 
2036 N NE2 . GLN A 265 ? 1.1919 1.1906 1.2014 -0.0327 0.0047  0.0276  331 GLN A NE2 
2037 N N   . GLY A 266 ? 1.2024 1.1940 1.2109 -0.0385 0.0063  0.0262  332 GLY A N   
2038 C CA  . GLY A 266 ? 1.4100 1.4068 1.4181 -0.0387 0.0058  0.0248  332 GLY A CA  
2039 C C   . GLY A 266 ? 1.6312 1.6272 1.6392 -0.0409 0.0061  0.0237  332 GLY A C   
2040 O O   . GLY A 266 ? 1.6659 1.6659 1.6726 -0.0412 0.0054  0.0229  332 GLY A O   
2041 N N   . GLU A 267 ? 1.2360 1.2271 1.2451 -0.0422 0.0072  0.0235  333 GLU A N   
2042 C CA  . GLU A 267 ? 1.6725 1.6633 1.6814 -0.0443 0.0073  0.0224  333 GLU A CA  
2043 C C   . GLU A 267 ? 1.7149 1.7102 1.7242 -0.0441 0.0073  0.0204  333 GLU A C   
2044 O O   . GLU A 267 ? 1.7555 1.7526 1.7633 -0.0456 0.0068  0.0198  333 GLU A O   
2045 C CB  . GLU A 267 ? 2.1172 2.1013 2.1274 -0.0458 0.0082  0.0226  333 GLU A CB  
2046 C CG  . GLU A 267 ? 2.9905 2.9735 3.0019 -0.0477 0.0086  0.0210  333 GLU A CG  
2047 C CD  . GLU A 267 ? 3.3058 3.2913 3.3195 -0.0467 0.0090  0.0191  333 GLU A CD  
2048 O OE1 . GLU A 267 ? 3.3752 3.3625 3.3900 -0.0445 0.0093  0.0191  333 GLU A OE1 
2049 O OE2 . GLU A 267 ? 3.4082 3.3937 3.4225 -0.0482 0.0090  0.0177  333 GLU A OE2 
2050 N N   . THR A 268 ? 1.8005 1.7982 1.8115 -0.0422 0.0077  0.0194  334 THR A N   
2051 C CA  . THR A 268 ? 1.8397 1.8416 1.8509 -0.0422 0.0077  0.0175  334 THR A CA  
2052 C C   . THR A 268 ? 1.7292 1.7360 1.7376 -0.0417 0.0065  0.0175  334 THR A C   
2053 O O   . THR A 268 ? 1.7005 1.7104 1.7077 -0.0420 0.0063  0.0163  334 THR A O   
2054 C CB  . THR A 268 ? 3.1692 3.1728 3.1829 -0.0402 0.0083  0.0164  334 THR A CB  
2055 O OG1 . THR A 268 ? 3.1725 3.1777 3.1867 -0.0410 0.0085  0.0146  334 THR A OG1 
2056 C CG2 . THR A 268 ? 3.1575 3.1656 3.1701 -0.0378 0.0077  0.0164  334 THR A CG2 
2057 N N   . PHE A 269 ? 1.8472 1.8543 1.8544 -0.0410 0.0058  0.0190  335 PHE A N   
2058 C CA  . PHE A 269 ? 1.4000 1.4114 1.4049 -0.0404 0.0045  0.0190  335 PHE A CA  
2059 C C   . PHE A 269 ? 1.2722 1.2829 1.2750 -0.0428 0.0041  0.0192  335 PHE A C   
2060 O O   . PHE A 269 ? 1.3379 1.3495 1.3399 -0.0441 0.0043  0.0180  335 PHE A O   
2061 C CB  . PHE A 269 ? 1.3461 1.3586 1.3507 -0.0388 0.0037  0.0203  335 PHE A CB  
2062 C CG  . PHE A 269 ? 1.5031 1.5206 1.5070 -0.0368 0.0028  0.0196  335 PHE A CG  
2063 C CD1 . PHE A 269 ? 1.6309 1.6498 1.6361 -0.0344 0.0027  0.0196  335 PHE A CD1 
2064 C CD2 . PHE A 269 ? 1.5455 1.5659 1.5473 -0.0372 0.0019  0.0189  335 PHE A CD2 
2065 C CE1 . PHE A 269 ? 1.6418 1.6650 1.6462 -0.0324 0.0017  0.0190  335 PHE A CE1 
2066 C CE2 . PHE A 269 ? 1.5893 1.6138 1.5901 -0.0354 0.0010  0.0182  335 PHE A CE2 
2067 C CZ  . PHE A 269 ? 1.5982 1.6241 1.6004 -0.0329 0.0008  0.0183  335 PHE A CZ  
2068 N N   . ASP A 270 ? 1.4325 1.4416 1.4343 -0.0435 0.0035  0.0207  336 ASP A N   
2069 C CA  . ASP A 270 ? 1.3421 1.3508 1.3417 -0.0455 0.0029  0.0211  336 ASP A CA  
2070 C C   . ASP A 270 ? 1.1433 1.1468 1.1435 -0.0478 0.0038  0.0214  336 ASP A C   
2071 O O   . ASP A 270 ? 1.0783 1.0813 1.0782 -0.0494 0.0042  0.0203  336 ASP A O   
2072 C CB  . ASP A 270 ? 1.4681 1.4780 1.4666 -0.0450 0.0017  0.0225  336 ASP A CB  
2073 C CG  . ASP A 270 ? 1.8446 1.8589 1.8408 -0.0449 0.0005  0.0220  336 ASP A CG  
2074 O OD1 . ASP A 270 ? 1.7527 1.7701 1.7485 -0.0442 0.0004  0.0207  336 ASP A OD1 
2075 O OD2 . ASP A 270 ? 1.8570 1.8716 1.8519 -0.0454 -0.0004 0.0231  336 ASP A OD2 
2076 N N   . TYR A 271 ? 1.0299 1.0294 1.0308 -0.0479 0.0040  0.0229  337 TYR A N   
2077 C CA  . TYR A 271 ? 1.0572 1.0507 1.0591 -0.0495 0.0049  0.0234  337 TYR A CA  
2078 C C   . TYR A 271 ? 0.9620 0.9540 0.9632 -0.0490 0.0044  0.0253  337 TYR A C   
2079 O O   . TYR A 271 ? 0.9327 0.9202 0.9335 -0.0504 0.0045  0.0265  337 TYR A O   
2080 C CB  . TYR A 271 ? 1.3432 1.3349 1.3440 -0.0521 0.0051  0.0228  337 TYR A CB  
2081 C CG  . TYR A 271 ? 2.5350 2.5210 2.5354 -0.0541 0.0053  0.0241  337 TYR A CG  
2082 C CD1 . TYR A 271 ? 2.4471 2.4332 2.4450 -0.0558 0.0045  0.0249  337 TYR A CD1 
2083 C CD2 . TYR A 271 ? 2.5112 2.4917 2.5133 -0.0543 0.0061  0.0246  337 TYR A CD2 
2084 C CE1 . TYR A 271 ? 2.2503 2.2314 2.2476 -0.0576 0.0047  0.0261  337 TYR A CE1 
2085 C CE2 . TYR A 271 ? 2.4153 2.3905 2.4167 -0.0561 0.0062  0.0258  337 TYR A CE2 
2086 C CZ  . TYR A 271 ? 2.1703 2.1460 2.1693 -0.0577 0.0055  0.0265  337 TYR A CZ  
2087 O OH  . TYR A 271 ? 1.9862 1.9567 1.9846 -0.0593 0.0057  0.0277  337 TYR A OH  
2088 N N   . ILE A 272 ? 1.1342 1.1296 1.1356 -0.0469 0.0038  0.0256  338 ILE A N   
2089 C CA  . ILE A 272 ? 1.1996 1.1953 1.2002 -0.0463 0.0029  0.0271  338 ILE A CA  
2090 C C   . ILE A 272 ? 1.2257 1.2159 1.2272 -0.0461 0.0036  0.0285  338 ILE A C   
2091 O O   . ILE A 272 ? 1.1783 1.1653 1.1814 -0.0459 0.0048  0.0280  338 ILE A O   
2092 C CB  . ILE A 272 ? 1.1565 1.1577 1.1572 -0.0439 0.0020  0.0268  338 ILE A CB  
2093 C CG1 . ILE A 272 ? 1.3127 1.3149 1.3130 -0.0430 0.0009  0.0283  338 ILE A CG1 
2094 C CG2 . ILE A 272 ? 1.1058 1.1075 1.1086 -0.0420 0.0028  0.0260  338 ILE A CG2 
2095 C CD1 . ILE A 272 ? 1.4028 1.4033 1.4014 -0.0449 0.0003  0.0294  338 ILE A CD1 
2096 N N   . GLY A 273 ? 1.3529 1.3416 1.3535 -0.0463 0.0029  0.0302  339 GLY A N   
2097 C CA  . GLY A 273 ? 1.5110 1.4946 1.5120 -0.0458 0.0035  0.0317  339 GLY A CA  
2098 C C   . GLY A 273 ? 1.6559 1.6331 1.6563 -0.0477 0.0041  0.0327  339 GLY A C   
2099 O O   . GLY A 273 ? 1.6506 1.6250 1.6498 -0.0481 0.0036  0.0344  339 GLY A O   
2100 N N   . SER A 274 ? 1.6343 1.6096 1.6354 -0.0489 0.0049  0.0315  340 SER A N   
2101 C CA  . SER A 274 ? 1.8080 1.7775 1.8089 -0.0509 0.0056  0.0319  340 SER A CA  
2102 C C   . SER A 274 ? 1.9129 1.8821 1.9116 -0.0527 0.0048  0.0328  340 SER A C   
2103 O O   . SER A 274 ? 1.9595 1.9240 1.9575 -0.0535 0.0049  0.0343  340 SER A O   
2104 C CB  . SER A 274 ? 1.8405 1.8105 1.8426 -0.0519 0.0063  0.0298  340 SER A CB  
2105 O OG  . SER A 274 ? 1.8071 1.7834 1.8083 -0.0520 0.0055  0.0288  340 SER A OG  
2106 N N   . SER A 275 ? 1.6745 1.6491 1.6722 -0.0531 0.0039  0.0320  341 SER A N   
2107 C CA  . SER A 275 ? 1.6341 1.6093 1.6298 -0.0548 0.0032  0.0327  341 SER A CA  
2108 C C   . SER A 275 ? 1.9514 1.9253 1.9461 -0.0544 0.0024  0.0347  341 SER A C   
2109 O O   . SER A 275 ? 2.0293 1.9992 2.0229 -0.0559 0.0025  0.0359  341 SER A O   
2110 C CB  . SER A 275 ? 1.3717 1.3532 1.3666 -0.0547 0.0024  0.0314  341 SER A CB  
2111 O OG  . SER A 275 ? 1.3147 1.2998 1.3110 -0.0524 0.0024  0.0306  341 SER A OG  
2112 N N   . ARG A 276 ? 1.9435 1.9201 1.9388 -0.0523 0.0019  0.0352  342 ARG A N   
2113 C CA  . ARG A 276 ? 2.0345 2.0104 2.0289 -0.0519 0.0011  0.0371  342 ARG A CA  
2114 C C   . ARG A 276 ? 2.0442 2.0132 2.0384 -0.0523 0.0018  0.0387  342 ARG A C   
2115 O O   . ARG A 276 ? 2.0491 2.0159 2.0420 -0.0534 0.0013  0.0401  342 ARG A O   
2116 C CB  . ARG A 276 ? 2.0035 1.9842 1.9985 -0.0497 0.0002  0.0373  342 ARG A CB  
2117 C CG  . ARG A 276 ? 2.2662 2.2507 2.2598 -0.0506 -0.0012 0.0376  342 ARG A CG  
2118 C CD  . ARG A 276 ? 2.2792 2.2704 2.2730 -0.0493 -0.0023 0.0367  342 ARG A CD  
2119 N NE  . ARG A 276 ? 2.3355 2.3292 2.3309 -0.0469 -0.0026 0.0368  342 ARG A NE  
2120 C CZ  . ARG A 276 ? 2.4206 2.4144 2.4162 -0.0461 -0.0033 0.0383  342 ARG A CZ  
2121 N NH1 . ARG A 276 ? 2.3992 2.3907 2.3936 -0.0475 -0.0038 0.0397  342 ARG A NH1 
2122 N NH2 . ARG A 276 ? 2.5031 2.4995 2.5003 -0.0439 -0.0036 0.0382  342 ARG A NH2 
2123 N N   . MET A 277 ? 2.1907 2.1561 2.1863 -0.0515 0.0029  0.0384  343 MET A N   
2124 C CA  . MET A 277 ? 2.2175 2.1759 2.2128 -0.0517 0.0036  0.0399  343 MET A CA  
2125 C C   . MET A 277 ? 2.2599 2.2144 2.2541 -0.0542 0.0039  0.0402  343 MET A C   
2126 O O   . MET A 277 ? 2.3143 2.2645 2.3073 -0.0548 0.0038  0.0420  343 MET A O   
2127 C CB  . MET A 277 ? 2.1632 2.1181 2.1600 -0.0504 0.0048  0.0394  343 MET A CB  
2128 C CG  . MET A 277 ? 2.1474 2.1069 2.1455 -0.0483 0.0047  0.0384  343 MET A CG  
2129 S SD  . MET A 277 ? 3.3361 3.2900 3.3357 -0.0476 0.0063  0.0376  343 MET A SD  
2130 C CE  . MET A 277 ? 1.5219 1.4670 1.5203 -0.0487 0.0068  0.0396  343 MET A CE  
2131 N N   . VAL A 278 ? 2.3183 2.2741 2.3128 -0.0557 0.0042  0.0385  344 VAL A N   
2132 C CA  . VAL A 278 ? 2.1941 2.1469 2.1876 -0.0583 0.0044  0.0386  344 VAL A CA  
2133 C C   . VAL A 278 ? 2.2050 2.1595 2.1964 -0.0592 0.0033  0.0398  344 VAL A C   
2134 O O   . VAL A 278 ? 2.1399 2.0902 2.1301 -0.0607 0.0033  0.0410  344 VAL A O   
2135 C CB  . VAL A 278 ? 2.2389 2.1944 2.2328 -0.0597 0.0046  0.0365  344 VAL A CB  
2136 C CG1 . VAL A 278 ? 2.1905 2.1416 2.1836 -0.0623 0.0049  0.0365  344 VAL A CG1 
2137 C CG2 . VAL A 278 ? 2.2003 2.1566 2.1964 -0.0585 0.0053  0.0349  344 VAL A CG2 
2138 N N   . TYR A 279 ? 2.2361 2.1969 2.2271 -0.0584 0.0023  0.0394  345 TYR A N   
2139 C CA  . TYR A 279 ? 2.1925 2.1558 2.1818 -0.0592 0.0011  0.0403  345 TYR A CA  
2140 C C   . TYR A 279 ? 2.2924 2.2519 2.2810 -0.0587 0.0008  0.0426  345 TYR A C   
2141 O O   . TYR A 279 ? 2.3490 2.3070 2.3361 -0.0603 0.0004  0.0437  345 TYR A O   
2142 C CB  . TYR A 279 ? 1.9959 1.9664 1.9853 -0.0579 0.0001  0.0394  345 TYR A CB  
2143 C CG  . TYR A 279 ? 1.8556 1.8296 1.8433 -0.0595 -0.0008 0.0389  345 TYR A CG  
2144 C CD1 . TYR A 279 ? 1.7885 1.7640 1.7758 -0.0607 -0.0005 0.0373  345 TYR A CD1 
2145 C CD2 . TYR A 279 ? 1.8308 1.8067 1.8174 -0.0596 -0.0020 0.0401  345 TYR A CD2 
2146 C CE1 . TYR A 279 ? 1.7864 1.7650 1.7719 -0.0621 -0.0013 0.0369  345 TYR A CE1 
2147 C CE2 . TYR A 279 ? 1.8376 1.8165 1.8225 -0.0609 -0.0028 0.0396  345 TYR A CE2 
2148 C CZ  . TYR A 279 ? 1.8471 1.8273 1.8314 -0.0622 -0.0024 0.0380  345 TYR A CZ  
2149 O OH  . TYR A 279 ? 1.8773 1.8605 1.8600 -0.0635 -0.0032 0.0376  345 TYR A OH  
2150 N N   . ASP A 280 ? 2.1071 2.0652 2.0969 -0.0567 0.0011  0.0433  346 ASP A N   
2151 C CA  . ASP A 280 ? 2.1766 2.1310 2.1658 -0.0559 0.0009  0.0455  346 ASP A CA  
2152 C C   . ASP A 280 ? 2.8331 2.7799 2.8218 -0.0573 0.0020  0.0464  346 ASP A C   
2153 O O   . ASP A 280 ? 2.8798 2.8233 2.8670 -0.0580 0.0017  0.0482  346 ASP A O   
2154 C CB  . ASP A 280 ? 2.0571 2.0121 2.0475 -0.0533 0.0010  0.0459  346 ASP A CB  
2155 C CG  . ASP A 280 ? 1.8785 1.8309 1.8682 -0.0522 0.0005  0.0482  346 ASP A CG  
2156 O OD1 . ASP A 280 ? 1.8528 1.8028 1.8410 -0.0536 0.0001  0.0496  346 ASP A OD1 
2157 O OD2 . ASP A 280 ? 1.7618 1.7145 1.7522 -0.0501 0.0005  0.0486  346 ASP A OD2 
2158 N N   . MET A 281 ? 2.7604 2.7044 2.7502 -0.0576 0.0031  0.0452  347 MET A N   
2159 C CA  . MET A 281 ? 2.6536 2.5905 2.6432 -0.0591 0.0042  0.0456  347 MET A CA  
2160 C C   . MET A 281 ? 2.5723 2.5093 2.5603 -0.0616 0.0037  0.0459  347 MET A C   
2161 O O   . MET A 281 ? 2.6754 2.6070 2.6625 -0.0628 0.0040  0.0472  347 MET A O   
2162 C CB  . MET A 281 ? 2.1005 2.0354 2.0920 -0.0593 0.0053  0.0438  347 MET A CB  
2163 C CG  . MET A 281 ? 1.6913 1.6180 1.6832 -0.0603 0.0065  0.0443  347 MET A CG  
2164 S SD  . MET A 281 ? 1.4099 1.3280 1.4014 -0.0591 0.0072  0.0468  347 MET A SD  
2165 C CE  . MET A 281 ? 1.1326 1.0437 1.1247 -0.0614 0.0082  0.0465  347 MET A CE  
2166 N N   . GLU A 282 ? 2.2890 2.2319 2.2765 -0.0625 0.0029  0.0446  348 GLU A N   
2167 C CA  . GLU A 282 ? 2.0119 1.9550 1.9978 -0.0650 0.0026  0.0446  348 GLU A CA  
2168 C C   . GLU A 282 ? 1.9808 1.9256 1.9649 -0.0652 0.0014  0.0461  348 GLU A C   
2169 O O   . GLU A 282 ? 2.1265 2.0689 2.1091 -0.0671 0.0013  0.0469  348 GLU A O   
2170 C CB  . GLU A 282 ? 1.7715 1.7197 1.7575 -0.0658 0.0024  0.0424  348 GLU A CB  
2171 C CG  . GLU A 282 ? 1.6335 1.5820 1.6176 -0.0684 0.0020  0.0421  348 GLU A CG  
2172 C CD  . GLU A 282 ? 1.4365 1.3920 1.4197 -0.0685 0.0010  0.0410  348 GLU A CD  
2173 O OE1 . GLU A 282 ? 1.3912 1.3511 1.3752 -0.0666 0.0005  0.0407  348 GLU A OE1 
2174 O OE2 . GLU A 282 ? 1.4285 1.3849 1.4102 -0.0705 0.0008  0.0405  348 GLU A OE2 
2175 N N   . LYS A 283 ? 1.9940 1.9427 1.9784 -0.0634 0.0006  0.0466  349 LYS A N   
2176 C CA  . LYS A 283 ? 1.9282 1.8797 1.9111 -0.0638 -0.0007 0.0476  349 LYS A CA  
2177 C C   . LYS A 283 ? 1.9347 1.8851 1.9177 -0.0621 -0.0011 0.0496  349 LYS A C   
2178 O O   . LYS A 283 ? 1.9457 1.8967 1.9275 -0.0626 -0.0020 0.0509  349 LYS A O   
2179 C CB  . LYS A 283 ? 1.9060 1.8650 1.8890 -0.0636 -0.0016 0.0461  349 LYS A CB  
2180 C CG  . LYS A 283 ? 1.9420 1.9053 1.9257 -0.0614 -0.0026 0.0465  349 LYS A CG  
2181 C CD  . LYS A 283 ? 1.9068 1.8770 1.8912 -0.0606 -0.0032 0.0447  349 LYS A CD  
2182 C CE  . LYS A 283 ? 1.8183 1.7918 1.8042 -0.0581 -0.0038 0.0449  349 LYS A CE  
2183 N NZ  . LYS A 283 ? 1.7585 1.7385 1.7450 -0.0570 -0.0045 0.0433  349 LYS A NZ  
2184 N N   . GLY A 284 ? 1.9619 1.9101 1.9463 -0.0601 -0.0005 0.0498  350 GLY A N   
2185 C CA  . GLY A 284 ? 1.9149 1.8630 1.8996 -0.0582 -0.0009 0.0513  350 GLY A CA  
2186 C C   . GLY A 284 ? 1.9570 1.8999 1.9404 -0.0585 -0.0010 0.0537  350 GLY A C   
2187 O O   . GLY A 284 ? 2.0423 1.9788 2.0252 -0.0591 0.0000  0.0545  350 GLY A O   
2229 N N   . GLU A 291 ? 2.8147 2.7112 2.8036 -0.0615 0.0088  0.0521  357 GLU A N   
2230 C CA  . GLU A 291 ? 2.8377 2.7270 2.8265 -0.0627 0.0095  0.0532  357 GLU A CA  
2231 C C   . GLU A 291 ? 2.9702 2.8539 2.9613 -0.0620 0.0108  0.0524  357 GLU A C   
2232 O O   . GLU A 291 ? 2.9727 2.8508 2.9644 -0.0633 0.0115  0.0525  357 GLU A O   
2238 N N   . ASN A 292 ? 2.9136 2.7989 2.9060 -0.0599 0.0111  0.0513  358 ASN A N   
2239 C CA  . ASN A 292 ? 2.8865 2.7672 2.8815 -0.0593 0.0122  0.0501  358 ASN A CA  
2240 C C   . ASN A 292 ? 2.7507 2.6360 2.7475 -0.0581 0.0122  0.0479  358 ASN A C   
2241 O O   . ASN A 292 ? 2.6609 2.5497 2.6568 -0.0561 0.0118  0.0482  358 ASN A O   
2246 N N   . VAL A 293 ? 2.4408 2.3263 2.4399 -0.0596 0.0125  0.0455  359 VAL A N   
2247 C CA  . VAL A 293 ? 2.3763 2.2646 2.3767 -0.0592 0.0121  0.0434  359 VAL A CA  
2248 C C   . VAL A 293 ? 2.6136 2.5011 2.6159 -0.0616 0.0120  0.0410  359 VAL A C   
2249 O O   . VAL A 293 ? 2.6386 2.5306 2.6417 -0.0633 0.0119  0.0396  359 VAL A O   
2253 N N   . ASP A 294 ? 2.8195 2.7015 2.8224 -0.0612 0.0118  0.0403  360 ASP A N   
2254 C CA  . ASP A 294 ? 2.8255 2.7041 2.8299 -0.0633 0.0115  0.0382  360 ASP A CA  
2255 C C   . ASP A 294 ? 2.6162 2.4958 2.6218 -0.0632 0.0109  0.0356  360 ASP A C   
2256 O O   . ASP A 294 ? 2.6269 2.5045 2.6335 -0.0652 0.0106  0.0335  360 ASP A O   
2257 C CB  . ASP A 294 ? 2.5460 2.4150 2.5502 -0.0635 0.0117  0.0394  360 ASP A CB  
2258 C CG  . ASP A 294 ? 2.4726 2.3395 2.4757 -0.0638 0.0123  0.0418  360 ASP A CG  
2259 O OD1 . ASP A 294 ? 2.4423 2.3147 2.4450 -0.0648 0.0124  0.0419  360 ASP A OD1 
2260 O OD2 . ASP A 294 ? 2.4582 2.3179 2.4608 -0.0630 0.0126  0.0435  360 ASP A OD2 
2261 N N   . SER A 295 ? 2.5228 2.4058 2.5284 -0.0610 0.0108  0.0356  361 SER A N   
2262 C CA  . SER A 295 ? 2.5799 2.4634 2.5865 -0.0608 0.0103  0.0334  361 SER A CA  
2263 C C   . SER A 295 ? 2.6974 2.5876 2.7041 -0.0591 0.0101  0.0330  361 SER A C   
2264 O O   . SER A 295 ? 2.7318 2.6236 2.7375 -0.0568 0.0103  0.0348  361 SER A O   
2267 N N   . PHE A 296 ? 2.6065 2.5009 2.6145 -0.0601 0.0097  0.0304  362 PHE A N   
2268 C CA  . PHE A 296 ? 2.5753 2.4764 2.5839 -0.0588 0.0095  0.0295  362 PHE A CA  
2269 C C   . PHE A 296 ? 2.4403 2.3401 2.4497 -0.0583 0.0091  0.0276  362 PHE A C   
2270 O O   . PHE A 296 ? 2.4504 2.3477 2.4605 -0.0599 0.0087  0.0254  362 PHE A O   
2278 N N   . VAL A 297 ? 2.3344 2.2350 2.3434 -0.0558 0.0091  0.0286  363 VAL A N   
2279 C CA  . VAL A 297 ? 2.0122 1.9128 2.0221 -0.0551 0.0087  0.0267  363 VAL A CA  
2280 C C   . VAL A 297 ? 1.8235 1.7335 1.8340 -0.0543 0.0087  0.0263  363 VAL A C   
2281 O O   . VAL A 297 ? 1.8312 1.7445 1.8406 -0.0526 0.0090  0.0281  363 VAL A O   
2285 N N   . GLU A 298 ? 1.9411 1.8555 1.9529 -0.0556 0.0084  0.0238  364 GLU A N   
2286 C CA  . GLU A 298 ? 1.7956 1.7187 1.8081 -0.0547 0.0085  0.0231  364 GLU A CA  
2287 C C   . GLU A 298 ? 1.7706 1.6938 1.7841 -0.0543 0.0081  0.0211  364 GLU A C   
2288 O O   . GLU A 298 ? 1.8088 1.7301 1.8226 -0.0560 0.0077  0.0187  364 GLU A O   
2294 N N   . LEU A 299 ? 1.6635 1.5900 1.6772 -0.0521 0.0082  0.0218  365 LEU A N   
2295 C CA  . LEU A 299 ? 1.6268 1.5552 1.6415 -0.0514 0.0079  0.0199  365 LEU A CA  
2296 C C   . LEU A 299 ? 1.7561 1.6947 1.7721 -0.0516 0.0081  0.0187  365 LEU A C   
2297 O O   . LEU A 299 ? 1.8029 1.7474 1.8190 -0.0504 0.0086  0.0200  365 LEU A O   
2302 N N   . GLY A 300 ? 1.8350 1.7757 1.8519 -0.0529 0.0078  0.0160  366 GLY A N   
2303 C CA  . GLY A 300 ? 1.8658 1.8163 1.8839 -0.0528 0.0080  0.0149  366 GLY A CA  
2304 C C   . GLY A 300 ? 1.9772 1.9294 1.9958 -0.0533 0.0078  0.0121  366 GLY A C   
2305 O O   . GLY A 300 ? 2.0381 1.9892 2.0560 -0.0553 0.0076  0.0098  366 GLY A O   
2306 N N   . GLN A 301 ? 2.0812 2.0358 2.1006 -0.0515 0.0079  0.0120  367 GLN A N   
2307 C CA  . GLN A 301 ? 2.2024 2.1574 2.2218 -0.0520 0.0079  0.0089  367 GLN A CA  
2308 C C   . GLN A 301 ? 1.9940 1.9381 2.0117 -0.0529 0.0077  0.0073  367 GLN A C   
2309 O O   . GLN A 301 ? 2.0237 1.9635 2.0402 -0.0548 0.0075  0.0060  367 GLN A O   
2315 N N   . VAL A 302 ? 1.8851 1.8242 1.9026 -0.0509 0.0078  0.0078  368 VAL A N   
2316 C CA  . VAL A 302 ? 1.7023 1.6303 1.7184 -0.0501 0.0079  0.0066  368 VAL A CA  
2317 C C   . VAL A 302 ? 1.9492 1.8790 1.9672 -0.0463 0.0085  0.0036  368 VAL A C   
2318 O O   . VAL A 302 ? 1.9343 1.8576 1.9525 -0.0430 0.0083  0.0029  368 VAL A O   
2322 N N   . ALA A 303 ? 1.8986 1.8382 1.9182 -0.0462 0.0091  0.0019  369 ALA A N   
2323 C CA  . ALA A 303 ? 2.1544 2.0990 2.1764 -0.0419 0.0095  -0.0006 369 ALA A CA  
2324 C C   . ALA A 303 ? 2.4038 2.3491 2.4261 -0.0422 0.0103  -0.0054 369 ALA A C   
2325 O O   . ALA A 303 ? 2.4888 2.4380 2.5130 -0.0386 0.0106  -0.0075 369 ALA A O   
2327 N N   . LEU A 304 ? 2.5465 2.4882 2.5670 -0.0463 0.0107  -0.0073 370 LEU A N   
2328 C CA  . LEU A 304 ? 2.5208 2.4623 2.5414 -0.0465 0.0114  -0.0119 370 LEU A CA  
2329 C C   . LEU A 304 ? 2.6260 2.5563 2.6445 -0.0481 0.0114  -0.0133 370 LEU A C   
2330 O O   . LEU A 304 ? 2.5875 2.5119 2.6042 -0.0508 0.0110  -0.0111 370 LEU A O   
2609 N N   . SER A 341 ? 2.5712 2.4869 2.5743 -0.0839 0.0085  -0.0121 418 SER A N   
2610 C CA  . SER A 341 ? 2.6515 2.5677 2.6537 -0.0866 0.0087  -0.0126 418 SER A CA  
2611 C C   . SER A 341 ? 2.7229 2.6474 2.7256 -0.0866 0.0086  -0.0106 418 SER A C   
2612 O O   . SER A 341 ? 2.7201 2.6453 2.7221 -0.0886 0.0087  -0.0107 418 SER A O   
2613 C CB  . SER A 341 ? 2.6431 2.5592 2.6439 -0.0885 0.0092  -0.0164 418 SER A CB  
2614 O OG  . SER A 341 ? 2.6654 2.5723 2.6653 -0.0895 0.0094  -0.0179 418 SER A OG  
2615 N N   . GLY A 342 ? 2.5488 2.4791 2.5527 -0.0843 0.0084  -0.0090 419 GLY A N   
2616 C CA  . GLY A 342 ? 2.7944 2.7328 2.7990 -0.0837 0.0083  -0.0073 419 GLY A CA  
2617 C C   . GLY A 342 ? 3.1055 3.0412 3.1106 -0.0833 0.0081  -0.0042 419 GLY A C   
2618 O O   . GLY A 342 ? 3.1521 3.0816 3.1576 -0.0826 0.0079  -0.0029 419 GLY A O   
2619 N N   . VAL A 343 ? 3.5476 3.4874 3.5526 -0.0839 0.0082  -0.0030 420 VAL A N   
2620 C CA  . VAL A 343 ? 3.8453 3.7833 3.8507 -0.0837 0.0081  -0.0003 420 VAL A CA  
2621 C C   . VAL A 343 ? 2.1163 2.0601 2.1230 -0.0812 0.0080  0.0023  420 VAL A C   
2622 O O   . VAL A 343 ? 2.1550 2.0978 2.1620 -0.0810 0.0081  0.0045  420 VAL A O   
2623 C CB  . VAL A 343 ? 4.1095 4.0468 4.1138 -0.0864 0.0083  -0.0009 420 VAL A CB  
2624 C CG1 . VAL A 343 ? 4.2421 4.1767 4.2451 -0.0887 0.0085  -0.0041 420 VAL A CG1 
2625 C CG2 . VAL A 343 ? 4.1039 4.0492 4.1082 -0.0859 0.0083  -0.0004 420 VAL A CG2 
2626 N N   . PRO A 344 ? 2.3777 2.3271 2.3851 -0.0791 0.0080  0.0021  421 PRO A N   
2627 C CA  . PRO A 344 ? 2.1910 2.1454 2.1997 -0.0764 0.0080  0.0043  421 PRO A CA  
2628 C C   . PRO A 344 ? 2.2842 2.2381 2.2940 -0.0740 0.0079  0.0052  421 PRO A C   
2629 O O   . PRO A 344 ? 2.3275 2.2813 2.3373 -0.0738 0.0078  0.0035  421 PRO A O   
2633 N N   . LEU A 345 ? 2.2625 2.2161 2.2731 -0.0723 0.0079  0.0077  422 LEU A N   
2634 C CA  . LEU A 345 ? 2.2348 2.1891 2.2466 -0.0697 0.0079  0.0091  422 LEU A CA  
2635 C C   . LEU A 345 ? 2.1610 2.1230 2.1736 -0.0675 0.0080  0.0085  422 LEU A C   
2636 O O   . LEU A 345 ? 2.2012 2.1687 2.2125 -0.0676 0.0081  0.0081  422 LEU A O   
2637 C CB  . LEU A 345 ? 2.1631 2.1163 2.1752 -0.0685 0.0081  0.0118  422 LEU A CB  
2638 C CG  . LEU A 345 ? 2.0895 2.0448 2.1026 -0.0656 0.0083  0.0136  422 LEU A CG  
2639 C CD1 . LEU A 345 ? 2.0925 2.0439 2.1060 -0.0650 0.0082  0.0133  422 LEU A CD1 
2640 C CD2 . LEU A 345 ? 2.0650 2.0182 2.0771 -0.0654 0.0085  0.0160  422 LEU A CD2 
2641 N N   . PRO A 346 ? 2.1239 2.0857 2.1373 -0.0659 0.0079  0.0085  423 PRO A N   
2642 C CA  . PRO A 346 ? 1.9394 1.9082 1.9537 -0.0635 0.0080  0.0083  423 PRO A CA  
2643 C C   . PRO A 346 ? 1.8942 1.8667 1.9085 -0.0614 0.0083  0.0105  423 PRO A C   
2644 O O   . PRO A 346 ? 1.9035 1.8762 1.9154 -0.0627 0.0083  0.0113  423 PRO A O   
2648 N N   . PRO A 347 ? 1.8746 1.8497 1.8901 -0.0588 0.0084  0.0111  424 PRO A N   
2649 C CA  . PRO A 347 ? 1.8495 1.8275 1.8636 -0.0574 0.0085  0.0130  424 PRO A CA  
2650 C C   . PRO A 347 ? 1.8732 1.8460 1.8886 -0.0564 0.0088  0.0149  424 PRO A C   
2651 O O   . PRO A 347 ? 1.8415 1.8112 1.8584 -0.0558 0.0088  0.0148  424 PRO A O   
2655 N N   . SER A 348 ? 1.9072 1.8782 1.9205 -0.0572 0.0087  0.0165  425 SER A N   
2656 C CA  . SER A 348 ? 1.8728 1.8383 1.8868 -0.0565 0.0090  0.0183  425 SER A CA  
2657 C C   . SER A 348 ? 1.8232 1.7920 1.8362 -0.0544 0.0091  0.0198  425 SER A C   
2658 O O   . SER A 348 ? 1.6887 1.6625 1.6994 -0.0543 0.0086  0.0199  425 SER A O   
2661 N N   . SER A 349 ? 1.6202 1.5860 1.6347 -0.0526 0.0096  0.0206  426 SER A N   
2662 C CA  . SER A 349 ? 2.0381 2.0049 2.0514 -0.0507 0.0097  0.0223  426 SER A CA  
2663 C C   . SER A 349 ? 2.3152 2.2802 2.3258 -0.0519 0.0092  0.0240  426 SER A C   
2664 O O   . SER A 349 ? 2.3140 2.2831 2.3226 -0.0515 0.0085  0.0247  426 SER A O   
2684 N N   . ARG A 352 ? 2.5791 2.5341 2.5848 -0.0591 0.0084  0.0262  429 ARG A N   
2685 C CA  . ARG A 352 ? 2.2021 2.1587 2.2063 -0.0615 0.0080  0.0253  429 ARG A CA  
2686 C C   . ARG A 352 ? 1.8799 1.8344 1.8818 -0.0628 0.0077  0.0269  429 ARG A C   
2687 O O   . ARG A 352 ? 1.8427 1.8011 1.8424 -0.0634 0.0070  0.0271  429 ARG A O   
2695 N N   . PHE A 353 ? 2.0588 2.0069 2.0613 -0.0631 0.0081  0.0281  430 PHE A N   
2696 C CA  . PHE A 353 ? 2.0410 1.9864 2.0414 -0.0644 0.0078  0.0297  430 PHE A CA  
2697 C C   . PHE A 353 ? 2.5936 2.5383 2.5930 -0.0673 0.0077  0.0287  430 PHE A C   
2698 O O   . PHE A 353 ? 2.5316 2.4740 2.5291 -0.0688 0.0075  0.0298  430 PHE A O   
2699 C CB  . PHE A 353 ? 2.1039 2.0424 2.1050 -0.0637 0.0084  0.0314  430 PHE A CB  
2700 C CG  . PHE A 353 ? 2.0505 1.9894 2.0520 -0.0609 0.0085  0.0326  430 PHE A CG  
2701 C CD1 . PHE A 353 ? 1.9045 1.8487 1.9046 -0.0597 0.0078  0.0332  430 PHE A CD1 
2702 C CD2 . PHE A 353 ? 2.0360 1.9700 2.0393 -0.0594 0.0093  0.0329  430 PHE A CD2 
2703 C CE1 . PHE A 353 ? 1.8025 1.7471 1.8029 -0.0573 0.0078  0.0342  430 PHE A CE1 
2704 C CE2 . PHE A 353 ? 1.8929 1.8271 1.8962 -0.0569 0.0094  0.0339  430 PHE A CE2 
2705 C CZ  . PHE A 353 ? 1.7945 1.7341 1.7964 -0.0559 0.0087  0.0346  430 PHE A CZ  
2706 N N   . LEU A 354 ? 2.3612 2.3083 2.3615 -0.0680 0.0078  0.0266  431 LEU A N   
2707 C CA  . LEU A 354 ? 2.3714 2.3179 2.3706 -0.0708 0.0078  0.0254  431 LEU A CA  
2708 C C   . LEU A 354 ? 2.3755 2.3260 2.3717 -0.0722 0.0072  0.0254  431 LEU A C   
2709 O O   . LEU A 354 ? 2.3754 2.3234 2.3702 -0.0745 0.0072  0.0256  431 LEU A O   
2714 N N   . ARG A 355 ? 2.3665 2.3232 2.3619 -0.0709 0.0067  0.0253  432 ARG A N   
2715 C CA  . ARG A 355 ? 2.1967 2.1575 2.1894 -0.0717 0.0061  0.0255  432 ARG A CA  
2716 C C   . ARG A 355 ? 2.2910 2.2494 2.2824 -0.0719 0.0057  0.0276  432 ARG A C   
2717 O O   . ARG A 355 ? 2.2519 2.2113 2.2410 -0.0733 0.0052  0.0281  432 ARG A O   
2725 N N   . ALA A 356 ? 2.0682 2.0231 2.0609 -0.0703 0.0059  0.0289  433 ALA A N   
2726 C CA  . ALA A 356 ? 2.1052 2.0581 2.0969 -0.0700 0.0056  0.0311  433 ALA A CA  
2727 C C   . ALA A 356 ? 2.2102 2.1559 2.2020 -0.0712 0.0060  0.0324  433 ALA A C   
2728 O O   . ALA A 356 ? 2.1550 2.0989 2.1452 -0.0715 0.0057  0.0341  433 ALA A O   
2730 N N   . ARG A 357 ? 2.3543 2.2957 2.3477 -0.0720 0.0068  0.0315  434 ARG A N   
2731 C CA  . ARG A 357 ? 2.4749 2.4090 2.4686 -0.0729 0.0073  0.0326  434 ARG A CA  
2732 C C   . ARG A 357 ? 2.6873 2.6182 2.6827 -0.0741 0.0079  0.0309  434 ARG A C   
2733 O O   . ARG A 357 ? 2.6788 2.6124 2.6757 -0.0734 0.0080  0.0292  434 ARG A O   
2741 N N   . ASN A 358 ? 2.6165 2.5418 2.6117 -0.0760 0.0083  0.0313  435 ASN A N   
2742 C CA  . ASN A 358 ? 2.5584 2.4813 2.5548 -0.0777 0.0086  0.0294  435 ASN A CA  
2743 C C   . ASN A 358 ? 2.7852 2.7035 2.7844 -0.0761 0.0091  0.0293  435 ASN A C   
2744 O O   . ASN A 358 ? 2.8075 2.7264 2.8086 -0.0760 0.0092  0.0274  435 ASN A O   
2749 N N   . ILE A 359 ? 2.4032 2.3166 2.4026 -0.0751 0.0094  0.0314  436 ILE A N   
2750 C CA  . ILE A 359 ? 2.5537 2.4642 2.5551 -0.0725 0.0099  0.0322  436 ILE A CA  
2751 C C   . ILE A 359 ? 2.6230 2.5264 2.6268 -0.0727 0.0104  0.0317  436 ILE A C   
2752 O O   . ILE A 359 ? 2.7977 2.6954 2.8010 -0.0738 0.0107  0.0329  436 ILE A O   
2757 N N   . SER A 360 ? 3.1343 3.0379 3.1406 -0.0717 0.0105  0.0301  437 SER A N   
2758 C CA  . SER A 360 ? 2.8023 2.6986 2.8093 -0.0719 0.0105  0.0296  437 SER A CA  
2759 C C   . SER A 360 ? 2.6310 2.5294 2.6388 -0.0711 0.0100  0.0278  437 SER A C   
2760 O O   . SER A 360 ? 2.5024 2.4071 2.5105 -0.0695 0.0100  0.0277  437 SER A O   
2761 C CB  . SER A 360 ? 2.7542 2.6442 2.7607 -0.0704 0.0108  0.0321  437 SER A CB  
2762 O OG  . SER A 360 ? 2.7220 2.6060 2.7288 -0.0698 0.0106  0.0315  437 SER A OG  
2763 N N   . GLY A 361 ? 2.4796 2.3847 2.4891 -0.0706 0.0088  0.0217  438 GLY A N   
2764 C CA  . GLY A 361 ? 2.5930 2.5040 2.6031 -0.0686 0.0088  0.0216  438 GLY A CA  
2765 C C   . GLY A 361 ? 2.2303 2.1402 2.2408 -0.0687 0.0083  0.0192  438 GLY A C   
2766 O O   . GLY A 361 ? 2.1134 2.0246 2.1236 -0.0706 0.0080  0.0168  438 GLY A O   
2767 N N   . VAL A 362 ? 2.3879 2.2961 2.3987 -0.0665 0.0082  0.0199  439 VAL A N   
2768 C CA  . VAL A 362 ? 2.1083 2.0153 2.1194 -0.0661 0.0078  0.0178  439 VAL A CA  
2769 C C   . VAL A 362 ? 1.7297 1.6424 1.7415 -0.0639 0.0078  0.0180  439 VAL A C   
2770 O O   . VAL A 362 ? 1.5175 1.4288 1.5294 -0.0617 0.0080  0.0200  439 VAL A O   
2774 N N   . VAL A 363 ? 1.9104 1.8293 1.9227 -0.0645 0.0076  0.0158  440 VAL A N   
2775 C CA  . VAL A 363 ? 1.9075 1.8317 1.9207 -0.0625 0.0076  0.0156  440 VAL A CA  
2776 C C   . VAL A 363 ? 1.9884 1.9086 2.0014 -0.0627 0.0071  0.0132  440 VAL A C   
2777 O O   . VAL A 363 ? 2.0698 1.9895 2.0823 -0.0646 0.0070  0.0106  440 VAL A O   
2781 N N   . LEU A 364 ? 1.8035 1.7202 1.8168 -0.0606 0.0070  0.0140  441 LEU A N   
2782 C CA  . LEU A 364 ? 1.7640 1.6765 1.7769 -0.0604 0.0066  0.0114  441 LEU A CA  
2783 C C   . LEU A 364 ? 1.7904 1.7111 1.8042 -0.0594 0.0067  0.0105  441 LEU A C   
2784 O O   . LEU A 364 ? 1.7732 1.6977 1.7878 -0.0574 0.0069  0.0126  441 LEU A O   
2789 N N   . ALA A 365 ? 1.7043 1.6277 1.7177 -0.0608 0.0068  0.0073  442 ALA A N   
2790 C CA  . ALA A 365 ? 1.7891 1.7207 1.8032 -0.0603 0.0070  0.0057  442 ALA A CA  
2791 C C   . ALA A 365 ? 1.8674 1.7965 1.8808 -0.0606 0.0073  0.0019  442 ALA A C   
2792 O O   . ALA A 365 ? 1.9191 1.8395 1.9312 -0.0610 0.0073  0.0005  442 ALA A O   
2794 N N   . ASP A 366 ? 2.1386 2.0751 2.1528 -0.0601 0.0077  0.0003  443 ASP A N   
2795 C CA  . ASP A 366 ? 2.4483 2.3839 2.4620 -0.0602 0.0083  -0.0037 443 ASP A CA  
2796 C C   . ASP A 366 ? 2.8876 2.8292 2.9010 -0.0623 0.0086  -0.0060 443 ASP A C   
2797 O O   . ASP A 366 ? 2.9765 2.9207 2.9899 -0.0624 0.0092  -0.0093 443 ASP A O   
2802 N N   . HIS A 367 ? 3.3554 3.2987 3.3684 -0.0639 0.0082  -0.0046 444 HIS A N   
2803 C CA  . HIS A 367 ? 3.8285 3.7771 3.8410 -0.0656 0.0085  -0.0068 444 HIS A CA  
2804 C C   . HIS A 367 ? 4.3360 4.2823 4.3473 -0.0681 0.0083  -0.0070 444 HIS A C   
2805 O O   . HIS A 367 ? 4.3304 4.2736 4.3415 -0.0686 0.0079  -0.0046 444 HIS A O   
2812 N N   . SER A 368 ? 3.0936 3.0411 3.1039 -0.0696 0.0087  -0.0102 445 SER A N   
2813 C CA  . SER A 368 ? 3.2468 3.1941 3.2560 -0.0721 0.0087  -0.0108 445 SER A CA  
2814 C C   . SER A 368 ? 3.4898 3.4463 3.4996 -0.0717 0.0086  -0.0094 445 SER A C   
2815 O O   . SER A 368 ? 3.4869 3.4442 3.4968 -0.0719 0.0084  -0.0071 445 SER A O   
2818 N N   . GLY A 369 ? 5.1286 5.0920 5.1387 -0.0709 0.0090  -0.0112 446 GLY A N   
2819 C CA  . GLY A 369 ? 5.1432 5.1152 5.1538 -0.0698 0.0090  -0.0099 446 GLY A CA  
2820 C C   . GLY A 369 ? 2.9667 2.9450 2.9788 -0.0667 0.0091  -0.0085 446 GLY A C   
2821 O O   . GLY A 369 ? 2.9378 2.9157 2.9509 -0.0652 0.0088  -0.0058 446 GLY A O   
2822 N N   . ALA A 370 ? 2.7497 2.7338 2.7620 -0.0657 0.0095  -0.0103 447 ALA A N   
2823 C CA  . ALA A 370 ? 2.6533 2.6434 2.6669 -0.0626 0.0097  -0.0094 447 ALA A CA  
2824 C C   . ALA A 370 ? 2.5409 2.5284 2.5560 -0.0610 0.0096  -0.0084 447 ALA A C   
2825 O O   . ALA A 370 ? 2.5646 2.5464 2.5795 -0.0620 0.0098  -0.0101 447 ALA A O   
2827 N N   . PHE A 371 ? 2.5519 2.5427 2.5681 -0.0586 0.0094  -0.0056 448 PHE A N   
2828 C CA  . PHE A 371 ? 2.4193 2.4086 2.4369 -0.0569 0.0094  -0.0046 448 PHE A CA  
2829 C C   . PHE A 371 ? 2.3978 2.3882 2.4160 -0.0562 0.0100  -0.0073 448 PHE A C   
2830 O O   . PHE A 371 ? 2.4017 2.3983 2.4199 -0.0553 0.0104  -0.0090 448 PHE A O   
2838 N N   . HIS A 372 ? 2.3104 2.2948 2.3290 -0.0564 0.0102  -0.0079 449 HIS A N   
2839 C CA  . HIS A 372 ? 2.2588 2.2449 2.2786 -0.0551 0.0110  -0.0105 449 HIS A CA  
2840 C C   . HIS A 372 ? 2.3031 2.2963 2.3247 -0.0520 0.0112  -0.0087 449 HIS A C   
2841 O O   . HIS A 372 ? 2.3077 2.3063 2.3303 -0.0504 0.0118  -0.0108 449 HIS A O   
2848 N N   . ASN A 373 ? 2.1635 2.1567 2.1855 -0.0510 0.0105  -0.0050 450 ASN A N   
2849 C CA  . ASN A 373 ? 2.0715 2.0714 2.0951 -0.0478 0.0106  -0.0030 450 ASN A CA  
2850 C C   . ASN A 373 ? 1.9836 1.9916 2.0071 -0.0459 0.0107  -0.0036 450 ASN A C   
2851 O O   . ASN A 373 ? 1.8974 1.9073 1.9197 -0.0460 0.0103  -0.0030 450 ASN A O   
2856 N N   . LYS A 374 ? 1.8953 1.9073 1.9198 -0.0440 0.0113  -0.0053 451 LYS A N   
2857 C CA  . LYS A 374 ? 2.1231 2.1419 2.1474 -0.0415 0.0114  -0.0061 451 LYS A CA  
2858 C C   . LYS A 374 ? 1.9733 1.9956 1.9981 -0.0378 0.0109  -0.0031 451 LYS A C   
2859 O O   . LYS A 374 ? 1.9743 2.0007 1.9982 -0.0350 0.0108  -0.0032 451 LYS A O   
2865 N N   . TYR A 375 ? 2.0244 2.0440 2.0501 -0.0377 0.0107  -0.0007 452 TYR A N   
2866 C CA  . TYR A 375 ? 2.0936 2.1155 2.1199 -0.0341 0.0104  0.0018  452 TYR A CA  
2867 C C   . TYR A 375 ? 2.4427 2.4616 2.4688 -0.0345 0.0101  0.0042  452 TYR A C   
2868 O O   . TYR A 375 ? 2.5075 2.5260 2.5348 -0.0328 0.0103  0.0058  452 TYR A O   
2877 N N   . TYR A 376 ? 2.1933 2.2106 2.2178 -0.0367 0.0099  0.0042  453 TYR A N   
2878 C CA  . TYR A 376 ? 1.7669 1.7815 1.7904 -0.0374 0.0098  0.0061  453 TYR A CA  
2879 C C   . TYR A 376 ? 1.5925 1.6109 1.6134 -0.0354 0.0098  0.0068  453 TYR A C   
2880 O O   . TYR A 376 ? 1.6385 1.6606 1.6565 -0.0350 0.0095  0.0057  453 TYR A O   
2889 N N   . GLN A 377 ? 1.7839 1.8010 1.8055 -0.0340 0.0099  0.0084  454 GLN A N   
2890 C CA  . GLN A 377 ? 1.6480 1.6683 1.6668 -0.0323 0.0094  0.0089  454 GLN A CA  
2891 C C   . GLN A 377 ? 1.4469 1.4714 1.4649 -0.0298 0.0092  0.0077  454 GLN A C   
2892 O O   . GLN A 377 ? 1.4291 1.4564 1.4438 -0.0292 0.0083  0.0075  454 GLN A O   
2898 N N   . SER A 378 ? 1.1947 1.2195 1.2155 -0.0284 0.0098  0.0070  455 SER A N   
2899 C CA  . SER A 378 ? 1.5483 1.5769 1.5679 -0.0262 0.0095  0.0056  455 SER A CA  
2900 C C   . SER A 378 ? 1.6440 1.6730 1.6645 -0.0237 0.0096  0.0063  455 SER A C   
2901 O O   . SER A 378 ? 1.6074 1.6338 1.6304 -0.0235 0.0102  0.0074  455 SER A O   
2904 N N   . ILE A 379 ? 2.1418 2.1736 2.1596 -0.0218 0.0088  0.0056  456 ILE A N   
2905 C CA  . ILE A 379 ? 2.3964 2.4289 2.4139 -0.0193 0.0084  0.0061  456 ILE A CA  
2906 C C   . ILE A 379 ? 2.7687 2.8002 2.7903 -0.0180 0.0095  0.0059  456 ILE A C   
2907 O O   . ILE A 379 ? 2.8550 2.8860 2.8768 -0.0165 0.0095  0.0067  456 ILE A O   
3153 N N   . LEU A 410 ? 2.1185 2.0275 2.1416 -0.0238 0.0063  0.0056  487 LEU A N   
3154 C CA  . LEU A 410 ? 2.2085 2.1182 2.2303 -0.0265 0.0056  0.0097  487 LEU A CA  
3155 C C   . LEU A 410 ? 2.3304 2.2298 2.3509 -0.0255 0.0048  0.0124  487 LEU A C   
3156 O O   . LEU A 410 ? 2.3230 2.2168 2.3413 -0.0290 0.0046  0.0141  487 LEU A O   
3157 C CB  . LEU A 410 ? 2.1140 2.0332 2.1373 -0.0248 0.0053  0.0120  487 LEU A CB  
3158 C CG  . LEU A 410 ? 1.9785 1.9086 2.0029 -0.0267 0.0061  0.0104  487 LEU A CG  
3159 C CD1 . LEU A 410 ? 1.9465 1.8794 1.9721 -0.0255 0.0070  0.0058  487 LEU A CD1 
3160 C CD2 . LEU A 410 ? 1.9019 1.8396 1.9280 -0.0240 0.0058  0.0130  487 LEU A CD2 
3161 N N   . ALA A 411 ? 2.2741 2.1710 2.2962 -0.0205 0.0044  0.0126  488 ALA A N   
3162 C CA  . ALA A 411 ? 2.3527 2.2404 2.3743 -0.0184 0.0037  0.0150  488 ALA A CA  
3163 C C   . ALA A 411 ? 2.3876 2.2655 2.4070 -0.0212 0.0041  0.0136  488 ALA A C   
3164 O O   . ALA A 411 ? 2.3824 2.2538 2.3999 -0.0232 0.0037  0.0164  488 ALA A O   
3165 C CB  . ALA A 411 ? 2.4013 2.2883 2.4252 -0.0126 0.0034  0.0143  488 ALA A CB  
3166 N N   . ASP A 412 ? 2.4121 2.2899 2.4318 -0.0218 0.0051  0.0091  489 ASP A N   
3167 C CA  . ASP A 412 ? 2.4596 2.3286 2.4774 -0.0246 0.0058  0.0070  489 ASP A CA  
3168 C C   . ASP A 412 ? 2.1865 2.0539 2.2016 -0.0302 0.0058  0.0086  489 ASP A C   
3169 O O   . ASP A 412 ? 2.2332 2.0932 2.2455 -0.0313 0.0052  0.0102  489 ASP A O   
3170 C CB  . ASP A 412 ? 2.7458 2.6168 2.7644 -0.0247 0.0069  0.0018  489 ASP A CB  
3171 C CG  . ASP A 412 ? 2.7785 2.6539 2.7999 -0.0193 0.0070  0.0001  489 ASP A CG  
3172 O OD1 . ASP A 412 ? 2.7874 2.6626 2.8101 -0.0154 0.0061  0.0029  489 ASP A OD1 
3173 O OD2 . ASP A 412 ? 2.7780 2.6568 2.8003 -0.0191 0.0078  -0.0040 489 ASP A OD2 
3174 N N   . VAL A 413 ? 2.1030 1.9790 2.1180 -0.0332 0.0059  0.0087  490 VAL A N   
3175 C CA  . VAL A 413 ? 1.9248 1.8001 1.9372 -0.0385 0.0057  0.0102  490 VAL A CA  
3176 C C   . VAL A 413 ? 1.8296 1.7017 1.8394 -0.0379 0.0044  0.0150  490 VAL A C   
3177 O O   . VAL A 413 ? 1.8313 1.7010 1.8420 -0.0395 0.0034  0.0163  490 VAL A O   
3178 C CB  . VAL A 413 ? 1.8445 1.7296 1.8572 -0.0419 0.0063  0.0094  490 VAL A CB  
3179 C CG1 . VAL A 413 ? 1.8831 1.7751 1.8967 -0.0409 0.0056  0.0131  490 VAL A CG1 
3180 C CG2 . VAL A 413 ? 1.7289 1.6149 1.7405 -0.0462 0.0057  0.0092  490 VAL A CG2 
3181 N N   . ALA A 414 ? 1.8421 1.7177 1.8538 -0.0343 0.0041  0.0175  491 ALA A N   
3182 C CA  . ALA A 414 ? 1.7906 1.6647 1.8001 -0.0329 0.0037  0.0216  491 ALA A CA  
3183 C C   . ALA A 414 ? 1.8100 1.6739 1.8171 -0.0314 0.0037  0.0219  491 ALA A C   
3184 O O   . ALA A 414 ? 1.7819 1.6425 1.7865 -0.0328 0.0047  0.0238  491 ALA A O   
3185 C CB  . ALA A 414 ? 1.8393 1.7191 1.8517 -0.0289 0.0027  0.0238  491 ALA A CB  
3186 N N   . THR A 415 ? 1.7767 1.6362 1.7856 -0.0285 0.0034  0.0196  492 THR A N   
3187 C CA  . THR A 415 ? 2.0994 1.9492 2.1059 -0.0270 0.0032  0.0198  492 THR A CA  
3188 C C   . THR A 415 ? 1.9288 1.7738 1.9312 -0.0317 0.0038  0.0190  492 THR A C   
3189 O O   . THR A 415 ? 1.9301 1.7717 1.9307 -0.0319 0.0052  0.0213  492 THR A O   
3190 C CB  . THR A 415 ? 2.5374 2.3838 2.5465 -0.0236 0.0033  0.0165  492 THR A CB  
3191 O OG1 . THR A 415 ? 2.5674 2.4198 2.5806 -0.0194 0.0032  0.0166  492 THR A OG1 
3192 C CG2 . THR A 415 ? 2.5501 2.3869 2.5567 -0.0217 0.0029  0.0169  492 THR A CG2 
3193 N N   . VAL A 416 ? 1.9759 1.8245 1.9803 -0.0352 0.0027  0.0163  493 VAL A N   
3194 C CA  . VAL A 416 ? 1.8673 1.7163 1.8771 -0.0384 0.0025  0.0160  493 VAL A CA  
3195 C C   . VAL A 416 ? 1.8240 1.6776 1.8358 -0.0397 0.0053  0.0191  493 VAL A C   
3196 O O   . VAL A 416 ? 1.8094 1.6582 1.8209 -0.0399 0.0059  0.0208  493 VAL A O   
3197 C CB  . VAL A 416 ? 2.0176 1.8690 2.0272 -0.0420 0.0034  0.0118  493 VAL A CB  
3198 C CG1 . VAL A 416 ? 1.9784 1.8331 1.9873 -0.0403 0.0043  0.0088  493 VAL A CG1 
3199 C CG2 . VAL A 416 ? 2.0440 1.9027 2.0547 -0.0460 0.0042  0.0124  493 VAL A CG2 
3200 N N   . LEU A 417 ? 1.8151 1.6757 1.8256 -0.0402 0.0063  0.0201  494 LEU A N   
3201 C CA  . LEU A 417 ? 1.8766 1.7409 1.8860 -0.0421 0.0071  0.0229  494 LEU A CA  
3202 C C   . LEU A 417 ? 2.0101 1.8693 2.0166 -0.0398 0.0076  0.0262  494 LEU A C   
3203 O O   . LEU A 417 ? 1.9912 1.8492 1.9977 -0.0413 0.0080  0.0280  494 LEU A O   
3204 C CB  . LEU A 417 ? 1.8198 1.6929 1.8287 -0.0423 0.0071  0.0235  494 LEU A CB  
3205 C CG  . LEU A 417 ? 1.6924 1.5739 1.7009 -0.0440 0.0073  0.0254  494 LEU A CG  
3206 C CD1 . LEU A 417 ? 1.7151 1.6039 1.7238 -0.0432 0.0068  0.0247  494 LEU A CD1 
3207 C CD2 . LEU A 417 ? 1.6626 1.5430 1.6689 -0.0426 0.0074  0.0287  494 LEU A CD2 
3208 N N   . GLY A 418 ? 2.0806 1.9361 2.0843 -0.0360 0.0070  0.0270  495 GLY A N   
3209 C CA  . GLY A 418 ? 2.1465 1.9974 2.1476 -0.0333 0.0066  0.0303  495 GLY A CA  
3210 C C   . GLY A 418 ? 2.1588 2.0020 2.1598 -0.0335 0.0076  0.0304  495 GLY A C   
3211 O O   . GLY A 418 ? 2.0000 1.8412 2.0000 -0.0334 0.0079  0.0331  495 GLY A O   
3212 N N   . ARG A 419 ? 2.2017 2.0404 2.2039 -0.0333 0.0079  0.0273  496 ARG A N   
3213 C CA  . ARG A 419 ? 2.2933 2.1253 2.2971 -0.0333 0.0087  0.0272  496 ARG A CA  
3214 C C   . ARG A 419 ? 2.3762 2.2113 2.3838 -0.0375 0.0085  0.0279  496 ARG A C   
3215 O O   . ARG A 419 ? 2.4101 2.2416 2.4172 -0.0377 0.0090  0.0301  496 ARG A O   
3216 C CB  . ARG A 419 ? 2.2825 2.1110 2.2899 -0.0322 0.0085  0.0237  496 ARG A CB  
3217 C CG  . ARG A 419 ? 2.3125 2.1278 2.3070 -0.0290 0.0078  0.0239  496 ARG A CG  
3218 C CD  . ARG A 419 ? 2.3567 2.1683 2.3567 -0.0300 -0.0020 0.0226  496 ARG A CD  
3219 N NE  . ARG A 419 ? 2.4063 2.2074 2.3995 -0.0265 -0.0009 0.0230  496 ARG A NE  
3220 C CZ  . ARG A 419 ? 2.4123 2.2079 2.4029 -0.0267 -0.0017 0.0254  496 ARG A CZ  
3221 N NH1 . ARG A 419 ? 2.3807 2.1900 2.3963 -0.0277 0.0047  0.0279  496 ARG A NH1 
3222 N NH2 . ARG A 419 ? 2.4212 2.2094 2.4096 -0.0230 -0.0009 0.0259  496 ARG A NH2 
3223 N N   . ALA A 420 ? 2.4790 2.3207 2.4884 -0.0406 0.0078  0.0262  497 ALA A N   
3224 C CA  . ALA A 420 ? 2.4712 2.3149 2.4814 -0.0447 0.0077  0.0263  497 ALA A CA  
3225 C C   . ALA A 420 ? 2.3312 2.1765 2.3395 -0.0448 0.0087  0.0298  497 ALA A C   
3226 O O   . ALA A 420 ? 2.2762 2.1174 2.2846 -0.0458 0.0090  0.0311  497 ALA A O   
3227 C CB  . ALA A 420 ? 2.5807 2.4317 2.5918 -0.0476 0.0071  0.0240  497 ALA A CB  
3228 N N   . LEU A 421 ? 2.3682 2.2185 2.3745 -0.0434 0.0090  0.0314  498 LEU A N   
3229 C CA  . LEU A 421 ? 2.2699 2.1219 2.2743 -0.0435 0.0094  0.0346  498 LEU A CA  
3230 C C   . LEU A 421 ? 2.3390 2.1831 2.3417 -0.0413 0.0098  0.0368  498 LEU A C   
3231 O O   . LEU A 421 ? 2.3335 2.1760 2.3361 -0.0427 0.0103  0.0385  498 LEU A O   
3232 C CB  . LEU A 421 ? 2.1638 2.0226 2.1662 -0.0419 0.0089  0.0359  498 LEU A CB  
3233 C CG  . LEU A 421 ? 2.0128 1.8811 2.0165 -0.0440 0.0087  0.0344  498 LEU A CG  
3234 C CD1 . LEU A 421 ? 1.9449 1.8167 1.9475 -0.0415 0.0080  0.0346  498 LEU A CD1 
3235 C CD2 . LEU A 421 ? 2.0215 1.8951 2.0246 -0.0457 0.0090  0.0360  498 LEU A CD2 
3236 N N   . TYR A 422 ? 2.3424 2.1812 2.3439 -0.0380 0.0096  0.0367  499 TYR A N   
3237 C CA  . TYR A 422 ? 2.4456 2.2769 2.4454 -0.0357 0.0099  0.0388  499 TYR A CA  
3238 C C   . TYR A 422 ? 2.5471 2.3736 2.5495 -0.0378 0.0105  0.0383  499 TYR A C   
3239 O O   . TYR A 422 ? 2.5287 2.3519 2.5300 -0.0377 0.0110  0.0408  499 TYR A O   
3240 C CB  . TYR A 422 ? 2.4910 2.3171 2.4889 -0.0317 0.0095  0.0381  499 TYR A CB  
3241 C CG  . TYR A 422 ? 2.5065 2.3246 2.5023 -0.0291 0.0098  0.0402  499 TYR A CG  
3242 C CD1 . TYR A 422 ? 2.4883 2.3058 2.4825 -0.0290 0.0099  0.0436  499 TYR A CD1 
3243 C CD2 . TYR A 422 ? 2.5356 2.3467 2.5307 -0.0268 0.0100  0.0385  499 TYR A CD2 
3244 C CE1 . TYR A 422 ? 2.4938 2.3041 2.4860 -0.0266 0.0102  0.0454  499 TYR A CE1 
3245 C CE2 . TYR A 422 ? 2.5392 2.3429 2.5320 -0.0244 0.0103  0.0402  499 TYR A CE2 
3246 C CZ  . TYR A 422 ? 2.5549 2.3584 2.5466 -0.0244 0.0104  0.0438  499 TYR A CZ  
3247 O OH  . TYR A 422 ? 2.6085 2.4048 2.5979 -0.0219 0.0106  0.0455  499 TYR A OH  
3248 N N   . GLU A 423 ? 2.4217 2.2476 2.4275 -0.0397 0.0101  0.0352  500 GLU A N   
3249 C CA  . GLU A 423 ? 2.6610 2.4823 2.6692 -0.0420 0.0099  0.0348  500 GLU A CA  
3250 C C   . GLU A 423 ? 2.6177 2.4429 2.6253 -0.0452 0.0102  0.0361  500 GLU A C   
3251 O O   . GLU A 423 ? 2.6688 2.4903 2.6762 -0.0460 0.0107  0.0379  500 GLU A O   
3252 C CB  . GLU A 423 ? 2.8807 2.7004 2.8917 -0.0436 0.0084  0.0310  500 GLU A CB  
3253 C CG  . GLU A 423 ? 2.3522 2.1645 2.3644 -0.0452 0.0078  0.0305  500 GLU A CG  
3254 C CD  . GLU A 423 ? 2.3496 2.1599 2.3623 -0.0476 0.0063  0.0265  500 GLU A CD  
3255 O OE1 . GLU A 423 ? 2.3506 2.1604 2.3633 -0.0461 0.0052  0.0242  500 GLU A OE1 
3256 O OE2 . GLU A 423 ? 2.3013 2.1100 2.3137 -0.0511 0.0063  0.0256  500 GLU A OE2 
3257 N N   . LEU A 424 ? 2.6482 2.4810 2.6556 -0.0470 0.0101  0.0352  501 LEU A N   
3258 C CA  . LEU A 424 ? 2.4894 2.3272 2.4966 -0.0501 0.0104  0.0360  501 LEU A CA  
3259 C C   . LEU A 424 ? 2.4548 2.2942 2.4596 -0.0489 0.0111  0.0395  501 LEU A C   
3260 O O   . LEU A 424 ? 2.4435 2.2860 2.4478 -0.0509 0.0113  0.0404  501 LEU A O   
3261 C CB  . LEU A 424 ? 2.3437 2.1898 2.3515 -0.0519 0.0098  0.0337  501 LEU A CB  
3262 C CG  . LEU A 424 ? 2.1255 1.9797 2.1326 -0.0539 0.0100  0.0343  501 LEU A CG  
3263 C CD1 . LEU A 424 ? 2.0421 1.8951 2.0497 -0.0571 0.0100  0.0338  501 LEU A CD1 
3264 C CD2 . LEU A 424 ? 2.0641 1.9260 2.0717 -0.0544 0.0095  0.0322  501 LEU A CD2 
3265 N N   . ALA A 425 ? 2.4809 2.3185 2.4836 -0.0453 0.0111  0.0412  502 ALA A N   
3266 C CA  . ALA A 425 ? 2.4856 2.3236 2.4855 -0.0440 0.0115  0.0445  502 ALA A CA  
3267 C C   . ALA A 425 ? 2.5720 2.4025 2.5715 -0.0435 0.0120  0.0463  502 ALA A C   
3268 O O   . ALA A 425 ? 2.5943 2.4232 2.5914 -0.0417 0.0122  0.0491  502 ALA A O   
3269 C CB  . ALA A 425 ? 2.4498 2.2889 2.4472 -0.0404 0.0109  0.0456  502 ALA A CB  
3270 N N   . GLY A 426 ? 2.5448 2.3709 2.5468 -0.0452 0.0121  0.0446  503 GLY A N   
3271 C CA  . GLY A 426 ? 2.5687 2.3875 2.5710 -0.0449 0.0126  0.0461  503 GLY A CA  
3272 C C   . GLY A 426 ? 2.6068 2.4191 2.6084 -0.0412 0.0127  0.0466  503 GLY A C   
3273 O O   . GLY A 426 ? 2.6243 2.4307 2.6254 -0.0401 0.0132  0.0485  503 GLY A O   
3274 N N   . GLY A 427 ? 2.6634 2.4768 2.6649 -0.0391 0.0123  0.0450  504 GLY A N   
3275 C CA  . GLY A 427 ? 2.7382 2.5458 2.7384 -0.0352 0.0124  0.0453  504 GLY A CA  
3276 C C   . GLY A 427 ? 2.7985 2.5999 2.8024 -0.0352 0.0125  0.0435  504 GLY A C   
3277 O O   . GLY A 427 ? 2.8575 2.6593 2.8649 -0.0385 0.0117  0.0417  504 GLY A O   
3278 N N   . ASP A 428 ? 2.2653 2.0484 2.2553 -0.0218 0.0124  0.0350  509 ASP A N   
3279 C CA  . ASP A 428 ? 2.2679 2.0482 2.2505 -0.0180 0.0077  0.0356  509 ASP A CA  
3280 C C   . ASP A 428 ? 2.2541 2.0412 2.2387 -0.0179 0.0061  0.0336  509 ASP A C   
3281 O O   . ASP A 428 ? 2.2020 1.9952 2.1894 -0.0212 0.0079  0.0324  509 ASP A O   
3282 C CB  . ASP A 428 ? 2.2682 2.0513 2.2517 -0.0157 0.0078  0.0401  509 ASP A CB  
3283 C CG  . ASP A 428 ? 2.2674 2.0454 2.2503 -0.0162 0.0098  0.0424  509 ASP A CG  
3284 O OD1 . ASP A 428 ? 2.2541 2.0245 2.2334 -0.0137 0.0087  0.0431  509 ASP A OD1 
3285 O OD2 . ASP A 428 ? 2.2810 2.0634 2.2683 -0.0193 0.0118  0.0437  509 ASP A OD2 
3286 N N   . THR A 429 ? 2.1093 1.8966 2.0950 -0.0139 0.0035  0.0332  510 THR A N   
3287 C CA  . THR A 429 ? 2.0948 1.8886 2.0837 -0.0133 0.0026  0.0311  510 THR A CA  
3288 C C   . THR A 429 ? 2.2263 2.0288 2.2168 -0.0136 0.0032  0.0335  510 THR A C   
3289 O O   . THR A 429 ? 2.2602 2.0639 2.2502 -0.0119 0.0032  0.0369  510 THR A O   
3290 C CB  . THR A 429 ? 1.9310 1.7238 1.9222 -0.0082 0.0012  0.0302  510 THR A CB  
3291 O OG1 . THR A 429 ? 1.8801 1.6746 1.8714 -0.0044 0.0009  0.0336  510 THR A OG1 
3292 C CG2 . THR A 429 ? 1.8824 1.6670 1.8731 -0.0073 0.0003  0.0281  510 THR A CG2 
3293 N N   . VAL A 430 ? 2.3147 2.1236 2.3074 -0.0154 0.0032  0.0315  511 VAL A N   
3294 C CA  . VAL A 430 ? 2.3147 2.1323 2.3093 -0.0153 0.0029  0.0332  511 VAL A CA  
3295 C C   . VAL A 430 ? 2.1471 1.9704 2.1445 -0.0165 0.0026  0.0301  511 VAL A C   
3296 O O   . VAL A 430 ? 2.1245 1.9479 2.1214 -0.0206 0.0034  0.0277  511 VAL A O   
3297 C CB  . VAL A 430 ? 2.4625 2.2836 2.4563 -0.0187 0.0042  0.0357  511 VAL A CB  
3298 C CG1 . VAL A 430 ? 2.5239 2.3433 2.5177 -0.0232 0.0062  0.0338  511 VAL A CG1 
3299 C CG2 . VAL A 430 ? 2.4556 2.2864 2.4513 -0.0194 0.0035  0.0364  511 VAL A CG2 
3300 N N   . GLN A 431 ? 2.2486 2.0772 2.2493 -0.0129 0.0015  0.0298  512 GLN A N   
3301 C CA  . GLN A 431 ? 2.3021 2.1366 2.3061 -0.0136 0.0015  0.0268  512 GLN A CA  
3302 C C   . GLN A 431 ? 2.4730 2.3168 2.4803 -0.0110 0.0007  0.0285  512 GLN A C   
3303 O O   . GLN A 431 ? 2.4904 2.3348 2.4979 -0.0072 -0.0001 0.0308  512 GLN A O   
3304 C CB  . GLN A 431 ? 2.2481 2.0784 2.2538 -0.0116 0.0016  0.0231  512 GLN A CB  
3305 C CG  . GLN A 431 ? 2.2052 2.0358 2.2132 -0.0058 0.0010  0.0232  512 GLN A CG  
3306 C CD  . GLN A 431 ? 2.1179 1.9526 2.1298 -0.0040 0.0015  0.0194  512 GLN A CD  
3307 O OE1 . GLN A 431 ? 2.0987 1.9316 2.1108 -0.0063 0.0023  0.0159  512 GLN A OE1 
3308 N NE2 . GLN A 431 ? 2.0674 1.9082 2.0822 0.0000  0.0011  0.0200  512 GLN A NE2 
3309 N N   . ALA A 432 ? 2.3283 2.1794 2.3379 -0.0131 0.0009  0.0271  513 ALA A N   
3310 C CA  . ALA A 432 ? 2.4318 2.2921 2.4444 -0.0111 0.0002  0.0286  513 ALA A CA  
3311 C C   . ALA A 432 ? 2.6609 2.5236 2.6774 -0.0064 0.0000  0.0267  513 ALA A C   
3312 O O   . ALA A 432 ? 2.6065 2.4659 2.6242 -0.0057 0.0007  0.0232  513 ALA A O   
3313 C CB  . ALA A 432 ? 2.3989 2.2663 2.4123 -0.0152 0.0006  0.0280  513 ALA A CB  
3314 N N   . ASP A 433 ? 2.4493 2.3180 2.4676 -0.0031 -0.0008 0.0288  514 ASP A N   
3315 C CA  . ASP A 433 ? 2.8552 2.7265 2.8769 0.0016  -0.0008 0.0269  514 ASP A CA  
3316 C C   . ASP A 433 ? 2.4721 2.3511 2.4974 0.0008  -0.0001 0.0248  514 ASP A C   
3317 O O   . ASP A 433 ? 2.4620 2.3475 2.4879 -0.0013 -0.0003 0.0265  514 ASP A O   
3318 C CB  . ASP A 433 ? 3.3660 3.2400 3.3877 0.0059  -0.0019 0.0298  514 ASP A CB  
3319 C CG  . ASP A 433 ? 3.6991 3.5802 3.7205 0.0046  -0.0026 0.0330  514 ASP A CG  
3320 O OD1 . ASP A 433 ? 3.8404 3.7219 3.8599 0.0002  -0.0024 0.0341  514 ASP A OD1 
3321 O OD2 . ASP A 433 ? 3.8385 3.7251 3.8613 0.0080  -0.0033 0.0342  514 ASP A OD2 
3322 N N   . PRO A 434 ? 2.6624 2.5407 2.6901 0.0024  0.0008  0.0209  515 PRO A N   
3323 C CA  . PRO A 434 ? 2.4639 2.3504 2.4934 0.0015  0.0017  0.0176  515 PRO A CA  
3324 C C   . PRO A 434 ? 2.3933 2.2890 2.4250 0.0047  0.0013  0.0187  515 PRO A C   
3325 O O   . PRO A 434 ? 2.4190 2.3234 2.4511 0.0031  0.0017  0.0179  515 PRO A O   
3326 C CB  . PRO A 434 ? 2.4917 2.3741 2.5220 0.0033  0.0027  0.0131  515 PRO A CB  
3327 C CG  . PRO A 434 ? 2.5212 2.3922 2.5496 0.0029  0.0025  0.0139  515 PRO A CG  
3328 C CD  . PRO A 434 ? 2.5371 2.4077 2.5637 0.0045  0.0011  0.0185  515 PRO A CD  
3329 N N   . GLN A 435 ? 2.4852 2.3789 2.5183 0.0092  0.0005  0.0207  516 GLN A N   
3330 C CA  . GLN A 435 ? 2.4831 2.3853 2.5186 0.0126  0.0000  0.0220  516 GLN A CA  
3331 C C   . GLN A 435 ? 2.2977 2.2065 2.3322 0.0098  -0.0005 0.0253  516 GLN A C   
3332 O O   . GLN A 435 ? 2.3734 2.2914 2.4094 0.0107  -0.0002 0.0248  516 GLN A O   
3333 C CB  . GLN A 435 ? 2.5263 2.4271 2.5614 0.0176  -0.0009 0.0228  516 GLN A CB  
3334 C CG  . GLN A 435 ? 3.4174 3.3213 3.4550 0.0214  -0.0001 0.0189  516 GLN A CG  
3335 C CD  . GLN A 435 ? 2.0168 1.9313 2.0571 0.0235  0.0000  0.0187  516 GLN A CD  
3336 O OE1 . GLN A 435 ? 1.9814 1.9008 2.0213 0.0241  -0.0009 0.0216  516 GLN A OE1 
3337 N NE2 . GLN A 435 ? 2.0059 1.9241 2.0486 0.0243  0.0012  0.0149  516 GLN A NE2 
3338 N N   . THR A 436 ? 2.3303 2.2349 2.3625 0.0069  -0.0011 0.0287  517 THR A N   
3339 C CA  . THR A 436 ? 2.1176 2.0290 2.1490 0.0042  -0.0015 0.0316  517 THR A CA  
3340 C C   . THR A 436 ? 1.8635 1.7821 1.8945 0.0004  -0.0004 0.0294  517 THR A C   
3341 O O   . THR A 436 ? 1.6467 1.5739 1.6785 0.0001  -0.0003 0.0303  517 THR A O   
3342 C CB  . THR A 436 ? 2.0211 1.9279 2.0482 0.0013  -0.0023 0.0347  517 THR A CB  
3343 O OG1 . THR A 436 ? 2.0635 1.9773 2.0896 -0.0010 -0.0024 0.0371  517 THR A OG1 
3344 C CG2 . THR A 436 ? 1.9480 1.8480 1.9730 -0.0029 -0.0016 0.0333  517 THR A CG2 
3345 N N   . VAL A 437 ? 1.6102 1.5249 1.6398 -0.0028 0.0003  0.0268  518 VAL A N   
3346 C CA  . VAL A 437 ? 1.7264 1.6474 1.7556 -0.0064 0.0014  0.0245  518 VAL A CA  
3347 C C   . VAL A 437 ? 1.3396 1.2700 1.3713 -0.0042 0.0022  0.0217  518 VAL A C   
3348 O O   . VAL A 437 ? 1.3956 1.3341 1.4277 -0.0056 0.0024  0.0226  518 VAL A O   
3349 C CB  . VAL A 437 ? 1.9552 1.8699 1.9828 -0.0094 0.0021  0.0216  518 VAL A CB  
3350 C CG1 . VAL A 437 ? 2.0080 1.9283 2.0348 -0.0139 0.0030  0.0198  518 VAL A CG1 
3351 C CG2 . VAL A 437 ? 2.3688 2.2734 2.3941 -0.0111 0.0014  0.0242  518 VAL A CG2 
3352 N N   . THR A 438 ? 1.4699 1.3993 1.5034 -0.0002 0.0024  0.0189  519 THR A N   
3353 C CA  . THR A 438 ? 1.2929 1.2307 1.3287 0.0019  0.0033  0.0158  519 THR A CA  
3354 C C   . THR A 438 ? 1.2394 1.1849 1.2768 0.0043  0.0030  0.0181  519 THR A C   
3355 O O   . THR A 438 ? 1.2384 1.1895 1.2753 0.0017  0.0030  0.0201  519 THR A O   
3359 N N   . ARG A 439 ? 1.4886 1.4258 1.5251 0.0069  0.0006  0.0259  520 ARG A N   
3360 C CA  . ARG A 439 ? 1.5676 1.5125 1.6052 0.0081  0.0002  0.0286  520 ARG A CA  
3361 C C   . ARG A 439 ? 1.5247 1.4749 1.5608 0.0034  0.0007  0.0296  520 ARG A C   
3362 O O   . ARG A 439 ? 1.5376 1.4968 1.5749 0.0032  0.0014  0.0292  520 ARG A O   
3370 N N   . LEU A 440 ? 1.3094 1.2539 1.3430 -0.0005 0.0005  0.0308  521 LEU A N   
3371 C CA  . LEU A 440 ? 1.3106 1.2590 1.3427 -0.0050 0.0007  0.0326  521 LEU A CA  
3372 C C   . LEU A 440 ? 1.3208 1.2762 1.3533 -0.0078 0.0021  0.0297  521 LEU A C   
3373 O O   . LEU A 440 ? 1.3700 1.3332 1.4028 -0.0093 0.0026  0.0307  521 LEU A O   
3374 C CB  . LEU A 440 ? 1.5397 1.4793 1.5691 -0.0083 0.0002  0.0343  521 LEU A CB  
3375 C CG  . LEU A 440 ? 1.8693 1.8124 1.8971 -0.0126 0.0003  0.0369  521 LEU A CG  
3376 C CD1 . LEU A 440 ? 2.3047 2.2520 2.3328 -0.0096 -0.0005 0.0396  521 LEU A CD1 
3377 C CD2 . LEU A 440 ? 1.7797 1.7155 1.8038 -0.0151 -0.0002 0.0378  521 LEU A CD2 
3378 N N   . LEU A 441 ? 1.7000 1.6533 1.7327 -0.0078 0.0028  0.0259  522 LEU A N   
3379 C CA  . LEU A 441 ? 1.7008 1.6598 1.7336 -0.0106 0.0040  0.0230  522 LEU A CA  
3380 C C   . LEU A 441 ? 1.8389 1.8083 1.8739 -0.0086 0.0046  0.0227  522 LEU A C   
3381 O O   . LEU A 441 ? 1.7829 1.7591 1.8179 -0.0113 0.0052  0.0234  522 LEU A O   
3386 N N   . TYR A 442 ? 1.0273 0.9980 1.0645 -0.0038 0.0044  0.0220  523 TYR A N   
3387 C CA  . TYR A 442 ? 1.5351 1.5153 1.5744 -0.0016 0.0050  0.0220  523 TYR A CA  
3388 C C   . TYR A 442 ? 2.0140 1.9984 2.0529 -0.0028 0.0047  0.0259  523 TYR A C   
3389 O O   . TYR A 442 ? 2.2194 2.2124 2.2597 -0.0024 0.0055  0.0256  523 TYR A O   
3398 N N   . GLY A 443 ? 2.0237 2.0026 2.0610 -0.0037 0.0036  0.0294  524 GLY A N   
3399 C CA  . GLY A 443 ? 2.2260 2.2095 2.2629 -0.0052 0.0034  0.0331  524 GLY A CA  
3400 C C   . GLY A 443 ? 1.6341 1.6226 1.6702 -0.0097 0.0045  0.0324  524 GLY A C   
3401 O O   . GLY A 443 ? 1.7421 1.7385 1.7791 -0.0103 0.0052  0.0334  524 GLY A O   
3402 N N   . PHE A 444 ? 2.4130 2.3976 2.4476 -0.0129 0.0048  0.0307  525 PHE A N   
3403 C CA  . PHE A 444 ? 1.7468 1.7373 1.7809 -0.0171 0.0059  0.0303  525 PHE A CA  
3404 C C   . PHE A 444 ? 1.3688 1.3658 1.4044 -0.0173 0.0072  0.0266  525 PHE A C   
3405 O O   . PHE A 444 ? 1.2761 1.2788 1.3111 -0.0202 0.0080  0.0264  525 PHE A O   
3413 N N   . LEU A 445 ? 1.2470 1.2436 1.2840 -0.0143 0.0074  0.0233  526 LEU A N   
3414 C CA  . LEU A 445 ? 1.2706 1.2743 1.3090 -0.0149 0.0088  0.0200  526 LEU A CA  
3415 C C   . LEU A 445 ? 1.3974 1.4075 1.4385 -0.0102 0.0093  0.0186  526 LEU A C   
3416 O O   . LEU A 445 ? 1.1994 1.2164 1.2419 -0.0100 0.0105  0.0162  526 LEU A O   
3421 N N   . ILE A 446 ? 1.3356 1.3437 1.3774 -0.0066 0.0085  0.0203  527 ILE A N   
3422 C CA  . ILE A 446 ? 1.5125 1.5255 1.5568 -0.0020 0.0089  0.0191  527 ILE A CA  
3423 C C   . ILE A 446 ? 1.7269 1.7430 1.7720 -0.0002 0.0084  0.0225  527 ILE A C   
3424 O O   . ILE A 446 ? 1.7667 1.7911 1.8134 0.0007  0.0094  0.0225  527 ILE A O   
3429 N N   . LYS A 447 ? 1.8772 1.8871 1.9211 0.0001  0.0071  0.0254  528 LYS A N   
3430 C CA  . LYS A 447 ? 1.9579 1.9701 2.0026 0.0024  0.0065  0.0284  528 LYS A CA  
3431 C C   . LYS A 447 ? 1.7573 1.7741 1.8010 -0.0006 0.0068  0.0317  528 LYS A C   
3432 O O   . LYS A 447 ? 1.7293 1.7439 1.7723 -0.0004 0.0058  0.0350  528 LYS A O   
3433 C CB  . LYS A 447 ? 2.0154 2.0188 2.0592 0.0045  0.0049  0.0302  528 LYS A CB  
3434 N N   . LEU A 448 ? 1.8486 1.8372 1.8838 0.0118  -0.0024 0.0417  538 LEU A N   
3435 C CA  . LEU A 448 ? 1.7105 1.6928 1.7427 0.0095  -0.0034 0.0438  538 LEU A CA  
3436 C C   . LEU A 448 ? 2.0191 2.0059 2.0498 0.0062  -0.0032 0.0449  538 LEU A C   
3437 O O   . LEU A 448 ? 1.9341 1.9169 1.9622 0.0034  -0.0036 0.0461  538 LEU A O   
3438 C CB  . LEU A 448 ? 1.4570 1.4318 1.4887 0.0078  -0.0034 0.0441  538 LEU A CB  
3439 C CG  . LEU A 448 ? 1.3299 1.2976 1.3626 0.0106  -0.0037 0.0429  538 LEU A CG  
3440 C CD1 . LEU A 448 ? 1.2230 1.1945 1.2589 0.0133  -0.0029 0.0405  538 LEU A CD1 
3441 C CD2 . LEU A 448 ? 0.5388 0.4972 0.5699 0.0082  -0.0038 0.0432  538 LEU A CD2 
3442 N N   . ARG A 449 ? 2.0812 2.0760 2.1132 0.0066  -0.0026 0.0441  539 ARG A N   
3443 C CA  . ARG A 449 ? 2.3509 2.3496 2.3815 0.0040  -0.0025 0.0447  539 ARG A CA  
3444 C C   . ARG A 449 ? 2.3989 2.3934 2.4269 0.0044  -0.0038 0.0462  539 ARG A C   
3445 O O   . ARG A 449 ? 2.4246 2.4216 2.4514 0.0026  -0.0039 0.0466  539 ARG A O   
3446 C CB  . ARG A 449 ? 2.5378 2.5458 2.5707 0.0042  -0.0014 0.0432  539 ARG A CB  
3447 C CG  . ARG A 449 ? 2.7770 2.7904 2.8128 0.0048  0.0001  0.0415  539 ARG A CG  
3448 C CD  . ARG A 449 ? 2.7452 2.7650 2.7823 0.0061  0.0012  0.0401  539 ARG A CD  
3449 N NE  . ARG A 449 ? 2.6512 2.6771 2.6903 0.0060  0.0032  0.0382  539 ARG A NE  
3450 C CZ  . ARG A 449 ? 2.5759 2.6090 2.6167 0.0041  0.0046  0.0372  539 ARG A CZ  
3451 N NH1 . ARG A 449 ? 2.5871 2.6212 2.6269 0.0029  0.0032  0.0368  539 ARG A NH1 
3452 N NH2 . ARG A 449 ? 2.5132 2.5444 2.5484 0.0043  0.0053  0.0332  539 ARG A NH2 
3453 N N   . GLN A 450 ? 2.6764 2.6645 2.7036 0.0070  -0.0048 0.0469  540 GLN A N   
3454 C CA  . GLN A 450 ? 2.5450 2.5286 2.5694 0.0071  -0.0060 0.0486  540 GLN A CA  
3455 C C   . GLN A 450 ? 2.4543 2.4309 2.4760 0.0046  -0.0063 0.0499  540 GLN A C   
3456 O O   . GLN A 450 ? 2.5048 2.4762 2.5240 0.0047  -0.0071 0.0515  540 GLN A O   
3457 C CB  . GLN A 450 ? 1.8986 1.8788 1.9229 0.0109  -0.0069 0.0487  540 GLN A CB  
3458 C CG  . GLN A 450 ? 1.9352 1.9086 1.9599 0.0133  -0.0074 0.0482  540 GLN A CG  
3459 C CD  . GLN A 450 ? 1.7139 1.6838 1.7380 0.0170  -0.0085 0.0481  540 GLN A CD  
3460 O OE1 . GLN A 450 ? 1.6844 1.6511 1.7063 0.0172  -0.0094 0.0498  540 GLN A OE1 
3461 N NE2 . GLN A 450 ? 1.6933 1.6635 1.7192 0.0199  -0.0084 0.0460  540 GLN A NE2 
3462 N N   . ASP A 451 ? 2.4604 2.4372 2.4825 0.0023  -0.0054 0.0492  541 ASP A N   
3463 C CA  . ASP A 451 ? 2.2891 2.2607 2.3085 -0.0009 -0.0054 0.0499  541 ASP A CA  
3464 C C   . ASP A 451 ? 2.3150 2.2919 2.3333 -0.0041 -0.0047 0.0493  541 ASP A C   
3465 O O   . ASP A 451 ? 2.2871 2.2606 2.3026 -0.0069 -0.0045 0.0495  541 ASP A O   
3466 C CB  . ASP A 451 ? 2.1104 2.0780 2.1306 -0.0015 -0.0049 0.0490  541 ASP A CB  
3467 C CG  . ASP A 451 ? 2.0254 1.9880 2.0471 0.0020  -0.0054 0.0489  541 ASP A CG  
3468 O OD1 . ASP A 451 ? 2.0704 2.0263 2.0901 0.0032  -0.0063 0.0500  541 ASP A OD1 
3469 O OD2 . ASP A 451 ? 1.9728 1.9380 1.9975 0.0038  -0.0049 0.0475  541 ASP A OD2 
3470 N N   . LEU A 452 ? 2.3670 2.3522 2.3875 -0.0036 -0.0042 0.0481  542 LEU A N   
3471 C CA  . LEU A 452 ? 2.3787 2.3701 2.3990 -0.0059 -0.0035 0.0467  542 LEU A CA  
3472 C C   . LEU A 452 ? 2.5310 2.5260 2.5508 -0.0058 -0.0039 0.0470  542 LEU A C   
3473 O O   . LEU A 452 ? 2.5204 2.5117 2.5388 -0.0048 -0.0047 0.0486  542 LEU A O   
3474 C CB  . LEU A 452 ? 2.3419 2.3401 2.3655 -0.0053 -0.0026 0.0449  542 LEU A CB  
3475 C CG  . LEU A 452 ? 2.3136 2.3087 2.3381 -0.0054 -0.0022 0.0446  542 LEU A CG  
3476 C CD1 . LEU A 452 ? 2.3103 2.3123 2.3377 -0.0052 -0.0011 0.0427  542 LEU A CD1 
3477 C CD2 . LEU A 452 ? 2.3030 2.2916 2.3243 -0.0083 -0.0021 0.0448  542 LEU A CD2 
3478 N N   . ARG A 453 ? 2.5261 2.5280 2.5469 -0.0068 -0.0034 0.0451  543 ARG A N   
3479 C CA  . ARG A 453 ? 2.4067 2.4159 2.4306 -0.0061 -0.0037 0.0453  543 ARG A CA  
3480 C C   . ARG A 453 ? 2.2197 2.2371 2.2466 -0.0073 -0.0035 0.0437  543 ARG A C   
3481 O O   . ARG A 453 ? 2.1209 2.1421 2.1487 -0.0085 -0.0042 0.0441  543 ARG A O   
3482 C CB  . ARG A 453 ? 2.4016 2.4089 2.4242 -0.0067 -0.0046 0.0474  543 ARG A CB  
3483 C CG  . ARG A 453 ? 2.0263 2.0403 2.0523 -0.0057 -0.0048 0.0478  543 ARG A CG  
3484 C CD  . ARG A 453 ? 2.0153 2.0358 2.0452 -0.0038 -0.0039 0.0463  543 ARG A CD  
3485 N NE  . ARG A 453 ? 2.0213 2.0379 2.0504 -0.0013 -0.0035 0.0462  543 ARG A NE  
3486 C CZ  . ARG A 453 ? 2.0085 2.0288 2.0400 0.0002  -0.0025 0.0446  543 ARG A CZ  
3487 N NH1 . ARG A 453 ? 2.0251 2.0532 2.0601 -0.0005 -0.0015 0.0431  543 ARG A NH1 
3488 N NH2 . ARG A 453 ? 1.9926 2.0089 2.0230 0.0027  -0.0025 0.0444  543 ARG A NH2 
3489 N N   . SER A 454 ? 2.1167 2.1364 2.1450 -0.0064 -0.0027 0.0420  544 SER A N   
3490 C CA  . SER A 454 ? 2.0007 2.0265 2.0308 -0.0069 -0.0029 0.0402  544 SER A CA  
3491 C C   . SER A 454 ? 1.8071 1.8366 1.8396 -0.0049 -0.0021 0.0386  544 SER A C   
3492 O O   . SER A 454 ? 1.5660 1.5960 1.6002 -0.0030 -0.0014 0.0387  544 SER A O   
3493 C CB  . SER A 454 ? 2.0725 2.0944 2.0994 -0.0093 -0.0029 0.0398  544 SER A CB  
3494 O OG  . SER A 454 ? 2.0717 2.0973 2.0992 -0.0093 -0.0029 0.0379  544 SER A OG  
3495 N N   . TYR A 455 ? 1.7776 1.8093 1.8098 -0.0052 -0.0025 0.0371  545 TYR A N   
3496 C CA  . TYR A 455 ? 1.7991 1.8339 1.8326 -0.0032 -0.0023 0.0355  545 TYR A CA  
3497 C C   . TYR A 455 ? 1.7917 1.8231 1.8223 -0.0048 -0.0018 0.0343  545 TYR A C   
3498 O O   . TYR A 455 ? 1.7123 1.7404 1.7404 -0.0073 -0.0018 0.0346  545 TYR A O   
3499 C CB  . TYR A 455 ? 2.3648 2.4010 2.3954 -0.0022 -0.0026 0.0329  545 TYR A CB  
3500 C CG  . TYR A 455 ? 2.7202 2.7541 2.7468 -0.0006 -0.0018 0.0292  545 TYR A CG  
3501 C CD1 . TYR A 455 ? 2.8726 2.9046 2.8986 0.0009  -0.0007 0.0279  545 TYR A CD1 
3502 C CD2 . TYR A 455 ? 2.8505 2.8838 2.8737 -0.0009 -0.0023 0.0274  545 TYR A CD2 
3503 C CE1 . TYR A 455 ? 2.9760 3.0052 2.9977 0.0020  -0.0004 0.0251  545 TYR A CE1 
3504 C CE2 . TYR A 455 ? 2.9919 3.0228 3.0116 0.0002  -0.0018 0.0246  545 TYR A CE2 
3505 C CZ  . TYR A 455 ? 3.0314 3.0603 3.0503 0.0015  -0.0009 0.0237  545 TYR A CZ  
3506 O OH  . TYR A 455 ? 3.0777 3.1025 3.0910 0.0010  0.0008  0.0221  545 TYR A OH  
3507 N N   . LEU A 456 ? 1.7292 1.7611 1.7598 -0.0033 -0.0013 0.0330  546 LEU A N   
3508 C CA  . LEU A 456 ? 1.9006 1.9308 1.9289 -0.0045 -0.0008 0.0315  546 LEU A CA  
3509 C C   . LEU A 456 ? 3.7763 3.8103 3.8031 -0.0031 -0.0022 0.0306  546 LEU A C   
3510 O O   . LEU A 456 ? 3.7722 3.8079 3.7980 -0.0041 -0.0034 0.0308  546 LEU A O   
3511 C CB  . LEU A 456 ? 1.7952 1.8225 1.8237 -0.0042 0.0008  0.0306  546 LEU A CB  
3512 C CG  . LEU A 456 ? 0.7097 0.7353 0.7418 -0.0034 0.0015  0.0334  546 LEU A CG  
3513 C CD1 . LEU A 456 ? 0.7093 0.7350 0.7442 -0.0022 0.0026  0.0338  546 LEU A CD1 
3514 C CD2 . LEU A 456 ? 0.7177 0.7374 0.7485 -0.0057 0.0013  0.0356  546 LEU A CD2 
3515 N N   . GLY A 457 ? 3.0603 3.0934 3.0852 -0.0014 -0.0014 0.0287  547 GLY A N   
3516 C CA  . GLY A 457 ? 3.0203 3.0524 3.0409 -0.0009 -0.0014 0.0258  547 GLY A CA  
3517 C C   . GLY A 457 ? 3.1651 3.1961 3.1842 0.0001  -0.0006 0.0246  547 GLY A C   
3518 O O   . GLY A 457 ? 3.1634 3.1926 3.1795 0.0009  -0.0003 0.0224  547 GLY A O   
3519 N N   . ASP A 458 ? 4.3276 4.3597 4.3493 -0.0005 -0.0005 0.0264  548 ASP A N   
3520 C CA  . ASP A 458 ? 4.5299 4.5611 4.5511 -0.0002 0.0007  0.0251  548 ASP A CA  
3521 C C   . ASP A 458 ? 1.6795 1.7088 1.7036 0.0001  0.0024  0.0250  548 ASP A C   
3522 O O   . ASP A 458 ? 1.5790 1.6077 1.6054 0.0006  0.0024  0.0267  548 ASP A O   
3523 C CB  . ASP A 458 ? 4.5967 4.6281 4.6169 -0.0025 0.0010  0.0234  548 ASP A CB  
3524 C CG  . ASP A 458 ? 1.5247 1.5557 1.5457 -0.0051 0.0009  0.0240  548 ASP A CG  
3525 O OD1 . ASP A 458 ? 1.5356 1.5677 1.5568 -0.0048 -0.0004 0.0256  548 ASP A OD1 
3526 O OD2 . ASP A 458 ? 1.5315 1.5608 1.5525 -0.0074 0.0021  0.0229  548 ASP A OD2 
3527 N N   . GLY A 459 ? 1.7528 1.7816 1.7769 -0.0002 0.0037  0.0228  549 GLY A N   
3528 C CA  . GLY A 459 ? 1.7467 1.7745 1.7740 0.0001  0.0052  0.0219  549 GLY A CA  
3529 C C   . GLY A 459 ? 1.7319 1.7597 1.7637 -0.0022 0.0061  0.0238  549 GLY A C   
3530 O O   . GLY A 459 ? 1.7690 1.7957 1.8048 -0.0023 0.0061  0.0278  549 GLY A O   
3531 N N   . PRO A 460 ? 1.4168 1.4446 1.4481 -0.0041 0.0070  0.0211  550 PRO A N   
3532 C CA  . PRO A 460 ? 1.3282 1.3543 1.3612 -0.0074 0.0078  0.0217  550 PRO A CA  
3533 C C   . PRO A 460 ? 1.3250 1.3485 1.3537 -0.0104 0.0073  0.0212  550 PRO A C   
3534 O O   . PRO A 460 ? 1.3660 1.3903 1.3910 -0.0104 0.0070  0.0185  550 PRO A O   
3535 C CB  . PRO A 460 ? 1.2432 1.2711 1.2759 -0.0077 0.0088  0.0179  550 PRO A CB  
3536 C CG  . PRO A 460 ? 1.3022 1.3308 1.3301 -0.0059 0.0081  0.0145  550 PRO A CG  
3537 C CD  . PRO A 460 ? 1.3772 1.4058 1.4049 -0.0033 0.0070  0.0168  550 PRO A CD  
3538 N N   . LEU A 461 ? 1.3461 1.3657 1.3757 -0.0126 0.0071  0.0241  551 LEU A N   
3539 C CA  . LEU A 461 ? 1.3037 1.3201 1.3296 -0.0154 0.0068  0.0237  551 LEU A CA  
3540 C C   . LEU A 461 ? 1.4582 1.4742 1.4815 -0.0176 0.0079  0.0204  551 LEU A C   
3541 O O   . LEU A 461 ? 1.5563 1.5724 1.5813 -0.0188 0.0087  0.0194  551 LEU A O   
3542 C CB  . LEU A 461 ? 1.0686 1.0790 1.0952 -0.0170 0.0062  0.0272  551 LEU A CB  
3543 C CG  . LEU A 461 ? 0.9950 1.0070 1.0219 -0.0145 0.0052  0.0290  551 LEU A CG  
3544 C CD1 . LEU A 461 ? 1.1430 1.1488 1.1704 -0.0150 0.0044  0.0323  551 LEU A CD1 
3545 C CD2 . LEU A 461 ? 0.9526 0.9664 0.9755 -0.0148 0.0049  0.0270  551 LEU A CD2 
3546 N N   . GLN A 462 ? 1.3860 1.4026 1.4068 -0.0178 0.0074  0.0198  552 GLN A N   
3547 C CA  . GLN A 462 ? 1.4715 1.4889 1.4913 -0.0195 0.0076  0.0185  552 GLN A CA  
3548 C C   . GLN A 462 ? 1.5658 1.5813 1.5840 -0.0208 0.0067  0.0204  552 GLN A C   
3549 O O   . GLN A 462 ? 1.6809 1.6984 1.6987 -0.0195 0.0053  0.0218  552 GLN A O   
3550 C CB  . GLN A 462 ? 1.5754 1.5978 1.5946 -0.0177 0.0066  0.0175  552 GLN A CB  
3551 C CG  . GLN A 462 ? 1.8176 1.8430 1.8356 -0.0157 0.0047  0.0188  552 GLN A CG  
3552 C CD  . GLN A 462 ? 2.1131 2.1391 2.1324 -0.0133 0.0042  0.0200  552 GLN A CD  
3553 O OE1 . GLN A 462 ? 2.2598 2.2838 2.2808 -0.0132 0.0053  0.0201  552 GLN A OE1 
3554 N NE2 . GLN A 462 ? 2.2609 2.2896 2.2793 -0.0114 0.0025  0.0209  552 GLN A NE2 
3555 N N   . HIS A 463 ? 1.6689 1.6807 1.6864 -0.0234 0.0076  0.0201  553 HIS A N   
3556 C CA  . HIS A 463 ? 1.6322 1.6405 1.6482 -0.0251 0.0072  0.0218  553 HIS A CA  
3557 C C   . HIS A 463 ? 1.6562 1.6663 1.6711 -0.0265 0.0066  0.0216  553 HIS A C   
3558 O O   . HIS A 463 ? 1.6066 1.6131 1.6207 -0.0286 0.0069  0.0222  553 HIS A O   
3559 C CB  . HIS A 463 ? 1.6111 1.6124 1.6269 -0.0268 0.0084  0.0222  553 HIS A CB  
3560 C CG  . HIS A 463 ? 1.6336 1.6344 1.6511 -0.0274 0.0093  0.0209  553 HIS A CG  
3561 N ND1 . HIS A 463 ? 1.7006 1.7041 1.7201 -0.0257 0.0089  0.0213  553 HIS A ND1 
3562 C CD2 . HIS A 463 ? 1.7452 1.7444 1.7637 -0.0294 0.0101  0.0197  553 HIS A CD2 
3563 C CE1 . HIS A 463 ? 1.7912 1.7946 1.8126 -0.0269 0.0094  0.0202  553 HIS A CE1 
3564 N NE2 . HIS A 463 ? 1.7911 1.7917 1.8118 -0.0293 0.0101  0.0192  553 HIS A NE2 
3565 N N   . TYR A 464 ? 1.6741 1.6891 1.6889 -0.0253 0.0059  0.0204  554 TYR A N   
3566 C CA  . TYR A 464 ? 1.5342 1.5518 1.5472 -0.0260 0.0048  0.0203  554 TYR A CA  
3567 C C   . TYR A 464 ? 1.4784 1.4963 1.4904 -0.0260 0.0034  0.0222  554 TYR A C   
3568 O O   . TYR A 464 ? 1.4723 1.4921 1.4847 -0.0241 0.0025  0.0230  554 TYR A O   
3569 C CB  . TYR A 464 ? 1.5547 1.5770 1.5673 -0.0241 0.0040  0.0192  554 TYR A CB  
3570 C CG  . TYR A 464 ? 1.5213 1.5464 1.5316 -0.0243 0.0024  0.0193  554 TYR A CG  
3571 C CD1 . TYR A 464 ? 1.4003 1.4249 1.4093 -0.0264 0.0024  0.0190  554 TYR A CD1 
3572 C CD2 . TYR A 464 ? 1.5026 1.5308 1.5122 -0.0224 0.0008  0.0199  554 TYR A CD2 
3573 C CE1 . TYR A 464 ? 1.3660 1.3932 1.3728 -0.0266 0.0010  0.0190  554 TYR A CE1 
3574 C CE2 . TYR A 464 ? 1.4618 1.4924 1.4694 -0.0226 -0.0006 0.0199  554 TYR A CE2 
3575 C CZ  . TYR A 464 ? 1.4167 1.4467 1.4228 -0.0248 -0.0005 0.0195  554 TYR A CZ  
3576 O OH  . TYR A 464 ? 1.5047 1.5371 1.5088 -0.0251 -0.0018 0.0195  554 TYR A OH  
3577 N N   . ILE A 465 ? 1.3039 1.3207 1.3144 -0.0280 0.0029  0.0228  555 ILE A N   
3578 C CA  . ILE A 465 ? 1.4666 1.4831 1.4764 -0.0282 0.0018  0.0246  555 ILE A CA  
3579 C C   . ILE A 465 ? 1.9068 1.9279 1.9163 -0.0264 0.0000  0.0250  555 ILE A C   
3580 O O   . ILE A 465 ? 2.0321 2.0529 2.0419 -0.0261 -0.0007 0.0265  555 ILE A O   
3581 C CB  . ILE A 465 ? 0.9965 1.0114 1.0046 -0.0307 0.0016  0.0250  555 ILE A CB  
3582 C CG1 . ILE A 465 ? 1.0771 1.0933 1.0844 -0.0316 0.0019  0.0234  555 ILE A CG1 
3583 C CG2 . ILE A 465 ? 0.8790 0.8883 0.8873 -0.0324 0.0028  0.0256  555 ILE A CG2 
3584 C CD1 . ILE A 465 ? 1.0908 1.1120 1.0975 -0.0300 0.0009  0.0223  555 ILE A CD1 
3585 N N   . ALA A 466 ? 2.1082 2.1331 2.1171 -0.0252 -0.0007 0.0238  556 ALA A N   
3586 C CA  . ALA A 466 ? 2.0216 2.0504 2.0300 -0.0237 -0.0024 0.0242  556 ALA A CA  
3587 C C   . ALA A 466 ? 1.9117 1.9406 1.9188 -0.0252 -0.0035 0.0252  556 ALA A C   
3588 O O   . ALA A 466 ? 1.8584 1.8857 1.8644 -0.0274 -0.0031 0.0251  556 ALA A O   
3589 C CB  . ALA A 466 ? 2.1053 2.1351 2.1154 -0.0214 -0.0028 0.0250  556 ALA A CB  
3590 N N   . VAL A 467 ? 1.7837 1.8151 1.7911 -0.0240 -0.0049 0.0260  557 VAL A N   
3591 C CA  . VAL A 467 ? 1.8213 1.8536 1.8276 -0.0252 -0.0061 0.0269  557 VAL A CA  
3592 C C   . VAL A 467 ? 2.0984 2.1288 2.1057 -0.0258 -0.0061 0.0286  557 VAL A C   
3593 O O   . VAL A 467 ? 2.0412 2.0699 2.0501 -0.0250 -0.0054 0.0292  557 VAL A O   
3594 C CB  . VAL A 467 ? 1.5678 1.6041 1.5736 -0.0237 -0.0077 0.0266  557 VAL A CB  
3595 C CG1 . VAL A 467 ? 1.6178 1.6556 1.6254 -0.0214 -0.0081 0.0271  557 VAL A CG1 
3596 C CG2 . VAL A 467 ? 1.4643 1.5021 1.4687 -0.0233 -0.0077 0.0250  557 VAL A CG2 
3631 N N   . THR A 473 ? 1.9798 1.9909 1.9974 -0.0181 0.0019  0.0309  563 THR A N   
3632 C CA  . THR A 473 ? 1.6211 1.6262 1.6374 -0.0196 0.0034  0.0302  563 THR A CA  
3633 C C   . THR A 473 ? 1.4901 1.4877 1.5040 -0.0217 0.0038  0.0315  563 THR A C   
3634 O O   . THR A 473 ? 1.5046 1.4972 1.5189 -0.0218 0.0035  0.0334  563 THR A O   
3638 N N   . THR A 474 ? 1.5190 1.5170 1.5319 -0.0232 0.0032  0.0320  564 THR A N   
3639 C CA  . THR A 474 ? 1.5997 1.5912 1.6105 -0.0250 0.0035  0.0333  564 THR A CA  
3640 C C   . THR A 474 ? 1.6551 1.6428 1.6651 -0.0238 0.0028  0.0356  564 THR A C   
3641 O O   . THR A 474 ? 1.5816 1.5626 1.5905 -0.0242 0.0028  0.0370  564 THR A O   
3645 N N   . TYR A 475 ? 1.6408 1.6335 1.6522 -0.0223 0.0015  0.0365  565 TYR A N   
3646 C CA  . TYR A 475 ? 1.7365 1.7270 1.7477 -0.0209 0.0007  0.0387  565 TYR A CA  
3647 C C   . TYR A 475 ? 1.7675 1.7543 1.7794 -0.0192 0.0007  0.0396  565 TYR A C   
3648 O O   . TYR A 475 ? 1.8267 1.8084 1.8380 -0.0185 -0.0001 0.0419  565 TYR A O   
3657 N N   . VAL A 476 ? 1.6360 1.6262 1.6503 -0.0183 0.0009  0.0386  566 VAL A N   
3658 C CA  . VAL A 476 ? 1.7106 1.6984 1.7274 -0.0166 0.0004  0.0401  566 VAL A CA  
3659 C C   . VAL A 476 ? 1.7883 1.7676 1.8035 -0.0182 0.0004  0.0410  566 VAL A C   
3660 O O   . VAL A 476 ? 1.8505 1.8240 1.8659 -0.0168 -0.0004 0.0430  566 VAL A O   
3664 N N   . VAL A 477 ? 1.3284 1.3066 1.3420 -0.0210 0.0014  0.0394  567 VAL A N   
3665 C CA  . VAL A 477 ? 1.6706 1.6404 1.6826 -0.0227 0.0015  0.0401  567 VAL A CA  
3666 C C   . VAL A 477 ? 1.4165 1.3807 1.4261 -0.0225 0.0008  0.0422  567 VAL A C   
3667 O O   . VAL A 477 ? 1.3696 1.3266 1.3789 -0.0219 0.0002  0.0435  567 VAL A O   
3671 N N   . GLN A 478 ? 1.9654 1.9329 1.9735 -0.0227 0.0009  0.0423  568 GLN A N   
3672 C CA  . GLN A 478 ? 1.8282 1.7913 1.8342 -0.0224 0.0003  0.0443  568 GLN A CA  
3673 C C   . GLN A 478 ? 2.0909 2.0513 2.0979 -0.0195 -0.0011 0.0464  568 GLN A C   
3674 O O   . GLN A 478 ? 2.1097 2.0627 2.1154 -0.0191 -0.0015 0.0479  568 GLN A O   
3680 N N   . TYR A 479 ? 1.8853 1.8514 1.8948 -0.0172 -0.0016 0.0463  569 TYR A N   
3681 C CA  . TYR A 479 ? 2.0467 2.0113 2.0575 -0.0140 -0.0028 0.0481  569 TYR A CA  
3682 C C   . TYR A 479 ? 2.3454 2.3031 2.3570 -0.0128 -0.0031 0.0485  569 TYR A C   
3683 O O   . TYR A 479 ? 2.2878 2.2400 2.2990 -0.0106 -0.0040 0.0500  569 TYR A O   
3692 N N   . ALA A 480 ? 2.0203 1.9781 2.0331 -0.0142 -0.0023 0.0470  570 ALA A N   
3693 C CA  . ALA A 480 ? 2.5004 2.4512 2.5142 -0.0133 -0.0025 0.0469  570 ALA A CA  
3694 C C   . ALA A 480 ? 1.9692 1.9109 1.9798 -0.0148 -0.0026 0.0476  570 ALA A C   
3695 O O   . ALA A 480 ? 1.9438 1.8789 1.9544 -0.0127 -0.0033 0.0484  570 ALA A O   
3697 N N   . LEU A 481 ? 2.2226 2.1641 2.2306 -0.0183 -0.0017 0.0471  571 LEU A N   
3698 C CA  . LEU A 481 ? 2.0668 2.0000 2.0721 -0.0197 -0.0015 0.0478  571 LEU A CA  
3699 C C   . LEU A 481 ? 2.3121 2.2419 2.3160 -0.0174 -0.0024 0.0501  571 LEU A C   
3700 O O   . LEU A 481 ? 2.4132 2.3351 2.4162 -0.0164 -0.0028 0.0509  571 LEU A O   
3705 N N   . ALA A 482 ? 2.5439 2.4794 2.5477 -0.0166 -0.0028 0.0510  572 ALA A N   
3706 C CA  . ALA A 482 ? 2.6724 2.6051 2.6750 -0.0143 -0.0038 0.0531  572 ALA A CA  
3707 C C   . ALA A 482 ? 2.4220 2.3510 2.4264 -0.0105 -0.0048 0.0536  572 ALA A C   
3708 O O   . ALA A 482 ? 2.4388 2.3611 2.4416 -0.0092 -0.0053 0.0549  572 ALA A O   
3710 N N   . ASN A 483 ? 2.6954 2.6287 2.7030 -0.0085 -0.0051 0.0525  573 ASN A N   
3711 C CA  . ASN A 483 ? 2.6140 2.5436 2.6233 -0.0045 -0.0060 0.0528  573 ASN A CA  
3712 C C   . ASN A 483 ? 2.5551 2.4756 2.5637 -0.0046 -0.0058 0.0522  573 ASN A C   
3713 O O   . ASN A 483 ? 2.5871 2.5011 2.5948 -0.0024 -0.0063 0.0531  573 ASN A O   
3714 C CB  . ASN A 483 ? 2.0700 2.0060 2.0832 -0.0021 -0.0061 0.0514  573 ASN A CB  
3715 C CG  . ASN A 483 ? 1.7699 1.7022 1.7850 0.0024  -0.0068 0.0510  573 ASN A CG  
3716 O OD1 . ASN A 483 ? 1.7420 1.6683 1.7554 0.0042  -0.0074 0.0520  573 ASN A OD1 
3717 N ND2 . ASN A 483 ? 1.7626 1.6993 1.7812 0.0043  -0.0065 0.0493  573 ASN A ND2 
3718 N N   . LEU A 484 ? 2.4404 2.3603 2.4495 -0.0074 -0.0048 0.0506  574 LEU A N   
3719 C CA  . LEU A 484 ? 2.3673 2.2789 2.3761 -0.0078 -0.0045 0.0494  574 LEU A CA  
3720 C C   . LEU A 484 ? 2.3376 2.2415 2.3427 -0.0095 -0.0042 0.0506  574 LEU A C   
3721 O O   . LEU A 484 ? 2.3495 2.2456 2.3541 -0.0085 -0.0042 0.0503  574 LEU A O   
3722 C CB  . LEU A 484 ? 2.4359 2.3496 2.4461 -0.0107 -0.0035 0.0472  574 LEU A CB  
3723 C CG  . LEU A 484 ? 2.5280 2.4473 2.5425 -0.0082 -0.0037 0.0459  574 LEU A CG  
3724 C CD1 . LEU A 484 ? 2.8286 2.7478 2.8447 -0.0031 -0.0047 0.0466  574 LEU A CD1 
3725 C CD2 . LEU A 484 ? 2.5367 2.4529 2.5530 -0.0092 -0.0030 0.0434  574 LEU A CD2 
3726 N N   . THR A 485 ? 2.3017 2.2080 2.3045 -0.0120 -0.0038 0.0518  575 THR A N   
3727 C CA  . THR A 485 ? 2.3611 2.2609 2.3607 -0.0138 -0.0032 0.0528  575 THR A CA  
3728 C C   . THR A 485 ? 2.3884 2.2867 2.3865 -0.0114 -0.0040 0.0553  575 THR A C   
3729 O O   . THR A 485 ? 2.3553 2.2496 2.3508 -0.0127 -0.0036 0.0567  575 THR A O   
3730 C CB  . THR A 485 ? 2.6955 2.5992 2.6937 -0.0180 -0.0020 0.0524  575 THR A CB  
3731 O OG1 . THR A 485 ? 2.7072 2.6146 2.7072 -0.0200 -0.0013 0.0500  575 THR A OG1 
3732 C CG2 . THR A 485 ? 2.6726 2.5697 2.6682 -0.0203 -0.0009 0.0529  575 THR A CG2 
3733 N N   . GLY A 486 ? 2.4951 2.3971 2.4949 -0.0080 -0.0052 0.0558  576 GLY A N   
3734 C CA  . GLY A 486 ? 2.7490 2.6502 2.7474 -0.0058 -0.0060 0.0580  576 GLY A CA  
3735 C C   . GLY A 486 ? 3.0918 2.9832 3.0881 -0.0047 -0.0060 0.0591  576 GLY A C   
3736 O O   . GLY A 486 ? 3.1398 3.0256 3.1368 -0.0041 -0.0057 0.0578  576 GLY A O   
3737 N N   . THR A 487 ? 3.0685 2.9578 3.0624 -0.0048 -0.0061 0.0612  577 THR A N   
3738 C CA  . THR A 487 ? 3.3036 3.1843 3.2955 -0.0031 -0.0062 0.0627  577 THR A CA  
3739 C C   . THR A 487 ? 3.1663 3.0479 3.1577 0.0002  -0.0075 0.0647  577 THR A C   
3740 O O   . THR A 487 ? 3.1929 3.0679 3.1830 0.0025  -0.0078 0.0659  577 THR A O   
3744 N N   . VAL A 488 ? 3.1086 2.9985 3.1010 0.0006  -0.0082 0.0650  578 VAL A N   
3745 C CA  . VAL A 488 ? 2.7712 2.6633 2.7632 0.0034  -0.0094 0.0667  578 VAL A CA  
3746 C C   . VAL A 488 ? 2.4312 2.3326 2.4256 0.0046  -0.0102 0.0659  578 VAL A C   
3747 O O   . VAL A 488 ? 2.4558 2.3632 2.4518 0.0027  -0.0097 0.0644  578 VAL A O   
3751 N N   . VAL A 489 ? 2.2432 2.1457 2.2380 0.0080  -0.0113 0.0668  579 VAL A N   
3752 C CA  . VAL A 489 ? 1.8159 1.7269 1.8130 0.0095  -0.0120 0.0661  579 VAL A CA  
3753 C C   . VAL A 489 ? 1.6572 1.5685 1.6532 0.0119  -0.0131 0.0678  579 VAL A C   
3754 O O   . VAL A 489 ? 1.5278 1.4410 1.5222 0.0103  -0.0132 0.0693  579 VAL A O   
3758 N N   . UNK A 490 ? 2.0889 2.0203 2.0825 0.0062  -0.0135 0.0705  581 UNK A N   
3759 C CA  . UNK A 490 ? 2.1246 2.0608 2.1198 0.0087  -0.0145 0.0704  581 UNK A CA  
3760 C C   . UNK A 490 ? 2.2384 2.1837 2.2356 0.0067  -0.0142 0.0696  581 UNK A C   
3761 O O   . UNK A 490 ? 2.3149 2.2618 2.3115 0.0038  -0.0139 0.0704  581 UNK A O   
3763 N N   . UNK A 491 ? 2.2803 2.2321 2.2806 0.0082  -0.0145 0.0683  582 UNK A N   
3764 C CA  . UNK A 491 ? 2.2158 2.1769 2.2192 0.0061  -0.0140 0.0673  582 UNK A CA  
3765 C C   . UNK A 491 ? 2.2427 2.2071 2.2462 0.0040  -0.0143 0.0691  582 UNK A C   
3766 O O   . UNK A 491 ? 2.2326 2.1960 2.2356 0.0053  -0.0152 0.0710  582 UNK A O   
3768 N N   . UNK A 492 ? 2.2164 2.1850 2.2208 0.0008  -0.0135 0.0685  583 UNK A N   
3769 C CA  . UNK A 492 ? 2.2835 2.2543 2.2877 -0.0014 -0.0139 0.0701  583 UNK A CA  
3770 C C   . UNK A 492 ? 2.4850 2.4650 2.4926 -0.0035 -0.0133 0.0688  583 UNK A C   
3771 O O   . UNK A 492 ? 2.5080 2.4904 2.5156 -0.0061 -0.0133 0.0693  583 UNK A O   
3773 N N   . UNK A 493 ? 2.3759 2.3612 2.3865 -0.0022 -0.0129 0.0671  584 UNK A N   
3774 C CA  . UNK A 493 ? 2.7135 2.7080 2.7278 -0.0038 -0.0123 0.0658  584 UNK A CA  
3775 C C   . UNK A 493 ? 3.1579 3.1544 3.1724 -0.0068 -0.0117 0.0646  584 UNK A C   
3776 O O   . UNK A 493 ? 3.2259 3.2265 3.2414 -0.0090 -0.0119 0.0650  584 UNK A O   
3778 N N   . UNK A 494 ? 3.7168 3.7106 3.7305 -0.0070 -0.0110 0.0631  585 UNK A N   
3779 C CA  . UNK A 494 ? 3.7143 3.7092 3.7278 -0.0098 -0.0106 0.0621  585 UNK A CA  
3780 C C   . UNK A 494 ? 3.3806 3.3811 3.3970 -0.0100 -0.0097 0.0595  585 UNK A C   
3781 O O   . UNK A 494 ? 3.3868 3.3868 3.4039 -0.0080 -0.0092 0.0585  585 UNK A O   
3783 N N   . UNK A 495 ? 2.9818 2.9881 3.0000 -0.0123 -0.0096 0.0583  586 UNK A N   
3784 C CA  . UNK A 495 ? 2.7741 2.7858 2.7948 -0.0128 -0.0089 0.0559  586 UNK A CA  
3785 C C   . UNK A 495 ? 3.3603 3.3699 3.3793 -0.0148 -0.0087 0.0548  586 UNK A C   
3786 O O   . UNK A 495 ? 3.3498 3.3639 3.3707 -0.0150 -0.0083 0.0528  586 UNK A O   
3838 N N   . UNK A 506 ? 2.7575 2.6976 2.7473 -0.0237 -0.0051 0.0639  603 UNK A N   
3839 C CA  . UNK A 506 ? 2.5573 2.4926 2.5465 -0.0228 -0.0040 0.0625  603 UNK A CA  
3840 C C   . UNK A 506 ? 2.4025 2.3351 2.3916 -0.0193 -0.0043 0.0628  603 UNK A C   
3841 O O   . UNK A 506 ? 2.3570 2.2826 2.3448 -0.0183 -0.0038 0.0630  603 UNK A O   
3843 N N   . UNK A 507 ? 2.4741 2.4125 2.4650 -0.0177 -0.0054 0.0628  604 UNK A N   
3844 C CA  . UNK A 507 ? 2.5330 2.4708 2.5246 -0.0148 -0.0056 0.0620  604 UNK A CA  
3845 C C   . UNK A 507 ? 2.7775 2.7230 2.7719 -0.0152 -0.0054 0.0598  604 UNK A C   
3846 O O   . UNK A 507 ? 2.6862 2.6374 2.6820 -0.0175 -0.0053 0.0590  604 UNK A O   
3848 N N   . UNK A 508 ? 2.5684 2.5148 2.5647 -0.0131 -0.0058 0.0591  605 UNK A N   
3849 C CA  . UNK A 508 ? 3.1259 3.0798 3.1248 -0.0134 -0.0054 0.0569  605 UNK A CA  
3850 C C   . UNK A 508 ? 3.1145 3.0735 3.1157 -0.0108 -0.0063 0.0569  605 UNK A C   
3851 O O   . UNK A 508 ? 3.0702 3.0259 3.0715 -0.0083 -0.0072 0.0583  605 UNK A O   
3853 N N   . UNK A 509 ? 3.2981 3.2652 3.3019 -0.0112 -0.0061 0.0553  606 UNK A N   
3854 C CA  . UNK A 509 ? 3.2633 3.2361 3.2699 -0.0089 -0.0067 0.0551  606 UNK A CA  
3855 C C   . UNK A 509 ? 3.2061 3.1800 3.2148 -0.0072 -0.0064 0.0538  606 UNK A C   
3856 O O   . UNK A 509 ? 3.2119 3.1888 3.2218 -0.0084 -0.0056 0.0521  606 UNK A O   
3858 N N   . UNK A 510 ? 3.1839 3.1564 3.1938 -0.0042 -0.0072 0.0547  607 UNK A N   
3859 C CA  . UNK A 510 ? 3.0377 3.0120 3.0504 -0.0020 -0.0072 0.0538  607 UNK A CA  
3860 C C   . UNK A 510 ? 3.1829 3.1627 3.1975 0.0001  -0.0075 0.0535  607 UNK A C   
3861 O O   . UNK A 510 ? 3.2358 3.2129 3.2493 0.0019  -0.0084 0.0549  607 UNK A O   
3863 N N   . UNK A 511 ? 3.6997 3.6873 3.7167 -0.0005 -0.0067 0.0518  608 UNK A N   
3864 C CA  . UNK A 511 ? 3.7553 3.7490 3.7747 0.0013  -0.0066 0.0510  608 UNK A CA  
3865 C C   . UNK A 511 ? 4.1619 4.1552 4.1804 0.0014  -0.0075 0.0530  608 UNK A C   
3866 O O   . UNK A 511 ? 4.2120 4.2047 4.2309 0.0039  -0.0081 0.0536  608 UNK A O   
3913 N N   . UNK A 521 ? 2.9080 2.8852 2.9185 0.0003  -0.0096 0.0582  620 UNK A N   
3914 C CA  . UNK A 521 ? 3.0284 2.9977 3.0354 0.0007  -0.0103 0.0602  620 UNK A CA  
3915 C C   . UNK A 521 ? 3.1116 3.0763 3.1161 -0.0019 -0.0096 0.0600  620 UNK A C   
3916 O O   . UNK A 521 ? 3.2044 3.1691 3.2098 -0.0026 -0.0089 0.0587  620 UNK A O   
3918 N N   . UNK A 522 ? 3.3862 3.3480 3.3887 -0.0036 -0.0098 0.0618  621 UNK A N   
3919 C CA  . UNK A 522 ? 3.3106 3.2662 3.3104 -0.0054 -0.0090 0.0617  621 UNK A CA  
3920 C C   . UNK A 522 ? 3.0535 2.9999 3.0513 -0.0041 -0.0094 0.0632  621 UNK A C   
3921 O O   . UNK A 522 ? 3.1225 3.0650 3.1184 -0.0032 -0.0100 0.0651  621 UNK A O   
3923 N N   . UNK A 523 ? 2.9632 2.9062 2.9617 -0.0040 -0.0090 0.0624  622 UNK A N   
3924 C CA  . UNK A 523 ? 2.5763 2.5107 2.5736 -0.0025 -0.0094 0.0636  622 UNK A CA  
3925 C C   . UNK A 523 ? 2.6155 2.5449 2.6109 -0.0054 -0.0083 0.0635  622 UNK A C   
3926 O O   . UNK A 523 ? 2.7051 2.6379 2.7013 -0.0078 -0.0074 0.0618  622 UNK A O   
3928 N N   . UNK A 524 ? 2.6753 2.5973 2.6682 -0.0053 -0.0084 0.0653  623 UNK A N   
3929 C CA  . UNK A 524 ? 2.6761 2.5921 2.6668 -0.0080 -0.0073 0.0655  623 UNK A CA  
3930 C C   . UNK A 524 ? 2.6801 2.5962 2.6723 -0.0095 -0.0065 0.0634  623 UNK A C   
3931 O O   . UNK A 524 ? 2.6195 2.5349 2.6136 -0.0077 -0.0068 0.0625  623 UNK A O   
3933 N N   . UNK A 525 ? 2.6454 2.5627 2.6367 -0.0128 -0.0053 0.0625  624 UNK A N   
3934 C CA  . UNK A 525 ? 2.6271 2.5450 2.6192 -0.0150 -0.0043 0.0605  624 UNK A CA  
3935 C C   . UNK A 525 ? 2.6395 2.5550 2.6296 -0.0182 -0.0030 0.0605  624 UNK A C   
3936 O O   . UNK A 525 ? 2.5880 2.5056 2.5768 -0.0191 -0.0029 0.0613  624 UNK A O   
3938 N N   . UNK A 526 ? 2.4075 2.3187 2.3976 -0.0199 -0.0020 0.0594  625 UNK A N   
3939 C CA  . UNK A 526 ? 2.5230 2.4320 2.5118 -0.0230 -0.0006 0.0590  625 UNK A CA  
3940 C C   . UNK A 526 ? 2.6902 2.6065 2.6798 -0.0254 0.0002  0.0570  625 UNK A C   
3941 O O   . UNK A 526 ? 2.7623 2.6788 2.7526 -0.0275 0.0013  0.0553  625 UNK A O   
3943 N N   . UNK A 527 ? 2.7371 2.6597 2.7268 -0.0248 -0.0003 0.0573  626 UNK A N   
3944 C CA  . UNK A 527 ? 2.7033 2.6337 2.6940 -0.0262 0.0003  0.0553  626 UNK A CA  
3945 C C   . UNK A 527 ? 2.6930 2.6264 2.6832 -0.0277 -0.0002 0.0565  626 UNK A C   
3946 O O   . UNK A 527 ? 2.7185 2.6513 2.7084 -0.0302 0.0003  0.0564  626 UNK A O   
3948 N N   . THR A 528 ? 3.0351 2.9825 3.0288 -0.0325 0.0001  0.0523  627 THR A N   
3949 C CA  . THR A 528 ? 3.0419 2.9913 3.0369 -0.0304 0.0003  0.0511  627 THR A CA  
3950 C C   . THR A 528 ? 2.7721 2.7269 2.7689 -0.0313 0.0008  0.0486  627 THR A C   
3951 O O   . THR A 528 ? 2.6391 2.5909 2.6358 -0.0320 0.0020  0.0473  627 THR A O   
3955 N N   . ALA A 529 ? 3.3239 3.2866 3.3224 -0.0312 -0.0002 0.0480  628 ALA A N   
3956 C CA  . ALA A 529 ? 2.8586 2.8273 2.8587 -0.0321 0.0000  0.0458  628 ALA A CA  
3957 C C   . ALA A 529 ? 2.4485 2.4167 2.4475 -0.0347 0.0000  0.0458  628 ALA A C   
3958 O O   . ALA A 529 ? 2.4010 2.3668 2.3987 -0.0355 -0.0005 0.0475  628 ALA A O   
3960 N N   . ARG A 530 ? 2.0627 2.0330 2.0622 -0.0360 0.0006  0.0439  629 ARG A N   
3961 C CA  . ARG A 530 ? 1.8852 1.8563 1.8839 -0.0383 0.0004  0.0437  629 ARG A CA  
3962 C C   . ARG A 530 ? 1.6652 1.6428 1.6649 -0.0389 0.0000  0.0418  629 ARG A C   
3963 O O   . ARG A 530 ? 1.5867 1.5669 1.5876 -0.0381 0.0005  0.0402  629 ARG A O   
3964 C CB  . ARG A 530 ? 1.9125 1.8768 1.9101 -0.0399 0.0016  0.0438  629 ARG A CB  
3965 C CG  . ARG A 530 ? 1.9570 1.9142 1.9530 -0.0401 0.0018  0.0459  629 ARG A CG  
3966 C CD  . ARG A 530 ? 1.9959 1.9534 1.9907 -0.0423 0.0012  0.0467  629 ARG A CD  
3967 N NE  . ARG A 530 ? 1.8809 1.8358 1.8754 -0.0446 0.0020  0.0458  629 ARG A NE  
3968 C CZ  . ARG A 530 ? 1.8076 1.7557 1.8011 -0.0456 0.0029  0.0467  629 ARG A CZ  
3969 N NH1 . ARG A 530 ? 1.8163 1.7592 1.8087 -0.0446 0.0029  0.0487  629 ARG A NH1 
3970 N NH2 . ARG A 530 ? 1.8230 1.7696 1.8165 -0.0477 0.0035  0.0458  629 ARG A NH2 
3971 N N   . LEU A 531 ? 1.7965 1.7766 1.7954 -0.0402 -0.0010 0.0423  630 LEU A N   
3972 C CA  . LEU A 531 ? 2.0159 2.0015 2.0149 -0.0410 -0.0016 0.0408  630 LEU A CA  
3973 C C   . LEU A 531 ? 2.4232 2.4083 2.4223 -0.0420 -0.0006 0.0390  630 LEU A C   
3974 O O   . LEU A 531 ? 2.4173 2.3972 2.4157 -0.0434 0.0004  0.0392  630 LEU A O   
3979 N N   . ALA A 532 ? 2.0786 2.0692 2.0786 -0.0412 -0.0009 0.0373  631 ALA A N   
3980 C CA  . ALA A 532 ? 2.2155 2.2069 2.2155 -0.0422 -0.0002 0.0355  631 ALA A CA  
3981 C C   . ALA A 532 ? 2.0891 2.0857 2.0883 -0.0428 -0.0011 0.0344  631 ALA A C   
3982 O O   . ALA A 532 ? 2.0195 2.0153 2.0177 -0.0446 -0.0008 0.0337  631 ALA A O   
3984 N N   . ARG A 533 ? 1.9467 1.9485 1.9463 -0.0413 -0.0023 0.0342  632 ARG A N   
3985 C CA  . ARG A 533 ? 1.9466 1.9532 1.9452 -0.0416 -0.0034 0.0333  632 ARG A CA  
3986 C C   . ARG A 533 ? 2.0395 2.0449 2.0364 -0.0439 -0.0033 0.0328  632 ARG A C   
3987 O O   . ARG A 533 ? 2.0640 2.0661 2.0599 -0.0456 -0.0032 0.0339  632 ARG A O   
3995 N N   . ALA A 534 ? 1.7329 1.7411 1.7293 -0.0439 -0.0032 0.0313  633 ALA A N   
3996 C CA  . ALA A 534 ? 1.9238 1.9301 1.9189 -0.0461 -0.0027 0.0307  633 ALA A CA  
3997 C C   . ALA A 534 ? 1.6893 1.6952 1.6824 -0.0482 -0.0033 0.0312  633 ALA A C   
3998 O O   . ALA A 534 ? 1.7359 1.7453 1.7281 -0.0480 -0.0045 0.0313  633 ALA A O   
4000 N N   . LEU A 535 ? 2.1222 2.1237 2.1146 -0.0502 -0.0025 0.0317  634 LEU A N   
4001 C CA  . LEU A 535 ? 1.9275 1.9279 1.9179 -0.0524 -0.0030 0.0321  634 LEU A CA  
4002 C C   . LEU A 535 ? 1.9061 1.9107 1.8954 -0.0527 -0.0035 0.0307  634 LEU A C   
4003 O O   . LEU A 535 ? 1.8954 1.8999 1.8844 -0.0534 -0.0028 0.0295  634 LEU A O   
4004 C CB  . LEU A 535 ? 1.8360 1.8312 1.8259 -0.0545 -0.0020 0.0325  634 LEU A CB  
4005 C CG  . LEU A 535 ? 1.8517 1.8425 1.8426 -0.0541 -0.0016 0.0341  634 LEU A CG  
4006 C CD1 . LEU A 535 ? 1.9368 1.9264 1.9297 -0.0525 -0.0006 0.0335  634 LEU A CD1 
4007 C CD2 . LEU A 535 ? 1.8495 1.8354 1.8393 -0.0563 -0.0011 0.0349  634 LEU A CD2 
4008 N N   . SER A 536 ? 1.7606 1.7689 1.7493 -0.0520 -0.0047 0.0309  635 SER A N   
4009 C CA  . SER A 536 ? 1.9207 1.9335 1.9085 -0.0515 -0.0053 0.0296  635 SER A CA  
4010 C C   . SER A 536 ? 1.9578 1.9730 1.9453 -0.0509 -0.0066 0.0304  635 SER A C   
4011 O O   . SER A 536 ? 2.0097 2.0283 1.9961 -0.0508 -0.0075 0.0297  635 SER A O   
4014 N N   . PRO A 537 ? 2.0599 2.0730 2.0482 -0.0507 -0.0067 0.0318  636 PRO A N   
4015 C CA  . PRO A 537 ? 1.8672 1.8828 1.8555 -0.0501 -0.0080 0.0325  636 PRO A CA  
4016 C C   . PRO A 537 ? 1.7143 1.7278 1.7009 -0.0523 -0.0084 0.0337  636 PRO A C   
4017 O O   . PRO A 537 ? 1.6668 1.6760 1.6528 -0.0539 -0.0076 0.0344  636 PRO A O   
4021 N N   . ALA A 538 ? 1.9358 1.9524 1.9217 -0.0522 -0.0096 0.0338  637 ALA A N   
4022 C CA  . ALA A 538 ? 1.9483 1.9638 1.9329 -0.0539 -0.0101 0.0350  637 ALA A CA  
4023 C C   . ALA A 538 ? 1.9454 1.9641 1.9306 -0.0527 -0.0114 0.0355  637 ALA A C   
4024 O O   . ALA A 538 ? 1.9200 1.9428 1.9053 -0.0517 -0.0121 0.0345  637 ALA A O   
4025 C CB  . ALA A 538 ? 1.9551 1.9709 1.9375 -0.0558 -0.0103 0.0344  637 ALA A CB  
4026 N N   . GLN A 539 ? 2.1583 2.1864 2.1430 -0.0500 -0.0121 0.0314  639 GLN A N   
4027 C CA  . GLN A 539 ? 2.1806 2.2111 2.1651 -0.0490 -0.0120 0.0299  639 GLN A CA  
4028 C C   . GLN A 539 ? 2.0838 2.1117 2.0683 -0.0496 -0.0107 0.0293  639 GLN A C   
4029 O O   . GLN A 539 ? 2.1332 2.1577 2.1184 -0.0501 -0.0099 0.0301  639 GLN A O   
4030 C CB  . GLN A 539 ? 2.2949 2.3278 2.2775 -0.0499 -0.0127 0.0292  639 GLN A CB  
4031 C CG  . GLN A 539 ? 2.5420 2.5778 2.5241 -0.0488 -0.0129 0.0277  639 GLN A CG  
4032 C CD  . GLN A 539 ? 2.4657 2.5026 2.4494 -0.0466 -0.0126 0.0270  639 GLN A CD  
4033 O OE1 . GLN A 539 ? 2.4705 2.5078 2.4559 -0.0450 -0.0128 0.0275  639 GLN A OE1 
4034 N NE2 . GLN A 539 ? 2.4677 2.5047 2.4509 -0.0466 -0.0119 0.0260  639 GLN A NE2 
4035 N N   . TRP A 540 ? 2.0495 2.0788 2.0329 -0.0499 -0.0104 0.0281  640 TRP A N   
4036 C CA  . TRP A 540 ? 1.8815 1.9087 1.8645 -0.0508 -0.0093 0.0274  640 TRP A CA  
4037 C C   . TRP A 540 ? 1.8143 1.8388 1.7957 -0.0535 -0.0089 0.0279  640 TRP A C   
4038 O O   . TRP A 540 ? 1.9249 1.9507 1.9045 -0.0547 -0.0094 0.0276  640 TRP A O   
4039 C CB  . TRP A 540 ? 1.7884 1.8186 1.7708 -0.0500 -0.0094 0.0259  640 TRP A CB  
4040 C CG  . TRP A 540 ? 1.8598 1.8887 1.8415 -0.0512 -0.0084 0.0250  640 TRP A CG  
4041 C CD1 . TRP A 540 ? 1.9443 1.9714 1.9270 -0.0510 -0.0073 0.0246  640 TRP A CD1 
4042 C CD2 . TRP A 540 ? 1.9368 1.9663 1.9164 -0.0529 -0.0084 0.0244  640 TRP A CD2 
4043 N NE1 . TRP A 540 ? 1.9860 2.0125 1.9675 -0.0525 -0.0066 0.0238  640 TRP A NE1 
4044 C CE2 . TRP A 540 ? 1.9524 1.9804 1.9320 -0.0537 -0.0073 0.0236  640 TRP A CE2 
4045 C CE3 . TRP A 540 ? 2.0817 2.1130 2.0597 -0.0539 -0.0092 0.0244  640 TRP A CE3 
4046 C CZ2 . TRP A 540 ? 1.9008 1.9291 1.8787 -0.0554 -0.0070 0.0229  640 TRP A CZ2 
4047 C CZ3 . TRP A 540 ? 2.1356 2.1670 2.1119 -0.0556 -0.0088 0.0237  640 TRP A CZ3 
4048 C CH2 . TRP A 540 ? 2.0346 2.0646 2.0109 -0.0563 -0.0078 0.0230  640 TRP A CH2 
4049 N N   . SER A 541 ? 1.6892 1.7097 1.6712 -0.0545 -0.0081 0.0287  641 SER A N   
4050 C CA  . SER A 541 ? 1.5476 1.5649 1.5281 -0.0571 -0.0077 0.0293  641 SER A CA  
4051 C C   . SER A 541 ? 1.7409 1.7565 1.7206 -0.0585 -0.0067 0.0284  641 SER A C   
4052 O O   . SER A 541 ? 1.7842 1.7977 1.7625 -0.0607 -0.0065 0.0288  641 SER A O   
4053 C CB  . SER A 541 ? 1.4344 1.4477 1.4157 -0.0576 -0.0074 0.0309  641 SER A CB  
4054 O OG  . SER A 541 ? 1.3301 1.3448 1.3119 -0.0566 -0.0084 0.0319  641 SER A OG  
4055 N N   . SER A 542 ? 1.6090 1.6254 1.5897 -0.0574 -0.0060 0.0274  642 SER A N   
4056 C CA  . SER A 542 ? 1.6802 1.6950 1.6603 -0.0590 -0.0050 0.0265  642 SER A CA  
4057 C C   . SER A 542 ? 2.7129 2.7300 2.6936 -0.0578 -0.0046 0.0249  642 SER A C   
4058 O O   . SER A 542 ? 2.6444 2.6647 2.6257 -0.0557 -0.0051 0.0244  642 SER A O   
4059 C CB  . SER A 542 ? 1.6708 1.6804 1.6517 -0.0602 -0.0041 0.0273  642 SER A CB  
4060 O OG  . SER A 542 ? 1.6385 1.6456 1.6179 -0.0624 -0.0042 0.0282  642 SER A OG  
4061 N N   . THR A 543 ? 2.4164 2.4316 2.3968 -0.0593 -0.0036 0.0242  643 THR A N   
4062 C CA  . THR A 543 ? 2.4458 2.4627 2.4264 -0.0588 -0.0030 0.0227  643 THR A CA  
4063 C C   . THR A 543 ? 2.2885 2.3012 2.2697 -0.0606 -0.0018 0.0225  643 THR A C   
4064 O O   . THR A 543 ? 2.2673 2.2802 2.2487 -0.0608 -0.0010 0.0213  643 THR A O   
4065 C CB  . THR A 543 ? 1.8181 1.8386 1.7967 -0.0593 -0.0035 0.0216  643 THR A CB  
4066 O OG1 . THR A 543 ? 1.8207 1.8447 1.7990 -0.0576 -0.0047 0.0218  643 THR A OG1 
4067 C CG2 . THR A 543 ? 1.7883 1.8104 1.7670 -0.0590 -0.0029 0.0201  643 THR A CG2 
4068 N N   . GLU A 544 ? 2.2315 2.2402 2.2128 -0.0618 -0.0016 0.0238  644 GLU A N   
4069 C CA  . GLU A 544 ? 1.9730 1.9769 1.9551 -0.0634 -0.0006 0.0240  644 GLU A CA  
4070 C C   . GLU A 544 ? 1.6683 1.6711 1.6528 -0.0616 0.0000  0.0240  644 GLU A C   
4071 O O   . GLU A 544 ? 1.6348 1.6368 1.6205 -0.0615 0.0008  0.0230  644 GLU A O   
4072 C CB  . GLU A 544 ? 2.0399 2.0400 2.0212 -0.0650 -0.0007 0.0256  644 GLU A CB  
4073 C CG  . GLU A 544 ? 1.8466 1.8478 1.8254 -0.0671 -0.0013 0.0256  644 GLU A CG  
4074 C CD  . GLU A 544 ? 1.8185 1.8157 1.7964 -0.0689 -0.0013 0.0271  644 GLU A CD  
4075 O OE1 . GLU A 544 ? 1.8114 1.8089 1.7892 -0.0681 -0.0021 0.0283  644 GLU A OE1 
4076 O OE2 . GLU A 544 ? 1.8042 1.7980 1.7816 -0.0710 -0.0007 0.0270  644 GLU A OE2 
4077 N N   . TYR A 545 ? 1.6332 1.6361 1.6186 -0.0600 -0.0005 0.0252  645 TYR A N   
4078 C CA  . TYR A 545 ? 1.5654 1.5678 1.5530 -0.0580 -0.0001 0.0252  645 TYR A CA  
4079 C C   . TYR A 545 ? 1.4874 1.4946 1.4754 -0.0557 -0.0005 0.0242  645 TYR A C   
4080 O O   . TYR A 545 ? 1.6091 1.6201 1.5957 -0.0555 -0.0013 0.0236  645 TYR A O   
4081 C CB  . TYR A 545 ? 1.5536 1.5542 1.5416 -0.0574 -0.0006 0.0270  645 TYR A CB  
4082 C CG  . TYR A 545 ? 1.7527 1.7479 1.7405 -0.0592 -0.0001 0.0281  645 TYR A CG  
4083 C CD1 . TYR A 545 ? 1.9556 1.9472 1.9440 -0.0607 0.0009  0.0276  645 TYR A CD1 
4084 C CD2 . TYR A 545 ? 1.8192 1.8129 1.8064 -0.0594 -0.0007 0.0298  645 TYR A CD2 
4085 C CE1 . TYR A 545 ? 2.0647 2.0510 2.0529 -0.0623 0.0013  0.0287  645 TYR A CE1 
4086 C CE2 . TYR A 545 ? 1.9557 1.9443 1.9426 -0.0610 -0.0003 0.0309  645 TYR A CE2 
4087 C CZ  . TYR A 545 ? 2.0694 2.0542 2.0568 -0.0624 0.0007  0.0304  645 TYR A CZ  
4088 O OH  . TYR A 545 ? 2.1031 2.0823 2.0902 -0.0640 0.0012  0.0315  645 TYR A OH  
4089 N N   . SER A 546 ? 1.6674 1.6743 1.6576 -0.0541 0.0001  0.0238  646 SER A N   
4090 C CA  . SER A 546 ? 1.4894 1.5004 1.4802 -0.0518 -0.0001 0.0228  646 SER A CA  
4091 C C   . SER A 546 ? 1.4192 1.4332 1.4100 -0.0498 -0.0013 0.0235  646 SER A C   
4092 O O   . SER A 546 ? 1.2520 1.2644 1.2437 -0.0491 -0.0015 0.0248  646 SER A O   
4093 C CB  . SER A 546 ? 1.3547 1.3645 1.3477 -0.0507 0.0009  0.0220  646 SER A CB  
4094 O OG  . SER A 546 ? 1.2341 1.2390 1.2286 -0.0516 0.0019  0.0226  646 SER A OG  
4095 N N   . THR A 547 ? 1.5491 1.5674 1.5388 -0.0488 -0.0021 0.0226  647 THR A N   
4096 C CA  . THR A 547 ? 1.6416 1.6630 1.6312 -0.0470 -0.0033 0.0230  647 THR A CA  
4097 C C   . THR A 547 ? 1.6068 1.6315 1.5972 -0.0446 -0.0035 0.0219  647 THR A C   
4098 O O   . THR A 547 ? 1.5042 1.5316 1.4933 -0.0446 -0.0038 0.0208  647 THR A O   
4099 C CB  . THR A 547 ? 2.0184 2.0420 2.0060 -0.0479 -0.0043 0.0231  647 THR A CB  
4100 O OG1 . THR A 547 ? 2.1102 2.1347 2.0963 -0.0491 -0.0040 0.0218  647 THR A OG1 
4101 C CG2 . THR A 547 ? 2.1174 2.1380 2.1043 -0.0499 -0.0044 0.0244  647 THR A CG2 
4102 N N   . TRP A 548 ? 1.4822 1.5068 1.4745 -0.0427 -0.0033 0.0222  648 TRP A N   
4103 C CA  . TRP A 548 ? 1.6276 1.6554 1.6204 -0.0404 -0.0036 0.0212  648 TRP A CA  
4104 C C   . TRP A 548 ? 1.6156 1.6450 1.6094 -0.0385 -0.0045 0.0219  648 TRP A C   
4105 O O   . TRP A 548 ? 1.6200 1.6475 1.6152 -0.0381 -0.0042 0.0230  648 TRP A O   
4106 C CB  . TRP A 548 ? 1.6895 1.7165 1.6837 -0.0397 -0.0024 0.0202  648 TRP A CB  
4107 C CG  . TRP A 548 ? 1.7705 1.7969 1.7639 -0.0414 -0.0016 0.0191  648 TRP A CG  
4108 C CD1 . TRP A 548 ? 1.8770 1.9047 1.8682 -0.0428 -0.0021 0.0187  648 TRP A CD1 
4109 C CD2 . TRP A 548 ? 1.7279 1.7530 1.7224 -0.0415 -0.0004 0.0181  648 TRP A CD2 
4110 N NE1 . TRP A 548 ? 1.9159 1.9430 1.9067 -0.0440 -0.0012 0.0175  648 TRP A NE1 
4111 C CE2 . TRP A 548 ? 1.8501 1.8757 1.8431 -0.0432 -0.0001 0.0172  648 TRP A CE2 
4112 C CE3 . TRP A 548 ? 1.8075 1.8310 1.8044 -0.0404 0.0006  0.0180  648 TRP A CE3 
4113 C CZ2 . TRP A 548 ? 1.9128 1.9374 1.9065 -0.0439 0.0010  0.0160  648 TRP A CZ2 
4114 C CZ3 . TRP A 548 ? 1.8940 1.9164 1.8917 -0.0411 0.0017  0.0169  648 TRP A CZ3 
4115 C CH2 . TRP A 548 ? 1.9304 1.9534 1.9266 -0.0429 0.0019  0.0159  648 TRP A CH2 
4116 N N   . THR A 549 ? 1.3926 1.4256 1.3855 -0.0372 -0.0056 0.0214  649 THR A N   
4117 C CA  . THR A 549 ? 1.5638 1.5986 1.5575 -0.0353 -0.0067 0.0220  649 THR A CA  
4118 C C   . THR A 549 ? 1.3409 1.3787 1.3347 -0.0330 -0.0073 0.0211  649 THR A C   
4119 O O   . THR A 549 ? 1.3682 1.4080 1.3604 -0.0330 -0.0078 0.0202  649 THR A O   
4120 C CB  . THR A 549 ? 2.0611 2.0970 2.0536 -0.0361 -0.0079 0.0228  649 THR A CB  
4121 O OG1 . THR A 549 ? 2.0619 2.1001 2.0525 -0.0365 -0.0086 0.0220  649 THR A OG1 
4122 C CG2 . THR A 549 ? 2.0995 2.1322 2.0920 -0.0383 -0.0074 0.0240  649 THR A CG2 
4123 N N   . GLU A 550 ? 1.4849 1.5226 1.4804 -0.0311 -0.0072 0.0214  650 GLU A N   
4124 C CA  . GLU A 550 ? 1.3099 1.3502 1.3056 -0.0287 -0.0078 0.0206  650 GLU A CA  
4125 C C   . GLU A 550 ? 1.0351 1.0779 1.0306 -0.0273 -0.0094 0.0211  650 GLU A C   
4126 O O   . GLU A 550 ? 0.9757 1.0183 0.9722 -0.0271 -0.0098 0.0222  650 GLU A O   
4127 C CB  . GLU A 550 ? 1.3620 1.4012 1.3596 -0.0272 -0.0069 0.0205  650 GLU A CB  
4128 C CG  . GLU A 550 ? 1.6142 1.6502 1.6128 -0.0286 -0.0055 0.0209  650 GLU A CG  
4129 C CD  . GLU A 550 ? 1.8612 1.8961 1.8618 -0.0272 -0.0046 0.0209  650 GLU A CD  
4130 O OE1 . GLU A 550 ? 1.9396 1.9763 1.9403 -0.0253 -0.0048 0.0200  650 GLU A OE1 
4131 O OE2 . GLU A 550 ? 1.9506 1.9827 1.9526 -0.0279 -0.0036 0.0216  650 GLU A OE2 
4132 N N   . SER A 551 ? 1.0726 1.1164 1.0674 -0.0260 -0.0094 0.0198  651 SER A N   
4133 C CA  . SER A 551 ? 0.9847 1.0278 0.9805 -0.0235 -0.0089 0.0189  651 SER A CA  
4134 C C   . SER A 551 ? 1.0319 1.0743 1.0296 -0.0213 -0.0087 0.0192  651 SER A C   
4135 O O   . SER A 551 ? 1.0234 1.0658 1.0218 -0.0210 -0.0085 0.0195  651 SER A O   
4136 C CB  . SER A 551 ? 1.0501 1.0928 1.0456 -0.0220 -0.0081 0.0171  651 SER A CB  
4137 O OG  . SER A 551 ? 1.2038 1.2452 1.2001 -0.0197 -0.0077 0.0162  651 SER A OG  
4138 N N   . ARG A 552 ? 0.8749 0.9168 0.8733 -0.0203 -0.0087 0.0192  652 ARG A N   
4139 C CA  . ARG A 552 ? 1.3053 1.3460 1.3051 -0.0179 -0.0083 0.0189  652 ARG A CA  
4140 C C   . ARG A 552 ? 2.0315 2.0707 2.0314 -0.0155 -0.0074 0.0170  652 ARG A C   
4141 O O   . ARG A 552 ? 2.1052 2.1440 2.1042 -0.0154 -0.0072 0.0159  652 ARG A O   
4142 C CB  . ARG A 552 ? 1.0739 1.1145 1.0743 -0.0177 -0.0086 0.0194  652 ARG A CB  
4143 C CG  . ARG A 552 ? 1.0414 1.0834 1.0420 -0.0200 -0.0096 0.0215  652 ARG A CG  
4144 C CD  . ARG A 552 ? 1.0448 1.0871 1.0454 -0.0205 -0.0100 0.0221  652 ARG A CD  
4145 N NE  . ARG A 552 ? 1.1362 1.1789 1.1383 -0.0207 -0.0105 0.0236  652 ARG A NE  
4146 C CZ  . ARG A 552 ? 1.2581 1.3012 1.2605 -0.0213 -0.0111 0.0245  652 ARG A CZ  
4147 N NH1 . ARG A 552 ? 1.2994 1.3427 1.3008 -0.0219 -0.0112 0.0241  652 ARG A NH1 
4148 N NH2 . ARG A 552 ? 1.2943 1.3378 1.2982 -0.0213 -0.0115 0.0260  652 ARG A NH2 
4149 N N   . TRP A 553 ? 2.2065 2.2445 2.2073 -0.0138 -0.0070 0.0167  653 TRP A N   
4150 C CA  . TRP A 553 ? 2.2001 2.2360 2.2009 -0.0116 -0.0063 0.0150  653 TRP A CA  
4151 C C   . TRP A 553 ? 1.8539 1.8912 1.8601 -0.0117 -0.0041 0.0141  653 TRP A C   
4152 O O   . TRP A 553 ? 1.8685 1.9060 1.8752 -0.0117 -0.0042 0.0147  653 TRP A O   
4153 C CB  . TRP A 553 ? 1.8792 1.9148 1.8807 -0.0108 -0.0060 0.0152  653 TRP A CB  
4154 C CG  . TRP A 553 ? 1.5932 1.6304 1.5945 -0.0122 -0.0062 0.0159  653 TRP A CG  
4155 C CD1 . TRP A 553 ? 1.5072 1.5463 1.5087 -0.0143 -0.0068 0.0176  653 TRP A CD1 
4156 C CD2 . TRP A 553 ? 1.5123 1.5493 1.5128 -0.0122 -0.0058 0.0149  653 TRP A CD2 
4157 N NE1 . TRP A 553 ? 1.5744 1.6146 1.5753 -0.0156 -0.0068 0.0177  653 TRP A NE1 
4158 C CE2 . TRP A 553 ? 1.6238 1.6628 1.6240 -0.0142 -0.0061 0.0159  653 TRP A CE2 
4159 C CE3 . TRP A 553 ? 1.7018 1.7371 1.7018 -0.0107 -0.0053 0.0133  653 TRP A CE3 
4160 C CZ2 . TRP A 553 ? 1.8098 1.8494 1.8092 -0.0147 -0.0058 0.0151  653 TRP A CZ2 
4161 C CZ3 . TRP A 553 ? 1.9002 1.9360 1.8996 -0.0110 -0.0051 0.0126  653 TRP A CZ3 
4162 C CH2 . TRP A 553 ? 1.9611 1.9991 1.9601 -0.0130 -0.0053 0.0135  653 TRP A CH2 
4163 N N   . LYS A 554 ? 1.6921 1.7256 1.6908 -0.0098 -0.0039 0.0146  654 LYS A N   
4164 C CA  . LYS A 554 ? 1.4007 1.4341 1.3997 -0.0090 -0.0036 0.0144  654 LYS A CA  
4165 C C   . LYS A 554 ? 1.1221 1.1548 1.1219 -0.0079 -0.0033 0.0144  654 LYS A C   
4166 O O   . LYS A 554 ? 1.0996 1.1361 1.1068 -0.0086 -0.0030 0.0137  654 LYS A O   
4167 C CB  . LYS A 554 ? 1.7830 1.8166 1.7817 -0.0086 -0.0033 0.0135  654 LYS A CB  
4168 C CG  . LYS A 554 ? 2.1753 2.2094 2.1738 -0.0087 -0.0033 0.0135  654 LYS A CG  
4169 C CD  . LYS A 554 ? 2.5404 2.5783 2.5466 -0.0095 -0.0030 0.0129  654 LYS A CD  
4170 C CE  . LYS A 554 ? 2.8187 2.8662 2.8220 -0.0117 -0.0040 0.0174  654 LYS A CE  
4171 N NZ  . LYS A 554 ? 2.7905 2.8285 2.7964 -0.0086 -0.0026 0.0121  654 LYS A NZ  
4177 N N   . ILE A 556 ? 1.0310 1.0619 1.0309 -0.0059 -0.0021 0.0124  656 ILE A N   
4178 C CA  . ILE A 556 ? 1.0241 1.0585 1.0298 -0.0065 -0.0019 0.0106  656 ILE A CA  
4179 C C   . ILE A 556 ? 1.1357 1.1694 1.1413 -0.0052 -0.0017 0.0101  656 ILE A C   
4180 O O   . ILE A 556 ? 1.1735 1.2032 1.1736 -0.0042 -0.0014 0.0113  656 ILE A O   
4181 C CB  . ILE A 556 ? 0.8842 0.9152 0.8833 -0.0064 -0.0023 0.0116  656 ILE A CB  
4182 C CG1 . ILE A 556 ? 0.8405 0.8748 0.8464 -0.0076 -0.0025 0.0115  656 ILE A CG1 
4183 C CG2 . ILE A 556 ? 0.8574 0.9010 0.8595 -0.0101 -0.0031 0.0141  656 ILE A CG2 
4184 C CD1 . ILE A 556 ? 0.8257 0.8607 0.8317 -0.0086 -0.0028 0.0120  656 ILE A CD1 
4185 N N   . ARG A 557 ? 0.8079 0.8417 0.8132 -0.0050 -0.0015 0.0094  657 ARG A N   
4186 C CA  . ARG A 557 ? 0.7347 0.7678 0.7399 -0.0040 -0.0012 0.0089  657 ARG A CA  
4187 C C   . ARG A 557 ? 0.8833 0.9136 0.8822 -0.0038 -0.0010 0.0090  657 ARG A C   
4188 O O   . ARG A 557 ? 0.8064 0.8490 0.8084 -0.0061 -0.0016 0.0112  657 ARG A O   
4189 C CB  . ARG A 557 ? 2.5495 2.5792 2.5491 -0.0032 -0.0009 0.0098  657 ARG A CB  
4190 C CG  . ARG A 557 ? 2.4642 2.4938 2.4642 -0.0032 -0.0010 0.0106  657 ARG A CG  
4191 C CD  . ARG A 557 ? 2.8914 2.9244 2.8972 -0.0032 -0.0010 0.0096  657 ARG A CD  
4192 N NE  . ARG A 557 ? 2.8422 2.8759 2.8479 -0.0038 -0.0012 0.0096  657 ARG A NE  
4193 C CZ  . ARG A 557 ? 2.7652 2.7991 2.7708 -0.0038 -0.0012 0.0095  657 ARG A CZ  
4194 N NH1 . ARG A 557 ? 2.7506 2.7806 2.7504 -0.0029 -0.0009 0.0104  657 ARG A NH1 
4195 N NH2 . ARG A 557 ? 2.7362 2.7708 2.7417 -0.0044 -0.0013 0.0095  657 ARG A NH2 
4196 N N   . ALA A 558 ? 1.2385 1.2684 1.2374 -0.0032 -0.0008 0.0085  658 ALA A N   
4197 C CA  . ALA A 558 ? 1.4554 1.4969 1.4572 -0.0044 -0.0010 0.0097  658 ALA A CA  
4198 C C   . ALA A 558 ? 1.4173 1.4471 1.4159 -0.0025 -0.0006 0.0074  658 ALA A C   
4199 O O   . ALA A 558 ? 1.4090 1.4489 1.4110 -0.0026 -0.0006 0.0093  658 ALA A O   
4200 C CB  . ALA A 558 ? 1.6319 1.6654 1.6360 -0.0037 -0.0008 0.0068  658 ALA A CB  
4201 N N   . ARG A 559 ? 1.4187 1.4519 1.4228 -0.0027 -0.0006 0.0066  659 ARG A N   
4202 C CA  . ARG A 559 ? 1.5856 1.6183 1.5897 -0.0019 -0.0004 0.0063  659 ARG A CA  
4203 C C   . ARG A 559 ? 1.6729 1.7031 1.6712 -0.0017 -0.0003 0.0063  659 ARG A C   
4204 O O   . ARG A 559 ? 1.6675 1.6985 1.6656 -0.0021 -0.0004 0.0063  659 ARG A O   
4205 C CB  . ARG A 559 ? 1.6829 1.7153 1.6871 -0.0017 -0.0004 0.0066  659 ARG A CB  
4206 C CG  . ARG A 559 ? 1.6695 1.6992 1.6683 -0.0021 -0.0005 0.0078  659 ARG A CG  
4207 C CD  . ARG A 559 ? 1.4219 1.4514 1.4208 -0.0018 -0.0004 0.0080  659 ARG A CD  
4208 N NE  . ARG A 559 ? 1.3694 1.3994 1.3685 -0.0022 -0.0006 0.0084  659 ARG A NE  
4209 C CZ  . ARG A 559 ? 1.3480 1.3786 1.3468 -0.0026 -0.0007 0.0085  659 ARG A CZ  
4210 N NH1 . ARG A 559 ? 1.4114 1.4537 1.4135 -0.0035 -0.0008 0.0101  659 ARG A NH1 
4211 N NH2 . ARG A 559 ? 1.3133 1.3443 1.3122 -0.0031 -0.0008 0.0089  659 ARG A NH2 
4212 N N   . ILE A 560 ? 1.4566 1.4863 1.4549 -0.0012 -0.0002 0.0060  660 ILE A N   
4213 C CA  . ILE A 560 ? 1.6017 1.6315 1.5998 -0.0009 -0.0001 0.0054  660 ILE A CA  
4214 C C   . ILE A 560 ? 1.9067 1.9359 1.9048 -0.0003 -0.0001 0.0055  660 ILE A C   
4215 O O   . ILE A 560 ? 1.9692 1.9978 1.9676 -0.0001 0.0000  0.0058  660 ILE A O   
4216 C CB  . ILE A 560 ? 1.6748 1.7071 1.6783 -0.0006 -0.0001 0.0046  660 ILE A CB  
4217 C CG1 . ILE A 560 ? 1.6589 1.6917 1.6623 -0.0012 -0.0002 0.0045  660 ILE A CG1 
4218 C CG2 . ILE A 560 ? 1.7748 1.8046 1.7727 -0.0003 0.0000  0.0045  660 ILE A CG2 
4219 C CD1 . ILE A 560 ? 1.6316 1.6612 1.6296 -0.0014 -0.0002 0.0055  660 ILE A CD1 
4220 N N   . PHE A 561 ? 2.0072 2.0368 2.0053 -0.0002 0.0000  0.0051  661 PHE A N   
4221 C CA  . PHE A 561 ? 2.1852 2.2171 2.1887 0.0003  0.0000  0.0048  661 PHE A CA  
4222 C C   . PHE A 561 ? 2.4275 2.4568 2.4255 0.0006  0.0001  0.0048  661 PHE A C   
4223 O O   . PHE A