data_4UM3
# 
_entry.id   4UM3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4UM3         
PDBE  EBI-60640    
WWPDB D_1290060640 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4UM1 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'ENGINEERED LS-ACHBP WITH ALPHA4-ALPHA4 BINDING POCKET IN COMPLEX WITH NS3573' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4UM3 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-05-14 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Shahsavar, A.' 1 
'Kastrup, J.S.' 2 
'Balle, T.'     3 
'Gajhede, M.'   4 
# 
_citation.id                        primary 
_citation.title                     
;Achbp Engineered to Mimic the Alpha4-Alpha4 Binding Pocket in Alpha4Beta2 Nicotinic Acetylcholine Receptors Reveals Interface Specific Interactions Important for Binding and Activity
;
_citation.journal_abbrev            Mol.Pharmacol. 
_citation.journal_volume            88 
_citation.page_first                697 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           MOPMA3 
_citation.country                   US 
_citation.journal_id_ISSN           0026-895X 
_citation.journal_id_CSD            0197 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26180047 
_citation.pdbx_database_id_DOI      10.1124/MOL.115.098061 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shahsavar, A.' 1 ? 
primary 'Ahring, P.K.'  2 ? 
primary 'Olsen, J.A.'   3 ? 
primary 'Krintel, C.'   4 ? 
primary 'Kastrup, J.S.' 5 ? 
primary 'Balle, T.'     6 ? 
primary 'Gajhede, M.'   7 ? 
# 
_cell.entry_id           4UM3 
_cell.length_a           135.490 
_cell.length_b           145.418 
_cell.length_c           234.906 
_cell.angle_alpha        90.00 
_cell.angle_beta         101.29 
_cell.angle_gamma        90.00 
_cell.Z_PDB              76 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4UM3 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ACETYLCHOLINE BINDING PROTEIN'          26053.143 38  ? YES ? 
'1-(6-BROMOPYRIDIN-3-YL)-1,4-DIAZEPANE (NS3920) BINDS AT THE INTERFACE OF EACH TWO MONOMERS' 
2 polymer     man 'ACETYLCHOLINE BINDING PROTEIN'          25938.053 1   ? YES ? 
'1-(6-BROMOPYRIDIN-3-YL)-1,4-DIAZEPANE (NS3920) BINDS AT THE INTERFACE OF EACH TWO MONOMERS' 
3 polymer     man 'ACETYLCHOLINE BINDING PROTEIN'          26052.158 1   ? YES ? 
'1-(6-BROMOPYRIDIN-3-YL)-1,4-DIAZEPANE (NS3920) BINDS AT THE INTERFACE OF EACH TWO MONOMERS' 
4 non-polymer syn '1-(6-bromopyridin-3-yl)-1,4-diazepane'  256.142   40  ? ?   ? ? 
5 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   3   ? ?   ? ? 
6 non-polymer syn 'SULFATE ION'                            96.063    1   ? ?   ? ? 
7 water       nat water                                    18.015    836 ? ?   ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'ACH-BINDING PROTEIN, ACHBP, ACETYLCHOLINE BINDING PROTEIN' 
2 'ACH-BINDING PROTEIN, ACHBP, ACETYLCHOLINE BINDING PROTEIN' 
3 'ACH-BINDING PROTEIN, ACHBP, ACETYLCHOLINE BINDING PROTEIN' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDR
TLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLAHVVSDGEVQYTPSIRQRFSCDVSGVDTESGATCRIKIG
SWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
;
;MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDR
TLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLAHVVSDGEVQYTPSIRQRFSCDVSGVDTESGATCRIKIG
SWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
;
A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,Q,R,T,U,V,W,X,Y,Z,a,b,c,d,e,f,g,h,i,j,k,l,m,n ? 
2 'polypeptide(L)' no no 
;MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRT
LAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLAHVVSDGEVQYTPSIRQRFSCDVSGVDTESGATCRIKIGS
WTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
;
;MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDRT
LAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLAHVVSDGEVQYTPSIRQRFSCDVSGVDTESGATCRIKIGS
WTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
;
P                                                                           ? 
3 'polypeptide(L)' no no 
;MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDR
TLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLAHVVSDGEVQYTPSIRQRFSCDVSGVDTQSGATCRIKIG
SWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
;
;MRRNIFCLACLWIVQACLSLDRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVDVVFWQQTTWSDR
TLAWNSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLTPQLAHVVSDGEVQYTPSIRQRFSCDVSGVDTQSGATCRIKIG
SWTHHSREISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSLNFRKKGRSEIL
;
S                                                                           ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   ARG n 
1 4   ASN n 
1 5   ILE n 
1 6   PHE n 
1 7   CYS n 
1 8   LEU n 
1 9   ALA n 
1 10  CYS n 
1 11  LEU n 
1 12  TRP n 
1 13  ILE n 
1 14  VAL n 
1 15  GLN n 
1 16  ALA n 
1 17  CYS n 
1 18  LEU n 
1 19  SER n 
1 20  LEU n 
1 21  ASP n 
1 22  ARG n 
1 23  ALA n 
1 24  ASP n 
1 25  ILE n 
1 26  LEU n 
1 27  TYR n 
1 28  ASN n 
1 29  ILE n 
1 30  ARG n 
1 31  GLN n 
1 32  THR n 
1 33  SER n 
1 34  ARG n 
1 35  PRO n 
1 36  ASP n 
1 37  VAL n 
1 38  ILE n 
1 39  PRO n 
1 40  THR n 
1 41  GLN n 
1 42  ARG n 
1 43  ASP n 
1 44  ARG n 
1 45  PRO n 
1 46  VAL n 
1 47  ALA n 
1 48  VAL n 
1 49  SER n 
1 50  VAL n 
1 51  SER n 
1 52  LEU n 
1 53  LYS n 
1 54  PHE n 
1 55  ILE n 
1 56  ASN n 
1 57  ILE n 
1 58  LEU n 
1 59  GLU n 
1 60  VAL n 
1 61  ASN n 
1 62  GLU n 
1 63  ILE n 
1 64  THR n 
1 65  ASN n 
1 66  GLU n 
1 67  VAL n 
1 68  ASP n 
1 69  VAL n 
1 70  VAL n 
1 71  PHE n 
1 72  TRP n 
1 73  GLN n 
1 74  GLN n 
1 75  THR n 
1 76  THR n 
1 77  TRP n 
1 78  SER n 
1 79  ASP n 
1 80  ARG n 
1 81  THR n 
1 82  LEU n 
1 83  ALA n 
1 84  TRP n 
1 85  ASN n 
1 86  SER n 
1 87  SER n 
1 88  HIS n 
1 89  SER n 
1 90  PRO n 
1 91  ASP n 
1 92  GLN n 
1 93  VAL n 
1 94  SER n 
1 95  VAL n 
1 96  PRO n 
1 97  ILE n 
1 98  SER n 
1 99  SER n 
1 100 LEU n 
1 101 TRP n 
1 102 VAL n 
1 103 PRO n 
1 104 ASP n 
1 105 LEU n 
1 106 ALA n 
1 107 ALA n 
1 108 TYR n 
1 109 ASN n 
1 110 ALA n 
1 111 ILE n 
1 112 SER n 
1 113 LYS n 
1 114 PRO n 
1 115 GLU n 
1 116 VAL n 
1 117 LEU n 
1 118 THR n 
1 119 PRO n 
1 120 GLN n 
1 121 LEU n 
1 122 ALA n 
1 123 HIS n 
1 124 VAL n 
1 125 VAL n 
1 126 SER n 
1 127 ASP n 
1 128 GLY n 
1 129 GLU n 
1 130 VAL n 
1 131 GLN n 
1 132 TYR n 
1 133 THR n 
1 134 PRO n 
1 135 SER n 
1 136 ILE n 
1 137 ARG n 
1 138 GLN n 
1 139 ARG n 
1 140 PHE n 
1 141 SER n 
1 142 CYS n 
1 143 ASP n 
1 144 VAL n 
1 145 SER n 
1 146 GLY n 
1 147 VAL n 
1 148 ASP n 
1 149 THR n 
1 150 GLU n 
1 151 SER n 
1 152 GLY n 
1 153 ALA n 
1 154 THR n 
1 155 CYS n 
1 156 ARG n 
1 157 ILE n 
1 158 LYS n 
1 159 ILE n 
1 160 GLY n 
1 161 SER n 
1 162 TRP n 
1 163 THR n 
1 164 HIS n 
1 165 HIS n 
1 166 SER n 
1 167 ARG n 
1 168 GLU n 
1 169 ILE n 
1 170 SER n 
1 171 VAL n 
1 172 ASP n 
1 173 PRO n 
1 174 THR n 
1 175 THR n 
1 176 GLU n 
1 177 ASN n 
1 178 SER n 
1 179 ASP n 
1 180 ASP n 
1 181 SER n 
1 182 GLU n 
1 183 TYR n 
1 184 PHE n 
1 185 SER n 
1 186 GLN n 
1 187 TYR n 
1 188 SER n 
1 189 ARG n 
1 190 PHE n 
1 191 GLU n 
1 192 ILE n 
1 193 LEU n 
1 194 ASP n 
1 195 VAL n 
1 196 THR n 
1 197 GLN n 
1 198 LYS n 
1 199 LYS n 
1 200 ASN n 
1 201 SER n 
1 202 VAL n 
1 203 THR n 
1 204 TYR n 
1 205 SER n 
1 206 CYS n 
1 207 CYS n 
1 208 PRO n 
1 209 GLU n 
1 210 ALA n 
1 211 TYR n 
1 212 GLU n 
1 213 ASP n 
1 214 VAL n 
1 215 GLU n 
1 216 VAL n 
1 217 SER n 
1 218 LEU n 
1 219 ASN n 
1 220 PHE n 
1 221 ARG n 
1 222 LYS n 
1 223 LYS n 
1 224 GLY n 
1 225 ARG n 
1 226 SER n 
1 227 GLU n 
1 228 ILE n 
1 229 LEU n 
2 1   MET n 
2 2   ARG n 
2 3   ARG n 
2 4   ASN n 
2 5   ILE n 
2 6   PHE n 
2 7   CYS n 
2 8   LEU n 
2 9   ALA n 
2 10  CYS n 
2 11  LEU n 
2 12  TRP n 
2 13  ILE n 
2 14  VAL n 
2 15  GLN n 
2 16  ALA n 
2 17  CYS n 
2 18  LEU n 
2 19  SER n 
2 20  LEU n 
2 21  ASP n 
2 22  ARG n 
2 23  ALA n 
2 24  ASP n 
2 25  ILE n 
2 26  LEU n 
2 27  TYR n 
2 28  ASN n 
2 29  ILE n 
2 30  ARG n 
2 31  GLN n 
2 32  THR n 
2 33  SER n 
2 34  ARG n 
2 35  PRO n 
2 36  ASP n 
2 37  VAL n 
2 38  ILE n 
2 39  PRO n 
2 40  THR n 
2 41  GLN n 
2 42  ARG n 
2 43  ARG n 
2 44  PRO n 
2 45  VAL n 
2 46  ALA n 
2 47  VAL n 
2 48  SER n 
2 49  VAL n 
2 50  SER n 
2 51  LEU n 
2 52  LYS n 
2 53  PHE n 
2 54  ILE n 
2 55  ASN n 
2 56  ILE n 
2 57  LEU n 
2 58  GLU n 
2 59  VAL n 
2 60  ASN n 
2 61  GLU n 
2 62  ILE n 
2 63  THR n 
2 64  ASN n 
2 65  GLU n 
2 66  VAL n 
2 67  ASP n 
2 68  VAL n 
2 69  VAL n 
2 70  PHE n 
2 71  TRP n 
2 72  GLN n 
2 73  GLN n 
2 74  THR n 
2 75  THR n 
2 76  TRP n 
2 77  SER n 
2 78  ASP n 
2 79  ARG n 
2 80  THR n 
2 81  LEU n 
2 82  ALA n 
2 83  TRP n 
2 84  ASN n 
2 85  SER n 
2 86  SER n 
2 87  HIS n 
2 88  SER n 
2 89  PRO n 
2 90  ASP n 
2 91  GLN n 
2 92  VAL n 
2 93  SER n 
2 94  VAL n 
2 95  PRO n 
2 96  ILE n 
2 97  SER n 
2 98  SER n 
2 99  LEU n 
2 100 TRP n 
2 101 VAL n 
2 102 PRO n 
2 103 ASP n 
2 104 LEU n 
2 105 ALA n 
2 106 ALA n 
2 107 TYR n 
2 108 ASN n 
2 109 ALA n 
2 110 ILE n 
2 111 SER n 
2 112 LYS n 
2 113 PRO n 
2 114 GLU n 
2 115 VAL n 
2 116 LEU n 
2 117 THR n 
2 118 PRO n 
2 119 GLN n 
2 120 LEU n 
2 121 ALA n 
2 122 HIS n 
2 123 VAL n 
2 124 VAL n 
2 125 SER n 
2 126 ASP n 
2 127 GLY n 
2 128 GLU n 
2 129 VAL n 
2 130 GLN n 
2 131 TYR n 
2 132 THR n 
2 133 PRO n 
2 134 SER n 
2 135 ILE n 
2 136 ARG n 
2 137 GLN n 
2 138 ARG n 
2 139 PHE n 
2 140 SER n 
2 141 CYS n 
2 142 ASP n 
2 143 VAL n 
2 144 SER n 
2 145 GLY n 
2 146 VAL n 
2 147 ASP n 
2 148 THR n 
2 149 GLU n 
2 150 SER n 
2 151 GLY n 
2 152 ALA n 
2 153 THR n 
2 154 CYS n 
2 155 ARG n 
2 156 ILE n 
2 157 LYS n 
2 158 ILE n 
2 159 GLY n 
2 160 SER n 
2 161 TRP n 
2 162 THR n 
2 163 HIS n 
2 164 HIS n 
2 165 SER n 
2 166 ARG n 
2 167 GLU n 
2 168 ILE n 
2 169 SER n 
2 170 VAL n 
2 171 ASP n 
2 172 PRO n 
2 173 THR n 
2 174 THR n 
2 175 GLU n 
2 176 ASN n 
2 177 SER n 
2 178 ASP n 
2 179 ASP n 
2 180 SER n 
2 181 GLU n 
2 182 TYR n 
2 183 PHE n 
2 184 SER n 
2 185 GLN n 
2 186 TYR n 
2 187 SER n 
2 188 ARG n 
2 189 PHE n 
2 190 GLU n 
2 191 ILE n 
2 192 LEU n 
2 193 ASP n 
2 194 VAL n 
2 195 THR n 
2 196 GLN n 
2 197 LYS n 
2 198 LYS n 
2 199 ASN n 
2 200 SER n 
2 201 VAL n 
2 202 THR n 
2 203 TYR n 
2 204 SER n 
2 205 CYS n 
2 206 CYS n 
2 207 PRO n 
2 208 GLU n 
2 209 ALA n 
2 210 TYR n 
2 211 GLU n 
2 212 ASP n 
2 213 VAL n 
2 214 GLU n 
2 215 VAL n 
2 216 SER n 
2 217 LEU n 
2 218 ASN n 
2 219 PHE n 
2 220 ARG n 
2 221 LYS n 
2 222 LYS n 
2 223 GLY n 
2 224 ARG n 
2 225 SER n 
2 226 GLU n 
2 227 ILE n 
2 228 LEU n 
3 1   MET n 
3 2   ARG n 
3 3   ARG n 
3 4   ASN n 
3 5   ILE n 
3 6   PHE n 
3 7   CYS n 
3 8   LEU n 
3 9   ALA n 
3 10  CYS n 
3 11  LEU n 
3 12  TRP n 
3 13  ILE n 
3 14  VAL n 
3 15  GLN n 
3 16  ALA n 
3 17  CYS n 
3 18  LEU n 
3 19  SER n 
3 20  LEU n 
3 21  ASP n 
3 22  ARG n 
3 23  ALA n 
3 24  ASP n 
3 25  ILE n 
3 26  LEU n 
3 27  TYR n 
3 28  ASN n 
3 29  ILE n 
3 30  ARG n 
3 31  GLN n 
3 32  THR n 
3 33  SER n 
3 34  ARG n 
3 35  PRO n 
3 36  ASP n 
3 37  VAL n 
3 38  ILE n 
3 39  PRO n 
3 40  THR n 
3 41  GLN n 
3 42  ARG n 
3 43  ASP n 
3 44  ARG n 
3 45  PRO n 
3 46  VAL n 
3 47  ALA n 
3 48  VAL n 
3 49  SER n 
3 50  VAL n 
3 51  SER n 
3 52  LEU n 
3 53  LYS n 
3 54  PHE n 
3 55  ILE n 
3 56  ASN n 
3 57  ILE n 
3 58  LEU n 
3 59  GLU n 
3 60  VAL n 
3 61  ASN n 
3 62  GLU n 
3 63  ILE n 
3 64  THR n 
3 65  ASN n 
3 66  GLU n 
3 67  VAL n 
3 68  ASP n 
3 69  VAL n 
3 70  VAL n 
3 71  PHE n 
3 72  TRP n 
3 73  GLN n 
3 74  GLN n 
3 75  THR n 
3 76  THR n 
3 77  TRP n 
3 78  SER n 
3 79  ASP n 
3 80  ARG n 
3 81  THR n 
3 82  LEU n 
3 83  ALA n 
3 84  TRP n 
3 85  ASN n 
3 86  SER n 
3 87  SER n 
3 88  HIS n 
3 89  SER n 
3 90  PRO n 
3 91  ASP n 
3 92  GLN n 
3 93  VAL n 
3 94  SER n 
3 95  VAL n 
3 96  PRO n 
3 97  ILE n 
3 98  SER n 
3 99  SER n 
3 100 LEU n 
3 101 TRP n 
3 102 VAL n 
3 103 PRO n 
3 104 ASP n 
3 105 LEU n 
3 106 ALA n 
3 107 ALA n 
3 108 TYR n 
3 109 ASN n 
3 110 ALA n 
3 111 ILE n 
3 112 SER n 
3 113 LYS n 
3 114 PRO n 
3 115 GLU n 
3 116 VAL n 
3 117 LEU n 
3 118 THR n 
3 119 PRO n 
3 120 GLN n 
3 121 LEU n 
3 122 ALA n 
3 123 HIS n 
3 124 VAL n 
3 125 VAL n 
3 126 SER n 
3 127 ASP n 
3 128 GLY n 
3 129 GLU n 
3 130 VAL n 
3 131 GLN n 
3 132 TYR n 
3 133 THR n 
3 134 PRO n 
3 135 SER n 
3 136 ILE n 
3 137 ARG n 
3 138 GLN n 
3 139 ARG n 
3 140 PHE n 
3 141 SER n 
3 142 CYS n 
3 143 ASP n 
3 144 VAL n 
3 145 SER n 
3 146 GLY n 
3 147 VAL n 
3 148 ASP n 
3 149 THR n 
3 150 GLN n 
3 151 SER n 
3 152 GLY n 
3 153 ALA n 
3 154 THR n 
3 155 CYS n 
3 156 ARG n 
3 157 ILE n 
3 158 LYS n 
3 159 ILE n 
3 160 GLY n 
3 161 SER n 
3 162 TRP n 
3 163 THR n 
3 164 HIS n 
3 165 HIS n 
3 166 SER n 
3 167 ARG n 
3 168 GLU n 
3 169 ILE n 
3 170 SER n 
3 171 VAL n 
3 172 ASP n 
3 173 PRO n 
3 174 THR n 
3 175 THR n 
3 176 GLU n 
3 177 ASN n 
3 178 SER n 
3 179 ASP n 
3 180 ASP n 
3 181 SER n 
3 182 GLU n 
3 183 TYR n 
3 184 PHE n 
3 185 SER n 
3 186 GLN n 
3 187 TYR n 
3 188 SER n 
3 189 ARG n 
3 190 PHE n 
3 191 GLU n 
3 192 ILE n 
3 193 LEU n 
3 194 ASP n 
3 195 VAL n 
3 196 THR n 
3 197 GLN n 
3 198 LYS n 
3 199 LYS n 
3 200 ASN n 
3 201 SER n 
3 202 VAL n 
3 203 THR n 
3 204 TYR n 
3 205 SER n 
3 206 CYS n 
3 207 CYS n 
3 208 PRO n 
3 209 GLU n 
3 210 ALA n 
3 211 TYR n 
3 212 GLU n 
3 213 ASP n 
3 214 VAL n 
3 215 GLU n 
3 216 VAL n 
3 217 SER n 
3 218 LEU n 
3 219 ASN n 
3 220 PHE n 
3 221 ARG n 
3 222 LYS n 
3 223 LYS n 
3 224 GLY n 
3 225 ARG n 
3 226 SER n 
3 227 GLU n 
3 228 ILE n 
3 229 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? 'GREAT POND SNAIL' ? ? ? ? ? ? ? ? 'LYMNAEA STAGNALIS' 6523 ? ? ? ? ? ? ? 'FALL ARMYWORM' 'SPODOPTERA FRUGIPERDA' 
7108 ? ? ? ? ? ? ? ? SF9 ? ? ? ? ? BACULOVIRUS ? ? ? PFASTBAC ? ? 
2 1 sample ? ? ? 'GREAT POND SNAIL' ? ? ? ? ? ? ? ? 'LYMNAEA STAGNALIS' 6523 ? ? ? ? ? ? ? 'FALL ARMYWORM' 'SPODOPTERA FRUGIPERDA' 
7108 ? ? ? ? ? ? ? ? SF9 ? ? ? ? ? BACULOVIRUS ? ? ? PFASTBAC ? ? 
3 1 sample ? ? ? 'GREAT POND SNAIL' ? ? ? ? ? ? ? ? 'LYMNAEA STAGNALIS' 6523 ? ? ? ? ? ? ? 'FALL ARMYWORM' 'SPODOPTERA FRUGIPERDA' 
7108 ? ? ? ? ? ? ? ? SF9 ? ? ? ? ? BACULOVIRUS ? ? ? PFASTBAC ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP ACHP_LYMST 1 ? ? P58154 ? 
2 UNP ACHP_LYMST 2 ? ? P58154 ? 
3 UNP ACHP_LYMST 3 ? ? P58154 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4UM3 A 1 ? 229 ? P58154 1 ? 229 ? -18 210 
2  1 4UM3 B 1 ? 229 ? P58154 1 ? 229 ? -18 210 
3  1 4UM3 C 1 ? 229 ? P58154 1 ? 229 ? -18 210 
4  1 4UM3 D 1 ? 229 ? P58154 1 ? 229 ? -18 210 
5  1 4UM3 E 1 ? 229 ? P58154 1 ? 229 ? -18 210 
6  1 4UM3 F 1 ? 229 ? P58154 1 ? 229 ? -18 210 
7  1 4UM3 G 1 ? 229 ? P58154 1 ? 229 ? -18 210 
8  1 4UM3 H 1 ? 229 ? P58154 1 ? 229 ? -18 210 
9  1 4UM3 I 1 ? 229 ? P58154 1 ? 229 ? -18 210 
10 1 4UM3 J 1 ? 229 ? P58154 1 ? 229 ? -18 210 
11 1 4UM3 K 1 ? 229 ? P58154 1 ? 229 ? -18 210 
12 1 4UM3 L 1 ? 229 ? P58154 1 ? 229 ? -18 210 
13 1 4UM3 M 1 ? 229 ? P58154 1 ? 229 ? -18 210 
14 1 4UM3 N 1 ? 229 ? P58154 1 ? 229 ? -18 210 
15 1 4UM3 O 1 ? 229 ? P58154 1 ? 229 ? -18 210 
16 2 4UM3 P 1 ? 228 ? P58154 1 ? 229 ? -18 210 
17 1 4UM3 Q 1 ? 229 ? P58154 1 ? 229 ? -18 210 
18 1 4UM3 R 1 ? 229 ? P58154 1 ? 229 ? -18 210 
19 3 4UM3 S 1 ? 229 ? P58154 1 ? 229 ? -18 210 
20 1 4UM3 T 1 ? 229 ? P58154 1 ? 229 ? -18 210 
21 1 4UM3 U 1 ? 229 ? P58154 1 ? 229 ? -18 210 
22 1 4UM3 V 1 ? 229 ? P58154 1 ? 229 ? -18 210 
23 1 4UM3 W 1 ? 229 ? P58154 1 ? 229 ? -18 210 
24 1 4UM3 X 1 ? 229 ? P58154 1 ? 229 ? -18 210 
25 1 4UM3 Y 1 ? 229 ? P58154 1 ? 229 ? -18 210 
26 1 4UM3 Z 1 ? 229 ? P58154 1 ? 229 ? -18 210 
27 1 4UM3 a 1 ? 229 ? P58154 1 ? 229 ? -18 210 
28 1 4UM3 b 1 ? 229 ? P58154 1 ? 229 ? -18 210 
29 1 4UM3 c 1 ? 229 ? P58154 1 ? 229 ? -18 210 
30 1 4UM3 d 1 ? 229 ? P58154 1 ? 229 ? -18 210 
31 1 4UM3 e 1 ? 229 ? P58154 1 ? 229 ? -18 210 
32 1 4UM3 f 1 ? 229 ? P58154 1 ? 229 ? -18 210 
33 1 4UM3 g 1 ? 229 ? P58154 1 ? 229 ? -18 210 
34 1 4UM3 h 1 ? 229 ? P58154 1 ? 229 ? -18 210 
35 1 4UM3 i 1 ? 229 ? P58154 1 ? 229 ? -18 210 
36 1 4UM3 j 1 ? 229 ? P58154 1 ? 229 ? -18 210 
37 1 4UM3 k 1 ? 229 ? P58154 1 ? 229 ? -18 210 
38 1 4UM3 l 1 ? 229 ? P58154 1 ? 229 ? -18 210 
39 1 4UM3 m 1 ? 229 ? P58154 1 ? 229 ? -18 210 
40 1 4UM3 n 1 ? 229 ? P58154 1 ? 229 ? -18 210 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  4UM3 HIS A 123 ? UNP P58154 ARG 123 'engineered mutation' 104 1   
1  4UM3 GLN A 131 ? UNP P58154 LEU 131 'engineered mutation' 112 2   
1  4UM3 THR A 133 ? UNP P58154 MET 133 'engineered mutation' 114 3   
2  4UM3 HIS B 123 ? UNP P58154 ARG 123 'engineered mutation' 104 4   
2  4UM3 GLN B 131 ? UNP P58154 LEU 131 'engineered mutation' 112 5   
2  4UM3 THR B 133 ? UNP P58154 MET 133 'engineered mutation' 114 6   
3  4UM3 HIS C 123 ? UNP P58154 ARG 123 'engineered mutation' 104 7   
3  4UM3 GLN C 131 ? UNP P58154 LEU 131 'engineered mutation' 112 8   
3  4UM3 THR C 133 ? UNP P58154 MET 133 'engineered mutation' 114 9   
4  4UM3 HIS D 123 ? UNP P58154 ARG 123 'engineered mutation' 104 10  
4  4UM3 GLN D 131 ? UNP P58154 LEU 131 'engineered mutation' 112 11  
4  4UM3 THR D 133 ? UNP P58154 MET 133 'engineered mutation' 114 12  
5  4UM3 HIS E 123 ? UNP P58154 ARG 123 'engineered mutation' 104 13  
5  4UM3 GLN E 131 ? UNP P58154 LEU 131 'engineered mutation' 112 14  
5  4UM3 THR E 133 ? UNP P58154 MET 133 'engineered mutation' 114 15  
6  4UM3 HIS F 123 ? UNP P58154 ARG 123 'engineered mutation' 104 16  
6  4UM3 GLN F 131 ? UNP P58154 LEU 131 'engineered mutation' 112 17  
6  4UM3 THR F 133 ? UNP P58154 MET 133 'engineered mutation' 114 18  
7  4UM3 HIS G 123 ? UNP P58154 ARG 123 'engineered mutation' 104 19  
7  4UM3 GLN G 131 ? UNP P58154 LEU 131 'engineered mutation' 112 20  
7  4UM3 THR G 133 ? UNP P58154 MET 133 'engineered mutation' 114 21  
8  4UM3 HIS H 123 ? UNP P58154 ARG 123 'engineered mutation' 104 22  
8  4UM3 GLN H 131 ? UNP P58154 LEU 131 'engineered mutation' 112 23  
8  4UM3 THR H 133 ? UNP P58154 MET 133 'engineered mutation' 114 24  
9  4UM3 HIS I 123 ? UNP P58154 ARG 123 'engineered mutation' 104 25  
9  4UM3 GLN I 131 ? UNP P58154 LEU 131 'engineered mutation' 112 26  
9  4UM3 THR I 133 ? UNP P58154 MET 133 'engineered mutation' 114 27  
10 4UM3 HIS J 123 ? UNP P58154 ARG 123 'engineered mutation' 104 28  
10 4UM3 GLN J 131 ? UNP P58154 LEU 131 'engineered mutation' 112 29  
10 4UM3 THR J 133 ? UNP P58154 MET 133 'engineered mutation' 114 30  
11 4UM3 HIS K 123 ? UNP P58154 ARG 123 'engineered mutation' 104 31  
11 4UM3 GLN K 131 ? UNP P58154 LEU 131 'engineered mutation' 112 32  
11 4UM3 THR K 133 ? UNP P58154 MET 133 'engineered mutation' 114 33  
12 4UM3 HIS L 123 ? UNP P58154 ARG 123 'engineered mutation' 104 34  
12 4UM3 GLN L 131 ? UNP P58154 LEU 131 'engineered mutation' 112 35  
12 4UM3 THR L 133 ? UNP P58154 MET 133 'engineered mutation' 114 36  
13 4UM3 HIS M 123 ? UNP P58154 ARG 123 'engineered mutation' 104 37  
13 4UM3 GLN M 131 ? UNP P58154 LEU 131 'engineered mutation' 112 38  
13 4UM3 THR M 133 ? UNP P58154 MET 133 'engineered mutation' 114 39  
14 4UM3 HIS N 123 ? UNP P58154 ARG 123 'engineered mutation' 104 40  
14 4UM3 GLN N 131 ? UNP P58154 LEU 131 'engineered mutation' 112 41  
14 4UM3 THR N 133 ? UNP P58154 MET 133 'engineered mutation' 114 42  
15 4UM3 HIS O 123 ? UNP P58154 ARG 123 'engineered mutation' 104 43  
15 4UM3 GLN O 131 ? UNP P58154 LEU 131 'engineered mutation' 112 44  
15 4UM3 THR O 133 ? UNP P58154 MET 133 'engineered mutation' 114 45  
16 4UM3 HIS P 122 ? UNP P58154 ARG 123 'engineered mutation' 104 46  
16 4UM3 GLN P 130 ? UNP P58154 LEU 131 'engineered mutation' 112 47  
16 4UM3 THR P 132 ? UNP P58154 MET 133 'engineered mutation' 114 48  
16 4UM3 ?   P ?   ? UNP P58154 ASP 43  deletion              ?   49  
17 4UM3 HIS Q 123 ? UNP P58154 ARG 123 'engineered mutation' 104 50  
17 4UM3 GLN Q 131 ? UNP P58154 LEU 131 'engineered mutation' 112 51  
17 4UM3 THR Q 133 ? UNP P58154 MET 133 'engineered mutation' 114 52  
18 4UM3 HIS R 123 ? UNP P58154 ARG 123 'engineered mutation' 104 53  
18 4UM3 GLN R 131 ? UNP P58154 LEU 131 'engineered mutation' 112 54  
18 4UM3 THR R 133 ? UNP P58154 MET 133 'engineered mutation' 114 55  
19 4UM3 HIS S 123 ? UNP P58154 ARG 123 'engineered mutation' 104 56  
19 4UM3 GLN S 131 ? UNP P58154 LEU 131 'engineered mutation' 112 57  
19 4UM3 THR S 133 ? UNP P58154 MET 133 'engineered mutation' 114 58  
19 4UM3 GLN S 150 ? UNP P58154 GLU 150 conflict              131 59  
20 4UM3 HIS T 123 ? UNP P58154 ARG 123 'engineered mutation' 104 60  
20 4UM3 GLN T 131 ? UNP P58154 LEU 131 'engineered mutation' 112 61  
20 4UM3 THR T 133 ? UNP P58154 MET 133 'engineered mutation' 114 62  
21 4UM3 HIS U 123 ? UNP P58154 ARG 123 'engineered mutation' 104 63  
21 4UM3 GLN U 131 ? UNP P58154 LEU 131 'engineered mutation' 112 64  
21 4UM3 THR U 133 ? UNP P58154 MET 133 'engineered mutation' 114 65  
22 4UM3 HIS V 123 ? UNP P58154 ARG 123 'engineered mutation' 104 66  
22 4UM3 GLN V 131 ? UNP P58154 LEU 131 'engineered mutation' 112 67  
22 4UM3 THR V 133 ? UNP P58154 MET 133 'engineered mutation' 114 68  
23 4UM3 HIS W 123 ? UNP P58154 ARG 123 'engineered mutation' 104 69  
23 4UM3 GLN W 131 ? UNP P58154 LEU 131 'engineered mutation' 112 70  
23 4UM3 THR W 133 ? UNP P58154 MET 133 'engineered mutation' 114 71  
24 4UM3 HIS X 123 ? UNP P58154 ARG 123 'engineered mutation' 104 72  
24 4UM3 GLN X 131 ? UNP P58154 LEU 131 'engineered mutation' 112 73  
24 4UM3 THR X 133 ? UNP P58154 MET 133 'engineered mutation' 114 74  
25 4UM3 HIS Y 123 ? UNP P58154 ARG 123 'engineered mutation' 104 75  
25 4UM3 GLN Y 131 ? UNP P58154 LEU 131 'engineered mutation' 112 76  
25 4UM3 THR Y 133 ? UNP P58154 MET 133 'engineered mutation' 114 77  
26 4UM3 HIS Z 123 ? UNP P58154 ARG 123 'engineered mutation' 104 78  
26 4UM3 GLN Z 131 ? UNP P58154 LEU 131 'engineered mutation' 112 79  
26 4UM3 THR Z 133 ? UNP P58154 MET 133 'engineered mutation' 114 80  
27 4UM3 HIS a 123 ? UNP P58154 ARG 123 'engineered mutation' 104 81  
27 4UM3 GLN a 131 ? UNP P58154 LEU 131 'engineered mutation' 112 82  
27 4UM3 THR a 133 ? UNP P58154 MET 133 'engineered mutation' 114 83  
28 4UM3 HIS b 123 ? UNP P58154 ARG 123 'engineered mutation' 104 84  
28 4UM3 GLN b 131 ? UNP P58154 LEU 131 'engineered mutation' 112 85  
28 4UM3 THR b 133 ? UNP P58154 MET 133 'engineered mutation' 114 86  
29 4UM3 HIS c 123 ? UNP P58154 ARG 123 'engineered mutation' 104 87  
29 4UM3 GLN c 131 ? UNP P58154 LEU 131 'engineered mutation' 112 88  
29 4UM3 THR c 133 ? UNP P58154 MET 133 'engineered mutation' 114 89  
30 4UM3 HIS d 123 ? UNP P58154 ARG 123 'engineered mutation' 104 90  
30 4UM3 GLN d 131 ? UNP P58154 LEU 131 'engineered mutation' 112 91  
30 4UM3 THR d 133 ? UNP P58154 MET 133 'engineered mutation' 114 92  
31 4UM3 HIS e 123 ? UNP P58154 ARG 123 'engineered mutation' 104 93  
31 4UM3 GLN e 131 ? UNP P58154 LEU 131 'engineered mutation' 112 94  
31 4UM3 THR e 133 ? UNP P58154 MET 133 'engineered mutation' 114 95  
32 4UM3 HIS f 123 ? UNP P58154 ARG 123 'engineered mutation' 104 96  
32 4UM3 GLN f 131 ? UNP P58154 LEU 131 'engineered mutation' 112 97  
32 4UM3 THR f 133 ? UNP P58154 MET 133 'engineered mutation' 114 98  
33 4UM3 HIS g 123 ? UNP P58154 ARG 123 'engineered mutation' 104 99  
33 4UM3 GLN g 131 ? UNP P58154 LEU 131 'engineered mutation' 112 100 
33 4UM3 THR g 133 ? UNP P58154 MET 133 'engineered mutation' 114 101 
34 4UM3 HIS h 123 ? UNP P58154 ARG 123 'engineered mutation' 104 102 
34 4UM3 GLN h 131 ? UNP P58154 LEU 131 'engineered mutation' 112 103 
34 4UM3 THR h 133 ? UNP P58154 MET 133 'engineered mutation' 114 104 
35 4UM3 HIS i 123 ? UNP P58154 ARG 123 'engineered mutation' 104 105 
35 4UM3 GLN i 131 ? UNP P58154 LEU 131 'engineered mutation' 112 106 
35 4UM3 THR i 133 ? UNP P58154 MET 133 'engineered mutation' 114 107 
36 4UM3 HIS j 123 ? UNP P58154 ARG 123 'engineered mutation' 104 108 
36 4UM3 GLN j 131 ? UNP P58154 LEU 131 'engineered mutation' 112 109 
36 4UM3 THR j 133 ? UNP P58154 MET 133 'engineered mutation' 114 110 
37 4UM3 HIS k 123 ? UNP P58154 ARG 123 'engineered mutation' 104 111 
37 4UM3 GLN k 131 ? UNP P58154 LEU 131 'engineered mutation' 112 112 
37 4UM3 THR k 133 ? UNP P58154 MET 133 'engineered mutation' 114 113 
38 4UM3 HIS l 123 ? UNP P58154 ARG 123 'engineered mutation' 104 114 
38 4UM3 GLN l 131 ? UNP P58154 LEU 131 'engineered mutation' 112 115 
38 4UM3 THR l 133 ? UNP P58154 MET 133 'engineered mutation' 114 116 
39 4UM3 HIS m 123 ? UNP P58154 ARG 123 'engineered mutation' 104 117 
39 4UM3 GLN m 131 ? UNP P58154 LEU 131 'engineered mutation' 112 118 
39 4UM3 THR m 133 ? UNP P58154 MET 133 'engineered mutation' 114 119 
40 4UM3 HIS n 123 ? UNP P58154 ARG 123 'engineered mutation' 104 120 
40 4UM3 GLN n 131 ? UNP P58154 LEU 131 'engineered mutation' 112 121 
40 4UM3 THR n 133 ? UNP P58154 MET 133 'engineered mutation' 114 122 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
09R non-polymer                  . '1-(6-bromopyridin-3-yl)-1,4-diazepane'  ? 'C10 H14 Br N3'  256.142 
ALA 'L-peptide linking'          y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking'          y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'          y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'          y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'          y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'          y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'          y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'            y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'          y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                  . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'          y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'          y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'          y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'          y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking' . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'          y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'          y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'          y SERINE                                   ? 'C3 H7 N O3'     105.093 
SO4 non-polymer                  . 'SULFATE ION'                            ? 'O4 S -2'        96.063  
THR 'L-peptide linking'          y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'          y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'          y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'          y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4UM3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.52 
_exptl_crystal.density_percent_sol   51.25 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1 M TRIS BASE (PH 8.0), 1-3% V/V POLYETHYLENE GLYCOL (PEG) 400 AND 1.8-2.3 M (NH4)2SO4' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'SI(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'MAX II BEAMLINE I911-3' 
_diffrn_source.pdbx_synchrotron_site       'MAX II' 
_diffrn_source.pdbx_synchrotron_beamline   I911-3 
_diffrn_source.pdbx_wavelength             1 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4UM3 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.07 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   242584 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.3 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.60 
_reflns.B_iso_Wilson_estimate        44.79 
_reflns.pdbx_redundancy              3.8 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   96.4 
_reflns_shell.Rmerge_I_obs           0.48 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.90 
_reflns_shell.pdbx_redundancy        3.7 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4UM3 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     242584 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.071 
_refine.ls_d_res_high                            2.703 
_refine.ls_percent_reflns_obs                    99.46 
_refine.ls_R_factor_obs                          0.1990 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1981 
_refine.ls_R_factor_R_free                       0.2440 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 2.0 
_refine.ls_number_reflns_R_free                  4882 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               46 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  'NUMBER OF TLS GROUPS IS 304' 
_refine.pdbx_starting_model                      'PDB ENTRY 3U8M' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.37 
_refine.pdbx_overall_phase_error                 24.82 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        63211 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         607 
_refine_hist.number_atoms_solvent             836 
_refine_hist.number_atoms_total               64654 
_refine_hist.d_res_high                       2.703 
_refine_hist.d_res_low                        30.071 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 65741 'X-RAY DIFFRACTION' ? 
f_angle_d          1.104  ? ? 89566 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 13.976 ? ? 23664 'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.065  ? ? 10191 'X-RAY DIFFRACTION' ? 
f_plane_restr      0.005  ? ? 11475 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1  A 1426 ?     ? POSITIONAL 1 1  'X-RAY DIFFRACTION' ? ? ? 
2  B 1426 0.070 ? POSITIONAL 1 2  'X-RAY DIFFRACTION' ? ? ? 
3  C 1434 0.070 ? POSITIONAL 1 3  'X-RAY DIFFRACTION' ? ? ? 
4  D 1420 0.071 ? POSITIONAL 1 4  'X-RAY DIFFRACTION' ? ? ? 
5  E 1448 0.064 ? POSITIONAL 1 5  'X-RAY DIFFRACTION' ? ? ? 
6  F 1434 0.059 ? POSITIONAL 1 6  'X-RAY DIFFRACTION' ? ? ? 
7  G 1434 0.066 ? POSITIONAL 1 7  'X-RAY DIFFRACTION' ? ? ? 
8  H 1434 0.065 ? POSITIONAL 1 8  'X-RAY DIFFRACTION' ? ? ? 
9  I 1434 0.067 ? POSITIONAL 1 9  'X-RAY DIFFRACTION' ? ? ? 
10 J 1434 0.068 ? POSITIONAL 1 10 'X-RAY DIFFRACTION' ? ? ? 
11 K 1434 0.058 ? POSITIONAL 1 11 'X-RAY DIFFRACTION' ? ? ? 
12 L 1426 0.065 ? POSITIONAL 1 12 'X-RAY DIFFRACTION' ? ? ? 
13 M 1434 0.063 ? POSITIONAL 1 13 'X-RAY DIFFRACTION' ? ? ? 
14 N 1429 0.066 ? POSITIONAL 1 14 'X-RAY DIFFRACTION' ? ? ? 
15 O 1434 0.060 ? POSITIONAL 1 15 'X-RAY DIFFRACTION' ? ? ? 
16 P 1434 0.050 ? POSITIONAL 1 16 'X-RAY DIFFRACTION' ? ? ? 
17 Q 1440 0.067 ? POSITIONAL 1 17 'X-RAY DIFFRACTION' ? ? ? 
18 R 1434 0.067 ? POSITIONAL 1 18 'X-RAY DIFFRACTION' ? ? ? 
19 S 1426 0.069 ? POSITIONAL 1 19 'X-RAY DIFFRACTION' ? ? ? 
20 T 1422 0.066 ? POSITIONAL 1 20 'X-RAY DIFFRACTION' ? ? ? 
21 U 1434 0.060 ? POSITIONAL 1 21 'X-RAY DIFFRACTION' ? ? ? 
22 V 1426 0.072 ? POSITIONAL 1 22 'X-RAY DIFFRACTION' ? ? ? 
23 W 1426 0.066 ? POSITIONAL 1 23 'X-RAY DIFFRACTION' ? ? ? 
24 X 1434 0.065 ? POSITIONAL 1 24 'X-RAY DIFFRACTION' ? ? ? 
25 Y 1434 0.055 ? POSITIONAL 1 25 'X-RAY DIFFRACTION' ? ? ? 
26 Z 1434 0.055 ? POSITIONAL 1 26 'X-RAY DIFFRACTION' ? ? ? 
27 A 1420 0.066 ? POSITIONAL 1 27 'X-RAY DIFFRACTION' ? ? ? 
28 B 1448 0.066 ? POSITIONAL 1 28 'X-RAY DIFFRACTION' ? ? ? 
29 C 1429 0.068 ? POSITIONAL 1 29 'X-RAY DIFFRACTION' ? ? ? 
30 D 1434 0.059 ? POSITIONAL 1 30 'X-RAY DIFFRACTION' ? ? ? 
31 E 1434 0.054 ? POSITIONAL 1 31 'X-RAY DIFFRACTION' ? ? ? 
32 F 1420 0.065 ? POSITIONAL 1 32 'X-RAY DIFFRACTION' ? ? ? 
33 G 1434 0.063 ? POSITIONAL 1 33 'X-RAY DIFFRACTION' ? ? ? 
34 H 1434 0.063 ? POSITIONAL 1 34 'X-RAY DIFFRACTION' ? ? ? 
35 I 1434 0.059 ? POSITIONAL 1 35 'X-RAY DIFFRACTION' ? ? ? 
36 J 1426 0.059 ? POSITIONAL 1 36 'X-RAY DIFFRACTION' ? ? ? 
37 K 1426 0.063 ? POSITIONAL 1 37 'X-RAY DIFFRACTION' ? ? ? 
38 L 1434 0.064 ? POSITIONAL 1 38 'X-RAY DIFFRACTION' ? ? ? 
39 M 1428 0.064 ? POSITIONAL 1 39 'X-RAY DIFFRACTION' ? ? ? 
40 N 1426 0.052 ? POSITIONAL 1 40 'X-RAY DIFFRACTION' ? ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.7027 2.7334  6687 0.2498 85.00  0.3021 . . 146 . . 
'X-RAY DIFFRACTION' . 2.7334 2.7655  7935 0.2623 100.00 0.3572 . . 197 . . 
'X-RAY DIFFRACTION' . 2.7655 2.7992  7917 0.2644 100.00 0.3358 . . 166 . . 
'X-RAY DIFFRACTION' . 2.7992 2.8346  7897 0.2628 100.00 0.3528 . . 147 . . 
'X-RAY DIFFRACTION' . 2.8346 2.8719  7989 0.2568 100.00 0.3246 . . 146 . . 
'X-RAY DIFFRACTION' . 2.8719 2.9112  7928 0.2526 100.00 0.3284 . . 141 . . 
'X-RAY DIFFRACTION' . 2.9112 2.9527  7970 0.2477 100.00 0.3537 . . 151 . . 
'X-RAY DIFFRACTION' . 2.9527 2.9968  7913 0.2345 100.00 0.2688 . . 153 . . 
'X-RAY DIFFRACTION' . 2.9968 3.0436  7942 0.2273 100.00 0.3190 . . 163 . . 
'X-RAY DIFFRACTION' . 3.0436 3.0934  7989 0.2207 100.00 0.2919 . . 140 . . 
'X-RAY DIFFRACTION' . 3.0934 3.1467  7957 0.2161 100.00 0.3034 . . 151 . . 
'X-RAY DIFFRACTION' . 3.1467 3.2039  7906 0.2153 100.00 0.2634 . . 171 . . 
'X-RAY DIFFRACTION' . 3.2039 3.2654  7928 0.2069 100.00 0.2534 . . 179 . . 
'X-RAY DIFFRACTION' . 3.2654 3.3320  7946 0.2062 100.00 0.2743 . . 158 . . 
'X-RAY DIFFRACTION' . 3.3320 3.4043  7953 0.1978 100.00 0.2639 . . 165 . . 
'X-RAY DIFFRACTION' . 3.4043 3.4834  7960 0.1922 100.00 0.2649 . . 179 . . 
'X-RAY DIFFRACTION' . 3.4834 3.5704  7929 0.1923 100.00 0.2384 . . 163 . . 
'X-RAY DIFFRACTION' . 3.5704 3.6668  7974 0.1979 100.00 0.2669 . . 183 . . 
'X-RAY DIFFRACTION' . 3.6668 3.7745  7905 0.1895 100.00 0.2471 . . 178 . . 
'X-RAY DIFFRACTION' . 3.7745 3.8960  7997 0.1878 100.00 0.2098 . . 151 . . 
'X-RAY DIFFRACTION' . 3.8960 4.0350  7954 0.1793 100.00 0.2368 . . 151 . . 
'X-RAY DIFFRACTION' . 4.0350 4.1961  7961 0.1716 100.00 0.2203 . . 165 . . 
'X-RAY DIFFRACTION' . 4.1961 4.3865  7986 0.1608 100.00 0.2034 . . 185 . . 
'X-RAY DIFFRACTION' . 4.3865 4.6170  7963 0.1618 100.00 0.1928 . . 154 . . 
'X-RAY DIFFRACTION' . 4.6170 4.9051  7962 0.1643 100.00 0.1880 . . 168 . . 
'X-RAY DIFFRACTION' . 4.9051 5.2820  8005 0.1676 100.00 0.1957 . . 168 . . 
'X-RAY DIFFRACTION' . 5.2820 5.8101  8012 0.1827 100.00 0.2246 . . 165 . . 
'X-RAY DIFFRACTION' . 5.8101 6.6429  8024 0.2049 100.00 0.2578 . . 172 . . 
'X-RAY DIFFRACTION' . 6.6429 8.3397  8079 0.2008 100.00 0.1897 . . 140 . . 
'X-RAY DIFFRACTION' . 8.3397 30.0732 8134 0.2206 100.00 0.2305 . . 186 . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1  ? 1 
2  ? 1 
3  ? 1 
4  ? 1 
5  ? 1 
6  ? 1 
7  ? 1 
8  ? 1 
9  ? 1 
10 ? 1 
11 ? 1 
12 ? 1 
13 ? 1 
14 ? 1 
15 ? 1 
16 ? 1 
17 ? 1 
18 ? 1 
19 ? 1 
20 ? 1 
21 ? 1 
22 ? 1 
23 ? 1 
24 ? 1 
25 ? 1 
26 ? 1 
27 ? 1 
28 ? 1 
29 ? 1 
30 ? 1 
31 ? 1 
32 ? 1 
33 ? 1 
34 ? 1 
35 ? 1 
36 ? 1 
37 ? 1 
38 ? 1 
39 ? 1 
40 ? 1 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN A AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
2  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN B AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202)
;
3  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN C AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
4  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN D AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 163:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
5  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN E AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
6  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN F AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
7  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN G AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
8  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN H AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
9  ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN I AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
10 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN J AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
11 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN K AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
12 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN L AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
13 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN M AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
14 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN N AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
15 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN O AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
16 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN P AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
17 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN Q AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
18 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN R AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
19 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN S AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
20 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN T AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
21 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN U AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
22 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN V AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
23 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN W AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
24 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN X AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
25 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN Y AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
26 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN Z AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
27 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN a AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
28 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN b AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
29 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN c AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
30 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN d AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
31 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN e AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
32 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN f AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
33 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN g AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
34 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN h AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
35 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN i AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
36 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN j AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
37 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN k AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
38 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN l AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
39 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN m AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
40 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;CHAIN n AND (RESSEQ 1:21 OR RESSEQ 26:39 OR RESSEQ 41:93 OR RESSEQ 95:119 OR RESSEQ 121:130 OR RESSEQ 132:147 OR RESSEQ 149:155 OR RESSEQ 161:169 OR RESSEQ 173:178 OR RESSEQ 180:202 )
;
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  4UM3 
_struct.title                     'Engineered Ls-AChBP with alpha4-alpha4 binding pocket in complex with NS3920' 
_struct.pdbx_descriptor           'ACETYLCHOLINE BINDING PROTEIN' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4UM3 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'NICOTINIC ACETYLCHOLINE RECEPTOR, ION CHANNEL, RECEPTOR STOICHIOMETRY, CYS-LOOP RECEPTOR, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 2 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 3 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 1 ? 
W  N N 1 ? 
X  N N 1 ? 
Y  N N 1 ? 
Z  N N 1 ? 
AA N N 1 ? 
BA N N 1 ? 
CA N N 1 ? 
DA N N 1 ? 
EA N N 1 ? 
FA N N 1 ? 
GA N N 1 ? 
HA N N 1 ? 
IA N N 1 ? 
JA N N 1 ? 
KA N N 1 ? 
LA N N 1 ? 
MA N N 1 ? 
NA N N 1 ? 
OA N N 4 ? 
PA N N 5 ? 
QA N N 4 ? 
RA N N 4 ? 
SA N N 4 ? 
TA N N 4 ? 
UA N N 4 ? 
VA N N 4 ? 
WA N N 4 ? 
XA N N 4 ? 
YA N N 4 ? 
ZA N N 4 ? 
AB N N 4 ? 
BB N N 4 ? 
CB N N 4 ? 
DB N N 4 ? 
EB N N 5 ? 
FB N N 4 ? 
GB N N 4 ? 
HB N N 4 ? 
IB N N 4 ? 
JB N N 4 ? 
KB N N 4 ? 
LB N N 6 ? 
MB N N 4 ? 
NB N N 4 ? 
OB N N 4 ? 
PB N N 4 ? 
QB N N 4 ? 
RB N N 4 ? 
SB N N 4 ? 
TB N N 4 ? 
UB N N 4 ? 
VB N N 5 ? 
WB N N 4 ? 
XB N N 4 ? 
YB N N 4 ? 
ZB N N 4 ? 
AC N N 4 ? 
BC N N 4 ? 
CC N N 4 ? 
DC N N 4 ? 
EC N N 4 ? 
FC N N 4 ? 
GC N N 7 ? 
HC N N 7 ? 
IC N N 7 ? 
JC N N 7 ? 
KC N N 7 ? 
LC N N 7 ? 
MC N N 7 ? 
NC N N 7 ? 
OC N N 7 ? 
PC N N 7 ? 
QC N N 7 ? 
RC N N 7 ? 
SC N N 7 ? 
TC N N 7 ? 
UC N N 7 ? 
VC N N 7 ? 
WC N N 7 ? 
XC N N 7 ? 
YC N N 7 ? 
ZC N N 7 ? 
AD N N 7 ? 
BD N N 7 ? 
CD N N 7 ? 
DD N N 7 ? 
ED N N 7 ? 
FD N N 7 ? 
GD N N 7 ? 
HD N N 7 ? 
ID N N 7 ? 
JD N N 7 ? 
KD N N 7 ? 
LD N N 7 ? 
MD N N 7 ? 
ND N N 7 ? 
OD N N 7 ? 
PD N N 7 ? 
QD N N 7 ? 
RD N N 7 ? 
SD N N 7 ? 
TD N N 7 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 ASP A  21 ? SER A  33  ? ASP A 2  SER A 14 1 ? 13 
HELX_P HELX_P2   AA2 ARG A  80 ? ALA A  83  ? ARG A 61 ALA A 64 5 ? 4  
HELX_P HELX_P3   AA3 SER A  98 ? LEU A  100 ? SER A 79 LEU A 81 5 ? 3  
HELX_P HELX_P4   AA4 ASP B  21 ? SER B  33  ? ASP B 2  SER B 14 1 ? 13 
HELX_P HELX_P5   AA5 ARG B  80 ? ALA B  83  ? ARG B 61 ALA B 64 5 ? 4  
HELX_P HELX_P6   AA6 SER B  98 ? LEU B  100 ? SER B 79 LEU B 81 5 ? 3  
HELX_P HELX_P7   AA7 ASP C  21 ? SER C  33  ? ASP C 2  SER C 14 1 ? 13 
HELX_P HELX_P8   AA8 ARG C  80 ? ALA C  83  ? ARG C 61 ALA C 64 5 ? 4  
HELX_P HELX_P9   AA9 SER C  98 ? LEU C  100 ? SER C 79 LEU C 81 5 ? 3  
HELX_P HELX_P10  AB1 ASP D  21 ? SER D  33  ? ASP D 2  SER D 14 1 ? 13 
HELX_P HELX_P11  AB2 ARG D  80 ? ALA D  83  ? ARG D 61 ALA D 64 5 ? 4  
HELX_P HELX_P12  AB3 SER D  98 ? LEU D  100 ? SER D 79 LEU D 81 5 ? 3  
HELX_P HELX_P13  AB4 ASP E  21 ? SER E  33  ? ASP E 2  SER E 14 1 ? 13 
HELX_P HELX_P14  AB5 ARG E  80 ? ALA E  83  ? ARG E 61 ALA E 64 5 ? 4  
HELX_P HELX_P15  AB6 SER E  98 ? LEU E  100 ? SER E 79 LEU E 81 5 ? 3  
HELX_P HELX_P16  AB7 ASP F  21 ? SER F  33  ? ASP F 2  SER F 14 1 ? 13 
HELX_P HELX_P17  AB8 ARG F  80 ? ALA F  83  ? ARG F 61 ALA F 64 5 ? 4  
HELX_P HELX_P18  AB9 SER F  98 ? LEU F  100 ? SER F 79 LEU F 81 5 ? 3  
HELX_P HELX_P19  AC1 ASP G  21 ? SER G  33  ? ASP G 2  SER G 14 1 ? 13 
HELX_P HELX_P20  AC2 ARG G  80 ? ALA G  83  ? ARG G 61 ALA G 64 5 ? 4  
HELX_P HELX_P21  AC3 SER G  98 ? LEU G  100 ? SER G 79 LEU G 81 5 ? 3  
HELX_P HELX_P22  AC4 ASP H  21 ? SER H  33  ? ASP H 2  SER H 14 1 ? 13 
HELX_P HELX_P23  AC5 ARG H  80 ? ALA H  83  ? ARG H 61 ALA H 64 5 ? 4  
HELX_P HELX_P24  AC6 SER H  98 ? LEU H  100 ? SER H 79 LEU H 81 5 ? 3  
HELX_P HELX_P25  AC7 ASP I  21 ? SER I  33  ? ASP I 2  SER I 14 1 ? 13 
HELX_P HELX_P26  AC8 ARG I  80 ? ALA I  83  ? ARG I 61 ALA I 64 5 ? 4  
HELX_P HELX_P27  AC9 SER I  98 ? LEU I  100 ? SER I 79 LEU I 81 5 ? 3  
HELX_P HELX_P28  AD1 ASP J  21 ? SER J  33  ? ASP J 2  SER J 14 1 ? 13 
HELX_P HELX_P29  AD2 ARG J  80 ? ALA J  83  ? ARG J 61 ALA J 64 5 ? 4  
HELX_P HELX_P30  AD3 SER J  98 ? LEU J  100 ? SER J 79 LEU J 81 5 ? 3  
HELX_P HELX_P31  AD4 ASP K  21 ? SER K  33  ? ASP K 2  SER K 14 1 ? 13 
HELX_P HELX_P32  AD5 ARG K  80 ? ALA K  83  ? ARG K 61 ALA K 64 5 ? 4  
HELX_P HELX_P33  AD6 SER K  98 ? LEU K  100 ? SER K 79 LEU K 81 5 ? 3  
HELX_P HELX_P34  AD7 ASP L  21 ? SER L  33  ? ASP L 2  SER L 14 1 ? 13 
HELX_P HELX_P35  AD8 ARG L  80 ? ALA L  83  ? ARG L 61 ALA L 64 5 ? 4  
HELX_P HELX_P36  AD9 SER L  98 ? LEU L  100 ? SER L 79 LEU L 81 5 ? 3  
HELX_P HELX_P37  AE1 ASP M  21 ? SER M  33  ? ASP M 2  SER M 14 1 ? 13 
HELX_P HELX_P38  AE2 ARG M  80 ? ALA M  83  ? ARG M 61 ALA M 64 5 ? 4  
HELX_P HELX_P39  AE3 SER M  98 ? LEU M  100 ? SER M 79 LEU M 81 5 ? 3  
HELX_P HELX_P40  AE4 ASP N  21 ? SER N  33  ? ASP N 2  SER N 14 1 ? 13 
HELX_P HELX_P41  AE5 ARG N  80 ? ALA N  83  ? ARG N 61 ALA N 64 5 ? 4  
HELX_P HELX_P42  AE6 SER N  98 ? LEU N  100 ? SER N 79 LEU N 81 5 ? 3  
HELX_P HELX_P43  AE7 ASP O  21 ? SER O  33  ? ASP O 2  SER O 14 1 ? 13 
HELX_P HELX_P44  AE8 ARG O  80 ? ALA O  83  ? ARG O 61 ALA O 64 5 ? 4  
HELX_P HELX_P45  AE9 SER O  98 ? LEU O  100 ? SER O 79 LEU O 81 5 ? 3  
HELX_P HELX_P46  AF1 ASP P  21 ? SER P  33  ? ASP P 2  SER P 14 1 ? 13 
HELX_P HELX_P47  AF2 ARG P  79 ? ALA P  82  ? ARG P 61 ALA P 64 5 ? 4  
HELX_P HELX_P48  AF3 SER P  97 ? LEU P  99  ? SER P 79 LEU P 81 5 ? 3  
HELX_P HELX_P49  AF4 ASP Q  21 ? SER Q  33  ? ASP Q 2  SER Q 14 1 ? 13 
HELX_P HELX_P50  AF5 ARG Q  80 ? ALA Q  83  ? ARG Q 61 ALA Q 64 5 ? 4  
HELX_P HELX_P51  AF6 SER Q  98 ? LEU Q  100 ? SER Q 79 LEU Q 81 5 ? 3  
HELX_P HELX_P52  AF7 ASP R  21 ? SER R  33  ? ASP R 2  SER R 14 1 ? 13 
HELX_P HELX_P53  AF8 ARG R  80 ? ALA R  83  ? ARG R 61 ALA R 64 5 ? 4  
HELX_P HELX_P54  AF9 SER R  98 ? LEU R  100 ? SER R 79 LEU R 81 5 ? 3  
HELX_P HELX_P55  AG1 ASP S  21 ? SER S  33  ? ASP S 2  SER S 14 1 ? 13 
HELX_P HELX_P56  AG2 ARG S  80 ? ALA S  83  ? ARG S 61 ALA S 64 5 ? 4  
HELX_P HELX_P57  AG3 SER S  98 ? LEU S  100 ? SER S 79 LEU S 81 5 ? 3  
HELX_P HELX_P58  AG4 ASP T  21 ? SER T  33  ? ASP T 2  SER T 14 1 ? 13 
HELX_P HELX_P59  AG5 ARG T  80 ? ALA T  83  ? ARG T 61 ALA T 64 5 ? 4  
HELX_P HELX_P60  AG6 SER T  98 ? LEU T  100 ? SER T 79 LEU T 81 5 ? 3  
HELX_P HELX_P61  AG7 ASP U  21 ? SER U  33  ? ASP U 2  SER U 14 1 ? 13 
HELX_P HELX_P62  AG8 ARG U  80 ? ALA U  83  ? ARG U 61 ALA U 64 5 ? 4  
HELX_P HELX_P63  AG9 SER U  98 ? LEU U  100 ? SER U 79 LEU U 81 5 ? 3  
HELX_P HELX_P64  AH1 ASP V  21 ? SER V  33  ? ASP V 2  SER V 14 1 ? 13 
HELX_P HELX_P65  AH2 ARG V  80 ? ALA V  83  ? ARG V 61 ALA V 64 5 ? 4  
HELX_P HELX_P66  AH3 SER V  98 ? LEU V  100 ? SER V 79 LEU V 81 5 ? 3  
HELX_P HELX_P67  AH4 ASP W  21 ? SER W  33  ? ASP W 2  SER W 14 1 ? 13 
HELX_P HELX_P68  AH5 ARG W  80 ? ALA W  83  ? ARG W 61 ALA W 64 5 ? 4  
HELX_P HELX_P69  AH6 SER W  98 ? LEU W  100 ? SER W 79 LEU W 81 5 ? 3  
HELX_P HELX_P70  AH7 ASP X  21 ? SER X  33  ? ASP X 2  SER X 14 1 ? 13 
HELX_P HELX_P71  AH8 ARG X  80 ? ALA X  83  ? ARG X 61 ALA X 64 5 ? 4  
HELX_P HELX_P72  AH9 SER X  98 ? LEU X  100 ? SER X 79 LEU X 81 5 ? 3  
HELX_P HELX_P73  AI1 ASP Y  21 ? SER Y  33  ? ASP Y 2  SER Y 14 1 ? 13 
HELX_P HELX_P74  AI2 ARG Y  80 ? ALA Y  83  ? ARG Y 61 ALA Y 64 5 ? 4  
HELX_P HELX_P75  AI3 SER Y  98 ? LEU Y  100 ? SER Y 79 LEU Y 81 5 ? 3  
HELX_P HELX_P76  AI4 ASP Z  21 ? SER Z  33  ? ASP Z 2  SER Z 14 1 ? 13 
HELX_P HELX_P77  AI5 ARG Z  80 ? ALA Z  83  ? ARG Z 61 ALA Z 64 5 ? 4  
HELX_P HELX_P78  AI6 SER Z  98 ? LEU Z  100 ? SER Z 79 LEU Z 81 5 ? 3  
HELX_P HELX_P79  AI7 ASP AA 21 ? SER AA 33  ? ASP a 2  SER a 14 1 ? 13 
HELX_P HELX_P80  AI8 ARG AA 80 ? ALA AA 83  ? ARG a 61 ALA a 64 5 ? 4  
HELX_P HELX_P81  AI9 SER AA 98 ? LEU AA 100 ? SER a 79 LEU a 81 5 ? 3  
HELX_P HELX_P82  AJ1 ASP BA 21 ? SER BA 33  ? ASP b 2  SER b 14 1 ? 13 
HELX_P HELX_P83  AJ2 ARG BA 80 ? ALA BA 83  ? ARG b 61 ALA b 64 5 ? 4  
HELX_P HELX_P84  AJ3 SER BA 98 ? LEU BA 100 ? SER b 79 LEU b 81 5 ? 3  
HELX_P HELX_P85  AJ4 ASP CA 21 ? SER CA 33  ? ASP c 2  SER c 14 1 ? 13 
HELX_P HELX_P86  AJ5 ARG CA 80 ? ALA CA 83  ? ARG c 61 ALA c 64 5 ? 4  
HELX_P HELX_P87  AJ6 SER CA 98 ? LEU CA 100 ? SER c 79 LEU c 81 5 ? 3  
HELX_P HELX_P88  AJ7 ASP DA 21 ? SER DA 33  ? ASP d 2  SER d 14 1 ? 13 
HELX_P HELX_P89  AJ8 ARG DA 80 ? ALA DA 83  ? ARG d 61 ALA d 64 5 ? 4  
HELX_P HELX_P90  AJ9 SER DA 98 ? LEU DA 100 ? SER d 79 LEU d 81 5 ? 3  
HELX_P HELX_P91  AK1 ASP EA 21 ? SER EA 33  ? ASP e 2  SER e 14 1 ? 13 
HELX_P HELX_P92  AK2 ARG EA 80 ? ALA EA 83  ? ARG e 61 ALA e 64 5 ? 4  
HELX_P HELX_P93  AK3 SER EA 98 ? LEU EA 100 ? SER e 79 LEU e 81 5 ? 3  
HELX_P HELX_P94  AK4 ASP FA 21 ? SER FA 33  ? ASP f 2  SER f 14 1 ? 13 
HELX_P HELX_P95  AK5 ARG FA 80 ? ALA FA 83  ? ARG f 61 ALA f 64 5 ? 4  
HELX_P HELX_P96  AK6 SER FA 98 ? LEU FA 100 ? SER f 79 LEU f 81 5 ? 3  
HELX_P HELX_P97  AK7 ASP GA 21 ? SER GA 33  ? ASP g 2  SER g 14 1 ? 13 
HELX_P HELX_P98  AK8 ARG GA 80 ? ALA GA 83  ? ARG g 61 ALA g 64 5 ? 4  
HELX_P HELX_P99  AK9 SER GA 98 ? LEU GA 100 ? SER g 79 LEU g 81 5 ? 3  
HELX_P HELX_P100 AL1 ASP HA 21 ? SER HA 33  ? ASP h 2  SER h 14 1 ? 13 
HELX_P HELX_P101 AL2 ARG HA 80 ? ALA HA 83  ? ARG h 61 ALA h 64 5 ? 4  
HELX_P HELX_P102 AL3 SER HA 98 ? LEU HA 100 ? SER h 79 LEU h 81 5 ? 3  
HELX_P HELX_P103 AL4 ASP IA 21 ? SER IA 33  ? ASP i 2  SER i 14 1 ? 13 
HELX_P HELX_P104 AL5 ARG IA 80 ? ALA IA 83  ? ARG i 61 ALA i 64 5 ? 4  
HELX_P HELX_P105 AL6 SER IA 98 ? LEU IA 100 ? SER i 79 LEU i 81 5 ? 3  
HELX_P HELX_P106 AL7 ASP JA 21 ? SER JA 33  ? ASP j 2  SER j 14 1 ? 13 
HELX_P HELX_P107 AL8 ARG JA 80 ? ALA JA 83  ? ARG j 61 ALA j 64 5 ? 4  
HELX_P HELX_P108 AL9 SER JA 98 ? LEU JA 100 ? SER j 79 LEU j 81 5 ? 3  
HELX_P HELX_P109 AM1 ASP KA 21 ? SER KA 33  ? ASP k 2  SER k 14 1 ? 13 
HELX_P HELX_P110 AM2 ARG KA 80 ? ALA KA 83  ? ARG k 61 ALA k 64 5 ? 4  
HELX_P HELX_P111 AM3 SER KA 98 ? LEU KA 100 ? SER k 79 LEU k 81 5 ? 3  
HELX_P HELX_P112 AM4 ASP LA 21 ? SER LA 33  ? ASP l 2  SER l 14 1 ? 13 
HELX_P HELX_P113 AM5 ARG LA 80 ? ALA LA 83  ? ARG l 61 ALA l 64 5 ? 4  
HELX_P HELX_P114 AM6 SER LA 98 ? LEU LA 100 ? SER l 79 LEU l 81 5 ? 3  
HELX_P HELX_P115 AM7 ASP MA 21 ? SER MA 33  ? ASP m 2  SER m 14 1 ? 13 
HELX_P HELX_P116 AM8 ARG MA 80 ? ALA MA 83  ? ARG m 61 ALA m 64 5 ? 4  
HELX_P HELX_P117 AM9 SER MA 98 ? LEU MA 100 ? SER m 79 LEU m 81 5 ? 3  
HELX_P HELX_P118 AN1 ASP NA 21 ? SER NA 33  ? ASP n 2  SER n 14 1 ? 13 
HELX_P HELX_P119 AN2 ARG NA 80 ? ALA NA 83  ? ARG n 61 ALA n 64 5 ? 4  
HELX_P HELX_P120 AN3 SER NA 98 ? LEU NA 100 ? SER n 79 LEU n 81 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ?   ? A  CYS 142 SG  ? ? ? 1_555 A  CYS 155 SG ? ? A CYS 123 A CYS 136 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf2  disulf ?   ? A  CYS 206 SG  ? ? ? 1_555 A  CYS 207 SG ? ? A CYS 187 A CYS 188 1_555 ? ? ? ? ? ? ? 2.056 ? ?               
disulf3  disulf ?   ? B  CYS 142 SG  ? ? ? 1_555 B  CYS 155 SG ? ? B CYS 123 B CYS 136 1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf4  disulf ?   ? B  CYS 206 SG  ? ? ? 1_555 B  CYS 207 SG ? ? B CYS 187 B CYS 188 1_555 ? ? ? ? ? ? ? 2.061 ? ?               
disulf5  disulf ?   ? C  CYS 142 SG  ? ? ? 1_555 C  CYS 155 SG ? ? C CYS 123 C CYS 136 1_555 ? ? ? ? ? ? ? 2.058 ? ?               
disulf6  disulf ?   ? C  CYS 206 SG  ? ? ? 1_555 C  CYS 207 SG ? ? C CYS 187 C CYS 188 1_555 ? ? ? ? ? ? ? 2.060 ? ?               
disulf7  disulf ?   ? D  CYS 142 SG  ? ? ? 1_555 D  CYS 155 SG ? ? D CYS 123 D CYS 136 1_555 ? ? ? ? ? ? ? 2.030 ? ?               
disulf8  disulf ?   ? D  CYS 206 SG  ? ? ? 1_555 D  CYS 207 SG ? ? D CYS 187 D CYS 188 1_555 ? ? ? ? ? ? ? 2.053 ? ?               
disulf9  disulf ?   ? E  CYS 142 SG  ? ? ? 1_555 E  CYS 155 SG ? ? E CYS 123 E CYS 136 1_555 ? ? ? ? ? ? ? 2.032 ? ?               
disulf10 disulf ?   ? E  CYS 206 SG  ? ? ? 1_555 E  CYS 207 SG ? ? E CYS 187 E CYS 188 1_555 ? ? ? ? ? ? ? 2.071 ? ?               
disulf11 disulf ?   ? F  CYS 142 SG  ? ? ? 1_555 F  CYS 155 SG ? ? F CYS 123 F CYS 136 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf12 disulf ?   ? F  CYS 206 SG  ? ? ? 1_555 F  CYS 207 SG ? ? F CYS 187 F CYS 188 1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf13 disulf ?   ? G  CYS 142 SG  ? ? ? 1_555 G  CYS 155 SG ? ? G CYS 123 G CYS 136 1_555 ? ? ? ? ? ? ? 2.031 ? ?               
disulf14 disulf ?   ? G  CYS 206 SG  ? ? ? 1_555 G  CYS 207 SG ? ? G CYS 187 G CYS 188 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf15 disulf ?   ? H  CYS 142 SG  ? ? ? 1_555 H  CYS 155 SG ? ? H CYS 123 H CYS 136 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf16 disulf ?   ? H  CYS 206 SG  ? ? ? 1_555 H  CYS 207 SG ? ? H CYS 187 H CYS 188 1_555 ? ? ? ? ? ? ? 2.054 ? ?               
disulf17 disulf ?   ? I  CYS 142 SG  ? ? ? 1_555 I  CYS 155 SG ? ? I CYS 123 I CYS 136 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf18 disulf ?   ? I  CYS 206 SG  ? ? ? 1_555 I  CYS 207 SG ? ? I CYS 187 I CYS 188 1_555 ? ? ? ? ? ? ? 2.076 ? ?               
disulf19 disulf ?   ? J  CYS 142 SG  ? ? ? 1_555 J  CYS 155 SG ? ? J CYS 123 J CYS 136 1_555 ? ? ? ? ? ? ? 2.070 ? ?               
disulf20 disulf ?   ? J  CYS 206 SG  ? ? ? 1_555 J  CYS 207 SG ? ? J CYS 187 J CYS 188 1_555 ? ? ? ? ? ? ? 2.053 ? ?               
disulf21 disulf ?   ? K  CYS 142 SG  ? ? ? 1_555 K  CYS 155 SG ? ? K CYS 123 K CYS 136 1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf22 disulf ?   ? K  CYS 206 SG  ? ? ? 1_555 K  CYS 207 SG ? ? K CYS 187 K CYS 188 1_555 ? ? ? ? ? ? ? 2.059 ? ?               
disulf23 disulf ?   ? L  CYS 142 SG  ? ? ? 1_555 L  CYS 155 SG ? ? L CYS 123 L CYS 136 1_555 ? ? ? ? ? ? ? 2.046 ? ?               
disulf24 disulf ?   ? L  CYS 206 SG  ? ? ? 1_555 L  CYS 207 SG ? ? L CYS 187 L CYS 188 1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf25 disulf ?   ? M  CYS 142 SG  ? ? ? 1_555 M  CYS 155 SG ? ? M CYS 123 M CYS 136 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf26 disulf ?   ? M  CYS 206 SG  ? ? ? 1_555 M  CYS 207 SG ? ? M CYS 187 M CYS 188 1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf27 disulf ?   ? N  CYS 142 SG  ? ? ? 1_555 N  CYS 155 SG ? ? N CYS 123 N CYS 136 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf28 disulf ?   ? N  CYS 206 SG  ? ? ? 1_555 N  CYS 207 SG ? ? N CYS 187 N CYS 188 1_555 ? ? ? ? ? ? ? 2.058 ? ?               
disulf29 disulf ?   ? O  CYS 142 SG  ? ? ? 1_555 O  CYS 155 SG ? ? O CYS 123 O CYS 136 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf30 disulf ?   ? O  CYS 206 SG  ? ? ? 1_555 O  CYS 207 SG ? ? O CYS 187 O CYS 188 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf31 disulf ?   ? P  CYS 141 SG  ? ? ? 1_555 P  CYS 154 SG ? ? P CYS 123 P CYS 136 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf32 disulf ?   ? P  CYS 205 SG  ? ? ? 1_555 P  CYS 206 SG ? ? P CYS 187 P CYS 188 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf33 disulf ?   ? Q  CYS 142 SG  ? ? ? 1_555 Q  CYS 155 SG ? ? Q CYS 123 Q CYS 136 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf34 disulf ?   ? Q  CYS 206 SG  ? ? ? 1_555 Q  CYS 207 SG ? ? Q CYS 187 Q CYS 188 1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf35 disulf ?   ? R  CYS 142 SG  ? ? ? 1_555 R  CYS 155 SG ? ? R CYS 123 R CYS 136 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf36 disulf ?   ? R  CYS 206 SG  ? ? ? 1_555 R  CYS 207 SG ? ? R CYS 187 R CYS 188 1_555 ? ? ? ? ? ? ? 2.062 ? ?               
disulf37 disulf ?   ? S  CYS 142 SG  ? ? ? 1_555 S  CYS 155 SG ? ? S CYS 123 S CYS 136 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf38 disulf ?   ? S  CYS 206 SG  ? ? ? 1_555 S  CYS 207 SG ? ? S CYS 187 S CYS 188 1_555 ? ? ? ? ? ? ? 2.074 ? ?               
disulf39 disulf ?   ? T  CYS 142 SG  ? ? ? 1_555 T  CYS 155 SG ? ? T CYS 123 T CYS 136 1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf40 disulf ?   ? T  CYS 206 SG  ? ? ? 1_555 T  CYS 207 SG ? ? T CYS 187 T CYS 188 1_555 ? ? ? ? ? ? ? 2.059 ? ?               
disulf41 disulf ?   ? U  CYS 142 SG  ? ? ? 1_555 U  CYS 155 SG ? ? U CYS 123 U CYS 136 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf42 disulf ?   ? U  CYS 206 SG  ? ? ? 1_555 U  CYS 207 SG ? ? U CYS 187 U CYS 188 1_555 ? ? ? ? ? ? ? 2.073 ? ?               
disulf43 disulf ?   ? V  CYS 142 SG  ? ? ? 1_555 V  CYS 155 SG ? ? V CYS 123 V CYS 136 1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf44 disulf ?   ? V  CYS 206 SG  ? ? ? 1_555 V  CYS 207 SG ? ? V CYS 187 V CYS 188 1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf45 disulf ?   ? W  CYS 142 SG  ? ? ? 1_555 W  CYS 155 SG ? ? W CYS 123 W CYS 136 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf46 disulf ?   ? W  CYS 206 SG  ? ? ? 1_555 W  CYS 207 SG ? ? W CYS 187 W CYS 188 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf47 disulf ?   ? X  CYS 142 SG  ? ? ? 1_555 X  CYS 155 SG ? ? X CYS 123 X CYS 136 1_555 ? ? ? ? ? ? ? 2.038 ? ?               
disulf48 disulf ?   ? X  CYS 206 SG  ? ? ? 1_555 X  CYS 207 SG ? ? X CYS 187 X CYS 188 1_555 ? ? ? ? ? ? ? 2.059 ? ?               
disulf49 disulf ?   ? Y  CYS 142 SG  ? ? ? 1_555 Y  CYS 155 SG ? ? Y CYS 123 Y CYS 136 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf50 disulf ?   ? Y  CYS 206 SG  ? ? ? 1_555 Y  CYS 207 SG ? ? Y CYS 187 Y CYS 188 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
disulf51 disulf ?   ? Z  CYS 142 SG  ? ? ? 1_555 Z  CYS 155 SG ? ? Z CYS 123 Z CYS 136 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf52 disulf ?   ? Z  CYS 206 SG  ? ? ? 1_555 Z  CYS 207 SG ? ? Z CYS 187 Z CYS 188 1_555 ? ? ? ? ? ? ? 2.067 ? ?               
disulf53 disulf ?   ? AA CYS 142 SG  ? ? ? 1_555 AA CYS 155 SG ? ? a CYS 123 a CYS 136 1_555 ? ? ? ? ? ? ? 2.051 ? ?               
disulf54 disulf ?   ? AA CYS 206 SG  ? ? ? 1_555 AA CYS 207 SG ? ? a CYS 187 a CYS 188 1_555 ? ? ? ? ? ? ? 2.053 ? ?               
disulf55 disulf ?   ? BA CYS 142 SG  ? ? ? 1_555 BA CYS 155 SG ? ? b CYS 123 b CYS 136 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf56 disulf ?   ? BA CYS 206 SG  ? ? ? 1_555 BA CYS 207 SG ? ? b CYS 187 b CYS 188 1_555 ? ? ? ? ? ? ? 2.050 ? ?               
disulf57 disulf ?   ? CA CYS 142 SG  ? ? ? 1_555 CA CYS 155 SG ? ? c CYS 123 c CYS 136 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf58 disulf ?   ? CA CYS 206 SG  ? ? ? 1_555 CA CYS 207 SG ? ? c CYS 187 c CYS 188 1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf59 disulf ?   ? DA CYS 142 SG  ? ? ? 1_555 DA CYS 155 SG ? ? d CYS 123 d CYS 136 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf60 disulf ?   ? DA CYS 206 SG  ? ? ? 1_555 DA CYS 207 SG ? ? d CYS 187 d CYS 188 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf61 disulf ?   ? EA CYS 142 SG  ? ? ? 1_555 EA CYS 155 SG ? ? e CYS 123 e CYS 136 1_555 ? ? ? ? ? ? ? 2.045 ? ?               
disulf62 disulf ?   ? EA CYS 206 SG  ? ? ? 1_555 EA CYS 207 SG ? ? e CYS 187 e CYS 188 1_555 ? ? ? ? ? ? ? 2.052 ? ?               
disulf63 disulf ?   ? FA CYS 142 SG  ? ? ? 1_555 FA CYS 155 SG ? ? f CYS 123 f CYS 136 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf64 disulf ?   ? FA CYS 206 SG  ? ? ? 1_555 FA CYS 207 SG ? ? f CYS 187 f CYS 188 1_555 ? ? ? ? ? ? ? 2.048 ? ?               
disulf65 disulf ?   ? GA CYS 142 SG  ? ? ? 1_555 GA CYS 155 SG ? ? g CYS 123 g CYS 136 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf66 disulf ?   ? GA CYS 206 SG  ? ? ? 1_555 GA CYS 207 SG ? ? g CYS 187 g CYS 188 1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf67 disulf ?   ? HA CYS 142 SG  ? ? ? 1_555 HA CYS 155 SG ? ? h CYS 123 h CYS 136 1_555 ? ? ? ? ? ? ? 2.039 ? ?               
disulf68 disulf ?   ? HA CYS 206 SG  ? ? ? 1_555 HA CYS 207 SG ? ? h CYS 187 h CYS 188 1_555 ? ? ? ? ? ? ? 2.056 ? ?               
disulf69 disulf ?   ? IA CYS 142 SG  ? ? ? 1_555 IA CYS 155 SG ? ? i CYS 123 i CYS 136 1_555 ? ? ? ? ? ? ? 2.036 ? ?               
disulf70 disulf ?   ? IA CYS 206 SG  ? ? ? 1_555 IA CYS 207 SG ? ? i CYS 187 i CYS 188 1_555 ? ? ? ? ? ? ? 2.053 ? ?               
disulf71 disulf ?   ? JA CYS 142 SG  ? ? ? 1_555 JA CYS 155 SG ? ? j CYS 123 j CYS 136 1_555 ? ? ? ? ? ? ? 2.041 ? ?               
disulf72 disulf ?   ? JA CYS 206 SG  ? ? ? 1_555 JA CYS 207 SG ? ? j CYS 187 j CYS 188 1_555 ? ? ? ? ? ? ? 2.788 ? ?               
disulf73 disulf ?   ? KA CYS 142 SG  ? ? ? 1_555 KA CYS 155 SG ? ? k CYS 123 k CYS 136 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf74 disulf ?   ? KA CYS 206 SG  ? ? ? 1_555 KA CYS 207 SG ? ? k CYS 187 k CYS 188 1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf75 disulf ?   ? LA CYS 142 SG  ? ? ? 1_555 LA CYS 155 SG ? ? l CYS 123 l CYS 136 1_555 ? ? ? ? ? ? ? 2.034 ? ?               
disulf76 disulf ?   ? LA CYS 206 SG  ? ? ? 1_555 LA CYS 207 SG ? ? l CYS 187 l CYS 188 1_555 ? ? ? ? ? ? ? 2.042 ? ?               
disulf77 disulf ?   ? MA CYS 142 SG  ? ? ? 1_555 MA CYS 155 SG ? ? m CYS 123 m CYS 136 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf78 disulf ?   ? MA CYS 206 SG  ? ? ? 1_555 MA CYS 207 SG ? ? m CYS 187 m CYS 188 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf79 disulf ?   ? NA CYS 142 SG  ? ? ? 1_555 NA CYS 155 SG ? ? n CYS 123 n CYS 136 1_555 ? ? ? ? ? ? ? 2.035 ? ?               
disulf80 disulf ?   ? NA CYS 206 SG  ? ? ? 1_555 NA CYS 207 SG ? ? n CYS 187 n CYS 188 1_555 ? ? ? ? ? ? ? 2.053 ? ?               
covale1  covale one ? A  ASN 85  ND2 ? ? ? 1_555 PA NAG .   C1 ? ? A ASN 66  A NAG 302 1_555 ? ? ? ? ? ? ? 1.360 ? N-Glycosylation 
covale2  covale one ? O  ASN 85  ND2 ? ? ? 1_555 EB NAG .   C1 ? ? O ASN 66  O NAG 302 1_555 ? ? ? ? ? ? ? 1.453 ? N-Glycosylation 
covale3  covale one ? DA ASN 85  ND2 ? ? ? 1_555 VB NAG .   C1 ? ? d ASN 66  d NAG 302 1_555 ? ? ? ? ? ? ? 1.296 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 6 ? 
AA3 ? 4 ? 
AA4 ? 6 ? 
AA5 ? 6 ? 
AA6 ? 4 ? 
AA7 ? 6 ? 
AA8 ? 6 ? 
AA9 ? 4 ? 
AB1 ? 6 ? 
AB2 ? 6 ? 
AB3 ? 4 ? 
AB4 ? 6 ? 
AB5 ? 6 ? 
AB6 ? 4 ? 
AB7 ? 6 ? 
AB8 ? 6 ? 
AB9 ? 4 ? 
AC1 ? 6 ? 
AC2 ? 6 ? 
AC3 ? 4 ? 
AC4 ? 6 ? 
AC5 ? 6 ? 
AC6 ? 4 ? 
AC7 ? 6 ? 
AC8 ? 6 ? 
AC9 ? 4 ? 
AD1 ? 6 ? 
AD2 ? 6 ? 
AD3 ? 4 ? 
AD4 ? 6 ? 
AD5 ? 6 ? 
AD6 ? 4 ? 
AD7 ? 6 ? 
AD8 ? 6 ? 
AD9 ? 4 ? 
AE1 ? 6 ? 
AE2 ? 6 ? 
AE3 ? 4 ? 
AE4 ? 6 ? 
AE5 ? 6 ? 
AE6 ? 4 ? 
AE7 ? 6 ? 
AE8 ? 6 ? 
AE9 ? 4 ? 
AF1 ? 6 ? 
AF2 ? 6 ? 
AF3 ? 4 ? 
AF4 ? 6 ? 
AF5 ? 6 ? 
AF6 ? 4 ? 
AF7 ? 6 ? 
AF8 ? 6 ? 
AF9 ? 4 ? 
AG1 ? 6 ? 
AG2 ? 6 ? 
AG3 ? 4 ? 
AG4 ? 6 ? 
AG5 ? 6 ? 
AG6 ? 4 ? 
AG7 ? 6 ? 
AG8 ? 6 ? 
AG9 ? 4 ? 
AH1 ? 6 ? 
AH2 ? 6 ? 
AH3 ? 4 ? 
AH4 ? 6 ? 
AH5 ? 6 ? 
AH6 ? 4 ? 
AH7 ? 6 ? 
AH8 ? 6 ? 
AH9 ? 4 ? 
AI1 ? 6 ? 
AI2 ? 6 ? 
AI3 ? 4 ? 
AI4 ? 6 ? 
AI5 ? 6 ? 
AI6 ? 4 ? 
AI7 ? 6 ? 
AI8 ? 6 ? 
AI9 ? 4 ? 
AJ1 ? 6 ? 
AJ2 ? 6 ? 
AJ3 ? 4 ? 
AJ4 ? 6 ? 
AJ5 ? 6 ? 
AJ6 ? 4 ? 
AJ7 ? 6 ? 
AJ8 ? 6 ? 
AJ9 ? 4 ? 
AK1 ? 6 ? 
AK2 ? 6 ? 
AK3 ? 4 ? 
AK4 ? 6 ? 
AK5 ? 6 ? 
AK6 ? 4 ? 
AK7 ? 6 ? 
AK8 ? 6 ? 
AK9 ? 4 ? 
AL1 ? 6 ? 
AL2 ? 6 ? 
AL3 ? 4 ? 
AL4 ? 6 ? 
AL5 ? 6 ? 
AL6 ? 4 ? 
AL7 ? 6 ? 
AL8 ? 6 ? 
AL9 ? 4 ? 
AM1 ? 6 ? 
AM2 ? 6 ? 
AM3 ? 4 ? 
AM4 ? 6 ? 
AM5 ? 6 ? 
AM6 ? 4 ? 
AM7 ? 6 ? 
AM8 ? 6 ? 
AM9 ? 4 ? 
AN1 ? 6 ? 
AN2 ? 6 ? 
AN3 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA1 5 6 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA5 5 6 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA7 5 6 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA8 5 6 ? parallel      
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB1 4 5 ? anti-parallel 
AB1 5 6 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? anti-parallel 
AB2 5 6 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB4 4 5 ? anti-parallel 
AB4 5 6 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB5 4 5 ? anti-parallel 
AB5 5 6 ? parallel      
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB7 4 5 ? anti-parallel 
AB7 5 6 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB8 4 5 ? anti-parallel 
AB8 5 6 ? parallel      
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC1 3 4 ? anti-parallel 
AC1 4 5 ? anti-parallel 
AC1 5 6 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC2 3 4 ? anti-parallel 
AC2 4 5 ? anti-parallel 
AC2 5 6 ? parallel      
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC4 3 4 ? anti-parallel 
AC4 4 5 ? anti-parallel 
AC4 5 6 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? anti-parallel 
AC5 4 5 ? anti-parallel 
AC5 5 6 ? parallel      
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC7 5 6 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC8 3 4 ? anti-parallel 
AC8 4 5 ? anti-parallel 
AC8 5 6 ? parallel      
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AC9 3 4 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD2 2 3 ? anti-parallel 
AD2 3 4 ? anti-parallel 
AD2 4 5 ? anti-parallel 
AD2 5 6 ? parallel      
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD3 3 4 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD4 2 3 ? anti-parallel 
AD4 3 4 ? anti-parallel 
AD4 4 5 ? anti-parallel 
AD4 5 6 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD5 3 4 ? anti-parallel 
AD5 4 5 ? anti-parallel 
AD5 5 6 ? parallel      
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD7 4 5 ? anti-parallel 
AD7 5 6 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD8 2 3 ? anti-parallel 
AD8 3 4 ? anti-parallel 
AD8 4 5 ? anti-parallel 
AD8 5 6 ? parallel      
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE1 2 3 ? anti-parallel 
AE1 3 4 ? anti-parallel 
AE1 4 5 ? anti-parallel 
AE1 5 6 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE2 2 3 ? anti-parallel 
AE2 3 4 ? anti-parallel 
AE2 4 5 ? anti-parallel 
AE2 5 6 ? parallel      
AE3 1 2 ? anti-parallel 
AE3 2 3 ? anti-parallel 
AE3 3 4 ? anti-parallel 
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? anti-parallel 
AE4 4 5 ? anti-parallel 
AE4 5 6 ? anti-parallel 
AE5 1 2 ? anti-parallel 
AE5 2 3 ? anti-parallel 
AE5 3 4 ? anti-parallel 
AE5 4 5 ? anti-parallel 
AE5 5 6 ? parallel      
AE6 1 2 ? anti-parallel 
AE6 2 3 ? anti-parallel 
AE6 3 4 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE7 2 3 ? anti-parallel 
AE7 3 4 ? anti-parallel 
AE7 4 5 ? anti-parallel 
AE7 5 6 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE8 3 4 ? anti-parallel 
AE8 4 5 ? anti-parallel 
AE8 5 6 ? parallel      
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AE9 3 4 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF1 3 4 ? anti-parallel 
AF1 4 5 ? anti-parallel 
AF1 5 6 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? anti-parallel 
AF2 4 5 ? anti-parallel 
AF2 5 6 ? parallel      
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF4 2 3 ? anti-parallel 
AF4 3 4 ? anti-parallel 
AF4 4 5 ? anti-parallel 
AF4 5 6 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF5 3 4 ? anti-parallel 
AF5 4 5 ? anti-parallel 
AF5 5 6 ? parallel      
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF6 3 4 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF7 2 3 ? anti-parallel 
AF7 3 4 ? anti-parallel 
AF7 4 5 ? anti-parallel 
AF7 5 6 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF8 2 3 ? anti-parallel 
AF8 3 4 ? anti-parallel 
AF8 4 5 ? anti-parallel 
AF8 5 6 ? parallel      
AF9 1 2 ? anti-parallel 
AF9 2 3 ? anti-parallel 
AF9 3 4 ? anti-parallel 
AG1 1 2 ? anti-parallel 
AG1 2 3 ? anti-parallel 
AG1 3 4 ? anti-parallel 
AG1 4 5 ? anti-parallel 
AG1 5 6 ? anti-parallel 
AG2 1 2 ? anti-parallel 
AG2 2 3 ? anti-parallel 
AG2 3 4 ? anti-parallel 
AG2 4 5 ? anti-parallel 
AG2 5 6 ? parallel      
AG3 1 2 ? anti-parallel 
AG3 2 3 ? anti-parallel 
AG3 3 4 ? anti-parallel 
AG4 1 2 ? anti-parallel 
AG4 2 3 ? anti-parallel 
AG4 3 4 ? anti-parallel 
AG4 4 5 ? anti-parallel 
AG4 5 6 ? anti-parallel 
AG5 1 2 ? anti-parallel 
AG5 2 3 ? anti-parallel 
AG5 3 4 ? anti-parallel 
AG5 4 5 ? anti-parallel 
AG5 5 6 ? parallel      
AG6 1 2 ? anti-parallel 
AG6 2 3 ? anti-parallel 
AG6 3 4 ? anti-parallel 
AG7 1 2 ? anti-parallel 
AG7 2 3 ? anti-parallel 
AG7 3 4 ? anti-parallel 
AG7 4 5 ? anti-parallel 
AG7 5 6 ? anti-parallel 
AG8 1 2 ? anti-parallel 
AG8 2 3 ? anti-parallel 
AG8 3 4 ? anti-parallel 
AG8 4 5 ? anti-parallel 
AG8 5 6 ? parallel      
AG9 1 2 ? anti-parallel 
AG9 2 3 ? anti-parallel 
AG9 3 4 ? anti-parallel 
AH1 1 2 ? anti-parallel 
AH1 2 3 ? anti-parallel 
AH1 3 4 ? anti-parallel 
AH1 4 5 ? anti-parallel 
AH1 5 6 ? anti-parallel 
AH2 1 2 ? anti-parallel 
AH2 2 3 ? anti-parallel 
AH2 3 4 ? anti-parallel 
AH2 4 5 ? anti-parallel 
AH2 5 6 ? parallel      
AH3 1 2 ? anti-parallel 
AH3 2 3 ? anti-parallel 
AH3 3 4 ? anti-parallel 
AH4 1 2 ? anti-parallel 
AH4 2 3 ? anti-parallel 
AH4 3 4 ? anti-parallel 
AH4 4 5 ? anti-parallel 
AH4 5 6 ? anti-parallel 
AH5 1 2 ? anti-parallel 
AH5 2 3 ? anti-parallel 
AH5 3 4 ? anti-parallel 
AH5 4 5 ? anti-parallel 
AH5 5 6 ? parallel      
AH6 1 2 ? anti-parallel 
AH6 2 3 ? anti-parallel 
AH6 3 4 ? anti-parallel 
AH7 1 2 ? anti-parallel 
AH7 2 3 ? anti-parallel 
AH7 3 4 ? anti-parallel 
AH7 4 5 ? anti-parallel 
AH7 5 6 ? anti-parallel 
AH8 1 2 ? anti-parallel 
AH8 2 3 ? anti-parallel 
AH8 3 4 ? anti-parallel 
AH8 4 5 ? anti-parallel 
AH8 5 6 ? parallel      
AH9 1 2 ? anti-parallel 
AH9 2 3 ? anti-parallel 
AH9 3 4 ? anti-parallel 
AI1 1 2 ? anti-parallel 
AI1 2 3 ? anti-parallel 
AI1 3 4 ? anti-parallel 
AI1 4 5 ? anti-parallel 
AI1 5 6 ? anti-parallel 
AI2 1 2 ? anti-parallel 
AI2 2 3 ? anti-parallel 
AI2 3 4 ? anti-parallel 
AI2 4 5 ? anti-parallel 
AI2 5 6 ? parallel      
AI3 1 2 ? anti-parallel 
AI3 2 3 ? anti-parallel 
AI3 3 4 ? anti-parallel 
AI4 1 2 ? anti-parallel 
AI4 2 3 ? anti-parallel 
AI4 3 4 ? anti-parallel 
AI4 4 5 ? anti-parallel 
AI4 5 6 ? anti-parallel 
AI5 1 2 ? anti-parallel 
AI5 2 3 ? anti-parallel 
AI5 3 4 ? anti-parallel 
AI5 4 5 ? anti-parallel 
AI5 5 6 ? parallel      
AI6 1 2 ? anti-parallel 
AI6 2 3 ? anti-parallel 
AI6 3 4 ? anti-parallel 
AI7 1 2 ? anti-parallel 
AI7 2 3 ? anti-parallel 
AI7 3 4 ? anti-parallel 
AI7 4 5 ? anti-parallel 
AI7 5 6 ? anti-parallel 
AI8 1 2 ? anti-parallel 
AI8 2 3 ? anti-parallel 
AI8 3 4 ? anti-parallel 
AI8 4 5 ? anti-parallel 
AI8 5 6 ? parallel      
AI9 1 2 ? anti-parallel 
AI9 2 3 ? anti-parallel 
AI9 3 4 ? anti-parallel 
AJ1 1 2 ? anti-parallel 
AJ1 2 3 ? anti-parallel 
AJ1 3 4 ? anti-parallel 
AJ1 4 5 ? anti-parallel 
AJ1 5 6 ? anti-parallel 
AJ2 1 2 ? anti-parallel 
AJ2 2 3 ? anti-parallel 
AJ2 3 4 ? anti-parallel 
AJ2 4 5 ? anti-parallel 
AJ2 5 6 ? parallel      
AJ3 1 2 ? anti-parallel 
AJ3 2 3 ? anti-parallel 
AJ3 3 4 ? anti-parallel 
AJ4 1 2 ? anti-parallel 
AJ4 2 3 ? anti-parallel 
AJ4 3 4 ? anti-parallel 
AJ4 4 5 ? anti-parallel 
AJ4 5 6 ? anti-parallel 
AJ5 1 2 ? anti-parallel 
AJ5 2 3 ? anti-parallel 
AJ5 3 4 ? anti-parallel 
AJ5 4 5 ? anti-parallel 
AJ5 5 6 ? parallel      
AJ6 1 2 ? anti-parallel 
AJ6 2 3 ? anti-parallel 
AJ6 3 4 ? anti-parallel 
AJ7 1 2 ? anti-parallel 
AJ7 2 3 ? anti-parallel 
AJ7 3 4 ? anti-parallel 
AJ7 4 5 ? anti-parallel 
AJ7 5 6 ? anti-parallel 
AJ8 1 2 ? anti-parallel 
AJ8 2 3 ? anti-parallel 
AJ8 3 4 ? anti-parallel 
AJ8 4 5 ? anti-parallel 
AJ8 5 6 ? parallel      
AJ9 1 2 ? anti-parallel 
AJ9 2 3 ? anti-parallel 
AJ9 3 4 ? anti-parallel 
AK1 1 2 ? anti-parallel 
AK1 2 3 ? anti-parallel 
AK1 3 4 ? anti-parallel 
AK1 4 5 ? anti-parallel 
AK1 5 6 ? anti-parallel 
AK2 1 2 ? anti-parallel 
AK2 2 3 ? anti-parallel 
AK2 3 4 ? anti-parallel 
AK2 4 5 ? anti-parallel 
AK2 5 6 ? parallel      
AK3 1 2 ? anti-parallel 
AK3 2 3 ? anti-parallel 
AK3 3 4 ? anti-parallel 
AK4 1 2 ? anti-parallel 
AK4 2 3 ? anti-parallel 
AK4 3 4 ? anti-parallel 
AK4 4 5 ? anti-parallel 
AK4 5 6 ? anti-parallel 
AK5 1 2 ? anti-parallel 
AK5 2 3 ? anti-parallel 
AK5 3 4 ? anti-parallel 
AK5 4 5 ? anti-parallel 
AK5 5 6 ? parallel      
AK6 1 2 ? anti-parallel 
AK6 2 3 ? anti-parallel 
AK6 3 4 ? anti-parallel 
AK7 1 2 ? anti-parallel 
AK7 2 3 ? anti-parallel 
AK7 3 4 ? anti-parallel 
AK7 4 5 ? anti-parallel 
AK7 5 6 ? anti-parallel 
AK8 1 2 ? anti-parallel 
AK8 2 3 ? anti-parallel 
AK8 3 4 ? anti-parallel 
AK8 4 5 ? anti-parallel 
AK8 5 6 ? parallel      
AK9 1 2 ? anti-parallel 
AK9 2 3 ? anti-parallel 
AK9 3 4 ? anti-parallel 
AL1 1 2 ? anti-parallel 
AL1 2 3 ? anti-parallel 
AL1 3 4 ? anti-parallel 
AL1 4 5 ? anti-parallel 
AL1 5 6 ? anti-parallel 
AL2 1 2 ? anti-parallel 
AL2 2 3 ? anti-parallel 
AL2 3 4 ? anti-parallel 
AL2 4 5 ? anti-parallel 
AL2 5 6 ? parallel      
AL3 1 2 ? anti-parallel 
AL3 2 3 ? anti-parallel 
AL3 3 4 ? anti-parallel 
AL4 1 2 ? anti-parallel 
AL4 2 3 ? anti-parallel 
AL4 3 4 ? anti-parallel 
AL4 4 5 ? anti-parallel 
AL4 5 6 ? anti-parallel 
AL5 1 2 ? anti-parallel 
AL5 2 3 ? anti-parallel 
AL5 3 4 ? anti-parallel 
AL5 4 5 ? anti-parallel 
AL5 5 6 ? parallel      
AL6 1 2 ? anti-parallel 
AL6 2 3 ? anti-parallel 
AL6 3 4 ? anti-parallel 
AL7 1 2 ? anti-parallel 
AL7 2 3 ? anti-parallel 
AL7 3 4 ? anti-parallel 
AL7 4 5 ? anti-parallel 
AL7 5 6 ? anti-parallel 
AL8 1 2 ? anti-parallel 
AL8 2 3 ? anti-parallel 
AL8 3 4 ? anti-parallel 
AL8 4 5 ? anti-parallel 
AL8 5 6 ? parallel      
AL9 1 2 ? anti-parallel 
AL9 2 3 ? anti-parallel 
AL9 3 4 ? anti-parallel 
AM1 1 2 ? anti-parallel 
AM1 2 3 ? anti-parallel 
AM1 3 4 ? anti-parallel 
AM1 4 5 ? anti-parallel 
AM1 5 6 ? anti-parallel 
AM2 1 2 ? anti-parallel 
AM2 2 3 ? anti-parallel 
AM2 3 4 ? anti-parallel 
AM2 4 5 ? anti-parallel 
AM2 5 6 ? parallel      
AM3 1 2 ? anti-parallel 
AM3 2 3 ? anti-parallel 
AM3 3 4 ? anti-parallel 
AM4 1 2 ? anti-parallel 
AM4 2 3 ? anti-parallel 
AM4 3 4 ? anti-parallel 
AM4 4 5 ? anti-parallel 
AM4 5 6 ? anti-parallel 
AM5 1 2 ? anti-parallel 
AM5 2 3 ? anti-parallel 
AM5 3 4 ? anti-parallel 
AM5 4 5 ? anti-parallel 
AM5 5 6 ? parallel      
AM6 1 2 ? anti-parallel 
AM6 2 3 ? anti-parallel 
AM6 3 4 ? anti-parallel 
AM7 1 2 ? anti-parallel 
AM7 2 3 ? anti-parallel 
AM7 3 4 ? anti-parallel 
AM7 4 5 ? anti-parallel 
AM7 5 6 ? anti-parallel 
AM8 1 2 ? anti-parallel 
AM8 2 3 ? anti-parallel 
AM8 3 4 ? anti-parallel 
AM8 4 5 ? anti-parallel 
AM8 5 6 ? parallel      
AM9 1 2 ? anti-parallel 
AM9 2 3 ? anti-parallel 
AM9 3 4 ? anti-parallel 
AN1 1 2 ? anti-parallel 
AN1 2 3 ? anti-parallel 
AN1 3 4 ? anti-parallel 
AN1 4 5 ? anti-parallel 
AN1 5 6 ? anti-parallel 
AN2 1 2 ? anti-parallel 
AN2 2 3 ? anti-parallel 
AN2 3 4 ? anti-parallel 
AN2 4 5 ? anti-parallel 
AN2 5 6 ? parallel      
AN3 1 2 ? anti-parallel 
AN3 2 3 ? anti-parallel 
AN3 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLN A  92  ? PRO A  96  ? GLN A 73  PRO A 77  
AA1 2 LEU A  121 ? VAL A  125 ? LEU A 102 VAL A 106 
AA1 3 GLU A  129 ? TYR A  132 ? GLU A 110 TYR A 113 
AA1 4 GLU A  66  ? SER A  78  ? GLU A 47  SER A 59  
AA1 5 SER A  135 ? SER A  141 ? SER A 116 SER A 122 
AA1 6 GLU A  115 ? VAL A  116 ? GLU A 96  VAL A 97  
AA2 1 GLN A  92  ? PRO A  96  ? GLN A 73  PRO A 77  
AA2 2 LEU A  121 ? VAL A  125 ? LEU A 102 VAL A 106 
AA2 3 GLU A  129 ? TYR A  132 ? GLU A 110 TYR A 113 
AA2 4 GLU A  66  ? SER A  78  ? GLU A 47  SER A 59  
AA2 5 VAL A  46  ? ILE A  57  ? VAL A 27  ILE A 38  
AA2 6 ILE A  169 ? ASP A  172 ? ILE A 150 ASP A 153 
AA3 1 LEU A  105 ? ALA A  107 ? LEU A 86  ALA A 88  
AA3 2 ALA A  153 ? SER A  161 ? ALA A 134 SER A 142 
AA3 3 ALA A  210 ? LYS A  222 ? ALA A 191 LYS A 203 
AA3 4 PHE A  190 ? THR A  203 ? PHE A 171 THR A 184 
AA4 1 GLN B  92  ? PRO B  96  ? GLN B 73  PRO B 77  
AA4 2 LEU B  121 ? VAL B  125 ? LEU B 102 VAL B 106 
AA4 3 GLU B  129 ? TYR B  132 ? GLU B 110 TYR B 113 
AA4 4 GLU B  66  ? SER B  78  ? GLU B 47  SER B 59  
AA4 5 SER B  135 ? SER B  141 ? SER B 116 SER B 122 
AA4 6 GLU B  115 ? VAL B  116 ? GLU B 96  VAL B 97  
AA5 1 GLN B  92  ? PRO B  96  ? GLN B 73  PRO B 77  
AA5 2 LEU B  121 ? VAL B  125 ? LEU B 102 VAL B 106 
AA5 3 GLU B  129 ? TYR B  132 ? GLU B 110 TYR B 113 
AA5 4 GLU B  66  ? SER B  78  ? GLU B 47  SER B 59  
AA5 5 VAL B  46  ? ASN B  61  ? VAL B 27  ASN B 42  
AA5 6 ILE B  169 ? ASP B  172 ? ILE B 150 ASP B 153 
AA6 1 LEU B  105 ? ALA B  107 ? LEU B 86  ALA B 88  
AA6 2 ALA B  153 ? SER B  161 ? ALA B 134 SER B 142 
AA6 3 ALA B  210 ? LYS B  222 ? ALA B 191 LYS B 203 
AA6 4 PHE B  190 ? THR B  203 ? PHE B 171 THR B 184 
AA7 1 GLN C  92  ? PRO C  96  ? GLN C 73  PRO C 77  
AA7 2 LEU C  121 ? VAL C  125 ? LEU C 102 VAL C 106 
AA7 3 GLU C  129 ? TYR C  132 ? GLU C 110 TYR C 113 
AA7 4 GLU C  66  ? SER C  78  ? GLU C 47  SER C 59  
AA7 5 SER C  135 ? SER C  141 ? SER C 116 SER C 122 
AA7 6 GLU C  115 ? VAL C  116 ? GLU C 96  VAL C 97  
AA8 1 GLN C  92  ? PRO C  96  ? GLN C 73  PRO C 77  
AA8 2 LEU C  121 ? VAL C  125 ? LEU C 102 VAL C 106 
AA8 3 GLU C  129 ? TYR C  132 ? GLU C 110 TYR C 113 
AA8 4 GLU C  66  ? SER C  78  ? GLU C 47  SER C 59  
AA8 5 VAL C  46  ? ASN C  61  ? VAL C 27  ASN C 42  
AA8 6 ILE C  169 ? ASP C  172 ? ILE C 150 ASP C 153 
AA9 1 LEU C  105 ? ALA C  107 ? LEU C 86  ALA C 88  
AA9 2 ALA C  153 ? SER C  161 ? ALA C 134 SER C 142 
AA9 3 ALA C  210 ? LYS C  222 ? ALA C 191 LYS C 203 
AA9 4 PHE C  190 ? THR C  203 ? PHE C 171 THR C 184 
AB1 1 GLN D  92  ? PRO D  96  ? GLN D 73  PRO D 77  
AB1 2 LEU D  121 ? VAL D  125 ? LEU D 102 VAL D 106 
AB1 3 GLU D  129 ? TYR D  132 ? GLU D 110 TYR D 113 
AB1 4 GLU D  66  ? SER D  78  ? GLU D 47  SER D 59  
AB1 5 SER D  135 ? SER D  141 ? SER D 116 SER D 122 
AB1 6 GLU D  115 ? VAL D  116 ? GLU D 96  VAL D 97  
AB2 1 GLN D  92  ? PRO D  96  ? GLN D 73  PRO D 77  
AB2 2 LEU D  121 ? VAL D  125 ? LEU D 102 VAL D 106 
AB2 3 GLU D  129 ? TYR D  132 ? GLU D 110 TYR D 113 
AB2 4 GLU D  66  ? SER D  78  ? GLU D 47  SER D 59  
AB2 5 VAL D  46  ? ASN D  61  ? VAL D 27  ASN D 42  
AB2 6 ILE D  169 ? ASP D  172 ? ILE D 150 ASP D 153 
AB3 1 LEU D  105 ? ALA D  107 ? LEU D 86  ALA D 88  
AB3 2 ALA D  153 ? SER D  161 ? ALA D 134 SER D 142 
AB3 3 ALA D  210 ? LYS D  222 ? ALA D 191 LYS D 203 
AB3 4 PHE D  190 ? THR D  203 ? PHE D 171 THR D 184 
AB4 1 GLN E  92  ? PRO E  96  ? GLN E 73  PRO E 77  
AB4 2 LEU E  121 ? VAL E  125 ? LEU E 102 VAL E 106 
AB4 3 GLU E  129 ? TYR E  132 ? GLU E 110 TYR E 113 
AB4 4 GLU E  66  ? SER E  78  ? GLU E 47  SER E 59  
AB4 5 SER E  135 ? SER E  141 ? SER E 116 SER E 122 
AB4 6 GLU E  115 ? VAL E  116 ? GLU E 96  VAL E 97  
AB5 1 GLN E  92  ? PRO E  96  ? GLN E 73  PRO E 77  
AB5 2 LEU E  121 ? VAL E  125 ? LEU E 102 VAL E 106 
AB5 3 GLU E  129 ? TYR E  132 ? GLU E 110 TYR E 113 
AB5 4 GLU E  66  ? SER E  78  ? GLU E 47  SER E 59  
AB5 5 VAL E  46  ? ASN E  61  ? VAL E 27  ASN E 42  
AB5 6 ILE E  169 ? ASP E  172 ? ILE E 150 ASP E 153 
AB6 1 LEU E  105 ? ALA E  107 ? LEU E 86  ALA E 88  
AB6 2 ALA E  153 ? SER E  161 ? ALA E 134 SER E 142 
AB6 3 ALA E  210 ? LYS E  222 ? ALA E 191 LYS E 203 
AB6 4 PHE E  190 ? THR E  203 ? PHE E 171 THR E 184 
AB7 1 GLN F  92  ? PRO F  96  ? GLN F 73  PRO F 77  
AB7 2 LEU F  121 ? VAL F  125 ? LEU F 102 VAL F 106 
AB7 3 GLU F  129 ? TYR F  132 ? GLU F 110 TYR F 113 
AB7 4 GLU F  66  ? SER F  78  ? GLU F 47  SER F 59  
AB7 5 SER F  135 ? SER F  141 ? SER F 116 SER F 122 
AB7 6 GLU F  115 ? VAL F  116 ? GLU F 96  VAL F 97  
AB8 1 GLN F  92  ? PRO F  96  ? GLN F 73  PRO F 77  
AB8 2 LEU F  121 ? VAL F  125 ? LEU F 102 VAL F 106 
AB8 3 GLU F  129 ? TYR F  132 ? GLU F 110 TYR F 113 
AB8 4 GLU F  66  ? SER F  78  ? GLU F 47  SER F 59  
AB8 5 VAL F  46  ? ILE F  57  ? VAL F 27  ILE F 38  
AB8 6 ILE F  169 ? ASP F  172 ? ILE F 150 ASP F 153 
AB9 1 LEU F  105 ? ALA F  107 ? LEU F 86  ALA F 88  
AB9 2 ALA F  153 ? SER F  161 ? ALA F 134 SER F 142 
AB9 3 ALA F  210 ? LYS F  222 ? ALA F 191 LYS F 203 
AB9 4 PHE F  190 ? THR F  203 ? PHE F 171 THR F 184 
AC1 1 GLN G  92  ? PRO G  96  ? GLN G 73  PRO G 77  
AC1 2 LEU G  121 ? VAL G  125 ? LEU G 102 VAL G 106 
AC1 3 GLU G  129 ? TYR G  132 ? GLU G 110 TYR G 113 
AC1 4 GLU G  66  ? SER G  78  ? GLU G 47  SER G 59  
AC1 5 SER G  135 ? SER G  141 ? SER G 116 SER G 122 
AC1 6 GLU G  115 ? VAL G  116 ? GLU G 96  VAL G 97  
AC2 1 GLN G  92  ? PRO G  96  ? GLN G 73  PRO G 77  
AC2 2 LEU G  121 ? VAL G  125 ? LEU G 102 VAL G 106 
AC2 3 GLU G  129 ? TYR G  132 ? GLU G 110 TYR G 113 
AC2 4 GLU G  66  ? SER G  78  ? GLU G 47  SER G 59  
AC2 5 VAL G  46  ? ASN G  61  ? VAL G 27  ASN G 42  
AC2 6 ILE G  169 ? ASP G  172 ? ILE G 150 ASP G 153 
AC3 1 LEU G  105 ? ALA G  107 ? LEU G 86  ALA G 88  
AC3 2 ALA G  153 ? SER G  161 ? ALA G 134 SER G 142 
AC3 3 ALA G  210 ? LYS G  222 ? ALA G 191 LYS G 203 
AC3 4 PHE G  190 ? THR G  203 ? PHE G 171 THR G 184 
AC4 1 GLN H  92  ? PRO H  96  ? GLN H 73  PRO H 77  
AC4 2 LEU H  121 ? VAL H  125 ? LEU H 102 VAL H 106 
AC4 3 GLU H  129 ? TYR H  132 ? GLU H 110 TYR H 113 
AC4 4 GLU H  66  ? SER H  78  ? GLU H 47  SER H 59  
AC4 5 SER H  135 ? SER H  141 ? SER H 116 SER H 122 
AC4 6 GLU H  115 ? VAL H  116 ? GLU H 96  VAL H 97  
AC5 1 GLN H  92  ? PRO H  96  ? GLN H 73  PRO H 77  
AC5 2 LEU H  121 ? VAL H  125 ? LEU H 102 VAL H 106 
AC5 3 GLU H  129 ? TYR H  132 ? GLU H 110 TYR H 113 
AC5 4 GLU H  66  ? SER H  78  ? GLU H 47  SER H 59  
AC5 5 VAL H  46  ? ILE H  57  ? VAL H 27  ILE H 38  
AC5 6 ILE H  169 ? ASP H  172 ? ILE H 150 ASP H 153 
AC6 1 LEU H  105 ? ALA H  107 ? LEU H 86  ALA H 88  
AC6 2 ALA H  153 ? SER H  161 ? ALA H 134 SER H 142 
AC6 3 ALA H  210 ? LYS H  222 ? ALA H 191 LYS H 203 
AC6 4 PHE H  190 ? THR H  203 ? PHE H 171 THR H 184 
AC7 1 GLN I  92  ? PRO I  96  ? GLN I 73  PRO I 77  
AC7 2 LEU I  121 ? VAL I  125 ? LEU I 102 VAL I 106 
AC7 3 GLU I  129 ? TYR I  132 ? GLU I 110 TYR I 113 
AC7 4 GLU I  66  ? SER I  78  ? GLU I 47  SER I 59  
AC7 5 SER I  135 ? SER I  141 ? SER I 116 SER I 122 
AC7 6 GLU I  115 ? VAL I  116 ? GLU I 96  VAL I 97  
AC8 1 GLN I  92  ? PRO I  96  ? GLN I 73  PRO I 77  
AC8 2 LEU I  121 ? VAL I  125 ? LEU I 102 VAL I 106 
AC8 3 GLU I  129 ? TYR I  132 ? GLU I 110 TYR I 113 
AC8 4 GLU I  66  ? SER I  78  ? GLU I 47  SER I 59  
AC8 5 VAL I  46  ? ILE I  57  ? VAL I 27  ILE I 38  
AC8 6 ILE I  169 ? ASP I  172 ? ILE I 150 ASP I 153 
AC9 1 LEU I  105 ? ALA I  107 ? LEU I 86  ALA I 88  
AC9 2 ALA I  153 ? SER I  161 ? ALA I 134 SER I 142 
AC9 3 ALA I  210 ? LYS I  222 ? ALA I 191 LYS I 203 
AC9 4 PHE I  190 ? THR I  203 ? PHE I 171 THR I 184 
AD1 1 GLN J  92  ? PRO J  96  ? GLN J 73  PRO J 77  
AD1 2 LEU J  121 ? VAL J  125 ? LEU J 102 VAL J 106 
AD1 3 GLU J  129 ? TYR J  132 ? GLU J 110 TYR J 113 
AD1 4 GLU J  66  ? SER J  78  ? GLU J 47  SER J 59  
AD1 5 SER J  135 ? SER J  141 ? SER J 116 SER J 122 
AD1 6 GLU J  115 ? VAL J  116 ? GLU J 96  VAL J 97  
AD2 1 GLN J  92  ? PRO J  96  ? GLN J 73  PRO J 77  
AD2 2 LEU J  121 ? VAL J  125 ? LEU J 102 VAL J 106 
AD2 3 GLU J  129 ? TYR J  132 ? GLU J 110 TYR J 113 
AD2 4 GLU J  66  ? SER J  78  ? GLU J 47  SER J 59  
AD2 5 VAL J  46  ? ASN J  61  ? VAL J 27  ASN J 42  
AD2 6 ILE J  169 ? ASP J  172 ? ILE J 150 ASP J 153 
AD3 1 LEU J  105 ? ALA J  107 ? LEU J 86  ALA J 88  
AD3 2 ALA J  153 ? SER J  161 ? ALA J 134 SER J 142 
AD3 3 ALA J  210 ? LYS J  222 ? ALA J 191 LYS J 203 
AD3 4 PHE J  190 ? THR J  203 ? PHE J 171 THR J 184 
AD4 1 GLN K  92  ? PRO K  96  ? GLN K 73  PRO K 77  
AD4 2 LEU K  121 ? VAL K  125 ? LEU K 102 VAL K 106 
AD4 3 GLU K  129 ? TYR K  132 ? GLU K 110 TYR K 113 
AD4 4 GLU K  66  ? SER K  78  ? GLU K 47  SER K 59  
AD4 5 SER K  135 ? SER K  141 ? SER K 116 SER K 122 
AD4 6 GLU K  115 ? VAL K  116 ? GLU K 96  VAL K 97  
AD5 1 GLN K  92  ? PRO K  96  ? GLN K 73  PRO K 77  
AD5 2 LEU K  121 ? VAL K  125 ? LEU K 102 VAL K 106 
AD5 3 GLU K  129 ? TYR K  132 ? GLU K 110 TYR K 113 
AD5 4 GLU K  66  ? SER K  78  ? GLU K 47  SER K 59  
AD5 5 VAL K  46  ? ASN K  61  ? VAL K 27  ASN K 42  
AD5 6 ILE K  169 ? ASP K  172 ? ILE K 150 ASP K 153 
AD6 1 LEU K  105 ? ALA K  107 ? LEU K 86  ALA K 88  
AD6 2 ALA K  153 ? SER K  161 ? ALA K 134 SER K 142 
AD6 3 ALA K  210 ? LYS K  222 ? ALA K 191 LYS K 203 
AD6 4 PHE K  190 ? THR K  203 ? PHE K 171 THR K 184 
AD7 1 GLN L  92  ? PRO L  96  ? GLN L 73  PRO L 77  
AD7 2 LEU L  121 ? VAL L  125 ? LEU L 102 VAL L 106 
AD7 3 GLU L  129 ? TYR L  132 ? GLU L 110 TYR L 113 
AD7 4 GLU L  66  ? SER L  78  ? GLU L 47  SER L 59  
AD7 5 SER L  135 ? SER L  141 ? SER L 116 SER L 122 
AD7 6 GLU L  115 ? VAL L  116 ? GLU L 96  VAL L 97  
AD8 1 GLN L  92  ? PRO L  96  ? GLN L 73  PRO L 77  
AD8 2 LEU L  121 ? VAL L  125 ? LEU L 102 VAL L 106 
AD8 3 GLU L  129 ? TYR L  132 ? GLU L 110 TYR L 113 
AD8 4 GLU L  66  ? SER L  78  ? GLU L 47  SER L 59  
AD8 5 VAL L  46  ? ILE L  57  ? VAL L 27  ILE L 38  
AD8 6 ILE L  169 ? ASP L  172 ? ILE L 150 ASP L 153 
AD9 1 LEU L  105 ? ALA L  107 ? LEU L 86  ALA L 88  
AD9 2 ALA L  153 ? SER L  161 ? ALA L 134 SER L 142 
AD9 3 ALA L  210 ? LYS L  222 ? ALA L 191 LYS L 203 
AD9 4 PHE L  190 ? THR L  203 ? PHE L 171 THR L 184 
AE1 1 GLN M  92  ? PRO M  96  ? GLN M 73  PRO M 77  
AE1 2 LEU M  121 ? VAL M  125 ? LEU M 102 VAL M 106 
AE1 3 GLU M  129 ? TYR M  132 ? GLU M 110 TYR M 113 
AE1 4 GLU M  66  ? SER M  78  ? GLU M 47  SER M 59  
AE1 5 SER M  135 ? SER M  141 ? SER M 116 SER M 122 
AE1 6 GLU M  115 ? VAL M  116 ? GLU M 96  VAL M 97  
AE2 1 GLN M  92  ? PRO M  96  ? GLN M 73  PRO M 77  
AE2 2 LEU M  121 ? VAL M  125 ? LEU M 102 VAL M 106 
AE2 3 GLU M  129 ? TYR M  132 ? GLU M 110 TYR M 113 
AE2 4 GLU M  66  ? SER M  78  ? GLU M 47  SER M 59  
AE2 5 VAL M  46  ? ILE M  57  ? VAL M 27  ILE M 38  
AE2 6 ILE M  169 ? ASP M  172 ? ILE M 150 ASP M 153 
AE3 1 LEU M  105 ? ALA M  107 ? LEU M 86  ALA M 88  
AE3 2 ALA M  153 ? SER M  161 ? ALA M 134 SER M 142 
AE3 3 ALA M  210 ? LYS M  222 ? ALA M 191 LYS M 203 
AE3 4 PHE M  190 ? THR M  203 ? PHE M 171 THR M 184 
AE4 1 GLN N  92  ? PRO N  96  ? GLN N 73  PRO N 77  
AE4 2 LEU N  121 ? VAL N  125 ? LEU N 102 VAL N 106 
AE4 3 GLU N  129 ? TYR N  132 ? GLU N 110 TYR N 113 
AE4 4 GLU N  66  ? SER N  78  ? GLU N 47  SER N 59  
AE4 5 SER N  135 ? SER N  141 ? SER N 116 SER N 122 
AE4 6 GLU N  115 ? VAL N  116 ? GLU N 96  VAL N 97  
AE5 1 GLN N  92  ? PRO N  96  ? GLN N 73  PRO N 77  
AE5 2 LEU N  121 ? VAL N  125 ? LEU N 102 VAL N 106 
AE5 3 GLU N  129 ? TYR N  132 ? GLU N 110 TYR N 113 
AE5 4 GLU N  66  ? SER N  78  ? GLU N 47  SER N 59  
AE5 5 VAL N  46  ? ILE N  57  ? VAL N 27  ILE N 38  
AE5 6 ILE N  169 ? ASP N  172 ? ILE N 150 ASP N 153 
AE6 1 LEU N  105 ? ALA N  107 ? LEU N 86  ALA N 88  
AE6 2 ALA N  153 ? SER N  161 ? ALA N 134 SER N 142 
AE6 3 ALA N  210 ? LYS N  222 ? ALA N 191 LYS N 203 
AE6 4 PHE N  190 ? THR N  203 ? PHE N 171 THR N 184 
AE7 1 GLN O  92  ? PRO O  96  ? GLN O 73  PRO O 77  
AE7 2 LEU O  121 ? VAL O  125 ? LEU O 102 VAL O 106 
AE7 3 GLU O  129 ? TYR O  132 ? GLU O 110 TYR O 113 
AE7 4 GLU O  66  ? SER O  78  ? GLU O 47  SER O 59  
AE7 5 SER O  135 ? SER O  141 ? SER O 116 SER O 122 
AE7 6 GLU O  115 ? VAL O  116 ? GLU O 96  VAL O 97  
AE8 1 GLN O  92  ? PRO O  96  ? GLN O 73  PRO O 77  
AE8 2 LEU O  121 ? VAL O  125 ? LEU O 102 VAL O 106 
AE8 3 GLU O  129 ? TYR O  132 ? GLU O 110 TYR O 113 
AE8 4 GLU O  66  ? SER O  78  ? GLU O 47  SER O 59  
AE8 5 VAL O  46  ? ASN O  61  ? VAL O 27  ASN O 42  
AE8 6 ILE O  169 ? ASP O  172 ? ILE O 150 ASP O 153 
AE9 1 LEU O  105 ? ALA O  107 ? LEU O 86  ALA O 88  
AE9 2 ALA O  153 ? SER O  161 ? ALA O 134 SER O 142 
AE9 3 ALA O  210 ? LYS O  222 ? ALA O 191 LYS O 203 
AE9 4 PHE O  190 ? THR O  203 ? PHE O 171 THR O 184 
AF1 1 GLN P  91  ? PRO P  95  ? GLN P 73  PRO P 77  
AF1 2 LEU P  120 ? VAL P  124 ? LEU P 102 VAL P 106 
AF1 3 GLU P  128 ? TYR P  131 ? GLU P 110 TYR P 113 
AF1 4 GLU P  65  ? SER P  77  ? GLU P 47  SER P 59  
AF1 5 SER P  134 ? SER P  140 ? SER P 116 SER P 122 
AF1 6 GLU P  114 ? VAL P  115 ? GLU P 96  VAL P 97  
AF2 1 GLN P  91  ? PRO P  95  ? GLN P 73  PRO P 77  
AF2 2 LEU P  120 ? VAL P  124 ? LEU P 102 VAL P 106 
AF2 3 GLU P  128 ? TYR P  131 ? GLU P 110 TYR P 113 
AF2 4 GLU P  65  ? SER P  77  ? GLU P 47  SER P 59  
AF2 5 VAL P  45  ? ILE P  56  ? VAL P 27  ILE P 38  
AF2 6 ILE P  168 ? ASP P  171 ? ILE P 150 ASP P 153 
AF3 1 LEU P  104 ? ALA P  106 ? LEU P 86  ALA P 88  
AF3 2 ALA P  152 ? SER P  160 ? ALA P 134 SER P 142 
AF3 3 ALA P  209 ? LYS P  221 ? ALA P 191 LYS P 203 
AF3 4 PHE P  189 ? THR P  202 ? PHE P 171 THR P 184 
AF4 1 GLN Q  92  ? PRO Q  96  ? GLN Q 73  PRO Q 77  
AF4 2 LEU Q  121 ? VAL Q  125 ? LEU Q 102 VAL Q 106 
AF4 3 GLU Q  129 ? TYR Q  132 ? GLU Q 110 TYR Q 113 
AF4 4 GLU Q  66  ? SER Q  78  ? GLU Q 47  SER Q 59  
AF4 5 SER Q  135 ? SER Q  141 ? SER Q 116 SER Q 122 
AF4 6 GLU Q  115 ? VAL Q  116 ? GLU Q 96  VAL Q 97  
AF5 1 GLN Q  92  ? PRO Q  96  ? GLN Q 73  PRO Q 77  
AF5 2 LEU Q  121 ? VAL Q  125 ? LEU Q 102 VAL Q 106 
AF5 3 GLU Q  129 ? TYR Q  132 ? GLU Q 110 TYR Q 113 
AF5 4 GLU Q  66  ? SER Q  78  ? GLU Q 47  SER Q 59  
AF5 5 VAL Q  46  ? ILE Q  57  ? VAL Q 27  ILE Q 38  
AF5 6 ILE Q  169 ? ASP Q  172 ? ILE Q 150 ASP Q 153 
AF6 1 LEU Q  105 ? ALA Q  107 ? LEU Q 86  ALA Q 88  
AF6 2 ALA Q  153 ? SER Q  161 ? ALA Q 134 SER Q 142 
AF6 3 ALA Q  210 ? LYS Q  222 ? ALA Q 191 LYS Q 203 
AF6 4 PHE Q  190 ? THR Q  203 ? PHE Q 171 THR Q 184 
AF7 1 GLN R  92  ? PRO R  96  ? GLN R 73  PRO R 77  
AF7 2 LEU R  121 ? VAL R  125 ? LEU R 102 VAL R 106 
AF7 3 GLU R  129 ? TYR R  132 ? GLU R 110 TYR R 113 
AF7 4 GLU R  66  ? SER R  78  ? GLU R 47  SER R 59  
AF7 5 SER R  135 ? SER R  141 ? SER R 116 SER R 122 
AF7 6 GLU R  115 ? VAL R  116 ? GLU R 96  VAL R 97  
AF8 1 GLN R  92  ? PRO R  96  ? GLN R 73  PRO R 77  
AF8 2 LEU R  121 ? VAL R  125 ? LEU R 102 VAL R 106 
AF8 3 GLU R  129 ? TYR R  132 ? GLU R 110 TYR R 113 
AF8 4 GLU R  66  ? SER R  78  ? GLU R 47  SER R 59  
AF8 5 VAL R  46  ? ASN R  61  ? VAL R 27  ASN R 42  
AF8 6 ILE R  169 ? ASP R  172 ? ILE R 150 ASP R 153 
AF9 1 LEU R  105 ? ALA R  107 ? LEU R 86  ALA R 88  
AF9 2 ALA R  153 ? SER R  161 ? ALA R 134 SER R 142 
AF9 3 ALA R  210 ? LYS R  222 ? ALA R 191 LYS R 203 
AF9 4 PHE R  190 ? THR R  203 ? PHE R 171 THR R 184 
AG1 1 GLN S  92  ? PRO S  96  ? GLN S 73  PRO S 77  
AG1 2 LEU S  121 ? VAL S  125 ? LEU S 102 VAL S 106 
AG1 3 GLU S  129 ? TYR S  132 ? GLU S 110 TYR S 113 
AG1 4 GLU S  66  ? SER S  78  ? GLU S 47  SER S 59  
AG1 5 SER S  135 ? SER S  141 ? SER S 116 SER S 122 
AG1 6 GLU S  115 ? VAL S  116 ? GLU S 96  VAL S 97  
AG2 1 GLN S  92  ? PRO S  96  ? GLN S 73  PRO S 77  
AG2 2 LEU S  121 ? VAL S  125 ? LEU S 102 VAL S 106 
AG2 3 GLU S  129 ? TYR S  132 ? GLU S 110 TYR S 113 
AG2 4 GLU S  66  ? SER S  78  ? GLU S 47  SER S 59  
AG2 5 VAL S  46  ? ILE S  57  ? VAL S 27  ILE S 38  
AG2 6 ILE S  169 ? ASP S  172 ? ILE S 150 ASP S 153 
AG3 1 LEU S  105 ? ALA S  107 ? LEU S 86  ALA S 88  
AG3 2 ALA S  153 ? SER S  161 ? ALA S 134 SER S 142 
AG3 3 ALA S  210 ? LYS S  222 ? ALA S 191 LYS S 203 
AG3 4 PHE S  190 ? THR S  203 ? PHE S 171 THR S 184 
AG4 1 GLN T  92  ? PRO T  96  ? GLN T 73  PRO T 77  
AG4 2 LEU T  121 ? VAL T  125 ? LEU T 102 VAL T 106 
AG4 3 GLU T  129 ? TYR T  132 ? GLU T 110 TYR T 113 
AG4 4 GLU T  66  ? SER T  78  ? GLU T 47  SER T 59  
AG4 5 SER T  135 ? SER T  141 ? SER T 116 SER T 122 
AG4 6 GLU T  115 ? VAL T  116 ? GLU T 96  VAL T 97  
AG5 1 GLN T  92  ? PRO T  96  ? GLN T 73  PRO T 77  
AG5 2 LEU T  121 ? VAL T  125 ? LEU T 102 VAL T 106 
AG5 3 GLU T  129 ? TYR T  132 ? GLU T 110 TYR T 113 
AG5 4 GLU T  66  ? SER T  78  ? GLU T 47  SER T 59  
AG5 5 VAL T  46  ? ASN T  61  ? VAL T 27  ASN T 42  
AG5 6 ILE T  169 ? ASP T  172 ? ILE T 150 ASP T 153 
AG6 1 LEU T  105 ? ALA T  107 ? LEU T 86  ALA T 88  
AG6 2 ALA T  153 ? SER T  161 ? ALA T 134 SER T 142 
AG6 3 ALA T  210 ? LYS T  222 ? ALA T 191 LYS T 203 
AG6 4 PHE T  190 ? THR T  203 ? PHE T 171 THR T 184 
AG7 1 GLN U  92  ? PRO U  96  ? GLN U 73  PRO U 77  
AG7 2 LEU U  121 ? VAL U  125 ? LEU U 102 VAL U 106 
AG7 3 GLU U  129 ? TYR U  132 ? GLU U 110 TYR U 113 
AG7 4 GLU U  66  ? SER U  78  ? GLU U 47  SER U 59  
AG7 5 SER U  135 ? SER U  141 ? SER U 116 SER U 122 
AG7 6 GLU U  115 ? VAL U  116 ? GLU U 96  VAL U 97  
AG8 1 GLN U  92  ? PRO U  96  ? GLN U 73  PRO U 77  
AG8 2 LEU U  121 ? VAL U  125 ? LEU U 102 VAL U 106 
AG8 3 GLU U  129 ? TYR U  132 ? GLU U 110 TYR U 113 
AG8 4 GLU U  66  ? SER U  78  ? GLU U 47  SER U 59  
AG8 5 VAL U  46  ? ASN U  61  ? VAL U 27  ASN U 42  
AG8 6 ILE U  169 ? ASP U  172 ? ILE U 150 ASP U 153 
AG9 1 LEU U  105 ? ALA U  107 ? LEU U 86  ALA U 88  
AG9 2 ALA U  153 ? SER U  161 ? ALA U 134 SER U 142 
AG9 3 ALA U  210 ? LYS U  222 ? ALA U 191 LYS U 203 
AG9 4 PHE U  190 ? THR U  203 ? PHE U 171 THR U 184 
AH1 1 GLN V  92  ? PRO V  96  ? GLN V 73  PRO V 77  
AH1 2 LEU V  121 ? VAL V  125 ? LEU V 102 VAL V 106 
AH1 3 GLU V  129 ? TYR V  132 ? GLU V 110 TYR V 113 
AH1 4 GLU V  66  ? SER V  78  ? GLU V 47  SER V 59  
AH1 5 SER V  135 ? SER V  141 ? SER V 116 SER V 122 
AH1 6 GLU V  115 ? VAL V  116 ? GLU V 96  VAL V 97  
AH2 1 GLN V  92  ? PRO V  96  ? GLN V 73  PRO V 77  
AH2 2 LEU V  121 ? VAL V  125 ? LEU V 102 VAL V 106 
AH2 3 GLU V  129 ? TYR V  132 ? GLU V 110 TYR V 113 
AH2 4 GLU V  66  ? SER V  78  ? GLU V 47  SER V 59  
AH2 5 VAL V  46  ? ASN V  61  ? VAL V 27  ASN V 42  
AH2 6 ILE V  169 ? ASP V  172 ? ILE V 150 ASP V 153 
AH3 1 LEU V  105 ? ALA V  107 ? LEU V 86  ALA V 88  
AH3 2 ALA V  153 ? SER V  161 ? ALA V 134 SER V 142 
AH3 3 ALA V  210 ? LYS V  222 ? ALA V 191 LYS V 203 
AH3 4 PHE V  190 ? THR V  203 ? PHE V 171 THR V 184 
AH4 1 GLN W  92  ? PRO W  96  ? GLN W 73  PRO W 77  
AH4 2 LEU W  121 ? VAL W  125 ? LEU W 102 VAL W 106 
AH4 3 GLU W  129 ? TYR W  132 ? GLU W 110 TYR W 113 
AH4 4 GLU W  66  ? SER W  78  ? GLU W 47  SER W 59  
AH4 5 SER W  135 ? SER W  141 ? SER W 116 SER W 122 
AH4 6 GLU W  115 ? VAL W  116 ? GLU W 96  VAL W 97  
AH5 1 GLN W  92  ? PRO W  96  ? GLN W 73  PRO W 77  
AH5 2 LEU W  121 ? VAL W  125 ? LEU W 102 VAL W 106 
AH5 3 GLU W  129 ? TYR W  132 ? GLU W 110 TYR W 113 
AH5 4 GLU W  66  ? SER W  78  ? GLU W 47  SER W 59  
AH5 5 VAL W  46  ? ILE W  57  ? VAL W 27  ILE W 38  
AH5 6 ILE W  169 ? ASP W  172 ? ILE W 150 ASP W 153 
AH6 1 LEU W  105 ? ALA W  107 ? LEU W 86  ALA W 88  
AH6 2 ALA W  153 ? SER W  161 ? ALA W 134 SER W 142 
AH6 3 ALA W  210 ? LYS W  222 ? ALA W 191 LYS W 203 
AH6 4 PHE W  190 ? THR W  203 ? PHE W 171 THR W 184 
AH7 1 GLN X  92  ? PRO X  96  ? GLN X 73  PRO X 77  
AH7 2 LEU X  121 ? VAL X  125 ? LEU X 102 VAL X 106 
AH7 3 GLU X  129 ? TYR X  132 ? GLU X 110 TYR X 113 
AH7 4 GLU X  66  ? SER X  78  ? GLU X 47  SER X 59  
AH7 5 SER X  135 ? SER X  141 ? SER X 116 SER X 122 
AH7 6 GLU X  115 ? VAL X  116 ? GLU X 96  VAL X 97  
AH8 1 GLN X  92  ? PRO X  96  ? GLN X 73  PRO X 77  
AH8 2 LEU X  121 ? VAL X  125 ? LEU X 102 VAL X 106 
AH8 3 GLU X  129 ? TYR X  132 ? GLU X 110 TYR X 113 
AH8 4 GLU X  66  ? SER X  78  ? GLU X 47  SER X 59  
AH8 5 VAL X  46  ? ILE X  57  ? VAL X 27  ILE X 38  
AH8 6 ILE X  169 ? ASP X  172 ? ILE X 150 ASP X 153 
AH9 1 LEU X  105 ? ALA X  107 ? LEU X 86  ALA X 88  
AH9 2 ALA X  153 ? SER X  161 ? ALA X 134 SER X 142 
AH9 3 ALA X  210 ? LYS X  222 ? ALA X 191 LYS X 203 
AH9 4 PHE X  190 ? THR X  203 ? PHE X 171 THR X 184 
AI1 1 GLN Y  92  ? PRO Y  96  ? GLN Y 73  PRO Y 77  
AI1 2 LEU Y  121 ? VAL Y  125 ? LEU Y 102 VAL Y 106 
AI1 3 GLU Y  129 ? TYR Y  132 ? GLU Y 110 TYR Y 113 
AI1 4 GLU Y  66  ? SER Y  78  ? GLU Y 47  SER Y 59  
AI1 5 SER Y  135 ? SER Y  141 ? SER Y 116 SER Y 122 
AI1 6 GLU Y  115 ? VAL Y  116 ? GLU Y 96  VAL Y 97  
AI2 1 GLN Y  92  ? PRO Y  96  ? GLN Y 73  PRO Y 77  
AI2 2 LEU Y  121 ? VAL Y  125 ? LEU Y 102 VAL Y 106 
AI2 3 GLU Y  129 ? TYR Y  132 ? GLU Y 110 TYR Y 113 
AI2 4 GLU Y  66  ? SER Y  78  ? GLU Y 47  SER Y 59  
AI2 5 VAL Y  46  ? ILE Y  57  ? VAL Y 27  ILE Y 38  
AI2 6 ILE Y  169 ? ASP Y  172 ? ILE Y 150 ASP Y 153 
AI3 1 LEU Y  105 ? ALA Y  107 ? LEU Y 86  ALA Y 88  
AI3 2 ALA Y  153 ? SER Y  161 ? ALA Y 134 SER Y 142 
AI3 3 ALA Y  210 ? LYS Y  222 ? ALA Y 191 LYS Y 203 
AI3 4 PHE Y  190 ? THR Y  203 ? PHE Y 171 THR Y 184 
AI4 1 GLN Z  92  ? PRO Z  96  ? GLN Z 73  PRO Z 77  
AI4 2 LEU Z  121 ? VAL Z  125 ? LEU Z 102 VAL Z 106 
AI4 3 GLU Z  129 ? TYR Z  132 ? GLU Z 110 TYR Z 113 
AI4 4 GLU Z  66  ? SER Z  78  ? GLU Z 47  SER Z 59  
AI4 5 SER Z  135 ? SER Z  141 ? SER Z 116 SER Z 122 
AI4 6 GLU Z  115 ? VAL Z  116 ? GLU Z 96  VAL Z 97  
AI5 1 GLN Z  92  ? PRO Z  96  ? GLN Z 73  PRO Z 77  
AI5 2 LEU Z  121 ? VAL Z  125 ? LEU Z 102 VAL Z 106 
AI5 3 GLU Z  129 ? TYR Z  132 ? GLU Z 110 TYR Z 113 
AI5 4 GLU Z  66  ? SER Z  78  ? GLU Z 47  SER Z 59  
AI5 5 VAL Z  46  ? ILE Z  57  ? VAL Z 27  ILE Z 38  
AI5 6 ILE Z  169 ? ASP Z  172 ? ILE Z 150 ASP Z 153 
AI6 1 LEU Z  105 ? ALA Z  107 ? LEU Z 86  ALA Z 88  
AI6 2 ALA Z  153 ? SER Z  161 ? ALA Z 134 SER Z 142 
AI6 3 ALA Z  210 ? LYS Z  222 ? ALA Z 191 LYS Z 203 
AI6 4 PHE Z  190 ? THR Z  203 ? PHE Z 171 THR Z 184 
AI7 1 GLN AA 92  ? PRO AA 96  ? GLN a 73  PRO a 77  
AI7 2 LEU AA 121 ? VAL AA 125 ? LEU a 102 VAL a 106 
AI7 3 GLU AA 129 ? TYR AA 132 ? GLU a 110 TYR a 113 
AI7 4 GLU AA 66  ? SER AA 78  ? GLU a 47  SER a 59  
AI7 5 SER AA 135 ? SER AA 141 ? SER a 116 SER a 122 
AI7 6 GLU AA 115 ? VAL AA 116 ? GLU a 96  VAL a 97  
AI8 1 GLN AA 92  ? PRO AA 96  ? GLN a 73  PRO a 77  
AI8 2 LEU AA 121 ? VAL AA 125 ? LEU a 102 VAL a 106 
AI8 3 GLU AA 129 ? TYR AA 132 ? GLU a 110 TYR a 113 
AI8 4 GLU AA 66  ? SER AA 78  ? GLU a 47  SER a 59  
AI8 5 VAL AA 46  ? ILE AA 57  ? VAL a 27  ILE a 38  
AI8 6 ILE AA 169 ? ASP AA 172 ? ILE a 150 ASP a 153 
AI9 1 LEU AA 105 ? ALA AA 107 ? LEU a 86  ALA a 88  
AI9 2 ALA AA 153 ? SER AA 161 ? ALA a 134 SER a 142 
AI9 3 ALA AA 210 ? LYS AA 222 ? ALA a 191 LYS a 203 
AI9 4 PHE AA 190 ? THR AA 203 ? PHE a 171 THR a 184 
AJ1 1 GLN BA 92  ? PRO BA 96  ? GLN b 73  PRO b 77  
AJ1 2 LEU BA 121 ? VAL BA 125 ? LEU b 102 VAL b 106 
AJ1 3 GLU BA 129 ? TYR BA 132 ? GLU b 110 TYR b 113 
AJ1 4 GLU BA 66  ? SER BA 78  ? GLU b 47  SER b 59  
AJ1 5 SER BA 135 ? SER BA 141 ? SER b 116 SER b 122 
AJ1 6 GLU BA 115 ? VAL BA 116 ? GLU b 96  VAL b 97  
AJ2 1 GLN BA 92  ? PRO BA 96  ? GLN b 73  PRO b 77  
AJ2 2 LEU BA 121 ? VAL BA 125 ? LEU b 102 VAL b 106 
AJ2 3 GLU BA 129 ? TYR BA 132 ? GLU b 110 TYR b 113 
AJ2 4 GLU BA 66  ? SER BA 78  ? GLU b 47  SER b 59  
AJ2 5 VAL BA 46  ? ASN BA 61  ? VAL b 27  ASN b 42  
AJ2 6 ILE BA 169 ? ASP BA 172 ? ILE b 150 ASP b 153 
AJ3 1 LEU BA 105 ? ALA BA 107 ? LEU b 86  ALA b 88  
AJ3 2 ALA BA 153 ? SER BA 161 ? ALA b 134 SER b 142 
AJ3 3 ALA BA 210 ? LYS BA 222 ? ALA b 191 LYS b 203 
AJ3 4 PHE BA 190 ? THR BA 203 ? PHE b 171 THR b 184 
AJ4 1 GLN CA 92  ? PRO CA 96  ? GLN c 73  PRO c 77  
AJ4 2 LEU CA 121 ? VAL CA 125 ? LEU c 102 VAL c 106 
AJ4 3 GLU CA 129 ? TYR CA 132 ? GLU c 110 TYR c 113 
AJ4 4 GLU CA 66  ? SER CA 78  ? GLU c 47  SER c 59  
AJ4 5 SER CA 135 ? SER CA 141 ? SER c 116 SER c 122 
AJ4 6 GLU CA 115 ? VAL CA 116 ? GLU c 96  VAL c 97  
AJ5 1 GLN CA 92  ? PRO CA 96  ? GLN c 73  PRO c 77  
AJ5 2 LEU CA 121 ? VAL CA 125 ? LEU c 102 VAL c 106 
AJ5 3 GLU CA 129 ? TYR CA 132 ? GLU c 110 TYR c 113 
AJ5 4 GLU CA 66  ? SER CA 78  ? GLU c 47  SER c 59  
AJ5 5 VAL CA 46  ? ILE CA 57  ? VAL c 27  ILE c 38  
AJ5 6 ILE CA 169 ? ASP CA 172 ? ILE c 150 ASP c 153 
AJ6 1 LEU CA 105 ? ALA CA 107 ? LEU c 86  ALA c 88  
AJ6 2 ALA CA 153 ? SER CA 161 ? ALA c 134 SER c 142 
AJ6 3 ALA CA 210 ? LYS CA 222 ? ALA c 191 LYS c 203 
AJ6 4 PHE CA 190 ? THR CA 203 ? PHE c 171 THR c 184 
AJ7 1 GLN DA 92  ? PRO DA 96  ? GLN d 73  PRO d 77  
AJ7 2 LEU DA 121 ? VAL DA 125 ? LEU d 102 VAL d 106 
AJ7 3 GLU DA 129 ? TYR DA 132 ? GLU d 110 TYR d 113 
AJ7 4 GLU DA 66  ? SER DA 78  ? GLU d 47  SER d 59  
AJ7 5 SER DA 135 ? SER DA 141 ? SER d 116 SER d 122 
AJ7 6 GLU DA 115 ? VAL DA 116 ? GLU d 96  VAL d 97  
AJ8 1 GLN DA 92  ? PRO DA 96  ? GLN d 73  PRO d 77  
AJ8 2 LEU DA 121 ? VAL DA 125 ? LEU d 102 VAL d 106 
AJ8 3 GLU DA 129 ? TYR DA 132 ? GLU d 110 TYR d 113 
AJ8 4 GLU DA 66  ? SER DA 78  ? GLU d 47  SER d 59  
AJ8 5 VAL DA 46  ? ILE DA 57  ? VAL d 27  ILE d 38  
AJ8 6 ILE DA 169 ? ASP DA 172 ? ILE d 150 ASP d 153 
AJ9 1 LEU DA 105 ? ALA DA 107 ? LEU d 86  ALA d 88  
AJ9 2 ALA DA 153 ? SER DA 161 ? ALA d 134 SER d 142 
AJ9 3 ALA DA 210 ? LYS DA 222 ? ALA d 191 LYS d 203 
AJ9 4 PHE DA 190 ? THR DA 203 ? PHE d 171 THR d 184 
AK1 1 GLN EA 92  ? PRO EA 96  ? GLN e 73  PRO e 77  
AK1 2 LEU EA 121 ? VAL EA 125 ? LEU e 102 VAL e 106 
AK1 3 GLU EA 129 ? TYR EA 132 ? GLU e 110 TYR e 113 
AK1 4 GLU EA 66  ? SER EA 78  ? GLU e 47  SER e 59  
AK1 5 SER EA 135 ? SER EA 141 ? SER e 116 SER e 122 
AK1 6 GLU EA 115 ? VAL EA 116 ? GLU e 96  VAL e 97  
AK2 1 GLN EA 92  ? PRO EA 96  ? GLN e 73  PRO e 77  
AK2 2 LEU EA 121 ? VAL EA 125 ? LEU e 102 VAL e 106 
AK2 3 GLU EA 129 ? TYR EA 132 ? GLU e 110 TYR e 113 
AK2 4 GLU EA 66  ? SER EA 78  ? GLU e 47  SER e 59  
AK2 5 VAL EA 46  ? ILE EA 57  ? VAL e 27  ILE e 38  
AK2 6 ILE EA 169 ? ASP EA 172 ? ILE e 150 ASP e 153 
AK3 1 LEU EA 105 ? ALA EA 107 ? LEU e 86  ALA e 88  
AK3 2 ALA EA 153 ? SER EA 161 ? ALA e 134 SER e 142 
AK3 3 ALA EA 210 ? LYS EA 222 ? ALA e 191 LYS e 203 
AK3 4 PHE EA 190 ? THR EA 203 ? PHE e 171 THR e 184 
AK4 1 GLN FA 92  ? PRO FA 96  ? GLN f 73  PRO f 77  
AK4 2 LEU FA 121 ? VAL FA 125 ? LEU f 102 VAL f 106 
AK4 3 GLU FA 129 ? TYR FA 132 ? GLU f 110 TYR f 113 
AK4 4 GLU FA 66  ? SER FA 78  ? GLU f 47  SER f 59  
AK4 5 SER FA 135 ? SER FA 141 ? SER f 116 SER f 122 
AK4 6 GLU FA 115 ? VAL FA 116 ? GLU f 96  VAL f 97  
AK5 1 GLN FA 92  ? PRO FA 96  ? GLN f 73  PRO f 77  
AK5 2 LEU FA 121 ? VAL FA 125 ? LEU f 102 VAL f 106 
AK5 3 GLU FA 129 ? TYR FA 132 ? GLU f 110 TYR f 113 
AK5 4 GLU FA 66  ? SER FA 78  ? GLU f 47  SER f 59  
AK5 5 VAL FA 46  ? ILE FA 57  ? VAL f 27  ILE f 38  
AK5 6 ILE FA 169 ? ASP FA 172 ? ILE f 150 ASP f 153 
AK6 1 LEU FA 105 ? ALA FA 107 ? LEU f 86  ALA f 88  
AK6 2 ALA FA 153 ? SER FA 161 ? ALA f 134 SER f 142 
AK6 3 ALA FA 210 ? LYS FA 222 ? ALA f 191 LYS f 203 
AK6 4 PHE FA 190 ? THR FA 203 ? PHE f 171 THR f 184 
AK7 1 GLN GA 92  ? PRO GA 96  ? GLN g 73  PRO g 77  
AK7 2 LEU GA 121 ? VAL GA 125 ? LEU g 102 VAL g 106 
AK7 3 GLU GA 129 ? TYR GA 132 ? GLU g 110 TYR g 113 
AK7 4 GLU GA 66  ? SER GA 78  ? GLU g 47  SER g 59  
AK7 5 SER GA 135 ? SER GA 141 ? SER g 116 SER g 122 
AK7 6 GLU GA 115 ? VAL GA 116 ? GLU g 96  VAL g 97  
AK8 1 GLN GA 92  ? PRO GA 96  ? GLN g 73  PRO g 77  
AK8 2 LEU GA 121 ? VAL GA 125 ? LEU g 102 VAL g 106 
AK8 3 GLU GA 129 ? TYR GA 132 ? GLU g 110 TYR g 113 
AK8 4 GLU GA 66  ? SER GA 78  ? GLU g 47  SER g 59  
AK8 5 VAL GA 46  ? ILE GA 57  ? VAL g 27  ILE g 38  
AK8 6 ILE GA 169 ? ASP GA 172 ? ILE g 150 ASP g 153 
AK9 1 LEU GA 105 ? ALA GA 107 ? LEU g 86  ALA g 88  
AK9 2 ALA GA 153 ? SER GA 161 ? ALA g 134 SER g 142 
AK9 3 ALA GA 210 ? LYS GA 222 ? ALA g 191 LYS g 203 
AK9 4 PHE GA 190 ? THR GA 203 ? PHE g 171 THR g 184 
AL1 1 GLN HA 92  ? PRO HA 96  ? GLN h 73  PRO h 77  
AL1 2 LEU HA 121 ? VAL HA 125 ? LEU h 102 VAL h 106 
AL1 3 GLU HA 129 ? TYR HA 132 ? GLU h 110 TYR h 113 
AL1 4 GLU HA 66  ? SER HA 78  ? GLU h 47  SER h 59  
AL1 5 SER HA 135 ? SER HA 141 ? SER h 116 SER h 122 
AL1 6 GLU HA 115 ? VAL HA 116 ? GLU h 96  VAL h 97  
AL2 1 GLN HA 92  ? PRO HA 96  ? GLN h 73  PRO h 77  
AL2 2 LEU HA 121 ? VAL HA 125 ? LEU h 102 VAL h 106 
AL2 3 GLU HA 129 ? TYR HA 132 ? GLU h 110 TYR h 113 
AL2 4 GLU HA 66  ? SER HA 78  ? GLU h 47  SER h 59  
AL2 5 VAL HA 46  ? ILE HA 57  ? VAL h 27  ILE h 38  
AL2 6 ILE HA 169 ? ASP HA 172 ? ILE h 150 ASP h 153 
AL3 1 LEU HA 105 ? ALA HA 107 ? LEU h 86  ALA h 88  
AL3 2 ALA HA 153 ? SER HA 161 ? ALA h 134 SER h 142 
AL3 3 ALA HA 210 ? LYS HA 222 ? ALA h 191 LYS h 203 
AL3 4 PHE HA 190 ? THR HA 203 ? PHE h 171 THR h 184 
AL4 1 GLN IA 92  ? PRO IA 96  ? GLN i 73  PRO i 77  
AL4 2 LEU IA 121 ? VAL IA 125 ? LEU i 102 VAL i 106 
AL4 3 GLU IA 129 ? TYR IA 132 ? GLU i 110 TYR i 113 
AL4 4 GLU IA 66  ? SER IA 78  ? GLU i 47  SER i 59  
AL4 5 SER IA 135 ? SER IA 141 ? SER i 116 SER i 122 
AL4 6 GLU IA 115 ? VAL IA 116 ? GLU i 96  VAL i 97  
AL5 1 GLN IA 92  ? PRO IA 96  ? GLN i 73  PRO i 77  
AL5 2 LEU IA 121 ? VAL IA 125 ? LEU i 102 VAL i 106 
AL5 3 GLU IA 129 ? TYR IA 132 ? GLU i 110 TYR i 113 
AL5 4 GLU IA 66  ? SER IA 78  ? GLU i 47  SER i 59  
AL5 5 VAL IA 46  ? ILE IA 57  ? VAL i 27  ILE i 38  
AL5 6 ILE IA 169 ? ASP IA 172 ? ILE i 150 ASP i 153 
AL6 1 LEU IA 105 ? ALA IA 107 ? LEU i 86  ALA i 88  
AL6 2 ALA IA 153 ? SER IA 161 ? ALA i 134 SER i 142 
AL6 3 ALA IA 210 ? LYS IA 222 ? ALA i 191 LYS i 203 
AL6 4 PHE IA 190 ? THR IA 203 ? PHE i 171 THR i 184 
AL7 1 GLN JA 92  ? PRO JA 96  ? GLN j 73  PRO j 77  
AL7 2 LEU JA 121 ? VAL JA 125 ? LEU j 102 VAL j 106 
AL7 3 GLU JA 129 ? TYR JA 132 ? GLU j 110 TYR j 113 
AL7 4 GLU JA 66  ? SER JA 78  ? GLU j 47  SER j 59  
AL7 5 SER JA 135 ? SER JA 141 ? SER j 116 SER j 122 
AL7 6 GLU JA 115 ? VAL JA 116 ? GLU j 96  VAL j 97  
AL8 1 GLN JA 92  ? PRO JA 96  ? GLN j 73  PRO j 77  
AL8 2 LEU JA 121 ? VAL JA 125 ? LEU j 102 VAL j 106 
AL8 3 GLU JA 129 ? TYR JA 132 ? GLU j 110 TYR j 113 
AL8 4 GLU JA 66  ? SER JA 78  ? GLU j 47  SER j 59  
AL8 5 VAL JA 46  ? ASN JA 61  ? VAL j 27  ASN j 42  
AL8 6 ILE JA 169 ? ASP JA 172 ? ILE j 150 ASP j 153 
AL9 1 LEU JA 105 ? ALA JA 107 ? LEU j 86  ALA j 88  
AL9 2 ALA JA 153 ? SER JA 161 ? ALA j 134 SER j 142 
AL9 3 ALA JA 210 ? LYS JA 222 ? ALA j 191 LYS j 203 
AL9 4 PHE JA 190 ? THR JA 203 ? PHE j 171 THR j 184 
AM1 1 GLN KA 92  ? PRO KA 96  ? GLN k 73  PRO k 77  
AM1 2 LEU KA 121 ? VAL KA 125 ? LEU k 102 VAL k 106 
AM1 3 GLU KA 129 ? TYR KA 132 ? GLU k 110 TYR k 113 
AM1 4 GLU KA 66  ? SER KA 78  ? GLU k 47  SER k 59  
AM1 5 SER KA 135 ? SER KA 141 ? SER k 116 SER k 122 
AM1 6 GLU KA 115 ? VAL KA 116 ? GLU k 96  VAL k 97  
AM2 1 GLN KA 92  ? PRO KA 96  ? GLN k 73  PRO k 77  
AM2 2 LEU KA 121 ? VAL KA 125 ? LEU k 102 VAL k 106 
AM2 3 GLU KA 129 ? TYR KA 132 ? GLU k 110 TYR k 113 
AM2 4 GLU KA 66  ? SER KA 78  ? GLU k 47  SER k 59  
AM2 5 VAL KA 46  ? ILE KA 57  ? VAL k 27  ILE k 38  
AM2 6 ILE KA 169 ? ASP KA 172 ? ILE k 150 ASP k 153 
AM3 1 LEU KA 105 ? ALA KA 107 ? LEU k 86  ALA k 88  
AM3 2 ALA KA 153 ? SER KA 161 ? ALA k 134 SER k 142 
AM3 3 ALA KA 210 ? LYS KA 222 ? ALA k 191 LYS k 203 
AM3 4 PHE KA 190 ? THR KA 203 ? PHE k 171 THR k 184 
AM4 1 GLN LA 92  ? PRO LA 96  ? GLN l 73  PRO l 77  
AM4 2 LEU LA 121 ? VAL LA 125 ? LEU l 102 VAL l 106 
AM4 3 GLU LA 129 ? TYR LA 132 ? GLU l 110 TYR l 113 
AM4 4 GLU LA 66  ? SER LA 78  ? GLU l 47  SER l 59  
AM4 5 SER LA 135 ? SER LA 141 ? SER l 116 SER l 122 
AM4 6 GLU LA 115 ? VAL LA 116 ? GLU l 96  VAL l 97  
AM5 1 GLN LA 92  ? PRO LA 96  ? GLN l 73  PRO l 77  
AM5 2 LEU LA 121 ? VAL LA 125 ? LEU l 102 VAL l 106 
AM5 3 GLU LA 129 ? TYR LA 132 ? GLU l 110 TYR l 113 
AM5 4 GLU LA 66  ? SER LA 78  ? GLU l 47  SER l 59  
AM5 5 VAL LA 46  ? ASN LA 61  ? VAL l 27  ASN l 42  
AM5 6 ILE LA 169 ? ASP LA 172 ? ILE l 150 ASP l 153 
AM6 1 LEU LA 105 ? ALA LA 107 ? LEU l 86  ALA l 88  
AM6 2 ALA LA 153 ? SER LA 161 ? ALA l 134 SER l 142 
AM6 3 ALA LA 210 ? LYS LA 222 ? ALA l 191 LYS l 203 
AM6 4 PHE LA 190 ? THR LA 203 ? PHE l 171 THR l 184 
AM7 1 GLN MA 92  ? PRO MA 96  ? GLN m 73  PRO m 77  
AM7 2 LEU MA 121 ? VAL MA 125 ? LEU m 102 VAL m 106 
AM7 3 GLU MA 129 ? TYR MA 132 ? GLU m 110 TYR m 113 
AM7 4 GLU MA 66  ? SER MA 78  ? GLU m 47  SER m 59  
AM7 5 SER MA 135 ? SER MA 141 ? SER m 116 SER m 122 
AM7 6 GLU MA 115 ? VAL MA 116 ? GLU m 96  VAL m 97  
AM8 1 GLN MA 92  ? PRO MA 96  ? GLN m 73  PRO m 77  
AM8 2 LEU MA 121 ? VAL MA 125 ? LEU m 102 VAL m 106 
AM8 3 GLU MA 129 ? TYR MA 132 ? GLU m 110 TYR m 113 
AM8 4 GLU MA 66  ? SER MA 78  ? GLU m 47  SER m 59  
AM8 5 VAL MA 46  ? ILE MA 57  ? VAL m 27  ILE m 38  
AM8 6 ILE MA 169 ? ASP MA 172 ? ILE m 150 ASP m 153 
AM9 1 LEU MA 105 ? ALA MA 107 ? LEU m 86  ALA m 88  
AM9 2 ALA MA 153 ? SER MA 161 ? ALA m 134 SER m 142 
AM9 3 ALA MA 210 ? LYS MA 222 ? ALA m 191 LYS m 203 
AM9 4 PHE MA 190 ? THR MA 203 ? PHE m 171 THR m 184 
AN1 1 GLN NA 92  ? PRO NA 96  ? GLN n 73  PRO n 77  
AN1 2 LEU NA 121 ? VAL NA 125 ? LEU n 102 VAL n 106 
AN1 3 GLU NA 129 ? TYR NA 132 ? GLU n 110 TYR n 113 
AN1 4 GLU NA 66  ? SER NA 78  ? GLU n 47  SER n 59  
AN1 5 SER NA 135 ? SER NA 141 ? SER n 116 SER n 122 
AN1 6 GLU NA 115 ? VAL NA 116 ? GLU n 96  VAL n 97  
AN2 1 GLN NA 92  ? PRO NA 96  ? GLN n 73  PRO n 77  
AN2 2 LEU NA 121 ? VAL NA 125 ? LEU n 102 VAL n 106 
AN2 3 GLU NA 129 ? TYR NA 132 ? GLU n 110 TYR n 113 
AN2 4 GLU NA 66  ? SER NA 78  ? GLU n 47  SER n 59  
AN2 5 VAL NA 46  ? ILE NA 57  ? VAL n 27  ILE n 38  
AN2 6 ILE NA 169 ? ASP NA 172 ? ILE n 150 ASP n 153 
AN3 1 LEU NA 105 ? ALA NA 107 ? LEU n 86  ALA n 88  
AN3 2 ALA NA 153 ? SER NA 161 ? ALA n 134 SER n 142 
AN3 3 ALA NA 210 ? LYS NA 222 ? ALA n 191 LYS n 203 
AN3 4 PHE NA 190 ? THR NA 203 ? PHE n 171 THR n 184 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N VAL A  95  ? N VAL A 76  O ALA A  122 ? O ALA A 103 
AA1 2 3 N HIS A  123 ? N HIS A 104 O GLN A  131 ? O GLN A 112 
AA1 3 4 O VAL A  130 ? O VAL A 111 N TRP A  77  ? N TRP A 58  
AA1 4 5 N PHE A  71  ? N PHE A 52  O ILE A  136 ? O ILE A 117 
AA1 5 6 O ARG A  137 ? O ARG A 118 N GLU A  115 ? N GLU A 96  
AA2 1 2 N VAL A  95  ? N VAL A 76  O ALA A  122 ? O ALA A 103 
AA2 2 3 N HIS A  123 ? N HIS A 104 O GLN A  131 ? O GLN A 112 
AA2 3 4 O VAL A  130 ? O VAL A 111 N TRP A  77  ? N TRP A 58  
AA2 4 5 O THR A  76  ? O THR A 57  N SER A  49  ? N SER A 30  
AA2 5 6 N VAL A  48  ? N VAL A 29  O SER A  170 ? O SER A 151 
AA3 1 2 N ALA A  106 ? N ALA A 87  O GLY A  160 ? O GLY A 141 
AA3 2 3 N ILE A  159 ? N ILE A 140 O VAL A  214 ? O VAL A 195 
AA3 3 4 O SER A  217 ? O SER A 198 N THR A  196 ? N THR A 177 
AA4 1 2 N VAL B  95  ? N VAL B 76  O ALA B  122 ? O ALA B 103 
AA4 2 3 N HIS B  123 ? N HIS B 104 O GLN B  131 ? O GLN B 112 
AA4 3 4 O VAL B  130 ? O VAL B 111 N TRP B  77  ? N TRP B 58  
AA4 4 5 N PHE B  71  ? N PHE B 52  O ILE B  136 ? O ILE B 117 
AA4 5 6 O ARG B  137 ? O ARG B 118 N GLU B  115 ? N GLU B 96  
AA5 1 2 N VAL B  95  ? N VAL B 76  O ALA B  122 ? O ALA B 103 
AA5 2 3 N HIS B  123 ? N HIS B 104 O GLN B  131 ? O GLN B 112 
AA5 3 4 O VAL B  130 ? O VAL B 111 N TRP B  77  ? N TRP B 58  
AA5 4 5 O VAL B  70  ? O VAL B 51  N ILE B  55  ? N ILE B 36  
AA5 5 6 N VAL B  48  ? N VAL B 29  O SER B  170 ? O SER B 151 
AA6 1 2 N ALA B  106 ? N ALA B 87  O GLY B  160 ? O GLY B 141 
AA6 2 3 N CYS B  155 ? N CYS B 136 O LEU B  218 ? O LEU B 199 
AA6 3 4 O GLU B  215 ? O GLU B 196 N LYS B  198 ? N LYS B 179 
AA7 1 2 N VAL C  95  ? N VAL C 76  O ALA C  122 ? O ALA C 103 
AA7 2 3 N HIS C  123 ? N HIS C 104 O GLN C  131 ? O GLN C 112 
AA7 3 4 O VAL C  130 ? O VAL C 111 N TRP C  77  ? N TRP C 58  
AA7 4 5 N PHE C  71  ? N PHE C 52  O ILE C  136 ? O ILE C 117 
AA7 5 6 O ARG C  137 ? O ARG C 118 N GLU C  115 ? N GLU C 96  
AA8 1 2 N VAL C  95  ? N VAL C 76  O ALA C  122 ? O ALA C 103 
AA8 2 3 N HIS C  123 ? N HIS C 104 O GLN C  131 ? O GLN C 112 
AA8 3 4 O VAL C  130 ? O VAL C 111 N TRP C  77  ? N TRP C 58  
AA8 4 5 O ASP C  68  ? O ASP C 49  N LEU C  58  ? N LEU C 39  
AA8 5 6 N VAL C  48  ? N VAL C 29  O SER C  170 ? O SER C 151 
AA9 1 2 N ALA C  106 ? N ALA C 87  O GLY C  160 ? O GLY C 141 
AA9 2 3 N CYS C  155 ? N CYS C 136 O LEU C  218 ? O LEU C 199 
AA9 3 4 O SER C  217 ? O SER C 198 N THR C  196 ? N THR C 177 
AB1 1 2 N VAL D  95  ? N VAL D 76  O ALA D  122 ? O ALA D 103 
AB1 2 3 N HIS D  123 ? N HIS D 104 O GLN D  131 ? O GLN D 112 
AB1 3 4 O VAL D  130 ? O VAL D 111 N TRP D  77  ? N TRP D 58  
AB1 4 5 N PHE D  71  ? N PHE D 52  O ILE D  136 ? O ILE D 117 
AB1 5 6 O ARG D  137 ? O ARG D 118 N GLU D  115 ? N GLU D 96  
AB2 1 2 N VAL D  95  ? N VAL D 76  O ALA D  122 ? O ALA D 103 
AB2 2 3 N HIS D  123 ? N HIS D 104 O GLN D  131 ? O GLN D 112 
AB2 3 4 O VAL D  130 ? O VAL D 111 N TRP D  77  ? N TRP D 58  
AB2 4 5 O ASP D  68  ? O ASP D 49  N LEU D  58  ? N LEU D 39  
AB2 5 6 N VAL D  48  ? N VAL D 29  O SER D  170 ? O SER D 151 
AB3 1 2 N ALA D  106 ? N ALA D 87  O GLY D  160 ? O GLY D 141 
AB3 2 3 N ILE D  159 ? N ILE D 140 O VAL D  214 ? O VAL D 195 
AB3 3 4 O SER D  217 ? O SER D 198 N THR D  196 ? N THR D 177 
AB4 1 2 N VAL E  95  ? N VAL E 76  O ALA E  122 ? O ALA E 103 
AB4 2 3 N HIS E  123 ? N HIS E 104 O GLN E  131 ? O GLN E 112 
AB4 3 4 O VAL E  130 ? O VAL E 111 N TRP E  77  ? N TRP E 58  
AB4 4 5 N PHE E  71  ? N PHE E 52  O ILE E  136 ? O ILE E 117 
AB4 5 6 O ARG E  137 ? O ARG E 118 N GLU E  115 ? N GLU E 96  
AB5 1 2 N VAL E  95  ? N VAL E 76  O ALA E  122 ? O ALA E 103 
AB5 2 3 N HIS E  123 ? N HIS E 104 O GLN E  131 ? O GLN E 112 
AB5 3 4 O VAL E  130 ? O VAL E 111 N TRP E  77  ? N TRP E 58  
AB5 4 5 O ASP E  68  ? O ASP E 49  N LEU E  58  ? N LEU E 39  
AB5 5 6 N VAL E  48  ? N VAL E 29  O SER E  170 ? O SER E 151 
AB6 1 2 N ALA E  106 ? N ALA E 87  O GLY E  160 ? O GLY E 141 
AB6 2 3 N CYS E  155 ? N CYS E 136 O LEU E  218 ? O LEU E 199 
AB6 3 4 O SER E  217 ? O SER E 198 N THR E  196 ? N THR E 177 
AB7 1 2 N VAL F  95  ? N VAL F 76  O ALA F  122 ? O ALA F 103 
AB7 2 3 N HIS F  123 ? N HIS F 104 O GLN F  131 ? O GLN F 112 
AB7 3 4 O VAL F  130 ? O VAL F 111 N TRP F  77  ? N TRP F 58  
AB7 4 5 N PHE F  71  ? N PHE F 52  O ILE F  136 ? O ILE F 117 
AB7 5 6 O ARG F  137 ? O ARG F 118 N GLU F  115 ? N GLU F 96  
AB8 1 2 N VAL F  95  ? N VAL F 76  O ALA F  122 ? O ALA F 103 
AB8 2 3 N HIS F  123 ? N HIS F 104 O GLN F  131 ? O GLN F 112 
AB8 3 4 O VAL F  130 ? O VAL F 111 N TRP F  77  ? N TRP F 58  
AB8 4 5 O VAL F  70  ? O VAL F 51  N ILE F  55  ? N ILE F 36  
AB8 5 6 N VAL F  48  ? N VAL F 29  O SER F  170 ? O SER F 151 
AB9 1 2 N ALA F  106 ? N ALA F 87  O GLY F  160 ? O GLY F 141 
AB9 2 3 N CYS F  155 ? N CYS F 136 O LEU F  218 ? O LEU F 199 
AB9 3 4 O SER F  217 ? O SER F 198 N THR F  196 ? N THR F 177 
AC1 1 2 N VAL G  95  ? N VAL G 76  O ALA G  122 ? O ALA G 103 
AC1 2 3 N HIS G  123 ? N HIS G 104 O GLN G  131 ? O GLN G 112 
AC1 3 4 O VAL G  130 ? O VAL G 111 N TRP G  77  ? N TRP G 58  
AC1 4 5 N PHE G  71  ? N PHE G 52  O ILE G  136 ? O ILE G 117 
AC1 5 6 O ARG G  137 ? O ARG G 118 N GLU G  115 ? N GLU G 96  
AC2 1 2 N VAL G  95  ? N VAL G 76  O ALA G  122 ? O ALA G 103 
AC2 2 3 N HIS G  123 ? N HIS G 104 O GLN G  131 ? O GLN G 112 
AC2 3 4 O VAL G  130 ? O VAL G 111 N TRP G  77  ? N TRP G 58  
AC2 4 5 O ASP G  68  ? O ASP G 49  N LEU G  58  ? N LEU G 39  
AC2 5 6 N VAL G  48  ? N VAL G 29  O SER G  170 ? O SER G 151 
AC3 1 2 N ALA G  106 ? N ALA G 87  O GLY G  160 ? O GLY G 141 
AC3 2 3 N ILE G  159 ? N ILE G 140 O VAL G  214 ? O VAL G 195 
AC3 3 4 O GLU G  215 ? O GLU G 196 N LYS G  198 ? N LYS G 179 
AC4 1 2 N VAL H  95  ? N VAL H 76  O ALA H  122 ? O ALA H 103 
AC4 2 3 N HIS H  123 ? N HIS H 104 O GLN H  131 ? O GLN H 112 
AC4 3 4 O VAL H  130 ? O VAL H 111 N TRP H  77  ? N TRP H 58  
AC4 4 5 N PHE H  71  ? N PHE H 52  O ILE H  136 ? O ILE H 117 
AC4 5 6 O ARG H  137 ? O ARG H 118 N GLU H  115 ? N GLU H 96  
AC5 1 2 N VAL H  95  ? N VAL H 76  O ALA H  122 ? O ALA H 103 
AC5 2 3 N HIS H  123 ? N HIS H 104 O GLN H  131 ? O GLN H 112 
AC5 3 4 O VAL H  130 ? O VAL H 111 N TRP H  77  ? N TRP H 58  
AC5 4 5 O VAL H  70  ? O VAL H 51  N ILE H  55  ? N ILE H 36  
AC5 5 6 N VAL H  48  ? N VAL H 29  O SER H  170 ? O SER H 151 
AC6 1 2 N ALA H  106 ? N ALA H 87  O GLY H  160 ? O GLY H 141 
AC6 2 3 N CYS H  155 ? N CYS H 136 O LEU H  218 ? O LEU H 199 
AC6 3 4 O GLU H  215 ? O GLU H 196 N LYS H  198 ? N LYS H 179 
AC7 1 2 N VAL I  95  ? N VAL I 76  O ALA I  122 ? O ALA I 103 
AC7 2 3 N HIS I  123 ? N HIS I 104 O GLN I  131 ? O GLN I 112 
AC7 3 4 O VAL I  130 ? O VAL I 111 N TRP I  77  ? N TRP I 58  
AC7 4 5 N PHE I  71  ? N PHE I 52  O ILE I  136 ? O ILE I 117 
AC7 5 6 O ARG I  137 ? O ARG I 118 N GLU I  115 ? N GLU I 96  
AC8 1 2 N VAL I  95  ? N VAL I 76  O ALA I  122 ? O ALA I 103 
AC8 2 3 N HIS I  123 ? N HIS I 104 O GLN I  131 ? O GLN I 112 
AC8 3 4 O VAL I  130 ? O VAL I 111 N TRP I  77  ? N TRP I 58  
AC8 4 5 O THR I  76  ? O THR I 57  N SER I  49  ? N SER I 30  
AC8 5 6 N VAL I  48  ? N VAL I 29  O SER I  170 ? O SER I 151 
AC9 1 2 N ALA I  106 ? N ALA I 87  O GLY I  160 ? O GLY I 141 
AC9 2 3 N ILE I  159 ? N ILE I 140 O VAL I  214 ? O VAL I 195 
AC9 3 4 O SER I  217 ? O SER I 198 N THR I  196 ? N THR I 177 
AD1 1 2 N VAL J  95  ? N VAL J 76  O ALA J  122 ? O ALA J 103 
AD1 2 3 N HIS J  123 ? N HIS J 104 O GLN J  131 ? O GLN J 112 
AD1 3 4 O VAL J  130 ? O VAL J 111 N TRP J  77  ? N TRP J 58  
AD1 4 5 N PHE J  71  ? N PHE J 52  O ILE J  136 ? O ILE J 117 
AD1 5 6 O ARG J  137 ? O ARG J 118 N GLU J  115 ? N GLU J 96  
AD2 1 2 N VAL J  95  ? N VAL J 76  O ALA J  122 ? O ALA J 103 
AD2 2 3 N HIS J  123 ? N HIS J 104 O GLN J  131 ? O GLN J 112 
AD2 3 4 O VAL J  130 ? O VAL J 111 N TRP J  77  ? N TRP J 58  
AD2 4 5 O ASP J  68  ? O ASP J 49  N LEU J  58  ? N LEU J 39  
AD2 5 6 N VAL J  48  ? N VAL J 29  O SER J  170 ? O SER J 151 
AD3 1 2 N ALA J  106 ? N ALA J 87  O GLY J  160 ? O GLY J 141 
AD3 2 3 N ILE J  159 ? N ILE J 140 O VAL J  214 ? O VAL J 195 
AD3 3 4 O GLU J  215 ? O GLU J 196 N LYS J  198 ? N LYS J 179 
AD4 1 2 N VAL K  95  ? N VAL K 76  O ALA K  122 ? O ALA K 103 
AD4 2 3 N HIS K  123 ? N HIS K 104 O GLN K  131 ? O GLN K 112 
AD4 3 4 O VAL K  130 ? O VAL K 111 N TRP K  77  ? N TRP K 58  
AD4 4 5 N PHE K  71  ? N PHE K 52  O ILE K  136 ? O ILE K 117 
AD4 5 6 O ARG K  137 ? O ARG K 118 N GLU K  115 ? N GLU K 96  
AD5 1 2 N VAL K  95  ? N VAL K 76  O ALA K  122 ? O ALA K 103 
AD5 2 3 N HIS K  123 ? N HIS K 104 O GLN K  131 ? O GLN K 112 
AD5 3 4 O VAL K  130 ? O VAL K 111 N TRP K  77  ? N TRP K 58  
AD5 4 5 O ASP K  68  ? O ASP K 49  N LEU K  58  ? N LEU K 39  
AD5 5 6 N VAL K  48  ? N VAL K 29  O SER K  170 ? O SER K 151 
AD6 1 2 N ALA K  106 ? N ALA K 87  O GLY K  160 ? O GLY K 141 
AD6 2 3 N CYS K  155 ? N CYS K 136 O LEU K  218 ? O LEU K 199 
AD6 3 4 O SER K  217 ? O SER K 198 N THR K  196 ? N THR K 177 
AD7 1 2 N VAL L  95  ? N VAL L 76  O ALA L  122 ? O ALA L 103 
AD7 2 3 N HIS L  123 ? N HIS L 104 O GLN L  131 ? O GLN L 112 
AD7 3 4 O VAL L  130 ? O VAL L 111 N TRP L  77  ? N TRP L 58  
AD7 4 5 N PHE L  71  ? N PHE L 52  O ILE L  136 ? O ILE L 117 
AD7 5 6 O ARG L  137 ? O ARG L 118 N GLU L  115 ? N GLU L 96  
AD8 1 2 N VAL L  95  ? N VAL L 76  O ALA L  122 ? O ALA L 103 
AD8 2 3 N HIS L  123 ? N HIS L 104 O GLN L  131 ? O GLN L 112 
AD8 3 4 O VAL L  130 ? O VAL L 111 N TRP L  77  ? N TRP L 58  
AD8 4 5 O THR L  76  ? O THR L 57  N SER L  49  ? N SER L 30  
AD8 5 6 N VAL L  48  ? N VAL L 29  O SER L  170 ? O SER L 151 
AD9 1 2 N ALA L  106 ? N ALA L 87  O GLY L  160 ? O GLY L 141 
AD9 2 3 N ILE L  159 ? N ILE L 140 O VAL L  214 ? O VAL L 195 
AD9 3 4 O GLU L  215 ? O GLU L 196 N LYS L  198 ? N LYS L 179 
AE1 1 2 N VAL M  95  ? N VAL M 76  O ALA M  122 ? O ALA M 103 
AE1 2 3 N HIS M  123 ? N HIS M 104 O GLN M  131 ? O GLN M 112 
AE1 3 4 O VAL M  130 ? O VAL M 111 N TRP M  77  ? N TRP M 58  
AE1 4 5 N PHE M  71  ? N PHE M 52  O ILE M  136 ? O ILE M 117 
AE1 5 6 O ARG M  137 ? O ARG M 118 N GLU M  115 ? N GLU M 96  
AE2 1 2 N VAL M  95  ? N VAL M 76  O ALA M  122 ? O ALA M 103 
AE2 2 3 N HIS M  123 ? N HIS M 104 O GLN M  131 ? O GLN M 112 
AE2 3 4 O VAL M  130 ? O VAL M 111 N TRP M  77  ? N TRP M 58  
AE2 4 5 O VAL M  70  ? O VAL M 51  N ILE M  55  ? N ILE M 36  
AE2 5 6 N VAL M  48  ? N VAL M 29  O SER M  170 ? O SER M 151 
AE3 1 2 N ALA M  106 ? N ALA M 87  O GLY M  160 ? O GLY M 141 
AE3 2 3 N CYS M  155 ? N CYS M 136 O LEU M  218 ? O LEU M 199 
AE3 3 4 O SER M  217 ? O SER M 198 N THR M  196 ? N THR M 177 
AE4 1 2 N VAL N  95  ? N VAL N 76  O ALA N  122 ? O ALA N 103 
AE4 2 3 N HIS N  123 ? N HIS N 104 O GLN N  131 ? O GLN N 112 
AE4 3 4 O VAL N  130 ? O VAL N 111 N TRP N  77  ? N TRP N 58  
AE4 4 5 N PHE N  71  ? N PHE N 52  O ILE N  136 ? O ILE N 117 
AE4 5 6 O ARG N  137 ? O ARG N 118 N GLU N  115 ? N GLU N 96  
AE5 1 2 N VAL N  95  ? N VAL N 76  O ALA N  122 ? O ALA N 103 
AE5 2 3 N HIS N  123 ? N HIS N 104 O GLN N  131 ? O GLN N 112 
AE5 3 4 O VAL N  130 ? O VAL N 111 N TRP N  77  ? N TRP N 58  
AE5 4 5 O VAL N  70  ? O VAL N 51  N ASN N  56  ? N ASN N 37  
AE5 5 6 N VAL N  48  ? N VAL N 29  O SER N  170 ? O SER N 151 
AE6 1 2 N ALA N  106 ? N ALA N 87  O GLY N  160 ? O GLY N 141 
AE6 2 3 N CYS N  155 ? N CYS N 136 O LEU N  218 ? O LEU N 199 
AE6 3 4 O GLU N  215 ? O GLU N 196 N LYS N  198 ? N LYS N 179 
AE7 1 2 N VAL O  95  ? N VAL O 76  O ALA O  122 ? O ALA O 103 
AE7 2 3 N HIS O  123 ? N HIS O 104 O GLN O  131 ? O GLN O 112 
AE7 3 4 O VAL O  130 ? O VAL O 111 N TRP O  77  ? N TRP O 58  
AE7 4 5 N PHE O  71  ? N PHE O 52  O ILE O  136 ? O ILE O 117 
AE7 5 6 O ARG O  137 ? O ARG O 118 N GLU O  115 ? N GLU O 96  
AE8 1 2 N VAL O  95  ? N VAL O 76  O ALA O  122 ? O ALA O 103 
AE8 2 3 N HIS O  123 ? N HIS O 104 O GLN O  131 ? O GLN O 112 
AE8 3 4 O VAL O  130 ? O VAL O 111 N TRP O  77  ? N TRP O 58  
AE8 4 5 O ASP O  68  ? O ASP O 49  N LEU O  58  ? N LEU O 39  
AE8 5 6 N VAL O  48  ? N VAL O 29  O SER O  170 ? O SER O 151 
AE9 1 2 N ALA O  106 ? N ALA O 87  O GLY O  160 ? O GLY O 141 
AE9 2 3 N ILE O  157 ? N ILE O 138 O VAL O  216 ? O VAL O 197 
AE9 3 4 O SER O  217 ? O SER O 198 N THR O  196 ? N THR O 177 
AF1 1 2 N VAL P  94  ? N VAL P 76  O ALA P  121 ? O ALA P 103 
AF1 2 3 N HIS P  122 ? N HIS P 104 O GLN P  130 ? O GLN P 112 
AF1 3 4 O VAL P  129 ? O VAL P 111 N TRP P  76  ? N TRP P 58  
AF1 4 5 N PHE P  70  ? N PHE P 52  O ILE P  135 ? O ILE P 117 
AF1 5 6 O ARG P  136 ? O ARG P 118 N GLU P  114 ? N GLU P 96  
AF2 1 2 N VAL P  94  ? N VAL P 76  O ALA P  121 ? O ALA P 103 
AF2 2 3 N HIS P  122 ? N HIS P 104 O GLN P  130 ? O GLN P 112 
AF2 3 4 O VAL P  129 ? O VAL P 111 N TRP P  76  ? N TRP P 58  
AF2 4 5 O VAL P  69  ? O VAL P 51  N ILE P  54  ? N ILE P 36  
AF2 5 6 N VAL P  47  ? N VAL P 29  O SER P  169 ? O SER P 151 
AF3 1 2 N ALA P  105 ? N ALA P 87  O GLY P  159 ? O GLY P 141 
AF3 2 3 N CYS P  154 ? N CYS P 136 O LEU P  217 ? O LEU P 199 
AF3 3 4 O SER P  216 ? O SER P 198 N THR P  195 ? N THR P 177 
AF4 1 2 N VAL Q  95  ? N VAL Q 76  O ALA Q  122 ? O ALA Q 103 
AF4 2 3 N HIS Q  123 ? N HIS Q 104 O GLN Q  131 ? O GLN Q 112 
AF4 3 4 O VAL Q  130 ? O VAL Q 111 N TRP Q  77  ? N TRP Q 58  
AF4 4 5 N PHE Q  71  ? N PHE Q 52  O ILE Q  136 ? O ILE Q 117 
AF4 5 6 O ARG Q  137 ? O ARG Q 118 N GLU Q  115 ? N GLU Q 96  
AF5 1 2 N VAL Q  95  ? N VAL Q 76  O ALA Q  122 ? O ALA Q 103 
AF5 2 3 N HIS Q  123 ? N HIS Q 104 O GLN Q  131 ? O GLN Q 112 
AF5 3 4 O VAL Q  130 ? O VAL Q 111 N TRP Q  77  ? N TRP Q 58  
AF5 4 5 O VAL Q  70  ? O VAL Q 51  N ILE Q  55  ? N ILE Q 36  
AF5 5 6 N VAL Q  48  ? N VAL Q 29  O SER Q  170 ? O SER Q 151 
AF6 1 2 N ALA Q  106 ? N ALA Q 87  O GLY Q  160 ? O GLY Q 141 
AF6 2 3 N CYS Q  155 ? N CYS Q 136 O LEU Q  218 ? O LEU Q 199 
AF6 3 4 O SER Q  217 ? O SER Q 198 N THR Q  196 ? N THR Q 177 
AF7 1 2 N VAL R  95  ? N VAL R 76  O ALA R  122 ? O ALA R 103 
AF7 2 3 N HIS R  123 ? N HIS R 104 O GLN R  131 ? O GLN R 112 
AF7 3 4 O VAL R  130 ? O VAL R 111 N TRP R  77  ? N TRP R 58  
AF7 4 5 N PHE R  71  ? N PHE R 52  O ILE R  136 ? O ILE R 117 
AF7 5 6 O ARG R  137 ? O ARG R 118 N GLU R  115 ? N GLU R 96  
AF8 1 2 N VAL R  95  ? N VAL R 76  O ALA R  122 ? O ALA R 103 
AF8 2 3 N HIS R  123 ? N HIS R 104 O GLN R  131 ? O GLN R 112 
AF8 3 4 O VAL R  130 ? O VAL R 111 N TRP R  77  ? N TRP R 58  
AF8 4 5 O ASP R  68  ? O ASP R 49  N LEU R  58  ? N LEU R 39  
AF8 5 6 N VAL R  48  ? N VAL R 29  O SER R  170 ? O SER R 151 
AF9 1 2 N ALA R  106 ? N ALA R 87  O GLY R  160 ? O GLY R 141 
AF9 2 3 N CYS R  155 ? N CYS R 136 O LEU R  218 ? O LEU R 199 
AF9 3 4 O SER R  217 ? O SER R 198 N THR R  196 ? N THR R 177 
AG1 1 2 N VAL S  95  ? N VAL S 76  O ALA S  122 ? O ALA S 103 
AG1 2 3 N HIS S  123 ? N HIS S 104 O GLN S  131 ? O GLN S 112 
AG1 3 4 O TYR S  132 ? O TYR S 113 N THR S  75  ? N THR S 56  
AG1 4 5 N PHE S  71  ? N PHE S 52  O ILE S  136 ? O ILE S 117 
AG1 5 6 O ARG S  137 ? O ARG S 118 N GLU S  115 ? N GLU S 96  
AG2 1 2 N VAL S  95  ? N VAL S 76  O ALA S  122 ? O ALA S 103 
AG2 2 3 N HIS S  123 ? N HIS S 104 O GLN S  131 ? O GLN S 112 
AG2 3 4 O TYR S  132 ? O TYR S 113 N THR S  75  ? N THR S 56  
AG2 4 5 O VAL S  70  ? O VAL S 51  N ILE S  55  ? N ILE S 36  
AG2 5 6 N VAL S  48  ? N VAL S 29  O SER S  170 ? O SER S 151 
AG3 1 2 N ALA S  106 ? N ALA S 87  O GLY S  160 ? O GLY S 141 
AG3 2 3 N CYS S  155 ? N CYS S 136 O LEU S  218 ? O LEU S 199 
AG3 3 4 O SER S  217 ? O SER S 198 N THR S  196 ? N THR S 177 
AG4 1 2 N VAL T  95  ? N VAL T 76  O ALA T  122 ? O ALA T 103 
AG4 2 3 N HIS T  123 ? N HIS T 104 O GLN T  131 ? O GLN T 112 
AG4 3 4 O VAL T  130 ? O VAL T 111 N TRP T  77  ? N TRP T 58  
AG4 4 5 N PHE T  71  ? N PHE T 52  O ILE T  136 ? O ILE T 117 
AG4 5 6 O ARG T  137 ? O ARG T 118 N GLU T  115 ? N GLU T 96  
AG5 1 2 N VAL T  95  ? N VAL T 76  O ALA T  122 ? O ALA T 103 
AG5 2 3 N HIS T  123 ? N HIS T 104 O GLN T  131 ? O GLN T 112 
AG5 3 4 O VAL T  130 ? O VAL T 111 N TRP T  77  ? N TRP T 58  
AG5 4 5 O VAL T  70  ? O VAL T 51  N ASN T  56  ? N ASN T 37  
AG5 5 6 N VAL T  48  ? N VAL T 29  O SER T  170 ? O SER T 151 
AG6 1 2 N ALA T  106 ? N ALA T 87  O GLY T  160 ? O GLY T 141 
AG6 2 3 N ILE T  159 ? N ILE T 140 O VAL T  214 ? O VAL T 195 
AG6 3 4 O SER T  217 ? O SER T 198 N THR T  196 ? N THR T 177 
AG7 1 2 N VAL U  95  ? N VAL U 76  O ALA U  122 ? O ALA U 103 
AG7 2 3 N HIS U  123 ? N HIS U 104 O GLN U  131 ? O GLN U 112 
AG7 3 4 O VAL U  130 ? O VAL U 111 N TRP U  77  ? N TRP U 58  
AG7 4 5 N PHE U  71  ? N PHE U 52  O ILE U  136 ? O ILE U 117 
AG7 5 6 O ARG U  137 ? O ARG U 118 N GLU U  115 ? N GLU U 96  
AG8 1 2 N VAL U  95  ? N VAL U 76  O ALA U  122 ? O ALA U 103 
AG8 2 3 N HIS U  123 ? N HIS U 104 O GLN U  131 ? O GLN U 112 
AG8 3 4 O VAL U  130 ? O VAL U 111 N TRP U  77  ? N TRP U 58  
AG8 4 5 O ASP U  68  ? O ASP U 49  N LEU U  58  ? N LEU U 39  
AG8 5 6 N VAL U  48  ? N VAL U 29  O SER U  170 ? O SER U 151 
AG9 1 2 N ALA U  106 ? N ALA U 87  O GLY U  160 ? O GLY U 141 
AG9 2 3 N ILE U  159 ? N ILE U 140 O VAL U  214 ? O VAL U 195 
AG9 3 4 O GLU U  215 ? O GLU U 196 N LYS U  198 ? N LYS U 179 
AH1 1 2 N VAL V  95  ? N VAL V 76  O ALA V  122 ? O ALA V 103 
AH1 2 3 N HIS V  123 ? N HIS V 104 O GLN V  131 ? O GLN V 112 
AH1 3 4 O VAL V  130 ? O VAL V 111 N TRP V  77  ? N TRP V 58  
AH1 4 5 N PHE V  71  ? N PHE V 52  O ILE V  136 ? O ILE V 117 
AH1 5 6 O ARG V  137 ? O ARG V 118 N GLU V  115 ? N GLU V 96  
AH2 1 2 N VAL V  95  ? N VAL V 76  O ALA V  122 ? O ALA V 103 
AH2 2 3 N HIS V  123 ? N HIS V 104 O GLN V  131 ? O GLN V 112 
AH2 3 4 O VAL V  130 ? O VAL V 111 N TRP V  77  ? N TRP V 58  
AH2 4 5 O ASP V  68  ? O ASP V 49  N LEU V  58  ? N LEU V 39  
AH2 5 6 N VAL V  48  ? N VAL V 29  O SER V  170 ? O SER V 151 
AH3 1 2 N ALA V  106 ? N ALA V 87  O GLY V  160 ? O GLY V 141 
AH3 2 3 N ILE V  159 ? N ILE V 140 O VAL V  214 ? O VAL V 195 
AH3 3 4 O SER V  217 ? O SER V 198 N THR V  196 ? N THR V 177 
AH4 1 2 N VAL W  95  ? N VAL W 76  O ALA W  122 ? O ALA W 103 
AH4 2 3 N HIS W  123 ? N HIS W 104 O GLN W  131 ? O GLN W 112 
AH4 3 4 O VAL W  130 ? O VAL W 111 N TRP W  77  ? N TRP W 58  
AH4 4 5 N PHE W  71  ? N PHE W 52  O ILE W  136 ? O ILE W 117 
AH4 5 6 O ARG W  137 ? O ARG W 118 N GLU W  115 ? N GLU W 96  
AH5 1 2 N VAL W  95  ? N VAL W 76  O ALA W  122 ? O ALA W 103 
AH5 2 3 N HIS W  123 ? N HIS W 104 O GLN W  131 ? O GLN W 112 
AH5 3 4 O VAL W  130 ? O VAL W 111 N TRP W  77  ? N TRP W 58  
AH5 4 5 O VAL W  70  ? O VAL W 51  N ILE W  55  ? N ILE W 36  
AH5 5 6 N VAL W  48  ? N VAL W 29  O SER W  170 ? O SER W 151 
AH6 1 2 N ALA W  106 ? N ALA W 87  O GLY W  160 ? O GLY W 141 
AH6 2 3 N ILE W  159 ? N ILE W 140 O VAL W  214 ? O VAL W 195 
AH6 3 4 O SER W  217 ? O SER W 198 N THR W  196 ? N THR W 177 
AH7 1 2 N VAL X  95  ? N VAL X 76  O ALA X  122 ? O ALA X 103 
AH7 2 3 N HIS X  123 ? N HIS X 104 O GLN X  131 ? O GLN X 112 
AH7 3 4 O VAL X  130 ? O VAL X 111 N TRP X  77  ? N TRP X 58  
AH7 4 5 N PHE X  71  ? N PHE X 52  O ILE X  136 ? O ILE X 117 
AH7 5 6 O ARG X  137 ? O ARG X 118 N GLU X  115 ? N GLU X 96  
AH8 1 2 N VAL X  95  ? N VAL X 76  O ALA X  122 ? O ALA X 103 
AH8 2 3 N HIS X  123 ? N HIS X 104 O GLN X  131 ? O GLN X 112 
AH8 3 4 O VAL X  130 ? O VAL X 111 N TRP X  77  ? N TRP X 58  
AH8 4 5 O THR X  76  ? O THR X 57  N SER X  49  ? N SER X 30  
AH8 5 6 N VAL X  48  ? N VAL X 29  O SER X  170 ? O SER X 151 
AH9 1 2 N ALA X  106 ? N ALA X 87  O GLY X  160 ? O GLY X 141 
AH9 2 3 N ILE X  159 ? N ILE X 140 O VAL X  214 ? O VAL X 195 
AH9 3 4 O SER X  217 ? O SER X 198 N THR X  196 ? N THR X 177 
AI1 1 2 N VAL Y  95  ? N VAL Y 76  O ALA Y  122 ? O ALA Y 103 
AI1 2 3 N HIS Y  123 ? N HIS Y 104 O GLN Y  131 ? O GLN Y 112 
AI1 3 4 O VAL Y  130 ? O VAL Y 111 N TRP Y  77  ? N TRP Y 58  
AI1 4 5 N PHE Y  71  ? N PHE Y 52  O ILE Y  136 ? O ILE Y 117 
AI1 5 6 O ARG Y  137 ? O ARG Y 118 N GLU Y  115 ? N GLU Y 96  
AI2 1 2 N VAL Y  95  ? N VAL Y 76  O ALA Y  122 ? O ALA Y 103 
AI2 2 3 N HIS Y  123 ? N HIS Y 104 O GLN Y  131 ? O GLN Y 112 
AI2 3 4 O VAL Y  130 ? O VAL Y 111 N TRP Y  77  ? N TRP Y 58  
AI2 4 5 O THR Y  76  ? O THR Y 57  N SER Y  49  ? N SER Y 30  
AI2 5 6 N VAL Y  48  ? N VAL Y 29  O SER Y  170 ? O SER Y 151 
AI3 1 2 N ALA Y  106 ? N ALA Y 87  O GLY Y  160 ? O GLY Y 141 
AI3 2 3 N ILE Y  159 ? N ILE Y 140 O VAL Y  214 ? O VAL Y 195 
AI3 3 4 O SER Y  217 ? O SER Y 198 N THR Y  196 ? N THR Y 177 
AI4 1 2 N VAL Z  95  ? N VAL Z 76  O ALA Z  122 ? O ALA Z 103 
AI4 2 3 N HIS Z  123 ? N HIS Z 104 O GLN Z  131 ? O GLN Z 112 
AI4 3 4 O VAL Z  130 ? O VAL Z 111 N TRP Z  77  ? N TRP Z 58  
AI4 4 5 N PHE Z  71  ? N PHE Z 52  O ILE Z  136 ? O ILE Z 117 
AI4 5 6 O ARG Z  137 ? O ARG Z 118 N GLU Z  115 ? N GLU Z 96  
AI5 1 2 N VAL Z  95  ? N VAL Z 76  O ALA Z  122 ? O ALA Z 103 
AI5 2 3 N HIS Z  123 ? N HIS Z 104 O GLN Z  131 ? O GLN Z 112 
AI5 3 4 O VAL Z  130 ? O VAL Z 111 N TRP Z  77  ? N TRP Z 58  
AI5 4 5 O VAL Z  70  ? O VAL Z 51  N ASN Z  56  ? N ASN Z 37  
AI5 5 6 N VAL Z  48  ? N VAL Z 29  O SER Z  170 ? O SER Z 151 
AI6 1 2 N ALA Z  106 ? N ALA Z 87  O GLY Z  160 ? O GLY Z 141 
AI6 2 3 N ILE Z  159 ? N ILE Z 140 O VAL Z  214 ? O VAL Z 195 
AI6 3 4 O SER Z  217 ? O SER Z 198 N THR Z  196 ? N THR Z 177 
AI7 1 2 N VAL AA 95  ? N VAL a 76  O ALA AA 122 ? O ALA a 103 
AI7 2 3 N HIS AA 123 ? N HIS a 104 O GLN AA 131 ? O GLN a 112 
AI7 3 4 O VAL AA 130 ? O VAL a 111 N TRP AA 77  ? N TRP a 58  
AI7 4 5 N PHE AA 71  ? N PHE a 52  O ILE AA 136 ? O ILE a 117 
AI7 5 6 O ARG AA 137 ? O ARG a 118 N GLU AA 115 ? N GLU a 96  
AI8 1 2 N VAL AA 95  ? N VAL a 76  O ALA AA 122 ? O ALA a 103 
AI8 2 3 N HIS AA 123 ? N HIS a 104 O GLN AA 131 ? O GLN a 112 
AI8 3 4 O VAL AA 130 ? O VAL a 111 N TRP AA 77  ? N TRP a 58  
AI8 4 5 O THR AA 76  ? O THR a 57  N SER AA 49  ? N SER a 30  
AI8 5 6 N VAL AA 48  ? N VAL a 29  O SER AA 170 ? O SER a 151 
AI9 1 2 N ALA AA 106 ? N ALA a 87  O GLY AA 160 ? O GLY a 141 
AI9 2 3 N ILE AA 159 ? N ILE a 140 O VAL AA 214 ? O VAL a 195 
AI9 3 4 O GLU AA 215 ? O GLU a 196 N LYS AA 198 ? N LYS a 179 
AJ1 1 2 N VAL BA 95  ? N VAL b 76  O ALA BA 122 ? O ALA b 103 
AJ1 2 3 N HIS BA 123 ? N HIS b 104 O GLN BA 131 ? O GLN b 112 
AJ1 3 4 O VAL BA 130 ? O VAL b 111 N TRP BA 77  ? N TRP b 58  
AJ1 4 5 N PHE BA 71  ? N PHE b 52  O ILE BA 136 ? O ILE b 117 
AJ1 5 6 O ARG BA 137 ? O ARG b 118 N GLU BA 115 ? N GLU b 96  
AJ2 1 2 N VAL BA 95  ? N VAL b 76  O ALA BA 122 ? O ALA b 103 
AJ2 2 3 N HIS BA 123 ? N HIS b 104 O GLN BA 131 ? O GLN b 112 
AJ2 3 4 O VAL BA 130 ? O VAL b 111 N TRP BA 77  ? N TRP b 58  
AJ2 4 5 O VAL BA 70  ? O VAL b 51  N ASN BA 56  ? N ASN b 37  
AJ2 5 6 N VAL BA 48  ? N VAL b 29  O SER BA 170 ? O SER b 151 
AJ3 1 2 N ALA BA 106 ? N ALA b 87  O GLY BA 160 ? O GLY b 141 
AJ3 2 3 N CYS BA 155 ? N CYS b 136 O LEU BA 218 ? O LEU b 199 
AJ3 3 4 O SER BA 217 ? O SER b 198 N THR BA 196 ? N THR b 177 
AJ4 1 2 N VAL CA 95  ? N VAL c 76  O ALA CA 122 ? O ALA c 103 
AJ4 2 3 N HIS CA 123 ? N HIS c 104 O GLN CA 131 ? O GLN c 112 
AJ4 3 4 O VAL CA 130 ? O VAL c 111 N TRP CA 77  ? N TRP c 58  
AJ4 4 5 N PHE CA 71  ? N PHE c 52  O ILE CA 136 ? O ILE c 117 
AJ4 5 6 O ARG CA 137 ? O ARG c 118 N GLU CA 115 ? N GLU c 96  
AJ5 1 2 N VAL CA 95  ? N VAL c 76  O ALA CA 122 ? O ALA c 103 
AJ5 2 3 N HIS CA 123 ? N HIS c 104 O GLN CA 131 ? O GLN c 112 
AJ5 3 4 O VAL CA 130 ? O VAL c 111 N TRP CA 77  ? N TRP c 58  
AJ5 4 5 O TRP CA 72  ? O TRP c 53  N LYS CA 53  ? N LYS c 34  
AJ5 5 6 N VAL CA 48  ? N VAL c 29  O SER CA 170 ? O SER c 151 
AJ6 1 2 N ALA CA 106 ? N ALA c 87  O GLY CA 160 ? O GLY c 141 
AJ6 2 3 N CYS CA 155 ? N CYS c 136 O LEU CA 218 ? O LEU c 199 
AJ6 3 4 O SER CA 217 ? O SER c 198 N THR CA 196 ? N THR c 177 
AJ7 1 2 N VAL DA 95  ? N VAL d 76  O ALA DA 122 ? O ALA d 103 
AJ7 2 3 N HIS DA 123 ? N HIS d 104 O GLN DA 131 ? O GLN d 112 
AJ7 3 4 O VAL DA 130 ? O VAL d 111 N TRP DA 77  ? N TRP d 58  
AJ7 4 5 N PHE DA 71  ? N PHE d 52  O ILE DA 136 ? O ILE d 117 
AJ7 5 6 O ARG DA 137 ? O ARG d 118 N GLU DA 115 ? N GLU d 96  
AJ8 1 2 N VAL DA 95  ? N VAL d 76  O ALA DA 122 ? O ALA d 103 
AJ8 2 3 N HIS DA 123 ? N HIS d 104 O GLN DA 131 ? O GLN d 112 
AJ8 3 4 O VAL DA 130 ? O VAL d 111 N TRP DA 77  ? N TRP d 58  
AJ8 4 5 O THR DA 76  ? O THR d 57  N SER DA 49  ? N SER d 30  
AJ8 5 6 N VAL DA 48  ? N VAL d 29  O SER DA 170 ? O SER d 151 
AJ9 1 2 N ALA DA 106 ? N ALA d 87  O GLY DA 160 ? O GLY d 141 
AJ9 2 3 N CYS DA 155 ? N CYS d 136 O LEU DA 218 ? O LEU d 199 
AJ9 3 4 O GLU DA 215 ? O GLU d 196 N LYS DA 198 ? N LYS d 179 
AK1 1 2 N VAL EA 95  ? N VAL e 76  O ALA EA 122 ? O ALA e 103 
AK1 2 3 N HIS EA 123 ? N HIS e 104 O GLN EA 131 ? O GLN e 112 
AK1 3 4 O VAL EA 130 ? O VAL e 111 N TRP EA 77  ? N TRP e 58  
AK1 4 5 N PHE EA 71  ? N PHE e 52  O ILE EA 136 ? O ILE e 117 
AK1 5 6 O ARG EA 137 ? O ARG e 118 N GLU EA 115 ? N GLU e 96  
AK2 1 2 N VAL EA 95  ? N VAL e 76  O ALA EA 122 ? O ALA e 103 
AK2 2 3 N HIS EA 123 ? N HIS e 104 O GLN EA 131 ? O GLN e 112 
AK2 3 4 O VAL EA 130 ? O VAL e 111 N TRP EA 77  ? N TRP e 58  
AK2 4 5 O THR EA 76  ? O THR e 57  N SER EA 49  ? N SER e 30  
AK2 5 6 N VAL EA 48  ? N VAL e 29  O SER EA 170 ? O SER e 151 
AK3 1 2 N ALA EA 106 ? N ALA e 87  O GLY EA 160 ? O GLY e 141 
AK3 2 3 N CYS EA 155 ? N CYS e 136 O LEU EA 218 ? O LEU e 199 
AK3 3 4 O SER EA 217 ? O SER e 198 N THR EA 196 ? N THR e 177 
AK4 1 2 N VAL FA 95  ? N VAL f 76  O ALA FA 122 ? O ALA f 103 
AK4 2 3 N HIS FA 123 ? N HIS f 104 O GLN FA 131 ? O GLN f 112 
AK4 3 4 O VAL FA 130 ? O VAL f 111 N TRP FA 77  ? N TRP f 58  
AK4 4 5 N PHE FA 71  ? N PHE f 52  O ILE FA 136 ? O ILE f 117 
AK4 5 6 O ARG FA 137 ? O ARG f 118 N GLU FA 115 ? N GLU f 96  
AK5 1 2 N VAL FA 95  ? N VAL f 76  O ALA FA 122 ? O ALA f 103 
AK5 2 3 N HIS FA 123 ? N HIS f 104 O GLN FA 131 ? O GLN f 112 
AK5 3 4 O VAL FA 130 ? O VAL f 111 N TRP FA 77  ? N TRP f 58  
AK5 4 5 O THR FA 76  ? O THR f 57  N SER FA 49  ? N SER f 30  
AK5 5 6 N VAL FA 48  ? N VAL f 29  O SER FA 170 ? O SER f 151 
AK6 1 2 N ALA FA 106 ? N ALA f 87  O GLY FA 160 ? O GLY f 141 
AK6 2 3 N CYS FA 155 ? N CYS f 136 O LEU FA 218 ? O LEU f 199 
AK6 3 4 O SER FA 217 ? O SER f 198 N THR FA 196 ? N THR f 177 
AK7 1 2 N VAL GA 95  ? N VAL g 76  O ALA GA 122 ? O ALA g 103 
AK7 2 3 N HIS GA 123 ? N HIS g 104 O GLN GA 131 ? O GLN g 112 
AK7 3 4 O VAL GA 130 ? O VAL g 111 N TRP GA 77  ? N TRP g 58  
AK7 4 5 N PHE GA 71  ? N PHE g 52  O ILE GA 136 ? O ILE g 117 
AK7 5 6 O ARG GA 137 ? O ARG g 118 N GLU GA 115 ? N GLU g 96  
AK8 1 2 N VAL GA 95  ? N VAL g 76  O ALA GA 122 ? O ALA g 103 
AK8 2 3 N HIS GA 123 ? N HIS g 104 O GLN GA 131 ? O GLN g 112 
AK8 3 4 O VAL GA 130 ? O VAL g 111 N TRP GA 77  ? N TRP g 58  
AK8 4 5 O THR GA 76  ? O THR g 57  N SER GA 49  ? N SER g 30  
AK8 5 6 N VAL GA 48  ? N VAL g 29  O SER GA 170 ? O SER g 151 
AK9 1 2 N ALA GA 106 ? N ALA g 87  O GLY GA 160 ? O GLY g 141 
AK9 2 3 N CYS GA 155 ? N CYS g 136 O LEU GA 218 ? O LEU g 199 
AK9 3 4 O SER GA 217 ? O SER g 198 N THR GA 196 ? N THR g 177 
AL1 1 2 N VAL HA 95  ? N VAL h 76  O ALA HA 122 ? O ALA h 103 
AL1 2 3 N HIS HA 123 ? N HIS h 104 O GLN HA 131 ? O GLN h 112 
AL1 3 4 O VAL HA 130 ? O VAL h 111 N TRP HA 77  ? N TRP h 58  
AL1 4 5 N PHE HA 71  ? N PHE h 52  O ILE HA 136 ? O ILE h 117 
AL1 5 6 O ARG HA 137 ? O ARG h 118 N GLU HA 115 ? N GLU h 96  
AL2 1 2 N VAL HA 95  ? N VAL h 76  O ALA HA 122 ? O ALA h 103 
AL2 2 3 N HIS HA 123 ? N HIS h 104 O GLN HA 131 ? O GLN h 112 
AL2 3 4 O VAL HA 130 ? O VAL h 111 N TRP HA 77  ? N TRP h 58  
AL2 4 5 O THR HA 76  ? O THR h 57  N SER HA 49  ? N SER h 30  
AL2 5 6 N VAL HA 48  ? N VAL h 29  O SER HA 170 ? O SER h 151 
AL3 1 2 N ALA HA 106 ? N ALA h 87  O GLY HA 160 ? O GLY h 141 
AL3 2 3 N ILE HA 159 ? N ILE h 140 O VAL HA 214 ? O VAL h 195 
AL3 3 4 O SER HA 217 ? O SER h 198 N THR HA 196 ? N THR h 177 
AL4 1 2 N VAL IA 95  ? N VAL i 76  O ALA IA 122 ? O ALA i 103 
AL4 2 3 N HIS IA 123 ? N HIS i 104 O GLN IA 131 ? O GLN i 112 
AL4 3 4 O VAL IA 130 ? O VAL i 111 N TRP IA 77  ? N TRP i 58  
AL4 4 5 N PHE IA 71  ? N PHE i 52  O ILE IA 136 ? O ILE i 117 
AL4 5 6 O ARG IA 137 ? O ARG i 118 N GLU IA 115 ? N GLU i 96  
AL5 1 2 N VAL IA 95  ? N VAL i 76  O ALA IA 122 ? O ALA i 103 
AL5 2 3 N HIS IA 123 ? N HIS i 104 O GLN IA 131 ? O GLN i 112 
AL5 3 4 O VAL IA 130 ? O VAL i 111 N TRP IA 77  ? N TRP i 58  
AL5 4 5 O THR IA 76  ? O THR i 57  N SER IA 49  ? N SER i 30  
AL5 5 6 N VAL IA 48  ? N VAL i 29  O SER IA 170 ? O SER i 151 
AL6 1 2 N ALA IA 106 ? N ALA i 87  O GLY IA 160 ? O GLY i 141 
AL6 2 3 N ILE IA 159 ? N ILE i 140 O VAL IA 214 ? O VAL i 195 
AL6 3 4 O GLU IA 215 ? O GLU i 196 N LYS IA 198 ? N LYS i 179 
AL7 1 2 N VAL JA 95  ? N VAL j 76  O ALA JA 122 ? O ALA j 103 
AL7 2 3 N HIS JA 123 ? N HIS j 104 O GLN JA 131 ? O GLN j 112 
AL7 3 4 O VAL JA 130 ? O VAL j 111 N TRP JA 77  ? N TRP j 58  
AL7 4 5 N PHE JA 71  ? N PHE j 52  O ILE JA 136 ? O ILE j 117 
AL7 5 6 O ARG JA 137 ? O ARG j 118 N GLU JA 115 ? N GLU j 96  
AL8 1 2 N VAL JA 95  ? N VAL j 76  O ALA JA 122 ? O ALA j 103 
AL8 2 3 N HIS JA 123 ? N HIS j 104 O GLN JA 131 ? O GLN j 112 
AL8 3 4 O VAL JA 130 ? O VAL j 111 N TRP JA 77  ? N TRP j 58  
AL8 4 5 O VAL JA 70  ? O VAL j 51  N ASN JA 56  ? N ASN j 37  
AL8 5 6 N VAL JA 48  ? N VAL j 29  O SER JA 170 ? O SER j 151 
AL9 1 2 N ALA JA 106 ? N ALA j 87  O GLY JA 160 ? O GLY j 141 
AL9 2 3 N CYS JA 155 ? N CYS j 136 O LEU JA 218 ? O LEU j 199 
AL9 3 4 O SER JA 217 ? O SER j 198 N THR JA 196 ? N THR j 177 
AM1 1 2 N VAL KA 95  ? N VAL k 76  O ALA KA 122 ? O ALA k 103 
AM1 2 3 N HIS KA 123 ? N HIS k 104 O GLN KA 131 ? O GLN k 112 
AM1 3 4 O VAL KA 130 ? O VAL k 111 N TRP KA 77  ? N TRP k 58  
AM1 4 5 N PHE KA 71  ? N PHE k 52  O ILE KA 136 ? O ILE k 117 
AM1 5 6 O ARG KA 137 ? O ARG k 118 N GLU KA 115 ? N GLU k 96  
AM2 1 2 N VAL KA 95  ? N VAL k 76  O ALA KA 122 ? O ALA k 103 
AM2 2 3 N HIS KA 123 ? N HIS k 104 O GLN KA 131 ? O GLN k 112 
AM2 3 4 O VAL KA 130 ? O VAL k 111 N TRP KA 77  ? N TRP k 58  
AM2 4 5 O THR KA 76  ? O THR k 57  N SER KA 49  ? N SER k 30  
AM2 5 6 N VAL KA 48  ? N VAL k 29  O SER KA 170 ? O SER k 151 
AM3 1 2 N ALA KA 106 ? N ALA k 87  O GLY KA 160 ? O GLY k 141 
AM3 2 3 N CYS KA 155 ? N CYS k 136 O LEU KA 218 ? O LEU k 199 
AM3 3 4 O SER KA 217 ? O SER k 198 N THR KA 196 ? N THR k 177 
AM4 1 2 N VAL LA 95  ? N VAL l 76  O ALA LA 122 ? O ALA l 103 
AM4 2 3 N HIS LA 123 ? N HIS l 104 O GLN LA 131 ? O GLN l 112 
AM4 3 4 O VAL LA 130 ? O VAL l 111 N TRP LA 77  ? N TRP l 58  
AM4 4 5 N PHE LA 71  ? N PHE l 52  O ILE LA 136 ? O ILE l 117 
AM4 5 6 O ARG LA 137 ? O ARG l 118 N GLU LA 115 ? N GLU l 96  
AM5 1 2 N VAL LA 95  ? N VAL l 76  O ALA LA 122 ? O ALA l 103 
AM5 2 3 N HIS LA 123 ? N HIS l 104 O GLN LA 131 ? O GLN l 112 
AM5 3 4 O VAL LA 130 ? O VAL l 111 N TRP LA 77  ? N TRP l 58  
AM5 4 5 O ASP LA 68  ? O ASP l 49  N LEU LA 58  ? N LEU l 39  
AM5 5 6 N VAL LA 48  ? N VAL l 29  O SER LA 170 ? O SER l 151 
AM6 1 2 N ALA LA 106 ? N ALA l 87  O GLY LA 160 ? O GLY l 141 
AM6 2 3 N CYS LA 155 ? N CYS l 136 O LEU LA 218 ? O LEU l 199 
AM6 3 4 O SER LA 217 ? O SER l 198 N THR LA 196 ? N THR l 177 
AM7 1 2 N VAL MA 95  ? N VAL m 76  O ALA MA 122 ? O ALA m 103 
AM7 2 3 N HIS MA 123 ? N HIS m 104 O GLN MA 131 ? O GLN m 112 
AM7 3 4 O VAL MA 130 ? O VAL m 111 N TRP MA 77  ? N TRP m 58  
AM7 4 5 N PHE MA 71  ? N PHE m 52  O ILE MA 136 ? O ILE m 117 
AM7 5 6 O ARG MA 137 ? O ARG m 118 N GLU MA 115 ? N GLU m 96  
AM8 1 2 N VAL MA 95  ? N VAL m 76  O ALA MA 122 ? O ALA m 103 
AM8 2 3 N HIS MA 123 ? N HIS m 104 O GLN MA 131 ? O GLN m 112 
AM8 3 4 O VAL MA 130 ? O VAL m 111 N TRP MA 77  ? N TRP m 58  
AM8 4 5 O THR MA 76  ? O THR m 57  N SER MA 49  ? N SER m 30  
AM8 5 6 N VAL MA 48  ? N VAL m 29  O SER MA 170 ? O SER m 151 
AM9 1 2 N ALA MA 106 ? N ALA m 87  O GLY MA 160 ? O GLY m 141 
AM9 2 3 N CYS MA 155 ? N CYS m 136 O LEU MA 218 ? O LEU m 199 
AM9 3 4 O GLU MA 215 ? O GLU m 196 N LYS MA 198 ? N LYS m 179 
AN1 1 2 N VAL NA 95  ? N VAL n 76  O ALA NA 122 ? O ALA n 103 
AN1 2 3 N HIS NA 123 ? N HIS n 104 O GLN NA 131 ? O GLN n 112 
AN1 3 4 O VAL NA 130 ? O VAL n 111 N TRP NA 77  ? N TRP n 58  
AN1 4 5 N PHE NA 71  ? N PHE n 52  O ILE NA 136 ? O ILE n 117 
AN1 5 6 O ARG NA 137 ? O ARG n 118 N GLU NA 115 ? N GLU n 96  
AN2 1 2 N VAL NA 95  ? N VAL n 76  O ALA NA 122 ? O ALA n 103 
AN2 2 3 N HIS NA 123 ? N HIS n 104 O GLN NA 131 ? O GLN n 112 
AN2 3 4 O VAL NA 130 ? O VAL n 111 N TRP NA 77  ? N TRP n 58  
AN2 4 5 O THR NA 76  ? O THR n 57  N SER NA 49  ? N SER n 30  
AN2 5 6 N VAL NA 48  ? N VAL n 29  O SER NA 170 ? O SER n 151 
AN3 1 2 N ALA NA 106 ? N ALA n 87  O GLY NA 160 ? O GLY n 141 
AN3 2 3 N CYS NA 155 ? N CYS n 136 O LEU NA 218 ? O LEU n 199 
AN3 3 4 O GLU NA 215 ? O GLU n 196 N LYS NA 198 ? N LYS n 179 
# 
_database_PDB_matrix.entry_id          4UM3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4UM3 
_atom_sites.fract_transf_matrix[1][1]   0.007381 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001473 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006877 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004341 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . LEU A  1 20  ? -15.060  15.433  -112.079 1.00 51.94  ? 1    LEU A N   1 
ATOM   2     C  CA  . LEU A  1 20  ? -16.091  14.952  -111.176 1.00 42.38  ? 1    LEU A CA  1 
ATOM   3     C  C   . LEU A  1 20  ? -16.364  15.933  -110.056 1.00 47.53  ? 1    LEU A C   1 
ATOM   4     O  O   . LEU A  1 20  ? -15.447  16.323  -109.350 1.00 54.82  ? 1    LEU A O   1 
ATOM   5     C  CB  . LEU A  1 20  ? -15.656  13.640  -110.560 1.00 32.33  ? 1    LEU A CB  1 
ATOM   6     C  CG  . LEU A  1 20  ? -15.808  12.392  -111.432 1.00 35.68  ? 1    LEU A CG  1 
ATOM   7     C  CD1 . LEU A  1 20  ? -15.407  11.140  -110.668 1.00 39.42  ? 1    LEU A CD1 1 
ATOM   8     C  CD2 . LEU A  1 20  ? -17.227  12.246  -111.937 1.00 35.41  ? 1    LEU A CD2 1 
ATOM   9     N  N   . ASP A  1 21  ? -17.623  16.332  -109.893 1.00 44.71  ? 2    ASP A N   1 
ATOM   10    C  CA  . ASP A  1 21  ? -18.043  17.025  -108.682 1.00 40.90  ? 2    ASP A CA  1 
ATOM   11    C  C   . ASP A  1 21  ? -18.955  16.117  -107.830 1.00 41.00  ? 2    ASP A C   1 
ATOM   12    O  O   . ASP A  1 21  ? -19.252  14.977  -108.227 1.00 36.01  ? 2    ASP A O   1 
ATOM   13    C  CB  . ASP A  1 21  ? -18.713  18.365  -109.002 1.00 52.45  ? 2    ASP A CB  1 
ATOM   14    C  CG  . ASP A  1 21  ? -19.908  18.234  -109.940 1.00 65.19  ? 2    ASP A CG  1 
ATOM   15    O  OD1 . ASP A  1 21  ? -20.443  17.117  -110.112 1.00 68.11  ? 2    ASP A OD1 1 
ATOM   16    O  OD2 . ASP A  1 21  ? -20.331  19.272  -110.496 1.00 69.48  ? 2    ASP A OD2 1 
ATOM   17    N  N   . ARG A  1 22  ? -19.374  16.606  -106.656 1.00 40.44  ? 3    ARG A N   1 
ATOM   18    C  CA  . ARG A  1 22  ? -20.258  15.844  -105.770 1.00 32.67  ? 3    ARG A CA  1 
ATOM   19    C  C   . ARG A  1 22  ? -21.506  15.298  -106.483 1.00 32.21  ? 3    ARG A C   1 
ATOM   20    O  O   . ARG A  1 22  ? -21.845  14.129  -106.354 1.00 25.13  ? 3    ARG A O   1 
ATOM   21    C  CB  . ARG A  1 22  ? -20.684  16.711  -104.587 1.00 33.29  ? 3    ARG A CB  1 
ATOM   22    C  CG  . ARG A  1 22  ? -19.644  16.797  -103.500 1.00 41.87  ? 3    ARG A CG  1 
ATOM   23    C  CD  . ARG A  1 22  ? -20.024  17.761  -102.403 1.00 45.94  ? 3    ARG A CD  1 
ATOM   24    N  NE  . ARG A  1 22  ? -18.925  17.915  -101.470 1.00 50.39  ? 3    ARG A NE  1 
ATOM   25    C  CZ  . ARG A  1 22  ? -17.985  18.848  -101.580 1.00 60.05  ? 3    ARG A CZ  1 
ATOM   26    N  NH1 . ARG A  1 22  ? -18.019  19.725  -102.571 1.00 59.10  ? 3    ARG A NH1 1 
ATOM   27    N  NH2 . ARG A  1 22  ? -17.006  18.910  -100.689 1.00 68.58  ? 3    ARG A NH2 1 
ATOM   28    N  N   . ALA A  1 23  ? -22.185  16.165  -107.229 1.00 35.40  ? 4    ALA A N   1 
ATOM   29    C  CA  . ALA A  1 23  ? -23.373  15.787  -107.978 1.00 33.78  ? 4    ALA A CA  1 
ATOM   30    C  C   . ALA A  1 23  ? -23.128  14.535  -108.834 1.00 35.31  ? 4    ALA A C   1 
ATOM   31    O  O   . ALA A  1 23  ? -23.923  13.583  -108.816 1.00 29.18  ? 4    ALA A O   1 
ATOM   32    C  CB  . ALA A  1 23  ? -23.833  16.962  -108.836 1.00 28.96  ? 4    ALA A CB  1 
ATOM   33    N  N   . ASP A  1 24  ? -22.015  14.525  -109.566 1.00 33.51  ? 5    ASP A N   1 
ATOM   34    C  CA  . ASP A  1 24  ? -21.705  13.392  -110.430 1.00 29.78  ? 5    ASP A CA  1 
ATOM   35    C  C   . ASP A  1 24  ? -21.436  12.133  -109.623 1.00 31.13  ? 5    ASP A C   1 
ATOM   36    O  O   . ASP A  1 24  ? -21.962  11.060  -109.943 1.00 33.92  ? 5    ASP A O   1 
ATOM   37    C  CB  . ASP A  1 24  ? -20.518  13.702  -111.354 1.00 34.15  ? 5    ASP A CB  1 
ATOM   38    C  CG  . ASP A  1 24  ? -20.766  14.922  -112.245 1.00 40.45  ? 5    ASP A CG  1 
ATOM   39    O  OD1 . ASP A  1 24  ? -21.941  15.138  -112.664 1.00 37.36  ? 5    ASP A OD1 1 
ATOM   40    O  OD2 . ASP A  1 24  ? -19.777  15.664  -112.498 1.00 43.90  ? 5    ASP A OD2 1 
ATOM   41    N  N   . ILE A  1 25  ? -20.628  12.275  -108.572 1.00 28.28  ? 6    ILE A N   1 
ATOM   42    C  CA  . ILE A  1 25  ? -20.247  11.146  -107.741 1.00 24.36  ? 6    ILE A CA  1 
ATOM   43    C  C   . ILE A  1 25  ? -21.467  10.504  -107.110 1.00 24.45  ? 6    ILE A C   1 
ATOM   44    O  O   . ILE A  1 25  ? -21.621  9.283   -107.095 1.00 34.62  ? 6    ILE A O   1 
ATOM   45    C  CB  . ILE A  1 25  ? -19.252  11.564  -106.645 1.00 35.89  ? 6    ILE A CB  1 
ATOM   46    C  CG1 . ILE A  1 25  ? -17.928  11.997  -107.286 1.00 41.00  ? 6    ILE A CG1 1 
ATOM   47    C  CG2 . ILE A  1 25  ? -19.036  10.426  -105.658 1.00 28.28  ? 6    ILE A CG2 1 
ATOM   48    C  CD1 . ILE A  1 25  ? -16.963  12.666  -106.316 1.00 42.76  ? 6    ILE A CD1 1 
ATOM   49    N  N   . LEU A  1 26  ? -22.358  11.335  -106.607 1.00 24.72  ? 7    LEU A N   1 
ATOM   50    C  CA  . LEU A  1 26  ? -23.553  10.825  -105.954 1.00 29.91  ? 7    LEU A CA  1 
ATOM   51    C  C   . LEU A  1 26  ? -24.479  10.199  -106.984 1.00 37.27  ? 7    LEU A C   1 
ATOM   52    O  O   . LEU A  1 26  ? -25.109  9.176   -106.718 1.00 39.88  ? 7    LEU A O   1 
ATOM   53    C  CB  . LEU A  1 26  ? -24.238  11.947  -105.178 1.00 25.16  ? 7    LEU A CB  1 
ATOM   54    C  CG  . LEU A  1 26  ? -23.418  12.365  -103.959 1.00 29.70  ? 7    LEU A CG  1 
ATOM   55    C  CD1 . LEU A  1 26  ? -23.768  13.775  -103.535 1.00 37.89  ? 7    LEU A CD1 1 
ATOM   56    C  CD2 . LEU A  1 26  ? -23.680  11.388  -102.830 1.00 25.30  ? 7    LEU A CD2 1 
ATOM   57    N  N   . TYR A  1 27  ? -24.537  10.805  -108.173 1.00 40.00  ? 8    TYR A N   1 
ATOM   58    C  CA  . TYR A  1 27  ? -25.309  10.248  -109.283 1.00 31.38  ? 8    TYR A CA  1 
ATOM   59    C  C   . TYR A  1 27  ? -24.816  8.844   -109.652 1.00 31.99  ? 8    TYR A C   1 
ATOM   60    O  O   . TYR A  1 27  ? -25.616  7.914   -109.754 1.00 24.15  ? 8    TYR A O   1 
ATOM   61    C  CB  . TYR A  1 27  ? -25.273  11.179  -110.487 1.00 34.55  ? 8    TYR A CB  1 
ATOM   62    C  CG  . TYR A  1 27  ? -26.004  10.650  -111.705 1.00 41.62  ? 8    TYR A CG  1 
ATOM   63    C  CD1 . TYR A  1 27  ? -27.383  10.726  -111.797 1.00 47.56  ? 8    TYR A CD1 1 
ATOM   64    C  CD2 . TYR A  1 27  ? -25.312  10.076  -112.762 1.00 41.02  ? 8    TYR A CD2 1 
ATOM   65    C  CE1 . TYR A  1 27  ? -28.055  10.236  -112.907 1.00 44.89  ? 8    TYR A CE1 1 
ATOM   66    C  CE2 . TYR A  1 27  ? -25.976  9.588   -113.865 1.00 42.49  ? 8    TYR A CE2 1 
ATOM   67    C  CZ  . TYR A  1 27  ? -27.347  9.668   -113.925 1.00 45.21  ? 8    TYR A CZ  1 
ATOM   68    O  OH  . TYR A  1 27  ? -28.012  9.189   -115.029 1.00 55.14  ? 8    TYR A OH  1 
ATOM   69    N  N   . ASN A  1 28  ? -23.504  8.680   -109.831 1.00 36.48  ? 9    ASN A N   1 
ATOM   70    C  CA  . ASN A  1 28  ? -22.943  7.356   -110.136 1.00 23.76  ? 9    ASN A CA  1 
ATOM   71    C  C   . ASN A  1 28  ? -23.249  6.350   -109.032 1.00 26.44  ? 9    ASN A C   1 
ATOM   72    O  O   . ASN A  1 28  ? -23.634  5.208   -109.305 1.00 25.05  ? 9    ASN A O   1 
ATOM   73    C  CB  . ASN A  1 28  ? -21.437  7.435   -110.372 1.00 23.60  ? 9    ASN A CB  1 
ATOM   74    C  CG  . ASN A  1 28  ? -21.061  8.358   -111.539 1.00 32.05  ? 9    ASN A CG  1 
ATOM   75    O  OD1 . ASN A  1 28  ? -21.850  8.582   -112.470 1.00 27.10  ? 9    ASN A OD1 1 
ATOM   76    N  ND2 . ASN A  1 28  ? -19.842  8.896   -111.488 1.00 32.15  ? 9    ASN A ND2 1 
ATOM   77    N  N   . ILE A  1 29  ? -23.162  6.758   -107.784 1.00 27.46  ? 10   ILE A N   1 
ATOM   78    C  CA  . ILE A  1 29  ? -23.465  5.861   -106.677 1.00 23.99  ? 10   ILE A CA  1 
ATOM   79    C  C   . ILE A  1 29  ? -24.900  5.378   -106.623 1.00 27.67  ? 10   ILE A C   1 
ATOM   80    O  O   . ILE A  1 29  ? -25.162  4.234   -106.447 1.00 25.99  ? 10   ILE A O   1 
ATOM   81    C  CB  . ILE A  1 29  ? -23.096  6.527   -105.359 1.00 24.20  ? 10   ILE A CB  1 
ATOM   82    C  CG1 . ILE A  1 29  ? -21.608  6.688   -105.257 1.00 30.21  ? 10   ILE A CG1 1 
ATOM   83    C  CG2 . ILE A  1 29  ? -23.534  5.742   -104.158 1.00 24.28  ? 10   ILE A CG2 1 
ATOM   84    C  CD1 . ILE A  1 29  ? -21.165  7.325   -103.977 1.00 27.17  ? 10   ILE A CD1 1 
ATOM   85    N  N   . ARG A  1 30  ? -25.823  6.283   -106.774 1.00 29.03  ? 11   ARG A N   1 
ATOM   86    C  CA  . ARG A  1 30  ? -27.217  5.999   -106.795 1.00 33.73  ? 11   ARG A CA  1 
ATOM   87    C  C   . ARG A  1 30  ? -27.597  5.105   -107.945 1.00 43.69  ? 11   ARG A C   1 
ATOM   88    O  O   . ARG A  1 30  ? -28.465  4.285   -107.828 1.00 51.73  ? 11   ARG A O   1 
ATOM   89    C  CB  . ARG A  1 30  ? -27.935  7.313   -106.934 1.00 41.87  ? 11   ARG A CB  1 
ATOM   90    C  CG  . ARG A  1 30  ? -29.407  7.301   -106.656 1.00 51.07  ? 11   ARG A CG  1 
ATOM   91    C  CD  . ARG A  1 30  ? -29.890  8.715   -106.414 1.00 59.53  ? 11   ARG A CD  1 
ATOM   92    N  NE  . ARG A  1 30  ? -30.229  9.424   -107.641 1.00 71.50  ? 11   ARG A NE  1 
ATOM   93    C  CZ  . ARG A  1 30  ? -29.605  10.501  -108.101 1.00 73.45  ? 11   ARG A CZ  1 
ATOM   94    N  NH1 . ARG A  1 30  ? -28.599  11.030  -107.442 1.00 69.91  ? 11   ARG A NH1 1 
ATOM   95    N  NH2 . ARG A  1 30  ? -30.006  11.055  -109.224 1.00 73.70  ? 11   ARG A NH2 1 
ATOM   96    N  N   . GLN A  1 31  ? -26.984  5.306   -109.089 1.00 43.51  ? 12   GLN A N   1 
ATOM   97    C  CA  . GLN A  1 31  ? -27.180  4.450   -110.245 1.00 39.46  ? 12   GLN A CA  1 
ATOM   98    C  C   . GLN A  1 31  ? -26.558  3.094   -110.204 1.00 38.40  ? 12   GLN A C   1 
ATOM   99    O  O   . GLN A  1 31  ? -27.098  2.178   -110.742 1.00 36.04  ? 12   GLN A O   1 
ATOM   100   C  CB  . GLN A  1 31  ? -26.763  5.139   -111.525 1.00 37.07  ? 12   GLN A CB  1 
ATOM   101   C  CG  . GLN A  1 31  ? -27.440  6.442   -111.761 1.00 42.93  ? 12   GLN A CG  1 
ATOM   102   C  CD  . GLN A  1 31  ? -28.888  6.271   -112.006 1.00 51.14  ? 12   GLN A CD  1 
ATOM   103   O  OE1 . GLN A  1 31  ? -29.704  7.009   -111.497 1.00 56.07  ? 12   GLN A OE1 1 
ATOM   104   N  NE2 . GLN A  1 31  ? -29.220  5.290   -112.781 1.00 53.95  ? 12   GLN A NE2 1 
ATOM   105   N  N   . THR A  1 32  ? -25.372  3.000   -109.654 1.00 39.35  ? 13   THR A N   1 
ATOM   106   C  CA  . THR A  1 32  ? -24.564  1.793   -109.829 1.00 47.20  ? 13   THR A CA  1 
ATOM   107   C  C   . THR A  1 32  ? -24.302  0.985   -108.559 1.00 45.97  ? 13   THR A C   1 
ATOM   108   O  O   . THR A  1 32  ? -23.953  -0.198  -108.626 1.00 37.78  ? 13   THR A O   1 
ATOM   109   C  CB  . THR A  1 32  ? -23.197  2.084   -110.518 1.00 34.41  ? 13   THR A CB  1 
ATOM   110   O  OG1 . THR A  1 32  ? -22.488  3.092   -109.780 1.00 42.60  ? 13   THR A OG1 1 
ATOM   111   C  CG2 . THR A  1 32  ? -23.413  2.545   -111.918 1.00 29.20  ? 13   THR A CG2 1 
ATOM   112   N  N   . SER A  1 33  ? -24.409  1.609   -107.403 1.00 47.33  ? 14   SER A N   1 
ATOM   113   C  CA  . SER A  1 33  ? -24.195  0.822   -106.198 1.00 55.23  ? 14   SER A CA  1 
ATOM   114   C  C   . SER A  1 33  ? -25.332  -0.204  -106.093 1.00 55.30  ? 14   SER A C   1 
ATOM   115   O  O   . SER A  1 33  ? -26.463  0.023   -106.565 1.00 59.39  ? 14   SER A O   1 
ATOM   116   C  CB  . SER A  1 33  ? -24.142  1.689   -104.947 1.00 53.39  ? 14   SER A CB  1 
ATOM   117   O  OG  . SER A  1 33  ? -25.449  1.854   -104.415 1.00 52.43  ? 14   SER A OG  1 
ATOM   118   N  N   . ARG A  1 34  ? -25.008  -1.342  -105.501 1.00 43.65  ? 15   ARG A N   1 
ATOM   119   C  CA  . ARG A  1 34  ? -25.944  -2.440  -105.383 1.00 36.00  ? 15   ARG A CA  1 
ATOM   120   C  C   . ARG A  1 34  ? -26.139  -2.742  -103.897 1.00 28.19  ? 15   ARG A C   1 
ATOM   121   O  O   . ARG A  1 34  ? -25.403  -3.563  -103.304 1.00 18.46  ? 15   ARG A O   1 
ATOM   122   C  CB  . ARG A  1 34  ? -25.389  -3.657  -106.130 1.00 33.07  ? 15   ARG A CB  1 
ATOM   123   C  CG  . ARG A  1 34  ? -25.169  -3.438  -107.614 1.00 31.11  ? 15   ARG A CG  1 
ATOM   124   C  CD  . ARG A  1 34  ? -26.506  -3.606  -108.374 1.00 33.99  ? 15   ARG A CD  1 
ATOM   125   N  NE  . ARG A  1 34  ? -27.126  -4.905  -108.078 1.00 41.72  ? 15   ARG A NE  1 
ATOM   126   C  CZ  . ARG A  1 34  ? -26.860  -6.038  -108.738 1.00 44.74  ? 15   ARG A CZ  1 
ATOM   127   N  NH1 . ARG A  1 34  ? -26.004  -6.021  -109.756 1.00 50.39  ? 15   ARG A NH1 1 
ATOM   128   N  NH2 . ARG A  1 34  ? -27.450  -7.183  -108.394 1.00 37.17  ? 15   ARG A NH2 1 
ATOM   129   N  N   . PRO A  1 35  ? -27.124  -2.068  -103.284 1.00 25.35  ? 16   PRO A N   1 
ATOM   130   C  CA  . PRO A  1 35  ? -27.312  -2.130  -101.826 1.00 23.64  ? 16   PRO A CA  1 
ATOM   131   C  C   . PRO A  1 35  ? -27.531  -3.567  -101.349 1.00 24.39  ? 16   PRO A C   1 
ATOM   132   O  O   . PRO A  1 35  ? -27.189  -3.920  -100.236 1.00 27.41  ? 16   PRO A O   1 
ATOM   133   C  CB  . PRO A  1 35  ? -28.573  -1.281  -101.586 1.00 17.28  ? 16   PRO A CB  1 
ATOM   134   C  CG  . PRO A  1 35  ? -28.738  -0.457  -102.837 1.00 15.96  ? 16   PRO A CG  1 
ATOM   135   C  CD  . PRO A  1 35  ? -28.130  -1.232  -103.959 1.00 15.04  ? 16   PRO A CD  1 
ATOM   136   N  N   . ASP A  1 36  ? -28.080  -4.386  -102.227 1.00 24.94  ? 17   ASP A N   1 
ATOM   137   C  CA  . ASP A  1 36  ? -28.396  -5.785  -101.943 1.00 24.85  ? 17   ASP A CA  1 
ATOM   138   C  C   . ASP A  1 36  ? -27.171  -6.680  -102.030 1.00 26.40  ? 17   ASP A C   1 
ATOM   139   O  O   . ASP A  1 36  ? -27.223  -7.852  -101.657 1.00 36.96  ? 17   ASP A O   1 
ATOM   140   C  CB  . ASP A  1 36  ? -29.472  -6.308  -102.926 1.00 15.37  ? 17   ASP A CB  1 
ATOM   141   C  CG  . ASP A  1 36  ? -29.193  -5.899  -104.408 1.00 80.95  ? 17   ASP A CG  1 
ATOM   142   O  OD1 . ASP A  1 36  ? -28.738  -4.753  -104.676 1.00 78.53  ? 17   ASP A OD1 1 
ATOM   143   O  OD2 . ASP A  1 36  ? -29.450  -6.722  -105.324 1.00 79.90  ? 17   ASP A OD2 1 
ATOM   144   N  N   . VAL A  1 37  ? -26.063  -6.129  -102.500 1.00 23.18  ? 18   VAL A N   1 
ATOM   145   C  CA  . VAL A  1 37  ? -24.917  -6.957  -102.884 1.00 14.98  ? 18   VAL A CA  1 
ATOM   146   C  C   . VAL A  1 37  ? -23.697  -6.683  -102.010 1.00 14.82  ? 18   VAL A C   1 
ATOM   147   O  O   . VAL A  1 37  ? -23.098  -5.610  -102.054 1.00 21.09  ? 18   VAL A O   1 
ATOM   148   C  CB  . VAL A  1 37  ? -24.537  -6.761  -104.388 1.00 30.88  ? 18   VAL A CB  1 
ATOM   149   C  CG1 . VAL A  1 37  ? -23.363  -7.626  -104.766 1.00 14.95  ? 18   VAL A CG1 1 
ATOM   150   C  CG2 . VAL A  1 37  ? -25.717  -7.027  -105.282 1.00 15.15  ? 18   VAL A CG2 1 
ATOM   151   N  N   . ILE A  1 38  ? -23.338  -7.668  -101.210 1.00 20.83  ? 19   ILE A N   1 
ATOM   152   C  CA  . ILE A  1 38  ? -22.185  -7.539  -100.344 1.00 24.55  ? 19   ILE A CA  1 
ATOM   153   C  C   . ILE A  1 38  ? -20.927  -7.370  -101.199 1.00 25.94  ? 19   ILE A C   1 
ATOM   154   O  O   . ILE A  1 38  ? -20.668  -8.153  -102.088 1.00 25.66  ? 19   ILE A O   1 
ATOM   155   C  CB  . ILE A  1 38  ? -22.100  -8.759  -99.389  1.00 28.56  ? 19   ILE A CB  1 
ATOM   156   C  CG1 . ILE A  1 38  ? -20.886  -8.672  -98.457  1.00 30.52  ? 19   ILE A CG1 1 
ATOM   157   C  CG2 . ILE A  1 38  ? -22.108  -10.068 -100.169 1.00 21.65  ? 19   ILE A CG2 1 
ATOM   158   C  CD1 . ILE A  1 38  ? -20.912  -9.702  -97.332  1.00 22.88  ? 19   ILE A CD1 1 
ATOM   159   N  N   . PRO A  1 39  ? -20.146  -6.323  -100.933 1.00 31.49  ? 20   PRO A N   1 
ATOM   160   C  CA  . PRO A  1 39  ? -18.960  -5.987  -101.738 1.00 29.05  ? 20   PRO A CA  1 
ATOM   161   C  C   . PRO A  1 39  ? -17.782  -6.881  -101.396 1.00 32.33  ? 20   PRO A C   1 
ATOM   162   O  O   . PRO A  1 39  ? -16.705  -6.380  -101.028 1.00 26.75  ? 20   PRO A O   1 
ATOM   163   C  CB  . PRO A  1 39  ? -18.650  -4.550  -101.316 1.00 26.72  ? 20   PRO A CB  1 
ATOM   164   C  CG  . PRO A  1 39  ? -19.125  -4.489  -99.863  1.00 31.93  ? 20   PRO A CG  1 
ATOM   165   C  CD  . PRO A  1 39  ? -20.314  -5.435  -99.767  1.00 31.96  ? 20   PRO A CD  1 
ATOM   166   N  N   . THR A  1 40  ? -17.969  -8.171  -101.533 1.00 40.40  ? 21   THR A N   1 
ATOM   167   C  CA  . THR A  1 40  ? -16.902  -9.130  -101.325 1.00 46.16  ? 21   THR A CA  1 
ATOM   168   C  C   . THR A  1 40  ? -15.990  -9.139  -102.497 1.00 51.67  ? 21   THR A C   1 
ATOM   169   O  O   . THR A  1 40  ? -16.435  -9.108  -103.612 1.00 55.76  ? 21   THR A O   1 
ATOM   170   C  CB  . THR A  1 40  ? -17.428  -10.538 -101.077 1.00 43.68  ? 21   THR A CB  1 
ATOM   171   O  OG1 . THR A  1 40  ? -16.354  -11.340 -100.639 1.00 51.39  ? 21   THR A OG1 1 
ATOM   172   C  CG2 . THR A  1 40  ? -17.990  -11.156 -102.298 1.00 36.43  ? 21   THR A CG2 1 
ATOM   173   N  N   . GLN A  1 41  ? -14.703  -9.138  -102.238 1.00 59.43  ? 22   GLN A N   1 
ATOM   174   C  CA  . GLN A  1 41  ? -13.737  -9.153  -103.292 1.00 63.30  ? 22   GLN A CA  1 
ATOM   175   C  C   . GLN A  1 41  ? -12.833  -10.343 -103.132 1.00 60.58  ? 22   GLN A C   1 
ATOM   176   O  O   . GLN A  1 41  ? -12.012  -10.342 -102.259 1.00 66.15  ? 22   GLN A O   1 
ATOM   177   C  CB  . GLN A  1 41  ? -12.889  -7.904  -103.150 1.00 67.40  ? 22   GLN A CB  1 
ATOM   178   C  CG  . GLN A  1 41  ? -12.394  -7.717  -101.737 1.00 75.22  ? 22   GLN A CG  1 
ATOM   179   C  CD  . GLN A  1 41  ? -11.538  -6.493  -101.562 1.00 83.29  ? 22   GLN A CD  1 
ATOM   180   O  OE1 . GLN A  1 41  ? -11.196  -5.832  -102.518 1.00 88.65  ? 22   GLN A OE1 1 
ATOM   181   N  NE2 . GLN A  1 41  ? -11.184  -6.190  -100.333 1.00 82.52  ? 22   GLN A NE2 1 
ATOM   182   N  N   . ARG A  1 42  ? -12.915  -11.317 -104.014 1.00 53.40  ? 23   ARG A N   1 
ATOM   183   C  CA  . ARG A  1 42  ? -12.016  -12.448 -103.953 1.00 59.11  ? 23   ARG A CA  1 
ATOM   184   C  C   . ARG A  1 42  ? -12.262  -13.404 -102.801 1.00 67.82  ? 23   ARG A C   1 
ATOM   185   O  O   . ARG A  1 42  ? -11.325  -13.962 -102.257 1.00 55.79  ? 23   ARG A O   1 
ATOM   186   C  CB  . ARG A  1 42  ? -10.591  -11.946 -103.895 1.00 56.57  ? 23   ARG A CB  1 
ATOM   187   C  CG  . ARG A  1 42  ? -10.250  -11.121 -105.093 0.82 56.95  ? 23   ARG A CG  1 
ATOM   188   C  CD  . ARG A  1 42  ? -10.551  -11.927 -106.343 0.27 59.82  ? 23   ARG A CD  1 
ATOM   189   N  NE  . ARG A  1 42  ? -10.950  -11.085 -107.459 0.59 61.39  ? 23   ARG A NE  1 
ATOM   190   C  CZ  . ARG A  1 42  ? -10.135  -10.708 -108.422 0.67 61.95  ? 23   ARG A CZ  1 
ATOM   191   N  NH1 . ARG A  1 42  ? -8.886   -11.126 -108.412 1.00 61.73  ? 23   ARG A NH1 1 
ATOM   192   N  NH2 . ARG A  1 42  ? -10.576  -9.926  -109.386 1.00 62.87  ? 23   ARG A NH2 1 
ATOM   193   N  N   . ARG A  1 44  ? -12.601  -14.154 -99.784  1.00 57.91  ? 25   ARG A N   1 
ATOM   194   C  CA  . ARG A  1 44  ? -12.105  -13.049 -98.956  1.00 56.64  ? 25   ARG A CA  1 
ATOM   195   C  C   . ARG A  1 44  ? -13.173  -12.166 -98.364  1.00 52.41  ? 25   ARG A C   1 
ATOM   196   O  O   . ARG A  1 44  ? -13.742  -11.374 -99.056  1.00 52.65  ? 25   ARG A O   1 
ATOM   197   C  CB  . ARG A  1 44  ? -11.197  -12.147 -99.750  1.00 58.65  ? 25   ARG A CB  1 
ATOM   198   C  CG  . ARG A  1 44  ? -10.641  -10.995 -98.938  1.00 60.70  ? 25   ARG A CG  1 
ATOM   199   C  CD  . ARG A  1 44  ? -10.114  -9.919  -99.857  1.00 64.70  ? 25   ARG A CD  1 
ATOM   200   N  NE  . ARG A  1 44  ? -8.888   -9.323  -99.377  1.00 66.04  ? 25   ARG A NE  1 
ATOM   201   C  CZ  . ARG A  1 44  ? -8.017   -8.724  -100.164 1.00 66.32  ? 25   ARG A CZ  1 
ATOM   202   N  NH1 . ARG A  1 44  ? -8.247   -8.661  -101.453 1.00 67.06  ? 25   ARG A NH1 1 
ATOM   203   N  NH2 . ARG A  1 44  ? -6.916   -8.198  -99.669  1.00 66.48  ? 25   ARG A NH2 1 
ATOM   204   N  N   . PRO A  1 45  ? -13.376  -12.278 -97.000  1.00 42.71  ? 26   PRO A N   1 
ATOM   205   C  CA  . PRO A  1 45  ? -14.489  -11.484 -96.466  1.00 34.56  ? 26   PRO A CA  1 
ATOM   206   C  C   . PRO A  1 45  ? -14.338  -9.990  -96.425  1.00 29.69  ? 26   PRO A C   1 
ATOM   207   O  O   . PRO A  1 45  ? -13.248  -9.508  -96.455  1.00 28.73  ? 26   PRO A O   1 
ATOM   208   C  CB  . PRO A  1 45  ? -14.602  -11.971 -95.047  1.00 30.10  ? 26   PRO A CB  1 
ATOM   209   C  CG  . PRO A  1 45  ? -13.260  -12.284 -94.673  1.00 29.17  ? 26   PRO A CG  1 
ATOM   210   C  CD  . PRO A  1 45  ? -12.785  -13.054 -95.827  1.00 31.66  ? 26   PRO A CD  1 
ATOM   211   N  N   . VAL A  1 46  ? -15.455  -9.279  -96.370  1.00 23.08  ? 27   VAL A N   1 
ATOM   212   C  CA  . VAL A  1 46  ? -15.469  -7.852  -96.087  1.00 21.05  ? 27   VAL A CA  1 
ATOM   213   C  C   . VAL A  1 46  ? -15.099  -7.647  -94.668  1.00 18.99  ? 27   VAL A C   1 
ATOM   214   O  O   . VAL A  1 46  ? -15.701  -8.186  -93.811  1.00 24.73  ? 27   VAL A O   1 
ATOM   215   C  CB  . VAL A  1 46  ? -16.875  -7.257  -96.171  1.00 24.37  ? 27   VAL A CB  1 
ATOM   216   C  CG1 . VAL A  1 46  ? -16.860  -5.782  -95.921  1.00 14.70  ? 27   VAL A CG1 1 
ATOM   217   C  CG2 . VAL A  1 46  ? -17.502  -7.515  -97.501  1.00 35.99  ? 27   VAL A CG2 1 
ATOM   218   N  N   . ALA A  1 47  ? -14.140  -6.792  -94.427  1.00 16.97  ? 28   ALA A N   1 
ATOM   219   C  CA  . ALA A  1 47  ? -13.696  -6.522  -93.105  1.00 16.29  ? 28   ALA A CA  1 
ATOM   220   C  C   . ALA A  1 47  ? -14.453  -5.375  -92.510  1.00 24.87  ? 28   ALA A C   1 
ATOM   221   O  O   . ALA A  1 47  ? -14.317  -4.282  -92.931  1.00 28.56  ? 28   ALA A O   1 
ATOM   222   C  CB  . ALA A  1 47  ? -12.244  -6.213  -93.130  1.00 15.29  ? 28   ALA A CB  1 
ATOM   223   N  N   . VAL A  1 48  ? -15.258  -5.653  -91.502  1.00 33.57  ? 29   VAL A N   1 
ATOM   224   C  CA  . VAL A  1 48  ? -16.060  -4.614  -90.845  1.00 33.49  ? 29   VAL A CA  1 
ATOM   225   C  C   . VAL A  1 48  ? -15.504  -4.224  -89.468  1.00 31.76  ? 29   VAL A C   1 
ATOM   226   O  O   . VAL A  1 48  ? -15.347  -5.085  -88.611  1.00 35.64  ? 29   VAL A O   1 
ATOM   227   C  CB  . VAL A  1 48  ? -17.508  -5.076  -90.687  1.00 26.48  ? 29   VAL A CB  1 
ATOM   228   C  CG1 . VAL A  1 48  ? -18.369  -3.934  -90.067  1.00 9.26   ? 29   VAL A CG1 1 
ATOM   229   C  CG2 . VAL A  1 48  ? -18.049  -5.532  -92.050  1.00 18.13  ? 29   VAL A CG2 1 
ATOM   230   N  N   . SER A  1 49  ? -15.186  -2.940  -89.284  1.00 29.33  ? 30   SER A N   1 
ATOM   231   C  CA  . SER A  1 49  ? -14.775  -2.384  -87.983  1.00 29.41  ? 30   SER A CA  1 
ATOM   232   C  C   . SER A  1 49  ? -15.990  -1.947  -87.210  1.00 35.46  ? 30   SER A C   1 
ATOM   233   O  O   . SER A  1 49  ? -16.819  -1.205  -87.741  1.00 39.30  ? 30   SER A O   1 
ATOM   234   C  CB  . SER A  1 49  ? -13.893  -1.143  -88.135  1.00 24.34  ? 30   SER A CB  1 
ATOM   235   O  OG  . SER A  1 49  ? -12.533  -1.501  -88.304  1.00 31.43  ? 30   SER A OG  1 
ATOM   236   N  N   . VAL A  1 50  ? -16.079  -2.376  -85.950  1.00 33.14  ? 31   VAL A N   1 
ATOM   237   C  CA  . VAL A  1 50  ? -17.143  -1.929  -85.074  1.00 32.67  ? 31   VAL A CA  1 
ATOM   238   C  C   . VAL A  1 50  ? -16.546  -1.318  -83.822  1.00 35.70  ? 31   VAL A C   1 
ATOM   239   O  O   . VAL A  1 50  ? -15.704  -1.922  -83.161  1.00 42.92  ? 31   VAL A O   1 
ATOM   240   C  CB  . VAL A  1 50  ? -18.065  -3.074  -84.678  1.00 35.97  ? 31   VAL A CB  1 
ATOM   241   C  CG1 . VAL A  1 50  ? -19.257  -2.530  -83.905  1.00 40.36  ? 31   VAL A CG1 1 
ATOM   242   C  CG2 . VAL A  1 50  ? -18.548  -3.807  -85.919  1.00 35.20  ? 31   VAL A CG2 1 
ATOM   243   N  N   . SER A  1 51  ? -16.988  -0.111  -83.500  1.00 30.68  ? 32   SER A N   1 
ATOM   244   C  CA  . SER A  1 51  ? -16.505  0.604   -82.331  1.00 28.41  ? 32   SER A CA  1 
ATOM   245   C  C   . SER A  1 51  ? -17.649  1.392   -81.687  1.00 27.59  ? 32   SER A C   1 
ATOM   246   O  O   . SER A  1 51  ? -18.141  2.381   -82.261  1.00 20.90  ? 32   SER A O   1 
ATOM   247   C  CB  . SER A  1 51  ? -15.372  1.535   -82.747  1.00 33.88  ? 32   SER A CB  1 
ATOM   248   O  OG  . SER A  1 51  ? -15.149  2.540   -81.775  1.00 41.40  ? 32   SER A OG  1 
ATOM   249   N  N   . LEU A  1 52  ? -18.098  0.942   -80.517  1.00 30.60  ? 33   LEU A N   1 
ATOM   250   C  CA  . LEU A  1 52  ? -19.153  1.661   -79.807  1.00 33.57  ? 33   LEU A CA  1 
ATOM   251   C  C   . LEU A  1 52  ? -18.571  2.836   -79.014  1.00 34.95  ? 33   LEU A C   1 
ATOM   252   O  O   . LEU A  1 52  ? -17.634  2.644   -78.257  1.00 27.56  ? 33   LEU A O   1 
ATOM   253   C  CB  . LEU A  1 52  ? -19.921  0.735   -78.879  1.00 26.50  ? 33   LEU A CB  1 
ATOM   254   C  CG  . LEU A  1 52  ? -20.460  -0.526  -79.532  1.00 21.28  ? 33   LEU A CG  1 
ATOM   255   C  CD1 . LEU A  1 52  ? -21.446  -1.227  -78.585  1.00 18.16  ? 33   LEU A CD1 1 
ATOM   256   C  CD2 . LEU A  1 52  ? -21.121  -0.186  -80.838  1.00 27.02  ? 33   LEU A CD2 1 
ATOM   257   N  N   . LYS A  1 53  ? -19.112  4.040   -79.234  1.00 37.12  ? 34   LYS A N   1 
ATOM   258   C  CA  . LYS A  1 53  ? -18.757  5.227   -78.468  1.00 33.89  ? 34   LYS A CA  1 
ATOM   259   C  C   . LYS A  1 53  ? -19.942  5.542   -77.578  1.00 30.85  ? 34   LYS A C   1 
ATOM   260   O  O   . LYS A  1 53  ? -20.969  6.041   -78.057  1.00 37.24  ? 34   LYS A O   1 
ATOM   261   C  CB  . LYS A  1 53  ? -18.501  6.414   -79.405  1.00 41.23  ? 34   LYS A CB  1 
ATOM   262   C  CG  . LYS A  1 53  ? -17.578  6.118   -80.578  1.00 42.99  ? 34   LYS A CG  1 
ATOM   263   C  CD  . LYS A  1 53  ? -16.117  6.096   -80.144  1.00 47.62  ? 34   LYS A CD  1 
ATOM   264   C  CE  . LYS A  1 53  ? -15.201  5.840   -81.334  1.00 52.87  ? 34   LYS A CE  1 
ATOM   265   N  NZ  . LYS A  1 53  ? -13.754  5.962   -80.967  1.00 56.73  ? 34   LYS A NZ  1 
ATOM   266   N  N   . PHE A  1 54  ? -19.822  5.247   -76.288  1.00 29.10  ? 35   PHE A N   1 
ATOM   267   C  CA  . PHE A  1 54  ? -20.959  5.434   -75.387  1.00 21.70  ? 35   PHE A CA  1 
ATOM   268   C  C   . PHE A  1 54  ? -21.190  6.897   -75.094  1.00 20.81  ? 35   PHE A C   1 
ATOM   269   O  O   . PHE A  1 54  ? -20.242  7.641   -74.827  1.00 16.80  ? 35   PHE A O   1 
ATOM   270   C  CB  . PHE A  1 54  ? -20.775  4.622   -74.118  1.00 17.41  ? 35   PHE A CB  1 
ATOM   271   C  CG  . PHE A  1 54  ? -20.777  3.134   -74.368  1.00 22.71  ? 35   PHE A CG  1 
ATOM   272   C  CD1 . PHE A  1 54  ? -21.980  2.430   -74.424  1.00 20.39  ? 35   PHE A CD1 1 
ATOM   273   C  CD2 . PHE A  1 54  ? -19.585  2.450   -74.596  1.00 18.25  ? 35   PHE A CD2 1 
ATOM   274   C  CE1 . PHE A  1 54  ? -21.995  1.072   -74.676  1.00 19.93  ? 35   PHE A CE1 1 
ATOM   275   C  CE2 . PHE A  1 54  ? -19.593  1.080   -74.833  1.00 13.83  ? 35   PHE A CE2 1 
ATOM   276   C  CZ  . PHE A  1 54  ? -20.798  0.391   -74.882  1.00 15.74  ? 35   PHE A CZ  1 
ATOM   277   N  N   . ILE A  1 55  ? -22.456  7.295   -75.186  1.00 22.49  ? 36   ILE A N   1 
ATOM   278   C  CA  . ILE A  1 55  ? -22.885  8.682   -75.031  1.00 20.66  ? 36   ILE A CA  1 
ATOM   279   C  C   . ILE A  1 55  ? -23.656  8.861   -73.733  1.00 23.95  ? 36   ILE A C   1 
ATOM   280   O  O   . ILE A  1 55  ? -23.466  9.842   -73.021  1.00 32.34  ? 36   ILE A O   1 
ATOM   281   C  CB  . ILE A  1 55  ? -23.807  9.081   -76.207  1.00 15.97  ? 36   ILE A CB  1 
ATOM   282   C  CG1 . ILE A  1 55  ? -23.111  8.759   -77.523  1.00 11.92  ? 36   ILE A CG1 1 
ATOM   283   C  CG2 . ILE A  1 55  ? -24.171  10.527  -76.133  1.00 17.86  ? 36   ILE A CG2 1 
ATOM   284   C  CD1 . ILE A  1 55  ? -21.744  9.408   -77.746  1.00 11.58  ? 36   ILE A CD1 1 
ATOM   285   N  N   . ASN A  1 56  ? -24.536  7.903   -73.441  1.00 23.79  ? 37   ASN A N   1 
ATOM   286   C  CA  . ASN A  1 56  ? -25.335  7.924   -72.222  1.00 25.33  ? 37   ASN A CA  1 
ATOM   287   C  C   . ASN A  1 56  ? -25.803  6.553   -71.734  1.00 26.55  ? 37   ASN A C   1 
ATOM   288   O  O   . ASN A  1 56  ? -25.920  5.606   -72.515  1.00 23.09  ? 37   ASN A O   1 
ATOM   289   C  CB  . ASN A  1 56  ? -26.535  8.868   -72.387  1.00 23.87  ? 37   ASN A CB  1 
ATOM   290   C  CG  . ASN A  1 56  ? -26.858  9.599   -71.114  1.00 28.45  ? 37   ASN A CG  1 
ATOM   291   O  OD1 . ASN A  1 56  ? -26.738  9.028   -70.042  1.00 38.55  ? 37   ASN A OD1 1 
ATOM   292   N  ND2 . ASN A  1 56  ? -27.231  10.877  -71.214  1.00 28.99  ? 37   ASN A ND2 1 
ATOM   293   N  N   . ILE A  1 57  ? -26.063  6.460   -70.430  1.00 29.92  ? 38   ILE A N   1 
ATOM   294   C  CA  . ILE A  1 57  ? -26.718  5.294   -69.840  1.00 23.15  ? 38   ILE A CA  1 
ATOM   295   C  C   . ILE A  1 57  ? -27.914  5.826   -69.112  1.00 27.67  ? 38   ILE A C   1 
ATOM   296   O  O   . ILE A  1 57  ? -27.773  6.670   -68.228  1.00 35.05  ? 38   ILE A O   1 
ATOM   297   C  CB  . ILE A  1 57  ? -25.793  4.545   -68.883  1.00 22.04  ? 38   ILE A CB  1 
ATOM   298   C  CG1 . ILE A  1 57  ? -24.545  4.061   -69.638  1.00 22.24  ? 38   ILE A CG1 1 
ATOM   299   C  CG2 . ILE A  1 57  ? -26.525  3.370   -68.256  1.00 17.09  ? 38   ILE A CG2 1 
ATOM   300   C  CD1 . ILE A  1 57  ? -23.508  3.403   -68.771  1.00 25.37  ? 38   ILE A CD1 1 
ATOM   301   N  N   . LEU A  1 58  ? -29.097  5.355   -69.484  1.00 29.67  ? 39   LEU A N   1 
ATOM   302   C  CA  . LEU A  1 58  ? -30.314  6.078   -69.121  1.00 34.18  ? 39   LEU A CA  1 
ATOM   303   C  C   . LEU A  1 58  ? -31.194  5.420   -68.081  1.00 39.50  ? 39   LEU A C   1 
ATOM   304   O  O   . LEU A  1 58  ? -31.776  6.114   -67.235  1.00 36.71  ? 39   LEU A O   1 
ATOM   305   C  CB  . LEU A  1 58  ? -31.158  6.350   -70.358  1.00 28.98  ? 39   LEU A CB  1 
ATOM   306   C  CG  . LEU A  1 58  ? -30.484  7.263   -71.365  1.00 35.82  ? 39   LEU A CG  1 
ATOM   307   C  CD1 . LEU A  1 58  ? -31.358  7.420   -72.609  1.00 39.72  ? 39   LEU A CD1 1 
ATOM   308   C  CD2 . LEU A  1 58  ? -30.205  8.606   -70.710  1.00 36.23  ? 39   LEU A CD2 1 
ATOM   309   N  N   . GLU A  1 59  ? -31.340  4.102   -68.178  1.00 38.81  ? 40   GLU A N   1 
ATOM   310   C  CA  . GLU A  1 59  ? -32.298  3.429   -67.323  1.00 49.88  ? 40   GLU A CA  1 
ATOM   311   C  C   . GLU A  1 59  ? -31.820  2.033   -66.962  1.00 59.23  ? 40   GLU A C   1 
ATOM   312   O  O   . GLU A  1 59  ? -32.002  1.074   -67.724  1.00 70.66  ? 40   GLU A O   1 
ATOM   313   C  CB  . GLU A  1 59  ? -33.682  3.406   -67.973  1.00 55.68  ? 40   GLU A CB  1 
ATOM   314   C  CG  . GLU A  1 59  ? -34.825  3.467   -66.982  1.00 68.50  ? 40   GLU A CG  1 
ATOM   315   C  CD  . GLU A  1 59  ? -36.118  3.983   -67.608  1.00 80.04  ? 40   GLU A CD  1 
ATOM   316   O  OE1 . GLU A  1 59  ? -36.120  4.270   -68.832  1.00 83.63  ? 40   GLU A OE1 1 
ATOM   317   O  OE2 . GLU A  1 59  ? -37.131  4.099   -66.872  1.00 82.96  ? 40   GLU A OE2 1 
ATOM   318   N  N   . VAL A  1 60  ? -31.182  1.940   -65.797  1.00 51.60  ? 41   VAL A N   1 
ATOM   319   C  CA  . VAL A  1 60  ? -30.654  0.686   -65.307  1.00 45.66  ? 41   VAL A CA  1 
ATOM   320   C  C   . VAL A  1 60  ? -31.697  0.026   -64.413  1.00 39.89  ? 41   VAL A C   1 
ATOM   321   O  O   . VAL A  1 60  ? -32.409  0.702   -63.669  1.00 33.95  ? 41   VAL A O   1 
ATOM   322   C  CB  . VAL A  1 60  ? -29.334  0.930   -64.558  1.00 53.17  ? 41   VAL A CB  1 
ATOM   323   C  CG1 . VAL A  1 60  ? -29.131  -0.072  -63.436  1.00 50.06  ? 41   VAL A CG1 1 
ATOM   324   C  CG2 . VAL A  1 60  ? -28.160  0.923   -65.547  1.00 58.60  ? 41   VAL A CG2 1 
ATOM   325   N  N   . ASN A  1 61  ? -31.832  -1.291  -64.535  1.00 41.81  ? 42   ASN A N   1 
ATOM   326   C  CA  . ASN A  1 61  ? -32.702  -2.064  -63.645  1.00 37.46  ? 42   ASN A CA  1 
ATOM   327   C  C   . ASN A  1 61  ? -31.978  -3.324  -63.195  1.00 39.59  ? 42   ASN A C   1 
ATOM   328   O  O   . ASN A  1 61  ? -31.883  -4.291  -63.954  1.00 40.34  ? 42   ASN A O   1 
ATOM   329   C  CB  . ASN A  1 61  ? -34.009  -2.425  -64.335  1.00 36.95  ? 42   ASN A CB  1 
ATOM   330   C  CG  . ASN A  1 61  ? -35.048  -2.981  -63.374  1.00 39.49  ? 42   ASN A CG  1 
ATOM   331   O  OD1 . ASN A  1 61  ? -34.720  -3.736  -62.450  1.00 44.34  ? 42   ASN A OD1 1 
ATOM   332   N  ND2 . ASN A  1 61  ? -36.316  -2.620  -63.594  1.00 37.43  ? 42   ASN A ND2 1 
ATOM   333   N  N   . GLU A  1 62  ? -31.466  -3.299  -61.962  1.00 40.56  ? 43   GLU A N   1 
ATOM   334   C  CA  . GLU A  1 62  ? -30.674  -4.392  -61.413  1.00 41.75  ? 43   GLU A CA  1 
ATOM   335   C  C   . GLU A  1 62  ? -31.515  -5.648  -61.166  1.00 43.17  ? 43   GLU A C   1 
ATOM   336   O  O   . GLU A  1 62  ? -30.996  -6.780  -61.188  1.00 42.00  ? 43   GLU A O   1 
ATOM   337   C  CB  . GLU A  1 62  ? -29.977  -3.952  -60.125  1.00 51.78  ? 43   GLU A CB  1 
ATOM   338   C  CG  . GLU A  1 62  ? -28.816  -4.856  -59.716  1.00 57.19  ? 43   GLU A CG  1 
ATOM   339   C  CD  . GLU A  1 62  ? -27.894  -4.214  -58.692  1.00 65.30  ? 43   GLU A CD  1 
ATOM   340   O  OE1 . GLU A  1 62  ? -28.214  -3.100  -58.204  1.00 69.22  ? 43   GLU A OE1 1 
ATOM   341   O  OE2 . GLU A  1 62  ? -26.845  -4.828  -58.380  1.00 67.49  ? 43   GLU A OE2 1 
ATOM   342   N  N   . ILE A  1 63  ? -32.816  -5.447  -60.953  1.00 41.88  ? 44   ILE A N   1 
ATOM   343   C  CA  . ILE A  1 63  ? -33.723  -6.571  -60.789  1.00 46.49  ? 44   ILE A CA  1 
ATOM   344   C  C   . ILE A  1 63  ? -33.873  -7.325  -62.098  1.00 40.33  ? 44   ILE A C   1 
ATOM   345   O  O   . ILE A  1 63  ? -33.560  -8.515  -62.178  1.00 42.19  ? 44   ILE A O   1 
ATOM   346   C  CB  . ILE A  1 63  ? -35.127  -6.138  -60.305  1.00 51.31  ? 44   ILE A CB  1 
ATOM   347   C  CG1 . ILE A  1 63  ? -35.012  -5.371  -58.986  1.00 58.99  ? 44   ILE A CG1 1 
ATOM   348   C  CG2 . ILE A  1 63  ? -36.055  -7.358  -60.176  1.00 42.84  ? 44   ILE A CG2 1 
ATOM   349   C  CD1 . ILE A  1 63  ? -34.243  -6.110  -57.906  1.00 58.99  ? 44   ILE A CD1 1 
ATOM   350   N  N   . THR A  1 64  ? -34.361  -6.626  -63.116  1.00 36.96  ? 45   THR A N   1 
ATOM   351   C  CA  . THR A  1 64  ? -34.647  -7.237  -64.414  1.00 39.53  ? 45   THR A CA  1 
ATOM   352   C  C   . THR A  1 64  ? -33.414  -7.468  -65.293  1.00 33.27  ? 45   THR A C   1 
ATOM   353   O  O   . THR A  1 64  ? -33.506  -8.176  -66.283  1.00 28.80  ? 45   THR A O   1 
ATOM   354   C  CB  . THR A  1 64  ? -35.669  -6.415  -65.209  1.00 40.14  ? 45   THR A CB  1 
ATOM   355   O  OG1 . THR A  1 64  ? -35.068  -5.196  -65.654  1.00 40.44  ? 45   THR A OG1 1 
ATOM   356   C  CG2 . THR A  1 64  ? -36.884  -6.116  -64.338  1.00 34.29  ? 45   THR A CG2 1 
ATOM   357   N  N   . ASN A  1 65  ? -32.277  -6.887  -64.910  1.00 36.58  ? 46   ASN A N   1 
ATOM   358   C  CA  . ASN A  1 65  ? -31.032  -7.024  -65.671  1.00 37.53  ? 46   ASN A CA  1 
ATOM   359   C  C   . ASN A  1 65  ? -31.137  -6.437  -67.071  1.00 34.54  ? 46   ASN A C   1 
ATOM   360   O  O   . ASN A  1 65  ? -30.782  -7.074  -68.062  1.00 32.90  ? 46   ASN A O   1 
ATOM   361   C  CB  . ASN A  1 65  ? -30.570  -8.480  -65.730  1.00 36.53  ? 46   ASN A CB  1 
ATOM   362   C  CG  . ASN A  1 65  ? -29.488  -8.793  -64.723  1.00 36.74  ? 46   ASN A CG  1 
ATOM   363   O  OD1 . ASN A  1 65  ? -28.703  -7.927  -64.325  1.00 36.95  ? 46   ASN A OD1 1 
ATOM   364   N  ND2 . ASN A  1 65  ? -29.419  -10.050 -64.331  1.00 21.93  ? 46   ASN A ND2 1 
ATOM   365   N  N   . GLU A  1 66  ? -31.651  -5.214  -67.131  1.00 37.75  ? 47   GLU A N   1 
ATOM   366   C  CA  . GLU A  1 66  ? -31.857  -4.510  -68.391  1.00 34.95  ? 47   GLU A CA  1 
ATOM   367   C  C   . GLU A  1 66  ? -31.305  -3.093  -68.269  1.00 37.98  ? 47   GLU A C   1 
ATOM   368   O  O   . GLU A  1 66  ? -31.471  -2.442  -67.228  1.00 38.95  ? 47   GLU A O   1 
ATOM   369   C  CB  . GLU A  1 66  ? -33.341  -4.480  -68.743  1.00 29.96  ? 47   GLU A CB  1 
ATOM   370   C  CG  . GLU A  1 66  ? -33.984  -5.846  -68.854  1.00 35.75  ? 47   GLU A CG  1 
ATOM   371   C  CD  . GLU A  1 66  ? -35.497  -5.777  -68.991  1.00 53.03  ? 47   GLU A CD  1 
ATOM   372   O  OE1 . GLU A  1 66  ? -36.019  -4.697  -69.350  1.00 60.49  ? 47   GLU A OE1 1 
ATOM   373   O  OE2 . GLU A  1 66  ? -36.160  -6.807  -68.739  1.00 60.64  ? 47   GLU A OE2 1 
ATOM   374   N  N   . VAL A  1 67  ? -30.619  -2.645  -69.321  1.00 37.04  ? 48   VAL A N   1 
ATOM   375   C  CA  . VAL A  1 67  ? -30.092  -1.287  -69.387  1.00 33.64  ? 48   VAL A CA  1 
ATOM   376   C  C   . VAL A  1 67  ? -30.500  -0.592  -70.673  1.00 40.50  ? 48   VAL A C   1 
ATOM   377   O  O   . VAL A  1 67  ? -30.734  -1.237  -71.705  1.00 38.59  ? 48   VAL A O   1 
ATOM   378   C  CB  . VAL A  1 67  ? -28.563  -1.257  -69.295  1.00 32.09  ? 48   VAL A CB  1 
ATOM   379   C  CG1 . VAL A  1 67  ? -28.089  -1.867  -67.984  1.00 37.17  ? 48   VAL A CG1 1 
ATOM   380   C  CG2 . VAL A  1 67  ? -27.971  -1.983  -70.443  1.00 28.32  ? 48   VAL A CG2 1 
ATOM   381   N  N   . ASP A  1 68  ? -30.587  0.730   -70.595  1.00 44.76  ? 49   ASP A N   1 
ATOM   382   C  CA  . ASP A  1 68  ? -30.986  1.552   -71.724  1.00 42.54  ? 49   ASP A CA  1 
ATOM   383   C  C   . ASP A  1 68  ? -29.773  2.407   -72.036  1.00 39.37  ? 49   ASP A C   1 
ATOM   384   O  O   . ASP A  1 68  ? -29.333  3.194   -71.197  1.00 41.67  ? 49   ASP A O   1 
ATOM   385   C  CB  . ASP A  1 68  ? -32.163  2.424   -71.311  1.00 47.51  ? 49   ASP A CB  1 
ATOM   386   C  CG  . ASP A  1 68  ? -33.026  2.840   -72.476  1.00 49.09  ? 49   ASP A CG  1 
ATOM   387   O  OD1 . ASP A  1 68  ? -32.506  3.578   -73.340  1.00 45.75  ? 49   ASP A OD1 1 
ATOM   388   O  OD2 . ASP A  1 68  ? -34.230  2.474   -72.498  1.00 53.77  ? 49   ASP A OD2 1 
ATOM   389   N  N   . VAL A  1 69  ? -29.210  2.224   -73.226  1.00 41.77  ? 50   VAL A N   1 
ATOM   390   C  CA  . VAL A  1 69  ? -27.940  2.850   -73.587  1.00 40.72  ? 50   VAL A CA  1 
ATOM   391   C  C   . VAL A  1 69  ? -28.073  3.711   -74.850  1.00 33.25  ? 50   VAL A C   1 
ATOM   392   O  O   . VAL A  1 69  ? -28.835  3.387   -75.774  1.00 27.10  ? 50   VAL A O   1 
ATOM   393   C  CB  . VAL A  1 69  ? -26.828  1.788   -73.794  1.00 39.93  ? 50   VAL A CB  1 
ATOM   394   C  CG1 . VAL A  1 69  ? -25.484  2.447   -74.048  1.00 41.30  ? 50   VAL A CG1 1 
ATOM   395   C  CG2 . VAL A  1 69  ? -26.733  0.885   -72.591  1.00 40.17  ? 50   VAL A CG2 1 
ATOM   396   N  N   . VAL A  1 70  ? -27.346  4.825   -74.858  1.00 25.78  ? 51   VAL A N   1 
ATOM   397   C  CA  . VAL A  1 70  ? -27.182  5.606   -76.056  1.00 25.66  ? 51   VAL A CA  1 
ATOM   398   C  C   . VAL A  1 70  ? -25.726  5.521   -76.488  1.00 24.68  ? 51   VAL A C   1 
ATOM   399   O  O   . VAL A  1 70  ? -24.814  5.771   -75.705  1.00 19.69  ? 51   VAL A O   1 
ATOM   400   C  CB  . VAL A  1 70  ? -27.595  7.059   -75.859  1.00 26.48  ? 51   VAL A CB  1 
ATOM   401   C  CG1 . VAL A  1 70  ? -27.151  7.903   -77.075  1.00 22.75  ? 51   VAL A CG1 1 
ATOM   402   C  CG2 . VAL A  1 70  ? -29.111  7.143   -75.637  1.00 28.90  ? 51   VAL A CG2 1 
ATOM   403   N  N   . PHE A  1 71  ? -25.500  5.176   -77.749  1.00 24.82  ? 52   PHE A N   1 
ATOM   404   C  CA  . PHE A  1 71  ? -24.129  5.020   -78.225  1.00 21.86  ? 52   PHE A CA  1 
ATOM   405   C  C   . PHE A  1 71  ? -23.990  5.264   -79.727  1.00 20.52  ? 52   PHE A C   1 
ATOM   406   O  O   . PHE A  1 71  ? -24.931  5.037   -80.503  1.00 18.54  ? 52   PHE A O   1 
ATOM   407   C  CB  . PHE A  1 71  ? -23.630  3.623   -77.876  1.00 13.83  ? 52   PHE A CB  1 
ATOM   408   C  CG  . PHE A  1 71  ? -24.467  2.520   -78.470  1.00 17.40  ? 52   PHE A CG  1 
ATOM   409   C  CD1 . PHE A  1 71  ? -25.679  2.152   -77.893  1.00 15.17  ? 52   PHE A CD1 1 
ATOM   410   C  CD2 . PHE A  1 71  ? -24.045  1.853   -79.617  1.00 22.06  ? 52   PHE A CD2 1 
ATOM   411   C  CE1 . PHE A  1 71  ? -26.449  1.136   -78.440  1.00 15.41  ? 52   PHE A CE1 1 
ATOM   412   C  CE2 . PHE A  1 71  ? -24.816  0.836   -80.180  1.00 20.73  ? 52   PHE A CE2 1 
ATOM   413   C  CZ  . PHE A  1 71  ? -26.013  0.475   -79.597  1.00 19.01  ? 52   PHE A CZ  1 
ATOM   414   N  N   . TRP A  1 72  ? -22.810  5.721   -80.132  1.00 17.77  ? 53   TRP A N   1 
ATOM   415   C  CA  . TRP A  1 72  ? -22.489  5.818   -81.558  1.00 22.08  ? 53   TRP A CA  1 
ATOM   416   C  C   . TRP A  1 72  ? -21.972  4.475   -81.994  1.00 23.34  ? 53   TRP A C   1 
ATOM   417   O  O   . TRP A  1 72  ? -20.976  4.003   -81.455  1.00 31.30  ? 53   TRP A O   1 
ATOM   418   C  CB  . TRP A  1 72  ? -21.385  6.839   -81.802  1.00 16.73  ? 53   TRP A CB  1 
ATOM   419   C  CG  . TRP A  1 72  ? -21.768  8.233   -81.460  1.00 20.26  ? 53   TRP A CG  1 
ATOM   420   C  CD1 . TRP A  1 72  ? -22.956  8.660   -80.943  1.00 25.53  ? 53   TRP A CD1 1 
ATOM   421   C  CD2 . TRP A  1 72  ? -20.964  9.401   -81.644  1.00 19.39  ? 53   TRP A CD2 1 
ATOM   422   N  NE1 . TRP A  1 72  ? -22.930  10.027  -80.769  1.00 24.01  ? 53   TRP A NE1 1 
ATOM   423   C  CE2 . TRP A  1 72  ? -21.717  10.506  -81.193  1.00 21.44  ? 53   TRP A CE2 1 
ATOM   424   C  CE3 . TRP A  1 72  ? -19.676  9.621   -82.151  1.00 17.80  ? 53   TRP A CE3 1 
ATOM   425   C  CZ2 . TRP A  1 72  ? -21.231  11.819  -81.239  1.00 21.37  ? 53   TRP A CZ2 1 
ATOM   426   C  CZ3 . TRP A  1 72  ? -19.190  10.919  -82.194  1.00 19.37  ? 53   TRP A CZ3 1 
ATOM   427   C  CH2 . TRP A  1 72  ? -19.968  12.005  -81.731  1.00 20.74  ? 53   TRP A CH2 1 
ATOM   428   N  N   . GLN A  1 73  ? -22.642  3.848   -82.948  1.00 17.02  ? 54   GLN A N   1 
ATOM   429   C  CA  . GLN A  1 73  ? -22.177  2.579   -83.497  1.00 18.87  ? 54   GLN A CA  1 
ATOM   430   C  C   . GLN A  1 73  ? -21.321  2.820   -84.744  1.00 20.33  ? 54   GLN A C   1 
ATOM   431   O  O   . GLN A  1 73  ? -21.795  2.701   -85.878  1.00 26.15  ? 54   GLN A O   1 
ATOM   432   C  CB  . GLN A  1 73  ? -23.368  1.693   -83.833  1.00 27.89  ? 54   GLN A CB  1 
ATOM   433   C  CG  . GLN A  1 73  ? -22.993  0.276   -84.189  1.00 34.77  ? 54   GLN A CG  1 
ATOM   434   C  CD  . GLN A  1 73  ? -24.187  -0.634  -84.167  1.00 41.88  ? 54   GLN A CD  1 
ATOM   435   O  OE1 . GLN A  1 73  ? -24.890  -0.734  -83.149  1.00 43.74  ? 54   GLN A OE1 1 
ATOM   436   N  NE2 . GLN A  1 73  ? -24.446  -1.295  -85.298  1.00 42.33  ? 54   GLN A NE2 1 
ATOM   437   N  N   . GLN A  1 74  ? -20.064  3.179   -84.525  1.00 21.14  ? 55   GLN A N   1 
ATOM   438   C  CA  . GLN A  1 74  ? -19.167  3.515   -85.615  1.00 22.13  ? 55   GLN A CA  1 
ATOM   439   C  C   . GLN A  1 74  ? -18.806  2.256   -86.400  1.00 21.46  ? 55   GLN A C   1 
ATOM   440   O  O   . GLN A  1 74  ? -18.107  1.383   -85.896  1.00 20.83  ? 55   GLN A O   1 
ATOM   441   C  CB  . GLN A  1 74  ? -17.896  4.174   -85.094  1.00 26.62  ? 55   GLN A CB  1 
ATOM   442   C  CG  . GLN A  1 74  ? -16.928  4.535   -86.201  1.00 35.18  ? 55   GLN A CG  1 
ATOM   443   C  CD  . GLN A  1 74  ? -15.617  5.065   -85.694  1.00 38.39  ? 55   GLN A CD  1 
ATOM   444   O  OE1 . GLN A  1 74  ? -15.523  6.223   -85.261  1.00 40.84  ? 55   GLN A OE1 1 
ATOM   445   N  NE2 . GLN A  1 74  ? -14.587  4.219   -85.733  1.00 37.48  ? 55   GLN A NE2 1 
ATOM   446   N  N   . THR A  1 75  ? -19.285  2.183   -87.639  1.00 14.73  ? 56   THR A N   1 
ATOM   447   C  CA  . THR A  1 75  ? -19.085  1.024   -88.484  1.00 17.56  ? 56   THR A CA  1 
ATOM   448   C  C   . THR A  1 75  ? -18.281  1.412   -89.733  1.00 27.15  ? 56   THR A C   1 
ATOM   449   O  O   . THR A  1 75  ? -18.586  2.391   -90.414  1.00 29.06  ? 56   THR A O   1 
ATOM   450   C  CB  . THR A  1 75  ? -20.427  0.417   -88.895  1.00 15.72  ? 56   THR A CB  1 
ATOM   451   O  OG1 . THR A  1 75  ? -21.278  0.330   -87.755  1.00 21.03  ? 56   THR A OG1 1 
ATOM   452   C  CG2 . THR A  1 75  ? -20.246  -0.967  -89.438  1.00 11.99  ? 56   THR A CG2 1 
ATOM   453   N  N   . THR A  1 76  ? -17.237  0.648   -90.023  1.00 29.13  ? 57   THR A N   1 
ATOM   454   C  CA  . THR A  1 76  ? -16.358  0.985   -91.128  1.00 29.32  ? 57   THR A CA  1 
ATOM   455   C  C   . THR A  1 76  ? -16.023  -0.230  -91.992  1.00 33.30  ? 57   THR A C   1 
ATOM   456   O  O   . THR A  1 76  ? -15.669  -1.316  -91.487  1.00 34.90  ? 57   THR A O   1 
ATOM   457   C  CB  . THR A  1 76  ? -15.085  1.657   -90.615  1.00 33.43  ? 57   THR A CB  1 
ATOM   458   O  OG1 . THR A  1 76  ? -15.463  2.802   -89.843  1.00 36.03  ? 57   THR A OG1 1 
ATOM   459   C  CG2 . THR A  1 76  ? -14.202  2.125   -91.773  1.00 35.98  ? 57   THR A CG2 1 
ATOM   460   N  N   . TRP A  1 77  ? -16.148  -0.054  -93.302  1.00 28.97  ? 58   TRP A N   1 
ATOM   461   C  CA  . TRP A  1 77  ? -15.802  -1.134  -94.218  1.00 25.27  ? 58   TRP A CA  1 
ATOM   462   C  C   . TRP A  1 77  ? -15.418  -0.597  -95.578  1.00 26.95  ? 58   TRP A C   1 
ATOM   463   O  O   . TRP A  1 77  ? -15.392  0.600   -95.822  1.00 24.66  ? 58   TRP A O   1 
ATOM   464   C  CB  . TRP A  1 77  ? -16.961  -2.119  -94.363  1.00 20.78  ? 58   TRP A CB  1 
ATOM   465   C  CG  . TRP A  1 77  ? -18.160  -1.512  -95.054  1.00 19.80  ? 58   TRP A CG  1 
ATOM   466   C  CD1 . TRP A  1 77  ? -18.481  -1.619  -96.370  1.00 16.35  ? 58   TRP A CD1 1 
ATOM   467   C  CD2 . TRP A  1 77  ? -19.183  -0.698  -94.455  1.00 22.25  ? 58   TRP A CD2 1 
ATOM   468   N  NE1 . TRP A  1 77  ? -19.643  -0.939  -96.629  1.00 20.24  ? 58   TRP A NE1 1 
ATOM   469   C  CE2 . TRP A  1 77  ? -20.096  -0.362  -95.472  1.00 24.00  ? 58   TRP A CE2 1 
ATOM   470   C  CE3 . TRP A  1 77  ? -19.418  -0.231  -93.160  1.00 24.00  ? 58   TRP A CE3 1 
ATOM   471   C  CZ2 . TRP A  1 77  ? -21.229  0.425   -95.241  1.00 28.35  ? 58   TRP A CZ2 1 
ATOM   472   C  CZ3 . TRP A  1 77  ? -20.553  0.544   -92.925  1.00 26.18  ? 58   TRP A CZ3 1 
ATOM   473   C  CH2 . TRP A  1 77  ? -21.441  0.868   -93.965  1.00 26.02  ? 58   TRP A CH2 1 
ATOM   474   N  N   . SER A  1 78  ? -15.112  -1.485  -96.502  1.00 34.60  ? 59   SER A N   1 
ATOM   475   C  CA  . SER A  1 78  ? -14.683  -1.144  -97.844  1.00 29.66  ? 59   SER A CA  1 
ATOM   476   C  C   . SER A  1 78  ? -15.579  -1.648  -98.938  1.00 28.71  ? 59   SER A C   1 
ATOM   477   O  O   . SER A  1 78  ? -15.895  -2.790  -98.964  1.00 28.03  ? 59   SER A O   1 
ATOM   478   C  CB  . SER A  1 78  ? -13.340  -1.756  -98.098  1.00 31.32  ? 59   SER A CB  1 
ATOM   479   O  OG  . SER A  1 78  ? -12.362  -0.786  -98.111  1.00 46.08  ? 59   SER A OG  1 
ATOM   480   N  N   . ASP A  1 79  ? -15.971  -0.763  -99.842  1.00 37.03  ? 60   ASP A N   1 
ATOM   481   C  CA  . ASP A  1 79  ? -16.591  -1.080  -101.106 1.00 31.53  ? 60   ASP A CA  1 
ATOM   482   C  C   . ASP A  1 79  ? -15.877  -0.321  -102.222 1.00 37.87  ? 60   ASP A C   1 
ATOM   483   O  O   . ASP A  1 79  ? -16.080  0.836   -102.391 1.00 20.61  ? 60   ASP A O   1 
ATOM   484   C  CB  . ASP A  1 79  ? -18.039  -0.658  -101.031 1.00 29.32  ? 60   ASP A CB  1 
ATOM   485   C  CG  . ASP A  1 79  ? -18.895  -1.305  -102.048 1.00 38.22  ? 60   ASP A CG  1 
ATOM   486   O  OD1 . ASP A  1 79  ? -18.374  -1.868  -102.976 1.00 40.56  ? 60   ASP A OD1 1 
ATOM   487   O  OD2 . ASP A  1 79  ? -20.110  -1.256  -101.931 1.00 37.44  ? 60   ASP A OD2 1 
ATOM   488   N  N   . ARG A  1 80  ? -15.072  -1.027  -102.994 1.00 42.97  ? 61   ARG A N   1 
ATOM   489   C  CA  . ARG A  1 80  ? -14.271  -0.502  -104.100 1.00 44.63  ? 61   ARG A CA  1 
ATOM   490   C  C   . ARG A  1 80  ? -15.089  -0.121  -105.293 1.00 33.05  ? 61   ARG A C   1 
ATOM   491   O  O   . ARG A  1 80  ? -14.727  0.667   -106.090 1.00 24.56  ? 61   ARG A O   1 
ATOM   492   C  CB  . ARG A  1 80  ? -13.243  -1.508  -104.483 1.00 53.45  ? 61   ARG A CB  1 
ATOM   493   C  CG  . ARG A  1 80  ? -12.350  -1.797  -103.329 1.00 67.00  ? 61   ARG A CG  1 
ATOM   494   C  CD  . ARG A  1 80  ? -11.013  -1.170  -103.553 1.00 78.02  ? 61   ARG A CD  1 
ATOM   495   N  NE  . ARG A  1 80  ? -10.265  -1.016  -102.310 1.00 87.79  ? 61   ARG A NE  1 
ATOM   496   C  CZ  . ARG A  1 80  ? -9.868   -1.998  -101.514 1.00 93.87  ? 61   ARG A CZ  1 
ATOM   497   N  NH1 . ARG A  1 80  ? -10.159  -3.252  -101.775 1.00 99.36  ? 61   ARG A NH1 1 
ATOM   498   N  NH2 . ARG A  1 80  ? -9.188   -1.707  -100.433 1.00 93.92  ? 61   ARG A NH2 1 
ATOM   499   N  N   . THR A  1 81  ? -16.257  -0.673  -105.307 1.00 28.64  ? 62   THR A N   1 
ATOM   500   C  CA  . THR A  1 81  ? -17.291  -0.414  -106.231 1.00 26.21  ? 62   THR A CA  1 
ATOM   501   C  C   . THR A  1 81  ? -17.608  1.062   -106.187 1.00 32.34  ? 62   THR A C   1 
ATOM   502   O  O   . THR A  1 81  ? -18.013  1.630   -107.173 1.00 37.62  ? 62   THR A O   1 
ATOM   503   C  CB  . THR A  1 81  ? -18.447  -1.296  -105.762 1.00 26.70  ? 62   THR A CB  1 
ATOM   504   O  OG1 . THR A  1 81  ? -18.347  -2.530  -106.447 1.00 20.18  ? 62   THR A OG1 1 
ATOM   505   C  CG2 . THR A  1 81  ? -19.808  -0.720  -105.953 1.00 27.56  ? 62   THR A CG2 1 
ATOM   506   N  N   . LEU A  1 82  ? -17.493  1.667   -105.028 1.00 26.80  ? 63   LEU A N   1 
ATOM   507   C  CA  . LEU A  1 82  ? -17.804  3.047   -104.882 1.00 20.13  ? 63   LEU A CA  1 
ATOM   508   C  C   . LEU A  1 82  ? -16.679  3.996   -105.226 1.00 28.18  ? 63   LEU A C   1 
ATOM   509   O  O   . LEU A  1 82  ? -16.899  5.151   -105.425 1.00 27.06  ? 63   LEU A O   1 
ATOM   510   C  CB  . LEU A  1 82  ? -18.288  3.279   -103.472 1.00 32.89  ? 63   LEU A CB  1 
ATOM   511   C  CG  . LEU A  1 82  ? -19.491  2.487   -103.040 1.00 34.84  ? 63   LEU A CG  1 
ATOM   512   C  CD1 . LEU A  1 82  ? -19.754  2.602   -101.569 1.00 19.31  ? 63   LEU A CD1 1 
ATOM   513   C  CD2 . LEU A  1 82  ? -20.670  2.958   -103.826 1.00 34.67  ? 63   LEU A CD2 1 
ATOM   514   N  N   . ALA A  1 83  ? -15.484  3.479   -105.387 1.00 29.52  ? 64   ALA A N   1 
ATOM   515   C  CA  . ALA A  1 83  ? -14.298  4.288   -105.551 1.00 31.39  ? 64   ALA A CA  1 
ATOM   516   C  C   . ALA A  1 83  ? -14.280  5.138   -106.790 1.00 34.81  ? 64   ALA A C   1 
ATOM   517   O  O   . ALA A  1 83  ? -14.893  4.823   -107.753 1.00 40.40  ? 64   ALA A O   1 
ATOM   518   C  CB  . ALA A  1 83  ? -13.092  3.399   -105.544 1.00 29.05  ? 64   ALA A CB  1 
ATOM   519   N  N   . TRP A  1 84  ? -13.585  6.252   -106.738 1.00 35.12  ? 65   TRP A N   1 
ATOM   520   C  CA  . TRP A  1 84  ? -13.479  7.150   -107.879 1.00 40.38  ? 65   TRP A CA  1 
ATOM   521   C  C   . TRP A  1 84  ? -12.112  7.835   -107.913 1.00 50.75  ? 65   TRP A C   1 
ATOM   522   O  O   . TRP A  1 84  ? -11.380  7.850   -106.908 1.00 46.28  ? 65   TRP A O   1 
ATOM   523   C  CB  . TRP A  1 84  ? -14.632  8.177   -107.904 1.00 38.56  ? 65   TRP A CB  1 
ATOM   524   C  CG  . TRP A  1 84  ? -14.574  9.234   -106.823 1.00 39.07  ? 65   TRP A CG  1 
ATOM   525   C  CD1 . TRP A  1 84  ? -13.914  10.429  -106.878 1.00 40.46  ? 65   TRP A CD1 1 
ATOM   526   C  CD2 . TRP A  1 84  ? -15.202  9.184   -105.524 1.00 39.29  ? 65   TRP A CD2 1 
ATOM   527   N  NE1 . TRP A  1 84  ? -14.075  11.122  -105.690 1.00 36.39  ? 65   TRP A NE1 1 
ATOM   528   C  CE2 . TRP A  1 84  ? -14.869  10.386  -104.853 1.00 36.83  ? 65   TRP A CE2 1 
ATOM   529   C  CE3 . TRP A  1 84  ? -16.009  8.240   -104.869 1.00 31.90  ? 65   TRP A CE3 1 
ATOM   530   C  CZ2 . TRP A  1 84  ? -15.324  10.666  -103.562 1.00 30.90  ? 65   TRP A CZ2 1 
ATOM   531   C  CZ3 . TRP A  1 84  ? -16.455  8.519   -103.596 1.00 22.55  ? 65   TRP A CZ3 1 
ATOM   532   C  CH2 . TRP A  1 84  ? -16.108  9.721   -102.952 1.00 28.42  ? 65   TRP A CH2 1 
ATOM   533   N  N   . ASN A  1 85  ? -11.772  8.371   -109.086 1.00 61.68  ? 66   ASN A N   1 
ATOM   534   C  CA  . ASN A  1 85  ? -10.536  9.120   -109.292 1.00 71.61  ? 66   ASN A CA  1 
ATOM   535   C  C   . ASN A  1 85  ? -10.663  10.502  -108.652 1.00 77.40  ? 66   ASN A C   1 
ATOM   536   O  O   . ASN A  1 85  ? -11.365  11.371  -109.175 1.00 81.46  ? 66   ASN A O   1 
ATOM   537   C  CB  . ASN A  1 85  ? -10.249  9.248   -110.803 1.00 74.88  ? 66   ASN A CB  1 
ATOM   538   C  CG  . ASN A  1 85  ? -8.856   9.787   -111.100 1.00 80.41  ? 66   ASN A CG  1 
ATOM   539   O  OD1 . ASN A  1 85  ? -8.205   10.369  -110.229 1.00 82.30  ? 66   ASN A OD1 1 
ATOM   540   N  ND2 . ASN A  1 85  ? -8.397   9.610   -112.342 1.00 84.41  ? 66   ASN A ND2 1 
ATOM   541   N  N   . SER A  1 86  ? -9.982   10.710  -107.529 1.00 80.34  ? 67   SER A N   1 
ATOM   542   C  CA  . SER A  1 86  ? -10.153  11.944  -106.760 1.00 86.85  ? 67   SER A CA  1 
ATOM   543   C  C   . SER A  1 86  ? -9.161   13.035  -107.126 1.00 84.19  ? 67   SER A C   1 
ATOM   544   O  O   . SER A  1 86  ? -8.930   13.941  -106.331 1.00 82.59  ? 67   SER A O   1 
ATOM   545   C  CB  . SER A  1 86  ? -10.034  11.667  -105.262 1.00 94.53  ? 67   SER A CB  1 
ATOM   546   O  OG  . SER A  1 86  ? -8.669   11.531  -104.897 1.00 98.46  ? 67   SER A OG  1 
ATOM   547   N  N   . SER A  1 87  ? -8.582   12.950  -108.322 1.00 86.09  ? 68   SER A N   1 
ATOM   548   C  CA  . SER A  1 87  ? -7.574   13.918  -108.758 1.00 84.34  ? 68   SER A CA  1 
ATOM   549   C  C   . SER A  1 87  ? -8.067   15.365  -108.660 1.00 74.35  ? 68   SER A C   1 
ATOM   550   O  O   . SER A  1 87  ? -7.452   16.205  -107.983 1.00 74.38  ? 68   SER A O   1 
ATOM   551   C  CB  . SER A  1 87  ? -7.108   13.606  -110.174 1.00 86.76  ? 68   SER A CB  1 
ATOM   552   O  OG  . SER A  1 87  ? -8.229   13.396  -111.004 1.00 91.99  ? 68   SER A OG  1 
ATOM   553   N  N   . HIS A  1 88  ? -9.186   15.650  -109.314 1.00 59.87  ? 69   HIS A N   1 
ATOM   554   C  CA  . HIS A  1 88  ? -9.753   16.986  -109.231 1.00 56.18  ? 69   HIS A CA  1 
ATOM   555   C  C   . HIS A  1 88  ? -11.170  16.920  -108.682 1.00 49.43  ? 69   HIS A C   1 
ATOM   556   O  O   . HIS A  1 88  ? -12.073  17.614  -109.139 1.00 45.08  ? 69   HIS A O   1 
ATOM   557   C  CB  . HIS A  1 88  ? -9.704   17.664  -110.606 1.00 63.13  ? 69   HIS A CB  1 
ATOM   558   C  CG  . HIS A  1 88  ? -8.315   17.826  -111.140 1.00 70.46  ? 69   HIS A CG  1 
ATOM   559   N  ND1 . HIS A  1 88  ? -7.665   16.828  -111.839 1.00 75.73  ? 69   HIS A ND1 1 
ATOM   560   C  CD2 . HIS A  1 88  ? -7.433   18.853  -111.045 1.00 69.61  ? 69   HIS A CD2 1 
ATOM   561   C  CE1 . HIS A  1 88  ? -6.454   17.241  -112.167 1.00 75.95  ? 69   HIS A CE1 1 
ATOM   562   N  NE2 . HIS A  1 88  ? -6.287   18.466  -111.694 1.00 72.72  ? 69   HIS A NE2 1 
ATOM   563   N  N   . SER A  1 89  ? -11.344  16.075  -107.676 1.00 50.87  ? 70   SER A N   1 
ATOM   564   C  CA  . SER A  1 89  ? -12.659  15.725  -107.162 1.00 49.15  ? 70   SER A CA  1 
ATOM   565   C  C   . SER A  1 89  ? -12.632  15.780  -105.634 1.00 42.02  ? 70   SER A C   1 
ATOM   566   O  O   . SER A  1 89  ? -11.560  15.803  -105.040 1.00 40.88  ? 70   SER A O   1 
ATOM   567   C  CB  . SER A  1 89  ? -13.036  14.308  -107.637 1.00 54.82  ? 70   SER A CB  1 
ATOM   568   O  OG  . SER A  1 89  ? -12.922  14.163  -109.048 1.00 57.22  ? 70   SER A OG  1 
ATOM   569   N  N   . PRO A  1 90  ? -13.813  15.816  -104.997 1.00 38.55  ? 71   PRO A N   1 
ATOM   570   C  CA  . PRO A  1 90  ? -13.895  15.669  -103.543 1.00 36.63  ? 71   PRO A CA  1 
ATOM   571   C  C   . PRO A  1 90  ? -13.298  14.333  -103.088 1.00 36.65  ? 71   PRO A C   1 
ATOM   572   O  O   . PRO A  1 90  ? -13.303  13.368  -103.858 1.00 38.69  ? 71   PRO A O   1 
ATOM   573   C  CB  . PRO A  1 90  ? -15.402  15.651  -103.284 1.00 38.75  ? 71   PRO A CB  1 
ATOM   574   C  CG  . PRO A  1 90  ? -16.004  16.369  -104.437 1.00 40.57  ? 71   PRO A CG  1 
ATOM   575   C  CD  . PRO A  1 90  ? -15.136  16.058  -105.606 1.00 40.84  ? 71   PRO A CD  1 
ATOM   576   N  N   . ASP A  1 91  ? -12.795  14.284  -101.851 1.00 37.46  ? 72   ASP A N   1 
ATOM   577   C  CA  . ASP A  1 91  ? -12.206  13.060  -101.297 1.00 42.15  ? 72   ASP A CA  1 
ATOM   578   C  C   . ASP A  1 91  ? -13.258  12.226  -100.624 1.00 36.87  ? 72   ASP A C   1 
ATOM   579   O  O   . ASP A  1 91  ? -13.060  11.038  -100.392 1.00 38.04  ? 72   ASP A O   1 
ATOM   580   C  CB  . ASP A  1 91  ? -11.140  13.381  -100.267 1.00 53.91  ? 72   ASP A CB  1 
ATOM   581   C  CG  . ASP A  1 91  ? -10.253  14.534  -100.688 1.00 71.30  ? 72   ASP A CG  1 
ATOM   582   O  OD1 . ASP A  1 91  ? -9.918   14.633  -101.893 1.00 79.30  ? 72   ASP A OD1 1 
ATOM   583   O  OD2 . ASP A  1 91  ? -9.895   15.349  -99.807  1.00 76.28  ? 72   ASP A OD2 1 
ATOM   584   N  N   . GLN A  1 92  ? -14.389  12.866  -100.341 1.00 29.49  ? 73   GLN A N   1 
ATOM   585   C  CA  . GLN A  1 92  ? -15.430  12.294  -99.509  1.00 27.59  ? 73   GLN A CA  1 
ATOM   586   C  C   . GLN A  1 92  ? -16.809  12.847  -99.839  1.00 20.20  ? 73   GLN A C   1 
ATOM   587   O  O   . GLN A  1 92  ? -16.946  14.034  -100.122 1.00 21.01  ? 73   GLN A O   1 
ATOM   588   C  CB  . GLN A  1 92  ? -15.102  12.618  -98.067  1.00 30.82  ? 73   GLN A CB  1 
ATOM   589   C  CG  . GLN A  1 92  ? -15.976  11.960  -97.056  1.00 35.66  ? 73   GLN A CG  1 
ATOM   590   C  CD  . GLN A  1 92  ? -15.611  12.409  -95.651  1.00 43.20  ? 73   GLN A CD  1 
ATOM   591   O  OE1 . GLN A  1 92  ? -16.015  13.494  -95.215  1.00 41.95  ? 73   GLN A OE1 1 
ATOM   592   N  NE2 . GLN A  1 92  ? -14.837  11.577  -94.933  1.00 46.65  ? 73   GLN A NE2 1 
ATOM   593   N  N   . VAL A  1 93  ? -17.825  11.982  -99.810  1.00 18.14  ? 74   VAL A N   1 
ATOM   594   C  CA  . VAL A  1 93  ? -19.223  12.422  -99.891  1.00 13.83  ? 74   VAL A CA  1 
ATOM   595   C  C   . VAL A  1 93  ? -20.084  11.785  -98.789  1.00 20.67  ? 74   VAL A C   1 
ATOM   596   O  O   . VAL A  1 93  ? -19.730  10.751  -98.179  1.00 15.12  ? 74   VAL A O   1 
ATOM   597   C  CB  . VAL A  1 93  ? -19.855  12.109  -101.276 1.00 14.20  ? 74   VAL A CB  1 
ATOM   598   C  CG1 . VAL A  1 93  ? -19.230  12.961  -102.371 1.00 23.69  ? 74   VAL A CG1 1 
ATOM   599   C  CG2 . VAL A  1 93  ? -19.704  10.636  -101.600 1.00 14.58  ? 74   VAL A CG2 1 
ATOM   600   N  N   . SER A  1 94  ? -21.227  12.404  -98.544  1.00 19.55  ? 75   SER A N   1 
ATOM   601   C  CA  . SER A  1 94  ? -22.217  11.822  -97.667  1.00 24.98  ? 75   SER A CA  1 
ATOM   602   C  C   . SER A  1 94  ? -23.352  11.207  -98.482  1.00 31.43  ? 75   SER A C   1 
ATOM   603   O  O   . SER A  1 94  ? -23.956  11.865  -99.338  1.00 37.67  ? 75   SER A O   1 
ATOM   604   C  CB  . SER A  1 94  ? -22.751  12.877  -96.704  1.00 27.41  ? 75   SER A CB  1 
ATOM   605   O  OG  . SER A  1 94  ? -21.725  13.274  -95.817  1.00 32.90  ? 75   SER A OG  1 
ATOM   606   N  N   . VAL A  1 95  ? -23.643  9.941   -98.202  1.00 25.78  ? 76   VAL A N   1 
ATOM   607   C  CA  . VAL A  1 95  ? -24.595  9.185   -98.986  1.00 15.98  ? 76   VAL A CA  1 
ATOM   608   C  C   . VAL A  1 95  ? -25.637  8.591   -98.066  1.00 17.89  ? 76   VAL A C   1 
ATOM   609   O  O   . VAL A  1 95  ? -25.307  8.013   -97.027  1.00 25.07  ? 76   VAL A O   1 
ATOM   610   C  CB  . VAL A  1 95  ? -23.867  8.031   -99.720  1.00 21.59  ? 76   VAL A CB  1 
ATOM   611   C  CG1 . VAL A  1 95  ? -24.825  7.286   -100.642 1.00 22.82  ? 76   VAL A CG1 1 
ATOM   612   C  CG2 . VAL A  1 95  ? -22.673  8.569   -100.499 1.00 26.20  ? 76   VAL A CG2 1 
ATOM   613   N  N   . PRO A  1 96  ? -26.909  8.704   -98.452  1.00 20.43  ? 77   PRO A N   1 
ATOM   614   C  CA  . PRO A  1 96  ? -27.976  7.953   -97.767  1.00 13.15  ? 77   PRO A CA  1 
ATOM   615   C  C   . PRO A  1 96  ? -27.682  6.436   -97.750  1.00 18.34  ? 77   PRO A C   1 
ATOM   616   O  O   . PRO A  1 96  ? -27.427  5.855   -98.793  1.00 24.04  ? 77   PRO A O   1 
ATOM   617   C  CB  . PRO A  1 96  ? -29.211  8.225   -98.658  1.00 13.28  ? 77   PRO A CB  1 
ATOM   618   C  CG  . PRO A  1 96  ? -28.900  9.498   -99.367  1.00 15.65  ? 77   PRO A CG  1 
ATOM   619   C  CD  . PRO A  1 96  ? -27.410  9.459   -99.623  1.00 18.98  ? 77   PRO A CD  1 
ATOM   620   N  N   . ILE A  1 97  ? -27.736  5.802   -96.589  1.00 24.32  ? 78   ILE A N   1 
ATOM   621   C  CA  . ILE A  1 97  ? -27.435  4.378   -96.499  1.00 25.62  ? 78   ILE A CA  1 
ATOM   622   C  C   . ILE A  1 97  ? -28.404  3.513   -97.307  1.00 21.91  ? 78   ILE A C   1 
ATOM   623   O  O   . ILE A  1 97  ? -28.097  2.372   -97.621  1.00 19.58  ? 78   ILE A O   1 
ATOM   624   C  CB  . ILE A  1 97  ? -27.419  3.843   -95.040  1.00 17.46  ? 78   ILE A CB  1 
ATOM   625   C  CG1 . ILE A  1 97  ? -28.774  4.016   -94.371  1.00 19.22  ? 78   ILE A CG1 1 
ATOM   626   C  CG2 . ILE A  1 97  ? -26.317  4.494   -94.221  1.00 20.86  ? 78   ILE A CG2 1 
ATOM   627   C  CD1 . ILE A  1 97  ? -28.915  3.183   -93.085  1.00 12.76  ? 78   ILE A CD1 1 
ATOM   628   N  N   . SER A  1 98  ? -29.572  4.040   -97.647  1.00 21.18  ? 79   SER A N   1 
ATOM   629   C  CA  . SER A  1 98  ? -30.467  3.309   -98.536  1.00 24.51  ? 79   SER A CA  1 
ATOM   630   C  C   . SER A  1 98  ? -29.885  3.137   -99.971  1.00 31.69  ? 79   SER A C   1 
ATOM   631   O  O   . SER A  1 98  ? -30.376  2.304   -100.735 1.00 15.21  ? 79   SER A O   1 
ATOM   632   C  CB  . SER A  1 98  ? -31.825  3.978   -98.577  1.00 29.93  ? 79   SER A CB  1 
ATOM   633   O  OG  . SER A  1 98  ? -31.695  5.333   -98.984  1.00 42.55  ? 79   SER A OG  1 
ATOM   634   N  N   . SER A  1 99  ? -28.839  3.907   -100.297 1.00 14.76  ? 80   SER A N   1 
ATOM   635   C  CA  . SER A  1 99  ? -28.154  3.837   -101.581 1.00 26.00  ? 80   SER A CA  1 
ATOM   636   C  C   . SER A  1 99  ? -26.863  3.045   -101.509 1.00 25.28  ? 80   SER A C   1 
ATOM   637   O  O   . SER A  1 99  ? -26.113  3.018   -102.466 1.00 29.62  ? 80   SER A O   1 
ATOM   638   C  CB  . SER A  1 99  ? -27.824  5.243   -102.106 1.00 27.46  ? 80   SER A CB  1 
ATOM   639   O  OG  . SER A  1 99  ? -28.997  5.982   -102.386 1.00 37.32  ? 80   SER A OG  1 
ATOM   640   N  N   . LEU A  1 100 ? -26.589  2.417   -100.375 1.00 25.42  ? 81   LEU A N   1 
ATOM   641   C  CA  . LEU A  1 100 ? -25.326  1.686   -100.181 1.00 23.46  ? 81   LEU A CA  1 
ATOM   642   C  C   . LEU A  1 100 ? -25.600  0.330   -99.604  1.00 26.27  ? 81   LEU A C   1 
ATOM   643   O  O   . LEU A  1 100 ? -26.569  0.120   -98.869  1.00 25.68  ? 81   LEU A O   1 
ATOM   644   C  CB  . LEU A  1 100 ? -24.407  2.388   -99.185  1.00 20.73  ? 81   LEU A CB  1 
ATOM   645   C  CG  . LEU A  1 100 ? -23.868  3.758   -99.542  1.00 26.88  ? 81   LEU A CG  1 
ATOM   646   C  CD1 . LEU A  1 100 ? -23.140  4.314   -98.362  1.00 30.94  ? 81   LEU A CD1 1 
ATOM   647   C  CD2 . LEU A  1 100 ? -22.941  3.625   -100.699 1.00 34.11  ? 81   LEU A CD2 1 
ATOM   648   N  N   . TRP A  1 101 ? -24.722  -0.610  -99.891  1.00 31.68  ? 82   TRP A N   1 
ATOM   649   C  CA  . TRP A  1 101 ? -24.763  -1.838  -99.113  1.00 26.41  ? 82   TRP A CA  1 
ATOM   650   C  C   . TRP A  1 101 ? -24.244  -1.551  -97.703  1.00 24.64  ? 82   TRP A C   1 
ATOM   651   O  O   . TRP A  1 101 ? -23.240  -0.855  -97.505  1.00 28.82  ? 82   TRP A O   1 
ATOM   652   C  CB  . TRP A  1 101 ? -23.939  -2.926  -99.760  1.00 18.30  ? 82   TRP A CB  1 
ATOM   653   C  CG  . TRP A  1 101 ? -23.864  -4.162  -98.910  1.00 26.04  ? 82   TRP A CG  1 
ATOM   654   C  CD1 . TRP A  1 101 ? -24.703  -5.243  -98.960  1.00 27.25  ? 82   TRP A CD1 1 
ATOM   655   C  CD2 . TRP A  1 101 ? -22.898  -4.450  -97.871  1.00 16.85  ? 82   TRP A CD2 1 
ATOM   656   N  NE1 . TRP A  1 101 ? -24.319  -6.180  -98.029  1.00 23.02  ? 82   TRP A NE1 1 
ATOM   657   C  CE2 . TRP A  1 101 ? -23.221  -5.724  -97.363  1.00 17.06  ? 82   TRP A CE2 1 
ATOM   658   C  CE3 . TRP A  1 101 ? -21.807  -3.757  -97.345  1.00 16.61  ? 82   TRP A CE3 1 
ATOM   659   C  CZ2 . TRP A  1 101 ? -22.466  -6.321  -96.352  1.00 17.04  ? 82   TRP A CZ2 1 
ATOM   660   C  CZ3 . TRP A  1 101 ? -21.065  -4.351  -96.352  1.00 16.59  ? 82   TRP A CZ3 1 
ATOM   661   C  CH2 . TRP A  1 101 ? -21.402  -5.622  -95.859  1.00 22.16  ? 82   TRP A CH2 1 
ATOM   662   N  N   . VAL A  1 102 ? -24.930  -2.100  -96.724  1.00 20.31  ? 83   VAL A N   1 
ATOM   663   C  CA  . VAL A  1 102 ? -24.558  -1.884  -95.333  1.00 26.83  ? 83   VAL A CA  1 
ATOM   664   C  C   . VAL A  1 102 ? -24.488  -3.249  -94.653  1.00 26.56  ? 83   VAL A C   1 
ATOM   665   O  O   . VAL A  1 102 ? -25.334  -4.110  -94.906  1.00 32.59  ? 83   VAL A O   1 
ATOM   666   C  CB  . VAL A  1 102 ? -25.591  -0.942  -94.640  1.00 31.51  ? 83   VAL A CB  1 
ATOM   667   C  CG1 . VAL A  1 102 ? -25.573  -1.123  -93.176  1.00 35.87  ? 83   VAL A CG1 1 
ATOM   668   C  CG2 . VAL A  1 102 ? -25.312  0.521   -94.981  1.00 25.36  ? 83   VAL A CG2 1 
ATOM   669   N  N   . PRO A  1 103 ? -23.466  -3.469  -93.817  1.00 24.77  ? 84   PRO A N   1 
ATOM   670   C  CA  . PRO A  1 103 ? -23.417  -4.732  -93.038  1.00 31.01  ? 84   PRO A CA  1 
ATOM   671   C  C   . PRO A  1 103 ? -24.673  -4.962  -92.177  1.00 26.61  ? 84   PRO A C   1 
ATOM   672   O  O   . PRO A  1 103 ? -25.112  -4.007  -91.498  1.00 23.04  ? 84   PRO A O   1 
ATOM   673   C  CB  . PRO A  1 103 ? -22.162  -4.571  -92.155  1.00 15.30  ? 84   PRO A CB  1 
ATOM   674   C  CG  . PRO A  1 103 ? -21.734  -3.114  -92.281  1.00 27.48  ? 84   PRO A CG  1 
ATOM   675   C  CD  . PRO A  1 103 ? -22.318  -2.577  -93.571  1.00 25.06  ? 84   PRO A CD  1 
ATOM   676   N  N   . ASP A  1 104 ? -25.233  -6.177  -92.218  1.00 23.15  ? 85   ASP A N   1 
ATOM   677   C  CA  . ASP A  1 104 ? -26.379  -6.532  -91.347  1.00 22.88  ? 85   ASP A CA  1 
ATOM   678   C  C   . ASP A  1 104 ? -26.060  -6.813  -89.858  1.00 24.74  ? 85   ASP A C   1 
ATOM   679   O  O   . ASP A  1 104 ? -26.466  -7.837  -89.283  1.00 30.03  ? 85   ASP A O   1 
ATOM   680   C  CB  . ASP A  1 104 ? -27.169  -7.683  -91.970  1.00 21.18  ? 85   ASP A CB  1 
ATOM   681   C  CG  . ASP A  1 104 ? -26.334  -8.929  -92.048  1.00 26.26  ? 85   ASP A CG  1 
ATOM   682   O  OD1 . ASP A  1 104 ? -25.124  -8.795  -92.345  1.00 25.39  ? 85   ASP A OD1 1 
ATOM   683   O  OD2 . ASP A  1 104 ? -26.872  -10.021 -91.956  1.00 25.61  ? 85   ASP A OD2 1 
ATOM   684   N  N   . LEU A  1 105 ? -25.356  -5.883  -89.223  1.00 21.86  ? 86   LEU A N   1 
ATOM   685   C  CA  . LEU A  1 105 ? -25.013  -6.038  -87.808  1.00 14.19  ? 86   LEU A CA  1 
ATOM   686   C  C   . LEU A  1 105 ? -26.269  -6.046  -86.930  1.00 13.82  ? 86   LEU A C   1 
ATOM   687   O  O   . LEU A  1 105 ? -27.264  -5.364  -87.198  1.00 25.04  ? 86   LEU A O   1 
ATOM   688   C  CB  . LEU A  1 105 ? -24.074  -4.927  -87.411  1.00 13.87  ? 86   LEU A CB  1 
ATOM   689   C  CG  . LEU A  1 105 ? -22.766  -4.848  -88.202  1.00 23.76  ? 86   LEU A CG  1 
ATOM   690   C  CD1 . LEU A  1 105 ? -21.834  -3.753  -87.628  1.00 19.64  ? 86   LEU A CD1 1 
ATOM   691   C  CD2 . LEU A  1 105 ? -22.025  -6.211  -88.282  1.00 14.77  ? 86   LEU A CD2 1 
ATOM   692   N  N   . ALA A  1 106 ? -26.231  -6.833  -85.879  1.00 13.79  ? 87   ALA A N   1 
ATOM   693   C  CA  . ALA A  1 106 ? -27.326  -6.822  -84.900  1.00 25.49  ? 87   ALA A CA  1 
ATOM   694   C  C   . ALA A  1 106 ? -26.710  -7.027  -83.547  1.00 22.33  ? 87   ALA A C   1 
ATOM   695   O  O   . ALA A  1 106 ? -25.671  -7.687  -83.435  1.00 24.60  ? 87   ALA A O   1 
ATOM   696   C  CB  . ALA A  1 106 ? -28.353  -7.925  -85.183  1.00 13.72  ? 87   ALA A CB  1 
ATOM   697   N  N   . ALA A  1 107 ? -27.356  -6.476  -82.525  1.00 24.61  ? 88   ALA A N   1 
ATOM   698   C  CA  . ALA A  1 107 ? -26.989  -6.731  -81.132  1.00 19.24  ? 88   ALA A CA  1 
ATOM   699   C  C   . ALA A  1 107 ? -27.781  -7.937  -80.653  1.00 23.02  ? 88   ALA A C   1 
ATOM   700   O  O   . ALA A  1 107 ? -29.021  -7.875  -80.529  1.00 23.80  ? 88   ALA A O   1 
ATOM   701   C  CB  . ALA A  1 107 ? -27.292  -5.522  -80.292  1.00 14.50  ? 88   ALA A CB  1 
ATOM   702   N  N   . TYR A  1 108 ? -27.070  -9.036  -80.395  1.00 23.65  ? 89   TYR A N   1 
ATOM   703   C  CA  . TYR A  1 108 ? -27.711  -10.294 -80.004  1.00 19.23  ? 89   TYR A CA  1 
ATOM   704   C  C   . TYR A  1 108 ? -28.559  -10.207 -78.751  1.00 17.30  ? 89   TYR A C   1 
ATOM   705   O  O   . TYR A  1 108 ? -29.600  -10.849 -78.656  1.00 17.83  ? 89   TYR A O   1 
ATOM   706   C  CB  . TYR A  1 108 ? -26.681  -11.398 -79.863  1.00 17.70  ? 89   TYR A CB  1 
ATOM   707   C  CG  . TYR A  1 108 ? -26.249  -11.954 -81.206  1.00 26.66  ? 89   TYR A CG  1 
ATOM   708   C  CD1 . TYR A  1 108 ? -25.410  -11.217 -82.043  1.00 26.42  ? 89   TYR A CD1 1 
ATOM   709   C  CD2 . TYR A  1 108 ? -26.675  -13.209 -81.642  1.00 27.64  ? 89   TYR A CD2 1 
ATOM   710   C  CE1 . TYR A  1 108 ? -25.000  -11.706 -83.261  1.00 23.95  ? 89   TYR A CE1 1 
ATOM   711   C  CE2 . TYR A  1 108 ? -26.267  -13.712 -82.873  1.00 30.98  ? 89   TYR A CE2 1 
ATOM   712   C  CZ  . TYR A  1 108 ? -25.430  -12.945 -83.676  1.00 29.26  ? 89   TYR A CZ  1 
ATOM   713   O  OH  . TYR A  1 108 ? -25.004  -13.416 -84.889  1.00 30.74  ? 89   TYR A OH  1 
ATOM   714   N  N   . ASN A  1 109 ? -28.119  -9.400  -77.796  1.00 19.54  ? 90   ASN A N   1 
ATOM   715   C  CA  . ASN A  1 109 ? -28.803  -9.297  -76.508  1.00 21.17  ? 90   ASN A CA  1 
ATOM   716   C  C   . ASN A  1 109 ? -29.624  -8.001  -76.373  1.00 26.24  ? 90   ASN A C   1 
ATOM   717   O  O   . ASN A  1 109 ? -30.023  -7.604  -75.274  1.00 28.27  ? 90   ASN A O   1 
ATOM   718   C  CB  . ASN A  1 109 ? -27.800  -9.432  -75.370  1.00 20.14  ? 90   ASN A CB  1 
ATOM   719   C  CG  . ASN A  1 109 ? -26.668  -8.410  -75.456  1.00 30.39  ? 90   ASN A CG  1 
ATOM   720   O  OD1 . ASN A  1 109 ? -26.112  -8.169  -76.533  1.00 38.84  ? 90   ASN A OD1 1 
ATOM   721   N  ND2 . ASN A  1 109 ? -26.321  -7.801  -74.310  1.00 31.51  ? 90   ASN A ND2 1 
ATOM   722   N  N   . ALA A  1 110 ? -29.870  -7.344  -77.503  1.00 25.47  ? 91   ALA A N   1 
ATOM   723   C  CA  . ALA A  1 110 ? -30.809  -6.227  -77.546  1.00 23.82  ? 91   ALA A CA  1 
ATOM   724   C  C   . ALA A  1 110 ? -32.239  -6.748  -77.370  1.00 25.68  ? 91   ALA A C   1 
ATOM   725   O  O   . ALA A  1 110 ? -32.591  -7.832  -77.871  1.00 30.82  ? 91   ALA A O   1 
ATOM   726   C  CB  . ALA A  1 110 ? -30.690  -5.488  -78.869  1.00 20.57  ? 91   ALA A CB  1 
ATOM   727   N  N   . ILE A  1 111 ? -33.064  -5.983  -76.659  1.00 21.12  ? 92   ILE A N   1 
ATOM   728   C  CA  . ILE A  1 111 ? -34.435  -6.411  -76.392  1.00 22.09  ? 92   ILE A CA  1 
ATOM   729   C  C   . ILE A  1 111 ? -35.407  -5.352  -76.843  1.00 23.73  ? 92   ILE A C   1 
ATOM   730   O  O   . ILE A  1 111 ? -36.611  -5.448  -76.587  1.00 24.30  ? 92   ILE A O   1 
ATOM   731   C  CB  . ILE A  1 111 ? -34.688  -6.727  -74.905  1.00 18.11  ? 92   ILE A CB  1 
ATOM   732   C  CG1 . ILE A  1 111 ? -34.440  -5.486  -74.045  1.00 21.44  ? 92   ILE A CG1 1 
ATOM   733   C  CG2 . ILE A  1 111 ? -33.842  -7.917  -74.445  1.00 18.85  ? 92   ILE A CG2 1 
ATOM   734   C  CD1 . ILE A  1 111 ? -34.741  -5.694  -72.581  1.00 28.43  ? 92   ILE A CD1 1 
ATOM   735   N  N   . SER A  1 112 ? -34.866  -4.319  -77.480  1.00 22.03  ? 93   SER A N   1 
ATOM   736   C  CA  . SER A  1 112 ? -35.688  -3.360  -78.224  1.00 29.15  ? 93   SER A CA  1 
ATOM   737   C  C   . SER A  1 112 ? -35.077  -3.190  -79.597  1.00 28.09  ? 93   SER A C   1 
ATOM   738   O  O   . SER A  1 112 ? -33.873  -3.432  -79.791  1.00 27.55  ? 93   SER A O   1 
ATOM   739   C  CB  . SER A  1 112 ? -35.758  -2.010  -77.506  1.00 25.05  ? 93   SER A CB  1 
ATOM   740   O  OG  . SER A  1 112 ? -34.556  -1.272  -77.671  1.00 21.46  ? 93   SER A OG  1 
ATOM   741   N  N   . LYS A  1 113 ? -35.873  -2.752  -80.559  1.00 30.36  ? 94   LYS A N   1 
ATOM   742   C  CA  . LYS A  1 113 ? -35.228  -2.477  -81.844  1.00 37.82  ? 94   LYS A CA  1 
ATOM   743   C  C   . LYS A  1 113 ? -34.398  -1.202  -81.746  1.00 33.79  ? 94   LYS A C   1 
ATOM   744   O  O   . LYS A  1 113 ? -34.692  -0.326  -80.912  1.00 33.35  ? 94   LYS A O   1 
ATOM   745   C  CB  . LYS A  1 113 ? -36.186  -2.502  -83.041  1.00 43.64  ? 94   LYS A CB  1 
ATOM   746   C  CG  . LYS A  1 113 ? -37.315  -1.503  -83.038  1.00 48.44  ? 94   LYS A CG  1 
ATOM   747   C  CD  . LYS A  1 113 ? -38.281  -1.771  -84.234  1.00 79.64  ? 94   LYS A CD  1 
ATOM   748   C  CE  . LYS A  1 113 ? -37.575  -1.764  -85.608  1.00 74.75  ? 94   LYS A CE  1 
ATOM   749   N  NZ  . LYS A  1 113 ? -38.463  -2.272  -86.692  1.00 70.21  ? 94   LYS A NZ  1 
ATOM   750   N  N   . PRO A  1 114 ? -33.321  -1.124  -82.548  1.00 29.93  ? 95   PRO A N   1 
ATOM   751   C  CA  . PRO A  1 114 ? -32.469  0.067   -82.423  1.00 28.34  ? 95   PRO A CA  1 
ATOM   752   C  C   . PRO A  1 114 ? -33.202  1.340   -82.856  1.00 33.32  ? 95   PRO A C   1 
ATOM   753   O  O   . PRO A  1 114 ? -33.740  1.396   -83.978  1.00 34.48  ? 95   PRO A O   1 
ATOM   754   C  CB  . PRO A  1 114 ? -31.278  -0.238  -83.362  1.00 19.84  ? 95   PRO A CB  1 
ATOM   755   C  CG  . PRO A  1 114 ? -31.761  -1.305  -84.296  1.00 13.52  ? 95   PRO A CG  1 
ATOM   756   C  CD  . PRO A  1 114 ? -32.793  -2.099  -83.529  1.00 22.90  ? 95   PRO A CD  1 
ATOM   757   N  N   . GLU A  1 115 ? -33.242  2.332   -81.963  1.00 34.50  ? 96   GLU A N   1 
ATOM   758   C  CA  . GLU A  1 115 ? -33.779  3.654   -82.302  1.00 31.49  ? 96   GLU A CA  1 
ATOM   759   C  C   . GLU A  1 115 ? -32.632  4.512   -82.837  1.00 26.24  ? 96   GLU A C   1 
ATOM   760   O  O   . GLU A  1 115 ? -31.741  4.911   -82.079  1.00 28.08  ? 96   GLU A O   1 
ATOM   761   C  CB  . GLU A  1 115 ? -34.413  4.297   -81.074  1.00 33.40  ? 96   GLU A CB  1 
ATOM   762   C  CG  . GLU A  1 115 ? -35.185  5.598   -81.306  1.00 39.33  ? 96   GLU A CG  1 
ATOM   763   C  CD  . GLU A  1 115 ? -35.771  6.183   -79.994  1.00 46.30  ? 96   GLU A CD  1 
ATOM   764   O  OE1 . GLU A  1 115 ? -35.606  5.529   -78.943  1.00 44.07  ? 96   GLU A OE1 1 
ATOM   765   O  OE2 . GLU A  1 115 ? -36.388  7.286   -80.013  1.00 44.99  ? 96   GLU A OE2 1 
ATOM   766   N  N   . VAL A  1 116 ? -32.627  4.758   -84.145  1.00 16.34  ? 97   VAL A N   1 
ATOM   767   C  CA  . VAL A  1 116 ? -31.590  5.595   -84.741  1.00 18.01  ? 97   VAL A CA  1 
ATOM   768   C  C   . VAL A  1 116 ? -31.965  7.060   -84.579  1.00 21.55  ? 97   VAL A C   1 
ATOM   769   O  O   . VAL A  1 116 ? -33.022  7.491   -85.023  1.00 30.35  ? 97   VAL A O   1 
ATOM   770   C  CB  . VAL A  1 116 ? -31.361  5.271   -86.230  1.00 22.48  ? 97   VAL A CB  1 
ATOM   771   C  CG1 . VAL A  1 116 ? -30.205  6.116   -86.792  1.00 16.69  ? 97   VAL A CG1 1 
ATOM   772   C  CG2 . VAL A  1 116 ? -31.082  3.780   -86.394  1.00 22.60  ? 97   VAL A CG2 1 
ATOM   773   N  N   . LEU A  1 117 ? -31.080  7.817   -83.943  1.00 14.71  ? 98   LEU A N   1 
ATOM   774   C  CA  . LEU A  1 117 ? -31.390  9.163   -83.500  1.00 16.90  ? 98   LEU A CA  1 
ATOM   775   C  C   . LEU A  1 117 ? -30.915  10.190  -84.498  1.00 26.31  ? 98   LEU A C   1 
ATOM   776   O  O   . LEU A  1 117 ? -31.323  11.342  -84.467  1.00 27.67  ? 98   LEU A O   1 
ATOM   777   C  CB  . LEU A  1 117 ? -30.698  9.438   -82.163  1.00 20.65  ? 98   LEU A CB  1 
ATOM   778   C  CG  . LEU A  1 117 ? -31.057  8.560   -80.955  1.00 18.81  ? 98   LEU A CG  1 
ATOM   779   C  CD1 . LEU A  1 117 ? -30.252  8.968   -79.706  1.00 13.32  ? 98   LEU A CD1 1 
ATOM   780   C  CD2 . LEU A  1 117 ? -32.544  8.621   -80.652  1.00 20.39  ? 98   LEU A CD2 1 
ATOM   781   N  N   . THR A  1 118 ? -30.048  9.763   -85.398  1.00 28.42  ? 99   THR A N   1 
ATOM   782   C  CA  . THR A  1 118 ? -29.364  10.691  -86.270  1.00 20.81  ? 99   THR A CA  1 
ATOM   783   C  C   . THR A  1 118 ? -29.717  10.458  -87.741  1.00 24.69  ? 99   THR A C   1 
ATOM   784   O  O   . THR A  1 118 ? -30.262  9.406   -88.085  1.00 21.93  ? 99   THR A O   1 
ATOM   785   C  CB  . THR A  1 118 ? -27.873  10.534  -86.048  1.00 18.94  ? 99   THR A CB  1 
ATOM   786   O  OG1 . THR A  1 118 ? -27.549  9.130   -86.025  1.00 15.15  ? 99   THR A OG1 1 
ATOM   787   C  CG2 . THR A  1 118 ? -27.496  11.179  -84.727  1.00 9.29   ? 99   THR A CG2 1 
ATOM   788   N  N   . PRO A  1 119 ? -29.430  11.451  -88.608  1.00 26.28  ? 100  PRO A N   1 
ATOM   789   C  CA  . PRO A  1 119 ? -29.670  11.305  -90.049  1.00 25.83  ? 100  PRO A CA  1 
ATOM   790   C  C   . PRO A  1 119 ? -28.935  10.087  -90.589  1.00 26.87  ? 100  PRO A C   1 
ATOM   791   O  O   . PRO A  1 119 ? -27.757  9.911   -90.255  1.00 28.06  ? 100  PRO A O   1 
ATOM   792   C  CB  . PRO A  1 119 ? -29.064  12.581  -90.628  1.00 24.92  ? 100  PRO A CB  1 
ATOM   793   C  CG  . PRO A  1 119 ? -29.249  13.592  -89.546  1.00 25.10  ? 100  PRO A CG  1 
ATOM   794   C  CD  . PRO A  1 119 ? -29.056  12.833  -88.254  1.00 26.38  ? 100  PRO A CD  1 
ATOM   795   N  N   . GLN A  1 120 ? -29.604  9.274   -91.409  1.00 22.34  ? 101  GLN A N   1 
ATOM   796   C  CA  . GLN A  1 120 ? -28.999  8.027   -91.864  1.00 22.89  ? 101  GLN A CA  1 
ATOM   797   C  C   . GLN A  1 120 ? -28.113  8.161   -93.094  1.00 18.95  ? 101  GLN A C   1 
ATOM   798   O  O   . GLN A  1 120 ? -28.462  7.723   -94.182  1.00 23.53  ? 101  GLN A O   1 
ATOM   799   C  CB  . GLN A  1 120 ? -30.064  6.940   -91.997  1.00 26.10  ? 101  GLN A CB  1 
ATOM   800   C  CG  . GLN A  1 120 ? -30.749  6.692   -90.657  1.00 27.08  ? 101  GLN A CG  1 
ATOM   801   C  CD  . GLN A  1 120 ? -31.811  5.661   -90.729  1.00 31.75  ? 101  GLN A CD  1 
ATOM   802   O  OE1 . GLN A  1 120 ? -31.668  4.653   -91.432  1.00 41.20  ? 101  GLN A OE1 1 
ATOM   803   N  NE2 . GLN A  1 120 ? -32.900  5.890   -90.005  1.00 26.93  ? 101  GLN A NE2 1 
ATOM   804   N  N   . LEU A  1 121 ? -26.963  8.798   -92.885  1.00 20.07  ? 102  LEU A N   1 
ATOM   805   C  CA  . LEU A  1 121 ? -26.004  9.091   -93.942  1.00 23.16  ? 102  LEU A CA  1 
ATOM   806   C  C   . LEU A  1 121 ? -24.658  8.462   -93.608  1.00 27.12  ? 102  LEU A C   1 
ATOM   807   O  O   . LEU A  1 121 ? -24.240  8.403   -92.441  1.00 24.78  ? 102  LEU A O   1 
ATOM   808   C  CB  . LEU A  1 121 ? -25.820  10.598  -94.098  1.00 23.70  ? 102  LEU A CB  1 
ATOM   809   C  CG  . LEU A  1 121 ? -27.032  11.445  -94.512  1.00 24.78  ? 102  LEU A CG  1 
ATOM   810   C  CD1 . LEU A  1 121 ? -26.688  12.925  -94.476  1.00 19.96  ? 102  LEU A CD1 1 
ATOM   811   C  CD2 . LEU A  1 121 ? -27.505  11.044  -95.908  1.00 26.44  ? 102  LEU A CD2 1 
ATOM   812   N  N   . ALA A  1 122 ? -23.968  8.002   -94.645  1.00 25.89  ? 103  ALA A N   1 
ATOM   813   C  CA  . ALA A  1 122 ? -22.647  7.420   -94.477  1.00 19.73  ? 103  ALA A CA  1 
ATOM   814   C  C   . ALA A  1 122 ? -21.606  8.234   -95.230  1.00 17.08  ? 103  ALA A C   1 
ATOM   815   O  O   . ALA A  1 122 ? -21.918  8.968   -96.173  1.00 22.64  ? 103  ALA A O   1 
ATOM   816   C  CB  . ALA A  1 122 ? -22.631  5.992   -94.982  1.00 13.27  ? 103  ALA A CB  1 
ATOM   817   N  N   . HIS A  1 123 ? -20.365  8.087   -94.800  1.00 15.41  ? 104  HIS A N   1 
ATOM   818   C  CA  A HIS A  1 123 ? -19.224  8.643   -95.507  0.68 20.56  ? 104  HIS A CA  1 
ATOM   819   C  CA  B HIS A  1 123 ? -19.238  8.659   -95.515  0.32 20.75  ? 104  HIS A CA  1 
ATOM   820   C  C   . HIS A  1 123 ? -18.731  7.662   -96.537  1.00 20.68  ? 104  HIS A C   1 
ATOM   821   O  O   . HIS A  1 123 ? -18.477  6.501   -96.220  1.00 20.40  ? 104  HIS A O   1 
ATOM   822   C  CB  A HIS A  1 123 ? -18.075  8.931   -94.542  0.68 23.08  ? 104  HIS A CB  1 
ATOM   823   C  CB  B HIS A  1 123 ? -18.100  9.026   -94.556  0.32 24.75  ? 104  HIS A CB  1 
ATOM   824   C  CG  A HIS A  1 123 ? -18.164  10.276  -93.907  0.68 30.12  ? 104  HIS A CG  1 
ATOM   825   C  CG  B HIS A  1 123 ? -18.249  10.375  -93.931  0.32 31.15  ? 104  HIS A CG  1 
ATOM   826   N  ND1 A HIS A  1 123 ? -19.024  11.246  -94.360  0.68 32.38  ? 104  HIS A ND1 1 
ATOM   827   N  ND1 B HIS A  1 123 ? -17.453  10.804  -92.891  0.32 32.96  ? 104  HIS A ND1 1 
ATOM   828   C  CD2 A HIS A  1 123 ? -17.505  10.810  -92.848  0.68 32.96  ? 104  HIS A CD2 1 
ATOM   829   C  CD2 B HIS A  1 123 ? -19.101  11.393  -94.202  0.32 33.28  ? 104  HIS A CD2 1 
ATOM   830   C  CE1 A HIS A  1 123 ? -18.893  12.329  -93.612  0.68 35.78  ? 104  HIS A CE1 1 
ATOM   831   C  CE1 B HIS A  1 123 ? -17.812  12.029  -92.545  0.32 35.38  ? 104  HIS A CE1 1 
ATOM   832   N  NE2 A HIS A  1 123 ? -17.983  12.088  -92.687  0.68 35.85  ? 104  HIS A NE2 1 
ATOM   833   N  NE2 B HIS A  1 123 ? -18.807  12.410  -93.326  0.32 36.20  ? 104  HIS A NE2 1 
ATOM   834   N  N   . VAL A  1 124 ? -18.587  8.121   -97.767  1.00 23.27  ? 105  VAL A N   1 
ATOM   835   C  CA  . VAL A  1 124 ? -17.867  7.321   -98.741  1.00 24.30  ? 105  VAL A CA  1 
ATOM   836   C  C   . VAL A  1 124 ? -16.638  8.116   -99.133  1.00 24.36  ? 105  VAL A C   1 
ATOM   837   O  O   . VAL A  1 124 ? -16.744  9.266   -99.539  1.00 31.10  ? 105  VAL A O   1 
ATOM   838   C  CB  . VAL A  1 124 ? -18.721  6.959   -99.950  1.00 25.75  ? 105  VAL A CB  1 
ATOM   839   C  CG1 . VAL A  1 124 ? -17.908  6.084   -100.922 1.00 29.94  ? 105  VAL A CG1 1 
ATOM   840   C  CG2 . VAL A  1 124 ? -19.972  6.234   -99.480  1.00 21.21  ? 105  VAL A CG2 1 
ATOM   841   N  N   . VAL A  1 125 ? -15.473  7.512   -98.944  1.00 27.73  ? 106  VAL A N   1 
ATOM   842   C  CA  . VAL A  1 125 ? -14.207  8.118   -99.357  1.00 33.85  ? 106  VAL A CA  1 
ATOM   843   C  C   . VAL A  1 125 ? -13.814  7.613   -100.779 1.00 25.98  ? 106  VAL A C   1 
ATOM   844   O  O   . VAL A  1 125 ? -14.163  6.485   -101.164 1.00 21.19  ? 106  VAL A O   1 
ATOM   845   C  CB  . VAL A  1 125 ? -13.105  7.819   -98.326  1.00 30.18  ? 106  VAL A CB  1 
ATOM   846   C  CG1 . VAL A  1 125 ? -11.864  8.640   -98.615  1.00 35.61  ? 106  VAL A CG1 1 
ATOM   847   C  CG2 . VAL A  1 125 ? -13.603  8.141   -96.973  1.00 33.02  ? 106  VAL A CG2 1 
ATOM   848   N  N   . SER A  1 126 ? -13.106  8.442   -101.543 1.00 22.96  ? 107  SER A N   1 
ATOM   849   C  CA  . SER A  1 126 ? -12.768  8.134   -102.932 1.00 22.74  ? 107  SER A CA  1 
ATOM   850   C  C   . SER A  1 126 ? -12.112  6.763   -103.125 1.00 27.15  ? 107  SER A C   1 
ATOM   851   O  O   . SER A  1 126 ? -12.325  6.112   -104.139 1.00 33.59  ? 107  SER A O   1 
ATOM   852   C  CB  . SER A  1 126 ? -11.891  9.228   -103.530 1.00 26.21  ? 107  SER A CB  1 
ATOM   853   O  OG  . SER A  1 126 ? -10.631  9.242   -102.903 1.00 32.72  ? 107  SER A OG  1 
ATOM   854   N  N   . ASP A  1 127 ? -11.351  6.302   -102.147 1.00 31.79  ? 108  ASP A N   1 
ATOM   855   C  CA  . ASP A  1 127 ? -10.789  4.947   -102.205 1.00 37.86  ? 108  ASP A CA  1 
ATOM   856   C  C   . ASP A  1 127 ? -11.808  3.809   -102.026 1.00 41.76  ? 108  ASP A C   1 
ATOM   857   O  O   . ASP A  1 127 ? -11.474  2.641   -102.241 1.00 50.18  ? 108  ASP A O   1 
ATOM   858   C  CB  . ASP A  1 127 ? -9.636   4.793   -101.195 1.00 41.59  ? 108  ASP A CB  1 
ATOM   859   C  CG  . ASP A  1 127 ? -10.073  4.984   -99.754  1.00 46.81  ? 108  ASP A CG  1 
ATOM   860   O  OD1 . ASP A  1 127 ? -11.209  5.434   -99.504  1.00 50.25  ? 108  ASP A OD1 1 
ATOM   861   O  OD2 . ASP A  1 127 ? -9.261   4.688   -98.859  1.00 52.86  ? 108  ASP A OD2 1 
ATOM   862   N  N   . GLY A  1 128 ? -13.033  4.136   -101.621 1.00 38.19  ? 109  GLY A N   1 
ATOM   863   C  CA  . GLY A  1 128 ? -14.048  3.114   -101.420 1.00 37.97  ? 109  GLY A CA  1 
ATOM   864   C  C   . GLY A  1 128 ? -14.287  2.750   -99.965  1.00 39.04  ? 109  GLY A C   1 
ATOM   865   O  O   . GLY A  1 128 ? -15.067  1.842   -99.682  1.00 37.27  ? 109  GLY A O   1 
ATOM   866   N  N   . GLU A  1 129 ? -13.609  3.444   -99.045  1.00 40.28  ? 110  GLU A N   1 
ATOM   867   C  CA  A GLU A  1 129 ? -13.827  3.268   -97.597  0.61 34.76  ? 110  GLU A CA  1 
ATOM   868   C  CA  B GLU A  1 129 ? -13.848  3.219   -97.628  0.39 34.90  ? 110  GLU A CA  1 
ATOM   869   C  C   . GLU A  1 129 ? -15.170  3.873   -97.224  1.00 31.64  ? 110  GLU A C   1 
ATOM   870   O  O   . GLU A  1 129 ? -15.444  5.038   -97.540  1.00 34.41  ? 110  GLU A O   1 
ATOM   871   C  CB  A GLU A  1 129 ? -12.718  3.934   -96.749  0.61 34.60  ? 110  GLU A CB  1 
ATOM   872   C  CB  B GLU A  1 129 ? -12.669  3.717   -96.785  0.39 34.00  ? 110  GLU A CB  1 
ATOM   873   C  CG  A GLU A  1 129 ? -12.781  3.634   -95.220  0.61 28.32  ? 110  GLU A CG  1 
ATOM   874   C  CG  B GLU A  1 129 ? -11.330  3.026   -97.130  0.39 31.95  ? 110  GLU A CG  1 
ATOM   875   C  CD  A GLU A  1 129 ? -11.756  4.425   -94.370  0.61 29.33  ? 110  GLU A CD  1 
ATOM   876   C  CD  B GLU A  1 129 ? -11.183  1.637   -96.505  0.39 26.89  ? 110  GLU A CD  1 
ATOM   877   O  OE1 A GLU A  1 129 ? -11.972  5.632   -94.136  0.61 24.78  ? 110  GLU A OE1 1 
ATOM   878   O  OE1 B GLU A  1 129 ? -12.033  1.269   -95.668  0.39 24.91  ? 110  GLU A OE1 1 
ATOM   879   O  OE2 A GLU A  1 129 ? -10.746  3.839   -93.914  0.61 31.91  ? 110  GLU A OE2 1 
ATOM   880   O  OE2 B GLU A  1 129 ? -10.213  0.922   -96.843  0.39 20.47  ? 110  GLU A OE2 1 
ATOM   881   N  N   . VAL A  1 130 ? -16.010  3.089   -96.566  1.00 29.02  ? 111  VAL A N   1 
ATOM   882   C  CA  . VAL A  1 130 ? -17.301  3.577   -96.105  1.00 28.32  ? 111  VAL A CA  1 
ATOM   883   C  C   . VAL A  1 130 ? -17.342  3.598   -94.590  1.00 28.69  ? 111  VAL A C   1 
ATOM   884   O  O   . VAL A  1 130 ? -16.921  2.641   -93.933  1.00 29.26  ? 111  VAL A O   1 
ATOM   885   C  CB  . VAL A  1 130 ? -18.448  2.705   -96.609  1.00 32.26  ? 111  VAL A CB  1 
ATOM   886   C  CG1 . VAL A  1 130 ? -19.793  3.327   -96.179  1.00 14.58  ? 111  VAL A CG1 1 
ATOM   887   C  CG2 . VAL A  1 130 ? -18.334  2.497   -98.141  1.00 16.91  ? 111  VAL A CG2 1 
ATOM   888   N  N   . GLN A  1 131 ? -17.817  4.705   -94.038  1.00 28.09  ? 112  GLN A N   1 
ATOM   889   C  CA  . GLN A  1 131 ? -18.048  4.783   -92.609  1.00 24.06  ? 112  GLN A CA  1 
ATOM   890   C  C   . GLN A  1 131 ? -19.492  5.206   -92.327  1.00 23.91  ? 112  GLN A C   1 
ATOM   891   O  O   . GLN A  1 131 ? -20.010  6.128   -92.953  1.00 26.24  ? 112  GLN A O   1 
ATOM   892   C  CB  . GLN A  1 131 ? -17.075  5.756   -91.958  1.00 29.83  ? 112  GLN A CB  1 
ATOM   893   C  CG  . GLN A  1 131 ? -17.196  5.782   -90.436  1.00 36.77  ? 112  GLN A CG  1 
ATOM   894   C  CD  . GLN A  1 131 ? -16.061  6.536   -89.787  1.00 38.69  ? 112  GLN A CD  1 
ATOM   895   O  OE1 . GLN A  1 131 ? -16.144  7.760   -89.603  1.00 39.30  ? 112  GLN A OE1 1 
ATOM   896   N  NE2 . GLN A  1 131 ? -14.977  5.814   -89.445  1.00 33.73  ? 112  GLN A NE2 1 
ATOM   897   N  N   . TYR A  1 132 ? -20.147  4.508   -91.406  1.00 22.55  ? 113  TYR A N   1 
ATOM   898   C  CA  . TYR A  1 132 ? -21.500  4.856   -90.973  1.00 19.26  ? 113  TYR A CA  1 
ATOM   899   C  C   . TYR A  1 132 ? -21.509  4.854   -89.456  1.00 21.02  ? 113  TYR A C   1 
ATOM   900   O  O   . TYR A  1 132 ? -21.163  3.848   -88.833  1.00 21.34  ? 113  TYR A O   1 
ATOM   901   C  CB  . TYR A  1 132 ? -22.494  3.838   -91.504  1.00 18.72  ? 113  TYR A CB  1 
ATOM   902   C  CG  . TYR A  1 132 ? -23.929  4.053   -91.073  1.00 23.70  ? 113  TYR A CG  1 
ATOM   903   C  CD1 . TYR A  1 132 ? -24.516  5.326   -91.113  1.00 23.86  ? 113  TYR A CD1 1 
ATOM   904   C  CD2 . TYR A  1 132 ? -24.717  2.974   -90.674  1.00 12.55  ? 113  TYR A CD2 1 
ATOM   905   C  CE1 . TYR A  1 132 ? -25.843  5.519   -90.739  1.00 20.19  ? 113  TYR A CE1 1 
ATOM   906   C  CE2 . TYR A  1 132 ? -26.036  3.153   -90.314  1.00 18.88  ? 113  TYR A CE2 1 
ATOM   907   C  CZ  . TYR A  1 132 ? -26.601  4.422   -90.336  1.00 20.48  ? 113  TYR A CZ  1 
ATOM   908   O  OH  . TYR A  1 132 ? -27.928  4.583   -89.958  1.00 25.02  ? 113  TYR A OH  1 
ATOM   909   N  N   . THR A  1 133 ? -21.891  5.982   -88.866  1.00 20.90  ? 114  THR A N   1 
ATOM   910   C  CA  . THR A  1 133 ? -21.857  6.140   -87.411  1.00 20.17  ? 114  THR A CA  1 
ATOM   911   C  C   . THR A  1 133 ? -23.150  6.689   -86.840  1.00 16.22  ? 114  THR A C   1 
ATOM   912   O  O   . THR A  1 133 ? -23.207  7.843   -86.422  1.00 16.78  ? 114  THR A O   1 
ATOM   913   C  CB  . THR A  1 133 ? -20.694  7.026   -86.993  1.00 23.14  ? 114  THR A CB  1 
ATOM   914   O  OG1 . THR A  1 133 ? -19.499  6.575   -87.661  1.00 29.70  ? 114  THR A OG1 1 
ATOM   915   C  CG2 . THR A  1 133 ? -20.522  6.985   -85.467  1.00 15.86  ? 114  THR A CG2 1 
ATOM   916   N  N   . PRO A  1 134 ? -24.207  5.862   -86.837  1.00 19.11  ? 115  PRO A N   1 
ATOM   917   C  CA  . PRO A  1 134 ? -25.474  6.356   -86.294  1.00 21.69  ? 115  PRO A CA  1 
ATOM   918   C  C   . PRO A  1 134 ? -25.385  6.439   -84.770  1.00 22.38  ? 115  PRO A C   1 
ATOM   919   O  O   . PRO A  1 134 ? -24.607  5.710   -84.143  1.00 10.40  ? 115  PRO A O   1 
ATOM   920   C  CB  . PRO A  1 134 ? -26.488  5.280   -86.738  1.00 17.27  ? 115  PRO A CB  1 
ATOM   921   C  CG  . PRO A  1 134 ? -25.677  4.020   -86.813  1.00 16.00  ? 115  PRO A CG  1 
ATOM   922   C  CD  . PRO A  1 134 ? -24.290  4.449   -87.257  1.00 18.66  ? 115  PRO A CD  1 
ATOM   923   N  N   . SER A  1 135 ? -26.145  7.350   -84.183  1.00 23.28  ? 116  SER A N   1 
ATOM   924   C  CA  . SER A  1 135 ? -26.293  7.374   -82.733  1.00 22.32  ? 116  SER A CA  1 
ATOM   925   C  C   . SER A  1 135 ? -27.525  6.552   -82.450  1.00 15.53  ? 116  SER A C   1 
ATOM   926   O  O   . SER A  1 135 ? -28.616  6.850   -82.931  1.00 19.66  ? 116  SER A O   1 
ATOM   927   C  CB  . SER A  1 135 ? -26.476  8.802   -82.213  1.00 26.31  ? 116  SER A CB  1 
ATOM   928   O  OG  . SER A  1 135 ? -26.491  8.843   -80.792  1.00 31.79  ? 116  SER A OG  1 
ATOM   929   N  N   . ILE A  1 136 ? -27.350  5.500   -81.676  1.00 15.91  ? 117  ILE A N   1 
ATOM   930   C  CA  . ILE A  1 136 ? -28.452  4.610   -81.356  1.00 21.26  ? 117  ILE A CA  1 
ATOM   931   C  C   . ILE A  1 136 ? -28.841  4.600   -79.867  1.00 21.58  ? 117  ILE A C   1 
ATOM   932   O  O   . ILE A  1 136 ? -27.972  4.590   -78.980  1.00 19.67  ? 117  ILE A O   1 
ATOM   933   C  CB  . ILE A  1 136 ? -28.090  3.205   -81.799  1.00 27.20  ? 117  ILE A CB  1 
ATOM   934   C  CG1 . ILE A  1 136 ? -27.865  3.189   -83.316  1.00 23.82  ? 117  ILE A CG1 1 
ATOM   935   C  CG2 . ILE A  1 136 ? -29.155  2.183   -81.347  1.00 26.66  ? 117  ILE A CG2 1 
ATOM   936   C  CD1 . ILE A  1 136 ? -27.319  1.866   -83.816  1.00 20.71  ? 117  ILE A CD1 1 
ATOM   937   N  N   . ARG A  1 137 ? -30.149  4.635   -79.606  1.00 21.71  ? 118  ARG A N   1 
ATOM   938   C  CA  . ARG A  1 137 ? -30.660  4.326   -78.283  1.00 22.14  ? 118  ARG A CA  1 
ATOM   939   C  C   . ARG A  1 137 ? -31.278  2.932   -78.335  1.00 24.32  ? 118  ARG A C   1 
ATOM   940   O  O   . ARG A  1 137 ? -32.103  2.649   -79.207  1.00 24.00  ? 118  ARG A O   1 
ATOM   941   C  CB  . ARG A  1 137 ? -31.701  5.345   -77.815  1.00 23.50  ? 118  ARG A CB  1 
ATOM   942   C  CG  . ARG A  1 137 ? -32.286  4.971   -76.469  1.00 26.72  ? 118  ARG A CG  1 
ATOM   943   C  CD  . ARG A  1 137 ? -33.153  6.053   -75.886  1.00 27.68  ? 118  ARG A CD  1 
ATOM   944   N  NE  . ARG A  1 137 ? -33.709  5.601   -74.614  1.00 34.34  ? 118  ARG A NE  1 
ATOM   945   C  CZ  . ARG A  1 137 ? -34.319  6.363   -73.717  1.00 33.82  ? 118  ARG A CZ  1 
ATOM   946   N  NH1 . ARG A  1 137 ? -34.449  7.668   -73.908  1.00 35.92  ? 118  ARG A NH1 1 
ATOM   947   N  NH2 . ARG A  1 137 ? -34.777  5.803   -72.610  1.00 38.81  ? 118  ARG A NH2 1 
ATOM   948   N  N   . GLN A  1 138 ? -30.865  2.068   -77.409  1.00 25.23  ? 119  GLN A N   1 
ATOM   949   C  CA  . GLN A  1 138 ? -31.313  0.673   -77.389  1.00 23.44  ? 119  GLN A CA  1 
ATOM   950   C  C   . GLN A  1 138 ? -31.305  0.051   -75.977  1.00 21.31  ? 119  GLN A C   1 
ATOM   951   O  O   . GLN A  1 138 ? -30.477  0.399   -75.134  1.00 19.88  ? 119  GLN A O   1 
ATOM   952   C  CB  . GLN A  1 138 ? -30.439  -0.149  -78.334  1.00 21.72  ? 119  GLN A CB  1 
ATOM   953   C  CG  . GLN A  1 138 ? -31.063  -1.428  -78.782  1.00 28.05  ? 119  GLN A CG  1 
ATOM   954   C  CD  . GLN A  1 138 ? -30.365  -2.002  -80.003  1.00 33.52  ? 119  GLN A CD  1 
ATOM   955   O  OE1 . GLN A  1 138 ? -29.175  -1.727  -80.242  1.00 31.77  ? 119  GLN A OE1 1 
ATOM   956   N  NE2 . GLN A  1 138 ? -31.102  -2.799  -80.789  1.00 33.35  ? 119  GLN A NE2 1 
ATOM   957   N  N   . ARG A  1 139 ? -32.227  -0.875  -75.732  1.00 19.06  ? 120  ARG A N   1 
ATOM   958   C  CA  . ARG A  1 139 ? -32.283  -1.564  -74.454  1.00 27.54  ? 120  ARG A CA  1 
ATOM   959   C  C   . ARG A  1 139 ? -31.674  -2.976  -74.542  1.00 32.90  ? 120  ARG A C   1 
ATOM   960   O  O   . ARG A  1 139 ? -31.982  -3.762  -75.449  1.00 29.68  ? 120  ARG A O   1 
ATOM   961   C  CB  . ARG A  1 139 ? -33.716  -1.584  -73.880  1.00 32.16  ? 120  ARG A CB  1 
ATOM   962   C  CG  . ARG A  1 139 ? -33.757  -1.404  -72.349  1.00 38.59  ? 120  ARG A CG  1 
ATOM   963   C  CD  . ARG A  1 139 ? -35.170  -1.484  -71.748  1.00 45.43  ? 120  ARG A CD  1 
ATOM   964   N  NE  . ARG A  1 139 ? -35.135  -1.636  -70.287  1.00 49.27  ? 120  ARG A NE  1 
ATOM   965   C  CZ  . ARG A  1 139 ? -34.992  -0.628  -69.423  1.00 53.54  ? 120  ARG A CZ  1 
ATOM   966   N  NH1 . ARG A  1 139 ? -34.885  0.619   -69.868  1.00 61.21  ? 120  ARG A NH1 1 
ATOM   967   N  NH2 . ARG A  1 139 ? -34.958  -0.857  -68.116  1.00 49.51  ? 120  ARG A NH2 1 
ATOM   968   N  N   . PHE A  1 140 ? -30.786  -3.284  -73.597  1.00 35.62  ? 121  PHE A N   1 
ATOM   969   C  CA  . PHE A  1 140 ? -30.085  -4.569  -73.592  1.00 29.49  ? 121  PHE A CA  1 
ATOM   970   C  C   . PHE A  1 140 ? -30.353  -5.406  -72.355  1.00 32.81  ? 121  PHE A C   1 
ATOM   971   O  O   . PHE A  1 140 ? -30.576  -4.886  -71.247  1.00 30.40  ? 121  PHE A O   1 
ATOM   972   C  CB  . PHE A  1 140 ? -28.583  -4.358  -73.702  1.00 24.52  ? 121  PHE A CB  1 
ATOM   973   C  CG  . PHE A  1 140 ? -28.160  -3.639  -74.950  1.00 29.90  ? 121  PHE A CG  1 
ATOM   974   C  CD1 . PHE A  1 140 ? -27.968  -4.337  -76.134  1.00 24.01  ? 121  PHE A CD1 1 
ATOM   975   C  CD2 . PHE A  1 140 ? -27.939  -2.268  -74.938  1.00 31.87  ? 121  PHE A CD2 1 
ATOM   976   C  CE1 . PHE A  1 140 ? -27.555  -3.680  -77.268  1.00 17.59  ? 121  PHE A CE1 1 
ATOM   977   C  CE2 . PHE A  1 140 ? -27.521  -1.614  -76.083  1.00 27.36  ? 121  PHE A CE2 1 
ATOM   978   C  CZ  . PHE A  1 140 ? -27.333  -2.321  -77.243  1.00 18.95  ? 121  PHE A CZ  1 
ATOM   979   N  N   . SER A  1 141 ? -30.323  -6.720  -72.561  1.00 33.93  ? 122  SER A N   1 
ATOM   980   C  CA  . SER A  1 141 ? -30.364  -7.677  -71.475  1.00 30.36  ? 122  SER A CA  1 
ATOM   981   C  C   . SER A  1 141 ? -28.928  -8.061  -71.180  1.00 32.06  ? 122  SER A C   1 
ATOM   982   O  O   . SER A  1 141 ? -28.256  -8.675  -72.019  1.00 28.25  ? 122  SER A O   1 
ATOM   983   C  CB  . SER A  1 141 ? -31.150  -8.905  -71.889  1.00 33.23  ? 122  SER A CB  1 
ATOM   984   O  OG  . SER A  1 141 ? -30.787  -10.027 -71.092  1.00 35.26  ? 122  SER A OG  1 
ATOM   985   N  N   . CYS A  1 142 ? -28.459  -7.682  -69.994  1.00 39.65  ? 123  CYS A N   1 
ATOM   986   C  CA  . CYS A  1 142 ? -27.094  -7.970  -69.562  1.00 38.58  ? 123  CYS A CA  1 
ATOM   987   C  C   . CYS A  1 142 ? -26.947  -7.985  -68.036  1.00 35.69  ? 123  CYS A C   1 
ATOM   988   O  O   . CYS A  1 142 ? -27.914  -7.769  -67.287  1.00 30.48  ? 123  CYS A O   1 
ATOM   989   C  CB  . CYS A  1 142 ? -26.122  -6.966  -70.174  1.00 39.68  ? 123  CYS A CB  1 
ATOM   990   S  SG  . CYS A  1 142 ? -26.600  -5.252  -69.896  1.00 69.22  ? 123  CYS A SG  1 
ATOM   991   N  N   . ASP A  1 143 ? -25.720  -8.235  -67.589  1.00 31.65  ? 124  ASP A N   1 
ATOM   992   C  CA  . ASP A  1 143 ? -25.443  -8.333  -66.177  1.00 28.16  ? 124  ASP A CA  1 
ATOM   993   C  C   . ASP A  1 143 ? -25.293  -6.953  -65.576  1.00 32.90  ? 124  ASP A C   1 
ATOM   994   O  O   . ASP A  1 143 ? -24.296  -6.269  -65.821  1.00 35.46  ? 124  ASP A O   1 
ATOM   995   C  CB  . ASP A  1 143 ? -24.173  -9.151  -65.934  1.00 32.17  ? 124  ASP A CB  1 
ATOM   996   C  CG  . ASP A  1 143 ? -23.982  -9.529  -64.465  1.00 41.60  ? 124  ASP A CG  1 
ATOM   997   O  OD1 . ASP A  1 143 ? -24.948  -9.435  -63.659  1.00 38.39  ? 124  ASP A OD1 1 
ATOM   998   O  OD2 . ASP A  1 143 ? -22.847  -9.928  -64.136  1.00 43.84  ? 124  ASP A OD2 1 
ATOM   999   N  N   . VAL A  1 144 ? -26.286  -6.556  -64.783  1.00 33.87  ? 125  VAL A N   1 
ATOM   1000  C  CA  . VAL A  1 144 ? -26.311  -5.237  -64.155  1.00 35.66  ? 125  VAL A CA  1 
ATOM   1001  C  C   . VAL A  1 144 ? -25.914  -5.306  -62.669  1.00 34.25  ? 125  VAL A C   1 
ATOM   1002  O  O   . VAL A  1 144 ? -25.855  -4.294  -61.972  1.00 39.43  ? 125  VAL A O   1 
ATOM   1003  C  CB  . VAL A  1 144 ? -27.707  -4.607  -64.325  1.00 44.27  ? 125  VAL A CB  1 
ATOM   1004  C  CG1 . VAL A  1 144 ? -27.694  -3.125  -63.969  1.00 46.70  ? 125  VAL A CG1 1 
ATOM   1005  C  CG2 . VAL A  1 144 ? -28.171  -4.782  -65.771  1.00 49.83  ? 125  VAL A CG2 1 
ATOM   1006  N  N   . SER A  1 145 ? -25.621  -6.511  -62.197  1.00 33.78  ? 126  SER A N   1 
ATOM   1007  C  CA  . SER A  1 145 ? -25.278  -6.721  -60.800  1.00 30.75  ? 126  SER A CA  1 
ATOM   1008  C  C   . SER A  1 145 ? -23.988  -5.978  -60.436  1.00 36.48  ? 126  SER A C   1 
ATOM   1009  O  O   . SER A  1 145 ? -22.984  -6.054  -61.155  1.00 46.84  ? 126  SER A O   1 
ATOM   1010  C  CB  . SER A  1 145 ? -25.143  -8.216  -60.509  1.00 32.14  ? 126  SER A CB  1 
ATOM   1011  O  OG  . SER A  1 145 ? -23.955  -8.732  -61.086  1.00 38.01  ? 126  SER A OG  1 
ATOM   1012  N  N   . GLY A  1 146 ? -24.036  -5.234  -59.331  1.00 35.64  ? 127  GLY A N   1 
ATOM   1013  C  CA  . GLY A  1 146 ? -22.883  -4.503  -58.838  1.00 35.72  ? 127  GLY A CA  1 
ATOM   1014  C  C   . GLY A  1 146 ? -22.831  -3.067  -59.322  1.00 41.70  ? 127  GLY A C   1 
ATOM   1015  O  O   . GLY A  1 146 ? -21.854  -2.341  -59.069  1.00 39.25  ? 127  GLY A O   1 
ATOM   1016  N  N   . VAL A  1 147 ? -23.888  -2.646  -60.018  1.00 43.99  ? 128  VAL A N   1 
ATOM   1017  C  CA  . VAL A  1 147 ? -23.924  -1.306  -60.611  1.00 43.64  ? 128  VAL A CA  1 
ATOM   1018  C  C   . VAL A  1 147 ? -23.776  -0.221  -59.536  1.00 41.73  ? 128  VAL A C   1 
ATOM   1019  O  O   . VAL A  1 147 ? -23.271  0.880   -59.785  1.00 35.67  ? 128  VAL A O   1 
ATOM   1020  C  CB  . VAL A  1 147 ? -25.210  -1.088  -61.448  1.00 23.98  ? 128  VAL A CB  1 
ATOM   1021  C  CG1 . VAL A  1 147 ? -26.447  -1.197  -60.584  1.00 23.66  ? 128  VAL A CG1 1 
ATOM   1022  C  CG2 . VAL A  1 147 ? -25.170  0.249   -62.184  1.00 22.14  ? 128  VAL A CG2 1 
ATOM   1023  N  N   . ASP A  1 148 ? -24.201  -0.556  -58.329  1.00 47.98  ? 129  ASP A N   1 
ATOM   1024  C  CA  . ASP A  1 148 ? -24.206  0.414   -57.262  1.00 52.98  ? 129  ASP A CA  1 
ATOM   1025  C  C   . ASP A  1 148 ? -23.002  0.261   -56.346  1.00 48.34  ? 129  ASP A C   1 
ATOM   1026  O  O   . ASP A  1 148 ? -22.923  0.930   -55.323  1.00 58.26  ? 129  ASP A O   1 
ATOM   1027  C  CB  . ASP A  1 148 ? -25.508  0.328   -56.471  1.00 62.88  ? 129  ASP A CB  1 
ATOM   1028  C  CG  . ASP A  1 148 ? -26.144  1.691   -56.262  1.00 71.24  ? 129  ASP A CG  1 
ATOM   1029  O  OD1 . ASP A  1 148 ? -25.384  2.678   -56.095  1.00 73.52  ? 129  ASP A OD1 1 
ATOM   1030  O  OD2 . ASP A  1 148 ? -27.396  1.777   -56.280  1.00 74.18  ? 129  ASP A OD2 1 
ATOM   1031  N  N   . THR A  1 149 ? -22.067  -0.607  -56.722  1.00 39.71  ? 130  THR A N   1 
ATOM   1032  C  CA  . THR A  1 149 ? -20.834  -0.793  -55.959  1.00 38.38  ? 130  THR A CA  1 
ATOM   1033  C  C   . THR A  1 149 ? -19.692  -0.005  -56.587  1.00 38.15  ? 130  THR A C   1 
ATOM   1034  O  O   . THR A  1 149 ? -19.891  0.696   -57.565  1.00 40.52  ? 130  THR A O   1 
ATOM   1035  C  CB  . THR A  1 149 ? -20.428  -2.281  -55.869  1.00 43.96  ? 130  THR A CB  1 
ATOM   1036  O  OG1 . THR A  1 149 ? -19.771  -2.687  -57.086  1.00 53.93  ? 130  THR A OG1 1 
ATOM   1037  C  CG2 . THR A  1 149 ? -21.652  -3.149  -55.604  1.00 33.99  ? 130  THR A CG2 1 
ATOM   1038  N  N   . GLU A  1 150 ? -18.490  -0.135  -56.035  1.00 44.01  ? 131  GLU A N   1 
ATOM   1039  C  CA  . GLU A  1 150 ? -17.392  0.689   -56.508  1.00 51.21  ? 131  GLU A CA  1 
ATOM   1040  C  C   . GLU A  1 150 ? -16.744  0.069   -57.744  1.00 53.46  ? 131  GLU A C   1 
ATOM   1041  O  O   . GLU A  1 150 ? -16.279  0.782   -58.651  1.00 54.61  ? 131  GLU A O   1 
ATOM   1042  C  CB  . GLU A  1 150 ? -16.381  0.973   -55.379  1.00 51.11  ? 131  GLU A CB  1 
ATOM   1043  C  CG  . GLU A  1 150 ? -15.791  2.421   -55.360  1.00 85.08  ? 131  GLU A CG  1 
ATOM   1044  C  CD  . GLU A  1 150 ? -16.826  3.568   -55.164  1.00 70.60  ? 131  GLU A CD  1 
ATOM   1045  O  OE1 . GLU A  1 150 ? -18.062  3.334   -55.160  1.00 66.11  ? 131  GLU A OE1 1 
ATOM   1046  O  OE2 . GLU A  1 150 ? -16.383  4.731   -55.024  1.00 71.60  ? 131  GLU A OE2 1 
ATOM   1047  N  N   . SER A  1 151 ? -16.751  -1.258  -57.791  1.00 50.20  ? 132  SER A N   1 
ATOM   1048  C  CA  . SER A  1 151 ? -16.189  -1.980  -58.928  1.00 54.12  ? 132  SER A CA  1 
ATOM   1049  C  C   . SER A  1 151 ? -17.146  -1.934  -60.135  1.00 52.61  ? 132  SER A C   1 
ATOM   1050  O  O   . SER A  1 151 ? -16.745  -2.148  -61.286  1.00 54.26  ? 132  SER A O   1 
ATOM   1051  C  CB  . SER A  1 151 ? -15.879  -3.422  -58.533  1.00 57.20  ? 132  SER A CB  1 
ATOM   1052  O  OG  . SER A  1 151 ? -17.073  -4.096  -58.172  1.00 59.62  ? 132  SER A OG  1 
ATOM   1053  N  N   . GLY A  1 152 ? -18.414  -1.649  -59.852  1.00 45.73  ? 133  GLY A N   1 
ATOM   1054  C  CA  . GLY A  1 152 ? -19.403  -1.416  -60.883  1.00 34.34  ? 133  GLY A CA  1 
ATOM   1055  C  C   . GLY A  1 152 ? -19.968  -2.675  -61.506  1.00 35.29  ? 133  GLY A C   1 
ATOM   1056  O  O   . GLY A  1 152 ? -19.547  -3.791  -61.184  1.00 39.62  ? 133  GLY A O   1 
ATOM   1057  N  N   . ALA A  1 153 ? -20.933  -2.494  -62.410  1.00 31.37  ? 134  ALA A N   1 
ATOM   1058  C  CA  . ALA A  1 153 ? -21.455  -3.593  -63.219  1.00 27.32  ? 134  ALA A CA  1 
ATOM   1059  C  C   . ALA A  1 153 ? -20.648  -3.735  -64.521  1.00 24.68  ? 134  ALA A C   1 
ATOM   1060  O  O   . ALA A  1 153 ? -20.033  -2.765  -64.994  1.00 28.05  ? 134  ALA A O   1 
ATOM   1061  C  CB  . ALA A  1 153 ? -22.916  -3.362  -63.519  1.00 24.15  ? 134  ALA A CB  1 
ATOM   1062  N  N   . THR A  1 154 ? -20.643  -4.941  -65.091  1.00 20.61  ? 135  THR A N   1 
ATOM   1063  C  CA  . THR A  1 154 ? -20.051  -5.135  -66.417  1.00 30.31  ? 135  THR A CA  1 
ATOM   1064  C  C   . THR A  1 154 ? -21.066  -5.691  -67.431  1.00 32.02  ? 135  THR A C   1 
ATOM   1065  O  O   . THR A  1 154 ? -21.326  -6.897  -67.487  1.00 31.95  ? 135  THR A O   1 
ATOM   1066  C  CB  . THR A  1 154 ? -18.779  -6.005  -66.382  1.00 30.98  ? 135  THR A CB  1 
ATOM   1067  O  OG1 . THR A  1 154 ? -17.794  -5.368  -65.563  1.00 33.78  ? 135  THR A OG1 1 
ATOM   1068  C  CG2 . THR A  1 154 ? -18.200  -6.173  -67.784  1.00 30.96  ? 135  THR A CG2 1 
ATOM   1069  N  N   . CYS A  1 155 ? -21.624  -4.791  -68.234  1.00 28.26  ? 136  CYS A N   1 
ATOM   1070  C  CA  . CYS A  1 155 ? -22.595  -5.163  -69.249  1.00 26.70  ? 136  CYS A CA  1 
ATOM   1071  C  C   . CYS A  1 155 ? -21.894  -5.543  -70.562  1.00 28.81  ? 136  CYS A C   1 
ATOM   1072  O  O   . CYS A  1 155 ? -21.132  -4.760  -71.129  1.00 25.09  ? 136  CYS A O   1 
ATOM   1073  C  CB  . CYS A  1 155 ? -23.577  -4.009  -69.487  1.00 21.97  ? 136  CYS A CB  1 
ATOM   1074  S  SG  . CYS A  1 155 ? -24.890  -4.434  -70.660  1.00 93.96  ? 136  CYS A SG  1 
ATOM   1075  N  N   . ARG A  1 156 ? -22.167  -6.749  -71.038  1.00 35.54  ? 137  ARG A N   1 
ATOM   1076  C  CA  . ARG A  1 156 ? -21.512  -7.287  -72.224  1.00 41.20  ? 137  ARG A CA  1 
ATOM   1077  C  C   . ARG A  1 156 ? -22.461  -7.198  -73.440  1.00 41.25  ? 137  ARG A C   1 
ATOM   1078  O  O   . ARG A  1 156 ? -23.539  -7.789  -73.443  1.00 45.57  ? 137  ARG A O   1 
ATOM   1079  C  CB  . ARG A  1 156 ? -21.106  -8.731  -71.945  1.00 50.08  ? 137  ARG A CB  1 
ATOM   1080  C  CG  . ARG A  1 156 ? -20.110  -9.326  -72.912  1.00 65.86  ? 137  ARG A CG  1 
ATOM   1081  C  CD  . ARG A  1 156 ? -19.783  -10.784 -72.543  1.00 73.16  ? 137  ARG A CD  1 
ATOM   1082  N  NE  . ARG A  1 156 ? -20.942  -11.682 -72.651  1.00 71.47  ? 137  ARG A NE  1 
ATOM   1083  C  CZ  . ARG A  1 156 ? -21.547  -12.255 -71.611  1.00 64.13  ? 137  ARG A CZ  1 
ATOM   1084  N  NH1 . ARG A  1 156 ? -21.103  -12.024 -70.380  1.00 63.09  ? 137  ARG A NH1 1 
ATOM   1085  N  NH2 . ARG A  1 156 ? -22.591  -13.056 -71.802  1.00 59.19  ? 137  ARG A NH2 1 
ATOM   1086  N  N   . ILE A  1 157 ? -22.074  -6.431  -74.458  1.00 35.29  ? 138  ILE A N   1 
ATOM   1087  C  CA  . ILE A  1 157 ? -22.909  -6.263  -75.645  1.00 35.33  ? 138  ILE A CA  1 
ATOM   1088  C  C   . ILE A  1 157 ? -22.343  -6.992  -76.869  1.00 34.73  ? 138  ILE A C   1 
ATOM   1089  O  O   . ILE A  1 157 ? -21.224  -6.705  -77.321  1.00 33.23  ? 138  ILE A O   1 
ATOM   1090  C  CB  . ILE A  1 157 ? -23.089  -4.775  -75.997  1.00 37.71  ? 138  ILE A CB  1 
ATOM   1091  C  CG1 . ILE A  1 157 ? -23.908  -4.065  -74.910  1.00 37.93  ? 138  ILE A CG1 1 
ATOM   1092  C  CG2 . ILE A  1 157 ? -23.726  -4.616  -77.387  1.00 31.12  ? 138  ILE A CG2 1 
ATOM   1093  C  CD1 . ILE A  1 157 ? -23.992  -2.570  -75.104  1.00 14.00  ? 138  ILE A CD1 1 
ATOM   1094  N  N   . LYS A  1 158 ? -23.125  -7.926  -77.409  1.00 33.76  ? 139  LYS A N   1 
ATOM   1095  C  CA  . LYS A  1 158 ? -22.663  -8.791  -78.505  1.00 29.29  ? 139  LYS A CA  1 
ATOM   1096  C  C   . LYS A  1 158 ? -23.181  -8.334  -79.864  1.00 29.15  ? 139  LYS A C   1 
ATOM   1097  O  O   . LYS A  1 158 ? -24.383  -8.424  -80.132  1.00 36.81  ? 139  LYS A O   1 
ATOM   1098  C  CB  . LYS A  1 158 ? -23.115  -10.221 -78.256  1.00 23.15  ? 139  LYS A CB  1 
ATOM   1099  C  CG  . LYS A  1 158 ? -22.661  -11.247 -79.273  1.00 18.54  ? 139  LYS A CG  1 
ATOM   1100  C  CD  . LYS A  1 158 ? -23.322  -12.591 -78.977  1.00 22.43  ? 139  LYS A CD  1 
ATOM   1101  C  CE  . LYS A  1 158 ? -23.079  -13.604 -80.084  1.00 33.95  ? 139  LYS A CE  1 
ATOM   1102  N  NZ  . LYS A  1 158 ? -23.791  -14.902 -79.822  1.00 35.88  ? 139  LYS A NZ  1 
ATOM   1103  N  N   . ILE A  1 159 ? -22.277  -7.849  -80.712  1.00 25.41  ? 140  ILE A N   1 
ATOM   1104  C  CA  . ILE A  1 159 ? -22.637  -7.353  -82.045  1.00 22.95  ? 140  ILE A CA  1 
ATOM   1105  C  C   . ILE A  1 159 ? -21.937  -8.118  -83.144  1.00 23.51  ? 140  ILE A C   1 
ATOM   1106  O  O   . ILE A  1 159 ? -20.719  -8.262  -83.113  1.00 26.78  ? 140  ILE A O   1 
ATOM   1107  C  CB  . ILE A  1 159 ? -22.282  -5.888  -82.205  1.00 22.09  ? 140  ILE A CB  1 
ATOM   1108  C  CG1 . ILE A  1 159 ? -23.069  -5.062  -81.185  1.00 27.57  ? 140  ILE A CG1 1 
ATOM   1109  C  CG2 . ILE A  1 159 ? -22.579  -5.434  -83.605  1.00 14.45  ? 140  ILE A CG2 1 
ATOM   1110  C  CD1 . ILE A  1 159 ? -22.794  -3.569  -81.287  1.00 34.04  ? 140  ILE A CD1 1 
ATOM   1111  N  N   . GLY A  1 160 ? -22.713  -8.601  -84.112  1.00 26.19  ? 141  GLY A N   1 
ATOM   1112  C  CA  . GLY A  1 160 ? -22.186  -9.310  -85.270  1.00 26.33  ? 141  GLY A CA  1 
ATOM   1113  C  C   . GLY A  1 160 ? -23.155  -9.316  -86.448  1.00 32.23  ? 141  GLY A C   1 
ATOM   1114  O  O   . GLY A  1 160 ? -24.300  -8.861  -86.339  1.00 35.15  ? 141  GLY A O   1 
ATOM   1115  N  N   . SER A  1 161 ? -22.689  -9.808  -87.592  1.00 29.89  ? 142  SER A N   1 
ATOM   1116  C  CA  . SER A  1 161 ? -23.562  -9.940  -88.741  1.00 23.98  ? 142  SER A CA  1 
ATOM   1117  C  C   . SER A  1 161 ? -24.658  -10.941 -88.422  1.00 24.16  ? 142  SER A C   1 
ATOM   1118  O  O   . SER A  1 161 ? -24.391  -12.000 -87.861  1.00 30.44  ? 142  SER A O   1 
ATOM   1119  C  CB  . SER A  1 161 ? -22.770  -10.422 -89.967  1.00 29.34  ? 142  SER A CB  1 
ATOM   1120  O  OG  . SER A  1 161 ? -23.619  -11.047 -90.934  1.00 24.26  ? 142  SER A OG  1 
ATOM   1121  N  N   . TRP A  1 162 ? -25.894  -10.620 -88.786  1.00 20.98  ? 143  TRP A N   1 
ATOM   1122  C  CA  . TRP A  1 162 ? -26.990  -11.561 -88.579  1.00 18.79  ? 143  TRP A CA  1 
ATOM   1123  C  C   . TRP A  1 162 ? -26.974  -12.731 -89.567  1.00 21.75  ? 143  TRP A C   1 
ATOM   1124  O  O   . TRP A  1 162 ? -27.271  -13.869 -89.207  1.00 26.57  ? 143  TRP A O   1 
ATOM   1125  C  CB  . TRP A  1 162 ? -28.340  -10.832 -88.639  1.00 14.46  ? 143  TRP A CB  1 
ATOM   1126  C  CG  . TRP A  1 162 ? -29.453  -11.592 -87.928  1.00 22.82  ? 143  TRP A CG  1 
ATOM   1127  C  CD1 . TRP A  1 162 ? -30.567  -12.144 -88.499  1.00 27.24  ? 143  TRP A CD1 1 
ATOM   1128  C  CD2 . TRP A  1 162 ? -29.536  -11.901 -86.522  1.00 20.97  ? 143  TRP A CD2 1 
ATOM   1129  N  NE1 . TRP A  1 162 ? -31.345  -12.766 -87.537  1.00 24.14  ? 143  TRP A NE1 1 
ATOM   1130  C  CE2 . TRP A  1 162 ? -30.736  -12.626 -86.321  1.00 23.65  ? 143  TRP A CE2 1 
ATOM   1131  C  CE3 . TRP A  1 162 ? -28.728  -11.620 -85.418  1.00 21.04  ? 143  TRP A CE3 1 
ATOM   1132  C  CZ2 . TRP A  1 162 ? -31.134  -13.083 -85.062  1.00 24.08  ? 143  TRP A CZ2 1 
ATOM   1133  C  CZ3 . TRP A  1 162 ? -29.134  -12.072 -84.162  1.00 20.22  ? 143  TRP A CZ3 1 
ATOM   1134  C  CH2 . TRP A  1 162 ? -30.329  -12.794 -83.999  1.00 15.82  ? 143  TRP A CH2 1 
ATOM   1135  N  N   . THR A  1 163 ? -26.653  -12.462 -90.827  1.00 22.06  ? 144  THR A N   1 
ATOM   1136  C  CA  . THR A  1 163 ? -26.802  -13.511 -91.840  1.00 25.62  ? 144  THR A CA  1 
ATOM   1137  C  C   . THR A  1 163 ? -25.538  -13.830 -92.617  1.00 26.51  ? 144  THR A C   1 
ATOM   1138  O  O   . THR A  1 163 ? -25.548  -14.723 -93.447  1.00 27.96  ? 144  THR A O   1 
ATOM   1139  C  CB  . THR A  1 163 ? -27.921  -13.207 -92.867  1.00 25.47  ? 144  THR A CB  1 
ATOM   1140  O  OG1 . THR A  1 163 ? -27.488  -12.166 -93.756  1.00 31.47  ? 144  THR A OG1 1 
ATOM   1141  C  CG2 . THR A  1 163 ? -29.221  -12.819 -92.168  1.00 26.45  ? 144  THR A CG2 1 
ATOM   1142  N  N   . HIS A  1 164 ? -24.455  -13.101 -92.383  1.00 22.65  ? 145  HIS A N   1 
ATOM   1143  C  CA  . HIS A  1 164 ? -23.241  -13.385 -93.146  1.00 22.18  ? 145  HIS A CA  1 
ATOM   1144  C  C   . HIS A  1 164 ? -22.208  -14.044 -92.254  1.00 31.93  ? 145  HIS A C   1 
ATOM   1145  O  O   . HIS A  1 164 ? -21.907  -13.543 -91.153  1.00 36.56  ? 145  HIS A O   1 
ATOM   1146  C  CB  . HIS A  1 164 ? -22.666  -12.117 -93.795  1.00 26.66  ? 145  HIS A CB  1 
ATOM   1147  C  CG  . HIS A  1 164 ? -23.537  -11.535 -94.866  1.00 26.44  ? 145  HIS A CG  1 
ATOM   1148  N  ND1 . HIS A  1 164 ? -23.655  -12.106 -96.112  1.00 29.22  ? 145  HIS A ND1 1 
ATOM   1149  C  CD2 . HIS A  1 164 ? -24.329  -10.438 -94.873  1.00 27.29  ? 145  HIS A CD2 1 
ATOM   1150  C  CE1 . HIS A  1 164 ? -24.483  -11.382 -96.846  1.00 34.09  ? 145  HIS A CE1 1 
ATOM   1151  N  NE2 . HIS A  1 164 ? -24.909  -10.369 -96.115  1.00 37.06  ? 145  HIS A NE2 1 
ATOM   1152  N  N   . HIS A  1 165 ? -21.684  -15.184 -92.709  1.00 31.14  ? 146  HIS A N   1 
ATOM   1153  C  CA  . HIS A  1 165 ? -20.689  -15.926 -91.918  1.00 34.16  ? 146  HIS A CA  1 
ATOM   1154  C  C   . HIS A  1 165 ? -19.263  -15.384 -92.097  1.00 34.98  ? 146  HIS A C   1 
ATOM   1155  O  O   . HIS A  1 165 ? -19.036  -14.407 -92.830  1.00 29.93  ? 146  HIS A O   1 
ATOM   1156  C  CB  . HIS A  1 165 ? -20.751  -17.429 -92.198  1.00 31.82  ? 146  HIS A CB  1 
ATOM   1157  C  CG  . HIS A  1 165 ? -20.569  -17.772 -93.636  1.00 38.76  ? 146  HIS A CG  1 
ATOM   1158  N  ND1 . HIS A  1 165 ? -19.370  -17.592 -94.296  1.00 38.81  ? 146  HIS A ND1 1 
ATOM   1159  C  CD2 . HIS A  1 165 ? -21.436  -18.269 -94.553  1.00 36.92  ? 146  HIS A CD2 1 
ATOM   1160  C  CE1 . HIS A  1 165 ? -19.505  -17.971 -95.556  1.00 32.17  ? 146  HIS A CE1 1 
ATOM   1161  N  NE2 . HIS A  1 165 ? -20.746  -18.393 -95.736  1.00 29.90  ? 146  HIS A NE2 1 
ATOM   1162  N  N   . SER A  1 166 ? -18.311  -16.016 -91.420  1.00 17.27  ? 147  SER A N   1 
ATOM   1163  C  CA  . SER A  1 166 ? -16.953  -15.490 -91.301  1.00 29.74  ? 147  SER A CA  1 
ATOM   1164  C  C   . SER A  1 166 ? -16.217  -15.310 -92.620  1.00 31.89  ? 147  SER A C   1 
ATOM   1165  O  O   . SER A  1 166 ? -15.314  -14.483 -92.706  1.00 35.62  ? 147  SER A O   1 
ATOM   1166  C  CB  . SER A  1 166 ? -16.115  -16.364 -90.367  1.00 34.88  ? 147  SER A CB  1 
ATOM   1167  O  OG  . SER A  1 166 ? -16.039  -17.698 -90.841  1.00 42.39  ? 147  SER A OG  1 
ATOM   1168  N  N   . ARG A  1 167 ? -16.569  -16.094 -93.634  1.00 35.35  ? 148  ARG A N   1 
ATOM   1169  C  CA  . ARG A  1 167 ? -15.943  -15.929 -94.952  1.00 42.25  ? 148  ARG A CA  1 
ATOM   1170  C  C   . ARG A  1 167 ? -16.581  -14.817 -95.844  1.00 39.12  ? 148  ARG A C   1 
ATOM   1171  O  O   . ARG A  1 167 ? -16.013  -14.443 -96.881  1.00 43.42  ? 148  ARG A O   1 
ATOM   1172  C  CB  . ARG A  1 167 ? -15.870  -17.276 -95.683  1.00 48.91  ? 148  ARG A CB  1 
ATOM   1173  C  CG  . ARG A  1 167 ? -14.788  -18.234 -95.161  1.00 60.08  ? 148  ARG A CG  1 
ATOM   1174  C  CD  . ARG A  1 167 ? -14.756  -19.566 -95.944  1.00 73.60  ? 148  ARG A CD  1 
ATOM   1175  N  NE  . ARG A  1 167 ? -15.960  -20.384 -95.740  1.00 81.51  ? 148  ARG A NE  1 
ATOM   1176  C  CZ  . ARG A  1 167 ? -16.941  -20.545 -96.634  1.00 82.31  ? 148  ARG A CZ  1 
ATOM   1177  N  NH1 . ARG A  1 167 ? -16.874  -19.955 -97.825  1.00 78.22  ? 148  ARG A NH1 1 
ATOM   1178  N  NH2 . ARG A  1 167 ? -17.997  -21.304 -96.336  1.00 82.78  ? 148  ARG A NH2 1 
ATOM   1179  N  N   . GLU A  1 168 ? -17.746  -14.309 -95.426  1.00 32.22  ? 149  GLU A N   1 
ATOM   1180  C  CA  . GLU A  1 168 ? -18.414  -13.177 -96.062  1.00 27.64  ? 149  GLU A CA  1 
ATOM   1181  C  C   . GLU A  1 168 ? -18.210  -11.884 -95.285  1.00 29.64  ? 149  GLU A C   1 
ATOM   1182  O  O   . GLU A  1 168 ? -17.841  -10.858 -95.866  1.00 34.10  ? 149  GLU A O   1 
ATOM   1183  C  CB  . GLU A  1 168 ? -19.908  -13.472 -96.243  1.00 34.48  ? 149  GLU A CB  1 
ATOM   1184  C  CG  . GLU A  1 168 ? -20.164  -14.616 -97.233  1.00 43.74  ? 149  GLU A CG  1 
ATOM   1185  C  CD  . GLU A  1 168 ? -21.595  -15.108 -97.247  1.00 50.71  ? 149  GLU A CD  1 
ATOM   1186  O  OE1 . GLU A  1 168 ? -22.351  -14.785 -96.307  1.00 50.02  ? 149  GLU A OE1 1 
ATOM   1187  O  OE2 . GLU A  1 168 ? -21.963  -15.824 -98.209  1.00 59.74  ? 149  GLU A OE2 1 
ATOM   1188  N  N   . ILE A  1 169 ? -18.434  -11.932 -93.971  1.00 29.13  ? 150  ILE A N   1 
ATOM   1189  C  CA  . ILE A  1 169 ? -18.188  -10.766 -93.115  1.00 26.26  ? 150  ILE A CA  1 
ATOM   1190  C  C   . ILE A  1 169 ? -17.318  -11.133 -91.918  1.00 24.90  ? 150  ILE A C   1 
ATOM   1191  O  O   . ILE A  1 169 ? -17.605  -12.097 -91.193  1.00 22.34  ? 150  ILE A O   1 
ATOM   1192  C  CB  . ILE A  1 169 ? -19.510  -10.110 -92.600  1.00 24.03  ? 150  ILE A CB  1 
ATOM   1193  C  CG1 . ILE A  1 169 ? -20.241  -9.414  -93.739  1.00 25.41  ? 150  ILE A CG1 1 
ATOM   1194  C  CG2 . ILE A  1 169 ? -19.217  -9.093  -91.477  1.00 15.97  ? 150  ILE A CG2 1 
ATOM   1195  C  CD1 . ILE A  1 169 ? -21.479  -8.617  -93.324  1.00 23.81  ? 150  ILE A CD1 1 
ATOM   1196  N  N   . SER A  1 170 ? -16.261  -10.351 -91.705  1.00 21.55  ? 151  SER A N   1 
ATOM   1197  C  CA  . SER A  1 170 ? -15.472  -10.484 -90.488  1.00 24.93  ? 151  SER A CA  1 
ATOM   1198  C  C   . SER A  1 170 ? -15.558  -9.184  -89.705  1.00 25.49  ? 151  SER A C   1 
ATOM   1199  O  O   . SER A  1 170 ? -15.435  -8.105  -90.287  1.00 23.04  ? 151  SER A O   1 
ATOM   1200  C  CB  . SER A  1 170 ? -14.031  -10.836 -90.789  1.00 17.36  ? 151  SER A CB  1 
ATOM   1201  O  OG  . SER A  1 170 ? -13.340  -9.679  -91.222  1.00 36.69  ? 151  SER A OG  1 
ATOM   1202  N  N   . VAL A  1 171 ? -15.810  -9.294  -88.396  1.00 30.12  ? 152  VAL A N   1 
ATOM   1203  C  CA  . VAL A  1 171 ? -15.896  -8.116  -87.529  1.00 38.98  ? 152  VAL A CA  1 
ATOM   1204  C  C   . VAL A  1 171 ? -14.644  -7.981  -86.660  1.00 43.38  ? 152  VAL A C   1 
ATOM   1205  O  O   . VAL A  1 171 ? -14.115  -8.968  -86.149  1.00 45.59  ? 152  VAL A O   1 
ATOM   1206  C  CB  . VAL A  1 171 ? -17.166  -8.114  -86.617  1.00 47.54  ? 152  VAL A CB  1 
ATOM   1207  C  CG1 . VAL A  1 171 ? -18.400  -7.835  -87.413  1.00 46.76  ? 152  VAL A CG1 1 
ATOM   1208  C  CG2 . VAL A  1 171 ? -17.304  -9.426  -85.901  1.00 49.18  ? 152  VAL A CG2 1 
ATOM   1209  N  N   . ASP A  1 172 ? -14.182  -6.746  -86.498  1.00 46.97  ? 153  ASP A N   1 
ATOM   1210  C  CA  . ASP A  1 172 ? -13.010  -6.453  -85.684  1.00 52.47  ? 153  ASP A CA  1 
ATOM   1211  C  C   . ASP A  1 172 ? -13.203  -5.163  -84.868  1.00 50.22  ? 153  ASP A C   1 
ATOM   1212  O  O   . ASP A  1 172 ? -13.872  -4.211  -85.307  1.00 43.99  ? 153  ASP A O   1 
ATOM   1213  C  CB  . ASP A  1 172 ? -11.760  -6.358  -86.565  1.00 59.18  ? 153  ASP A CB  1 
ATOM   1214  C  CG  . ASP A  1 172 ? -11.455  -7.663  -87.280  1.00 74.09  ? 153  ASP A CG  1 
ATOM   1215  O  OD1 . ASP A  1 172 ? -10.876  -8.563  -86.632  1.00 81.57  ? 153  ASP A OD1 1 
ATOM   1216  O  OD2 . ASP A  1 172 ? -11.793  -7.794  -88.483  1.00 79.97  ? 153  ASP A OD2 1 
ATOM   1217  N  N   . PRO A  1 173 ? -12.636  -5.141  -83.655  1.00 59.71  ? 154  PRO A N   1 
ATOM   1218  C  CA  . PRO A  1 173 ? -12.607  -3.923  -82.835  1.00 61.00  ? 154  PRO A CA  1 
ATOM   1219  C  C   . PRO A  1 173 ? -11.669  -2.888  -83.438  1.00 73.97  ? 154  PRO A C   1 
ATOM   1220  O  O   . PRO A  1 173 ? -10.878  -3.224  -84.319  1.00 78.65  ? 154  PRO A O   1 
ATOM   1221  C  CB  . PRO A  1 173 ? -12.038  -4.411  -81.509  1.00 56.11  ? 154  PRO A CB  1 
ATOM   1222  C  CG  . PRO A  1 173 ? -12.291  -5.900  -81.500  1.00 57.37  ? 154  PRO A CG  1 
ATOM   1223  C  CD  . PRO A  1 173 ? -12.141  -6.321  -82.925  1.00 56.79  ? 154  PRO A CD  1 
ATOM   1224  N  N   . THR A  1 174 ? -11.752  -1.648  -82.967  1.00 82.60  ? 155  THR A N   1 
ATOM   1225  C  CA  . THR A  1 174 ? -10.919  -0.566  -83.502  1.00 90.22  ? 155  THR A CA  1 
ATOM   1226  C  C   . THR A  1 174 ? -9.712   -0.290  -82.608  1.00 96.58  ? 155  THR A C   1 
ATOM   1227  O  O   . THR A  1 174 ? -8.571   -0.301  -83.073  1.00 100.46 ? 155  THR A O   1 
ATOM   1228  C  CB  . THR A  1 174 ? -11.731  0.745   -83.698  1.00 98.27  ? 155  THR A CB  1 
ATOM   1229  O  OG1 . THR A  1 174 ? -12.598  0.615   -84.831  1.00 96.22  ? 155  THR A OG1 1 
ATOM   1230  C  CG2 . THR A  1 174 ? -10.806  1.939   -83.914  1.00 98.22  ? 155  THR A CG2 1 
ATOM   1231  N  N   . ASP A  1 180 ? -12.622  6.099   -73.438  1.00 71.61  ? 161  ASP A N   1 
ATOM   1232  C  CA  . ASP A  1 180 ? -13.905  5.415   -73.399  1.00 75.01  ? 161  ASP A CA  1 
ATOM   1233  C  C   . ASP A  1 180 ? -15.033  6.379   -73.104  1.00 69.89  ? 161  ASP A C   1 
ATOM   1234  O  O   . ASP A  1 180 ? -16.099  6.339   -73.683  1.00 64.48  ? 161  ASP A O   1 
ATOM   1235  C  CB  . ASP A  1 180 ? -13.877  4.366   -72.306  1.00 81.37  ? 161  ASP A CB  1 
ATOM   1236  C  CG  . ASP A  1 180 ? -12.571  3.618   -72.247  1.00 83.53  ? 161  ASP A CG  1 
ATOM   1237  O  OD1 . ASP A  1 180 ? -12.049  3.289   -73.321  1.00 85.55  ? 161  ASP A OD1 1 
ATOM   1238  O  OD2 . ASP A  1 180 ? -12.072  3.368   -71.133  1.00 78.02  ? 161  ASP A OD2 1 
ATOM   1239  N  N   . SER A  1 181 ? -14.747  7.279   -72.197  1.00 71.06  ? 162  SER A N   1 
ATOM   1240  C  CA  . SER A  1 181 ? -15.724  8.157   -71.616  1.00 70.56  ? 162  SER A CA  1 
ATOM   1241  C  C   . SER A  1 181 ? -15.729  9.459   -72.391  1.00 70.36  ? 162  SER A C   1 
ATOM   1242  O  O   . SER A  1 181 ? -16.259  10.443  -71.932  1.00 75.84  ? 162  SER A O   1 
ATOM   1243  C  CB  . SER A  1 181 ? -15.370  8.404   -70.154  1.00 65.44  ? 162  SER A CB  1 
ATOM   1244  O  OG  . SER A  1 181 ? -16.421  8.088   -69.271  1.00 65.28  ? 162  SER A OG  1 
ATOM   1245  N  N   . GLU A  1 182 ? -15.106  9.463   -73.559  1.00 61.78  ? 163  GLU A N   1 
ATOM   1246  C  CA  . GLU A  1 182 ? -14.795  10.687  -74.284  1.00 50.87  ? 163  GLU A CA  1 
ATOM   1247  C  C   . GLU A  1 182 ? -15.967  11.540  -74.709  1.00 39.12  ? 163  GLU A C   1 
ATOM   1248  O  O   . GLU A  1 182 ? -15.903  12.739  -74.680  1.00 30.79  ? 163  GLU A O   1 
ATOM   1249  C  CB  . GLU A  1 182 ? -13.963  10.342  -75.509  1.00 52.66  ? 163  GLU A CB  1 
ATOM   1250  C  CG  . GLU A  1 182 ? -13.652  11.555  -76.365  1.00 60.65  ? 163  GLU A CG  1 
ATOM   1251  C  CD  . GLU A  1 182 ? -12.882  11.260  -77.618  1.00 63.58  ? 163  GLU A CD  1 
ATOM   1252  O  OE1 . GLU A  1 182 ? -12.896  10.116  -78.066  1.00 67.59  ? 163  GLU A OE1 1 
ATOM   1253  O  OE2 . GLU A  1 182 ? -12.272  12.187  -78.158  1.00 58.73  ? 163  GLU A OE2 1 
ATOM   1254  N  N   . TYR A  1 183 ? -17.007  10.903  -75.172  1.00 35.76  ? 164  TYR A N   1 
ATOM   1255  C  CA  . TYR A  1 183 ? -18.174  11.595  -75.597  1.00 32.54  ? 164  TYR A CA  1 
ATOM   1256  C  C   . TYR A  1 183 ? -19.306  11.319  -74.669  1.00 38.89  ? 164  TYR A C   1 
ATOM   1257  O  O   . TYR A  1 183 ? -20.423  11.658  -74.969  1.00 40.28  ? 164  TYR A O   1 
ATOM   1258  C  CB  . TYR A  1 183 ? -18.570  11.163  -76.989  1.00 37.55  ? 164  TYR A CB  1 
ATOM   1259  C  CG  . TYR A  1 183 ? -17.546  11.370  -78.041  1.00 40.34  ? 164  TYR A CG  1 
ATOM   1260  C  CD1 . TYR A  1 183 ? -17.035  12.590  -78.267  1.00 40.66  ? 164  TYR A CD1 1 
ATOM   1261  C  CD2 . TYR A  1 183 ? -17.107  10.339  -78.808  1.00 41.02  ? 164  TYR A CD2 1 
ATOM   1262  C  CE1 . TYR A  1 183 ? -16.094  12.789  -79.216  1.00 44.67  ? 164  TYR A CE1 1 
ATOM   1263  C  CE2 . TYR A  1 183 ? -16.169  10.533  -79.758  1.00 41.30  ? 164  TYR A CE2 1 
ATOM   1264  C  CZ  . TYR A  1 183 ? -15.679  11.772  -79.954  1.00 46.72  ? 164  TYR A CZ  1 
ATOM   1265  O  OH  . TYR A  1 183 ? -14.754  12.011  -80.901  1.00 49.96  ? 164  TYR A OH  1 
ATOM   1266  N  N   . PHE A  1 184 ? -19.019  10.672  -73.550  1.00 40.88  ? 165  PHE A N   1 
ATOM   1267  C  CA  . PHE A  1 184 ? -20.031  10.292  -72.589  1.00 35.42  ? 165  PHE A CA  1 
ATOM   1268  C  C   . PHE A  1 184 ? -20.559  11.480  -71.849  1.00 38.06  ? 165  PHE A C   1 
ATOM   1269  O  O   . PHE A  1 184 ? -19.822  12.357  -71.543  1.00 33.81  ? 165  PHE A O   1 
ATOM   1270  C  CB  . PHE A  1 184 ? -19.458  9.303   -71.617  1.00 28.62  ? 165  PHE A CB  1 
ATOM   1271  C  CG  . PHE A  1 184 ? -20.479  8.572   -70.839  1.00 28.33  ? 165  PHE A CG  1 
ATOM   1272  C  CD1 . PHE A  1 184 ? -21.154  7.556   -71.392  1.00 24.61  ? 165  PHE A CD1 1 
ATOM   1273  C  CD2 . PHE A  1 184 ? -20.738  8.894   -69.559  1.00 24.54  ? 165  PHE A CD2 1 
ATOM   1274  C  CE1 . PHE A  1 184 ? -22.093  6.871   -70.691  1.00 30.56  ? 165  PHE A CE1 1 
ATOM   1275  C  CE2 . PHE A  1 184 ? -21.667  8.222   -68.847  1.00 31.47  ? 165  PHE A CE2 1 
ATOM   1276  C  CZ  . PHE A  1 184 ? -22.353  7.208   -69.408  1.00 28.29  ? 165  PHE A CZ  1 
ATOM   1277  N  N   . SER A  1 185 ? -21.842  11.498  -71.564  1.00 24.15  ? 166  SER A N   1 
ATOM   1278  C  CA  . SER A  1 185 ? -22.471  12.623  -70.915  1.00 31.63  ? 166  SER A CA  1 
ATOM   1279  C  C   . SER A  1 185 ? -22.105  12.792  -69.460  1.00 29.49  ? 166  SER A C   1 
ATOM   1280  O  O   . SER A  1 185 ? -22.202  11.902  -68.689  1.00 29.17  ? 166  SER A O   1 
ATOM   1281  C  CB  . SER A  1 185 ? -23.973  12.492  -71.035  1.00 37.19  ? 166  SER A CB  1 
ATOM   1282  O  OG  . SER A  1 185 ? -24.637  13.684  -70.718  1.00 42.75  ? 166  SER A OG  1 
ATOM   1283  N  N   . GLN A  1 186 ? -21.685  13.973  -69.090  1.00 37.94  ? 167  GLN A N   1 
ATOM   1284  C  CA  . GLN A  1 186 ? -21.359  14.224  -67.690  1.00 40.11  ? 167  GLN A CA  1 
ATOM   1285  C  C   . GLN A  1 186 ? -22.637  14.326  -66.858  1.00 36.45  ? 167  GLN A C   1 
ATOM   1286  O  O   . GLN A  1 186 ? -22.590  14.350  -65.627  1.00 42.15  ? 167  GLN A O   1 
ATOM   1287  C  CB  . GLN A  1 186 ? -20.551  15.506  -67.564  1.00 46.25  ? 167  GLN A CB  1 
ATOM   1288  C  CG  . GLN A  1 186 ? -21.307  16.721  -68.045  1.00 55.61  ? 167  GLN A CG  1 
ATOM   1289  C  CD  . GLN A  1 186 ? -20.521  18.005  -67.861  1.00 63.93  ? 167  GLN A CD  1 
ATOM   1290  O  OE1 . GLN A  1 186 ? -20.380  18.797  -68.804  1.00 66.94  ? 167  GLN A OE1 1 
ATOM   1291  N  NE2 . GLN A  1 186 ? -20.011  18.226  -66.641  1.00 63.89  ? 167  GLN A NE2 1 
ATOM   1292  N  N   . TYR A  1 187 ? -23.782  14.365  -67.536  1.00 28.14  ? 168  TYR A N   1 
ATOM   1293  C  CA  . TYR A  1 187 ? -25.056  14.505  -66.853  1.00 24.38  ? 168  TYR A CA  1 
ATOM   1294  C  C   . TYR A  1 187 ? -25.781  13.192  -66.674  1.00 29.41  ? 168  TYR A C   1 
ATOM   1295  O  O   . TYR A  1 187 ? -26.909  13.160  -66.172  1.00 38.93  ? 168  TYR A O   1 
ATOM   1296  C  CB  . TYR A  1 187 ? -25.951  15.523  -67.568  1.00 24.22  ? 168  TYR A CB  1 
ATOM   1297  C  CG  . TYR A  1 187 ? -25.266  16.849  -67.742  1.00 25.50  ? 168  TYR A CG  1 
ATOM   1298  C  CD1 . TYR A  1 187 ? -24.857  17.590  -66.633  1.00 24.88  ? 168  TYR A CD1 1 
ATOM   1299  C  CD2 . TYR A  1 187 ? -25.007  17.357  -69.013  1.00 25.54  ? 168  TYR A CD2 1 
ATOM   1300  C  CE1 . TYR A  1 187 ? -24.221  18.812  -66.780  1.00 29.43  ? 168  TYR A CE1 1 
ATOM   1301  C  CE2 . TYR A  1 187 ? -24.373  18.573  -69.178  1.00 28.17  ? 168  TYR A CE2 1 
ATOM   1302  C  CZ  . TYR A  1 187 ? -23.976  19.297  -68.059  1.00 31.06  ? 168  TYR A CZ  1 
ATOM   1303  O  OH  . TYR A  1 187 ? -23.335  20.504  -68.218  1.00 27.72  ? 168  TYR A OH  1 
ATOM   1304  N  N   . SER A  1 188 ? -25.151  12.100  -67.085  1.00 29.12  ? 169  SER A N   1 
ATOM   1305  C  CA  . SER A  1 188 ? -25.677  10.786  -66.728  1.00 33.68  ? 169  SER A CA  1 
ATOM   1306  C  C   . SER A  1 188 ? -25.611  10.551  -65.197  1.00 33.10  ? 169  SER A C   1 
ATOM   1307  O  O   . SER A  1 188 ? -24.717  11.068  -64.518  1.00 32.61  ? 169  SER A O   1 
ATOM   1308  C  CB  . SER A  1 188 ? -24.911  9.695   -67.463  1.00 37.52  ? 169  SER A CB  1 
ATOM   1309  O  OG  . SER A  1 188 ? -25.453  8.410   -67.195  1.00 41.58  ? 169  SER A OG  1 
ATOM   1310  N  N   . ARG A  1 189 ? -26.566  9.787   -64.659  1.00 30.20  ? 170  ARG A N   1 
ATOM   1311  C  CA  . ARG A  1 189 ? -26.421  9.284   -63.297  1.00 30.25  ? 170  ARG A CA  1 
ATOM   1312  C  C   . ARG A  1 189 ? -25.361  8.192   -63.285  1.00 34.55  ? 170  ARG A C   1 
ATOM   1313  O  O   . ARG A  1 189 ? -24.986  7.715   -62.209  1.00 38.62  ? 170  ARG A O   1 
ATOM   1314  C  CB  . ARG A  1 189 ? -27.736  8.748   -62.719  1.00 23.46  ? 170  ARG A CB  1 
ATOM   1315  C  CG  . ARG A  1 189 ? -28.916  9.582   -63.079  1.00 35.48  ? 170  ARG A CG  1 
ATOM   1316  C  CD  . ARG A  1 189 ? -30.119  9.311   -62.229  1.00 34.06  ? 170  ARG A CD  1 
ATOM   1317  N  NE  . ARG A  1 189 ? -30.548  7.913   -62.205  1.00 43.15  ? 170  ARG A NE  1 
ATOM   1318  C  CZ  . ARG A  1 189 ? -31.033  7.305   -61.112  1.00 52.79  ? 170  ARG A CZ  1 
ATOM   1319  N  NH1 . ARG A  1 189 ? -31.140  7.970   -59.956  1.00 52.71  ? 170  ARG A NH1 1 
ATOM   1320  N  NH2 . ARG A  1 189 ? -31.404  6.027   -61.159  1.00 53.39  ? 170  ARG A NH2 1 
ATOM   1321  N  N   . PHE A  1 190 ? -24.866  7.801   -64.466  1.00 26.30  ? 171  PHE A N   1 
ATOM   1322  C  CA  . PHE A  1 190 ? -23.819  6.777   -64.537  1.00 20.47  ? 171  PHE A CA  1 
ATOM   1323  C  C   . PHE A  1 190 ? -22.498  7.280   -65.106  1.00 24.36  ? 171  PHE A C   1 
ATOM   1324  O  O   . PHE A  1 190 ? -22.455  8.265   -65.865  1.00 31.20  ? 171  PHE A O   1 
ATOM   1325  C  CB  . PHE A  1 190 ? -24.330  5.559   -65.298  1.00 27.49  ? 171  PHE A CB  1 
ATOM   1326  C  CG  . PHE A  1 190 ? -25.566  4.947   -64.684  1.00 32.26  ? 171  PHE A CG  1 
ATOM   1327  C  CD1 . PHE A  1 190 ? -26.832  5.430   -65.009  1.00 33.81  ? 171  PHE A CD1 1 
ATOM   1328  C  CD2 . PHE A  1 190 ? -25.465  3.912   -63.761  1.00 31.12  ? 171  PHE A CD2 1 
ATOM   1329  C  CE1 . PHE A  1 190 ? -27.984  4.883   -64.440  1.00 30.55  ? 171  PHE A CE1 1 
ATOM   1330  C  CE2 . PHE A  1 190 ? -26.612  3.356   -63.184  1.00 29.99  ? 171  PHE A CE2 1 
ATOM   1331  C  CZ  . PHE A  1 190 ? -27.872  3.844   -63.527  1.00 29.04  ? 171  PHE A CZ  1 
ATOM   1332  N  N   . GLU A  1 191 ? -21.415  6.623   -64.699  1.00 27.29  ? 172  GLU A N   1 
ATOM   1333  C  CA  . GLU A  1 191 ? -20.080  6.956   -65.184  1.00 32.94  ? 172  GLU A CA  1 
ATOM   1334  C  C   . GLU A  1 191 ? -19.375  5.676   -65.570  1.00 38.99  ? 172  GLU A C   1 
ATOM   1335  O  O   . GLU A  1 191 ? -19.638  4.624   -64.969  1.00 37.78  ? 172  GLU A O   1 
ATOM   1336  C  CB  . GLU A  1 191 ? -19.264  7.695   -64.128  1.00 39.69  ? 172  GLU A CB  1 
ATOM   1337  C  CG  . GLU A  1 191 ? -18.759  6.846   -62.978  1.00 49.42  ? 172  GLU A CG  1 
ATOM   1338  C  CD  . GLU A  1 191 ? -18.208  7.706   -61.856  1.00 63.13  ? 172  GLU A CD  1 
ATOM   1339  O  OE1 . GLU A  1 191 ? -18.095  8.938   -62.059  1.00 67.64  ? 172  GLU A OE1 1 
ATOM   1340  O  OE2 . GLU A  1 191 ? -17.899  7.161   -60.770  1.00 69.14  ? 172  GLU A OE2 1 
ATOM   1341  N  N   . ILE A  1 192 ? -18.484  5.776   -66.565  1.00 41.93  ? 173  ILE A N   1 
ATOM   1342  C  CA  . ILE A  1 192 ? -17.847  4.615   -67.175  1.00 35.85  ? 173  ILE A CA  1 
ATOM   1343  C  C   . ILE A  1 192 ? -16.469  4.388   -66.607  1.00 29.23  ? 173  ILE A C   1 
ATOM   1344  O  O   . ILE A  1 192 ? -15.647  5.285   -66.638  1.00 28.15  ? 173  ILE A O   1 
ATOM   1345  C  CB  . ILE A  1 192 ? -17.728  4.786   -68.694  1.00 34.98  ? 173  ILE A CB  1 
ATOM   1346  C  CG1 . ILE A  1 192 ? -19.124  4.906   -69.297  1.00 38.91  ? 173  ILE A CG1 1 
ATOM   1347  C  CG2 . ILE A  1 192 ? -16.974  3.613   -69.321  1.00 33.18  ? 173  ILE A CG2 1 
ATOM   1348  C  CD1 . ILE A  1 192 ? -19.148  4.803   -70.806  1.00 38.52  ? 173  ILE A CD1 1 
ATOM   1349  N  N   . LEU A  1 193 ? -16.220  3.177   -66.113  1.00 31.18  ? 174  LEU A N   1 
ATOM   1350  C  CA  . LEU A  1 193 ? -14.925  2.825   -65.543  1.00 36.43  ? 174  LEU A CA  1 
ATOM   1351  C  C   . LEU A  1 193 ? -13.979  2.305   -66.609  1.00 42.56  ? 174  LEU A C   1 
ATOM   1352  O  O   . LEU A  1 193 ? -12.821  2.724   -66.697  1.00 44.89  ? 174  LEU A O   1 
ATOM   1353  C  CB  . LEU A  1 193 ? -15.103  1.787   -64.438  1.00 37.24  ? 174  LEU A CB  1 
ATOM   1354  C  CG  . LEU A  1 193 ? -16.152  2.179   -63.388  1.00 35.50  ? 174  LEU A CG  1 
ATOM   1355  C  CD1 . LEU A  1 193 ? -16.332  1.104   -62.321  1.00 28.78  ? 174  LEU A CD1 1 
ATOM   1356  C  CD2 . LEU A  1 193 ? -15.791  3.528   -62.757  1.00 37.12  ? 174  LEU A CD2 1 
ATOM   1357  N  N   . ASP A  1 194 ? -14.483  1.392   -67.429  1.00 44.26  ? 175  ASP A N   1 
ATOM   1358  C  CA  . ASP A  1 194 ? -13.675  0.801   -68.489  1.00 40.92  ? 175  ASP A CA  1 
ATOM   1359  C  C   . ASP A  1 194 ? -14.528  0.256   -69.645  1.00 35.31  ? 175  ASP A C   1 
ATOM   1360  O  O   . ASP A  1 194 ? -15.664  -0.183  -69.456  1.00 39.56  ? 175  ASP A O   1 
ATOM   1361  C  CB  . ASP A  1 194 ? -12.776  -0.301  -67.910  1.00 40.83  ? 175  ASP A CB  1 
ATOM   1362  C  CG  . ASP A  1 194 ? -11.603  -0.653  -68.824  1.00 50.22  ? 175  ASP A CG  1 
ATOM   1363  O  OD1 . ASP A  1 194 ? -11.174  0.198   -69.635  1.00 55.07  ? 175  ASP A OD1 1 
ATOM   1364  O  OD2 . ASP A  1 194 ? -11.097  -1.787  -68.727  1.00 54.34  ? 175  ASP A OD2 1 
ATOM   1365  N  N   . VAL A  1 195 ? -13.973  0.300   -70.849  1.00 22.53  ? 176  VAL A N   1 
ATOM   1366  C  CA  . VAL A  1 195 ? -14.587  -0.387  -71.981  1.00 27.01  ? 176  VAL A CA  1 
ATOM   1367  C  C   . VAL A  1 195 ? -13.587  -1.325  -72.660  1.00 31.32  ? 176  VAL A C   1 
ATOM   1368  O  O   . VAL A  1 195 ? -12.553  -0.879  -73.151  1.00 35.74  ? 176  VAL A O   1 
ATOM   1369  C  CB  . VAL A  1 195 ? -15.087  0.599   -73.023  1.00 21.25  ? 176  VAL A CB  1 
ATOM   1370  C  CG1 . VAL A  1 195 ? -15.706  -0.155  -74.185  1.00 42.31  ? 176  VAL A CG1 1 
ATOM   1371  C  CG2 . VAL A  1 195 ? -16.090  1.553   -72.395  1.00 25.67  ? 176  VAL A CG2 1 
ATOM   1372  N  N   . THR A  1 196 ? -13.892  -2.620  -72.679  1.00 28.07  ? 177  THR A N   1 
ATOM   1373  C  CA  . THR A  1 196 ? -13.023  -3.574  -73.347  1.00 36.22  ? 177  THR A CA  1 
ATOM   1374  C  C   . THR A  1 196 ? -13.784  -4.260  -74.485  1.00 43.48  ? 177  THR A C   1 
ATOM   1375  O  O   . THR A  1 196 ? -15.006  -4.450  -74.410  1.00 39.29  ? 177  THR A O   1 
ATOM   1376  C  CB  . THR A  1 196 ? -12.420  -4.629  -72.371  1.00 43.47  ? 177  THR A CB  1 
ATOM   1377  O  OG1 . THR A  1 196 ? -13.460  -5.482  -71.869  1.00 43.92  ? 177  THR A OG1 1 
ATOM   1378  C  CG2 . THR A  1 196 ? -11.690  -3.952  -71.212  1.00 40.19  ? 177  THR A CG2 1 
ATOM   1379  N  N   . GLN A  1 197 ? -13.055  -4.616  -75.542  1.00 46.33  ? 178  GLN A N   1 
ATOM   1380  C  CA  . GLN A  1 197 ? -13.654  -5.255  -76.702  1.00 44.00  ? 178  GLN A CA  1 
ATOM   1381  C  C   . GLN A  1 197 ? -12.991  -6.609  -76.963  1.00 47.76  ? 178  GLN A C   1 
ATOM   1382  O  O   . GLN A  1 197 ? -11.810  -6.800  -76.700  1.00 51.54  ? 178  GLN A O   1 
ATOM   1383  C  CB  . GLN A  1 197 ? -13.563  -4.335  -77.925  1.00 43.26  ? 178  GLN A CB  1 
ATOM   1384  C  CG  . GLN A  1 197 ? -14.145  -2.929  -77.690  1.00 51.60  ? 178  GLN A CG  1 
ATOM   1385  C  CD  . GLN A  1 197 ? -14.716  -2.255  -78.956  1.00 54.02  ? 178  GLN A CD  1 
ATOM   1386  O  OE1 . GLN A  1 197 ? -14.419  -2.666  -80.091  1.00 56.16  ? 178  GLN A OE1 1 
ATOM   1387  N  NE2 . GLN A  1 197 ? -15.544  -1.204  -78.754  1.00 46.63  ? 178  GLN A NE2 1 
ATOM   1388  N  N   . LYS A  1 198 ? -13.755  -7.553  -77.489  1.00 48.15  ? 179  LYS A N   1 
ATOM   1389  C  CA  . LYS A  1 198 ? -13.253  -8.897  -77.703  1.00 45.78  ? 179  LYS A CA  1 
ATOM   1390  C  C   . LYS A  1 198 ? -13.979  -9.552  -78.875  1.00 46.28  ? 179  LYS A C   1 
ATOM   1391  O  O   . LYS A  1 198 ? -15.205  -9.519  -78.982  1.00 50.50  ? 179  LYS A O   1 
ATOM   1392  C  CB  . LYS A  1 198 ? -13.429  -9.727  -76.438  1.00 49.42  ? 179  LYS A CB  1 
ATOM   1393  C  CG  . LYS A  1 198 ? -13.113  -11.199 -76.597  1.00 56.29  ? 179  LYS A CG  1 
ATOM   1394  C  CD  . LYS A  1 198 ? -13.448  -11.982 -75.331  1.00 63.57  ? 179  LYS A CD  1 
ATOM   1395  C  CE  . LYS A  1 198 ? -13.021  -13.450 -75.473  1.00 67.38  ? 179  LYS A CE  1 
ATOM   1396  N  NZ  . LYS A  1 198 ? -13.190  -14.236 -74.209  1.00 68.86  ? 179  LYS A NZ  1 
ATOM   1397  N  N   . LYS A  1 199 ? -13.209  -10.152 -79.763  1.00 43.36  ? 180  LYS A N   1 
ATOM   1398  C  CA  . LYS A  1 199 ? -13.774  -10.725 -80.958  1.00 45.33  ? 180  LYS A CA  1 
ATOM   1399  C  C   . LYS A  1 199 ? -14.014  -12.203 -80.745  1.00 51.12  ? 180  LYS A C   1 
ATOM   1400  O  O   . LYS A  1 199 ? -13.182  -12.884 -80.135  1.00 58.21  ? 180  LYS A O   1 
ATOM   1401  C  CB  . LYS A  1 199 ? -12.830  -10.500 -82.139  1.00 48.11  ? 180  LYS A CB  1 
ATOM   1402  C  CG  . LYS A  1 199 ? -13.178  -11.316 -83.363  1.00 57.45  ? 180  LYS A CG  1 
ATOM   1403  C  CD  . LYS A  1 199 ? -12.229  -11.015 -84.494  1.00 65.44  ? 180  LYS A CD  1 
ATOM   1404  C  CE  . LYS A  1 199 ? -12.463  -11.962 -85.647  1.00 70.79  ? 180  LYS A CE  1 
ATOM   1405  N  NZ  . LYS A  1 199 ? -11.785  -11.514 -86.912  1.00 75.21  ? 180  LYS A NZ  1 
ATOM   1406  N  N   . ASN A  1 200 ? -15.151  -12.695 -81.237  1.00 49.05  ? 181  ASN A N   1 
ATOM   1407  C  CA  . ASN A  1 200 ? -15.480  -14.118 -81.149  1.00 45.06  ? 181  ASN A CA  1 
ATOM   1408  C  C   . ASN A  1 200 ? -15.902  -14.679 -82.484  1.00 38.19  ? 181  ASN A C   1 
ATOM   1409  O  O   . ASN A  1 200 ? -16.207  -13.938 -83.415  1.00 42.20  ? 181  ASN A O   1 
ATOM   1410  C  CB  . ASN A  1 200 ? -16.592  -14.382 -80.125  1.00 46.37  ? 181  ASN A CB  1 
ATOM   1411  C  CG  . ASN A  1 200 ? -16.231  -13.912 -78.756  1.00 52.37  ? 181  ASN A CG  1 
ATOM   1412  O  OD1 . ASN A  1 200 ? -15.448  -14.559 -78.058  1.00 61.87  ? 181  ASN A OD1 1 
ATOM   1413  N  ND2 . ASN A  1 200 ? -16.787  -12.772 -78.352  1.00 50.28  ? 181  ASN A ND2 1 
ATOM   1414  N  N   . SER A  1 201 ? -15.934  -16.004 -82.560  1.00 31.81  ? 182  SER A N   1 
ATOM   1415  C  CA  . SER A  1 201 ? -16.364  -16.702 -83.768  1.00 31.48  ? 182  SER A CA  1 
ATOM   1416  C  C   . SER A  1 201 ? -17.178  -17.911 -83.340  1.00 34.45  ? 182  SER A C   1 
ATOM   1417  O  O   . SER A  1 201 ? -16.646  -18.844 -82.739  1.00 41.69  ? 182  SER A O   1 
ATOM   1418  C  CB  . SER A  1 201 ? -15.159  -17.133 -84.591  1.00 32.77  ? 182  SER A CB  1 
ATOM   1419  O  OG  . SER A  1 201 ? -15.563  -17.703 -85.820  1.00 40.78  ? 182  SER A OG  1 
ATOM   1420  N  N   . VAL A  1 202 ? -18.473  -17.886 -83.637  1.00 31.50  ? 183  VAL A N   1 
ATOM   1421  C  CA  . VAL A  1 202 ? -19.409  -18.823 -83.023  1.00 33.95  ? 183  VAL A CA  1 
ATOM   1422  C  C   . VAL A  1 202 ? -20.133  -19.623 -84.082  1.00 39.64  ? 183  VAL A C   1 
ATOM   1423  O  O   . VAL A  1 202 ? -20.538  -19.080 -85.105  1.00 45.40  ? 183  VAL A O   1 
ATOM   1424  C  CB  . VAL A  1 202 ? -20.476  -18.076 -82.140  1.00 44.27  ? 183  VAL A CB  1 
ATOM   1425  C  CG1 . VAL A  1 202 ? -21.476  -19.048 -81.537  1.00 48.41  ? 183  VAL A CG1 1 
ATOM   1426  C  CG2 . VAL A  1 202 ? -19.817  -17.254 -81.042  1.00 30.28  ? 183  VAL A CG2 1 
ATOM   1427  N  N   . THR A  1 203 ? -20.303  -20.917 -83.835  1.00 37.92  ? 184  THR A N   1 
ATOM   1428  C  CA  . THR A  1 203 ? -21.133  -21.754 -84.703  1.00 34.45  ? 184  THR A CA  1 
ATOM   1429  C  C   . THR A  1 203 ? -22.521  -21.951 -84.090  1.00 36.84  ? 184  THR A C   1 
ATOM   1430  O  O   . THR A  1 203 ? -22.667  -22.175 -82.886  1.00 43.31  ? 184  THR A O   1 
ATOM   1431  C  CB  . THR A  1 203 ? -20.494  -23.114 -84.946  1.00 32.99  ? 184  THR A CB  1 
ATOM   1432  O  OG1 . THR A  1 203 ? -19.155  -22.928 -85.431  1.00 40.31  ? 184  THR A OG1 1 
ATOM   1433  C  CG2 . THR A  1 203 ? -21.309  -23.908 -85.955  1.00 28.01  ? 184  THR A CG2 1 
ATOM   1434  N  N   . TYR A  1 204 ? -23.543  -21.838 -84.924  1.00 34.39  ? 185  TYR A N   1 
ATOM   1435  C  CA  . TYR A  1 204 ? -24.927  -21.899 -84.464  1.00 32.09  ? 185  TYR A CA  1 
ATOM   1436  C  C   . TYR A  1 204 ? -25.550  -23.175 -84.991  1.00 37.56  ? 185  TYR A C   1 
ATOM   1437  O  O   . TYR A  1 204 ? -25.069  -23.743 -85.975  1.00 49.06  ? 185  TYR A O   1 
ATOM   1438  C  CB  . TYR A  1 204 ? -25.711  -20.638 -84.926  1.00 30.70  ? 185  TYR A CB  1 
ATOM   1439  C  CG  . TYR A  1 204 ? -25.173  -19.352 -84.307  1.00 35.85  ? 185  TYR A CG  1 
ATOM   1440  C  CD1 . TYR A  1 204 ? -24.081  -18.701 -84.857  1.00 35.77  ? 185  TYR A CD1 1 
ATOM   1441  C  CD2 . TYR A  1 204 ? -25.718  -18.833 -83.134  1.00 33.53  ? 185  TYR A CD2 1 
ATOM   1442  C  CE1 . TYR A  1 204 ? -23.555  -17.577 -84.270  1.00 32.65  ? 185  TYR A CE1 1 
ATOM   1443  C  CE2 . TYR A  1 204 ? -25.204  -17.702 -82.553  1.00 29.54  ? 185  TYR A CE2 1 
ATOM   1444  C  CZ  . TYR A  1 204 ? -24.127  -17.076 -83.127  1.00 34.44  ? 185  TYR A CZ  1 
ATOM   1445  O  OH  . TYR A  1 204 ? -23.619  -15.927 -82.549  1.00 45.64  ? 185  TYR A OH  1 
ATOM   1446  N  N   . SER A  1 205 ? -26.624  -23.623 -84.348  1.00 33.47  ? 186  SER A N   1 
ATOM   1447  C  CA  . SER A  1 205 ? -27.262  -24.888 -84.705  1.00 40.34  ? 186  SER A CA  1 
ATOM   1448  C  C   . SER A  1 205 ? -27.772  -24.946 -86.129  1.00 53.41  ? 186  SER A C   1 
ATOM   1449  O  O   . SER A  1 205 ? -27.693  -25.978 -86.802  1.00 64.44  ? 186  SER A O   1 
ATOM   1450  C  CB  . SER A  1 205 ? -28.411  -25.154 -83.755  1.00 44.47  ? 186  SER A CB  1 
ATOM   1451  O  OG  . SER A  1 205 ? -27.906  -25.277 -82.435  1.00 50.22  ? 186  SER A OG  1 
ATOM   1452  N  N   . CYS A  1 206 ? -28.300  -23.820 -86.581  1.00 54.46  ? 187  CYS A N   1 
ATOM   1453  C  CA  . CYS A  1 206 ? -28.933  -23.723 -87.879  1.00 46.10  ? 187  CYS A CA  1 
ATOM   1454  C  C   . CYS A  1 206 ? -27.949  -23.980 -89.032  1.00 47.64  ? 187  CYS A C   1 
ATOM   1455  O  O   . CYS A  1 206 ? -28.317  -24.580 -90.034  1.00 51.81  ? 187  CYS A O   1 
ATOM   1456  C  CB  . CYS A  1 206 ? -29.511  -22.320 -88.031  1.00 40.40  ? 187  CYS A CB  1 
ATOM   1457  S  SG  . CYS A  1 206 ? -28.225  -21.072 -88.415  1.00 78.54  ? 187  CYS A SG  1 
ATOM   1458  N  N   . CYS A  1 207 ? -26.707  -23.512 -88.894  1.00 43.36  ? 188  CYS A N   1 
ATOM   1459  C  CA  . CYS A  1 207 ? -25.804  -23.385 -90.040  1.00 38.96  ? 188  CYS A CA  1 
ATOM   1460  C  C   . CYS A  1 207 ? -24.448  -23.967 -89.728  1.00 40.12  ? 188  CYS A C   1 
ATOM   1461  O  O   . CYS A  1 207 ? -24.010  -23.937 -88.592  1.00 28.11  ? 188  CYS A O   1 
ATOM   1462  C  CB  . CYS A  1 207 ? -25.659  -21.906 -90.426  1.00 38.88  ? 188  CYS A CB  1 
ATOM   1463  S  SG  . CYS A  1 207 ? -27.200  -20.999 -90.196  1.00 50.09  ? 188  CYS A SG  1 
ATOM   1464  N  N   . PRO A  1 208 ? -23.776  -24.504 -90.749  1.00 41.81  ? 189  PRO A N   1 
ATOM   1465  C  CA  . PRO A  1 208 ? -22.478  -25.166 -90.574  1.00 37.31  ? 189  PRO A CA  1 
ATOM   1466  C  C   . PRO A  1 208 ? -21.335  -24.183 -90.429  1.00 38.60  ? 189  PRO A C   1 
ATOM   1467  O  O   . PRO A  1 208 ? -20.311  -24.575 -89.890  1.00 43.52  ? 189  PRO A O   1 
ATOM   1468  C  CB  . PRO A  1 208 ? -22.314  -25.948 -91.875  1.00 29.49  ? 189  PRO A CB  1 
ATOM   1469  C  CG  . PRO A  1 208 ? -23.099  -25.164 -92.878  1.00 33.07  ? 189  PRO A CG  1 
ATOM   1470  C  CD  . PRO A  1 208 ? -24.260  -24.579 -92.140  1.00 39.75  ? 189  PRO A CD  1 
ATOM   1471  N  N   . GLU A  1 209 ? -21.494  -22.947 -90.904  1.00 41.43  ? 190  GLU A N   1 
ATOM   1472  C  CA  . GLU A  1 209 ? -20.390  -21.983 -90.894  1.00 44.52  ? 190  GLU A CA  1 
ATOM   1473  C  C   . GLU A  1 209 ? -20.325  -21.219 -89.595  1.00 39.94  ? 190  GLU A C   1 
ATOM   1474  O  O   . GLU A  1 209 ? -21.258  -21.273 -88.796  1.00 38.53  ? 190  GLU A O   1 
ATOM   1475  C  CB  . GLU A  1 209 ? -20.497  -20.993 -92.052  1.00 55.75  ? 190  GLU A CB  1 
ATOM   1476  C  CG  . GLU A  1 209 ? -20.717  -21.643 -93.414  1.00 63.75  ? 190  GLU A CG  1 
ATOM   1477  C  CD  . GLU A  1 209 ? -22.181  -21.861 -93.711  1.00 73.52  ? 190  GLU A CD  1 
ATOM   1478  O  OE1 . GLU A  1 209 ? -23.025  -21.542 -92.839  1.00 77.00  ? 190  GLU A OE1 1 
ATOM   1479  O  OE2 . GLU A  1 209 ? -22.485  -22.343 -94.822  1.00 80.43  ? 190  GLU A OE2 1 
ATOM   1480  N  N   . ALA A  1 210 ? -19.211  -20.517 -89.388  1.00 28.68  ? 191  ALA A N   1 
ATOM   1481  C  CA  . ALA A  1 210 ? -19.013  -19.716 -88.179  1.00 31.91  ? 191  ALA A CA  1 
ATOM   1482  C  C   . ALA A  1 210 ? -19.310  -18.236 -88.439  1.00 29.45  ? 191  ALA A C   1 
ATOM   1483  O  O   . ALA A  1 210 ? -18.924  -17.680 -89.463  1.00 35.52  ? 191  ALA A O   1 
ATOM   1484  C  CB  . ALA A  1 210 ? -17.589  -19.900 -87.604  1.00 26.86  ? 191  ALA A CB  1 
ATOM   1485  N  N   . TYR A  1 211 ? -19.998  -17.611 -87.496  1.00 25.73  ? 192  TYR A N   1 
ATOM   1486  C  CA  . TYR A  1 211 ? -20.329  -16.197 -87.556  1.00 26.22  ? 192  TYR A CA  1 
ATOM   1487  C  C   . TYR A  1 211 ? -19.523  -15.436 -86.508  1.00 30.15  ? 192  TYR A C   1 
ATOM   1488  O  O   . TYR A  1 211 ? -19.456  -15.825 -85.327  1.00 31.37  ? 192  TYR A O   1 
ATOM   1489  C  CB  . TYR A  1 211 ? -21.830  -16.007 -87.311  1.00 29.81  ? 192  TYR A CB  1 
ATOM   1490  C  CG  . TYR A  1 211 ? -22.688  -16.543 -88.429  1.00 32.79  ? 192  TYR A CG  1 
ATOM   1491  C  CD1 . TYR A  1 211 ? -22.879  -17.911 -88.590  1.00 29.11  ? 192  TYR A CD1 1 
ATOM   1492  C  CD2 . TYR A  1 211 ? -23.291  -15.685 -89.333  1.00 32.27  ? 192  TYR A CD2 1 
ATOM   1493  C  CE1 . TYR A  1 211 ? -23.648  -18.410 -89.617  1.00 31.38  ? 192  TYR A CE1 1 
ATOM   1494  C  CE2 . TYR A  1 211 ? -24.076  -16.177 -90.366  1.00 31.94  ? 192  TYR A CE2 1 
ATOM   1495  C  CZ  . TYR A  1 211 ? -24.245  -17.543 -90.507  1.00 32.39  ? 192  TYR A CZ  1 
ATOM   1496  O  OH  . TYR A  1 211 ? -25.014  -18.063 -91.530  1.00 33.27  ? 192  TYR A OH  1 
ATOM   1497  N  N   . GLU A  1 212 ? -18.902  -14.349 -86.945  1.00 28.05  ? 193  GLU A N   1 
ATOM   1498  C  CA  . GLU A  1 212 ? -18.095  -13.543 -86.052  1.00 22.73  ? 193  GLU A CA  1 
ATOM   1499  C  C   . GLU A  1 212 ? -18.947  -12.505 -85.336  1.00 26.06  ? 193  GLU A C   1 
ATOM   1500  O  O   . GLU A  1 212 ? -19.993  -12.076 -85.824  1.00 37.66  ? 193  GLU A O   1 
ATOM   1501  C  CB  . GLU A  1 212 ? -16.971  -12.866 -86.834  1.00 27.02  ? 193  GLU A CB  1 
ATOM   1502  C  CG  . GLU A  1 212 ? -16.077  -13.839 -87.574  1.00 38.27  ? 193  GLU A CG  1 
ATOM   1503  C  CD  . GLU A  1 212 ? -14.759  -13.206 -88.020  1.00 50.41  ? 193  GLU A CD  1 
ATOM   1504  O  OE1 . GLU A  1 212 ? -14.618  -11.971 -87.876  1.00 53.85  ? 193  GLU A OE1 1 
ATOM   1505  O  OE2 . GLU A  1 212 ? -13.863  -13.943 -88.505  1.00 53.49  ? 193  GLU A OE2 1 
ATOM   1506  N  N   . ASP A  1 213 ? -18.503  -12.125 -84.154  1.00 26.07  ? 194  ASP A N   1 
ATOM   1507  C  CA  . ASP A  1 213 ? -19.145  -11.067 -83.397  1.00 30.72  ? 194  ASP A CA  1 
ATOM   1508  C  C   . ASP A  1 213 ? -18.084  -10.296 -82.606  1.00 24.61  ? 194  ASP A C   1 
ATOM   1509  O  O   . ASP A  1 213 ? -16.938  -10.744 -82.451  1.00 19.65  ? 194  ASP A O   1 
ATOM   1510  C  CB  . ASP A  1 213 ? -20.238  -11.607 -82.458  1.00 38.66  ? 194  ASP A CB  1 
ATOM   1511  C  CG  . ASP A  1 213 ? -19.674  -12.424 -81.297  1.00 50.94  ? 194  ASP A CG  1 
ATOM   1512  O  OD1 . ASP A  1 213 ? -19.162  -11.821 -80.321  1.00 51.42  ? 194  ASP A OD1 1 
ATOM   1513  O  OD2 . ASP A  1 213 ? -19.753  -13.676 -81.352  1.00 59.79  ? 194  ASP A OD2 1 
ATOM   1514  N  N   . VAL A  1 214 ? -18.466  -9.118  -82.138  1.00 18.18  ? 195  VAL A N   1 
ATOM   1515  C  CA  . VAL A  1 214 ? -17.631  -8.386  -81.207  1.00 30.15  ? 195  VAL A CA  1 
ATOM   1516  C  C   . VAL A  1 214 ? -18.393  -8.280  -79.884  1.00 31.89  ? 195  VAL A C   1 
ATOM   1517  O  O   . VAL A  1 214 ? -19.579  -7.928  -79.851  1.00 29.79  ? 195  VAL A O   1 
ATOM   1518  C  CB  . VAL A  1 214 ? -17.247  -6.990  -81.757  1.00 33.27  ? 195  VAL A CB  1 
ATOM   1519  C  CG1 . VAL A  1 214 ? -16.598  -6.149  -80.675  1.00 30.51  ? 195  VAL A CG1 1 
ATOM   1520  C  CG2 . VAL A  1 214 ? -16.311  -7.137  -82.940  1.00 39.96  ? 195  VAL A CG2 1 
ATOM   1521  N  N   . GLU A  1 215 ? -17.729  -8.620  -78.791  1.00 34.75  ? 196  GLU A N   1 
ATOM   1522  C  CA  . GLU A  1 215 ? -18.334  -8.400  -77.474  1.00 38.52  ? 196  GLU A CA  1 
ATOM   1523  C  C   . GLU A  1 215 ? -17.708  -7.191  -76.827  1.00 35.88  ? 196  GLU A C   1 
ATOM   1524  O  O   . GLU A  1 215 ? -16.534  -7.216  -76.457  1.00 36.71  ? 196  GLU A O   1 
ATOM   1525  C  CB  . GLU A  1 215 ? -18.203  -9.615  -76.558  1.00 40.34  ? 196  GLU A CB  1 
ATOM   1526  C  CG  . GLU A  1 215 ? -19.299  -10.654 -76.783  1.00 51.60  ? 196  GLU A CG  1 
ATOM   1527  C  CD  . GLU A  1 215 ? -19.027  -11.982 -76.079  1.00 62.59  ? 196  GLU A CD  1 
ATOM   1528  O  OE1 . GLU A  1 215 ? -18.050  -12.066 -75.297  1.00 71.28  ? 196  GLU A OE1 1 
ATOM   1529  O  OE2 . GLU A  1 215 ? -19.798  -12.940 -76.316  1.00 59.72  ? 196  GLU A OE2 1 
ATOM   1530  N  N   . VAL A  1 216 ? -18.502  -6.130  -76.712  1.00 31.43  ? 197  VAL A N   1 
ATOM   1531  C  CA  . VAL A  1 216 ? -18.082  -4.924  -76.020  1.00 29.22  ? 197  VAL A CA  1 
ATOM   1532  C  C   . VAL A  1 216 ? -18.499  -5.028  -74.551  1.00 25.84  ? 197  VAL A C   1 
ATOM   1533  O  O   . VAL A  1 216 ? -19.685  -5.145  -74.243  1.00 18.69  ? 197  VAL A O   1 
ATOM   1534  C  CB  . VAL A  1 216 ? -18.709  -3.694  -76.662  1.00 20.65  ? 197  VAL A CB  1 
ATOM   1535  C  CG1 . VAL A  1 216 ? -18.285  -2.473  -75.915  1.00 13.09  ? 197  VAL A CG1 1 
ATOM   1536  C  CG2 . VAL A  1 216 ? -18.281  -3.615  -78.105  1.00 20.36  ? 197  VAL A CG2 1 
ATOM   1537  N  N   . SER A  1 217 ? -17.514  -5.023  -73.657  1.00 26.97  ? 198  SER A N   1 
ATOM   1538  C  CA  . SER A  1 217 ? -17.764  -5.054  -72.215  1.00 28.35  ? 198  SER A CA  1 
ATOM   1539  C  C   . SER A  1 217 ? -17.732  -3.653  -71.601  1.00 28.60  ? 198  SER A C   1 
ATOM   1540  O  O   . SER A  1 217 ? -16.676  -2.989  -71.538  1.00 19.82  ? 198  SER A O   1 
ATOM   1541  C  CB  . SER A  1 217 ? -16.757  -5.954  -71.507  1.00 28.17  ? 198  SER A CB  1 
ATOM   1542  O  OG  . SER A  1 217 ? -16.994  -7.308  -71.851  1.00 28.19  ? 198  SER A OG  1 
ATOM   1543  N  N   . LEU A  1 218 ? -18.907  -3.204  -71.172  1.00 32.35  ? 199  LEU A N   1 
ATOM   1544  C  CA  . LEU A  1 218 ? -19.073  -1.877  -70.615  1.00 34.63  ? 199  LEU A CA  1 
ATOM   1545  C  C   . LEU A  1 218 ? -19.057  -2.017  -69.110  1.00 43.24  ? 199  LEU A C   1 
ATOM   1546  O  O   . LEU A  1 218 ? -19.978  -2.588  -68.515  1.00 50.84  ? 199  LEU A O   1 
ATOM   1547  C  CB  . LEU A  1 218 ? -20.396  -1.253  -71.094  1.00 30.92  ? 199  LEU A CB  1 
ATOM   1548  C  CG  . LEU A  1 218 ? -20.755  0.142   -70.564  1.00 27.52  ? 199  LEU A CG  1 
ATOM   1549  C  CD1 . LEU A  1 218 ? -19.717  1.168   -71.020  1.00 25.37  ? 199  LEU A CD1 1 
ATOM   1550  C  CD2 . LEU A  1 218 ? -22.159  0.562   -71.016  1.00 23.10  ? 199  LEU A CD2 1 
ATOM   1551  N  N   . ASN A  1 219 ? -17.993  -1.525  -68.491  1.00 41.86  ? 200  ASN A N   1 
ATOM   1552  C  CA  . ASN A  1 219 ? -17.900  -1.532  -67.038  1.00 32.55  ? 200  ASN A CA  1 
ATOM   1553  C  C   . ASN A  1 219 ? -18.286  -0.156  -66.548  1.00 29.46  ? 200  ASN A C   1 
ATOM   1554  O  O   . ASN A  1 219 ? -17.586  0.836   -66.805  1.00 31.88  ? 200  ASN A O   1 
ATOM   1555  C  CB  . ASN A  1 219 ? -16.488  -1.942  -66.584  1.00 37.75  ? 200  ASN A CB  1 
ATOM   1556  C  CG  . ASN A  1 219 ? -16.310  -1.929  -65.053  1.00 38.20  ? 200  ASN A CG  1 
ATOM   1557  O  OD1 . ASN A  1 219 ? -15.272  -1.489  -64.556  1.00 42.54  ? 200  ASN A OD1 1 
ATOM   1558  N  ND2 . ASN A  1 219 ? -17.323  -2.391  -64.312  1.00 31.85  ? 200  ASN A ND2 1 
ATOM   1559  N  N   . PHE A  1 220 ? -19.420  -0.090  -65.856  1.00 28.28  ? 201  PHE A N   1 
ATOM   1560  C  CA  . PHE A  1 220 ? -19.929  1.196   -65.370  1.00 32.21  ? 201  PHE A CA  1 
ATOM   1561  C  C   . PHE A  1 220 ? -20.513  1.090   -63.960  1.00 29.64  ? 201  PHE A C   1 
ATOM   1562  O  O   . PHE A  1 220 ? -20.768  0.000   -63.468  1.00 31.92  ? 201  PHE A O   1 
ATOM   1563  C  CB  . PHE A  1 220 ? -21.002  1.717   -66.323  1.00 26.18  ? 201  PHE A CB  1 
ATOM   1564  C  CG  . PHE A  1 220 ? -22.276  0.910   -66.294  1.00 19.04  ? 201  PHE A CG  1 
ATOM   1565  C  CD1 . PHE A  1 220 ? -22.309  -0.382  -66.791  1.00 18.85  ? 201  PHE A CD1 1 
ATOM   1566  C  CD2 . PHE A  1 220 ? -23.445  1.453   -65.772  1.00 17.83  ? 201  PHE A CD2 1 
ATOM   1567  C  CE1 . PHE A  1 220 ? -23.493  -1.129  -66.779  1.00 20.54  ? 201  PHE A CE1 1 
ATOM   1568  C  CE2 . PHE A  1 220 ? -24.629  0.718   -65.742  1.00 13.88  ? 201  PHE A CE2 1 
ATOM   1569  C  CZ  . PHE A  1 220 ? -24.658  -0.576  -66.243  1.00 13.84  ? 201  PHE A CZ  1 
ATOM   1570  N  N   . ARG A  1 221 ? -20.746  2.233   -63.333  1.00 25.11  ? 202  ARG A N   1 
ATOM   1571  C  CA  . ARG A  1 221 ? -21.346  2.284   -62.009  1.00 29.58  ? 202  ARG A CA  1 
ATOM   1572  C  C   . ARG A  1 221 ? -22.148  3.562   -61.813  1.00 31.56  ? 202  ARG A C   1 
ATOM   1573  O  O   . ARG A  1 221 ? -21.911  4.577   -62.486  1.00 27.06  ? 202  ARG A O   1 
ATOM   1574  C  CB  . ARG A  1 221 ? -20.275  2.170   -60.906  1.00 31.67  ? 202  ARG A CB  1 
ATOM   1575  C  CG  . ARG A  1 221 ? -19.481  3.423   -60.697  1.00 29.65  ? 202  ARG A CG  1 
ATOM   1576  C  CD  . ARG A  1 221 ? -18.457  3.269   -59.592  1.00 37.78  ? 202  ARG A CD  1 
ATOM   1577  N  NE  . ARG A  1 221 ? -17.573  4.434   -59.555  1.00 44.74  ? 202  ARG A NE  1 
ATOM   1578  C  CZ  . ARG A  1 221 ? -16.302  4.398   -59.172  1.00 44.00  ? 202  ARG A CZ  1 
ATOM   1579  N  NH1 . ARG A  1 221 ? -15.765  3.251   -58.780  1.00 37.08  ? 202  ARG A NH1 1 
ATOM   1580  N  NH2 . ARG A  1 221 ? -15.573  5.508   -59.185  1.00 47.89  ? 202  ARG A NH2 1 
ATOM   1581  N  N   . LYS A  1 222 ? -23.109  3.512   -60.897  1.00 32.42  ? 203  LYS A N   1 
ATOM   1582  C  CA  . LYS A  1 222 ? -23.907  4.693   -60.599  1.00 30.61  ? 203  LYS A CA  1 
ATOM   1583  C  C   . LYS A  1 222 ? -23.005  5.703   -59.895  1.00 27.58  ? 203  LYS A C   1 
ATOM   1584  O  O   . LYS A  1 222 ? -22.292  5.342   -58.965  1.00 24.50  ? 203  LYS A O   1 
ATOM   1585  C  CB  . LYS A  1 222 ? -25.090  4.301   -59.709  1.00 33.26  ? 203  LYS A CB  1 
ATOM   1586  C  CG  . LYS A  1 222 ? -26.208  5.335   -59.552  1.00 31.83  ? 203  LYS A CG  1 
ATOM   1587  C  CD  . LYS A  1 222 ? -27.439  4.631   -58.969  1.00 30.56  ? 203  LYS A CD  1 
ATOM   1588  C  CE  . LYS A  1 222 ? -28.749  5.409   -59.194  1.00 34.57  ? 203  LYS A CE  1 
ATOM   1589  N  NZ  . LYS A  1 222 ? -29.946  4.806   -58.469  1.00 33.96  ? 203  LYS A NZ  1 
ATOM   1590  N  N   . LYS A  1 223 ? -22.988  6.953   -60.356  1.00 33.00  ? 204  LYS A N   1 
ATOM   1591  C  CA  . LYS A  1 223 ? -22.403  8.032   -59.546  1.00 30.35  ? 204  LYS A CA  1 
ATOM   1592  C  C   . LYS A  1 223 ? -23.082  8.078   -58.167  1.00 24.28  ? 204  LYS A C   1 
ATOM   1593  O  O   . LYS A  1 223 ? -24.151  7.485   -57.966  1.00 24.99  ? 204  LYS A O   1 
ATOM   1594  C  CB  . LYS A  1 223 ? -22.579  9.388   -60.215  1.00 21.86  ? 204  LYS A CB  1 
ATOM   1595  C  CG  . LYS A  1 223 ? -21.955  9.490   -61.554  1.00 23.61  ? 204  LYS A CG  1 
ATOM   1596  C  CD  . LYS A  1 223 ? -22.587  10.653  -62.284  1.00 23.36  ? 204  LYS A CD  1 
ATOM   1597  C  CE  . LYS A  1 223 ? -21.710  11.138  -63.386  1.00 26.95  ? 204  LYS A CE  1 
ATOM   1598  N  NZ  . LYS A  1 223 ? -22.407  12.198  -64.177  1.00 31.88  ? 204  LYS A NZ  1 
ATOM   1599  N  N   . GLY A  1 224 ? -22.470  8.783   -57.221  1.00 21.15  ? 205  GLY A N   1 
ATOM   1600  C  CA  . GLY A  1 224 ? -23.104  8.959   -55.926  1.00 24.31  ? 205  GLY A CA  1 
ATOM   1601  C  C   . GLY A  1 224 ? -23.963  10.204  -55.949  1.00 27.33  ? 205  GLY A C   1 
ATOM   1602  O  O   . GLY A  1 224 ? -23.712  11.122  -56.763  1.00 25.66  ? 205  GLY A O   1 
ATOM   1603  N  N   . ARG A  1 225 ? -24.986  10.230  -55.095  1.00 29.27  ? 206  ARG A N   1 
ATOM   1604  C  CA  . ARG A  1 225 ? -25.657  11.487  -54.758  1.00 34.63  ? 206  ARG A CA  1 
ATOM   1605  C  C   . ARG A  1 225 ? -24.566  12.516  -54.492  1.00 38.84  ? 206  ARG A C   1 
ATOM   1606  O  O   . ARG A  1 225 ? -23.795  12.359  -53.537  1.00 40.71  ? 206  ARG A O   1 
ATOM   1607  C  CB  . ARG A  1 225 ? -26.480  11.297  -53.508  1.00 34.69  ? 206  ARG A CB  1 
ATOM   1608  C  CG  . ARG A  1 225 ? -27.136  9.932   -53.417  1.00 37.82  ? 206  ARG A CG  1 
ATOM   1609  C  CD  . ARG A  1 225 ? -27.298  9.551   -51.953  1.00 45.51  ? 206  ARG A CD  1 
ATOM   1610  N  NE  . ARG A  1 225 ? -27.274  10.717  -51.058  1.00 44.54  ? 206  ARG A NE  1 
ATOM   1611  C  CZ  . ARG A  1 225 ? -28.355  11.312  -50.545  1.00 42.51  ? 206  ARG A CZ  1 
ATOM   1612  N  NH1 . ARG A  1 225 ? -29.579  10.861  -50.808  1.00 29.92  ? 206  ARG A NH1 1 
ATOM   1613  N  NH2 . ARG A  1 225 ? -28.206  12.362  -49.745  1.00 51.30  ? 206  ARG A NH2 1 
ATOM   1614  N  N   . SER A  1 226 ? -24.528  13.551  -55.337  1.00 44.84  ? 207  SER A N   1 
ATOM   1615  C  CA  . SER A  1 226 ? -23.377  14.466  -55.572  1.00 49.71  ? 207  SER A CA  1 
ATOM   1616  C  C   . SER A  1 226 ? -22.560  14.042  -56.823  1.00 42.89  ? 207  SER A C   1 
ATOM   1617  O  O   . SER A  1 226 ? -23.049  14.108  -57.968  1.00 44.04  ? 207  SER A O   1 
ATOM   1618  C  CB  . SER A  1 226 ? -22.472  14.735  -54.333  1.00 44.24  ? 207  SER A CB  1 
ATOM   1619  O  OG  . SER A  1 226 ? -21.859  13.552  -53.784  1.00 41.13  ? 207  SER A OG  1 
ATOM   1620  N  N   . LEU B  1 20  ? -21.828  -17.529 -112.643 1.00 48.65  ? 1    LEU B N   1 
ATOM   1621  C  CA  . LEU B  1 20  ? -22.700  -16.746 -111.784 1.00 40.86  ? 1    LEU B CA  1 
ATOM   1622  C  C   . LEU B  1 20  ? -21.975  -16.290 -110.544 1.00 40.95  ? 1    LEU B C   1 
ATOM   1623  O  O   . LEU B  1 20  ? -21.387  -17.105 -109.841 1.00 50.37  ? 1    LEU B O   1 
ATOM   1624  C  CB  . LEU B  1 20  ? -23.878  -17.585 -111.323 1.00 34.81  ? 1    LEU B CB  1 
ATOM   1625  C  CG  . LEU B  1 20  ? -25.022  -17.762 -112.297 1.00 33.03  ? 1    LEU B CG  1 
ATOM   1626  C  CD1 . LEU B  1 20  ? -26.159  -18.593 -111.659 1.00 27.25  ? 1    LEU B CD1 1 
ATOM   1627  C  CD2 . LEU B  1 20  ? -25.498  -16.394 -112.726 1.00 36.67  ? 1    LEU B CD2 1 
ATOM   1628  N  N   . ASP B  1 21  ? -22.031  -14.991 -110.264 1.00 32.29  ? 2    ASP B N   1 
ATOM   1629  C  CA  . ASP B  1 21  ? -21.601  -14.488 -108.966 1.00 28.18  ? 2    ASP B CA  1 
ATOM   1630  C  C   . ASP B  1 21  ? -22.791  -13.946 -108.168 1.00 29.44  ? 2    ASP B C   1 
ATOM   1631  O  O   . ASP B  1 21  ? -23.923  -13.949 -108.668 1.00 18.42  ? 2    ASP B O   1 
ATOM   1632  C  CB  . ASP B  1 21  ? -20.482  -13.445 -109.094 1.00 33.42  ? 2    ASP B CB  1 
ATOM   1633  C  CG  . ASP B  1 21  ? -20.867  -12.279 -109.967 1.00 38.61  ? 2    ASP B CG  1 
ATOM   1634  O  OD1 . ASP B  1 21  ? -22.083  -12.132 -110.262 1.00 44.15  ? 2    ASP B OD1 1 
ATOM   1635  O  OD2 . ASP B  1 21  ? -19.947  -11.504 -110.351 1.00 33.55  ? 2    ASP B OD2 1 
ATOM   1636  N  N   . ARG B  1 22  ? -22.535  -13.503 -106.934 1.00 18.01  ? 3    ARG B N   1 
ATOM   1637  C  CA  . ARG B  1 22  ? -23.610  -13.044 -106.062 1.00 29.22  ? 3    ARG B CA  1 
ATOM   1638  C  C   . ARG B  1 22  ? -24.457  -11.982 -106.755 1.00 27.73  ? 3    ARG B C   1 
ATOM   1639  O  O   . ARG B  1 22  ? -25.693  -12.077 -106.765 1.00 28.85  ? 3    ARG B O   1 
ATOM   1640  C  CB  . ARG B  1 22  ? -23.065  -12.470 -104.733 1.00 28.14  ? 3    ARG B CB  1 
ATOM   1641  C  CG  . ARG B  1 22  ? -22.773  -13.483 -103.677 1.00 26.14  ? 3    ARG B CG  1 
ATOM   1642  C  CD  . ARG B  1 22  ? -22.028  -12.908 -102.471 1.00 27.48  ? 3    ARG B CD  1 
ATOM   1643  N  NE  . ARG B  1 22  ? -21.648  -14.009 -101.593 1.00 43.26  ? 3    ARG B NE  1 
ATOM   1644  C  CZ  . ARG B  1 22  ? -20.483  -14.647 -101.661 1.00 55.81  ? 3    ARG B CZ  1 
ATOM   1645  N  NH1 . ARG B  1 22  ? -19.566  -14.255 -102.543 1.00 58.27  ? 3    ARG B NH1 1 
ATOM   1646  N  NH2 . ARG B  1 22  ? -20.229  -15.655 -100.829 1.00 60.37  ? 3    ARG B NH2 1 
ATOM   1647  N  N   . ALA B  1 23  ? -23.788  -10.971 -107.310 1.00 22.96  ? 4    ALA B N   1 
ATOM   1648  C  CA  . ALA B  1 23  ? -24.476  -9.888  -108.000 1.00 26.69  ? 4    ALA B CA  1 
ATOM   1649  C  C   . ALA B  1 23  ? -25.490  -10.430 -109.030 1.00 28.14  ? 4    ALA B C   1 
ATOM   1650  O  O   . ALA B  1 23  ? -26.653  -9.992  -109.056 1.00 27.36  ? 4    ALA B O   1 
ATOM   1651  C  CB  . ALA B  1 23  ? -23.457  -8.971  -108.649 1.00 35.30  ? 4    ALA B CB  1 
ATOM   1652  N  N   . ASP B  1 24  ? -25.065  -11.408 -109.838 1.00 27.83  ? 5    ASP B N   1 
ATOM   1653  C  CA  . ASP B  1 24  ? -25.950  -11.992 -110.851 1.00 32.94  ? 5    ASP B CA  1 
ATOM   1654  C  C   . ASP B  1 24  ? -27.146  -12.705 -110.221 1.00 33.50  ? 5    ASP B C   1 
ATOM   1655  O  O   . ASP B  1 24  ? -28.293  -12.494 -110.648 1.00 37.51  ? 5    ASP B O   1 
ATOM   1656  C  CB  . ASP B  1 24  ? -25.197  -12.950 -111.786 1.00 37.36  ? 5    ASP B CB  1 
ATOM   1657  C  CG  . ASP B  1 24  ? -24.067  -12.271 -112.557 1.00 48.43  ? 5    ASP B CG  1 
ATOM   1658  O  OD1 . ASP B  1 24  ? -24.221  -11.093 -112.981 1.00 46.26  ? 5    ASP B OD1 1 
ATOM   1659  O  OD2 . ASP B  1 24  ? -23.023  -12.945 -112.748 1.00 56.87  ? 5    ASP B OD2 1 
ATOM   1660  N  N   . ILE B  1 25  ? -26.871  -13.539 -109.208 1.00 27.19  ? 6    ILE B N   1 
ATOM   1661  C  CA  . ILE B  1 25  ? -27.908  -14.325 -108.510 1.00 23.62  ? 6    ILE B CA  1 
ATOM   1662  C  C   . ILE B  1 25  ? -28.961  -13.429 -107.861 1.00 26.94  ? 6    ILE B C   1 
ATOM   1663  O  O   . ILE B  1 25  ? -30.168  -13.659 -107.979 1.00 30.64  ? 6    ILE B O   1 
ATOM   1664  C  CB  . ILE B  1 25  ? -27.283  -15.243 -107.436 1.00 23.11  ? 6    ILE B CB  1 
ATOM   1665  C  CG1 . ILE B  1 25  ? -26.437  -16.325 -108.106 1.00 24.71  ? 6    ILE B CG1 1 
ATOM   1666  C  CG2 . ILE B  1 25  ? -28.352  -15.896 -106.605 1.00 18.00  ? 6    ILE B CG2 1 
ATOM   1667  C  CD1 . ILE B  1 25  ? -25.570  -17.122 -107.176 1.00 17.61  ? 6    ILE B CD1 1 
ATOM   1668  N  N   . LEU B  1 26  ? -28.494  -12.379 -107.200 1.00 28.05  ? 7    LEU B N   1 
ATOM   1669  C  CA  . LEU B  1 26  ? -29.386  -11.400 -106.605 1.00 24.05  ? 7    LEU B CA  1 
ATOM   1670  C  C   . LEU B  1 26  ? -30.183  -10.639 -107.645 1.00 28.30  ? 7    LEU B C   1 
ATOM   1671  O  O   . LEU B  1 26  ? -31.388  -10.419 -107.468 1.00 29.08  ? 7    LEU B O   1 
ATOM   1672  C  CB  . LEU B  1 26  ? -28.608  -10.447 -105.702 1.00 20.97  ? 7    LEU B CB  1 
ATOM   1673  C  CG  . LEU B  1 26  ? -28.054  -11.201 -104.478 1.00 19.53  ? 7    LEU B CG  1 
ATOM   1674  C  CD1 . LEU B  1 26  ? -26.864  -10.456 -103.888 1.00 18.40  ? 7    LEU B CD1 1 
ATOM   1675  C  CD2 . LEU B  1 26  ? -29.153  -11.421 -103.475 1.00 18.32  ? 7    LEU B CD2 1 
ATOM   1676  N  N   . TYR B  1 27  ? -29.523  -10.249 -108.736 1.00 27.63  ? 8    TYR B N   1 
ATOM   1677  C  CA  . TYR B  1 27  ? -30.220  -9.607  -109.839 1.00 24.26  ? 8    TYR B CA  1 
ATOM   1678  C  C   . TYR B  1 27  ? -31.362  -10.510 -110.377 1.00 35.77  ? 8    TYR B C   1 
ATOM   1679  O  O   . TYR B  1 27  ? -32.522  -10.076 -110.506 1.00 20.45  ? 8    TYR B O   1 
ATOM   1680  C  CB  . TYR B  1 27  ? -29.221  -9.280  -110.946 1.00 32.01  ? 8    TYR B CB  1 
ATOM   1681  C  CG  . TYR B  1 27  ? -29.846  -8.646  -112.164 1.00 34.76  ? 8    TYR B CG  1 
ATOM   1682  C  CD1 . TYR B  1 27  ? -30.223  -7.308  -112.151 1.00 38.51  ? 8    TYR B CD1 1 
ATOM   1683  C  CD2 . TYR B  1 27  ? -30.036  -9.373  -113.332 1.00 42.89  ? 8    TYR B CD2 1 
ATOM   1684  C  CE1 . TYR B  1 27  ? -30.788  -6.716  -113.262 1.00 46.86  ? 8    TYR B CE1 1 
ATOM   1685  C  CE2 . TYR B  1 27  ? -30.610  -8.785  -114.458 1.00 51.39  ? 8    TYR B CE2 1 
ATOM   1686  C  CZ  . TYR B  1 27  ? -30.983  -7.454  -114.415 1.00 53.33  ? 8    TYR B CZ  1 
ATOM   1687  O  OH  . TYR B  1 27  ? -31.549  -6.868  -115.528 1.00 58.66  ? 8    TYR B OH  1 
ATOM   1688  N  N   . ASN B  1 28  ? -31.049  -11.770 -110.684 1.00 25.78  ? 9    ASN B N   1 
ATOM   1689  C  CA  . ASN B  1 28  ? -32.089  -12.676 -111.169 1.00 23.15  ? 9    ASN B CA  1 
ATOM   1690  C  C   . ASN B  1 28  ? -33.233  -12.821 -110.173 1.00 26.20  ? 9    ASN B C   1 
ATOM   1691  O  O   . ASN B  1 28  ? -34.406  -12.775 -110.549 1.00 20.10  ? 9    ASN B O   1 
ATOM   1692  C  CB  . ASN B  1 28  ? -31.524  -14.048 -111.510 1.00 28.08  ? 9    ASN B CB  1 
ATOM   1693  C  CG  . ASN B  1 28  ? -30.438  -13.991 -112.567 1.00 34.60  ? 9    ASN B CG  1 
ATOM   1694  O  OD1 . ASN B  1 28  ? -30.388  -13.070 -113.388 1.00 34.91  ? 9    ASN B OD1 1 
ATOM   1695  N  ND2 . ASN B  1 28  ? -29.555  -14.990 -112.551 1.00 39.89  ? 9    ASN B ND2 1 
ATOM   1696  N  N   . ILE B  1 29  ? -32.921  -12.962 -108.898 1.00 29.67  ? 10   ILE B N   1 
ATOM   1697  C  CA  . ILE B  1 29  ? -33.919  -13.109 -107.855 1.00 25.21  ? 10   ILE B CA  1 
ATOM   1698  C  C   . ILE B  1 29  ? -34.830  -11.923 -107.681 1.00 19.72  ? 10   ILE B C   1 
ATOM   1699  O  O   . ILE B  1 29  ? -36.002  -12.054 -107.537 1.00 19.82  ? 10   ILE B O   1 
ATOM   1700  C  CB  . ILE B  1 29  ? -33.253  -13.524 -106.546 1.00 29.47  ? 10   ILE B CB  1 
ATOM   1701  C  CG1 . ILE B  1 29  ? -32.785  -14.929 -106.697 1.00 18.62  ? 10   ILE B CG1 1 
ATOM   1702  C  CG2 . ILE B  1 29  ? -34.220  -13.500 -105.391 1.00 30.20  ? 10   ILE B CG2 1 
ATOM   1703  C  CD1 . ILE B  1 29  ? -32.216  -15.517 -105.461 1.00 44.17  ? 10   ILE B CD1 1 
ATOM   1704  N  N   . ARG B  1 30  ? -34.263  -10.754 -107.717 1.00 23.43  ? 11   ARG B N   1 
ATOM   1705  C  CA  . ARG B  1 30  ? -35.016  -9.544  -107.723 1.00 21.91  ? 11   ARG B CA  1 
ATOM   1706  C  C   . ARG B  1 30  ? -35.878  -9.300  -108.936 1.00 23.68  ? 11   ARG B C   1 
ATOM   1707  O  O   . ARG B  1 30  ? -36.930  -8.777  -108.818 1.00 23.33  ? 11   ARG B O   1 
ATOM   1708  C  CB  . ARG B  1 30  ? -34.057  -8.401  -107.546 1.00 31.26  ? 11   ARG B CB  1 
ATOM   1709  C  CG  . ARG B  1 30  ? -34.726  -7.078  -107.464 1.00 46.76  ? 11   ARG B CG  1 
ATOM   1710  C  CD  . ARG B  1 30  ? -33.756  -6.058  -106.983 1.00 63.02  ? 11   ARG B CD  1 
ATOM   1711  N  NE  . ARG B  1 30  ? -32.578  -6.017  -107.827 1.00 75.61  ? 11   ARG B NE  1 
ATOM   1712  C  CZ  . ARG B  1 30  ? -32.343  -5.056  -108.699 1.00 82.88  ? 11   ARG B CZ  1 
ATOM   1713  N  NH1 . ARG B  1 30  ? -33.208  -4.066  -108.826 1.00 79.48  ? 11   ARG B NH1 1 
ATOM   1714  N  NH2 . ARG B  1 30  ? -31.249  -5.080  -109.424 1.00 87.51  ? 11   ARG B NH2 1 
ATOM   1715  N  N   . GLN B  1 31  ? -35.383  -9.585  -110.118 1.00 25.89  ? 12   GLN B N   1 
ATOM   1716  C  CA  . GLN B  1 31  ? -36.169  -9.498  -111.331 1.00 24.46  ? 12   GLN B CA  1 
ATOM   1717  C  C   . GLN B  1 31  ? -37.251  -10.513 -111.500 1.00 29.40  ? 12   GLN B C   1 
ATOM   1718  O  O   . GLN B  1 31  ? -38.267  -10.216 -112.020 1.00 37.03  ? 12   GLN B O   1 
ATOM   1719  C  CB  . GLN B  1 31  ? -35.298  -9.445  -112.550 1.00 32.24  ? 12   GLN B CB  1 
ATOM   1720  C  CG  . GLN B  1 31  ? -34.360  -8.277  -112.571 1.00 39.03  ? 12   GLN B CG  1 
ATOM   1721  C  CD  . GLN B  1 31  ? -35.075  -6.986  -112.608 1.00 42.51  ? 12   GLN B CD  1 
ATOM   1722  O  OE1 . GLN B  1 31  ? -34.903  -6.144  -111.759 1.00 39.95  ? 12   GLN B OE1 1 
ATOM   1723  N  NE2 . GLN B  1 31  ? -35.886  -6.821  -113.590 1.00 49.82  ? 12   GLN B NE2 1 
ATOM   1724  N  N   . THR B  1 32  ? -37.015  -11.734 -111.080 1.00 28.95  ? 13   THR B N   1 
ATOM   1725  C  CA  . THR B  1 32  ? -37.905  -12.845 -111.426 1.00 34.36  ? 13   THR B CA  1 
ATOM   1726  C  C   . THR B  1 32  ? -38.667  -13.502 -110.288 1.00 38.97  ? 13   THR B C   1 
ATOM   1727  O  O   . THR B  1 32  ? -39.599  -14.272 -110.543 1.00 34.55  ? 13   THR B O   1 
ATOM   1728  C  CB  . THR B  1 32  ? -37.157  -13.980 -112.119 1.00 35.96  ? 13   THR B CB  1 
ATOM   1729  O  OG1 . THR B  1 32  ? -36.095  -14.424 -111.270 1.00 37.41  ? 13   THR B OG1 1 
ATOM   1730  C  CG2 . THR B  1 32  ? -36.598  -13.518 -113.454 1.00 37.35  ? 13   THR B CG2 1 
ATOM   1731  N  N   . SER B  1 33  ? -38.265  -13.264 -109.047 1.00 43.79  ? 14   SER B N   1 
ATOM   1732  C  CA  . SER B  1 33  ? -39.033  -13.837 -107.946 1.00 54.51  ? 14   SER B CA  1 
ATOM   1733  C  C   . SER B  1 33  ? -40.354  -13.085 -107.875 1.00 58.68  ? 14   SER B C   1 
ATOM   1734  O  O   . SER B  1 33  ? -40.447  -11.898 -108.247 1.00 65.82  ? 14   SER B O   1 
ATOM   1735  C  CB  . SER B  1 33  ? -38.300  -13.767 -106.603 1.00 57.38  ? 14   SER B CB  1 
ATOM   1736  O  OG  . SER B  1 33  ? -38.590  -12.552 -105.937 1.00 58.46  ? 14   SER B OG  1 
ATOM   1737  N  N   . ARG B  1 34  ? -41.383  -13.787 -107.425 1.00 47.84  ? 15   ARG B N   1 
ATOM   1738  C  CA  . ARG B  1 34  ? -42.711  -13.213 -107.401 1.00 42.95  ? 15   ARG B CA  1 
ATOM   1739  C  C   . ARG B  1 34  ? -43.215  -13.243 -105.962 1.00 38.42  ? 15   ARG B C   1 
ATOM   1740  O  O   . ARG B  1 34  ? -43.854  -14.217 -105.552 1.00 40.21  ? 15   ARG B O   1 
ATOM   1741  C  CB  . ARG B  1 34  ? -43.626  -14.022 -108.322 1.00 41.09  ? 15   ARG B CB  1 
ATOM   1742  C  CG  . ARG B  1 34  ? -43.216  -14.021 -109.792 1.00 39.09  ? 15   ARG B CG  1 
ATOM   1743  C  CD  . ARG B  1 34  ? -43.724  -12.756 -110.498 1.00 41.72  ? 15   ARG B CD  1 
ATOM   1744  N  NE  . ARG B  1 34  ? -45.168  -12.619 -110.298 1.00 45.35  ? 15   ARG B NE  1 
ATOM   1745  C  CZ  . ARG B  1 34  ? -46.105  -13.127 -111.101 1.00 45.31  ? 15   ARG B CZ  1 
ATOM   1746  N  NH1 . ARG B  1 34  ? -45.757  -13.787 -112.209 1.00 54.07  ? 15   ARG B NH1 1 
ATOM   1747  N  NH2 . ARG B  1 34  ? -47.394  -12.961 -110.803 1.00 30.41  ? 15   ARG B NH2 1 
ATOM   1748  N  N   . PRO B  1 35  ? -42.918  -12.175 -105.189 1.00 32.78  ? 16   PRO B N   1 
ATOM   1749  C  CA  . PRO B  1 35  ? -43.185  -12.107 -103.738 1.00 29.76  ? 16   PRO B CA  1 
ATOM   1750  C  C   . PRO B  1 35  ? -44.650  -12.338 -103.397 1.00 27.87  ? 16   PRO B C   1 
ATOM   1751  O  O   . PRO B  1 35  ? -44.985  -12.794 -102.310 1.00 27.45  ? 16   PRO B O   1 
ATOM   1752  C  CB  . PRO B  1 35  ? -42.808  -10.669 -103.370 1.00 24.66  ? 16   PRO B CB  1 
ATOM   1753  C  CG  . PRO B  1 35  ? -41.878  -10.215 -104.480 1.00 21.64  ? 16   PRO B CG  1 
ATOM   1754  C  CD  . PRO B  1 35  ? -42.382  -10.903 -105.711 1.00 20.25  ? 16   PRO B CD  1 
ATOM   1755  N  N   . ASP B  1 36  ? -45.509  -12.053 -104.357 1.00 30.11  ? 17   ASP B N   1 
ATOM   1756  C  CA  . ASP B  1 36  ? -46.946  -12.198 -104.205 1.00 28.26  ? 17   ASP B CA  1 
ATOM   1757  C  C   . ASP B  1 36  ? -47.407  -13.633 -104.468 1.00 26.24  ? 17   ASP B C   1 
ATOM   1758  O  O   . ASP B  1 36  ? -48.564  -13.981 -104.226 1.00 25.33  ? 17   ASP B O   1 
ATOM   1759  C  CB  . ASP B  1 36  ? -47.664  -11.217 -105.170 1.00 37.60  ? 17   ASP B CB  1 
ATOM   1760  C  CG  . ASP B  1 36  ? -47.094  -11.259 -106.622 1.00 71.93  ? 17   ASP B CG  1 
ATOM   1761  O  OD1 . ASP B  1 36  ? -45.851  -11.335 -106.811 1.00 67.40  ? 17   ASP B OD1 1 
ATOM   1762  O  OD2 . ASP B  1 36  ? -47.897  -11.205 -107.587 1.00 74.73  ? 17   ASP B OD2 1 
ATOM   1763  N  N   . VAL B  1 37  ? -46.506  -14.461 -104.981 1.00 28.39  ? 18   VAL B N   1 
ATOM   1764  C  CA  . VAL B  1 37  ? -46.896  -15.777 -105.493 1.00 28.96  ? 18   VAL B CA  1 
ATOM   1765  C  C   . VAL B  1 37  ? -46.347  -16.923 -104.662 1.00 26.02  ? 18   VAL B C   1 
ATOM   1766  O  O   . VAL B  1 37  ? -45.135  -17.135 -104.587 1.00 23.01  ? 18   VAL B O   1 
ATOM   1767  C  CB  . VAL B  1 37  ? -46.467  -15.963 -106.963 1.00 26.92  ? 18   VAL B CB  1 
ATOM   1768  C  CG1 . VAL B  1 37  ? -46.942  -17.315 -107.502 1.00 22.30  ? 18   VAL B CG1 1 
ATOM   1769  C  CG2 . VAL B  1 37  ? -47.015  -14.850 -107.786 1.00 29.81  ? 18   VAL B CG2 1 
ATOM   1770  N  N   . ILE B  1 38  ? -47.253  -17.666 -104.041 1.00 26.22  ? 19   ILE B N   1 
ATOM   1771  C  CA  . ILE B  1 38  ? -46.862  -18.806 -103.224 1.00 30.59  ? 19   ILE B CA  1 
ATOM   1772  C  C   . ILE B  1 38  ? -46.250  -19.897 -104.101 1.00 32.83  ? 19   ILE B C   1 
ATOM   1773  O  O   . ILE B  1 38  ? -46.846  -20.338 -105.080 1.00 40.42  ? 19   ILE B O   1 
ATOM   1774  C  CB  . ILE B  1 38  ? -48.065  -19.336 -102.424 1.00 29.18  ? 19   ILE B CB  1 
ATOM   1775  C  CG1 . ILE B  1 38  ? -47.665  -20.516 -101.545 1.00 27.72  ? 19   ILE B CG1 1 
ATOM   1776  C  CG2 . ILE B  1 38  ? -49.227  -19.693 -103.356 1.00 21.66  ? 19   ILE B CG2 1 
ATOM   1777  C  CD1 . ILE B  1 38  ? -48.758  -20.919 -100.586 1.00 22.49  ? 19   ILE B CD1 1 
ATOM   1778  N  N   . PRO B  1 39  ? -45.027  -20.314 -103.768 1.00 29.33  ? 20   PRO B N   1 
ATOM   1779  C  CA  . PRO B  1 39  ? -44.263  -21.237 -104.633 1.00 25.07  ? 20   PRO B CA  1 
ATOM   1780  C  C   . PRO B  1 39  ? -44.781  -22.668 -104.489 1.00 35.87  ? 20   PRO B C   1 
ATOM   1781  O  O   . PRO B  1 39  ? -44.020  -23.591 -104.178 1.00 40.61  ? 20   PRO B O   1 
ATOM   1782  C  CB  . PRO B  1 39  ? -42.844  -21.127 -104.079 1.00 24.77  ? 20   PRO B CB  1 
ATOM   1783  C  CG  . PRO B  1 39  ? -43.079  -20.821 -102.535 1.00 26.59  ? 20   PRO B CG  1 
ATOM   1784  C  CD  . PRO B  1 39  ? -44.335  -19.982 -102.498 1.00 25.78  ? 20   PRO B CD  1 
ATOM   1785  N  N   . THR B  1 40  ? -46.083  -22.837 -104.689 1.00 38.81  ? 21   THR B N   1 
ATOM   1786  C  CA  . THR B  1 40  ? -46.705  -24.142 -104.593 1.00 43.12  ? 21   THR B CA  1 
ATOM   1787  C  C   . THR B  1 40  ? -46.311  -24.992 -105.808 1.00 56.58  ? 21   THR B C   1 
ATOM   1788  O  O   . THR B  1 40  ? -46.186  -24.483 -106.923 1.00 55.22  ? 21   THR B O   1 
ATOM   1789  C  CB  . THR B  1 40  ? -48.224  -23.998 -104.482 1.00 45.46  ? 21   THR B CB  1 
ATOM   1790  O  OG1 . THR B  1 40  ? -48.799  -25.249 -104.097 1.00 58.67  ? 21   THR B OG1 1 
ATOM   1791  C  CG2 . THR B  1 40  ? -48.833  -23.520 -105.800 1.00 35.23  ? 21   THR B CG2 1 
ATOM   1792  N  N   . GLN B  1 41  ? -46.095  -26.286 -105.590 1.00 66.71  ? 22   GLN B N   1 
ATOM   1793  C  CA  . GLN B  1 41  ? -45.507  -27.144 -106.613 1.00 68.76  ? 22   GLN B CA  1 
ATOM   1794  C  C   . GLN B  1 41  ? -46.519  -28.161 -107.156 1.00 66.31  ? 22   GLN B C   1 
ATOM   1795  O  O   . GLN B  1 41  ? -46.484  -29.347 -106.820 1.00 66.95  ? 22   GLN B O   1 
ATOM   1796  C  CB  . GLN B  1 41  ? -44.253  -27.833 -106.048 1.00 72.35  ? 22   GLN B CB  1 
ATOM   1797  C  CG  . GLN B  1 41  ? -43.142  -28.117 -107.069 1.00 77.32  ? 22   GLN B CG  1 
ATOM   1798  C  CD  . GLN B  1 41  ? -41.830  -28.559 -106.420 1.00 81.34  ? 22   GLN B CD  1 
ATOM   1799  O  OE1 . GLN B  1 41  ? -41.621  -28.370 -105.213 1.00 87.06  ? 22   GLN B OE1 1 
ATOM   1800  N  NE2 . GLN B  1 41  ? -40.939  -29.148 -107.220 1.00 76.87  ? 22   GLN B NE2 1 
ATOM   1801  N  N   . ASP B  1 43  ? -49.692  -29.975 -107.308 1.00 62.06  ? 24   ASP B N   1 
ATOM   1802  C  CA  . ASP B  1 43  ? -50.358  -29.180 -106.257 1.00 69.99  ? 24   ASP B CA  1 
ATOM   1803  C  C   . ASP B  1 43  ? -50.028  -29.567 -104.794 1.00 74.15  ? 24   ASP B C   1 
ATOM   1804  O  O   . ASP B  1 43  ? -50.926  -29.743 -103.962 1.00 74.51  ? 24   ASP B O   1 
ATOM   1805  C  CB  . ASP B  1 43  ? -51.884  -29.124 -106.468 1.00 69.74  ? 24   ASP B CB  1 
ATOM   1806  C  CG  . ASP B  1 43  ? -52.319  -27.913 -107.300 1.00 67.72  ? 24   ASP B CG  1 
ATOM   1807  O  OD1 . ASP B  1 43  ? -51.483  -27.397 -108.070 1.00 68.20  ? 24   ASP B OD1 1 
ATOM   1808  O  OD2 . ASP B  1 43  ? -53.489  -27.474 -107.177 1.00 64.26  ? 24   ASP B OD2 1 
ATOM   1809  N  N   . ARG B  1 44  ? -48.735  -29.685 -104.493 1.00 75.10  ? 25   ARG B N   1 
ATOM   1810  C  CA  . ARG B  1 44  ? -48.278  -29.844 -103.118 1.00 71.81  ? 25   ARG B CA  1 
ATOM   1811  C  C   . ARG B  1 44  ? -48.477  -28.537 -102.369 1.00 59.45  ? 25   ARG B C   1 
ATOM   1812  O  O   . ARG B  1 44  ? -48.338  -27.457 -102.923 1.00 60.82  ? 25   ARG B O   1 
ATOM   1813  C  CB  . ARG B  1 44  ? -46.783  -30.215 -103.060 1.00 78.50  ? 25   ARG B CB  1 
ATOM   1814  C  CG  . ARG B  1 44  ? -46.317  -30.651 -101.663 1.00 83.39  ? 25   ARG B CG  1 
ATOM   1815  C  CD  . ARG B  1 44  ? -44.828  -30.394 -101.373 1.00 87.45  ? 25   ARG B CD  1 
ATOM   1816  N  NE  . ARG B  1 44  ? -44.443  -30.862 -100.032 1.00 87.59  ? 25   ARG B NE  1 
ATOM   1817  C  CZ  . ARG B  1 44  ? -43.231  -31.309 -99.703  1.00 85.77  ? 25   ARG B CZ  1 
ATOM   1818  N  NH1 . ARG B  1 44  ? -42.264  -31.369 -100.607 1.00 87.55  ? 25   ARG B NH1 1 
ATOM   1819  N  NH2 . ARG B  1 44  ? -42.987  -31.710 -98.469  1.00 83.43  ? 25   ARG B NH2 1 
ATOM   1820  N  N   . PRO B  1 45  ? -48.818  -28.632 -101.099 1.00 48.62  ? 26   PRO B N   1 
ATOM   1821  C  CA  . PRO B  1 45  ? -48.626  -27.478 -100.216 1.00 38.92  ? 26   PRO B CA  1 
ATOM   1822  C  C   . PRO B  1 45  ? -47.150  -27.178 -100.012 1.00 32.62  ? 26   PRO B C   1 
ATOM   1823  O  O   . PRO B  1 45  ? -46.322  -28.074 -100.003 1.00 32.79  ? 26   PRO B O   1 
ATOM   1824  C  CB  . PRO B  1 45  ? -49.215  -27.966 -98.890  1.00 37.51  ? 26   PRO B CB  1 
ATOM   1825  C  CG  . PRO B  1 45  ? -49.159  -29.460 -98.964  1.00 35.44  ? 26   PRO B CG  1 
ATOM   1826  C  CD  . PRO B  1 45  ? -49.440  -29.773 -100.411 1.00 45.00  ? 26   PRO B CD  1 
ATOM   1827  N  N   . VAL B  1 46  ? -46.820  -25.912 -99.835  1.00 31.96  ? 27   VAL B N   1 
ATOM   1828  C  CA  . VAL B  1 46  ? -45.478  -25.546 -99.408  1.00 29.19  ? 27   VAL B CA  1 
ATOM   1829  C  C   . VAL B  1 46  ? -45.268  -25.987 -97.958  1.00 28.59  ? 27   VAL B C   1 
ATOM   1830  O  O   . VAL B  1 46  ? -46.031  -25.620 -97.037  1.00 19.25  ? 27   VAL B O   1 
ATOM   1831  C  CB  . VAL B  1 46  ? -45.264  -24.039 -99.487  1.00 23.66  ? 27   VAL B CB  1 
ATOM   1832  C  CG1 . VAL B  1 46  ? -43.840  -23.695 -99.045  1.00 20.83  ? 27   VAL B CG1 1 
ATOM   1833  C  CG2 . VAL B  1 46  ? -45.544  -23.535 -100.887 1.00 27.65  ? 27   VAL B CG2 1 
ATOM   1834  N  N   . ALA B  1 47  ? -44.227  -26.780 -97.756  1.00 29.37  ? 28   ALA B N   1 
ATOM   1835  C  CA  . ALA B  1 47  ? -43.910  -27.258 -96.423  1.00 24.74  ? 28   ALA B CA  1 
ATOM   1836  C  C   . ALA B  1 47  ? -43.088  -26.194 -95.650  1.00 22.22  ? 28   ALA B C   1 
ATOM   1837  O  O   . ALA B  1 47  ? -41.944  -25.908 -95.987  1.00 25.99  ? 28   ALA B O   1 
ATOM   1838  C  CB  . ALA B  1 47  ? -43.175  -28.583 -96.520  1.00 12.32  ? 28   ALA B CB  1 
ATOM   1839  N  N   . VAL B  1 48  ? -43.680  -25.619 -94.609  1.00 21.82  ? 29   VAL B N   1 
ATOM   1840  C  CA  . VAL B  1 48  ? -43.009  -24.600 -93.817  1.00 21.64  ? 29   VAL B CA  1 
ATOM   1841  C  C   . VAL B  1 48  ? -42.621  -25.141 -92.440  1.00 25.76  ? 29   VAL B C   1 
ATOM   1842  O  O   . VAL B  1 48  ? -43.479  -25.604 -91.682  1.00 29.75  ? 29   VAL B O   1 
ATOM   1843  C  CB  . VAL B  1 48  ? -43.915  -23.341 -93.646  1.00 25.89  ? 29   VAL B CB  1 
ATOM   1844  C  CG1 . VAL B  1 48  ? -43.193  -22.238 -92.855  1.00 21.49  ? 29   VAL B CG1 1 
ATOM   1845  C  CG2 . VAL B  1 48  ? -44.402  -22.816 -95.012  1.00 23.93  ? 29   VAL B CG2 1 
ATOM   1846  N  N   . SER B  1 49  ? -41.325  -25.098 -92.130  1.00 28.42  ? 30   SER B N   1 
ATOM   1847  C  CA  . SER B  1 49  ? -40.813  -25.411 -90.790  1.00 32.67  ? 30   SER B CA  1 
ATOM   1848  C  C   . SER B  1 49  ? -40.854  -24.165 -89.912  1.00 42.14  ? 30   SER B C   1 
ATOM   1849  O  O   . SER B  1 49  ? -40.408  -23.086 -90.317  1.00 42.97  ? 30   SER B O   1 
ATOM   1850  C  CB  . SER B  1 49  ? -39.351  -25.854 -90.842  1.00 30.70  ? 30   SER B CB  1 
ATOM   1851  O  OG  . SER B  1 49  ? -39.232  -27.162 -91.302  1.00 43.20  ? 30   SER B OG  1 
ATOM   1852  N  N   . VAL B  1 50  ? -41.366  -24.318 -88.700  1.00 44.13  ? 31   VAL B N   1 
ATOM   1853  C  CA  . VAL B  1 50  ? -41.335  -23.240 -87.727  1.00 40.62  ? 31   VAL B CA  1 
ATOM   1854  C  C   . VAL B  1 50  ? -40.684  -23.753 -86.467  1.00 38.68  ? 31   VAL B C   1 
ATOM   1855  O  O   . VAL B  1 50  ? -41.052  -24.807 -85.950  1.00 42.98  ? 31   VAL B O   1 
ATOM   1856  C  CB  . VAL B  1 50  ? -42.735  -22.749 -87.381  1.00 42.18  ? 31   VAL B CB  1 
ATOM   1857  C  CG1 . VAL B  1 50  ? -42.657  -21.501 -86.517  1.00 38.55  ? 31   VAL B CG1 1 
ATOM   1858  C  CG2 . VAL B  1 50  ? -43.498  -22.453 -88.649  1.00 49.99  ? 31   VAL B CG2 1 
ATOM   1859  N  N   . SER B  1 51  ? -39.712  -23.001 -85.982  1.00 35.06  ? 32   SER B N   1 
ATOM   1860  C  CA  . SER B  1 51  ? -38.997  -23.353 -84.772  1.00 33.40  ? 32   SER B CA  1 
ATOM   1861  C  C   . SER B  1 51  ? -38.674  -22.081 -83.963  1.00 37.34  ? 32   SER B C   1 
ATOM   1862  O  O   . SER B  1 51  ? -37.861  -21.257 -84.386  1.00 44.17  ? 32   SER B O   1 
ATOM   1863  C  CB  . SER B  1 51  ? -37.723  -24.113 -85.143  1.00 34.10  ? 32   SER B CB  1 
ATOM   1864  O  OG  . SER B  1 51  ? -36.777  -24.137 -84.080  1.00 40.61  ? 32   SER B OG  1 
ATOM   1865  N  N   . LEU B  1 52  ? -39.318  -21.912 -82.811  1.00 36.34  ? 33   LEU B N   1 
ATOM   1866  C  CA  . LEU B  1 52  ? -39.028  -20.766 -81.958  1.00 30.43  ? 33   LEU B CA  1 
ATOM   1867  C  C   . LEU B  1 52  ? -37.800  -21.046 -81.072  1.00 25.65  ? 33   LEU B C   1 
ATOM   1868  O  O   . LEU B  1 52  ? -37.749  -22.058 -80.398  1.00 31.38  ? 33   LEU B O   1 
ATOM   1869  C  CB  . LEU B  1 52  ? -40.243  -20.419 -81.102  1.00 30.32  ? 33   LEU B CB  1 
ATOM   1870  C  CG  . LEU B  1 52  ? -41.554  -20.201 -81.860  1.00 27.19  ? 33   LEU B CG  1 
ATOM   1871  C  CD1 . LEU B  1 52  ? -42.613  -19.605 -80.943  1.00 29.39  ? 33   LEU B CD1 1 
ATOM   1872  C  CD2 . LEU B  1 52  ? -41.326  -19.304 -83.051  1.00 30.43  ? 33   LEU B CD2 1 
ATOM   1873  N  N   . LYS B  1 53  ? -36.811  -20.159 -81.112  1.00 18.33  ? 34   LYS B N   1 
ATOM   1874  C  CA  . LYS B  1 53  ? -35.664  -20.224 -80.240  1.00 19.28  ? 34   LYS B CA  1 
ATOM   1875  C  C   . LYS B  1 53  ? -35.825  -19.065 -79.275  1.00 29.56  ? 34   LYS B C   1 
ATOM   1876  O  O   . LYS B  1 53  ? -35.646  -17.901 -79.658  1.00 36.77  ? 34   LYS B O   1 
ATOM   1877  C  CB  . LYS B  1 53  ? -34.362  -20.059 -81.011  1.00 24.41  ? 34   LYS B CB  1 
ATOM   1878  C  CG  . LYS B  1 53  ? -34.281  -20.894 -82.276  1.00 37.57  ? 34   LYS B CG  1 
ATOM   1879  C  CD  . LYS B  1 53  ? -33.859  -22.305 -81.972  1.00 47.26  ? 34   LYS B CD  1 
ATOM   1880  C  CE  . LYS B  1 53  ? -33.702  -23.124 -83.255  1.00 56.79  ? 34   LYS B CE  1 
ATOM   1881  N  NZ  . LYS B  1 53  ? -33.163  -24.487 -82.973  1.00 61.17  ? 34   LYS B NZ  1 
ATOM   1882  N  N   . PHE B  1 54  ? -36.165  -19.376 -78.024  1.00 28.28  ? 35   PHE B N   1 
ATOM   1883  C  CA  . PHE B  1 54  ? -36.414  -18.323 -77.055  1.00 25.57  ? 35   PHE B CA  1 
ATOM   1884  C  C   . PHE B  1 54  ? -35.146  -17.663 -76.573  1.00 26.13  ? 35   PHE B C   1 
ATOM   1885  O  O   . PHE B  1 54  ? -34.172  -18.340 -76.280  1.00 25.36  ? 35   PHE B O   1 
ATOM   1886  C  CB  . PHE B  1 54  ? -37.260  -18.833 -75.913  1.00 22.06  ? 35   PHE B CB  1 
ATOM   1887  C  CG  . PHE B  1 54  ? -38.627  -19.238 -76.345  1.00 17.05  ? 35   PHE B CG  1 
ATOM   1888  C  CD1 . PHE B  1 54  ? -39.639  -18.304 -76.425  1.00 14.72  ? 35   PHE B CD1 1 
ATOM   1889  C  CD2 . PHE B  1 54  ? -38.889  -20.550 -76.724  1.00 18.06  ? 35   PHE B CD2 1 
ATOM   1890  C  CE1 . PHE B  1 54  ? -40.917  -18.680 -76.852  1.00 22.75  ? 35   PHE B CE1 1 
ATOM   1891  C  CE2 . PHE B  1 54  ? -40.162  -20.934 -77.146  1.00 14.34  ? 35   PHE B CE2 1 
ATOM   1892  C  CZ  . PHE B  1 54  ? -41.175  -20.004 -77.210  1.00 14.31  ? 35   PHE B CZ  1 
ATOM   1893  N  N   . ILE B  1 55  ? -35.173  -16.330 -76.539  1.00 28.41  ? 36   ILE B N   1 
ATOM   1894  C  CA  . ILE B  1 55  ? -34.009  -15.532 -76.184  1.00 30.69  ? 36   ILE B CA  1 
ATOM   1895  C  C   . ILE B  1 55  ? -34.206  -14.859 -74.825  1.00 29.58  ? 36   ILE B C   1 
ATOM   1896  O  O   . ILE B  1 55  ? -33.287  -14.755 -74.001  1.00 29.10  ? 36   ILE B O   1 
ATOM   1897  C  CB  . ILE B  1 55  ? -33.734  -14.449 -77.249  1.00 25.12  ? 36   ILE B CB  1 
ATOM   1898  C  CG1 . ILE B  1 55  ? -33.716  -15.082 -78.639  1.00 20.04  ? 36   ILE B CG1 1 
ATOM   1899  C  CG2 . ILE B  1 55  ? -32.412  -13.719 -76.934  1.00 10.93  ? 36   ILE B CG2 1 
ATOM   1900  C  CD1 . ILE B  1 55  ? -32.648  -16.178 -78.808  1.00 10.87  ? 36   ILE B CD1 1 
ATOM   1901  N  N   . ASN B  1 56  ? -35.419  -14.387 -74.600  1.00 25.45  ? 37   ASN B N   1 
ATOM   1902  C  CA  . ASN B  1 56  ? -35.707  -13.718 -73.354  1.00 32.43  ? 37   ASN B CA  1 
ATOM   1903  C  C   . ASN B  1 56  ? -37.185  -13.694 -73.006  1.00 33.47  ? 37   ASN B C   1 
ATOM   1904  O  O   . ASN B  1 56  ? -38.044  -13.734 -73.888  1.00 32.68  ? 37   ASN B O   1 
ATOM   1905  C  CB  . ASN B  1 56  ? -35.137  -12.297 -73.362  1.00 36.34  ? 37   ASN B CB  1 
ATOM   1906  C  CG  . ASN B  1 56  ? -34.618  -11.880 -72.003  1.00 44.41  ? 37   ASN B CG  1 
ATOM   1907  O  OD1 . ASN B  1 56  ? -35.194  -12.233 -70.966  1.00 46.14  ? 37   ASN B OD1 1 
ATOM   1908  N  ND2 . ASN B  1 56  ? -33.508  -11.151 -71.994  1.00 44.67  ? 37   ASN B ND2 1 
ATOM   1909  N  N   . ILE B  1 57  ? -37.466  -13.661 -71.705  1.00 29.33  ? 38   ILE B N   1 
ATOM   1910  C  CA  . ILE B  1 57  ? -38.817  -13.407 -71.212  1.00 27.42  ? 38   ILE B CA  1 
ATOM   1911  C  C   . ILE B  1 57  ? -38.753  -12.145 -70.352  1.00 30.68  ? 38   ILE B C   1 
ATOM   1912  O  O   . ILE B  1 57  ? -38.004  -12.097 -69.379  1.00 40.28  ? 38   ILE B O   1 
ATOM   1913  C  CB  . ILE B  1 57  ? -39.348  -14.604 -70.408  1.00 25.11  ? 38   ILE B CB  1 
ATOM   1914  C  CG1 . ILE B  1 57  ? -39.364  -15.859 -71.282  1.00 28.44  ? 38   ILE B CG1 1 
ATOM   1915  C  CG2 . ILE B  1 57  ? -40.741  -14.313 -69.853  1.00 23.86  ? 38   ILE B CG2 1 
ATOM   1916  C  CD1 . ILE B  1 57  ? -39.779  -17.122 -70.545  1.00 27.52  ? 38   ILE B CD1 1 
ATOM   1917  N  N   . LEU B  1 58  ? -39.526  -11.121 -70.711  1.00 23.90  ? 39   LEU B N   1 
ATOM   1918  C  CA  . LEU B  1 58  ? -39.259  -9.780  -70.214  1.00 19.98  ? 39   LEU B CA  1 
ATOM   1919  C  C   . LEU B  1 58  ? -40.286  -9.257  -69.259  1.00 31.57  ? 39   LEU B C   1 
ATOM   1920  O  O   . LEU B  1 58  ? -39.948  -8.589  -68.273  1.00 43.93  ? 39   LEU B O   1 
ATOM   1921  C  CB  . LEU B  1 58  ? -39.190  -8.819  -71.370  1.00 29.69  ? 39   LEU B CB  1 
ATOM   1922  C  CG  . LEU B  1 58  ? -38.021  -9.080  -72.307  1.00 39.97  ? 39   LEU B CG  1 
ATOM   1923  C  CD1 . LEU B  1 58  ? -38.059  -8.069  -73.425  1.00 37.09  ? 39   LEU B CD1 1 
ATOM   1924  C  CD2 . LEU B  1 58  ? -36.689  -9.019  -71.538  1.00 44.65  ? 39   LEU B CD2 1 
ATOM   1925  N  N   . GLU B  1 59  ? -41.547  -9.523  -69.562  1.00 32.26  ? 40   GLU B N   1 
ATOM   1926  C  CA  . GLU B  1 59  ? -42.598  -8.945  -68.743  1.00 41.33  ? 40   GLU B CA  1 
ATOM   1927  C  C   . GLU B  1 59  ? -43.734  -9.918  -68.534  1.00 46.64  ? 40   GLU B C   1 
ATOM   1928  O  O   . GLU B  1 59  ? -44.605  -10.069 -69.394  1.00 54.60  ? 40   GLU B O   1 
ATOM   1929  C  CB  . GLU B  1 59  ? -43.112  -7.659  -69.376  1.00 47.90  ? 40   GLU B CB  1 
ATOM   1930  C  CG  . GLU B  1 59  ? -43.724  -6.707  -68.386  1.00 63.62  ? 40   GLU B CG  1 
ATOM   1931  C  CD  . GLU B  1 59  ? -43.371  -5.266  -68.703  1.00 76.25  ? 40   GLU B CD  1 
ATOM   1932  O  OE1 . GLU B  1 59  ? -43.070  -4.995  -69.894  1.00 80.60  ? 40   GLU B OE1 1 
ATOM   1933  O  OE2 . GLU B  1 59  ? -43.383  -4.423  -67.766  1.00 77.78  ? 40   GLU B OE2 1 
ATOM   1934  N  N   . VAL B  1 60  ? -43.720  -10.584 -67.387  1.00 39.97  ? 41   VAL B N   1 
ATOM   1935  C  CA  . VAL B  1 60  ? -44.790  -11.499 -67.051  1.00 33.97  ? 41   VAL B CA  1 
ATOM   1936  C  C   . VAL B  1 60  ? -45.819  -10.756 -66.199  1.00 35.45  ? 41   VAL B C   1 
ATOM   1937  O  O   . VAL B  1 60  ? -45.451  -9.928  -65.362  1.00 46.56  ? 41   VAL B O   1 
ATOM   1938  C  CB  . VAL B  1 60  ? -44.231  -12.736 -66.339  1.00 32.42  ? 41   VAL B CB  1 
ATOM   1939  C  CG1 . VAL B  1 60  ? -45.252  -13.333 -65.400  1.00 42.44  ? 41   VAL B CG1 1 
ATOM   1940  C  CG2 . VAL B  1 60  ? -43.776  -13.763 -67.350  1.00 29.01  ? 41   VAL B CG2 1 
ATOM   1941  N  N   . ASN B  1 61  ? -47.100  -11.013 -66.451  1.00 28.89  ? 42   ASN B N   1 
ATOM   1942  C  CA  . ASN B  1 61  ? -48.182  -10.488 -65.617  1.00 34.26  ? 42   ASN B CA  1 
ATOM   1943  C  C   . ASN B  1 61  ? -49.201  -11.604 -65.308  1.00 44.96  ? 42   ASN B C   1 
ATOM   1944  O  O   . ASN B  1 61  ? -49.998  -11.975 -66.189  1.00 39.70  ? 42   ASN B O   1 
ATOM   1945  C  CB  . ASN B  1 61  ? -48.855  -9.289  -66.297  1.00 28.59  ? 42   ASN B CB  1 
ATOM   1946  C  CG  . ASN B  1 61  ? -49.837  -8.548  -65.383  1.00 35.26  ? 42   ASN B CG  1 
ATOM   1947  O  OD1 . ASN B  1 61  ? -50.586  -9.154  -64.589  1.00 52.25  ? 42   ASN B OD1 1 
ATOM   1948  N  ND2 . ASN B  1 61  ? -49.835  -7.220  -65.495  1.00 19.68  ? 42   ASN B ND2 1 
ATOM   1949  N  N   . GLU B  1 62  ? -49.165  -12.127 -64.068  1.00 48.46  ? 43   GLU B N   1 
ATOM   1950  C  CA  . GLU B  1 62  ? -49.968  -13.296 -63.696  1.00 46.64  ? 43   GLU B CA  1 
ATOM   1951  C  C   . GLU B  1 62  ? -51.441  -12.919 -63.534  1.00 41.03  ? 43   GLU B C   1 
ATOM   1952  O  O   . GLU B  1 62  ? -52.343  -13.748 -63.708  1.00 44.05  ? 43   GLU B O   1 
ATOM   1953  C  CB  . GLU B  1 62  ? -49.429  -13.964 -62.431  1.00 51.84  ? 43   GLU B CB  1 
ATOM   1954  C  CG  . GLU B  1 62  ? -49.953  -15.392 -62.219  1.00 57.99  ? 43   GLU B CG  1 
ATOM   1955  C  CD  . GLU B  1 62  ? -49.159  -16.167 -61.164  1.00 63.11  ? 43   GLU B CD  1 
ATOM   1956  O  OE1 . GLU B  1 62  ? -48.252  -15.559 -60.529  1.00 58.07  ? 43   GLU B OE1 1 
ATOM   1957  O  OE2 . GLU B  1 62  ? -49.447  -17.380 -60.981  1.00 67.07  ? 43   GLU B OE2 1 
ATOM   1958  N  N   . ILE B  1 63  ? -51.684  -11.653 -63.231  1.00 34.86  ? 44   ILE B N   1 
ATOM   1959  C  CA  . ILE B  1 63  ? -53.052  -11.144 -63.190  1.00 44.24  ? 44   ILE B CA  1 
ATOM   1960  C  C   . ILE B  1 63  ? -53.703  -11.088 -64.594  1.00 43.43  ? 44   ILE B C   1 
ATOM   1961  O  O   . ILE B  1 63  ? -54.745  -11.698 -64.843  1.00 39.40  ? 44   ILE B O   1 
ATOM   1962  C  CB  . ILE B  1 63  ? -53.108  -9.727  -62.554  1.00 41.97  ? 44   ILE B CB  1 
ATOM   1963  C  CG1 . ILE B  1 63  ? -52.437  -9.733  -61.184  1.00 48.09  ? 44   ILE B CG1 1 
ATOM   1964  C  CG2 . ILE B  1 63  ? -54.556  -9.216  -62.459  1.00 34.42  ? 44   ILE B CG2 1 
ATOM   1965  C  CD1 . ILE B  1 63  ? -52.991  -10.797 -60.238  1.00 57.87  ? 44   ILE B CD1 1 
ATOM   1966  N  N   . THR B  1 64  ? -53.088  -10.339 -65.502  1.00 40.72  ? 45   THR B N   1 
ATOM   1967  C  CA  . THR B  1 64  ? -53.651  -10.144 -66.843  1.00 42.45  ? 45   THR B CA  1 
ATOM   1968  C  C   . THR B  1 64  ? -53.398  -11.303 -67.810  1.00 43.33  ? 45   THR B C   1 
ATOM   1969  O  O   . THR B  1 64  ? -53.960  -11.334 -68.910  1.00 40.86  ? 45   THR B O   1 
ATOM   1970  C  CB  . THR B  1 64  ? -53.131  -8.859  -67.510  1.00 39.54  ? 45   THR B CB  1 
ATOM   1971  O  OG1 . THR B  1 64  ? -51.742  -9.010  -67.834  1.00 37.76  ? 45   THR B OG1 1 
ATOM   1972  C  CG2 . THR B  1 64  ? -53.306  -7.673  -66.575  1.00 44.77  ? 45   THR B CG2 1 
ATOM   1973  N  N   . ASN B  1 65  ? -52.558  -12.249 -67.401  1.00 44.57  ? 46   ASN B N   1 
ATOM   1974  C  CA  . ASN B  1 65  ? -52.220  -13.389 -68.252  1.00 44.41  ? 46   ASN B CA  1 
ATOM   1975  C  C   . ASN B  1 65  ? -51.569  -12.953 -69.564  1.00 39.88  ? 46   ASN B C   1 
ATOM   1976  O  O   . ASN B  1 65  ? -51.996  -13.343 -70.654  1.00 43.07  ? 46   ASN B O   1 
ATOM   1977  C  CB  . ASN B  1 65  ? -53.439  -14.284 -68.512  1.00 46.40  ? 46   ASN B CB  1 
ATOM   1978  C  CG  . ASN B  1 65  ? -53.472  -15.497 -67.613  1.00 51.12  ? 46   ASN B CG  1 
ATOM   1979  O  OD1 . ASN B  1 65  ? -52.428  -15.966 -67.110  1.00 52.27  ? 46   ASN B OD1 1 
ATOM   1980  N  ND2 . ASN B  1 65  ? -54.677  -16.029 -67.409  1.00 52.02  ? 46   ASN B ND2 1 
ATOM   1981  N  N   . GLU B  1 66  ? -50.532  -12.134 -69.440  1.00 30.92  ? 47   GLU B N   1 
ATOM   1982  C  CA  . GLU B  1 66  ? -49.826  -11.615 -70.590  1.00 26.50  ? 47   GLU B CA  1 
ATOM   1983  C  C   . GLU B  1 66  ? -48.326  -11.735 -70.366  1.00 31.56  ? 47   GLU B C   1 
ATOM   1984  O  O   . GLU B  1 66  ? -47.836  -11.468 -69.270  1.00 34.60  ? 47   GLU B O   1 
ATOM   1985  C  CB  . GLU B  1 66  ? -50.225  -10.161 -70.839  1.00 22.65  ? 47   GLU B CB  1 
ATOM   1986  C  CG  . GLU B  1 66  ? -51.724  -9.966  -71.111  1.00 25.59  ? 47   GLU B CG  1 
ATOM   1987  C  CD  . GLU B  1 66  ? -52.136  -8.490  -71.214  1.00 29.77  ? 47   GLU B CD  1 
ATOM   1988  O  OE1 . GLU B  1 66  ? -51.229  -7.629  -71.391  1.00 22.55  ? 47   GLU B OE1 1 
ATOM   1989  O  OE2 . GLU B  1 66  ? -53.367  -8.199  -71.105  1.00 33.60  ? 47   GLU B OE2 1 
ATOM   1990  N  N   . VAL B  1 67  ? -47.609  -12.173 -71.398  1.00 34.70  ? 48   VAL B N   1 
ATOM   1991  C  CA  . VAL B  1 67  ? -46.148  -12.242 -71.354  1.00 35.54  ? 48   VAL B CA  1 
ATOM   1992  C  C   . VAL B  1 67  ? -45.489  -11.522 -72.554  1.00 32.10  ? 48   VAL B C   1 
ATOM   1993  O  O   . VAL B  1 67  ? -46.046  -11.442 -73.655  1.00 23.02  ? 48   VAL B O   1 
ATOM   1994  C  CB  . VAL B  1 67  ? -45.639  -13.696 -71.345  1.00 36.68  ? 48   VAL B CB  1 
ATOM   1995  C  CG1 . VAL B  1 67  ? -46.145  -14.431 -70.141  1.00 42.39  ? 48   VAL B CG1 1 
ATOM   1996  C  CG2 . VAL B  1 67  ? -46.094  -14.393 -72.610  1.00 38.24  ? 48   VAL B CG2 1 
ATOM   1997  N  N   . ASP B  1 68  ? -44.284  -11.019 -72.324  1.00 31.67  ? 49   ASP B N   1 
ATOM   1998  C  CA  . ASP B  1 68  ? -43.524  -10.300 -73.322  1.00 23.02  ? 49   ASP B CA  1 
ATOM   1999  C  C   . ASP B  1 68  ? -42.309  -11.174 -73.573  1.00 28.53  ? 49   ASP B C   1 
ATOM   2000  O  O   . ASP B  1 68  ? -41.507  -11.419 -72.671  1.00 39.06  ? 49   ASP B O   1 
ATOM   2001  C  CB  . ASP B  1 68  ? -43.088  -8.967  -72.729  1.00 29.84  ? 49   ASP B CB  1 
ATOM   2002  C  CG  . ASP B  1 68  ? -42.863  -7.883  -73.768  1.00 40.35  ? 49   ASP B CG  1 
ATOM   2003  O  OD1 . ASP B  1 68  ? -41.982  -8.043  -74.639  1.00 49.22  ? 49   ASP B OD1 1 
ATOM   2004  O  OD2 . ASP B  1 68  ? -43.539  -6.835  -73.673  1.00 40.19  ? 49   ASP B OD2 1 
ATOM   2005  N  N   . VAL B  1 69  ? -42.185  -11.660 -74.797  1.00 33.73  ? 50   VAL B N   1 
ATOM   2006  C  CA  . VAL B  1 69  ? -41.170  -12.644 -75.146  1.00 34.86  ? 50   VAL B CA  1 
ATOM   2007  C  C   . VAL B  1 69  ? -40.297  -12.141 -76.288  1.00 34.40  ? 50   VAL B C   1 
ATOM   2008  O  O   . VAL B  1 69  ? -40.775  -11.447 -77.187  1.00 38.99  ? 50   VAL B O   1 
ATOM   2009  C  CB  . VAL B  1 69  ? -41.822  -13.974 -75.565  1.00 35.47  ? 50   VAL B CB  1 
ATOM   2010  C  CG1 . VAL B  1 69  ? -40.775  -15.026 -75.851  1.00 36.57  ? 50   VAL B CG1 1 
ATOM   2011  C  CG2 . VAL B  1 69  ? -42.762  -14.455 -74.472  1.00 38.10  ? 50   VAL B CG2 1 
ATOM   2012  N  N   . VAL B  1 70  ? -39.010  -12.481 -76.220  1.00 30.41  ? 51   VAL B N   1 
ATOM   2013  C  CA  . VAL B  1 70  ? -38.078  -12.314 -77.334  1.00 26.16  ? 51   VAL B CA  1 
ATOM   2014  C  C   . VAL B  1 70  ? -37.608  -13.676 -77.855  1.00 25.25  ? 51   VAL B C   1 
ATOM   2015  O  O   . VAL B  1 70  ? -37.074  -14.502 -77.121  1.00 27.32  ? 51   VAL B O   1 
ATOM   2016  C  CB  . VAL B  1 70  ? -36.870  -11.459 -76.948  1.00 20.30  ? 51   VAL B CB  1 
ATOM   2017  C  CG1 . VAL B  1 70  ? -35.857  -11.472 -78.068  1.00 20.06  ? 51   VAL B CG1 1 
ATOM   2018  C  CG2 . VAL B  1 70  ? -37.314  -10.017 -76.657  1.00 19.65  ? 51   VAL B CG2 1 
ATOM   2019  N  N   . PHE B  1 71  ? -37.804  -13.914 -79.137  1.00 24.30  ? 52   PHE B N   1 
ATOM   2020  C  CA  . PHE B  1 71  ? -37.503  -15.223 -79.693  1.00 20.48  ? 52   PHE B CA  1 
ATOM   2021  C  C   . PHE B  1 71  ? -37.143  -15.114 -81.183  1.00 27.44  ? 52   PHE B C   1 
ATOM   2022  O  O   . PHE B  1 71  ? -37.624  -14.221 -81.899  1.00 29.45  ? 52   PHE B O   1 
ATOM   2023  C  CB  . PHE B  1 71  ? -38.720  -16.113 -79.542  1.00 15.13  ? 52   PHE B CB  1 
ATOM   2024  C  CG  . PHE B  1 71  ? -39.956  -15.570 -80.248  1.00 24.58  ? 52   PHE B CG  1 
ATOM   2025  C  CD1 . PHE B  1 71  ? -40.743  -14.586 -79.651  1.00 28.65  ? 52   PHE B CD1 1 
ATOM   2026  C  CD2 . PHE B  1 71  ? -40.326  -16.035 -81.520  1.00 24.72  ? 52   PHE B CD2 1 
ATOM   2027  C  CE1 . PHE B  1 71  ? -41.887  -14.077 -80.302  1.00 33.08  ? 52   PHE B CE1 1 
ATOM   2028  C  CE2 . PHE B  1 71  ? -41.471  -15.543 -82.170  1.00 23.02  ? 52   PHE B CE2 1 
ATOM   2029  C  CZ  . PHE B  1 71  ? -42.252  -14.566 -81.562  1.00 27.65  ? 52   PHE B CZ  1 
ATOM   2030  N  N   . TRP B  1 72  ? -36.297  -16.032 -81.639  1.00 26.28  ? 53   TRP B N   1 
ATOM   2031  C  CA  . TRP B  1 72  ? -35.983  -16.158 -83.054  1.00 26.53  ? 53   TRP B CA  1 
ATOM   2032  C  C   . TRP B  1 72  ? -37.053  -17.020 -83.679  1.00 29.72  ? 53   TRP B C   1 
ATOM   2033  O  O   . TRP B  1 72  ? -37.255  -18.170 -83.260  1.00 29.01  ? 53   TRP B O   1 
ATOM   2034  C  CB  . TRP B  1 72  ? -34.652  -16.865 -83.259  1.00 18.72  ? 53   TRP B CB  1 
ATOM   2035  C  CG  . TRP B  1 72  ? -33.485  -16.135 -82.709  1.00 14.34  ? 53   TRP B CG  1 
ATOM   2036  C  CD1 . TRP B  1 72  ? -33.501  -14.957 -82.047  1.00 15.13  ? 53   TRP B CD1 1 
ATOM   2037  C  CD2 . TRP B  1 72  ? -32.109  -16.540 -82.790  1.00 15.28  ? 53   TRP B CD2 1 
ATOM   2038  N  NE1 . TRP B  1 72  ? -32.219  -14.595 -81.698  1.00 20.53  ? 53   TRP B NE1 1 
ATOM   2039  C  CE2 . TRP B  1 72  ? -31.345  -15.550 -82.137  1.00 16.13  ? 53   TRP B CE2 1 
ATOM   2040  C  CE3 . TRP B  1 72  ? -31.453  -17.633 -83.367  1.00 12.17  ? 53   TRP B CE3 1 
ATOM   2041  C  CZ2 . TRP B  1 72  ? -29.945  -15.619 -82.036  1.00 16.42  ? 53   TRP B CZ2 1 
ATOM   2042  C  CZ3 . TRP B  1 72  ? -30.063  -17.699 -83.285  1.00 17.08  ? 53   TRP B CZ3 1 
ATOM   2043  C  CH2 . TRP B  1 72  ? -29.324  -16.700 -82.614  1.00 22.36  ? 53   TRP B CH2 1 
ATOM   2044  N  N   . GLN B  1 73  ? -37.735  -16.479 -84.685  1.00 22.88  ? 54   GLN B N   1 
ATOM   2045  C  CA  . GLN B  1 73  ? -38.761  -17.248 -85.381  1.00 19.43  ? 54   GLN B CA  1 
ATOM   2046  C  C   . GLN B  1 73  ? -38.144  -17.886 -86.628  1.00 23.85  ? 54   GLN B C   1 
ATOM   2047  O  O   . GLN B  1 73  ? -38.329  -17.406 -87.756  1.00 22.88  ? 54   GLN B O   1 
ATOM   2048  C  CB  . GLN B  1 73  ? -39.941  -16.350 -85.753  1.00 17.25  ? 54   GLN B CB  1 
ATOM   2049  C  CG  . GLN B  1 73  ? -41.157  -17.110 -86.245  1.00 21.00  ? 54   GLN B CG  1 
ATOM   2050  C  CD  . GLN B  1 73  ? -42.399  -16.253 -86.253  1.00 29.55  ? 54   GLN B CD  1 
ATOM   2051  O  OE1 . GLN B  1 73  ? -42.788  -15.708 -85.225  1.00 38.50  ? 54   GLN B OE1 1 
ATOM   2052  N  NE2 . GLN B  1 73  ? -43.019  -16.108 -87.415  1.00 34.37  ? 54   GLN B NE2 1 
ATOM   2053  N  N   . GLN B  1 74  ? -37.393  -18.965 -86.421  1.00 24.75  ? 55   GLN B N   1 
ATOM   2054  C  CA  . GLN B  1 74  ? -36.732  -19.638 -87.536  1.00 31.73  ? 55   GLN B CA  1 
ATOM   2055  C  C   . GLN B  1 74  ? -37.767  -20.280 -88.444  1.00 34.84  ? 55   GLN B C   1 
ATOM   2056  O  O   . GLN B  1 74  ? -38.468  -21.225 -88.029  1.00 28.83  ? 55   GLN B O   1 
ATOM   2057  C  CB  . GLN B  1 74  ? -35.756  -20.704 -87.053  1.00 35.00  ? 55   GLN B CB  1 
ATOM   2058  C  CG  . GLN B  1 74  ? -35.072  -21.464 -88.179  1.00 33.79  ? 55   GLN B CG  1 
ATOM   2059  C  CD  . GLN B  1 74  ? -34.215  -22.603 -87.665  1.00 37.19  ? 55   GLN B CD  1 
ATOM   2060  O  OE1 . GLN B  1 74  ? -33.130  -22.376 -87.118  1.00 50.70  ? 55   GLN B OE1 1 
ATOM   2061  N  NE2 . GLN B  1 74  ? -34.702  -23.840 -87.820  1.00 24.14  ? 55   GLN B NE2 1 
ATOM   2062  N  N   . THR B  1 75  ? -37.849  -19.755 -89.674  1.00 30.69  ? 56   THR B N   1 
ATOM   2063  C  CA  . THR B  1 75  ? -38.820  -20.199 -90.659  1.00 23.87  ? 56   THR B CA  1 
ATOM   2064  C  C   . THR B  1 75  ? -38.121  -20.735 -91.922  1.00 27.63  ? 56   THR B C   1 
ATOM   2065  O  O   . THR B  1 75  ? -37.275  -20.064 -92.520  1.00 31.63  ? 56   THR B O   1 
ATOM   2066  C  CB  . THR B  1 75  ? -39.786  -19.078 -91.014  1.00 19.57  ? 56   THR B CB  1 
ATOM   2067  O  OG1 . THR B  1 75  ? -40.237  -18.432 -89.816  1.00 20.98  ? 56   THR B OG1 1 
ATOM   2068  C  CG2 . THR B  1 75  ? -40.987  -19.634 -91.774  1.00 17.47  ? 56   THR B CG2 1 
ATOM   2069  N  N   . THR B  1 76  ? -38.480  -21.948 -92.329  1.00 19.26  ? 57   THR B N   1 
ATOM   2070  C  CA  . THR B  1 76  ? -37.791  -22.601 -93.432  1.00 25.40  ? 57   THR B CA  1 
ATOM   2071  C  C   . THR B  1 76  ? -38.765  -23.207 -94.446  1.00 29.94  ? 57   THR B C   1 
ATOM   2072  O  O   . THR B  1 76  ? -39.716  -23.926 -94.087  1.00 30.26  ? 57   THR B O   1 
ATOM   2073  C  CB  . THR B  1 76  ? -36.800  -23.685 -92.932  1.00 37.71  ? 57   THR B CB  1 
ATOM   2074  O  OG1 . THR B  1 76  ? -35.897  -23.102 -91.980  1.00 41.92  ? 57   THR B OG1 1 
ATOM   2075  C  CG2 . THR B  1 76  ? -35.992  -24.254 -94.093  1.00 34.21  ? 57   THR B CG2 1 
ATOM   2076  N  N   . TRP B  1 77  ? -38.535  -22.908 -95.721  1.00 26.87  ? 58   TRP B N   1 
ATOM   2077  C  CA  . TRP B  1 77  ? -39.386  -23.454 -96.768  1.00 22.62  ? 58   TRP B CA  1 
ATOM   2078  C  C   . TRP B  1 77  ? -38.613  -23.561 -98.055  1.00 23.94  ? 58   TRP B C   1 
ATOM   2079  O  O   . TRP B  1 77  ? -37.412  -23.286 -98.104  1.00 20.70  ? 58   TRP B O   1 
ATOM   2080  C  CB  . TRP B  1 77  ? -40.645  -22.616 -96.943  1.00 19.26  ? 58   TRP B CB  1 
ATOM   2081  C  CG  . TRP B  1 77  ? -40.384  -21.265 -97.488  1.00 20.71  ? 58   TRP B CG  1 
ATOM   2082  C  CD1 . TRP B  1 77  ? -40.479  -20.882 -98.789  1.00 23.89  ? 58   TRP B CD1 1 
ATOM   2083  C  CD2 . TRP B  1 77  ? -39.975  -20.106 -96.756  1.00 19.45  ? 58   TRP B CD2 1 
ATOM   2084  N  NE1 . TRP B  1 77  ? -40.155  -19.553 -98.913  1.00 24.25  ? 58   TRP B NE1 1 
ATOM   2085  C  CE2 . TRP B  1 77  ? -39.846  -19.048 -97.682  1.00 17.41  ? 58   TRP B CE2 1 
ATOM   2086  C  CE3 . TRP B  1 77  ? -39.712  -19.856 -95.404  1.00 22.61  ? 58   TRP B CE3 1 
ATOM   2087  C  CZ2 . TRP B  1 77  ? -39.461  -17.756 -97.310  1.00 18.37  ? 58   TRP B CZ2 1 
ATOM   2088  C  CZ3 . TRP B  1 77  ? -39.326  -18.570 -95.025  1.00 24.16  ? 58   TRP B CZ3 1 
ATOM   2089  C  CH2 . TRP B  1 77  ? -39.195  -17.535 -95.981  1.00 23.83  ? 58   TRP B CH2 1 
ATOM   2090  N  N   . SER B  1 78  ? -39.300  -23.974 -99.103  1.00 36.80  ? 59   SER B N   1 
ATOM   2091  C  CA  . SER B  1 78  ? -38.638  -24.257 -100.370 1.00 40.28  ? 59   SER B CA  1 
ATOM   2092  C  C   . SER B  1 78  ? -39.319  -23.495 -101.501 1.00 33.34  ? 59   SER B C   1 
ATOM   2093  O  O   . SER B  1 78  ? -40.550  -23.514 -101.624 1.00 34.23  ? 59   SER B O   1 
ATOM   2094  C  CB  . SER B  1 78  ? -38.652  -25.770 -100.625 1.00 48.72  ? 59   SER B CB  1 
ATOM   2095  O  OG  . SER B  1 78  ? -37.816  -26.106 -101.709 1.00 61.25  ? 59   SER B OG  1 
ATOM   2096  N  N   . ASP B  1 79  ? -38.513  -22.803 -102.300 1.00 41.34  ? 60   ASP B N   1 
ATOM   2097  C  CA  . ASP B  1 79  ? -38.996  -22.131 -103.502 1.00 47.49  ? 60   ASP B CA  1 
ATOM   2098  C  C   . ASP B  1 79  ? -38.059  -22.442 -104.668 1.00 45.01  ? 60   ASP B C   1 
ATOM   2099  O  O   . ASP B  1 79  ? -37.035  -21.772 -104.839 1.00 43.11  ? 60   ASP B O   1 
ATOM   2100  C  CB  . ASP B  1 79  ? -39.055  -20.626 -103.270 1.00 59.84  ? 60   ASP B CB  1 
ATOM   2101  C  CG  . ASP B  1 79  ? -39.777  -19.873 -104.393 1.00 73.46  ? 60   ASP B CG  1 
ATOM   2102  O  OD1 . ASP B  1 79  ? -39.882  -20.410 -105.522 1.00 76.55  ? 60   ASP B OD1 1 
ATOM   2103  O  OD2 . ASP B  1 79  ? -40.244  -18.733 -104.139 1.00 78.21  ? 60   ASP B OD2 1 
ATOM   2104  N  N   . ARG B  1 80  ? -38.414  -23.456 -105.463 1.00 43.97  ? 61   ARG B N   1 
ATOM   2105  C  CA  . ARG B  1 80  ? -37.562  -23.906 -106.575 1.00 41.40  ? 61   ARG B CA  1 
ATOM   2106  C  C   . ARG B  1 80  ? -37.291  -22.817 -107.613 1.00 33.62  ? 61   ARG B C   1 
ATOM   2107  O  O   . ARG B  1 80  ? -36.239  -22.817 -108.248 1.00 26.58  ? 61   ARG B O   1 
ATOM   2108  C  CB  . ARG B  1 80  ? -38.132  -25.147 -107.247 1.00 47.68  ? 61   ARG B CB  1 
ATOM   2109  C  CG  . ARG B  1 80  ? -38.354  -26.303 -106.283 1.00 65.44  ? 61   ARG B CG  1 
ATOM   2110  C  CD  . ARG B  1 80  ? -37.053  -26.931 -105.795 1.00 77.23  ? 61   ARG B CD  1 
ATOM   2111  N  NE  . ARG B  1 80  ? -37.268  -27.759 -104.601 1.00 88.12  ? 61   ARG B NE  1 
ATOM   2112  C  CZ  . ARG B  1 80  ? -37.702  -29.020 -104.615 1.00 93.12  ? 61   ARG B CZ  1 
ATOM   2113  N  NH1 . ARG B  1 80  ? -37.979  -29.623 -105.770 1.00 92.97  ? 61   ARG B NH1 1 
ATOM   2114  N  NH2 . ARG B  1 80  ? -37.860  -29.681 -103.469 1.00 92.78  ? 61   ARG B NH2 1 
ATOM   2115  N  N   . THR B  1 81  ? -38.219  -21.869 -107.751 1.00 31.00  ? 62   THR B N   1 
ATOM   2116  C  CA  . THR B  1 81  ? -38.082  -20.808 -108.749 1.00 30.81  ? 62   THR B CA  1 
ATOM   2117  C  C   . THR B  1 81  ? -36.901  -19.893 -108.439 1.00 32.30  ? 62   THR B C   1 
ATOM   2118  O  O   . THR B  1 81  ? -36.578  -18.994 -109.222 1.00 34.98  ? 62   THR B O   1 
ATOM   2119  C  CB  . THR B  1 81  ? -39.390  -19.947 -108.893 1.00 49.73  ? 62   THR B CB  1 
ATOM   2120  O  OG1 . THR B  1 81  ? -39.449  -18.935 -107.873 1.00 42.69  ? 62   THR B OG1 1 
ATOM   2121  C  CG2 . THR B  1 81  ? -40.639  -20.825 -108.818 1.00 53.47  ? 62   THR B CG2 1 
ATOM   2122  N  N   . LEU B  1 82  ? -36.272  -20.104 -107.285 1.00 27.72  ? 63   LEU B N   1 
ATOM   2123  C  CA  . LEU B  1 82  ? -35.099  -19.313 -106.906 1.00 25.19  ? 63   LEU B CA  1 
ATOM   2124  C  C   . LEU B  1 82  ? -33.802  -20.100 -107.101 1.00 24.16  ? 63   LEU B C   1 
ATOM   2125  O  O   . LEU B  1 82  ? -32.701  -19.557 -106.988 1.00 24.89  ? 63   LEU B O   1 
ATOM   2126  C  CB  . LEU B  1 82  ? -35.204  -18.884 -105.457 1.00 26.55  ? 63   LEU B CB  1 
ATOM   2127  C  CG  . LEU B  1 82  ? -36.438  -18.096 -105.052 1.00 27.16  ? 63   LEU B CG  1 
ATOM   2128  C  CD1 . LEU B  1 82  ? -36.454  -18.008 -103.520 1.00 24.58  ? 63   LEU B CD1 1 
ATOM   2129  C  CD2 . LEU B  1 82  ? -36.365  -16.720 -105.673 1.00 29.83  ? 63   LEU B CD2 1 
ATOM   2130  N  N   . ALA B  1 83  ? -33.940  -21.388 -107.378 1.00 25.47  ? 64   ALA B N   1 
ATOM   2131  C  CA  . ALA B  1 83  ? -32.783  -22.262 -107.544 1.00 32.79  ? 64   ALA B CA  1 
ATOM   2132  C  C   . ALA B  1 83  ? -31.864  -21.840 -108.706 1.00 36.16  ? 64   ALA B C   1 
ATOM   2133  O  O   . ALA B  1 83  ? -32.294  -21.193 -109.667 1.00 22.74  ? 64   ALA B O   1 
ATOM   2134  C  CB  . ALA B  1 83  ? -33.229  -23.735 -107.692 1.00 22.81  ? 64   ALA B CB  1 
ATOM   2135  N  N   . TRP B  1 84  ? -30.588  -22.197 -108.583 1.00 40.64  ? 65   TRP B N   1 
ATOM   2136  C  CA  . TRP B  1 84  ? -29.593  -21.898 -109.608 1.00 39.74  ? 65   TRP B CA  1 
ATOM   2137  C  C   . TRP B  1 84  ? -28.512  -22.974 -109.619 1.00 42.08  ? 65   TRP B C   1 
ATOM   2138  O  O   . TRP B  1 84  ? -28.356  -23.720 -108.643 1.00 49.00  ? 65   TRP B O   1 
ATOM   2139  C  CB  . TRP B  1 84  ? -28.971  -20.490 -109.419 1.00 22.53  ? 65   TRP B CB  1 
ATOM   2140  C  CG  . TRP B  1 84  ? -28.035  -20.335 -108.216 1.00 34.17  ? 65   TRP B CG  1 
ATOM   2141  C  CD1 . TRP B  1 84  ? -26.685  -20.604 -108.168 1.00 33.26  ? 65   TRP B CD1 1 
ATOM   2142  C  CD2 . TRP B  1 84  ? -28.391  -19.864 -106.910 1.00 34.73  ? 65   TRP B CD2 1 
ATOM   2143  N  NE1 . TRP B  1 84  ? -26.191  -20.338 -106.910 1.00 31.59  ? 65   TRP B NE1 1 
ATOM   2144  C  CE2 . TRP B  1 84  ? -27.218  -19.883 -106.119 1.00 35.68  ? 65   TRP B CE2 1 
ATOM   2145  C  CE3 . TRP B  1 84  ? -29.590  -19.439 -106.328 1.00 21.91  ? 65   TRP B CE3 1 
ATOM   2146  C  CZ2 . TRP B  1 84  ? -27.209  -19.488 -104.776 1.00 33.16  ? 65   TRP B CZ2 1 
ATOM   2147  C  CZ3 . TRP B  1 84  ? -29.584  -19.052 -105.005 1.00 30.63  ? 65   TRP B CZ3 1 
ATOM   2148  C  CH2 . TRP B  1 84  ? -28.397  -19.078 -104.239 1.00 29.20  ? 65   TRP B CH2 1 
ATOM   2149  N  N   . ASN B  1 85  ? -27.775  -23.044 -110.729 1.00 42.96  ? 66   ASN B N   1 
ATOM   2150  C  CA  . ASN B  1 85  ? -26.668  -23.979 -110.898 1.00 47.28  ? 66   ASN B CA  1 
ATOM   2151  C  C   . ASN B  1 85  ? -25.451  -23.502 -110.114 1.00 54.99  ? 66   ASN B C   1 
ATOM   2152  O  O   . ASN B  1 85  ? -24.795  -22.545 -110.512 1.00 59.00  ? 66   ASN B O   1 
ATOM   2153  C  CB  . ASN B  1 85  ? -26.333  -24.084 -112.380 1.00 55.60  ? 66   ASN B CB  1 
ATOM   2154  C  CG  . ASN B  1 85  ? -25.408  -25.226 -112.689 1.00 64.61  ? 66   ASN B CG  1 
ATOM   2155  O  OD1 . ASN B  1 85  ? -24.705  -25.728 -111.800 1.00 63.46  ? 66   ASN B OD1 1 
ATOM   2156  N  ND2 . ASN B  1 85  ? -25.392  -25.652 -113.965 1.00 69.12  ? 66   ASN B ND2 1 
ATOM   2157  N  N   . SER B  1 86  ? -25.148  -24.172 -109.002 1.00 60.79  ? 67   SER B N   1 
ATOM   2158  C  CA  . SER B  1 86  ? -24.100  -23.722 -108.082 1.00 62.48  ? 67   SER B CA  1 
ATOM   2159  C  C   . SER B  1 86  ? -22.724  -24.306 -108.379 1.00 63.73  ? 67   SER B C   1 
ATOM   2160  O  O   . SER B  1 86  ? -21.863  -24.320 -107.509 1.00 58.52  ? 67   SER B O   1 
ATOM   2161  C  CB  . SER B  1 86  ? -24.474  -24.062 -106.633 1.00 65.42  ? 67   SER B CB  1 
ATOM   2162  O  OG  . SER B  1 86  ? -24.196  -25.420 -106.345 1.00 68.60  ? 67   SER B OG  1 
ATOM   2163  N  N   . SER B  1 87  ? -22.522  -24.785 -109.602 1.00 78.73  ? 68   SER B N   1 
ATOM   2164  C  CA  . SER B  1 87  ? -21.259  -25.426 -109.987 1.00 85.77  ? 68   SER B CA  1 
ATOM   2165  C  C   . SER B  1 87  ? -20.042  -24.543 -109.697 1.00 81.60  ? 68   SER B C   1 
ATOM   2166  O  O   . SER B  1 87  ? -19.104  -24.966 -109.013 1.00 80.58  ? 68   SER B O   1 
ATOM   2167  C  CB  . SER B  1 87  ? -21.291  -25.828 -111.464 1.00 90.61  ? 68   SER B CB  1 
ATOM   2168  O  OG  . SER B  1 87  ? -21.746  -24.749 -112.266 1.00 96.48  ? 68   SER B OG  1 
ATOM   2169  N  N   . HIS B  1 88  ? -20.069  -23.316 -110.213 1.00 75.84  ? 69   HIS B N   1 
ATOM   2170  C  CA  . HIS B  1 88  ? -18.984  -22.369 -109.980 1.00 70.95  ? 69   HIS B CA  1 
ATOM   2171  C  C   . HIS B  1 88  ? -19.562  -21.089 -109.409 1.00 57.23  ? 69   HIS B C   1 
ATOM   2172  O  O   . HIS B  1 88  ? -19.159  -19.988 -109.772 1.00 53.43  ? 69   HIS B O   1 
ATOM   2173  C  CB  . HIS B  1 88  ? -18.204  -22.087 -111.280 1.00 79.29  ? 69   HIS B CB  1 
ATOM   2174  C  CG  . HIS B  1 88  ? -17.573  -23.305 -111.884 1.00 83.57  ? 69   HIS B CG  1 
ATOM   2175  N  ND1 . HIS B  1 88  ? -18.243  -24.130 -112.764 1.00 84.62  ? 69   HIS B ND1 1 
ATOM   2176  C  CD2 . HIS B  1 88  ? -16.345  -23.851 -111.715 1.00 85.17  ? 69   HIS B CD2 1 
ATOM   2177  C  CE1 . HIS B  1 88  ? -17.452  -25.128 -113.116 1.00 86.35  ? 69   HIS B CE1 1 
ATOM   2178  N  NE2 . HIS B  1 88  ? -16.294  -24.981 -112.497 1.00 87.60  ? 69   HIS B NE2 1 
ATOM   2179  N  N   . SER B  1 89  ? -20.518  -21.254 -108.504 1.00 53.74  ? 70   SER B N   1 
ATOM   2180  C  CA  . SER B  1 89  ? -21.266  -20.141 -107.930 1.00 50.31  ? 70   SER B CA  1 
ATOM   2181  C  C   . SER B  1 89  ? -21.333  -20.302 -106.410 1.00 47.73  ? 70   SER B C   1 
ATOM   2182  O  O   . SER B  1 89  ? -21.014  -21.367 -105.884 1.00 46.49  ? 70   SER B O   1 
ATOM   2183  C  CB  . SER B  1 89  ? -22.682  -20.130 -108.516 1.00 52.00  ? 70   SER B CB  1 
ATOM   2184  O  OG  . SER B  1 89  ? -22.646  -20.249 -109.921 1.00 59.26  ? 70   SER B OG  1 
ATOM   2185  N  N   . PRO B  1 90  ? -21.746  -19.240 -105.703 1.00 44.43  ? 71   PRO B N   1 
ATOM   2186  C  CA  . PRO B  1 90  ? -22.016  -19.356 -104.269 1.00 39.94  ? 71   PRO B CA  1 
ATOM   2187  C  C   . PRO B  1 90  ? -23.128  -20.362 -104.013 1.00 38.32  ? 71   PRO B C   1 
ATOM   2188  O  O   . PRO B  1 90  ? -23.986  -20.536 -104.885 1.00 38.80  ? 71   PRO B O   1 
ATOM   2189  C  CB  . PRO B  1 90  ? -22.505  -17.953 -103.907 1.00 44.52  ? 71   PRO B CB  1 
ATOM   2190  C  CG  . PRO B  1 90  ? -21.850  -17.046 -104.927 1.00 42.95  ? 71   PRO B CG  1 
ATOM   2191  C  CD  . PRO B  1 90  ? -21.811  -17.842 -106.184 1.00 43.96  ? 71   PRO B CD  1 
ATOM   2192  N  N   . ASP B  1 91  ? -23.127  -20.985 -102.836 1.00 39.18  ? 72   ASP B N   1 
ATOM   2193  C  CA  . ASP B  1 91  ? -24.172  -21.940 -102.464 1.00 42.42  ? 72   ASP B CA  1 
ATOM   2194  C  C   . ASP B  1 91  ? -25.365  -21.228 -101.851 1.00 33.62  ? 72   ASP B C   1 
ATOM   2195  O  O   . ASP B  1 91  ? -26.465  -21.796 -101.750 1.00 33.74  ? 72   ASP B O   1 
ATOM   2196  C  CB  . ASP B  1 91  ? -23.633  -22.952 -101.449 1.00 51.10  ? 72   ASP B CB  1 
ATOM   2197  C  CG  . ASP B  1 91  ? -22.235  -23.420 -101.780 1.00 55.86  ? 72   ASP B CG  1 
ATOM   2198  O  OD1 . ASP B  1 91  ? -21.949  -23.608 -102.972 1.00 61.98  ? 72   ASP B OD1 1 
ATOM   2199  O  OD2 . ASP B  1 91  ? -21.419  -23.590 -100.855 1.00 56.79  ? 72   ASP B OD2 1 
ATOM   2200  N  N   . GLN B  1 92  ? -25.139  -19.982 -101.446 1.00 20.19  ? 73   GLN B N   1 
ATOM   2201  C  CA  . GLN B  1 92  ? -26.095  -19.303 -100.596 1.00 28.56  ? 73   GLN B CA  1 
ATOM   2202  C  C   . GLN B  1 92  ? -25.952  -17.820 -100.755 1.00 23.70  ? 73   GLN B C   1 
ATOM   2203  O  O   . GLN B  1 92  ? -24.835  -17.333 -100.928 1.00 25.58  ? 73   GLN B O   1 
ATOM   2204  C  CB  . GLN B  1 92  ? -25.811  -19.680 -99.135  1.00 41.77  ? 73   GLN B CB  1 
ATOM   2205  C  CG  . GLN B  1 92  ? -26.756  -19.086 -98.109  1.00 48.65  ? 73   GLN B CG  1 
ATOM   2206  C  CD  . GLN B  1 92  ? -26.344  -19.416 -96.681  1.00 50.07  ? 73   GLN B CD  1 
ATOM   2207  O  OE1 . GLN B  1 92  ? -25.523  -18.712 -96.095  1.00 56.82  ? 73   GLN B OE1 1 
ATOM   2208  N  NE2 . GLN B  1 92  ? -26.909  -20.486 -96.118  1.00 42.72  ? 73   GLN B NE2 1 
ATOM   2209  N  N   . VAL B  1 93  ? -27.076  -17.107 -100.681 1.00 15.09  ? 74   VAL B N   1 
ATOM   2210  C  CA  . VAL B  1 93  ? -27.057  -15.642 -100.656 1.00 24.78  ? 74   VAL B CA  1 
ATOM   2211  C  C   . VAL B  1 93  ? -28.029  -15.139 -99.597  1.00 27.14  ? 74   VAL B C   1 
ATOM   2212  O  O   . VAL B  1 93  ? -28.899  -15.891 -99.124  1.00 22.72  ? 74   VAL B O   1 
ATOM   2213  C  CB  . VAL B  1 93  ? -27.428  -15.014 -102.034 1.00 22.94  ? 74   VAL B CB  1 
ATOM   2214  C  CG1 . VAL B  1 93  ? -26.312  -15.255 -103.081 1.00 17.93  ? 74   VAL B CG1 1 
ATOM   2215  C  CG2 . VAL B  1 93  ? -28.790  -15.532 -102.514 1.00 14.68  ? 74   VAL B CG2 1 
ATOM   2216  N  N   . SER B  1 94  ? -27.869  -13.867 -99.247  1.00 27.44  ? 75   SER B N   1 
ATOM   2217  C  CA  . SER B  1 94  ? -28.771  -13.182 -98.353  1.00 23.12  ? 75   SER B CA  1 
ATOM   2218  C  C   . SER B  1 94  ? -29.624  -12.212 -99.155  1.00 31.16  ? 75   SER B C   1 
ATOM   2219  O  O   . SER B  1 94  ? -29.110  -11.363 -99.895  1.00 37.00  ? 75   SER B O   1 
ATOM   2220  C  CB  . SER B  1 94  ? -27.969  -12.440 -97.278  1.00 29.25  ? 75   SER B CB  1 
ATOM   2221  O  OG  . SER B  1 94  ? -27.339  -13.357 -96.386  1.00 30.59  ? 75   SER B OG  1 
ATOM   2222  N  N   . VAL B  1 95  ? -30.934  -12.336 -99.000  1.00 32.01  ? 76   VAL B N   1 
ATOM   2223  C  CA  . VAL B  1 95  ? -31.855  -11.587 -99.828  1.00 32.88  ? 76   VAL B CA  1 
ATOM   2224  C  C   . VAL B  1 95  ? -32.829  -10.859 -98.931  1.00 29.26  ? 76   VAL B C   1 
ATOM   2225  O  O   . VAL B  1 95  ? -33.319  -11.430 -97.962  1.00 29.02  ? 76   VAL B O   1 
ATOM   2226  C  CB  . VAL B  1 95  ? -32.629  -12.549 -100.764 1.00 33.93  ? 76   VAL B CB  1 
ATOM   2227  C  CG1 . VAL B  1 95  ? -33.540  -11.790 -101.707 1.00 35.94  ? 76   VAL B CG1 1 
ATOM   2228  C  CG2 . VAL B  1 95  ? -31.662  -13.398 -101.538 1.00 33.45  ? 76   VAL B CG2 1 
ATOM   2229  N  N   . PRO B  1 96  ? -33.130  -9.598  -99.267  1.00 27.98  ? 77   PRO B N   1 
ATOM   2230  C  CA  . PRO B  1 96  ? -34.219  -8.866  -98.609  1.00 27.85  ? 77   PRO B CA  1 
ATOM   2231  C  C   . PRO B  1 96  ? -35.544  -9.632  -98.745  1.00 28.13  ? 77   PRO B C   1 
ATOM   2232  O  O   . PRO B  1 96  ? -35.896  -10.039 -99.853  1.00 28.91  ? 77   PRO B O   1 
ATOM   2233  C  CB  . PRO B  1 96  ? -34.279  -7.546  -99.406  1.00 15.38  ? 77   PRO B CB  1 
ATOM   2234  C  CG  . PRO B  1 96  ? -32.909  -7.370  -99.931  1.00 14.20  ? 77   PRO B CG  1 
ATOM   2235  C  CD  . PRO B  1 96  ? -32.443  -8.774  -100.271 1.00 12.13  ? 77   PRO B CD  1 
ATOM   2236  N  N   . ILE B  1 97  ? -36.273  -9.813  -97.648  1.00 22.28  ? 78   ILE B N   1 
ATOM   2237  C  CA  . ILE B  1 97  ? -37.543  -10.534 -97.727  1.00 20.20  ? 78   ILE B CA  1 
ATOM   2238  C  C   . ILE B  1 97  ? -38.579  -9.831  -98.600  1.00 29.31  ? 78   ILE B C   1 
ATOM   2239  O  O   . ILE B  1 97  ? -39.537  -10.458 -99.071  1.00 38.42  ? 78   ILE B O   1 
ATOM   2240  C  CB  . ILE B  1 97  ? -38.147  -10.834 -96.349  1.00 15.07  ? 78   ILE B CB  1 
ATOM   2241  C  CG1 . ILE B  1 97  ? -38.358  -9.551  -95.567  1.00 11.42  ? 78   ILE B CG1 1 
ATOM   2242  C  CG2 . ILE B  1 97  ? -37.264  -11.835 -95.555  1.00 16.21  ? 78   ILE B CG2 1 
ATOM   2243  C  CD1 . ILE B  1 97  ? -39.307  -9.739  -94.368  1.00 15.98  ? 78   ILE B CD1 1 
ATOM   2244  N  N   . SER B  1 98  ? -38.393  -8.537  -98.835  1.00 28.32  ? 79   SER B N   1 
ATOM   2245  C  CA  . SER B  1 98  ? -39.297  -7.818  -99.734  1.00 27.06  ? 79   SER B CA  1 
ATOM   2246  C  C   . SER B  1 98  ? -39.160  -8.310  -101.190 1.00 26.28  ? 79   SER B C   1 
ATOM   2247  O  O   . SER B  1 98  ? -40.054  -8.095  -101.998 1.00 21.01  ? 79   SER B O   1 
ATOM   2248  C  CB  . SER B  1 98  ? -39.081  -6.314  -99.644  1.00 22.23  ? 79   SER B CB  1 
ATOM   2249  O  OG  . SER B  1 98  ? -37.718  -6.007  -99.805  1.00 26.01  ? 79   SER B OG  1 
ATOM   2250  N  N   . SER B  1 99  ? -38.055  -8.994  -101.494 1.00 12.15  ? 80   SER B N   1 
ATOM   2251  C  CA  . SER B  1 99  ? -37.813  -9.564  -102.801 1.00 12.51  ? 80   SER B CA  1 
ATOM   2252  C  C   . SER B  1 99  ? -38.156  -11.052 -102.861 1.00 29.78  ? 80   SER B C   1 
ATOM   2253  O  O   . SER B  1 99  ? -37.843  -11.728 -103.840 1.00 31.88  ? 80   SER B O   1 
ATOM   2254  C  CB  . SER B  1 99  ? -36.345  -9.399  -103.183 1.00 27.89  ? 80   SER B CB  1 
ATOM   2255  O  OG  . SER B  1 99  ? -35.981  -8.029  -103.307 1.00 29.20  ? 80   SER B OG  1 
ATOM   2256  N  N   . LEU B  1 100 ? -38.783  -11.580 -101.820 1.00 24.91  ? 81   LEU B N   1 
ATOM   2257  C  CA  . LEU B  1 100 ? -39.095  -13.006 -101.784 1.00 22.98  ? 81   LEU B CA  1 
ATOM   2258  C  C   . LEU B  1 100 ? -40.527  -13.213 -101.360 1.00 21.48  ? 81   LEU B C   1 
ATOM   2259  O  O   . LEU B  1 100 ? -41.092  -12.400 -100.638 1.00 27.45  ? 81   LEU B O   1 
ATOM   2260  C  CB  . LEU B  1 100 ? -38.229  -13.732 -100.755 1.00 20.88  ? 81   LEU B CB  1 
ATOM   2261  C  CG  . LEU B  1 100 ? -36.738  -13.779 -100.994 1.00 21.61  ? 81   LEU B CG  1 
ATOM   2262  C  CD1 . LEU B  1 100 ? -36.129  -14.384 -99.730  1.00 14.27  ? 81   LEU B CD1 1 
ATOM   2263  C  CD2 . LEU B  1 100 ? -36.434  -14.606 -102.248 1.00 22.56  ? 81   LEU B CD2 1 
ATOM   2264  N  N   . TRP B  1 101 ? -41.116  -14.323 -101.769 1.00 18.32  ? 82   TRP B N   1 
ATOM   2265  C  CA  . TRP B  1 101 ? -42.372  -14.712 -101.171 1.00 22.00  ? 82   TRP B CA  1 
ATOM   2266  C  C   . TRP B  1 101 ? -42.058  -15.263 -99.809  1.00 30.38  ? 82   TRP B C   1 
ATOM   2267  O  O   . TRP B  1 101 ? -41.111  -16.032 -99.643  1.00 35.21  ? 82   TRP B O   1 
ATOM   2268  C  CB  . TRP B  1 101 ? -43.080  -15.782 -101.979 1.00 14.07  ? 82   TRP B CB  1 
ATOM   2269  C  CG  . TRP B  1 101 ? -44.298  -16.311 -101.303 1.00 19.88  ? 82   TRP B CG  1 
ATOM   2270  C  CD1 . TRP B  1 101 ? -45.577  -15.853 -101.448 1.00 22.60  ? 82   TRP B CD1 1 
ATOM   2271  C  CD2 . TRP B  1 101 ? -44.361  -17.401 -100.349 1.00 17.30  ? 82   TRP B CD2 1 
ATOM   2272  N  NE1 . TRP B  1 101 ? -46.435  -16.603 -100.663 1.00 19.96  ? 82   TRP B NE1 1 
ATOM   2273  C  CE2 . TRP B  1 101 ? -45.722  -17.541 -99.998  1.00 14.46  ? 82   TRP B CE2 1 
ATOM   2274  C  CE3 . TRP B  1 101 ? -43.411  -18.242 -99.787  1.00 15.68  ? 82   TRP B CE3 1 
ATOM   2275  C  CZ2 . TRP B  1 101 ? -46.131  -18.514 -99.082  1.00 14.69  ? 82   TRP B CZ2 1 
ATOM   2276  C  CZ3 . TRP B  1 101 ? -43.833  -19.209 -98.893  1.00 14.80  ? 82   TRP B CZ3 1 
ATOM   2277  C  CH2 . TRP B  1 101 ? -45.183  -19.334 -98.547  1.00 18.90  ? 82   TRP B CH2 1 
ATOM   2278  N  N   . VAL B  1 102 ? -42.874  -14.869 -98.839  1.00 31.90  ? 83   VAL B N   1 
ATOM   2279  C  CA  . VAL B  1 102 ? -42.685  -15.279 -97.460  1.00 30.73  ? 83   VAL B CA  1 
ATOM   2280  C  C   . VAL B  1 102 ? -44.014  -15.806 -96.952  1.00 25.70  ? 83   VAL B C   1 
ATOM   2281  O  O   . VAL B  1 102 ? -45.065  -15.214 -97.238  1.00 29.24  ? 83   VAL B O   1 
ATOM   2282  C  CB  . VAL B  1 102 ? -42.192  -14.080 -96.610  1.00 21.72  ? 83   VAL B CB  1 
ATOM   2283  C  CG1 . VAL B  1 102 ? -42.445  -14.304 -95.111  1.00 21.16  ? 83   VAL B CG1 1 
ATOM   2284  C  CG2 . VAL B  1 102 ? -40.713  -13.815 -96.893  1.00 13.74  ? 83   VAL B CG2 1 
ATOM   2285  N  N   . PRO B  1 103 ? -43.982  -16.938 -96.233  1.00 19.65  ? 84   PRO B N   1 
ATOM   2286  C  CA  . PRO B  1 103 ? -45.217  -17.444 -95.612  1.00 26.74  ? 84   PRO B CA  1 
ATOM   2287  C  C   . PRO B  1 103 ? -45.883  -16.393 -94.673  1.00 25.46  ? 84   PRO B C   1 
ATOM   2288  O  O   . PRO B  1 103 ? -45.183  -15.671 -93.930  1.00 21.95  ? 84   PRO B O   1 
ATOM   2289  C  CB  . PRO B  1 103 ? -44.758  -18.722 -94.861  1.00 14.30  ? 84   PRO B CB  1 
ATOM   2290  C  CG  . PRO B  1 103 ? -43.272  -18.657 -94.817  1.00 18.26  ? 84   PRO B CG  1 
ATOM   2291  C  CD  . PRO B  1 103 ? -42.823  -17.808 -95.983  1.00 17.99  ? 84   PRO B CD  1 
ATOM   2292  N  N   . ASP B  1 104 ? -47.215  -16.292 -94.748  1.00 23.21  ? 85   ASP B N   1 
ATOM   2293  C  CA  . ASP B  1 104 ? -47.965  -15.316 -93.945  1.00 22.07  ? 85   ASP B CA  1 
ATOM   2294  C  C   . ASP B  1 104 ? -48.265  -15.823 -92.517  1.00 19.55  ? 85   ASP B C   1 
ATOM   2295  O  O   . ASP B  1 104 ? -49.414  -15.887 -92.086  1.00 22.76  ? 85   ASP B O   1 
ATOM   2296  C  CB  . ASP B  1 104 ? -49.240  -14.877 -94.667  1.00 19.93  ? 85   ASP B CB  1 
ATOM   2297  C  CG  . ASP B  1 104 ? -50.197  -16.021 -94.913  1.00 24.13  ? 85   ASP B CG  1 
ATOM   2298  O  OD1 . ASP B  1 104 ? -49.776  -17.192 -94.893  1.00 32.53  ? 85   ASP B OD1 1 
ATOM   2299  O  OD2 . ASP B  1 104 ? -51.388  -15.763 -95.144  1.00 25.54  ? 85   ASP B OD2 1 
ATOM   2300  N  N   . LEU B  1 105 ? -47.222  -16.208 -91.799  1.00 17.83  ? 86   LEU B N   1 
ATOM   2301  C  CA  . LEU B  1 105 ? -47.404  -16.734 -90.469  1.00 22.89  ? 86   LEU B CA  1 
ATOM   2302  C  C   . LEU B  1 105 ? -47.902  -15.632 -89.511  1.00 25.28  ? 86   LEU B C   1 
ATOM   2303  O  O   . LEU B  1 105 ? -47.506  -14.471 -89.606  1.00 30.07  ? 86   LEU B O   1 
ATOM   2304  C  CB  . LEU B  1 105 ? -46.094  -17.359 -89.976  1.00 18.43  ? 86   LEU B CB  1 
ATOM   2305  C  CG  . LEU B  1 105 ? -45.548  -18.522 -90.789  1.00 17.23  ? 86   LEU B CG  1 
ATOM   2306  C  CD1 . LEU B  1 105 ? -44.285  -19.085 -90.144  1.00 17.68  ? 86   LEU B CD1 1 
ATOM   2307  C  CD2 . LEU B  1 105 ? -46.631  -19.622 -90.991  1.00 20.05  ? 86   LEU B CD2 1 
ATOM   2308  N  N   . ALA B  1 106 ? -48.795  -16.001 -88.606  1.00 21.24  ? 87   ALA B N   1 
ATOM   2309  C  CA  . ALA B  1 106 ? -49.182  -15.110 -87.518  1.00 26.72  ? 87   ALA B CA  1 
ATOM   2310  C  C   . ALA B  1 106 ? -49.326  -15.870 -86.197  1.00 26.82  ? 87   ALA B C   1 
ATOM   2311  O  O   . ALA B  1 106 ? -49.676  -17.070 -86.176  1.00 29.78  ? 87   ALA B O   1 
ATOM   2312  C  CB  . ALA B  1 106 ? -50.468  -14.406 -87.857  1.00 26.39  ? 87   ALA B CB  1 
ATOM   2313  N  N   . ALA B  1 107 ? -49.062  -15.166 -85.100  1.00 20.24  ? 88   ALA B N   1 
ATOM   2314  C  CA  . ALA B  1 107 ? -49.286  -15.712 -83.767  1.00 17.61  ? 88   ALA B CA  1 
ATOM   2315  C  C   . ALA B  1 107 ? -50.729  -15.380 -83.397  1.00 22.85  ? 88   ALA B C   1 
ATOM   2316  O  O   . ALA B  1 107 ? -51.069  -14.206 -83.209  1.00 26.52  ? 88   ALA B O   1 
ATOM   2317  C  CB  . ALA B  1 107 ? -48.320  -15.119 -82.800  1.00 12.45  ? 88   ALA B CB  1 
ATOM   2318  N  N   . TYR B  1 108 ? -51.581  -16.410 -83.322  1.00 21.86  ? 89   TYR B N   1 
ATOM   2319  C  CA  . TYR B  1 108 ? -53.012  -16.231 -83.019  1.00 16.10  ? 89   TYR B CA  1 
ATOM   2320  C  C   . TYR B  1 108 ? -53.307  -15.543 -81.699  1.00 17.05  ? 89   TYR B C   1 
ATOM   2321  O  O   . TYR B  1 108 ? -54.264  -14.797 -81.602  1.00 19.47  ? 89   TYR B O   1 
ATOM   2322  C  CB  . TYR B  1 108 ? -53.743  -17.574 -83.049  1.00 18.34  ? 89   TYR B CB  1 
ATOM   2323  C  CG  . TYR B  1 108 ? -54.006  -18.045 -84.454  1.00 33.38  ? 89   TYR B CG  1 
ATOM   2324  C  CD1 . TYR B  1 108 ? -52.957  -18.474 -85.277  1.00 36.69  ? 89   TYR B CD1 1 
ATOM   2325  C  CD2 . TYR B  1 108 ? -55.295  -18.027 -84.988  1.00 39.27  ? 89   TYR B CD2 1 
ATOM   2326  C  CE1 . TYR B  1 108 ? -53.193  -18.889 -86.580  1.00 36.48  ? 89   TYR B CE1 1 
ATOM   2327  C  CE2 . TYR B  1 108 ? -55.536  -18.444 -86.305  1.00 43.07  ? 89   TYR B CE2 1 
ATOM   2328  C  CZ  . TYR B  1 108 ? -54.484  -18.872 -87.083  1.00 40.51  ? 89   TYR B CZ  1 
ATOM   2329  O  OH  . TYR B  1 108 ? -54.736  -19.287 -88.356  1.00 46.45  ? 89   TYR B OH  1 
ATOM   2330  N  N   . ASN B  1 109 ? -52.487  -15.802 -80.682  1.00 21.48  ? 90   ASN B N   1 
ATOM   2331  C  CA  . ASN B  1 109 ? -52.703  -15.224 -79.368  1.00 24.07  ? 90   ASN B CA  1 
ATOM   2332  C  C   . ASN B  1 109 ? -51.771  -14.045 -79.064  1.00 22.33  ? 90   ASN B C   1 
ATOM   2333  O  O   . ASN B  1 109 ? -51.619  -13.628 -77.903  1.00 19.81  ? 90   ASN B O   1 
ATOM   2334  C  CB  . ASN B  1 109 ? -52.600  -16.306 -78.297  1.00 27.67  ? 90   ASN B CB  1 
ATOM   2335  C  CG  . ASN B  1 109 ? -51.279  -17.051 -78.345  1.00 34.81  ? 90   ASN B CG  1 
ATOM   2336  O  OD1 . ASN B  1 109 ? -50.760  -17.368 -79.432  1.00 32.15  ? 90   ASN B OD1 1 
ATOM   2337  N  ND2 . ASN B  1 109 ? -50.716  -17.334 -77.159  1.00 37.41  ? 90   ASN B ND2 1 
ATOM   2338  N  N   . ALA B  1 110 ? -51.146  -13.506 -80.107  1.00 21.37  ? 91   ALA B N   1 
ATOM   2339  C  CA  . ALA B  1 110 ? -50.356  -12.275 -79.966  1.00 24.03  ? 91   ALA B CA  1 
ATOM   2340  C  C   . ALA B  1 110 ? -51.300  -11.101 -79.749  1.00 23.71  ? 91   ALA B C   1 
ATOM   2341  O  O   . ALA B  1 110 ? -52.401  -11.078 -80.295  1.00 26.32  ? 91   ALA B O   1 
ATOM   2342  C  CB  . ALA B  1 110 ? -49.501  -12.037 -81.195  1.00 24.10  ? 91   ALA B CB  1 
ATOM   2343  N  N   . ILE B  1 111 ? -50.888  -10.141 -78.933  1.00 23.35  ? 92   ILE B N   1 
ATOM   2344  C  CA  . ILE B  1 111 ? -51.738  -8.988  -78.629  1.00 23.69  ? 92   ILE B CA  1 
ATOM   2345  C  C   . ILE B  1 111 ? -50.985  -7.705  -78.915  1.00 22.43  ? 92   ILE B C   1 
ATOM   2346  O  O   . ILE B  1 111 ? -51.433  -6.617  -78.582  1.00 26.33  ? 92   ILE B O   1 
ATOM   2347  C  CB  . ILE B  1 111 ? -52.235  -8.987  -77.156  1.00 25.61  ? 92   ILE B CB  1 
ATOM   2348  C  CG1 . ILE B  1 111 ? -51.057  -8.938  -76.172  1.00 23.84  ? 92   ILE B CG1 1 
ATOM   2349  C  CG2 . ILE B  1 111 ? -53.125  -10.184 -76.899  1.00 29.63  ? 92   ILE B CG2 1 
ATOM   2350  C  CD1 . ILE B  1 111 ? -51.470  -8.876  -74.719  1.00 21.29  ? 92   ILE B CD1 1 
ATOM   2351  N  N   . SER B  1 112 ? -49.809  -7.854  -79.507  1.00 19.25  ? 93   SER B N   1 
ATOM   2352  C  CA  . SER B  1 112 ? -49.084  -6.726  -80.064  1.00 22.21  ? 93   SER B CA  1 
ATOM   2353  C  C   . SER B  1 112 ? -48.575  -7.195  -81.415  1.00 30.21  ? 93   SER B C   1 
ATOM   2354  O  O   . SER B  1 112 ? -48.327  -8.382  -81.597  1.00 30.61  ? 93   SER B O   1 
ATOM   2355  C  CB  . SER B  1 112 ? -47.910  -6.333  -79.172  1.00 20.33  ? 93   SER B CB  1 
ATOM   2356  O  OG  . SER B  1 112 ? -46.844  -7.261  -79.289  1.00 19.96  ? 93   SER B OG  1 
ATOM   2357  N  N   . LYS B  1 113 ? -48.438  -6.297  -82.383  1.00 36.65  ? 94   LYS B N   1 
ATOM   2358  C  CA  . LYS B  1 113 ? -47.817  -6.701  -83.648  1.00 37.53  ? 94   LYS B CA  1 
ATOM   2359  C  C   . LYS B  1 113 ? -46.331  -6.972  -83.440  1.00 37.24  ? 94   LYS B C   1 
ATOM   2360  O  O   . LYS B  1 113 ? -45.693  -6.346  -82.593  1.00 43.05  ? 94   LYS B O   1 
ATOM   2361  C  CB  . LYS B  1 113 ? -48.062  -5.688  -84.772  1.00 40.90  ? 94   LYS B CB  1 
ATOM   2362  C  CG  . LYS B  1 113 ? -47.239  -4.427  -84.735  1.00 46.17  ? 94   LYS B CG  1 
ATOM   2363  C  CD  . LYS B  1 113 ? -47.780  -3.446  -85.761  1.00 49.14  ? 94   LYS B CD  1 
ATOM   2364  C  CE  . LYS B  1 113 ? -48.015  -4.163  -87.104  1.00 53.15  ? 94   LYS B CE  1 
ATOM   2365  N  NZ  . LYS B  1 113 ? -48.559  -3.281  -88.181  1.00 54.83  ? 94   LYS B NZ  1 
ATOM   2366  N  N   . PRO B  1 114 ? -45.784  -7.937  -84.190  1.00 33.45  ? 95   PRO B N   1 
ATOM   2367  C  CA  . PRO B  1 114 ? -44.394  -8.368  -83.979  1.00 29.37  ? 95   PRO B CA  1 
ATOM   2368  C  C   . PRO B  1 114 ? -43.384  -7.250  -84.239  1.00 27.18  ? 95   PRO B C   1 
ATOM   2369  O  O   . PRO B  1 114 ? -43.410  -6.595  -85.272  1.00 35.70  ? 95   PRO B O   1 
ATOM   2370  C  CB  . PRO B  1 114 ? -44.214  -9.505  -84.994  1.00 27.69  ? 95   PRO B CB  1 
ATOM   2371  C  CG  . PRO B  1 114 ? -45.322  -9.311  -85.996  1.00 28.34  ? 95   PRO B CG  1 
ATOM   2372  C  CD  . PRO B  1 114 ? -46.462  -8.728  -85.232  1.00 29.80  ? 95   PRO B CD  1 
ATOM   2373  N  N   . GLU B  1 115 ? -42.526  -7.007  -83.264  1.00 27.08  ? 96   GLU B N   1 
ATOM   2374  C  CA  . GLU B  1 115 ? -41.436  -6.060  -83.404  1.00 25.40  ? 96   GLU B CA  1 
ATOM   2375  C  C   . GLU B  1 115 ? -40.239  -6.880  -83.899  1.00 21.83  ? 96   GLU B C   1 
ATOM   2376  O  O   . GLU B  1 115 ? -39.672  -7.733  -83.182  1.00 17.51  ? 96   GLU B O   1 
ATOM   2377  C  CB  . GLU B  1 115 ? -41.138  -5.389  -82.047  1.00 36.96  ? 96   GLU B CB  1 
ATOM   2378  C  CG  . GLU B  1 115 ? -40.142  -4.216  -82.074  1.00 46.89  ? 96   GLU B CG  1 
ATOM   2379  C  CD  . GLU B  1 115 ? -39.881  -3.633  -80.672  1.00 55.75  ? 96   GLU B CD  1 
ATOM   2380  O  OE1 . GLU B  1 115 ? -40.540  -4.104  -79.713  1.00 58.49  ? 96   GLU B OE1 1 
ATOM   2381  O  OE2 . GLU B  1 115 ? -39.023  -2.719  -80.523  1.00 57.95  ? 96   GLU B OE2 1 
ATOM   2382  N  N   . VAL B  1 116 ? -39.867  -6.654  -85.148  1.00 23.13  ? 97   VAL B N   1 
ATOM   2383  C  CA  . VAL B  1 116 ? -38.705  -7.325  -85.711  1.00 23.92  ? 97   VAL B CA  1 
ATOM   2384  C  C   . VAL B  1 116 ? -37.446  -6.538  -85.368  1.00 22.25  ? 97   VAL B C   1 
ATOM   2385  O  O   . VAL B  1 116 ? -37.292  -5.381  -85.746  1.00 19.73  ? 97   VAL B O   1 
ATOM   2386  C  CB  . VAL B  1 116 ? -38.836  -7.511  -87.236  1.00 26.89  ? 97   VAL B CB  1 
ATOM   2387  C  CG1 . VAL B  1 116 ? -37.647  -8.313  -87.782  1.00 20.88  ? 97   VAL B CG1 1 
ATOM   2388  C  CG2 . VAL B  1 116 ? -40.166  -8.195  -87.580  1.00 26.54  ? 97   VAL B CG2 1 
ATOM   2389  N  N   . LEU B  1 117 ? -36.554  -7.180  -84.631  1.00 29.62  ? 98   LEU B N   1 
ATOM   2390  C  CA  . LEU B  1 117 ? -35.391  -6.508  -84.044  1.00 26.31  ? 98   LEU B CA  1 
ATOM   2391  C  C   . LEU B  1 117 ? -34.192  -6.565  -84.960  1.00 27.03  ? 98   LEU B C   1 
ATOM   2392  O  O   . LEU B  1 117 ? -33.234  -5.826  -84.774  1.00 29.78  ? 98   LEU B O   1 
ATOM   2393  C  CB  . LEU B  1 117 ? -35.011  -7.176  -82.720  1.00 18.53  ? 98   LEU B CB  1 
ATOM   2394  C  CG  . LEU B  1 117 ? -36.100  -7.304  -81.662  1.00 18.15  ? 98   LEU B CG  1 
ATOM   2395  C  CD1 . LEU B  1 117 ? -35.550  -8.073  -80.470  1.00 21.18  ? 98   LEU B CD1 1 
ATOM   2396  C  CD2 . LEU B  1 117 ? -36.583  -5.938  -81.234  1.00 21.01  ? 98   LEU B CD2 1 
ATOM   2397  N  N   . THR B  1 118 ? -34.240  -7.455  -85.942  1.00 24.76  ? 99   THR B N   1 
ATOM   2398  C  CA  . THR B  1 118 ? -33.060  -7.755  -86.742  1.00 22.62  ? 99   THR B CA  1 
ATOM   2399  C  C   . THR B  1 118 ? -33.254  -7.332  -88.208  1.00 24.95  ? 99   THR B C   1 
ATOM   2400  O  O   . THR B  1 118 ? -34.391  -7.084  -88.634  1.00 28.47  ? 99   THR B O   1 
ATOM   2401  C  CB  . THR B  1 118 ? -32.754  -9.245  -86.649  1.00 19.37  ? 99   THR B CB  1 
ATOM   2402  O  OG1 . THR B  1 118 ? -33.986  -9.970  -86.740  1.00 20.82  ? 99   THR B OG1 1 
ATOM   2403  C  CG2 . THR B  1 118 ? -32.098  -9.550  -85.333  1.00 18.80  ? 99   THR B CG2 1 
ATOM   2404  N  N   . PRO B  1 119 ? -32.144  -7.222  -88.969  1.00 21.74  ? 100  PRO B N   1 
ATOM   2405  C  CA  . PRO B  1 119 ? -32.210  -6.949  -90.415  1.00 23.01  ? 100  PRO B CA  1 
ATOM   2406  C  C   . PRO B  1 119 ? -33.096  -7.972  -91.123  1.00 25.32  ? 100  PRO B C   1 
ATOM   2407  O  O   . PRO B  1 119 ? -32.937  -9.176  -90.879  1.00 26.89  ? 100  PRO B O   1 
ATOM   2408  C  CB  . PRO B  1 119 ? -30.754  -7.113  -90.865  1.00 18.88  ? 100  PRO B CB  1 
ATOM   2409  C  CG  . PRO B  1 119 ? -29.943  -6.736  -89.665  1.00 15.46  ? 100  PRO B CG  1 
ATOM   2410  C  CD  . PRO B  1 119 ? -30.749  -7.247  -88.476  1.00 20.97  ? 100  PRO B CD  1 
ATOM   2411  N  N   . GLN B  1 120 ? -34.026  -7.506  -91.955  1.00 21.10  ? 101  GLN B N   1 
ATOM   2412  C  CA  . GLN B  1 120 ? -34.980  -8.414  -92.572  1.00 27.93  ? 101  GLN B CA  1 
ATOM   2413  C  C   . GLN B  1 120 ? -34.436  -9.086  -93.846  1.00 29.69  ? 101  GLN B C   1 
ATOM   2414  O  O   . GLN B  1 120 ? -34.858  -8.789  -94.966  1.00 40.59  ? 101  GLN B O   1 
ATOM   2415  C  CB  . GLN B  1 120 ? -36.316  -7.697  -92.777  1.00 32.46  ? 101  GLN B CB  1 
ATOM   2416  C  CG  . GLN B  1 120 ? -36.823  -7.119  -91.475  1.00 34.18  ? 101  GLN B CG  1 
ATOM   2417  C  CD  . GLN B  1 120 ? -38.198  -6.510  -91.588  1.00 45.79  ? 101  GLN B CD  1 
ATOM   2418  O  OE1 . GLN B  1 120 ? -38.996  -6.898  -92.437  1.00 55.60  ? 101  GLN B OE1 1 
ATOM   2419  N  NE2 . GLN B  1 120 ? -38.491  -5.552  -90.724  1.00 48.13  ? 101  GLN B NE2 1 
ATOM   2420  N  N   . LEU B  1 121 ? -33.495  -10.003 -93.637  1.00 23.68  ? 102  LEU B N   1 
ATOM   2421  C  CA  . LEU B  1 121 ? -32.827  -10.721 -94.713  1.00 24.80  ? 102  LEU B CA  1 
ATOM   2422  C  C   . LEU B  1 121 ? -33.031  -12.218 -94.540  1.00 27.88  ? 102  LEU B C   1 
ATOM   2423  O  O   . LEU B  1 121 ? -33.092  -12.718 -93.408  1.00 19.74  ? 102  LEU B O   1 
ATOM   2424  C  CB  . LEU B  1 121 ? -31.325  -10.421 -94.701  1.00 19.35  ? 102  LEU B CB  1 
ATOM   2425  C  CG  . LEU B  1 121 ? -30.910  -8.966  -94.920  1.00 16.02  ? 102  LEU B CG  1 
ATOM   2426  C  CD1 . LEU B  1 121 ? -29.406  -8.853  -94.795  1.00 15.26  ? 102  LEU B CD1 1 
ATOM   2427  C  CD2 . LEU B  1 121 ? -31.359  -8.505  -96.319  1.00 22.24  ? 102  LEU B CD2 1 
ATOM   2428  N  N   . ALA B  1 122 ? -33.138  -12.927 -95.662  1.00 12.57  ? 103  ALA B N   1 
ATOM   2429  C  CA  . ALA B  1 122 ? -33.298  -14.379 -95.652  1.00 13.01  ? 103  ALA B CA  1 
ATOM   2430  C  C   . ALA B  1 122 ? -32.114  -15.070 -96.343  1.00 25.48  ? 103  ALA B C   1 
ATOM   2431  O  O   . ALA B  1 122 ? -31.410  -14.456 -97.143  1.00 31.12  ? 103  ALA B O   1 
ATOM   2432  C  CB  . ALA B  1 122 ? -34.615  -14.784 -96.298  1.00 13.15  ? 103  ALA B CB  1 
ATOM   2433  N  N   . HIS B  1 123 ? -31.884  -16.340 -96.012  1.00 13.77  ? 104  HIS B N   1 
ATOM   2434  C  CA  . HIS B  1 123 ? -30.923  -17.164 -96.723  1.00 14.20  ? 104  HIS B CA  1 
ATOM   2435  C  C   . HIS B  1 123 ? -31.654  -17.847 -97.886  1.00 28.14  ? 104  HIS B C   1 
ATOM   2436  O  O   . HIS B  1 123 ? -32.709  -18.505 -97.690  1.00 21.36  ? 104  HIS B O   1 
ATOM   2437  C  CB  . HIS B  1 123 ? -30.341  -18.254 -95.848  1.00 19.19  ? 104  HIS B CB  1 
ATOM   2438  C  CG  . HIS B  1 123 ? -29.197  -17.813 -94.989  1.00 36.13  ? 104  HIS B CG  1 
ATOM   2439  N  ND1 . HIS B  1 123 ? -28.416  -16.721 -95.286  1.00 40.74  ? 104  HIS B ND1 1 
ATOM   2440  C  CD2 . HIS B  1 123 ? -28.707  -18.329 -93.830  1.00 35.67  ? 104  HIS B CD2 1 
ATOM   2441  C  CE1 . HIS B  1 123 ? -27.492  -16.576 -94.344  1.00 35.20  ? 104  HIS B CE1 1 
ATOM   2442  N  NE2 . HIS B  1 123 ? -27.657  -17.527 -93.447  1.00 29.60  ? 104  HIS B NE2 1 
ATOM   2443  N  N   . VAL B  1 124 ? -31.113  -17.687 -99.097  1.00 22.42  ? 105  VAL B N   1 
ATOM   2444  C  CA  . VAL B  1 124 ? -31.560  -18.526 -100.216 1.00 22.21  ? 105  VAL B CA  1 
ATOM   2445  C  C   . VAL B  1 124 ? -30.406  -19.429 -100.609 1.00 17.62  ? 105  VAL B C   1 
ATOM   2446  O  O   . VAL B  1 124 ? -29.302  -18.953 -100.880 1.00 15.47  ? 105  VAL B O   1 
ATOM   2447  C  CB  . VAL B  1 124 ? -32.088  -17.710 -101.412 1.00 30.91  ? 105  VAL B CB  1 
ATOM   2448  C  CG1 . VAL B  1 124 ? -32.626  -18.631 -102.493 1.00 33.77  ? 105  VAL B CG1 1 
ATOM   2449  C  CG2 . VAL B  1 124 ? -33.184  -16.759 -100.941 1.00 34.75  ? 105  VAL B CG2 1 
ATOM   2450  N  N   . VAL B  1 125 ? -30.647  -20.737 -100.553 1.00 19.50  ? 106  VAL B N   1 
ATOM   2451  C  CA  . VAL B  1 125 ? -29.630  -21.720 -100.927 1.00 25.83  ? 106  VAL B CA  1 
ATOM   2452  C  C   . VAL B  1 125 ? -29.850  -22.091 -102.392 1.00 26.61  ? 106  VAL B C   1 
ATOM   2453  O  O   . VAL B  1 125 ? -30.975  -21.995 -102.887 1.00 30.60  ? 106  VAL B O   1 
ATOM   2454  C  CB  . VAL B  1 125 ? -29.673  -22.963 -99.992  1.00 21.45  ? 106  VAL B CB  1 
ATOM   2455  C  CG1 . VAL B  1 125 ? -28.487  -23.849 -100.233 1.00 28.36  ? 106  VAL B CG1 1 
ATOM   2456  C  CG2 . VAL B  1 125 ? -29.640  -22.523 -98.564  1.00 19.13  ? 106  VAL B CG2 1 
ATOM   2457  N  N   . SER B  1 126 ? -28.785  -22.480 -103.090 1.00 29.15  ? 107  SER B N   1 
ATOM   2458  C  CA  . SER B  1 126 ? -28.859  -22.754 -104.540 1.00 31.34  ? 107  SER B CA  1 
ATOM   2459  C  C   . SER B  1 126 ? -29.950  -23.759 -104.937 1.00 31.18  ? 107  SER B C   1 
ATOM   2460  O  O   . SER B  1 126 ? -30.472  -23.690 -106.046 1.00 32.65  ? 107  SER B O   1 
ATOM   2461  C  CB  . SER B  1 126 ? -27.510  -23.210 -105.084 1.00 35.28  ? 107  SER B CB  1 
ATOM   2462  O  OG  . SER B  1 126 ? -27.127  -24.444 -104.503 1.00 43.51  ? 107  SER B OG  1 
ATOM   2463  N  N   . ASP B  1 127 ? -30.296  -24.675 -104.032 1.00 30.81  ? 108  ASP B N   1 
ATOM   2464  C  CA  . ASP B  1 127 ? -31.363  -25.641 -104.298 1.00 36.25  ? 108  ASP B CA  1 
ATOM   2465  C  C   . ASP B  1 127 ? -32.771  -25.044 -104.178 1.00 43.42  ? 108  ASP B C   1 
ATOM   2466  O  O   . ASP B  1 127 ? -33.757  -25.714 -104.482 1.00 53.51  ? 108  ASP B O   1 
ATOM   2467  C  CB  . ASP B  1 127 ? -31.228  -26.875 -103.406 1.00 42.87  ? 108  ASP B CB  1 
ATOM   2468  C  CG  . ASP B  1 127 ? -31.267  -26.540 -101.923 1.00 55.81  ? 108  ASP B CG  1 
ATOM   2469  O  OD1 . ASP B  1 127 ? -31.146  -25.348 -101.581 1.00 64.88  ? 108  ASP B OD1 1 
ATOM   2470  O  OD2 . ASP B  1 127 ? -31.410  -27.471 -101.095 1.00 58.74  ? 108  ASP B OD2 1 
ATOM   2471  N  N   . GLY B  1 128 ? -32.871  -23.792 -103.737 1.00 38.93  ? 109  GLY B N   1 
ATOM   2472  C  CA  . GLY B  1 128 ? -34.170  -23.163 -103.549 1.00 34.45  ? 109  GLY B CA  1 
ATOM   2473  C  C   . GLY B  1 128 ? -34.699  -23.200 -102.115 1.00 35.25  ? 109  GLY B C   1 
ATOM   2474  O  O   . GLY B  1 128 ? -35.816  -22.715 -101.828 1.00 34.54  ? 109  GLY B O   1 
ATOM   2475  N  N   . GLU B  1 129 ? -33.919  -23.777 -101.202 1.00 32.39  ? 110  GLU B N   1 
ATOM   2476  C  CA  . GLU B  1 129 ? -34.279  -23.719 -99.783  1.00 39.45  ? 110  GLU B CA  1 
ATOM   2477  C  C   . GLU B  1 129 ? -34.132  -22.287 -99.259  1.00 31.10  ? 110  GLU B C   1 
ATOM   2478  O  O   . GLU B  1 129 ? -33.106  -21.625 -99.484  1.00 30.47  ? 110  GLU B O   1 
ATOM   2479  C  CB  . GLU B  1 129 ? -33.449  -24.688 -98.941  1.00 52.26  ? 110  GLU B CB  1 
ATOM   2480  C  CG  . GLU B  1 129 ? -33.397  -24.314 -97.455  1.00 64.15  ? 110  GLU B CG  1 
ATOM   2481  C  CD  . GLU B  1 129 ? -33.003  -25.479 -96.547  1.00 75.02  ? 110  GLU B CD  1 
ATOM   2482  O  OE1 . GLU B  1 129 ? -33.145  -26.649 -96.975  1.00 81.97  ? 110  GLU B OE1 1 
ATOM   2483  O  OE2 . GLU B  1 129 ? -32.563  -25.222 -95.404  1.00 75.39  ? 110  GLU B OE2 1 
ATOM   2484  N  N   . VAL B  1 130 ? -35.178  -21.810 -98.591  1.00 24.75  ? 111  VAL B N   1 
ATOM   2485  C  CA  . VAL B  1 130 ? -35.197  -20.468 -98.009  1.00 24.49  ? 111  VAL B CA  1 
ATOM   2486  C  C   . VAL B  1 130 ? -35.342  -20.559 -96.488  1.00 27.06  ? 111  VAL B C   1 
ATOM   2487  O  O   . VAL B  1 130 ? -36.201  -21.282 -95.955  1.00 20.89  ? 111  VAL B O   1 
ATOM   2488  C  CB  . VAL B  1 130 ? -36.347  -19.604 -98.565  1.00 29.17  ? 111  VAL B CB  1 
ATOM   2489  C  CG1 . VAL B  1 130 ? -36.184  -18.175 -98.071  1.00 31.69  ? 111  VAL B CG1 1 
ATOM   2490  C  CG2 . VAL B  1 130 ? -36.386  -19.658 -100.090 1.00 29.05  ? 111  VAL B CG2 1 
ATOM   2491  N  N   . GLN B  1 131 ? -34.475  -19.837 -95.790  1.00 29.88  ? 112  GLN B N   1 
ATOM   2492  C  CA  . GLN B  1 131 ? -34.593  -19.706 -94.358  1.00 24.42  ? 112  GLN B CA  1 
ATOM   2493  C  C   . GLN B  1 131 ? -34.653  -18.242 -93.958  1.00 25.13  ? 112  GLN B C   1 
ATOM   2494  O  O   . GLN B  1 131 ? -33.870  -17.432 -94.433  1.00 34.54  ? 112  GLN B O   1 
ATOM   2495  C  CB  . GLN B  1 131 ? -33.410  -20.346 -93.670  1.00 34.20  ? 112  GLN B CB  1 
ATOM   2496  C  CG  . GLN B  1 131 ? -33.596  -20.418 -92.165  1.00 37.49  ? 112  GLN B CG  1 
ATOM   2497  C  CD  . GLN B  1 131 ? -32.601  -21.324 -91.497  1.00 47.64  ? 112  GLN B CD  1 
ATOM   2498  O  OE1 . GLN B  1 131 ? -31.493  -20.899 -91.147  1.00 53.91  ? 112  GLN B OE1 1 
ATOM   2499  N  NE2 . GLN B  1 131 ? -32.983  -22.588 -91.312  1.00 50.22  ? 112  GLN B NE2 1 
ATOM   2500  N  N   . TYR B  1 132 ? -35.606  -17.909 -93.100  1.00 17.72  ? 113  TYR B N   1 
ATOM   2501  C  CA  . TYR B  1 132 ? -35.728  -16.570 -92.561  1.00 23.55  ? 113  TYR B CA  1 
ATOM   2502  C  C   . TYR B  1 132 ? -35.875  -16.682 -91.035  1.00 27.63  ? 113  TYR B C   1 
ATOM   2503  O  O   . TYR B  1 132 ? -36.778  -17.362 -90.539  1.00 32.39  ? 113  TYR B O   1 
ATOM   2504  C  CB  . TYR B  1 132 ? -36.919  -15.848 -93.203  1.00 20.42  ? 113  TYR B CB  1 
ATOM   2505  C  CG  . TYR B  1 132 ? -37.203  -14.483 -92.636  1.00 19.20  ? 113  TYR B CG  1 
ATOM   2506  C  CD1 . TYR B  1 132 ? -36.188  -13.530 -92.518  1.00 24.40  ? 113  TYR B CD1 1 
ATOM   2507  C  CD2 . TYR B  1 132 ? -38.486  -14.131 -92.219  1.00 14.56  ? 113  TYR B CD2 1 
ATOM   2508  C  CE1 . TYR B  1 132 ? -36.445  -12.245 -91.980  1.00 22.64  ? 113  TYR B CE1 1 
ATOM   2509  C  CE2 . TYR B  1 132 ? -38.751  -12.846 -91.697  1.00 17.90  ? 113  TYR B CE2 1 
ATOM   2510  C  CZ  . TYR B  1 132 ? -37.723  -11.917 -91.572  1.00 18.42  ? 113  TYR B CZ  1 
ATOM   2511  O  OH  . TYR B  1 132 ? -37.970  -10.661 -91.055  1.00 21.86  ? 113  TYR B OH  1 
ATOM   2512  N  N   . THR B  1 133 ? -34.965  -16.043 -90.302  1.00 23.20  ? 114  THR B N   1 
ATOM   2513  C  CA  . THR B  1 133 ? -34.942  -16.157 -88.844  1.00 28.71  ? 114  THR B CA  1 
ATOM   2514  C  C   . THR B  1 133 ? -34.855  -14.795 -88.155  1.00 30.07  ? 114  THR B C   1 
ATOM   2515  O  O   . THR B  1 133 ? -33.808  -14.432 -87.582  1.00 12.11  ? 114  THR B O   1 
ATOM   2516  C  CB  . THR B  1 133 ? -33.779  -17.052 -88.376  1.00 35.33  ? 114  THR B CB  1 
ATOM   2517  O  OG1 . THR B  1 133 ? -33.779  -18.285 -89.118  1.00 40.03  ? 114  THR B OG1 1 
ATOM   2518  C  CG2 . THR B  1 133 ? -33.903  -17.353 -86.880  1.00 32.80  ? 114  THR B CG2 1 
ATOM   2519  N  N   . PRO B  1 134 ? -35.950  -14.024 -88.218  1.00 11.97  ? 115  PRO B N   1 
ATOM   2520  C  CA  . PRO B  1 134 ? -35.942  -12.747 -87.502  1.00 11.47  ? 115  PRO B CA  1 
ATOM   2521  C  C   . PRO B  1 134 ? -35.988  -12.960 -85.953  1.00 19.11  ? 115  PRO B C   1 
ATOM   2522  O  O   . PRO B  1 134 ? -36.590  -13.926 -85.435  1.00 11.67  ? 115  PRO B O   1 
ATOM   2523  C  CB  . PRO B  1 134 ? -37.225  -12.068 -87.991  1.00 14.17  ? 115  PRO B CB  1 
ATOM   2524  C  CG  . PRO B  1 134 ? -38.187  -13.253 -88.206  1.00 11.69  ? 115  PRO B CG  1 
ATOM   2525  C  CD  . PRO B  1 134 ? -37.287  -14.382 -88.731  1.00 12.12  ? 115  PRO B CD  1 
ATOM   2526  N  N   . SER B  1 135 ? -35.328  -12.069 -85.217  1.00 20.70  ? 116  SER B N   1 
ATOM   2527  C  CA  . SER B  1 135 ? -35.519  -12.014 -83.784  1.00 20.77  ? 116  SER B CA  1 
ATOM   2528  C  C   . SER B  1 135 ? -36.716  -11.107 -83.542  1.00 22.19  ? 116  SER B C   1 
ATOM   2529  O  O   . SER B  1 135 ? -36.731  -9.966  -84.011  1.00 21.41  ? 116  SER B O   1 
ATOM   2530  C  CB  . SER B  1 135 ? -34.289  -11.467 -83.088  1.00 20.79  ? 116  SER B CB  1 
ATOM   2531  O  OG  . SER B  1 135 ? -34.422  -11.606 -81.675  1.00 31.55  ? 116  SER B OG  1 
ATOM   2532  N  N   . ILE B  1 136 ? -37.715  -11.626 -82.825  1.00 18.04  ? 117  ILE B N   1 
ATOM   2533  C  CA  . ILE B  1 136 ? -38.954  -10.898 -82.599  1.00 24.80  ? 117  ILE B CA  1 
ATOM   2534  C  C   . ILE B  1 136 ? -39.239  -10.656 -81.113  1.00 31.26  ? 117  ILE B C   1 
ATOM   2535  O  O   . ILE B  1 136 ? -39.063  -11.545 -80.257  1.00 30.68  ? 117  ILE B O   1 
ATOM   2536  C  CB  . ILE B  1 136 ? -40.121  -11.639 -83.253  1.00 34.86  ? 117  ILE B CB  1 
ATOM   2537  C  CG1 . ILE B  1 136 ? -39.902  -11.695 -84.785  1.00 36.95  ? 117  ILE B CG1 1 
ATOM   2538  C  CG2 . ILE B  1 136 ? -41.462  -10.992 -82.852  1.00 36.02  ? 117  ILE B CG2 1 
ATOM   2539  C  CD1 . ILE B  1 136 ? -40.910  -12.556 -85.546  1.00 35.70  ? 117  ILE B CD1 1 
ATOM   2540  N  N   . ARG B  1 137 ? -39.663  -9.436  -80.799  1.00 29.52  ? 118  ARG B N   1 
ATOM   2541  C  CA  . ARG B  1 137 ? -40.222  -9.173  -79.484  1.00 21.39  ? 118  ARG B CA  1 
ATOM   2542  C  C   . ARG B  1 137 ? -41.722  -9.027  -79.664  1.00 19.00  ? 118  ARG B C   1 
ATOM   2543  O  O   . ARG B  1 137 ? -42.176  -8.251  -80.499  1.00 20.37  ? 118  ARG B O   1 
ATOM   2544  C  CB  . ARG B  1 137 ? -39.626  -7.910  -78.841  1.00 22.13  ? 118  ARG B CB  1 
ATOM   2545  C  CG  . ARG B  1 137 ? -40.280  -7.610  -77.494  1.00 26.62  ? 118  ARG B CG  1 
ATOM   2546  C  CD  . ARG B  1 137 ? -39.611  -6.511  -76.747  1.00 35.91  ? 118  ARG B CD  1 
ATOM   2547  N  NE  . ARG B  1 137 ? -40.314  -6.254  -75.494  1.00 48.43  ? 118  ARG B NE  1 
ATOM   2548  C  CZ  . ARG B  1 137 ? -39.841  -5.506  -74.501  1.00 59.79  ? 118  ARG B CZ  1 
ATOM   2549  N  NH1 . ARG B  1 137 ? -38.640  -4.943  -74.594  1.00 61.29  ? 118  ARG B NH1 1 
ATOM   2550  N  NH2 . ARG B  1 137 ? -40.569  -5.338  -73.404  1.00 66.79  ? 118  ARG B NH2 1 
ATOM   2551  N  N   . GLN B  1 138 ? -42.488  -9.774  -78.881  1.00 24.52  ? 119  GLN B N   1 
ATOM   2552  C  CA  . GLN B  1 138 ? -43.944  -9.765  -79.011  1.00 29.54  ? 119  GLN B CA  1 
ATOM   2553  C  C   . GLN B  1 138 ? -44.673  -10.098 -77.708  1.00 26.13  ? 119  GLN B C   1 
ATOM   2554  O  O   . GLN B  1 138 ? -44.161  -10.864 -76.876  1.00 19.29  ? 119  GLN B O   1 
ATOM   2555  C  CB  . GLN B  1 138 ? -44.363  -10.747 -80.096  1.00 33.96  ? 119  GLN B CB  1 
ATOM   2556  C  CG  . GLN B  1 138 ? -45.749  -10.507 -80.643  1.00 36.25  ? 119  GLN B CG  1 
ATOM   2557  C  CD  . GLN B  1 138 ? -45.979  -11.224 -81.975  1.00 33.26  ? 119  GLN B CD  1 
ATOM   2558  O  OE1 . GLN B  1 138 ? -45.333  -12.228 -82.280  1.00 27.90  ? 119  GLN B OE1 1 
ATOM   2559  N  NE2 . GLN B  1 138 ? -46.902  -10.703 -82.771  1.00 32.19  ? 119  GLN B NE2 1 
ATOM   2560  N  N   . ARG B  1 139 ? -45.883  -9.554  -77.575  1.00 19.76  ? 120  ARG B N   1 
ATOM   2561  C  CA  . ARG B  1 139 ? -46.645  -9.688  -76.355  1.00 23.09  ? 120  ARG B CA  1 
ATOM   2562  C  C   . ARG B  1 139 ? -47.756  -10.698 -76.591  1.00 25.99  ? 120  ARG B C   1 
ATOM   2563  O  O   . ARG B  1 139 ? -48.492  -10.553 -77.540  1.00 23.52  ? 120  ARG B O   1 
ATOM   2564  C  CB  . ARG B  1 139 ? -47.184  -8.313  -75.909  1.00 22.66  ? 120  ARG B CB  1 
ATOM   2565  C  CG  . ARG B  1 139 ? -47.801  -8.317  -74.488  1.00 27.83  ? 120  ARG B CG  1 
ATOM   2566  C  CD  . ARG B  1 139 ? -48.045  -6.921  -73.842  1.00 45.43  ? 120  ARG B CD  1 
ATOM   2567  N  NE  . ARG B  1 139 ? -48.384  -7.041  -72.409  1.00 40.09  ? 120  ARG B NE  1 
ATOM   2568  C  CZ  . ARG B  1 139 ? -47.486  -7.182  -71.430  1.00 39.09  ? 120  ARG B CZ  1 
ATOM   2569  N  NH1 . ARG B  1 139 ? -46.186  -7.205  -71.695  1.00 40.09  ? 120  ARG B NH1 1 
ATOM   2570  N  NH2 . ARG B  1 139 ? -47.877  -7.300  -70.176  1.00 43.39  ? 120  ARG B NH2 1 
ATOM   2571  N  N   . PHE B  1 140 ? -47.862  -11.729 -75.741  1.00 33.39  ? 121  PHE B N   1 
ATOM   2572  C  CA  . PHE B  1 140 ? -48.874  -12.788 -75.905  1.00 31.79  ? 121  PHE B CA  1 
ATOM   2573  C  C   . PHE B  1 140 ? -49.881  -12.884 -74.750  1.00 29.56  ? 121  PHE B C   1 
ATOM   2574  O  O   . PHE B  1 140 ? -49.613  -12.520 -73.602  1.00 26.49  ? 121  PHE B O   1 
ATOM   2575  C  CB  . PHE B  1 140 ? -48.211  -14.157 -76.083  1.00 32.10  ? 121  PHE B CB  1 
ATOM   2576  C  CG  . PHE B  1 140 ? -47.278  -14.230 -77.239  1.00 35.56  ? 121  PHE B CG  1 
ATOM   2577  C  CD1 . PHE B  1 140 ? -47.761  -14.503 -78.504  1.00 35.83  ? 121  PHE B CD1 1 
ATOM   2578  C  CD2 . PHE B  1 140 ? -45.910  -14.034 -77.068  1.00 36.76  ? 121  PHE B CD2 1 
ATOM   2579  C  CE1 . PHE B  1 140 ? -46.907  -14.577 -79.573  1.00 30.73  ? 121  PHE B CE1 1 
ATOM   2580  C  CE2 . PHE B  1 140 ? -45.047  -14.108 -78.150  1.00 33.14  ? 121  PHE B CE2 1 
ATOM   2581  C  CZ  . PHE B  1 140 ? -45.554  -14.374 -79.404  1.00 28.33  ? 121  PHE B CZ  1 
ATOM   2582  N  N   . SER B  1 141 ? -51.051  -13.397 -75.083  1.00 29.67  ? 122  SER B N   1 
ATOM   2583  C  CA  . SER B  1 141 ? -52.066  -13.696 -74.112  1.00 20.64  ? 122  SER B CA  1 
ATOM   2584  C  C   . SER B  1 141 ? -52.006  -15.206 -73.936  1.00 31.52  ? 122  SER B C   1 
ATOM   2585  O  O   . SER B  1 141 ? -52.299  -15.964 -74.870  1.00 35.26  ? 122  SER B O   1 
ATOM   2586  C  CB  . SER B  1 141 ? -53.428  -13.225 -74.639  1.00 13.19  ? 122  SER B CB  1 
ATOM   2587  O  OG  . SER B  1 141 ? -54.490  -14.032 -74.161  1.00 24.44  ? 122  SER B OG  1 
ATOM   2588  N  N   . CYS B  1 142 ? -51.594  -15.644 -72.748  1.00 44.25  ? 123  CYS B N   1 
ATOM   2589  C  CA  . CYS B  1 142 ? -51.493  -17.071 -72.450  1.00 50.30  ? 123  CYS B CA  1 
ATOM   2590  C  C   . CYS B  1 142 ? -51.570  -17.347 -70.955  1.00 47.94  ? 123  CYS B C   1 
ATOM   2591  O  O   . CYS B  1 142 ? -51.663  -16.423 -70.151  1.00 46.06  ? 123  CYS B O   1 
ATOM   2592  C  CB  . CYS B  1 142 ? -50.192  -17.629 -73.009  1.00 56.55  ? 123  CYS B CB  1 
ATOM   2593  S  SG  . CYS B  1 142 ? -48.756  -16.733 -72.437  1.00 67.69  ? 123  CYS B SG  1 
ATOM   2594  N  N   . ASP B  1 143 ? -51.537  -18.627 -70.593  1.00 46.94  ? 124  ASP B N   1 
ATOM   2595  C  CA  . ASP B  1 143 ? -51.676  -19.040 -69.203  1.00 44.25  ? 124  ASP B CA  1 
ATOM   2596  C  C   . ASP B  1 143 ? -50.376  -18.831 -68.437  1.00 38.07  ? 124  ASP B C   1 
ATOM   2597  O  O   . ASP B  1 143 ? -49.394  -19.549 -68.658  1.00 38.18  ? 124  ASP B O   1 
ATOM   2598  C  CB  . ASP B  1 143 ? -52.092  -20.505 -69.123  1.00 51.48  ? 124  ASP B CB  1 
ATOM   2599  C  CG  . ASP B  1 143 ? -52.445  -20.929 -67.714  1.00 48.51  ? 124  ASP B CG  1 
ATOM   2600  O  OD1 . ASP B  1 143 ? -52.678  -20.031 -66.866  1.00 45.21  ? 124  ASP B OD1 1 
ATOM   2601  O  OD2 . ASP B  1 143 ? -52.497  -22.152 -67.472  1.00 48.82  ? 124  ASP B OD2 1 
ATOM   2602  N  N   . VAL B  1 144 ? -50.383  -17.842 -67.540  1.00 33.01  ? 125  VAL B N   1 
ATOM   2603  C  CA  . VAL B  1 144 ? -49.193  -17.462 -66.791  1.00 34.53  ? 125  VAL B CA  1 
ATOM   2604  C  C   . VAL B  1 144 ? -49.279  -17.980 -65.341  1.00 42.19  ? 125  VAL B C   1 
ATOM   2605  O  O   . VAL B  1 144 ? -48.371  -17.777 -64.522  1.00 39.65  ? 125  VAL B O   1 
ATOM   2606  C  CB  . VAL B  1 144 ? -49.009  -15.945 -66.819  1.00 36.36  ? 125  VAL B CB  1 
ATOM   2607  C  CG1 . VAL B  1 144 ? -47.642  -15.573 -66.304  1.00 46.59  ? 125  VAL B CG1 1 
ATOM   2608  C  CG2 . VAL B  1 144 ? -49.173  -15.419 -68.242  1.00 26.07  ? 125  VAL B CG2 1 
ATOM   2609  N  N   . SER B  1 145 ? -50.372  -18.681 -65.041  1.00 44.31  ? 126  SER B N   1 
ATOM   2610  C  CA  . SER B  1 145 ? -50.573  -19.255 -63.710  1.00 41.71  ? 126  SER B CA  1 
ATOM   2611  C  C   . SER B  1 145 ? -49.488  -20.274 -63.339  1.00 45.19  ? 126  SER B C   1 
ATOM   2612  O  O   . SER B  1 145 ? -49.199  -21.210 -64.093  1.00 44.09  ? 126  SER B O   1 
ATOM   2613  C  CB  . SER B  1 145 ? -51.979  -19.879 -63.575  1.00 37.30  ? 126  SER B CB  1 
ATOM   2614  O  OG  . SER B  1 145 ? -52.081  -21.150 -64.204  1.00 33.63  ? 126  SER B OG  1 
ATOM   2615  N  N   . GLY B  1 146 ? -48.881  -20.070 -62.170  1.00 49.68  ? 127  GLY B N   1 
ATOM   2616  C  CA  . GLY B  1 146 ? -47.883  -20.990 -61.643  1.00 48.27  ? 127  GLY B CA  1 
ATOM   2617  C  C   . GLY B  1 146 ? -46.463  -20.583 -61.988  1.00 45.29  ? 127  GLY B C   1 
ATOM   2618  O  O   . GLY B  1 146 ? -45.505  -21.329 -61.740  1.00 37.33  ? 127  GLY B O   1 
ATOM   2619  N  N   . VAL B  1 147 ? -46.322  -19.386 -62.549  1.00 47.13  ? 128  VAL B N   1 
ATOM   2620  C  CA  . VAL B  1 147 ? -45.024  -18.913 -63.002  1.00 48.89  ? 128  VAL B CA  1 
ATOM   2621  C  C   . VAL B  1 147 ? -44.069  -18.816 -61.826  1.00 49.33  ? 128  VAL B C   1 
ATOM   2622  O  O   . VAL B  1 147 ? -42.861  -18.956 -61.983  1.00 52.26  ? 128  VAL B O   1 
ATOM   2623  C  CB  . VAL B  1 147 ? -45.139  -17.549 -63.738  1.00 65.08  ? 128  VAL B CB  1 
ATOM   2624  C  CG1 . VAL B  1 147 ? -45.743  -16.494 -62.818  1.00 69.54  ? 128  VAL B CG1 1 
ATOM   2625  C  CG2 . VAL B  1 147 ? -43.793  -17.098 -64.292  1.00 57.31  ? 128  VAL B CG2 1 
ATOM   2626  N  N   . ASP B  1 148 ? -44.621  -18.599 -60.640  1.00 58.53  ? 129  ASP B N   1 
ATOM   2627  C  CA  . ASP B  1 148 ? -43.808  -18.425 -59.435  1.00 67.89  ? 129  ASP B CA  1 
ATOM   2628  C  C   . ASP B  1 148 ? -43.638  -19.694 -58.602  1.00 65.46  ? 129  ASP B C   1 
ATOM   2629  O  O   . ASP B  1 148 ? -43.051  -19.658 -57.531  1.00 66.92  ? 129  ASP B O   1 
ATOM   2630  C  CB  . ASP B  1 148 ? -44.367  -17.304 -58.566  1.00 77.41  ? 129  ASP B CB  1 
ATOM   2631  C  CG  . ASP B  1 148 ? -43.298  -16.316 -58.149  1.00 90.53  ? 129  ASP B CG  1 
ATOM   2632  O  OD1 . ASP B  1 148 ? -42.160  -16.761 -57.865  1.00 91.58  ? 129  ASP B OD1 1 
ATOM   2633  O  OD2 . ASP B  1 148 ? -43.588  -15.098 -58.118  1.00 98.72  ? 129  ASP B OD2 1 
ATOM   2634  N  N   . THR B  1 149 ? -44.144  -20.810 -59.112  1.00 64.65  ? 130  THR B N   1 
ATOM   2635  C  CA  . THR B  1 149 ? -43.982  -22.119 -58.486  1.00 61.27  ? 130  THR B CA  1 
ATOM   2636  C  C   . THR B  1 149 ? -42.792  -22.866 -59.112  1.00 64.97  ? 130  THR B C   1 
ATOM   2637  O  O   . THR B  1 149 ? -42.126  -22.345 -60.007  1.00 70.15  ? 130  THR B O   1 
ATOM   2638  C  CB  . THR B  1 149 ? -45.275  -22.969 -58.627  1.00 50.69  ? 130  THR B CB  1 
ATOM   2639  O  OG1 . THR B  1 149 ? -45.347  -23.536 -59.946  1.00 59.97  ? 130  THR B OG1 1 
ATOM   2640  C  CG2 . THR B  1 149 ? -46.516  -22.115 -58.373  1.00 45.76  ? 130  THR B CG2 1 
ATOM   2641  N  N   . GLU B  1 150 ? -42.522  -24.083 -58.648  1.00 63.36  ? 131  GLU B N   1 
ATOM   2642  C  CA  . GLU B  1 150 ? -41.395  -24.864 -59.168  1.00 62.73  ? 131  GLU B CA  1 
ATOM   2643  C  C   . GLU B  1 150 ? -41.740  -25.554 -60.502  1.00 56.46  ? 131  GLU B C   1 
ATOM   2644  O  O   . GLU B  1 150 ? -40.881  -25.739 -61.374  1.00 54.58  ? 131  GLU B O   1 
ATOM   2645  C  CB  . GLU B  1 150 ? -40.938  -25.895 -58.123  1.00 68.04  ? 131  GLU B CB  1 
ATOM   2646  C  CG  . GLU B  1 150 ? -39.425  -26.140 -58.046  1.00 76.74  ? 131  GLU B CG  1 
ATOM   2647  C  CD  . GLU B  1 150 ? -38.624  -24.922 -57.549  1.00 84.08  ? 131  GLU B CD  1 
ATOM   2648  O  OE1 . GLU B  1 150 ? -39.236  -23.941 -57.057  1.00 85.21  ? 131  GLU B OE1 1 
ATOM   2649  O  OE2 . GLU B  1 150 ? -37.372  -24.951 -57.651  1.00 85.74  ? 131  GLU B OE2 1 
ATOM   2650  N  N   . SER B  1 151 ? -43.002  -25.939 -60.655  1.00 49.75  ? 132  SER B N   1 
ATOM   2651  C  CA  . SER B  1 151 ? -43.422  -26.621 -61.860  1.00 49.83  ? 132  SER B CA  1 
ATOM   2652  C  C   . SER B  1 151 ? -43.586  -25.600 -62.987  1.00 53.29  ? 132  SER B C   1 
ATOM   2653  O  O   . SER B  1 151 ? -43.579  -25.961 -64.165  1.00 50.99  ? 132  SER B O   1 
ATOM   2654  C  CB  . SER B  1 151 ? -44.720  -27.383 -61.616  1.00 49.95  ? 132  SER B CB  1 
ATOM   2655  O  OG  . SER B  1 151 ? -45.763  -26.488 -61.278  1.00 49.74  ? 132  SER B OG  1 
ATOM   2656  N  N   . GLY B  1 152 ? -43.727  -24.326 -62.612  1.00 53.40  ? 133  GLY B N   1 
ATOM   2657  C  CA  . GLY B  1 152 ? -43.722  -23.226 -63.566  1.00 45.22  ? 133  GLY B CA  1 
ATOM   2658  C  C   . GLY B  1 152 ? -45.042  -22.980 -64.279  1.00 40.76  ? 133  GLY B C   1 
ATOM   2659  O  O   . GLY B  1 152 ? -46.022  -23.708 -64.084  1.00 40.99  ? 133  GLY B O   1 
ATOM   2660  N  N   . ALA B  1 153 ? -45.072  -21.937 -65.107  1.00 38.64  ? 134  ALA B N   1 
ATOM   2661  C  CA  . ALA B  1 153 ? -46.220  -21.692 -65.982  1.00 39.26  ? 134  ALA B CA  1 
ATOM   2662  C  C   . ALA B  1 153 ? -45.972  -22.374 -67.312  1.00 27.53  ? 134  ALA B C   1 
ATOM   2663  O  O   . ALA B  1 153 ? -44.821  -22.634 -67.662  1.00 21.64  ? 134  ALA B O   1 
ATOM   2664  C  CB  . ALA B  1 153 ? -46.427  -20.212 -66.191  1.00 40.26  ? 134  ALA B CB  1 
ATOM   2665  N  N   . THR B  1 154 ? -47.045  -22.673 -68.035  1.00 22.82  ? 135  THR B N   1 
ATOM   2666  C  CA  . THR B  1 154 ? -46.927  -23.178 -69.406  1.00 29.82  ? 135  THR B CA  1 
ATOM   2667  C  C   . THR B  1 154 ? -47.707  -22.280 -70.362  1.00 36.63  ? 135  THR B C   1 
ATOM   2668  O  O   . THR B  1 154 ? -48.946  -22.366 -70.466  1.00 28.64  ? 135  THR B O   1 
ATOM   2669  C  CB  . THR B  1 154 ? -47.394  -24.636 -69.547  1.00 32.59  ? 135  THR B CB  1 
ATOM   2670  O  OG1 . THR B  1 154 ? -46.595  -25.477 -68.709  1.00 41.25  ? 135  THR B OG1 1 
ATOM   2671  C  CG2 . THR B  1 154 ? -47.229  -25.100 -70.984  1.00 40.34  ? 135  THR B CG2 1 
ATOM   2672  N  N   . CYS B  1 155 ? -46.966  -21.397 -71.034  1.00 42.37  ? 136  CYS B N   1 
ATOM   2673  C  CA  . CYS B  1 155 ? -47.530  -20.517 -72.043  1.00 42.82  ? 136  CYS B CA  1 
ATOM   2674  C  C   . CYS B  1 155 ? -47.538  -21.193 -73.422  1.00 37.67  ? 136  CYS B C   1 
ATOM   2675  O  O   . CYS B  1 155 ? -46.493  -21.619 -73.938  1.00 40.94  ? 136  CYS B O   1 
ATOM   2676  C  CB  . CYS B  1 155 ? -46.739  -19.213 -72.090  1.00 46.53  ? 136  CYS B CB  1 
ATOM   2677  S  SG  . CYS B  1 155 ? -47.385  -18.003 -73.282  1.00 56.39  ? 136  CYS B SG  1 
ATOM   2678  N  N   . ARG B  1 156 ? -48.726  -21.283 -74.008  1.00 31.96  ? 137  ARG B N   1 
ATOM   2679  C  CA  . ARG B  1 156 ? -48.921  -21.915 -75.324  1.00 36.21  ? 137  ARG B CA  1 
ATOM   2680  C  C   . ARG B  1 156 ? -49.013  -20.869 -76.469  1.00 43.47  ? 137  ARG B C   1 
ATOM   2681  O  O   . ARG B  1 156 ? -49.910  -20.017 -76.489  1.00 43.17  ? 137  ARG B O   1 
ATOM   2682  C  CB  . ARG B  1 156 ? -50.185  -22.775 -75.256  1.00 37.26  ? 137  ARG B CB  1 
ATOM   2683  C  CG  . ARG B  1 156 ? -50.349  -23.801 -76.344  1.00 46.67  ? 137  ARG B CG  1 
ATOM   2684  C  CD  . ARG B  1 156 ? -51.662  -24.588 -76.157  1.00 54.61  ? 137  ARG B CD  1 
ATOM   2685  N  NE  . ARG B  1 156 ? -52.851  -23.737 -76.271  1.00 57.83  ? 137  ARG B NE  1 
ATOM   2686  C  CZ  . ARG B  1 156 ? -53.664  -23.424 -75.260  1.00 61.97  ? 137  ARG B CZ  1 
ATOM   2687  N  NH1 . ARG B  1 156 ? -53.433  -23.900 -74.038  1.00 67.51  ? 137  ARG B NH1 1 
ATOM   2688  N  NH2 . ARG B  1 156 ? -54.719  -22.638 -75.466  1.00 58.50  ? 137  ARG B NH2 1 
ATOM   2689  N  N   . ILE B  1 157 ? -48.076  -20.923 -77.411  1.00 42.13  ? 138  ILE B N   1 
ATOM   2690  C  CA  . ILE B  1 157 ? -48.054  -19.972 -78.541  1.00 37.10  ? 138  ILE B CA  1 
ATOM   2691  C  C   . ILE B  1 157 ? -48.475  -20.603 -79.868  1.00 27.74  ? 138  ILE B C   1 
ATOM   2692  O  O   . ILE B  1 157 ? -47.839  -21.540 -80.347  1.00 25.36  ? 138  ILE B O   1 
ATOM   2693  C  CB  . ILE B  1 157 ? -46.671  -19.339 -78.731  1.00 32.80  ? 138  ILE B CB  1 
ATOM   2694  C  CG1 . ILE B  1 157 ? -46.346  -18.453 -77.531  1.00 35.49  ? 138  ILE B CG1 1 
ATOM   2695  C  CG2 . ILE B  1 157 ? -46.648  -18.523 -80.011  1.00 28.34  ? 138  ILE B CG2 1 
ATOM   2696  C  CD1 . ILE B  1 157 ? -44.945  -17.955 -77.525  1.00 16.36  ? 138  ILE B CD1 1 
ATOM   2697  N  N   . LYS B  1 158 ? -49.544  -20.080 -80.463  1.00 26.44  ? 139  LYS B N   1 
ATOM   2698  C  CA  . LYS B  1 158 ? -50.145  -20.692 -81.665  1.00 28.76  ? 139  LYS B CA  1 
ATOM   2699  C  C   . LYS B  1 158 ? -49.763  -19.941 -82.936  1.00 24.93  ? 139  LYS B C   1 
ATOM   2700  O  O   . LYS B  1 158 ? -50.202  -18.798 -83.152  1.00 21.48  ? 139  LYS B O   1 
ATOM   2701  C  CB  . LYS B  1 158 ? -51.659  -20.704 -81.541  1.00 16.05  ? 139  LYS B CB  1 
ATOM   2702  C  CG  . LYS B  1 158 ? -52.390  -21.333 -82.707  1.00 28.68  ? 139  LYS B CG  1 
ATOM   2703  C  CD  . LYS B  1 158 ? -53.911  -21.231 -82.501  1.00 24.87  ? 139  LYS B CD  1 
ATOM   2704  C  CE  . LYS B  1 158 ? -54.651  -21.620 -83.774  1.00 28.18  ? 139  LYS B CE  1 
ATOM   2705  N  NZ  . LYS B  1 158 ? -56.140  -21.430 -83.688  1.00 28.09  ? 139  LYS B NZ  1 
ATOM   2706  N  N   . ILE B  1 159 ? -48.952  -20.577 -83.773  1.00 15.35  ? 140  ILE B N   1 
ATOM   2707  C  CA  . ILE B  1 159 ? -48.457  -19.942 -85.007  1.00 23.78  ? 140  ILE B CA  1 
ATOM   2708  C  C   . ILE B  1 159 ? -48.874  -20.727 -86.241  1.00 27.99  ? 140  ILE B C   1 
ATOM   2709  O  O   . ILE B  1 159 ? -48.628  -21.931 -86.330  1.00 29.90  ? 140  ILE B O   1 
ATOM   2710  C  CB  . ILE B  1 159 ? -46.929  -19.848 -85.005  1.00 19.54  ? 140  ILE B CB  1 
ATOM   2711  C  CG1 . ILE B  1 159 ? -46.473  -18.941 -83.860  1.00 23.62  ? 140  ILE B CG1 1 
ATOM   2712  C  CG2 . ILE B  1 159 ? -46.434  -19.336 -86.329  1.00 19.33  ? 140  ILE B CG2 1 
ATOM   2713  C  CD1 . ILE B  1 159 ? -44.969  -18.748 -83.769  1.00 24.36  ? 140  ILE B CD1 1 
ATOM   2714  N  N   . GLY B  1 160 ? -49.509  -20.047 -87.186  1.00 31.99  ? 141  GLY B N   1 
ATOM   2715  C  CA  . GLY B  1 160 ? -49.906  -20.674 -88.436  1.00 33.21  ? 141  GLY B CA  1 
ATOM   2716  C  C   . GLY B  1 160 ? -50.090  -19.662 -89.557  1.00 34.06  ? 141  GLY B C   1 
ATOM   2717  O  O   . GLY B  1 160 ? -49.990  -18.443 -89.327  1.00 26.35  ? 141  GLY B O   1 
ATOM   2718  N  N   . SER B  1 161 ? -50.336  -20.161 -90.775  1.00 36.07  ? 142  SER B N   1 
ATOM   2719  C  CA  . SER B  1 161 ? -50.644  -19.291 -91.914  1.00 27.06  ? 142  SER B CA  1 
ATOM   2720  C  C   . SER B  1 161 ? -51.966  -18.595 -91.674  1.00 24.94  ? 142  SER B C   1 
ATOM   2721  O  O   . SER B  1 161 ? -52.964  -19.231 -91.341  1.00 26.60  ? 142  SER B O   1 
ATOM   2722  C  CB  . SER B  1 161 ? -50.760  -20.092 -93.204  1.00 23.66  ? 142  SER B CB  1 
ATOM   2723  O  OG  . SER B  1 161 ? -51.380  -19.333 -94.232  1.00 20.59  ? 142  SER B OG  1 
ATOM   2724  N  N   . TRP B  1 162 ? -51.985  -17.284 -91.843  1.00 18.60  ? 143  TRP B N   1 
ATOM   2725  C  CA  . TRP B  1 162 ? -53.226  -16.546 -91.662  1.00 24.60  ? 143  TRP B CA  1 
ATOM   2726  C  C   . TRP B  1 162 ? -54.234  -16.807 -92.801  1.00 35.46  ? 143  TRP B C   1 
ATOM   2727  O  O   . TRP B  1 162 ? -55.430  -16.946 -92.556  1.00 41.64  ? 143  TRP B O   1 
ATOM   2728  C  CB  . TRP B  1 162 ? -52.943  -15.048 -91.535  1.00 21.23  ? 143  TRP B CB  1 
ATOM   2729  C  CG  . TRP B  1 162 ? -54.053  -14.301 -90.897  1.00 18.97  ? 143  TRP B CG  1 
ATOM   2730  C  CD1 . TRP B  1 162 ? -54.862  -13.362 -91.482  1.00 26.29  ? 143  TRP B CD1 1 
ATOM   2731  C  CD2 . TRP B  1 162 ? -54.502  -14.429 -89.555  1.00 21.42  ? 143  TRP B CD2 1 
ATOM   2732  N  NE1 . TRP B  1 162 ? -55.776  -12.883 -90.566  1.00 26.30  ? 143  TRP B NE1 1 
ATOM   2733  C  CE2 . TRP B  1 162 ? -55.586  -13.534 -89.377  1.00 24.61  ? 143  TRP B CE2 1 
ATOM   2734  C  CE3 . TRP B  1 162 ? -54.099  -15.214 -88.471  1.00 30.75  ? 143  TRP B CE3 1 
ATOM   2735  C  CZ2 . TRP B  1 162 ? -56.266  -13.400 -88.162  1.00 23.89  ? 143  TRP B CZ2 1 
ATOM   2736  C  CZ3 . TRP B  1 162 ? -54.776  -15.073 -87.242  1.00 26.87  ? 143  TRP B CZ3 1 
ATOM   2737  C  CH2 . TRP B  1 162 ? -55.834  -14.170 -87.103  1.00 20.35  ? 143  TRP B CH2 1 
ATOM   2738  N  N   . THR B  1 163 ? -53.761  -16.868 -94.043  1.00 35.01  ? 144  THR B N   1 
ATOM   2739  C  CA  . THR B  1 163 ? -54.687  -16.963 -95.172  1.00 32.14  ? 144  THR B CA  1 
ATOM   2740  C  C   . THR B  1 163 ? -54.533  -18.192 -96.048  1.00 28.72  ? 144  THR B C   1 
ATOM   2741  O  O   . THR B  1 163 ? -55.347  -18.409 -96.926  1.00 30.96  ? 144  THR B O   1 
ATOM   2742  C  CB  . THR B  1 163 ? -54.637  -15.718 -96.084  1.00 28.80  ? 144  THR B CB  1 
ATOM   2743  O  OG1 . THR B  1 163 ? -53.424  -15.733 -96.852  1.00 31.60  ? 144  THR B OG1 1 
ATOM   2744  C  CG2 . THR B  1 163 ? -54.704  -14.477 -95.250  1.00 25.35  ? 144  THR B CG2 1 
ATOM   2745  N  N   . HIS B  1 164 ? -53.505  -18.999 -95.825  1.00 26.69  ? 145  HIS B N   1 
ATOM   2746  C  CA  . HIS B  1 164 ? -53.347  -20.183 -96.653  1.00 27.08  ? 145  HIS B CA  1 
ATOM   2747  C  C   . HIS B  1 164 ? -53.760  -21.415 -95.889  1.00 30.95  ? 145  HIS B C   1 
ATOM   2748  O  O   . HIS B  1 164 ? -53.304  -21.620 -94.766  1.00 36.56  ? 145  HIS B O   1 
ATOM   2749  C  CB  . HIS B  1 164 ? -51.913  -20.298 -97.199  1.00 30.24  ? 145  HIS B CB  1 
ATOM   2750  C  CG  . HIS B  1 164 ? -51.546  -19.206 -98.160  1.00 28.46  ? 145  HIS B CG  1 
ATOM   2751  N  ND1 . HIS B  1 164 ? -52.090  -19.118 -99.424  1.00 25.57  ? 145  HIS B ND1 1 
ATOM   2752  C  CD2 . HIS B  1 164 ? -50.703  -18.154 -98.038  1.00 27.43  ? 145  HIS B CD2 1 
ATOM   2753  C  CE1 . HIS B  1 164 ? -51.590  -18.063 -100.042 1.00 24.02  ? 145  HIS B CE1 1 
ATOM   2754  N  NE2 . HIS B  1 164 ? -50.753  -17.455 -99.225  1.00 26.03  ? 145  HIS B NE2 1 
ATOM   2755  N  N   . HIS B  1 165 ? -54.633  -22.227 -96.489  1.00 30.86  ? 146  HIS B N   1 
ATOM   2756  C  CA  . HIS B  1 165 ? -55.084  -23.473 -95.852  1.00 33.10  ? 146  HIS B CA  1 
ATOM   2757  C  C   . HIS B  1 165 ? -54.101  -24.644 -96.063  1.00 37.40  ? 146  HIS B C   1 
ATOM   2758  O  O   . HIS B  1 165 ? -53.029  -24.472 -96.665  1.00 37.23  ? 146  HIS B O   1 
ATOM   2759  C  CB  . HIS B  1 165 ? -56.504  -23.838 -96.306  1.00 36.39  ? 146  HIS B CB  1 
ATOM   2760  C  CG  . HIS B  1 165 ? -56.644  -24.008 -97.790  1.00 44.12  ? 146  HIS B CG  1 
ATOM   2761  N  ND1 . HIS B  1 165 ? -56.067  -25.054 -98.491  1.00 39.66  ? 146  HIS B ND1 1 
ATOM   2762  C  CD2 . HIS B  1 165 ? -57.291  -23.256 -98.711  1.00 46.64  ? 146  HIS B CD2 1 
ATOM   2763  C  CE1 . HIS B  1 165 ? -56.361  -24.938 -99.769  1.00 37.23  ? 146  HIS B CE1 1 
ATOM   2764  N  NE2 . HIS B  1 165 ? -57.106  -23.857 -99.931  1.00 41.43  ? 146  HIS B NE2 1 
ATOM   2765  N  N   . SER B  1 166 ? -54.480  -25.829 -95.581  1.00 38.76  ? 147  SER B N   1 
ATOM   2766  C  CA  . SER B  1 166 ? -53.566  -26.974 -95.495  1.00 37.05  ? 147  SER B CA  1 
ATOM   2767  C  C   . SER B  1 166 ? -53.037  -27.462 -96.837  1.00 38.41  ? 147  SER B C   1 
ATOM   2768  O  O   . SER B  1 166 ? -51.979  -28.099 -96.897  1.00 44.40  ? 147  SER B O   1 
ATOM   2769  C  CB  . SER B  1 166 ? -54.211  -28.136 -94.722  1.00 36.17  ? 147  SER B CB  1 
ATOM   2770  O  OG  . SER B  1 166 ? -55.412  -28.547 -95.345  1.00 36.94  ? 147  SER B OG  1 
ATOM   2771  N  N   . ARG B  1 167 ? -53.748  -27.166 -97.920  1.00 34.82  ? 148  ARG B N   1 
ATOM   2772  C  CA  . ARG B  1 167 ? -53.293  -27.657 -99.219  1.00 30.37  ? 148  ARG B CA  1 
ATOM   2773  C  C   . ARG B  1 167 ? -52.468  -26.626 -100.012 1.00 31.05  ? 148  ARG B C   1 
ATOM   2774  O  O   . ARG B  1 167 ? -51.937  -26.905 -101.089 1.00 31.80  ? 148  ARG B O   1 
ATOM   2775  C  CB  . ARG B  1 167 ? -54.460  -28.267 -99.991  1.00 27.94  ? 148  ARG B CB  1 
ATOM   2776  C  CG  . ARG B  1 167 ? -54.723  -29.733 -99.580  1.00 28.66  ? 148  ARG B CG  1 
ATOM   2777  C  CD  . ARG B  1 167 ? -53.515  -30.622 -99.977  1.00 78.59  ? 148  ARG B CD  1 
ATOM   2778  N  NE  . ARG B  1 167 ? -53.581  -31.979 -99.434  1.00 80.16  ? 148  ARG B NE  1 
ATOM   2779  C  CZ  . ARG B  1 167 ? -52.687  -32.944 -99.661  1.00 79.70  ? 148  ARG B CZ  1 
ATOM   2780  N  NH1 . ARG B  1 167 ? -51.636  -32.717 -100.445 1.00 76.44  ? 148  ARG B NH1 1 
ATOM   2781  N  NH2 . ARG B  1 167 ? -52.850  -34.147 -99.102  1.00 79.56  ? 148  ARG B NH2 1 
ATOM   2782  N  N   . GLU B  1 168 ? -52.334  -25.444 -99.426  1.00 30.79  ? 149  GLU B N   1 
ATOM   2783  C  CA  . GLU B  1 168 ? -51.374  -24.450 -99.877  1.00 31.95  ? 149  GLU B CA  1 
ATOM   2784  C  C   . GLU B  1 168 ? -50.167  -24.334 -98.914  1.00 37.87  ? 149  GLU B C   1 
ATOM   2785  O  O   . GLU B  1 168 ? -49.014  -24.322 -99.358  1.00 44.93  ? 149  GLU B O   1 
ATOM   2786  C  CB  . GLU B  1 168 ? -52.068  -23.088 -100.080 1.00 26.82  ? 149  GLU B CB  1 
ATOM   2787  C  CG  . GLU B  1 168 ? -53.232  -23.153 -101.054 1.00 24.90  ? 149  GLU B CG  1 
ATOM   2788  C  CD  . GLU B  1 168 ? -54.125  -21.922 -101.005 1.00 40.37  ? 149  GLU B CD  1 
ATOM   2789  O  OE1 . GLU B  1 168 ? -54.148  -21.215 -99.978  1.00 49.34  ? 149  GLU B OE1 1 
ATOM   2790  O  OE2 . GLU B  1 168 ? -54.814  -21.651 -101.999 1.00 48.15  ? 149  GLU B OE2 1 
ATOM   2791  N  N   . ILE B  1 169 ? -50.425  -24.243 -97.607  1.00 32.13  ? 150  ILE B N   1 
ATOM   2792  C  CA  . ILE B  1 169 ? -49.330  -24.212 -96.636  1.00 33.84  ? 150  ILE B CA  1 
ATOM   2793  C  C   . ILE B  1 169 ? -49.502  -25.239 -95.519  1.00 38.31  ? 150  ILE B C   1 
ATOM   2794  O  O   . ILE B  1 169 ? -50.539  -25.260 -94.832  1.00 42.41  ? 150  ILE B O   1 
ATOM   2795  C  CB  . ILE B  1 169 ? -49.130  -22.812 -96.005  1.00 28.99  ? 150  ILE B CB  1 
ATOM   2796  C  CG1 . ILE B  1 169 ? -48.574  -21.828 -97.038  1.00 25.95  ? 150  ILE B CG1 1 
ATOM   2797  C  CG2 . ILE B  1 169 ? -48.152  -22.891 -94.843  1.00 24.92  ? 150  ILE B CG2 1 
ATOM   2798  C  CD1 . ILE B  1 169 ? -48.261  -20.453 -96.461  1.00 24.11  ? 150  ILE B CD1 1 
ATOM   2799  N  N   . SER B  1 170 ? -48.490  -26.088 -95.334  1.00 33.70  ? 151  SER B N   1 
ATOM   2800  C  CA  . SER B  1 170 ? -48.448  -26.940 -94.146  1.00 36.61  ? 151  SER B CA  1 
ATOM   2801  C  C   . SER B  1 170 ? -47.300  -26.507 -93.214  1.00 39.39  ? 151  SER B C   1 
ATOM   2802  O  O   . SER B  1 170 ? -46.173  -26.251 -93.669  1.00 37.52  ? 151  SER B O   1 
ATOM   2803  C  CB  . SER B  1 170 ? -48.337  -28.419 -94.517  1.00 34.09  ? 151  SER B CB  1 
ATOM   2804  O  OG  . SER B  1 170 ? -47.014  -28.733 -94.901  1.00 38.83  ? 151  SER B OG  1 
ATOM   2805  N  N   . VAL B  1 171 ? -47.593  -26.406 -91.917  1.00 41.15  ? 152  VAL B N   1 
ATOM   2806  C  CA  . VAL B  1 171 ? -46.568  -26.063 -90.928  1.00 44.67  ? 152  VAL B CA  1 
ATOM   2807  C  C   . VAL B  1 171 ? -46.135  -27.288 -90.148  1.00 49.66  ? 152  VAL B C   1 
ATOM   2808  O  O   . VAL B  1 171 ? -46.952  -28.161 -89.837  1.00 56.61  ? 152  VAL B O   1 
ATOM   2809  C  CB  . VAL B  1 171 ? -47.027  -24.960 -89.932  1.00 23.17  ? 152  VAL B CB  1 
ATOM   2810  C  CG1 . VAL B  1 171 ? -47.082  -23.618 -90.617  1.00 28.88  ? 152  VAL B CG1 1 
ATOM   2811  C  CG2 . VAL B  1 171 ? -48.378  -25.292 -89.361  1.00 24.35  ? 152  VAL B CG2 1 
ATOM   2812  N  N   . ASP B  1 172 ? -44.846  -27.355 -89.837  1.00 49.22  ? 153  ASP B N   1 
ATOM   2813  C  CA  . ASP B  1 172 ? -44.313  -28.478 -89.085  1.00 52.27  ? 153  ASP B CA  1 
ATOM   2814  C  C   . ASP B  1 172 ? -43.239  -27.987 -88.140  1.00 46.18  ? 153  ASP B C   1 
ATOM   2815  O  O   . ASP B  1 172 ? -42.527  -27.036 -88.448  1.00 45.13  ? 153  ASP B O   1 
ATOM   2816  C  CB  . ASP B  1 172 ? -43.750  -29.548 -90.033  1.00 64.81  ? 153  ASP B CB  1 
ATOM   2817  C  CG  . ASP B  1 172 ? -44.831  -30.187 -90.917  1.00 75.04  ? 153  ASP B CG  1 
ATOM   2818  O  OD1 . ASP B  1 172 ? -45.574  -31.056 -90.398  1.00 75.22  ? 153  ASP B OD1 1 
ATOM   2819  O  OD2 . ASP B  1 172 ? -44.931  -29.823 -92.124  1.00 78.20  ? 153  ASP B OD2 1 
ATOM   2820  N  N   . PRO B  1 173 ? -43.134  -28.623 -86.967  1.00 49.31  ? 154  PRO B N   1 
ATOM   2821  C  CA  . PRO B  1 173 ? -42.029  -28.351 -86.027  1.00 49.27  ? 154  PRO B CA  1 
ATOM   2822  C  C   . PRO B  1 173 ? -40.692  -28.872 -86.574  1.00 57.55  ? 154  PRO B C   1 
ATOM   2823  O  O   . PRO B  1 173 ? -40.673  -29.635 -87.544  1.00 62.03  ? 154  PRO B O   1 
ATOM   2824  C  CB  . PRO B  1 173 ? -42.432  -29.139 -84.775  1.00 42.55  ? 154  PRO B CB  1 
ATOM   2825  C  CG  . PRO B  1 173 ? -43.924  -29.373 -84.930  1.00 43.94  ? 154  PRO B CG  1 
ATOM   2826  C  CD  . PRO B  1 173 ? -44.138  -29.544 -86.401  1.00 43.57  ? 154  PRO B CD  1 
ATOM   2827  N  N   . THR B  1 174 ? -39.588  -28.473 -85.953  1.00 62.11  ? 155  THR B N   1 
ATOM   2828  C  CA  . THR B  1 174 ? -38.260  -28.906 -86.396  1.00 65.62  ? 155  THR B CA  1 
ATOM   2829  C  C   . THR B  1 174 ? -37.713  -30.057 -85.553  1.00 72.54  ? 155  THR B C   1 
ATOM   2830  O  O   . THR B  1 174 ? -37.300  -31.092 -86.083  1.00 75.28  ? 155  THR B O   1 
ATOM   2831  C  CB  . THR B  1 174 ? -37.256  -27.728 -86.380  1.00 63.79  ? 155  THR B CB  1 
ATOM   2832  O  OG1 . THR B  1 174 ? -37.539  -26.851 -87.480  1.00 68.24  ? 155  THR B OG1 1 
ATOM   2833  C  CG2 . THR B  1 174 ? -35.817  -28.221 -86.490  1.00 58.60  ? 155  THR B CG2 1 
ATOM   2834  N  N   . SER B  1 181 ? -33.160  -23.877 -73.910  1.00 67.52  ? 162  SER B N   1 
ATOM   2835  C  CA  . SER B  1 181 ? -32.484  -22.744 -73.273  1.00 72.51  ? 162  SER B CA  1 
ATOM   2836  C  C   . SER B  1 181 ? -31.173  -22.441 -73.988  1.00 66.51  ? 162  SER B C   1 
ATOM   2837  O  O   . SER B  1 181 ? -30.286  -21.781 -73.436  1.00 73.54  ? 162  SER B O   1 
ATOM   2838  C  CB  . SER B  1 181 ? -32.195  -23.009 -71.773  1.00 71.36  ? 162  SER B CB  1 
ATOM   2839  O  OG  . SER B  1 181 ? -33.372  -23.187 -70.998  1.00 70.56  ? 162  SER B OG  1 
ATOM   2840  N  N   . GLU B  1 182 ? -31.038  -22.936 -75.204  1.00 49.55  ? 163  GLU B N   1 
ATOM   2841  C  CA  . GLU B  1 182 ? -29.750  -22.866 -75.862  1.00 44.27  ? 163  GLU B CA  1 
ATOM   2842  C  C   . GLU B  1 182 ? -29.254  -21.413 -76.044  1.00 44.76  ? 163  GLU B C   1 
ATOM   2843  O  O   . GLU B  1 182 ? -28.085  -21.112 -75.779  1.00 42.75  ? 163  GLU B O   1 
ATOM   2844  C  CB  . GLU B  1 182 ? -29.817  -23.602 -77.193  1.00 49.82  ? 163  GLU B CB  1 
ATOM   2845  C  CG  . GLU B  1 182 ? -28.486  -23.677 -77.905  1.00 55.78  ? 163  GLU B CG  1 
ATOM   2846  C  CD  . GLU B  1 182 ? -28.597  -24.248 -79.306  1.00 62.31  ? 163  GLU B CD  1 
ATOM   2847  O  OE1 . GLU B  1 182 ? -29.720  -24.280 -79.868  1.00 68.07  ? 163  GLU B OE1 1 
ATOM   2848  O  OE2 . GLU B  1 182 ? -27.551  -24.661 -79.849  1.00 63.95  ? 163  GLU B OE2 1 
ATOM   2849  N  N   . TYR B  1 183 ? -30.143  -20.518 -76.482  1.00 40.92  ? 164  TYR B N   1 
ATOM   2850  C  CA  . TYR B  1 183 ? -29.786  -19.113 -76.629  1.00 36.85  ? 164  TYR B CA  1 
ATOM   2851  C  C   . TYR B  1 183 ? -30.502  -18.237 -75.601  1.00 37.01  ? 164  TYR B C   1 
ATOM   2852  O  O   . TYR B  1 183 ? -30.471  -16.997 -75.673  1.00 38.00  ? 164  TYR B O   1 
ATOM   2853  C  CB  . TYR B  1 183 ? -30.092  -18.621 -78.045  1.00 40.07  ? 164  TYR B CB  1 
ATOM   2854  C  CG  . TYR B  1 183 ? -29.489  -19.487 -79.126  1.00 40.89  ? 164  TYR B CG  1 
ATOM   2855  C  CD1 . TYR B  1 183 ? -28.117  -19.713 -79.175  1.00 37.33  ? 164  TYR B CD1 1 
ATOM   2856  C  CD2 . TYR B  1 183 ? -30.291  -20.073 -80.101  1.00 42.78  ? 164  TYR B CD2 1 
ATOM   2857  C  CE1 . TYR B  1 183 ? -27.560  -20.495 -80.162  1.00 42.29  ? 164  TYR B CE1 1 
ATOM   2858  C  CE2 . TYR B  1 183 ? -29.752  -20.865 -81.089  1.00 43.82  ? 164  TYR B CE2 1 
ATOM   2859  C  CZ  . TYR B  1 183 ? -28.379  -21.075 -81.124  1.00 46.26  ? 164  TYR B CZ  1 
ATOM   2860  O  OH  . TYR B  1 183 ? -27.819  -21.870 -82.116  1.00 48.43  ? 164  TYR B OH  1 
ATOM   2861  N  N   . PHE B  1 184 ? -31.146  -18.876 -74.633  1.00 34.26  ? 165  PHE B N   1 
ATOM   2862  C  CA  . PHE B  1 184 ? -31.880  -18.122 -73.632  1.00 27.77  ? 165  PHE B CA  1 
ATOM   2863  C  C   . PHE B  1 184 ? -30.956  -17.290 -72.722  1.00 26.84  ? 165  PHE B C   1 
ATOM   2864  O  O   . PHE B  1 184 ? -29.923  -17.765 -72.256  1.00 24.74  ? 165  PHE B O   1 
ATOM   2865  C  CB  . PHE B  1 184 ? -32.780  -19.032 -72.803  1.00 24.28  ? 165  PHE B CB  1 
ATOM   2866  C  CG  . PHE B  1 184 ? -33.854  -18.285 -72.051  1.00 29.92  ? 165  PHE B CG  1 
ATOM   2867  C  CD1 . PHE B  1 184 ? -34.954  -17.750 -72.717  1.00 29.61  ? 165  PHE B CD1 1 
ATOM   2868  C  CD2 . PHE B  1 184 ? -33.757  -18.089 -70.684  1.00 31.66  ? 165  PHE B CD2 1 
ATOM   2869  C  CE1 . PHE B  1 184 ? -35.940  -17.040 -72.025  1.00 27.89  ? 165  PHE B CE1 1 
ATOM   2870  C  CE2 . PHE B  1 184 ? -34.748  -17.379 -69.979  1.00 28.90  ? 165  PHE B CE2 1 
ATOM   2871  C  CZ  . PHE B  1 184 ? -35.838  -16.856 -70.664  1.00 29.16  ? 165  PHE B CZ  1 
ATOM   2872  N  N   . SER B  1 185 ? -31.331  -16.036 -72.486  1.00 23.64  ? 166  SER B N   1 
ATOM   2873  C  CA  . SER B  1 185 ? -30.499  -15.142 -71.696  1.00 24.02  ? 166  SER B CA  1 
ATOM   2874  C  C   . SER B  1 185 ? -30.360  -15.614 -70.242  1.00 27.84  ? 166  SER B C   1 
ATOM   2875  O  O   . SER B  1 185 ? -31.344  -15.817 -69.521  1.00 24.08  ? 166  SER B O   1 
ATOM   2876  C  CB  . SER B  1 185 ? -31.064  -13.728 -71.740  1.00 16.00  ? 166  SER B CB  1 
ATOM   2877  O  OG  . SER B  1 185 ? -30.168  -12.818 -71.130  1.00 20.19  ? 166  SER B OG  1 
ATOM   2878  N  N   . GLN B  1 186 ? -29.128  -15.771 -69.793  1.00 32.47  ? 167  GLN B N   1 
ATOM   2879  C  CA  . GLN B  1 186 ? -28.902  -16.062 -68.380  1.00 32.57  ? 167  GLN B CA  1 
ATOM   2880  C  C   . GLN B  1 186 ? -29.290  -14.879 -67.470  1.00 35.62  ? 167  GLN B C   1 
ATOM   2881  O  O   . GLN B  1 186 ? -29.334  -15.036 -66.249  1.00 32.31  ? 167  GLN B O   1 
ATOM   2882  C  CB  . GLN B  1 186 ? -27.444  -16.425 -68.146  1.00 27.16  ? 167  GLN B CB  1 
ATOM   2883  C  CG  . GLN B  1 186 ? -26.496  -15.270 -68.430  1.00 35.99  ? 167  GLN B CG  1 
ATOM   2884  C  CD  . GLN B  1 186 ? -25.040  -15.616 -68.165  1.00 47.16  ? 167  GLN B CD  1 
ATOM   2885  O  OE1 . GLN B  1 186 ? -24.174  -15.397 -69.017  1.00 58.36  ? 167  GLN B OE1 1 
ATOM   2886  N  NE2 . GLN B  1 186 ? -24.761  -16.148 -66.983  1.00 45.41  ? 167  GLN B NE2 1 
ATOM   2887  N  N   . TYR B  1 187 ? -29.569  -13.710 -68.056  1.00 28.88  ? 168  TYR B N   1 
ATOM   2888  C  CA  . TYR B  1 187 ? -29.851  -12.527 -67.258  1.00 27.53  ? 168  TYR B CA  1 
ATOM   2889  C  C   . TYR B  1 187 ? -31.342  -12.279 -67.144  1.00 31.40  ? 168  TYR B C   1 
ATOM   2890  O  O   . TYR B  1 187 ? -31.786  -11.292 -66.549  1.00 31.36  ? 168  TYR B O   1 
ATOM   2891  C  CB  . TYR B  1 187 ? -29.093  -11.305 -67.790  1.00 30.61  ? 168  TYR B CB  1 
ATOM   2892  C  CG  . TYR B  1 187 ? -27.615  -11.570 -67.863  1.00 29.06  ? 168  TYR B CG  1 
ATOM   2893  C  CD1 . TYR B  1 187 ? -26.887  -11.857 -66.713  1.00 24.27  ? 168  TYR B CD1 1 
ATOM   2894  C  CD2 . TYR B  1 187 ? -26.949  -11.565 -69.084  1.00 22.03  ? 168  TYR B CD2 1 
ATOM   2895  C  CE1 . TYR B  1 187 ? -25.531  -12.117 -66.777  1.00 22.94  ? 168  TYR B CE1 1 
ATOM   2896  C  CE2 . TYR B  1 187 ? -25.598  -11.817 -69.160  1.00 16.36  ? 168  TYR B CE2 1 
ATOM   2897  C  CZ  . TYR B  1 187 ? -24.898  -12.103 -68.011  1.00 28.85  ? 168  TYR B CZ  1 
ATOM   2898  O  OH  . TYR B  1 187 ? -23.546  -12.354 -68.107  1.00 40.43  ? 168  TYR B OH  1 
ATOM   2899  N  N   . SER B  1 188 ? -32.128  -13.182 -67.707  1.00 16.16  ? 169  SER B N   1 
ATOM   2900  C  CA  . SER B  1 188 ? -33.571  -13.082 -67.510  1.00 23.71  ? 169  SER B CA  1 
ATOM   2901  C  C   . SER B  1 188 ? -33.900  -13.389 -66.052  1.00 30.64  ? 169  SER B C   1 
ATOM   2902  O  O   . SER B  1 188 ? -33.173  -14.133 -65.402  1.00 37.65  ? 169  SER B O   1 
ATOM   2903  C  CB  . SER B  1 188 ? -34.295  -14.057 -68.423  1.00 20.61  ? 169  SER B CB  1 
ATOM   2904  O  OG  . SER B  1 188 ? -35.695  -13.972 -68.226  1.00 23.58  ? 169  SER B OG  1 
ATOM   2905  N  N   . ARG B  1 189 ? -34.972  -12.822 -65.511  1.00 30.13  ? 170  ARG B N   1 
ATOM   2906  C  CA  . ARG B  1 189 ? -35.371  -13.194 -64.146  1.00 28.70  ? 170  ARG B CA  1 
ATOM   2907  C  C   . ARG B  1 189 ? -35.987  -14.582 -64.236  1.00 30.19  ? 170  ARG B C   1 
ATOM   2908  O  O   . ARG B  1 189 ? -36.190  -15.254 -63.232  1.00 35.97  ? 170  ARG B O   1 
ATOM   2909  C  CB  . ARG B  1 189 ? -36.361  -12.182 -63.527  1.00 16.30  ? 170  ARG B CB  1 
ATOM   2910  C  CG  . ARG B  1 189 ? -35.931  -10.760 -63.718  1.00 47.14  ? 170  ARG B CG  1 
ATOM   2911  C  CD  . ARG B  1 189 ? -36.736  -9.766  -62.916  1.00 50.86  ? 170  ARG B CD  1 
ATOM   2912  N  NE  . ARG B  1 189 ? -38.185  -9.976  -62.902  1.00 56.39  ? 170  ARG B NE  1 
ATOM   2913  C  CZ  . ARG B  1 189 ? -38.944  -9.878  -61.802  1.00 60.10  ? 170  ARG B CZ  1 
ATOM   2914  N  NH1 . ARG B  1 189 ? -38.390  -9.602  -60.623  1.00 52.87  ? 170  ARG B NH1 1 
ATOM   2915  N  NH2 . ARG B  1 189 ? -40.261  -10.064 -61.877  1.00 64.60  ? 170  ARG B NH2 1 
ATOM   2916  N  N   . PHE B  1 190 ? -36.261  -15.024 -65.461  1.00 33.23  ? 171  PHE B N   1 
ATOM   2917  C  CA  . PHE B  1 190 ? -36.967  -16.285 -65.663  1.00 30.09  ? 171  PHE B CA  1 
ATOM   2918  C  C   . PHE B  1 190 ? -36.020  -17.358 -66.197  1.00 26.75  ? 171  PHE B C   1 
ATOM   2919  O  O   . PHE B  1 190 ? -34.880  -17.047 -66.562  1.00 31.14  ? 171  PHE B O   1 
ATOM   2920  C  CB  . PHE B  1 190 ? -38.165  -16.057 -66.582  1.00 28.36  ? 171  PHE B CB  1 
ATOM   2921  C  CG  . PHE B  1 190 ? -39.114  -15.009 -66.077  1.00 25.19  ? 171  PHE B CG  1 
ATOM   2922  C  CD1 . PHE B  1 190 ? -40.167  -15.346 -65.234  1.00 31.36  ? 171  PHE B CD1 1 
ATOM   2923  C  CD2 . PHE B  1 190 ? -38.942  -13.677 -66.416  1.00 24.31  ? 171  PHE B CD2 1 
ATOM   2924  C  CE1 . PHE B  1 190 ? -41.055  -14.354 -64.738  1.00 29.17  ? 171  PHE B CE1 1 
ATOM   2925  C  CE2 . PHE B  1 190 ? -39.823  -12.681 -65.921  1.00 28.49  ? 171  PHE B CE2 1 
ATOM   2926  C  CZ  . PHE B  1 190 ? -40.874  -13.018 -65.087  1.00 21.93  ? 171  PHE B CZ  1 
ATOM   2927  N  N   . GLU B  1 191 ? -36.479  -18.612 -66.201  1.00 22.89  ? 172  GLU B N   1 
ATOM   2928  C  CA  . GLU B  1 191 ? -35.687  -19.758 -66.682  1.00 26.70  ? 172  GLU B CA  1 
ATOM   2929  C  C   . GLU B  1 191 ? -36.613  -20.744 -67.376  1.00 33.23  ? 172  GLU B C   1 
ATOM   2930  O  O   . GLU B  1 191 ? -37.784  -20.878 -67.001  1.00 34.76  ? 172  GLU B O   1 
ATOM   2931  C  CB  . GLU B  1 191 ? -35.003  -20.476 -65.535  1.00 29.63  ? 172  GLU B CB  1 
ATOM   2932  C  CG  . GLU B  1 191 ? -35.991  -20.855 -64.420  1.00 49.00  ? 172  GLU B CG  1 
ATOM   2933  C  CD  . GLU B  1 191 ? -35.312  -21.462 -63.202  1.00 60.59  ? 172  GLU B CD  1 
ATOM   2934  O  OE1 . GLU B  1 191 ? -34.062  -21.369 -63.096  1.00 63.71  ? 172  GLU B OE1 1 
ATOM   2935  O  OE2 . GLU B  1 191 ? -36.031  -22.040 -62.357  1.00 63.56  ? 172  GLU B OE2 1 
ATOM   2936  N  N   . ILE B  1 192 ? -36.098  -21.428 -68.398  1.00 33.53  ? 173  ILE B N   1 
ATOM   2937  C  CA  . ILE B  1 192 ? -36.940  -22.315 -69.184  1.00 35.26  ? 173  ILE B CA  1 
ATOM   2938  C  C   . ILE B  1 192 ? -36.769  -23.753 -68.711  1.00 36.86  ? 173  ILE B C   1 
ATOM   2939  O  O   . ILE B  1 192 ? -35.655  -24.256 -68.635  1.00 37.66  ? 173  ILE B O   1 
ATOM   2940  C  CB  . ILE B  1 192 ? -36.673  -22.196 -70.703  1.00 31.53  ? 173  ILE B CB  1 
ATOM   2941  C  CG1 . ILE B  1 192 ? -36.972  -20.784 -71.182  1.00 28.75  ? 173  ILE B CG1 1 
ATOM   2942  C  CG2 . ILE B  1 192 ? -37.514  -23.203 -71.475  1.00 26.71  ? 173  ILE B CG2 1 
ATOM   2943  C  CD1 . ILE B  1 192 ? -36.838  -20.619 -72.651  1.00 29.08  ? 173  ILE B CD1 1 
ATOM   2944  N  N   . LEU B  1 193 ? -37.884  -24.398 -68.385  1.00 36.38  ? 174  LEU B N   1 
ATOM   2945  C  CA  . LEU B  1 193 ? -37.858  -25.772 -67.937  1.00 38.24  ? 174  LEU B CA  1 
ATOM   2946  C  C   . LEU B  1 193 ? -37.966  -26.694 -69.142  1.00 48.04  ? 174  LEU B C   1 
ATOM   2947  O  O   . LEU B  1 193 ? -37.182  -27.631 -69.284  1.00 49.55  ? 174  LEU B O   1 
ATOM   2948  C  CB  . LEU B  1 193 ? -38.988  -26.037 -66.934  1.00 34.31  ? 174  LEU B CB  1 
ATOM   2949  C  CG  . LEU B  1 193 ? -39.048  -24.998 -65.811  1.00 33.47  ? 174  LEU B CG  1 
ATOM   2950  C  CD1 . LEU B  1 193 ? -40.283  -25.211 -64.942  1.00 32.18  ? 174  LEU B CD1 1 
ATOM   2951  C  CD2 . LEU B  1 193 ? -37.747  -25.006 -64.997  1.00 19.85  ? 174  LEU B CD2 1 
ATOM   2952  N  N   . ASP B  1 194 ? -38.930  -26.423 -70.017  1.00 52.36  ? 175  ASP B N   1 
ATOM   2953  C  CA  . ASP B  1 194 ? -39.144  -27.270 -71.180  1.00 53.81  ? 175  ASP B CA  1 
ATOM   2954  C  C   . ASP B  1 194 ? -39.849  -26.530 -72.323  1.00 49.42  ? 175  ASP B C   1 
ATOM   2955  O  O   . ASP B  1 194 ? -40.650  -25.624 -72.090  1.00 55.29  ? 175  ASP B O   1 
ATOM   2956  C  CB  . ASP B  1 194 ? -39.957  -28.493 -70.770  1.00 65.33  ? 175  ASP B CB  1 
ATOM   2957  C  CG  . ASP B  1 194 ? -39.861  -29.621 -71.779  1.00 80.89  ? 175  ASP B CG  1 
ATOM   2958  O  OD1 . ASP B  1 194 ? -38.853  -29.668 -72.529  1.00 85.38  ? 175  ASP B OD1 1 
ATOM   2959  O  OD2 . ASP B  1 194 ? -40.791  -30.464 -71.811  1.00 87.63  ? 175  ASP B OD2 1 
ATOM   2960  N  N   . VAL B  1 195 ? -39.537  -26.911 -73.560  1.00 38.98  ? 176  VAL B N   1 
ATOM   2961  C  CA  . VAL B  1 195 ? -40.276  -26.425 -74.724  1.00 39.85  ? 176  VAL B CA  1 
ATOM   2962  C  C   . VAL B  1 195 ? -40.772  -27.609 -75.541  1.00 40.49  ? 176  VAL B C   1 
ATOM   2963  O  O   . VAL B  1 195 ? -39.976  -28.441 -75.974  1.00 39.72  ? 176  VAL B O   1 
ATOM   2964  C  CB  . VAL B  1 195 ? -39.404  -25.537 -75.641  1.00 40.70  ? 176  VAL B CB  1 
ATOM   2965  C  CG1 . VAL B  1 195 ? -40.186  -25.102 -76.876  1.00 32.97  ? 176  VAL B CG1 1 
ATOM   2966  C  CG2 . VAL B  1 195 ? -38.888  -24.313 -74.892  1.00 42.29  ? 176  VAL B CG2 1 
ATOM   2967  N  N   . THR B  1 196 ? -42.083  -27.692 -75.739  1.00 43.41  ? 177  THR B N   1 
ATOM   2968  C  CA  . THR B  1 196 ? -42.663  -28.759 -76.555  1.00 49.49  ? 177  THR B CA  1 
ATOM   2969  C  C   . THR B  1 196 ? -43.462  -28.146 -77.683  1.00 47.31  ? 177  THR B C   1 
ATOM   2970  O  O   . THR B  1 196 ? -44.046  -27.080 -77.529  1.00 50.07  ? 177  THR B O   1 
ATOM   2971  C  CB  . THR B  1 196 ? -43.557  -29.727 -75.745  1.00 56.69  ? 177  THR B CB  1 
ATOM   2972  O  OG1 . THR B  1 196 ? -44.728  -29.042 -75.288  1.00 56.03  ? 177  THR B OG1 1 
ATOM   2973  C  CG2 . THR B  1 196 ? -42.792  -30.294 -74.540  1.00 60.67  ? 177  THR B CG2 1 
ATOM   2974  N  N   . GLN B  1 197 ? -43.465  -28.816 -78.824  1.00 49.17  ? 178  GLN B N   1 
ATOM   2975  C  CA  . GLN B  1 197 ? -44.154  -28.316 -79.998  1.00 48.19  ? 178  GLN B CA  1 
ATOM   2976  C  C   . GLN B  1 197 ? -45.210  -29.320 -80.439  1.00 49.30  ? 178  GLN B C   1 
ATOM   2977  O  O   . GLN B  1 197 ? -45.044  -30.535 -80.313  1.00 54.69  ? 178  GLN B O   1 
ATOM   2978  C  CB  . GLN B  1 197 ? -43.155  -28.015 -81.120  1.00 49.10  ? 178  GLN B CB  1 
ATOM   2979  C  CG  . GLN B  1 197 ? -42.026  -27.070 -80.697  1.00 59.79  ? 178  GLN B CG  1 
ATOM   2980  C  CD  . GLN B  1 197 ? -41.452  -26.228 -81.856  1.00 71.83  ? 178  GLN B CD  1 
ATOM   2981  O  OE1 . GLN B  1 197 ? -41.666  -26.544 -83.032  1.00 76.13  ? 178  GLN B OE1 1 
ATOM   2982  N  NE2 . GLN B  1 197 ? -40.719  -25.146 -81.518  1.00 71.21  ? 178  GLN B NE2 1 
ATOM   2983  N  N   . LYS B  1 198 ? -46.313  -28.797 -80.940  1.00 47.85  ? 179  LYS B N   1 
ATOM   2984  C  CA  . LYS B  1 198 ? -47.413  -29.639 -81.369  1.00 47.92  ? 179  LYS B CA  1 
ATOM   2985  C  C   . LYS B  1 198 ? -48.124  -29.064 -82.617  1.00 45.77  ? 179  LYS B C   1 
ATOM   2986  O  O   . LYS B  1 198 ? -48.504  -27.889 -82.664  1.00 50.11  ? 179  LYS B O   1 
ATOM   2987  C  CB  . LYS B  1 198 ? -48.389  -29.860 -80.202  1.00 46.92  ? 179  LYS B CB  1 
ATOM   2988  C  CG  . LYS B  1 198 ? -49.707  -30.492 -80.602  1.00 51.05  ? 179  LYS B CG  1 
ATOM   2989  C  CD  . LYS B  1 198 ? -50.669  -30.686 -79.428  1.00 56.26  ? 179  LYS B CD  1 
ATOM   2990  C  CE  . LYS B  1 198 ? -51.956  -31.371 -79.911  1.00 57.73  ? 179  LYS B CE  1 
ATOM   2991  N  NZ  . LYS B  1 198 ? -52.924  -31.635 -78.819  1.00 59.24  ? 179  LYS B NZ  1 
ATOM   2992  N  N   . LYS B  1 199 ? -48.308  -29.909 -83.621  1.00 38.68  ? 180  LYS B N   1 
ATOM   2993  C  CA  . LYS B  1 199 ? -48.982  -29.495 -84.839  1.00 34.88  ? 180  LYS B CA  1 
ATOM   2994  C  C   . LYS B  1 199 ? -50.491  -29.739 -84.796  1.00 34.27  ? 180  LYS B C   1 
ATOM   2995  O  O   . LYS B  1 199 ? -50.949  -30.807 -84.389  1.00 47.47  ? 180  LYS B O   1 
ATOM   2996  C  CB  . LYS B  1 199 ? -48.380  -30.225 -86.036  1.00 32.46  ? 180  LYS B CB  1 
ATOM   2997  C  CG  . LYS B  1 199 ? -49.136  -29.994 -87.325  1.00 33.31  ? 180  LYS B CG  1 
ATOM   2998  C  CD  . LYS B  1 199 ? -48.467  -30.728 -88.471  1.00 37.46  ? 180  LYS B CD  1 
ATOM   2999  C  CE  . LYS B  1 199 ? -49.324  -30.683 -89.700  1.00 37.19  ? 180  LYS B CE  1 
ATOM   3000  N  NZ  . LYS B  1 199 ? -48.528  -30.982 -90.910  1.00 40.12  ? 180  LYS B NZ  1 
ATOM   3001  N  N   . ASN B  1 200 ? -51.260  -28.750 -85.223  1.00 25.61  ? 181  ASN B N   1 
ATOM   3002  C  CA  . ASN B  1 200 ? -52.709  -28.890 -85.313  1.00 35.07  ? 181  ASN B CA  1 
ATOM   3003  C  C   . ASN B  1 200 ? -53.256  -28.537 -86.673  1.00 44.63  ? 181  ASN B C   1 
ATOM   3004  O  O   . ASN B  1 200 ? -52.578  -27.900 -87.485  1.00 49.94  ? 181  ASN B O   1 
ATOM   3005  C  CB  . ASN B  1 200 ? -53.398  -28.003 -84.285  1.00 38.34  ? 181  ASN B CB  1 
ATOM   3006  C  CG  . ASN B  1 200 ? -52.985  -28.330 -82.903  1.00 34.07  ? 181  ASN B CG  1 
ATOM   3007  O  OD1 . ASN B  1 200 ? -53.425  -29.341 -82.345  1.00 38.42  ? 181  ASN B OD1 1 
ATOM   3008  N  ND2 . ASN B  1 200 ? -52.104  -27.503 -82.335  1.00 33.87  ? 181  ASN B ND2 1 
ATOM   3009  N  N   . SER B  1 201 ? -54.501  -28.948 -86.907  1.00 48.95  ? 182  SER B N   1 
ATOM   3010  C  CA  . SER B  1 201 ? -55.210  -28.611 -88.141  1.00 48.44  ? 182  SER B CA  1 
ATOM   3011  C  C   . SER B  1 201 ? -56.639  -28.233 -87.785  1.00 45.51  ? 182  SER B C   1 
ATOM   3012  O  O   . SER B  1 201 ? -57.413  -29.073 -87.336  1.00 54.26  ? 182  SER B O   1 
ATOM   3013  C  CB  . SER B  1 201 ? -55.194  -29.789 -89.103  1.00 52.26  ? 182  SER B CB  1 
ATOM   3014  O  OG  . SER B  1 201 ? -55.750  -29.420 -90.355  1.00 54.65  ? 182  SER B OG  1 
ATOM   3015  N  N   . VAL B  1 202 ? -56.979  -26.963 -87.974  1.00 40.01  ? 183  VAL B N   1 
ATOM   3016  C  CA  . VAL B  1 202 ? -58.229  -26.420 -87.457  1.00 39.02  ? 183  VAL B CA  1 
ATOM   3017  C  C   . VAL B  1 202 ? -59.111  -25.905 -88.581  1.00 45.55  ? 183  VAL B C   1 
ATOM   3018  O  O   . VAL B  1 202 ? -58.621  -25.338 -89.562  1.00 49.55  ? 183  VAL B O   1 
ATOM   3019  C  CB  . VAL B  1 202 ? -57.963  -25.277 -86.450  1.00 34.42  ? 183  VAL B CB  1 
ATOM   3020  C  CG1 . VAL B  1 202 ? -59.260  -24.722 -85.903  1.00 20.87  ? 183  VAL B CG1 1 
ATOM   3021  C  CG2 . VAL B  1 202 ? -57.065  -25.761 -85.308  1.00 30.46  ? 183  VAL B CG2 1 
ATOM   3022  N  N   . THR B  1 203 ? -60.416  -26.124 -88.440  1.00 45.54  ? 184  THR B N   1 
ATOM   3023  C  CA  . THR B  1 203 ? -61.394  -25.533 -89.347  1.00 42.87  ? 184  THR B CA  1 
ATOM   3024  C  C   . THR B  1 203 ? -62.066  -24.330 -88.689  1.00 38.68  ? 184  THR B C   1 
ATOM   3025  O  O   . THR B  1 203 ? -62.534  -24.425 -87.574  1.00 44.95  ? 184  THR B O   1 
ATOM   3026  C  CB  . THR B  1 203 ? -62.487  -26.537 -89.799  1.00 32.00  ? 184  THR B CB  1 
ATOM   3027  O  OG1 . THR B  1 203 ? -61.880  -27.737 -90.296  1.00 36.29  ? 184  THR B OG1 1 
ATOM   3028  C  CG2 . THR B  1 203 ? -63.348  -25.918 -90.923  1.00 32.01  ? 184  THR B CG2 1 
ATOM   3029  N  N   . TYR B  1 204 ? -62.110  -23.209 -89.399  1.00 33.23  ? 185  TYR B N   1 
ATOM   3030  C  CA  . TYR B  1 204 ? -62.713  -21.986 -88.904  1.00 27.73  ? 185  TYR B CA  1 
ATOM   3031  C  C   . TYR B  1 204 ? -64.061  -21.728 -89.585  1.00 37.89  ? 185  TYR B C   1 
ATOM   3032  O  O   . TYR B  1 204 ? -64.332  -22.247 -90.667  1.00 38.75  ? 185  TYR B O   1 
ATOM   3033  C  CB  . TYR B  1 204 ? -61.752  -20.815 -89.119  1.00 25.64  ? 185  TYR B CB  1 
ATOM   3034  C  CG  . TYR B  1 204 ? -60.427  -21.030 -88.431  1.00 31.58  ? 185  TYR B CG  1 
ATOM   3035  C  CD1 . TYR B  1 204 ? -59.433  -21.849 -88.992  1.00 30.82  ? 185  TYR B CD1 1 
ATOM   3036  C  CD2 . TYR B  1 204 ? -60.176  -20.440 -87.188  1.00 35.43  ? 185  TYR B CD2 1 
ATOM   3037  C  CE1 . TYR B  1 204 ? -58.207  -22.053 -88.324  1.00 36.91  ? 185  TYR B CE1 1 
ATOM   3038  C  CE2 . TYR B  1 204 ? -58.965  -20.644 -86.509  1.00 35.89  ? 185  TYR B CE2 1 
ATOM   3039  C  CZ  . TYR B  1 204 ? -57.985  -21.442 -87.079  1.00 40.85  ? 185  TYR B CZ  1 
ATOM   3040  O  OH  . TYR B  1 204 ? -56.799  -21.623 -86.400  1.00 45.23  ? 185  TYR B OH  1 
ATOM   3041  N  N   . SER B  1 205 ? -64.902  -20.926 -88.939  1.00 45.24  ? 186  SER B N   1 
ATOM   3042  C  CA  . SER B  1 205 ? -66.267  -20.710 -89.387  1.00 49.50  ? 186  SER B CA  1 
ATOM   3043  C  C   . SER B  1 205 ? -66.316  -20.109 -90.781  1.00 56.38  ? 186  SER B C   1 
ATOM   3044  O  O   . SER B  1 205 ? -67.204  -20.427 -91.577  1.00 53.09  ? 186  SER B O   1 
ATOM   3045  C  CB  . SER B  1 205 ? -66.980  -19.786 -88.415  1.00 53.26  ? 186  SER B CB  1 
ATOM   3046  O  OG  . SER B  1 205 ? -67.059  -20.402 -87.153  1.00 64.99  ? 186  SER B OG  1 
ATOM   3047  N  N   . CYS B  1 206 ? -65.352  -19.238 -91.066  1.00 59.18  ? 187  CYS B N   1 
ATOM   3048  C  CA  . CYS B  1 206 ? -65.360  -18.440 -92.281  1.00 55.36  ? 187  CYS B CA  1 
ATOM   3049  C  C   . CYS B  1 206 ? -65.226  -19.318 -93.525  1.00 57.56  ? 187  CYS B C   1 
ATOM   3050  O  O   . CYS B  1 206 ? -65.826  -19.045 -94.573  1.00 56.71  ? 187  CYS B O   1 
ATOM   3051  C  CB  . CYS B  1 206 ? -64.210  -17.430 -92.238  1.00 51.81  ? 187  CYS B CB  1 
ATOM   3052  S  SG  . CYS B  1 206 ? -62.585  -18.207 -92.483  1.00 73.26  ? 187  CYS B SG  1 
ATOM   3053  N  N   . CYS B  1 207 ? -64.438  -20.379 -93.397  1.00 57.03  ? 188  CYS B N   1 
ATOM   3054  C  CA  . CYS B  1 207 ? -63.909  -21.080 -94.562  1.00 57.70  ? 188  CYS B CA  1 
ATOM   3055  C  C   . CYS B  1 207 ? -64.068  -22.585 -94.401  1.00 56.46  ? 188  CYS B C   1 
ATOM   3056  O  O   . CYS B  1 207 ? -64.031  -23.107 -93.281  1.00 58.05  ? 188  CYS B O   1 
ATOM   3057  C  CB  . CYS B  1 207 ? -62.427  -20.698 -94.789  1.00 59.05  ? 188  CYS B CB  1 
ATOM   3058  S  SG  . CYS B  1 207 ? -62.025  -18.959 -94.318  1.00 126.31 ? 188  CYS B SG  1 
ATOM   3059  N  N   . PRO B  1 208 ? -64.252  -23.290 -95.528  1.00 51.97  ? 189  PRO B N   1 
ATOM   3060  C  CA  . PRO B  1 208 ? -64.495  -24.741 -95.532  1.00 46.08  ? 189  PRO B CA  1 
ATOM   3061  C  C   . PRO B  1 208 ? -63.225  -25.577 -95.377  1.00 51.55  ? 189  PRO B C   1 
ATOM   3062  O  O   . PRO B  1 208 ? -63.318  -26.745 -95.001  1.00 55.10  ? 189  PRO B O   1 
ATOM   3063  C  CB  . PRO B  1 208 ? -65.107  -24.985 -96.913  1.00 37.75  ? 189  PRO B CB  1 
ATOM   3064  C  CG  . PRO B  1 208 ? -64.517  -23.926 -97.763  1.00 44.44  ? 189  PRO B CG  1 
ATOM   3065  C  CD  . PRO B  1 208 ? -64.375  -22.706 -96.876  1.00 48.43  ? 189  PRO B CD  1 
ATOM   3066  N  N   . GLU B  1 209 ? -62.058  -25.001 -95.656  1.00 52.59  ? 190  GLU B N   1 
ATOM   3067  C  CA  . GLU B  1 209 ? -60.800  -25.749 -95.557  1.00 50.50  ? 190  GLU B CA  1 
ATOM   3068  C  C   . GLU B  1 209 ? -60.181  -25.710 -94.143  1.00 38.21  ? 190  GLU B C   1 
ATOM   3069  O  O   . GLU B  1 209 ? -60.566  -24.910 -93.277  1.00 41.33  ? 190  GLU B O   1 
ATOM   3070  C  CB  . GLU B  1 209 ? -59.787  -25.247 -96.597  1.00 60.87  ? 190  GLU B CB  1 
ATOM   3071  C  CG  . GLU B  1 209 ? -60.352  -25.076 -98.009  1.00 76.75  ? 190  GLU B CG  1 
ATOM   3072  C  CD  . GLU B  1 209 ? -60.980  -23.697 -98.247  1.00 93.00  ? 190  GLU B CD  1 
ATOM   3073  O  OE1 . GLU B  1 209 ? -60.992  -22.855 -97.309  1.00 97.75  ? 190  GLU B OE1 1 
ATOM   3074  O  OE2 . GLU B  1 209 ? -61.456  -23.458 -99.383  1.00 97.64  ? 190  GLU B OE2 1 
ATOM   3075  N  N   . ALA B  1 210 ? -59.213  -26.582 -93.922  1.00 22.41  ? 191  ALA B N   1 
ATOM   3076  C  CA  . ALA B  1 210 ? -58.495  -26.603 -92.673  1.00 26.34  ? 191  ALA B CA  1 
ATOM   3077  C  C   . ALA B  1 210 ? -57.170  -25.844 -92.754  1.00 33.69  ? 191  ALA B C   1 
ATOM   3078  O  O   . ALA B  1 210 ? -56.432  -25.947 -93.739  1.00 35.82  ? 191  ALA B O   1 
ATOM   3079  C  CB  . ALA B  1 210 ? -58.249  -28.030 -92.219  1.00 23.95  ? 191  ALA B CB  1 
ATOM   3080  N  N   . TYR B  1 211 ? -56.867  -25.106 -91.690  1.00 32.10  ? 192  TYR B N   1 
ATOM   3081  C  CA  . TYR B  1 211 ? -55.632  -24.343 -91.609  1.00 31.31  ? 192  TYR B CA  1 
ATOM   3082  C  C   . TYR B  1 211 ? -54.736  -24.971 -90.556  1.00 32.88  ? 192  TYR B C   1 
ATOM   3083  O  O   . TYR B  1 211 ? -55.186  -25.280 -89.452  1.00 35.77  ? 192  TYR B O   1 
ATOM   3084  C  CB  . TYR B  1 211 ? -55.927  -22.882 -91.259  1.00 28.59  ? 192  TYR B CB  1 
ATOM   3085  C  CG  . TYR B  1 211 ? -56.596  -22.124 -92.382  1.00 35.26  ? 192  TYR B CG  1 
ATOM   3086  C  CD1 . TYR B  1 211 ? -57.925  -22.352 -92.700  1.00 37.98  ? 192  TYR B CD1 1 
ATOM   3087  C  CD2 . TYR B  1 211 ? -55.891  -21.183 -93.135  1.00 34.90  ? 192  TYR B CD2 1 
ATOM   3088  C  CE1 . TYR B  1 211 ? -58.541  -21.666 -93.737  1.00 36.73  ? 192  TYR B CE1 1 
ATOM   3089  C  CE2 . TYR B  1 211 ? -56.496  -20.492 -94.166  1.00 33.39  ? 192  TYR B CE2 1 
ATOM   3090  C  CZ  . TYR B  1 211 ? -57.826  -20.732 -94.466  1.00 38.40  ? 192  TYR B CZ  1 
ATOM   3091  O  OH  . TYR B  1 211 ? -58.453  -20.042 -95.505  1.00 46.95  ? 192  TYR B OH  1 
ATOM   3092  N  N   . GLU B  1 212 ? -53.469  -25.166 -90.895  1.00 28.20  ? 193  GLU B N   1 
ATOM   3093  C  CA  . GLU B  1 212 ? -52.552  -25.787 -89.957  1.00 29.05  ? 193  GLU B CA  1 
ATOM   3094  C  C   . GLU B  1 212 ? -51.904  -24.732 -89.077  1.00 32.84  ? 193  GLU B C   1 
ATOM   3095  O  O   . GLU B  1 212 ? -51.771  -23.571 -89.481  1.00 36.30  ? 193  GLU B O   1 
ATOM   3096  C  CB  . GLU B  1 212 ? -51.484  -26.614 -90.677  1.00 20.49  ? 193  GLU B CB  1 
ATOM   3097  C  CG  . GLU B  1 212 ? -52.069  -27.735 -91.528  1.00 37.93  ? 193  GLU B CG  1 
ATOM   3098  C  CD  . GLU B  1 212 ? -51.025  -28.725 -92.025  1.00 34.27  ? 193  GLU B CD  1 
ATOM   3099  O  OE1 . GLU B  1 212 ? -49.812  -28.496 -91.767  1.00 32.45  ? 193  GLU B OE1 1 
ATOM   3100  O  OE2 . GLU B  1 212 ? -51.427  -29.740 -92.653  1.00 30.77  ? 193  GLU B OE2 1 
ATOM   3101  N  N   . ASP B  1 213 ? -51.509  -25.145 -87.876  1.00 28.59  ? 194  ASP B N   1 
ATOM   3102  C  CA  . ASP B  1 213 ? -50.758  -24.282 -86.988  1.00 29.34  ? 194  ASP B CA  1 
ATOM   3103  C  C   . ASP B  1 213 ? -49.765  -25.102 -86.199  1.00 31.55  ? 194  ASP B C   1 
ATOM   3104  O  O   . ASP B  1 213 ? -49.857  -26.323 -86.163  1.00 41.02  ? 194  ASP B O   1 
ATOM   3105  C  CB  . ASP B  1 213 ? -51.678  -23.502 -86.038  1.00 35.99  ? 194  ASP B CB  1 
ATOM   3106  C  CG  . ASP B  1 213 ? -52.393  -24.393 -85.036  1.00 46.88  ? 194  ASP B CG  1 
ATOM   3107  O  OD1 . ASP B  1 213 ? -51.763  -24.779 -84.018  1.00 53.96  ? 194  ASP B OD1 1 
ATOM   3108  O  OD2 . ASP B  1 213 ? -53.596  -24.693 -85.248  1.00 47.52  ? 194  ASP B OD2 1 
ATOM   3109  N  N   . VAL B  1 214 ? -48.797  -24.429 -85.590  1.00 30.30  ? 195  VAL B N   1 
ATOM   3110  C  CA  . VAL B  1 214 ? -47.927  -25.076 -84.626  1.00 33.20  ? 195  VAL B CA  1 
ATOM   3111  C  C   . VAL B  1 214 ? -48.180  -24.459 -83.250  1.00 31.17  ? 195  VAL B C   1 
ATOM   3112  O  O   . VAL B  1 214 ? -48.222  -23.239 -83.117  1.00 32.74  ? 195  VAL B O   1 
ATOM   3113  C  CB  . VAL B  1 214 ? -46.453  -24.949 -85.034  1.00 34.12  ? 195  VAL B CB  1 
ATOM   3114  C  CG1 . VAL B  1 214 ? -45.525  -25.406 -83.903  1.00 39.13  ? 195  VAL B CG1 1 
ATOM   3115  C  CG2 . VAL B  1 214 ? -46.206  -25.769 -86.261  1.00 37.96  ? 195  VAL B CG2 1 
ATOM   3116  N  N   . GLU B  1 215 ? -48.401  -25.294 -82.239  1.00 30.57  ? 196  GLU B N   1 
ATOM   3117  C  CA  . GLU B  1 215 ? -48.492  -24.785 -80.867  1.00 35.25  ? 196  GLU B CA  1 
ATOM   3118  C  C   . GLU B  1 215 ? -47.204  -25.085 -80.118  1.00 34.39  ? 196  GLU B C   1 
ATOM   3119  O  O   . GLU B  1 215 ? -46.833  -26.230 -79.907  1.00 44.14  ? 196  GLU B O   1 
ATOM   3120  C  CB  . GLU B  1 215 ? -49.705  -25.348 -80.117  1.00 35.46  ? 196  GLU B CB  1 
ATOM   3121  C  CG  . GLU B  1 215 ? -51.019  -24.636 -80.405  1.00 38.15  ? 196  GLU B CG  1 
ATOM   3122  C  CD  . GLU B  1 215 ? -52.241  -25.345 -79.828  1.00 45.68  ? 196  GLU B CD  1 
ATOM   3123  O  OE1 . GLU B  1 215 ? -52.092  -26.401 -79.147  1.00 52.22  ? 196  GLU B OE1 1 
ATOM   3124  O  OE2 . GLU B  1 215 ? -53.361  -24.839 -80.071  1.00 43.74  ? 196  GLU B OE2 1 
ATOM   3125  N  N   . VAL B  1 216 ? -46.500  -24.040 -79.748  1.00 29.93  ? 197  VAL B N   1 
ATOM   3126  C  CA  . VAL B  1 216 ? -45.262  -24.182 -79.025  1.00 27.55  ? 197  VAL B CA  1 
ATOM   3127  C  C   . VAL B  1 216 ? -45.615  -23.927 -77.575  1.00 35.57  ? 197  VAL B C   1 
ATOM   3128  O  O   . VAL B  1 216 ? -46.144  -22.872 -77.231  1.00 40.77  ? 197  VAL B O   1 
ATOM   3129  C  CB  . VAL B  1 216 ? -44.232  -23.145 -79.493  1.00 31.98  ? 197  VAL B CB  1 
ATOM   3130  C  CG1 . VAL B  1 216 ? -42.975  -23.242 -78.664  1.00 32.98  ? 197  VAL B CG1 1 
ATOM   3131  C  CG2 . VAL B  1 216 ? -43.929  -23.316 -80.970  1.00 27.63  ? 197  VAL B CG2 1 
ATOM   3132  N  N   . SER B  1 217 ? -45.363  -24.913 -76.722  1.00 40.93  ? 198  SER B N   1 
ATOM   3133  C  CA  . SER B  1 217 ? -45.638  -24.763 -75.299  1.00 36.63  ? 198  SER B CA  1 
ATOM   3134  C  C   . SER B  1 217 ? -44.349  -24.410 -74.573  1.00 34.26  ? 198  SER B C   1 
ATOM   3135  O  O   . SER B  1 217 ? -43.373  -25.173 -74.573  1.00 34.97  ? 198  SER B O   1 
ATOM   3136  C  CB  . SER B  1 217 ? -46.269  -26.022 -74.720  1.00 39.85  ? 198  SER B CB  1 
ATOM   3137  O  OG  . SER B  1 217 ? -47.597  -26.174 -75.191  1.00 40.65  ? 198  SER B OG  1 
ATOM   3138  N  N   . LEU B  1 218 ? -44.343  -23.221 -73.986  1.00 28.35  ? 199  LEU B N   1 
ATOM   3139  C  CA  . LEU B  1 218 ? -43.184  -22.737 -73.271  1.00 29.13  ? 199  LEU B CA  1 
ATOM   3140  C  C   . LEU B  1 218 ? -43.405  -22.915 -71.769  1.00 35.18  ? 199  LEU B C   1 
ATOM   3141  O  O   . LEU B  1 218 ? -44.215  -22.215 -71.153  1.00 41.39  ? 199  LEU B O   1 
ATOM   3142  C  CB  . LEU B  1 218 ? -42.946  -21.268 -73.605  1.00 28.19  ? 199  LEU B CB  1 
ATOM   3143  C  CG  . LEU B  1 218 ? -41.793  -20.559 -72.895  1.00 25.15  ? 199  LEU B CG  1 
ATOM   3144  C  CD1 . LEU B  1 218 ? -40.468  -21.211 -73.271  1.00 25.73  ? 199  LEU B CD1 1 
ATOM   3145  C  CD2 . LEU B  1 218 ? -41.783  -19.075 -73.245  1.00 20.58  ? 199  LEU B CD2 1 
ATOM   3146  N  N   . ASN B  1 219 ? -42.694  -23.868 -71.186  1.00 28.59  ? 200  ASN B N   1 
ATOM   3147  C  CA  . ASN B  1 219 ? -42.779  -24.095 -69.761  1.00 31.23  ? 200  ASN B CA  1 
ATOM   3148  C  C   . ASN B  1 219 ? -41.626  -23.350 -69.067  1.00 34.48  ? 200  ASN B C   1 
ATOM   3149  O  O   . ASN B  1 219 ? -40.449  -23.691 -69.218  1.00 41.51  ? 200  ASN B O   1 
ATOM   3150  C  CB  . ASN B  1 219 ? -42.773  -25.608 -69.436  1.00 31.98  ? 200  ASN B CB  1 
ATOM   3151  C  CG  . ASN B  1 219 ? -42.853  -25.903 -67.911  1.00 47.95  ? 200  ASN B CG  1 
ATOM   3152  O  OD1 . ASN B  1 219 ? -42.134  -26.763 -67.395  1.00 49.86  ? 200  ASN B OD1 1 
ATOM   3153  N  ND2 . ASN B  1 219 ? -43.719  -25.174 -67.198  1.00 40.64  ? 200  ASN B ND2 1 
ATOM   3154  N  N   . PHE B  1 220 ? -41.969  -22.323 -68.306  1.00 25.99  ? 201  PHE B N   1 
ATOM   3155  C  CA  . PHE B  1 220 ? -40.965  -21.479 -67.683  1.00 26.04  ? 201  PHE B CA  1 
ATOM   3156  C  C   . PHE B  1 220 ? -41.410  -21.073 -66.273  1.00 28.68  ? 201  PHE B C   1 
ATOM   3157  O  O   . PHE B  1 220 ? -42.588  -21.205 -65.923  1.00 29.71  ? 201  PHE B O   1 
ATOM   3158  C  CB  . PHE B  1 220 ? -40.735  -20.228 -68.515  1.00 27.15  ? 201  PHE B CB  1 
ATOM   3159  C  CG  . PHE B  1 220 ? -41.903  -19.265 -68.495  1.00 32.54  ? 201  PHE B CG  1 
ATOM   3160  C  CD1 . PHE B  1 220 ? -43.098  -19.564 -69.154  1.00 31.30  ? 201  PHE B CD1 1 
ATOM   3161  C  CD2 . PHE B  1 220 ? -41.810  -18.052 -67.827  1.00 35.05  ? 201  PHE B CD2 1 
ATOM   3162  C  CE1 . PHE B  1 220 ? -44.192  -18.665 -69.142  1.00 22.15  ? 201  PHE B CE1 1 
ATOM   3163  C  CE2 . PHE B  1 220 ? -42.895  -17.144 -67.820  1.00 30.33  ? 201  PHE B CE2 1 
ATOM   3164  C  CZ  . PHE B  1 220 ? -44.085  -17.464 -68.478  1.00 21.18  ? 201  PHE B CZ  1 
ATOM   3165  N  N   . ARG B  1 221 ? -40.459  -20.579 -65.482  1.00 24.96  ? 202  ARG B N   1 
ATOM   3166  C  CA  . ARG B  1 221 ? -40.726  -20.115 -64.128  1.00 27.14  ? 202  ARG B CA  1 
ATOM   3167  C  C   . ARG B  1 221 ? -39.773  -19.002 -63.702  1.00 29.52  ? 202  ARG B C   1 
ATOM   3168  O  O   . ARG B  1 221 ? -38.649  -18.870 -64.223  1.00 24.75  ? 202  ARG B O   1 
ATOM   3169  C  CB  . ARG B  1 221 ? -40.614  -21.268 -63.117  1.00 39.40  ? 202  ARG B CB  1 
ATOM   3170  C  CG  . ARG B  1 221 ? -39.174  -21.657 -62.766  1.00 39.64  ? 202  ARG B CG  1 
ATOM   3171  C  CD  . ARG B  1 221 ? -39.104  -22.801 -61.762  1.00 35.16  ? 202  ARG B CD  1 
ATOM   3172  N  NE  . ARG B  1 221 ? -37.729  -23.284 -61.664  1.00 37.28  ? 202  ARG B NE  1 
ATOM   3173  C  CZ  . ARG B  1 221 ? -37.383  -24.531 -61.373  1.00 35.68  ? 202  ARG B CZ  1 
ATOM   3174  N  NH1 . ARG B  1 221 ? -38.322  -25.437 -61.149  1.00 35.68  ? 202  ARG B NH1 1 
ATOM   3175  N  NH2 . ARG B  1 221 ? -36.096  -24.871 -61.325  1.00 34.27  ? 202  ARG B NH2 1 
ATOM   3176  N  N   . LYS B  1 222 ? -40.241  -18.200 -62.748  1.00 37.33  ? 203  LYS B N   1 
ATOM   3177  C  CA  . LYS B  1 222 ? -39.421  -17.183 -62.105  1.00 43.51  ? 203  LYS B CA  1 
ATOM   3178  C  C   . LYS B  1 222 ? -38.262  -17.846 -61.359  1.00 37.92  ? 203  LYS B C   1 
ATOM   3179  O  O   . LYS B  1 222 ? -38.434  -18.910 -60.753  1.00 38.37  ? 203  LYS B O   1 
ATOM   3180  C  CB  . LYS B  1 222 ? -40.280  -16.375 -61.123  1.00 56.61  ? 203  LYS B CB  1 
ATOM   3181  C  CG  . LYS B  1 222 ? -39.798  -14.938 -60.880  1.00 65.06  ? 203  LYS B CG  1 
ATOM   3182  C  CD  . LYS B  1 222 ? -40.924  -14.063 -60.326  1.00 68.85  ? 203  LYS B CD  1 
ATOM   3183  C  CE  . LYS B  1 222 ? -40.458  -12.640 -60.071  1.00 72.75  ? 203  LYS B CE  1 
ATOM   3184  N  NZ  . LYS B  1 222 ? -41.421  -11.862 -59.225  1.00 76.99  ? 203  LYS B NZ  1 
ATOM   3185  N  N   . LYS B  1 223 ? -37.079  -17.240 -61.417  1.00 37.06  ? 204  LYS B N   1 
ATOM   3186  C  CA  . LYS B  1 223 ? -35.942  -17.749 -60.659  1.00 45.15  ? 204  LYS B CA  1 
ATOM   3187  C  C   . LYS B  1 223 ? -36.028  -17.267 -59.216  1.00 63.85  ? 204  LYS B C   1 
ATOM   3188  O  O   . LYS B  1 223 ? -36.642  -16.226 -58.938  1.00 70.76  ? 204  LYS B O   1 
ATOM   3189  C  CB  . LYS B  1 223 ? -34.622  -17.269 -61.254  1.00 37.17  ? 204  LYS B CB  1 
ATOM   3190  C  CG  . LYS B  1 223 ? -34.300  -17.732 -62.648  1.00 28.06  ? 204  LYS B CG  1 
ATOM   3191  C  CD  . LYS B  1 223 ? -33.218  -16.800 -63.218  1.00 28.26  ? 204  LYS B CD  1 
ATOM   3192  C  CE  . LYS B  1 223 ? -32.215  -17.529 -64.116  1.00 24.35  ? 204  LYS B CE  1 
ATOM   3193  N  NZ  . LYS B  1 223 ? -31.086  -16.639 -64.512  1.00 21.31  ? 204  LYS B NZ  1 
ATOM   3194  N  N   . GLY B  1 224 ? -35.401  -18.017 -58.305  1.00 71.58  ? 205  GLY B N   1 
ATOM   3195  C  CA  . GLY B  1 224 ? -35.311  -17.619 -56.908  1.00 71.32  ? 205  GLY B CA  1 
ATOM   3196  C  C   . GLY B  1 224 ? -34.338  -16.472 -56.681  1.00 70.31  ? 205  GLY B C   1 
ATOM   3197  O  O   . GLY B  1 224 ? -33.154  -16.680 -56.408  1.00 69.06  ? 205  GLY B O   1 
ATOM   3198  N  N   . LEU C  1 20  ? -54.797  -21.004 -116.652 1.00 49.59  ? 1    LEU C N   1 
ATOM   3199  C  CA  . LEU C  1 20  ? -54.429  -20.040 -115.649 1.00 47.02  ? 1    LEU C CA  1 
ATOM   3200  C  C   . LEU C  1 20  ? -53.897  -20.736 -114.411 1.00 48.50  ? 1    LEU C C   1 
ATOM   3201  O  O   . LEU C  1 20  ? -54.537  -21.653 -113.902 1.00 56.69  ? 1    LEU C O   1 
ATOM   3202  C  CB  . LEU C  1 20  ? -55.656  -19.225 -115.267 1.00 53.66  ? 1    LEU C CB  1 
ATOM   3203  C  CG  . LEU C  1 20  ? -56.088  -18.085 -116.196 1.00 55.35  ? 1    LEU C CG  1 
ATOM   3204  C  CD1 . LEU C  1 20  ? -57.282  -17.330 -115.593 1.00 51.10  ? 1    LEU C CD1 1 
ATOM   3205  C  CD2 . LEU C  1 20  ? -54.930  -17.133 -116.441 1.00 58.27  ? 1    LEU C CD2 1 
ATOM   3206  N  N   . ASP C  1 21  ? -52.725  -20.313 -113.937 1.00 41.36  ? 2    ASP C N   1 
ATOM   3207  C  CA  . ASP C  1 21  ? -52.263  -20.702 -112.610 1.00 42.25  ? 2    ASP C CA  1 
ATOM   3208  C  C   . ASP C  1 21  ? -52.250  -19.491 -111.656 1.00 44.90  ? 2    ASP C C   1 
ATOM   3209  O  O   . ASP C  1 21  ? -52.618  -18.381 -112.064 1.00 41.79  ? 2    ASP C O   1 
ATOM   3210  C  CB  . ASP C  1 21  ? -50.899  -21.411 -112.673 1.00 45.53  ? 2    ASP C CB  1 
ATOM   3211  C  CG  . ASP C  1 21  ? -49.818  -20.571 -113.330 1.00 49.21  ? 2    ASP C CG  1 
ATOM   3212  O  OD1 . ASP C  1 21  ? -50.029  -19.353 -113.533 1.00 50.53  ? 2    ASP C OD1 1 
ATOM   3213  O  OD2 . ASP C  1 21  ? -48.733  -21.140 -113.623 1.00 50.30  ? 2    ASP C OD2 1 
ATOM   3214  N  N   . ARG C  1 22  ? -51.849  -19.702 -110.397 1.00 44.61  ? 3    ARG C N   1 
ATOM   3215  C  CA  . ARG C  1 22  ? -51.821  -18.608 -109.413 1.00 37.89  ? 3    ARG C CA  1 
ATOM   3216  C  C   . ARG C  1 22  ? -51.025  -17.420 -109.915 1.00 34.01  ? 3    ARG C C   1 
ATOM   3217  O  O   . ARG C  1 22  ? -51.501  -16.284 -109.853 1.00 35.98  ? 3    ARG C O   1 
ATOM   3218  C  CB  . ARG C  1 22  ? -51.265  -19.068 -108.061 1.00 39.94  ? 3    ARG C CB  1 
ATOM   3219  C  CG  . ARG C  1 22  ? -52.265  -19.811 -107.207 1.00 35.93  ? 3    ARG C CG  1 
ATOM   3220  C  CD  . ARG C  1 22  ? -51.623  -20.455 -106.007 1.00 32.47  ? 3    ARG C CD  1 
ATOM   3221  N  NE  . ARG C  1 22  ? -52.615  -21.273 -105.318 1.00 46.29  ? 3    ARG C NE  1 
ATOM   3222  C  CZ  . ARG C  1 22  ? -52.814  -22.570 -105.548 1.00 56.91  ? 3    ARG C CZ  1 
ATOM   3223  N  NH1 . ARG C  1 22  ? -52.070  -23.215 -106.439 1.00 57.62  ? 3    ARG C NH1 1 
ATOM   3224  N  NH2 . ARG C  1 22  ? -53.751  -23.230 -104.877 1.00 62.60  ? 3    ARG C NH2 1 
ATOM   3225  N  N   . ALA C  1 23  ? -49.826  -17.697 -110.428 1.00 33.17  ? 4    ALA C N   1 
ATOM   3226  C  CA  . ALA C  1 23  ? -48.931  -16.655 -110.920 1.00 31.63  ? 4    ALA C CA  1 
ATOM   3227  C  C   . ALA C  1 23  ? -49.647  -15.762 -111.934 1.00 32.22  ? 4    ALA C C   1 
ATOM   3228  O  O   . ALA C  1 23  ? -49.570  -14.529 -111.879 1.00 33.50  ? 4    ALA C O   1 
ATOM   3229  C  CB  . ALA C  1 23  ? -47.679  -17.267 -111.516 1.00 24.05  ? 4    ALA C CB  1 
ATOM   3230  N  N   . ASP C  1 24  ? -50.369  -16.379 -112.851 1.00 30.39  ? 5    ASP C N   1 
ATOM   3231  C  CA  . ASP C  1 24  ? -51.063  -15.592 -113.863 1.00 34.65  ? 5    ASP C CA  1 
ATOM   3232  C  C   . ASP C  1 24  ? -52.175  -14.743 -113.265 1.00 32.17  ? 5    ASP C C   1 
ATOM   3233  O  O   . ASP C  1 24  ? -52.304  -13.555 -113.595 1.00 30.82  ? 5    ASP C O   1 
ATOM   3234  C  CB  . ASP C  1 24  ? -51.617  -16.488 -114.988 1.00 34.43  ? 5    ASP C CB  1 
ATOM   3235  C  CG  . ASP C  1 24  ? -50.532  -17.273 -115.702 1.00 44.61  ? 5    ASP C CG  1 
ATOM   3236  O  OD1 . ASP C  1 24  ? -49.414  -16.737 -115.906 1.00 51.85  ? 5    ASP C OD1 1 
ATOM   3237  O  OD2 . ASP C  1 24  ? -50.799  -18.442 -116.062 1.00 49.57  ? 5    ASP C OD2 1 
ATOM   3238  N  N   . ILE C  1 25  ? -52.982  -15.371 -112.407 1.00 35.25  ? 6    ILE C N   1 
ATOM   3239  C  CA  . ILE C  1 25  ? -54.108  -14.707 -111.741 1.00 37.03  ? 6    ILE C CA  1 
ATOM   3240  C  C   . ILE C  1 25  ? -53.647  -13.502 -110.925 1.00 41.88  ? 6    ILE C C   1 
ATOM   3241  O  O   . ILE C  1 25  ? -54.208  -12.400 -111.045 1.00 48.79  ? 6    ILE C O   1 
ATOM   3242  C  CB  . ILE C  1 25  ? -54.893  -15.678 -110.837 1.00 35.26  ? 6    ILE C CB  1 
ATOM   3243  C  CG1 . ILE C  1 25  ? -55.544  -16.773 -111.682 1.00 38.54  ? 6    ILE C CG1 1 
ATOM   3244  C  CG2 . ILE C  1 25  ? -55.944  -14.936 -110.024 1.00 30.03  ? 6    ILE C CG2 1 
ATOM   3245  C  CD1 . ILE C  1 25  ? -56.090  -17.933 -110.873 1.00 22.93  ? 6    ILE C CD1 1 
ATOM   3246  N  N   . LEU C  1 26  ? -52.606  -13.704 -110.121 1.00 35.09  ? 7    LEU C N   1 
ATOM   3247  C  CA  . LEU C  1 26  ? -52.056  -12.611 -109.319 1.00 31.22  ? 7    LEU C CA  1 
ATOM   3248  C  C   . LEU C  1 26  ? -51.473  -11.503 -110.209 1.00 33.75  ? 7    LEU C C   1 
ATOM   3249  O  O   . LEU C  1 26  ? -51.639  -10.315 -109.941 1.00 34.96  ? 7    LEU C O   1 
ATOM   3250  C  CB  . LEU C  1 26  ? -51.017  -13.154 -108.358 1.00 27.85  ? 7    LEU C CB  1 
ATOM   3251  C  CG  . LEU C  1 26  ? -51.682  -14.039 -107.292 1.00 31.31  ? 7    LEU C CG  1 
ATOM   3252  C  CD1 . LEU C  1 26  ? -50.684  -14.982 -106.671 1.00 29.53  ? 7    LEU C CD1 1 
ATOM   3253  C  CD2 . LEU C  1 26  ? -52.342  -13.202 -106.205 1.00 33.69  ? 7    LEU C CD2 1 
ATOM   3254  N  N   . TYR C  1 27  ? -50.813  -11.899 -111.290 1.00 34.45  ? 8    TYR C N   1 
ATOM   3255  C  CA  . TYR C  1 27  ? -50.300  -10.944 -112.263 1.00 33.44  ? 8    TYR C CA  1 
ATOM   3256  C  C   . TYR C  1 27  ? -51.421  -10.068 -112.833 1.00 33.10  ? 8    TYR C C   1 
ATOM   3257  O  O   . TYR C  1 27  ? -51.312  -8.833  -112.848 1.00 30.05  ? 8    TYR C O   1 
ATOM   3258  C  CB  . TYR C  1 27  ? -49.543  -11.670 -113.390 1.00 35.54  ? 8    TYR C CB  1 
ATOM   3259  C  CG  . TYR C  1 27  ? -48.987  -10.742 -114.459 1.00 32.39  ? 8    TYR C CG  1 
ATOM   3260  C  CD1 . TYR C  1 27  ? -47.843  -9.972  -114.231 1.00 31.30  ? 8    TYR C CD1 1 
ATOM   3261  C  CD2 . TYR C  1 27  ? -49.613  -10.628 -115.686 1.00 34.33  ? 8    TYR C CD2 1 
ATOM   3262  C  CE1 . TYR C  1 27  ? -47.340  -9.114  -115.198 1.00 30.93  ? 8    TYR C CE1 1 
ATOM   3263  C  CE2 . TYR C  1 27  ? -49.118  -9.779  -116.670 1.00 37.68  ? 8    TYR C CE2 1 
ATOM   3264  C  CZ  . TYR C  1 27  ? -47.979  -9.029  -116.426 1.00 39.71  ? 8    TYR C CZ  1 
ATOM   3265  O  OH  . TYR C  1 27  ? -47.491  -8.201  -117.427 1.00 45.73  ? 8    TYR C OH  1 
ATOM   3266  N  N   . ASN C  1 28  ? -52.527  -10.637 -113.223 1.00 33.79  ? 9    ASN C N   1 
ATOM   3267  C  CA  . ASN C  1 28  ? -53.651  -9.875  -113.692 1.00 26.85  ? 9    ASN C CA  1 
ATOM   3268  C  C   . ASN C  1 28  ? -54.328  -8.956  -112.732 1.00 26.27  ? 9    ASN C C   1 
ATOM   3269  O  O   . ASN C  1 28  ? -54.825  -7.938  -113.133 1.00 22.78  ? 9    ASN C O   1 
ATOM   3270  C  CB  . ASN C  1 28  ? -54.687  -10.811 -114.259 1.00 22.80  ? 9    ASN C CB  1 
ATOM   3271  C  CG  . ASN C  1 28  ? -54.180  -11.591 -115.408 1.00 26.42  ? 9    ASN C CG  1 
ATOM   3272  O  OD1 . ASN C  1 28  ? -53.247  -11.233 -116.050 1.00 22.97  ? 9    ASN C OD1 1 
ATOM   3273  N  ND2 . ASN C  1 28  ? -54.810  -12.667 -115.664 1.00 29.87  ? 9    ASN C ND2 1 
ATOM   3274  N  N   . ILE C  1 29  ? -54.455  -9.391  -111.492 1.00 24.76  ? 10   ILE C N   1 
ATOM   3275  C  CA  . ILE C  1 29  ? -54.979  -8.581  -110.421 1.00 24.64  ? 10   ILE C CA  1 
ATOM   3276  C  C   . ILE C  1 29  ? -54.093  -7.390  -110.118 1.00 30.47  ? 10   ILE C C   1 
ATOM   3277  O  O   . ILE C  1 29  ? -54.563  -6.300  -109.988 1.00 32.42  ? 10   ILE C O   1 
ATOM   3278  C  CB  . ILE C  1 29  ? -55.213  -9.452  -109.195 1.00 32.58  ? 10   ILE C CB  1 
ATOM   3279  C  CG1 . ILE C  1 29  ? -56.425  -10.328 -109.432 1.00 35.94  ? 10   ILE C CG1 1 
ATOM   3280  C  CG2 . ILE C  1 29  ? -55.460  -8.634  -107.957 1.00 28.90  ? 10   ILE C CG2 1 
ATOM   3281  C  CD1 . ILE C  1 29  ? -56.689  -11.356 -108.370 1.00 22.76  ? 10   ILE C CD1 1 
ATOM   3282  N  N   . ARG C  1 30  ? -52.807  -7.607  -110.062 1.00 32.27  ? 11   ARG C N   1 
ATOM   3283  C  CA  . ARG C  1 30  ? -51.892  -6.537  -109.856 1.00 37.67  ? 11   ARG C CA  1 
ATOM   3284  C  C   . ARG C  1 30  ? -51.901  -5.562  -110.998 1.00 40.47  ? 11   ARG C C   1 
ATOM   3285  O  O   . ARG C  1 30  ? -51.884  -4.383  -110.786 1.00 44.78  ? 11   ARG C O   1 
ATOM   3286  C  CB  . ARG C  1 30  ? -50.510  -7.102  -109.598 1.00 41.50  ? 11   ARG C CB  1 
ATOM   3287  C  CG  . ARG C  1 30  ? -49.360  -6.128  -109.459 1.00 42.00  ? 11   ARG C CG  1 
ATOM   3288  C  CD  . ARG C  1 30  ? -48.065  -6.809  -109.057 1.00 47.24  ? 11   ARG C CD  1 
ATOM   3289  N  NE  . ARG C  1 30  ? -48.109  -8.262  -109.156 1.00 54.30  ? 11   ARG C NE  1 
ATOM   3290  C  CZ  . ARG C  1 30  ? -47.407  -9.011  -109.990 1.00 58.36  ? 11   ARG C CZ  1 
ATOM   3291  N  NH1 . ARG C  1 30  ? -46.518  -8.490  -110.799 1.00 58.08  ? 11   ARG C NH1 1 
ATOM   3292  N  NH2 . ARG C  1 30  ? -47.585  -10.306 -109.972 1.00 58.17  ? 11   ARG C NH2 1 
ATOM   3293  N  N   . GLN C  1 31  ? -51.905  -6.043  -112.219 1.00 38.77  ? 12   GLN C N   1 
ATOM   3294  C  CA  . GLN C  1 31  ? -51.945  -5.168  -113.373 1.00 33.39  ? 12   GLN C CA  1 
ATOM   3295  C  C   . GLN C  1 31  ? -53.204  -4.410  -113.596 1.00 35.05  ? 12   GLN C C   1 
ATOM   3296  O  O   . GLN C  1 31  ? -53.186  -3.331  -114.079 1.00 46.28  ? 12   GLN C O   1 
ATOM   3297  C  CB  . GLN C  1 31  ? -51.563  -5.898  -114.621 1.00 36.30  ? 12   GLN C CB  1 
ATOM   3298  C  CG  . GLN C  1 31  ? -50.220  -6.541  -114.513 1.00 46.50  ? 12   GLN C CG  1 
ATOM   3299  C  CD  . GLN C  1 31  ? -49.109  -5.565  -114.581 1.00 51.80  ? 12   GLN C CD  1 
ATOM   3300  O  OE1 . GLN C  1 31  ? -48.326  -5.451  -113.671 1.00 56.32  ? 12   GLN C OE1 1 
ATOM   3301  N  NE2 . GLN C  1 31  ? -49.024  -4.870  -115.661 1.00 50.43  ? 12   GLN C NE2 1 
ATOM   3302  N  N   . THR C  1 32  ? -54.318  -5.019  -113.317 1.00 35.49  ? 13   THR C N   1 
ATOM   3303  C  CA  . THR C  1 32  ? -55.605  -4.464  -113.735 1.00 36.83  ? 13   THR C CA  1 
ATOM   3304  C  C   . THR C  1 32  ? -56.565  -4.059  -112.628 1.00 38.53  ? 13   THR C C   1 
ATOM   3305  O  O   . THR C  1 32  ? -57.531  -3.345  -112.887 1.00 39.24  ? 13   THR C O   1 
ATOM   3306  C  CB  . THR C  1 32  ? -56.375  -5.443  -114.598 1.00 41.22  ? 13   THR C CB  1 
ATOM   3307  O  OG1 . THR C  1 32  ? -56.470  -6.692  -113.896 1.00 43.25  ? 13   THR C OG1 1 
ATOM   3308  C  CG2 . THR C  1 32  ? -55.679  -5.630  -115.929 1.00 47.72  ? 13   THR C CG2 1 
ATOM   3309  N  N   . SER C  1 33  ? -56.356  -4.531  -111.409 1.00 51.99  ? 14   SER C N   1 
ATOM   3310  C  CA  . SER C  1 33  ? -57.243  -4.064  -110.340 1.00 60.82  ? 14   SER C CA  1 
ATOM   3311  C  C   . SER C  1 33  ? -56.956  -2.590  -110.082 1.00 65.42  ? 14   SER C C   1 
ATOM   3312  O  O   . SER C  1 33  ? -55.829  -2.099  -110.277 1.00 69.23  ? 14   SER C O   1 
ATOM   3313  C  CB  . SER C  1 33  ? -57.096  -4.862  -109.043 1.00 58.57  ? 14   SER C CB  1 
ATOM   3314  O  OG  . SER C  1 33  ? -56.146  -4.243  -108.193 1.00 59.62  ? 14   SER C OG  1 
ATOM   3315  N  N   . ARG C  1 34  ? -57.988  -1.881  -109.664 1.00 60.04  ? 15   ARG C N   1 
ATOM   3316  C  CA  . ARG C  1 34  ? -57.876  -0.453  -109.478 1.00 52.48  ? 15   ARG C CA  1 
ATOM   3317  C  C   . ARG C  1 34  ? -58.237  -0.185  -108.035 1.00 42.03  ? 15   ARG C C   1 
ATOM   3318  O  O   . ARG C  1 34  ? -59.416  0.004   -107.717 1.00 36.29  ? 15   ARG C O   1 
ATOM   3319  C  CB  . ARG C  1 34  ? -58.844  0.257   -110.426 1.00 56.07  ? 15   ARG C CB  1 
ATOM   3320  C  CG  . ARG C  1 34  ? -58.569  0.008   -111.909 1.00 57.14  ? 15   ARG C CG  1 
ATOM   3321  C  CD  . ARG C  1 34  ? -57.485  0.954   -112.407 1.00 61.32  ? 15   ARG C CD  1 
ATOM   3322  N  NE  . ARG C  1 34  ? -57.820  2.343   -112.077 1.00 61.09  ? 15   ARG C NE  1 
ATOM   3323  C  CZ  . ARG C  1 34  ? -58.525  3.157   -112.862 1.00 51.77  ? 15   ARG C CZ  1 
ATOM   3324  N  NH1 . ARG C  1 34  ? -58.953  2.723   -114.041 1.00 54.48  ? 15   ARG C NH1 1 
ATOM   3325  N  NH2 . ARG C  1 34  ? -58.794  4.401   -112.466 1.00 41.88  ? 15   ARG C NH2 1 
ATOM   3326  N  N   . PRO C  1 35  ? -57.223  -0.193  -107.148 1.00 38.92  ? 16   PRO C N   1 
ATOM   3327  C  CA  . PRO C  1 35  ? -57.421  -0.097  -105.690 1.00 38.24  ? 16   PRO C CA  1 
ATOM   3328  C  C   . PRO C  1 35  ? -58.118  1.205   -105.285 1.00 41.27  ? 16   PRO C C   1 
ATOM   3329  O  O   . PRO C  1 35  ? -58.784  1.268   -104.258 1.00 46.66  ? 16   PRO C O   1 
ATOM   3330  C  CB  . PRO C  1 35  ? -55.989  -0.125  -105.129 1.00 33.34  ? 16   PRO C CB  1 
ATOM   3331  C  CG  . PRO C  1 35  ? -55.129  -0.672  -106.230 1.00 31.37  ? 16   PRO C CG  1 
ATOM   3332  C  CD  . PRO C  1 35  ? -55.794  -0.235  -107.513 1.00 35.04  ? 16   PRO C CD  1 
ATOM   3333  N  N   . ASP C  1 36  ? -57.960  2.230   -106.108 1.00 34.73  ? 17   ASP C N   1 
ATOM   3334  C  CA  . ASP C  1 36  ? -58.597  3.522   -105.896 1.00 34.55  ? 17   ASP C CA  1 
ATOM   3335  C  C   . ASP C  1 36  ? -60.086  3.543   -106.309 1.00 38.81  ? 17   ASP C C   1 
ATOM   3336  O  O   . ASP C  1 36  ? -60.828  4.504   -106.025 1.00 35.29  ? 17   ASP C O   1 
ATOM   3337  C  CB  . ASP C  1 36  ? -57.811  4.596   -106.673 1.00 34.54  ? 17   ASP C CB  1 
ATOM   3338  C  CG  . ASP C  1 36  ? -57.528  4.196   -108.153 1.00 94.05  ? 17   ASP C CG  1 
ATOM   3339  O  OD1 . ASP C  1 36  ? -57.191  3.019   -108.433 1.00 93.92  ? 17   ASP C OD1 1 
ATOM   3340  O  OD2 . ASP C  1 36  ? -57.622  5.070   -109.047 1.00 92.48  ? 17   ASP C OD2 1 
ATOM   3341  N  N   . VAL C  1 37  ? -60.516  2.484   -106.987 1.00 43.57  ? 18   VAL C N   1 
ATOM   3342  C  CA  . VAL C  1 37  ? -61.821  2.478   -107.639 1.00 41.86  ? 18   VAL C CA  1 
ATOM   3343  C  C   . VAL C  1 37  ? -62.816  1.528   -106.978 1.00 34.52  ? 18   VAL C C   1 
ATOM   3344  O  O   . VAL C  1 37  ? -62.662  0.313   -107.007 1.00 29.54  ? 18   VAL C O   1 
ATOM   3345  C  CB  . VAL C  1 37  ? -61.703  2.169   -109.150 1.00 37.03  ? 18   VAL C CB  1 
ATOM   3346  C  CG1 . VAL C  1 37  ? -63.080  2.213   -109.813 1.00 33.69  ? 18   VAL C CG1 1 
ATOM   3347  C  CG2 . VAL C  1 37  ? -60.753  3.159   -109.800 1.00 41.86  ? 18   VAL C CG2 1 
ATOM   3348  N  N   . ILE C  1 38  ? -63.846  2.097   -106.373 1.00 32.06  ? 19   ILE C N   1 
ATOM   3349  C  CA  . ILE C  1 38  ? -64.900  1.286   -105.794 1.00 30.18  ? 19   ILE C CA  1 
ATOM   3350  C  C   . ILE C  1 38  ? -65.620  0.478   -106.892 1.00 30.45  ? 19   ILE C C   1 
ATOM   3351  O  O   . ILE C  1 38  ? -66.105  1.041   -107.873 1.00 30.32  ? 19   ILE C O   1 
ATOM   3352  C  CB  . ILE C  1 38  ? -65.866  2.172   -104.998 1.00 30.90  ? 19   ILE C CB  1 
ATOM   3353  C  CG1 . ILE C  1 38  ? -66.978  1.348   -104.339 1.00 34.40  ? 19   ILE C CG1 1 
ATOM   3354  C  CG2 . ILE C  1 38  ? -66.421  3.291   -105.872 1.00 31.70  ? 19   ILE C CG2 1 
ATOM   3355  C  CD1 . ILE C  1 38  ? -67.807  2.158   -103.352 1.00 29.26  ? 19   ILE C CD1 1 
ATOM   3356  N  N   . PRO C  1 39  ? -65.682  -0.850  -106.721 1.00 31.03  ? 20   PRO C N   1 
ATOM   3357  C  CA  . PRO C  1 39  ? -66.254  -1.777  -107.708 1.00 29.89  ? 20   PRO C CA  1 
ATOM   3358  C  C   . PRO C  1 39  ? -67.780  -1.729  -107.672 1.00 32.40  ? 20   PRO C C   1 
ATOM   3359  O  O   . PRO C  1 39  ? -68.448  -2.749  -107.500 1.00 32.81  ? 20   PRO C O   1 
ATOM   3360  C  CB  . PRO C  1 39  ? -65.752  -3.147  -107.233 1.00 29.12  ? 20   PRO C CB  1 
ATOM   3361  C  CG  . PRO C  1 39  ? -65.649  -2.995  -105.735 1.00 29.16  ? 20   PRO C CG  1 
ATOM   3362  C  CD  . PRO C  1 39  ? -65.292  -1.535  -105.473 1.00 29.74  ? 20   PRO C CD  1 
ATOM   3363  N  N   . THR C  1 40  ? -68.322  -0.530  -107.823 1.00 34.97  ? 21   THR C N   1 
ATOM   3364  C  CA  . THR C  1 40  ? -69.757  -0.356  -107.856 1.00 42.57  ? 21   THR C CA  1 
ATOM   3365  C  C   . THR C  1 40  ? -70.308  -0.921  -109.171 1.00 52.63  ? 21   THR C C   1 
ATOM   3366  O  O   . THR C  1 40  ? -69.668  -0.828  -110.234 1.00 57.27  ? 21   THR C O   1 
ATOM   3367  C  CB  . THR C  1 40  ? -70.132  1.125   -107.645 1.00 43.28  ? 21   THR C CB  1 
ATOM   3368  O  OG1 . THR C  1 40  ? -71.537  1.234   -107.393 1.00 45.93  ? 21   THR C OG1 1 
ATOM   3369  C  CG2 . THR C  1 40  ? -69.710  2.000   -108.854 1.00 29.00  ? 21   THR C CG2 1 
ATOM   3370  N  N   . GLN C  1 41  ? -71.487  -1.525  -109.075 1.00 56.17  ? 22   GLN C N   1 
ATOM   3371  C  CA  . GLN C  1 41  ? -72.085  -2.265  -110.177 1.00 60.96  ? 22   GLN C CA  1 
ATOM   3372  C  C   . GLN C  1 41  ? -73.516  -1.813  -110.530 1.00 64.40  ? 22   GLN C C   1 
ATOM   3373  O  O   . GLN C  1 41  ? -74.392  -1.796  -109.666 1.00 63.29  ? 22   GLN C O   1 
ATOM   3374  C  CB  . GLN C  1 41  ? -72.080  -3.735  -109.786 1.00 66.32  ? 22   GLN C CB  1 
ATOM   3375  C  CG  . GLN C  1 41  ? -72.555  -4.681  -110.840 1.00 71.09  ? 22   GLN C CG  1 
ATOM   3376  C  CD  . GLN C  1 41  ? -72.173  -6.095  -110.489 1.00 76.02  ? 22   GLN C CD  1 
ATOM   3377  O  OE1 . GLN C  1 41  ? -71.965  -6.413  -109.312 1.00 70.63  ? 22   GLN C OE1 1 
ATOM   3378  N  NE2 . GLN C  1 41  ? -72.048  -6.954  -111.506 1.00 82.59  ? 22   GLN C NE2 1 
ATOM   3379  N  N   . ARG C  1 42  ? -73.749  -1.469  -111.800 1.00 73.23  ? 23   ARG C N   1 
ATOM   3380  C  CA  . ARG C  1 42  ? -75.060  -0.976  -112.280 1.00 78.89  ? 23   ARG C CA  1 
ATOM   3381  C  C   . ARG C  1 42  ? -75.720  0.053   -111.350 1.00 82.21  ? 23   ARG C C   1 
ATOM   3382  O  O   . ARG C  1 42  ? -76.902  -0.080  -111.018 1.00 82.10  ? 23   ARG C O   1 
ATOM   3383  C  CB  . ARG C  1 42  ? -76.058  -2.121  -112.529 1.00 78.98  ? 23   ARG C CB  1 
ATOM   3384  C  CG  . ARG C  1 42  ? -75.570  -3.228  -113.451 1.00 80.27  ? 23   ARG C CG  1 
ATOM   3385  C  CD  . ARG C  1 42  ? -75.134  -2.711  -114.801 1.00 77.60  ? 23   ARG C CD  1 
ATOM   3386  N  NE  . ARG C  1 42  ? -74.189  -3.619  -115.457 1.00 75.51  ? 23   ARG C NE  1 
ATOM   3387  C  CZ  . ARG C  1 42  ? -72.863  -3.475  -115.442 1.00 72.86  ? 23   ARG C CZ  1 
ATOM   3388  N  NH1 . ARG C  1 42  ? -72.307  -2.456  -114.798 1.00 70.82  ? 23   ARG C NH1 1 
ATOM   3389  N  NH2 . ARG C  1 42  ? -72.088  -4.347  -116.081 1.00 71.85  ? 23   ARG C NH2 1 
ATOM   3390  N  N   . ASP C  1 43  ? -74.956  1.058   -110.925 1.00 85.14  ? 24   ASP C N   1 
ATOM   3391  C  CA  . ASP C  1 43  ? -75.472  2.097   -110.027 1.00 92.64  ? 24   ASP C CA  1 
ATOM   3392  C  C   . ASP C  1 43  ? -76.065  1.538   -108.720 1.00 90.30  ? 24   ASP C C   1 
ATOM   3393  O  O   . ASP C  1 43  ? -76.857  2.202   -108.040 1.00 92.52  ? 24   ASP C O   1 
ATOM   3394  C  CB  . ASP C  1 43  ? -76.480  3.004   -110.752 1.00 97.93  ? 24   ASP C CB  1 
ATOM   3395  C  CG  . ASP C  1 43  ? -75.826  3.872   -111.816 1.00 101.89 ? 24   ASP C CG  1 
ATOM   3396  O  OD1 . ASP C  1 43  ? -74.665  3.589   -112.178 1.00 104.51 ? 24   ASP C OD1 1 
ATOM   3397  O  OD2 . ASP C  1 43  ? -76.471  4.832   -112.291 1.00 101.82 ? 24   ASP C OD2 1 
ATOM   3398  N  N   . ARG C  1 44  ? -75.677  0.311   -108.386 1.00 81.57  ? 25   ARG C N   1 
ATOM   3399  C  CA  . ARG C  1 44  ? -76.012  -0.281  -107.101 1.00 71.83  ? 25   ARG C CA  1 
ATOM   3400  C  C   . ARG C  1 44  ? -74.799  -0.333  -106.169 1.00 60.52  ? 25   ARG C C   1 
ATOM   3401  O  O   . ARG C  1 44  ? -73.671  -0.615  -106.571 1.00 57.21  ? 25   ARG C O   1 
ATOM   3402  C  CB  . ARG C  1 44  ? -76.628  -1.672  -107.273 1.00 76.16  ? 25   ARG C CB  1 
ATOM   3403  C  CG  . ARG C  1 44  ? -78.107  -1.641  -107.576 1.00 83.05  ? 25   ARG C CG  1 
ATOM   3404  C  CD  . ARG C  1 44  ? -78.535  -2.878  -108.354 1.00 91.14  ? 25   ARG C CD  1 
ATOM   3405  N  NE  . ARG C  1 44  ? -78.892  -4.005  -107.489 1.00 96.61  ? 25   ARG C NE  1 
ATOM   3406  C  CZ  . ARG C  1 44  ? -79.919  -4.825  -107.710 1.00 98.21  ? 25   ARG C CZ  1 
ATOM   3407  N  NH1 . ARG C  1 44  ? -80.699  -4.645  -108.770 1.00 97.70  ? 25   ARG C NH1 1 
ATOM   3408  N  NH2 . ARG C  1 44  ? -80.172  -5.828  -106.874 1.00 97.85  ? 25   ARG C NH2 1 
ATOM   3409  N  N   . PRO C  1 45  ? -75.041  -0.057  -104.898 1.00 54.24  ? 26   PRO C N   1 
ATOM   3410  C  CA  . PRO C  1 45  ? -73.983  -0.035  -103.889 1.00 46.03  ? 26   PRO C CA  1 
ATOM   3411  C  C   . PRO C  1 45  ? -73.285  -1.378  -103.773 1.00 45.07  ? 26   PRO C C   1 
ATOM   3412  O  O   . PRO C  1 45  ? -73.900  -2.431  -104.029 1.00 28.69  ? 26   PRO C O   1 
ATOM   3413  C  CB  . PRO C  1 45  ? -74.744  0.262   -102.608 1.00 44.40  ? 26   PRO C CB  1 
ATOM   3414  C  CG  . PRO C  1 45  ? -76.143  -0.200  -102.896 1.00 47.49  ? 26   PRO C CG  1 
ATOM   3415  C  CD  . PRO C  1 45  ? -76.376  0.131   -104.313 1.00 51.01  ? 26   PRO C CD  1 
ATOM   3416  N  N   . VAL C  1 46  ? -72.002  -1.323  -103.413 1.00 29.70  ? 27   VAL C N   1 
ATOM   3417  C  CA  . VAL C  1 46  ? -71.251  -2.504  -103.056 1.00 29.36  ? 27   VAL C CA  1 
ATOM   3418  C  C   . VAL C  1 46  ? -71.778  -2.977  -101.704 1.00 32.66  ? 27   VAL C C   1 
ATOM   3419  O  O   . VAL C  1 46  ? -71.816  -2.220  -100.733 1.00 32.97  ? 27   VAL C O   1 
ATOM   3420  C  CB  . VAL C  1 46  ? -69.742  -2.216  -102.966 1.00 30.22  ? 27   VAL C CB  1 
ATOM   3421  C  CG1 . VAL C  1 46  ? -68.980  -3.503  -102.630 1.00 29.65  ? 27   VAL C CG1 1 
ATOM   3422  C  CG2 . VAL C  1 46  ? -69.219  -1.616  -104.279 1.00 31.20  ? 27   VAL C CG2 1 
ATOM   3423  N  N   . ALA C  1 47  ? -72.217  -4.225  -101.653 1.00 35.51  ? 28   ALA C N   1 
ATOM   3424  C  CA  . ALA C  1 47  ? -72.700  -4.799  -100.401 1.00 30.28  ? 28   ALA C CA  1 
ATOM   3425  C  C   . ALA C  1 47  ? -71.536  -5.353  -99.553  1.00 35.52  ? 28   ALA C C   1 
ATOM   3426  O  O   . ALA C  1 47  ? -70.918  -6.362  -99.888  1.00 39.20  ? 28   ALA C O   1 
ATOM   3427  C  CB  . ALA C  1 47  ? -73.722  -5.876  -100.680 1.00 17.59  ? 28   ALA C CB  1 
ATOM   3428  N  N   . VAL C  1 48  ? -71.248  -4.689  -98.447  1.00 35.89  ? 29   VAL C N   1 
ATOM   3429  C  CA  . VAL C  1 48  ? -70.169  -5.114  -97.558  1.00 35.37  ? 29   VAL C CA  1 
ATOM   3430  C  C   . VAL C  1 48  ? -70.694  -5.790  -96.277  1.00 34.16  ? 29   VAL C C   1 
ATOM   3431  O  O   . VAL C  1 48  ? -71.396  -5.164  -95.480  1.00 31.46  ? 29   VAL C O   1 
ATOM   3432  C  CB  . VAL C  1 48  ? -69.291  -3.905  -97.166  1.00 36.81  ? 29   VAL C CB  1 
ATOM   3433  C  CG1 . VAL C  1 48  ? -68.123  -4.342  -96.279  1.00 17.10  ? 29   VAL C CG1 1 
ATOM   3434  C  CG2 . VAL C  1 48  ? -68.808  -3.154  -98.439  1.00 18.49  ? 29   VAL C CG2 1 
ATOM   3435  N  N   . SER C  1 49  ? -70.342  -7.063  -96.092  1.00 36.91  ? 30   SER C N   1 
ATOM   3436  C  CA  . SER C  1 49  ? -70.570  -7.792  -94.841  1.00 33.12  ? 30   SER C CA  1 
ATOM   3437  C  C   . SER C  1 49  ? -69.515  -7.471  -93.798  1.00 34.41  ? 30   SER C C   1 
ATOM   3438  O  O   . SER C  1 49  ? -68.316  -7.550  -94.072  1.00 40.22  ? 30   SER C O   1 
ATOM   3439  C  CB  . SER C  1 49  ? -70.514  -9.298  -95.077  1.00 36.35  ? 30   SER C CB  1 
ATOM   3440  O  OG  . SER C  1 49  ? -71.718  -9.763  -95.639  1.00 41.10  ? 30   SER C OG  1 
ATOM   3441  N  N   . VAL C  1 50  ? -69.960  -7.135  -92.593  1.00 34.02  ? 31   VAL C N   1 
ATOM   3442  C  CA  . VAL C  1 50  ? -69.046  -6.922  -91.474  1.00 38.13  ? 31   VAL C CA  1 
ATOM   3443  C  C   . VAL C  1 50  ? -69.439  -7.807  -90.308  1.00 36.91  ? 31   VAL C C   1 
ATOM   3444  O  O   . VAL C  1 50  ? -70.592  -7.797  -89.871  1.00 36.51  ? 31   VAL C O   1 
ATOM   3445  C  CB  . VAL C  1 50  ? -69.039  -5.468  -90.990  1.00 39.48  ? 31   VAL C CB  1 
ATOM   3446  C  CG1 . VAL C  1 50  ? -67.944  -5.265  -89.955  1.00 39.52  ? 31   VAL C CG1 1 
ATOM   3447  C  CG2 . VAL C  1 50  ? -68.817  -4.541  -92.156  1.00 40.02  ? 31   VAL C CG2 1 
ATOM   3448  N  N   . SER C  1 51  ? -68.472  -8.570  -89.808  1.00 34.16  ? 32   SER C N   1 
ATOM   3449  C  CA  . SER C  1 51  ? -68.703  -9.496  -88.712  1.00 30.82  ? 32   SER C CA  1 
ATOM   3450  C  C   . SER C  1 51  ? -67.491  -9.513  -87.800  1.00 30.63  ? 32   SER C C   1 
ATOM   3451  O  O   . SER C  1 51  ? -66.412  -9.968  -88.205  1.00 32.68  ? 32   SER C O   1 
ATOM   3452  C  CB  . SER C  1 51  ? -68.957  -10.893 -89.258  1.00 29.35  ? 32   SER C CB  1 
ATOM   3453  O  OG  . SER C  1 51  ? -68.767  -11.871 -88.246  1.00 33.84  ? 32   SER C OG  1 
ATOM   3454  N  N   . LEU C  1 52  ? -67.656  -8.995  -86.580  1.00 28.35  ? 33   LEU C N   1 
ATOM   3455  C  CA  . LEU C  1 52  ? -66.559  -8.981  -85.611  1.00 25.91  ? 33   LEU C CA  1 
ATOM   3456  C  C   . LEU C  1 52  ? -66.508  -10.310 -84.840  1.00 29.17  ? 33   LEU C C   1 
ATOM   3457  O  O   . LEU C  1 52  ? -67.513  -10.764 -84.284  1.00 36.39  ? 33   LEU C O   1 
ATOM   3458  C  CB  . LEU C  1 52  ? -66.708  -7.814  -84.646  1.00 25.52  ? 33   LEU C CB  1 
ATOM   3459  C  CG  . LEU C  1 52  ? -66.823  -6.429  -85.252  1.00 25.55  ? 33   LEU C CG  1 
ATOM   3460  C  CD1 . LEU C  1 52  ? -66.735  -5.345  -84.170  1.00 26.23  ? 33   LEU C CD1 1 
ATOM   3461  C  CD2 . LEU C  1 52  ? -65.736  -6.261  -86.282  1.00 25.03  ? 33   LEU C CD2 1 
ATOM   3462  N  N   . LYS C  1 53  ? -65.344  -10.941 -84.840  1.00 22.35  ? 34   LYS C N   1 
ATOM   3463  C  CA  . LYS C  1 53  ? -65.129  -12.153 -84.072  1.00 26.66  ? 34   LYS C CA  1 
ATOM   3464  C  C   . LYS C  1 53  ? -64.205  -11.756 -82.945  1.00 26.01  ? 34   LYS C C   1 
ATOM   3465  O  O   . LYS C  1 53  ? -63.016  -11.516 -83.167  1.00 26.17  ? 34   LYS C O   1 
ATOM   3466  C  CB  . LYS C  1 53  ? -64.463  -13.256 -84.921  1.00 34.42  ? 34   LYS C CB  1 
ATOM   3467  C  CG  . LYS C  1 53  ? -65.087  -13.495 -86.284  1.00 37.40  ? 34   LYS C CG  1 
ATOM   3468  C  CD  . LYS C  1 53  ? -66.358  -14.290 -86.185  1.00 47.46  ? 34   LYS C CD  1 
ATOM   3469  C  CE  . LYS C  1 53  ? -66.936  -14.577 -87.569  1.00 56.42  ? 34   LYS C CE  1 
ATOM   3470  N  NZ  . LYS C  1 53  ? -68.061  -15.560 -87.524  1.00 63.42  ? 34   LYS C NZ  1 
ATOM   3471  N  N   . PHE C  1 54  ? -64.747  -11.666 -81.736  1.00 32.07  ? 35   PHE C N   1 
ATOM   3472  C  CA  . PHE C  1 54  ? -63.957  -11.207 -80.601  1.00 27.95  ? 35   PHE C CA  1 
ATOM   3473  C  C   . PHE C  1 54  ? -62.996  -12.279 -80.143  1.00 25.55  ? 35   PHE C C   1 
ATOM   3474  O  O   . PHE C  1 54  ? -63.375  -13.433 -79.994  1.00 28.70  ? 35   PHE C O   1 
ATOM   3475  C  CB  . PHE C  1 54  ? -64.863  -10.721 -79.479  1.00 25.31  ? 35   PHE C CB  1 
ATOM   3476  C  CG  . PHE C  1 54  ? -65.648  -9.490  -79.852  1.00 24.81  ? 35   PHE C CG  1 
ATOM   3477  C  CD1 . PHE C  1 54  ? -65.083  -8.236  -79.738  1.00 24.55  ? 35   PHE C CD1 1 
ATOM   3478  C  CD2 . PHE C  1 54  ? -66.933  -9.595  -80.350  1.00 25.43  ? 35   PHE C CD2 1 
ATOM   3479  C  CE1 . PHE C  1 54  ? -65.798  -7.109  -80.082  1.00 27.26  ? 35   PHE C CE1 1 
ATOM   3480  C  CE2 . PHE C  1 54  ? -67.651  -8.472  -80.707  1.00 22.91  ? 35   PHE C CE2 1 
ATOM   3481  C  CZ  . PHE C  1 54  ? -67.085  -7.233  -80.569  1.00 26.78  ? 35   PHE C CZ  1 
ATOM   3482  N  N   . ILE C  1 55  ? -61.740  -11.877 -79.964  1.00 22.02  ? 36   ILE C N   1 
ATOM   3483  C  CA  . ILE C  1 55  ? -60.656  -12.767 -79.552  1.00 27.58  ? 36   ILE C CA  1 
ATOM   3484  C  C   . ILE C  1 55  ? -60.233  -12.508 -78.105  1.00 26.05  ? 36   ILE C C   1 
ATOM   3485  O  O   . ILE C  1 55  ? -59.987  -13.436 -77.357  1.00 25.27  ? 36   ILE C O   1 
ATOM   3486  C  CB  . ILE C  1 55  ? -59.431  -12.569 -80.450  1.00 24.89  ? 36   ILE C CB  1 
ATOM   3487  C  CG1 . ILE C  1 55  ? -59.853  -12.594 -81.899  1.00 24.34  ? 36   ILE C CG1 1 
ATOM   3488  C  CG2 . ILE C  1 55  ? -58.392  -13.621 -80.170  1.00 21.99  ? 36   ILE C CG2 1 
ATOM   3489  C  CD1 . ILE C  1 55  ? -60.510  -13.909 -82.321  1.00 29.15  ? 36   ILE C CD1 1 
ATOM   3490  N  N   . ASN C  1 56  ? -60.144  -11.236 -77.721  1.00 35.83  ? 37   ASN C N   1 
ATOM   3491  C  CA  . ASN C  1 56  ? -59.789  -10.880 -76.347  1.00 22.91  ? 37   ASN C CA  1 
ATOM   3492  C  C   . ASN C  1 56  ? -60.270  -9.511  -75.910  1.00 24.58  ? 37   ASN C C   1 
ATOM   3493  O  O   . ASN C  1 56  ? -60.450  -8.617  -76.723  1.00 40.62  ? 37   ASN C O   1 
ATOM   3494  C  CB  . ASN C  1 56  ? -58.280  -10.953 -76.183  1.00 40.79  ? 37   ASN C CB  1 
ATOM   3495  C  CG  . ASN C  1 56  ? -57.866  -11.463 -74.821  1.00 41.70  ? 37   ASN C CG  1 
ATOM   3496  O  OD1 . ASN C  1 56  ? -58.491  -11.118 -73.816  1.00 45.37  ? 37   ASN C OD1 1 
ATOM   3497  N  ND2 . ASN C  1 56  ? -56.815  -12.302 -74.776  1.00 23.40  ? 37   ASN C ND2 1 
ATOM   3498  N  N   . ILE C  1 57  ? -60.496  -9.358  -74.615  1.00 28.07  ? 38   ILE C N   1 
ATOM   3499  C  CA  . ILE C  1 57  ? -60.745  -8.053  -74.009  1.00 28.49  ? 38   ILE C CA  1 
ATOM   3500  C  C   . ILE C  1 57  ? -59.629  -7.841  -73.002  1.00 23.63  ? 38   ILE C C   1 
ATOM   3501  O  O   . ILE C  1 57  ? -59.431  -8.677  -72.148  1.00 33.38  ? 38   ILE C O   1 
ATOM   3502  C  CB  . ILE C  1 57  ? -62.101  -8.021  -73.318  1.00 28.69  ? 38   ILE C CB  1 
ATOM   3503  C  CG1 . ILE C  1 57  ? -63.204  -8.235  -74.360  1.00 23.41  ? 38   ILE C CG1 1 
ATOM   3504  C  CG2 . ILE C  1 57  ? -62.274  -6.726  -72.547  1.00 23.79  ? 38   ILE C CG2 1 
ATOM   3505  C  CD1 . ILE C  1 57  ? -64.576  -8.346  -73.779  1.00 26.79  ? 38   ILE C CD1 1 
ATOM   3506  N  N   . LEU C  1 58  ? -58.892  -6.744  -73.114  1.00 38.53  ? 39   LEU C N   1 
ATOM   3507  C  CA  . LEU C  1 58  ? -57.588  -6.669  -72.470  1.00 40.90  ? 39   LEU C CA  1 
ATOM   3508  C  C   . LEU C  1 58  ? -57.520  -5.693  -71.313  1.00 44.19  ? 39   LEU C C   1 
ATOM   3509  O  O   . LEU C  1 58  ? -56.873  -5.941  -70.287  1.00 45.64  ? 39   LEU C O   1 
ATOM   3510  C  CB  . LEU C  1 58  ? -56.515  -6.312  -73.506  1.00 40.65  ? 39   LEU C CB  1 
ATOM   3511  C  CG  . LEU C  1 58  ? -56.282  -7.392  -74.556  1.00 42.55  ? 39   LEU C CG  1 
ATOM   3512  C  CD1 . LEU C  1 58  ? -55.246  -6.934  -75.544  1.00 44.61  ? 39   LEU C CD1 1 
ATOM   3513  C  CD2 . LEU C  1 58  ? -55.856  -8.697  -73.881  1.00 43.63  ? 39   LEU C CD2 1 
ATOM   3514  N  N   . GLU C  1 59  ? -58.171  -4.568  -71.494  1.00 43.51  ? 40   GLU C N   1 
ATOM   3515  C  CA  . GLU C  1 59  ? -58.093  -3.542  -70.505  1.00 49.68  ? 40   GLU C CA  1 
ATOM   3516  C  C   . GLU C  1 59  ? -59.446  -2.904  -70.542  1.00 51.54  ? 40   GLU C C   1 
ATOM   3517  O  O   . GLU C  1 59  ? -59.941  -2.461  -71.583  1.00 58.55  ? 40   GLU C O   1 
ATOM   3518  C  CB  . GLU C  1 59  ? -56.992  -2.556  -70.856  1.00 58.81  ? 40   GLU C CB  1 
ATOM   3519  C  CG  . GLU C  1 59  ? -56.334  -1.889  -69.679  1.00 68.09  ? 40   GLU C CG  1 
ATOM   3520  C  CD  . GLU C  1 59  ? -54.865  -1.638  -69.948  1.00 78.58  ? 40   GLU C CD  1 
ATOM   3521  O  OE1 . GLU C  1 59  ? -54.401  -2.010  -71.056  1.00 82.13  ? 40   GLU C OE1 1 
ATOM   3522  O  OE2 . GLU C  1 59  ? -54.179  -1.085  -69.060  1.00 79.95  ? 40   GLU C OE2 1 
ATOM   3523  N  N   . VAL C  1 60  ? -60.074  -2.936  -69.393  1.00 43.43  ? 41   VAL C N   1 
ATOM   3524  C  CA  . VAL C  1 60  ? -61.307  -2.237  -69.197  1.00 41.68  ? 41   VAL C CA  1 
ATOM   3525  C  C   . VAL C  1 60  ? -61.039  -1.148  -68.164  1.00 37.43  ? 41   VAL C C   1 
ATOM   3526  O  O   . VAL C  1 60  ? -60.247  -1.333  -67.244  1.00 38.03  ? 41   VAL C O   1 
ATOM   3527  C  CB  . VAL C  1 60  ? -62.371  -3.223  -68.722  1.00 47.93  ? 41   VAL C CB  1 
ATOM   3528  C  CG1 . VAL C  1 60  ? -63.332  -2.577  -67.764  1.00 47.74  ? 41   VAL C CG1 1 
ATOM   3529  C  CG2 . VAL C  1 60  ? -63.084  -3.838  -69.921  1.00 50.51  ? 41   VAL C CG2 1 
ATOM   3530  N  N   . ASN C  1 61  ? -61.667  0.002   -68.349  1.00 32.21  ? 42   ASN C N   1 
ATOM   3531  C  CA  . ASN C  1 61  ? -61.600  1.087   -67.383  1.00 32.61  ? 42   ASN C CA  1 
ATOM   3532  C  C   . ASN C  1 61  ? -62.987  1.672   -67.191  1.00 29.22  ? 42   ASN C C   1 
ATOM   3533  O  O   . ASN C  1 61  ? -63.487  2.435   -68.030  1.00 27.11  ? 42   ASN C O   1 
ATOM   3534  C  CB  . ASN C  1 61  ? -60.606  2.170   -67.828  1.00 39.15  ? 42   ASN C CB  1 
ATOM   3535  C  CG  . ASN C  1 61  ? -60.313  3.197   -66.728  1.00 37.82  ? 42   ASN C CG  1 
ATOM   3536  O  OD1 . ASN C  1 61  ? -61.206  3.594   -65.960  1.00 31.21  ? 42   ASN C OD1 1 
ATOM   3537  N  ND2 . ASN C  1 61  ? -59.055  3.631   -66.654  1.00 38.12  ? 42   ASN C ND2 1 
ATOM   3538  N  N   . GLU C  1 62  ? -63.603  1.325   -66.069  1.00 34.50  ? 43   GLU C N   1 
ATOM   3539  C  CA  . GLU C  1 62  ? -64.983  1.715   -65.803  1.00 37.41  ? 43   GLU C CA  1 
ATOM   3540  C  C   . GLU C  1 62  ? -65.119  3.203   -65.486  1.00 38.54  ? 43   GLU C C   1 
ATOM   3541  O  O   . GLU C  1 62  ? -66.183  3.797   -65.707  1.00 41.98  ? 43   GLU C O   1 
ATOM   3542  C  CB  . GLU C  1 62  ? -65.579  0.864   -64.682  1.00 34.61  ? 43   GLU C CB  1 
ATOM   3543  C  CG  . GLU C  1 62  ? -67.102  0.877   -64.666  1.00 36.97  ? 43   GLU C CG  1 
ATOM   3544  C  CD  . GLU C  1 62  ? -67.699  -0.177  -63.727  1.00 51.46  ? 43   GLU C CD  1 
ATOM   3545  O  OE1 . GLU C  1 62  ? -66.915  -0.924  -63.084  1.00 58.43  ? 43   GLU C OE1 1 
ATOM   3546  O  OE2 . GLU C  1 62  ? -68.954  -0.257  -63.636  1.00 52.86  ? 43   GLU C OE2 1 
ATOM   3547  N  N   . ILE C  1 63  ? -64.043  3.807   -64.988  1.00 35.27  ? 44   ILE C N   1 
ATOM   3548  C  CA  . ILE C  1 63  ? -64.030  5.260   -64.774  1.00 40.38  ? 44   ILE C CA  1 
ATOM   3549  C  C   . ILE C  1 63  ? -64.021  6.024   -66.111  1.00 40.99  ? 44   ILE C C   1 
ATOM   3550  O  O   . ILE C  1 63  ? -64.908  6.827   -66.382  1.00 40.85  ? 44   ILE C O   1 
ATOM   3551  C  CB  . ILE C  1 63  ? -62.793  5.720   -63.951  1.00 41.11  ? 44   ILE C CB  1 
ATOM   3552  C  CG1 . ILE C  1 63  ? -62.689  4.949   -62.629  1.00 36.56  ? 44   ILE C CG1 1 
ATOM   3553  C  CG2 . ILE C  1 63  ? -62.821  7.237   -63.749  1.00 31.67  ? 44   ILE C CG2 1 
ATOM   3554  C  CD1 . ILE C  1 63  ? -63.939  5.031   -61.810  1.00 36.84  ? 44   ILE C CD1 1 
ATOM   3555  N  N   . THR C  1 64  ? -63.012  5.768   -66.938  1.00 39.89  ? 45   THR C N   1 
ATOM   3556  C  CA  . THR C  1 64  ? -62.849  6.496   -68.196  1.00 43.44  ? 45   THR C CA  1 
ATOM   3557  C  C   . THR C  1 64  ? -63.778  6.020   -69.321  1.00 38.60  ? 45   THR C C   1 
ATOM   3558  O  O   . THR C  1 64  ? -63.875  6.683   -70.361  1.00 35.54  ? 45   THR C O   1 
ATOM   3559  C  CB  . THR C  1 64  ? -61.385  6.450   -68.701  1.00 44.26  ? 45   THR C CB  1 
ATOM   3560  O  OG1 . THR C  1 64  ? -61.040  5.111   -69.084  1.00 43.40  ? 45   THR C OG1 1 
ATOM   3561  C  CG2 . THR C  1 64  ? -60.443  6.914   -67.617  1.00 46.23  ? 45   THR C CG2 1 
ATOM   3562  N  N   . ASN C  1 65  ? -64.448  4.886   -69.109  1.00 33.40  ? 46   ASN C N   1 
ATOM   3563  C  CA  . ASN C  1 65  ? -65.310  4.291   -70.125  1.00 37.10  ? 46   ASN C CA  1 
ATOM   3564  C  C   . ASN C  1 65  ? -64.557  3.911   -71.411  1.00 45.37  ? 46   ASN C C   1 
ATOM   3565  O  O   . ASN C  1 65  ? -64.974  4.236   -72.528  1.00 52.53  ? 46   ASN C O   1 
ATOM   3566  C  CB  . ASN C  1 65  ? -66.508  5.199   -70.433  1.00 39.98  ? 46   ASN C CB  1 
ATOM   3567  C  CG  . ASN C  1 65  ? -67.780  4.778   -69.690  1.00 43.42  ? 46   ASN C CG  1 
ATOM   3568  O  OD1 . ASN C  1 65  ? -67.947  3.608   -69.320  1.00 44.62  ? 46   ASN C OD1 1 
ATOM   3569  N  ND2 . ASN C  1 65  ? -68.690  5.734   -69.481  1.00 38.03  ? 46   ASN C ND2 1 
ATOM   3570  N  N   . GLU C  1 66  ? -63.439  3.218   -71.237  1.00 43.95  ? 47   GLU C N   1 
ATOM   3571  C  CA  . GLU C  1 66  ? -62.591  2.850   -72.347  1.00 45.43  ? 47   GLU C CA  1 
ATOM   3572  C  C   . GLU C  1 66  ? -62.272  1.369   -72.267  1.00 45.00  ? 47   GLU C C   1 
ATOM   3573  O  O   . GLU C  1 66  ? -62.022  0.856   -71.180  1.00 38.03  ? 47   GLU C O   1 
ATOM   3574  C  CB  . GLU C  1 66  ? -61.310  3.686   -72.313  1.00 48.76  ? 47   GLU C CB  1 
ATOM   3575  C  CG  . GLU C  1 66  ? -61.559  5.193   -72.446  1.00 56.40  ? 47   GLU C CG  1 
ATOM   3576  C  CD  . GLU C  1 66  ? -60.292  6.027   -72.294  1.00 64.20  ? 47   GLU C CD  1 
ATOM   3577  O  OE1 . GLU C  1 66  ? -59.183  5.460   -72.396  1.00 68.31  ? 47   GLU C OE1 1 
ATOM   3578  O  OE2 . GLU C  1 66  ? -60.403  7.252   -72.071  1.00 66.13  ? 47   GLU C OE2 1 
ATOM   3579  N  N   . VAL C  1 67  ? -62.301  0.683   -73.413  1.00 48.68  ? 48   VAL C N   1 
ATOM   3580  C  CA  . VAL C  1 67  ? -61.932  -0.735  -73.470  1.00 47.36  ? 48   VAL C CA  1 
ATOM   3581  C  C   . VAL C  1 67  ? -60.905  -1.013  -74.566  1.00 46.27  ? 48   VAL C C   1 
ATOM   3582  O  O   . VAL C  1 67  ? -60.840  -0.314  -75.574  1.00 47.84  ? 48   VAL C O   1 
ATOM   3583  C  CB  . VAL C  1 67  ? -63.146  -1.650  -73.686  1.00 43.52  ? 48   VAL C CB  1 
ATOM   3584  C  CG1 . VAL C  1 67  ? -64.123  -1.518  -72.542  1.00 37.26  ? 48   VAL C CG1 1 
ATOM   3585  C  CG2 . VAL C  1 67  ? -63.820  -1.331  -75.024  1.00 43.58  ? 48   VAL C CG2 1 
ATOM   3586  N  N   . ASP C  1 68  ? -60.104  -2.044  -74.344  1.00 43.66  ? 49   ASP C N   1 
ATOM   3587  C  CA  . ASP C  1 68  ? -59.072  -2.448  -75.278  1.00 42.06  ? 49   ASP C CA  1 
ATOM   3588  C  C   . ASP C  1 68  ? -59.463  -3.838  -75.772  1.00 39.30  ? 49   ASP C C   1 
ATOM   3589  O  O   . ASP C  1 68  ? -59.497  -4.800  -75.003  1.00 42.81  ? 49   ASP C O   1 
ATOM   3590  C  CB  . ASP C  1 68  ? -57.729  -2.490  -74.554  1.00 48.75  ? 49   ASP C CB  1 
ATOM   3591  C  CG  . ASP C  1 68  ? -56.551  -2.275  -75.482  1.00 58.65  ? 49   ASP C CG  1 
ATOM   3592  O  OD1 . ASP C  1 68  ? -56.340  -3.129  -76.362  1.00 63.85  ? 49   ASP C OD1 1 
ATOM   3593  O  OD2 . ASP C  1 68  ? -55.814  -1.276  -75.320  1.00 62.62  ? 49   ASP C OD2 1 
ATOM   3594  N  N   . VAL C  1 69  ? -59.778  -3.944  -77.054  1.00 36.25  ? 50   VAL C N   1 
ATOM   3595  C  CA  . VAL C  1 69  ? -60.314  -5.184  -77.596  1.00 30.39  ? 50   VAL C CA  1 
ATOM   3596  C  C   . VAL C  1 69  ? -59.425  -5.724  -78.712  1.00 29.69  ? 50   VAL C C   1 
ATOM   3597  O  O   . VAL C  1 69  ? -58.799  -4.963  -79.453  1.00 33.32  ? 50   VAL C O   1 
ATOM   3598  C  CB  . VAL C  1 69  ? -61.755  -4.977  -78.117  1.00 39.05  ? 50   VAL C CB  1 
ATOM   3599  C  CG1 . VAL C  1 69  ? -62.372  -6.297  -78.576  1.00 39.92  ? 50   VAL C CG1 1 
ATOM   3600  C  CG2 . VAL C  1 69  ? -62.620  -4.335  -77.036  1.00 45.98  ? 50   VAL C CG2 1 
ATOM   3601  N  N   . VAL C  1 70  ? -59.361  -7.044  -78.804  1.00 31.52  ? 51   VAL C N   1 
ATOM   3602  C  CA  . VAL C  1 70  ? -58.763  -7.712  -79.942  1.00 32.88  ? 51   VAL C CA  1 
ATOM   3603  C  C   . VAL C  1 70  ? -59.871  -8.479  -80.652  1.00 32.99  ? 51   VAL C C   1 
ATOM   3604  O  O   . VAL C  1 70  ? -60.613  -9.235  -80.020  1.00 29.97  ? 51   VAL C O   1 
ATOM   3605  C  CB  . VAL C  1 70  ? -57.638  -8.679  -79.526  1.00 29.90  ? 51   VAL C CB  1 
ATOM   3606  C  CG1 . VAL C  1 70  ? -57.204  -9.509  -80.737  1.00 27.80  ? 51   VAL C CG1 1 
ATOM   3607  C  CG2 . VAL C  1 70  ? -56.448  -7.903  -78.977  1.00 21.71  ? 51   VAL C CG2 1 
ATOM   3608  N  N   . PHE C  1 71  ? -59.985  -8.279  -81.959  1.00 21.03  ? 52   PHE C N   1 
ATOM   3609  C  CA  . PHE C  1 71  ? -61.064  -8.899  -82.729  1.00 27.41  ? 52   PHE C CA  1 
ATOM   3610  C  C   . PHE C  1 71  ? -60.694  -9.077  -84.192  1.00 30.92  ? 52   PHE C C   1 
ATOM   3611  O  O   . PHE C  1 71  ? -59.921  -8.296  -84.741  1.00 20.23  ? 52   PHE C O   1 
ATOM   3612  C  CB  . PHE C  1 71  ? -62.330  -8.054  -82.643  1.00 26.71  ? 52   PHE C CB  1 
ATOM   3613  C  CG  . PHE C  1 71  ? -62.159  -6.650  -83.170  1.00 27.61  ? 52   PHE C CG  1 
ATOM   3614  C  CD1 . PHE C  1 71  ? -61.543  -5.669  -82.392  1.00 33.33  ? 52   PHE C CD1 1 
ATOM   3615  C  CD2 . PHE C  1 71  ? -62.607  -6.305  -84.430  1.00 24.03  ? 52   PHE C CD2 1 
ATOM   3616  C  CE1 . PHE C  1 71  ? -61.375  -4.361  -82.869  1.00 29.50  ? 52   PHE C CE1 1 
ATOM   3617  C  CE2 . PHE C  1 71  ? -62.444  -5.010  -84.909  1.00 24.60  ? 52   PHE C CE2 1 
ATOM   3618  C  CZ  . PHE C  1 71  ? -61.828  -4.033  -84.120  1.00 23.68  ? 52   PHE C CZ  1 
ATOM   3619  N  N   . TRP C  1 72  ? -61.241  -10.121 -84.805  1.00 29.01  ? 53   TRP C N   1 
ATOM   3620  C  CA  . TRP C  1 72  ? -61.133  -10.297 -86.242  1.00 29.07  ? 53   TRP C CA  1 
ATOM   3621  C  C   . TRP C  1 72  ? -62.227  -9.469  -86.887  1.00 28.22  ? 53   TRP C C   1 
ATOM   3622  O  O   . TRP C  1 72  ? -63.419  -9.633  -86.571  1.00 27.21  ? 53   TRP C O   1 
ATOM   3623  C  CB  . TRP C  1 72  ? -61.356  -11.755 -86.619  1.00 35.83  ? 53   TRP C CB  1 
ATOM   3624  C  CG  . TRP C  1 72  ? -60.327  -12.694 -86.085  1.00 32.04  ? 53   TRP C CG  1 
ATOM   3625  C  CD1 . TRP C  1 72  ? -59.247  -12.385 -85.297  1.00 23.20  ? 53   TRP C CD1 1 
ATOM   3626  C  CD2 . TRP C  1 72  ? -60.266  -14.109 -86.326  1.00 28.96  ? 53   TRP C CD2 1 
ATOM   3627  N  NE1 . TRP C  1 72  ? -58.521  -13.532 -85.025  1.00 25.04  ? 53   TRP C NE1 1 
ATOM   3628  C  CE2 . TRP C  1 72  ? -59.123  -14.597 -85.640  1.00 27.90  ? 53   TRP C CE2 1 
ATOM   3629  C  CE3 . TRP C  1 72  ? -61.068  -15.004 -87.039  1.00 26.32  ? 53   TRP C CE3 1 
ATOM   3630  C  CZ2 . TRP C  1 72  ? -58.764  -15.958 -85.665  1.00 26.31  ? 53   TRP C CZ2 1 
ATOM   3631  C  CZ3 . TRP C  1 72  ? -60.711  -16.349 -87.061  1.00 28.70  ? 53   TRP C CZ3 1 
ATOM   3632  C  CH2 . TRP C  1 72  ? -59.567  -16.812 -86.374  1.00 28.39  ? 53   TRP C CH2 1 
ATOM   3633  N  N   . GLN C  1 73  ? -61.828  -8.577  -87.791  1.00 24.09  ? 54   GLN C N   1 
ATOM   3634  C  CA  . GLN C  1 73  ? -62.794  -7.789  -88.530  1.00 24.28  ? 54   GLN C CA  1 
ATOM   3635  C  C   . GLN C  1 73  ? -63.071  -8.445  -89.888  1.00 28.07  ? 54   GLN C C   1 
ATOM   3636  O  O   . GLN C  1 73  ? -62.556  -8.017  -90.935  1.00 27.36  ? 54   GLN C O   1 
ATOM   3637  C  CB  . GLN C  1 73  ? -62.289  -6.354  -88.705  1.00 25.74  ? 54   GLN C CB  1 
ATOM   3638  C  CG  . GLN C  1 73  ? -63.344  -5.378  -89.192  1.00 25.19  ? 54   GLN C CG  1 
ATOM   3639  C  CD  . GLN C  1 73  ? -62.930  -3.932  -89.007  1.00 36.45  ? 54   GLN C CD  1 
ATOM   3640  O  OE1 . GLN C  1 73  ? -62.719  -3.468  -87.872  1.00 43.53  ? 54   GLN C OE1 1 
ATOM   3641  N  NE2 . GLN C  1 73  ? -62.808  -3.200  -90.122  1.00 38.70  ? 54   GLN C NE2 1 
ATOM   3642  N  N   . GLN C  1 74  ? -63.899  -9.481  -89.871  1.00 28.16  ? 55   GLN C N   1 
ATOM   3643  C  CA  . GLN C  1 74  ? -64.208  -10.202 -91.105  1.00 34.83  ? 55   GLN C CA  1 
ATOM   3644  C  C   . GLN C  1 74  ? -65.048  -9.367  -92.090  1.00 31.54  ? 55   GLN C C   1 
ATOM   3645  O  O   . GLN C  1 74  ? -66.235  -9.110  -91.856  1.00 27.59  ? 55   GLN C O   1 
ATOM   3646  C  CB  . GLN C  1 74  ? -64.931  -11.510 -90.799  1.00 36.54  ? 55   GLN C CB  1 
ATOM   3647  C  CG  . GLN C  1 74  ? -65.292  -12.287 -92.034  1.00 36.31  ? 55   GLN C CG  1 
ATOM   3648  C  CD  . GLN C  1 74  ? -66.135  -13.501 -91.732  1.00 35.16  ? 55   GLN C CD  1 
ATOM   3649  O  OE1 . GLN C  1 74  ? -65.638  -14.505 -91.203  1.00 39.56  ? 55   GLN C OE1 1 
ATOM   3650  N  NE2 . GLN C  1 74  ? -67.423  -13.422 -92.064  1.00 32.11  ? 55   GLN C NE2 1 
ATOM   3651  N  N   . THR C  1 75  ? -64.424  -8.968  -93.196  1.00 28.79  ? 56   THR C N   1 
ATOM   3652  C  CA  . THR C  1 75  ? -65.049  -8.059  -94.151  1.00 27.10  ? 56   THR C CA  1 
ATOM   3653  C  C   . THR C  1 75  ? -65.200  -8.764  -95.495  1.00 30.99  ? 56   THR C C   1 
ATOM   3654  O  O   . THR C  1 75  ? -64.248  -9.359  -96.008  1.00 33.38  ? 56   THR C O   1 
ATOM   3655  C  CB  . THR C  1 75  ? -64.247  -6.755  -94.300  1.00 30.12  ? 56   THR C CB  1 
ATOM   3656  O  OG1 . THR C  1 75  ? -63.884  -6.235  -92.998  1.00 34.36  ? 56   THR C OG1 1 
ATOM   3657  C  CG2 . THR C  1 75  ? -65.076  -5.733  -95.026  1.00 35.49  ? 56   THR C CG2 1 
ATOM   3658  N  N   . THR C  1 76  ? -66.406  -8.722  -96.057  1.00 28.55  ? 57   THR C N   1 
ATOM   3659  C  CA  . THR C  1 76  ? -66.681  -9.475  -97.274  1.00 28.97  ? 57   THR C CA  1 
ATOM   3660  C  C   . THR C  1 76  ? -67.463  -8.669  -98.291  1.00 23.88  ? 57   THR C C   1 
ATOM   3661  O  O   . THR C  1 76  ? -68.508  -8.105  -97.990  1.00 25.71  ? 57   THR C O   1 
ATOM   3662  C  CB  . THR C  1 76  ? -67.437  -10.783 -96.975  1.00 32.93  ? 57   THR C CB  1 
ATOM   3663  O  OG1 . THR C  1 76  ? -66.699  -11.553 -96.014  1.00 33.61  ? 57   THR C OG1 1 
ATOM   3664  C  CG2 . THR C  1 76  ? -67.582  -11.605 -98.247  1.00 35.94  ? 57   THR C CG2 1 
ATOM   3665  N  N   . TRP C  1 77  ? -66.950  -8.626  -99.507  1.00 18.83  ? 58   TRP C N   1 
ATOM   3666  C  CA  . TRP C  1 77  ? -67.633  -7.900  -100.565 1.00 28.99  ? 58   TRP C CA  1 
ATOM   3667  C  C   . TRP C  1 77  ? -67.380  -8.522  -101.929 1.00 42.08  ? 58   TRP C C   1 
ATOM   3668  O  O   . TRP C  1 77  ? -66.733  -9.569  -102.052 1.00 46.76  ? 58   TRP C O   1 
ATOM   3669  C  CB  . TRP C  1 77  ? -67.226  -6.426  -100.554 1.00 23.40  ? 58   TRP C CB  1 
ATOM   3670  C  CG  . TRP C  1 77  ? -65.798  -6.191  -100.940 1.00 22.76  ? 58   TRP C CG  1 
ATOM   3671  C  CD1 . TRP C  1 77  ? -65.326  -5.816  -102.169 1.00 19.69  ? 58   TRP C CD1 1 
ATOM   3672  C  CD2 . TRP C  1 77  ? -64.655  -6.299  -100.079 1.00 25.81  ? 58   TRP C CD2 1 
ATOM   3673  N  NE1 . TRP C  1 77  ? -63.962  -5.677  -102.124 1.00 23.60  ? 58   TRP C NE1 1 
ATOM   3674  C  CE2 . TRP C  1 77  ? -63.523  -5.971  -100.868 1.00 26.52  ? 58   TRP C CE2 1 
ATOM   3675  C  CE3 . TRP C  1 77  ? -64.484  -6.660  -98.735  1.00 23.61  ? 58   TRP C CE3 1 
ATOM   3676  C  CZ2 . TRP C  1 77  ? -62.217  -5.981  -100.333 1.00 26.93  ? 58   TRP C CZ2 1 
ATOM   3677  C  CZ3 . TRP C  1 77  ? -63.191  -6.673  -98.207  1.00 26.80  ? 58   TRP C CZ3 1 
ATOM   3678  C  CH2 . TRP C  1 77  ? -62.068  -6.334  -99.011  1.00 29.50  ? 58   TRP C CH2 1 
ATOM   3679  N  N   . SER C  1 78  ? -67.889  -7.873  -102.965 1.00 46.66  ? 59   SER C N   1 
ATOM   3680  C  CA  . SER C  1 78  ? -67.801  -8.451  -104.301 1.00 44.05  ? 59   SER C CA  1 
ATOM   3681  C  C   . SER C  1 78  ? -67.160  -7.467  -105.275 1.00 35.56  ? 59   SER C C   1 
ATOM   3682  O  O   . SER C  1 78  ? -67.566  -6.305  -105.342 1.00 35.92  ? 59   SER C O   1 
ATOM   3683  C  CB  . SER C  1 78  ? -69.202  -8.846  -104.773 1.00 48.27  ? 59   SER C CB  1 
ATOM   3684  O  OG  . SER C  1 78  ? -69.139  -9.629  -105.946 1.00 60.05  ? 59   SER C OG  1 
ATOM   3685  N  N   . ASP C  1 79  ? -66.131  -7.902  -105.980 1.00 33.32  ? 60   ASP C N   1 
ATOM   3686  C  CA  . ASP C  1 79  ? -65.595  -7.142  -107.081 1.00 36.72  ? 60   ASP C CA  1 
ATOM   3687  C  C   . ASP C  1 79  ? -65.478  -8.011  -108.326 1.00 39.40  ? 60   ASP C C   1 
ATOM   3688  O  O   . ASP C  1 79  ? -64.635  -8.834  -108.389 1.00 40.27  ? 60   ASP C O   1 
ATOM   3689  C  CB  . ASP C  1 79  ? -64.238  -6.634  -106.673 1.00 36.80  ? 60   ASP C CB  1 
ATOM   3690  C  CG  . ASP C  1 79  ? -63.673  -5.655  -107.625 1.00 42.14  ? 60   ASP C CG  1 
ATOM   3691  O  OD1 . ASP C  1 79  ? -64.172  -5.506  -108.706 1.00 43.20  ? 60   ASP C OD1 1 
ATOM   3692  O  OD2 . ASP C  1 79  ? -62.699  -5.018  -107.310 1.00 40.38  ? 60   ASP C OD2 1 
ATOM   3693  N  N   . ARG C  1 80  ? -66.312  -7.786  -109.325 1.00 41.80  ? 61   ARG C N   1 
ATOM   3694  C  CA  . ARG C  1 80  ? -66.394  -8.598  -110.551 1.00 44.54  ? 61   ARG C CA  1 
ATOM   3695  C  C   . ARG C  1 80  ? -65.184  -8.433  -111.413 1.00 31.01  ? 61   ARG C C   1 
ATOM   3696  O  O   . ARG C  1 80  ? -64.815  -9.241  -112.195 1.00 25.13  ? 61   ARG C O   1 
ATOM   3697  C  CB  . ARG C  1 80  ? -67.597  -8.182  -111.380 1.00 51.41  ? 61   ARG C CB  1 
ATOM   3698  C  CG  . ARG C  1 80  ? -68.953  -8.529  -110.832 1.00 60.50  ? 61   ARG C CG  1 
ATOM   3699  C  CD  . ARG C  1 80  ? -69.240  -9.991  -110.983 1.00 70.74  ? 61   ARG C CD  1 
ATOM   3700  N  NE  . ARG C  1 80  ? -69.094  -10.624 -109.706 1.00 86.36  ? 61   ARG C NE  1 
ATOM   3701  C  CZ  . ARG C  1 80  ? -69.946  -10.464 -108.709 1.00 99.02  ? 61   ARG C CZ  1 
ATOM   3702  N  NH1 . ARG C  1 80  ? -71.002  -9.695  -108.876 1.00 104.00 ? 61   ARG C NH1 1 
ATOM   3703  N  NH2 . ARG C  1 80  ? -69.737  -11.076 -107.551 1.00 102.24 ? 61   ARG C NH2 1 
ATOM   3704  N  N   . THR C  1 81  ? -64.577  -7.317  -111.206 1.00 27.87  ? 62   THR C N   1 
ATOM   3705  C  CA  . THR C  1 81  ? -63.431  -6.873  -111.894 1.00 30.66  ? 62   THR C CA  1 
ATOM   3706  C  C   . THR C  1 81  ? -62.365  -7.931  -111.701 1.00 40.27  ? 62   THR C C   1 
ATOM   3707  O  O   . THR C  1 81  ? -61.529  -8.108  -112.553 1.00 49.52  ? 62   THR C O   1 
ATOM   3708  C  CB  . THR C  1 81  ? -63.063  -5.533  -111.253 1.00 32.50  ? 62   THR C CB  1 
ATOM   3709  O  OG1 . THR C  1 81  ? -63.787  -4.508  -111.908 1.00 36.88  ? 62   THR C OG1 1 
ATOM   3710  C  CG2 . THR C  1 81  ? -61.616  -5.221  -111.295 1.00 26.90  ? 62   THR C CG2 1 
ATOM   3711  N  N   . LEU C  1 82  ? -62.370  -8.596  -110.557 1.00 36.03  ? 63   LEU C N   1 
ATOM   3712  C  CA  . LEU C  1 82  ? -61.372  -9.587  -110.201 1.00 30.55  ? 63   LEU C CA  1 
ATOM   3713  C  C   . LEU C  1 82  ? -61.664  -11.017 -110.595 1.00 30.26  ? 63   LEU C C   1 
ATOM   3714  O  O   . LEU C  1 82  ? -60.864  -11.877 -110.381 1.00 35.40  ? 63   LEU C O   1 
ATOM   3715  C  CB  . LEU C  1 82  ? -61.171  -9.574  -108.708 1.00 31.36  ? 63   LEU C CB  1 
ATOM   3716  C  CG  . LEU C  1 82  ? -60.615  -8.354  -108.038 1.00 34.17  ? 63   LEU C CG  1 
ATOM   3717  C  CD1 . LEU C  1 82  ? -60.788  -8.454  -106.556 1.00 22.62  ? 63   LEU C CD1 1 
ATOM   3718  C  CD2 . LEU C  1 82  ? -59.167  -8.250  -108.398 1.00 38.32  ? 63   LEU C CD2 1 
ATOM   3719  N  N   . ALA C  1 83  ? -62.821  -11.265 -111.151 1.00 21.49  ? 64   ALA C N   1 
ATOM   3720  C  CA  . ALA C  1 83  ? -63.232  -12.602 -111.501 1.00 27.44  ? 64   ALA C CA  1 
ATOM   3721  C  C   . ALA C  1 83  ? -62.467  -13.271 -112.635 1.00 33.20  ? 64   ALA C C   1 
ATOM   3722  O  O   . ALA C  1 83  ? -61.945  -12.610 -113.492 1.00 31.51  ? 64   ALA C O   1 
ATOM   3723  C  CB  . ALA C  1 83  ? -64.695  -12.591 -111.821 1.00 28.51  ? 64   ALA C CB  1 
ATOM   3724  N  N   . TRP C  1 84  ? -62.386  -14.597 -112.616 1.00 35.17  ? 65   TRP C N   1 
ATOM   3725  C  CA  . TRP C  1 84  ? -61.690  -15.336 -113.668 1.00 33.96  ? 65   TRP C CA  1 
ATOM   3726  C  C   . TRP C  1 84  ? -62.349  -16.688 -113.920 1.00 41.49  ? 65   TRP C C   1 
ATOM   3727  O  O   . TRP C  1 84  ? -63.108  -17.189 -113.080 1.00 40.51  ? 65   TRP C O   1 
ATOM   3728  C  CB  . TRP C  1 84  ? -60.188  -15.505 -113.357 1.00 27.72  ? 65   TRP C CB  1 
ATOM   3729  C  CG  . TRP C  1 84  ? -59.884  -16.450 -112.220 1.00 37.19  ? 65   TRP C CG  1 
ATOM   3730  C  CD1 . TRP C  1 84  ? -59.722  -17.810 -112.298 1.00 42.30  ? 65   TRP C CD1 1 
ATOM   3731  C  CD2 . TRP C  1 84  ? -59.702  -16.108 -110.837 1.00 39.00  ? 65   TRP C CD2 1 
ATOM   3732  N  NE1 . TRP C  1 84  ? -59.462  -18.333 -111.050 1.00 37.25  ? 65   TRP C NE1 1 
ATOM   3733  C  CE2 . TRP C  1 84  ? -59.444  -17.312 -110.137 1.00 37.98  ? 65   TRP C CE2 1 
ATOM   3734  C  CE3 . TRP C  1 84  ? -59.740  -14.908 -110.123 1.00 36.03  ? 65   TRP C CE3 1 
ATOM   3735  C  CZ2 . TRP C  1 84  ? -59.216  -17.341 -108.760 1.00 33.02  ? 65   TRP C CZ2 1 
ATOM   3736  C  CZ3 . TRP C  1 84  ? -59.517  -14.944 -108.760 1.00 38.69  ? 65   TRP C CZ3 1 
ATOM   3737  C  CH2 . TRP C  1 84  ? -59.260  -16.153 -108.094 1.00 35.32  ? 65   TRP C CH2 1 
ATOM   3738  N  N   . ASN C  1 85  ? -62.051  -17.266 -115.081 1.00 49.99  ? 66   ASN C N   1 
ATOM   3739  C  CA  . ASN C  1 85  ? -62.568  -18.576 -115.460 1.00 60.39  ? 66   ASN C CA  1 
ATOM   3740  C  C   . ASN C  1 85  ? -61.816  -19.666 -114.692 1.00 64.81  ? 66   ASN C C   1 
ATOM   3741  O  O   . ASN C  1 85  ? -60.647  -19.937 -114.968 1.00 69.97  ? 66   ASN C O   1 
ATOM   3742  C  CB  . ASN C  1 85  ? -62.429  -18.765 -116.979 1.00 67.82  ? 66   ASN C CB  1 
ATOM   3743  C  CG  . ASN C  1 85  ? -63.196  -19.975 -117.505 1.00 74.20  ? 66   ASN C CG  1 
ATOM   3744  O  OD1 . ASN C  1 85  ? -63.539  -20.886 -116.748 1.00 74.00  ? 66   ASN C OD1 1 
ATOM   3745  N  ND2 . ASN C  1 85  ? -63.453  -19.993 -118.819 1.00 75.61  ? 66   ASN C ND2 1 
ATOM   3746  N  N   . SER C  1 86  ? -62.486  -20.286 -113.728 1.00 67.09  ? 67   SER C N   1 
ATOM   3747  C  CA  . SER C  1 86  ? -61.825  -21.229 -112.828 1.00 75.86  ? 67   SER C CA  1 
ATOM   3748  C  C   . SER C  1 86  ? -61.917  -22.678 -113.293 1.00 82.12  ? 67   SER C C   1 
ATOM   3749  O  O   . SER C  1 86  ? -61.767  -23.601 -112.487 1.00 85.94  ? 67   SER C O   1 
ATOM   3750  C  CB  . SER C  1 86  ? -62.412  -21.130 -111.415 1.00 80.56  ? 67   SER C CB  1 
ATOM   3751  O  OG  . SER C  1 86  ? -63.631  -21.849 -111.310 1.00 82.71  ? 67   SER C OG  1 
ATOM   3752  N  N   . SER C  1 87  ? -62.168  -22.878 -114.582 1.00 83.94  ? 68   SER C N   1 
ATOM   3753  C  CA  . SER C  1 87  ? -62.318  -24.226 -115.131 1.00 83.79  ? 68   SER C CA  1 
ATOM   3754  C  C   . SER C  1 87  ? -61.127  -25.134 -114.783 1.00 80.00  ? 68   SER C C   1 
ATOM   3755  O  O   . SER C  1 87  ? -61.301  -26.205 -114.195 1.00 78.05  ? 68   SER C O   1 
ATOM   3756  C  CB  . SER C  1 87  ? -62.545  -24.170 -116.647 1.00 82.11  ? 68   SER C CB  1 
ATOM   3757  O  OG  . SER C  1 87  ? -61.632  -23.281 -117.262 1.00 82.44  ? 68   SER C OG  1 
ATOM   3758  N  N   . HIS C  1 88  ? -59.922  -24.691 -115.125 1.00 77.52  ? 69   HIS C N   1 
ATOM   3759  C  CA  . HIS C  1 88  ? -58.718  -25.460 -114.835 1.00 77.86  ? 69   HIS C CA  1 
ATOM   3760  C  C   . HIS C  1 88  ? -57.761  -24.584 -114.068 1.00 72.89  ? 69   HIS C C   1 
ATOM   3761  O  O   . HIS C  1 88  ? -56.557  -24.589 -114.313 1.00 75.57  ? 69   HIS C O   1 
ATOM   3762  C  CB  . HIS C  1 88  ? -58.077  -25.973 -116.127 1.00 87.46  ? 69   HIS C CB  1 
ATOM   3763  C  CG  . HIS C  1 88  ? -58.976  -26.868 -116.925 1.00 98.19  ? 69   HIS C CG  1 
ATOM   3764  N  ND1 . HIS C  1 88  ? -59.879  -26.388 -117.851 1.00 102.86 ? 69   HIS C ND1 1 
ATOM   3765  C  CD2 . HIS C  1 88  ? -59.131  -28.215 -116.913 1.00 100.52 ? 69   HIS C CD2 1 
ATOM   3766  C  CE1 . HIS C  1 88  ? -60.542  -27.400 -118.384 1.00 103.93 ? 69   HIS C CE1 1 
ATOM   3767  N  NE2 . HIS C  1 88  ? -60.106  -28.519 -117.831 1.00 103.26 ? 69   HIS C NE2 1 
ATOM   3768  N  N   . SER C  1 89  ? -58.323  -23.831 -113.130 1.00 67.33  ? 70   SER C N   1 
ATOM   3769  C  CA  . SER C  1 89  ? -57.595  -22.828 -112.379 1.00 63.37  ? 70   SER C CA  1 
ATOM   3770  C  C   . SER C  1 89  ? -57.915  -22.979 -110.892 1.00 58.80  ? 70   SER C C   1 
ATOM   3771  O  O   . SER C  1 89  ? -58.881  -23.660 -110.537 1.00 59.55  ? 70   SER C O   1 
ATOM   3772  C  CB  . SER C  1 89  ? -58.014  -21.443 -112.876 1.00 67.06  ? 70   SER C CB  1 
ATOM   3773  O  OG  . SER C  1 89  ? -57.928  -21.374 -114.291 1.00 72.20  ? 70   SER C OG  1 
ATOM   3774  N  N   . PRO C  1 90  ? -57.099  -22.361 -110.015 1.00 52.95  ? 71   PRO C N   1 
ATOM   3775  C  CA  . PRO C  1 90  ? -57.458  -22.245 -108.591 1.00 41.57  ? 71   PRO C CA  1 
ATOM   3776  C  C   . PRO C  1 90  ? -58.797  -21.519 -108.384 1.00 36.49  ? 71   PRO C C   1 
ATOM   3777  O  O   . PRO C  1 90  ? -59.164  -20.638 -109.173 1.00 35.88  ? 71   PRO C O   1 
ATOM   3778  C  CB  . PRO C  1 90  ? -56.325  -21.389 -108.027 1.00 42.79  ? 71   PRO C CB  1 
ATOM   3779  C  CG  . PRO C  1 90  ? -55.152  -21.656 -108.930 1.00 48.22  ? 71   PRO C CG  1 
ATOM   3780  C  CD  . PRO C  1 90  ? -55.745  -21.839 -110.300 1.00 52.65  ? 71   PRO C CD  1 
ATOM   3781  N  N   . ASP C  1 91  ? -59.518  -21.871 -107.326 1.00 33.29  ? 72   ASP C N   1 
ATOM   3782  C  CA  . ASP C  1 91  ? -60.779  -21.199 -107.022 1.00 38.87  ? 72   ASP C CA  1 
ATOM   3783  C  C   . ASP C  1 91  ? -60.553  -19.908 -106.248 1.00 38.89  ? 72   ASP C C   1 
ATOM   3784  O  O   . ASP C  1 91  ? -61.449  -19.049 -106.176 1.00 34.49  ? 72   ASP C O   1 
ATOM   3785  C  CB  . ASP C  1 91  ? -61.678  -22.108 -106.193 1.00 49.78  ? 72   ASP C CB  1 
ATOM   3786  C  CG  . ASP C  1 91  ? -61.629  -23.540 -106.656 1.00 68.05  ? 72   ASP C CG  1 
ATOM   3787  O  OD1 . ASP C  1 91  ? -61.538  -23.755 -107.888 1.00 78.02  ? 72   ASP C OD1 1 
ATOM   3788  O  OD2 . ASP C  1 91  ? -61.665  -24.449 -105.793 1.00 71.80  ? 72   ASP C OD2 1 
ATOM   3789  N  N   . GLN C  1 92  ? -59.348  -19.775 -105.685 1.00 26.00  ? 73   GLN C N   1 
ATOM   3790  C  CA  . GLN C  1 92  ? -59.068  -18.763 -104.672 1.00 26.78  ? 73   GLN C CA  1 
ATOM   3791  C  C   . GLN C  1 92  ? -57.593  -18.434 -104.612 1.00 28.51  ? 73   GLN C C   1 
ATOM   3792  O  O   . GLN C  1 92  ? -56.741  -19.329 -104.718 1.00 29.97  ? 73   GLN C O   1 
ATOM   3793  C  CB  . GLN C  1 92  ? -59.505  -19.287 -103.307 1.00 32.36  ? 73   GLN C CB  1 
ATOM   3794  C  CG  . GLN C  1 92  ? -59.365  -18.306 -102.180 1.00 38.95  ? 73   GLN C CG  1 
ATOM   3795  C  CD  . GLN C  1 92  ? -59.689  -18.933 -100.855 1.00 43.46  ? 73   GLN C CD  1 
ATOM   3796  O  OE1 . GLN C  1 92  ? -58.831  -19.566 -100.237 1.00 51.89  ? 73   GLN C OE1 1 
ATOM   3797  N  NE2 . GLN C  1 92  ? -60.934  -18.781 -100.413 1.00 44.43  ? 73   GLN C NE2 1 
ATOM   3798  N  N   . VAL C  1 93  ? -57.287  -17.152 -104.431 1.00 23.74  ? 74   VAL C N   1 
ATOM   3799  C  CA  . VAL C  1 93  ? -55.906  -16.730 -104.207 1.00 18.97  ? 74   VAL C CA  1 
ATOM   3800  C  C   . VAL C  1 93  ? -55.825  -15.758 -103.044 1.00 19.79  ? 74   VAL C C   1 
ATOM   3801  O  O   . VAL C  1 93  ? -56.847  -15.182 -102.625 1.00 11.66  ? 74   VAL C O   1 
ATOM   3802  C  CB  . VAL C  1 93  ? -55.295  -16.051 -105.452 1.00 14.57  ? 74   VAL C CB  1 
ATOM   3803  C  CG1 . VAL C  1 93  ? -55.062  -17.073 -106.542 1.00 14.16  ? 74   VAL C CG1 1 
ATOM   3804  C  CG2 . VAL C  1 93  ? -56.200  -14.880 -105.933 1.00 20.10  ? 74   VAL C CG2 1 
ATOM   3805  N  N   . SER C  1 94  ? -54.608  -15.556 -102.544 1.00 17.32  ? 75   SER C N   1 
ATOM   3806  C  CA  . SER C  1 94  ? -54.400  -14.590 -101.482 1.00 16.46  ? 75   SER C CA  1 
ATOM   3807  C  C   . SER C  1 94  ? -53.703  -13.408 -102.085 1.00 20.25  ? 75   SER C C   1 
ATOM   3808  O  O   . SER C  1 94  ? -52.689  -13.564 -102.763 1.00 27.61  ? 75   SER C O   1 
ATOM   3809  C  CB  . SER C  1 94  ? -53.561  -15.187 -100.349 1.00 7.19   ? 75   SER C CB  1 
ATOM   3810  O  OG  . SER C  1 94  ? -54.298  -16.164 -99.673  1.00 25.17  ? 75   SER C OG  1 
ATOM   3811  N  N   . VAL C  1 95  ? -54.233  -12.220 -101.820 1.00 22.39  ? 76   VAL C N   1 
ATOM   3812  C  CA  . VAL C  1 95  ? -53.744  -11.009 -102.490 1.00 25.37  ? 76   VAL C CA  1 
ATOM   3813  C  C   . VAL C  1 95  ? -53.483  -9.925  -101.479 1.00 20.50  ? 76   VAL C C   1 
ATOM   3814  O  O   . VAL C  1 95  ? -54.325  -9.678  -100.622 1.00 18.47  ? 76   VAL C O   1 
ATOM   3815  C  CB  . VAL C  1 95  ? -54.782  -10.466 -103.490 1.00 24.22  ? 76   VAL C CB  1 
ATOM   3816  C  CG1 . VAL C  1 95  ? -54.240  -9.249  -104.220 1.00 30.10  ? 76   VAL C CG1 1 
ATOM   3817  C  CG2 . VAL C  1 95  ? -55.214  -11.557 -104.453 1.00 14.13  ? 76   VAL C CG2 1 
ATOM   3818  N  N   . PRO C  1 96  ? -52.316  -9.273  -101.583 1.00 23.39  ? 77   PRO C N   1 
ATOM   3819  C  CA  . PRO C  1 96  ? -52.028  -8.105  -100.738 1.00 22.70  ? 77   PRO C CA  1 
ATOM   3820  C  C   . PRO C  1 96  ? -53.134  -7.054  -100.907 1.00 26.52  ? 77   PRO C C   1 
ATOM   3821  O  O   . PRO C  1 96  ? -53.475  -6.703  -102.047 1.00 21.00  ? 77   PRO C O   1 
ATOM   3822  C  CB  . PRO C  1 96  ? -50.701  -7.574  -101.317 1.00 10.68  ? 77   PRO C CB  1 
ATOM   3823  C  CG  . PRO C  1 96  ? -50.084  -8.749  -101.985 1.00 10.97  ? 77   PRO C CG  1 
ATOM   3824  C  CD  . PRO C  1 96  ? -51.224  -9.555  -102.540 1.00 15.96  ? 77   PRO C CD  1 
ATOM   3825  N  N   . ILE C  1 97  ? -53.685  -6.551  -99.800  1.00 30.27  ? 78   ILE C N   1 
ATOM   3826  C  CA  . ILE C  1 97  ? -54.766  -5.559  -99.903  1.00 32.61  ? 78   ILE C CA  1 
ATOM   3827  C  C   . ILE C  1 97  ? -54.342  -4.254  -100.616 1.00 30.74  ? 78   ILE C C   1 
ATOM   3828  O  O   . ILE C  1 97  ? -55.184  -3.508  -101.118 1.00 29.87  ? 78   ILE C O   1 
ATOM   3829  C  CB  . ILE C  1 97  ? -55.406  -5.210  -98.555  1.00 24.42  ? 78   ILE C CB  1 
ATOM   3830  C  CG1 . ILE C  1 97  ? -54.368  -4.567  -97.622  1.00 27.70  ? 78   ILE C CG1 1 
ATOM   3831  C  CG2 . ILE C  1 97  ? -56.081  -6.420  -97.950  1.00 17.77  ? 78   ILE C CG2 1 
ATOM   3832  C  CD1 . ILE C  1 97  ? -54.982  -3.798  -96.501  1.00 7.40   ? 78   ILE C CD1 1 
ATOM   3833  N  N   . SER C  1 98  ? -53.043  -3.976  -100.648 1.00 21.54  ? 79   SER C N   1 
ATOM   3834  C  CA  . SER C  1 98  ? -52.545  -2.828  -101.400 1.00 17.85  ? 79   SER C CA  1 
ATOM   3835  C  C   . SER C  1 98  ? -52.800  -2.958  -102.902 1.00 28.85  ? 79   SER C C   1 
ATOM   3836  O  O   . SER C  1 98  ? -52.794  -1.949  -103.620 1.00 30.93  ? 79   SER C O   1 
ATOM   3837  C  CB  . SER C  1 98  ? -51.061  -2.591  -101.138 1.00 19.84  ? 79   SER C CB  1 
ATOM   3838  O  OG  . SER C  1 98  ? -50.298  -3.754  -101.371 1.00 32.04  ? 79   SER C OG  1 
ATOM   3839  N  N   . SER C  1 99  ? -53.042  -4.186  -103.369 1.00 31.99  ? 80   SER C N   1 
ATOM   3840  C  CA  . SER C  1 99  ? -53.390  -4.440  -104.781 1.00 29.29  ? 80   SER C CA  1 
ATOM   3841  C  C   . SER C  1 99  ? -54.894  -4.587  -105.014 1.00 29.76  ? 80   SER C C   1 
ATOM   3842  O  O   . SER C  1 99  ? -55.314  -4.985  -106.087 1.00 31.51  ? 80   SER C O   1 
ATOM   3843  C  CB  . SER C  1 99  ? -52.704  -5.709  -105.295 1.00 33.64  ? 80   SER C CB  1 
ATOM   3844  O  OG  . SER C  1 99  ? -51.294  -5.599  -105.207 1.00 42.38  ? 80   SER C OG  1 
ATOM   3845  N  N   . LEU C  1 100 ? -55.708  -4.302  -104.007 1.00 34.29  ? 81   LEU C N   1 
ATOM   3846  C  CA  . LEU C  1 100 ? -57.154  -4.448  -104.156 1.00 35.69  ? 81   LEU C CA  1 
ATOM   3847  C  C   . LEU C  1 100 ? -57.844  -3.205  -103.689 1.00 34.49  ? 81   LEU C C   1 
ATOM   3848  O  O   . LEU C  1 100 ? -57.317  -2.483  -102.847 1.00 40.83  ? 81   LEU C O   1 
ATOM   3849  C  CB  . LEU C  1 100 ? -57.677  -5.578  -103.281 1.00 38.08  ? 81   LEU C CB  1 
ATOM   3850  C  CG  . LEU C  1 100 ? -57.258  -6.983  -103.655 1.00 41.01  ? 81   LEU C CG  1 
ATOM   3851  C  CD1 . LEU C  1 100 ? -57.816  -7.919  -102.624 1.00 39.36  ? 81   LEU C CD1 1 
ATOM   3852  C  CD2 . LEU C  1 100 ? -57.781  -7.316  -105.024 1.00 40.48  ? 81   LEU C CD2 1 
ATOM   3853  N  N   . TRP C  1 101 ? -59.035  -2.954  -104.210 1.00 32.01  ? 82   TRP C N   1 
ATOM   3854  C  CA  . TRP C  1 101 ? -59.882  -1.974  -103.567 1.00 30.18  ? 82   TRP C CA  1 
ATOM   3855  C  C   . TRP C  1 101 ? -60.424  -2.574  -102.267 1.00 28.15  ? 82   TRP C C   1 
ATOM   3856  O  O   . TRP C  1 101 ? -60.802  -3.740  -102.203 1.00 16.42  ? 82   TRP C O   1 
ATOM   3857  C  CB  . TRP C  1 101 ? -61.017  -1.537  -104.458 1.00 20.26  ? 82   TRP C CB  1 
ATOM   3858  C  CG  . TRP C  1 101 ? -61.957  -0.604  -103.762 1.00 21.45  ? 82   TRP C CG  1 
ATOM   3859  C  CD1 . TRP C  1 101 ? -61.909  0.752   -103.772 1.00 26.79  ? 82   TRP C CD1 1 
ATOM   3860  C  CD2 . TRP C  1 101 ? -63.110  -0.965  -102.961 1.00 17.84  ? 82   TRP C CD2 1 
ATOM   3861  N  NE1 . TRP C  1 101 ? -62.963  1.263   -103.047 1.00 23.31  ? 82   TRP C NE1 1 
ATOM   3862  C  CE2 . TRP C  1 101 ? -63.696  0.251   -102.556 1.00 19.02  ? 82   TRP C CE2 1 
ATOM   3863  C  CE3 . TRP C  1 101 ? -63.678  -2.175  -102.589 1.00 23.26  ? 82   TRP C CE3 1 
ATOM   3864  C  CZ2 . TRP C  1 101 ? -64.854  0.256   -101.756 1.00 20.21  ? 82   TRP C CZ2 1 
ATOM   3865  C  CZ3 . TRP C  1 101 ? -64.831  -2.154  -101.819 1.00 17.09  ? 82   TRP C CZ3 1 
ATOM   3866  C  CH2 . TRP C  1 101 ? -65.400  -0.946  -101.404 1.00 19.67  ? 82   TRP C CH2 1 
ATOM   3867  N  N   . VAL C  1 102 ? -60.450  -1.754  -101.232 1.00 35.01  ? 83   VAL C N   1 
ATOM   3868  C  CA  . VAL C  1 102 ? -60.903  -2.194  -99.917  1.00 37.73  ? 83   VAL C CA  1 
ATOM   3869  C  C   . VAL C  1 102 ? -61.894  -1.159  -99.360  1.00 30.21  ? 83   VAL C C   1 
ATOM   3870  O  O   . VAL C  1 102 ? -61.672  0.048   -99.496  1.00 32.20  ? 83   VAL C O   1 
ATOM   3871  C  CB  . VAL C  1 102 ? -59.693  -2.385  -98.964  1.00 36.63  ? 83   VAL C CB  1 
ATOM   3872  C  CG1 . VAL C  1 102 ? -60.134  -2.325  -97.546  1.00 42.88  ? 83   VAL C CG1 1 
ATOM   3873  C  CG2 . VAL C  1 102 ? -58.982  -3.716  -99.254  1.00 33.07  ? 83   VAL C CG2 1 
ATOM   3874  N  N   . PRO C  1 103 ? -63.008  -1.613  -98.782  1.00 23.99  ? 84   PRO C N   1 
ATOM   3875  C  CA  . PRO C  1 103 ? -63.954  -0.642  -98.194  1.00 29.68  ? 84   PRO C CA  1 
ATOM   3876  C  C   . PRO C  1 103 ? -63.265  0.265   -97.097  1.00 39.51  ? 84   PRO C C   1 
ATOM   3877  O  O   . PRO C  1 103 ? -62.523  -0.331  -96.315  1.00 37.08  ? 84   PRO C O   1 
ATOM   3878  C  CB  . PRO C  1 103 ? -65.058  -1.554  -97.595  1.00 27.33  ? 84   PRO C CB  1 
ATOM   3879  C  CG  . PRO C  1 103 ? -64.506  -2.999  -97.625  1.00 26.08  ? 84   PRO C CG  1 
ATOM   3880  C  CD  . PRO C  1 103 ? -63.474  -3.016  -98.716  1.00 29.89  ? 84   PRO C CD  1 
ATOM   3881  N  N   . ASP C  1 104 ? -63.482  1.594   -97.080  1.00 34.61  ? 85   ASP C N   1 
ATOM   3882  C  CA  . ASP C  1 104 ? -63.005  2.468   -96.019  1.00 34.21  ? 85   ASP C CA  1 
ATOM   3883  C  C   . ASP C  1 104 ? -63.664  2.401   -94.692  1.00 32.64  ? 85   ASP C C   1 
ATOM   3884  O  O   . ASP C  1 104 ? -64.094  3.445   -94.198  1.00 31.62  ? 85   ASP C O   1 
ATOM   3885  C  CB  . ASP C  1 104 ? -63.047  3.923   -96.410  1.00 34.67  ? 85   ASP C CB  1 
ATOM   3886  C  CG  . ASP C  1 104 ? -64.299  4.347   -97.020  1.00 35.00  ? 85   ASP C CG  1 
ATOM   3887  O  OD1 . ASP C  1 104 ? -65.193  3.567   -97.459  1.00 37.69  ? 85   ASP C OD1 1 
ATOM   3888  O  OD2 . ASP C  1 104 ? -64.368  5.588   -97.027  1.00 28.82  ? 85   ASP C OD2 1 
ATOM   3889  N  N   . LEU C  1 105 ? -63.778  1.207   -94.125  1.00 31.38  ? 86   LEU C N   1 
ATOM   3890  C  CA  . LEU C  1 105 ? -64.494  1.062   -92.877  1.00 27.70  ? 86   LEU C CA  1 
ATOM   3891  C  C   . LEU C  1 105 ? -63.730  1.758   -91.764  1.00 21.15  ? 86   LEU C C   1 
ATOM   3892  O  O   . LEU C  1 105 ? -62.504  1.767   -91.748  1.00 22.55  ? 86   LEU C O   1 
ATOM   3893  C  CB  . LEU C  1 105 ? -64.704  -0.400  -92.552  1.00 22.13  ? 86   LEU C CB  1 
ATOM   3894  C  CG  . LEU C  1 105 ? -65.569  -1.154  -93.567  1.00 18.95  ? 86   LEU C CG  1 
ATOM   3895  C  CD1 . LEU C  1 105 ? -65.831  -2.622  -93.127  1.00 16.60  ? 86   LEU C CD1 1 
ATOM   3896  C  CD2 . LEU C  1 105 ? -66.887  -0.412  -93.852  1.00 14.01  ? 86   LEU C CD2 1 
ATOM   3897  N  N   . ALA C  1 106 ? -64.465  2.389   -90.860  1.00 16.98  ? 87   ALA C N   1 
ATOM   3898  C  CA  . ALA C  1 106 ? -63.858  2.945   -89.637  1.00 27.49  ? 87   ALA C CA  1 
ATOM   3899  C  C   . ALA C  1 106 ? -64.754  2.724   -88.421  1.00 20.56  ? 87   ALA C C   1 
ATOM   3900  O  O   . ALA C  1 106 ? -65.993  2.775   -88.526  1.00 16.97  ? 87   ALA C O   1 
ATOM   3901  C  CB  . ALA C  1 106 ? -63.553  4.427   -89.819  1.00 30.19  ? 87   ALA C CB  1 
ATOM   3902  N  N   . ALA C  1 107 ? -64.135  2.487   -87.273  1.00 23.26  ? 88   ALA C N   1 
ATOM   3903  C  CA  . ALA C  1 107 ? -64.894  2.462   -85.999  1.00 21.59  ? 88   ALA C CA  1 
ATOM   3904  C  C   . ALA C  1 107 ? -65.062  3.886   -85.479  1.00 18.70  ? 88   ALA C C   1 
ATOM   3905  O  O   . ALA C  1 107 ? -64.080  4.557   -85.136  1.00 19.06  ? 88   ALA C O   1 
ATOM   3906  C  CB  . ALA C  1 107 ? -64.207  1.581   -84.961  1.00 13.52  ? 88   ALA C CB  1 
ATOM   3907  N  N   . TYR C  1 108 ? -66.308  4.350   -85.434  1.00 25.18  ? 89   TYR C N   1 
ATOM   3908  C  CA  . TYR C  1 108 ? -66.612  5.743   -85.076  1.00 26.14  ? 89   TYR C CA  1 
ATOM   3909  C  C   . TYR C  1 108 ? -66.194  6.094   -83.648  1.00 30.07  ? 89   TYR C C   1 
ATOM   3910  O  O   . TYR C  1 108 ? -65.795  7.228   -83.361  1.00 35.88  ? 89   TYR C O   1 
ATOM   3911  C  CB  . TYR C  1 108 ? -68.102  6.036   -85.272  1.00 23.76  ? 89   TYR C CB  1 
ATOM   3912  C  CG  . TYR C  1 108 ? -68.464  6.296   -86.716  1.00 29.31  ? 89   TYR C CG  1 
ATOM   3913  C  CD1 . TYR C  1 108 ? -68.455  5.259   -87.651  1.00 30.41  ? 89   TYR C CD1 1 
ATOM   3914  C  CD2 . TYR C  1 108 ? -68.801  7.573   -87.153  1.00 31.87  ? 89   TYR C CD2 1 
ATOM   3915  C  CE1 . TYR C  1 108 ? -68.774  5.481   -88.974  1.00 30.34  ? 89   TYR C CE1 1 
ATOM   3916  C  CE2 . TYR C  1 108 ? -69.131  7.807   -88.478  1.00 31.00  ? 89   TYR C CE2 1 
ATOM   3917  C  CZ  . TYR C  1 108 ? -69.118  6.756   -89.384  1.00 32.44  ? 89   TYR C CZ  1 
ATOM   3918  O  OH  . TYR C  1 108 ? -69.440  6.977   -90.705  1.00 36.51  ? 89   TYR C OH  1 
ATOM   3919  N  N   . ASN C  1 109 ? -66.278  5.116   -82.754  1.00 24.59  ? 90   ASN C N   1 
ATOM   3920  C  CA  . ASN C  1 109 ? -65.966  5.362   -81.350  1.00 23.87  ? 90   ASN C CA  1 
ATOM   3921  C  C   . ASN C  1 109 ? -64.602  4.799   -80.948  1.00 30.80  ? 90   ASN C C   1 
ATOM   3922  O  O   . ASN C  1 109 ? -64.292  4.655   -79.760  1.00 32.05  ? 90   ASN C O   1 
ATOM   3923  C  CB  . ASN C  1 109 ? -67.084  4.837   -80.447  1.00 16.41  ? 90   ASN C CB  1 
ATOM   3924  C  CG  . ASN C  1 109 ? -67.389  3.379   -80.686  1.00 30.31  ? 90   ASN C CG  1 
ATOM   3925  O  OD1 . ASN C  1 109 ? -67.428  2.914   -81.826  1.00 35.23  ? 90   ASN C OD1 1 
ATOM   3926  N  ND2 . ASN C  1 109 ? -67.596  2.638   -79.605  1.00 39.89  ? 90   ASN C ND2 1 
ATOM   3927  N  N   . ALA C  1 110 ? -63.786  4.481   -81.949  1.00 28.48  ? 91   ALA C N   1 
ATOM   3928  C  CA  . ALA C  1 110 ? -62.395  4.134   -81.685  1.00 23.66  ? 91   ALA C CA  1 
ATOM   3929  C  C   . ALA C  1 110 ? -61.634  5.378   -81.193  1.00 28.59  ? 91   ALA C C   1 
ATOM   3930  O  O   . ALA C  1 110 ? -61.872  6.500   -81.654  1.00 29.97  ? 91   ALA C O   1 
ATOM   3931  C  CB  . ALA C  1 110 ? -61.739  3.562   -82.933  1.00 15.97  ? 91   ALA C CB  1 
ATOM   3932  N  N   . ILE C  1 111 ? -60.713  5.182   -80.255  1.00 30.70  ? 92   ILE C N   1 
ATOM   3933  C  CA  . ILE C  1 111 ? -59.891  6.288   -79.780  1.00 29.29  ? 92   ILE C CA  1 
ATOM   3934  C  C   . ILE C  1 111 ? -58.415  5.982   -79.932  1.00 32.82  ? 92   ILE C C   1 
ATOM   3935  O  O   . ILE C  1 111 ? -57.570  6.730   -79.457  1.00 33.83  ? 92   ILE C O   1 
ATOM   3936  C  CB  . ILE C  1 111 ? -60.179  6.631   -78.319  1.00 29.36  ? 92   ILE C CB  1 
ATOM   3937  C  CG1 . ILE C  1 111 ? -59.886  5.433   -77.436  1.00 34.51  ? 92   ILE C CG1 1 
ATOM   3938  C  CG2 . ILE C  1 111 ? -61.618  7.046   -78.142  1.00 27.74  ? 92   ILE C CG2 1 
ATOM   3939  C  CD1 . ILE C  1 111 ? -60.152  5.682   -75.969  1.00 36.18  ? 92   ILE C CD1 1 
ATOM   3940  N  N   . SER C  1 112 ? -58.104  4.872   -80.593  1.00 34.92  ? 93   SER C N   1 
ATOM   3941  C  CA  . SER C  1 112 ? -56.747  4.630   -81.083  1.00 24.86  ? 93   SER C CA  1 
ATOM   3942  C  C   . SER C  1 112 ? -56.876  4.212   -82.529  1.00 18.87  ? 93   SER C C   1 
ATOM   3943  O  O   . SER C  1 112 ? -57.938  3.736   -82.944  1.00 17.85  ? 93   SER C O   1 
ATOM   3944  C  CB  . SER C  1 112 ? -56.078  3.526   -80.268  1.00 24.56  ? 93   SER C CB  1 
ATOM   3945  O  OG  . SER C  1 112 ? -56.700  2.270   -80.481  1.00 26.72  ? 93   SER C OG  1 
ATOM   3946  N  N   . LYS C  1 113 ? -55.813  4.371   -83.306  1.00 26.04  ? 94   LYS C N   1 
ATOM   3947  C  CA  . LYS C  1 113 ? -55.854  3.848   -84.674  1.00 37.91  ? 94   LYS C CA  1 
ATOM   3948  C  C   . LYS C  1 113 ? -55.734  2.323   -84.640  1.00 43.31  ? 94   LYS C C   1 
ATOM   3949  O  O   . LYS C  1 113 ? -55.028  1.779   -83.794  1.00 52.82  ? 94   LYS C O   1 
ATOM   3950  C  CB  . LYS C  1 113 ? -54.786  4.498   -85.563  1.00 41.45  ? 94   LYS C CB  1 
ATOM   3951  C  CG  . LYS C  1 113 ? -53.357  4.271   -85.135  1.00 43.23  ? 94   LYS C CG  1 
ATOM   3952  C  CD  . LYS C  1 113 ? -52.431  5.076   -86.025  1.00 51.92  ? 94   LYS C CD  1 
ATOM   3953  C  CE  . LYS C  1 113 ? -52.636  4.737   -87.523  1.00 55.71  ? 94   LYS C CE  1 
ATOM   3954  N  NZ  . LYS C  1 113 ? -51.947  5.684   -88.467  1.00 51.04  ? 94   LYS C NZ  1 
ATOM   3955  N  N   . PRO C  1 114 ? -56.439  1.621   -85.542  1.00 36.91  ? 95   PRO C N   1 
ATOM   3956  C  CA  . PRO C  1 114 ? -56.409  0.153   -85.496  1.00 37.02  ? 95   PRO C CA  1 
ATOM   3957  C  C   . PRO C  1 114 ? -54.990  -0.415  -85.658  1.00 43.93  ? 95   PRO C C   1 
ATOM   3958  O  O   . PRO C  1 114 ? -54.293  -0.088  -86.628  1.00 58.67  ? 95   PRO C O   1 
ATOM   3959  C  CB  . PRO C  1 114 ? -57.293  -0.258  -86.687  1.00 30.40  ? 95   PRO C CB  1 
ATOM   3960  C  CG  . PRO C  1 114 ? -57.309  0.922   -87.580  1.00 30.29  ? 95   PRO C CG  1 
ATOM   3961  C  CD  . PRO C  1 114 ? -57.229  2.121   -86.677  1.00 33.49  ? 95   PRO C CD  1 
ATOM   3962  N  N   . GLU C  1 115 ? -54.569  -1.241  -84.703  1.00 32.67  ? 96   GLU C N   1 
ATOM   3963  C  CA  . GLU C  1 115 ? -53.321  -1.995  -84.825  1.00 31.60  ? 96   GLU C CA  1 
ATOM   3964  C  C   . GLU C  1 115 ? -53.616  -3.339  -85.511  1.00 29.47  ? 96   GLU C C   1 
ATOM   3965  O  O   . GLU C  1 115 ? -54.278  -4.221  -84.918  1.00 27.18  ? 96   GLU C O   1 
ATOM   3966  C  CB  . GLU C  1 115 ? -52.711  -2.220  -83.449  1.00 36.63  ? 96   GLU C CB  1 
ATOM   3967  C  CG  . GLU C  1 115 ? -51.308  -2.806  -83.425  1.00 50.92  ? 96   GLU C CG  1 
ATOM   3968  C  CD  . GLU C  1 115 ? -50.783  -3.009  -81.991  1.00 68.79  ? 96   GLU C CD  1 
ATOM   3969  O  OE1 . GLU C  1 115 ? -51.513  -2.641  -81.024  1.00 78.97  ? 96   GLU C OE1 1 
ATOM   3970  O  OE2 . GLU C  1 115 ? -49.646  -3.533  -81.833  1.00 67.15  ? 96   GLU C OE2 1 
ATOM   3971  N  N   . VAL C  1 116 ? -53.171  -3.478  -86.770  1.00 28.55  ? 97   VAL C N   1 
ATOM   3972  C  CA  . VAL C  1 116 ? -53.381  -4.719  -87.533  1.00 26.05  ? 97   VAL C CA  1 
ATOM   3973  C  C   . VAL C  1 116 ? -52.299  -5.712  -87.172  1.00 28.63  ? 97   VAL C C   1 
ATOM   3974  O  O   . VAL C  1 116 ? -51.120  -5.455  -87.384  1.00 33.94  ? 97   VAL C O   1 
ATOM   3975  C  CB  . VAL C  1 116 ? -53.398  -4.474  -89.055  1.00 18.53  ? 97   VAL C CB  1 
ATOM   3976  C  CG1 . VAL C  1 116 ? -53.612  -5.773  -89.819  1.00 21.98  ? 97   VAL C CG1 1 
ATOM   3977  C  CG2 . VAL C  1 116 ? -54.482  -3.492  -89.387  1.00 9.52   ? 97   VAL C CG2 1 
ATOM   3978  N  N   . LEU C  1 117 ? -52.705  -6.844  -86.611  1.00 23.59  ? 98   LEU C N   1 
ATOM   3979  C  CA  . LEU C  1 117 ? -51.755  -7.763  -86.008  1.00 17.48  ? 98   LEU C CA  1 
ATOM   3980  C  C   . LEU C  1 117 ? -51.296  -8.807  -87.034  1.00 27.52  ? 98   LEU C C   1 
ATOM   3981  O  O   . LEU C  1 117 ? -50.271  -9.469  -86.872  1.00 34.86  ? 98   LEU C O   1 
ATOM   3982  C  CB  . LEU C  1 117 ? -52.406  -8.440  -84.792  1.00 15.25  ? 98   LEU C CB  1 
ATOM   3983  C  CG  . LEU C  1 117 ? -52.963  -7.585  -83.634  1.00 12.64  ? 98   LEU C CG  1 
ATOM   3984  C  CD1 . LEU C  1 117 ? -53.620  -8.474  -82.582  1.00 14.58  ? 98   LEU C CD1 1 
ATOM   3985  C  CD2 . LEU C  1 117 ? -51.890  -6.754  -82.989  1.00 7.79   ? 98   LEU C CD2 1 
ATOM   3986  N  N   . THR C  1 118 ? -52.077  -8.956  -88.092  1.00 26.97  ? 99   THR C N   1 
ATOM   3987  C  CA  . THR C  1 118 ? -51.907  -10.072 -89.013  1.00 26.16  ? 99   THR C CA  1 
ATOM   3988  C  C   . THR C  1 118 ? -51.432  -9.616  -90.407  1.00 25.40  ? 99   THR C C   1 
ATOM   3989  O  O   . THR C  1 118 ? -51.562  -8.426  -90.769  1.00 19.67  ? 99   THR C O   1 
ATOM   3990  C  CB  . THR C  1 118 ? -53.220  -10.842 -89.104  1.00 26.80  ? 99   THR C CB  1 
ATOM   3991  O  OG1 . THR C  1 118 ? -54.291  -9.901  -89.249  1.00 28.85  ? 99   THR C OG1 1 
ATOM   3992  C  CG2 . THR C  1 118 ? -53.421  -11.653 -87.830  1.00 27.13  ? 99   THR C CG2 1 
ATOM   3993  N  N   . PRO C  1 119 ? -50.845  -10.550 -91.182  1.00 24.41  ? 100  PRO C N   1 
ATOM   3994  C  CA  . PRO C  1 119 ? -50.467  -10.251 -92.584  1.00 22.59  ? 100  PRO C CA  1 
ATOM   3995  C  C   . PRO C  1 119 ? -51.641  -9.665  -93.370  1.00 19.66  ? 100  PRO C C   1 
ATOM   3996  O  O   . PRO C  1 119 ? -52.762  -10.177 -93.303  1.00 20.30  ? 100  PRO C O   1 
ATOM   3997  C  CB  . PRO C  1 119 ? -50.101  -11.620 -93.153  1.00 20.04  ? 100  PRO C CB  1 
ATOM   3998  C  CG  . PRO C  1 119 ? -49.576  -12.384 -91.916  1.00 24.84  ? 100  PRO C CG  1 
ATOM   3999  C  CD  . PRO C  1 119 ? -50.416  -11.899 -90.748  1.00 16.80  ? 100  PRO C CD  1 
ATOM   4000  N  N   . GLN C  1 120 ? -51.398  -8.578  -94.089  1.00 16.44  ? 101  GLN C N   1 
ATOM   4001  C  CA  . GLN C  1 120 ? -52.493  -7.859  -94.710  1.00 20.21  ? 101  GLN C CA  1 
ATOM   4002  C  C   . GLN C  1 120 ? -52.821  -8.416  -96.095  1.00 27.79  ? 101  GLN C C   1 
ATOM   4003  O  O   . GLN C  1 120 ? -52.554  -7.788  -97.125  1.00 28.74  ? 101  GLN C O   1 
ATOM   4004  C  CB  . GLN C  1 120 ? -52.184  -6.360  -94.733  1.00 16.18  ? 101  GLN C CB  1 
ATOM   4005  C  CG  . GLN C  1 120 ? -52.014  -5.829  -93.341  1.00 19.71  ? 101  GLN C CG  1 
ATOM   4006  C  CD  . GLN C  1 120 ? -51.848  -4.324  -93.250  1.00 27.44  ? 101  GLN C CD  1 
ATOM   4007  O  OE1 . GLN C  1 120 ? -52.406  -3.575  -94.054  1.00 38.11  ? 101  GLN C OE1 1 
ATOM   4008  N  NE2 . GLN C  1 120 ? -51.094  -3.868  -92.241  1.00 21.97  ? 101  GLN C NE2 1 
ATOM   4009  N  N   . LEU C  1 121 ? -53.413  -9.609  -96.084  1.00 29.15  ? 102  LEU C N   1 
ATOM   4010  C  CA  . LEU C  1 121 ? -53.760  -10.356 -97.282  1.00 20.61  ? 102  LEU C CA  1 
ATOM   4011  C  C   . LEU C  1 121 ? -55.260  -10.603 -97.307  1.00 19.38  ? 102  LEU C C   1 
ATOM   4012  O  O   . LEU C  1 121 ? -55.874  -10.854 -96.261  1.00 24.28  ? 102  LEU C O   1 
ATOM   4013  C  CB  . LEU C  1 121 ? -53.014  -11.698 -97.282  1.00 16.76  ? 102  LEU C CB  1 
ATOM   4014  C  CG  . LEU C  1 121 ? -51.484  -11.637 -97.385  1.00 19.34  ? 102  LEU C CG  1 
ATOM   4015  C  CD1 . LEU C  1 121 ? -50.901  -13.031 -97.373  1.00 23.18  ? 102  LEU C CD1 1 
ATOM   4016  C  CD2 . LEU C  1 121 ? -51.053  -10.930 -98.655  1.00 22.86  ? 102  LEU C CD2 1 
ATOM   4017  N  N   . ALA C  1 122 ? -55.847  -10.543 -98.496  1.00 10.39  ? 103  ALA C N   1 
ATOM   4018  C  CA  . ALA C  1 122 ? -57.251  -10.893 -98.662  1.00 16.60  ? 103  ALA C CA  1 
ATOM   4019  C  C   . ALA C  1 122 ? -57.401  -12.154 -99.527  1.00 20.37  ? 103  ALA C C   1 
ATOM   4020  O  O   . ALA C  1 122 ? -56.479  -12.531 -100.244 1.00 20.64  ? 103  ALA C O   1 
ATOM   4021  C  CB  . ALA C  1 122 ? -58.005  -9.730  -99.284  1.00 20.29  ? 103  ALA C CB  1 
ATOM   4022  N  N   . HIS C  1 123 ? -58.559  -12.798 -99.434  1.00 20.57  ? 104  HIS C N   1 
ATOM   4023  C  CA  . HIS C  1 123 ? -58.930  -13.902 -100.286 1.00 18.39  ? 104  HIS C CA  1 
ATOM   4024  C  C   . HIS C  1 123 ? -59.711  -13.334 -101.457 1.00 24.69  ? 104  HIS C C   1 
ATOM   4025  O  O   . HIS C  1 123 ? -60.630  -12.530 -101.282 1.00 31.99  ? 104  HIS C O   1 
ATOM   4026  C  CB  . HIS C  1 123 ? -59.843  -14.848 -99.520  1.00 24.13  ? 104  HIS C CB  1 
ATOM   4027  C  CG  . HIS C  1 123 ? -59.117  -15.869 -98.696  1.00 28.20  ? 104  HIS C CG  1 
ATOM   4028  N  ND1 . HIS C  1 123 ? -57.765  -16.110 -98.829  1.00 32.39  ? 104  HIS C ND1 1 
ATOM   4029  C  CD2 . HIS C  1 123 ? -59.565  -16.714 -97.733  1.00 23.69  ? 104  HIS C CD2 1 
ATOM   4030  C  CE1 . HIS C  1 123 ? -57.412  -17.062 -97.978  1.00 30.73  ? 104  HIS C CE1 1 
ATOM   4031  N  NE2 . HIS C  1 123 ? -58.479  -17.443 -97.297  1.00 23.44  ? 104  HIS C NE2 1 
ATOM   4032  N  N   . VAL C  1 124 ? -59.342  -13.735 -102.660 1.00 27.19  ? 105  VAL C N   1 
ATOM   4033  C  CA  . VAL C  1 124 ? -60.170  -13.415 -103.812 1.00 27.59  ? 105  VAL C CA  1 
ATOM   4034  C  C   . VAL C  1 124 ? -60.605  -14.745 -104.412 1.00 27.15  ? 105  VAL C C   1 
ATOM   4035  O  O   . VAL C  1 124 ? -59.777  -15.616 -104.715 1.00 31.38  ? 105  VAL C O   1 
ATOM   4036  C  CB  . VAL C  1 124 ? -59.445  -12.541 -104.863 1.00 24.18  ? 105  VAL C CB  1 
ATOM   4037  C  CG1 . VAL C  1 124 ? -60.395  -12.220 -106.004 1.00 23.10  ? 105  VAL C CG1 1 
ATOM   4038  C  CG2 . VAL C  1 124 ? -58.900  -11.263 -104.240 1.00 21.81  ? 105  VAL C CG2 1 
ATOM   4039  N  N   . VAL C  1 125 ? -61.910  -14.919 -104.530 1.00 26.63  ? 106  VAL C N   1 
ATOM   4040  C  CA  . VAL C  1 125 ? -62.461  -16.135 -105.115 1.00 38.51  ? 106  VAL C CA  1 
ATOM   4041  C  C   . VAL C  1 125 ? -62.752  -15.895 -106.601 1.00 37.75  ? 106  VAL C C   1 
ATOM   4042  O  O   . VAL C  1 125 ? -63.022  -14.759 -107.006 1.00 31.37  ? 106  VAL C O   1 
ATOM   4043  C  CB  . VAL C  1 125 ? -63.739  -16.568 -104.375 1.00 43.70  ? 106  VAL C CB  1 
ATOM   4044  C  CG1 . VAL C  1 125 ? -64.218  -17.941 -104.867 1.00 41.37  ? 106  VAL C CG1 1 
ATOM   4045  C  CG2 . VAL C  1 125 ? -63.496  -16.582 -102.870 1.00 45.08  ? 106  VAL C CG2 1 
ATOM   4046  N  N   . SER C  1 126 ? -62.686  -16.954 -107.402 1.00 38.60  ? 107  SER C N   1 
ATOM   4047  C  CA  . SER C  1 126 ? -62.816  -16.827 -108.862 1.00 43.63  ? 107  SER C CA  1 
ATOM   4048  C  C   . SER C  1 126 ? -64.054  -16.060 -109.328 1.00 37.18  ? 107  SER C C   1 
ATOM   4049  O  O   . SER C  1 126 ? -64.017  -15.419 -110.371 1.00 35.60  ? 107  SER C O   1 
ATOM   4050  C  CB  . SER C  1 126 ? -62.761  -18.199 -109.547 1.00 47.14  ? 107  SER C CB  1 
ATOM   4051  O  OG  . SER C  1 126 ? -63.824  -19.039 -109.108 1.00 46.59  ? 107  SER C OG  1 
ATOM   4052  N  N   . ASP C  1 127 ? -65.133  -16.116 -108.547 1.00 36.29  ? 108  ASP C N   1 
ATOM   4053  C  CA  . ASP C  1 127 ? -66.347  -15.345 -108.847 1.00 34.14  ? 108  ASP C CA  1 
ATOM   4054  C  C   . ASP C  1 127 ? -66.245  -13.856 -108.523 1.00 34.91  ? 108  ASP C C   1 
ATOM   4055  O  O   . ASP C  1 127 ? -67.174  -13.108 -108.798 1.00 41.72  ? 108  ASP C O   1 
ATOM   4056  C  CB  . ASP C  1 127 ? -67.557  -15.929 -108.117 1.00 37.40  ? 108  ASP C CB  1 
ATOM   4057  C  CG  . ASP C  1 127 ? -67.381  -15.948 -106.591 1.00 42.84  ? 108  ASP C CG  1 
ATOM   4058  O  OD1 . ASP C  1 127 ? -66.235  -15.746 -106.130 1.00 41.23  ? 108  ASP C OD1 1 
ATOM   4059  O  OD2 . ASP C  1 127 ? -68.381  -16.183 -105.853 1.00 44.08  ? 108  ASP C OD2 1 
ATOM   4060  N  N   . GLY C  1 128 ? -65.135  -13.426 -107.925 1.00 33.17  ? 109  GLY C N   1 
ATOM   4061  C  CA  . GLY C  1 128 ? -64.965  -12.024 -107.559 1.00 36.58  ? 109  GLY C CA  1 
ATOM   4062  C  C   . GLY C  1 128 ? -65.325  -11.690 -106.103 1.00 37.46  ? 109  GLY C C   1 
ATOM   4063  O  O   . GLY C  1 128 ? -65.333  -10.516 -105.687 1.00 33.49  ? 109  GLY C O   1 
ATOM   4064  N  N   . GLU C  1 129 ? -65.637  -12.725 -105.323 1.00 39.02  ? 110  GLU C N   1 
ATOM   4065  C  CA  . GLU C  1 129 ? -65.893  -12.573 -103.884 1.00 38.94  ? 110  GLU C CA  1 
ATOM   4066  C  C   . GLU C  1 129 ? -64.584  -12.267 -103.172 1.00 32.14  ? 110  GLU C C   1 
ATOM   4067  O  O   . GLU C  1 129 ? -63.614  -12.998 -103.325 1.00 30.32  ? 110  GLU C O   1 
ATOM   4068  C  CB  . GLU C  1 129 ? -66.518  -13.834 -103.279 1.00 47.12  ? 110  GLU C CB  1 
ATOM   4069  C  CG  . GLU C  1 129 ? -67.270  -13.573 -101.955 1.00 61.74  ? 110  GLU C CG  1 
ATOM   4070  C  CD  . GLU C  1 129 ? -67.016  -14.636 -100.869 1.00 69.63  ? 110  GLU C CD  1 
ATOM   4071  O  OE1 . GLU C  1 129 ? -67.639  -15.725 -100.928 1.00 72.37  ? 110  GLU C OE1 1 
ATOM   4072  O  OE2 . GLU C  1 129 ? -66.197  -14.373 -99.954  1.00 68.90  ? 110  GLU C OE2 1 
ATOM   4073  N  N   . VAL C  1 130 ? -64.550  -11.177 -102.411 1.00 28.04  ? 111  VAL C N   1 
ATOM   4074  C  CA  . VAL C  1 130 ? -63.346  -10.784 -101.685 1.00 21.86  ? 111  VAL C CA  1 
ATOM   4075  C  C   . VAL C  1 130 ? -63.611  -10.811 -100.204 1.00 24.58  ? 111  VAL C C   1 
ATOM   4076  O  O   . VAL C  1 130 ? -64.624  -10.291 -99.735  1.00 32.00  ? 111  VAL C O   1 
ATOM   4077  C  CB  . VAL C  1 130 ? -62.856  -9.359  -102.049 1.00 30.10  ? 111  VAL C CB  1 
ATOM   4078  C  CG1 . VAL C  1 130 ? -61.519  -9.070  -101.344 1.00 27.26  ? 111  VAL C CG1 1 
ATOM   4079  C  CG2 . VAL C  1 130 ? -62.720  -9.203  -103.574 1.00 23.53  ? 111  VAL C CG2 1 
ATOM   4080  N  N   . GLN C  1 131 ? -62.705  -11.438 -99.467  1.00 25.79  ? 112  GLN C N   1 
ATOM   4081  C  CA  . GLN C  1 131 ? -62.810  -11.474 -98.029  1.00 27.42  ? 112  GLN C CA  1 
ATOM   4082  C  C   . GLN C  1 131 ? -61.497  -10.993 -97.425  1.00 30.59  ? 112  GLN C C   1 
ATOM   4083  O  O   . GLN C  1 131 ? -60.418  -11.363 -97.869  1.00 34.75  ? 112  GLN C O   1 
ATOM   4084  C  CB  . GLN C  1 131 ? -63.177  -12.871 -97.522  1.00 35.26  ? 112  GLN C CB  1 
ATOM   4085  C  CG  . GLN C  1 131 ? -63.410  -12.905 -96.000  1.00 38.37  ? 112  GLN C CG  1 
ATOM   4086  C  CD  . GLN C  1 131 ? -64.031  -14.189 -95.532  1.00 38.88  ? 112  GLN C CD  1 
ATOM   4087  O  OE1 . GLN C  1 131 ? -63.326  -15.142 -95.173  1.00 45.35  ? 112  GLN C OE1 1 
ATOM   4088  N  NE2 . GLN C  1 131 ? -65.361  -14.231 -95.536  1.00 34.41  ? 112  GLN C NE2 1 
ATOM   4089  N  N   . TYR C  1 132 ? -61.597  -10.128 -96.430  1.00 29.81  ? 113  TYR C N   1 
ATOM   4090  C  CA  . TYR C  1 132 ? -60.428  -9.647  -95.714  1.00 28.74  ? 113  TYR C CA  1 
ATOM   4091  C  C   . TYR C  1 132 ? -60.754  -9.713  -94.212  1.00 29.98  ? 113  TYR C C   1 
ATOM   4092  O  O   . TYR C  1 132 ? -61.757  -9.151  -93.765  1.00 31.57  ? 113  TYR C O   1 
ATOM   4093  C  CB  . TYR C  1 132 ? -60.075  -8.222  -96.169  1.00 22.91  ? 113  TYR C CB  1 
ATOM   4094  C  CG  . TYR C  1 132 ? -58.916  -7.583  -95.424  1.00 21.48  ? 113  TYR C CG  1 
ATOM   4095  C  CD1 . TYR C  1 132 ? -57.725  -8.286  -95.194  1.00 21.91  ? 113  TYR C CD1 1 
ATOM   4096  C  CD2 . TYR C  1 132 ? -59.006  -6.272  -94.966  1.00 10.18  ? 113  TYR C CD2 1 
ATOM   4097  C  CE1 . TYR C  1 132 ? -56.661  -7.699  -94.505  1.00 17.89  ? 113  TYR C CE1 1 
ATOM   4098  C  CE2 . TYR C  1 132 ? -57.963  -5.688  -94.269  1.00 13.72  ? 113  TYR C CE2 1 
ATOM   4099  C  CZ  . TYR C  1 132 ? -56.793  -6.389  -94.039  1.00 18.84  ? 113  TYR C CZ  1 
ATOM   4100  O  OH  . TYR C  1 132 ? -55.761  -5.735  -93.357  1.00 22.03  ? 113  TYR C OH  1 
ATOM   4101  N  N   . THR C  1 133 ? -59.928  -10.433 -93.455  1.00 20.82  ? 114  THR C N   1 
ATOM   4102  C  CA  . THR C  1 133 ? -60.181  -10.659 -92.037  1.00 19.87  ? 114  THR C CA  1 
ATOM   4103  C  C   . THR C  1 133 ? -58.906  -10.372 -91.214  1.00 18.63  ? 114  THR C C   1 
ATOM   4104  O  O   . THR C  1 133 ? -58.216  -11.262 -90.735  1.00 15.77  ? 114  THR C O   1 
ATOM   4105  C  CB  . THR C  1 133 ? -60.716  -12.092 -91.758  1.00 31.36  ? 114  THR C CB  1 
ATOM   4106  O  OG1 . THR C  1 133 ? -61.817  -12.398 -92.632  1.00 29.74  ? 114  THR C OG1 1 
ATOM   4107  C  CG2 . THR C  1 133 ? -61.175  -12.208 -90.301  1.00 34.25  ? 114  THR C CG2 1 
ATOM   4108  N  N   . PRO C  1 134 ? -58.572  -9.099  -91.065  1.00 18.98  ? 115  PRO C N   1 
ATOM   4109  C  CA  . PRO C  1 134 ? -57.429  -8.812  -90.201  1.00 18.17  ? 115  PRO C CA  1 
ATOM   4110  C  C   . PRO C  1 134 ? -57.803  -9.003  -88.725  1.00 25.63  ? 115  PRO C C   1 
ATOM   4111  O  O   . PRO C  1 134 ? -58.975  -8.824  -88.340  1.00 29.58  ? 115  PRO C O   1 
ATOM   4112  C  CB  . PRO C  1 134 ? -57.154  -7.331  -90.478  1.00 11.89  ? 115  PRO C CB  1 
ATOM   4113  C  CG  . PRO C  1 134 ? -58.521  -6.764  -90.840  1.00 13.88  ? 115  PRO C CG  1 
ATOM   4114  C  CD  . PRO C  1 134 ? -59.216  -7.885  -91.601  1.00 18.12  ? 115  PRO C CD  1 
ATOM   4115  N  N   . SER C  1 135 ? -56.820  -9.380  -87.910  1.00 22.58  ? 116  SER C N   1 
ATOM   4116  C  CA  . SER C  1 135 ? -56.990  -9.351  -86.466  1.00 21.37  ? 116  SER C CA  1 
ATOM   4117  C  C   . SER C  1 135 ? -56.543  -7.974  -86.010  1.00 22.01  ? 116  SER C C   1 
ATOM   4118  O  O   . SER C  1 135 ? -55.415  -7.533  -86.285  1.00 25.20  ? 116  SER C O   1 
ATOM   4119  C  CB  . SER C  1 135 ? -56.142  -10.423 -85.797  1.00 25.41  ? 116  SER C CB  1 
ATOM   4120  O  OG  . SER C  1 135 ? -56.482  -10.569 -84.435  1.00 31.74  ? 116  SER C OG  1 
ATOM   4121  N  N   . ILE C  1 136 ? -57.434  -7.284  -85.317  1.00 20.87  ? 117  ILE C N   1 
ATOM   4122  C  CA  . ILE C  1 136 ? -57.177  -5.906  -84.897  1.00 22.88  ? 117  ILE C CA  1 
ATOM   4123  C  C   . ILE C  1 136 ? -57.208  -5.727  -83.370  1.00 22.25  ? 117  ILE C C   1 
ATOM   4124  O  O   . ILE C  1 136 ? -58.113  -6.221  -82.664  1.00 18.08  ? 117  ILE C O   1 
ATOM   4125  C  CB  . ILE C  1 136 ? -58.195  -4.949  -85.568  1.00 23.13  ? 117  ILE C CB  1 
ATOM   4126  C  CG1 . ILE C  1 136 ? -58.038  -4.997  -87.096  1.00 29.02  ? 117  ILE C CG1 1 
ATOM   4127  C  CG2 . ILE C  1 136 ? -58.067  -3.528  -85.042  1.00 15.13  ? 117  ILE C CG2 1 
ATOM   4128  C  CD1 . ILE C  1 136 ? -59.123  -4.255  -87.860  1.00 27.07  ? 117  ILE C CD1 1 
ATOM   4129  N  N   . ARG C  1 137 ? -56.198  -5.034  -82.861  1.00 18.27  ? 118  ARG C N   1 
ATOM   4130  C  CA  . ARG C  1 137 ? -56.278  -4.525  -81.501  1.00 21.64  ? 118  ARG C CA  1 
ATOM   4131  C  C   . ARG C  1 137 ? -56.602  -3.046  -81.496  1.00 21.05  ? 118  ARG C C   1 
ATOM   4132  O  O   . ARG C  1 137 ? -55.895  -2.248  -82.118  1.00 21.10  ? 118  ARG C O   1 
ATOM   4133  C  CB  . ARG C  1 137 ? -54.975  -4.737  -80.738  1.00 24.30  ? 118  ARG C CB  1 
ATOM   4134  C  CG  . ARG C  1 137 ? -55.057  -4.164  -79.334  1.00 21.12  ? 118  ARG C CG  1 
ATOM   4135  C  CD  . ARG C  1 137 ? -53.914  -4.629  -78.476  1.00 23.92  ? 118  ARG C CD  1 
ATOM   4136  N  NE  . ARG C  1 137 ? -54.013  -4.024  -77.156  1.00 23.94  ? 118  ARG C NE  1 
ATOM   4137  C  CZ  . ARG C  1 137 ? -53.211  -4.274  -76.136  1.00 23.58  ? 118  ARG C CZ  1 
ATOM   4138  N  NH1 . ARG C  1 137 ? -52.232  -5.170  -76.277  1.00 16.94  ? 118  ARG C NH1 1 
ATOM   4139  N  NH2 . ARG C  1 137 ? -53.417  -3.630  -74.978  1.00 26.98  ? 118  ARG C NH2 1 
ATOM   4140  N  N   . GLN C  1 138 ? -57.655  -2.666  -80.785  1.00 21.33  ? 119  GLN C N   1 
ATOM   4141  C  CA  . GLN C  1 138 ? -58.080  -1.278  -80.830  1.00 25.63  ? 119  GLN C CA  1 
ATOM   4142  C  C   . GLN C  1 138 ? -58.759  -0.873  -79.534  1.00 27.60  ? 119  GLN C C   1 
ATOM   4143  O  O   . GLN C  1 138 ? -59.395  -1.699  -78.885  1.00 28.58  ? 119  GLN C O   1 
ATOM   4144  C  CB  . GLN C  1 138 ? -59.003  -1.053  -82.029  1.00 28.33  ? 119  GLN C CB  1 
ATOM   4145  C  CG  . GLN C  1 138 ? -59.155  0.411   -82.419  1.00 29.04  ? 119  GLN C CG  1 
ATOM   4146  C  CD  . GLN C  1 138 ? -59.826  0.569   -83.765  1.00 30.71  ? 119  GLN C CD  1 
ATOM   4147  O  OE1 . GLN C  1 138 ? -60.571  -0.306  -84.209  1.00 30.96  ? 119  GLN C OE1 1 
ATOM   4148  N  NE2 . GLN C  1 138 ? -59.553  1.679   -84.429  1.00 36.71  ? 119  GLN C NE2 1 
ATOM   4149  N  N   . ARG C  1 139 ? -58.603  0.394   -79.156  1.00 28.27  ? 120  ARG C N   1 
ATOM   4150  C  CA  . ARG C  1 139 ? -59.282  0.949   -77.987  1.00 27.26  ? 120  ARG C CA  1 
ATOM   4151  C  C   . ARG C  1 139 ? -60.542  1.713   -78.394  1.00 27.26  ? 120  ARG C C   1 
ATOM   4152  O  O   . ARG C  1 139 ? -60.548  2.464   -79.392  1.00 30.12  ? 120  ARG C O   1 
ATOM   4153  C  CB  . ARG C  1 139 ? -58.353  1.897   -77.243  1.00 33.66  ? 120  ARG C CB  1 
ATOM   4154  C  CG  . ARG C  1 139 ? -57.718  1.358   -75.975  1.00 41.59  ? 120  ARG C CG  1 
ATOM   4155  C  CD  . ARG C  1 139 ? -56.872  2.459   -75.343  1.00 50.46  ? 120  ARG C CD  1 
ATOM   4156  N  NE  . ARG C  1 139 ? -55.725  2.788   -76.192  1.00 57.64  ? 120  ARG C NE  1 
ATOM   4157  C  CZ  . ARG C  1 139 ? -55.114  3.973   -76.226  1.00 58.28  ? 120  ARG C CZ  1 
ATOM   4158  N  NH1 . ARG C  1 139 ? -55.533  4.974   -75.448  1.00 53.60  ? 120  ARG C NH1 1 
ATOM   4159  N  NH2 . ARG C  1 139 ? -54.076  4.145   -77.045  1.00 57.73  ? 120  ARG C NH2 1 
ATOM   4160  N  N   . PHE C  1 140 ? -61.600  1.523   -77.609  1.00 19.71  ? 121  PHE C N   1 
ATOM   4161  C  CA  . PHE C  1 140 ? -62.890  2.149   -77.869  1.00 14.56  ? 121  PHE C CA  1 
ATOM   4162  C  C   . PHE C  1 140 ? -63.393  2.930   -76.696  1.00 19.76  ? 121  PHE C C   1 
ATOM   4163  O  O   . PHE C  1 140 ? -63.057  2.655   -75.528  1.00 25.51  ? 121  PHE C O   1 
ATOM   4164  C  CB  . PHE C  1 140 ? -63.936  1.097   -78.254  1.00 24.90  ? 121  PHE C CB  1 
ATOM   4165  C  CG  . PHE C  1 140 ? -63.578  0.320   -79.491  1.00 30.89  ? 121  PHE C CG  1 
ATOM   4166  C  CD1 . PHE C  1 140 ? -63.858  0.828   -80.736  1.00 24.70  ? 121  PHE C CD1 1 
ATOM   4167  C  CD2 . PHE C  1 140 ? -62.926  -0.898  -79.400  1.00 31.25  ? 121  PHE C CD2 1 
ATOM   4168  C  CE1 . PHE C  1 140 ? -63.532  0.128   -81.846  1.00 26.12  ? 121  PHE C CE1 1 
ATOM   4169  C  CE2 . PHE C  1 140 ? -62.597  -1.605  -80.527  1.00 27.86  ? 121  PHE C CE2 1 
ATOM   4170  C  CZ  . PHE C  1 140 ? -62.902  -1.090  -81.746  1.00 29.70  ? 121  PHE C CZ  1 
ATOM   4171  N  N   . SER C  1 141 ? -64.204  3.928   -77.019  1.00 25.97  ? 122  SER C N   1 
ATOM   4172  C  CA  . SER C  1 141 ? -64.923  4.695   -76.010  1.00 31.13  ? 122  SER C CA  1 
ATOM   4173  C  C   . SER C  1 141 ? -66.336  4.167   -76.030  1.00 34.25  ? 122  SER C C   1 
ATOM   4174  O  O   . SER C  1 141 ? -67.035  4.319   -77.029  1.00 45.00  ? 122  SER C O   1 
ATOM   4175  C  CB  . SER C  1 141 ? -64.920  6.178   -76.355  1.00 30.58  ? 122  SER C CB  1 
ATOM   4176  O  OG  . SER C  1 141 ? -66.086  6.818   -75.843  1.00 29.21  ? 122  SER C OG  1 
ATOM   4177  N  N   . CYS C  1 142 ? -66.750  3.521   -74.945  1.00 50.69  ? 123  CYS C N   1 
ATOM   4178  C  CA  . CYS C  1 142 ? -68.089  2.953   -74.872  1.00 47.25  ? 123  CYS C CA  1 
ATOM   4179  C  C   . CYS C  1 142 ? -68.551  2.771   -73.439  1.00 48.97  ? 123  CYS C C   1 
ATOM   4180  O  O   . CYS C  1 142 ? -67.804  3.059   -72.495  1.00 52.34  ? 123  CYS C O   1 
ATOM   4181  C  CB  . CYS C  1 142 ? -68.115  1.623   -75.602  1.00 50.22  ? 123  CYS C CB  1 
ATOM   4182  S  SG  . CYS C  1 142 ? -66.791  0.517   -75.092  1.00 68.24  ? 123  CYS C SG  1 
ATOM   4183  N  N   . ASP C  1 143 ? -69.782  2.290   -73.279  1.00 47.11  ? 124  ASP C N   1 
ATOM   4184  C  CA  . ASP C  1 143 ? -70.363  2.126   -71.949  1.00 48.30  ? 124  ASP C CA  1 
ATOM   4185  C  C   . ASP C  1 143 ? -69.850  0.882   -71.221  1.00 49.15  ? 124  ASP C C   1 
ATOM   4186  O  O   . ASP C  1 143 ? -70.224  -0.250  -71.564  1.00 48.12  ? 124  ASP C O   1 
ATOM   4187  C  CB  . ASP C  1 143 ? -71.879  2.056   -72.035  1.00 50.59  ? 124  ASP C CB  1 
ATOM   4188  C  CG  . ASP C  1 143 ? -72.547  2.165   -70.667  1.00 55.99  ? 124  ASP C CG  1 
ATOM   4189  O  OD1 . ASP C  1 143 ? -71.899  2.627   -69.688  1.00 54.42  ? 124  ASP C OD1 1 
ATOM   4190  O  OD2 . ASP C  1 143 ? -73.736  1.790   -70.585  1.00 59.26  ? 124  ASP C OD2 1 
ATOM   4191  N  N   . VAL C  1 144 ? -69.012  1.101   -70.206  1.00 43.55  ? 125  VAL C N   1 
ATOM   4192  C  CA  . VAL C  1 144 ? -68.348  0.011   -69.492  1.00 39.05  ? 125  VAL C CA  1 
ATOM   4193  C  C   . VAL C  1 144 ? -69.037  -0.237  -68.144  1.00 38.18  ? 125  VAL C C   1 
ATOM   4194  O  O   . VAL C  1 144 ? -68.685  -1.156  -67.397  1.00 35.88  ? 125  VAL C O   1 
ATOM   4195  C  CB  . VAL C  1 144 ? -66.835  0.311   -69.314  1.00 49.28  ? 125  VAL C CB  1 
ATOM   4196  C  CG1 . VAL C  1 144 ? -66.098  -0.920  -68.888  1.00 47.90  ? 125  VAL C CG1 1 
ATOM   4197  C  CG2 . VAL C  1 144 ? -66.236  0.803   -70.626  1.00 52.75  ? 125  VAL C CG2 1 
ATOM   4198  N  N   . SER C  1 145 ? -70.044  0.583   -67.856  1.00 38.51  ? 126  SER C N   1 
ATOM   4199  C  CA  . SER C  1 145 ? -70.782  0.478   -66.608  1.00 44.86  ? 126  SER C CA  1 
ATOM   4200  C  C   . SER C  1 145 ? -71.458  -0.897  -66.451  1.00 54.11  ? 126  SER C C   1 
ATOM   4201  O  O   . SER C  1 145 ? -72.145  -1.378  -67.362  1.00 55.50  ? 126  SER C O   1 
ATOM   4202  C  CB  . SER C  1 145 ? -71.814  1.603   -66.490  1.00 43.54  ? 126  SER C CB  1 
ATOM   4203  O  OG  . SER C  1 145 ? -72.944  1.327   -67.297  1.00 41.83  ? 126  SER C OG  1 
ATOM   4204  N  N   . GLY C  1 146 ? -71.240  -1.527  -65.293  1.00 55.38  ? 127  GLY C N   1 
ATOM   4205  C  CA  . GLY C  1 146 ? -71.817  -2.824  -64.994  1.00 51.86  ? 127  GLY C CA  1 
ATOM   4206  C  C   . GLY C  1 146 ? -70.933  -3.995  -65.376  1.00 34.62  ? 127  GLY C C   1 
ATOM   4207  O  O   . GLY C  1 146 ? -71.350  -5.151  -65.291  1.00 34.70  ? 127  GLY C O   1 
ATOM   4208  N  N   . VAL C  1 147 ? -69.704  -3.697  -65.788  1.00 34.50  ? 128  VAL C N   1 
ATOM   4209  C  CA  . VAL C  1 147 ? -68.781  -4.736  -66.219  1.00 39.35  ? 128  VAL C CA  1 
ATOM   4210  C  C   . VAL C  1 147 ? -68.531  -5.759  -65.114  1.00 47.07  ? 128  VAL C C   1 
ATOM   4211  O  O   . VAL C  1 147 ? -68.311  -6.943  -65.389  1.00 48.26  ? 128  VAL C O   1 
ATOM   4212  C  CB  . VAL C  1 147 ? -67.455  -4.133  -66.734  1.00 42.05  ? 128  VAL C CB  1 
ATOM   4213  C  CG1 . VAL C  1 147 ? -66.761  -3.304  -65.651  1.00 34.32  ? 128  VAL C CG1 1 
ATOM   4214  C  CG2 . VAL C  1 147 ? -66.541  -5.237  -67.294  1.00 43.93  ? 128  VAL C CG2 1 
ATOM   4215  N  N   . ASP C  1 148 ? -68.602  -5.297  -63.866  1.00 56.47  ? 129  ASP C N   1 
ATOM   4216  C  CA  . ASP C  1 148 ? -68.293  -6.127  -62.708  1.00 61.14  ? 129  ASP C CA  1 
ATOM   4217  C  C   . ASP C  1 148 ? -69.539  -6.752  -62.077  1.00 58.13  ? 129  ASP C C   1 
ATOM   4218  O  O   . ASP C  1 148 ? -69.455  -7.399  -61.032  1.00 60.84  ? 129  ASP C O   1 
ATOM   4219  C  CB  . ASP C  1 148 ? -67.500  -5.319  -61.668  1.00 66.82  ? 129  ASP C CB  1 
ATOM   4220  C  CG  . ASP C  1 148 ? -66.258  -6.058  -61.179  1.00 72.22  ? 129  ASP C CG  1 
ATOM   4221  O  OD1 . ASP C  1 148 ? -66.328  -7.308  -61.035  1.00 75.78  ? 129  ASP C OD1 1 
ATOM   4222  O  OD2 . ASP C  1 148 ? -65.215  -5.391  -60.955  1.00 70.01  ? 129  ASP C OD2 1 
ATOM   4223  N  N   . THR C  1 149 ? -70.687  -6.560  -62.721  1.00 53.39  ? 130  THR C N   1 
ATOM   4224  C  CA  . THR C  1 149 ? -71.942  -7.184  -62.287  1.00 53.71  ? 130  THR C CA  1 
ATOM   4225  C  C   . THR C  1 149 ? -72.224  -8.471  -63.087  1.00 51.41  ? 130  THR C C   1 
ATOM   4226  O  O   . THR C  1 149 ? -71.414  -8.880  -63.904  1.00 50.98  ? 130  THR C O   1 
ATOM   4227  C  CB  . THR C  1 149 ? -73.143  -6.221  -62.414  1.00 50.83  ? 130  THR C CB  1 
ATOM   4228  O  OG1 . THR C  1 149 ? -73.619  -6.218  -63.772  1.00 52.38  ? 130  THR C OG1 1 
ATOM   4229  C  CG2 . THR C  1 149 ? -72.745  -4.808  -61.970  1.00 47.14  ? 130  THR C CG2 1 
ATOM   4230  N  N   . GLU C  1 150 ? -73.366  -9.107  -62.858  1.00 53.16  ? 131  GLU C N   1 
ATOM   4231  C  CA  . GLU C  1 150 ? -73.662  -10.375 -63.524  1.00 58.59  ? 131  GLU C CA  1 
ATOM   4232  C  C   . GLU C  1 150 ? -74.322  -10.129 -64.887  1.00 50.74  ? 131  GLU C C   1 
ATOM   4233  O  O   . GLU C  1 150 ? -74.179  -10.894 -65.836  1.00 39.27  ? 131  GLU C O   1 
ATOM   4234  C  CB  . GLU C  1 150 ? -74.557  -11.251 -62.642  1.00 67.06  ? 131  GLU C CB  1 
ATOM   4235  C  CG  . GLU C  1 150 ? -74.400  -12.751 -62.887  1.00 76.49  ? 131  GLU C CG  1 
ATOM   4236  C  CD  . GLU C  1 150 ? -73.116  -13.327 -62.276  1.00 89.83  ? 131  GLU C CD  1 
ATOM   4237  O  OE1 . GLU C  1 150 ? -72.273  -12.540 -61.779  1.00 96.80  ? 131  GLU C OE1 1 
ATOM   4238  O  OE2 . GLU C  1 150 ? -72.947  -14.570 -62.283  1.00 91.61  ? 131  GLU C OE2 1 
ATOM   4239  N  N   . SER C  1 151 ? -75.045  -9.034  -64.987  1.00 50.98  ? 132  SER C N   1 
ATOM   4240  C  CA  . SER C  1 151 ? -75.656  -8.711  -66.254  1.00 51.28  ? 132  SER C CA  1 
ATOM   4241  C  C   . SER C  1 151 ? -74.597  -8.129  -67.211  1.00 56.13  ? 132  SER C C   1 
ATOM   4242  O  O   . SER C  1 151 ? -74.781  -8.130  -68.432  1.00 56.42  ? 132  SER C O   1 
ATOM   4243  C  CB  . SER C  1 151 ? -76.817  -7.749  -66.046  1.00 50.19  ? 132  SER C CB  1 
ATOM   4244  O  OG  . SER C  1 151 ? -76.353  -6.568  -65.420  1.00 61.93  ? 132  SER C OG  1 
ATOM   4245  N  N   . GLY C  1 152 ? -73.492  -7.647  -66.641  1.00 55.68  ? 133  GLY C N   1 
ATOM   4246  C  CA  . GLY C  1 152 ? -72.338  -7.225  -67.406  1.00 53.90  ? 133  GLY C CA  1 
ATOM   4247  C  C   . GLY C  1 152 ? -72.486  -5.854  -68.031  1.00 56.43  ? 133  GLY C C   1 
ATOM   4248  O  O   . GLY C  1 152 ? -73.525  -5.206  -67.882  1.00 56.53  ? 133  GLY C O   1 
ATOM   4249  N  N   . ALA C  1 153 ? -71.436  -5.410  -68.729  1.00 43.57  ? 134  ALA C N   1 
ATOM   4250  C  CA  . ALA C  1 153 ? -71.477  -4.153  -69.460  1.00 43.47  ? 134  ALA C CA  1 
ATOM   4251  C  C   . ALA C  1 153 ? -71.891  -4.450  -70.883  1.00 46.25  ? 134  ALA C C   1 
ATOM   4252  O  O   . ALA C  1 153 ? -71.726  -5.577  -71.357  1.00 51.75  ? 134  ALA C O   1 
ATOM   4253  C  CB  . ALA C  1 153 ? -70.127  -3.473  -69.430  1.00 44.66  ? 134  ALA C CB  1 
ATOM   4254  N  N   . THR C  1 154 ? -72.445  -3.450  -71.562  1.00 48.02  ? 135  THR C N   1 
ATOM   4255  C  CA  . THR C  1 154 ? -72.728  -3.581  -72.997  1.00 48.56  ? 135  THR C CA  1 
ATOM   4256  C  C   . THR C  1 154 ? -72.026  -2.498  -73.809  1.00 44.78  ? 135  THR C C   1 
ATOM   4257  O  O   . THR C  1 154 ? -72.495  -1.364  -73.875  1.00 46.81  ? 135  THR C O   1 
ATOM   4258  C  CB  . THR C  1 154 ? -74.232  -3.575  -73.315  1.00 48.57  ? 135  THR C CB  1 
ATOM   4259  O  OG1 . THR C  1 154 ? -74.861  -4.679  -72.658  1.00 50.47  ? 135  THR C OG1 1 
ATOM   4260  C  CG2 . THR C  1 154 ? -74.452  -3.727  -74.822  1.00 49.11  ? 135  THR C CG2 1 
ATOM   4261  N  N   . CYS C  1 155 ? -70.892  -2.861  -74.408  1.00 38.32  ? 136  CYS C N   1 
ATOM   4262  C  CA  . CYS C  1 155 ? -70.122  -1.934  -75.225  1.00 37.25  ? 136  CYS C CA  1 
ATOM   4263  C  C   . CYS C  1 155 ? -70.620  -1.972  -76.676  1.00 34.24  ? 136  CYS C C   1 
ATOM   4264  O  O   . CYS C  1 155 ? -70.693  -3.040  -77.305  1.00 29.11  ? 136  CYS C O   1 
ATOM   4265  C  CB  . CYS C  1 155 ? -68.623  -2.260  -75.144  1.00 39.67  ? 136  CYS C CB  1 
ATOM   4266  S  SG  . CYS C  1 155 ? -67.573  -1.110  -76.081  1.00 62.05  ? 136  CYS C SG  1 
ATOM   4267  N  N   . ARG C  1 156 ? -70.971  -0.801  -77.199  1.00 35.93  ? 137  ARG C N   1 
ATOM   4268  C  CA  . ARG C  1 156 ? -71.518  -0.680  -78.550  1.00 36.43  ? 137  ARG C CA  1 
ATOM   4269  C  C   . ARG C  1 156 ? -70.455  -0.143  -79.528  1.00 35.25  ? 137  ARG C C   1 
ATOM   4270  O  O   . ARG C  1 156 ? -69.986  0.986   -79.400  1.00 34.75  ? 137  ARG C O   1 
ATOM   4271  C  CB  . ARG C  1 156 ? -72.734  0.240   -78.514  1.00 40.26  ? 137  ARG C CB  1 
ATOM   4272  C  CG  . ARG C  1 156 ? -73.653  0.200   -79.715  1.00 50.08  ? 137  ARG C CG  1 
ATOM   4273  C  CD  . ARG C  1 156 ? -74.836  1.184   -79.531  1.00 64.60  ? 137  ARG C CD  1 
ATOM   4274  N  NE  . ARG C  1 156 ? -74.413  2.595   -79.481  1.00 74.06  ? 137  ARG C NE  1 
ATOM   4275  C  CZ  . ARG C  1 156 ? -74.473  3.375   -78.400  1.00 74.66  ? 137  ARG C CZ  1 
ATOM   4276  N  NH1 . ARG C  1 156 ? -74.961  2.892   -77.259  1.00 78.03  ? 137  ARG C NH1 1 
ATOM   4277  N  NH2 . ARG C  1 156 ? -74.047  4.638   -78.460  1.00 69.61  ? 137  ARG C NH2 1 
ATOM   4278  N  N   . ILE C  1 157 ? -70.063  -0.967  -80.492  1.00 34.27  ? 138  ILE C N   1 
ATOM   4279  C  CA  . ILE C  1 157 ? -69.075  -0.550  -81.483  1.00 40.51  ? 138  ILE C CA  1 
ATOM   4280  C  C   . ILE C  1 157 ? -69.714  -0.204  -82.852  1.00 27.42  ? 138  ILE C C   1 
ATOM   4281  O  O   . ILE C  1 157 ? -70.417  -1.017  -83.444  1.00 24.13  ? 138  ILE C O   1 
ATOM   4282  C  CB  . ILE C  1 157 ? -67.985  -1.620  -81.652  1.00 38.15  ? 138  ILE C CB  1 
ATOM   4283  C  CG1 . ILE C  1 157 ? -67.187  -1.763  -80.360  1.00 32.09  ? 138  ILE C CG1 1 
ATOM   4284  C  CG2 . ILE C  1 157 ? -67.073  -1.283  -82.818  1.00 36.63  ? 138  ILE C CG2 1 
ATOM   4285  C  CD1 . ILE C  1 157 ? -66.220  -2.925  -80.402  1.00 19.28  ? 138  ILE C CD1 1 
ATOM   4286  N  N   . LYS C  1 158 ? -69.456  1.010   -83.333  1.00 18.64  ? 139  LYS C N   1 
ATOM   4287  C  CA  . LYS C  1 158 ? -70.079  1.519   -84.554  1.00 28.93  ? 139  LYS C CA  1 
ATOM   4288  C  C   . LYS C  1 158 ? -69.098  1.528   -85.739  1.00 32.25  ? 139  LYS C C   1 
ATOM   4289  O  O   . LYS C  1 158 ? -68.124  2.296   -85.765  1.00 27.45  ? 139  LYS C O   1 
ATOM   4290  C  CB  . LYS C  1 158 ? -70.642  2.918   -84.320  1.00 20.38  ? 139  LYS C CB  1 
ATOM   4291  C  CG  . LYS C  1 158 ? -71.305  3.550   -85.532  1.00 24.88  ? 139  LYS C CG  1 
ATOM   4292  C  CD  . LYS C  1 158 ? -71.620  5.005   -85.240  1.00 26.22  ? 139  LYS C CD  1 
ATOM   4293  C  CE  . LYS C  1 158 ? -72.150  5.744   -86.436  1.00 29.02  ? 139  LYS C CE  1 
ATOM   4294  N  NZ  . LYS C  1 158 ? -72.405  7.209   -86.117  1.00 30.54  ? 139  LYS C NZ  1 
ATOM   4295  N  N   . ILE C  1 159 ? -69.352  0.651   -86.708  1.00 36.06  ? 140  ILE C N   1 
ATOM   4296  C  CA  . ILE C  1 159 ? -68.474  0.515   -87.875  1.00 32.28  ? 140  ILE C CA  1 
ATOM   4297  C  C   . ILE C  1 159 ? -69.220  0.820   -89.157  1.00 26.37  ? 140  ILE C C   1 
ATOM   4298  O  O   . ILE C  1 159 ? -70.261  0.220   -89.426  1.00 27.76  ? 140  ILE C O   1 
ATOM   4299  C  CB  . ILE C  1 159 ? -67.893  -0.903  -87.980  1.00 27.34  ? 140  ILE C CB  1 
ATOM   4300  C  CG1 . ILE C  1 159 ? -67.050  -1.212  -86.746  1.00 32.25  ? 140  ILE C CG1 1 
ATOM   4301  C  CG2 . ILE C  1 159 ? -67.045  -1.050  -89.238  1.00 22.36  ? 140  ILE C CG2 1 
ATOM   4302  C  CD1 . ILE C  1 159 ? -66.359  -2.561  -86.785  1.00 30.58  ? 140  ILE C CD1 1 
ATOM   4303  N  N   . GLY C  1 160 ? -68.687  1.749   -89.943  1.00 23.25  ? 141  GLY C N   1 
ATOM   4304  C  CA  . GLY C  1 160 ? -69.206  1.994   -91.276  1.00 28.46  ? 141  GLY C CA  1 
ATOM   4305  C  C   . GLY C  1 160 ? -68.201  2.623   -92.222  1.00 27.54  ? 141  GLY C C   1 
ATOM   4306  O  O   . GLY C  1 160 ? -67.073  2.954   -91.834  1.00 27.71  ? 141  GLY C O   1 
ATOM   4307  N  N   . SER C  1 161 ? -68.610  2.803   -93.473  1.00 25.84  ? 142  SER C N   1 
ATOM   4308  C  CA  . SER C  1 161 ? -67.761  3.480   -94.443  1.00 29.83  ? 142  SER C CA  1 
ATOM   4309  C  C   . SER C  1 161 ? -67.563  4.934   -94.041  1.00 28.96  ? 142  SER C C   1 
ATOM   4310  O  O   . SER C  1 161 ? -68.537  5.657   -93.746  1.00 25.50  ? 142  SER C O   1 
ATOM   4311  C  CB  . SER C  1 161 ? -68.398  3.451   -95.836  1.00 39.15  ? 142  SER C CB  1 
ATOM   4312  O  OG  . SER C  1 161 ? -67.809  4.427   -96.689  1.00 36.93  ? 142  SER C OG  1 
ATOM   4313  N  N   . TRP C  1 162 ? -66.310  5.379   -94.050  1.00 27.52  ? 143  TRP C N   1 
ATOM   4314  C  CA  . TRP C  1 162 ? -66.014  6.770   -93.693  1.00 27.92  ? 143  TRP C CA  1 
ATOM   4315  C  C   . TRP C  1 162 ? -66.468  7.777   -94.777  1.00 27.37  ? 143  TRP C C   1 
ATOM   4316  O  O   . TRP C  1 162 ? -67.026  8.837   -94.471  1.00 28.02  ? 143  TRP C O   1 
ATOM   4317  C  CB  . TRP C  1 162 ? -64.524  6.942   -93.378  1.00 27.49  ? 143  TRP C CB  1 
ATOM   4318  C  CG  . TRP C  1 162 ? -64.223  8.164   -92.546  1.00 27.22  ? 143  TRP C CG  1 
ATOM   4319  C  CD1 . TRP C  1 162 ? -63.492  9.264   -92.918  1.00 27.92  ? 143  TRP C CD1 1 
ATOM   4320  C  CD2 . TRP C  1 162 ? -64.639  8.398   -91.199  1.00 25.31  ? 143  TRP C CD2 1 
ATOM   4321  N  NE1 . TRP C  1 162 ? -63.434  10.168  -91.876  1.00 27.42  ? 143  TRP C NE1 1 
ATOM   4322  C  CE2 . TRP C  1 162 ? -64.140  9.665   -90.818  1.00 24.89  ? 143  TRP C CE2 1 
ATOM   4323  C  CE3 . TRP C  1 162 ? -65.400  7.668   -90.282  1.00 24.40  ? 143  TRP C CE3 1 
ATOM   4324  C  CZ2 . TRP C  1 162 ? -64.382  10.212  -89.567  1.00 25.29  ? 143  TRP C CZ2 1 
ATOM   4325  C  CZ3 . TRP C  1 162 ? -65.632  8.215   -89.029  1.00 23.35  ? 143  TRP C CZ3 1 
ATOM   4326  C  CH2 . TRP C  1 162 ? -65.118  9.468   -88.684  1.00 23.54  ? 143  TRP C CH2 1 
ATOM   4327  N  N   . THR C  1 163 ? -66.236  7.447   -96.044  1.00 26.28  ? 144  THR C N   1 
ATOM   4328  C  CA  . THR C  1 163 ? -66.509  8.404   -97.111  1.00 28.74  ? 144  THR C CA  1 
ATOM   4329  C  C   . THR C  1 163 ? -67.538  7.962   -98.157  1.00 33.24  ? 144  THR C C   1 
ATOM   4330  O  O   . THR C  1 163 ? -67.918  8.754   -99.016  1.00 41.42  ? 144  THR C O   1 
ATOM   4331  C  CB  . THR C  1 163 ? -65.221  8.848   -97.851  1.00 42.04  ? 144  THR C CB  1 
ATOM   4332  O  OG1 . THR C  1 163 ? -64.786  7.810   -98.750  1.00 46.23  ? 144  THR C OG1 1 
ATOM   4333  C  CG2 . THR C  1 163 ? -64.125  9.198   -96.851  1.00 40.31  ? 144  THR C CG2 1 
ATOM   4334  N  N   . HIS C  1 164 ? -68.000  6.723   -98.101  1.00 28.61  ? 145  HIS C N   1 
ATOM   4335  C  CA  . HIS C  1 164 ? -68.993  6.292   -99.084  1.00 35.09  ? 145  HIS C CA  1 
ATOM   4336  C  C   . HIS C  1 164 ? -70.395  6.227   -98.463  1.00 36.12  ? 145  HIS C C   1 
ATOM   4337  O  O   . HIS C  1 164 ? -70.596  5.618   -97.406  1.00 26.03  ? 145  HIS C O   1 
ATOM   4338  C  CB  . HIS C  1 164 ? -68.600  4.952   -99.739  1.00 34.26  ? 145  HIS C CB  1 
ATOM   4339  C  CG  . HIS C  1 164 ? -67.343  5.020   -100.550 1.00 37.37  ? 145  HIS C CG  1 
ATOM   4340  N  ND1 . HIS C  1 164 ? -67.298  5.605   -101.800 1.00 49.92  ? 145  HIS C ND1 1 
ATOM   4341  C  CD2 . HIS C  1 164 ? -66.087  4.577   -100.299 1.00 33.51  ? 145  HIS C CD2 1 
ATOM   4342  C  CE1 . HIS C  1 164 ? -66.071  5.515   -102.283 1.00 49.39  ? 145  HIS C CE1 1 
ATOM   4343  N  NE2 . HIS C  1 164 ? -65.315  4.896   -101.391 1.00 42.11  ? 145  HIS C NE2 1 
ATOM   4344  N  N   . HIS C  1 165 ? -71.363  6.870   -99.113  1.00 38.28  ? 146  HIS C N   1 
ATOM   4345  C  CA  . HIS C  1 165 ? -72.741  6.857   -98.620  1.00 33.85  ? 146  HIS C CA  1 
ATOM   4346  C  C   . HIS C  1 165 ? -73.513  5.599   -99.052  1.00 34.78  ? 146  HIS C C   1 
ATOM   4347  O  O   . HIS C  1 165 ? -72.976  4.712   -99.740  1.00 33.98  ? 146  HIS C O   1 
ATOM   4348  C  CB  . HIS C  1 165 ? -73.470  8.125   -99.042  1.00 31.46  ? 146  HIS C CB  1 
ATOM   4349  C  CG  . HIS C  1 165 ? -73.478  8.352   -100.525 1.00 39.21  ? 146  HIS C CG  1 
ATOM   4350  N  ND1 . HIS C  1 165 ? -74.201  7.564   -101.402 1.00 38.87  ? 146  HIS C ND1 1 
ATOM   4351  C  CD2 . HIS C  1 165 ? -72.858  9.283   -101.288 1.00 39.60  ? 146  HIS C CD2 1 
ATOM   4352  C  CE1 . HIS C  1 165 ? -74.031  8.007   -102.634 1.00 32.93  ? 146  HIS C CE1 1 
ATOM   4353  N  NE2 . HIS C  1 165 ? -73.216  9.046   -102.595 1.00 32.82  ? 146  HIS C NE2 1 
ATOM   4354  N  N   . SER C  1 166 ? -74.779  5.530   -98.652  1.00 32.03  ? 147  SER C N   1 
ATOM   4355  C  CA  . SER C  1 166 ? -75.573  4.301   -98.799  1.00 25.60  ? 147  SER C CA  1 
ATOM   4356  C  C   . SER C  1 166 ? -75.718  3.799   -100.222 1.00 31.65  ? 147  SER C C   1 
ATOM   4357  O  O   . SER C  1 166 ? -76.032  2.629   -100.429 1.00 38.84  ? 147  SER C O   1 
ATOM   4358  C  CB  . SER C  1 166 ? -76.967  4.464   -98.198  1.00 17.08  ? 147  SER C CB  1 
ATOM   4359  O  OG  . SER C  1 166 ? -77.676  5.500   -98.849  1.00 20.62  ? 147  SER C OG  1 
ATOM   4360  N  N   . ARG C  1 167 ? -75.502  4.659   -101.207 1.00 33.52  ? 148  ARG C N   1 
ATOM   4361  C  CA  . ARG C  1 167 ? -75.691  4.215   -102.585 1.00 35.71  ? 148  ARG C CA  1 
ATOM   4362  C  C   . ARG C  1 167 ? -74.397  3.667   -103.184 1.00 37.14  ? 148  ARG C C   1 
ATOM   4363  O  O   . ARG C  1 167 ? -74.408  2.918   -104.158 1.00 41.77  ? 148  ARG C O   1 
ATOM   4364  C  CB  . ARG C  1 167 ? -76.325  5.312   -103.437 1.00 38.63  ? 148  ARG C CB  1 
ATOM   4365  C  CG  . ARG C  1 167 ? -77.852  5.416   -103.251 1.00 46.67  ? 148  ARG C CG  1 
ATOM   4366  C  CD  . ARG C  1 167 ? -78.481  6.528   -104.110 1.00 55.65  ? 148  ARG C CD  1 
ATOM   4367  N  NE  . ARG C  1 167 ? -78.003  7.849   -103.705 1.00 62.80  ? 148  ARG C NE  1 
ATOM   4368  C  CZ  . ARG C  1 167 ? -76.960  8.477   -104.249 1.00 69.15  ? 148  ARG C CZ  1 
ATOM   4369  N  NH1 . ARG C  1 167 ? -76.292  7.910   -105.250 1.00 71.60  ? 148  ARG C NH1 1 
ATOM   4370  N  NH2 . ARG C  1 167 ? -76.589  9.676   -103.794 1.00 69.71  ? 148  ARG C NH2 1 
ATOM   4371  N  N   . GLU C  1 168 ? -73.283  4.030   -102.566 1.00 35.03  ? 149  GLU C N   1 
ATOM   4372  C  CA  . GLU C  1 168 ? -71.977  3.494   -102.942 1.00 30.77  ? 149  GLU C CA  1 
ATOM   4373  C  C   . GLU C  1 168 ? -71.581  2.295   -102.088 1.00 36.58  ? 149  GLU C C   1 
ATOM   4374  O  O   . GLU C  1 168 ? -71.182  1.272   -102.616 1.00 36.27  ? 149  GLU C O   1 
ATOM   4375  C  CB  . GLU C  1 168 ? -70.916  4.589   -102.859 1.00 28.59  ? 149  GLU C CB  1 
ATOM   4376  C  CG  . GLU C  1 168 ? -71.189  5.707   -103.839 1.00 40.01  ? 149  GLU C CG  1 
ATOM   4377  C  CD  . GLU C  1 168 ? -70.359  6.954   -103.602 1.00 53.26  ? 149  GLU C CD  1 
ATOM   4378  O  OE1 . GLU C  1 168 ? -69.816  7.116   -102.476 1.00 53.66  ? 149  GLU C OE1 1 
ATOM   4379  O  OE2 . GLU C  1 168 ? -70.267  7.773   -104.559 1.00 58.50  ? 149  GLU C OE2 1 
ATOM   4380  N  N   . ILE C  1 169 ? -71.712  2.410   -100.766 1.00 43.27  ? 150  ILE C N   1 
ATOM   4381  C  CA  . ILE C  1 169 ? -71.475  1.258   -99.886  1.00 40.22  ? 150  ILE C CA  1 
ATOM   4382  C  C   . ILE C  1 169 ? -72.627  1.008   -98.913  1.00 35.31  ? 150  ILE C C   1 
ATOM   4383  O  O   . ILE C  1 169 ? -73.042  1.918   -98.181  1.00 34.58  ? 150  ILE C O   1 
ATOM   4384  C  CB  . ILE C  1 169 ? -70.187  1.427   -99.073  1.00 38.25  ? 150  ILE C CB  1 
ATOM   4385  C  CG1 . ILE C  1 169 ? -68.970  1.321   -99.974  1.00 36.62  ? 150  ILE C CG1 1 
ATOM   4386  C  CG2 . ILE C  1 169 ? -70.077  0.363   -98.017  1.00 37.67  ? 150  ILE C CG2 1 
ATOM   4387  C  CD1 . ILE C  1 169 ? -67.668  1.423   -99.224  1.00 33.92  ? 150  ILE C CD1 1 
ATOM   4388  N  N   . SER C  1 170 ? -73.139  -0.226  -98.902  1.00 31.53  ? 151  SER C N   1 
ATOM   4389  C  CA  . SER C  1 170 ? -74.070  -0.648  -97.847  1.00 31.90  ? 151  SER C CA  1 
ATOM   4390  C  C   . SER C  1 170 ? -73.420  -1.707  -96.952  1.00 27.85  ? 151  SER C C   1 
ATOM   4391  O  O   . SER C  1 170 ? -72.776  -2.643  -97.441  1.00 26.95  ? 151  SER C O   1 
ATOM   4392  C  CB  . SER C  1 170 ? -75.387  -1.165  -98.432  1.00 38.13  ? 151  SER C CB  1 
ATOM   4393  O  OG  . SER C  1 170 ? -75.231  -2.472  -98.924  1.00 50.36  ? 151  SER C OG  1 
ATOM   4394  N  N   . VAL C  1 171 ? -73.558  -1.544  -95.643  1.00 28.66  ? 152  VAL C N   1 
ATOM   4395  C  CA  . VAL C  1 171 ? -73.000  -2.521  -94.715  1.00 36.43  ? 152  VAL C CA  1 
ATOM   4396  C  C   . VAL C  1 171 ? -74.098  -3.391  -94.133  1.00 43.34  ? 152  VAL C C   1 
ATOM   4397  O  O   . VAL C  1 171 ? -75.200  -2.918  -93.872  1.00 48.24  ? 152  VAL C O   1 
ATOM   4398  C  CB  . VAL C  1 171 ? -72.231  -1.848  -93.585  1.00 39.60  ? 152  VAL C CB  1 
ATOM   4399  C  CG1 . VAL C  1 171 ? -70.914  -1.308  -94.115  1.00 43.37  ? 152  VAL C CG1 1 
ATOM   4400  C  CG2 . VAL C  1 171 ? -73.075  -0.739  -92.956  1.00 37.82  ? 152  VAL C CG2 1 
ATOM   4401  N  N   . ASP C  1 172 ? -73.796  -4.667  -93.934  1.00 43.64  ? 153  ASP C N   1 
ATOM   4402  C  CA  . ASP C  1 172 ? -74.764  -5.598  -93.356  1.00 49.16  ? 153  ASP C CA  1 
ATOM   4403  C  C   . ASP C  1 172 ? -74.094  -6.597  -92.421  1.00 45.30  ? 153  ASP C C   1 
ATOM   4404  O  O   . ASP C  1 172 ? -72.941  -6.986  -92.638  1.00 46.65  ? 153  ASP C O   1 
ATOM   4405  C  CB  . ASP C  1 172 ? -75.511  -6.341  -94.464  1.00 62.45  ? 153  ASP C CB  1 
ATOM   4406  C  CG  . ASP C  1 172 ? -76.339  -5.404  -95.339  1.00 72.76  ? 153  ASP C CG  1 
ATOM   4407  O  OD1 . ASP C  1 172 ? -77.452  -5.027  -94.916  1.00 73.03  ? 153  ASP C OD1 1 
ATOM   4408  O  OD2 . ASP C  1 172 ? -75.883  -5.049  -96.452  1.00 79.69  ? 153  ASP C OD2 1 
ATOM   4409  N  N   . PRO C  1 173 ? -74.806  -7.003  -91.356  1.00 63.66  ? 154  PRO C N   1 
ATOM   4410  C  CA  . PRO C  1 173 ? -74.294  -8.035  -90.440  1.00 67.61  ? 154  PRO C CA  1 
ATOM   4411  C  C   . PRO C  1 173 ? -74.266  -9.397  -91.127  1.00 79.14  ? 154  PRO C C   1 
ATOM   4412  O  O   . PRO C  1 173 ? -74.857  -9.533  -92.203  1.00 85.08  ? 154  PRO C O   1 
ATOM   4413  C  CB  . PRO C  1 173 ? -75.324  -8.037  -89.304  1.00 56.87  ? 154  PRO C CB  1 
ATOM   4414  C  CG  . PRO C  1 173 ? -75.980  -6.701  -89.371  1.00 54.73  ? 154  PRO C CG  1 
ATOM   4415  C  CD  . PRO C  1 173 ? -76.034  -6.373  -90.843  1.00 59.89  ? 154  PRO C CD  1 
ATOM   4416  N  N   . THR C  1 174 ? -73.602  -10.383 -90.524  1.00 82.21  ? 155  THR C N   1 
ATOM   4417  C  CA  . THR C  1 174 ? -73.523  -11.723 -91.122  1.00 86.02  ? 155  THR C CA  1 
ATOM   4418  C  C   . THR C  1 174 ? -74.517  -12.703 -90.502  1.00 88.15  ? 155  THR C C   1 
ATOM   4419  O  O   . THR C  1 174 ? -75.303  -13.342 -91.213  1.00 86.50  ? 155  THR C O   1 
ATOM   4420  C  CB  . THR C  1 174 ? -72.098  -12.311 -91.036  1.00 85.58  ? 155  THR C CB  1 
ATOM   4421  O  OG1 . THR C  1 174 ? -71.254  -11.659 -91.997  1.00 86.40  ? 155  THR C OG1 1 
ATOM   4422  C  CG2 . THR C  1 174 ? -72.108  -13.809 -91.318  1.00 83.04  ? 155  THR C CG2 1 
ATOM   4423  N  N   . ASP C  1 180 ? -70.449  -16.478 -80.629  1.00 106.36 ? 161  ASP C N   1 
ATOM   4424  C  CA  . ASP C  1 180 ? -69.928  -15.264 -80.000  1.00 103.03 ? 161  ASP C CA  1 
ATOM   4425  C  C   . ASP C  1 180 ? -68.542  -15.519 -79.408  1.00 92.72  ? 161  ASP C C   1 
ATOM   4426  O  O   . ASP C  1 180 ? -67.530  -14.993 -79.883  1.00 89.44  ? 161  ASP C O   1 
ATOM   4427  C  CB  . ASP C  1 180 ? -70.874  -14.768 -78.894  1.00 106.62 ? 161  ASP C CB  1 
ATOM   4428  C  CG  . ASP C  1 180 ? -72.313  -14.581 -79.375  1.00 111.23 ? 161  ASP C CG  1 
ATOM   4429  O  OD1 . ASP C  1 180 ? -72.529  -14.425 -80.598  1.00 113.39 ? 161  ASP C OD1 1 
ATOM   4430  O  OD2 . ASP C  1 180 ? -73.229  -14.583 -78.519  1.00 112.23 ? 161  ASP C OD2 1 
ATOM   4431  N  N   . SER C  1 181 ? -68.511  -16.347 -78.372  1.00 86.81  ? 162  SER C N   1 
ATOM   4432  C  CA  . SER C  1 181 ? -67.271  -16.696 -77.687  1.00 83.83  ? 162  SER C CA  1 
ATOM   4433  C  C   . SER C  1 181 ? -66.501  -17.765 -78.452  1.00 81.81  ? 162  SER C C   1 
ATOM   4434  O  O   . SER C  1 181 ? -65.676  -18.480 -77.874  1.00 82.07  ? 162  SER C O   1 
ATOM   4435  C  CB  . SER C  1 181 ? -67.563  -17.211 -76.267  1.00 81.40  ? 162  SER C CB  1 
ATOM   4436  O  OG  . SER C  1 181 ? -68.187  -16.227 -75.464  1.00 81.59  ? 162  SER C OG  1 
ATOM   4437  N  N   . GLU C  1 182 ? -66.768  -17.880 -79.748  1.00 79.12  ? 163  GLU C N   1 
ATOM   4438  C  CA  . GLU C  1 182 ? -66.233  -18.996 -80.522  1.00 73.69  ? 163  GLU C CA  1 
ATOM   4439  C  C   . GLU C  1 182 ? -64.701  -19.032 -80.540  1.00 65.98  ? 163  GLU C C   1 
ATOM   4440  O  O   . GLU C  1 182 ? -64.096  -20.095 -80.342  1.00 64.92  ? 163  GLU C O   1 
ATOM   4441  C  CB  . GLU C  1 182 ? -66.787  -18.992 -81.941  1.00 70.91  ? 163  GLU C CB  1 
ATOM   4442  C  CG  . GLU C  1 182 ? -66.400  -20.238 -82.711  1.00 77.50  ? 163  GLU C CG  1 
ATOM   4443  C  CD  . GLU C  1 182 ? -66.798  -20.194 -84.188  1.00 80.08  ? 163  GLU C CD  1 
ATOM   4444  O  OE1 . GLU C  1 182 ? -67.118  -19.088 -84.703  1.00 81.57  ? 163  GLU C OE1 1 
ATOM   4445  O  OE2 . GLU C  1 182 ? -66.782  -21.276 -84.831  1.00 75.39  ? 163  GLU C OE2 1 
ATOM   4446  N  N   . TYR C  1 183 ? -64.083  -17.870 -80.762  1.00 52.68  ? 164  TYR C N   1 
ATOM   4447  C  CA  . TYR C  1 183 ? -62.627  -17.766 -80.753  1.00 41.49  ? 164  TYR C CA  1 
ATOM   4448  C  C   . TYR C  1 183 ? -62.134  -16.916 -79.614  1.00 45.69  ? 164  TYR C C   1 
ATOM   4449  O  O   . TYR C  1 183 ? -60.956  -16.553 -79.579  1.00 46.99  ? 164  TYR C O   1 
ATOM   4450  C  CB  . TYR C  1 183 ? -62.116  -17.168 -82.060  1.00 50.78  ? 164  TYR C CB  1 
ATOM   4451  C  CG  . TYR C  1 183 ? -62.619  -17.885 -83.298  1.00 50.11  ? 164  TYR C CG  1 
ATOM   4452  C  CD1 . TYR C  1 183 ? -62.360  -19.243 -83.491  1.00 51.52  ? 164  TYR C CD1 1 
ATOM   4453  C  CD2 . TYR C  1 183 ? -63.350  -17.209 -84.254  1.00 48.86  ? 164  TYR C CD2 1 
ATOM   4454  C  CE1 . TYR C  1 183 ? -62.823  -19.903 -84.597  1.00 59.94  ? 164  TYR C CE1 1 
ATOM   4455  C  CE2 . TYR C  1 183 ? -63.812  -17.851 -85.376  1.00 60.06  ? 164  TYR C CE2 1 
ATOM   4456  C  CZ  . TYR C  1 183 ? -63.552  -19.202 -85.548  1.00 65.78  ? 164  TYR C CZ  1 
ATOM   4457  O  OH  . TYR C  1 183 ? -64.022  -19.844 -86.677  1.00 68.68  ? 164  TYR C OH  1 
ATOM   4458  N  N   . PHE C  1 184 ? -63.027  -16.596 -78.676  1.00 46.34  ? 165  PHE C N   1 
ATOM   4459  C  CA  . PHE C  1 184 ? -62.646  -15.785 -77.536  1.00 41.87  ? 165  PHE C CA  1 
ATOM   4460  C  C   . PHE C  1 184 ? -61.680  -16.529 -76.597  1.00 44.19  ? 165  PHE C C   1 
ATOM   4461  O  O   . PHE C  1 184 ? -61.867  -17.704 -76.286  1.00 51.07  ? 165  PHE C O   1 
ATOM   4462  C  CB  . PHE C  1 184 ? -63.883  -15.290 -76.776  1.00 43.99  ? 165  PHE C CB  1 
ATOM   4463  C  CG  . PHE C  1 184 ? -63.603  -14.140 -75.851  1.00 32.75  ? 165  PHE C CG  1 
ATOM   4464  C  CD1 . PHE C  1 184 ? -63.393  -12.874 -76.353  1.00 32.48  ? 165  PHE C CD1 1 
ATOM   4465  C  CD2 . PHE C  1 184 ? -63.558  -14.328 -74.494  1.00 32.73  ? 165  PHE C CD2 1 
ATOM   4466  C  CE1 . PHE C  1 184 ? -63.135  -11.791 -75.506  1.00 37.48  ? 165  PHE C CE1 1 
ATOM   4467  C  CE2 . PHE C  1 184 ? -63.307  -13.248 -73.616  1.00 38.24  ? 165  PHE C CE2 1 
ATOM   4468  C  CZ  . PHE C  1 184 ? -63.089  -11.971 -74.135  1.00 34.42  ? 165  PHE C CZ  1 
ATOM   4469  N  N   . SER C  1 185 ? -60.647  -15.826 -76.145  1.00 41.01  ? 166  SER C N   1 
ATOM   4470  C  CA  . SER C  1 185 ? -59.621  -16.413 -75.297  1.00 36.31  ? 166  SER C CA  1 
ATOM   4471  C  C   . SER C  1 185 ? -60.169  -16.811 -73.934  1.00 40.96  ? 166  SER C C   1 
ATOM   4472  O  O   . SER C  1 185 ? -60.776  -16.001 -73.230  1.00 42.92  ? 166  SER C O   1 
ATOM   4473  C  CB  . SER C  1 185 ? -58.478  -15.418 -75.112  1.00 34.33  ? 166  SER C CB  1 
ATOM   4474  O  OG  . SER C  1 185 ? -57.414  -16.033 -74.418  1.00 39.45  ? 166  SER C OG  1 
ATOM   4475  N  N   . GLN C  1 186 ? -59.930  -18.055 -73.546  1.00 44.38  ? 167  GLN C N   1 
ATOM   4476  C  CA  . GLN C  1 186 ? -60.319  -18.516 -72.211  1.00 44.88  ? 167  GLN C CA  1 
ATOM   4477  C  C   . GLN C  1 186 ? -59.437  -17.896 -71.128  1.00 42.75  ? 167  GLN C C   1 
ATOM   4478  O  O   . GLN C  1 186 ? -59.730  -18.024 -69.947  1.00 43.50  ? 167  GLN C O   1 
ATOM   4479  C  CB  . GLN C  1 186 ? -60.242  -20.038 -72.109  1.00 42.57  ? 167  GLN C CB  1 
ATOM   4480  C  CG  . GLN C  1 186 ? -58.824  -20.570 -72.269  1.00 46.50  ? 167  GLN C CG  1 
ATOM   4481  C  CD  . GLN C  1 186 ? -58.756  -22.083 -72.172  1.00 55.58  ? 167  GLN C CD  1 
ATOM   4482  O  OE1 . GLN C  1 186 ? -58.207  -22.748 -73.047  1.00 65.82  ? 167  GLN C OE1 1 
ATOM   4483  N  NE2 . GLN C  1 186 ? -59.319  -22.631 -71.108  1.00 55.32  ? 167  GLN C NE2 1 
ATOM   4484  N  N   . TYR C  1 187 ? -58.368  -17.219 -71.542  1.00 37.76  ? 168  TYR C N   1 
ATOM   4485  C  CA  . TYR C  1 187 ? -57.412  -16.643 -70.608  1.00 36.39  ? 168  TYR C CA  1 
ATOM   4486  C  C   . TYR C  1 187 ? -57.625  -15.153 -70.378  1.00 33.37  ? 168  TYR C C   1 
ATOM   4487  O  O   . TYR C  1 187 ? -56.863  -14.502 -69.654  1.00 31.46  ? 168  TYR C O   1 
ATOM   4488  C  CB  . TYR C  1 187 ? -55.983  -16.922 -71.062  1.00 40.58  ? 168  TYR C CB  1 
ATOM   4489  C  CG  . TYR C  1 187 ? -55.727  -18.393 -71.236  1.00 46.11  ? 168  TYR C CG  1 
ATOM   4490  C  CD1 . TYR C  1 187 ? -55.842  -19.284 -70.154  1.00 47.88  ? 168  TYR C CD1 1 
ATOM   4491  C  CD2 . TYR C  1 187 ? -55.398  -18.909 -72.482  1.00 39.47  ? 168  TYR C CD2 1 
ATOM   4492  C  CE1 . TYR C  1 187 ? -55.620  -20.661 -70.324  1.00 47.81  ? 168  TYR C CE1 1 
ATOM   4493  C  CE2 . TYR C  1 187 ? -55.174  -20.267 -72.657  1.00 41.21  ? 168  TYR C CE2 1 
ATOM   4494  C  CZ  . TYR C  1 187 ? -55.286  -21.140 -71.586  1.00 45.82  ? 168  TYR C CZ  1 
ATOM   4495  O  OH  . TYR C  1 187 ? -55.056  -22.483 -71.791  1.00 49.06  ? 168  TYR C OH  1 
ATOM   4496  N  N   . SER C  1 188 ? -58.672  -14.618 -70.994  1.00 31.83  ? 169  SER C N   1 
ATOM   4497  C  CA  . SER C  1 188 ? -59.119  -13.261 -70.681  1.00 33.43  ? 169  SER C CA  1 
ATOM   4498  C  C   . SER C  1 188 ? -59.705  -13.192 -69.273  1.00 31.68  ? 169  SER C C   1 
ATOM   4499  O  O   . SER C  1 188 ? -60.205  -14.193 -68.735  1.00 38.43  ? 169  SER C O   1 
ATOM   4500  C  CB  . SER C  1 188 ? -60.178  -12.795 -71.677  1.00 35.65  ? 169  SER C CB  1 
ATOM   4501  O  OG  . SER C  1 188 ? -60.526  -11.445 -71.423  1.00 44.89  ? 169  SER C OG  1 
ATOM   4502  N  N   . ARG C  1 189 ? -59.652  -11.998 -68.690  1.00 31.42  ? 170  ARG C N   1 
ATOM   4503  C  CA  . ARG C  1 189 ? -60.231  -11.742 -67.382  1.00 31.44  ? 170  ARG C CA  1 
ATOM   4504  C  C   . ARG C  1 189 ? -61.692  -11.437 -67.580  1.00 45.66  ? 170  ARG C C   1 
ATOM   4505  O  O   . ARG C  1 189 ? -62.412  -11.168 -66.635  1.00 39.32  ? 170  ARG C O   1 
ATOM   4506  C  CB  . ARG C  1 189 ? -59.558  -10.553 -66.724  1.00 31.07  ? 170  ARG C CB  1 
ATOM   4507  C  CG  . ARG C  1 189 ? -58.069  -10.728 -66.560  1.00 52.03  ? 170  ARG C CG  1 
ATOM   4508  C  CD  . ARG C  1 189 ? -57.552  -10.041 -65.304  1.00 52.87  ? 170  ARG C CD  1 
ATOM   4509  N  NE  . ARG C  1 189 ? -57.622  -8.580  -65.339  1.00 56.99  ? 170  ARG C NE  1 
ATOM   4510  C  CZ  . ARG C  1 189 ? -57.841  -7.812  -64.268  1.00 69.55  ? 170  ARG C CZ  1 
ATOM   4511  N  NH1 . ARG C  1 189 ? -58.042  -8.350  -63.061  1.00 75.75  ? 170  ARG C NH1 1 
ATOM   4512  N  NH2 . ARG C  1 189 ? -57.872  -6.494  -64.404  1.00 72.61  ? 170  ARG C NH2 1 
ATOM   4513  N  N   . PHE C  1 190 ? -62.139  -11.486 -68.826  1.00 34.46  ? 171  PHE C N   1 
ATOM   4514  C  CA  . PHE C  1 190 ? -63.528  -11.187 -69.125  1.00 32.13  ? 171  PHE C CA  1 
ATOM   4515  C  C   . PHE C  1 190 ? -64.157  -12.355 -69.863  1.00 32.22  ? 171  PHE C C   1 
ATOM   4516  O  O   . PHE C  1 190 ? -63.449  -13.228 -70.388  1.00 35.82  ? 171  PHE C O   1 
ATOM   4517  C  CB  . PHE C  1 190 ? -63.613  -9.902  -69.946  1.00 31.31  ? 171  PHE C CB  1 
ATOM   4518  C  CG  . PHE C  1 190 ? -62.953  -8.716  -69.281  1.00 37.17  ? 171  PHE C CG  1 
ATOM   4519  C  CD1 . PHE C  1 190 ? -61.573  -8.540  -69.344  1.00 41.42  ? 171  PHE C CD1 1 
ATOM   4520  C  CD2 . PHE C  1 190 ? -63.712  -7.775  -68.587  1.00 36.70  ? 171  PHE C CD2 1 
ATOM   4521  C  CE1 . PHE C  1 190 ? -60.965  -7.442  -68.729  1.00 41.03  ? 171  PHE C CE1 1 
ATOM   4522  C  CE2 . PHE C  1 190 ? -63.107  -6.670  -67.967  1.00 34.39  ? 171  PHE C CE2 1 
ATOM   4523  C  CZ  . PHE C  1 190 ? -61.738  -6.506  -68.039  1.00 37.35  ? 171  PHE C CZ  1 
ATOM   4524  N  N   . GLU C  1 191 ? -65.485  -12.368 -69.895  1.00 32.88  ? 172  GLU C N   1 
ATOM   4525  C  CA  . GLU C  1 191 ? -66.235  -13.431 -70.542  1.00 41.64  ? 172  GLU C CA  1 
ATOM   4526  C  C   . GLU C  1 191 ? -67.424  -12.849 -71.296  1.00 45.07  ? 172  GLU C C   1 
ATOM   4527  O  O   . GLU C  1 191 ? -68.087  -11.932 -70.812  1.00 53.07  ? 172  GLU C O   1 
ATOM   4528  C  CB  . GLU C  1 191 ? -66.686  -14.481 -69.512  1.00 50.34  ? 172  GLU C CB  1 
ATOM   4529  C  CG  . GLU C  1 191 ? -67.613  -13.995 -68.396  1.00 54.67  ? 172  GLU C CG  1 
ATOM   4530  C  CD  . GLU C  1 191 ? -68.140  -15.160 -67.555  1.00 62.15  ? 172  GLU C CD  1 
ATOM   4531  O  OE1 . GLU C  1 191 ? -68.115  -16.304 -68.053  1.00 64.11  ? 172  GLU C OE1 1 
ATOM   4532  O  OE2 . GLU C  1 191 ? -68.579  -14.943 -66.400  1.00 64.61  ? 172  GLU C OE2 1 
ATOM   4533  N  N   . ILE C  1 192 ? -67.692  -13.367 -72.488  1.00 42.20  ? 173  ILE C N   1 
ATOM   4534  C  CA  . ILE C  1 192 ? -68.721  -12.765 -73.323  1.00 42.62  ? 173  ILE C CA  1 
ATOM   4535  C  C   . ILE C  1 192 ? -70.072  -13.407 -73.078  1.00 37.08  ? 173  ILE C C   1 
ATOM   4536  O  O   . ILE C  1 192 ? -70.223  -14.623 -73.197  1.00 38.40  ? 173  ILE C O   1 
ATOM   4537  C  CB  . ILE C  1 192 ? -68.365  -12.844 -74.824  1.00 46.93  ? 173  ILE C CB  1 
ATOM   4538  C  CG1 . ILE C  1 192 ? -67.058  -12.097 -75.087  1.00 46.49  ? 173  ILE C CG1 1 
ATOM   4539  C  CG2 . ILE C  1 192 ? -69.511  -12.279 -75.682  1.00 43.84  ? 173  ILE C CG2 1 
ATOM   4540  C  CD1 . ILE C  1 192 ? -66.759  -11.939 -76.535  1.00 48.84  ? 173  ILE C CD1 1 
ATOM   4541  N  N   . LEU C  1 193 ? -71.048  -12.578 -72.730  1.00 30.56  ? 174  LEU C N   1 
ATOM   4542  C  CA  . LEU C  1 193 ? -72.400  -13.056 -72.499  1.00 30.87  ? 174  LEU C CA  1 
ATOM   4543  C  C   . LEU C  1 193 ? -73.184  -13.131 -73.813  1.00 45.43  ? 174  LEU C C   1 
ATOM   4544  O  O   . LEU C  1 193 ? -73.836  -14.136 -74.106  1.00 53.37  ? 174  LEU C O   1 
ATOM   4545  C  CB  . LEU C  1 193 ? -73.114  -12.157 -71.486  1.00 23.79  ? 174  LEU C CB  1 
ATOM   4546  C  CG  . LEU C  1 193 ? -72.289  -11.918 -70.223  1.00 33.65  ? 174  LEU C CG  1 
ATOM   4547  C  CD1 . LEU C  1 193 ? -73.025  -10.987 -69.265  1.00 37.37  ? 174  LEU C CD1 1 
ATOM   4548  C  CD2 . LEU C  1 193 ? -71.918  -13.258 -69.554  1.00 36.24  ? 174  LEU C CD2 1 
ATOM   4549  N  N   . ASP C  1 194 ? -73.114  -12.067 -74.605  1.00 47.81  ? 175  ASP C N   1 
ATOM   4550  C  CA  . ASP C  1 194 ? -73.889  -11.998 -75.826  1.00 53.39  ? 175  ASP C CA  1 
ATOM   4551  C  C   . ASP C  1 194 ? -73.311  -10.974 -76.812  1.00 47.02  ? 175  ASP C C   1 
ATOM   4552  O  O   . ASP C  1 194 ? -72.736  -9.955  -76.406  1.00 48.20  ? 175  ASP C O   1 
ATOM   4553  C  CB  . ASP C  1 194 ? -75.362  -11.675 -75.510  1.00 62.16  ? 175  ASP C CB  1 
ATOM   4554  C  CG  . ASP C  1 194 ? -76.301  -12.002 -76.672  1.00 70.15  ? 175  ASP C CG  1 
ATOM   4555  O  OD1 . ASP C  1 194 ? -75.961  -12.889 -77.484  1.00 71.47  ? 175  ASP C OD1 1 
ATOM   4556  O  OD2 . ASP C  1 194 ? -77.377  -11.371 -76.771  1.00 73.43  ? 175  ASP C OD2 1 
ATOM   4557  N  N   . VAL C  1 195 ? -73.457  -11.265 -78.108  1.00 30.51  ? 176  VAL C N   1 
ATOM   4558  C  CA  . VAL C  1 195 ? -73.090  -10.319 -79.148  1.00 29.97  ? 176  VAL C CA  1 
ATOM   4559  C  C   . VAL C  1 195 ? -74.277  -10.111 -80.077  1.00 34.39  ? 176  VAL C C   1 
ATOM   4560  O  O   . VAL C  1 195 ? -74.751  -11.062 -80.693  1.00 39.55  ? 176  VAL C O   1 
ATOM   4561  C  CB  . VAL C  1 195 ? -71.900  -10.808 -80.006  1.00 28.30  ? 176  VAL C CB  1 
ATOM   4562  C  CG1 . VAL C  1 195 ? -71.577  -9.765  -81.067  1.00 36.26  ? 176  VAL C CG1 1 
ATOM   4563  C  CG2 . VAL C  1 195 ? -70.661  -11.074 -79.160  1.00 23.49  ? 176  VAL C CG2 1 
ATOM   4564  N  N   . THR C  1 196 ? -74.769  -8.881  -80.176  1.00 31.79  ? 177  THR C N   1 
ATOM   4565  C  CA  . THR C  1 196 ? -75.855  -8.583  -81.107  1.00 37.15  ? 177  THR C CA  1 
ATOM   4566  C  C   . THR C  1 196 ? -75.386  -7.522  -82.089  1.00 38.58  ? 177  THR C C   1 
ATOM   4567  O  O   . THR C  1 196 ? -74.552  -6.687  -81.741  1.00 40.74  ? 177  THR C O   1 
ATOM   4568  C  CB  . THR C  1 196 ? -77.146  -8.129  -80.408  1.00 45.62  ? 177  THR C CB  1 
ATOM   4569  O  OG1 . THR C  1 196 ? -76.940  -6.854  -79.781  1.00 55.11  ? 177  THR C OG1 1 
ATOM   4570  C  CG2 . THR C  1 196 ? -77.575  -9.163  -79.374  1.00 47.84  ? 177  THR C CG2 1 
ATOM   4571  N  N   . GLN C  1 197 ? -75.892  -7.584  -83.321  1.00 39.29  ? 178  GLN C N   1 
ATOM   4572  C  CA  . GLN C  1 197 ? -75.530  -6.629  -84.365  1.00 40.30  ? 178  GLN C CA  1 
ATOM   4573  C  C   . GLN C  1 197 ? -76.778  -5.931  -84.899  1.00 44.44  ? 178  GLN C C   1 
ATOM   4574  O  O   . GLN C  1 197 ? -77.877  -6.491  -84.906  1.00 49.74  ? 178  GLN C O   1 
ATOM   4575  C  CB  . GLN C  1 197 ? -74.779  -7.329  -85.495  1.00 47.97  ? 178  GLN C CB  1 
ATOM   4576  C  CG  . GLN C  1 197 ? -73.587  -8.176  -85.018  1.00 67.90  ? 178  GLN C CG  1 
ATOM   4577  C  CD  . GLN C  1 197 ? -72.489  -8.352  -86.085  1.00 77.15  ? 178  GLN C CD  1 
ATOM   4578  O  OE1 . GLN C  1 197 ? -72.712  -8.100  -87.276  1.00 78.45  ? 178  GLN C OE1 1 
ATOM   4579  N  NE2 . GLN C  1 197 ? -71.295  -8.782  -85.649  1.00 77.22  ? 178  GLN C NE2 1 
ATOM   4580  N  N   . LYS C  1 198 ? -76.612  -4.704  -85.361  1.00 42.44  ? 179  LYS C N   1 
ATOM   4581  C  CA  . LYS C  1 198 ? -77.750  -3.892  -85.764  1.00 40.37  ? 179  LYS C CA  1 
ATOM   4582  C  C   . LYS C  1 198 ? -77.281  -2.889  -86.793  1.00 44.14  ? 179  LYS C C   1 
ATOM   4583  O  O   . LYS C  1 198 ? -76.234  -2.253  -86.643  1.00 50.43  ? 179  LYS C O   1 
ATOM   4584  C  CB  . LYS C  1 198 ? -78.370  -3.158  -84.564  1.00 38.98  ? 179  LYS C CB  1 
ATOM   4585  C  CG  . LYS C  1 198 ? -79.417  -2.095  -84.927  1.00 41.20  ? 179  LYS C CG  1 
ATOM   4586  C  CD  . LYS C  1 198 ? -79.716  -1.115  -83.749  1.00 120.34 ? 179  LYS C CD  1 
ATOM   4587  C  CE  . LYS C  1 198 ? -80.782  -0.040  -84.109  1.00 76.29  ? 179  LYS C CE  1 
ATOM   4588  N  NZ  . LYS C  1 198 ? -81.108  0.942   -83.006  1.00 73.05  ? 179  LYS C NZ  1 
ATOM   4589  N  N   . LYS C  1 199 ? -78.060  -2.755  -87.850  1.00 44.46  ? 180  LYS C N   1 
ATOM   4590  C  CA  . LYS C  1 199 ? -77.677  -1.894  -88.958  1.00 43.48  ? 180  LYS C CA  1 
ATOM   4591  C  C   . LYS C  1 199 ? -78.394  -0.551  -88.842  1.00 41.67  ? 180  LYS C C   1 
ATOM   4592  O  O   . LYS C  1 199 ? -79.575  -0.487  -88.479  1.00 46.67  ? 180  LYS C O   1 
ATOM   4593  C  CB  . LYS C  1 199 ? -77.986  -2.584  -90.291  1.00 40.76  ? 180  LYS C CB  1 
ATOM   4594  C  CG  . LYS C  1 199 ? -77.909  -1.668  -91.479  1.00 48.20  ? 180  LYS C CG  1 
ATOM   4595  C  CD  . LYS C  1 199 ? -78.291  -2.406  -92.754  1.00 54.68  ? 180  LYS C CD  1 
ATOM   4596  C  CE  . LYS C  1 199 ? -78.402  -1.443  -93.915  1.00 56.25  ? 180  LYS C CE  1 
ATOM   4597  N  NZ  . LYS C  1 199 ? -78.344  -2.129  -95.248  1.00 56.87  ? 180  LYS C NZ  1 
ATOM   4598  N  N   . ASN C  1 200 ? -77.665  0.525   -89.119  1.00 34.84  ? 181  ASN C N   1 
ATOM   4599  C  CA  . ASN C  1 200 ? -78.227  1.867   -89.095  1.00 29.16  ? 181  ASN C CA  1 
ATOM   4600  C  C   . ASN C  1 200 ? -77.894  2.650   -90.347  1.00 36.18  ? 181  ASN C C   1 
ATOM   4601  O  O   . ASN C  1 200 ? -76.980  2.312   -91.108  1.00 39.89  ? 181  ASN C O   1 
ATOM   4602  C  CB  . ASN C  1 200 ? -77.709  2.646   -87.901  1.00 34.99  ? 181  ASN C CB  1 
ATOM   4603  C  CG  . ASN C  1 200 ? -78.042  1.978   -86.592  1.00 45.07  ? 181  ASN C CG  1 
ATOM   4604  O  OD1 . ASN C  1 200 ? -79.202  1.971   -86.161  1.00 49.00  ? 181  ASN C OD1 1 
ATOM   4605  N  ND2 . ASN C  1 200 ? -77.028  1.404   -85.946  1.00 44.21  ? 181  ASN C ND2 1 
ATOM   4606  N  N   . SER C  1 201 ? -78.647  3.718   -90.550  1.00 38.34  ? 182  SER C N   1 
ATOM   4607  C  CA  . SER C  1 201 ? -78.436  4.608   -91.678  1.00 38.44  ? 182  SER C CA  1 
ATOM   4608  C  C   . SER C  1 201 ? -78.549  6.040   -91.157  1.00 36.18  ? 182  SER C C   1 
ATOM   4609  O  O   . SER C  1 201 ? -79.630  6.478   -90.741  1.00 33.42  ? 182  SER C O   1 
ATOM   4610  C  CB  . SER C  1 201 ? -79.470  4.326   -92.784  1.00 37.66  ? 182  SER C CB  1 
ATOM   4611  O  OG  . SER C  1 201 ? -79.187  5.049   -93.972  1.00 33.34  ? 182  SER C OG  1 
ATOM   4612  N  N   . VAL C  1 202 ? -77.431  6.763   -91.168  1.00 36.82  ? 183  VAL C N   1 
ATOM   4613  C  CA  . VAL C  1 202 ? -77.359  8.062   -90.503  1.00 39.79  ? 183  VAL C CA  1 
ATOM   4614  C  C   . VAL C  1 202 ? -76.990  9.153   -91.479  1.00 45.28  ? 183  VAL C C   1 
ATOM   4615  O  O   . VAL C  1 202 ? -76.136  8.955   -92.336  1.00 47.64  ? 183  VAL C O   1 
ATOM   4616  C  CB  . VAL C  1 202 ? -76.283  8.041   -89.386  1.00 32.35  ? 183  VAL C CB  1 
ATOM   4617  C  CG1 . VAL C  1 202 ? -76.147  9.374   -88.734  1.00 20.45  ? 183  VAL C CG1 1 
ATOM   4618  C  CG2 . VAL C  1 202 ? -76.583  6.938   -88.372  1.00 21.25  ? 183  VAL C CG2 1 
ATOM   4619  N  N   . THR C  1 203 ? -77.620  10.314  -91.350  1.00 46.11  ? 184  THR C N   1 
ATOM   4620  C  CA  . THR C  1 203 ? -77.199  11.464  -92.136  1.00 42.03  ? 184  THR C CA  1 
ATOM   4621  C  C   . THR C  1 203 ? -76.439  12.441  -91.249  1.00 48.50  ? 184  THR C C   1 
ATOM   4622  O  O   . THR C  1 203 ? -76.776  12.694  -90.080  1.00 60.96  ? 184  THR C O   1 
ATOM   4623  C  CB  . THR C  1 203 ? -78.338  12.197  -92.780  1.00 39.65  ? 184  THR C CB  1 
ATOM   4624  O  OG1 . THR C  1 203 ? -79.162  11.323  -93.542  1.00 42.62  ? 184  THR C OG1 1 
ATOM   4625  C  CG2 . THR C  1 203 ? -77.831  13.280  -93.674  1.00 32.78  ? 184  THR C CG2 1 
ATOM   4626  N  N   . TYR C  1 204 ? -75.362  12.954  -91.810  1.00 40.84  ? 185  TYR C N   1 
ATOM   4627  C  CA  . TYR C  1 204 ? -74.459  13.803  -91.064  1.00 40.54  ? 185  TYR C CA  1 
ATOM   4628  C  C   . TYR C  1 204 ? -74.569  15.220  -91.582  1.00 52.55  ? 185  TYR C C   1 
ATOM   4629  O  O   . TYR C  1 204 ? -75.017  15.441  -92.708  1.00 56.59  ? 185  TYR C O   1 
ATOM   4630  C  CB  . TYR C  1 204 ? -73.023  13.275  -91.169  1.00 37.26  ? 185  TYR C CB  1 
ATOM   4631  C  CG  . TYR C  1 204 ? -72.859  11.881  -90.595  1.00 42.89  ? 185  TYR C CG  1 
ATOM   4632  C  CD1 . TYR C  1 204 ? -73.229  10.749  -91.330  1.00 46.36  ? 185  TYR C CD1 1 
ATOM   4633  C  CD2 . TYR C  1 204 ? -72.357  11.693  -89.315  1.00 33.59  ? 185  TYR C CD2 1 
ATOM   4634  C  CE1 . TYR C  1 204 ? -73.098  9.483   -90.802  1.00 38.69  ? 185  TYR C CE1 1 
ATOM   4635  C  CE2 . TYR C  1 204 ? -72.221  10.433  -88.794  1.00 30.02  ? 185  TYR C CE2 1 
ATOM   4636  C  CZ  . TYR C  1 204 ? -72.589  9.331   -89.536  1.00 31.74  ? 185  TYR C CZ  1 
ATOM   4637  O  OH  . TYR C  1 204 ? -72.448  8.061   -89.005  1.00 39.72  ? 185  TYR C OH  1 
ATOM   4638  N  N   . SER C  1 205 ? -74.156  16.174  -90.749  1.00 58.85  ? 186  SER C N   1 
ATOM   4639  C  CA  . SER C  1 205 ? -74.293  17.600  -91.050  1.00 53.67  ? 186  SER C CA  1 
ATOM   4640  C  C   . SER C  1 205 ? -73.596  17.997  -92.329  1.00 36.71  ? 186  SER C C   1 
ATOM   4641  O  O   . SER C  1 205 ? -74.093  18.831  -93.070  1.00 45.77  ? 186  SER C O   1 
ATOM   4642  C  CB  . SER C  1 205 ? -73.746  18.432  -89.887  1.00 55.17  ? 186  SER C CB  1 
ATOM   4643  O  OG  . SER C  1 205 ? -74.502  18.192  -88.716  1.00 51.74  ? 186  SER C OG  1 
ATOM   4644  N  N   . CYS C  1 206 ? -72.441  17.389  -92.566  1.00 25.76  ? 187  CYS C N   1 
ATOM   4645  C  CA  . CYS C  1 206 ? -71.577  17.738  -93.689  1.00 33.92  ? 187  CYS C CA  1 
ATOM   4646  C  C   . CYS C  1 206 ? -72.208  17.469  -95.066  1.00 41.02  ? 187  CYS C C   1 
ATOM   4647  O  O   . CYS C  1 206 ? -71.982  18.220  -96.005  1.00 40.88  ? 187  CYS C O   1 
ATOM   4648  C  CB  . CYS C  1 206 ? -70.259  16.962  -93.583  1.00 30.17  ? 187  CYS C CB  1 
ATOM   4649  S  SG  . CYS C  1 206 ? -70.369  15.214  -94.117  1.00 78.88  ? 187  CYS C SG  1 
ATOM   4650  N  N   . CYS C  1 207 ? -72.990  16.393  -95.166  1.00 46.07  ? 188  CYS C N   1 
ATOM   4651  C  CA  . CYS C  1 207 ? -73.364  15.813  -96.451  1.00 46.72  ? 188  CYS C CA  1 
ATOM   4652  C  C   . CYS C  1 207 ? -74.844  15.482  -96.484  1.00 56.43  ? 188  CYS C C   1 
ATOM   4653  O  O   . CYS C  1 207 ? -75.437  15.164  -95.453  1.00 67.13  ? 188  CYS C O   1 
ATOM   4654  C  CB  . CYS C  1 207 ? -72.532  14.553  -96.705  1.00 49.91  ? 188  CYS C CB  1 
ATOM   4655  S  SG  . CYS C  1 207 ? -70.812  14.653  -96.049  1.00 81.92  ? 188  CYS C SG  1 
ATOM   4656  N  N   . PRO C  1 208 ? -75.451  15.569  -97.674  1.00 54.23  ? 189  PRO C N   1 
ATOM   4657  C  CA  . PRO C  1 208 ? -76.896  15.365  -97.824  1.00 52.00  ? 189  PRO C CA  1 
ATOM   4658  C  C   . PRO C  1 208 ? -77.289  13.890  -97.821  1.00 50.90  ? 189  PRO C C   1 
ATOM   4659  O  O   . PRO C  1 208 ? -78.445  13.593  -97.515  1.00 53.98  ? 189  PRO C O   1 
ATOM   4660  C  CB  . PRO C  1 208 ? -77.186  15.986  -99.190  1.00 55.87  ? 189  PRO C CB  1 
ATOM   4661  C  CG  . PRO C  1 208 ? -75.883  15.817  -99.954  1.00 52.00  ? 189  PRO C CG  1 
ATOM   4662  C  CD  . PRO C  1 208 ? -74.798  15.976  -98.935  1.00 50.22  ? 189  PRO C CD  1 
ATOM   4663  N  N   . GLU C  1 209 ? -76.356  12.993  -98.152  1.00 50.38  ? 190  GLU C N   1 
ATOM   4664  C  CA  . GLU C  1 209 ? -76.668  11.561  -98.258  1.00 53.64  ? 190  GLU C CA  1 
ATOM   4665  C  C   . GLU C  1 209 ? -76.554  10.819  -96.933  1.00 42.88  ? 190  GLU C C   1 
ATOM   4666  O  O   . GLU C  1 209 ? -75.976  11.319  -95.971  1.00 40.49  ? 190  GLU C O   1 
ATOM   4667  C  CB  . GLU C  1 209 ? -75.775  10.872  -99.289  1.00 67.27  ? 190  GLU C CB  1 
ATOM   4668  C  CG  . GLU C  1 209 ? -75.663  11.599  -100.614 1.00 78.66  ? 190  GLU C CG  1 
ATOM   4669  C  CD  . GLU C  1 209 ? -74.537  12.626  -100.613 1.00 90.03  ? 190  GLU C CD  1 
ATOM   4670  O  OE1 . GLU C  1 209 ? -73.883  12.798  -99.547  1.00 92.26  ? 190  GLU C OE1 1 
ATOM   4671  O  OE2 . GLU C  1 209 ? -74.304  13.247  -101.679 1.00 92.51  ? 190  GLU C OE2 1 
ATOM   4672  N  N   . ALA C  1 210 ? -77.115  9.618   -96.892  1.00 33.73  ? 191  ALA C N   1 
ATOM   4673  C  CA  . ALA C  1 210 ? -77.083  8.811   -95.680  1.00 31.01  ? 191  ALA C CA  1 
ATOM   4674  C  C   . ALA C  1 210 ? -75.946  7.778   -95.743  1.00 35.14  ? 191  ALA C C   1 
ATOM   4675  O  O   . ALA C  1 210 ? -75.716  7.122   -96.778  1.00 36.56  ? 191  ALA C O   1 
ATOM   4676  C  CB  . ALA C  1 210 ? -78.419  8.122   -95.461  1.00 24.59  ? 191  ALA C CB  1 
ATOM   4677  N  N   . TYR C  1 211 ? -75.237  7.639   -94.634  1.00 32.33  ? 192  TYR C N   1 
ATOM   4678  C  CA  . TYR C  1 211 ? -74.162  6.667   -94.532  1.00 17.77  ? 192  TYR C CA  1 
ATOM   4679  C  C   . TYR C  1 211 ? -74.587  5.531   -93.636  1.00 17.76  ? 192  TYR C C   1 
ATOM   4680  O  O   . TYR C  1 211 ? -75.132  5.738   -92.523  1.00 22.99  ? 192  TYR C O   1 
ATOM   4681  C  CB  . TYR C  1 211 ? -72.903  7.335   -93.979  1.00 36.66  ? 192  TYR C CB  1 
ATOM   4682  C  CG  . TYR C  1 211 ? -72.286  8.335   -94.926  1.00 32.68  ? 192  TYR C CG  1 
ATOM   4683  C  CD1 . TYR C  1 211 ? -72.895  9.547   -95.185  1.00 36.53  ? 192  TYR C CD1 1 
ATOM   4684  C  CD2 . TYR C  1 211 ? -71.109  8.051   -95.579  1.00 31.24  ? 192  TYR C CD2 1 
ATOM   4685  C  CE1 . TYR C  1 211 ? -72.336  10.453  -96.065  1.00 37.70  ? 192  TYR C CE1 1 
ATOM   4686  C  CE2 . TYR C  1 211 ? -70.542  8.947   -96.458  1.00 33.69  ? 192  TYR C CE2 1 
ATOM   4687  C  CZ  . TYR C  1 211 ? -71.152  10.149  -96.693  1.00 36.54  ? 192  TYR C CZ  1 
ATOM   4688  O  OH  . TYR C  1 211 ? -70.575  11.051  -97.563  1.00 40.14  ? 192  TYR C OH  1 
ATOM   4689  N  N   . GLU C  1 212 ? -74.346  4.319   -94.107  1.00 19.96  ? 193  GLU C N   1 
ATOM   4690  C  CA  . GLU C  1 212 ? -74.700  3.144   -93.314  1.00 31.46  ? 193  GLU C CA  1 
ATOM   4691  C  C   . GLU C  1 212 ? -73.603  2.743   -92.326  1.00 29.53  ? 193  GLU C C   1 
ATOM   4692  O  O   . GLU C  1 212 ? -72.414  2.956   -92.578  1.00 31.57  ? 193  GLU C O   1 
ATOM   4693  C  CB  . GLU C  1 212 ? -75.062  1.972   -94.231  1.00 36.18  ? 193  GLU C CB  1 
ATOM   4694  C  CG  . GLU C  1 212 ? -76.234  2.277   -95.142  1.00 44.17  ? 193  GLU C CG  1 
ATOM   4695  C  CD  . GLU C  1 212 ? -76.808  1.030   -95.803  1.00 45.29  ? 193  GLU C CD  1 
ATOM   4696  O  OE1 . GLU C  1 212 ? -76.225  -0.062  -95.600  1.00 44.50  ? 193  GLU C OE1 1 
ATOM   4697  O  OE2 . GLU C  1 212 ? -77.842  1.152   -96.514  1.00 43.62  ? 193  GLU C OE2 1 
ATOM   4698  N  N   . ASP C  1 213 ? -74.010  2.167   -91.204  1.00 28.84  ? 194  ASP C N   1 
ATOM   4699  C  CA  . ASP C  1 213 ? -73.060  1.582   -90.260  1.00 31.65  ? 194  ASP C CA  1 
ATOM   4700  C  C   . ASP C  1 213 ? -73.623  0.290   -89.659  1.00 32.00  ? 194  ASP C C   1 
ATOM   4701  O  O   . ASP C  1 213 ? -74.822  0.008   -89.745  1.00 32.27  ? 194  ASP C O   1 
ATOM   4702  C  CB  . ASP C  1 213 ? -72.724  2.568   -89.144  1.00 36.45  ? 194  ASP C CB  1 
ATOM   4703  C  CG  . ASP C  1 213 ? -73.931  2.870   -88.253  1.00 49.03  ? 194  ASP C CG  1 
ATOM   4704  O  OD1 . ASP C  1 213 ? -74.222  2.050   -87.347  1.00 55.43  ? 194  ASP C OD1 1 
ATOM   4705  O  OD2 . ASP C  1 213 ? -74.590  3.917   -88.456  1.00 51.89  ? 194  ASP C OD2 1 
ATOM   4706  N  N   . VAL C  1 214 ? -72.745  -0.500  -89.062  1.00 30.72  ? 195  VAL C N   1 
ATOM   4707  C  CA  . VAL C  1 214 ? -73.185  -1.599  -88.232  1.00 35.54  ? 195  VAL C CA  1 
ATOM   4708  C  C   . VAL C  1 214 ? -72.816  -1.306  -86.780  1.00 37.35  ? 195  VAL C C   1 
ATOM   4709  O  O   . VAL C  1 214 ? -71.684  -0.898  -86.487  1.00 38.77  ? 195  VAL C O   1 
ATOM   4710  C  CB  . VAL C  1 214 ? -72.553  -2.899  -88.703  1.00 39.93  ? 195  VAL C CB  1 
ATOM   4711  C  CG1 . VAL C  1 214 ? -72.814  -4.018  -87.708  1.00 40.43  ? 195  VAL C CG1 1 
ATOM   4712  C  CG2 . VAL C  1 214 ? -73.125  -3.257  -90.066  1.00 45.26  ? 195  VAL C CG2 1 
ATOM   4713  N  N   . GLU C  1 215 ? -73.776  -1.480  -85.875  1.00 37.80  ? 196  GLU C N   1 
ATOM   4714  C  CA  . GLU C  1 215 ? -73.495  -1.366  -84.452  1.00 34.99  ? 196  GLU C CA  1 
ATOM   4715  C  C   . GLU C  1 215 ? -73.442  -2.753  -83.847  1.00 36.81  ? 196  GLU C C   1 
ATOM   4716  O  O   . GLU C  1 215 ? -74.452  -3.451  -83.758  1.00 36.09  ? 196  GLU C O   1 
ATOM   4717  C  CB  . GLU C  1 215 ? -74.526  -0.486  -83.739  1.00 38.87  ? 196  GLU C CB  1 
ATOM   4718  C  CG  . GLU C  1 215 ? -74.206  1.013   -83.792  1.00 50.08  ? 196  GLU C CG  1 
ATOM   4719  C  CD  . GLU C  1 215 ? -75.311  1.897   -83.213  1.00 58.77  ? 196  GLU C CD  1 
ATOM   4720  O  OE1 . GLU C  1 215 ? -76.296  1.347   -82.664  1.00 58.14  ? 196  GLU C OE1 1 
ATOM   4721  O  OE2 . GLU C  1 215 ? -75.184  3.144   -83.318  1.00 64.73  ? 196  GLU C OE2 1 
ATOM   4722  N  N   . VAL C  1 216 ? -72.243  -3.153  -83.443  1.00 37.31  ? 197  VAL C N   1 
ATOM   4723  C  CA  . VAL C  1 216 ? -72.046  -4.418  -82.763  1.00 31.82  ? 197  VAL C CA  1 
ATOM   4724  C  C   . VAL C  1 216 ? -72.103  -4.139  -81.287  1.00 33.01  ? 197  VAL C C   1 
ATOM   4725  O  O   . VAL C  1 216 ? -71.313  -3.333  -80.786  1.00 34.69  ? 197  VAL C O   1 
ATOM   4726  C  CB  . VAL C  1 216 ? -70.684  -5.006  -83.129  1.00 30.95  ? 197  VAL C CB  1 
ATOM   4727  C  CG1 . VAL C  1 216 ? -70.457  -6.334  -82.431  1.00 17.10  ? 197  VAL C CG1 1 
ATOM   4728  C  CG2 . VAL C  1 216 ? -70.595  -5.174  -84.667  1.00 27.75  ? 197  VAL C CG2 1 
ATOM   4729  N  N   . SER C  1 217 ? -73.056  -4.773  -80.601  1.00 38.84  ? 198  SER C N   1 
ATOM   4730  C  CA  . SER C  1 217 ? -73.179  -4.668  -79.136  1.00 41.57  ? 198  SER C CA  1 
ATOM   4731  C  C   . SER C  1 217 ? -72.497  -5.835  -78.432  1.00 38.46  ? 198  SER C C   1 
ATOM   4732  O  O   . SER C  1 217 ? -72.937  -6.979  -78.531  1.00 43.59  ? 198  SER C O   1 
ATOM   4733  C  CB  . SER C  1 217 ? -74.643  -4.577  -78.698  1.00 38.52  ? 198  SER C CB  1 
ATOM   4734  O  OG  . SER C  1 217 ? -75.184  -3.323  -79.040  1.00 40.51  ? 198  SER C OG  1 
ATOM   4735  N  N   . LEU C  1 218 ? -71.415  -5.530  -77.726  1.00 33.23  ? 199  LEU C N   1 
ATOM   4736  C  CA  . LEU C  1 218 ? -70.665  -6.539  -76.992  1.00 32.92  ? 199  LEU C CA  1 
ATOM   4737  C  C   . LEU C  1 218 ? -71.083  -6.550  -75.529  1.00 32.30  ? 199  LEU C C   1 
ATOM   4738  O  O   . LEU C  1 218 ? -70.784  -5.623  -74.774  1.00 34.40  ? 199  LEU C O   1 
ATOM   4739  C  CB  . LEU C  1 218 ? -69.167  -6.262  -77.115  1.00 28.96  ? 199  LEU C CB  1 
ATOM   4740  C  CG  . LEU C  1 218 ? -68.224  -7.233  -76.417  1.00 26.15  ? 199  LEU C CG  1 
ATOM   4741  C  CD1 . LEU C  1 218 ? -68.412  -8.651  -76.939  1.00 25.52  ? 199  LEU C CD1 1 
ATOM   4742  C  CD2 . LEU C  1 218 ? -66.792  -6.768  -76.629  1.00 17.55  ? 199  LEU C CD2 1 
ATOM   4743  N  N   . ASN C  1 219 ? -71.804  -7.589  -75.132  1.00 33.88  ? 200  ASN C N   1 
ATOM   4744  C  CA  . ASN C  1 219 ? -72.201  -7.745  -73.741  1.00 34.84  ? 200  ASN C CA  1 
ATOM   4745  C  C   . ASN C  1 219 ? -71.215  -8.668  -73.047  1.00 31.60  ? 200  ASN C C   1 
ATOM   4746  O  O   . ASN C  1 219 ? -71.135  -9.857  -73.346  1.00 35.63  ? 200  ASN C O   1 
ATOM   4747  C  CB  . ASN C  1 219 ? -73.641  -8.269  -73.634  1.00 38.13  ? 200  ASN C CB  1 
ATOM   4748  C  CG  . ASN C  1 219 ? -74.126  -8.411  -72.173  1.00 36.62  ? 200  ASN C CG  1 
ATOM   4749  O  OD1 . ASN C  1 219 ? -74.825  -9.374  -71.845  1.00 41.00  ? 200  ASN C OD1 1 
ATOM   4750  N  ND2 . ASN C  1 219 ? -73.757  -7.451  -71.302  1.00 23.56  ? 200  ASN C ND2 1 
ATOM   4751  N  N   . PHE C  1 220 ? -70.451  -8.109  -72.121  1.00 28.19  ? 201  PHE C N   1 
ATOM   4752  C  CA  . PHE C  1 220 ? -69.391  -8.865  -71.469  1.00 28.91  ? 201  PHE C CA  1 
ATOM   4753  C  C   . PHE C  1 220 ? -69.311  -8.489  -70.000  1.00 30.63  ? 201  PHE C C   1 
ATOM   4754  O  O   . PHE C  1 220 ? -69.859  -7.454  -69.588  1.00 25.05  ? 201  PHE C O   1 
ATOM   4755  C  CB  . PHE C  1 220 ? -68.043  -8.594  -72.160  1.00 27.03  ? 201  PHE C CB  1 
ATOM   4756  C  CG  . PHE C  1 220 ? -67.504  -7.209  -71.917  1.00 27.23  ? 201  PHE C CG  1 
ATOM   4757  C  CD1 . PHE C  1 220 ? -68.121  -6.101  -72.488  1.00 30.73  ? 201  PHE C CD1 1 
ATOM   4758  C  CD2 . PHE C  1 220 ? -66.395  -7.010  -71.113  1.00 32.74  ? 201  PHE C CD2 1 
ATOM   4759  C  CE1 . PHE C  1 220 ? -67.643  -4.821  -72.254  1.00 34.75  ? 201  PHE C CE1 1 
ATOM   4760  C  CE2 . PHE C  1 220 ? -65.901  -5.727  -70.869  1.00 33.94  ? 201  PHE C CE2 1 
ATOM   4761  C  CZ  . PHE C  1 220 ? -66.525  -4.634  -71.438  1.00 36.02  ? 201  PHE C CZ  1 
ATOM   4762  N  N   . ARG C  1 221 ? -68.636  -9.332  -69.218  1.00 35.81  ? 202  ARG C N   1 
ATOM   4763  C  CA  . ARG C  1 221 ? -68.457  -9.072  -67.797  1.00 39.46  ? 202  ARG C CA  1 
ATOM   4764  C  C   . ARG C  1 221 ? -67.145  -9.613  -67.294  1.00 37.09  ? 202  ARG C C   1 
ATOM   4765  O  O   . ARG C  1 221 ? -66.535  -10.518 -67.889  1.00 19.34  ? 202  ARG C O   1 
ATOM   4766  C  CB  . ARG C  1 221 ? -69.603  -9.645  -66.964  1.00 46.63  ? 202  ARG C CB  1 
ATOM   4767  C  CG  . ARG C  1 221 ? -69.528  -11.150 -66.811  1.00 53.75  ? 202  ARG C CG  1 
ATOM   4768  C  CD  . ARG C  1 221 ? -70.639  -11.692 -65.934  1.00 61.38  ? 202  ARG C CD  1 
ATOM   4769  N  NE  . ARG C  1 221 ? -70.691  -13.154 -66.012  1.00 63.93  ? 202  ARG C NE  1 
ATOM   4770  C  CZ  . ARG C  1 221 ? -71.804  -13.882 -65.931  1.00 65.33  ? 202  ARG C CZ  1 
ATOM   4771  N  NH1 . ARG C  1 221 ? -72.984  -13.294 -65.764  1.00 68.55  ? 202  ARG C NH1 1 
ATOM   4772  N  NH2 . ARG C  1 221 ? -71.734  -15.206 -66.020  1.00 63.15  ? 202  ARG C NH2 1 
ATOM   4773  N  N   . LYS C  1 222 ? -66.732  -9.032  -66.173  1.00 38.20  ? 203  LYS C N   1 
ATOM   4774  C  CA  . LYS C  1 222 ? -65.495  -9.420  -65.519  1.00 40.46  ? 203  LYS C CA  1 
ATOM   4775  C  C   . LYS C  1 222 ? -65.680  -10.767 -64.835  1.00 35.88  ? 203  LYS C C   1 
ATOM   4776  O  O   . LYS C  1 222 ? -66.626  -10.947 -64.087  1.00 33.55  ? 203  LYS C O   1 
ATOM   4777  C  CB  . LYS C  1 222 ? -65.079  -8.352  -64.518  1.00 39.32  ? 203  LYS C CB  1 
ATOM   4778  C  CG  . LYS C  1 222 ? -63.598  -8.271  -64.276  1.00 38.77  ? 203  LYS C CG  1 
ATOM   4779  C  CD  . LYS C  1 222 ? -63.180  -6.832  -63.940  1.00 41.14  ? 203  LYS C CD  1 
ATOM   4780  C  CE  . LYS C  1 222 ? -61.703  -6.793  -63.620  1.00 42.53  ? 203  LYS C CE  1 
ATOM   4781  N  NZ  . LYS C  1 222 ? -61.029  -7.922  -64.329  1.00 46.25  ? 203  LYS C NZ  1 
ATOM   4782  N  N   . LYS C  1 223 ? -64.824  -11.735 -65.168  1.00 34.07  ? 204  LYS C N   1 
ATOM   4783  C  CA  . LYS C  1 223 ? -64.737  -12.972 -64.416  1.00 26.80  ? 204  LYS C CA  1 
ATOM   4784  C  C   . LYS C  1 223 ? -64.106  -12.528 -63.121  1.00 31.86  ? 204  LYS C C   1 
ATOM   4785  O  O   . LYS C  1 223 ? -63.380  -11.526 -63.119  1.00 34.14  ? 204  LYS C O   1 
ATOM   4786  C  CB  . LYS C  1 223 ? -63.778  -13.932 -65.096  1.00 23.33  ? 204  LYS C CB  1 
ATOM   4787  C  CG  . LYS C  1 223 ? -64.251  -14.519 -66.393  1.00 27.44  ? 204  LYS C CG  1 
ATOM   4788  C  CD  . LYS C  1 223 ? -63.051  -15.094 -67.153  1.00 31.35  ? 204  LYS C CD  1 
ATOM   4789  C  CE  . LYS C  1 223 ? -63.006  -16.610 -67.042  1.00 35.64  ? 204  LYS C CE  1 
ATOM   4790  N  NZ  . LYS C  1 223 ? -62.071  -17.250 -68.018  1.00 38.75  ? 204  LYS C NZ  1 
ATOM   4791  N  N   . GLY C  1 224 ? -64.368  -13.244 -62.030  1.00 33.70  ? 205  GLY C N   1 
ATOM   4792  C  CA  . GLY C  1 224 ? -63.658  -13.000 -60.781  1.00 35.83  ? 205  GLY C CA  1 
ATOM   4793  C  C   . GLY C  1 224 ? -62.256  -13.564 -60.899  1.00 40.08  ? 205  GLY C C   1 
ATOM   4794  O  O   . GLY C  1 224 ? -62.029  -14.449 -61.728  1.00 42.36  ? 205  GLY C O   1 
ATOM   4795  N  N   . ARG C  1 225 ? -61.314  -13.060 -60.097  1.00 40.08  ? 206  ARG C N   1 
ATOM   4796  C  CA  . ARG C  1 225 ? -59.937  -13.564 -60.137  1.00 38.96  ? 206  ARG C CA  1 
ATOM   4797  C  C   . ARG C  1 225 ? -59.835  -15.004 -59.590  1.00 42.88  ? 206  ARG C C   1 
ATOM   4798  O  O   . ARG C  1 225 ? -59.769  -15.990 -60.353  1.00 38.02  ? 206  ARG C O   1 
ATOM   4799  C  CB  . ARG C  1 225 ? -59.010  -12.629 -59.363  1.00 40.52  ? 206  ARG C CB  1 
ATOM   4800  C  CG  . ARG C  1 225 ? -58.997  -12.901 -57.867  1.00 42.19  ? 206  ARG C CG  1 
ATOM   4801  C  CD  . ARG C  1 225 ? -58.376  -11.746 -57.053  1.00 40.31  ? 206  ARG C CD  1 
ATOM   4802  N  NE  . ARG C  1 225 ? -56.969  -11.430 -57.350  1.00 36.13  ? 206  ARG C NE  1 
ATOM   4803  C  CZ  . ARG C  1 225 ? -55.899  -12.027 -56.808  1.00 30.76  ? 206  ARG C CZ  1 
ATOM   4804  N  NH1 . ARG C  1 225 ? -56.042  -13.018 -55.940  1.00 27.77  ? 206  ARG C NH1 1 
ATOM   4805  N  NH2 . ARG C  1 225 ? -54.666  -11.637 -57.147  1.00 21.84  ? 206  ARG C NH2 1 
ATOM   4806  N  N   . LEU D  1 20  ? -67.814  9.828   -118.772 1.00 56.37  ? 1    LEU D N   1 
ATOM   4807  C  CA  . LEU D  1 20  ? -66.930  9.663   -117.623 1.00 57.88  ? 1    LEU D CA  1 
ATOM   4808  C  C   . LEU D  1 20  ? -67.569  8.793   -116.553 1.00 60.87  ? 1    LEU D C   1 
ATOM   4809  O  O   . LEU D  1 20  ? -68.700  9.055   -116.130 1.00 65.52  ? 1    LEU D O   1 
ATOM   4810  C  CB  . LEU D  1 20  ? -66.594  11.025  -117.002 1.00 57.50  ? 1    LEU D CB  1 
ATOM   4811  C  CG  . LEU D  1 20  ? -65.550  11.892  -117.696 1.00 55.36  ? 1    LEU D CG  1 
ATOM   4812  C  CD1 . LEU D  1 20  ? -65.296  13.166  -116.896 1.00 56.25  ? 1    LEU D CD1 1 
ATOM   4813  C  CD2 . LEU D  1 20  ? -64.268  11.102  -117.879 1.00 54.11  ? 1    LEU D CD2 1 
ATOM   4814  N  N   . ASP D  1 21  ? -66.848  7.762   -116.115 1.00 59.12  ? 2    ASP D N   1 
ATOM   4815  C  CA  . ASP D  1 21  ? -67.204  7.049   -114.876 1.00 54.72  ? 2    ASP D CA  1 
ATOM   4816  C  C   . ASP D  1 21  ? -66.150  7.292   -113.765 1.00 35.35  ? 2    ASP D C   1 
ATOM   4817  O  O   . ASP D  1 21  ? -65.152  8.001   -113.992 1.00 33.74  ? 2    ASP D O   1 
ATOM   4818  C  CB  . ASP D  1 21  ? -67.443  5.556   -115.140 1.00 45.91  ? 2    ASP D CB  1 
ATOM   4819  C  CG  . ASP D  1 21  ? -66.250  4.877   -115.764 1.00 46.07  ? 2    ASP D CG  1 
ATOM   4820  O  OD1 . ASP D  1 21  ? -65.150  5.468   -115.754 1.00 45.24  ? 2    ASP D OD1 1 
ATOM   4821  O  OD2 . ASP D  1 21  ? -66.403  3.738   -116.251 1.00 53.48  ? 2    ASP D OD2 1 
ATOM   4822  N  N   . ARG D  1 22  ? -66.365  6.711   -112.583 1.00 36.72  ? 3    ARG D N   1 
ATOM   4823  C  CA  . ARG D  1 22  ? -65.425  6.875   -111.469 1.00 38.98  ? 3    ARG D CA  1 
ATOM   4824  C  C   . ARG D  1 22  ? -63.991  6.543   -111.863 1.00 39.61  ? 3    ARG D C   1 
ATOM   4825  O  O   . ARG D  1 22  ? -63.055  7.321   -111.597 1.00 44.82  ? 3    ARG D O   1 
ATOM   4826  C  CB  . ARG D  1 22  ? -65.837  6.027   -110.257 1.00 43.33  ? 3    ARG D CB  1 
ATOM   4827  C  CG  . ARG D  1 22  ? -66.931  6.638   -109.417 1.00 52.30  ? 3    ARG D CG  1 
ATOM   4828  C  CD  . ARG D  1 22  ? -67.465  5.675   -108.361 1.00 60.33  ? 3    ARG D CD  1 
ATOM   4829  N  NE  . ARG D  1 22  ? -68.615  6.266   -107.682 1.00 74.89  ? 3    ARG D NE  1 
ATOM   4830  C  CZ  . ARG D  1 22  ? -69.877  6.116   -108.078 1.00 87.49  ? 3    ARG D CZ  1 
ATOM   4831  N  NH1 . ARG D  1 22  ? -70.154  5.360   -109.138 1.00 90.81  ? 3    ARG D NH1 1 
ATOM   4832  N  NH2 . ARG D  1 22  ? -70.864  6.712   -107.406 1.00 90.70  ? 3    ARG D NH2 1 
ATOM   4833  N  N   . ALA D  1 23  ? -63.827  5.383   -112.492 1.00 31.53  ? 4    ALA D N   1 
ATOM   4834  C  CA  . ALA D  1 23  ? -62.513  4.935   -112.924 1.00 30.69  ? 4    ALA D CA  1 
ATOM   4835  C  C   . ALA D  1 23  ? -61.801  6.019   -113.716 1.00 32.28  ? 4    ALA D C   1 
ATOM   4836  O  O   . ALA D  1 23  ? -60.638  6.310   -113.449 1.00 39.31  ? 4    ALA D O   1 
ATOM   4837  C  CB  . ALA D  1 23  ? -62.624  3.651   -113.735 1.00 35.02  ? 4    ALA D CB  1 
ATOM   4838  N  N   . ASP D  1 24  ? -62.501  6.639   -114.663 1.00 28.95  ? 5    ASP D N   1 
ATOM   4839  C  CA  . ASP D  1 24  ? -61.864  7.636   -115.508 1.00 40.04  ? 5    ASP D CA  1 
ATOM   4840  C  C   . ASP D  1 24  ? -61.492  8.877   -114.713 1.00 33.37  ? 5    ASP D C   1 
ATOM   4841  O  O   . ASP D  1 24  ? -60.383  9.403   -114.846 1.00 32.79  ? 5    ASP D O   1 
ATOM   4842  C  CB  . ASP D  1 24  ? -62.763  8.023   -116.688 1.00 54.93  ? 5    ASP D CB  1 
ATOM   4843  C  CG  . ASP D  1 24  ? -63.073  6.843   -117.616 1.00 69.01  ? 5    ASP D CG  1 
ATOM   4844  O  OD1 . ASP D  1 24  ? -62.201  5.949   -117.793 1.00 71.88  ? 5    ASP D OD1 1 
ATOM   4845  O  OD2 . ASP D  1 24  ? -64.199  6.819   -118.174 1.00 73.18  ? 5    ASP D OD2 1 
ATOM   4846  N  N   . ILE D  1 25  ? -62.429  9.345   -113.892 1.00 32.79  ? 6    ILE D N   1 
ATOM   4847  C  CA  . ILE D  1 25  ? -62.207  10.521  -113.053 1.00 37.56  ? 6    ILE D CA  1 
ATOM   4848  C  C   . ILE D  1 25  ? -60.999  10.330  -112.123 1.00 39.32  ? 6    ILE D C   1 
ATOM   4849  O  O   . ILE D  1 25  ? -60.120  11.192  -112.019 1.00 28.13  ? 6    ILE D O   1 
ATOM   4850  C  CB  . ILE D  1 25  ? -63.475  10.855  -112.237 1.00 39.11  ? 6    ILE D CB  1 
ATOM   4851  C  CG1 . ILE D  1 25  ? -64.615  11.257  -113.195 1.00 37.24  ? 6    ILE D CG1 1 
ATOM   4852  C  CG2 . ILE D  1 25  ? -63.178  11.950  -111.196 1.00 40.66  ? 6    ILE D CG2 1 
ATOM   4853  C  CD1 . ILE D  1 25  ? -65.995  11.342  -112.550 1.00 37.55  ? 6    ILE D CD1 1 
ATOM   4854  N  N   . LEU D  1 26  ? -60.949  9.173   -111.476 1.00 34.36  ? 7    LEU D N   1 
ATOM   4855  C  CA  . LEU D  1 26  ? -59.856  8.879   -110.571 1.00 34.16  ? 7    LEU D CA  1 
ATOM   4856  C  C   . LEU D  1 26  ? -58.530  8.764   -111.307 1.00 30.65  ? 7    LEU D C   1 
ATOM   4857  O  O   . LEU D  1 26  ? -57.486  9.225   -110.829 1.00 29.17  ? 7    LEU D O   1 
ATOM   4858  C  CB  . LEU D  1 26  ? -60.169  7.622   -109.768 1.00 34.19  ? 7    LEU D CB  1 
ATOM   4859  C  CG  . LEU D  1 26  ? -61.319  7.875   -108.775 1.00 32.68  ? 7    LEU D CG  1 
ATOM   4860  C  CD1 . LEU D  1 26  ? -62.000  6.580   -108.399 1.00 27.47  ? 7    LEU D CD1 1 
ATOM   4861  C  CD2 . LEU D  1 26  ? -60.792  8.597   -107.533 1.00 27.16  ? 7    LEU D CD2 1 
ATOM   4862  N  N   . TYR D  1 27  ? -58.587  8.178   -112.494 1.00 33.38  ? 8    TYR D N   1 
ATOM   4863  C  CA  . TYR D  1 27  ? -57.420  8.098   -113.363 1.00 28.05  ? 8    TYR D CA  1 
ATOM   4864  C  C   . TYR D  1 27  ? -56.903  9.485   -113.714 1.00 28.09  ? 8    TYR D C   1 
ATOM   4865  O  O   . TYR D  1 27  ? -55.719  9.753   -113.562 1.00 38.88  ? 8    TYR D O   1 
ATOM   4866  C  CB  . TYR D  1 27  ? -57.752  7.310   -114.627 1.00 32.39  ? 8    TYR D CB  1 
ATOM   4867  C  CG  . TYR D  1 27  ? -56.595  7.200   -115.604 1.00 41.54  ? 8    TYR D CG  1 
ATOM   4868  C  CD1 . TYR D  1 27  ? -55.550  6.303   -115.388 1.00 48.07  ? 8    TYR D CD1 1 
ATOM   4869  C  CD2 . TYR D  1 27  ? -56.548  7.990   -116.740 1.00 43.82  ? 8    TYR D CD2 1 
ATOM   4870  C  CE1 . TYR D  1 27  ? -54.489  6.208   -116.276 1.00 49.79  ? 8    TYR D CE1 1 
ATOM   4871  C  CE2 . TYR D  1 27  ? -55.497  7.902   -117.630 1.00 48.50  ? 8    TYR D CE2 1 
ATOM   4872  C  CZ  . TYR D  1 27  ? -54.470  7.009   -117.399 1.00 52.03  ? 8    TYR D CZ  1 
ATOM   4873  O  OH  . TYR D  1 27  ? -53.422  6.930   -118.300 1.00 57.57  ? 8    TYR D OH  1 
ATOM   4874  N  N   . ASN D  1 28  ? -57.763  10.349  -114.162 1.00 28.31  ? 9    ASN D N   1 
ATOM   4875  C  CA  . ASN D  1 28  ? -57.333  11.647  -114.515 1.00 36.07  ? 9    ASN D CA  1 
ATOM   4876  C  C   . ASN D  1 28  ? -56.764  12.363  -113.344 1.00 36.48  ? 9    ASN D C   1 
ATOM   4877  O  O   . ASN D  1 28  ? -55.786  13.046  -113.456 1.00 32.82  ? 9    ASN D O   1 
ATOM   4878  C  CB  . ASN D  1 28  ? -58.510  12.455  -115.018 1.00 46.49  ? 9    ASN D CB  1 
ATOM   4879  C  CG  . ASN D  1 28  ? -59.129  11.904  -116.274 1.00 51.54  ? 9    ASN D CG  1 
ATOM   4880  O  OD1 . ASN D  1 28  ? -58.531  11.155  -117.008 1.00 55.87  ? 9    ASN D OD1 1 
ATOM   4881  N  ND2 . ASN D  1 28  ? -60.347  12.297  -116.522 1.00 49.15  ? 9    ASN D ND2 1 
ATOM   4882  N  N   . ILE D  1 29  ? -57.405  12.240  -112.207 1.00 36.93  ? 10   ILE D N   1 
ATOM   4883  C  CA  . ILE D  1 29  ? -56.989  12.963  -111.039 1.00 34.23  ? 10   ILE D CA  1 
ATOM   4884  C  C   . ILE D  1 29  ? -55.617  12.500  -110.650 1.00 33.47  ? 10   ILE D C   1 
ATOM   4885  O  O   . ILE D  1 29  ? -54.782  13.278  -110.284 1.00 34.28  ? 10   ILE D O   1 
ATOM   4886  C  CB  . ILE D  1 29  ? -58.023  12.794  -109.917 1.00 40.83  ? 10   ILE D CB  1 
ATOM   4887  C  CG1 . ILE D  1 29  ? -59.195  13.730  -110.139 1.00 38.56  ? 10   ILE D CG1 1 
ATOM   4888  C  CG2 . ILE D  1 29  ? -57.450  13.104  -108.558 1.00 43.57  ? 10   ILE D CG2 1 
ATOM   4889  C  CD1 . ILE D  1 29  ? -60.312  13.552  -109.157 1.00 38.49  ? 10   ILE D CD1 1 
ATOM   4890  N  N   . ARG D  1 30  ? -55.405  11.205  -110.713 1.00 35.45  ? 11   ARG D N   1 
ATOM   4891  C  CA  . ARG D  1 30  ? -54.144  10.610  -110.341 1.00 39.93  ? 11   ARG D CA  1 
ATOM   4892  C  C   . ARG D  1 30  ? -53.020  11.020  -111.263 1.00 42.35  ? 11   ARG D C   1 
ATOM   4893  O  O   . ARG D  1 30  ? -51.925  11.283  -110.838 1.00 42.87  ? 11   ARG D O   1 
ATOM   4894  C  CB  . ARG D  1 30  ? -54.312  9.093   -110.266 1.00 45.06  ? 11   ARG D CB  1 
ATOM   4895  C  CG  . ARG D  1 30  ? -53.055  8.281   -110.113 1.00 53.57  ? 11   ARG D CG  1 
ATOM   4896  C  CD  . ARG D  1 30  ? -53.294  6.846   -109.681 1.00 60.69  ? 11   ARG D CD  1 
ATOM   4897  N  NE  . ARG D  1 30  ? -54.624  6.335   -109.968 1.00 65.05  ? 11   ARG D NE  1 
ATOM   4898  C  CZ  . ARG D  1 30  ? -54.940  5.488   -110.939 1.00 65.97  ? 11   ARG D CZ  1 
ATOM   4899  N  NH1 . ARG D  1 30  ? -54.030  5.038   -111.769 1.00 64.78  ? 11   ARG D NH1 1 
ATOM   4900  N  NH2 . ARG D  1 30  ? -56.189  5.100   -111.077 1.00 63.15  ? 11   ARG D NH2 1 
ATOM   4901  N  N   . GLN D  1 31  ? -53.304  11.050  -112.546 1.00 42.37  ? 12   GLN D N   1 
ATOM   4902  C  CA  . GLN D  1 31  ? -52.382  11.525  -113.544 1.00 37.19  ? 12   GLN D CA  1 
ATOM   4903  C  C   . GLN D  1 31  ? -52.045  13.002  -113.500 1.00 41.11  ? 12   GLN D C   1 
ATOM   4904  O  O   . GLN D  1 31  ? -50.930  13.386  -113.727 1.00 48.50  ? 12   GLN D O   1 
ATOM   4905  C  CB  . GLN D  1 31  ? -52.878  11.147  -114.907 1.00 35.76  ? 12   GLN D CB  1 
ATOM   4906  C  CG  . GLN D  1 31  ? -53.026  9.671   -115.081 1.00 40.74  ? 12   GLN D CG  1 
ATOM   4907  C  CD  . GLN D  1 31  ? -51.720  8.958   -114.965 1.00 52.19  ? 12   GLN D CD  1 
ATOM   4908  O  OE1 . GLN D  1 31  ? -51.626  7.907   -114.368 1.00 59.99  ? 12   GLN D OE1 1 
ATOM   4909  N  NE2 . GLN D  1 31  ? -50.700  9.539   -115.511 1.00 54.84  ? 12   GLN D NE2 1 
ATOM   4910  N  N   . THR D  1 32  ? -53.017  13.837  -113.227 1.00 35.19  ? 13   THR D N   1 
ATOM   4911  C  CA  . THR D  1 32  ? -52.872  15.273  -113.453 1.00 39.32  ? 13   THR D CA  1 
ATOM   4912  C  C   . THR D  1 32  ? -52.890  16.181  -112.216 1.00 54.60  ? 13   THR D C   1 
ATOM   4913  O  O   . THR D  1 32  ? -52.477  17.345  -112.287 1.00 63.55  ? 13   THR D O   1 
ATOM   4914  C  CB  . THR D  1 32  ? -53.928  15.807  -114.444 1.00 33.45  ? 13   THR D CB  1 
ATOM   4915  O  OG1 . THR D  1 32  ? -55.241  15.504  -113.956 1.00 29.38  ? 13   THR D OG1 1 
ATOM   4916  C  CG2 . THR D  1 32  ? -53.741  15.195  -115.813 1.00 37.85  ? 13   THR D CG2 1 
ATOM   4917  N  N   . SER D  1 33  ? -53.397  15.700  -111.095 1.00 58.51  ? 14   SER D N   1 
ATOM   4918  C  CA  . SER D  1 33  ? -53.353  16.555  -109.916 1.00 59.51  ? 14   SER D CA  1 
ATOM   4919  C  C   . SER D  1 33  ? -51.891  16.703  -109.489 1.00 61.78  ? 14   SER D C   1 
ATOM   4920  O  O   . SER D  1 33  ? -51.053  15.812  -109.705 1.00 62.86  ? 14   SER D O   1 
ATOM   4921  C  CB  . SER D  1 33  ? -54.207  16.005  -108.774 1.00 55.48  ? 14   SER D CB  1 
ATOM   4922  O  OG  . SER D  1 33  ? -53.431  15.143  -107.967 1.00 59.90  ? 14   SER D OG  1 
ATOM   4923  N  N   . ARG D  1 34  ? -51.583  17.853  -108.914 1.00 60.17  ? 15   ARG D N   1 
ATOM   4924  C  CA  . ARG D  1 34  ? -50.218  18.156  -108.516 1.00 56.08  ? 15   ARG D CA  1 
ATOM   4925  C  C   . ARG D  1 34  ? -50.208  18.399  -107.015 1.00 52.31  ? 15   ARG D C   1 
ATOM   4926  O  O   . ARG D  1 34  ? -50.402  19.535  -106.568 1.00 53.87  ? 15   ARG D O   1 
ATOM   4927  C  CB  . ARG D  1 34  ? -49.754  19.402  -109.263 1.00 53.16  ? 15   ARG D CB  1 
ATOM   4928  C  CG  . ARG D  1 34  ? -49.747  19.258  -110.769 1.00 45.43  ? 15   ARG D CG  1 
ATOM   4929  C  CD  . ARG D  1 34  ? -48.473  18.569  -111.223 1.00 45.08  ? 15   ARG D CD  1 
ATOM   4930  N  NE  . ARG D  1 34  ? -47.287  19.241  -110.691 1.00 48.51  ? 15   ARG D NE  1 
ATOM   4931  C  CZ  . ARG D  1 34  ? -46.646  20.231  -111.307 1.00 55.86  ? 15   ARG D CZ  1 
ATOM   4932  N  NH1 . ARG D  1 34  ? -47.077  20.666  -112.490 1.00 64.53  ? 15   ARG D NH1 1 
ATOM   4933  N  NH2 . ARG D  1 34  ? -45.575  20.786  -110.749 1.00 53.34  ? 15   ARG D NH2 1 
ATOM   4934  N  N   . PRO D  1 35  ? -50.012  17.323  -106.230 1.00 49.54  ? 16   PRO D N   1 
ATOM   4935  C  CA  . PRO D  1 35  ? -50.140  17.360  -104.761 1.00 46.04  ? 16   PRO D CA  1 
ATOM   4936  C  C   . PRO D  1 35  ? -49.212  18.399  -104.124 1.00 35.60  ? 16   PRO D C   1 
ATOM   4937  O  O   . PRO D  1 35  ? -49.524  18.963  -103.081 1.00 32.54  ? 16   PRO D O   1 
ATOM   4938  C  CB  . PRO D  1 35  ? -49.743  15.936  -104.329 1.00 43.60  ? 16   PRO D CB  1 
ATOM   4939  C  CG  . PRO D  1 35  ? -49.953  15.096  -105.545 1.00 47.31  ? 16   PRO D CG  1 
ATOM   4940  C  CD  . PRO D  1 35  ? -49.636  15.985  -106.719 1.00 48.84  ? 16   PRO D CD  1 
ATOM   4941  N  N   . ASP D  1 36  ? -48.084  18.635  -104.775 1.00 30.10  ? 17   ASP D N   1 
ATOM   4942  C  CA  . ASP D  1 36  ? -47.090  19.611  -104.354 1.00 30.29  ? 17   ASP D CA  1 
ATOM   4943  C  C   . ASP D  1 36  ? -47.490  21.070  -104.651 1.00 31.64  ? 17   ASP D C   1 
ATOM   4944  O  O   . ASP D  1 36  ? -46.844  22.018  -104.187 1.00 31.22  ? 17   ASP D O   1 
ATOM   4945  C  CB  . ASP D  1 36  ? -45.747  19.300  -105.049 1.00 25.02  ? 17   ASP D CB  1 
ATOM   4946  C  CG  . ASP D  1 36  ? -45.891  19.082  -106.593 1.00 99.90  ? 17   ASP D CG  1 
ATOM   4947  O  OD1 . ASP D  1 36  ? -46.870  18.441  -107.054 1.00 98.60  ? 17   ASP D OD1 1 
ATOM   4948  O  OD2 . ASP D  1 36  ? -45.010  19.545  -107.360 1.00 99.47  ? 17   ASP D OD2 1 
ATOM   4949  N  N   . VAL D  1 37  ? -48.549  21.249  -105.432 1.00 33.66  ? 18   VAL D N   1 
ATOM   4950  C  CA  . VAL D  1 37  ? -48.879  22.557  -105.965 1.00 25.66  ? 18   VAL D CA  1 
ATOM   4951  C  C   . VAL D  1 37  ? -50.163  23.094  -105.361 1.00 31.45  ? 18   VAL D C   1 
ATOM   4952  O  O   . VAL D  1 37  ? -51.241  22.533  -105.566 1.00 28.32  ? 18   VAL D O   1 
ATOM   4953  C  CB  . VAL D  1 37  ? -49.012  22.519  -107.502 1.00 34.30  ? 18   VAL D CB  1 
ATOM   4954  C  CG1 . VAL D  1 37  ? -49.348  23.935  -108.070 1.00 26.22  ? 18   VAL D CG1 1 
ATOM   4955  C  CG2 . VAL D  1 37  ? -47.727  21.923  -108.128 1.00 26.00  ? 18   VAL D CG2 1 
ATOM   4956  N  N   . ILE D  1 38  ? -50.038  24.180  -104.598 1.00 30.52  ? 19   ILE D N   1 
ATOM   4957  C  CA  . ILE D  1 38  ? -51.191  24.861  -104.037 1.00 29.94  ? 19   ILE D CA  1 
ATOM   4958  C  C   . ILE D  1 38  ? -52.089  25.444  -105.143 1.00 41.59  ? 19   ILE D C   1 
ATOM   4959  O  O   . ILE D  1 38  ? -51.625  26.210  -106.005 1.00 42.89  ? 19   ILE D O   1 
ATOM   4960  C  CB  . ILE D  1 38  ? -50.740  25.955  -103.066 1.00 25.31  ? 19   ILE D CB  1 
ATOM   4961  C  CG1 . ILE D  1 38  ? -51.936  26.690  -102.461 1.00 26.94  ? 19   ILE D CG1 1 
ATOM   4962  C  CG2 . ILE D  1 38  ? -49.804  26.926  -103.740 1.00 25.38  ? 19   ILE D CG2 1 
ATOM   4963  C  CD1 . ILE D  1 38  ? -51.549  27.515  -101.251 1.00 25.35  ? 19   ILE D CD1 1 
ATOM   4964  N  N   . PRO D  1 39  ? -53.388  25.080  -105.124 1.00 39.78  ? 20   PRO D N   1 
ATOM   4965  C  CA  . PRO D  1 39  ? -54.328  25.428  -106.194 1.00 33.71  ? 20   PRO D CA  1 
ATOM   4966  C  C   . PRO D  1 39  ? -54.761  26.870  -106.099 1.00 42.07  ? 20   PRO D C   1 
ATOM   4967  O  O   . PRO D  1 39  ? -55.965  27.146  -106.065 1.00 38.13  ? 20   PRO D O   1 
ATOM   4968  C  CB  . PRO D  1 39  ? -55.528  24.513  -105.909 1.00 27.31  ? 20   PRO D CB  1 
ATOM   4969  C  CG  . PRO D  1 39  ? -55.498  24.302  -104.450 1.00 26.14  ? 20   PRO D CG  1 
ATOM   4970  C  CD  . PRO D  1 39  ? -54.043  24.323  -104.043 1.00 25.88  ? 20   PRO D CD  1 
ATOM   4971  N  N   . THR D  1 40  ? -53.786  27.775  -106.052 1.00 56.58  ? 21   THR D N   1 
ATOM   4972  C  CA  . THR D  1 40  ? -54.061  29.199  -105.928 1.00 67.97  ? 21   THR D CA  1 
ATOM   4973  C  C   . THR D  1 40  ? -54.638  29.725  -107.247 1.00 73.53  ? 21   THR D C   1 
ATOM   4974  O  O   . THR D  1 40  ? -54.203  29.330  -108.330 1.00 72.77  ? 21   THR D O   1 
ATOM   4975  C  CB  . THR D  1 40  ? -52.807  29.973  -105.478 1.00 70.69  ? 21   THR D CB  1 
ATOM   4976  O  OG1 . THR D  1 40  ? -53.164  31.314  -105.123 1.00 78.84  ? 21   THR D OG1 1 
ATOM   4977  C  CG2 . THR D  1 40  ? -51.752  29.978  -106.570 1.00 65.52  ? 21   THR D CG2 1 
ATOM   4978  N  N   . GLN D  1 41  ? -55.660  30.570  -107.134 1.00 78.15  ? 22   GLN D N   1 
ATOM   4979  C  CA  . GLN D  1 41  ? -56.444  30.999  -108.284 1.00 84.28  ? 22   GLN D CA  1 
ATOM   4980  C  C   . GLN D  1 41  ? -56.270  32.495  -108.570 1.00 83.54  ? 22   GLN D C   1 
ATOM   4981  O  O   . GLN D  1 41  ? -56.834  33.338  -107.866 1.00 82.46  ? 22   GLN D O   1 
ATOM   4982  C  CB  . GLN D  1 41  ? -57.933  30.655  -108.077 1.00 90.28  ? 22   GLN D CB  1 
ATOM   4983  C  CG  . GLN D  1 41  ? -58.852  31.099  -109.235 1.00 96.73  ? 22   GLN D CG  1 
ATOM   4984  C  CD  . GLN D  1 41  ? -60.183  30.345  -109.294 1.00 98.60  ? 22   GLN D CD  1 
ATOM   4985  O  OE1 . GLN D  1 41  ? -60.615  29.740  -108.306 1.00 98.32  ? 22   GLN D OE1 1 
ATOM   4986  N  NE2 . GLN D  1 41  ? -60.831  30.372  -110.464 1.00 96.77  ? 22   GLN D NE2 1 
ATOM   4987  N  N   . ARG D  1 42  ? -55.486  32.804  -109.605 1.00 82.20  ? 23   ARG D N   1 
ATOM   4988  C  CA  . ARG D  1 42  ? -55.252  34.183  -110.061 1.00 81.49  ? 23   ARG D CA  1 
ATOM   4989  C  C   . ARG D  1 42  ? -54.720  35.082  -108.950 1.00 80.06  ? 23   ARG D C   1 
ATOM   4990  O  O   . ARG D  1 42  ? -55.203  36.206  -108.759 1.00 77.35  ? 23   ARG D O   1 
ATOM   4991  C  CB  . ARG D  1 42  ? -56.517  34.796  -110.689 1.00 81.75  ? 23   ARG D CB  1 
ATOM   4992  C  CG  . ARG D  1 42  ? -57.203  33.907  -111.742 1.00 83.24  ? 23   ARG D CG  1 
ATOM   4993  C  CD  . ARG D  1 42  ? -56.569  33.941  -113.159 1.00 73.34  ? 23   ARG D CD  1 
ATOM   4994  N  NE  . ARG D  1 42  ? -55.283  33.234  -113.303 1.00 70.44  ? 23   ARG D NE  1 
ATOM   4995  C  CZ  . ARG D  1 42  ? -55.101  31.911  -113.232 1.00 60.67  ? 23   ARG D CZ  1 
ATOM   4996  N  NH1 . ARG D  1 42  ? -56.112  31.081  -112.982 1.00 53.91  ? 23   ARG D NH1 1 
ATOM   4997  N  NH2 . ARG D  1 42  ? -53.885  31.415  -113.405 1.00 56.92  ? 23   ARG D NH2 1 
ATOM   4998  N  N   . ASP D  1 43  ? -53.730  34.562  -108.224 1.00 82.99  ? 24   ASP D N   1 
ATOM   4999  C  CA  . ASP D  1 43  ? -53.104  35.261  -107.100 1.00 83.67  ? 24   ASP D CA  1 
ATOM   5000  C  C   . ASP D  1 43  ? -54.068  35.596  -105.950 1.00 80.92  ? 24   ASP D C   1 
ATOM   5001  O  O   . ASP D  1 43  ? -53.825  36.503  -105.157 1.00 79.91  ? 24   ASP D O   1 
ATOM   5002  C  CB  . ASP D  1 43  ? -52.345  36.505  -107.587 1.00 82.71  ? 24   ASP D CB  1 
ATOM   5003  C  CG  . ASP D  1 43  ? -50.952  36.171  -108.101 1.00 81.54  ? 24   ASP D CG  1 
ATOM   5004  O  OD1 . ASP D  1 43  ? -50.550  34.984  -107.996 1.00 84.10  ? 24   ASP D OD1 1 
ATOM   5005  O  OD2 . ASP D  1 43  ? -50.264  37.091  -108.598 1.00 75.31  ? 24   ASP D OD2 1 
ATOM   5006  N  N   . ARG D  1 44  ? -55.164  34.856  -105.870 1.00 80.36  ? 25   ARG D N   1 
ATOM   5007  C  CA  . ARG D  1 44  ? -56.065  34.969  -104.738 1.00 84.85  ? 25   ARG D CA  1 
ATOM   5008  C  C   . ARG D  1 44  ? -55.877  33.722  -103.874 1.00 78.39  ? 25   ARG D C   1 
ATOM   5009  O  O   . ARG D  1 44  ? -55.832  32.604  -104.407 1.00 75.95  ? 25   ARG D O   1 
ATOM   5010  C  CB  . ARG D  1 44  ? -57.520  35.078  -105.210 1.00 92.76  ? 25   ARG D CB  1 
ATOM   5011  C  CG  . ARG D  1 44  ? -57.726  36.014  -106.382 1.00 99.24  ? 25   ARG D CG  1 
ATOM   5012  C  CD  . ARG D  1 44  ? -59.173  36.028  -106.838 1.00 105.29 ? 25   ARG D CD  1 
ATOM   5013  N  NE  . ARG D  1 44  ? -59.338  36.816  -108.058 1.00 112.50 ? 25   ARG D NE  1 
ATOM   5014  C  CZ  . ARG D  1 44  ? -59.459  38.142  -108.088 1.00 117.29 ? 25   ARG D CZ  1 
ATOM   5015  N  NH1 . ARG D  1 44  ? -59.435  38.840  -106.961 1.00 119.73 ? 25   ARG D NH1 1 
ATOM   5016  N  NH2 . ARG D  1 44  ? -59.603  38.772  -109.247 1.00 117.62 ? 25   ARG D NH2 1 
ATOM   5017  N  N   . PRO D  1 45  ? -55.779  33.910  -102.542 1.00 69.48  ? 26   PRO D N   1 
ATOM   5018  C  CA  . PRO D  1 45  ? -55.534  32.805  -101.607 1.00 61.24  ? 26   PRO D CA  1 
ATOM   5019  C  C   . PRO D  1 45  ? -56.588  31.697  -101.691 1.00 49.98  ? 26   PRO D C   1 
ATOM   5020  O  O   . PRO D  1 45  ? -57.770  31.951  -101.976 1.00 44.18  ? 26   PRO D O   1 
ATOM   5021  C  CB  . PRO D  1 45  ? -55.624  33.485  -100.233 1.00 65.41  ? 26   PRO D CB  1 
ATOM   5022  C  CG  . PRO D  1 45  ? -56.513  34.670  -100.454 1.00 66.88  ? 26   PRO D CG  1 
ATOM   5023  C  CD  . PRO D  1 45  ? -56.121  35.160  -101.834 1.00 67.81  ? 26   PRO D CD  1 
ATOM   5024  N  N   . VAL D  1 46  ? -56.151  30.467  -101.440 1.00 36.03  ? 27   VAL D N   1 
ATOM   5025  C  CA  . VAL D  1 46  ? -57.072  29.354  -101.328 1.00 34.99  ? 27   VAL D CA  1 
ATOM   5026  C  C   . VAL D  1 46  ? -57.819  29.522  -100.026 1.00 41.83  ? 27   VAL D C   1 
ATOM   5027  O  O   . VAL D  1 46  ? -57.201  29.644  -98.956  1.00 46.61  ? 27   VAL D O   1 
ATOM   5028  C  CB  . VAL D  1 46  ? -56.330  28.006  -101.311 1.00 32.53  ? 27   VAL D CB  1 
ATOM   5029  C  CG1 . VAL D  1 46  ? -57.324  26.842  -101.151 1.00 29.75  ? 27   VAL D CG1 1 
ATOM   5030  C  CG2 . VAL D  1 46  ? -55.470  27.853  -102.577 1.00 32.66  ? 27   VAL D CG2 1 
ATOM   5031  N  N   . ALA D  1 47  ? -59.143  29.534  -100.111 1.00 39.24  ? 28   ALA D N   1 
ATOM   5032  C  CA  . ALA D  1 47  ? -59.983  29.671  -98.921  1.00 32.58  ? 28   ALA D CA  1 
ATOM   5033  C  C   . ALA D  1 47  ? -60.229  28.316  -98.270  1.00 31.41  ? 28   ALA D C   1 
ATOM   5034  O  O   . ALA D  1 47  ? -60.975  27.481  -98.806  1.00 32.19  ? 28   ALA D O   1 
ATOM   5035  C  CB  . ALA D  1 47  ? -61.310  30.328  -99.278  1.00 32.29  ? 28   ALA D CB  1 
ATOM   5036  N  N   . VAL D  1 48  ? -59.624  28.111  -97.101  1.00 35.17  ? 29   VAL D N   1 
ATOM   5037  C  CA  . VAL D  1 48  ? -59.756  26.858  -96.363  1.00 33.06  ? 29   VAL D CA  1 
ATOM   5038  C  C   . VAL D  1 48  ? -60.716  27.014  -95.171  1.00 34.47  ? 29   VAL D C   1 
ATOM   5039  O  O   . VAL D  1 48  ? -60.489  27.847  -94.301  1.00 38.00  ? 29   VAL D O   1 
ATOM   5040  C  CB  . VAL D  1 48  ? -58.367  26.368  -95.867  1.00 47.00  ? 29   VAL D CB  1 
ATOM   5041  C  CG1 . VAL D  1 48  ? -58.490  25.032  -95.124  1.00 49.06  ? 29   VAL D CG1 1 
ATOM   5042  C  CG2 . VAL D  1 48  ? -57.377  26.258  -97.039  1.00 43.04  ? 29   VAL D CG2 1 
ATOM   5043  N  N   . SER D  1 49  ? -61.792  26.225  -95.161  1.00 35.82  ? 30   SER D N   1 
ATOM   5044  C  CA  . SER D  1 49  ? -62.691  26.091  -94.011  1.00 37.44  ? 30   SER D CA  1 
ATOM   5045  C  C   . SER D  1 49  ? -62.199  25.039  -93.029  1.00 35.53  ? 30   SER D C   1 
ATOM   5046  O  O   . SER D  1 49  ? -61.852  23.919  -93.421  1.00 42.23  ? 30   SER D O   1 
ATOM   5047  C  CB  . SER D  1 49  ? -64.080  25.651  -94.455  1.00 46.38  ? 30   SER D CB  1 
ATOM   5048  O  OG  . SER D  1 49  ? -64.800  26.721  -95.026  1.00 55.86  ? 30   SER D OG  1 
ATOM   5049  N  N   . VAL D  1 50  ? -62.197  25.393  -91.750  1.00 25.58  ? 31   VAL D N   1 
ATOM   5050  C  CA  . VAL D  1 50  ? -61.797  24.463  -90.711  1.00 31.67  ? 31   VAL D CA  1 
ATOM   5051  C  C   . VAL D  1 50  ? -62.876  24.426  -89.657  1.00 38.61  ? 31   VAL D C   1 
ATOM   5052  O  O   . VAL D  1 50  ? -63.308  25.462  -89.136  1.00 48.08  ? 31   VAL D O   1 
ATOM   5053  C  CB  . VAL D  1 50  ? -60.464  24.858  -90.047  1.00 39.14  ? 31   VAL D CB  1 
ATOM   5054  C  CG1 . VAL D  1 50  ? -59.999  23.744  -89.102  1.00 41.19  ? 31   VAL D CG1 1 
ATOM   5055  C  CG2 . VAL D  1 50  ? -59.394  25.156  -91.107  1.00 40.61  ? 31   VAL D CG2 1 
ATOM   5056  N  N   . SER D  1 51  ? -63.304  23.219  -89.331  1.00 35.18  ? 32   SER D N   1 
ATOM   5057  C  CA  . SER D  1 51  ? -64.350  23.029  -88.347  1.00 35.08  ? 32   SER D CA  1 
ATOM   5058  C  C   . SER D  1 51  ? -64.024  21.776  -87.538  1.00 39.07  ? 32   SER D C   1 
ATOM   5059  O  O   . SER D  1 51  ? -63.985  20.668  -88.087  1.00 43.89  ? 32   SER D O   1 
ATOM   5060  C  CB  . SER D  1 51  ? -65.706  22.923  -89.058  1.00 40.84  ? 32   SER D CB  1 
ATOM   5061  O  OG  . SER D  1 51  ? -66.701  22.325  -88.235  1.00 46.71  ? 32   SER D OG  1 
ATOM   5062  N  N   . LEU D  1 52  ? -63.754  21.948  -86.243  1.00 38.48  ? 33   LEU D N   1 
ATOM   5063  C  CA  . LEU D  1 52  ? -63.504  20.790  -85.370  1.00 33.77  ? 33   LEU D CA  1 
ATOM   5064  C  C   . LEU D  1 52  ? -64.803  20.243  -84.817  1.00 32.47  ? 33   LEU D C   1 
ATOM   5065  O  O   . LEU D  1 52  ? -65.591  20.991  -84.244  1.00 41.26  ? 33   LEU D O   1 
ATOM   5066  C  CB  . LEU D  1 52  ? -62.574  21.145  -84.220  1.00 33.89  ? 33   LEU D CB  1 
ATOM   5067  C  CG  . LEU D  1 52  ? -61.242  21.768  -84.640  1.00 40.08  ? 33   LEU D CG  1 
ATOM   5068  C  CD1 . LEU D  1 52  ? -60.280  21.868  -83.465  1.00 37.37  ? 33   LEU D CD1 1 
ATOM   5069  C  CD2 . LEU D  1 52  ? -60.610  20.981  -85.770  1.00 45.77  ? 33   LEU D CD2 1 
ATOM   5070  N  N   . LYS D  1 53  ? -65.036  18.950  -85.025  1.00 28.27  ? 34   LYS D N   1 
ATOM   5071  C  CA  . LYS D  1 53  ? -66.189  18.267  -84.457  1.00 33.71  ? 34   LYS D CA  1 
ATOM   5072  C  C   . LYS D  1 53  ? -65.640  17.373  -83.358  1.00 36.47  ? 34   LYS D C   1 
ATOM   5073  O  O   . LYS D  1 53  ? -65.008  16.344  -83.637  1.00 30.82  ? 34   LYS D O   1 
ATOM   5074  C  CB  . LYS D  1 53  ? -66.922  17.420  -85.510  1.00 35.91  ? 34   LYS D CB  1 
ATOM   5075  C  CG  . LYS D  1 53  ? -67.221  18.143  -86.808  1.00 43.29  ? 34   LYS D CG  1 
ATOM   5076  C  CD  . LYS D  1 53  ? -68.431  19.074  -86.698  1.00 51.92  ? 34   LYS D CD  1 
ATOM   5077  C  CE  . LYS D  1 53  ? -68.733  19.731  -88.045  1.00 57.81  ? 34   LYS D CE  1 
ATOM   5078  N  NZ  . LYS D  1 53  ? -70.022  20.476  -88.027  1.00 61.29  ? 34   LYS D NZ  1 
ATOM   5079  N  N   . PHE D  1 54  ? -65.862  17.770  -82.106  1.00 36.98  ? 35   PHE D N   1 
ATOM   5080  C  CA  . PHE D  1 54  ? -65.293  17.034  -80.997  1.00 29.13  ? 35   PHE D CA  1 
ATOM   5081  C  C   . PHE D  1 54  ? -66.060  15.744  -80.768  1.00 30.48  ? 35   PHE D C   1 
ATOM   5082  O  O   . PHE D  1 54  ? -67.295  15.729  -80.767  1.00 36.51  ? 35   PHE D O   1 
ATOM   5083  C  CB  . PHE D  1 54  ? -65.239  17.909  -79.765  1.00 23.45  ? 35   PHE D CB  1 
ATOM   5084  C  CG  . PHE D  1 54  ? -64.289  19.054  -79.904  1.00 23.16  ? 35   PHE D CG  1 
ATOM   5085  C  CD1 . PHE D  1 54  ? -62.932  18.885  -79.666  1.00 21.57  ? 35   PHE D CD1 1 
ATOM   5086  C  CD2 . PHE D  1 54  ? -64.742  20.297  -80.302  1.00 27.72  ? 35   PHE D CD2 1 
ATOM   5087  C  CE1 . PHE D  1 54  ? -62.044  19.941  -79.807  1.00 21.74  ? 35   PHE D CE1 1 
ATOM   5088  C  CE2 . PHE D  1 54  ? -63.866  21.366  -80.438  1.00 27.05  ? 35   PHE D CE2 1 
ATOM   5089  C  CZ  . PHE D  1 54  ? -62.511  21.188  -80.192  1.00 23.97  ? 35   PHE D CZ  1 
ATOM   5090  N  N   . ILE D  1 55  ? -65.305  14.666  -80.612  1.00 20.67  ? 36   ILE D N   1 
ATOM   5091  C  CA  . ILE D  1 55  ? -65.857  13.334  -80.430  1.00 27.99  ? 36   ILE D CA  1 
ATOM   5092  C  C   . ILE D  1 55  ? -65.636  12.863  -78.992  1.00 34.07  ? 36   ILE D C   1 
ATOM   5093  O  O   . ILE D  1 55  ? -66.522  12.272  -78.367  1.00 38.19  ? 36   ILE D O   1 
ATOM   5094  C  CB  . ILE D  1 55  ? -65.178  12.341  -81.410  1.00 23.97  ? 36   ILE D CB  1 
ATOM   5095  C  CG1 . ILE D  1 55  ? -65.222  12.917  -82.832  1.00 21.62  ? 36   ILE D CG1 1 
ATOM   5096  C  CG2 . ILE D  1 55  ? -65.818  10.942  -81.340  1.00 18.06  ? 36   ILE D CG2 1 
ATOM   5097  C  CD1 . ILE D  1 55  ? -66.616  13.186  -83.333  1.00 19.95  ? 36   ILE D CD1 1 
ATOM   5098  N  N   . ASN D  1 56  ? -64.447  13.129  -78.466  1.00 33.55  ? 37   ASN D N   1 
ATOM   5099  C  CA  . ASN D  1 56  ? -64.130  12.708  -77.114  1.00 36.09  ? 37   ASN D CA  1 
ATOM   5100  C  C   . ASN D  1 56  ? -63.020  13.517  -76.450  1.00 43.91  ? 37   ASN D C   1 
ATOM   5101  O  O   . ASN D  1 56  ? -62.150  14.073  -77.112  1.00 47.95  ? 37   ASN D O   1 
ATOM   5102  C  CB  . ASN D  1 56  ? -63.757  11.228  -77.102  1.00 38.38  ? 37   ASN D CB  1 
ATOM   5103  C  CG  . ASN D  1 56  ? -64.238  10.506  -75.847  1.00 41.20  ? 37   ASN D CG  1 
ATOM   5104  O  OD1 . ASN D  1 56  ? -64.198  11.049  -74.739  1.00 36.23  ? 37   ASN D OD1 1 
ATOM   5105  N  ND2 . ASN D  1 56  ? -64.701  9.270   -76.023  1.00 46.29  ? 37   ASN D ND2 1 
ATOM   5106  N  N   . ILE D  1 57  ? -63.068  13.579  -75.123  1.00 47.40  ? 38   ILE D N   1 
ATOM   5107  C  CA  . ILE D  1 57  ? -61.988  14.143  -74.320  1.00 38.38  ? 38   ILE D CA  1 
ATOM   5108  C  C   . ILE D  1 57  ? -61.558  13.051  -73.357  1.00 35.87  ? 38   ILE D C   1 
ATOM   5109  O  O   . ILE D  1 57  ? -62.372  12.541  -72.584  1.00 34.79  ? 38   ILE D O   1 
ATOM   5110  C  CB  . ILE D  1 57  ? -62.449  15.370  -73.541  1.00 31.96  ? 38   ILE D CB  1 
ATOM   5111  C  CG1 . ILE D  1 57  ? -62.914  16.456  -74.518  1.00 23.83  ? 38   ILE D CG1 1 
ATOM   5112  C  CG2 . ILE D  1 57  ? -61.342  15.870  -72.664  1.00 15.92  ? 38   ILE D CG2 1 
ATOM   5113  C  CD1 . ILE D  1 57  ? -63.571  17.651  -73.858  1.00 28.86  ? 38   ILE D CD1 1 
ATOM   5114  N  N   . LEU D  1 58  ? -60.281  12.694  -73.413  1.00 40.39  ? 39   LEU D N   1 
ATOM   5115  C  CA  . LEU D  1 58  ? -59.834  11.420  -72.872  1.00 48.87  ? 39   LEU D CA  1 
ATOM   5116  C  C   . LEU D  1 58  ? -58.974  11.523  -71.627  1.00 52.88  ? 39   LEU D C   1 
ATOM   5117  O  O   . LEU D  1 58  ? -59.150  10.744  -70.682  1.00 58.38  ? 39   LEU D O   1 
ATOM   5118  C  CB  . LEU D  1 58  ? -59.083  10.628  -73.939  1.00 52.15  ? 39   LEU D CB  1 
ATOM   5119  C  CG  . LEU D  1 58  ? -59.928  10.178  -75.129  1.00 56.20  ? 39   LEU D CG  1 
ATOM   5120  C  CD1 . LEU D  1 58  ? -59.072  9.428   -76.138  1.00 56.32  ? 39   LEU D CD1 1 
ATOM   5121  C  CD2 . LEU D  1 58  ? -61.095  9.315   -74.668  1.00 57.52  ? 39   LEU D CD2 1 
ATOM   5122  N  N   . GLU D  1 59  ? -58.020  12.452  -71.648  1.00 49.77  ? 40   GLU D N   1 
ATOM   5123  C  CA  . GLU D  1 59  ? -57.073  12.592  -70.540  1.00 53.87  ? 40   GLU D CA  1 
ATOM   5124  C  C   . GLU D  1 59  ? -56.847  14.047  -70.232  1.00 52.68  ? 40   GLU D C   1 
ATOM   5125  O  O   . GLU D  1 59  ? -56.203  14.772  -70.983  1.00 63.52  ? 40   GLU D O   1 
ATOM   5126  C  CB  . GLU D  1 59  ? -55.724  11.951  -70.852  1.00 58.91  ? 40   GLU D CB  1 
ATOM   5127  C  CG  . GLU D  1 59  ? -55.744  10.459  -71.034  1.00 65.75  ? 40   GLU D CG  1 
ATOM   5128  C  CD  . GLU D  1 59  ? -54.795  10.027  -72.130  1.00 74.82  ? 40   GLU D CD  1 
ATOM   5129  O  OE1 . GLU D  1 59  ? -55.232  10.013  -73.296  1.00 76.34  ? 40   GLU D OE1 1 
ATOM   5130  O  OE2 . GLU D  1 59  ? -53.613  9.722   -71.838  1.00 79.46  ? 40   GLU D OE2 1 
ATOM   5131  N  N   . VAL D  1 60  ? -57.407  14.480  -69.123  1.00 42.52  ? 41   VAL D N   1 
ATOM   5132  C  CA  . VAL D  1 60  ? -57.220  15.841  -68.690  1.00 37.65  ? 41   VAL D CA  1 
ATOM   5133  C  C   . VAL D  1 60  ? -56.238  15.794  -67.529  1.00 40.03  ? 41   VAL D C   1 
ATOM   5134  O  O   . VAL D  1 60  ? -56.287  14.880  -66.699  1.00 40.73  ? 41   VAL D O   1 
ATOM   5135  C  CB  . VAL D  1 60  ? -58.564  16.469  -68.277  1.00 33.87  ? 41   VAL D CB  1 
ATOM   5136  C  CG1 . VAL D  1 60  ? -58.383  17.510  -67.198  1.00 35.16  ? 41   VAL D CG1 1 
ATOM   5137  C  CG2 . VAL D  1 60  ? -59.290  17.047  -69.497  1.00 25.14  ? 41   VAL D CG2 1 
ATOM   5138  N  N   . ASN D  1 61  ? -55.316  16.750  -67.505  1.00 36.78  ? 42   ASN D N   1 
ATOM   5139  C  CA  . ASN D  1 61  ? -54.355  16.881  -66.421  1.00 37.04  ? 42   ASN D CA  1 
ATOM   5140  C  C   . ASN D  1 61  ? -54.229  18.356  -66.033  1.00 43.83  ? 42   ASN D C   1 
ATOM   5141  O  O   . ASN D  1 61  ? -53.582  19.147  -66.742  1.00 45.84  ? 42   ASN D O   1 
ATOM   5142  C  CB  . ASN D  1 61  ? -52.993  16.302  -66.813  1.00 36.97  ? 42   ASN D CB  1 
ATOM   5143  C  CG  . ASN D  1 61  ? -52.004  16.238  -65.631  1.00 36.60  ? 42   ASN D CG  1 
ATOM   5144  O  OD1 . ASN D  1 61  ? -51.969  17.134  -64.772  1.00 41.08  ? 42   ASN D OD1 1 
ATOM   5145  N  ND2 . ASN D  1 61  ? -51.189  15.168  -65.594  1.00 22.37  ? 42   ASN D ND2 1 
ATOM   5146  N  N   . GLU D  1 62  ? -54.847  18.707  -64.898  1.00 45.79  ? 43   GLU D N   1 
ATOM   5147  C  CA  . GLU D  1 62  ? -55.009  20.098  -64.501  1.00 49.56  ? 43   GLU D CA  1 
ATOM   5148  C  C   . GLU D  1 62  ? -53.685  20.650  -63.996  1.00 44.53  ? 43   GLU D C   1 
ATOM   5149  O  O   . GLU D  1 62  ? -53.434  21.880  -64.033  1.00 36.10  ? 43   GLU D O   1 
ATOM   5150  C  CB  . GLU D  1 62  ? -56.117  20.249  -63.459  1.00 65.23  ? 43   GLU D CB  1 
ATOM   5151  C  CG  . GLU D  1 62  ? -56.583  21.699  -63.271  1.00 79.98  ? 43   GLU D CG  1 
ATOM   5152  C  CD  . GLU D  1 62  ? -57.877  21.820  -62.467  1.00 86.76  ? 43   GLU D CD  1 
ATOM   5153  O  OE1 . GLU D  1 62  ? -58.371  20.778  -61.962  1.00 86.30  ? 43   GLU D OE1 1 
ATOM   5154  O  OE2 . GLU D  1 62  ? -58.391  22.961  -62.348  1.00 88.15  ? 43   GLU D OE2 1 
ATOM   5155  N  N   . ILE D  1 63  ? -52.822  19.731  -63.559  1.00 45.53  ? 44   ILE D N   1 
ATOM   5156  C  CA  . ILE D  1 63  ? -51.481  20.101  -63.112  1.00 49.11  ? 44   ILE D CA  1 
ATOM   5157  C  C   . ILE D  1 63  ? -50.602  20.512  -64.280  1.00 47.24  ? 44   ILE D C   1 
ATOM   5158  O  O   . ILE D  1 63  ? -50.100  21.631  -64.315  1.00 53.43  ? 44   ILE D O   1 
ATOM   5159  C  CB  . ILE D  1 63  ? -50.773  18.964  -62.355  1.00 55.33  ? 44   ILE D CB  1 
ATOM   5160  C  CG1 . ILE D  1 63  ? -51.612  18.514  -61.161  1.00 58.87  ? 44   ILE D CG1 1 
ATOM   5161  C  CG2 . ILE D  1 63  ? -49.385  19.419  -61.906  1.00 58.55  ? 44   ILE D CG2 1 
ATOM   5162  C  CD1 . ILE D  1 63  ? -51.988  19.657  -60.182  1.00 85.68  ? 44   ILE D CD1 1 
ATOM   5163  N  N   . THR D  1 64  ? -50.421  19.603  -65.237  1.00 44.01  ? 45   THR D N   1 
ATOM   5164  C  CA  . THR D  1 64  ? -49.545  19.862  -66.383  1.00 36.64  ? 45   THR D CA  1 
ATOM   5165  C  C   . THR D  1 64  ? -50.183  20.736  -67.451  1.00 37.27  ? 45   THR D C   1 
ATOM   5166  O  O   . THR D  1 64  ? -49.477  21.184  -68.345  1.00 42.43  ? 45   THR D O   1 
ATOM   5167  C  CB  . THR D  1 64  ? -49.051  18.570  -67.053  1.00 31.04  ? 45   THR D CB  1 
ATOM   5168  O  OG1 . THR D  1 64  ? -50.161  17.885  -67.645  1.00 51.18  ? 45   THR D OG1 1 
ATOM   5169  C  CG2 . THR D  1 64  ? -48.417  17.652  -66.054  1.00 25.68  ? 45   THR D CG2 1 
ATOM   5170  N  N   . ASN D  1 65  ? -51.500  20.959  -67.369  1.00 35.34  ? 46   ASN D N   1 
ATOM   5171  C  CA  . ASN D  1 65  ? -52.228  21.720  -68.391  1.00 38.39  ? 46   ASN D CA  1 
ATOM   5172  C  C   . ASN D  1 65  ? -52.182  21.040  -69.789  1.00 35.58  ? 46   ASN D C   1 
ATOM   5173  O  O   . ASN D  1 65  ? -51.829  21.652  -70.819  1.00 29.83  ? 46   ASN D O   1 
ATOM   5174  C  CB  . ASN D  1 65  ? -51.727  23.170  -68.459  1.00 41.21  ? 46   ASN D CB  1 
ATOM   5175  C  CG  . ASN D  1 65  ? -52.597  24.127  -67.692  1.00 41.13  ? 46   ASN D CG  1 
ATOM   5176  O  OD1 . ASN D  1 65  ? -53.778  23.874  -67.470  1.00 44.84  ? 46   ASN D OD1 1 
ATOM   5177  N  ND2 . ASN D  1 65  ? -52.018  25.244  -67.290  1.00 39.77  ? 46   ASN D ND2 1 
ATOM   5178  N  N   . GLU D  1 66  ? -52.540  19.761  -69.804  1.00 30.81  ? 47   GLU D N   1 
ATOM   5179  C  CA  . GLU D  1 66  ? -52.508  18.996  -71.026  1.00 30.01  ? 47   GLU D CA  1 
ATOM   5180  C  C   . GLU D  1 66  ? -53.810  18.216  -71.177  1.00 30.26  ? 47   GLU D C   1 
ATOM   5181  O  O   . GLU D  1 66  ? -54.328  17.686  -70.205  1.00 22.76  ? 47   GLU D O   1 
ATOM   5182  C  CB  . GLU D  1 66  ? -51.304  18.060  -71.028  1.00 30.55  ? 47   GLU D CB  1 
ATOM   5183  C  CG  . GLU D  1 66  ? -49.972  18.777  -70.923  1.00 38.80  ? 47   GLU D CG  1 
ATOM   5184  C  CD  . GLU D  1 66  ? -48.787  17.817  -70.772  1.00 51.18  ? 47   GLU D CD  1 
ATOM   5185  O  OE1 . GLU D  1 66  ? -48.959  16.596  -71.042  1.00 55.68  ? 47   GLU D OE1 1 
ATOM   5186  O  OE2 . GLU D  1 66  ? -47.684  18.293  -70.382  1.00 51.07  ? 47   GLU D OE2 1 
ATOM   5187  N  N   . VAL D  1 67  ? -54.341  18.158  -72.401  1.00 33.41  ? 48   VAL D N   1 
ATOM   5188  C  CA  . VAL D  1 67  ? -55.557  17.395  -72.661  1.00 30.44  ? 48   VAL D CA  1 
ATOM   5189  C  C   . VAL D  1 67  ? -55.346  16.490  -73.857  1.00 30.03  ? 48   VAL D C   1 
ATOM   5190  O  O   . VAL D  1 67  ? -54.543  16.781  -74.736  1.00 34.60  ? 48   VAL D O   1 
ATOM   5191  C  CB  . VAL D  1 67  ? -56.801  18.287  -72.931  1.00 28.75  ? 48   VAL D CB  1 
ATOM   5192  C  CG1 . VAL D  1 67  ? -57.146  19.112  -71.699  1.00 32.42  ? 48   VAL D CG1 1 
ATOM   5193  C  CG2 . VAL D  1 67  ? -56.546  19.190  -74.145  1.00 27.36  ? 48   VAL D CG2 1 
ATOM   5194  N  N   . ASP D  1 68  ? -56.091  15.393  -73.870  1.00 29.64  ? 49   ASP D N   1 
ATOM   5195  C  CA  . ASP D  1 68  ? -56.072  14.425  -74.949  1.00 32.89  ? 49   ASP D CA  1 
ATOM   5196  C  C   . ASP D  1 68  ? -57.460  14.443  -75.615  1.00 36.44  ? 49   ASP D C   1 
ATOM   5197  O  O   . ASP D  1 68  ? -58.473  14.108  -75.004  1.00 35.47  ? 49   ASP D O   1 
ATOM   5198  C  CB  . ASP D  1 68  ? -55.770  13.048  -74.371  1.00 38.16  ? 49   ASP D CB  1 
ATOM   5199  C  CG  . ASP D  1 68  ? -55.060  12.141  -75.350  1.00 47.15  ? 49   ASP D CG  1 
ATOM   5200  O  OD1 . ASP D  1 68  ? -55.677  11.800  -76.372  1.00 55.67  ? 49   ASP D OD1 1 
ATOM   5201  O  OD2 . ASP D  1 68  ? -53.902  11.743  -75.093  1.00 47.01  ? 49   ASP D OD2 1 
ATOM   5202  N  N   . VAL D  1 69  ? -57.507  14.859  -76.875  1.00 41.50  ? 50   VAL D N   1 
ATOM   5203  C  CA  . VAL D  1 69  ? -58.783  15.084  -77.550  1.00 34.47  ? 50   VAL D CA  1 
ATOM   5204  C  C   . VAL D  1 69  ? -58.927  14.241  -78.813  1.00 32.64  ? 50   VAL D C   1 
ATOM   5205  O  O   . VAL D  1 69  ? -57.967  14.038  -79.559  1.00 32.67  ? 50   VAL D O   1 
ATOM   5206  C  CB  . VAL D  1 69  ? -58.956  16.568  -77.922  1.00 32.25  ? 50   VAL D CB  1 
ATOM   5207  C  CG1 . VAL D  1 69  ? -60.347  16.824  -78.469  1.00 34.34  ? 50   VAL D CG1 1 
ATOM   5208  C  CG2 . VAL D  1 69  ? -58.717  17.446  -76.711  1.00 38.63  ? 50   VAL D CG2 1 
ATOM   5209  N  N   . VAL D  1 70  ? -60.131  13.734  -79.043  1.00 32.27  ? 51   VAL D N   1 
ATOM   5210  C  CA  . VAL D  1 70  ? -60.458  13.119  -80.320  1.00 29.05  ? 51   VAL D CA  1 
ATOM   5211  C  C   . VAL D  1 70  ? -61.473  14.009  -81.028  1.00 30.68  ? 51   VAL D C   1 
ATOM   5212  O  O   . VAL D  1 70  ? -62.493  14.382  -80.438  1.00 32.83  ? 51   VAL D O   1 
ATOM   5213  C  CB  . VAL D  1 70  ? -61.039  11.718  -80.146  1.00 24.51  ? 51   VAL D CB  1 
ATOM   5214  C  CG1 . VAL D  1 70  ? -61.610  11.225  -81.463  1.00 14.61  ? 51   VAL D CG1 1 
ATOM   5215  C  CG2 . VAL D  1 70  ? -59.959  10.770  -79.629  1.00 19.74  ? 51   VAL D CG2 1 
ATOM   5216  N  N   . PHE D  1 71  ? -61.190  14.360  -82.284  1.00 28.21  ? 52   PHE D N   1 
ATOM   5217  C  CA  . PHE D  1 71  ? -62.034  15.301  -83.036  1.00 27.66  ? 52   PHE D CA  1 
ATOM   5218  C  C   . PHE D  1 71  ? -61.923  15.079  -84.530  1.00 35.27  ? 52   PHE D C   1 
ATOM   5219  O  O   . PHE D  1 71  ? -60.883  14.657  -85.033  1.00 37.75  ? 52   PHE D O   1 
ATOM   5220  C  CB  . PHE D  1 71  ? -61.649  16.742  -82.729  1.00 27.69  ? 52   PHE D CB  1 
ATOM   5221  C  CG  . PHE D  1 71  ? -60.207  17.059  -83.045  1.00 35.54  ? 52   PHE D CG  1 
ATOM   5222  C  CD1 . PHE D  1 71  ? -59.184  16.715  -82.152  1.00 43.36  ? 52   PHE D CD1 1 
ATOM   5223  C  CD2 . PHE D  1 71  ? -59.865  17.691  -84.234  1.00 28.41  ? 52   PHE D CD2 1 
ATOM   5224  C  CE1 . PHE D  1 71  ? -57.842  16.995  -82.462  1.00 42.55  ? 52   PHE D CE1 1 
ATOM   5225  C  CE2 . PHE D  1 71  ? -58.536  17.970  -84.549  1.00 24.52  ? 52   PHE D CE2 1 
ATOM   5226  C  CZ  . PHE D  1 71  ? -57.525  17.623  -83.671  1.00 33.54  ? 52   PHE D CZ  1 
ATOM   5227  N  N   . TRP D  1 72  ? -63.010  15.353  -85.238  1.00 39.34  ? 53   TRP D N   1 
ATOM   5228  C  CA  . TRP D  1 72  ? -62.977  15.343  -86.690  1.00 33.32  ? 53   TRP D CA  1 
ATOM   5229  C  C   . TRP D  1 72  ? -62.471  16.695  -87.121  1.00 30.03  ? 53   TRP D C   1 
ATOM   5230  O  O   . TRP D  1 72  ? -63.055  17.721  -86.766  1.00 35.84  ? 53   TRP D O   1 
ATOM   5231  C  CB  . TRP D  1 72  ? -64.371  15.143  -87.275  1.00 29.48  ? 53   TRP D CB  1 
ATOM   5232  C  CG  . TRP D  1 72  ? -64.987  13.837  -86.966  1.00 24.92  ? 53   TRP D CG  1 
ATOM   5233  C  CD1 . TRP D  1 72  ? -64.453  12.829  -86.216  1.00 24.18  ? 53   TRP D CD1 1 
ATOM   5234  C  CD2 . TRP D  1 72  ? -66.270  13.385  -87.403  1.00 24.27  ? 53   TRP D CD2 1 
ATOM   5235  N  NE1 . TRP D  1 72  ? -65.330  11.778  -86.151  1.00 22.72  ? 53   TRP D NE1 1 
ATOM   5236  C  CE2 . TRP D  1 72  ? -66.454  12.092  -86.868  1.00 22.47  ? 53   TRP D CE2 1 
ATOM   5237  C  CE3 . TRP D  1 72  ? -67.283  13.952  -88.191  1.00 24.77  ? 53   TRP D CE3 1 
ATOM   5238  C  CZ2 . TRP D  1 72  ? -67.619  11.350  -87.095  1.00 26.88  ? 53   TRP D CZ2 1 
ATOM   5239  C  CZ3 . TRP D  1 72  ? -68.428  13.220  -88.419  1.00 29.36  ? 53   TRP D CZ3 1 
ATOM   5240  C  CH2 . TRP D  1 72  ? -68.591  11.925  -87.868  1.00 30.78  ? 53   TRP D CH2 1 
ATOM   5241  N  N   . GLN D  1 73  ? -61.387  16.708  -87.883  1.00 26.71  ? 54   GLN D N   1 
ATOM   5242  C  CA  . GLN D  1 73  ? -60.883  17.958  -88.432  1.00 32.17  ? 54   GLN D CA  1 
ATOM   5243  C  C   . GLN D  1 73  ? -61.444  18.171  -89.846  1.00 32.38  ? 54   GLN D C   1 
ATOM   5244  O  O   . GLN D  1 73  ? -60.773  17.899  -90.836  1.00 24.47  ? 54   GLN D O   1 
ATOM   5245  C  CB  . GLN D  1 73  ? -59.360  17.931  -88.458  1.00 31.53  ? 54   GLN D CB  1 
ATOM   5246  C  CG  . GLN D  1 73  ? -58.710  19.258  -88.752  1.00 31.81  ? 54   GLN D CG  1 
ATOM   5247  C  CD  . GLN D  1 73  ? -57.231  19.246  -88.400  1.00 40.15  ? 54   GLN D CD  1 
ATOM   5248  O  OE1 . GLN D  1 73  ? -56.852  18.987  -87.262  1.00 47.96  ? 54   GLN D OE1 1 
ATOM   5249  N  NE2 . GLN D  1 73  ? -56.392  19.522  -89.375  1.00 44.62  ? 54   GLN D NE2 1 
ATOM   5250  N  N   . GLN D  1 74  ? -62.684  18.647  -89.927  1.00 34.01  ? 55   GLN D N   1 
ATOM   5251  C  CA  . GLN D  1 74  ? -63.335  18.855  -91.212  1.00 33.21  ? 55   GLN D CA  1 
ATOM   5252  C  C   . GLN D  1 74  ? -62.685  20.008  -91.977  1.00 33.47  ? 55   GLN D C   1 
ATOM   5253  O  O   . GLN D  1 74  ? -62.805  21.180  -91.599  1.00 36.59  ? 55   GLN D O   1 
ATOM   5254  C  CB  . GLN D  1 74  ? -64.819  19.141  -91.016  1.00 41.66  ? 55   GLN D CB  1 
ATOM   5255  C  CG  . GLN D  1 74  ? -65.532  19.421  -92.319  1.00 51.81  ? 55   GLN D CG  1 
ATOM   5256  C  CD  . GLN D  1 74  ? -66.980  19.803  -92.126  1.00 55.64  ? 55   GLN D CD  1 
ATOM   5257  O  OE1 . GLN D  1 74  ? -67.821  18.949  -91.824  1.00 63.12  ? 55   GLN D OE1 1 
ATOM   5258  N  NE2 . GLN D  1 74  ? -67.286  21.090  -92.302  1.00 49.29  ? 55   GLN D NE2 1 
ATOM   5259  N  N   . THR D  1 75  ? -62.000  19.678  -93.065  1.00 33.31  ? 56   THR D N   1 
ATOM   5260  C  CA  . THR D  1 75  ? -61.256  20.685  -93.811  1.00 31.87  ? 56   THR D CA  1 
ATOM   5261  C  C   . THR D  1 75  ? -61.859  20.791  -95.207  1.00 39.30  ? 56   THR D C   1 
ATOM   5262  O  O   . THR D  1 75  ? -62.082  19.776  -95.858  1.00 46.27  ? 56   THR D O   1 
ATOM   5263  C  CB  . THR D  1 75  ? -59.751  20.346  -93.870  1.00 25.76  ? 56   THR D CB  1 
ATOM   5264  O  OG1 . THR D  1 75  ? -59.277  20.017  -92.559  1.00 36.86  ? 56   THR D OG1 1 
ATOM   5265  C  CG2 . THR D  1 75  ? -58.944  21.521  -94.351  1.00 17.84  ? 56   THR D CG2 1 
ATOM   5266  N  N   . THR D  1 76  ? -62.145  22.014  -95.661  1.00 39.34  ? 57   THR D N   1 
ATOM   5267  C  CA  . THR D  1 76  ? -62.795  22.192  -96.954  1.00 40.32  ? 57   THR D CA  1 
ATOM   5268  C  C   . THR D  1 76  ? -62.119  23.288  -97.768  1.00 38.22  ? 57   THR D C   1 
ATOM   5269  O  O   . THR D  1 76  ? -61.854  24.387  -97.269  1.00 36.79  ? 57   THR D O   1 
ATOM   5270  C  CB  . THR D  1 76  ? -64.302  22.474  -96.799  1.00 42.54  ? 57   THR D CB  1 
ATOM   5271  O  OG1 . THR D  1 76  ? -64.903  21.419  -96.039  1.00 48.32  ? 57   THR D OG1 1 
ATOM   5272  C  CG2 . THR D  1 76  ? -64.980  22.515  -98.149  1.00 45.12  ? 57   THR D CG2 1 
ATOM   5273  N  N   . TRP D  1 77  ? -61.830  22.981  -99.026  1.00 31.83  ? 58   TRP D N   1 
ATOM   5274  C  CA  . TRP D  1 77  ? -61.266  23.987  -99.911  1.00 37.08  ? 58   TRP D CA  1 
ATOM   5275  C  C   . TRP D  1 77  ? -61.623  23.709  -101.367 1.00 35.53  ? 58   TRP D C   1 
ATOM   5276  O  O   . TRP D  1 77  ? -62.361  22.765  -101.682 1.00 29.92  ? 58   TRP D O   1 
ATOM   5277  C  CB  . TRP D  1 77  ? -59.749  24.063  -99.732  1.00 39.49  ? 58   TRP D CB  1 
ATOM   5278  C  CG  . TRP D  1 77  ? -59.038  22.822  -100.199 1.00 44.05  ? 58   TRP D CG  1 
ATOM   5279  C  CD1 . TRP D  1 77  ? -58.437  22.621  -101.417 1.00 41.20  ? 58   TRP D CD1 1 
ATOM   5280  C  CD2 . TRP D  1 77  ? -58.865  21.604  -99.459  1.00 41.58  ? 58   TRP D CD2 1 
ATOM   5281  N  NE1 . TRP D  1 77  ? -57.895  21.360  -101.466 1.00 38.21  ? 58   TRP D NE1 1 
ATOM   5282  C  CE2 . TRP D  1 77  ? -58.146  20.712  -100.285 1.00 35.96  ? 58   TRP D CE2 1 
ATOM   5283  C  CE3 . TRP D  1 77  ? -59.250  21.184  -98.178  1.00 36.23  ? 58   TRP D CE3 1 
ATOM   5284  C  CZ2 . TRP D  1 77  ? -57.787  19.436  -99.870  1.00 38.03  ? 58   TRP D CZ2 1 
ATOM   5285  C  CZ3 . TRP D  1 77  ? -58.908  19.913  -97.768  1.00 33.24  ? 58   TRP D CZ3 1 
ATOM   5286  C  CH2 . TRP D  1 77  ? -58.174  19.051  -98.609  1.00 38.04  ? 58   TRP D CH2 1 
ATOM   5287  N  N   . SER D  1 78  ? -61.079  24.527  -102.254 1.00 35.19  ? 59   SER D N   1 
ATOM   5288  C  CA  . SER D  1 78  ? -61.444  24.439  -103.654 1.00 38.48  ? 59   SER D CA  1 
ATOM   5289  C  C   . SER D  1 78  ? -60.212  24.272  -104.549 1.00 39.84  ? 59   SER D C   1 
ATOM   5290  O  O   . SER D  1 78  ? -59.224  24.996  -104.403 1.00 45.65  ? 59   SER D O   1 
ATOM   5291  C  CB  . SER D  1 78  ? -62.240  25.676  -104.039 1.00 38.88  ? 59   SER D CB  1 
ATOM   5292  O  OG  . SER D  1 78  ? -62.874  25.473  -105.282 1.00 52.06  ? 59   SER D OG  1 
ATOM   5293  N  N   . ASP D  1 79  ? -60.273  23.302  -105.460 1.00 50.85  ? 60   ASP D N   1 
ATOM   5294  C  CA  . ASP D  1 79  ? -59.208  23.074  -106.438 1.00 50.58  ? 60   ASP D CA  1 
ATOM   5295  C  C   . ASP D  1 79  ? -59.840  22.831  -107.817 1.00 49.14  ? 60   ASP D C   1 
ATOM   5296  O  O   . ASP D  1 79  ? -60.229  21.708  -108.152 1.00 46.04  ? 60   ASP D O   1 
ATOM   5297  C  CB  . ASP D  1 79  ? -58.336  21.882  -106.018 1.00 55.11  ? 60   ASP D CB  1 
ATOM   5298  C  CG  . ASP D  1 79  ? -57.075  21.736  -106.867 1.00 60.09  ? 60   ASP D CG  1 
ATOM   5299  O  OD1 . ASP D  1 79  ? -57.027  22.313  -107.980 1.00 66.36  ? 60   ASP D OD1 1 
ATOM   5300  O  OD2 . ASP D  1 79  ? -56.130  21.039  -106.419 1.00 57.87  ? 60   ASP D OD2 1 
ATOM   5301  N  N   . ARG D  1 80  ? -59.936  23.889  -108.617 1.00 51.92  ? 61   ARG D N   1 
ATOM   5302  C  CA  . ARG D  1 80  ? -60.621  23.827  -109.911 1.00 50.89  ? 61   ARG D CA  1 
ATOM   5303  C  C   . ARG D  1 80  ? -59.951  22.878  -110.897 1.00 48.71  ? 61   ARG D C   1 
ATOM   5304  O  O   . ARG D  1 80  ? -60.619  22.331  -111.762 1.00 44.33  ? 61   ARG D O   1 
ATOM   5305  C  CB  . ARG D  1 80  ? -60.724  25.207  -110.531 1.00 54.78  ? 61   ARG D CB  1 
ATOM   5306  C  CG  . ARG D  1 80  ? -61.423  26.223  -109.652 1.00 68.32  ? 61   ARG D CG  1 
ATOM   5307  C  CD  . ARG D  1 80  ? -62.911  25.936  -109.512 1.00 82.92  ? 61   ARG D CD  1 
ATOM   5308  N  NE  . ARG D  1 80  ? -63.506  26.673  -108.391 1.00 95.37  ? 61   ARG D NE  1 
ATOM   5309  C  CZ  . ARG D  1 80  ? -63.887  27.949  -108.435 1.00 104.15 ? 61   ARG D CZ  1 
ATOM   5310  N  NH1 . ARG D  1 80  ? -63.736  28.663  -109.548 1.00 108.54 ? 61   ARG D NH1 1 
ATOM   5311  N  NH2 . ARG D  1 80  ? -64.416  28.515  -107.361 1.00 105.99 ? 61   ARG D NH2 1 
ATOM   5312  N  N   . THR D  1 81  ? -58.644  22.664  -110.749 1.00 50.37  ? 62   THR D N   1 
ATOM   5313  C  CA  . THR D  1 81  ? -57.913  21.744  -111.615 1.00 56.39  ? 62   THR D CA  1 
ATOM   5314  C  C   . THR D  1 81  ? -58.413  20.293  -111.499 1.00 65.80  ? 62   THR D C   1 
ATOM   5315  O  O   . THR D  1 81  ? -58.019  19.425  -112.286 1.00 73.46  ? 62   THR D O   1 
ATOM   5316  C  CB  . THR D  1 81  ? -56.377  21.792  -111.343 1.00 78.75  ? 62   THR D CB  1 
ATOM   5317  O  OG1 . THR D  1 81  ? -56.039  20.953  -110.225 1.00 74.99  ? 62   THR D OG1 1 
ATOM   5318  C  CG2 . THR D  1 81  ? -55.912  23.217  -111.078 1.00 77.33  ? 62   THR D CG2 1 
ATOM   5319  N  N   . LEU D  1 82  ? -59.272  20.029  -110.516 1.00 61.58  ? 63   LEU D N   1 
ATOM   5320  C  CA  . LEU D  1 82  ? -59.832  18.694  -110.329 1.00 56.08  ? 63   LEU D CA  1 
ATOM   5321  C  C   . LEU D  1 82  ? -61.241  18.578  -110.924 1.00 55.37  ? 63   LEU D C   1 
ATOM   5322  O  O   . LEU D  1 82  ? -61.796  17.476  -111.053 1.00 57.43  ? 63   LEU D O   1 
ATOM   5323  C  CB  . LEU D  1 82  ? -59.871  18.348  -108.845 1.00 46.45  ? 63   LEU D CB  1 
ATOM   5324  C  CG  . LEU D  1 82  ? -58.535  18.351  -108.119 1.00 45.44  ? 63   LEU D CG  1 
ATOM   5325  C  CD1 . LEU D  1 82  ? -58.760  18.253  -106.598 1.00 43.03  ? 63   LEU D CD1 1 
ATOM   5326  C  CD2 . LEU D  1 82  ? -57.684  17.205  -108.638 1.00 44.08  ? 63   LEU D CD2 1 
ATOM   5327  N  N   . ALA D  1 83  ? -61.814  19.721  -111.287 1.00 49.25  ? 64   ALA D N   1 
ATOM   5328  C  CA  . ALA D  1 83  ? -63.201  19.777  -111.750 1.00 47.03  ? 64   ALA D CA  1 
ATOM   5329  C  C   . ALA D  1 83  ? -63.432  18.978  -113.018 1.00 47.73  ? 64   ALA D C   1 
ATOM   5330  O  O   . ALA D  1 83  ? -62.520  18.786  -113.819 1.00 50.97  ? 64   ALA D O   1 
ATOM   5331  C  CB  . ALA D  1 83  ? -63.636  21.212  -111.961 1.00 40.51  ? 64   ALA D CB  1 
ATOM   5332  N  N   . TRP D  1 84  ? -64.659  18.504  -113.186 1.00 41.47  ? 65   TRP D N   1 
ATOM   5333  C  CA  . TRP D  1 84  ? -65.029  17.752  -114.369 1.00 56.94  ? 65   TRP D CA  1 
ATOM   5334  C  C   . TRP D  1 84  ? -66.491  17.995  -114.742 1.00 69.44  ? 65   TRP D C   1 
ATOM   5335  O  O   . TRP D  1 84  ? -67.287  18.472  -113.922 1.00 64.11  ? 65   TRP D O   1 
ATOM   5336  C  CB  . TRP D  1 84  ? -64.753  16.260  -114.200 1.00 41.86  ? 65   TRP D CB  1 
ATOM   5337  C  CG  . TRP D  1 84  ? -65.671  15.539  -113.244 1.00 49.45  ? 65   TRP D CG  1 
ATOM   5338  C  CD1 . TRP D  1 84  ? -66.898  14.998  -113.524 1.00 47.23  ? 65   TRP D CD1 1 
ATOM   5339  C  CD2 . TRP D  1 84  ? -65.406  15.236  -111.863 1.00 41.34  ? 65   TRP D CD2 1 
ATOM   5340  N  NE1 . TRP D  1 84  ? -67.425  14.405  -112.395 1.00 42.64  ? 65   TRP D NE1 1 
ATOM   5341  C  CE2 . TRP D  1 84  ? -66.530  14.537  -111.367 1.00 42.12  ? 65   TRP D CE2 1 
ATOM   5342  C  CE3 . TRP D  1 84  ? -64.340  15.510  -110.999 1.00 40.44  ? 65   TRP D CE3 1 
ATOM   5343  C  CZ2 . TRP D  1 84  ? -66.611  14.109  -110.032 1.00 41.31  ? 65   TRP D CZ2 1 
ATOM   5344  C  CZ3 . TRP D  1 84  ? -64.429  15.086  -109.683 1.00 40.00  ? 65   TRP D CZ3 1 
ATOM   5345  C  CH2 . TRP D  1 84  ? -65.554  14.387  -109.218 1.00 40.44  ? 65   TRP D CH2 1 
ATOM   5346  N  N   . ASN D  1 85  ? -66.820  17.678  -115.995 1.00 87.35  ? 66   ASN D N   1 
ATOM   5347  C  CA  . ASN D  1 85  ? -68.171  17.807  -116.524 1.00 100.68 ? 66   ASN D CA  1 
ATOM   5348  C  C   . ASN D  1 85  ? -69.042  16.662  -116.010 1.00 107.72 ? 66   ASN D C   1 
ATOM   5349  O  O   . ASN D  1 85  ? -68.927  15.525  -116.479 1.00 105.81 ? 66   ASN D O   1 
ATOM   5350  C  CB  . ASN D  1 85  ? -68.129  17.808  -118.055 1.00 110.70 ? 66   ASN D CB  1 
ATOM   5351  C  CG  . ASN D  1 85  ? -69.452  18.218  -118.683 1.00 122.78 ? 66   ASN D CG  1 
ATOM   5352  O  OD1 . ASN D  1 85  ? -70.497  18.175  -118.035 1.00 130.09 ? 66   ASN D OD1 1 
ATOM   5353  N  ND2 . ASN D  1 85  ? -69.413  18.612  -119.957 1.00 123.63 ? 66   ASN D ND2 1 
ATOM   5354  N  N   . SER D  1 86  ? -69.917  16.972  -115.054 1.00 118.03 ? 67   SER D N   1 
ATOM   5355  C  CA  . SER D  1 86  ? -70.701  15.951  -114.349 1.00 127.57 ? 67   SER D CA  1 
ATOM   5356  C  C   . SER D  1 86  ? -72.044  15.640  -114.999 1.00 132.21 ? 67   SER D C   1 
ATOM   5357  O  O   . SER D  1 86  ? -72.945  15.119  -114.337 1.00 132.52 ? 67   SER D O   1 
ATOM   5358  C  CB  . SER D  1 86  ? -70.952  16.367  -112.895 1.00 130.84 ? 67   SER D CB  1 
ATOM   5359  O  OG  . SER D  1 86  ? -72.029  17.293  -112.806 1.00 133.42 ? 67   SER D OG  1 
ATOM   5360  N  N   . SER D  1 87  ? -72.178  15.963  -116.280 1.00 135.13 ? 68   SER D N   1 
ATOM   5361  C  CA  . SER D  1 87  ? -73.444  15.783  -116.985 1.00 139.60 ? 68   SER D CA  1 
ATOM   5362  C  C   . SER D  1 87  ? -73.962  14.346  -116.892 1.00 135.70 ? 68   SER D C   1 
ATOM   5363  O  O   . SER D  1 87  ? -75.098  14.109  -116.479 1.00 134.43 ? 68   SER D O   1 
ATOM   5364  C  CB  . SER D  1 87  ? -73.295  16.207  -118.450 1.00 147.37 ? 68   SER D CB  1 
ATOM   5365  O  OG  . SER D  1 87  ? -72.110  15.652  -119.010 1.00 150.59 ? 68   SER D OG  1 
ATOM   5366  N  N   . HIS D  1 88  ? -73.120  13.390  -117.266 1.00 133.82 ? 69   HIS D N   1 
ATOM   5367  C  CA  . HIS D  1 88  ? -73.490  11.984  -117.186 1.00 133.95 ? 69   HIS D CA  1 
ATOM   5368  C  C   . HIS D  1 88  ? -72.439  11.239  -116.389 1.00 128.30 ? 69   HIS D C   1 
ATOM   5369  O  O   . HIS D  1 88  ? -72.032  10.132  -116.743 1.00 128.08 ? 69   HIS D O   1 
ATOM   5370  C  CB  . HIS D  1 88  ? -73.620  11.388  -118.582 1.00 140.92 ? 69   HIS D CB  1 
ATOM   5371  C  CG  . HIS D  1 88  ? -74.660  12.054  -119.422 1.00 148.20 ? 69   HIS D CG  1 
ATOM   5372  N  ND1 . HIS D  1 88  ? -74.399  13.166  -120.202 1.00 150.15 ? 69   HIS D ND1 1 
ATOM   5373  C  CD2 . HIS D  1 88  ? -75.977  11.782  -119.598 1.00 151.13 ? 69   HIS D CD2 1 
ATOM   5374  C  CE1 . HIS D  1 88  ? -75.498  13.537  -120.824 1.00 151.89 ? 69   HIS D CE1 1 
ATOM   5375  N  NE2 . HIS D  1 88  ? -76.473  12.708  -120.476 1.00 152.56 ? 69   HIS D NE2 1 
ATOM   5376  N  N   . SER D  1 89  ? -72.012  11.867  -115.300 1.00 121.60 ? 70   SER D N   1 
ATOM   5377  C  CA  . SER D  1 89  ? -70.904  11.381  -114.492 1.00 111.56 ? 70   SER D CA  1 
ATOM   5378  C  C   . SER D  1 89  ? -71.305  11.471  -113.024 1.00 95.04  ? 70   SER D C   1 
ATOM   5379  O  O   . SER D  1 89  ? -72.291  12.135  -112.701 1.00 95.64  ? 70   SER D O   1 
ATOM   5380  C  CB  . SER D  1 89  ? -69.669  12.254  -114.752 1.00 117.94 ? 70   SER D CB  1 
ATOM   5381  O  OG  . SER D  1 89  ? -69.411  12.391  -116.144 1.00 122.44 ? 70   SER D OG  1 
ATOM   5382  N  N   . PRO D  1 90  ? -70.557  10.792  -112.130 1.00 77.65  ? 71   PRO D N   1 
ATOM   5383  C  CA  . PRO D  1 90  ? -70.722  10.975  -110.674 1.00 67.00  ? 71   PRO D CA  1 
ATOM   5384  C  C   . PRO D  1 90  ? -70.454  12.418  -110.236 1.00 60.32  ? 71   PRO D C   1 
ATOM   5385  O  O   . PRO D  1 90  ? -69.667  13.117  -110.897 1.00 62.99  ? 71   PRO D O   1 
ATOM   5386  C  CB  . PRO D  1 90  ? -69.647  10.068  -110.082 1.00 66.44  ? 71   PRO D CB  1 
ATOM   5387  C  CG  . PRO D  1 90  ? -69.398  9.045   -111.126 1.00 70.29  ? 71   PRO D CG  1 
ATOM   5388  C  CD  . PRO D  1 90  ? -69.603  9.716   -112.452 1.00 70.94  ? 71   PRO D CD  1 
ATOM   5389  N  N   . ASP D  1 91  ? -71.094  12.855  -109.148 1.00 52.77  ? 72   ASP D N   1 
ATOM   5390  C  CA  . ASP D  1 91  ? -70.953  14.233  -108.678 1.00 54.24  ? 72   ASP D CA  1 
ATOM   5391  C  C   . ASP D  1 91  ? -69.771  14.337  -107.756 1.00 52.42  ? 72   ASP D C   1 
ATOM   5392  O  O   . ASP D  1 91  ? -69.271  15.430  -107.487 1.00 48.85  ? 72   ASP D O   1 
ATOM   5393  C  CB  . ASP D  1 91  ? -72.189  14.675  -107.908 1.00 67.73  ? 72   ASP D CB  1 
ATOM   5394  C  CG  . ASP D  1 91  ? -73.477  14.286  -108.594 1.00 85.58  ? 72   ASP D CG  1 
ATOM   5395  O  OD1 . ASP D  1 91  ? -73.515  14.381  -109.833 1.00 93.55  ? 72   ASP D OD1 1 
ATOM   5396  O  OD2 . ASP D  1 91  ? -74.447  13.890  -107.902 1.00 90.73  ? 72   ASP D OD2 1 
ATOM   5397  N  N   . GLN D  1 92  ? -69.331  13.176  -107.277 1.00 34.18  ? 73   GLN D N   1 
ATOM   5398  C  CA  . GLN D  1 92  ? -68.384  13.085  -106.170 1.00 33.96  ? 73   GLN D CA  1 
ATOM   5399  C  C   . GLN D  1 92  ? -67.573  11.793  -106.197 1.00 27.18  ? 73   GLN D C   1 
ATOM   5400  O  O   . GLN D  1 92  ? -68.104  10.715  -106.480 1.00 24.77  ? 73   GLN D O   1 
ATOM   5401  C  CB  . GLN D  1 92  ? -69.165  13.149  -104.874 1.00 43.31  ? 73   GLN D CB  1 
ATOM   5402  C  CG  . GLN D  1 92  ? -68.330  13.218  -103.630 1.00 56.19  ? 73   GLN D CG  1 
ATOM   5403  C  CD  . GLN D  1 92  ? -69.190  13.176  -102.371 1.00 66.47  ? 73   GLN D CD  1 
ATOM   5404  O  OE1 . GLN D  1 92  ? -69.614  12.105  -101.934 1.00 72.22  ? 73   GLN D OE1 1 
ATOM   5405  N  NE2 . GLN D  1 92  ? -69.461  14.344  -101.792 1.00 68.22  ? 73   GLN D NE2 1 
ATOM   5406  N  N   . VAL D  1 93  ? -66.281  11.893  -105.904 1.00 22.63  ? 74   VAL D N   1 
ATOM   5407  C  CA  . VAL D  1 93  ? -65.473  10.688  -105.732 1.00 27.71  ? 74   VAL D CA  1 
ATOM   5408  C  C   . VAL D  1 93  ? -64.661  10.749  -104.433 1.00 37.37  ? 74   VAL D C   1 
ATOM   5409  O  O   . VAL D  1 93  ? -64.487  11.822  -103.832 1.00 48.13  ? 74   VAL D O   1 
ATOM   5410  C  CB  . VAL D  1 93  ? -64.510  10.456  -106.900 1.00 14.96  ? 74   VAL D CB  1 
ATOM   5411  C  CG1 . VAL D  1 93  ? -65.280  10.107  -108.160 1.00 26.33  ? 74   VAL D CG1 1 
ATOM   5412  C  CG2 . VAL D  1 93  ? -63.623  11.672  -107.096 1.00 15.21  ? 74   VAL D CG2 1 
ATOM   5413  N  N   . SER D  1 94  ? -64.163  9.597   -104.007 1.00 32.05  ? 75   SER D N   1 
ATOM   5414  C  CA  . SER D  1 94  ? -63.269  9.553   -102.867 1.00 30.93  ? 75   SER D CA  1 
ATOM   5415  C  C   . SER D  1 94  ? -61.861  9.331   -103.390 1.00 34.23  ? 75   SER D C   1 
ATOM   5416  O  O   . SER D  1 94  ? -61.603  8.416   -104.182 1.00 35.21  ? 75   SER D O   1 
ATOM   5417  C  CB  . SER D  1 94  ? -63.657  8.441   -101.879 1.00 28.00  ? 75   SER D CB  1 
ATOM   5418  O  OG  . SER D  1 94  ? -64.857  8.746   -101.203 1.00 32.59  ? 75   SER D OG  1 
ATOM   5419  N  N   . VAL D  1 95  ? -60.941  10.172  -102.943 1.00 29.94  ? 76   VAL D N   1 
ATOM   5420  C  CA  . VAL D  1 95  ? -59.594  10.132  -103.466 1.00 26.99  ? 76   VAL D CA  1 
ATOM   5421  C  C   . VAL D  1 95  ? -58.623  10.074  -102.310 1.00 32.71  ? 76   VAL D C   1 
ATOM   5422  O  O   . VAL D  1 95  ? -58.794  10.784  -101.314 1.00 44.15  ? 76   VAL D O   1 
ATOM   5423  C  CB  . VAL D  1 95  ? -59.322  11.399  -104.305 1.00 29.35  ? 76   VAL D CB  1 
ATOM   5424  C  CG1 . VAL D  1 95  ? -57.920  11.366  -104.925 1.00 33.99  ? 76   VAL D CG1 1 
ATOM   5425  C  CG2 . VAL D  1 95  ? -60.396  11.575  -105.371 1.00 19.54  ? 76   VAL D CG2 1 
ATOM   5426  N  N   . PRO D  1 96  ? -57.603  9.221   -102.424 1.00 28.76  ? 77   PRO D N   1 
ATOM   5427  C  CA  . PRO D  1 96  ? -56.502  9.208   -101.440 1.00 24.21  ? 77   PRO D CA  1 
ATOM   5428  C  C   . PRO D  1 96  ? -55.829  10.576  -101.361 1.00 28.27  ? 77   PRO D C   1 
ATOM   5429  O  O   . PRO D  1 96  ? -55.431  11.120  -102.394 1.00 32.78  ? 77   PRO D O   1 
ATOM   5430  C  CB  . PRO D  1 96  ? -55.511  8.207   -102.035 1.00 20.46  ? 77   PRO D CB  1 
ATOM   5431  C  CG  . PRO D  1 96  ? -56.370  7.320   -102.918 1.00 28.57  ? 77   PRO D CG  1 
ATOM   5432  C  CD  . PRO D  1 96  ? -57.454  8.194   -103.470 1.00 27.32  ? 77   PRO D CD  1 
ATOM   5433  N  N   . ILE D  1 97  ? -55.685  11.126  -100.161 1.00 32.08  ? 78   ILE D N   1 
ATOM   5434  C  CA  . ILE D  1 97  ? -55.069  12.450  -100.027 1.00 36.79  ? 78   ILE D CA  1 
ATOM   5435  C  C   . ILE D  1 97  ? -53.638  12.535  -100.595 1.00 39.02  ? 78   ILE D C   1 
ATOM   5436  O  O   . ILE D  1 97  ? -53.148  13.619  -100.915 1.00 40.18  ? 78   ILE D O   1 
ATOM   5437  C  CB  . ILE D  1 97  ? -55.090  12.976  -98.571  1.00 27.19  ? 78   ILE D CB  1 
ATOM   5438  C  CG1 . ILE D  1 97  ? -54.281  12.073  -97.647  1.00 28.65  ? 78   ILE D CG1 1 
ATOM   5439  C  CG2 . ILE D  1 97  ? -56.524  13.158  -98.075  1.00 19.44  ? 78   ILE D CG2 1 
ATOM   5440  C  CD1 . ILE D  1 97  ? -53.928  12.730  -96.324  1.00 13.31  ? 78   ILE D CD1 1 
ATOM   5441  N  N   . SER D  1 98  ? -52.974  11.395  -100.730 1.00 39.86  ? 79   SER D N   1 
ATOM   5442  C  CA  . SER D  1 98  ? -51.641  11.380  -101.334 1.00 40.02  ? 79   SER D CA  1 
ATOM   5443  C  C   . SER D  1 98  ? -51.699  11.780  -102.817 1.00 36.38  ? 79   SER D C   1 
ATOM   5444  O  O   . SER D  1 98  ? -50.691  12.164  -103.398 1.00 38.89  ? 79   SER D O   1 
ATOM   5445  C  CB  . SER D  1 98  ? -50.973  10.011  -101.161 1.00 40.47  ? 79   SER D CB  1 
ATOM   5446  O  OG  . SER D  1 98  ? -51.829  8.964   -101.600 1.00 45.23  ? 79   SER D OG  1 
ATOM   5447  N  N   . SER D  1 99  ? -52.883  11.705  -103.415 1.00 28.92  ? 80   SER D N   1 
ATOM   5448  C  CA  . SER D  1 99  ? -53.065  12.102  -104.810 1.00 28.94  ? 80   SER D CA  1 
ATOM   5449  C  C   . SER D  1 99  ? -53.604  13.518  -104.956 1.00 30.54  ? 80   SER D C   1 
ATOM   5450  O  O   . SER D  1 99  ? -53.932  13.935  -106.041 1.00 29.89  ? 80   SER D O   1 
ATOM   5451  C  CB  . SER D  1 99  ? -54.032  11.149  -105.522 1.00 34.88  ? 80   SER D CB  1 
ATOM   5452  O  OG  . SER D  1 99  ? -53.510  9.835   -105.556 1.00 43.51  ? 80   SER D OG  1 
ATOM   5453  N  N   . LEU D  1 100 ? -53.721  14.256  -103.860 1.00 36.85  ? 81   LEU D N   1 
ATOM   5454  C  CA  . LEU D  1 100 ? -54.304  15.587  -103.911 1.00 26.64  ? 81   LEU D CA  1 
ATOM   5455  C  C   . LEU D  1 100 ? -53.385  16.538  -103.208 1.00 27.09  ? 81   LEU D C   1 
ATOM   5456  O  O   . LEU D  1 100 ? -52.613  16.128  -102.344 1.00 30.09  ? 81   LEU D O   1 
ATOM   5457  C  CB  . LEU D  1 100 ? -55.630  15.604  -103.166 1.00 27.26  ? 81   LEU D CB  1 
ATOM   5458  C  CG  . LEU D  1 100 ? -56.777  14.816  -103.766 1.00 27.46  ? 81   LEU D CG  1 
ATOM   5459  C  CD1 . LEU D  1 100 ? -57.950  14.832  -102.830 1.00 14.55  ? 81   LEU D CD1 1 
ATOM   5460  C  CD2 . LEU D  1 100 ? -57.134  15.474  -105.092 1.00 29.00  ? 81   LEU D CD2 1 
ATOM   5461  N  N   . TRP D  1 101 ? -53.469  17.814  -103.564 1.00 30.06  ? 82   TRP D N   1 
ATOM   5462  C  CA  . TRP D  1 101 ? -52.889  18.835  -102.719 1.00 27.64  ? 82   TRP D CA  1 
ATOM   5463  C  C   . TRP D  1 101 ? -53.765  19.008  -101.485 1.00 28.32  ? 82   TRP D C   1 
ATOM   5464  O  O   . TRP D  1 101 ? -54.989  19.063  -101.575 1.00 26.71  ? 82   TRP D O   1 
ATOM   5465  C  CB  . TRP D  1 101 ? -52.787  20.158  -103.445 1.00 21.00  ? 82   TRP D CB  1 
ATOM   5466  C  CG  . TRP D  1 101 ? -52.262  21.269  -102.552 1.00 24.80  ? 82   TRP D CG  1 
ATOM   5467  C  CD1 . TRP D  1 101 ? -50.945  21.647  -102.374 1.00 28.57  ? 82   TRP D CD1 1 
ATOM   5468  C  CD2 . TRP D  1 101 ? -53.052  22.144  -101.705 1.00 18.23  ? 82   TRP D CD2 1 
ATOM   5469  N  NE1 . TRP D  1 101 ? -50.883  22.711  -101.489 1.00 25.90  ? 82   TRP D NE1 1 
ATOM   5470  C  CE2 . TRP D  1 101 ? -52.122  23.017  -101.083 1.00 21.12  ? 82   TRP D CE2 1 
ATOM   5471  C  CE3 . TRP D  1 101 ? -54.402  22.252  -101.453 1.00 21.74  ? 82   TRP D CE3 1 
ATOM   5472  C  CZ2 . TRP D  1 101 ? -52.583  24.007  -100.198 1.00 20.11  ? 82   TRP D CZ2 1 
ATOM   5473  C  CZ3 . TRP D  1 101 ? -54.830  23.241  -100.586 1.00 22.46  ? 82   TRP D CZ3 1 
ATOM   5474  C  CH2 . TRP D  1 101 ? -53.922  24.102  -99.964  1.00 22.35  ? 82   TRP D CH2 1 
ATOM   5475  N  N   . VAL D  1 102 ? -53.116  19.115  -100.339 1.00 30.12  ? 83   VAL D N   1 
ATOM   5476  C  CA  . VAL D  1 102 ? -53.810  19.278  -99.073  1.00 32.60  ? 83   VAL D CA  1 
ATOM   5477  C  C   . VAL D  1 102 ? -53.198  20.450  -98.302  1.00 29.44  ? 83   VAL D C   1 
ATOM   5478  O  O   . VAL D  1 102 ? -51.970  20.620  -98.276  1.00 27.39  ? 83   VAL D O   1 
ATOM   5479  C  CB  . VAL D  1 102 ? -53.710  17.970  -98.256  1.00 32.98  ? 83   VAL D CB  1 
ATOM   5480  C  CG1 . VAL D  1 102 ? -53.960  18.225  -96.812  1.00 38.98  ? 83   VAL D CG1 1 
ATOM   5481  C  CG2 . VAL D  1 102 ? -54.696  16.946  -98.788  1.00 30.59  ? 83   VAL D CG2 1 
ATOM   5482  N  N   . PRO D  1 103 ? -54.050  21.280  -97.691  1.00 31.20  ? 84   PRO D N   1 
ATOM   5483  C  CA  . PRO D  1 103 ? -53.525  22.381  -96.876  1.00 30.85  ? 84   PRO D CA  1 
ATOM   5484  C  C   . PRO D  1 103 ? -52.630  21.869  -95.748  1.00 29.81  ? 84   PRO D C   1 
ATOM   5485  O  O   . PRO D  1 103 ? -52.946  20.847  -95.134  1.00 19.59  ? 84   PRO D O   1 
ATOM   5486  C  CB  . PRO D  1 103 ? -54.787  23.070  -96.323  1.00 26.35  ? 84   PRO D CB  1 
ATOM   5487  C  CG  . PRO D  1 103 ? -55.935  22.176  -96.649  1.00 30.24  ? 84   PRO D CG  1 
ATOM   5488  C  CD  . PRO D  1 103 ? -55.519  21.310  -97.807  1.00 35.75  ? 84   PRO D CD  1 
ATOM   5489  N  N   . ASP D  1 104 ? -51.524  22.572  -95.502  1.00 34.86  ? 85   ASP D N   1 
ATOM   5490  C  CA  . ASP D  1 104 ? -50.554  22.170  -94.491  1.00 35.69  ? 85   ASP D CA  1 
ATOM   5491  C  C   . ASP D  1 104 ? -50.942  22.679  -93.105  1.00 40.28  ? 85   ASP D C   1 
ATOM   5492  O  O   . ASP D  1 104 ? -50.139  23.344  -92.437  1.00 48.69  ? 85   ASP D O   1 
ATOM   5493  C  CB  . ASP D  1 104 ? -49.133  22.625  -94.885  1.00 35.31  ? 85   ASP D CB  1 
ATOM   5494  C  CG  . ASP D  1 104 ? -48.991  24.165  -94.960  1.00 36.16  ? 85   ASP D CG  1 
ATOM   5495  O  OD1 . ASP D  1 104 ? -50.026  24.871  -95.040  1.00 34.15  ? 85   ASP D OD1 1 
ATOM   5496  O  OD2 . ASP D  1 104 ? -47.840  24.671  -94.939  1.00 35.43  ? 85   ASP D OD2 1 
ATOM   5497  N  N   . LEU D  1 105 ? -52.168  22.368  -92.678  1.00 31.73  ? 86   LEU D N   1 
ATOM   5498  C  CA  . LEU D  1 105 ? -52.644  22.817  -91.379  1.00 29.42  ? 86   LEU D CA  1 
ATOM   5499  C  C   . LEU D  1 105 ? -51.870  22.166  -90.221  1.00 28.74  ? 86   LEU D C   1 
ATOM   5500  O  O   . LEU D  1 105 ? -51.463  21.009  -90.303  1.00 25.62  ? 86   LEU D O   1 
ATOM   5501  C  CB  . LEU D  1 105 ? -54.123  22.517  -91.238  1.00 29.38  ? 86   LEU D CB  1 
ATOM   5502  C  CG  . LEU D  1 105 ? -55.002  23.232  -92.244  1.00 28.90  ? 86   LEU D CG  1 
ATOM   5503  C  CD1 . LEU D  1 105 ? -56.487  22.962  -91.923  1.00 27.86  ? 86   LEU D CD1 1 
ATOM   5504  C  CD2 . LEU D  1 105 ? -54.663  24.733  -92.258  1.00 28.13  ? 86   LEU D CD2 1 
ATOM   5505  N  N   . ALA D  1 106 ? -51.649  22.923  -89.157  1.00 18.52  ? 87   ALA D N   1 
ATOM   5506  C  CA  . ALA D  1 106 ? -51.029  22.375  -87.957  1.00 28.38  ? 87   ALA D CA  1 
ATOM   5507  C  C   . ALA D  1 106 ? -51.653  23.005  -86.711  1.00 31.37  ? 87   ALA D C   1 
ATOM   5508  O  O   . ALA D  1 106 ? -52.036  24.186  -86.721  1.00 31.97  ? 87   ALA D O   1 
ATOM   5509  C  CB  . ALA D  1 106 ? -49.522  22.604  -87.979  1.00 29.29  ? 87   ALA D CB  1 
ATOM   5510  N  N   . ALA D  1 107 ? -51.776  22.216  -85.649  1.00 31.93  ? 88   ALA D N   1 
ATOM   5511  C  CA  . ALA D  1 107 ? -52.196  22.749  -84.357  1.00 27.97  ? 88   ALA D CA  1 
ATOM   5512  C  C   . ALA D  1 107 ? -50.953  23.277  -83.619  1.00 29.31  ? 88   ALA D C   1 
ATOM   5513  O  O   . ALA D  1 107 ? -50.051  22.492  -83.254  1.00 32.21  ? 88   ALA D O   1 
ATOM   5514  C  CB  . ALA D  1 107 ? -52.902  21.676  -83.540  1.00 26.96  ? 88   ALA D CB  1 
ATOM   5515  N  N   . TYR D  1 108 ? -50.907  24.597  -83.398  1.00 28.58  ? 89   TYR D N   1 
ATOM   5516  C  CA  . TYR D  1 108 ? -49.725  25.254  -82.820  1.00 24.11  ? 89   TYR D CA  1 
ATOM   5517  C  C   . TYR D  1 108 ? -49.407  24.797  -81.414  1.00 27.38  ? 89   TYR D C   1 
ATOM   5518  O  O   . TYR D  1 108 ? -48.246  24.750  -81.018  1.00 38.85  ? 89   TYR D O   1 
ATOM   5519  C  CB  . TYR D  1 108 ? -49.886  26.766  -82.844  1.00 28.04  ? 89   TYR D CB  1 
ATOM   5520  C  CG  . TYR D  1 108 ? -49.616  27.370  -84.203  1.00 36.33  ? 89   TYR D CG  1 
ATOM   5521  C  CD1 . TYR D  1 108 ? -50.498  27.169  -85.260  1.00 36.66  ? 89   TYR D CD1 1 
ATOM   5522  C  CD2 . TYR D  1 108 ? -48.470  28.135  -84.433  1.00 40.76  ? 89   TYR D CD2 1 
ATOM   5523  C  CE1 . TYR D  1 108 ? -50.256  27.716  -86.512  1.00 39.64  ? 89   TYR D CE1 1 
ATOM   5524  C  CE2 . TYR D  1 108 ? -48.221  28.697  -85.685  1.00 43.55  ? 89   TYR D CE2 1 
ATOM   5525  C  CZ  . TYR D  1 108 ? -49.119  28.486  -86.723  1.00 39.97  ? 89   TYR D CZ  1 
ATOM   5526  O  OH  . TYR D  1 108 ? -48.885  29.034  -87.969  1.00 34.63  ? 89   TYR D OH  1 
ATOM   5527  N  N   . ASN D  1 109 ? -50.437  24.441  -80.663  1.00 22.63  ? 90   ASN D N   1 
ATOM   5528  C  CA  . ASN D  1 109 ? -50.238  24.060  -79.267  1.00 27.91  ? 90   ASN D CA  1 
ATOM   5529  C  C   . ASN D  1 109 ? -50.387  22.550  -79.074  1.00 29.18  ? 90   ASN D C   1 
ATOM   5530  O  O   . ASN D  1 109 ? -50.584  22.064  -77.956  1.00 36.06  ? 90   ASN D O   1 
ATOM   5531  C  CB  . ASN D  1 109 ? -51.192  24.845  -78.344  1.00 22.72  ? 90   ASN D CB  1 
ATOM   5532  C  CG  . ASN D  1 109 ? -52.651  24.720  -78.776  1.00 37.20  ? 90   ASN D CG  1 
ATOM   5533  O  OD1 . ASN D  1 109 ? -52.967  24.721  -79.972  1.00 40.37  ? 90   ASN D OD1 1 
ATOM   5534  N  ND2 . ASN D  1 109 ? -53.540  24.575  -77.809  1.00 35.46  ? 90   ASN D ND2 1 
ATOM   5535  N  N   . ALA D  1 110 ? -50.299  21.809  -80.172  1.00 20.47  ? 91   ALA D N   1 
ATOM   5536  C  CA  . ALA D  1 110 ? -50.269  20.350  -80.105  1.00 23.13  ? 91   ALA D CA  1 
ATOM   5537  C  C   . ALA D  1 110 ? -48.913  19.935  -79.554  1.00 24.05  ? 91   ALA D C   1 
ATOM   5538  O  O   . ALA D  1 110 ? -47.902  20.571  -79.838  1.00 22.22  ? 91   ALA D O   1 
ATOM   5539  C  CB  . ALA D  1 110 ? -50.509  19.740  -81.479  1.00 19.05  ? 91   ALA D CB  1 
ATOM   5540  N  N   . ILE D  1 111 ? -48.893  18.896  -78.723  1.00 32.91  ? 92   ILE D N   1 
ATOM   5541  C  CA  . ILE D  1 111 ? -47.632  18.415  -78.141  1.00 35.56  ? 92   ILE D CA  1 
ATOM   5542  C  C   . ILE D  1 111 ? -47.392  16.943  -78.474  1.00 37.11  ? 92   ILE D C   1 
ATOM   5543  O  O   . ILE D  1 111 ? -46.448  16.328  -77.985  1.00 38.43  ? 92   ILE D O   1 
ATOM   5544  C  CB  . ILE D  1 111 ? -47.566  18.642  -76.625  1.00 30.80  ? 92   ILE D CB  1 
ATOM   5545  C  CG1 . ILE D  1 111 ? -48.692  17.868  -75.914  1.00 31.85  ? 92   ILE D CG1 1 
ATOM   5546  C  CG2 . ILE D  1 111 ? -47.643  20.098  -76.337  1.00 21.09  ? 92   ILE D CG2 1 
ATOM   5547  C  CD1 . ILE D  1 111 ? -48.631  17.937  -74.384  1.00 27.87  ? 92   ILE D CD1 1 
ATOM   5548  N  N   . SER D  1 112 ? -48.273  16.391  -79.301  1.00 37.02  ? 93   SER D N   1 
ATOM   5549  C  CA  . SER D  1 112 ? -48.065  15.080  -79.916  1.00 36.31  ? 93   SER D CA  1 
ATOM   5550  C  C   . SER D  1 112 ? -48.379  15.233  -81.411  1.00 30.20  ? 93   SER D C   1 
ATOM   5551  O  O   . SER D  1 112 ? -49.165  16.107  -81.776  1.00 27.82  ? 93   SER D O   1 
ATOM   5552  C  CB  . SER D  1 112 ? -48.970  14.020  -79.255  1.00 33.66  ? 93   SER D CB  1 
ATOM   5553  O  OG  . SER D  1 112 ? -50.348  14.200  -79.571  1.00 30.49  ? 93   SER D OG  1 
ATOM   5554  N  N   . LYS D  1 113 ? -47.770  14.426  -82.282  1.00 30.01  ? 94   LYS D N   1 
ATOM   5555  C  CA  . LYS D  1 113 ? -48.144  14.486  -83.703  1.00 29.14  ? 94   LYS D CA  1 
ATOM   5556  C  C   . LYS D  1 113 ? -49.521  13.887  -83.867  1.00 32.95  ? 94   LYS D C   1 
ATOM   5557  O  O   . LYS D  1 113 ? -49.926  13.052  -83.078  1.00 43.38  ? 94   LYS D O   1 
ATOM   5558  C  CB  . LYS D  1 113 ? -47.126  13.817  -84.621  1.00 28.30  ? 94   LYS D CB  1 
ATOM   5559  C  CG  . LYS D  1 113 ? -47.117  12.303  -84.615  1.00 33.23  ? 94   LYS D CG  1 
ATOM   5560  C  CD  . LYS D  1 113 ? -45.852  11.796  -85.336  1.00 37.02  ? 94   LYS D CD  1 
ATOM   5561  C  CE  . LYS D  1 113 ? -45.591  12.604  -86.641  1.00 85.60  ? 94   LYS D CE  1 
ATOM   5562  N  NZ  . LYS D  1 113 ? -44.306  12.281  -87.372  1.00 83.87  ? 94   LYS D NZ  1 
ATOM   5563  N  N   . PRO D  1 114 ? -50.282  14.372  -84.849  1.00 35.57  ? 95   PRO D N   1 
ATOM   5564  C  CA  . PRO D  1 114 ? -51.674  13.920  -84.962  1.00 36.27  ? 95   PRO D CA  1 
ATOM   5565  C  C   . PRO D  1 114 ? -51.763  12.438  -85.289  1.00 35.30  ? 95   PRO D C   1 
ATOM   5566  O  O   . PRO D  1 114 ? -51.131  11.975  -86.221  1.00 32.31  ? 95   PRO D O   1 
ATOM   5567  C  CB  . PRO D  1 114 ? -52.238  14.773  -86.115  1.00 15.65  ? 95   PRO D CB  1 
ATOM   5568  C  CG  . PRO D  1 114 ? -51.054  15.357  -86.796  1.00 15.69  ? 95   PRO D CG  1 
ATOM   5569  C  CD  . PRO D  1 114 ? -49.983  15.488  -85.764  1.00 15.97  ? 95   PRO D CD  1 
ATOM   5570  N  N   . GLU D  1 115 ? -52.518  11.696  -84.490  1.00 40.06  ? 96   GLU D N   1 
ATOM   5571  C  CA  . GLU D  1 115 ? -52.805  10.308  -84.803  1.00 38.84  ? 96   GLU D CA  1 
ATOM   5572  C  C   . GLU D  1 115 ? -54.092  10.278  -85.638  1.00 35.89  ? 96   GLU D C   1 
ATOM   5573  O  O   . GLU D  1 115 ? -55.188  10.589  -85.135  1.00 41.80  ? 96   GLU D O   1 
ATOM   5574  C  CB  . GLU D  1 115 ? -52.961  9.511   -83.509  1.00 46.45  ? 96   GLU D CB  1 
ATOM   5575  C  CG  . GLU D  1 115 ? -53.108  7.985   -83.659  1.00 59.73  ? 96   GLU D CG  1 
ATOM   5576  C  CD  . GLU D  1 115 ? -53.261  7.257   -82.300  1.00 66.63  ? 96   GLU D CD  1 
ATOM   5577  O  OE1 . GLU D  1 115 ? -53.212  7.938   -81.238  1.00 69.09  ? 96   GLU D OE1 1 
ATOM   5578  O  OE2 . GLU D  1 115 ? -53.429  6.009   -82.295  1.00 64.07  ? 96   GLU D OE2 1 
ATOM   5579  N  N   . VAL D  1 116 ? -53.960  9.928   -86.915  1.00 26.04  ? 97   VAL D N   1 
ATOM   5580  C  CA  . VAL D  1 116 ? -55.121  9.859   -87.803  1.00 26.04  ? 97   VAL D CA  1 
ATOM   5581  C  C   . VAL D  1 116 ? -55.764  8.499   -87.661  1.00 26.23  ? 97   VAL D C   1 
ATOM   5582  O  O   . VAL D  1 116 ? -55.143  7.479   -87.939  1.00 29.59  ? 97   VAL D O   1 
ATOM   5583  C  CB  . VAL D  1 116 ? -54.743  10.134  -89.264  1.00 13.35  ? 97   VAL D CB  1 
ATOM   5584  C  CG1 . VAL D  1 116 ? -55.975  10.085  -90.144  1.00 17.43  ? 97   VAL D CG1 1 
ATOM   5585  C  CG2 . VAL D  1 116 ? -54.101  11.497  -89.358  1.00 17.74  ? 97   VAL D CG2 1 
ATOM   5586  N  N   . LEU D  1 117 ? -57.013  8.482   -87.215  1.00 26.76  ? 98   LEU D N   1 
ATOM   5587  C  CA  . LEU D  1 117 ? -57.670  7.225   -86.855  1.00 25.49  ? 98   LEU D CA  1 
ATOM   5588  C  C   . LEU D  1 117 ? -58.400  6.595   -88.042  1.00 31.80  ? 98   LEU D C   1 
ATOM   5589  O  O   . LEU D  1 117 ? -58.727  5.411   -88.021  1.00 33.56  ? 98   LEU D O   1 
ATOM   5590  C  CB  . LEU D  1 117 ? -58.654  7.473   -85.708  1.00 17.51  ? 98   LEU D CB  1 
ATOM   5591  C  CG  . LEU D  1 117 ? -58.133  8.116   -84.416  1.00 20.35  ? 98   LEU D CG  1 
ATOM   5592  C  CD1 . LEU D  1 117 ? -59.275  8.338   -83.411  1.00 25.10  ? 98   LEU D CD1 1 
ATOM   5593  C  CD2 . LEU D  1 117 ? -57.029  7.286   -83.771  1.00 16.39  ? 98   LEU D CD2 1 
ATOM   5594  N  N   . THR D  1 118 ? -58.664  7.406   -89.067  1.00 30.79  ? 99   THR D N   1 
ATOM   5595  C  CA  . THR D  1 118 ? -59.562  7.029   -90.149  1.00 23.04  ? 99   THR D CA  1 
ATOM   5596  C  C   . THR D  1 118 ? -58.831  6.892   -91.481  1.00 25.49  ? 99   THR D C   1 
ATOM   5597  O  O   . THR D  1 118 ? -57.715  7.390   -91.623  1.00 24.56  ? 99   THR D O   1 
ATOM   5598  C  CB  . THR D  1 118 ? -60.667  8.055   -90.280  1.00 19.82  ? 99   THR D CB  1 
ATOM   5599  O  OG1 . THR D  1 118 ? -60.085  9.352   -90.215  1.00 17.21  ? 99   THR D OG1 1 
ATOM   5600  C  CG2 . THR D  1 118 ? -61.657  7.886   -89.150  1.00 29.66  ? 99   THR D CG2 1 
ATOM   5601  N  N   . PRO D  1 119 ? -59.446  6.176   -92.452  1.00 28.41  ? 100  PRO D N   1 
ATOM   5602  C  CA  . PRO D  1 119 ? -58.883  6.060   -93.815  1.00 20.07  ? 100  PRO D CA  1 
ATOM   5603  C  C   . PRO D  1 119 ? -58.598  7.442   -94.385  1.00 14.73  ? 100  PRO D C   1 
ATOM   5604  O  O   . PRO D  1 119 ? -59.448  8.323   -94.280  1.00 16.28  ? 100  PRO D O   1 
ATOM   5605  C  CB  . PRO D  1 119 ? -60.010  5.391   -94.607  1.00 18.69  ? 100  PRO D CB  1 
ATOM   5606  C  CG  . PRO D  1 119 ? -60.736  4.564   -93.610  1.00 25.27  ? 100  PRO D CG  1 
ATOM   5607  C  CD  . PRO D  1 119 ? -60.667  5.357   -92.290  1.00 27.79  ? 100  PRO D CD  1 
ATOM   5608  N  N   . GLN D  1 120 ? -57.411  7.654   -94.940  1.00 19.04  ? 101  GLN D N   1 
ATOM   5609  C  CA  . GLN D  1 120 ? -57.060  9.000   -95.397  1.00 20.62  ? 101  GLN D CA  1 
ATOM   5610  C  C   . GLN D  1 120 ? -57.536  9.274   -96.820  1.00 20.10  ? 101  GLN D C   1 
ATOM   5611  O  O   . GLN D  1 120 ? -56.737  9.310   -97.743  1.00 24.24  ? 101  GLN D O   1 
ATOM   5612  C  CB  . GLN D  1 120 ? -55.569  9.243   -95.231  1.00 25.85  ? 101  GLN D CB  1 
ATOM   5613  C  CG  . GLN D  1 120 ? -55.135  9.011   -93.796  1.00 38.75  ? 101  GLN D CG  1 
ATOM   5614  C  CD  . GLN D  1 120 ? -53.656  9.244   -93.533  1.00 43.61  ? 101  GLN D CD  1 
ATOM   5615  O  OE1 . GLN D  1 120 ? -53.022  10.059  -94.178  1.00 51.03  ? 101  GLN D OE1 1 
ATOM   5616  N  NE2 . GLN D  1 120 ? -53.111  8.529   -92.564  1.00 43.39  ? 101  GLN D NE2 1 
ATOM   5617  N  N   . LEU D  1 121 ? -58.852  9.461   -96.956  1.00 22.89  ? 102  LEU D N   1 
ATOM   5618  C  CA  . LEU D  1 121 ? -59.526  9.729   -98.226  1.00 28.38  ? 102  LEU D CA  1 
ATOM   5619  C  C   . LEU D  1 121 ? -60.264  11.064  -98.158  1.00 30.55  ? 102  LEU D C   1 
ATOM   5620  O  O   . LEU D  1 121 ? -60.794  11.445  -97.111  1.00 36.09  ? 102  LEU D O   1 
ATOM   5621  C  CB  . LEU D  1 121 ? -60.539  8.632   -98.541  1.00 29.73  ? 102  LEU D CB  1 
ATOM   5622  C  CG  . LEU D  1 121 ? -59.995  7.217   -98.683  1.00 24.47  ? 102  LEU D CG  1 
ATOM   5623  C  CD1 . LEU D  1 121 ? -61.155  6.253   -98.873  1.00 23.49  ? 102  LEU D CD1 1 
ATOM   5624  C  CD2 . LEU D  1 121 ? -59.055  7.184   -99.861  1.00 21.28  ? 102  LEU D CD2 1 
ATOM   5625  N  N   . ALA D  1 122 ? -60.307  11.766  -99.287  1.00 21.34  ? 103  ALA D N   1 
ATOM   5626  C  CA  . ALA D  1 122 ? -61.004  13.029  -99.356  1.00 15.88  ? 103  ALA D CA  1 
ATOM   5627  C  C   . ALA D  1 122 ? -62.163  12.914  -100.341 1.00 25.17  ? 103  ALA D C   1 
ATOM   5628  O  O   . ALA D  1 122 ? -62.190  12.006  -101.185 1.00 32.51  ? 103  ALA D O   1 
ATOM   5629  C  CB  . ALA D  1 122 ? -60.052  14.131  -99.780  1.00 14.35  ? 103  ALA D CB  1 
ATOM   5630  N  N   . HIS D  1 123 ? -63.115  13.837  -100.219 1.00 22.62  ? 104  HIS D N   1 
ATOM   5631  C  CA  . HIS D  1 123 ? -64.182  14.008  -101.173 1.00 24.14  ? 104  HIS D CA  1 
ATOM   5632  C  C   . HIS D  1 123 ? -63.733  15.011  -102.227 1.00 29.43  ? 104  HIS D C   1 
ATOM   5633  O  O   . HIS D  1 123 ? -63.294  16.129  -101.897 1.00 25.78  ? 104  HIS D O   1 
ATOM   5634  C  CB  . HIS D  1 123 ? -65.441  14.511  -100.470 1.00 15.65  ? 104  HIS D CB  1 
ATOM   5635  C  CG  . HIS D  1 123 ? -66.292  13.409  -99.922  1.00 44.06  ? 104  HIS D CG  1 
ATOM   5636  N  ND1 . HIS D  1 123 ? -65.960  12.082  -100.063 1.00 38.20  ? 104  HIS D ND1 1 
ATOM   5637  C  CD2 . HIS D  1 123 ? -67.456  13.438  -99.222  1.00 44.77  ? 104  HIS D CD2 1 
ATOM   5638  C  CE1 . HIS D  1 123 ? -66.887  11.335  -99.481  1.00 36.49  ? 104  HIS D CE1 1 
ATOM   5639  N  NE2 . HIS D  1 123 ? -67.803  12.132  -98.961  1.00 37.55  ? 104  HIS D NE2 1 
ATOM   5640  N  N   . VAL D  1 124 ? -63.820  14.615  -103.495 1.00 26.64  ? 105  VAL D N   1 
ATOM   5641  C  CA  . VAL D  1 124 ? -63.729  15.604  -104.569 1.00 29.79  ? 105  VAL D CA  1 
ATOM   5642  C  C   . VAL D  1 124 ? -65.065  15.687  -105.302 1.00 27.60  ? 105  VAL D C   1 
ATOM   5643  O  O   . VAL D  1 124 ? -65.600  14.660  -105.764 1.00 22.37  ? 105  VAL D O   1 
ATOM   5644  C  CB  . VAL D  1 124 ? -62.583  15.323  -105.539 1.00 29.99  ? 105  VAL D CB  1 
ATOM   5645  C  CG1 . VAL D  1 124 ? -62.471  16.463  -106.538 1.00 24.44  ? 105  VAL D CG1 1 
ATOM   5646  C  CG2 . VAL D  1 124 ? -61.273  15.157  -104.770 1.00 33.35  ? 105  VAL D CG2 1 
ATOM   5647  N  N   . VAL D  1 125 ? -65.629  16.897  -105.337 1.00 26.85  ? 106  VAL D N   1 
ATOM   5648  C  CA  . VAL D  1 125 ? -66.912  17.142  -105.990 1.00 33.18  ? 106  VAL D CA  1 
ATOM   5649  C  C   . VAL D  1 125 ? -66.619  17.676  -107.388 1.00 36.78  ? 106  VAL D C   1 
ATOM   5650  O  O   . VAL D  1 125 ? -65.577  18.292  -107.598 1.00 39.68  ? 106  VAL D O   1 
ATOM   5651  C  CB  . VAL D  1 125 ? -67.786  18.136  -105.181 1.00 25.88  ? 106  VAL D CB  1 
ATOM   5652  C  CG1 . VAL D  1 125 ? -69.179  18.218  -105.755 1.00 25.16  ? 106  VAL D CG1 1 
ATOM   5653  C  CG2 . VAL D  1 125 ? -67.888  17.688  -103.756 1.00 18.05  ? 106  VAL D CG2 1 
ATOM   5654  N  N   . SER D  1 126 ? -67.523  17.428  -108.336 1.00 38.40  ? 107  SER D N   1 
ATOM   5655  C  CA  . SER D  1 126 ? -67.306  17.766  -109.756 1.00 44.19  ? 107  SER D CA  1 
ATOM   5656  C  C   . SER D  1 126 ? -66.958  19.238  -110.028 1.00 43.48  ? 107  SER D C   1 
ATOM   5657  O  O   . SER D  1 126 ? -66.298  19.552  -111.048 1.00 43.91  ? 107  SER D O   1 
ATOM   5658  C  CB  . SER D  1 126 ? -68.504  17.353  -110.617 1.00 39.64  ? 107  SER D CB  1 
ATOM   5659  O  OG  . SER D  1 126 ? -69.662  18.099  -110.275 1.00 32.40  ? 107  SER D OG  1 
ATOM   5660  N  N   . ASP D  1 127 ? -67.385  20.125  -109.123 1.00 30.55  ? 108  ASP D N   1 
ATOM   5661  C  CA  . ASP D  1 127 ? -67.020  21.544  -109.217 1.00 36.41  ? 108  ASP D CA  1 
ATOM   5662  C  C   . ASP D  1 127 ? -65.610  21.866  -108.701 1.00 40.54  ? 108  ASP D C   1 
ATOM   5663  O  O   . ASP D  1 127 ? -65.161  23.001  -108.789 1.00 47.55  ? 108  ASP D O   1 
ATOM   5664  C  CB  . ASP D  1 127 ? -68.044  22.426  -108.506 1.00 41.90  ? 108  ASP D CB  1 
ATOM   5665  C  CG  . ASP D  1 127 ? -68.198  22.069  -107.035 1.00 57.86  ? 108  ASP D CG  1 
ATOM   5666  O  OD1 . ASP D  1 127 ? -67.658  21.018  -106.625 1.00 63.10  ? 108  ASP D OD1 1 
ATOM   5667  O  OD2 . ASP D  1 127 ? -68.869  22.828  -106.285 1.00 62.94  ? 108  ASP D OD2 1 
ATOM   5668  N  N   . GLY D  1 128 ? -64.911  20.875  -108.166 1.00 42.87  ? 109  GLY D N   1 
ATOM   5669  C  CA  . GLY D  1 128 ? -63.557  21.093  -107.678 1.00 45.59  ? 109  GLY D CA  1 
ATOM   5670  C  C   . GLY D  1 128 ? -63.486  21.356  -106.182 1.00 44.84  ? 109  GLY D C   1 
ATOM   5671  O  O   . GLY D  1 128 ? -62.439  21.722  -105.640 1.00 39.70  ? 109  GLY D O   1 
ATOM   5672  N  N   . GLU D  1 129 ? -64.609  21.186  -105.505 1.00 50.30  ? 110  GLU D N   1 
ATOM   5673  C  CA  . GLU D  1 129 ? -64.613  21.376  -104.068 1.00 54.92  ? 110  GLU D CA  1 
ATOM   5674  C  C   . GLU D  1 129 ? -64.087  20.118  -103.388 1.00 48.23  ? 110  GLU D C   1 
ATOM   5675  O  O   . GLU D  1 129 ? -64.516  19.002  -103.696 1.00 51.56  ? 110  GLU D O   1 
ATOM   5676  C  CB  . GLU D  1 129 ? -66.013  21.711  -103.591 1.00 59.72  ? 110  GLU D CB  1 
ATOM   5677  C  CG  . GLU D  1 129 ? -66.043  22.836  -102.627 1.00 66.91  ? 110  GLU D CG  1 
ATOM   5678  C  CD  . GLU D  1 129 ? -66.801  22.445  -101.392 1.00 76.20  ? 110  GLU D CD  1 
ATOM   5679  O  OE1 . GLU D  1 129 ? -67.385  21.336  -101.383 1.00 69.57  ? 110  GLU D OE1 1 
ATOM   5680  O  OE2 . GLU D  1 129 ? -66.815  23.244  -100.435 1.00 87.33  ? 110  GLU D OE2 1 
ATOM   5681  N  N   . VAL D  1 130 ? -63.127  20.306  -102.492 1.00 39.62  ? 111  VAL D N   1 
ATOM   5682  C  CA  . VAL D  1 130 ? -62.502  19.190  -101.793 1.00 37.12  ? 111  VAL D CA  1 
ATOM   5683  C  C   . VAL D  1 130 ? -62.801  19.253  -100.303 1.00 33.33  ? 111  VAL D C   1 
ATOM   5684  O  O   . VAL D  1 130 ? -62.676  20.307  -99.665  1.00 37.26  ? 111  VAL D O   1 
ATOM   5685  C  CB  . VAL D  1 130 ? -60.972  19.183  -101.982 1.00 35.49  ? 111  VAL D CB  1 
ATOM   5686  C  CG1 . VAL D  1 130 ? -60.398  17.946  -101.368 1.00 34.85  ? 111  VAL D CG1 1 
ATOM   5687  C  CG2 . VAL D  1 130 ? -60.594  19.276  -103.470 1.00 29.40  ? 111  VAL D CG2 1 
ATOM   5688  N  N   . GLN D  1 131 ? -63.218  18.126  -99.753  1.00 28.82  ? 112  GLN D N   1 
ATOM   5689  C  CA  . GLN D  1 131 ? -63.401  18.036  -98.323  1.00 27.26  ? 112  GLN D CA  1 
ATOM   5690  C  C   . GLN D  1 131 ? -62.608  16.858  -97.787  1.00 30.20  ? 112  GLN D C   1 
ATOM   5691  O  O   . GLN D  1 131 ? -62.643  15.778  -98.345  1.00 38.36  ? 112  GLN D O   1 
ATOM   5692  C  CB  . GLN D  1 131 ? -64.872  17.893  -97.973  1.00 33.41  ? 112  GLN D CB  1 
ATOM   5693  C  CG  . GLN D  1 131 ? -65.128  17.943  -96.480  1.00 41.77  ? 112  GLN D CG  1 
ATOM   5694  C  CD  . GLN D  1 131 ? -66.597  18.056  -96.150  1.00 48.43  ? 112  GLN D CD  1 
ATOM   5695  O  OE1 . GLN D  1 131 ? -67.295  17.042  -96.013  1.00 54.67  ? 112  GLN D OE1 1 
ATOM   5696  N  NE2 . GLN D  1 131 ? -67.081  19.296  -96.017  1.00 46.74  ? 112  GLN D NE2 1 
ATOM   5697  N  N   . TYR D  1 132 ? -61.862  17.086  -96.718  1.00 31.39  ? 113  TYR D N   1 
ATOM   5698  C  CA  . TYR D  1 132 ? -61.142  16.038  -96.007  1.00 31.34  ? 113  TYR D CA  1 
ATOM   5699  C  C   . TYR D  1 132 ? -61.468  16.150  -94.502  1.00 34.77  ? 113  TYR D C   1 
ATOM   5700  O  O   . TYR D  1 132 ? -61.280  17.211  -93.887  1.00 37.04  ? 113  TYR D O   1 
ATOM   5701  C  CB  . TYR D  1 132 ? -59.651  16.212  -96.252  1.00 31.50  ? 113  TYR D CB  1 
ATOM   5702  C  CG  . TYR D  1 132 ? -58.765  15.221  -95.532  1.00 34.30  ? 113  TYR D CG  1 
ATOM   5703  C  CD1 . TYR D  1 132 ? -59.073  13.854  -95.516  1.00 36.45  ? 113  TYR D CD1 1 
ATOM   5704  C  CD2 . TYR D  1 132 ? -57.599  15.642  -94.895  1.00 28.72  ? 113  TYR D CD2 1 
ATOM   5705  C  CE1 . TYR D  1 132 ? -58.250  12.923  -94.847  1.00 31.95  ? 113  TYR D CE1 1 
ATOM   5706  C  CE2 . TYR D  1 132 ? -56.777  14.731  -94.245  1.00 30.96  ? 113  TYR D CE2 1 
ATOM   5707  C  CZ  . TYR D  1 132 ? -57.106  13.370  -94.218  1.00 29.08  ? 113  TYR D CZ  1 
ATOM   5708  O  OH  . TYR D  1 132 ? -56.268  12.465  -93.579  1.00 23.97  ? 113  TYR D OH  1 
ATOM   5709  N  N   . THR D  1 133 ? -61.969  15.059  -93.923  1.00 28.23  ? 114  THR D N   1 
ATOM   5710  C  CA  . THR D  1 133 ? -62.418  15.051  -92.535  1.00 22.44  ? 114  THR D CA  1 
ATOM   5711  C  C   . THR D  1 133 ? -61.860  13.844  -91.759  1.00 24.55  ? 114  THR D C   1 
ATOM   5712  O  O   . THR D  1 133 ? -62.574  12.879  -91.444  1.00 27.88  ? 114  THR D O   1 
ATOM   5713  C  CB  . THR D  1 133 ? -63.938  15.089  -92.477  1.00 20.50  ? 114  THR D CB  1 
ATOM   5714  O  OG1 . THR D  1 133 ? -64.405  16.133  -93.358  1.00 19.09  ? 114  THR D OG1 1 
ATOM   5715  C  CG2 . THR D  1 133 ? -64.424  15.334  -91.029  1.00 19.30  ? 114  THR D CG2 1 
ATOM   5716  N  N   . PRO D  1 134 ? -60.559  13.882  -91.463  1.00 20.70  ? 115  PRO D N   1 
ATOM   5717  C  CA  . PRO D  1 134 ? -60.003  12.778  -90.686  1.00 20.94  ? 115  PRO D CA  1 
ATOM   5718  C  C   . PRO D  1 134 ? -60.442  12.885  -89.233  1.00 26.36  ? 115  PRO D C   1 
ATOM   5719  O  O   . PRO D  1 134 ? -60.699  14.004  -88.753  1.00 31.16  ? 115  PRO D O   1 
ATOM   5720  C  CB  . PRO D  1 134 ? -58.484  13.016  -90.782  1.00 20.24  ? 115  PRO D CB  1 
ATOM   5721  C  CG  . PRO D  1 134 ? -58.340  14.494  -90.971  1.00 21.67  ? 115  PRO D CG  1 
ATOM   5722  C  CD  . PRO D  1 134 ? -59.541  14.894  -91.818  1.00 22.56  ? 115  PRO D CD  1 
ATOM   5723  N  N   . SER D  1 135 ? -60.534  11.743  -88.550  1.00 23.33  ? 116  SER D N   1 
ATOM   5724  C  CA  . SER D  1 135 ? -60.750  11.748  -87.114  1.00 24.74  ? 116  SER D CA  1 
ATOM   5725  C  C   . SER D  1 135 ? -59.377  11.677  -86.515  1.00 22.83  ? 116  SER D C   1 
ATOM   5726  O  O   . SER D  1 135 ? -58.613  10.754  -86.807  1.00 25.17  ? 116  SER D O   1 
ATOM   5727  C  CB  . SER D  1 135 ? -61.592  10.556  -86.672  1.00 27.69  ? 116  SER D CB  1 
ATOM   5728  O  OG  . SER D  1 135 ? -61.906  10.676  -85.298  1.00 34.53  ? 116  SER D OG  1 
ATOM   5729  N  N   . ILE D  1 136 ? -59.052  12.661  -85.691  1.00 24.75  ? 117  ILE D N   1 
ATOM   5730  C  CA  . ILE D  1 136 ? -57.711  12.776  -85.111  1.00 20.35  ? 117  ILE D CA  1 
ATOM   5731  C  C   . ILE D  1 136 ? -57.707  12.686  -83.595  1.00 23.64  ? 117  ILE D C   1 
ATOM   5732  O  O   . ILE D  1 136 ? -58.563  13.292  -82.931  1.00 27.14  ? 117  ILE D O   1 
ATOM   5733  C  CB  . ILE D  1 136 ? -57.085  14.094  -85.518  1.00 22.00  ? 117  ILE D CB  1 
ATOM   5734  C  CG1 . ILE D  1 136 ? -56.875  14.094  -87.033  1.00 27.36  ? 117  ILE D CG1 1 
ATOM   5735  C  CG2 . ILE D  1 136 ? -55.780  14.308  -84.794  1.00 25.86  ? 117  ILE D CG2 1 
ATOM   5736  C  CD1 . ILE D  1 136 ? -56.467  15.406  -87.614  1.00 30.82  ? 117  ILE D CD1 1 
ATOM   5737  N  N   . ARG D  1 137 ? -56.764  11.909  -83.054  1.00 26.07  ? 118  ARG D N   1 
ATOM   5738  C  CA  . ARG D  1 137 ? -56.476  11.941  -81.612  1.00 27.54  ? 118  ARG D CA  1 
ATOM   5739  C  C   . ARG D  1 137 ? -55.180  12.689  -81.381  1.00 24.57  ? 118  ARG D C   1 
ATOM   5740  O  O   . ARG D  1 137 ? -54.145  12.362  -81.956  1.00 21.03  ? 118  ARG D O   1 
ATOM   5741  C  CB  . ARG D  1 137 ? -56.367  10.537  -80.991  1.00 26.43  ? 118  ARG D CB  1 
ATOM   5742  C  CG  . ARG D  1 137 ? -56.030  10.607  -79.530  1.00 26.51  ? 118  ARG D CG  1 
ATOM   5743  C  CD  . ARG D  1 137 ? -56.070  9.263   -78.853  1.00 36.34  ? 118  ARG D CD  1 
ATOM   5744  N  NE  . ARG D  1 137 ? -55.662  9.376   -77.446  1.00 41.56  ? 118  ARG D NE  1 
ATOM   5745  C  CZ  . ARG D  1 137 ? -55.881  8.458   -76.510  1.00 42.21  ? 118  ARG D CZ  1 
ATOM   5746  N  NH1 . ARG D  1 137 ? -56.521  7.332   -76.794  1.00 43.47  ? 118  ARG D NH1 1 
ATOM   5747  N  NH2 . ARG D  1 137 ? -55.466  8.677   -75.278  1.00 47.61  ? 118  ARG D NH2 1 
ATOM   5748  N  N   . GLN D  1 138 ? -55.230  13.703  -80.536  1.00 29.40  ? 119  GLN D N   1 
ATOM   5749  C  CA  . GLN D  1 138 ? -54.060  14.537  -80.340  1.00 27.33  ? 119  GLN D CA  1 
ATOM   5750  C  C   . GLN D  1 138 ? -54.011  15.165  -78.948  1.00 30.45  ? 119  GLN D C   1 
ATOM   5751  O  O   . GLN D  1 138 ? -55.057  15.437  -78.318  1.00 30.61  ? 119  GLN D O   1 
ATOM   5752  C  CB  . GLN D  1 138 ? -54.029  15.620  -81.414  1.00 22.67  ? 119  GLN D CB  1 
ATOM   5753  C  CG  . GLN D  1 138 ? -52.681  16.254  -81.582  1.00 24.47  ? 119  GLN D CG  1 
ATOM   5754  C  CD  . GLN D  1 138 ? -52.596  17.078  -82.834  1.00 23.97  ? 119  GLN D CD  1 
ATOM   5755  O  OE1 . GLN D  1 138 ? -53.609  17.553  -83.356  1.00 29.48  ? 119  GLN D OE1 1 
ATOM   5756  N  NE2 . GLN D  1 138 ? -51.390  17.257  -83.325  1.00 25.25  ? 119  GLN D NE2 1 
ATOM   5757  N  N   . ARG D  1 139 ? -52.791  15.407  -78.470  1.00 30.81  ? 120  ARG D N   1 
ATOM   5758  C  CA  . ARG D  1 139 ? -52.608  16.001  -77.142  1.00 32.62  ? 120  ARG D CA  1 
ATOM   5759  C  C   . ARG D  1 139 ? -52.275  17.492  -77.294  1.00 31.54  ? 120  ARG D C   1 
ATOM   5760  O  O   . ARG D  1 139 ? -51.482  17.899  -78.175  1.00 26.74  ? 120  ARG D O   1 
ATOM   5761  C  CB  . ARG D  1 139 ? -51.537  15.238  -76.346  1.00 18.82  ? 120  ARG D CB  1 
ATOM   5762  C  CG  . ARG D  1 139 ? -51.561  15.451  -74.866  1.00 33.82  ? 120  ARG D CG  1 
ATOM   5763  C  CD  . ARG D  1 139 ? -50.881  14.262  -74.116  1.00 46.93  ? 120  ARG D CD  1 
ATOM   5764  N  NE  . ARG D  1 139 ? -50.685  14.435  -72.663  1.00 39.52  ? 120  ARG D NE  1 
ATOM   5765  C  CZ  . ARG D  1 139 ? -51.653  14.321  -71.753  1.00 43.52  ? 120  ARG D CZ  1 
ATOM   5766  N  NH1 . ARG D  1 139 ? -52.902  14.074  -72.125  1.00 40.05  ? 120  ARG D NH1 1 
ATOM   5767  N  NH2 . ARG D  1 139 ? -51.381  14.473  -70.460  1.00 53.66  ? 120  ARG D NH2 1 
ATOM   5768  N  N   . PHE D  1 140 ? -52.929  18.308  -76.468  1.00 20.16  ? 121  PHE D N   1 
ATOM   5769  C  CA  . PHE D  1 140 ? -52.718  19.755  -76.505  1.00 20.84  ? 121  PHE D CA  1 
ATOM   5770  C  C   . PHE D  1 140 ? -52.236  20.331  -75.200  1.00 23.52  ? 121  PHE D C   1 
ATOM   5771  O  O   . PHE D  1 140 ? -52.554  19.838  -74.098  1.00 27.21  ? 121  PHE D O   1 
ATOM   5772  C  CB  . PHE D  1 140 ? -53.982  20.488  -76.961  1.00 21.06  ? 121  PHE D CB  1 
ATOM   5773  C  CG  . PHE D  1 140 ? -54.457  20.065  -78.335  1.00 33.56  ? 121  PHE D CG  1 
ATOM   5774  C  CD1 . PHE D  1 140 ? -53.897  20.611  -79.482  1.00 26.42  ? 121  PHE D CD1 1 
ATOM   5775  C  CD2 . PHE D  1 140 ? -55.432  19.086  -78.477  1.00 34.74  ? 121  PHE D CD2 1 
ATOM   5776  C  CE1 . PHE D  1 140 ? -54.319  20.209  -80.701  1.00 26.75  ? 121  PHE D CE1 1 
ATOM   5777  C  CE2 . PHE D  1 140 ? -55.860  18.696  -79.726  1.00 28.95  ? 121  PHE D CE2 1 
ATOM   5778  C  CZ  . PHE D  1 140 ? -55.308  19.254  -80.826  1.00 25.33  ? 121  PHE D CZ  1 
ATOM   5779  N  N   . SER D  1 141 ? -51.464  21.394  -75.335  1.00 26.24  ? 122  SER D N   1 
ATOM   5780  C  CA  . SER D  1 141 ? -51.097  22.212  -74.200  1.00 31.40  ? 122  SER D CA  1 
ATOM   5781  C  C   . SER D  1 141 ? -52.066  23.370  -74.166  1.00 31.70  ? 122  SER D C   1 
ATOM   5782  O  O   . SER D  1 141 ? -52.068  24.202  -75.072  1.00 31.81  ? 122  SER D O   1 
ATOM   5783  C  CB  . SER D  1 141 ? -49.670  22.718  -74.365  1.00 38.00  ? 122  SER D CB  1 
ATOM   5784  O  OG  . SER D  1 141 ? -49.451  23.882  -73.587  1.00 49.95  ? 122  SER D OG  1 
ATOM   5785  N  N   . CYS D  1 142 ? -52.903  23.414  -73.133  1.00 33.31  ? 123  CYS D N   1 
ATOM   5786  C  CA  . CYS D  1 142 ? -53.881  24.505  -73.001  1.00 44.66  ? 123  CYS D CA  1 
ATOM   5787  C  C   . CYS D  1 142 ? -54.359  24.714  -71.552  1.00 41.67  ? 123  CYS D C   1 
ATOM   5788  O  O   . CYS D  1 142 ? -53.995  23.966  -70.643  1.00 28.74  ? 123  CYS D O   1 
ATOM   5789  C  CB  . CYS D  1 142 ? -55.074  24.255  -73.930  1.00 48.34  ? 123  CYS D CB  1 
ATOM   5790  S  SG  . CYS D  1 142 ? -55.862  22.669  -73.581  1.00 98.62  ? 123  CYS D SG  1 
ATOM   5791  N  N   . ASP D  1 143 ? -55.195  25.728  -71.354  1.00 42.72  ? 124  ASP D N   1 
ATOM   5792  C  CA  . ASP D  1 143 ? -55.686  26.046  -70.026  1.00 45.84  ? 124  ASP D CA  1 
ATOM   5793  C  C   . ASP D  1 143 ? -56.762  25.076  -69.549  1.00 45.70  ? 124  ASP D C   1 
ATOM   5794  O  O   . ASP D  1 143 ? -57.907  25.142  -69.975  1.00 55.30  ? 124  ASP D O   1 
ATOM   5795  C  CB  . ASP D  1 143 ? -56.229  27.476  -69.991  1.00 53.29  ? 124  ASP D CB  1 
ATOM   5796  C  CG  . ASP D  1 143 ? -56.491  27.971  -68.574  1.00 53.77  ? 124  ASP D CG  1 
ATOM   5797  O  OD1 . ASP D  1 143 ? -55.985  27.351  -67.604  1.00 49.36  ? 124  ASP D OD1 1 
ATOM   5798  O  OD2 . ASP D  1 143 ? -57.201  28.988  -68.444  1.00 55.43  ? 124  ASP D OD2 1 
ATOM   5799  N  N   . VAL D  1 144 ? -56.390  24.196  -68.637  1.00 37.21  ? 125  VAL D N   1 
ATOM   5800  C  CA  . VAL D  1 144 ? -57.295  23.197  -68.111  1.00 37.08  ? 125  VAL D CA  1 
ATOM   5801  C  C   . VAL D  1 144 ? -57.860  23.620  -66.728  1.00 46.10  ? 125  VAL D C   1 
ATOM   5802  O  O   . VAL D  1 144 ? -58.650  22.896  -66.094  1.00 41.50  ? 125  VAL D O   1 
ATOM   5803  C  CB  . VAL D  1 144 ? -56.563  21.850  -68.025  1.00 42.32  ? 125  VAL D CB  1 
ATOM   5804  C  CG1 . VAL D  1 144 ? -57.524  20.717  -67.766  1.00 41.16  ? 125  VAL D CG1 1 
ATOM   5805  C  CG2 . VAL D  1 144 ? -55.818  21.597  -69.323  1.00 49.40  ? 125  VAL D CG2 1 
ATOM   5806  N  N   . SER D  1 145 ? -57.468  24.806  -66.267  1.00 48.58  ? 126  SER D N   1 
ATOM   5807  C  CA  . SER D  1 145 ? -57.953  25.303  -64.967  1.00 49.98  ? 126  SER D CA  1 
ATOM   5808  C  C   . SER D  1 145 ? -59.489  25.475  -64.941  1.00 54.96  ? 126  SER D C   1 
ATOM   5809  O  O   . SER D  1 145 ? -60.089  26.103  -65.833  1.00 54.11  ? 126  SER D O   1 
ATOM   5810  C  CB  . SER D  1 145 ? -57.243  26.601  -64.537  1.00 44.99  ? 126  SER D CB  1 
ATOM   5811  O  OG  . SER D  1 145 ? -57.714  27.726  -65.260  1.00 51.24  ? 126  SER D OG  1 
ATOM   5812  N  N   . GLY D  1 146 ? -60.118  24.885  -63.923  1.00 52.90  ? 127  GLY D N   1 
ATOM   5813  C  CA  . GLY D  1 146 ? -61.546  25.033  -63.712  1.00 45.35  ? 127  GLY D CA  1 
ATOM   5814  C  C   . GLY D  1 146 ? -62.338  23.936  -64.366  1.00 45.44  ? 127  GLY D C   1 
ATOM   5815  O  O   . GLY D  1 146 ? -63.570  23.998  -64.435  1.00 38.18  ? 127  GLY D O   1 
ATOM   5816  N  N   . VAL D  1 147 ? -61.629  22.917  -64.845  1.00 53.59  ? 128  VAL D N   1 
ATOM   5817  C  CA  . VAL D  1 147 ? -62.276  21.776  -65.501  1.00 55.50  ? 128  VAL D CA  1 
ATOM   5818  C  C   . VAL D  1 147 ? -63.302  21.095  -64.584  1.00 53.36  ? 128  VAL D C   1 
ATOM   5819  O  O   . VAL D  1 147 ? -64.336  20.593  -65.048  1.00 36.49  ? 128  VAL D O   1 
ATOM   5820  C  CB  . VAL D  1 147 ? -61.227  20.753  -66.009  1.00 49.92  ? 128  VAL D CB  1 
ATOM   5821  C  CG1 . VAL D  1 147 ? -60.362  20.235  -64.856  1.00 44.95  ? 128  VAL D CG1 1 
ATOM   5822  C  CG2 . VAL D  1 147 ? -61.901  19.606  -66.769  1.00 52.09  ? 128  VAL D CG2 1 
ATOM   5823  N  N   . ASP D  1 148 ? -63.013  21.121  -63.282  1.00 64.95  ? 129  ASP D N   1 
ATOM   5824  C  CA  . ASP D  1 148 ? -63.832  20.447  -62.277  1.00 72.94  ? 129  ASP D CA  1 
ATOM   5825  C  C   . ASP D  1 148 ? -64.887  21.365  -61.623  1.00 66.37  ? 129  ASP D C   1 
ATOM   5826  O  O   . ASP D  1 148 ? -65.583  20.958  -60.701  1.00 68.08  ? 129  ASP D O   1 
ATOM   5827  C  CB  . ASP D  1 148 ? -62.931  19.817  -61.203  1.00 83.86  ? 129  ASP D CB  1 
ATOM   5828  C  CG  . ASP D  1 148 ? -63.298  18.372  -60.909  1.00 89.70  ? 129  ASP D CG  1 
ATOM   5829  O  OD1 . ASP D  1 148 ? -64.516  18.066  -60.887  1.00 86.51  ? 129  ASP D OD1 1 
ATOM   5830  O  OD2 . ASP D  1 148 ? -62.372  17.549  -60.703  1.00 94.76  ? 129  ASP D OD2 1 
ATOM   5831  N  N   . THR D  1 149 ? -64.995  22.598  -62.104  1.00 60.42  ? 130  THR D N   1 
ATOM   5832  C  CA  . THR D  1 149 ? -66.008  23.535  -61.633  1.00 54.94  ? 130  THR D CA  1 
ATOM   5833  C  C   . THR D  1 149 ? -67.224  23.536  -62.556  1.00 63.59  ? 130  THR D C   1 
ATOM   5834  O  O   . THR D  1 149 ? -67.269  22.776  -63.529  1.00 71.55  ? 130  THR D O   1 
ATOM   5835  C  CB  . THR D  1 149 ? -65.463  24.971  -61.564  1.00 48.91  ? 130  THR D CB  1 
ATOM   5836  O  OG1 . THR D  1 149 ? -65.473  25.556  -62.879  1.00 52.42  ? 130  THR D OG1 1 
ATOM   5837  C  CG2 . THR D  1 149 ? -64.047  24.977  -60.991  1.00 43.84  ? 130  THR D CG2 1 
ATOM   5838  N  N   . GLU D  1 150 ? -68.195  24.406  -62.254  1.00 64.48  ? 131  GLU D N   1 
ATOM   5839  C  CA  . GLU D  1 150 ? -69.468  24.459  -62.995  1.00 62.47  ? 131  GLU D CA  1 
ATOM   5840  C  C   . GLU D  1 150 ? -69.438  25.443  -64.166  1.00 57.73  ? 131  GLU D C   1 
ATOM   5841  O  O   . GLU D  1 150 ? -70.362  25.499  -64.971  1.00 59.30  ? 131  GLU D O   1 
ATOM   5842  C  CB  . GLU D  1 150 ? -70.669  24.742  -62.063  1.00 59.95  ? 131  GLU D CB  1 
ATOM   5843  C  CG  . GLU D  1 150 ? -71.861  23.744  -62.205  1.00 82.59  ? 131  GLU D CG  1 
ATOM   5844  C  CD  . GLU D  1 150 ? -71.521  22.253  -61.878  1.00 53.76  ? 131  GLU D CD  1 
ATOM   5845  O  OE1 . GLU D  1 150 ? -70.827  21.963  -60.850  1.00 43.88  ? 131  GLU D OE1 1 
ATOM   5846  O  OE2 . GLU D  1 150 ? -71.976  21.365  -62.656  1.00 56.20  ? 131  GLU D OE2 1 
ATOM   5847  N  N   . SER D  1 151 ? -68.365  26.206  -64.279  1.00 56.23  ? 132  SER D N   1 
ATOM   5848  C  CA  . SER D  1 151 ? -68.174  27.053  -65.461  1.00 60.55  ? 132  SER D CA  1 
ATOM   5849  C  C   . SER D  1 151 ? -67.218  26.375  -66.457  1.00 54.94  ? 132  SER D C   1 
ATOM   5850  O  O   . SER D  1 151 ? -67.137  26.750  -67.622  1.00 39.86  ? 132  SER D O   1 
ATOM   5851  C  CB  . SER D  1 151 ? -67.638  28.424  -65.049  1.00 61.67  ? 132  SER D CB  1 
ATOM   5852  O  OG  . SER D  1 151 ? -66.424  28.278  -64.329  1.00 62.06  ? 132  SER D OG  1 
ATOM   5853  N  N   . GLY D  1 152 ? -66.485  25.380  -65.963  1.00 58.26  ? 133  GLY D N   1 
ATOM   5854  C  CA  . GLY D  1 152 ? -65.649  24.545  -66.802  1.00 46.06  ? 133  GLY D CA  1 
ATOM   5855  C  C   . GLY D  1 152 ? -64.325  25.172  -67.170  1.00 42.43  ? 133  GLY D C   1 
ATOM   5856  O  O   . GLY D  1 152 ? -64.070  26.343  -66.867  1.00 44.26  ? 133  GLY D O   1 
ATOM   5857  N  N   . ALA D  1 153 ? -63.477  24.378  -67.822  1.00 41.48  ? 134  ALA D N   1 
ATOM   5858  C  CA  . ALA D  1 153 ? -62.234  24.874  -68.409  1.00 42.38  ? 134  ALA D CA  1 
ATOM   5859  C  C   . ALA D  1 153 ? -62.498  25.371  -69.823  1.00 42.32  ? 134  ALA D C   1 
ATOM   5860  O  O   . ALA D  1 153 ? -63.462  24.958  -70.473  1.00 24.47  ? 134  ALA D O   1 
ATOM   5861  C  CB  . ALA D  1 153 ? -61.163  23.785  -68.424  1.00 38.93  ? 134  ALA D CB  1 
ATOM   5862  N  N   . THR D  1 154 ? -61.650  26.275  -70.294  1.00 45.63  ? 135  THR D N   1 
ATOM   5863  C  CA  . THR D  1 154 ? -61.705  26.675  -71.695  1.00 44.80  ? 135  THR D CA  1 
ATOM   5864  C  C   . THR D  1 154 ? -60.353  26.440  -72.358  1.00 43.89  ? 135  THR D C   1 
ATOM   5865  O  O   . THR D  1 154 ? -59.412  27.217  -72.177  1.00 44.08  ? 135  THR D O   1 
ATOM   5866  C  CB  . THR D  1 154 ? -62.166  28.130  -71.875  1.00 46.63  ? 135  THR D CB  1 
ATOM   5867  O  OG1 . THR D  1 154 ? -63.477  28.283  -71.306  1.00 55.85  ? 135  THR D OG1 1 
ATOM   5868  C  CG2 . THR D  1 154 ? -62.211  28.501  -73.358  1.00 39.61  ? 135  THR D CG2 1 
ATOM   5869  N  N   . CYS D  1 155 ? -60.268  25.342  -73.105  1.00 45.01  ? 136  CYS D N   1 
ATOM   5870  C  CA  . CYS D  1 155 ? -59.078  24.997  -73.864  1.00 42.79  ? 136  CYS D CA  1 
ATOM   5871  C  C   . CYS D  1 155 ? -59.109  25.611  -75.270  1.00 40.96  ? 136  CYS D C   1 
ATOM   5872  O  O   . CYS D  1 155 ? -60.031  25.388  -76.045  1.00 43.97  ? 136  CYS D O   1 
ATOM   5873  C  CB  . CYS D  1 155 ? -58.942  23.482  -73.948  1.00 40.63  ? 136  CYS D CB  1 
ATOM   5874  S  SG  . CYS D  1 155 ? -57.450  22.975  -74.808  1.00 88.45  ? 136  CYS D SG  1 
ATOM   5875  N  N   . ARG D  1 156 ? -58.087  26.389  -75.589  1.00 44.20  ? 137  ARG D N   1 
ATOM   5876  C  CA  . ARG D  1 156 ? -58.027  27.120  -76.849  1.00 45.86  ? 137  ARG D CA  1 
ATOM   5877  C  C   . ARG D  1 156 ? -57.081  26.405  -77.822  1.00 41.52  ? 137  ARG D C   1 
ATOM   5878  O  O   . ARG D  1 156 ? -55.891  26.267  -77.547  1.00 44.56  ? 137  ARG D O   1 
ATOM   5879  C  CB  . ARG D  1 156 ? -57.542  28.550  -76.568  1.00 49.36  ? 137  ARG D CB  1 
ATOM   5880  C  CG  . ARG D  1 156 ? -57.726  29.546  -77.691  1.00 58.46  ? 137  ARG D CG  1 
ATOM   5881  C  CD  . ARG D  1 156 ? -57.187  30.935  -77.317  1.00 68.74  ? 137  ARG D CD  1 
ATOM   5882  N  NE  . ARG D  1 156 ? -55.738  30.952  -77.085  1.00 74.20  ? 137  ARG D NE  1 
ATOM   5883  C  CZ  . ARG D  1 156 ? -55.158  31.102  -75.890  1.00 74.76  ? 137  ARG D CZ  1 
ATOM   5884  N  NH1 . ARG D  1 156 ? -55.900  31.259  -74.791  1.00 72.22  ? 137  ARG D NH1 1 
ATOM   5885  N  NH2 . ARG D  1 156 ? -53.829  31.101  -75.794  1.00 73.38  ? 137  ARG D NH2 1 
ATOM   5886  N  N   . ILE D  1 157 ? -57.613  25.955  -78.952  1.00 37.21  ? 138  ILE D N   1 
ATOM   5887  C  CA  . ILE D  1 157 ? -56.812  25.248  -79.952  1.00 37.93  ? 138  ILE D CA  1 
ATOM   5888  C  C   . ILE D  1 157 ? -56.548  26.099  -81.191  1.00 33.70  ? 138  ILE D C   1 
ATOM   5889  O  O   . ILE D  1 157 ? -57.473  26.554  -81.846  1.00 34.05  ? 138  ILE D O   1 
ATOM   5890  C  CB  . ILE D  1 157 ? -57.473  23.910  -80.358  1.00 40.63  ? 138  ILE D CB  1 
ATOM   5891  C  CG1 . ILE D  1 157 ? -57.499  22.947  -79.147  1.00 43.93  ? 138  ILE D CG1 1 
ATOM   5892  C  CG2 . ILE D  1 157 ? -56.762  23.279  -81.556  1.00 27.68  ? 138  ILE D CG2 1 
ATOM   5893  C  CD1 . ILE D  1 157 ? -58.274  21.649  -79.399  1.00 41.56  ? 138  ILE D CD1 1 
ATOM   5894  N  N   . LYS D  1 158 ? -55.273  26.299  -81.510  1.00 32.99  ? 139  LYS D N   1 
ATOM   5895  C  CA  . LYS D  1 158 ? -54.879  27.185  -82.602  1.00 34.77  ? 139  LYS D CA  1 
ATOM   5896  C  C   . LYS D  1 158 ? -54.437  26.406  -83.833  1.00 33.81  ? 139  LYS D C   1 
ATOM   5897  O  O   . LYS D  1 158 ? -53.388  25.746  -83.821  1.00 35.72  ? 139  LYS D O   1 
ATOM   5898  C  CB  . LYS D  1 158 ? -53.740  28.094  -82.137  1.00 37.47  ? 139  LYS D CB  1 
ATOM   5899  C  CG  . LYS D  1 158 ? -53.245  29.109  -83.163  1.00 37.32  ? 139  LYS D CG  1 
ATOM   5900  C  CD  . LYS D  1 158 ? -51.993  29.829  -82.640  1.00 42.35  ? 139  LYS D CD  1 
ATOM   5901  C  CE  . LYS D  1 158 ? -51.341  30.707  -83.711  1.00 43.67  ? 139  LYS D CE  1 
ATOM   5902  N  NZ  . LYS D  1 158 ? -50.050  31.317  -83.223  1.00 41.90  ? 139  LYS D NZ  1 
ATOM   5903  N  N   . ILE D  1 159 ? -55.231  26.504  -84.897  1.00 31.19  ? 140  ILE D N   1 
ATOM   5904  C  CA  . ILE D  1 159 ? -54.957  25.788  -86.147  1.00 32.79  ? 140  ILE D CA  1 
ATOM   5905  C  C   . ILE D  1 159 ? -54.768  26.739  -87.310  1.00 25.55  ? 140  ILE D C   1 
ATOM   5906  O  O   . ILE D  1 159 ? -55.629  27.569  -87.575  1.00 30.11  ? 140  ILE D O   1 
ATOM   5907  C  CB  . ILE D  1 159 ? -56.096  24.805  -86.484  1.00 40.08  ? 140  ILE D CB  1 
ATOM   5908  C  CG1 . ILE D  1 159 ? -56.201  23.736  -85.389  1.00 39.58  ? 140  ILE D CG1 1 
ATOM   5909  C  CG2 . ILE D  1 159 ? -55.882  24.155  -87.848  1.00 40.98  ? 140  ILE D CG2 1 
ATOM   5910  C  CD1 . ILE D  1 159 ? -57.258  22.695  -85.655  1.00 42.61  ? 140  ILE D CD1 1 
ATOM   5911  N  N   . GLY D  1 160 ? -53.632  26.629  -87.998  1.00 24.35  ? 141  GLY D N   1 
ATOM   5912  C  CA  . GLY D  1 160 ? -53.391  27.385  -89.227  1.00 24.18  ? 141  GLY D CA  1 
ATOM   5913  C  C   . GLY D  1 160 ? -52.430  26.720  -90.209  1.00 30.80  ? 141  GLY D C   1 
ATOM   5914  O  O   . GLY D  1 160 ? -51.853  25.659  -89.951  1.00 34.82  ? 141  GLY D O   1 
ATOM   5915  N  N   . SER D  1 161 ? -52.248  27.340  -91.361  1.00 34.47  ? 142  SER D N   1 
ATOM   5916  C  CA  . SER D  1 161 ? -51.230  26.851  -92.271  1.00 34.41  ? 142  SER D CA  1 
ATOM   5917  C  C   . SER D  1 161 ? -49.841  27.041  -91.654  1.00 29.51  ? 142  SER D C   1 
ATOM   5918  O  O   . SER D  1 161 ? -49.528  28.096  -91.127  1.00 34.10  ? 142  SER D O   1 
ATOM   5919  C  CB  . SER D  1 161 ? -51.311  27.572  -93.617  1.00 34.33  ? 142  SER D CB  1 
ATOM   5920  O  OG  . SER D  1 161 ? -50.136  27.308  -94.365  1.00 35.19  ? 142  SER D OG  1 
ATOM   5921  N  N   . TRP D  1 162 ? -49.007  26.018  -91.723  1.00 30.09  ? 143  TRP D N   1 
ATOM   5922  C  CA  . TRP D  1 162 ? -47.655  26.125  -91.186  1.00 32.04  ? 143  TRP D CA  1 
ATOM   5923  C  C   . TRP D  1 162 ? -46.750  26.983  -92.073  1.00 35.95  ? 143  TRP D C   1 
ATOM   5924  O  O   . TRP D  1 162 ? -45.955  27.762  -91.559  1.00 35.93  ? 143  TRP D O   1 
ATOM   5925  C  CB  . TRP D  1 162 ? -47.034  24.733  -91.006  1.00 30.42  ? 143  TRP D CB  1 
ATOM   5926  C  CG  . TRP D  1 162 ? -45.878  24.729  -90.053  1.00 29.68  ? 143  TRP D CG  1 
ATOM   5927  C  CD1 . TRP D  1 162 ? -44.567  24.457  -90.334  1.00 31.55  ? 143  TRP D CD1 1 
ATOM   5928  C  CD2 . TRP D  1 162 ? -45.930  25.010  -88.652  1.00 29.58  ? 143  TRP D CD2 1 
ATOM   5929  N  NE1 . TRP D  1 162 ? -43.799  24.532  -89.173  1.00 21.12  ? 143  TRP D NE1 1 
ATOM   5930  C  CE2 . TRP D  1 162 ? -44.614  24.896  -88.139  1.00 28.11  ? 143  TRP D CE2 1 
ATOM   5931  C  CE3 . TRP D  1 162 ? -46.959  25.358  -87.777  1.00 27.63  ? 143  TRP D CE3 1 
ATOM   5932  C  CZ2 . TRP D  1 162 ? -44.305  25.127  -86.801  1.00 33.33  ? 143  TRP D CZ2 1 
ATOM   5933  C  CZ3 . TRP D  1 162 ? -46.659  25.585  -86.445  1.00 28.32  ? 143  TRP D CZ3 1 
ATOM   5934  C  CH2 . TRP D  1 162 ? -45.340  25.462  -85.964  1.00 31.16  ? 143  TRP D CH2 1 
ATOM   5935  N  N   . THR D  1 163 ? -46.864  26.844  -93.396  1.00 37.84  ? 144  THR D N   1 
ATOM   5936  C  CA  . THR D  1 163 ? -45.910  27.494  -94.300  1.00 35.07  ? 144  THR D CA  1 
ATOM   5937  C  C   . THR D  1 163 ? -46.532  28.470  -95.291  1.00 37.70  ? 144  THR D C   1 
ATOM   5938  O  O   . THR D  1 163 ? -45.820  29.195  -95.962  1.00 38.91  ? 144  THR D O   1 
ATOM   5939  C  CB  . THR D  1 163 ? -45.035  26.466  -95.098  1.00 31.72  ? 144  THR D CB  1 
ATOM   5940  O  OG1 . THR D  1 163 ? -45.819  25.840  -96.131  1.00 29.82  ? 144  THR D OG1 1 
ATOM   5941  C  CG2 . THR D  1 163 ? -44.434  25.416  -94.175  1.00 27.81  ? 144  THR D CG2 1 
ATOM   5942  N  N   . HIS D  1 164 ? -47.853  28.491  -95.411  1.00 39.22  ? 145  HIS D N   1 
ATOM   5943  C  CA  . HIS D  1 164 ? -48.479  29.415  -96.374  1.00 42.03  ? 145  HIS D CA  1 
ATOM   5944  C  C   . HIS D  1 164 ? -49.076  30.643  -95.671  1.00 40.64  ? 145  HIS D C   1 
ATOM   5945  O  O   . HIS D  1 164 ? -49.864  30.523  -94.719  1.00 43.23  ? 145  HIS D O   1 
ATOM   5946  C  CB  . HIS D  1 164 ? -49.529  28.697  -97.223  1.00 24.79  ? 145  HIS D CB  1 
ATOM   5947  C  CG  . HIS D  1 164 ? -48.961  27.642  -98.115  1.00 36.96  ? 145  HIS D CG  1 
ATOM   5948  N  ND1 . HIS D  1 164 ? -48.273  27.941  -99.276  1.00 43.17  ? 145  HIS D ND1 1 
ATOM   5949  C  CD2 . HIS D  1 164 ? -49.002  26.289  -98.045  1.00 36.94  ? 145  HIS D CD2 1 
ATOM   5950  C  CE1 . HIS D  1 164 ? -47.909  26.821  -99.873  1.00 44.78  ? 145  HIS D CE1 1 
ATOM   5951  N  NE2 . HIS D  1 164 ? -48.341  25.800  -99.149  1.00 42.31  ? 145  HIS D NE2 1 
ATOM   5952  N  N   . HIS D  1 165 ? -48.676  31.826  -96.117  1.00 38.58  ? 146  HIS D N   1 
ATOM   5953  C  CA  . HIS D  1 165 ? -49.176  33.067  -95.509  1.00 36.52  ? 146  HIS D CA  1 
ATOM   5954  C  C   . HIS D  1 165 ? -50.566  33.455  -96.051  1.00 35.91  ? 146  HIS D C   1 
ATOM   5955  O  O   . HIS D  1 165 ? -51.170  32.721  -96.841  1.00 29.30  ? 146  HIS D O   1 
ATOM   5956  C  CB  . HIS D  1 165 ? -48.167  34.210  -95.664  1.00 35.36  ? 146  HIS D CB  1 
ATOM   5957  C  CG  . HIS D  1 165 ? -47.798  34.507  -97.091  1.00 47.04  ? 146  HIS D CG  1 
ATOM   5958  N  ND1 . HIS D  1 165 ? -48.690  35.035  -98.009  1.00 48.10  ? 146  HIS D ND1 1 
ATOM   5959  C  CD2 . HIS D  1 165 ? -46.629  34.346  -97.760  1.00 46.25  ? 146  HIS D CD2 1 
ATOM   5960  C  CE1 . HIS D  1 165 ? -48.081  35.189  -99.171  1.00 47.49  ? 146  HIS D CE1 1 
ATOM   5961  N  NE2 . HIS D  1 165 ? -46.828  34.783  -99.046  1.00 44.63  ? 146  HIS D NE2 1 
ATOM   5962  N  N   . SER D  1 166 ? -51.067  34.608  -95.617  1.00 42.64  ? 147  SER D N   1 
ATOM   5963  C  CA  . SER D  1 166 ? -52.471  34.986  -95.843  1.00 42.98  ? 147  SER D CA  1 
ATOM   5964  C  C   . SER D  1 166 ? -52.858  35.167  -97.304  1.00 49.26  ? 147  SER D C   1 
ATOM   5965  O  O   . SER D  1 166 ? -54.039  35.077  -97.645  1.00 53.29  ? 147  SER D O   1 
ATOM   5966  C  CB  . SER D  1 166 ? -52.800  36.269  -95.092  1.00 37.64  ? 147  SER D CB  1 
ATOM   5967  O  OG  . SER D  1 166 ? -51.901  37.294  -95.467  1.00 34.88  ? 147  SER D OG  1 
ATOM   5968  N  N   . ARG D  1 167 ? -51.875  35.431  -98.160  1.00 50.18  ? 148  ARG D N   1 
ATOM   5969  C  CA  . ARG D  1 167 ? -52.150  35.634  -99.577  1.00 56.42  ? 148  ARG D CA  1 
ATOM   5970  C  C   . ARG D  1 167 ? -52.173  34.319  -100.358 1.00 52.18  ? 148  ARG D C   1 
ATOM   5971  O  O   . ARG D  1 167 ? -52.670  34.270  -101.494 1.00 54.28  ? 148  ARG D O   1 
ATOM   5972  C  CB  . ARG D  1 167 ? -51.155  36.630  -100.193 1.00 67.69  ? 148  ARG D CB  1 
ATOM   5973  C  CG  . ARG D  1 167 ? -51.303  38.075  -99.677  1.00 74.63  ? 148  ARG D CG  1 
ATOM   5974  C  CD  . ARG D  1 167 ? -50.456  39.077  -100.483 1.00 82.19  ? 148  ARG D CD  1 
ATOM   5975  N  NE  . ARG D  1 167 ? -49.049  39.091  -100.079 1.00 83.88  ? 148  ARG D NE  1 
ATOM   5976  C  CZ  . ARG D  1 167 ? -48.054  38.575  -100.796 1.00 82.52  ? 148  ARG D CZ  1 
ATOM   5977  N  NH1 . ARG D  1 167 ? -48.306  38.009  -101.966 1.00 79.28  ? 148  ARG D NH1 1 
ATOM   5978  N  NH2 . ARG D  1 167 ? -46.805  38.625  -100.342 1.00 83.48  ? 148  ARG D NH2 1 
ATOM   5979  N  N   . GLU D  1 168 ? -51.631  33.264  -99.741  1.00 43.15  ? 149  GLU D N   1 
ATOM   5980  C  CA  . GLU D  1 168 ? -51.680  31.913  -100.289 1.00 38.58  ? 149  GLU D CA  1 
ATOM   5981  C  C   . GLU D  1 168 ? -52.787  31.054  -99.649  1.00 38.72  ? 149  GLU D C   1 
ATOM   5982  O  O   . GLU D  1 168 ? -53.569  30.411  -100.350 1.00 37.98  ? 149  GLU D O   1 
ATOM   5983  C  CB  . GLU D  1 168 ? -50.312  31.248  -100.168 1.00 45.97  ? 149  GLU D CB  1 
ATOM   5984  C  CG  . GLU D  1 168 ? -49.233  31.967  -100.958 1.00 56.79  ? 149  GLU D CG  1 
ATOM   5985  C  CD  . GLU D  1 168 ? -47.822  31.532  -100.598 1.00 71.24  ? 149  GLU D CD  1 
ATOM   5986  O  OE1 . GLU D  1 168 ? -47.625  30.925  -99.514  1.00 80.32  ? 149  GLU D OE1 1 
ATOM   5987  O  OE2 . GLU D  1 168 ? -46.907  31.814  -101.408 1.00 73.21  ? 149  GLU D OE2 1 
ATOM   5988  N  N   . ILE D  1 169 ? -52.860  31.050  -98.321  1.00 41.19  ? 150  ILE D N   1 
ATOM   5989  C  CA  . ILE D  1 169 ? -53.928  30.337  -97.624  1.00 40.72  ? 150  ILE D CA  1 
ATOM   5990  C  C   . ILE D  1 169 ? -54.632  31.210  -96.580  1.00 42.98  ? 150  ILE D C   1 
ATOM   5991  O  O   . ILE D  1 169 ? -53.990  31.805  -95.695  1.00 41.06  ? 150  ILE D O   1 
ATOM   5992  C  CB  . ILE D  1 169 ? -53.413  29.066  -96.926  1.00 45.22  ? 150  ILE D CB  1 
ATOM   5993  C  CG1 . ILE D  1 169 ? -53.030  28.006  -97.965  1.00 51.62  ? 150  ILE D CG1 1 
ATOM   5994  C  CG2 . ILE D  1 169 ? -54.473  28.506  -95.964  1.00 45.68  ? 150  ILE D CG2 1 
ATOM   5995  C  CD1 . ILE D  1 169 ? -52.638  26.652  -97.367  1.00 53.82  ? 150  ILE D CD1 1 
ATOM   5996  N  N   . SER D  1 170 ? -55.958  31.289  -96.693  1.00 45.03  ? 151  SER D N   1 
ATOM   5997  C  CA  . SER D  1 170 ? -56.769  31.925  -95.658  1.00 42.04  ? 151  SER D CA  1 
ATOM   5998  C  C   . SER D  1 170 ? -57.662  30.888  -94.975  1.00 42.43  ? 151  SER D C   1 
ATOM   5999  O  O   . SER D  1 170 ? -58.282  30.038  -95.635  1.00 40.98  ? 151  SER D O   1 
ATOM   6000  C  CB  . SER D  1 170 ? -57.621  33.049  -96.234  1.00 40.67  ? 151  SER D CB  1 
ATOM   6001  O  OG  . SER D  1 170 ? -58.721  32.502  -96.933  1.00 45.35  ? 151  SER D OG  1 
ATOM   6002  N  N   . VAL D  1 171 ? -57.728  30.950  -93.653  1.00 26.15  ? 152  VAL D N   1 
ATOM   6003  C  CA  . VAL D  1 171 ? -58.526  29.983  -92.912  1.00 48.58  ? 152  VAL D CA  1 
ATOM   6004  C  C   . VAL D  1 171 ? -59.741  30.675  -92.343  1.00 47.74  ? 152  VAL D C   1 
ATOM   6005  O  O   . VAL D  1 171 ? -59.654  31.814  -91.900  1.00 52.75  ? 152  VAL D O   1 
ATOM   6006  C  CB  . VAL D  1 171 ? -57.741  29.312  -91.746  1.00 35.98  ? 152  VAL D CB  1 
ATOM   6007  C  CG1 . VAL D  1 171 ? -56.734  28.290  -92.266  1.00 24.80  ? 152  VAL D CG1 1 
ATOM   6008  C  CG2 . VAL D  1 171 ? -57.070  30.367  -90.892  1.00 34.47  ? 152  VAL D CG2 1 
ATOM   6009  N  N   . ASP D  1 172 ? -60.872  29.981  -92.353  1.00 48.16  ? 153  ASP D N   1 
ATOM   6010  C  CA  . ASP D  1 172 ? -62.126  30.530  -91.859  1.00 57.92  ? 153  ASP D CA  1 
ATOM   6011  C  C   . ASP D  1 172 ? -62.933  29.463  -91.135  1.00 59.32  ? 153  ASP D C   1 
ATOM   6012  O  O   . ASP D  1 172 ? -62.903  28.287  -91.509  1.00 57.04  ? 153  ASP D O   1 
ATOM   6013  C  CB  . ASP D  1 172 ? -62.946  31.118  -93.010  1.00 73.15  ? 153  ASP D CB  1 
ATOM   6014  C  CG  . ASP D  1 172 ? -62.253  32.302  -93.674  1.00 90.57  ? 153  ASP D CG  1 
ATOM   6015  O  OD1 . ASP D  1 172 ? -62.289  33.410  -93.083  1.00 95.58  ? 153  ASP D OD1 1 
ATOM   6016  O  OD2 . ASP D  1 172 ? -61.671  32.123  -94.775  1.00 95.76  ? 153  ASP D OD2 1 
ATOM   6017  N  N   . PRO D  1 173 ? -63.647  29.867  -90.077  1.00 59.58  ? 154  PRO D N   1 
ATOM   6018  C  CA  . PRO D  1 173 ? -64.562  28.959  -89.380  1.00 63.66  ? 154  PRO D CA  1 
ATOM   6019  C  C   . PRO D  1 173 ? -65.773  28.637  -90.258  1.00 71.89  ? 154  PRO D C   1 
ATOM   6020  O  O   . PRO D  1 173 ? -65.977  29.291  -91.277  1.00 71.14  ? 154  PRO D O   1 
ATOM   6021  C  CB  . PRO D  1 173 ? -64.997  29.778  -88.163  1.00 59.75  ? 154  PRO D CB  1 
ATOM   6022  C  CG  . PRO D  1 173 ? -63.927  30.819  -87.996  1.00 57.10  ? 154  PRO D CG  1 
ATOM   6023  C  CD  . PRO D  1 173 ? -63.509  31.156  -89.378  1.00 57.50  ? 154  PRO D CD  1 
ATOM   6024  N  N   . THR D  1 174 ? -66.564  27.642  -89.866  1.00 79.79  ? 155  THR D N   1 
ATOM   6025  C  CA  . THR D  1 174 ? -67.738  27.231  -90.644  1.00 82.57  ? 155  THR D CA  1 
ATOM   6026  C  C   . THR D  1 174 ? -69.034  27.813  -90.065  1.00 81.86  ? 155  THR D C   1 
ATOM   6027  O  O   . THR D  1 174 ? -69.809  28.477  -90.766  1.00 79.53  ? 155  THR D O   1 
ATOM   6028  C  CB  . THR D  1 174 ? -67.850  25.679  -90.732  1.00 94.45  ? 155  THR D CB  1 
ATOM   6029  O  OG1 . THR D  1 174 ? -66.842  25.162  -91.613  1.00 94.63  ? 155  THR D OG1 1 
ATOM   6030  C  CG2 . THR D  1 174 ? -69.222  25.262  -91.241  1.00 93.08  ? 155  THR D CG2 1 
ATOM   6031  N  N   . SER D  1 178 ? -71.927  26.137  -86.650  1.00 54.02  ? 159  SER D N   1 
ATOM   6032  C  CA  . SER D  1 178 ? -72.001  24.707  -86.452  1.00 57.71  ? 159  SER D CA  1 
ATOM   6033  C  C   . SER D  1 178 ? -71.788  24.310  -85.006  1.00 59.58  ? 159  SER D C   1 
ATOM   6034  O  O   . SER D  1 178 ? -71.594  25.146  -84.163  1.00 60.14  ? 159  SER D O   1 
ATOM   6035  C  CB  . SER D  1 178 ? -71.008  24.011  -87.336  1.00 60.45  ? 159  SER D CB  1 
ATOM   6036  O  OG  . SER D  1 178 ? -71.692  23.221  -88.268  1.00 63.43  ? 159  SER D OG  1 
ATOM   6037  N  N   . ASP D  1 179 ? -71.797  23.015  -84.742  1.00 58.49  ? 160  ASP D N   1 
ATOM   6038  C  CA  . ASP D  1 179 ? -72.105  22.470  -83.449  1.00 51.08  ? 160  ASP D CA  1 
ATOM   6039  C  C   . ASP D  1 179 ? -71.127  21.480  -82.945  1.00 55.59  ? 160  ASP D C   1 
ATOM   6040  O  O   . ASP D  1 179 ? -70.258  21.075  -83.649  1.00 56.00  ? 160  ASP D O   1 
ATOM   6041  C  CB  . ASP D  1 179 ? -73.443  21.771  -83.498  1.00 46.92  ? 160  ASP D CB  1 
ATOM   6042  C  CG  . ASP D  1 179 ? -74.172  21.858  -82.218  1.00 49.89  ? 160  ASP D CG  1 
ATOM   6043  O  OD1 . ASP D  1 179 ? -73.574  22.179  -81.203  1.00 46.34  ? 160  ASP D OD1 1 
ATOM   6044  O  OD2 . ASP D  1 179 ? -75.368  21.617  -82.219  1.00 53.08  ? 160  ASP D OD2 1 
ATOM   6045  N  N   . ASP D  1 180 ? -71.323  21.125  -81.678  1.00 30.00  ? 161  ASP D N   1 
ATOM   6046  C  CA  . ASP D  1 180 ? -70.649  20.044  -80.971  1.00 30.00  ? 161  ASP D CA  1 
ATOM   6047  C  C   . ASP D  1 180 ? -71.237  19.850  -79.605  1.00 30.00  ? 161  ASP D C   1 
ATOM   6048  O  O   . ASP D  1 180 ? -71.093  20.696  -78.761  1.00 30.00  ? 161  ASP D O   1 
ATOM   6049  C  CB  . ASP D  1 180 ? -69.204  20.357  -80.778  1.00 20.00  ? 161  ASP D CB  1 
ATOM   6050  C  CG  . ASP D  1 180 ? -68.427  20.070  -81.961  1.00 20.00  ? 161  ASP D CG  1 
ATOM   6051  O  OD1 . ASP D  1 180 ? -68.281  20.975  -82.765  1.00 20.00  ? 161  ASP D OD1 1 
ATOM   6052  O  OD2 . ASP D  1 180 ? -68.005  18.930  -82.112  1.00 20.00  ? 161  ASP D OD2 1 
ATOM   6053  N  N   . GLU D  1 182 ? -71.933  17.639  -81.027  1.00 91.41  ? 163  GLU D N   1 
ATOM   6054  C  CA  . GLU D  1 182 ? -73.150  17.156  -81.642  1.00 81.10  ? 163  GLU D CA  1 
ATOM   6055  C  C   . GLU D  1 182 ? -72.924  15.691  -81.865  1.00 70.03  ? 163  GLU D C   1 
ATOM   6056  O  O   . GLU D  1 182 ? -73.847  14.904  -81.913  1.00 69.55  ? 163  GLU D O   1 
ATOM   6057  C  CB  . GLU D  1 182 ? -73.400  17.918  -82.929  1.00 80.24  ? 163  GLU D CB  1 
ATOM   6058  C  CG  . GLU D  1 182 ? -74.351  17.272  -83.911  1.00 78.74  ? 163  GLU D CG  1 
ATOM   6059  C  CD  . GLU D  1 182 ? -74.029  17.636  -85.331  1.00 75.79  ? 163  GLU D CD  1 
ATOM   6060  O  OE1 . GLU D  1 182 ? -72.966  18.191  -85.581  1.00 70.24  ? 163  GLU D OE1 1 
ATOM   6061  O  OE2 . GLU D  1 182 ? -74.832  17.367  -86.206  1.00 81.81  ? 163  GLU D OE2 1 
ATOM   6062  N  N   . TYR D  1 183 ? -71.642  15.358  -81.941  1.00 59.83  ? 164  TYR D N   1 
ATOM   6063  C  CA  . TYR D  1 183 ? -71.146  14.001  -82.090  1.00 49.80  ? 164  TYR D CA  1 
ATOM   6064  C  C   . TYR D  1 183 ? -70.282  13.555  -80.927  1.00 36.23  ? 164  TYR D C   1 
ATOM   6065  O  O   . TYR D  1 183 ? -69.640  12.555  -80.972  1.00 34.65  ? 164  TYR D O   1 
ATOM   6066  C  CB  . TYR D  1 183 ? -70.330  13.922  -83.351  1.00 51.14  ? 164  TYR D CB  1 
ATOM   6067  C  CG  . TYR D  1 183 ? -71.127  14.176  -84.556  1.00 58.36  ? 164  TYR D CG  1 
ATOM   6068  C  CD1 . TYR D  1 183 ? -72.394  13.680  -84.663  1.00 62.67  ? 164  TYR D CD1 1 
ATOM   6069  C  CD2 . TYR D  1 183 ? -70.623  14.903  -85.588  1.00 64.15  ? 164  TYR D CD2 1 
ATOM   6070  C  CE1 . TYR D  1 183 ? -73.151  13.899  -85.774  1.00 69.93  ? 164  TYR D CE1 1 
ATOM   6071  C  CE2 . TYR D  1 183 ? -71.363  15.133  -86.711  1.00 71.56  ? 164  TYR D CE2 1 
ATOM   6072  C  CZ  . TYR D  1 183 ? -72.627  14.624  -86.799  1.00 74.57  ? 164  TYR D CZ  1 
ATOM   6073  O  OH  . TYR D  1 183 ? -73.381  14.861  -87.917  1.00 74.52  ? 164  TYR D OH  1 
ATOM   6074  N  N   . PHE D  1 184 ? -70.312  14.311  -79.872  1.00 27.52  ? 165  PHE D N   1 
ATOM   6075  C  CA  . PHE D  1 184 ? -69.529  14.063  -78.688  1.00 31.76  ? 165  PHE D CA  1 
ATOM   6076  C  C   . PHE D  1 184 ? -70.026  12.836  -77.919  1.00 34.22  ? 165  PHE D C   1 
ATOM   6077  O  O   . PHE D  1 184 ? -71.240  12.641  -77.768  1.00 33.65  ? 165  PHE D O   1 
ATOM   6078  C  CB  . PHE D  1 184 ? -69.536  15.280  -77.785  1.00 28.84  ? 165  PHE D CB  1 
ATOM   6079  C  CG  . PHE D  1 184 ? -68.476  15.256  -76.752  1.00 28.74  ? 165  PHE D CG  1 
ATOM   6080  C  CD1 . PHE D  1 184 ? -67.149  15.487  -77.107  1.00 26.22  ? 165  PHE D CD1 1 
ATOM   6081  C  CD2 . PHE D  1 184 ? -68.787  15.003  -75.419  1.00 31.14  ? 165  PHE D CD2 1 
ATOM   6082  C  CE1 . PHE D  1 184 ? -66.131  15.454  -76.132  1.00 29.95  ? 165  PHE D CE1 1 
ATOM   6083  C  CE2 . PHE D  1 184 ? -67.783  14.974  -74.440  1.00 30.70  ? 165  PHE D CE2 1 
ATOM   6084  C  CZ  . PHE D  1 184 ? -66.450  15.195  -74.795  1.00 27.17  ? 165  PHE D CZ  1 
ATOM   6085  N  N   . SER D  1 185 ? -69.077  12.017  -77.450  1.00 30.28  ? 166  SER D N   1 
ATOM   6086  C  CA  . SER D  1 185 ? -69.396  10.750  -76.824  1.00 21.67  ? 166  SER D CA  1 
ATOM   6087  C  C   . SER D  1 185 ? -70.133  10.995  -75.506  1.00 30.39  ? 166  SER D C   1 
ATOM   6088  O  O   . SER D  1 185 ? -69.683  11.771  -74.667  1.00 28.21  ? 166  SER D O   1 
ATOM   6089  C  CB  . SER D  1 185 ? -68.117  9.954   -76.601  1.00 24.36  ? 166  SER D CB  1 
ATOM   6090  O  OG  . SER D  1 185 ? -68.405  8.683   -76.055  1.00 32.90  ? 166  SER D OG  1 
ATOM   6091  N  N   . GLN D  1 186 ? -71.274  10.345  -75.326  1.00 33.67  ? 167  GLN D N   1 
ATOM   6092  C  CA  . GLN D  1 186 ? -71.967  10.394  -74.041  1.00 31.57  ? 167  GLN D CA  1 
ATOM   6093  C  C   . GLN D  1 186 ? -71.197  9.600   -72.972  1.00 38.75  ? 167  GLN D C   1 
ATOM   6094  O  O   . GLN D  1 186 ? -71.494  9.706   -71.793  1.00 51.83  ? 167  GLN D O   1 
ATOM   6095  C  CB  . GLN D  1 186 ? -73.386  9.848   -74.172  1.00 29.65  ? 167  GLN D CB  1 
ATOM   6096  C  CG  . GLN D  1 186 ? -73.417  8.372   -74.548  1.00 47.22  ? 167  GLN D CG  1 
ATOM   6097  C  CD  . GLN D  1 186 ? -74.826  7.805   -74.655  1.00 57.95  ? 167  GLN D CD  1 
ATOM   6098  O  OE1 . GLN D  1 186 ? -75.180  7.166   -75.657  1.00 59.26  ? 167  GLN D OE1 1 
ATOM   6099  N  NE2 . GLN D  1 186 ? -75.634  8.019   -73.615  1.00 59.90  ? 167  GLN D NE2 1 
ATOM   6100  N  N   . TYR D  1 187 ? -70.200  8.822   -73.377  1.00 35.13  ? 168  TYR D N   1 
ATOM   6101  C  CA  . TYR D  1 187 ? -69.467  8.005   -72.429  1.00 37.18  ? 168  TYR D CA  1 
ATOM   6102  C  C   . TYR D  1 187 ? -68.153  8.634   -71.977  1.00 34.15  ? 168  TYR D C   1 
ATOM   6103  O  O   . TYR D  1 187 ? -67.382  8.029   -71.214  1.00 36.47  ? 168  TYR D O   1 
ATOM   6104  C  CB  . TYR D  1 187 ? -69.236  6.625   -73.018  1.00 41.93  ? 168  TYR D CB  1 
ATOM   6105  C  CG  . TYR D  1 187 ? -70.521  5.992   -73.451  1.00 41.35  ? 168  TYR D CG  1 
ATOM   6106  C  CD1 . TYR D  1 187 ? -71.503  5.681   -72.519  1.00 40.37  ? 168  TYR D CD1 1 
ATOM   6107  C  CD2 . TYR D  1 187 ? -70.762  5.704   -74.796  1.00 33.68  ? 168  TYR D CD2 1 
ATOM   6108  C  CE1 . TYR D  1 187 ? -72.703  5.101   -72.911  1.00 42.02  ? 168  TYR D CE1 1 
ATOM   6109  C  CE2 . TYR D  1 187 ? -71.963  5.124   -75.201  1.00 28.75  ? 168  TYR D CE2 1 
ATOM   6110  C  CZ  . TYR D  1 187 ? -72.930  4.819   -74.255  1.00 37.00  ? 168  TYR D CZ  1 
ATOM   6111  O  OH  . TYR D  1 187 ? -74.120  4.234   -74.643  1.00 40.52  ? 168  TYR D OH  1 
ATOM   6112  N  N   . SER D  1 188 ? -67.896  9.850   -72.446  1.00 27.10  ? 169  SER D N   1 
ATOM   6113  C  CA  . SER D  1 188 ? -66.782  10.632  -71.905  1.00 34.15  ? 169  SER D CA  1 
ATOM   6114  C  C   . SER D  1 188 ? -67.072  11.026  -70.439  1.00 41.25  ? 169  SER D C   1 
ATOM   6115  O  O   . SER D  1 188 ? -68.235  11.156  -70.029  1.00 43.45  ? 169  SER D O   1 
ATOM   6116  C  CB  . SER D  1 188 ? -66.559  11.894  -72.752  1.00 33.33  ? 169  SER D CB  1 
ATOM   6117  O  OG  . SER D  1 188 ? -65.423  12.632  -72.326  1.00 31.93  ? 169  SER D OG  1 
ATOM   6118  N  N   . ARG D  1 189 ? -66.033  11.251  -69.648  1.00 38.01  ? 170  ARG D N   1 
ATOM   6119  C  CA  . ARG D  1 189 ? -66.261  11.678  -68.280  1.00 32.53  ? 170  ARG D CA  1 
ATOM   6120  C  C   . ARG D  1 189 ? -66.694  13.124  -68.301  1.00 37.11  ? 170  ARG D C   1 
ATOM   6121  O  O   . ARG D  1 189 ? -67.248  13.641  -67.323  1.00 45.56  ? 170  ARG D O   1 
ATOM   6122  C  CB  . ARG D  1 189 ? -65.003  11.495  -67.437  1.00 33.83  ? 170  ARG D CB  1 
ATOM   6123  C  CG  . ARG D  1 189 ? -64.519  10.060  -67.430  1.00 43.61  ? 170  ARG D CG  1 
ATOM   6124  C  CD  . ARG D  1 189 ? -63.710  9.733   -66.222  1.00 56.85  ? 170  ARG D CD  1 
ATOM   6125  N  NE  . ARG D  1 189 ? -62.475  10.508  -66.127  1.00 67.14  ? 170  ARG D NE  1 
ATOM   6126  C  CZ  . ARG D  1 189 ? -61.912  10.854  -64.966  1.00 73.38  ? 170  ARG D CZ  1 
ATOM   6127  N  NH1 . ARG D  1 189 ? -62.488  10.500  -63.818  1.00 76.13  ? 170  ARG D NH1 1 
ATOM   6128  N  NH2 . ARG D  1 189 ? -60.785  11.565  -64.945  1.00 71.55  ? 170  ARG D NH2 1 
ATOM   6129  N  N   . PHE D  1 190 ? -66.464  13.772  -69.435  1.00 35.09  ? 171  PHE D N   1 
ATOM   6130  C  CA  . PHE D  1 190 ? -66.762  15.193  -69.577  1.00 31.75  ? 171  PHE D CA  1 
ATOM   6131  C  C   . PHE D  1 190 ? -67.966  15.419  -70.477  1.00 32.39  ? 171  PHE D C   1 
ATOM   6132  O  O   . PHE D  1 190 ? -68.516  14.474  -71.074  1.00 37.85  ? 171  PHE D O   1 
ATOM   6133  C  CB  . PHE D  1 190 ? -65.548  15.949  -70.123  1.00 29.08  ? 171  PHE D CB  1 
ATOM   6134  C  CG  . PHE D  1 190 ? -64.239  15.599  -69.433  1.00 31.41  ? 171  PHE D CG  1 
ATOM   6135  C  CD1 . PHE D  1 190 ? -63.570  14.416  -69.721  1.00 33.37  ? 171  PHE D CD1 1 
ATOM   6136  C  CD2 . PHE D  1 190 ? -63.674  16.455  -68.515  1.00 33.99  ? 171  PHE D CD2 1 
ATOM   6137  C  CE1 . PHE D  1 190 ? -62.371  14.095  -69.099  1.00 32.41  ? 171  PHE D CE1 1 
ATOM   6138  C  CE2 . PHE D  1 190 ? -62.476  16.135  -67.885  1.00 34.21  ? 171  PHE D CE2 1 
ATOM   6139  C  CZ  . PHE D  1 190 ? -61.825  14.959  -68.189  1.00 35.03  ? 171  PHE D CZ  1 
ATOM   6140  N  N   . GLU D  1 191 ? -68.387  16.677  -70.531  1.00 31.25  ? 172  GLU D N   1 
ATOM   6141  C  CA  . GLU D  1 191 ? -69.411  17.144  -71.463  1.00 33.98  ? 172  GLU D CA  1 
ATOM   6142  C  C   . GLU D  1 191 ? -69.025  18.555  -71.864  1.00 36.05  ? 172  GLU D C   1 
ATOM   6143  O  O   . GLU D  1 191 ? -68.310  19.257  -71.147  1.00 43.55  ? 172  GLU D O   1 
ATOM   6144  C  CB  . GLU D  1 191 ? -70.813  17.147  -70.850  1.00 39.66  ? 172  GLU D CB  1 
ATOM   6145  C  CG  . GLU D  1 191 ? -71.053  18.285  -69.880  1.00 51.40  ? 172  GLU D CG  1 
ATOM   6146  C  CD  . GLU D  1 191 ? -72.079  17.945  -68.816  1.00 66.44  ? 172  GLU D CD  1 
ATOM   6147  O  OE1 . GLU D  1 191 ? -72.463  16.758  -68.715  1.00 73.83  ? 172  GLU D OE1 1 
ATOM   6148  O  OE2 . GLU D  1 191 ? -72.495  18.862  -68.071  1.00 70.88  ? 172  GLU D OE2 1 
ATOM   6149  N  N   . ILE D  1 192 ? -69.488  18.956  -73.029  1.00 31.93  ? 173  ILE D N   1 
ATOM   6150  C  CA  . ILE D  1 192 ? -69.060  20.196  -73.624  1.00 31.86  ? 173  ILE D CA  1 
ATOM   6151  C  C   . ILE D  1 192 ? -70.119  21.235  -73.390  1.00 32.19  ? 173  ILE D C   1 
ATOM   6152  O  O   . ILE D  1 192 ? -71.299  21.010  -73.678  1.00 27.32  ? 173  ILE D O   1 
ATOM   6153  C  CB  . ILE D  1 192 ? -68.848  20.030  -75.130  1.00 35.56  ? 173  ILE D CB  1 
ATOM   6154  C  CG1 . ILE D  1 192 ? -67.703  19.047  -75.405  1.00 38.74  ? 173  ILE D CG1 1 
ATOM   6155  C  CG2 . ILE D  1 192 ? -68.579  21.391  -75.800  1.00 35.10  ? 173  ILE D CG2 1 
ATOM   6156  C  CD1 . ILE D  1 192 ? -67.322  18.971  -76.876  1.00 47.62  ? 173  ILE D CD1 1 
ATOM   6157  N  N   . LEU D  1 193 ? -69.729  22.290  -72.708  1.00 35.67  ? 174  LEU D N   1 
ATOM   6158  C  CA  . LEU D  1 193 ? -70.571  23.430  -72.542  1.00 39.89  ? 174  LEU D CA  1 
ATOM   6159  C  C   . LEU D  1 193 ? -70.720  24.249  -73.779  1.00 43.74  ? 174  LEU D C   1 
ATOM   6160  O  O   . LEU D  1 193 ? -71.792  24.548  -74.187  1.00 46.29  ? 174  LEU D O   1 
ATOM   6161  C  CB  . LEU D  1 193 ? -70.033  24.280  -71.413  1.00 44.10  ? 174  LEU D CB  1 
ATOM   6162  C  CG  . LEU D  1 193 ? -69.672  23.410  -70.222  1.00 38.17  ? 174  LEU D CG  1 
ATOM   6163  C  CD1 . LEU D  1 193 ? -69.084  24.221  -69.104  1.00 36.24  ? 174  LEU D CD1 1 
ATOM   6164  C  CD2 . LEU D  1 193 ? -70.888  22.631  -69.793  1.00 31.61  ? 174  LEU D CD2 1 
ATOM   6165  N  N   . ASP D  1 194 ? -69.614  24.564  -74.415  1.00 55.94  ? 175  ASP D N   1 
ATOM   6166  C  CA  . ASP D  1 194 ? -69.652  25.409  -75.580  1.00 62.38  ? 175  ASP D CA  1 
ATOM   6167  C  C   . ASP D  1 194 ? -68.475  25.305  -76.491  1.00 55.63  ? 175  ASP D C   1 
ATOM   6168  O  O   . ASP D  1 194 ? -67.397  25.023  -76.052  1.00 55.50  ? 175  ASP D O   1 
ATOM   6169  C  CB  . ASP D  1 194 ? -69.713  26.839  -75.108  1.00 74.25  ? 175  ASP D CB  1 
ATOM   6170  C  CG  . ASP D  1 194 ? -70.288  27.749  -76.125  1.00 84.18  ? 175  ASP D CG  1 
ATOM   6171  O  OD1 . ASP D  1 194 ? -70.909  27.262  -77.078  1.00 87.89  ? 175  ASP D OD1 1 
ATOM   6172  O  OD2 . ASP D  1 194 ? -70.132  28.960  -75.967  1.00 87.07  ? 175  ASP D OD2 1 
ATOM   6173  N  N   . VAL D  1 195 ? -68.672  25.620  -77.757  1.00 50.52  ? 176  VAL D N   1 
ATOM   6174  C  CA  . VAL D  1 195 ? -67.555  25.775  -78.653  1.00 46.29  ? 176  VAL D CA  1 
ATOM   6175  C  C   . VAL D  1 195 ? -67.636  27.092  -79.384  1.00 44.24  ? 176  VAL D C   1 
ATOM   6176  O  O   . VAL D  1 195 ? -68.592  27.341  -80.048  1.00 51.01  ? 176  VAL D O   1 
ATOM   6177  C  CB  . VAL D  1 195 ? -67.526  24.658  -79.693  1.00 50.60  ? 176  VAL D CB  1 
ATOM   6178  C  CG1 . VAL D  1 195 ? -66.216  24.659  -80.426  1.00 54.15  ? 176  VAL D CG1 1 
ATOM   6179  C  CG2 . VAL D  1 195 ? -67.708  23.316  -79.051  1.00 52.46  ? 176  VAL D CG2 1 
ATOM   6180  N  N   . THR D  1 196 ? -66.605  27.912  -79.310  1.00 37.81  ? 177  THR D N   1 
ATOM   6181  C  CA  . THR D  1 196 ? -66.559  29.144  -80.084  1.00 36.68  ? 177  THR D CA  1 
ATOM   6182  C  C   . THR D  1 196 ? -65.313  29.164  -80.953  1.00 40.26  ? 177  THR D C   1 
ATOM   6183  O  O   . THR D  1 196 ? -64.283  28.608  -80.576  1.00 44.60  ? 177  THR D O   1 
ATOM   6184  C  CB  . THR D  1 196 ? -66.607  30.391  -79.191  1.00 40.14  ? 177  THR D CB  1 
ATOM   6185  O  OG1 . THR D  1 196 ? -65.405  30.470  -78.415  1.00 49.16  ? 177  THR D OG1 1 
ATOM   6186  C  CG2 . THR D  1 196 ? -67.813  30.330  -78.269  1.00 35.45  ? 177  THR D CG2 1 
ATOM   6187  N  N   . GLN D  1 197 ? -65.414  29.785  -82.127  1.00 42.39  ? 178  GLN D N   1 
ATOM   6188  C  CA  . GLN D  1 197 ? -64.297  29.830  -83.072  1.00 43.80  ? 178  GLN D CA  1 
ATOM   6189  C  C   . GLN D  1 197 ? -63.935  31.288  -83.341  1.00 45.27  ? 178  GLN D C   1 
ATOM   6190  O  O   . GLN D  1 197 ? -64.800  32.162  -83.347  1.00 46.49  ? 178  GLN D O   1 
ATOM   6191  C  CB  . GLN D  1 197 ? -64.632  29.067  -84.367  1.00 43.52  ? 178  GLN D CB  1 
ATOM   6192  C  CG  . GLN D  1 197 ? -65.100  27.623  -84.117  1.00 54.89  ? 178  GLN D CG  1 
ATOM   6193  C  CD  . GLN D  1 197 ? -64.804  26.664  -85.282  1.00 73.72  ? 178  GLN D CD  1 
ATOM   6194  O  OE1 . GLN D  1 197 ? -64.520  27.097  -86.406  1.00 82.49  ? 178  GLN D OE1 1 
ATOM   6195  N  NE2 . GLN D  1 197 ? -64.863  25.352  -85.010  1.00 76.67  ? 178  GLN D NE2 1 
ATOM   6196  N  N   . LYS D  1 198 ? -62.651  31.562  -83.517  1.00 46.63  ? 179  LYS D N   1 
ATOM   6197  C  CA  . LYS D  1 198 ? -62.217  32.932  -83.777  1.00 48.05  ? 179  LYS D CA  1 
ATOM   6198  C  C   . LYS D  1 198 ? -60.986  32.976  -84.696  1.00 53.81  ? 179  LYS D C   1 
ATOM   6199  O  O   . LYS D  1 198 ? -59.969  32.307  -84.438  1.00 56.20  ? 179  LYS D O   1 
ATOM   6200  C  CB  . LYS D  1 198 ? -61.951  33.687  -82.477  1.00 42.72  ? 179  LYS D CB  1 
ATOM   6201  C  CG  . LYS D  1 198 ? -61.384  35.094  -82.681  1.00 50.67  ? 179  LYS D CG  1 
ATOM   6202  C  CD  . LYS D  1 198 ? -60.977  35.719  -81.347  1.00 59.56  ? 179  LYS D CD  1 
ATOM   6203  C  CE  . LYS D  1 198 ? -60.431  37.132  -81.518  1.00 63.13  ? 179  LYS D CE  1 
ATOM   6204  N  NZ  . LYS D  1 198 ? -60.023  37.740  -80.207  1.00 60.86  ? 179  LYS D NZ  1 
ATOM   6205  N  N   . LYS D  1 199 ? -61.099  33.762  -85.771  1.00 45.56  ? 180  LYS D N   1 
ATOM   6206  C  CA  . LYS D  1 199 ? -60.059  33.840  -86.774  1.00 36.72  ? 180  LYS D CA  1 
ATOM   6207  C  C   . LYS D  1 199 ? -59.026  34.904  -86.405  1.00 34.94  ? 180  LYS D C   1 
ATOM   6208  O  O   . LYS D  1 199 ? -59.381  35.979  -85.929  1.00 32.49  ? 180  LYS D O   1 
ATOM   6209  C  CB  . LYS D  1 199 ? -60.680  34.130  -88.143  1.00 37.14  ? 180  LYS D CB  1 
ATOM   6210  C  CG  . LYS D  1 199 ? -59.661  34.468  -89.216  1.00 38.94  ? 180  LYS D CG  1 
ATOM   6211  C  CD  . LYS D  1 199 ? -60.326  34.706  -90.553  1.00 44.22  ? 180  LYS D CD  1 
ATOM   6212  C  CE  . LYS D  1 199 ? -59.312  35.268  -91.530  1.00 52.10  ? 180  LYS D CE  1 
ATOM   6213  N  NZ  . LYS D  1 199 ? -59.788  35.172  -92.931  1.00 59.10  ? 180  LYS D NZ  1 
ATOM   6214  N  N   . ASN D  1 200 ? -57.748  34.587  -86.607  1.00 40.21  ? 181  ASN D N   1 
ATOM   6215  C  CA  . ASN D  1 200 ? -56.659  35.535  -86.355  1.00 43.97  ? 181  ASN D CA  1 
ATOM   6216  C  C   . ASN D  1 200 ? -55.692  35.627  -87.516  1.00 48.20  ? 181  ASN D C   1 
ATOM   6217  O  O   . ASN D  1 200 ? -55.662  34.769  -88.410  1.00 52.02  ? 181  ASN D O   1 
ATOM   6218  C  CB  . ASN D  1 200 ? -55.864  35.160  -85.101  1.00 47.97  ? 181  ASN D CB  1 
ATOM   6219  C  CG  . ASN D  1 200 ? -56.723  35.102  -83.864  1.00 52.14  ? 181  ASN D CG  1 
ATOM   6220  O  OD1 . ASN D  1 200 ? -57.119  36.133  -83.324  1.00 52.71  ? 181  ASN D OD1 1 
ATOM   6221  N  ND2 . ASN D  1 200 ? -57.018  33.885  -83.402  1.00 56.59  ? 181  ASN D ND2 1 
ATOM   6222  N  N   . SER D  1 201 ? -54.890  36.682  -87.489  1.00 52.07  ? 182  SER D N   1 
ATOM   6223  C  CA  . SER D  1 201 ? -53.855  36.885  -88.496  1.00 50.63  ? 182  SER D CA  1 
ATOM   6224  C  C   . SER D  1 201 ? -52.614  37.363  -87.753  1.00 42.85  ? 182  SER D C   1 
ATOM   6225  O  O   . SER D  1 201 ? -52.616  38.441  -87.179  1.00 45.03  ? 182  SER D O   1 
ATOM   6226  C  CB  . SER D  1 201 ? -54.312  37.906  -89.543  1.00 52.66  ? 182  SER D CB  1 
ATOM   6227  O  OG  . SER D  1 201 ? -53.417  37.972  -90.652  1.00 54.65  ? 182  SER D OG  1 
ATOM   6228  N  N   . VAL D  1 202 ? -51.564  36.546  -87.754  1.00 36.22  ? 183  VAL D N   1 
ATOM   6229  C  CA  . VAL D  1 202 ? -50.400  36.800  -86.923  1.00 31.64  ? 183  VAL D CA  1 
ATOM   6230  C  C   . VAL D  1 202 ? -49.139  36.925  -87.755  1.00 33.22  ? 183  VAL D C   1 
ATOM   6231  O  O   . VAL D  1 202 ? -48.956  36.204  -88.728  1.00 37.57  ? 183  VAL D O   1 
ATOM   6232  C  CB  . VAL D  1 202 ? -50.205  35.664  -85.906  1.00 35.39  ? 183  VAL D CB  1 
ATOM   6233  C  CG1 . VAL D  1 202 ? -48.988  35.905  -85.028  1.00 33.37  ? 183  VAL D CG1 1 
ATOM   6234  C  CG2 . VAL D  1 202 ? -51.435  35.498  -85.066  1.00 23.61  ? 183  VAL D CG2 1 
ATOM   6235  N  N   . THR D  1 203 ? -48.271  37.855  -87.365  1.00 43.38  ? 184  THR D N   1 
ATOM   6236  C  CA  . THR D  1 203 ? -46.949  37.961  -87.971  1.00 52.12  ? 184  THR D CA  1 
ATOM   6237  C  C   . THR D  1 203 ? -45.915  37.300  -87.077  1.00 47.85  ? 184  THR D C   1 
ATOM   6238  O  O   . THR D  1 203 ? -45.893  37.516  -85.882  1.00 51.64  ? 184  THR D O   1 
ATOM   6239  C  CB  . THR D  1 203 ? -46.513  39.418  -88.230  1.00 58.59  ? 184  THR D CB  1 
ATOM   6240  O  OG1 . THR D  1 203 ? -47.473  40.044  -89.073  1.00 64.38  ? 184  THR D OG1 1 
ATOM   6241  C  CG2 . THR D  1 203 ? -45.190  39.441  -88.956  1.00 61.88  ? 184  THR D CG2 1 
ATOM   6242  N  N   . TYR D  1 204 ? -45.044  36.509  -87.683  1.00 45.53  ? 185  TYR D N   1 
ATOM   6243  C  CA  . TYR D  1 204 ? -43.994  35.816  -86.961  1.00 41.93  ? 185  TYR D CA  1 
ATOM   6244  C  C   . TYR D  1 204 ? -42.634  36.404  -87.294  1.00 42.33  ? 185  TYR D C   1 
ATOM   6245  O  O   . TYR D  1 204 ? -42.446  36.964  -88.389  1.00 40.07  ? 185  TYR D O   1 
ATOM   6246  C  CB  . TYR D  1 204 ? -44.030  34.323  -87.325  1.00 41.38  ? 185  TYR D CB  1 
ATOM   6247  C  CG  . TYR D  1 204 ? -45.342  33.672  -86.950  1.00 44.08  ? 185  TYR D CG  1 
ATOM   6248  C  CD1 . TYR D  1 204 ? -46.458  33.768  -87.783  1.00 45.52  ? 185  TYR D CD1 1 
ATOM   6249  C  CD2 . TYR D  1 204 ? -45.487  33.008  -85.731  1.00 40.93  ? 185  TYR D CD2 1 
ATOM   6250  C  CE1 . TYR D  1 204 ? -47.685  33.194  -87.411  1.00 44.53  ? 185  TYR D CE1 1 
ATOM   6251  C  CE2 . TYR D  1 204 ? -46.697  32.441  -85.356  1.00 39.32  ? 185  TYR D CE2 1 
ATOM   6252  C  CZ  . TYR D  1 204 ? -47.788  32.527  -86.193  1.00 38.49  ? 185  TYR D CZ  1 
ATOM   6253  O  OH  . TYR D  1 204 ? -48.972  31.932  -85.800  1.00 35.45  ? 185  TYR D OH  1 
ATOM   6254  N  N   . SER D  1 205 ? -41.693  36.245  -86.356  1.00 43.18  ? 186  SER D N   1 
ATOM   6255  C  CA  . SER D  1 205 ? -40.352  36.841  -86.445  1.00 53.76  ? 186  SER D CA  1 
ATOM   6256  C  C   . SER D  1 205 ? -39.611  36.470  -87.719  1.00 57.10  ? 186  SER D C   1 
ATOM   6257  O  O   . SER D  1 205 ? -38.898  37.289  -88.304  1.00 62.29  ? 186  SER D O   1 
ATOM   6258  C  CB  . SER D  1 205 ? -39.503  36.430  -85.246  1.00 58.46  ? 186  SER D CB  1 
ATOM   6259  O  OG  . SER D  1 205 ? -40.073  36.925  -84.052  1.00 68.70  ? 186  SER D OG  1 
ATOM   6260  N  N   . CYS D  1 206 ? -39.797  35.232  -88.141  1.00 57.81  ? 187  CYS D N   1 
ATOM   6261  C  CA  . CYS D  1 206 ? -39.074  34.674  -89.280  1.00 65.76  ? 187  CYS D CA  1 
ATOM   6262  C  C   . CYS D  1 206 ? -39.398  35.371  -90.608  1.00 67.56  ? 187  CYS D C   1 
ATOM   6263  O  O   . CYS D  1 206 ? -38.534  35.524  -91.479  1.00 64.60  ? 187  CYS D O   1 
ATOM   6264  C  CB  . CYS D  1 206 ? -39.412  33.182  -89.408  1.00 64.65  ? 187  CYS D CB  1 
ATOM   6265  S  SG  . CYS D  1 206 ? -41.091  32.855  -90.086  1.00 92.61  ? 187  CYS D SG  1 
ATOM   6266  N  N   . CYS D  1 207 ? -40.654  35.781  -90.752  1.00 68.01  ? 188  CYS D N   1 
ATOM   6267  C  CA  . CYS D  1 207 ? -41.191  36.126  -92.055  1.00 66.33  ? 188  CYS D CA  1 
ATOM   6268  C  C   . CYS D  1 207 ? -41.953  37.441  -92.003  1.00 62.56  ? 188  CYS D C   1 
ATOM   6269  O  O   . CYS D  1 207 ? -42.557  37.787  -90.985  1.00 60.08  ? 188  CYS D O   1 
ATOM   6270  C  CB  . CYS D  1 207 ? -42.101  34.992  -92.560  1.00 68.89  ? 188  CYS D CB  1 
ATOM   6271  S  SG  . CYS D  1 207 ? -41.572  33.335  -92.023  1.00 80.89  ? 188  CYS D SG  1 
ATOM   6272  N  N   . PRO D  1 208 ? -41.928  38.176  -93.118  1.00 61.01  ? 189  PRO D N   1 
ATOM   6273  C  CA  . PRO D  1 208 ? -42.591  39.477  -93.211  1.00 55.86  ? 189  PRO D CA  1 
ATOM   6274  C  C   . PRO D  1 208 ? -44.108  39.392  -93.415  1.00 55.53  ? 189  PRO D C   1 
ATOM   6275  O  O   . PRO D  1 208 ? -44.812  40.361  -93.163  1.00 63.54  ? 189  PRO D O   1 
ATOM   6276  C  CB  . PRO D  1 208 ? -41.934  40.096  -94.442  1.00 58.49  ? 189  PRO D CB  1 
ATOM   6277  C  CG  . PRO D  1 208 ? -41.581  38.925  -95.302  1.00 60.68  ? 189  PRO D CG  1 
ATOM   6278  C  CD  . PRO D  1 208 ? -41.185  37.833  -94.350  1.00 58.64  ? 189  PRO D CD  1 
ATOM   6279  N  N   . GLU D  1 209 ? -44.618  38.262  -93.874  1.00 52.46  ? 190  GLU D N   1 
ATOM   6280  C  CA  . GLU D  1 209 ? -46.044  38.170  -94.158  1.00 57.36  ? 190  GLU D CA  1 
ATOM   6281  C  C   . GLU D  1 209 ? -46.829  37.684  -92.941  1.00 47.40  ? 190  GLU D C   1 
ATOM   6282  O  O   . GLU D  1 209 ? -46.254  37.192  -91.963  1.00 43.94  ? 190  GLU D O   1 
ATOM   6283  C  CB  . GLU D  1 209 ? -46.301  37.238  -95.354  1.00 74.40  ? 190  GLU D CB  1 
ATOM   6284  C  CG  . GLU D  1 209 ? -45.436  37.511  -96.587  1.00 86.98  ? 190  GLU D CG  1 
ATOM   6285  C  CD  . GLU D  1 209 ? -44.110  36.762  -96.555  1.00 95.95  ? 190  GLU D CD  1 
ATOM   6286  O  OE1 . GLU D  1 209 ? -43.846  36.046  -95.552  1.00 96.99  ? 190  GLU D OE1 1 
ATOM   6287  O  OE2 . GLU D  1 209 ? -43.338  36.891  -97.538  1.00 98.97  ? 190  GLU D OE2 1 
ATOM   6288  N  N   . ALA D  1 210 ? -48.149  37.829  -93.002  1.00 41.80  ? 191  ALA D N   1 
ATOM   6289  C  CA  . ALA D  1 210 ? -49.008  37.357  -91.925  1.00 34.08  ? 191  ALA D CA  1 
ATOM   6290  C  C   . ALA D  1 210 ? -49.616  36.007  -92.256  1.00 34.59  ? 191  ALA D C   1 
ATOM   6291  O  O   . ALA D  1 210 ? -50.018  35.727  -93.411  1.00 32.22  ? 191  ALA D O   1 
ATOM   6292  C  CB  . ALA D  1 210 ? -50.087  38.342  -91.598  1.00 24.91  ? 191  ALA D CB  1 
ATOM   6293  N  N   . TYR D  1 211 ? -49.671  35.171  -91.221  1.00 31.01  ? 192  TYR D N   1 
ATOM   6294  C  CA  . TYR D  1 211 ? -50.244  33.835  -91.321  1.00 24.60  ? 192  TYR D CA  1 
ATOM   6295  C  C   . TYR D  1 211 ? -51.565  33.789  -90.572  1.00 26.55  ? 192  TYR D C   1 
ATOM   6296  O  O   . TYR D  1 211 ? -51.678  34.257  -89.437  1.00 29.54  ? 192  TYR D O   1 
ATOM   6297  C  CB  . TYR D  1 211 ? -49.258  32.801  -90.792  1.00 24.12  ? 192  TYR D CB  1 
ATOM   6298  C  CG  . TYR D  1 211 ? -48.037  32.648  -91.683  1.00 29.33  ? 192  TYR D CG  1 
ATOM   6299  C  CD1 . TYR D  1 211 ? -47.032  33.615  -91.698  1.00 28.12  ? 192  TYR D CD1 1 
ATOM   6300  C  CD2 . TYR D  1 211 ? -47.898  31.548  -92.518  1.00 26.17  ? 192  TYR D CD2 1 
ATOM   6301  C  CE1 . TYR D  1 211 ? -45.916  33.486  -92.510  1.00 25.44  ? 192  TYR D CE1 1 
ATOM   6302  C  CE2 . TYR D  1 211 ? -46.790  31.410  -93.332  1.00 29.31  ? 192  TYR D CE2 1 
ATOM   6303  C  CZ  . TYR D  1 211 ? -45.807  32.382  -93.329  1.00 33.28  ? 192  TYR D CZ  1 
ATOM   6304  O  OH  . TYR D  1 211 ? -44.709  32.239  -94.143  1.00 40.56  ? 192  TYR D OH  1 
ATOM   6305  N  N   . GLU D  1 212 ? -52.581  33.241  -91.215  1.00 29.76  ? 193  GLU D N   1 
ATOM   6306  C  CA  . GLU D  1 212 ? -53.888  33.167  -90.582  1.00 30.29  ? 193  GLU D CA  1 
ATOM   6307  C  C   . GLU D  1 212 ? -54.013  31.887  -89.775  1.00 28.47  ? 193  GLU D C   1 
ATOM   6308  O  O   . GLU D  1 212 ? -53.381  30.867  -90.088  1.00 33.12  ? 193  GLU D O   1 
ATOM   6309  C  CB  . GLU D  1 212 ? -54.994  33.239  -91.638  1.00 36.18  ? 193  GLU D CB  1 
ATOM   6310  C  CG  . GLU D  1 212 ? -54.976  34.514  -92.455  1.00 40.85  ? 193  GLU D CG  1 
ATOM   6311  C  CD  . GLU D  1 212 ? -56.265  34.748  -93.232  1.00 48.82  ? 193  GLU D CD  1 
ATOM   6312  O  OE1 . GLU D  1 212 ? -57.157  33.863  -93.199  1.00 50.73  ? 193  GLU D OE1 1 
ATOM   6313  O  OE2 . GLU D  1 212 ? -56.382  35.821  -93.876  1.00 52.16  ? 193  GLU D OE2 1 
ATOM   6314  N  N   . ASP D  1 213 ? -54.828  31.941  -88.732  1.00 27.83  ? 194  ASP D N   1 
ATOM   6315  C  CA  . ASP D  1 213 ? -55.152  30.741  -87.950  1.00 34.33  ? 194  ASP D CA  1 
ATOM   6316  C  C   . ASP D  1 213 ? -56.585  30.819  -87.467  1.00 39.50  ? 194  ASP D C   1 
ATOM   6317  O  O   . ASP D  1 213 ? -57.213  31.888  -87.477  1.00 43.33  ? 194  ASP D O   1 
ATOM   6318  C  CB  . ASP D  1 213 ? -54.210  30.565  -86.753  1.00 38.69  ? 194  ASP D CB  1 
ATOM   6319  C  CG  . ASP D  1 213 ? -54.390  31.656  -85.690  1.00 46.44  ? 194  ASP D CG  1 
ATOM   6320  O  OD1 . ASP D  1 213 ? -55.349  31.575  -84.882  1.00 48.64  ? 194  ASP D OD1 1 
ATOM   6321  O  OD2 . ASP D  1 213 ? -53.560  32.586  -85.652  1.00 49.62  ? 194  ASP D OD2 1 
ATOM   6322  N  N   . VAL D  1 214 ? -57.108  29.683  -87.043  1.00 36.32  ? 195  VAL D N   1 
ATOM   6323  C  CA  . VAL D  1 214 ? -58.393  29.675  -86.372  1.00 33.78  ? 195  VAL D CA  1 
ATOM   6324  C  C   . VAL D  1 214 ? -58.140  29.223  -84.954  1.00 32.59  ? 195  VAL D C   1 
ATOM   6325  O  O   . VAL D  1 214 ? -57.431  28.245  -84.731  1.00 37.00  ? 195  VAL D O   1 
ATOM   6326  C  CB  . VAL D  1 214 ? -59.380  28.735  -87.070  1.00 35.95  ? 195  VAL D CB  1 
ATOM   6327  C  CG1 . VAL D  1 214 ? -60.603  28.492  -86.189  1.00 40.55  ? 195  VAL D CG1 1 
ATOM   6328  C  CG2 . VAL D  1 214 ? -59.774  29.310  -88.415  1.00 34.43  ? 195  VAL D CG2 1 
ATOM   6329  N  N   . GLU D  1 215 ? -58.694  29.953  -83.991  1.00 34.96  ? 196  GLU D N   1 
ATOM   6330  C  CA  . GLU D  1 215 ? -58.665  29.509  -82.594  1.00 35.46  ? 196  GLU D CA  1 
ATOM   6331  C  C   . GLU D  1 215 ? -60.017  28.963  -82.189  1.00 28.62  ? 196  GLU D C   1 
ATOM   6332  O  O   . GLU D  1 215 ? -60.998  29.693  -82.086  1.00 26.78  ? 196  GLU D O   1 
ATOM   6333  C  CB  . GLU D  1 215 ? -58.224  30.628  -81.637  1.00 40.89  ? 196  GLU D CB  1 
ATOM   6334  C  CG  . GLU D  1 215 ? -56.720  30.802  -81.541  1.00 46.73  ? 196  GLU D CG  1 
ATOM   6335  C  CD  . GLU D  1 215 ? -56.309  32.035  -80.755  1.00 54.27  ? 196  GLU D CD  1 
ATOM   6336  O  OE1 . GLU D  1 215 ? -57.203  32.707  -80.182  1.00 57.58  ? 196  GLU D OE1 1 
ATOM   6337  O  OE2 . GLU D  1 215 ? -55.086  32.319  -80.709  1.00 54.92  ? 196  GLU D OE2 1 
ATOM   6338  N  N   . VAL D  1 216 ? -60.057  27.660  -81.968  1.00 30.90  ? 197  VAL D N   1 
ATOM   6339  C  CA  . VAL D  1 216 ? -61.250  26.995  -81.475  1.00 31.82  ? 197  VAL D CA  1 
ATOM   6340  C  C   . VAL D  1 216 ? -61.184  26.932  -79.951  1.00 34.46  ? 197  VAL D C   1 
ATOM   6341  O  O   . VAL D  1 216 ? -60.271  26.327  -79.389  1.00 34.34  ? 197  VAL D O   1 
ATOM   6342  C  CB  . VAL D  1 216 ? -61.353  25.574  -82.054  1.00 32.21  ? 197  VAL D CB  1 
ATOM   6343  C  CG1 . VAL D  1 216 ? -62.639  24.895  -81.582  1.00 31.12  ? 197  VAL D CG1 1 
ATOM   6344  C  CG2 . VAL D  1 216 ? -61.309  25.629  -83.579  1.00 34.04  ? 197  VAL D CG2 1 
ATOM   6345  N  N   . SER D  1 217 ? -62.135  27.583  -79.286  1.00 38.37  ? 198  SER D N   1 
ATOM   6346  C  CA  . SER D  1 217 ? -62.226  27.549  -77.822  1.00 34.03  ? 198  SER D CA  1 
ATOM   6347  C  C   . SER D  1 217 ? -63.200  26.462  -77.410  1.00 35.91  ? 198  SER D C   1 
ATOM   6348  O  O   . SER D  1 217 ? -64.396  26.522  -77.706  1.00 41.01  ? 198  SER D O   1 
ATOM   6349  C  CB  . SER D  1 217 ? -62.659  28.901  -77.238  1.00 24.69  ? 198  SER D CB  1 
ATOM   6350  O  OG  . SER D  1 217 ? -61.650  29.885  -77.404  1.00 25.75  ? 198  SER D OG  1 
ATOM   6351  N  N   . LEU D  1 218 ? -62.671  25.457  -76.732  1.00 30.61  ? 199  LEU D N   1 
ATOM   6352  C  CA  . LEU D  1 218 ? -63.474  24.351  -76.243  1.00 35.22  ? 199  LEU D CA  1 
ATOM   6353  C  C   . LEU D  1 218 ? -63.762  24.543  -74.752  1.00 42.23  ? 199  LEU D C   1 
ATOM   6354  O  O   . LEU D  1 218 ? -62.878  24.366  -73.900  1.00 44.24  ? 199  LEU D O   1 
ATOM   6355  C  CB  . LEU D  1 218 ? -62.738  23.034  -76.481  1.00 36.55  ? 199  LEU D CB  1 
ATOM   6356  C  CG  . LEU D  1 218 ? -63.411  21.768  -75.980  1.00 43.97  ? 199  LEU D CG  1 
ATOM   6357  C  CD1 . LEU D  1 218 ? -64.727  21.542  -76.712  1.00 45.97  ? 199  LEU D CD1 1 
ATOM   6358  C  CD2 . LEU D  1 218 ? -62.479  20.574  -76.161  1.00 46.90  ? 199  LEU D CD2 1 
ATOM   6359  N  N   . ASN D  1 219 ? -64.996  24.919  -74.441  1.00 38.95  ? 200  ASN D N   1 
ATOM   6360  C  CA  . ASN D  1 219 ? -65.410  25.047  -73.059  1.00 36.09  ? 200  ASN D CA  1 
ATOM   6361  C  C   . ASN D  1 219 ? -66.048  23.741  -72.557  1.00 32.27  ? 200  ASN D C   1 
ATOM   6362  O  O   . ASN D  1 219 ? -67.137  23.354  -72.992  1.00 32.81  ? 200  ASN D O   1 
ATOM   6363  C  CB  . ASN D  1 219 ? -66.362  26.242  -72.893  1.00 40.96  ? 200  ASN D CB  1 
ATOM   6364  C  CG  . ASN D  1 219 ? -66.787  26.463  -71.439  1.00 43.01  ? 200  ASN D CG  1 
ATOM   6365  O  OD1 . ASN D  1 219 ? -67.958  26.736  -71.169  1.00 46.58  ? 200  ASN D OD1 1 
ATOM   6366  N  ND2 . ASN D  1 219 ? -65.842  26.323  -70.501  1.00 36.16  ? 200  ASN D ND2 1 
ATOM   6367  N  N   . PHE D  1 220 ? -65.363  23.058  -71.646  1.00 25.59  ? 201  PHE D N   1 
ATOM   6368  C  CA  . PHE D  1 220 ? -65.829  21.762  -71.187  1.00 24.82  ? 201  PHE D CA  1 
ATOM   6369  C  C   . PHE D  1 220 ? -65.644  21.626  -69.671  1.00 33.21  ? 201  PHE D C   1 
ATOM   6370  O  O   . PHE D  1 220 ? -64.908  22.408  -69.064  1.00 35.08  ? 201  PHE D O   1 
ATOM   6371  C  CB  . PHE D  1 220 ? -65.073  20.647  -71.922  1.00 22.57  ? 201  PHE D CB  1 
ATOM   6372  C  CG  . PHE D  1 220 ? -63.613  20.541  -71.537  1.00 28.03  ? 201  PHE D CG  1 
ATOM   6373  C  CD1 . PHE D  1 220 ? -62.696  21.514  -71.946  1.00 29.32  ? 201  PHE D CD1 1 
ATOM   6374  C  CD2 . PHE D  1 220 ? -63.160  19.474  -70.743  1.00 29.04  ? 201  PHE D CD2 1 
ATOM   6375  C  CE1 . PHE D  1 220 ? -61.346  21.419  -71.595  1.00 30.03  ? 201  PHE D CE1 1 
ATOM   6376  C  CE2 . PHE D  1 220 ? -61.818  19.373  -70.377  1.00 27.72  ? 201  PHE D CE2 1 
ATOM   6377  C  CZ  . PHE D  1 220 ? -60.907  20.350  -70.801  1.00 29.32  ? 201  PHE D CZ  1 
ATOM   6378  N  N   . ARG D  1 221 ? -66.357  20.675  -69.099  1.00 37.93  ? 202  ARG D N   1 
ATOM   6379  C  CA  . ARG D  1 221 ? -66.213  20.309  -67.723  1.00 44.04  ? 202  ARG D CA  1 
ATOM   6380  C  C   . ARG D  1 221 ? -66.584  18.856  -67.481  1.00 45.43  ? 202  ARG D C   1 
ATOM   6381  O  O   . ARG D  1 221 ? -67.210  18.226  -68.291  1.00 40.48  ? 202  ARG D O   1 
ATOM   6382  C  CB  . ARG D  1 221 ? -67.106  21.177  -66.874  1.00 47.09  ? 202  ARG D CB  1 
ATOM   6383  C  CG  . ARG D  1 221 ? -68.544  20.890  -67.136  1.00 49.31  ? 202  ARG D CG  1 
ATOM   6384  C  CD  . ARG D  1 221 ? -69.455  21.470  -66.121  1.00 49.67  ? 202  ARG D CD  1 
ATOM   6385  N  NE  . ARG D  1 221 ? -70.761  20.943  -66.400  1.00 53.15  ? 202  ARG D NE  1 
ATOM   6386  C  CZ  . ARG D  1 221 ? -71.870  21.614  -66.212  1.00 59.41  ? 202  ARG D CZ  1 
ATOM   6387  N  NH1 . ARG D  1 221 ? -71.814  22.825  -65.739  1.00 61.20  ? 202  ARG D NH1 1 
ATOM   6388  N  NH2 . ARG D  1 221 ? -73.021  21.065  -66.483  1.00 61.21  ? 202  ARG D NH2 1 
ATOM   6389  N  N   . LYS D  1 222 ? -66.196  18.372  -66.316  1.00 48.63  ? 203  LYS D N   1 
ATOM   6390  C  CA  . LYS D  1 222 ? -66.481  17.044  -65.815  1.00 47.98  ? 203  LYS D CA  1 
ATOM   6391  C  C   . LYS D  1 222 ? -67.926  16.833  -65.440  1.00 46.06  ? 203  LYS D C   1 
ATOM   6392  O  O   . LYS D  1 222 ? -68.507  17.638  -64.783  1.00 42.54  ? 203  LYS D O   1 
ATOM   6393  C  CB  . LYS D  1 222 ? -65.618  16.849  -64.589  1.00 48.10  ? 203  LYS D CB  1 
ATOM   6394  C  CG  . LYS D  1 222 ? -65.485  15.455  -64.036  1.00 49.72  ? 203  LYS D CG  1 
ATOM   6395  C  CD  . LYS D  1 222 ? -64.268  15.404  -63.135  1.00 49.20  ? 203  LYS D CD  1 
ATOM   6396  C  CE  . LYS D  1 222 ? -64.180  14.121  -62.349  1.00 52.17  ? 203  LYS D CE  1 
ATOM   6397  N  NZ  . LYS D  1 222 ? -62.782  13.828  -61.964  1.00 53.16  ? 203  LYS D NZ  1 
ATOM   6398  N  N   . LYS D  1 223 ? -68.467  15.693  -65.819  1.00 51.23  ? 204  LYS D N   1 
ATOM   6399  C  CA  . LYS D  1 223 ? -69.850  15.311  -65.588  1.00 55.46  ? 204  LYS D CA  1 
ATOM   6400  C  C   . LYS D  1 223 ? -70.205  14.897  -64.173  1.00 54.05  ? 204  LYS D C   1 
ATOM   6401  O  O   . LYS D  1 223 ? -69.379  14.681  -63.334  1.00 54.99  ? 204  LYS D O   1 
ATOM   6402  C  CB  . LYS D  1 223 ? -70.195  14.116  -66.461  1.00 54.46  ? 204  LYS D CB  1 
ATOM   6403  C  CG  . LYS D  1 223 ? -70.703  14.371  -67.849  1.00 54.81  ? 204  LYS D CG  1 
ATOM   6404  C  CD  . LYS D  1 223 ? -70.766  13.025  -68.539  1.00 59.76  ? 204  LYS D CD  1 
ATOM   6405  C  CE  . LYS D  1 223 ? -71.434  13.059  -69.894  1.00 58.91  ? 204  LYS D CE  1 
ATOM   6406  N  NZ  . LYS D  1 223 ? -71.136  11.862  -70.703  1.00 53.94  ? 204  LYS D NZ  1 
ATOM   6407  N  N   . GLY D  1 224 ? -71.484  14.792  -63.934  1.00 53.63  ? 205  GLY D N   1 
ATOM   6408  C  CA  . GLY D  1 224 ? -71.972  14.253  -62.696  1.00 61.82  ? 205  GLY D CA  1 
ATOM   6409  C  C   . GLY D  1 224 ? -72.510  12.850  -62.855  1.00 66.99  ? 205  GLY D C   1 
ATOM   6410  O  O   . GLY D  1 224 ? -73.710  12.633  -62.963  1.00 68.04  ? 205  GLY D O   1 
ATOM   6411  N  N   . LEU E  1 20  ? -43.492  32.070  -115.542 1.00 67.32  ? 1    LEU E N   1 
ATOM   6412  C  CA  . LEU E  1 20  ? -43.429  31.031  -114.516 1.00 58.77  ? 1    LEU E CA  1 
ATOM   6413  C  C   . LEU E  1 20  ? -44.528  31.199  -113.486 1.00 57.77  ? 1    LEU E C   1 
ATOM   6414  O  O   . LEU E  1 20  ? -44.664  32.262  -112.892 1.00 55.62  ? 1    LEU E O   1 
ATOM   6415  C  CB  . LEU E  1 20  ? -42.089  31.072  -113.778 1.00 49.82  ? 1    LEU E CB  1 
ATOM   6416  C  CG  . LEU E  1 20  ? -40.872  30.462  -114.466 1.00 44.22  ? 1    LEU E CG  1 
ATOM   6417  C  CD1 . LEU E  1 20  ? -39.643  30.499  -113.555 1.00 41.28  ? 1    LEU E CD1 1 
ATOM   6418  C  CD2 . LEU E  1 20  ? -41.162  29.054  -114.890 1.00 45.98  ? 1    LEU E CD2 1 
ATOM   6419  N  N   . ASP E  1 21  ? -45.303  30.144  -113.269 1.00 59.77  ? 2    ASP E N   1 
ATOM   6420  C  CA  . ASP E  1 21  ? -46.196  30.098  -112.126 1.00 60.82  ? 2    ASP E CA  1 
ATOM   6421  C  C   . ASP E  1 21  ? -45.694  29.051  -111.127 1.00 51.59  ? 2    ASP E C   1 
ATOM   6422  O  O   . ASP E  1 21  ? -44.662  28.407  -111.374 1.00 45.53  ? 2    ASP E O   1 
ATOM   6423  C  CB  . ASP E  1 21  ? -47.653  29.844  -112.553 1.00 72.58  ? 2    ASP E CB  1 
ATOM   6424  C  CG  . ASP E  1 21  ? -47.827  28.568  -113.373 1.00 78.45  ? 2    ASP E CG  1 
ATOM   6425  O  OD1 . ASP E  1 21  ? -46.907  27.720  -113.390 1.00 80.32  ? 2    ASP E OD1 1 
ATOM   6426  O  OD2 . ASP E  1 21  ? -48.907  28.407  -113.988 1.00 80.72  ? 2    ASP E OD2 1 
ATOM   6427  N  N   . ARG E  1 22  ? -46.414  28.893  -110.013 1.00 47.83  ? 3    ARG E N   1 
ATOM   6428  C  CA  . ARG E  1 22  ? -46.031  27.947  -108.978 1.00 43.53  ? 3    ARG E CA  1 
ATOM   6429  C  C   . ARG E  1 22  ? -45.822  26.537  -109.544 1.00 40.49  ? 3    ARG E C   1 
ATOM   6430  O  O   . ARG E  1 22  ? -44.787  25.906  -109.288 1.00 33.82  ? 3    ARG E O   1 
ATOM   6431  C  CB  . ARG E  1 22  ? -47.078  27.930  -107.860 1.00 46.75  ? 3    ARG E CB  1 
ATOM   6432  C  CG  . ARG E  1 22  ? -46.930  29.062  -106.875 1.00 50.04  ? 3    ARG E CG  1 
ATOM   6433  C  CD  . ARG E  1 22  ? -48.061  29.096  -105.868 1.00 58.78  ? 3    ARG E CD  1 
ATOM   6434  N  NE  . ARG E  1 22  ? -47.945  30.276  -105.023 1.00 66.19  ? 3    ARG E NE  1 
ATOM   6435  C  CZ  . ARG E  1 22  ? -48.489  31.452  -105.318 1.00 70.40  ? 3    ARG E CZ  1 
ATOM   6436  N  NH1 . ARG E  1 22  ? -49.199  31.594  -106.429 1.00 70.66  ? 3    ARG E NH1 1 
ATOM   6437  N  NH2 . ARG E  1 22  ? -48.325  32.482  -104.500 1.00 72.38  ? 3    ARG E NH2 1 
ATOM   6438  N  N   . ALA E  1 23  ? -46.802  26.066  -110.320 1.00 41.69  ? 4    ALA E N   1 
ATOM   6439  C  CA  . ALA E  1 23  ? -46.757  24.732  -110.934 1.00 36.07  ? 4    ALA E CA  1 
ATOM   6440  C  C   . ALA E  1 23  ? -45.435  24.493  -111.662 1.00 34.96  ? 4    ALA E C   1 
ATOM   6441  O  O   . ALA E  1 23  ? -44.801  23.444  -111.509 1.00 39.41  ? 4    ALA E O   1 
ATOM   6442  C  CB  . ALA E  1 23  ? -47.945  24.519  -111.878 1.00 29.57  ? 4    ALA E CB  1 
ATOM   6443  N  N   . ASP E  1 24  ? -45.009  25.471  -112.444 1.00 33.58  ? 5    ASP E N   1 
ATOM   6444  C  CA  . ASP E  1 24  ? -43.764  25.330  -113.186 1.00 38.79  ? 5    ASP E CA  1 
ATOM   6445  C  C   . ASP E  1 24  ? -42.547  25.285  -112.257 1.00 35.78  ? 5    ASP E C   1 
ATOM   6446  O  O   . ASP E  1 24  ? -41.672  24.426  -112.401 1.00 33.33  ? 5    ASP E O   1 
ATOM   6447  C  CB  . ASP E  1 24  ? -43.616  26.467  -114.209 1.00 51.13  ? 5    ASP E CB  1 
ATOM   6448  C  CG  . ASP E  1 24  ? -44.744  26.488  -115.259 1.00 62.27  ? 5    ASP E CG  1 
ATOM   6449  O  OD1 . ASP E  1 24  ? -45.268  25.407  -115.635 1.00 64.74  ? 5    ASP E OD1 1 
ATOM   6450  O  OD2 . ASP E  1 24  ? -45.100  27.604  -115.715 1.00 65.85  ? 5    ASP E OD2 1 
ATOM   6451  N  N   . ILE E  1 25  ? -42.498  26.214  -111.307 1.00 38.30  ? 6    ILE E N   1 
ATOM   6452  C  CA  . ILE E  1 25  ? -41.386  26.305  -110.359 1.00 37.11  ? 6    ILE E CA  1 
ATOM   6453  C  C   . ILE E  1 25  ? -41.211  25.028  -109.549 1.00 40.20  ? 6    ILE E C   1 
ATOM   6454  O  O   . ILE E  1 25  ? -40.096  24.508  -109.410 1.00 42.48  ? 6    ILE E O   1 
ATOM   6455  C  CB  . ILE E  1 25  ? -41.574  27.484  -109.395 1.00 34.28  ? 6    ILE E CB  1 
ATOM   6456  C  CG1 . ILE E  1 25  ? -41.508  28.803  -110.168 1.00 41.85  ? 6    ILE E CG1 1 
ATOM   6457  C  CG2 . ILE E  1 25  ? -40.520  27.463  -108.322 1.00 26.38  ? 6    ILE E CG2 1 
ATOM   6458  C  CD1 . ILE E  1 25  ? -41.916  30.017  -109.357 1.00 45.03  ? 6    ILE E CD1 1 
ATOM   6459  N  N   . LEU E  1 26  ? -42.321  24.522  -109.017 1.00 38.24  ? 7    LEU E N   1 
ATOM   6460  C  CA  . LEU E  1 26  ? -42.317  23.258  -108.286 1.00 36.77  ? 7    LEU E CA  1 
ATOM   6461  C  C   . LEU E  1 26  ? -41.910  22.073  -109.174 1.00 43.50  ? 7    LEU E C   1 
ATOM   6462  O  O   . LEU E  1 26  ? -41.162  21.192  -108.736 1.00 46.01  ? 7    LEU E O   1 
ATOM   6463  C  CB  . LEU E  1 26  ? -43.682  23.031  -107.648 1.00 33.35  ? 7    LEU E CB  1 
ATOM   6464  C  CG  . LEU E  1 26  ? -43.954  24.044  -106.531 1.00 30.13  ? 7    LEU E CG  1 
ATOM   6465  C  CD1 . LEU E  1 26  ? -45.438  24.159  -106.226 1.00 26.28  ? 7    LEU E CD1 1 
ATOM   6466  C  CD2 . LEU E  1 26  ? -43.184  23.656  -105.274 1.00 30.73  ? 7    LEU E CD2 1 
ATOM   6467  N  N   . TYR E  1 27  ? -42.392  22.069  -110.420 1.00 40.07  ? 8    TYR E N   1 
ATOM   6468  C  CA  . TYR E  1 27  ? -42.013  21.054  -111.391 1.00 37.02  ? 8    TYR E CA  1 
ATOM   6469  C  C   . TYR E  1 27  ? -40.494  21.079  -111.632 1.00 35.80  ? 8    TYR E C   1 
ATOM   6470  O  O   . TYR E  1 27  ? -39.827  20.039  -111.576 1.00 31.01  ? 8    TYR E O   1 
ATOM   6471  C  CB  . TYR E  1 27  ? -42.779  21.254  -112.701 1.00 42.79  ? 8    TYR E CB  1 
ATOM   6472  C  CG  . TYR E  1 27  ? -42.400  20.273  -113.785 1.00 48.61  ? 8    TYR E CG  1 
ATOM   6473  C  CD1 . TYR E  1 27  ? -42.889  18.966  -113.768 1.00 55.15  ? 8    TYR E CD1 1 
ATOM   6474  C  CD2 . TYR E  1 27  ? -41.560  20.647  -114.823 1.00 50.95  ? 8    TYR E CD2 1 
ATOM   6475  C  CE1 . TYR E  1 27  ? -42.548  18.054  -114.765 1.00 57.94  ? 8    TYR E CE1 1 
ATOM   6476  C  CE2 . TYR E  1 27  ? -41.207  19.746  -115.829 1.00 55.71  ? 8    TYR E CE2 1 
ATOM   6477  C  CZ  . TYR E  1 27  ? -41.703  18.447  -115.796 1.00 60.79  ? 8    TYR E CZ  1 
ATOM   6478  O  OH  . TYR E  1 27  ? -41.352  17.544  -116.795 1.00 63.70  ? 8    TYR E OH  1 
ATOM   6479  N  N   . ASN E  1 28  ? -39.940  22.261  -111.893 1.00 36.78  ? 9    ASN E N   1 
ATOM   6480  C  CA  . ASN E  1 28  ? -38.496  22.357  -112.095 1.00 38.66  ? 9    ASN E CA  1 
ATOM   6481  C  C   . ASN E  1 28  ? -37.717  21.888  -110.865 1.00 33.47  ? 9    ASN E C   1 
ATOM   6482  O  O   . ASN E  1 28  ? -36.716  21.176  -110.987 1.00 27.82  ? 9    ASN E O   1 
ATOM   6483  C  CB  . ASN E  1 28  ? -38.074  23.783  -112.463 1.00 44.34  ? 9    ASN E CB  1 
ATOM   6484  C  CG  . ASN E  1 28  ? -38.700  24.265  -113.741 1.00 49.84  ? 9    ASN E CG  1 
ATOM   6485  O  OD1 . ASN E  1 28  ? -39.050  23.476  -114.629 1.00 49.13  ? 9    ASN E OD1 1 
ATOM   6486  N  ND2 . ASN E  1 28  ? -38.841  25.579  -113.854 1.00 55.98  ? 9    ASN E ND2 1 
ATOM   6487  N  N   . ILE E  1 29  ? -38.184  22.279  -109.694 1.00 32.59  ? 10   ILE E N   1 
ATOM   6488  C  CA  . ILE E  1 29  ? -37.535  21.901  -108.462 1.00 30.00  ? 10   ILE E CA  1 
ATOM   6489  C  C   . ILE E  1 29  ? -37.566  20.421  -108.262 1.00 28.68  ? 10   ILE E C   1 
ATOM   6490  O  O   . ILE E  1 29  ? -36.586  19.830  -107.948 1.00 31.80  ? 10   ILE E O   1 
ATOM   6491  C  CB  . ILE E  1 29  ? -38.174  22.633  -107.275 1.00 31.73  ? 10   ILE E CB  1 
ATOM   6492  C  CG1 . ILE E  1 29  ? -37.798  24.092  -107.340 1.00 28.24  ? 10   ILE E CG1 1 
ATOM   6493  C  CG2 . ILE E  1 29  ? -37.744  22.071  -105.949 1.00 19.50  ? 10   ILE E CG2 1 
ATOM   6494  C  CD1 . ILE E  1 29  ? -38.308  24.917  -106.203 1.00 26.74  ? 10   ILE E CD1 1 
ATOM   6495  N  N   . ARG E  1 30  ? -38.703  19.827  -108.490 1.00 25.23  ? 11   ARG E N   1 
ATOM   6496  C  CA  . ARG E  1 30  ? -38.862  18.424  -108.347 1.00 28.09  ? 11   ARG E CA  1 
ATOM   6497  C  C   . ARG E  1 30  ? -37.996  17.675  -109.334 1.00 35.17  ? 11   ARG E C   1 
ATOM   6498  O  O   . ARG E  1 30  ? -37.462  16.642  -109.040 1.00 37.36  ? 11   ARG E O   1 
ATOM   6499  C  CB  . ARG E  1 30  ? -40.320  18.135  -108.580 1.00 33.23  ? 11   ARG E CB  1 
ATOM   6500  C  CG  . ARG E  1 30  ? -40.823  16.760  -108.255 1.00 46.17  ? 11   ARG E CG  1 
ATOM   6501  C  CD  . ARG E  1 30  ? -42.318  16.811  -108.084 1.00 59.97  ? 11   ARG E CD  1 
ATOM   6502  N  NE  . ARG E  1 30  ? -43.010  17.337  -109.263 1.00 76.95  ? 11   ARG E NE  1 
ATOM   6503  C  CZ  . ARG E  1 30  ? -43.637  16.583  -110.165 1.00 84.48  ? 11   ARG E CZ  1 
ATOM   6504  N  NH1 . ARG E  1 30  ? -43.670  15.264  -110.032 1.00 85.62  ? 11   ARG E NH1 1 
ATOM   6505  N  NH2 . ARG E  1 30  ? -44.234  17.138  -111.203 1.00 83.30  ? 11   ARG E NH2 1 
ATOM   6506  N  N   . GLN E  1 31  ? -37.926  18.168  -110.550 1.00 38.59  ? 12   GLN E N   1 
ATOM   6507  C  CA  . GLN E  1 31  ? -37.119  17.554  -111.583 1.00 37.39  ? 12   GLN E CA  1 
ATOM   6508  C  C   . GLN E  1 31  ? -35.642  17.637  -111.427 1.00 36.53  ? 12   GLN E C   1 
ATOM   6509  O  O   . GLN E  1 31  ? -34.948  16.724  -111.763 1.00 40.53  ? 12   GLN E O   1 
ATOM   6510  C  CB  . GLN E  1 31  ? -37.509  18.065  -112.942 1.00 39.05  ? 12   GLN E CB  1 
ATOM   6511  C  CG  . GLN E  1 31  ? -38.869  17.623  -113.400 1.00 43.56  ? 12   GLN E CG  1 
ATOM   6512  C  CD  . GLN E  1 31  ? -39.022  16.148  -113.446 1.00 49.08  ? 12   GLN E CD  1 
ATOM   6513  O  OE1 . GLN E  1 31  ? -39.667  15.581  -112.614 1.00 56.41  ? 12   GLN E OE1 1 
ATOM   6514  N  NE2 . GLN E  1 31  ? -38.439  15.525  -114.419 1.00 49.96  ? 12   GLN E NE2 1 
ATOM   6515  N  N   . THR E  1 32  ? -35.169  18.767  -110.957 1.00 31.39  ? 13   THR E N   1 
ATOM   6516  C  CA  . THR E  1 32  ? -33.749  19.136  -111.034 1.00 35.20  ? 13   THR E CA  1 
ATOM   6517  C  C   . THR E  1 32  ? -33.000  19.314  -109.714 1.00 41.70  ? 13   THR E C   1 
ATOM   6518  O  O   . THR E  1 32  ? -31.760  19.347  -109.697 1.00 41.36  ? 13   THR E O   1 
ATOM   6519  C  CB  . THR E  1 32  ? -33.533  20.427  -111.847 1.00 29.21  ? 13   THR E CB  1 
ATOM   6520  O  OG1 . THR E  1 32  ? -34.338  21.466  -111.281 1.00 29.82  ? 13   THR E OG1 1 
ATOM   6521  C  CG2 . THR E  1 32  ? -33.917  20.204  -113.299 1.00 28.31  ? 13   THR E CG2 1 
ATOM   6522  N  N   . SER E  1 33  ? -33.720  19.486  -108.614 1.00 47.54  ? 14   SER E N   1 
ATOM   6523  C  CA  . SER E  1 33  ? -33.019  19.585  -107.338 1.00 48.20  ? 14   SER E CA  1 
ATOM   6524  C  C   . SER E  1 33  ? -32.429  18.220  -107.016 1.00 54.36  ? 14   SER E C   1 
ATOM   6525  O  O   . SER E  1 33  ? -32.982  17.163  -107.366 1.00 60.30  ? 14   SER E O   1 
ATOM   6526  C  CB  . SER E  1 33  ? -33.935  20.026  -106.211 1.00 44.28  ? 14   SER E CB  1 
ATOM   6527  O  OG  . SER E  1 33  ? -34.584  18.897  -105.671 1.00 46.24  ? 14   SER E OG  1 
ATOM   6528  N  N   . ARG E  1 34  ? -31.285  18.251  -106.360 1.00 50.74  ? 15   ARG E N   1 
ATOM   6529  C  CA  . ARG E  1 34  ? -30.578  17.030  -106.057 1.00 45.01  ? 15   ARG E CA  1 
ATOM   6530  C  C   . ARG E  1 34  ? -30.486  16.909  -104.525 1.00 33.43  ? 15   ARG E C   1 
ATOM   6531  O  O   . ARG E  1 34  ? -29.531  17.384  -103.907 1.00 27.38  ? 15   ARG E O   1 
ATOM   6532  C  CB  . ARG E  1 34  ? -29.196  17.075  -106.714 1.00 44.41  ? 15   ARG E CB  1 
ATOM   6533  C  CG  . ARG E  1 34  ? -29.229  17.182  -108.216 1.00 48.99  ? 15   ARG E CG  1 
ATOM   6534  C  CD  . ARG E  1 34  ? -29.408  15.803  -108.838 1.00 58.53  ? 15   ARG E CD  1 
ATOM   6535  N  NE  . ARG E  1 34  ? -28.387  14.881  -108.333 1.00 61.63  ? 15   ARG E NE  1 
ATOM   6536  C  CZ  . ARG E  1 34  ? -27.204  14.680  -108.912 1.00 55.63  ? 15   ARG E CZ  1 
ATOM   6537  N  NH1 . ARG E  1 34  ? -26.897  15.319  -110.045 1.00 52.80  ? 15   ARG E NH1 1 
ATOM   6538  N  NH2 . ARG E  1 34  ? -26.337  13.833  -108.359 1.00 48.27  ? 15   ARG E NH2 1 
ATOM   6539  N  N   . PRO E  1 35  ? -31.501  16.286  -103.920 1.00 27.43  ? 16   PRO E N   1 
ATOM   6540  C  CA  . PRO E  1 35  ? -31.616  16.209  -102.456 1.00 29.04  ? 16   PRO E CA  1 
ATOM   6541  C  C   . PRO E  1 35  ? -30.387  15.551  -101.821 1.00 27.73  ? 16   PRO E C   1 
ATOM   6542  O  O   . PRO E  1 35  ? -30.050  15.843  -100.683 1.00 30.56  ? 16   PRO E O   1 
ATOM   6543  C  CB  . PRO E  1 35  ? -32.873  15.348  -102.236 1.00 29.65  ? 16   PRO E CB  1 
ATOM   6544  C  CG  . PRO E  1 35  ? -33.643  15.417  -103.572 1.00 26.55  ? 16   PRO E CG  1 
ATOM   6545  C  CD  . PRO E  1 35  ? -32.604  15.603  -104.633 1.00 18.69  ? 16   PRO E CD  1 
ATOM   6546  N  N   . ASP E  1 36  ? -29.712  14.699  -102.575 1.00 26.61  ? 17   ASP E N   1 
ATOM   6547  C  CA  . ASP E  1 36  ? -28.543  14.002  -102.088 1.00 18.23  ? 17   ASP E CA  1 
ATOM   6548  C  C   . ASP E  1 36  ? -27.290  14.867  -102.171 1.00 23.79  ? 17   ASP E C   1 
ATOM   6549  O  O   . ASP E  1 36  ? -26.240  14.509  -101.647 1.00 26.75  ? 17   ASP E O   1 
ATOM   6550  C  CB  . ASP E  1 36  ? -28.356  12.709  -102.900 1.00 47.73  ? 17   ASP E CB  1 
ATOM   6551  C  CG  . ASP E  1 36  ? -28.473  12.932  -104.436 1.00 72.66  ? 17   ASP E CG  1 
ATOM   6552  O  OD1 . ASP E  1 36  ? -29.359  13.694  -104.890 1.00 68.46  ? 17   ASP E OD1 1 
ATOM   6553  O  OD2 . ASP E  1 36  ? -27.678  12.335  -105.204 1.00 78.19  ? 17   ASP E OD2 1 
ATOM   6554  N  N   . VAL E  1 37  ? -27.402  16.013  -102.831 1.00 26.34  ? 18   VAL E N   1 
ATOM   6555  C  CA  . VAL E  1 37  ? -26.235  16.830  -103.146 1.00 26.99  ? 18   VAL E CA  1 
ATOM   6556  C  C   . VAL E  1 37  ? -26.179  18.152  -102.357 1.00 28.62  ? 18   VAL E C   1 
ATOM   6557  O  O   . VAL E  1 37  ? -27.011  19.052  -102.536 1.00 25.19  ? 18   VAL E O   1 
ATOM   6558  C  CB  . VAL E  1 37  ? -26.165  17.109  -104.654 1.00 19.46  ? 18   VAL E CB  1 
ATOM   6559  C  CG1 . VAL E  1 37  ? -24.943  17.926  -104.992 1.00 19.76  ? 18   VAL E CG1 1 
ATOM   6560  C  CG2 . VAL E  1 37  ? -26.159  15.804  -105.421 1.00 19.45  ? 18   VAL E CG2 1 
ATOM   6561  N  N   . ILE E  1 38  ? -25.186  18.266  -101.486 1.00 28.12  ? 19   ILE E N   1 
ATOM   6562  C  CA  . ILE E  1 38  ? -24.997  19.493  -100.749 1.00 34.19  ? 19   ILE E CA  1 
ATOM   6563  C  C   . ILE E  1 38  ? -24.680  20.644  -101.725 1.00 34.57  ? 19   ILE E C   1 
ATOM   6564  O  O   . ILE E  1 38  ? -23.754  20.546  -102.551 1.00 27.75  ? 19   ILE E O   1 
ATOM   6565  C  CB  . ILE E  1 38  ? -23.909  19.301  -99.680  1.00 35.66  ? 19   ILE E CB  1 
ATOM   6566  C  CG1 . ILE E  1 38  ? -23.710  20.575  -98.844  1.00 31.21  ? 19   ILE E CG1 1 
ATOM   6567  C  CG2 . ILE E  1 38  ? -22.619  18.780  -100.321 1.00 19.03  ? 19   ILE E CG2 1 
ATOM   6568  C  CD1 . ILE E  1 38  ? -22.805  20.353  -97.668  1.00 18.65  ? 19   ILE E CD1 1 
ATOM   6569  N  N   . PRO E  1 39  ? -25.473  21.731  -101.646 1.00 33.99  ? 20   PRO E N   1 
ATOM   6570  C  CA  . PRO E  1 39  ? -25.329  22.895  -102.532 1.00 29.66  ? 20   PRO E CA  1 
ATOM   6571  C  C   . PRO E  1 39  ? -24.136  23.758  -102.121 1.00 30.83  ? 20   PRO E C   1 
ATOM   6572  O  O   . PRO E  1 39  ? -24.277  24.947  -101.854 1.00 32.57  ? 20   PRO E O   1 
ATOM   6573  C  CB  . PRO E  1 39  ? -26.630  23.660  -102.307 1.00 32.04  ? 20   PRO E CB  1 
ATOM   6574  C  CG  . PRO E  1 39  ? -26.945  23.393  -100.833 1.00 33.78  ? 20   PRO E CG  1 
ATOM   6575  C  CD  . PRO E  1 39  ? -26.492  21.950  -100.597 1.00 31.24  ? 20   PRO E CD  1 
ATOM   6576  N  N   . THR E  1 40  ? -22.964  23.147  -102.056 1.00 37.79  ? 21   THR E N   1 
ATOM   6577  C  CA  . THR E  1 40  ? -21.735  23.879  -101.794 1.00 45.72  ? 21   THR E CA  1 
ATOM   6578  C  C   . THR E  1 40  ? -21.318  24.697  -103.044 1.00 84.86  ? 21   THR E C   1 
ATOM   6579  O  O   . THR E  1 40  ? -21.524  24.265  -104.183 1.00 80.73  ? 21   THR E O   1 
ATOM   6580  C  CB  . THR E  1 40  ? -20.636  22.900  -101.344 1.00 56.17  ? 21   THR E CB  1 
ATOM   6581  O  OG1 . THR E  1 40  ? -19.538  23.619  -100.772 1.00 65.16  ? 21   THR E OG1 1 
ATOM   6582  C  CG2 . THR E  1 40  ? -20.161  22.044  -102.513 1.00 58.34  ? 21   THR E CG2 1 
ATOM   6583  N  N   . GLN E  1 41  ? -20.759  25.889  -102.836 1.00 88.86  ? 22   GLN E N   1 
ATOM   6584  C  CA  . GLN E  1 41  ? -20.445  26.798  -103.950 1.00 88.35  ? 22   GLN E CA  1 
ATOM   6585  C  C   . GLN E  1 41  ? -18.938  26.996  -104.185 1.00 85.56  ? 22   GLN E C   1 
ATOM   6586  O  O   . GLN E  1 41  ? -18.222  27.544  -103.344 1.00 83.99  ? 22   GLN E O   1 
ATOM   6587  C  CB  . GLN E  1 41  ? -21.154  28.153  -103.761 1.00 87.96  ? 22   GLN E CB  1 
ATOM   6588  C  CG  . GLN E  1 41  ? -22.096  28.554  -104.913 1.00 89.98  ? 22   GLN E CG  1 
ATOM   6589  C  CD  . GLN E  1 41  ? -22.886  29.831  -104.633 1.00 91.35  ? 22   GLN E CD  1 
ATOM   6590  O  OE1 . GLN E  1 41  ? -23.362  30.053  -103.513 1.00 91.58  ? 22   GLN E OE1 1 
ATOM   6591  N  NE2 . GLN E  1 41  ? -23.028  30.678  -105.658 1.00 91.42  ? 22   GLN E NE2 1 
ATOM   6592  N  N   . PRO E  1 45  ? -18.204  26.611  -97.766  1.00 38.30  ? 26   PRO E N   1 
ATOM   6593  C  CA  . PRO E  1 45  ? -19.247  25.884  -97.019  1.00 43.52  ? 26   PRO E CA  1 
ATOM   6594  C  C   . PRO E  1 45  ? -20.633  26.497  -97.209  1.00 35.61  ? 26   PRO E C   1 
ATOM   6595  O  O   . PRO E  1 45  ? -20.774  27.698  -97.443  1.00 28.40  ? 26   PRO E O   1 
ATOM   6596  C  CB  . PRO E  1 45  ? -18.795  26.023  -95.537  1.00 20.87  ? 26   PRO E CB  1 
ATOM   6597  C  CG  . PRO E  1 45  ? -17.903  27.228  -95.519  1.00 22.51  ? 26   PRO E CG  1 
ATOM   6598  C  CD  . PRO E  1 45  ? -17.200  27.221  -96.869  1.00 29.50  ? 26   PRO E CD  1 
ATOM   6599  N  N   . VAL E  1 46  ? -21.653  25.658  -97.115  1.00 29.99  ? 27   VAL E N   1 
ATOM   6600  C  CA  . VAL E  1 46  ? -23.020  26.140  -96.985  1.00 30.19  ? 27   VAL E CA  1 
ATOM   6601  C  C   . VAL E  1 46  ? -23.240  26.738  -95.583  1.00 31.90  ? 27   VAL E C   1 
ATOM   6602  O  O   . VAL E  1 46  ? -23.022  26.082  -94.563  1.00 34.08  ? 27   VAL E O   1 
ATOM   6603  C  CB  . VAL E  1 46  ? -24.028  25.002  -97.180  1.00 28.18  ? 27   VAL E CB  1 
ATOM   6604  C  CG1 . VAL E  1 46  ? -25.457  25.519  -96.994  1.00 27.63  ? 27   VAL E CG1 1 
ATOM   6605  C  CG2 . VAL E  1 46  ? -23.843  24.350  -98.532  1.00 31.24  ? 27   VAL E CG2 1 
ATOM   6606  N  N   . ALA E  1 47  ? -23.675  27.987  -95.540  1.00 34.02  ? 28   ALA E N   1 
ATOM   6607  C  CA  . ALA E  1 47  ? -23.899  28.666  -94.274  1.00 33.76  ? 28   ALA E CA  1 
ATOM   6608  C  C   . ALA E  1 47  ? -25.298  28.360  -93.749  1.00 27.84  ? 28   ALA E C   1 
ATOM   6609  O  O   . ALA E  1 47  ? -26.291  28.790  -94.323  1.00 29.10  ? 28   ALA E O   1 
ATOM   6610  C  CB  . ALA E  1 47  ? -23.703  30.159  -94.441  1.00 39.23  ? 28   ALA E CB  1 
ATOM   6611  N  N   . VAL E  1 48  ? -25.368  27.621  -92.649  1.00 25.88  ? 29   VAL E N   1 
ATOM   6612  C  CA  . VAL E  1 48  ? -26.648  27.217  -92.078  1.00 26.60  ? 29   VAL E CA  1 
ATOM   6613  C  C   . VAL E  1 48  ? -26.955  27.996  -90.796  1.00 28.18  ? 29   VAL E C   1 
ATOM   6614  O  O   . VAL E  1 48  ? -26.172  27.957  -89.848  1.00 27.40  ? 29   VAL E O   1 
ATOM   6615  C  CB  . VAL E  1 48  ? -26.675  25.697  -91.761  1.00 24.35  ? 29   VAL E CB  1 
ATOM   6616  C  CG1 . VAL E  1 48  ? -28.040  25.300  -91.171  1.00 23.55  ? 29   VAL E CG1 1 
ATOM   6617  C  CG2 . VAL E  1 48  ? -26.358  24.852  -93.020  1.00 25.19  ? 29   VAL E CG2 1 
ATOM   6618  N  N   . SER E  1 49  ? -28.082  28.711  -90.792  1.00 31.69  ? 30   SER E N   1 
ATOM   6619  C  CA  . SER E  1 49  ? -28.605  29.382  -89.603  1.00 37.08  ? 30   SER E CA  1 
ATOM   6620  C  C   . SER E  1 49  ? -29.499  28.449  -88.818  1.00 46.50  ? 30   SER E C   1 
ATOM   6621  O  O   . SER E  1 49  ? -30.408  27.839  -89.376  1.00 52.11  ? 30   SER E O   1 
ATOM   6622  C  CB  . SER E  1 49  ? -29.434  30.602  -89.970  1.00 31.83  ? 30   SER E CB  1 
ATOM   6623  O  OG  . SER E  1 49  ? -28.581  31.666  -90.319  1.00 33.90  ? 30   SER E OG  1 
ATOM   6624  N  N   . VAL E  1 50  ? -29.240  28.354  -87.518  1.00 43.59  ? 31   VAL E N   1 
ATOM   6625  C  CA  . VAL E  1 50  ? -30.061  27.568  -86.614  1.00 38.31  ? 31   VAL E CA  1 
ATOM   6626  C  C   . VAL E  1 50  ? -30.554  28.449  -85.475  1.00 42.20  ? 31   VAL E C   1 
ATOM   6627  O  O   . VAL E  1 50  ? -29.769  29.141  -84.815  1.00 46.01  ? 31   VAL E O   1 
ATOM   6628  C  CB  . VAL E  1 50  ? -29.275  26.405  -86.003  1.00 34.48  ? 31   VAL E CB  1 
ATOM   6629  C  CG1 . VAL E  1 50  ? -30.202  25.537  -85.203  1.00 29.97  ? 31   VAL E CG1 1 
ATOM   6630  C  CG2 . VAL E  1 50  ? -28.612  25.591  -87.097  1.00 36.35  ? 31   VAL E CG2 1 
ATOM   6631  N  N   . SER E  1 51  ? -31.859  28.412  -85.244  1.00 39.53  ? 32   SER E N   1 
ATOM   6632  C  CA  . SER E  1 51  ? -32.479  29.221  -84.222  1.00 42.42  ? 32   SER E CA  1 
ATOM   6633  C  C   . SER E  1 51  ? -33.630  28.421  -83.614  1.00 47.68  ? 32   SER E C   1 
ATOM   6634  O  O   . SER E  1 51  ? -34.617  28.128  -84.293  1.00 50.89  ? 32   SER E O   1 
ATOM   6635  C  CB  . SER E  1 51  ? -32.971  30.549  -84.820  1.00 44.81  ? 32   SER E CB  1 
ATOM   6636  O  OG  . SER E  1 51  ? -33.868  31.221  -83.938  1.00 46.98  ? 32   SER E OG  1 
ATOM   6637  N  N   . LEU E  1 52  ? -33.488  28.048  -82.341  1.00 47.39  ? 33   LEU E N   1 
ATOM   6638  C  CA  . LEU E  1 52  ? -34.551  27.340  -81.631  1.00 37.71  ? 33   LEU E CA  1 
ATOM   6639  C  C   . LEU E  1 52  ? -35.557  28.311  -81.018  1.00 35.35  ? 33   LEU E C   1 
ATOM   6640  O  O   . LEU E  1 52  ? -35.185  29.210  -80.274  1.00 37.72  ? 33   LEU E O   1 
ATOM   6641  C  CB  . LEU E  1 52  ? -33.969  26.464  -80.541  1.00 33.15  ? 33   LEU E CB  1 
ATOM   6642  C  CG  . LEU E  1 52  ? -32.899  25.482  -80.993  1.00 29.17  ? 33   LEU E CG  1 
ATOM   6643  C  CD1 . LEU E  1 52  ? -32.616  24.481  -79.863  1.00 18.43  ? 33   LEU E CD1 1 
ATOM   6644  C  CD2 . LEU E  1 52  ? -33.323  24.783  -82.308  1.00 30.13  ? 33   LEU E CD2 1 
ATOM   6645  N  N   . LYS E  1 53  ? -36.828  28.138  -81.360  1.00 33.55  ? 34   LYS E N   1 
ATOM   6646  C  CA  . LYS E  1 53  ? -37.903  28.925  -80.783  1.00 29.70  ? 34   LYS E CA  1 
ATOM   6647  C  C   . LYS E  1 53  ? -38.650  27.987  -79.838  1.00 33.99  ? 34   LYS E C   1 
ATOM   6648  O  O   . LYS E  1 53  ? -39.386  27.096  -80.276  1.00 35.33  ? 34   LYS E O   1 
ATOM   6649  C  CB  . LYS E  1 53  ? -38.867  29.445  -81.872  1.00 22.49  ? 34   LYS E CB  1 
ATOM   6650  C  CG  . LYS E  1 53  ? -38.195  30.116  -83.048  1.00 31.93  ? 34   LYS E CG  1 
ATOM   6651  C  CD  . LYS E  1 53  ? -37.722  31.534  -82.729  1.00 44.70  ? 34   LYS E CD  1 
ATOM   6652  C  CE  . LYS E  1 53  ? -37.122  32.210  -83.963  1.00 56.02  ? 34   LYS E CE  1 
ATOM   6653  N  NZ  . LYS E  1 53  ? -36.825  33.666  -83.747  1.00 66.31  ? 34   LYS E NZ  1 
ATOM   6654  N  N   . PHE E  1 54  ? -38.473  28.179  -78.537  1.00 34.40  ? 35   PHE E N   1 
ATOM   6655  C  CA  . PHE E  1 54  ? -39.060  27.243  -77.584  1.00 31.14  ? 35   PHE E CA  1 
ATOM   6656  C  C   . PHE E  1 54  ? -40.544  27.457  -77.427  1.00 26.57  ? 35   PHE E C   1 
ATOM   6657  O  O   . PHE E  1 54  ? -41.010  28.575  -77.357  1.00 31.80  ? 35   PHE E O   1 
ATOM   6658  C  CB  . PHE E  1 54  ? -38.322  27.302  -76.253  1.00 30.41  ? 35   PHE E CB  1 
ATOM   6659  C  CG  . PHE E  1 54  ? -36.907  26.821  -76.346  1.00 30.82  ? 35   PHE E CG  1 
ATOM   6660  C  CD1 . PHE E  1 54  ? -36.610  25.475  -76.187  1.00 35.71  ? 35   PHE E CD1 1 
ATOM   6661  C  CD2 . PHE E  1 54  ? -35.874  27.704  -76.638  1.00 29.50  ? 35   PHE E CD2 1 
ATOM   6662  C  CE1 . PHE E  1 54  ? -35.290  25.015  -76.274  1.00 36.63  ? 35   PHE E CE1 1 
ATOM   6663  C  CE2 . PHE E  1 54  ? -34.551  27.256  -76.734  1.00 30.49  ? 35   PHE E CE2 1 
ATOM   6664  C  CZ  . PHE E  1 54  ? -34.260  25.911  -76.547  1.00 33.49  ? 35   PHE E CZ  1 
ATOM   6665  N  N   . ILE E  1 55  ? -41.283  26.365  -77.396  1.00 20.38  ? 36   ILE E N   1 
ATOM   6666  C  CA  . ILE E  1 55  ? -42.733  26.434  -77.438  1.00 27.58  ? 36   ILE E CA  1 
ATOM   6667  C  C   . ILE E  1 55  ? -43.247  25.917  -76.130  1.00 26.21  ? 36   ILE E C   1 
ATOM   6668  O  O   . ILE E  1 55  ? -44.150  26.507  -75.515  1.00 23.77  ? 36   ILE E O   1 
ATOM   6669  C  CB  . ILE E  1 55  ? -43.322  25.582  -78.614  1.00 28.77  ? 36   ILE E CB  1 
ATOM   6670  C  CG1 . ILE E  1 55  ? -42.689  25.996  -79.941  1.00 21.28  ? 36   ILE E CG1 1 
ATOM   6671  C  CG2 . ILE E  1 55  ? -44.847  25.704  -78.703  1.00 21.30  ? 36   ILE E CG2 1 
ATOM   6672  C  CD1 . ILE E  1 55  ? -42.839  27.496  -80.275  1.00 20.32  ? 36   ILE E CD1 1 
ATOM   6673  N  N   . ASN E  1 56  ? -42.645  24.818  -75.681  1.00 32.32  ? 37   ASN E N   1 
ATOM   6674  C  CA  . ASN E  1 56  ? -43.054  24.214  -74.411  1.00 32.01  ? 37   ASN E CA  1 
ATOM   6675  C  C   . ASN E  1 56  ? -42.002  23.358  -73.756  1.00 23.59  ? 37   ASN E C   1 
ATOM   6676  O  O   . ASN E  1 56  ? -41.169  22.778  -74.432  1.00 20.81  ? 37   ASN E O   1 
ATOM   6677  C  CB  . ASN E  1 56  ? -44.326  23.394  -74.620  1.00 37.88  ? 37   ASN E CB  1 
ATOM   6678  C  CG  . ASN E  1 56  ? -45.263  23.451  -73.422  1.00 35.14  ? 37   ASN E CG  1 
ATOM   6679  O  OD1 . ASN E  1 56  ? -44.826  23.439  -72.275  1.00 33.64  ? 37   ASN E OD1 1 
ATOM   6680  N  ND2 . ASN E  1 56  ? -46.559  23.507  -73.692  1.00 36.58  ? 37   ASN E ND2 1 
ATOM   6681  N  N   . ILE E  1 57  ? -42.030  23.284  -72.452  1.00 27.16  ? 38   ILE E N   1 
ATOM   6682  C  CA  . ILE E  1 57  ? -41.176  22.395  -71.728  1.00 29.63  ? 38   ILE E CA  1 
ATOM   6683  C  C   . ILE E  1 57  ? -42.109  21.473  -71.021  1.00 32.76  ? 38   ILE E C   1 
ATOM   6684  O  O   . ILE E  1 57  ? -43.017  21.934  -70.452  1.00 44.35  ? 38   ILE E O   1 
ATOM   6685  C  CB  . ILE E  1 57  ? -40.370  23.165  -70.727  1.00 34.55  ? 38   ILE E CB  1 
ATOM   6686  C  CG1 . ILE E  1 57  ? -39.386  24.038  -71.446  1.00 32.93  ? 38   ILE E CG1 1 
ATOM   6687  C  CG2 . ILE E  1 57  ? -39.617  22.221  -69.841  1.00 39.36  ? 38   ILE E CG2 1 
ATOM   6688  C  CD1 . ILE E  1 57  ? -38.406  24.699  -70.549  1.00 33.31  ? 38   ILE E CD1 1 
ATOM   6689  N  N   . LEU E  1 58  ? -41.941  20.171  -71.129  1.00 29.58  ? 39   LEU E N   1 
ATOM   6690  C  CA  . LEU E  1 58  ? -42.993  19.253  -70.749  1.00 38.43  ? 39   LEU E CA  1 
ATOM   6691  C  C   . LEU E  1 58  ? -42.839  18.324  -69.562  1.00 49.58  ? 39   LEU E C   1 
ATOM   6692  O  O   . LEU E  1 58  ? -43.765  18.160  -68.824  1.00 60.53  ? 39   LEU E O   1 
ATOM   6693  C  CB  . LEU E  1 58  ? -43.410  18.427  -71.931  1.00 40.85  ? 39   LEU E CB  1 
ATOM   6694  C  CG  . LEU E  1 58  ? -44.100  19.101  -73.086  1.00 45.43  ? 39   LEU E CG  1 
ATOM   6695  C  CD1 . LEU E  1 58  ? -44.507  18.010  -74.031  1.00 47.22  ? 39   LEU E CD1 1 
ATOM   6696  C  CD2 . LEU E  1 58  ? -45.337  19.815  -72.617  1.00 51.02  ? 39   LEU E CD2 1 
ATOM   6697  N  N   . GLU E  1 59  ? -41.729  17.643  -69.424  1.00 51.21  ? 40   GLU E N   1 
ATOM   6698  C  CA  . GLU E  1 59  ? -41.464  16.912  -68.213  1.00 61.65  ? 40   GLU E CA  1 
ATOM   6699  C  C   . GLU E  1 59  ? -39.992  17.070  -67.927  1.00 63.93  ? 40   GLU E C   1 
ATOM   6700  O  O   . GLU E  1 59  ? -39.193  16.942  -68.795  1.00 71.33  ? 40   GLU E O   1 
ATOM   6701  C  CB  . GLU E  1 59  ? -41.915  15.453  -68.299  1.00 72.30  ? 40   GLU E CB  1 
ATOM   6702  C  CG  . GLU E  1 59  ? -43.316  15.208  -68.880  1.00 83.98  ? 40   GLU E CG  1 
ATOM   6703  C  CD  . GLU E  1 59  ? -44.518  15.294  -67.891  1.00 93.64  ? 40   GLU E CD  1 
ATOM   6704  O  OE1 . GLU E  1 59  ? -44.370  15.226  -66.630  1.00 95.68  ? 40   GLU E OE1 1 
ATOM   6705  O  OE2 . GLU E  1 59  ? -45.658  15.426  -68.399  1.00 96.45  ? 40   GLU E OE2 1 
ATOM   6706  N  N   . VAL E  1 60  ? -39.642  17.354  -66.692  1.00 53.44  ? 41   VAL E N   1 
ATOM   6707  C  CA  . VAL E  1 60  ? -38.289  17.574  -66.302  1.00 40.64  ? 41   VAL E CA  1 
ATOM   6708  C  C   . VAL E  1 60  ? -38.103  16.498  -65.293  1.00 32.90  ? 41   VAL E C   1 
ATOM   6709  O  O   . VAL E  1 60  ? -39.029  16.170  -64.635  1.00 30.69  ? 41   VAL E O   1 
ATOM   6710  C  CB  . VAL E  1 60  ? -38.155  18.958  -65.678  1.00 43.16  ? 41   VAL E CB  1 
ATOM   6711  C  CG1 . VAL E  1 60  ? -37.014  19.058  -64.712  1.00 42.24  ? 41   VAL E CG1 1 
ATOM   6712  C  CG2 . VAL E  1 60  ? -37.996  19.996  -66.742  1.00 41.50  ? 41   VAL E CG2 1 
ATOM   6713  N  N   . ASN E  1 61  ? -36.942  15.879  -65.255  1.00 29.58  ? 42   ASN E N   1 
ATOM   6714  C  CA  . ASN E  1 61  ? -36.578  15.002  -64.179  1.00 31.15  ? 42   ASN E CA  1 
ATOM   6715  C  C   . ASN E  1 61  ? -35.280  15.501  -63.691  1.00 27.41  ? 42   ASN E C   1 
ATOM   6716  O  O   . ASN E  1 61  ? -34.295  15.390  -64.315  1.00 30.19  ? 42   ASN E O   1 
ATOM   6717  C  CB  . ASN E  1 61  ? -36.437  13.584  -64.685  1.00 36.81  ? 42   ASN E CB  1 
ATOM   6718  C  CG  . ASN E  1 61  ? -36.652  12.545  -63.624  1.00 38.08  ? 42   ASN E CG  1 
ATOM   6719  O  OD1 . ASN E  1 61  ? -36.015  12.548  -62.606  1.00 36.47  ? 42   ASN E OD1 1 
ATOM   6720  N  ND2 . ASN E  1 61  ? -37.506  11.613  -63.908  1.00 33.76  ? 42   ASN E ND2 1 
ATOM   6721  N  N   . GLU E  1 62  ? -35.284  16.033  -62.514  1.00 28.84  ? 43   GLU E N   1 
ATOM   6722  C  CA  . GLU E  1 62  ? -34.046  16.513  -61.898  1.00 36.69  ? 43   GLU E CA  1 
ATOM   6723  C  C   . GLU E  1 62  ? -33.143  15.373  -61.455  1.00 35.75  ? 43   GLU E C   1 
ATOM   6724  O  O   . GLU E  1 62  ? -31.923  15.531  -61.393  1.00 43.86  ? 43   GLU E O   1 
ATOM   6725  C  CB  . GLU E  1 62  ? -34.350  17.436  -60.715  1.00 46.40  ? 43   GLU E CB  1 
ATOM   6726  C  CG  . GLU E  1 62  ? -33.184  18.323  -60.316  1.00 51.22  ? 43   GLU E CG  1 
ATOM   6727  C  CD  . GLU E  1 62  ? -33.600  19.487  -59.417  1.00 55.10  ? 43   GLU E CD  1 
ATOM   6728  O  OE1 . GLU E  1 62  ? -34.788  19.552  -59.017  1.00 52.85  ? 43   GLU E OE1 1 
ATOM   6729  O  OE2 . GLU E  1 62  ? -32.729  20.339  -59.124  1.00 58.09  ? 43   GLU E OE2 1 
ATOM   6730  N  N   . ILE E  1 63  ? -33.740  14.222  -61.171  1.00 30.04  ? 44   ILE E N   1 
ATOM   6731  C  CA  . ILE E  1 63  ? -32.966  13.047  -60.834  1.00 32.76  ? 44   ILE E CA  1 
ATOM   6732  C  C   . ILE E  1 63  ? -32.192  12.563  -62.064  1.00 33.14  ? 44   ILE E C   1 
ATOM   6733  O  O   . ILE E  1 63  ? -30.958  12.502  -62.060  1.00 38.90  ? 44   ILE E O   1 
ATOM   6734  C  CB  . ILE E  1 63  ? -33.867  11.900  -60.284  1.00 59.31  ? 44   ILE E CB  1 
ATOM   6735  C  CG1 . ILE E  1 63  ? -34.695  12.387  -59.092  1.00 58.80  ? 44   ILE E CG1 1 
ATOM   6736  C  CG2 . ILE E  1 63  ? -33.027  10.682  -59.899  1.00 57.22  ? 44   ILE E CG2 1 
ATOM   6737  C  CD1 . ILE E  1 63  ? -33.868  13.001  -57.997  1.00 57.69  ? 44   ILE E CD1 1 
ATOM   6738  N  N   . THR E  1 64  ? -32.924  12.211  -63.112  1.00 28.01  ? 45   THR E N   1 
ATOM   6739  C  CA  . THR E  1 64  ? -32.318  11.577  -64.276  1.00 30.84  ? 45   THR E CA  1 
ATOM   6740  C  C   . THR E  1 64  ? -31.606  12.573  -65.189  1.00 36.22  ? 45   THR E C   1 
ATOM   6741  O  O   . THR E  1 64  ? -30.875  12.172  -66.099  1.00 38.15  ? 45   THR E O   1 
ATOM   6742  C  CB  . THR E  1 64  ? -33.354  10.803  -65.109  1.00 26.17  ? 45   THR E CB  1 
ATOM   6743  O  OG1 . THR E  1 64  ? -34.319  11.718  -65.651  1.00 26.35  ? 45   THR E OG1 1 
ATOM   6744  C  CG2 . THR E  1 64  ? -34.057  9.752   -64.268  1.00 21.51  ? 45   THR E CG2 1 
ATOM   6745  N  N   . ASN E  1 65  ? -31.837  13.866  -64.959  1.00 37.27  ? 46   ASN E N   1 
ATOM   6746  C  CA  . ASN E  1 65  ? -31.265  14.910  -65.813  1.00 31.63  ? 46   ASN E CA  1 
ATOM   6747  C  C   . ASN E  1 65  ? -31.764  14.815  -67.292  1.00 40.95  ? 46   ASN E C   1 
ATOM   6748  O  O   . ASN E  1 65  ? -30.991  14.828  -68.268  1.00 31.68  ? 46   ASN E O   1 
ATOM   6749  C  CB  . ASN E  1 65  ? -29.734  14.902  -65.723  1.00 24.62  ? 46   ASN E CB  1 
ATOM   6750  C  CG  . ASN E  1 65  ? -29.200  15.959  -64.798  1.00 25.45  ? 46   ASN E CG  1 
ATOM   6751  O  OD1 . ASN E  1 65  ? -29.844  17.000  -64.573  1.00 28.98  ? 46   ASN E OD1 1 
ATOM   6752  N  ND2 . ASN E  1 65  ? -27.997  15.711  -64.251  1.00 23.73  ? 46   ASN E ND2 1 
ATOM   6753  N  N   . GLU E  1 66  ? -33.079  14.721  -67.429  1.00 36.69  ? 47   GLU E N   1 
ATOM   6754  C  CA  . GLU E  1 66  ? -33.702  14.611  -68.721  1.00 29.89  ? 47   GLU E CA  1 
ATOM   6755  C  C   . GLU E  1 66  ? -34.831  15.612  -68.794  1.00 28.74  ? 47   GLU E C   1 
ATOM   6756  O  O   . GLU E  1 66  ? -35.531  15.827  -67.800  1.00 20.67  ? 47   GLU E O   1 
ATOM   6757  C  CB  . GLU E  1 66  ? -34.201  13.188  -68.921  1.00 19.97  ? 47   GLU E CB  1 
ATOM   6758  C  CG  . GLU E  1 66  ? -33.070  12.169  -68.871  1.00 31.76  ? 47   GLU E CG  1 
ATOM   6759  C  CD  . GLU E  1 66  ? -33.576  10.741  -68.917  1.00 41.17  ? 47   GLU E CD  1 
ATOM   6760  O  OE1 . GLU E  1 66  ? -34.768  10.545  -69.242  1.00 47.93  ? 47   GLU E OE1 1 
ATOM   6761  O  OE2 . GLU E  1 66  ? -32.787  9.816   -68.614  1.00 46.51  ? 47   GLU E OE2 1 
ATOM   6762  N  N   . VAL E  1 67  ? -34.971  16.252  -69.953  1.00 31.67  ? 48   VAL E N   1 
ATOM   6763  C  CA  . VAL E  1 67  ? -36.082  17.165  -70.202  1.00 36.90  ? 48   VAL E CA  1 
ATOM   6764  C  C   . VAL E  1 67  ? -36.774  16.812  -71.520  1.00 42.04  ? 48   VAL E C   1 
ATOM   6765  O  O   . VAL E  1 67  ? -36.165  16.235  -72.427  1.00 41.88  ? 48   VAL E O   1 
ATOM   6766  C  CB  . VAL E  1 67  ? -35.639  18.651  -70.254  1.00 49.19  ? 48   VAL E CB  1 
ATOM   6767  C  CG1 . VAL E  1 67  ? -35.054  19.073  -68.945  1.00 51.99  ? 48   VAL E CG1 1 
ATOM   6768  C  CG2 . VAL E  1 67  ? -34.641  18.867  -71.382  1.00 49.06  ? 48   VAL E CG2 1 
ATOM   6769  N  N   . ASP E  1 68  ? -38.054  17.155  -71.599  1.00 43.23  ? 49   ASP E N   1 
ATOM   6770  C  CA  . ASP E  1 68  ? -38.854  16.953  -72.786  1.00 36.39  ? 49   ASP E CA  1 
ATOM   6771  C  C   . ASP E  1 68  ? -39.219  18.348  -73.289  1.00 32.59  ? 49   ASP E C   1 
ATOM   6772  O  O   . ASP E  1 68  ? -39.923  19.104  -72.620  1.00 41.32  ? 49   ASP E O   1 
ATOM   6773  C  CB  . ASP E  1 68  ? -40.107  16.156  -72.411  1.00 41.51  ? 49   ASP E CB  1 
ATOM   6774  C  CG  . ASP E  1 68  ? -40.670  15.352  -73.577  1.00 45.16  ? 49   ASP E CG  1 
ATOM   6775  O  OD1 . ASP E  1 68  ? -41.105  15.969  -74.561  1.00 52.23  ? 49   ASP E OD1 1 
ATOM   6776  O  OD2 . ASP E  1 68  ? -40.708  14.110  -73.520  1.00 43.94  ? 49   ASP E OD2 1 
ATOM   6777  N  N   . VAL E  1 69  ? -38.731  18.701  -74.462  1.00 28.99  ? 50   VAL E N   1 
ATOM   6778  C  CA  . VAL E  1 69  ? -38.949  20.035  -74.976  1.00 29.68  ? 50   VAL E CA  1 
ATOM   6779  C  C   . VAL E  1 69  ? -39.734  20.010  -76.292  1.00 32.19  ? 50   VAL E C   1 
ATOM   6780  O  O   . VAL E  1 69  ? -39.600  19.067  -77.085  1.00 29.43  ? 50   VAL E O   1 
ATOM   6781  C  CB  . VAL E  1 69  ? -37.597  20.732  -75.165  1.00 28.29  ? 50   VAL E CB  1 
ATOM   6782  C  CG1 . VAL E  1 69  ? -37.791  22.196  -75.595  1.00 31.37  ? 50   VAL E CG1 1 
ATOM   6783  C  CG2 . VAL E  1 69  ? -36.796  20.646  -73.873  1.00 23.35  ? 50   VAL E CG2 1 
ATOM   6784  N  N   . VAL E  1 70  ? -40.564  21.036  -76.497  1.00 31.24  ? 51   VAL E N   1 
ATOM   6785  C  CA  . VAL E  1 70  ? -41.138  21.328  -77.808  1.00 31.16  ? 51   VAL E CA  1 
ATOM   6786  C  C   . VAL E  1 70  ? -40.559  22.640  -78.328  1.00 30.79  ? 51   VAL E C   1 
ATOM   6787  O  O   . VAL E  1 70  ? -40.583  23.662  -77.634  1.00 32.18  ? 51   VAL E O   1 
ATOM   6788  C  CB  . VAL E  1 70  ? -42.678  21.387  -77.765  1.00 29.57  ? 51   VAL E CB  1 
ATOM   6789  C  CG1 . VAL E  1 70  ? -43.242  21.867  -79.118  1.00 26.57  ? 51   VAL E CG1 1 
ATOM   6790  C  CG2 . VAL E  1 70  ? -43.236  20.026  -77.413  1.00 29.22  ? 51   VAL E CG2 1 
ATOM   6791  N  N   . PHE E  1 71  ? -40.038  22.613  -79.548  1.00 31.45  ? 52   PHE E N   1 
ATOM   6792  C  CA  . PHE E  1 71  ? -39.413  23.810  -80.105  1.00 35.51  ? 52   PHE E CA  1 
ATOM   6793  C  C   . PHE E  1 71  ? -39.480  23.854  -81.636  1.00 34.09  ? 52   PHE E C   1 
ATOM   6794  O  O   . PHE E  1 71  ? -39.530  22.814  -82.287  1.00 29.19  ? 52   PHE E O   1 
ATOM   6795  C  CB  . PHE E  1 71  ? -37.961  23.875  -79.642  1.00 34.94  ? 52   PHE E CB  1 
ATOM   6796  C  CG  . PHE E  1 71  ? -37.142  22.688  -80.070  1.00 30.39  ? 52   PHE E CG  1 
ATOM   6797  C  CD1 . PHE E  1 71  ? -37.173  21.516  -79.344  1.00 28.54  ? 52   PHE E CD1 1 
ATOM   6798  C  CD2 . PHE E  1 71  ? -36.344  22.746  -81.211  1.00 33.92  ? 52   PHE E CD2 1 
ATOM   6799  C  CE1 . PHE E  1 71  ? -36.415  20.399  -79.737  1.00 28.79  ? 52   PHE E CE1 1 
ATOM   6800  C  CE2 . PHE E  1 71  ? -35.584  21.646  -81.610  1.00 31.73  ? 52   PHE E CE2 1 
ATOM   6801  C  CZ  . PHE E  1 71  ? -35.619  20.468  -80.866  1.00 28.08  ? 52   PHE E CZ  1 
ATOM   6802  N  N   . TRP E  1 72  ? -39.494  25.064  -82.190  1.00 18.20  ? 53   TRP E N   1 
ATOM   6803  C  CA  . TRP E  1 72  ? -39.364  25.252  -83.616  1.00 20.33  ? 53   TRP E CA  1 
ATOM   6804  C  C   . TRP E  1 72  ? -37.882  25.257  -83.911  1.00 24.44  ? 53   TRP E C   1 
ATOM   6805  O  O   . TRP E  1 72  ? -37.144  26.067  -83.344  1.00 28.59  ? 53   TRP E O   1 
ATOM   6806  C  CB  . TRP E  1 72  ? -39.957  26.591  -84.047  1.00 18.05  ? 53   TRP E CB  1 
ATOM   6807  C  CG  . TRP E  1 72  ? -41.438  26.694  -83.855  1.00 26.67  ? 53   TRP E CG  1 
ATOM   6808  C  CD1 . TRP E  1 72  ? -42.260  25.766  -83.288  1.00 26.38  ? 53   TRP E CD1 1 
ATOM   6809  C  CD2 . TRP E  1 72  ? -42.280  27.792  -84.245  1.00 29.47  ? 53   TRP E CD2 1 
ATOM   6810  N  NE1 . TRP E  1 72  ? -43.564  26.222  -83.285  1.00 27.17  ? 53   TRP E NE1 1 
ATOM   6811  C  CE2 . TRP E  1 72  ? -43.603  27.458  -83.858  1.00 27.65  ? 53   TRP E CE2 1 
ATOM   6812  C  CE3 . TRP E  1 72  ? -42.038  29.023  -84.867  1.00 33.74  ? 53   TRP E CE3 1 
ATOM   6813  C  CZ2 . TRP E  1 72  ? -44.692  28.316  -84.089  1.00 20.13  ? 53   TRP E CZ2 1 
ATOM   6814  C  CZ3 . TRP E  1 72  ? -43.113  29.881  -85.091  1.00 39.97  ? 53   TRP E CZ3 1 
ATOM   6815  C  CH2 . TRP E  1 72  ? -44.428  29.522  -84.692  1.00 43.61  ? 53   TRP E CH2 1 
ATOM   6816  N  N   . GLN E  1 73  ? -37.440  24.345  -84.778  1.00 25.64  ? 54   GLN E N   1 
ATOM   6817  C  CA  . GLN E  1 73  ? -36.057  24.351  -85.235  1.00 25.95  ? 54   GLN E CA  1 
ATOM   6818  C  C   . GLN E  1 73  ? -35.944  25.101  -86.552  1.00 29.46  ? 54   GLN E C   1 
ATOM   6819  O  O   . GLN E  1 73  ? -35.913  24.482  -87.629  1.00 26.73  ? 54   GLN E O   1 
ATOM   6820  C  CB  . GLN E  1 73  ? -35.550  22.938  -85.410  1.00 26.81  ? 54   GLN E CB  1 
ATOM   6821  C  CG  . GLN E  1 73  ? -34.056  22.839  -85.588  1.00 33.48  ? 54   GLN E CG  1 
ATOM   6822  C  CD  . GLN E  1 73  ? -33.548  21.422  -85.340  1.00 41.83  ? 54   GLN E CD  1 
ATOM   6823  O  OE1 . GLN E  1 73  ? -33.750  20.865  -84.267  1.00 38.29  ? 54   GLN E OE1 1 
ATOM   6824  N  NE2 . GLN E  1 73  ? -32.900  20.831  -86.348  1.00 48.60  ? 54   GLN E NE2 1 
ATOM   6825  N  N   . GLN E  1 74  ? -35.886  26.434  -86.451  1.00 27.06  ? 55   GLN E N   1 
ATOM   6826  C  CA  . GLN E  1 74  ? -35.788  27.301  -87.618  1.00 28.26  ? 55   GLN E CA  1 
ATOM   6827  C  C   . GLN E  1 74  ? -34.428  27.154  -88.299  1.00 26.77  ? 55   GLN E C   1 
ATOM   6828  O  O   . GLN E  1 74  ? -33.418  27.605  -87.780  1.00 23.22  ? 55   GLN E O   1 
ATOM   6829  C  CB  . GLN E  1 74  ? -36.043  28.761  -87.243  1.00 35.53  ? 55   GLN E CB  1 
ATOM   6830  C  CG  . GLN E  1 74  ? -35.942  29.683  -88.441  1.00 50.13  ? 55   GLN E CG  1 
ATOM   6831  C  CD  . GLN E  1 74  ? -36.088  31.138  -88.068  1.00 56.45  ? 55   GLN E CD  1 
ATOM   6832  O  OE1 . GLN E  1 74  ? -37.194  31.605  -87.786  1.00 62.72  ? 55   GLN E OE1 1 
ATOM   6833  N  NE2 . GLN E  1 74  ? -34.971  31.864  -88.054  1.00 52.02  ? 55   GLN E NE2 1 
ATOM   6834  N  N   . THR E  1 75  ? -34.410  26.523  -89.470  1.00 32.41  ? 56   THR E N   1 
ATOM   6835  C  CA  . THR E  1 75  ? -33.159  26.270  -90.189  1.00 29.58  ? 56   THR E CA  1 
ATOM   6836  C  C   . THR E  1 75  ? -33.162  27.050  -91.499  1.00 24.97  ? 56   THR E C   1 
ATOM   6837  O  O   . THR E  1 75  ? -34.132  26.995  -92.239  1.00 25.22  ? 56   THR E O   1 
ATOM   6838  C  CB  . THR E  1 75  ? -32.980  24.763  -90.458  1.00 26.17  ? 56   THR E CB  1 
ATOM   6839  O  OG1 . THR E  1 75  ? -33.285  24.045  -89.268  1.00 32.38  ? 56   THR E OG1 1 
ATOM   6840  C  CG2 . THR E  1 75  ? -31.564  24.431  -90.850  1.00 21.91  ? 56   THR E CG2 1 
ATOM   6841  N  N   . THR E  1 76  ? -32.084  27.779  -91.779  1.00 25.87  ? 57   THR E N   1 
ATOM   6842  C  CA  . THR E  1 76  ? -32.031  28.625  -92.975  1.00 24.86  ? 57   THR E CA  1 
ATOM   6843  C  C   . THR E  1 76  ? -30.707  28.480  -93.719  1.00 28.48  ? 57   THR E C   1 
ATOM   6844  O  O   . THR E  1 76  ? -29.632  28.571  -93.116  1.00 35.45  ? 57   THR E O   1 
ATOM   6845  C  CB  . THR E  1 76  ? -32.288  30.107  -92.640  1.00 24.36  ? 57   THR E CB  1 
ATOM   6846  O  OG1 . THR E  1 76  ? -33.560  30.239  -91.989  1.00 22.55  ? 57   THR E OG1 1 
ATOM   6847  C  CG2 . THR E  1 76  ? -32.341  30.935  -93.905  1.00 35.60  ? 57   THR E CG2 1 
ATOM   6848  N  N   . TRP E  1 77  ? -30.790  28.242  -95.028  1.00 16.54  ? 58   TRP E N   1 
ATOM   6849  C  CA  . TRP E  1 77  ? -29.591  28.143  -95.836  1.00 17.87  ? 58   TRP E CA  1 
ATOM   6850  C  C   . TRP E  1 77  ? -29.855  28.573  -97.272  1.00 23.84  ? 58   TRP E C   1 
ATOM   6851  O  O   . TRP E  1 77  ? -30.973  28.958  -97.634  1.00 18.71  ? 58   TRP E O   1 
ATOM   6852  C  CB  . TRP E  1 77  ? -29.021  26.717  -95.783  1.00 21.64  ? 58   TRP E CB  1 
ATOM   6853  C  CG  . TRP E  1 77  ? -29.891  25.717  -96.458  1.00 21.51  ? 58   TRP E CG  1 
ATOM   6854  C  CD1 . TRP E  1 77  ? -29.766  25.237  -97.747  1.00 21.20  ? 58   TRP E CD1 1 
ATOM   6855  C  CD2 . TRP E  1 77  ? -31.038  25.079  -95.901  1.00 21.60  ? 58   TRP E CD2 1 
ATOM   6856  N  NE1 . TRP E  1 77  ? -30.761  24.337  -98.007  1.00 22.33  ? 58   TRP E NE1 1 
ATOM   6857  C  CE2 . TRP E  1 77  ? -31.557  24.222  -96.903  1.00 24.28  ? 58   TRP E CE2 1 
ATOM   6858  C  CE3 . TRP E  1 77  ? -31.680  25.154  -94.664  1.00 22.15  ? 58   TRP E CE3 1 
ATOM   6859  C  CZ2 . TRP E  1 77  ? -32.684  23.419  -96.679  1.00 25.28  ? 58   TRP E CZ2 1 
ATOM   6860  C  CZ3 . TRP E  1 77  ? -32.816  24.379  -94.451  1.00 21.04  ? 58   TRP E CZ3 1 
ATOM   6861  C  CH2 . TRP E  1 77  ? -33.306  23.519  -95.453  1.00 23.40  ? 58   TRP E CH2 1 
ATOM   6862  N  N   . SER E  1 78  ? -28.820  28.480  -98.090  1.00 29.35  ? 59   SER E N   1 
ATOM   6863  C  CA  . SER E  1 78  ? -28.910  28.924  -99.460  1.00 36.21  ? 59   SER E CA  1 
ATOM   6864  C  C   . SER E  1 78  ? -28.582  27.791  -100.440 1.00 37.52  ? 59   SER E C   1 
ATOM   6865  O  O   . SER E  1 78  ? -27.587  27.067  -100.267 1.00 39.38  ? 59   SER E O   1 
ATOM   6866  C  CB  . SER E  1 78  ? -27.968  30.111  -99.654  1.00 39.76  ? 59   SER E CB  1 
ATOM   6867  O  OG  . SER E  1 78  ? -28.162  30.721  -100.914 1.00 38.49  ? 59   SER E OG  1 
ATOM   6868  N  N   . ASP E  1 79  ? -29.435  27.639  -101.451 1.00 45.30  ? 60   ASP E N   1 
ATOM   6869  C  CA  . ASP E  1 79  ? -29.196  26.712  -102.551 1.00 43.17  ? 60   ASP E CA  1 
ATOM   6870  C  C   . ASP E  1 79  ? -29.518  27.393  -103.885 1.00 37.04  ? 60   ASP E C   1 
ATOM   6871  O  O   . ASP E  1 79  ? -30.682  27.412  -104.304 1.00 32.31  ? 60   ASP E O   1 
ATOM   6872  C  CB  . ASP E  1 79  ? -30.050  25.459  -102.372 1.00 46.81  ? 60   ASP E CB  1 
ATOM   6873  C  CG  . ASP E  1 79  ? -29.693  24.356  -103.360 1.00 53.52  ? 60   ASP E CG  1 
ATOM   6874  O  OD1 . ASP E  1 79  ? -29.088  24.657  -104.409 1.00 58.23  ? 60   ASP E OD1 1 
ATOM   6875  O  OD2 . ASP E  1 79  ? -30.009  23.175  -103.081 1.00 55.15  ? 60   ASP E OD2 1 
ATOM   6876  N  N   . ARG E  1 80  ? -28.483  27.923  -104.545 1.00 42.62  ? 61   ARG E N   1 
ATOM   6877  C  CA  . ARG E  1 80  ? -28.636  28.711  -105.779 1.00 54.33  ? 61   ARG E CA  1 
ATOM   6878  C  C   . ARG E  1 80  ? -29.246  27.915  -106.917 1.00 50.44  ? 61   ARG E C   1 
ATOM   6879  O  O   . ARG E  1 80  ? -29.952  28.478  -107.752 1.00 52.86  ? 61   ARG E O   1 
ATOM   6880  C  CB  . ARG E  1 80  ? -27.311  29.340  -106.229 1.00 63.90  ? 61   ARG E CB  1 
ATOM   6881  C  CG  . ARG E  1 80  ? -26.687  30.270  -105.190 1.00 78.13  ? 61   ARG E CG  1 
ATOM   6882  C  CD  . ARG E  1 80  ? -27.493  31.558  -104.953 1.00 87.57  ? 61   ARG E CD  1 
ATOM   6883  N  NE  . ARG E  1 80  ? -27.111  32.216  -103.697 1.00 93.65  ? 61   ARG E NE  1 
ATOM   6884  C  CZ  . ARG E  1 80  ? -26.040  32.993  -103.542 1.00 96.60  ? 61   ARG E CZ  1 
ATOM   6885  N  NH1 . ARG E  1 80  ? -25.224  33.224  -104.565 1.00 96.56  ? 61   ARG E NH1 1 
ATOM   6886  N  NH2 . ARG E  1 80  ? -25.784  33.538  -102.356 1.00 97.47  ? 61   ARG E NH2 1 
ATOM   6887  N  N   . THR E  1 81  ? -29.004  26.606  -106.922 1.00 45.17  ? 62   THR E N   1 
ATOM   6888  C  CA  . THR E  1 81  ? -29.570  25.723  -107.951 1.00 47.53  ? 62   THR E CA  1 
ATOM   6889  C  C   . THR E  1 81  ? -31.109  25.670  -107.952 1.00 49.07  ? 62   THR E C   1 
ATOM   6890  O  O   . THR E  1 81  ? -31.725  25.071  -108.850 1.00 56.44  ? 62   THR E O   1 
ATOM   6891  C  CB  . THR E  1 81  ? -29.010  24.284  -107.849 1.00 47.03  ? 62   THR E CB  1 
ATOM   6892  O  OG1 . THR E  1 81  ? -29.755  23.527  -106.880 1.00 42.92  ? 62   THR E OG1 1 
ATOM   6893  C  CG2 . THR E  1 81  ? -27.537  24.310  -107.469 1.00 48.47  ? 62   THR E CG2 1 
ATOM   6894  N  N   . LEU E  1 82  ? -31.721  26.290  -106.945 1.00 38.28  ? 63   LEU E N   1 
ATOM   6895  C  CA  . LEU E  1 82  ? -33.174  26.370  -106.868 1.00 34.53  ? 63   LEU E CA  1 
ATOM   6896  C  C   . LEU E  1 82  ? -33.692  27.734  -107.297 1.00 38.87  ? 63   LEU E C   1 
ATOM   6897  O  O   . LEU E  1 82  ? -34.905  27.921  -107.393 1.00 42.26  ? 63   LEU E O   1 
ATOM   6898  C  CB  . LEU E  1 82  ? -33.631  26.108  -105.450 1.00 33.49  ? 63   LEU E CB  1 
ATOM   6899  C  CG  . LEU E  1 82  ? -33.240  24.760  -104.863 1.00 35.30  ? 63   LEU E CG  1 
ATOM   6900  C  CD1 . LEU E  1 82  ? -33.553  24.757  -103.375 1.00 34.73  ? 63   LEU E CD1 1 
ATOM   6901  C  CD2 . LEU E  1 82  ? -34.007  23.646  -105.571 1.00 32.32  ? 63   LEU E CD2 1 
ATOM   6902  N  N   . ALA E  1 83  ? -32.779  28.679  -107.538 1.00 26.89  ? 64   ALA E N   1 
ATOM   6903  C  CA  . ALA E  1 83  ? -33.154  30.054  -107.866 1.00 34.44  ? 64   ALA E CA  1 
ATOM   6904  C  C   . ALA E  1 83  ? -33.917  30.165  -109.191 1.00 34.49  ? 64   ALA E C   1 
ATOM   6905  O  O   . ALA E  1 83  ? -33.764  29.323  -110.080 1.00 34.99  ? 64   ALA E O   1 
ATOM   6906  C  CB  . ALA E  1 83  ? -31.933  30.933  -107.893 1.00 27.28  ? 64   ALA E CB  1 
ATOM   6907  N  N   . TRP E  1 84  ? -34.745  31.197  -109.311 1.00 32.37  ? 65   TRP E N   1 
ATOM   6908  C  CA  . TRP E  1 84  ? -35.469  31.448  -110.545 1.00 36.73  ? 65   TRP E CA  1 
ATOM   6909  C  C   . TRP E  1 84  ? -35.698  32.948  -110.760 1.00 48.59  ? 65   TRP E C   1 
ATOM   6910  O  O   . TRP E  1 84  ? -35.591  33.738  -109.833 1.00 46.24  ? 65   TRP E O   1 
ATOM   6911  C  CB  . TRP E  1 84  ? -36.797  30.669  -110.583 1.00 35.94  ? 65   TRP E CB  1 
ATOM   6912  C  CG  . TRP E  1 84  ? -37.861  31.180  -109.644 1.00 34.02  ? 65   TRP E CG  1 
ATOM   6913  C  CD1 . TRP E  1 84  ? -38.756  32.183  -109.879 1.00 29.60  ? 65   TRP E CD1 1 
ATOM   6914  C  CD2 . TRP E  1 84  ? -38.139  30.692  -108.325 1.00 33.69  ? 65   TRP E CD2 1 
ATOM   6915  N  NE1 . TRP E  1 84  ? -39.567  32.363  -108.784 1.00 29.22  ? 65   TRP E NE1 1 
ATOM   6916  C  CE2 . TRP E  1 84  ? -39.207  31.465  -107.814 1.00 35.33  ? 65   TRP E CE2 1 
ATOM   6917  C  CE3 . TRP E  1 84  ? -37.575  29.700  -107.526 1.00 30.83  ? 65   TRP E CE3 1 
ATOM   6918  C  CZ2 . TRP E  1 84  ? -39.734  31.255  -106.526 1.00 31.89  ? 65   TRP E CZ2 1 
ATOM   6919  C  CZ3 . TRP E  1 84  ? -38.094  29.497  -106.250 1.00 34.30  ? 65   TRP E CZ3 1 
ATOM   6920  C  CH2 . TRP E  1 84  ? -39.167  30.270  -105.767 1.00 34.72  ? 65   TRP E CH2 1 
ATOM   6921  N  N   . ASN E  1 85  ? -35.996  33.322  -111.999 1.00 66.67  ? 66   ASN E N   1 
ATOM   6922  C  CA  . ASN E  1 85  ? -36.297  34.698  -112.351 1.00 80.99  ? 66   ASN E CA  1 
ATOM   6923  C  C   . ASN E  1 85  ? -37.710  35.062  -111.883 1.00 86.36  ? 66   ASN E C   1 
ATOM   6924  O  O   . ASN E  1 85  ? -38.701  34.614  -112.473 1.00 92.41  ? 66   ASN E O   1 
ATOM   6925  C  CB  . ASN E  1 85  ? -36.172  34.861  -113.866 1.00 90.46  ? 66   ASN E CB  1 
ATOM   6926  C  CG  . ASN E  1 85  ? -36.186  36.308  -114.305 1.00 102.21 ? 66   ASN E CG  1 
ATOM   6927  O  OD1 . ASN E  1 85  ? -36.644  37.188  -113.574 1.00 104.70 ? 66   ASN E OD1 1 
ATOM   6928  N  ND2 . ASN E  1 85  ? -35.689  36.564  -115.520 1.00 108.28 ? 66   ASN E ND2 1 
ATOM   6929  N  N   . SER E  1 86  ? -37.801  35.875  -110.830 1.00 82.94  ? 67   SER E N   1 
ATOM   6930  C  CA  . SER E  1 86  ? -39.086  36.187  -110.200 1.00 83.93  ? 67   SER E CA  1 
ATOM   6931  C  C   . SER E  1 86  ? -39.756  37.440  -110.754 1.00 90.99  ? 67   SER E C   1 
ATOM   6932  O  O   . SER E  1 86  ? -40.605  38.027  -110.071 1.00 93.64  ? 67   SER E O   1 
ATOM   6933  C  CB  . SER E  1 86  ? -38.917  36.367  -108.690 1.00 81.54  ? 67   SER E CB  1 
ATOM   6934  O  OG  . SER E  1 86  ? -38.429  37.662  -108.388 1.00 80.71  ? 67   SER E OG  1 
ATOM   6935  N  N   . SER E  1 87  ? -39.379  37.847  -111.966 1.00 92.62  ? 68   SER E N   1 
ATOM   6936  C  CA  . SER E  1 87  ? -39.931  39.059  -112.576 1.00 100.11 ? 68   SER E CA  1 
ATOM   6937  C  C   . SER E  1 87  ? -41.459  39.059  -112.604 1.00 98.00  ? 68   SER E C   1 
ATOM   6938  O  O   . SER E  1 87  ? -42.102  40.002  -112.133 1.00 96.76  ? 68   SER E O   1 
ATOM   6939  C  CB  . SER E  1 87  ? -39.385  39.240  -113.995 1.00 107.99 ? 68   SER E CB  1 
ATOM   6940  O  OG  . SER E  1 87  ? -39.462  38.021  -114.717 1.00 113.63 ? 68   SER E OG  1 
ATOM   6941  N  N   . HIS E  1 88  ? -42.031  37.993  -113.153 1.00 96.99  ? 69   HIS E N   1 
ATOM   6942  C  CA  . HIS E  1 88  ? -43.475  37.876  -113.248 1.00 98.31  ? 69   HIS E CA  1 
ATOM   6943  C  C   . HIS E  1 88  ? -43.900  36.543  -112.648 1.00 92.22  ? 69   HIS E C   1 
ATOM   6944  O  O   . HIS E  1 88  ? -44.780  35.857  -113.170 1.00 94.53  ? 69   HIS E O   1 
ATOM   6945  C  CB  . HIS E  1 88  ? -43.909  38.007  -114.703 1.00 106.79 ? 69   HIS E CB  1 
ATOM   6946  C  CG  . HIS E  1 88  ? -43.485  39.304  -115.346 1.00 113.21 ? 69   HIS E CG  1 
ATOM   6947  N  ND1 . HIS E  1 88  ? -42.386  39.423  -116.144 1.00 114.91 ? 69   HIS E ND1 1 
ATOM   6948  C  CD2 . HIS E  1 88  ? -43.982  40.552  -115.210 1.00 114.84 ? 69   HIS E CD2 1 
ATOM   6949  C  CE1 . HIS E  1 88  ? -42.273  40.690  -116.547 1.00 115.04 ? 69   HIS E CE1 1 
ATOM   6950  N  NE2 . HIS E  1 88  ? -43.268  41.369  -116.040 1.00 115.31 ? 69   HIS E NE2 1 
ATOM   6951  N  N   . SER E  1 89  ? -43.265  36.205  -111.528 1.00 83.01  ? 70   SER E N   1 
ATOM   6952  C  CA  . SER E  1 89  ? -43.414  34.912  -110.880 1.00 68.44  ? 70   SER E CA  1 
ATOM   6953  C  C   . SER E  1 89  ? -43.583  35.134  -109.389 1.00 64.73  ? 70   SER E C   1 
ATOM   6954  O  O   . SER E  1 89  ? -43.323  36.235  -108.893 1.00 67.75  ? 70   SER E O   1 
ATOM   6955  C  CB  . SER E  1 89  ? -42.158  34.073  -111.134 1.00 61.85  ? 70   SER E CB  1 
ATOM   6956  O  OG  . SER E  1 89  ? -41.879  33.941  -112.518 1.00 57.08  ? 70   SER E OG  1 
ATOM   6957  N  N   . PRO E  1 90  ? -44.024  34.095  -108.662 1.00 61.64  ? 71   PRO E N   1 
ATOM   6958  C  CA  . PRO E  1 90  ? -44.034  34.140  -107.190 1.00 57.53  ? 71   PRO E CA  1 
ATOM   6959  C  C   . PRO E  1 90  ? -42.626  34.322  -106.622 1.00 50.43  ? 71   PRO E C   1 
ATOM   6960  O  O   . PRO E  1 90  ? -41.662  33.901  -107.243 1.00 38.96  ? 71   PRO E O   1 
ATOM   6961  C  CB  . PRO E  1 90  ? -44.565  32.758  -106.804 1.00 62.50  ? 71   PRO E CB  1 
ATOM   6962  C  CG  . PRO E  1 90  ? -45.384  32.320  -107.984 1.00 65.76  ? 71   PRO E CG  1 
ATOM   6963  C  CD  . PRO E  1 90  ? -44.695  32.893  -109.191 1.00 64.05  ? 71   PRO E CD  1 
ATOM   6964  N  N   . ASP E  1 91  ? -42.513  34.932  -105.449 1.00 63.52  ? 72   ASP E N   1 
ATOM   6965  C  CA  . ASP E  1 91  ? -41.213  35.154  -104.820 1.00 74.08  ? 72   ASP E CA  1 
ATOM   6966  C  C   . ASP E  1 91  ? -40.820  33.948  -103.999 1.00 67.14  ? 72   ASP E C   1 
ATOM   6967  O  O   . ASP E  1 91  ? -39.653  33.790  -103.629 1.00 63.97  ? 72   ASP E O   1 
ATOM   6968  C  CB  . ASP E  1 91  ? -41.267  36.367  -103.889 1.00 89.78  ? 72   ASP E CB  1 
ATOM   6969  C  CG  . ASP E  1 91  ? -42.063  37.515  -104.472 1.00 105.27 ? 72   ASP E CG  1 
ATOM   6970  O  OD1 . ASP E  1 91  ? -41.968  37.727  -105.702 1.00 113.33 ? 72   ASP E OD1 1 
ATOM   6971  O  OD2 . ASP E  1 91  ? -42.789  38.195  -103.706 1.00 107.58 ? 72   ASP E OD2 1 
ATOM   6972  N  N   . GLN E  1 92  ? -41.810  33.101  -103.721 1.00 49.12  ? 73   GLN E N   1 
ATOM   6973  C  CA  . GLN E  1 92  ? -41.671  32.048  -102.727 1.00 45.17  ? 73   GLN E CA  1 
ATOM   6974  C  C   . GLN E  1 92  ? -42.611  30.882  -103.017 1.00 32.60  ? 73   GLN E C   1 
ATOM   6975  O  O   . GLN E  1 92  ? -43.755  31.083  -103.438 1.00 34.07  ? 73   GLN E O   1 
ATOM   6976  C  CB  . GLN E  1 92  ? -41.981  32.633  -101.341 1.00 52.08  ? 73   GLN E CB  1 
ATOM   6977  C  CG  . GLN E  1 92  ? -41.727  31.712  -100.170 1.00 58.24  ? 73   GLN E CG  1 
ATOM   6978  C  CD  . GLN E  1 92  ? -42.182  32.322  -98.857  1.00 63.02  ? 73   GLN E CD  1 
ATOM   6979  O  OE1 . GLN E  1 92  ? -43.376  32.315  -98.537  1.00 65.03  ? 73   GLN E OE1 1 
ATOM   6980  N  NE2 . GLN E  1 92  ? -41.234  32.860  -98.090  1.00 65.05  ? 73   GLN E NE2 1 
ATOM   6981  N  N   . VAL E  1 93  ? -42.130  29.669  -102.779 1.00 26.25  ? 74   VAL E N   1 
ATOM   6982  C  CA  . VAL E  1 93  ? -42.987  28.485  -102.813 1.00 28.23  ? 74   VAL E CA  1 
ATOM   6983  C  C   . VAL E  1 93  ? -42.769  27.591  -101.602 1.00 25.98  ? 74   VAL E C   1 
ATOM   6984  O  O   . VAL E  1 93  ? -41.747  27.703  -100.903 1.00 25.03  ? 74   VAL E O   1 
ATOM   6985  C  CB  . VAL E  1 93  ? -42.762  27.639  -104.087 1.00 34.72  ? 74   VAL E CB  1 
ATOM   6986  C  CG1 . VAL E  1 93  ? -43.257  28.381  -105.346 1.00 28.55  ? 74   VAL E CG1 1 
ATOM   6987  C  CG2 . VAL E  1 93  ? -41.294  27.232  -104.198 1.00 38.31  ? 74   VAL E CG2 1 
ATOM   6988  N  N   . SER E  1 94  ? -43.732  26.705  -101.358 1.00 24.91  ? 75   SER E N   1 
ATOM   6989  C  CA  . SER E  1 94  ? -43.577  25.679  -100.330 1.00 23.08  ? 75   SER E CA  1 
ATOM   6990  C  C   . SER E  1 94  ? -43.255  24.349  -100.976 1.00 28.77  ? 75   SER E C   1 
ATOM   6991  O  O   . SER E  1 94  ? -43.969  23.898  -101.866 1.00 38.36  ? 75   SER E O   1 
ATOM   6992  C  CB  . SER E  1 94  ? -44.824  25.571  -99.489  1.00 20.82  ? 75   SER E CB  1 
ATOM   6993  O  OG  . SER E  1 94  ? -44.951  26.742  -98.709  1.00 31.33  ? 75   SER E OG  1 
ATOM   6994  N  N   . VAL E  1 95  ? -42.161  23.737  -100.544 1.00 29.17  ? 76   VAL E N   1 
ATOM   6995  C  CA  . VAL E  1 95  ? -41.661  22.514  -101.167 1.00 31.32  ? 76   VAL E CA  1 
ATOM   6996  C  C   . VAL E  1 95  ? -41.487  21.424  -100.116 1.00 29.65  ? 76   VAL E C   1 
ATOM   6997  O  O   . VAL E  1 95  ? -40.925  21.683  -99.054  1.00 29.95  ? 76   VAL E O   1 
ATOM   6998  C  CB  . VAL E  1 95  ? -40.299  22.771  -101.827 1.00 30.58  ? 76   VAL E CB  1 
ATOM   6999  C  CG1 . VAL E  1 95  ? -39.807  21.534  -102.557 1.00 30.67  ? 76   VAL E CG1 1 
ATOM   7000  C  CG2 . VAL E  1 95  ? -40.392  23.971  -102.763 1.00 28.88  ? 76   VAL E CG2 1 
ATOM   7001  N  N   . PRO E  1 96  ? -41.970  20.203  -100.412 1.00 24.69  ? 77   PRO E N   1 
ATOM   7002  C  CA  . PRO E  1 96  ? -41.696  19.044  -99.551  1.00 22.23  ? 77   PRO E CA  1 
ATOM   7003  C  C   . PRO E  1 96  ? -40.187  18.874  -99.369  1.00 29.03  ? 77   PRO E C   1 
ATOM   7004  O  O   . PRO E  1 96  ? -39.448  18.908  -100.345 1.00 33.36  ? 77   PRO E O   1 
ATOM   7005  C  CB  . PRO E  1 96  ? -42.261  17.869  -100.361 1.00 10.72  ? 77   PRO E CB  1 
ATOM   7006  C  CG  . PRO E  1 96  ? -43.315  18.480  -101.207 1.00 23.36  ? 77   PRO E CG  1 
ATOM   7007  C  CD  . PRO E  1 96  ? -42.794  19.848  -101.584 1.00 21.22  ? 77   PRO E CD  1 
ATOM   7008  N  N   . ILE E  1 97  ? -39.725  18.686  -98.138  1.00 33.18  ? 78   ILE E N   1 
ATOM   7009  C  CA  . ILE E  1 97  ? -38.283  18.572  -97.915  1.00 33.88  ? 78   ILE E CA  1 
ATOM   7010  C  C   . ILE E  1 97  ? -37.679  17.352  -98.598  1.00 32.00  ? 78   ILE E C   1 
ATOM   7011  O  O   . ILE E  1 97  ? -36.474  17.310  -98.863  1.00 38.35  ? 78   ILE E O   1 
ATOM   7012  C  CB  . ILE E  1 97  ? -37.914  18.578  -96.426  1.00 32.84  ? 78   ILE E CB  1 
ATOM   7013  C  CG1 . ILE E  1 97  ? -38.590  17.406  -95.708  1.00 29.23  ? 78   ILE E CG1 1 
ATOM   7014  C  CG2 . ILE E  1 97  ? -38.288  19.925  -95.783  1.00 35.00  ? 78   ILE E CG2 1 
ATOM   7015  C  CD1 . ILE E  1 97  ? -38.036  17.086  -94.303  1.00 15.91  ? 78   ILE E CD1 1 
ATOM   7016  N  N   . SER E  1 98  ? -38.515  16.365  -98.898  1.00 26.08  ? 79   SER E N   1 
ATOM   7017  C  CA  . SER E  1 98  ? -38.032  15.193  -99.622  1.00 27.19  ? 79   SER E CA  1 
ATOM   7018  C  C   . SER E  1 98  ? -37.545  15.547  -101.037 1.00 31.37  ? 79   SER E C   1 
ATOM   7019  O  O   . SER E  1 98  ? -36.793  14.784  -101.643 1.00 36.99  ? 79   SER E O   1 
ATOM   7020  C  CB  . SER E  1 98  ? -39.088  14.093  -99.653  1.00 28.48  ? 79   SER E CB  1 
ATOM   7021  O  OG  . SER E  1 98  ? -40.327  14.579  -100.122 1.00 37.63  ? 79   SER E OG  1 
ATOM   7022  N  N   . SER E  1 99  ? -37.961  16.709  -101.544 1.00 30.58  ? 80   SER E N   1 
ATOM   7023  C  CA  . SER E  1 99  ? -37.540  17.199  -102.864 1.00 25.77  ? 80   SER E CA  1 
ATOM   7024  C  C   . SER E  1 99  ? -36.387  18.189  -102.789 1.00 30.72  ? 80   SER E C   1 
ATOM   7025  O  O   . SER E  1 99  ? -36.045  18.785  -103.787 1.00 35.62  ? 80   SER E O   1 
ATOM   7026  C  CB  . SER E  1 99  ? -38.706  17.885  -103.586 1.00 23.62  ? 80   SER E CB  1 
ATOM   7027  O  OG  . SER E  1 99  ? -39.771  16.981  -103.821 1.00 31.30  ? 80   SER E OG  1 
ATOM   7028  N  N   . LEU E  1 100 ? -35.808  18.388  -101.611 1.00 34.87  ? 81   LEU E N   1 
ATOM   7029  C  CA  . LEU E  1 100 ? -34.752  19.383  -101.443 1.00 32.71  ? 81   LEU E CA  1 
ATOM   7030  C  C   . LEU E  1 100 ? -33.609  18.786  -100.675 1.00 28.67  ? 81   LEU E C   1 
ATOM   7031  O  O   . LEU E  1 100 ? -33.804  17.878  -99.877  1.00 34.35  ? 81   LEU E O   1 
ATOM   7032  C  CB  . LEU E  1 100 ? -35.238  20.552  -100.600 1.00 35.22  ? 81   LEU E CB  1 
ATOM   7033  C  CG  . LEU E  1 100 ? -36.318  21.455  -101.142 1.00 34.39  ? 81   LEU E CG  1 
ATOM   7034  C  CD1 . LEU E  1 100 ? -36.688  22.458  -100.077 1.00 26.64  ? 81   LEU E CD1 1 
ATOM   7035  C  CD2 . LEU E  1 100 ? -35.784  22.157  -102.340 1.00 41.92  ? 81   LEU E CD2 1 
ATOM   7036  N  N   . TRP E  1 101 ? -32.420  19.329  -100.872 1.00 20.49  ? 82   TRP E N   1 
ATOM   7037  C  CA  . TRP E  1 101 ? -31.337  18.987  -99.987  1.00 19.94  ? 82   TRP E CA  1 
ATOM   7038  C  C   . TRP E  1 101 ? -31.545  19.726  -98.666  1.00 24.66  ? 82   TRP E C   1 
ATOM   7039  O  O   . TRP E  1 101 ? -31.919  20.902  -98.631  1.00 26.60  ? 82   TRP E O   1 
ATOM   7040  C  CB  . TRP E  1 101 ? -29.986  19.343  -100.577 1.00 17.77  ? 82   TRP E CB  1 
ATOM   7041  C  CG  . TRP E  1 101 ? -28.871  19.122  -99.585  1.00 23.50  ? 82   TRP E CG  1 
ATOM   7042  C  CD1 . TRP E  1 101 ? -28.119  17.992  -99.449  1.00 24.18  ? 82   TRP E CD1 1 
ATOM   7043  C  CD2 . TRP E  1 101 ? -28.392  20.053  -98.581  1.00 17.06  ? 82   TRP E CD2 1 
ATOM   7044  N  NE1 . TRP E  1 101 ? -27.205  18.164  -98.442  1.00 19.79  ? 82   TRP E NE1 1 
ATOM   7045  C  CE2 . TRP E  1 101 ? -27.339  19.403  -97.909  1.00 16.69  ? 82   TRP E CE2 1 
ATOM   7046  C  CE3 . TRP E  1 101 ? -28.744  21.353  -98.221  1.00 23.33  ? 82   TRP E CE3 1 
ATOM   7047  C  CZ2 . TRP E  1 101 ? -26.635  20.028  -96.861  1.00 22.93  ? 82   TRP E CZ2 1 
ATOM   7048  C  CZ3 . TRP E  1 101 ? -28.036  21.974  -97.196  1.00 23.31  ? 82   TRP E CZ3 1 
ATOM   7049  C  CH2 . TRP E  1 101 ? -26.996  21.307  -96.525  1.00 25.87  ? 82   TRP E CH2 1 
ATOM   7050  N  N   . VAL E  1 102 ? -31.296  19.011  -97.584  1.00 21.33  ? 83   VAL E N   1 
ATOM   7051  C  CA  . VAL E  1 102 ? -31.526  19.509  -96.243  1.00 21.84  ? 83   VAL E CA  1 
ATOM   7052  C  C   . VAL E  1 102 ? -30.282  19.228  -95.374  1.00 25.24  ? 83   VAL E C   1 
ATOM   7053  O  O   . VAL E  1 102 ? -29.717  18.127  -95.400  1.00 17.01  ? 83   VAL E O   1 
ATOM   7054  C  CB  . VAL E  1 102 ? -32.805  18.878  -95.613  1.00 21.18  ? 83   VAL E CB  1 
ATOM   7055  C  CG1 . VAL E  1 102 ? -32.787  19.057  -94.124  1.00 35.11  ? 83   VAL E CG1 1 
ATOM   7056  C  CG2 . VAL E  1 102 ? -34.061  19.519  -96.173  1.00 18.55  ? 83   VAL E CG2 1 
ATOM   7057  N  N   . PRO E  1 103 ? -29.832  20.230  -94.618  1.00 12.72  ? 84   PRO E N   1 
ATOM   7058  C  CA  . PRO E  1 103 ? -28.690  19.987  -93.736  1.00 22.20  ? 84   PRO E CA  1 
ATOM   7059  C  C   . PRO E  1 103 ? -28.956  18.818  -92.742  1.00 21.12  ? 84   PRO E C   1 
ATOM   7060  O  O   . PRO E  1 103 ? -30.068  18.709  -92.204  1.00 15.94  ? 84   PRO E O   1 
ATOM   7061  C  CB  . PRO E  1 103 ? -28.518  21.331  -93.003  1.00 17.71  ? 84   PRO E CB  1 
ATOM   7062  C  CG  . PRO E  1 103 ? -29.779  22.075  -93.225  1.00 22.07  ? 84   PRO E CG  1 
ATOM   7063  C  CD  . PRO E  1 103 ? -30.326  21.605  -94.542  1.00 25.29  ? 84   PRO E CD  1 
ATOM   7064  N  N   . ASP E  1 104 ? -27.963  17.948  -92.526  1.00 18.53  ? 85   ASP E N   1 
ATOM   7065  C  CA  . ASP E  1 104 ? -28.142  16.783  -91.639  1.00 17.50  ? 85   ASP E CA  1 
ATOM   7066  C  C   . ASP E  1 104 ? -27.911  17.146  -90.181  1.00 20.40  ? 85   ASP E C   1 
ATOM   7067  O  O   . ASP E  1 104 ? -27.057  16.563  -89.514  1.00 17.43  ? 85   ASP E O   1 
ATOM   7068  C  CB  . ASP E  1 104 ? -27.213  15.620  -92.029  1.00 15.87  ? 85   ASP E CB  1 
ATOM   7069  C  CG  . ASP E  1 104 ? -25.725  16.004  -92.023  1.00 23.72  ? 85   ASP E CG  1 
ATOM   7070  O  OD1 . ASP E  1 104 ? -25.391  17.227  -92.023  1.00 16.94  ? 85   ASP E OD1 1 
ATOM   7071  O  OD2 . ASP E  1 104 ? -24.888  15.054  -92.031  1.00 32.41  ? 85   ASP E OD2 1 
ATOM   7072  N  N   . LEU E  1 105 ? -28.670  18.114  -89.688  1.00 24.66  ? 86   LEU E N   1 
ATOM   7073  C  CA  . LEU E  1 105 ? -28.510  18.581  -88.312  1.00 32.37  ? 86   LEU E CA  1 
ATOM   7074  C  C   . LEU E  1 105 ? -28.964  17.510  -87.308  1.00 33.83  ? 86   LEU E C   1 
ATOM   7075  O  O   . LEU E  1 105 ? -29.926  16.777  -87.547  1.00 32.51  ? 86   LEU E O   1 
ATOM   7076  C  CB  . LEU E  1 105 ? -29.287  19.886  -88.078  1.00 13.94  ? 86   LEU E CB  1 
ATOM   7077  C  CG  . LEU E  1 105 ? -28.843  21.077  -88.916  1.00 17.47  ? 86   LEU E CG  1 
ATOM   7078  C  CD1 . LEU E  1 105 ? -29.574  22.333  -88.467  1.00 17.45  ? 86   LEU E CD1 1 
ATOM   7079  C  CD2 . LEU E  1 105 ? -27.321  21.274  -88.882  1.00 14.11  ? 86   LEU E CD2 1 
ATOM   7080  N  N   . ALA E  1 106 ? -28.258  17.417  -86.185  1.00 30.97  ? 87   ALA E N   1 
ATOM   7081  C  CA  . ALA E  1 106 ? -28.649  16.496  -85.130  1.00 26.05  ? 87   ALA E CA  1 
ATOM   7082  C  C   . ALA E  1 106 ? -28.359  17.135  -83.787  1.00 29.70  ? 87   ALA E C   1 
ATOM   7083  O  O   . ALA E  1 106 ? -27.389  17.886  -83.639  1.00 30.22  ? 87   ALA E O   1 
ATOM   7084  C  CB  . ALA E  1 106 ? -27.910  15.153  -85.269  1.00 20.18  ? 87   ALA E CB  1 
ATOM   7085  N  N   . ALA E  1 107 ? -29.211  16.845  -82.809  1.00 31.70  ? 88   ALA E N   1 
ATOM   7086  C  CA  . ALA E  1 107 ? -28.959  17.246  -81.423  1.00 25.69  ? 88   ALA E CA  1 
ATOM   7087  C  C   . ALA E  1 107 ? -28.098  16.165  -80.796  1.00 22.48  ? 88   ALA E C   1 
ATOM   7088  O  O   . ALA E  1 107 ? -28.537  15.014  -80.683  1.00 23.38  ? 88   ALA E O   1 
ATOM   7089  C  CB  . ALA E  1 107 ? -30.278  17.398  -80.657  1.00 17.70  ? 88   ALA E CB  1 
ATOM   7090  N  N   . TYR E  1 108 ? -26.877  16.529  -80.403  1.00 21.48  ? 89   TYR E N   1 
ATOM   7091  C  CA  . TYR E  1 108 ? -25.902  15.552  -79.895  1.00 19.55  ? 89   TYR E CA  1 
ATOM   7092  C  C   . TYR E  1 108 ? -26.343  14.910  -78.606  1.00 22.79  ? 89   TYR E C   1 
ATOM   7093  O  O   . TYR E  1 108 ? -26.037  13.748  -78.358  1.00 25.14  ? 89   TYR E O   1 
ATOM   7094  C  CB  . TYR E  1 108 ? -24.540  16.210  -79.694  1.00 18.14  ? 89   TYR E CB  1 
ATOM   7095  C  CG  . TYR E  1 108 ? -23.770  16.332  -80.968  1.00 17.65  ? 89   TYR E CG  1 
ATOM   7096  C  CD1 . TYR E  1 108 ? -24.188  17.213  -81.974  1.00 16.57  ? 89   TYR E CD1 1 
ATOM   7097  C  CD2 . TYR E  1 108 ? -22.646  15.550  -81.200  1.00 22.46  ? 89   TYR E CD2 1 
ATOM   7098  C  CE1 . TYR E  1 108 ? -23.489  17.335  -83.165  1.00 19.27  ? 89   TYR E CE1 1 
ATOM   7099  C  CE2 . TYR E  1 108 ? -21.934  15.653  -82.409  1.00 28.10  ? 89   TYR E CE2 1 
ATOM   7100  C  CZ  . TYR E  1 108 ? -22.365  16.552  -83.383  1.00 27.89  ? 89   TYR E CZ  1 
ATOM   7101  O  OH  . TYR E  1 108 ? -21.683  16.678  -84.577  1.00 30.83  ? 89   TYR E OH  1 
ATOM   7102  N  N   . ASN E  1 109 ? -27.050  15.682  -77.781  1.00 24.51  ? 90   ASN E N   1 
ATOM   7103  C  CA  . ASN E  1 109 ? -27.491  15.211  -76.461  1.00 29.75  ? 90   ASN E CA  1 
ATOM   7104  C  C   . ASN E  1 109 ? -28.988  14.856  -76.425  1.00 32.37  ? 90   ASN E C   1 
ATOM   7105  O  O   . ASN E  1 109 ? -29.604  14.751  -75.353  1.00 34.36  ? 90   ASN E O   1 
ATOM   7106  C  CB  . ASN E  1 109 ? -27.140  16.221  -75.361  1.00 16.36  ? 90   ASN E CB  1 
ATOM   7107  C  CG  . ASN E  1 109 ? -27.713  17.585  -75.619  1.00 27.86  ? 90   ASN E CG  1 
ATOM   7108  O  OD1 . ASN E  1 109 ? -27.688  18.088  -76.754  1.00 33.57  ? 90   ASN E OD1 1 
ATOM   7109  N  ND2 . ASN E  1 109 ? -28.254  18.198  -74.572  1.00 27.04  ? 90   ASN E ND2 1 
ATOM   7110  N  N   . ALA E  1 110 ? -29.566  14.672  -77.609  1.00 28.10  ? 91   ALA E N   1 
ATOM   7111  C  CA  . ALA E  1 110 ? -30.918  14.152  -77.709  1.00 27.23  ? 91   ALA E CA  1 
ATOM   7112  C  C   . ALA E  1 110 ? -30.856  12.665  -77.332  1.00 27.41  ? 91   ALA E C   1 
ATOM   7113  O  O   . ALA E  1 110 ? -29.857  11.992  -77.623  1.00 22.25  ? 91   ALA E O   1 
ATOM   7114  C  CB  . ALA E  1 110 ? -31.443  14.331  -79.098  1.00 30.02  ? 91   ALA E CB  1 
ATOM   7115  N  N   . ILE E  1 111 ? -31.889  12.181  -76.636  1.00 29.93  ? 92   ILE E N   1 
ATOM   7116  C  CA  . ILE E  1 111 ? -31.981  10.773  -76.238  1.00 29.15  ? 92   ILE E CA  1 
ATOM   7117  C  C   . ILE E  1 111 ? -33.264  10.127  -76.778  1.00 26.67  ? 92   ILE E C   1 
ATOM   7118  O  O   . ILE E  1 111 ? -33.588  8.997   -76.440  1.00 32.47  ? 92   ILE E O   1 
ATOM   7119  C  CB  . ILE E  1 111 ? -31.911  10.593  -74.703  1.00 27.88  ? 92   ILE E CB  1 
ATOM   7120  C  CG1 . ILE E  1 111 ? -33.071  11.311  -74.029  1.00 24.50  ? 92   ILE E CG1 1 
ATOM   7121  C  CG2 . ILE E  1 111 ? -30.594  11.111  -74.157  1.00 29.92  ? 92   ILE E CG2 1 
ATOM   7122  C  CD1 . ILE E  1 111 ? -33.127  11.071  -72.557  1.00 25.57  ? 92   ILE E CD1 1 
ATOM   7123  N  N   . SER E  1 112 ? -34.003  10.871  -77.595  1.00 17.86  ? 93   SER E N   1 
ATOM   7124  C  CA  . SER E  1 112 ? -35.093  10.308  -78.374  1.00 21.42  ? 93   SER E CA  1 
ATOM   7125  C  C   . SER E  1 112 ? -34.947  10.853  -79.784  1.00 27.84  ? 93   SER E C   1 
ATOM   7126  O  O   . SER E  1 112 ? -34.389  11.949  -79.973  1.00 25.63  ? 93   SER E O   1 
ATOM   7127  C  CB  . SER E  1 112 ? -36.426  10.732  -77.792  1.00 22.31  ? 93   SER E CB  1 
ATOM   7128  O  OG  . SER E  1 112 ? -36.649  12.105  -78.054  1.00 26.48  ? 93   SER E OG  1 
ATOM   7129  N  N   . LYS E  1 113 ? -35.423  10.120  -80.790  1.00 29.56  ? 94   LYS E N   1 
ATOM   7130  C  CA  . LYS E  1 113 ? -35.334  10.684  -82.144  1.00 30.60  ? 94   LYS E CA  1 
ATOM   7131  C  C   . LYS E  1 113 ? -36.347  11.809  -82.198  1.00 22.45  ? 94   LYS E C   1 
ATOM   7132  O  O   . LYS E  1 113 ? -37.282  11.825  -81.399  1.00 29.35  ? 94   LYS E O   1 
ATOM   7133  C  CB  . LYS E  1 113 ? -35.519  9.642   -83.267  1.00 33.04  ? 94   LYS E CB  1 
ATOM   7134  C  CG  . LYS E  1 113 ? -36.923  9.137   -83.477  1.00 35.92  ? 94   LYS E CG  1 
ATOM   7135  C  CD  . LYS E  1 113 ? -36.889  8.000   -84.470  1.00 41.77  ? 94   LYS E CD  1 
ATOM   7136  C  CE  . LYS E  1 113 ? -36.211  8.422   -85.770  1.00 48.87  ? 94   LYS E CE  1 
ATOM   7137  N  NZ  . LYS E  1 113 ? -35.860  7.244   -86.623  1.00 51.75  ? 94   LYS E NZ  1 
ATOM   7138  N  N   . PRO E  1 114 ? -36.116  12.800  -83.075  1.00 15.62  ? 95   PRO E N   1 
ATOM   7139  C  CA  . PRO E  1 114 ? -37.007  13.964  -83.163  1.00 13.85  ? 95   PRO E CA  1 
ATOM   7140  C  C   . PRO E  1 114 ? -38.390  13.626  -83.677  1.00 16.81  ? 95   PRO E C   1 
ATOM   7141  O  O   . PRO E  1 114 ? -38.516  13.063  -84.750  1.00 28.48  ? 95   PRO E O   1 
ATOM   7142  C  CB  . PRO E  1 114 ? -36.280  14.898  -84.144  1.00 13.76  ? 95   PRO E CB  1 
ATOM   7143  C  CG  . PRO E  1 114 ? -35.301  14.082  -84.802  1.00 13.63  ? 95   PRO E CG  1 
ATOM   7144  C  CD  . PRO E  1 114 ? -34.894  13.008  -83.873  1.00 13.77  ? 95   PRO E CD  1 
ATOM   7145  N  N   . GLU E  1 115 ? -39.415  13.963  -82.903  1.00 19.57  ? 96   GLU E N   1 
ATOM   7146  C  CA  . GLU E  1 115 ? -40.792  13.815  -83.343  1.00 20.98  ? 96   GLU E CA  1 
ATOM   7147  C  C   . GLU E  1 115 ? -41.206  15.124  -84.032  1.00 30.50  ? 96   GLU E C   1 
ATOM   7148  O  O   . GLU E  1 115 ? -41.402  16.161  -83.370  1.00 35.30  ? 96   GLU E O   1 
ATOM   7149  C  CB  . GLU E  1 115 ? -41.691  13.496  -82.160  1.00 21.89  ? 96   GLU E CB  1 
ATOM   7150  C  CG  . GLU E  1 115 ? -43.136  13.105  -82.486  1.00 38.57  ? 96   GLU E CG  1 
ATOM   7151  C  CD  . GLU E  1 115 ? -43.997  12.892  -81.225  1.00 50.14  ? 96   GLU E CD  1 
ATOM   7152  O  OE1 . GLU E  1 115 ? -43.448  12.975  -80.098  1.00 53.57  ? 96   GLU E OE1 1 
ATOM   7153  O  OE2 . GLU E  1 115 ? -45.223  12.644  -81.361  1.00 52.55  ? 96   GLU E OE2 1 
ATOM   7154  N  N   . VAL E  1 116 ? -41.303  15.083  -85.363  1.00 28.54  ? 97   VAL E N   1 
ATOM   7155  C  CA  . VAL E  1 116 ? -41.709  16.266  -86.127  1.00 27.84  ? 97   VAL E CA  1 
ATOM   7156  C  C   . VAL E  1 116 ? -43.215  16.355  -86.073  1.00 22.88  ? 97   VAL E C   1 
ATOM   7157  O  O   . VAL E  1 116 ? -43.913  15.426  -86.493  1.00 20.94  ? 97   VAL E O   1 
ATOM   7158  C  CB  . VAL E  1 116 ? -41.209  16.203  -87.606  1.00 24.58  ? 97   VAL E CB  1 
ATOM   7159  C  CG1 . VAL E  1 116 ? -41.593  17.459  -88.382  1.00 17.61  ? 97   VAL E CG1 1 
ATOM   7160  C  CG2 . VAL E  1 116 ? -39.696  16.005  -87.646  1.00 21.29  ? 97   VAL E CG2 1 
ATOM   7161  N  N   . LEU E  1 117 ? -43.708  17.474  -85.545  1.00 24.43  ? 98   LEU E N   1 
ATOM   7162  C  CA  . LEU E  1 117 ? -45.144  17.661  -85.288  1.00 25.37  ? 98   LEU E CA  1 
ATOM   7163  C  C   . LEU E  1 117 ? -45.882  18.331  -86.466  1.00 32.67  ? 98   LEU E C   1 
ATOM   7164  O  O   . LEU E  1 117 ? -47.107  18.314  -86.551  1.00 29.07  ? 98   LEU E O   1 
ATOM   7165  C  CB  . LEU E  1 117 ? -45.315  18.511  -84.047  1.00 24.02  ? 98   LEU E CB  1 
ATOM   7166  C  CG  . LEU E  1 117 ? -44.649  18.039  -82.739  1.00 25.04  ? 98   LEU E CG  1 
ATOM   7167  C  CD1 . LEU E  1 117 ? -44.860  19.067  -81.609  1.00 14.25  ? 98   LEU E CD1 1 
ATOM   7168  C  CD2 . LEU E  1 117 ? -45.157  16.662  -82.317  1.00 20.61  ? 98   LEU E CD2 1 
ATOM   7169  N  N   . THR E  1 118 ? -45.120  18.913  -87.382  1.00 32.26  ? 99   THR E N   1 
ATOM   7170  C  CA  . THR E  1 118 ? -45.693  19.783  -88.401  1.00 28.80  ? 99   THR E CA  1 
ATOM   7171  C  C   . THR E  1 118 ? -45.467  19.224  -89.804  1.00 30.36  ? 99   THR E C   1 
ATOM   7172  O  O   . THR E  1 118 ? -44.585  18.383  -89.997  1.00 28.67  ? 99   THR E O   1 
ATOM   7173  C  CB  . THR E  1 118 ? -45.082  21.200  -88.260  1.00 28.48  ? 99   THR E CB  1 
ATOM   7174  O  OG1 . THR E  1 118 ? -43.672  21.088  -88.031  1.00 21.54  ? 99   THR E OG1 1 
ATOM   7175  C  CG2 . THR E  1 118 ? -45.689  21.908  -87.063  1.00 28.24  ? 99   THR E CG2 1 
ATOM   7176  N  N   . PRO E  1 119 ? -46.277  19.670  -90.784  1.00 33.83  ? 100  PRO E N   1 
ATOM   7177  C  CA  . PRO E  1 119 ? -46.073  19.302  -92.203  1.00 29.86  ? 100  PRO E CA  1 
ATOM   7178  C  C   . PRO E  1 119 ? -44.644  19.585  -92.663  1.00 12.22  ? 100  PRO E C   1 
ATOM   7179  O  O   . PRO E  1 119 ? -44.154  20.688  -92.461  1.00 16.53  ? 100  PRO E O   1 
ATOM   7180  C  CB  . PRO E  1 119 ? -47.029  20.227  -92.946  1.00 26.98  ? 100  PRO E CB  1 
ATOM   7181  C  CG  . PRO E  1 119 ? -48.155  20.457  -91.956  1.00 31.66  ? 100  PRO E CG  1 
ATOM   7182  C  CD  . PRO E  1 119 ? -47.477  20.513  -90.596  1.00 35.14  ? 100  PRO E CD  1 
ATOM   7183  N  N   . GLN E  1 120 ? -43.980  18.596  -93.251  1.00 12.03  ? 101  GLN E N   1 
ATOM   7184  C  CA  . GLN E  1 120 ? -42.568  18.740  -93.594  1.00 25.99  ? 101  GLN E CA  1 
ATOM   7185  C  C   . GLN E  1 120 ? -42.359  19.476  -94.929  1.00 33.33  ? 101  GLN E C   1 
ATOM   7186  O  O   . GLN E  1 120 ? -41.946  18.882  -95.945  1.00 36.79  ? 101  GLN E O   1 
ATOM   7187  C  CB  . GLN E  1 120 ? -41.879  17.372  -93.554  1.00 24.26  ? 101  GLN E CB  1 
ATOM   7188  C  CG  . GLN E  1 120 ? -42.059  16.715  -92.187  1.00 29.02  ? 101  GLN E CG  1 
ATOM   7189  C  CD  . GLN E  1 120 ? -41.369  15.394  -92.025  1.00 28.10  ? 101  GLN E CD  1 
ATOM   7190  O  OE1 . GLN E  1 120 ? -40.302  15.159  -92.573  1.00 36.78  ? 101  GLN E OE1 1 
ATOM   7191  N  NE2 . GLN E  1 120 ? -41.973  14.520  -91.244  1.00 29.37  ? 101  GLN E NE2 1 
ATOM   7192  N  N   . LEU E  1 121 ? -42.663  20.778  -94.898  1.00 26.23  ? 102  LEU E N   1 
ATOM   7193  C  CA  . LEU E  1 121 ? -42.514  21.654  -96.041  1.00 20.54  ? 102  LEU E CA  1 
ATOM   7194  C  C   . LEU E  1 121 ? -41.515  22.757  -95.733  1.00 26.72  ? 102  LEU E C   1 
ATOM   7195  O  O   . LEU E  1 121 ? -41.420  23.218  -94.593  1.00 22.66  ? 102  LEU E O   1 
ATOM   7196  C  CB  . LEU E  1 121 ? -43.849  22.272  -96.416  1.00 20.50  ? 102  LEU E CB  1 
ATOM   7197  C  CG  . LEU E  1 121 ? -44.965  21.308  -96.820  1.00 20.55  ? 102  LEU E CG  1 
ATOM   7198  C  CD1 . LEU E  1 121 ? -46.248  22.081  -96.951  1.00 11.72  ? 102  LEU E CD1 1 
ATOM   7199  C  CD2 . LEU E  1 121 ? -44.626  20.650  -98.140  1.00 25.90  ? 102  LEU E CD2 1 
ATOM   7200  N  N   . ALA E  1 122 ? -40.775  23.176  -96.759  1.00 30.82  ? 103  ALA E N   1 
ATOM   7201  C  CA  . ALA E  1 122 ? -39.814  24.253  -96.609  1.00 31.19  ? 103  ALA E CA  1 
ATOM   7202  C  C   . ALA E  1 122 ? -40.195  25.431  -97.495  1.00 30.61  ? 103  ALA E C   1 
ATOM   7203  O  O   . ALA E  1 122 ? -40.959  25.291  -98.447  1.00 38.35  ? 103  ALA E O   1 
ATOM   7204  C  CB  . ALA E  1 122 ? -38.396  23.767  -96.923  1.00 12.17  ? 103  ALA E CB  1 
ATOM   7205  N  N   . HIS E  1 123 ? -39.673  26.600  -97.155  1.00 27.16  ? 104  HIS E N   1 
ATOM   7206  C  CA  A HIS E  1 123 ? -39.781  27.765  -98.009  0.50 29.68  ? 104  HIS E CA  1 
ATOM   7207  C  CA  B HIS E  1 123 ? -39.801  27.756  -98.017  0.50 29.67  ? 104  HIS E CA  1 
ATOM   7208  C  C   . HIS E  1 123 ? -38.611  27.817  -98.971  1.00 32.37  ? 104  HIS E C   1 
ATOM   7209  O  O   . HIS E  1 123 ? -37.465  27.675  -98.560  1.00 33.52  ? 104  HIS E O   1 
ATOM   7210  C  CB  A HIS E  1 123 ? -39.773  29.035  -97.167  0.50 29.87  ? 104  HIS E CB  1 
ATOM   7211  C  CB  B HIS E  1 123 ? -39.880  29.042  -97.196  0.50 30.02  ? 104  HIS E CB  1 
ATOM   7212  C  CG  A HIS E  1 123 ? -41.136  29.412  -96.694  0.50 31.61  ? 104  HIS E CG  1 
ATOM   7213  C  CG  B HIS E  1 123 ? -41.260  29.374  -96.718  0.50 31.47  ? 104  HIS E CG  1 
ATOM   7214  N  ND1 A HIS E  1 123 ? -42.267  28.845  -97.173  0.50 30.07  ? 104  HIS E ND1 1 
ATOM   7215  N  ND1 B HIS E  1 123 ? -41.508  30.367  -95.793  0.50 32.03  ? 104  HIS E ND1 1 
ATOM   7216  C  CD2 A HIS E  1 123 ? -41.524  30.336  -95.749  0.50 31.95  ? 104  HIS E CD2 1 
ATOM   7217  C  CD2 B HIS E  1 123 ? -42.468  28.850  -97.041  0.50 30.26  ? 104  HIS E CD2 1 
ATOM   7218  C  CE1 A HIS E  1 123 ? -43.328  29.386  -96.576  0.50 30.80  ? 104  HIS E CE1 1 
ATOM   7219  C  CE1 B HIS E  1 123 ? -42.809  30.443  -95.570  0.50 31.99  ? 104  HIS E CE1 1 
ATOM   7220  N  NE2 A HIS E  1 123 ? -42.892  30.279  -95.715  0.50 31.80  ? 104  HIS E NE2 1 
ATOM   7221  N  NE2 B HIS E  1 123 ? -43.414  29.533  -96.312  0.50 30.49  ? 104  HIS E NE2 1 
ATOM   7222  N  N   . VAL E  1 124 ? -38.895  28.016  -100.254 1.00 33.25  ? 105  VAL E N   1 
ATOM   7223  C  CA  . VAL E  1 124 ? -37.825  28.325  -101.194 1.00 29.74  ? 105  VAL E CA  1 
ATOM   7224  C  C   . VAL E  1 124 ? -38.150  29.680  -101.778 1.00 30.39  ? 105  VAL E C   1 
ATOM   7225  O  O   . VAL E  1 124 ? -39.235  29.892  -102.325 1.00 36.98  ? 105  VAL E O   1 
ATOM   7226  C  CB  . VAL E  1 124 ? -37.670  27.287  -102.306 1.00 30.18  ? 105  VAL E CB  1 
ATOM   7227  C  CG1 . VAL E  1 124 ? -36.482  27.659  -103.181 1.00 27.43  ? 105  VAL E CG1 1 
ATOM   7228  C  CG2 . VAL E  1 124 ? -37.464  25.898  -101.713 1.00 34.13  ? 105  VAL E CG2 1 
ATOM   7229  N  N   . VAL E  1 125 ? -37.226  30.615  -101.626 1.00 27.66  ? 106  VAL E N   1 
ATOM   7230  C  CA  . VAL E  1 125 ? -37.415  31.965  -102.153 1.00 32.83  ? 106  VAL E CA  1 
ATOM   7231  C  C   . VAL E  1 125 ? -36.690  32.022  -103.477 1.00 31.41  ? 106  VAL E C   1 
ATOM   7232  O  O   . VAL E  1 125 ? -35.727  31.276  -103.663 1.00 26.88  ? 106  VAL E O   1 
ATOM   7233  C  CB  . VAL E  1 125 ? -36.843  33.023  -101.183 1.00 40.42  ? 106  VAL E CB  1 
ATOM   7234  C  CG1 . VAL E  1 125 ? -37.184  34.422  -101.664 1.00 40.29  ? 106  VAL E CG1 1 
ATOM   7235  C  CG2 . VAL E  1 125 ? -37.365  32.788  -99.751  1.00 40.11  ? 106  VAL E CG2 1 
ATOM   7236  N  N   . SER E  1 126 ? -37.139  32.897  -104.385 1.00 38.96  ? 107  SER E N   1 
ATOM   7237  C  CA  . SER E  1 126 ? -36.613  32.958  -105.767 1.00 35.68  ? 107  SER E CA  1 
ATOM   7238  C  C   . SER E  1 126 ? -35.090  33.100  -105.859 1.00 34.57  ? 107  SER E C   1 
ATOM   7239  O  O   . SER E  1 126 ? -34.478  32.598  -106.794 1.00 33.55  ? 107  SER E O   1 
ATOM   7240  C  CB  . SER E  1 126 ? -37.289  34.068  -106.572 1.00 32.71  ? 107  SER E CB  1 
ATOM   7241  O  OG  . SER E  1 126 ? -37.079  35.335  -105.977 1.00 33.69  ? 107  SER E OG  1 
ATOM   7242  N  N   . ASP E  1 127 ? -34.483  33.763  -104.878 1.00 37.36  ? 108  ASP E N   1 
ATOM   7243  C  CA  . ASP E  1 127 ? -33.024  33.903  -104.822 1.00 35.60  ? 108  ASP E CA  1 
ATOM   7244  C  C   . ASP E  1 127 ? -32.302  32.620  -104.402 1.00 39.10  ? 108  ASP E C   1 
ATOM   7245  O  O   . ASP E  1 127 ? -31.077  32.559  -104.427 1.00 43.64  ? 108  ASP E O   1 
ATOM   7246  C  CB  . ASP E  1 127 ? -32.616  35.062  -103.895 1.00 38.16  ? 108  ASP E CB  1 
ATOM   7247  C  CG  . ASP E  1 127 ? -33.100  34.870  -102.453 1.00 51.90  ? 108  ASP E CG  1 
ATOM   7248  O  OD1 . ASP E  1 127 ? -33.934  33.964  -102.202 1.00 57.21  ? 108  ASP E OD1 1 
ATOM   7249  O  OD2 . ASP E  1 127 ? -32.654  35.635  -101.566 1.00 54.42  ? 108  ASP E OD2 1 
ATOM   7250  N  N   . GLY E  1 128 ? -33.049  31.593  -104.006 1.00 40.45  ? 109  GLY E N   1 
ATOM   7251  C  CA  . GLY E  1 128 ? -32.433  30.330  -103.628 1.00 38.77  ? 109  GLY E CA  1 
ATOM   7252  C  C   . GLY E  1 128 ? -32.276  30.157  -102.129 1.00 42.21  ? 109  GLY E C   1 
ATOM   7253  O  O   . GLY E  1 128 ? -31.669  29.193  -101.662 1.00 40.56  ? 109  GLY E O   1 
ATOM   7254  N  N   . GLU E  1 129 ? -32.819  31.087  -101.355 1.00 46.24  ? 110  GLU E N   1 
ATOM   7255  C  CA  . GLU E  1 129 ? -32.728  30.933  -99.916  1.00 39.05  ? 110  GLU E CA  1 
ATOM   7256  C  C   . GLU E  1 129 ? -33.802  29.950  -99.484  1.00 32.14  ? 110  GLU E C   1 
ATOM   7257  O  O   . GLU E  1 129 ? -34.951  30.015  -99.938  1.00 40.31  ? 110  GLU E O   1 
ATOM   7258  C  CB  . GLU E  1 129 ? -32.868  32.266  -99.184  1.00 44.24  ? 110  GLU E CB  1 
ATOM   7259  C  CG  . GLU E  1 129 ? -32.250  32.241  -97.779  1.00 53.74  ? 110  GLU E CG  1 
ATOM   7260  C  CD  . GLU E  1 129 ? -32.947  33.188  -96.783  1.00 58.21  ? 110  GLU E CD  1 
ATOM   7261  O  OE1 . GLU E  1 129 ? -34.133  33.556  -96.989  1.00 53.07  ? 110  GLU E OE1 1 
ATOM   7262  O  OE2 . GLU E  1 129 ? -32.295  33.560  -95.783  1.00 64.40  ? 110  GLU E OE2 1 
ATOM   7263  N  N   . VAL E  1 130 ? -33.408  29.012  -98.630  1.00 28.06  ? 111  VAL E N   1 
ATOM   7264  C  CA  . VAL E  1 130 ? -34.319  27.982  -98.135  1.00 26.98  ? 111  VAL E CA  1 
ATOM   7265  C  C   . VAL E  1 130 ? -34.487  28.088  -96.628  1.00 29.90  ? 111  VAL E C   1 
ATOM   7266  O  O   . VAL E  1 130 ? -33.512  28.239  -95.888  1.00 32.54  ? 111  VAL E O   1 
ATOM   7267  C  CB  . VAL E  1 130 ? -33.828  26.570  -98.482  1.00 25.24  ? 111  VAL E CB  1 
ATOM   7268  C  CG1 . VAL E  1 130 ? -34.890  25.544  -98.086  1.00 18.22  ? 111  VAL E CG1 1 
ATOM   7269  C  CG2 . VAL E  1 130 ? -33.467  26.478  -99.994  1.00 28.85  ? 111  VAL E CG2 1 
ATOM   7270  N  N   . GLN E  1 131 ? -35.730  28.029  -96.177  1.00 30.54  ? 112  GLN E N   1 
ATOM   7271  C  CA  . GLN E  1 131 ? -36.003  27.993  -94.754  1.00 31.61  ? 112  GLN E CA  1 
ATOM   7272  C  C   . GLN E  1 131 ? -36.908  26.832  -94.441  1.00 35.21  ? 112  GLN E C   1 
ATOM   7273  O  O   . GLN E  1 131 ? -37.895  26.612  -95.132  1.00 37.56  ? 112  GLN E O   1 
ATOM   7274  C  CB  . GLN E  1 131 ? -36.665  29.271  -94.291  1.00 37.77  ? 112  GLN E CB  1 
ATOM   7275  C  CG  . GLN E  1 131 ? -36.875  29.303  -92.803  1.00 43.27  ? 112  GLN E CG  1 
ATOM   7276  C  CD  . GLN E  1 131 ? -37.290  30.668  -92.317  1.00 50.70  ? 112  GLN E CD  1 
ATOM   7277  O  OE1 . GLN E  1 131 ? -38.482  30.959  -92.229  1.00 52.36  ? 112  GLN E OE1 1 
ATOM   7278  N  NE2 . GLN E  1 131 ? -36.310  31.517  -91.997  1.00 54.85  ? 112  GLN E NE2 1 
ATOM   7279  N  N   . TYR E  1 132 ? -36.551  26.079  -93.408  1.00 37.43  ? 113  TYR E N   1 
ATOM   7280  C  CA  . TYR E  1 132 ? -37.332  24.934  -92.947  1.00 30.61  ? 113  TYR E CA  1 
ATOM   7281  C  C   . TYR E  1 132 ? -37.461  25.079  -91.442  1.00 24.98  ? 113  TYR E C   1 
ATOM   7282  O  O   . TYR E  1 132 ? -36.446  25.205  -90.743  1.00 23.40  ? 113  TYR E O   1 
ATOM   7283  C  CB  . TYR E  1 132 ? -36.642  23.605  -93.328  1.00 28.05  ? 113  TYR E CB  1 
ATOM   7284  C  CG  . TYR E  1 132 ? -37.330  22.339  -92.827  1.00 23.89  ? 113  TYR E CG  1 
ATOM   7285  C  CD1 . TYR E  1 132 ? -38.701  22.167  -92.941  1.00 27.38  ? 113  TYR E CD1 1 
ATOM   7286  C  CD2 . TYR E  1 132 ? -36.601  21.314  -92.267  1.00 16.62  ? 113  TYR E CD2 1 
ATOM   7287  C  CE1 . TYR E  1 132 ? -39.333  21.016  -92.471  1.00 12.59  ? 113  TYR E CE1 1 
ATOM   7288  C  CE2 . TYR E  1 132 ? -37.209  20.165  -91.817  1.00 17.31  ? 113  TYR E CE2 1 
ATOM   7289  C  CZ  . TYR E  1 132 ? -38.578  20.016  -91.912  1.00 22.29  ? 113  TYR E CZ  1 
ATOM   7290  O  OH  . TYR E  1 132 ? -39.165  18.822  -91.446  1.00 20.50  ? 113  TYR E OH  1 
ATOM   7291  N  N   . THR E  1 133 ? -38.705  25.087  -90.957  1.00 22.67  ? 114  THR E N   1 
ATOM   7292  C  CA  . THR E  1 133 ? -38.968  25.320  -89.536  1.00 26.99  ? 114  THR E CA  1 
ATOM   7293  C  C   . THR E  1 133 ? -39.958  24.308  -88.942  1.00 20.05  ? 114  THR E C   1 
ATOM   7294  O  O   . THR E  1 133 ? -41.124  24.608  -88.664  1.00 17.94  ? 114  THR E O   1 
ATOM   7295  C  CB  . THR E  1 133 ? -39.409  26.766  -89.276  1.00 28.28  ? 114  THR E CB  1 
ATOM   7296  O  OG1 . THR E  1 133 ? -38.502  27.667  -89.945  1.00 26.47  ? 114  THR E OG1 1 
ATOM   7297  C  CG2 . THR E  1 133 ? -39.455  27.046  -87.755  1.00 28.13  ? 114  THR E CG2 1 
ATOM   7298  N  N   . PRO E  1 134 ? -39.488  23.084  -88.744  1.00 22.69  ? 115  PRO E N   1 
ATOM   7299  C  CA  . PRO E  1 134 ? -40.388  22.102  -88.138  1.00 27.89  ? 115  PRO E CA  1 
ATOM   7300  C  C   . PRO E  1 134 ? -40.576  22.363  -86.620  1.00 25.12  ? 115  PRO E C   1 
ATOM   7301  O  O   . PRO E  1 134 ? -39.684  22.860  -85.918  1.00 18.24  ? 115  PRO E O   1 
ATOM   7302  C  CB  . PRO E  1 134 ? -39.651  20.773  -88.369  1.00 13.30  ? 115  PRO E CB  1 
ATOM   7303  C  CG  . PRO E  1 134 ? -38.187  21.147  -88.338  1.00 13.41  ? 115  PRO E CG  1 
ATOM   7304  C  CD  . PRO E  1 134 ? -38.137  22.539  -88.990  1.00 27.32  ? 115  PRO E CD  1 
ATOM   7305  N  N   . SER E  1 135 ? -41.759  22.043  -86.120  1.00 23.35  ? 116  SER E N   1 
ATOM   7306  C  CA  . SER E  1 135 ? -41.949  22.033  -84.699  1.00 26.31  ? 116  SER E CA  1 
ATOM   7307  C  C   . SER E  1 135 ? -41.600  20.620  -84.210  1.00 28.41  ? 116  SER E C   1 
ATOM   7308  O  O   . SER E  1 135 ? -42.168  19.615  -84.664  1.00 34.34  ? 116  SER E O   1 
ATOM   7309  C  CB  . SER E  1 135 ? -43.374  22.408  -84.329  1.00 29.02  ? 116  SER E CB  1 
ATOM   7310  O  OG  . SER E  1 135 ? -43.498  22.494  -82.913  1.00 32.08  ? 116  SER E OG  1 
ATOM   7311  N  N   . ILE E  1 136 ? -40.647  20.548  -83.292  1.00 24.89  ? 117  ILE E N   1 
ATOM   7312  C  CA  . ILE E  1 136 ? -40.129  19.264  -82.845  1.00 25.95  ? 117  ILE E CA  1 
ATOM   7313  C  C   . ILE E  1 136 ? -40.357  19.018  -81.359  1.00 31.43  ? 117  ILE E C   1 
ATOM   7314  O  O   . ILE E  1 136 ? -40.136  19.901  -80.516  1.00 37.60  ? 117  ILE E O   1 
ATOM   7315  C  CB  . ILE E  1 136 ? -38.636  19.161  -83.167  1.00 24.14  ? 117  ILE E CB  1 
ATOM   7316  C  CG1 . ILE E  1 136 ? -38.450  19.175  -84.696  1.00 27.35  ? 117  ILE E CG1 1 
ATOM   7317  C  CG2 . ILE E  1 136 ? -38.032  17.911  -82.518  1.00 18.74  ? 117  ILE E CG2 1 
ATOM   7318  C  CD1 . ILE E  1 136 ? -37.008  19.217  -85.174  1.00 28.43  ? 117  ILE E CD1 1 
ATOM   7319  N  N   . ARG E  1 137 ? -40.834  17.825  -81.032  1.00 33.49  ? 118  ARG E N   1 
ATOM   7320  C  CA  . ARG E  1 137 ? -40.810  17.382  -79.633  1.00 30.23  ? 118  ARG E CA  1 
ATOM   7321  C  C   . ARG E  1 137 ? -39.682  16.385  -79.451  1.00 26.55  ? 118  ARG E C   1 
ATOM   7322  O  O   . ARG E  1 137 ? -39.587  15.401  -80.189  1.00 22.23  ? 118  ARG E O   1 
ATOM   7323  C  CB  . ARG E  1 137 ? -42.127  16.745  -79.196  1.00 24.49  ? 118  ARG E CB  1 
ATOM   7324  C  CG  . ARG E  1 137 ? -42.050  16.242  -77.792  1.00 28.74  ? 118  ARG E CG  1 
ATOM   7325  C  CD  . ARG E  1 137 ? -43.388  15.784  -77.277  1.00 39.79  ? 118  ARG E CD  1 
ATOM   7326  N  NE  . ARG E  1 137 ? -43.261  15.283  -75.908  1.00 46.65  ? 118  ARG E NE  1 
ATOM   7327  C  CZ  . ARG E  1 137 ? -44.273  15.042  -75.077  1.00 48.14  ? 118  ARG E CZ  1 
ATOM   7328  N  NH1 . ARG E  1 137 ? -45.528  15.257  -75.455  1.00 46.49  ? 118  ARG E NH1 1 
ATOM   7329  N  NH2 . ARG E  1 137 ? -44.020  14.595  -73.851  1.00 50.77  ? 118  ARG E NH2 1 
ATOM   7330  N  N   . GLN E  1 138 ? -38.815  16.640  -78.477  1.00 31.66  ? 119  GLN E N   1 
ATOM   7331  C  CA  . GLN E  1 138 ? -37.641  15.792  -78.299  1.00 32.65  ? 119  GLN E CA  1 
ATOM   7332  C  C   . GLN E  1 138 ? -37.183  15.773  -76.842  1.00 32.99  ? 119  GLN E C   1 
ATOM   7333  O  O   . GLN E  1 138 ? -37.378  16.753  -76.116  1.00 30.00  ? 119  GLN E O   1 
ATOM   7334  C  CB  . GLN E  1 138 ? -36.515  16.252  -79.219  1.00 31.12  ? 119  GLN E CB  1 
ATOM   7335  C  CG  . GLN E  1 138 ? -35.444  15.210  -79.460  1.00 32.36  ? 119  GLN E CG  1 
ATOM   7336  C  CD  . GLN E  1 138 ? -34.532  15.579  -80.635  1.00 27.98  ? 119  GLN E CD  1 
ATOM   7337  O  OE1 . GLN E  1 138 ? -34.404  16.754  -80.989  1.00 26.74  ? 119  GLN E OE1 1 
ATOM   7338  N  NE2 . GLN E  1 138 ? -33.905  14.571  -81.241  1.00 24.10  ? 119  GLN E NE2 1 
ATOM   7339  N  N   . ARG E  1 139 ? -36.596  14.644  -76.435  1.00 34.47  ? 120  ARG E N   1 
ATOM   7340  C  CA  . ARG E  1 139 ? -35.976  14.477  -75.121  1.00 31.68  ? 120  ARG E CA  1 
ATOM   7341  C  C   . ARG E  1 139 ? -34.467  14.651  -75.139  1.00 28.23  ? 120  ARG E C   1 
ATOM   7342  O  O   . ARG E  1 139 ? -33.745  14.037  -75.936  1.00 15.55  ? 120  ARG E O   1 
ATOM   7343  C  CB  . ARG E  1 139 ? -36.325  13.117  -74.533  1.00 34.87  ? 120  ARG E CB  1 
ATOM   7344  C  CG  . ARG E  1 139 ? -37.765  13.057  -74.084  1.00 48.46  ? 120  ARG E CG  1 
ATOM   7345  C  CD  . ARG E  1 139 ? -38.196  11.684  -73.572  1.00 58.20  ? 120  ARG E CD  1 
ATOM   7346  N  NE  . ARG E  1 139 ? -38.271  10.637  -74.606  1.00 57.42  ? 120  ARG E NE  1 
ATOM   7347  C  CZ  . ARG E  1 139 ? -39.212  10.538  -75.551  1.00 50.97  ? 120  ARG E CZ  1 
ATOM   7348  N  NH1 . ARG E  1 139 ? -40.185  11.449  -75.676  1.00 43.33  ? 120  ARG E NH1 1 
ATOM   7349  N  NH2 . ARG E  1 139 ? -39.168  9.512   -76.389  1.00 54.15  ? 120  ARG E NH2 1 
ATOM   7350  N  N   . PHE E  1 140 ? -34.004  15.478  -74.216  1.00 24.48  ? 121  PHE E N   1 
ATOM   7351  C  CA  . PHE E  1 140 ? -32.586  15.742  -74.066  1.00 21.52  ? 121  PHE E CA  1 
ATOM   7352  C  C   . PHE E  1 140 ? -32.030  15.339  -72.706  1.00 23.92  ? 121  PHE E C   1 
ATOM   7353  O  O   . PHE E  1 140 ? -32.735  15.336  -71.688  1.00 27.74  ? 121  PHE E O   1 
ATOM   7354  C  CB  . PHE E  1 140 ? -32.327  17.227  -74.281  1.00 23.40  ? 121  PHE E CB  1 
ATOM   7355  C  CG  . PHE E  1 140 ? -32.768  17.710  -75.621  1.00 23.79  ? 121  PHE E CG  1 
ATOM   7356  C  CD1 . PHE E  1 140 ? -31.959  17.552  -76.719  1.00 24.40  ? 121  PHE E CD1 1 
ATOM   7357  C  CD2 . PHE E  1 140 ? -34.007  18.291  -75.794  1.00 28.02  ? 121  PHE E CD2 1 
ATOM   7358  C  CE1 . PHE E  1 140 ? -32.378  17.989  -77.979  1.00 23.20  ? 121  PHE E CE1 1 
ATOM   7359  C  CE2 . PHE E  1 140 ? -34.426  18.728  -77.045  1.00 24.99  ? 121  PHE E CE2 1 
ATOM   7360  C  CZ  . PHE E  1 140 ? -33.608  18.572  -78.136  1.00 16.65  ? 121  PHE E CZ  1 
ATOM   7361  N  N   . SER E  1 141 ? -30.753  14.995  -72.718  1.00 25.07  ? 122  SER E N   1 
ATOM   7362  C  CA  . SER E  1 141 ? -29.979  14.765  -71.521  1.00 22.63  ? 122  SER E CA  1 
ATOM   7363  C  C   . SER E  1 141 ? -29.205  16.047  -71.308  1.00 30.22  ? 122  SER E C   1 
ATOM   7364  O  O   . SER E  1 141 ? -28.393  16.434  -72.143  1.00 35.82  ? 122  SER E O   1 
ATOM   7365  C  CB  . SER E  1 141 ? -29.029  13.595  -71.730  1.00 25.19  ? 122  SER E CB  1 
ATOM   7366  O  OG  . SER E  1 141 ? -27.904  13.697  -70.876  1.00 33.26  ? 122  SER E OG  1 
ATOM   7367  N  N   . CYS E  1 142 ? -29.480  16.726  -70.200  1.00 36.63  ? 123  CYS E N   1 
ATOM   7368  C  CA  . CYS E  1 142 ? -28.809  17.984  -69.893  1.00 31.91  ? 123  CYS E CA  1 
ATOM   7369  C  C   . CYS E  1 142 ? -28.936  18.283  -68.412  1.00 32.46  ? 123  CYS E C   1 
ATOM   7370  O  O   . CYS E  1 142 ? -29.580  17.522  -67.678  1.00 29.26  ? 123  CYS E O   1 
ATOM   7371  C  CB  . CYS E  1 142 ? -29.413  19.118  -70.711  1.00 28.06  ? 123  CYS E CB  1 
ATOM   7372  S  SG  . CYS E  1 142 ? -31.208  19.250  -70.494  1.00 81.05  ? 123  CYS E SG  1 
ATOM   7373  N  N   . ASP E  1 143 ? -28.324  19.393  -67.990  1.00 35.82  ? 124  ASP E N   1 
ATOM   7374  C  CA  . ASP E  1 143 ? -28.254  19.768  -66.574  1.00 40.12  ? 124  ASP E CA  1 
ATOM   7375  C  C   . ASP E  1 143 ? -29.561  20.389  -66.127  1.00 38.41  ? 124  ASP E C   1 
ATOM   7376  O  O   . ASP E  1 143 ? -29.897  21.505  -66.529  1.00 45.05  ? 124  ASP E O   1 
ATOM   7377  C  CB  . ASP E  1 143 ? -27.091  20.731  -66.325  1.00 44.53  ? 124  ASP E CB  1 
ATOM   7378  C  CG  . ASP E  1 143 ? -26.820  20.951  -64.855  1.00 44.55  ? 124  ASP E CG  1 
ATOM   7379  O  OD1 . ASP E  1 143 ? -27.292  20.150  -64.023  1.00 46.51  ? 124  ASP E OD1 1 
ATOM   7380  O  OD2 . ASP E  1 143 ? -26.116  21.926  -64.543  1.00 47.63  ? 124  ASP E OD2 1 
ATOM   7381  N  N   . VAL E  1 144 ? -30.298  19.655  -65.301  1.00 33.47  ? 125  VAL E N   1 
ATOM   7382  C  CA  . VAL E  1 144 ? -31.616  20.091  -64.856  1.00 33.50  ? 125  VAL E CA  1 
ATOM   7383  C  C   . VAL E  1 144 ? -31.549  20.601  -63.397  1.00 36.90  ? 125  VAL E C   1 
ATOM   7384  O  O   . VAL E  1 144 ? -32.550  21.029  -62.815  1.00 38.13  ? 125  VAL E O   1 
ATOM   7385  C  CB  . VAL E  1 144 ? -32.639  18.949  -65.017  1.00 33.22  ? 125  VAL E CB  1 
ATOM   7386  C  CG1 . VAL E  1 144 ? -34.052  19.458  -64.865  1.00 44.86  ? 125  VAL E CG1 1 
ATOM   7387  C  CG2 . VAL E  1 144 ? -32.499  18.311  -66.386  1.00 21.91  ? 125  VAL E CG2 1 
ATOM   7388  N  N   . SER E  1 145 ? -30.347  20.580  -62.830  1.00 33.16  ? 126  SER E N   1 
ATOM   7389  C  CA  . SER E  1 145 ? -30.151  20.994  -61.454  1.00 33.91  ? 126  SER E CA  1 
ATOM   7390  C  C   . SER E  1 145 ? -30.470  22.474  -61.275  1.00 33.84  ? 126  SER E C   1 
ATOM   7391  O  O   . SER E  1 145 ? -29.967  23.319  -62.012  1.00 31.22  ? 126  SER E O   1 
ATOM   7392  C  CB  . SER E  1 145 ? -28.718  20.682  -60.979  1.00 32.79  ? 126  SER E CB  1 
ATOM   7393  O  OG  . SER E  1 145 ? -27.791  21.599  -61.515  1.00 31.77  ? 126  SER E OG  1 
ATOM   7394  N  N   . GLY E  1 146 ? -31.330  22.769  -60.301  1.00 35.42  ? 127  GLY E N   1 
ATOM   7395  C  CA  . GLY E  1 146 ? -31.671  24.137  -59.966  1.00 36.25  ? 127  GLY E CA  1 
ATOM   7396  C  C   . GLY E  1 146 ? -32.977  24.574  -60.580  1.00 41.74  ? 127  GLY E C   1 
ATOM   7397  O  O   . GLY E  1 146 ? -33.374  25.742  -60.462  1.00 40.05  ? 127  GLY E O   1 
ATOM   7398  N  N   . VAL E  1 147 ? -33.658  23.631  -61.223  1.00 47.94  ? 128  VAL E N   1 
ATOM   7399  C  CA  . VAL E  1 147 ? -34.876  23.943  -61.974  1.00 47.67  ? 128  VAL E CA  1 
ATOM   7400  C  C   . VAL E  1 147 ? -35.929  24.533  -61.057  1.00 42.20  ? 128  VAL E C   1 
ATOM   7401  O  O   . VAL E  1 147 ? -36.749  25.349  -61.479  1.00 35.20  ? 128  VAL E O   1 
ATOM   7402  C  CB  . VAL E  1 147 ? -35.432  22.695  -62.733  1.00 52.10  ? 128  VAL E CB  1 
ATOM   7403  C  CG1 . VAL E  1 147 ? -35.776  21.558  -61.759  1.00 45.92  ? 128  VAL E CG1 1 
ATOM   7404  C  CG2 . VAL E  1 147 ? -36.638  23.071  -63.601  1.00 53.16  ? 128  VAL E CG2 1 
ATOM   7405  N  N   . ASP E  1 148 ? -35.876  24.134  -59.790  1.00 52.34  ? 129  ASP E N   1 
ATOM   7406  C  CA  . ASP E  1 148 ? -36.882  24.547  -58.821  1.00 60.70  ? 129  ASP E CA  1 
ATOM   7407  C  C   . ASP E  1 148 ? -36.442  25.747  -57.972  1.00 55.59  ? 129  ASP E C   1 
ATOM   7408  O  O   . ASP E  1 148 ? -37.144  26.150  -57.040  1.00 59.60  ? 129  ASP E O   1 
ATOM   7409  C  CB  . ASP E  1 148 ? -37.279  23.363  -57.938  1.00 71.72  ? 129  ASP E CB  1 
ATOM   7410  C  CG  . ASP E  1 148 ? -38.788  23.200  -57.830  1.00 82.25  ? 129  ASP E CG  1 
ATOM   7411  O  OD1 . ASP E  1 148 ? -39.492  24.236  -57.778  1.00 85.35  ? 129  ASP E OD1 1 
ATOM   7412  O  OD2 . ASP E  1 148 ? -39.267  22.040  -57.801  1.00 85.72  ? 129  ASP E OD2 1 
ATOM   7413  N  N   . THR E  1 149 ? -35.289  26.318  -58.309  1.00 48.31  ? 130  THR E N   1 
ATOM   7414  C  CA  . THR E  1 149 ? -34.803  27.525  -57.653  1.00 49.81  ? 130  THR E CA  1 
ATOM   7415  C  C   . THR E  1 149 ? -35.161  28.767  -58.465  1.00 57.56  ? 130  THR E C   1 
ATOM   7416  O  O   . THR E  1 149 ? -35.794  28.672  -59.519  1.00 57.30  ? 130  THR E O   1 
ATOM   7417  C  CB  . THR E  1 149 ? -33.284  27.471  -57.431  1.00 45.87  ? 130  THR E CB  1 
ATOM   7418  O  OG1 . THR E  1 149 ? -32.608  27.836  -58.639  1.00 51.81  ? 130  THR E OG1 1 
ATOM   7419  C  CG2 . THR E  1 149 ? -32.861  26.060  -57.010  1.00 37.58  ? 130  THR E CG2 1 
ATOM   7420  N  N   . GLU E  1 150 ? -34.750  29.936  -57.982  1.00 65.79  ? 131  GLU E N   1 
ATOM   7421  C  CA  . GLU E  1 150 ? -35.109  31.187  -58.652  1.00 68.74  ? 131  GLU E CA  1 
ATOM   7422  C  C   . GLU E  1 150 ? -34.179  31.494  -59.831  1.00 59.06  ? 131  GLU E C   1 
ATOM   7423  O  O   . GLU E  1 150 ? -34.588  32.114  -60.821  1.00 55.60  ? 131  GLU E O   1 
ATOM   7424  C  CB  . GLU E  1 150 ? -35.158  32.355  -57.650  1.00 75.93  ? 131  GLU E CB  1 
ATOM   7425  C  CG  . GLU E  1 150 ? -36.268  33.392  -57.921  1.00 86.01  ? 131  GLU E CG  1 
ATOM   7426  C  CD  . GLU E  1 150 ? -37.699  32.812  -57.855  1.00 93.71  ? 131  GLU E CD  1 
ATOM   7427  O  OE1 . GLU E  1 150 ? -37.902  31.738  -57.237  1.00 97.02  ? 131  GLU E OE1 1 
ATOM   7428  O  OE2 . GLU E  1 150 ? -38.628  33.442  -58.418  1.00 93.02  ? 131  GLU E OE2 1 
ATOM   7429  N  N   . SER E  1 151 ? -32.930  31.049  -59.720  1.00 52.88  ? 132  SER E N   1 
ATOM   7430  C  CA  . SER E  1 151 ? -31.952  31.248  -60.781  1.00 51.35  ? 132  SER E CA  1 
ATOM   7431  C  C   . SER E  1 151 ? -32.166  30.201  -61.902  1.00 52.85  ? 132  SER E C   1 
ATOM   7432  O  O   . SER E  1 151 ? -31.706  30.372  -63.040  1.00 44.38  ? 132  SER E O   1 
ATOM   7433  C  CB  . SER E  1 151 ? -30.528  31.189  -60.222  1.00 46.14  ? 132  SER E CB  1 
ATOM   7434  O  OG  . SER E  1 151 ? -30.281  29.910  -59.672  1.00 52.16  ? 132  SER E OG  1 
ATOM   7435  N  N   . GLY E  1 152 ? -32.877  29.125  -61.565  1.00 53.13  ? 133  GLY E N   1 
ATOM   7436  C  CA  . GLY E  1 152 ? -33.312  28.160  -62.554  1.00 50.82  ? 133  GLY E CA  1 
ATOM   7437  C  C   . GLY E  1 152 ? -32.239  27.179  -62.992  1.00 48.33  ? 133  GLY E C   1 
ATOM   7438  O  O   . GLY E  1 152 ? -31.080  27.262  -62.552  1.00 41.15  ? 133  GLY E O   1 
ATOM   7439  N  N   . ALA E  1 153 ? -32.636  26.237  -63.851  1.00 48.49  ? 134  ALA E N   1 
ATOM   7440  C  CA  . ALA E  1 153 ? -31.691  25.319  -64.473  1.00 48.88  ? 134  ALA E CA  1 
ATOM   7441  C  C   . ALA E  1 153 ? -31.212  25.909  -65.795  1.00 41.36  ? 134  ALA E C   1 
ATOM   7442  O  O   . ALA E  1 153 ? -31.869  26.787  -66.378  1.00 37.21  ? 134  ALA E O   1 
ATOM   7443  C  CB  . ALA E  1 153 ? -32.326  23.952  -64.690  1.00 52.29  ? 134  ALA E CB  1 
ATOM   7444  N  N   . THR E  1 154 ? -30.058  25.439  -66.256  1.00 38.04  ? 135  THR E N   1 
ATOM   7445  C  CA  . THR E  1 154 ? -29.566  25.829  -67.577  1.00 43.12  ? 135  THR E CA  1 
ATOM   7446  C  C   . THR E  1 154 ? -29.270  24.593  -68.421  1.00 46.19  ? 135  THR E C   1 
ATOM   7447  O  O   . THR E  1 154 ? -28.242  23.924  -68.252  1.00 44.51  ? 135  THR E O   1 
ATOM   7448  C  CB  . THR E  1 154 ? -28.332  26.776  -67.523  1.00 50.16  ? 135  THR E CB  1 
ATOM   7449  O  OG1 . THR E  1 154 ? -28.679  27.986  -66.840  1.00 53.97  ? 135  THR E OG1 1 
ATOM   7450  C  CG2 . THR E  1 154 ? -27.870  27.140  -68.921  1.00 45.76  ? 135  THR E CG2 1 
ATOM   7451  N  N   . CYS E  1 155 ? -30.204  24.290  -69.320  1.00 46.04  ? 136  CYS E N   1 
ATOM   7452  C  CA  . CYS E  1 155 ? -30.088  23.143  -70.189  1.00 38.79  ? 136  CYS E CA  1 
ATOM   7453  C  C   . CYS E  1 155 ? -29.404  23.548  -71.501  1.00 40.43  ? 136  CYS E C   1 
ATOM   7454  O  O   . CYS E  1 155 ? -29.864  24.448  -72.211  1.00 34.91  ? 136  CYS E O   1 
ATOM   7455  C  CB  . CYS E  1 155 ? -31.467  22.527  -70.447  1.00 33.78  ? 136  CYS E CB  1 
ATOM   7456  S  SG  . CYS E  1 155 ? -31.400  21.023  -71.468  1.00 89.60  ? 136  CYS E SG  1 
ATOM   7457  N  N   . ARG E  1 156 ? -28.300  22.872  -71.811  1.00 46.55  ? 137  ARG E N   1 
ATOM   7458  C  CA  . ARG E  1 156 ? -27.480  23.183  -72.976  1.00 45.12  ? 137  ARG E CA  1 
ATOM   7459  C  C   . ARG E  1 156 ? -27.760  22.177  -74.113  1.00 39.63  ? 137  ARG E C   1 
ATOM   7460  O  O   . ARG E  1 156 ? -27.534  20.977  -73.976  1.00 42.30  ? 137  ARG E O   1 
ATOM   7461  C  CB  . ARG E  1 156 ? -26.002  23.166  -72.553  1.00 49.97  ? 137  ARG E CB  1 
ATOM   7462  C  CG  . ARG E  1 156 ? -25.024  23.843  -73.499  1.00 52.84  ? 137  ARG E CG  1 
ATOM   7463  C  CD  . ARG E  1 156 ? -23.582  23.728  -72.989  1.00 57.42  ? 137  ARG E CD  1 
ATOM   7464  N  NE  . ARG E  1 156 ? -23.106  22.341  -72.915  1.00 64.41  ? 137  ARG E NE  1 
ATOM   7465  C  CZ  . ARG E  1 156 ? -22.861  21.685  -71.782  1.00 68.39  ? 137  ARG E CZ  1 
ATOM   7466  N  NH1 . ARG E  1 156 ? -23.039  22.296  -70.617  1.00 69.58  ? 137  ARG E NH1 1 
ATOM   7467  N  NH2 . ARG E  1 156 ? -22.432  20.423  -71.813  1.00 67.55  ? 137  ARG E NH2 1 
ATOM   7468  N  N   . ILE E  1 157 ? -28.268  22.671  -75.230  1.00 35.30  ? 138  ILE E N   1 
ATOM   7469  C  CA  . ILE E  1 157 ? -28.582  21.812  -76.364  1.00 31.43  ? 138  ILE E CA  1 
ATOM   7470  C  C   . ILE E  1 157 ? -27.603  22.003  -77.517  1.00 26.73  ? 138  ILE E C   1 
ATOM   7471  O  O   . ILE E  1 157 ? -27.474  23.098  -78.043  1.00 28.83  ? 138  ILE E O   1 
ATOM   7472  C  CB  . ILE E  1 157 ? -30.006  22.062  -76.869  1.00 28.70  ? 138  ILE E CB  1 
ATOM   7473  C  CG1 . ILE E  1 157 ? -31.002  21.564  -75.805  1.00 27.42  ? 138  ILE E CG1 1 
ATOM   7474  C  CG2 . ILE E  1 157 ? -30.219  21.384  -78.234  1.00 18.88  ? 138  ILE E CG2 1 
ATOM   7475  C  CD1 . ILE E  1 157 ? -32.448  21.939  -76.071  1.00 24.57  ? 138  ILE E CD1 1 
ATOM   7476  N  N   . LYS E  1 158 ? -26.933  20.926  -77.911  1.00 17.70  ? 139  LYS E N   1 
ATOM   7477  C  CA  . LYS E  1 158 ? -25.869  20.980  -78.906  1.00 30.62  ? 139  LYS E CA  1 
ATOM   7478  C  C   . LYS E  1 158 ? -26.368  20.482  -80.280  1.00 30.24  ? 139  LYS E C   1 
ATOM   7479  O  O   . LYS E  1 158 ? -26.699  19.301  -80.446  1.00 33.48  ? 139  LYS E O   1 
ATOM   7480  C  CB  . LYS E  1 158 ? -24.665  20.153  -78.427  1.00 23.52  ? 139  LYS E CB  1 
ATOM   7481  C  CG  . LYS E  1 158 ? -23.486  20.119  -79.405  1.00 23.99  ? 139  LYS E CG  1 
ATOM   7482  C  CD  . LYS E  1 158 ? -22.418  19.134  -78.954  1.00 17.28  ? 139  LYS E CD  1 
ATOM   7483  C  CE  . LYS E  1 158 ? -21.336  18.946  -80.011  1.00 16.97  ? 139  LYS E CE  1 
ATOM   7484  N  NZ  . LYS E  1 158 ? -20.359  17.899  -79.644  1.00 26.35  ? 139  LYS E NZ  1 
ATOM   7485  N  N   . ILE E  1 159 ? -26.427  21.392  -81.250  1.00 25.58  ? 140  ILE E N   1 
ATOM   7486  C  CA  . ILE E  1 159 ? -26.927  21.065  -82.586  1.00 26.48  ? 140  ILE E CA  1 
ATOM   7487  C  C   . ILE E  1 159 ? -25.900  21.364  -83.657  1.00 23.56  ? 140  ILE E C   1 
ATOM   7488  O  O   . ILE E  1 159 ? -25.375  22.477  -83.716  1.00 27.78  ? 140  ILE E O   1 
ATOM   7489  C  CB  . ILE E  1 159 ? -28.175  21.877  -82.913  1.00 23.78  ? 140  ILE E CB  1 
ATOM   7490  C  CG1 . ILE E  1 159 ? -29.293  21.516  -81.938  1.00 23.73  ? 140  ILE E CG1 1 
ATOM   7491  C  CG2 . ILE E  1 159 ? -28.602  21.622  -84.365  1.00 19.83  ? 140  ILE E CG2 1 
ATOM   7492  C  CD1 . ILE E  1 159 ? -30.615  22.147  -82.267  1.00 29.06  ? 140  ILE E CD1 1 
ATOM   7493  N  N   . GLY E  1 160 ? -25.617  20.376  -84.501  1.00 22.65  ? 141  GLY E N   1 
ATOM   7494  C  CA  . GLY E  1 160 ? -24.704  20.558  -85.626  1.00 26.60  ? 141  GLY E CA  1 
ATOM   7495  C  C   . GLY E  1 160 ? -24.897  19.535  -86.737  1.00 27.29  ? 141  GLY E C   1 
ATOM   7496  O  O   . GLY E  1 160 ? -25.708  18.611  -86.618  1.00 27.58  ? 141  GLY E O   1 
ATOM   7497  N  N   . SER E  1 161 ? -24.145  19.695  -87.823  1.00 27.57  ? 142  SER E N   1 
ATOM   7498  C  CA  . SER E  1 161 ? -24.153  18.702  -88.892  1.00 22.99  ? 142  SER E CA  1 
ATOM   7499  C  C   . SER E  1 161 ? -23.548  17.409  -88.394  1.00 24.18  ? 142  SER E C   1 
ATOM   7500  O  O   . SER E  1 161 ? -22.462  17.406  -87.823  1.00 29.00  ? 142  SER E O   1 
ATOM   7501  C  CB  . SER E  1 161 ? -23.365  19.212  -90.108  1.00 26.48  ? 142  SER E CB  1 
ATOM   7502  O  OG  . SER E  1 161 ? -23.089  18.187  -91.053  1.00 31.28  ? 142  SER E OG  1 
ATOM   7503  N  N   . TRP E  1 162 ? -24.245  16.303  -88.618  1.00 28.48  ? 143  TRP E N   1 
ATOM   7504  C  CA  . TRP E  1 162 ? -23.731  14.990  -88.221  1.00 28.72  ? 143  TRP E CA  1 
ATOM   7505  C  C   . TRP E  1 162 ? -22.540  14.555  -89.091  1.00 29.91  ? 143  TRP E C   1 
ATOM   7506  O  O   . TRP E  1 162 ? -21.533  14.079  -88.566  1.00 34.16  ? 143  TRP E O   1 
ATOM   7507  C  CB  . TRP E  1 162 ? -24.856  13.942  -88.253  1.00 22.22  ? 143  TRP E CB  1 
ATOM   7508  C  CG  . TRP E  1 162 ? -24.556  12.724  -87.425  1.00 23.24  ? 143  TRP E CG  1 
ATOM   7509  C  CD1 . TRP E  1 162 ? -24.366  11.433  -87.870  1.00 28.24  ? 143  TRP E CD1 1 
ATOM   7510  C  CD2 . TRP E  1 162 ? -24.410  12.680  -86.005  1.00 20.24  ? 143  TRP E CD2 1 
ATOM   7511  N  NE1 . TRP E  1 162 ? -24.113  10.602  -86.801  1.00 22.20  ? 143  TRP E NE1 1 
ATOM   7512  C  CE2 . TRP E  1 162 ? -24.133  11.341  -85.649  1.00 18.19  ? 143  TRP E CE2 1 
ATOM   7513  C  CE3 . TRP E  1 162 ? -24.491  13.652  -84.988  1.00 29.34  ? 143  TRP E CE3 1 
ATOM   7514  C  CZ2 . TRP E  1 162 ? -23.927  10.944  -84.310  1.00 27.66  ? 143  TRP E CZ2 1 
ATOM   7515  C  CZ3 . TRP E  1 162 ? -24.296  13.262  -83.659  1.00 22.76  ? 143  TRP E CZ3 1 
ATOM   7516  C  CH2 . TRP E  1 162 ? -24.017  11.916  -83.333  1.00 25.86  ? 143  TRP E CH2 1 
ATOM   7517  N  N   . THR E  1 163 ? -22.657  14.724  -90.414  1.00 27.97  ? 144  THR E N   1 
ATOM   7518  C  CA  . THR E  1 163 ? -21.638  14.203  -91.335  1.00 24.24  ? 144  THR E CA  1 
ATOM   7519  C  C   . THR E  1 163 ? -20.892  15.221  -92.188  1.00 19.59  ? 144  THR E C   1 
ATOM   7520  O  O   . THR E  1 163 ? -19.953  14.844  -92.887  1.00 22.79  ? 144  THR E O   1 
ATOM   7521  C  CB  . THR E  1 163 ? -22.210  13.155  -92.287  1.00 23.15  ? 144  THR E CB  1 
ATOM   7522  O  OG1 . THR E  1 163 ? -22.989  13.805  -93.286  1.00 25.44  ? 144  THR E OG1 1 
ATOM   7523  C  CG2 . THR E  1 163 ? -23.076  12.190  -91.542  1.00 24.21  ? 144  THR E CG2 1 
ATOM   7524  N  N   . HIS E  1 164 ? -21.286  16.497  -92.141  1.00 15.85  ? 145  HIS E N   1 
ATOM   7525  C  CA  . HIS E  1 164 ? -20.517  17.523  -92.859  1.00 20.49  ? 145  HIS E CA  1 
ATOM   7526  C  C   . HIS E  1 164 ? -19.626  18.387  -91.961  1.00 20.75  ? 145  HIS E C   1 
ATOM   7527  O  O   . HIS E  1 164 ? -20.118  18.993  -91.015  1.00 23.00  ? 145  HIS E O   1 
ATOM   7528  C  CB  . HIS E  1 164 ? -21.438  18.390  -93.726  1.00 28.13  ? 145  HIS E CB  1 
ATOM   7529  C  CG  . HIS E  1 164 ? -22.154  17.627  -94.800  1.00 33.93  ? 145  HIS E CG  1 
ATOM   7530  N  ND1 . HIS E  1 164 ? -21.526  17.206  -95.956  1.00 33.07  ? 145  HIS E ND1 1 
ATOM   7531  C  CD2 . HIS E  1 164 ? -23.441  17.204  -94.888  1.00 35.52  ? 145  HIS E CD2 1 
ATOM   7532  C  CE1 . HIS E  1 164 ? -22.404  16.571  -96.720  1.00 34.42  ? 145  HIS E CE1 1 
ATOM   7533  N  NE2 . HIS E  1 164 ? -23.570  16.553  -96.097  1.00 37.63  ? 145  HIS E NE2 1 
ATOM   7534  N  N   . HIS E  1 165 ? -18.321  18.433  -92.257  1.00 25.04  ? 146  HIS E N   1 
ATOM   7535  C  CA  . HIS E  1 165 ? -17.363  19.242  -91.486  1.00 32.99  ? 146  HIS E CA  1 
ATOM   7536  C  C   . HIS E  1 165 ? -17.408  20.737  -91.859  1.00 43.98  ? 146  HIS E C   1 
ATOM   7537  O  O   . HIS E  1 165 ? -18.182  21.162  -92.736  1.00 44.66  ? 146  HIS E O   1 
ATOM   7538  C  CB  . HIS E  1 165 ? -15.933  18.700  -91.624  1.00 33.85  ? 146  HIS E CB  1 
ATOM   7539  C  CG  . HIS E  1 165 ? -15.436  18.620  -93.037  1.00 38.70  ? 146  HIS E CG  1 
ATOM   7540  N  ND1 . HIS E  1 165 ? -15.146  19.736  -93.793  1.00 45.47  ? 146  HIS E ND1 1 
ATOM   7541  C  CD2 . HIS E  1 165 ? -15.172  17.552  -93.829  1.00 40.18  ? 146  HIS E CD2 1 
ATOM   7542  C  CE1 . HIS E  1 165 ? -14.727  19.361  -94.990  1.00 45.28  ? 146  HIS E CE1 1 
ATOM   7543  N  NE2 . HIS E  1 165 ? -14.734  18.040  -95.037  1.00 44.39  ? 146  HIS E NE2 1 
ATOM   7544  N  N   . SER E  1 166 ? -16.553  21.524  -91.206  1.00 42.14  ? 147  SER E N   1 
ATOM   7545  C  CA  . SER E  1 166 ? -16.647  22.989  -91.264  1.00 34.48  ? 147  SER E CA  1 
ATOM   7546  C  C   . SER E  1 166 ? -16.516  23.576  -92.678  1.00 36.15  ? 147  SER E C   1 
ATOM   7547  O  O   . SER E  1 166 ? -16.944  24.703  -92.928  1.00 40.89  ? 147  SER E O   1 
ATOM   7548  C  CB  . SER E  1 166 ? -15.626  23.635  -90.320  1.00 27.97  ? 147  SER E CB  1 
ATOM   7549  O  OG  . SER E  1 166 ? -14.300  23.239  -90.655  1.00 27.04  ? 147  SER E OG  1 
ATOM   7550  N  N   . ARG E  1 167 ? -15.947  22.821  -93.609  1.00 35.00  ? 148  ARG E N   1 
ATOM   7551  C  CA  . ARG E  1 167 ? -15.715  23.361  -94.956  1.00 33.37  ? 148  ARG E CA  1 
ATOM   7552  C  C   . ARG E  1 167 ? -16.926  23.083  -95.835  1.00 31.50  ? 148  ARG E C   1 
ATOM   7553  O  O   . ARG E  1 167 ? -17.150  23.732  -96.836  1.00 40.56  ? 148  ARG E O   1 
ATOM   7554  C  CB  . ARG E  1 167 ? -14.466  22.754  -95.591  1.00 32.46  ? 148  ARG E CB  1 
ATOM   7555  C  CG  . ARG E  1 167 ? -13.160  23.480  -95.316  1.00 39.06  ? 148  ARG E CG  1 
ATOM   7556  C  CD  . ARG E  1 167 ? -12.084  22.964  -96.286  1.00 50.19  ? 148  ARG E CD  1 
ATOM   7557  N  NE  . ARG E  1 167 ? -11.991  21.498  -96.241  1.00 62.79  ? 148  ARG E NE  1 
ATOM   7558  C  CZ  . ARG E  1 167 ? -11.651  20.709  -97.267  1.00 70.63  ? 148  ARG E CZ  1 
ATOM   7559  N  NH1 . ARG E  1 167 ? -11.372  21.228  -98.458  1.00 70.62  ? 148  ARG E NH1 1 
ATOM   7560  N  NH2 . ARG E  1 167 ? -11.592  19.389  -97.102  1.00 72.86  ? 148  ARG E NH2 1 
ATOM   7561  N  N   . GLU E  1 168 ? -17.702  22.099  -95.451  1.00 28.92  ? 149  GLU E N   1 
ATOM   7562  C  CA  . GLU E  1 168 ? -18.923  21.802  -96.171  1.00 28.45  ? 149  GLU E CA  1 
ATOM   7563  C  C   . GLU E  1 168 ? -20.138  22.493  -95.532  1.00 32.32  ? 149  GLU E C   1 
ATOM   7564  O  O   . GLU E  1 168 ? -20.955  23.101  -96.231  1.00 30.93  ? 149  GLU E O   1 
ATOM   7565  C  CB  . GLU E  1 168 ? -19.122  20.273  -96.257  1.00 24.06  ? 149  GLU E CB  1 
ATOM   7566  C  CG  . GLU E  1 168 ? -18.008  19.576  -97.027  1.00 30.29  ? 149  GLU E CG  1 
ATOM   7567  C  CD  . GLU E  1 168 ? -17.961  18.055  -96.848  1.00 43.41  ? 149  GLU E CD  1 
ATOM   7568  O  OE1 . GLU E  1 168 ? -18.568  17.520  -95.882  1.00 46.98  ? 149  GLU E OE1 1 
ATOM   7569  O  OE2 . GLU E  1 168 ? -17.291  17.393  -97.688  1.00 48.02  ? 149  GLU E OE2 1 
ATOM   7570  N  N   . ILE E  1 169 ? -20.257  22.409  -94.206  1.00 26.76  ? 150  ILE E N   1 
ATOM   7571  C  CA  . ILE E  1 169 ? -21.343  23.098  -93.512  1.00 23.77  ? 150  ILE E CA  1 
ATOM   7572  C  C   . ILE E  1 169 ? -20.853  23.904  -92.324  1.00 24.85  ? 150  ILE E C   1 
ATOM   7573  O  O   . ILE E  1 169 ? -20.147  23.394  -91.449  1.00 36.93  ? 150  ILE E O   1 
ATOM   7574  C  CB  . ILE E  1 169 ? -22.421  22.118  -93.000  1.00 21.17  ? 150  ILE E CB  1 
ATOM   7575  C  CG1 . ILE E  1 169 ? -23.177  21.485  -94.162  1.00 21.63  ? 150  ILE E CG1 1 
ATOM   7576  C  CG2 . ILE E  1 169 ? -23.376  22.831  -92.074  1.00 18.42  ? 150  ILE E CG2 1 
ATOM   7577  C  CD1 . ILE E  1 169 ? -24.323  20.620  -93.731  1.00 26.53  ? 150  ILE E CD1 1 
ATOM   7578  N  N   . SER E  1 170 ? -21.244  25.163  -92.282  1.00 26.23  ? 151  SER E N   1 
ATOM   7579  C  CA  . SER E  1 170 ? -20.971  25.989  -91.109  1.00 37.29  ? 151  SER E CA  1 
ATOM   7580  C  C   . SER E  1 170 ? -22.298  26.405  -90.473  1.00 42.42  ? 151  SER E C   1 
ATOM   7581  O  O   . SER E  1 170 ? -23.230  26.837  -91.179  1.00 41.59  ? 151  SER E O   1 
ATOM   7582  C  CB  . SER E  1 170 ? -20.131  27.226  -91.468  1.00 37.18  ? 151  SER E CB  1 
ATOM   7583  O  OG  . SER E  1 170 ? -20.919  28.200  -92.138  1.00 34.91  ? 151  SER E OG  1 
ATOM   7584  N  N   . VAL E  1 171 ? -22.392  26.258  -89.151  1.00 40.15  ? 152  VAL E N   1 
ATOM   7585  C  CA  . VAL E  1 171 ? -23.616  26.642  -88.447  1.00 41.83  ? 152  VAL E CA  1 
ATOM   7586  C  C   . VAL E  1 171 ? -23.422  27.947  -87.693  1.00 43.66  ? 152  VAL E C   1 
ATOM   7587  O  O   . VAL E  1 171 ? -22.360  28.189  -87.103  1.00 46.73  ? 152  VAL E O   1 
ATOM   7588  C  CB  . VAL E  1 171 ? -24.110  25.549  -87.457  1.00 40.93  ? 152  VAL E CB  1 
ATOM   7589  C  CG1 . VAL E  1 171 ? -24.665  24.351  -88.215  1.00 36.76  ? 152  VAL E CG1 1 
ATOM   7590  C  CG2 . VAL E  1 171 ? -22.984  25.130  -86.524  1.00 43.64  ? 152  VAL E CG2 1 
ATOM   7591  N  N   . ASP E  1 172 ? -24.454  28.784  -87.707  1.00 39.52  ? 153  ASP E N   1 
ATOM   7592  C  CA  . ASP E  1 172 ? -24.409  30.059  -87.006  1.00 42.48  ? 153  ASP E CA  1 
ATOM   7593  C  C   . ASP E  1 172 ? -25.742  30.380  -86.345  1.00 47.03  ? 153  ASP E C   1 
ATOM   7594  O  O   . ASP E  1 172 ? -26.797  30.020  -86.865  1.00 52.69  ? 153  ASP E O   1 
ATOM   7595  C  CB  . ASP E  1 172 ? -24.022  31.171  -87.972  1.00 51.06  ? 153  ASP E CB  1 
ATOM   7596  C  CG  . ASP E  1 172 ? -22.636  30.962  -88.563  1.00 66.64  ? 153  ASP E CG  1 
ATOM   7597  O  OD1 . ASP E  1 172 ? -21.650  31.266  -87.841  1.00 69.40  ? 153  ASP E OD1 1 
ATOM   7598  O  OD2 . ASP E  1 172 ? -22.536  30.486  -89.733  1.00 70.93  ? 153  ASP E OD2 1 
ATOM   7599  N  N   . PRO E  1 173 ? -25.699  31.045  -85.180  1.00 59.81  ? 154  PRO E N   1 
ATOM   7600  C  CA  . PRO E  1 173 ? -26.915  31.519  -84.514  1.00 60.24  ? 154  PRO E CA  1 
ATOM   7601  C  C   . PRO E  1 173 ? -27.548  32.647  -85.312  1.00 72.94  ? 154  PRO E C   1 
ATOM   7602  O  O   . PRO E  1 173 ? -26.904  33.181  -86.218  1.00 75.16  ? 154  PRO E O   1 
ATOM   7603  C  CB  . PRO E  1 173 ? -26.392  32.070  -83.193  1.00 53.23  ? 154  PRO E CB  1 
ATOM   7604  C  CG  . PRO E  1 173 ? -25.075  31.395  -82.994  1.00 53.69  ? 154  PRO E CG  1 
ATOM   7605  C  CD  . PRO E  1 173 ? -24.500  31.268  -84.356  1.00 54.16  ? 154  PRO E CD  1 
ATOM   7606  N  N   . THR E  1 174 ? -28.786  33.006  -84.977  1.00 81.44  ? 155  THR E N   1 
ATOM   7607  C  CA  . THR E  1 174 ? -29.503  34.071  -85.684  1.00 82.82  ? 155  THR E CA  1 
ATOM   7608  C  C   . THR E  1 174 ? -29.454  35.395  -84.932  1.00 80.96  ? 155  THR E C   1 
ATOM   7609  O  O   . THR E  1 174 ? -29.030  36.410  -85.488  1.00 78.74  ? 155  THR E O   1 
ATOM   7610  C  CB  . THR E  1 174 ? -30.968  33.688  -85.947  1.00 83.84  ? 155  THR E CB  1 
ATOM   7611  O  OG1 . THR E  1 174 ? -31.020  32.702  -86.989  1.00 84.56  ? 155  THR E OG1 1 
ATOM   7612  C  CG2 . THR E  1 174 ? -31.784  34.914  -86.358  1.00 82.67  ? 155  THR E CG2 1 
ATOM   7613  N  N   . GLU E  1 182 ? -40.987  33.648  -76.166  1.00 79.75  ? 163  GLU E N   1 
ATOM   7614  C  CA  . GLU E  1 182 ? -41.710  34.494  -77.091  1.00 75.04  ? 163  GLU E CA  1 
ATOM   7615  C  C   . GLU E  1 182 ? -42.907  33.782  -77.610  1.00 67.81  ? 163  GLU E C   1 
ATOM   7616  O  O   . GLU E  1 182 ? -43.981  34.325  -77.596  1.00 69.33  ? 163  GLU E O   1 
ATOM   7617  C  CB  . GLU E  1 182 ? -40.842  34.898  -78.265  1.00 80.62  ? 163  GLU E CB  1 
ATOM   7618  C  CG  . GLU E  1 182 ? -41.598  35.584  -79.387  1.00 91.78  ? 163  GLU E CG  1 
ATOM   7619  C  CD  . GLU E  1 182 ? -40.799  35.620  -80.676  1.00 100.68 ? 163  GLU E CD  1 
ATOM   7620  O  OE1 . GLU E  1 182 ? -39.840  34.823  -80.785  1.00 104.71 ? 163  GLU E OE1 1 
ATOM   7621  O  OE2 . GLU E  1 182 ? -41.119  36.440  -81.578  1.00 99.97  ? 163  GLU E OE2 1 
ATOM   7622  N  N   . TYR E  1 183 ? -42.710  32.580  -78.122  1.00 61.34  ? 164  TYR E N   1 
ATOM   7623  C  CA  . TYR E  1 183 ? -43.813  31.722  -78.496  1.00 53.48  ? 164  TYR E CA  1 
ATOM   7624  C  C   . TYR E  1 183 ? -44.025  30.659  -77.453  1.00 43.92  ? 164  TYR E C   1 
ATOM   7625  O  O   . TYR E  1 183 ? -44.819  29.785  -77.629  1.00 38.87  ? 164  TYR E O   1 
ATOM   7626  C  CB  . TYR E  1 183 ? -43.596  31.070  -79.845  1.00 55.40  ? 164  TYR E CB  1 
ATOM   7627  C  CG  . TYR E  1 183 ? -43.351  32.002  -80.970  1.00 56.28  ? 164  TYR E CG  1 
ATOM   7628  C  CD1 . TYR E  1 183 ? -44.263  32.957  -81.301  1.00 60.33  ? 164  TYR E CD1 1 
ATOM   7629  C  CD2 . TYR E  1 183 ? -42.213  31.905  -81.716  1.00 58.70  ? 164  TYR E CD2 1 
ATOM   7630  C  CE1 . TYR E  1 183 ? -44.031  33.819  -82.331  1.00 66.61  ? 164  TYR E CE1 1 
ATOM   7631  C  CE2 . TYR E  1 183 ? -41.969  32.752  -82.746  1.00 64.68  ? 164  TYR E CE2 1 
ATOM   7632  C  CZ  . TYR E  1 183 ? -42.880  33.702  -83.047  1.00 72.30  ? 164  TYR E CZ  1 
ATOM   7633  O  OH  . TYR E  1 183 ? -42.620  34.540  -84.089  1.00 80.77  ? 164  TYR E OH  1 
ATOM   7634  N  N   . PHE E  1 184 ? -43.307  30.758  -76.357  1.00 33.92  ? 165  PHE E N   1 
ATOM   7635  C  CA  . PHE E  1 184 ? -43.436  29.814  -75.290  1.00 33.63  ? 165  PHE E CA  1 
ATOM   7636  C  C   . PHE E  1 184 ? -44.841  29.816  -74.758  1.00 44.51  ? 165  PHE E C   1 
ATOM   7637  O  O   . PHE E  1 184 ? -45.437  30.835  -74.595  1.00 43.43  ? 165  PHE E O   1 
ATOM   7638  C  CB  . PHE E  1 184 ? -42.410  30.106  -74.202  1.00 33.45  ? 165  PHE E CB  1 
ATOM   7639  C  CG  . PHE E  1 184 ? -42.136  28.952  -73.301  1.00 34.86  ? 165  PHE E CG  1 
ATOM   7640  C  CD1 . PHE E  1 184 ? -41.442  27.885  -73.746  1.00 33.02  ? 165  PHE E CD1 1 
ATOM   7641  C  CD2 . PHE E  1 184 ? -42.552  28.956  -72.016  1.00 32.98  ? 165  PHE E CD2 1 
ATOM   7642  C  CE1 . PHE E  1 184 ? -41.200  26.824  -72.954  1.00 32.74  ? 165  PHE E CE1 1 
ATOM   7643  C  CE2 . PHE E  1 184 ? -42.293  27.901  -71.204  1.00 36.64  ? 165  PHE E CE2 1 
ATOM   7644  C  CZ  . PHE E  1 184 ? -41.621  26.832  -71.672  1.00 35.15  ? 165  PHE E CZ  1 
ATOM   7645  N  N   . SER E  1 185 ? -45.367  28.643  -74.509  1.00 33.45  ? 166  SER E N   1 
ATOM   7646  C  CA  . SER E  1 185 ? -46.693  28.446  -73.917  1.00 43.32  ? 166  SER E CA  1 
ATOM   7647  C  C   . SER E  1 185 ? -46.823  29.030  -72.497  1.00 44.88  ? 166  SER E C   1 
ATOM   7648  O  O   . SER E  1 185 ? -45.997  28.763  -71.627  1.00 33.08  ? 166  SER E O   1 
ATOM   7649  C  CB  . SER E  1 185 ? -47.036  26.952  -73.903  1.00 40.85  ? 166  SER E CB  1 
ATOM   7650  O  OG  . SER E  1 185 ? -48.367  26.733  -73.471  1.00 42.69  ? 166  SER E OG  1 
ATOM   7651  N  N   . GLN E  1 186 ? -47.864  29.828  -72.271  1.00 51.97  ? 167  GLN E N   1 
ATOM   7652  C  CA  . GLN E  1 186 ? -48.139  30.373  -70.937  1.00 55.51  ? 167  GLN E CA  1 
ATOM   7653  C  C   . GLN E  1 186 ? -48.723  29.300  -70.034  1.00 49.13  ? 167  GLN E C   1 
ATOM   7654  O  O   . GLN E  1 186 ? -48.877  29.518  -68.837  1.00 47.32  ? 167  GLN E O   1 
ATOM   7655  C  CB  . GLN E  1 186 ? -49.120  31.538  -71.008  1.00 62.79  ? 167  GLN E CB  1 
ATOM   7656  C  CG  . GLN E  1 186 ? -50.477  31.141  -71.555  1.00 71.50  ? 167  GLN E CG  1 
ATOM   7657  C  CD  . GLN E  1 186 ? -51.463  32.294  -71.588  1.00 80.43  ? 167  GLN E CD  1 
ATOM   7658  O  OE1 . GLN E  1 186 ? -52.093  32.563  -72.615  1.00 86.40  ? 167  GLN E OE1 1 
ATOM   7659  N  NE2 . GLN E  1 186 ? -51.611  32.976  -70.459  1.00 81.35  ? 167  GLN E NE2 1 
ATOM   7660  N  N   . TYR E  1 187 ? -49.048  28.142  -70.609  1.00 46.05  ? 168  TYR E N   1 
ATOM   7661  C  CA  . TYR E  1 187 ? -49.666  27.065  -69.840  1.00 44.97  ? 168  TYR E CA  1 
ATOM   7662  C  C   . TYR E  1 187 ? -48.671  26.004  -69.400  1.00 43.33  ? 168  TYR E C   1 
ATOM   7663  O  O   . TYR E  1 187 ? -49.051  25.001  -68.797  1.00 42.28  ? 168  TYR E O   1 
ATOM   7664  C  CB  . TYR E  1 187 ? -50.828  26.449  -70.609  1.00 48.55  ? 168  TYR E CB  1 
ATOM   7665  C  CG  . TYR E  1 187 ? -51.844  27.490  -70.993  1.00 55.23  ? 168  TYR E CG  1 
ATOM   7666  C  CD1 . TYR E  1 187 ? -52.513  28.223  -70.013  1.00 59.66  ? 168  TYR E CD1 1 
ATOM   7667  C  CD2 . TYR E  1 187 ? -52.127  27.759  -72.328  1.00 53.28  ? 168  TYR E CD2 1 
ATOM   7668  C  CE1 . TYR E  1 187 ? -53.441  29.199  -70.355  1.00 63.97  ? 168  TYR E CE1 1 
ATOM   7669  C  CE2 . TYR E  1 187 ? -53.052  28.726  -72.677  1.00 59.05  ? 168  TYR E CE2 1 
ATOM   7670  C  CZ  . TYR E  1 187 ? -53.711  29.441  -71.689  1.00 66.17  ? 168  TYR E CZ  1 
ATOM   7671  O  OH  . TYR E  1 187 ? -54.636  30.405  -72.036  1.00 71.06  ? 168  TYR E OH  1 
ATOM   7672  N  N   . SER E  1 188 ? -47.395  26.233  -69.692  1.00 42.78  ? 169  SER E N   1 
ATOM   7673  C  CA  . SER E  1 188 ? -46.339  25.349  -69.209  1.00 40.68  ? 169  SER E CA  1 
ATOM   7674  C  C   . SER E  1 188 ? -46.218  25.519  -67.691  1.00 39.63  ? 169  SER E C   1 
ATOM   7675  O  O   . SER E  1 188 ? -46.523  26.582  -67.162  1.00 44.08  ? 169  SER E O   1 
ATOM   7676  C  CB  . SER E  1 188 ? -45.004  25.690  -69.894  1.00 36.32  ? 169  SER E CB  1 
ATOM   7677  O  OG  . SER E  1 188 ? -43.982  24.800  -69.490  1.00 34.51  ? 169  SER E OG  1 
ATOM   7678  N  N   . ARG E  1 189 ? -45.779  24.471  -66.999  1.00 35.63  ? 170  ARG E N   1 
ATOM   7679  C  CA  . ARG E  1 189 ? -45.403  24.542  -65.593  1.00 36.93  ? 170  ARG E CA  1 
ATOM   7680  C  C   . ARG E  1 189 ? -44.124  25.339  -65.440  1.00 43.49  ? 170  ARG E C   1 
ATOM   7681  O  O   . ARG E  1 189 ? -43.683  25.641  -64.324  1.00 52.75  ? 170  ARG E O   1 
ATOM   7682  C  CB  . ARG E  1 189 ? -45.124  23.138  -65.036  1.00 38.24  ? 170  ARG E CB  1 
ATOM   7683  C  CG  . ARG E  1 189 ? -46.253  22.138  -65.205  1.00 45.50  ? 170  ARG E CG  1 
ATOM   7684  C  CD  . ARG E  1 189 ? -46.431  21.288  -63.950  1.00 51.67  ? 170  ARG E CD  1 
ATOM   7685  N  NE  . ARG E  1 189 ? -45.383  20.282  -63.752  1.00 57.48  ? 170  ARG E NE  1 
ATOM   7686  C  CZ  . ARG E  1 189 ? -45.054  19.785  -62.561  1.00 67.26  ? 170  ARG E CZ  1 
ATOM   7687  N  NH1 . ARG E  1 189 ? -45.674  20.216  -61.472  1.00 71.77  ? 170  ARG E NH1 1 
ATOM   7688  N  NH2 . ARG E  1 189 ? -44.102  18.871  -62.449  1.00 69.58  ? 170  ARG E NH2 1 
ATOM   7689  N  N   . PHE E  1 190 ? -43.511  25.659  -66.567  1.00 23.36  ? 171  PHE E N   1 
ATOM   7690  C  CA  . PHE E  1 190 ? -42.187  26.256  -66.578  1.00 28.16  ? 171  PHE E CA  1 
ATOM   7691  C  C   . PHE E  1 190 ? -42.199  27.593  -67.271  1.00 30.48  ? 171  PHE E C   1 
ATOM   7692  O  O   . PHE E  1 190 ? -43.109  27.882  -68.062  1.00 34.65  ? 171  PHE E O   1 
ATOM   7693  C  CB  . PHE E  1 190 ? -41.186  25.318  -67.264  1.00 30.25  ? 171  PHE E CB  1 
ATOM   7694  C  CG  . PHE E  1 190 ? -41.149  23.949  -66.649  1.00 32.55  ? 171  PHE E CG  1 
ATOM   7695  C  CD1 . PHE E  1 190 ? -42.058  22.964  -67.045  1.00 32.56  ? 171  PHE E CD1 1 
ATOM   7696  C  CD2 . PHE E  1 190 ? -40.239  23.660  -65.642  1.00 32.88  ? 171  PHE E CD2 1 
ATOM   7697  C  CE1 . PHE E  1 190 ? -42.050  21.706  -66.451  1.00 37.36  ? 171  PHE E CE1 1 
ATOM   7698  C  CE2 . PHE E  1 190 ? -40.223  22.402  -65.034  1.00 37.61  ? 171  PHE E CE2 1 
ATOM   7699  C  CZ  . PHE E  1 190 ? -41.135  21.420  -65.434  1.00 37.63  ? 171  PHE E CZ  1 
ATOM   7700  N  N   . GLU E  1 191 ? -41.177  28.391  -66.955  1.00 29.31  ? 172  GLU E N   1 
ATOM   7701  C  CA  . GLU E  1 191 ? -40.979  29.705  -67.543  1.00 31.24  ? 172  GLU E CA  1 
ATOM   7702  C  C   . GLU E  1 191 ? -39.532  29.856  -67.994  1.00 33.82  ? 172  GLU E C   1 
ATOM   7703  O  O   . GLU E  1 191 ? -38.628  29.243  -67.416  1.00 36.69  ? 172  GLU E O   1 
ATOM   7704  C  CB  . GLU E  1 191 ? -41.363  30.806  -66.557  1.00 39.13  ? 172  GLU E CB  1 
ATOM   7705  C  CG  . GLU E  1 191 ? -40.343  31.183  -65.498  1.00 46.66  ? 172  GLU E CG  1 
ATOM   7706  C  CD  . GLU E  1 191 ? -40.879  32.333  -64.678  1.00 59.00  ? 172  GLU E CD  1 
ATOM   7707  O  OE1 . GLU E  1 191 ? -41.840  32.958  -65.173  1.00 65.09  ? 172  GLU E OE1 1 
ATOM   7708  O  OE2 . GLU E  1 191 ? -40.387  32.604  -63.558  1.00 60.97  ? 172  GLU E OE2 1 
ATOM   7709  N  N   . ILE E  1 192 ? -39.315  30.643  -69.043  1.00 30.92  ? 173  ILE E N   1 
ATOM   7710  C  CA  . ILE E  1 192 ? -37.969  30.799  -69.574  1.00 31.53  ? 173  ILE E CA  1 
ATOM   7711  C  C   . ILE E  1 192 ? -37.378  32.105  -69.092  1.00 32.95  ? 173  ILE E C   1 
ATOM   7712  O  O   . ILE E  1 192 ? -37.990  33.168  -69.245  1.00 38.84  ? 173  ILE E O   1 
ATOM   7713  C  CB  . ILE E  1 192 ? -37.956  30.776  -71.110  1.00 31.15  ? 173  ILE E CB  1 
ATOM   7714  C  CG1 . ILE E  1 192 ? -38.481  29.434  -71.608  1.00 31.71  ? 173  ILE E CG1 1 
ATOM   7715  C  CG2 . ILE E  1 192 ? -36.552  31.051  -71.620  1.00 31.59  ? 173  ILE E CG2 1 
ATOM   7716  C  CD1 . ILE E  1 192 ? -38.304  29.229  -73.077  1.00 36.39  ? 173  ILE E CD1 1 
ATOM   7717  N  N   . LEU E  1 193 ? -36.189  32.026  -68.508  1.00 30.35  ? 174  LEU E N   1 
ATOM   7718  C  CA  . LEU E  1 193 ? -35.532  33.220  -67.981  1.00 34.42  ? 174  LEU E CA  1 
ATOM   7719  C  C   . LEU E  1 193 ? -34.654  33.829  -69.060  1.00 43.38  ? 174  LEU E C   1 
ATOM   7720  O  O   . LEU E  1 193 ? -34.695  35.035  -69.315  1.00 49.69  ? 174  LEU E O   1 
ATOM   7721  C  CB  . LEU E  1 193 ? -34.703  32.885  -66.736  1.00 27.66  ? 174  LEU E CB  1 
ATOM   7722  C  CG  . LEU E  1 193 ? -35.476  32.100  -65.682  1.00 29.29  ? 174  LEU E CG  1 
ATOM   7723  C  CD1 . LEU E  1 193 ? -34.578  31.744  -64.506  1.00 33.63  ? 174  LEU E CD1 1 
ATOM   7724  C  CD2 . LEU E  1 193 ? -36.724  32.861  -65.227  1.00 26.58  ? 174  LEU E CD2 1 
ATOM   7725  N  N   . ASP E  1 194 ? -33.866  32.982  -69.710  1.00 42.58  ? 175  ASP E N   1 
ATOM   7726  C  CA  . ASP E  1 194 ? -32.961  33.453  -70.748  1.00 41.89  ? 175  ASP E CA  1 
ATOM   7727  C  C   . ASP E  1 194 ? -32.592  32.355  -71.770  1.00 37.03  ? 175  ASP E C   1 
ATOM   7728  O  O   . ASP E  1 194 ? -32.547  31.169  -71.446  1.00 31.56  ? 175  ASP E O   1 
ATOM   7729  C  CB  . ASP E  1 194 ? -31.708  34.052  -70.104  1.00 47.86  ? 175  ASP E CB  1 
ATOM   7730  C  CG  . ASP E  1 194 ? -30.927  34.946  -71.059  1.00 61.67  ? 175  ASP E CG  1 
ATOM   7731  O  OD1 . ASP E  1 194 ? -31.552  35.515  -71.982  1.00 67.34  ? 175  ASP E OD1 1 
ATOM   7732  O  OD2 . ASP E  1 194 ? -29.691  35.083  -70.889  1.00 67.03  ? 175  ASP E OD2 1 
ATOM   7733  N  N   . VAL E  1 195 ? -32.365  32.762  -73.017  1.00 35.01  ? 176  VAL E N   1 
ATOM   7734  C  CA  . VAL E  1 195 ? -31.819  31.865  -74.020  1.00 34.64  ? 176  VAL E CA  1 
ATOM   7735  C  C   . VAL E  1 195 ? -30.569  32.483  -74.620  1.00 34.15  ? 176  VAL E C   1 
ATOM   7736  O  O   . VAL E  1 195 ? -30.632  33.559  -75.205  1.00 38.27  ? 176  VAL E O   1 
ATOM   7737  C  CB  . VAL E  1 195 ? -32.829  31.575  -75.146  1.00 36.15  ? 176  VAL E CB  1 
ATOM   7738  C  CG1 . VAL E  1 195 ? -32.212  30.648  -76.215  1.00 31.94  ? 176  VAL E CG1 1 
ATOM   7739  C  CG2 . VAL E  1 195 ? -34.101  30.948  -74.573  1.00 34.55  ? 176  VAL E CG2 1 
ATOM   7740  N  N   . THR E  1 196 ? -29.433  31.810  -74.461  1.00 29.82  ? 177  THR E N   1 
ATOM   7741  C  CA  . THR E  1 196 ? -28.205  32.247  -75.117  1.00 35.78  ? 177  THR E CA  1 
ATOM   7742  C  C   . THR E  1 196 ? -27.691  31.189  -76.111  1.00 41.37  ? 177  THR E C   1 
ATOM   7743  O  O   . THR E  1 196 ? -27.873  29.978  -75.926  1.00 40.23  ? 177  THR E O   1 
ATOM   7744  C  CB  . THR E  1 196 ? -27.109  32.603  -74.104  1.00 36.44  ? 177  THR E CB  1 
ATOM   7745  O  OG1 . THR E  1 196 ? -26.669  31.407  -73.452  1.00 41.68  ? 177  THR E OG1 1 
ATOM   7746  C  CG2 . THR E  1 196 ? -27.645  33.578  -73.077  1.00 36.60  ? 177  THR E CG2 1 
ATOM   7747  N  N   . GLN E  1 197 ? -27.049  31.658  -77.171  1.00 46.90  ? 178  GLN E N   1 
ATOM   7748  C  CA  . GLN E  1 197 ? -26.531  30.768  -78.196  1.00 49.76  ? 178  GLN E CA  1 
ATOM   7749  C  C   . GLN E  1 197 ? -25.017  30.978  -78.338  1.00 51.19  ? 178  GLN E C   1 
ATOM   7750  O  O   . GLN E  1 197 ? -24.508  32.084  -78.198  1.00 53.08  ? 178  GLN E O   1 
ATOM   7751  C  CB  . GLN E  1 197 ? -27.274  30.991  -79.528  1.00 51.11  ? 178  GLN E CB  1 
ATOM   7752  C  CG  . GLN E  1 197 ? -28.814  30.918  -79.421  1.00 61.77  ? 178  GLN E CG  1 
ATOM   7753  C  CD  . GLN E  1 197 ? -29.501  30.432  -80.719  1.00 76.45  ? 178  GLN E CD  1 
ATOM   7754  O  OE1 . GLN E  1 197 ? -28.888  30.424  -81.798  1.00 81.92  ? 178  GLN E OE1 1 
ATOM   7755  N  NE2 . GLN E  1 197 ? -30.780  30.018  -80.609  1.00 75.54  ? 178  GLN E NE2 1 
ATOM   7756  N  N   . LYS E  1 198 ? -24.287  29.910  -78.597  1.00 51.88  ? 179  LYS E N   1 
ATOM   7757  C  CA  . LYS E  1 198 ? -22.850  30.013  -78.782  1.00 49.12  ? 179  LYS E CA  1 
ATOM   7758  C  C   . LYS E  1 198 ? -22.454  29.030  -79.876  1.00 43.92  ? 179  LYS E C   1 
ATOM   7759  O  O   . LYS E  1 198 ? -23.056  27.962  -80.017  1.00 42.53  ? 179  LYS E O   1 
ATOM   7760  C  CB  . LYS E  1 198 ? -22.135  29.711  -77.462  1.00 51.69  ? 179  LYS E CB  1 
ATOM   7761  C  CG  . LYS E  1 198 ? -20.731  29.156  -77.587  1.00 52.51  ? 179  LYS E CG  1 
ATOM   7762  C  CD  . LYS E  1 198 ? -20.132  28.880  -76.215  1.00 52.70  ? 179  LYS E CD  1 
ATOM   7763  C  CE  . LYS E  1 198 ? -18.659  28.494  -76.307  1.00 54.20  ? 179  LYS E CE  1 
ATOM   7764  N  NZ  . LYS E  1 198 ? -17.921  28.739  -75.020  1.00 54.24  ? 179  LYS E NZ  1 
ATOM   7765  N  N   . LYS E  1 199 ? -21.466  29.413  -80.670  1.00 44.23  ? 180  LYS E N   1 
ATOM   7766  C  CA  . LYS E  1 199 ? -20.990  28.590  -81.772  1.00 38.97  ? 180  LYS E CA  1 
ATOM   7767  C  C   . LYS E  1 199 ? -19.666  27.919  -81.404  1.00 31.77  ? 180  LYS E C   1 
ATOM   7768  O  O   . LYS E  1 199 ? -18.785  28.559  -80.830  1.00 30.87  ? 180  LYS E O   1 
ATOM   7769  C  CB  . LYS E  1 199 ? -20.815  29.449  -83.031  1.00 36.92  ? 180  LYS E CB  1 
ATOM   7770  C  CG  . LYS E  1 199 ? -20.107  28.711  -84.152  1.00 47.01  ? 180  LYS E CG  1 
ATOM   7771  C  CD  . LYS E  1 199 ? -19.952  29.579  -85.357  1.00 51.80  ? 180  LYS E CD  1 
ATOM   7772  C  CE  . LYS E  1 199 ? -19.038  28.927  -86.354  1.00 57.34  ? 180  LYS E CE  1 
ATOM   7773  N  NZ  . LYS E  1 199 ? -19.152  29.571  -87.706  1.00 61.91  ? 180  LYS E NZ  1 
ATOM   7774  N  N   . ASN E  1 200 ? -19.540  26.633  -81.732  1.00 24.25  ? 181  ASN E N   1 
ATOM   7775  C  CA  . ASN E  1 200 ? -18.326  25.874  -81.468  1.00 26.37  ? 181  ASN E CA  1 
ATOM   7776  C  C   . ASN E  1 200 ? -17.828  25.124  -82.693  1.00 34.22  ? 181  ASN E C   1 
ATOM   7777  O  O   . ASN E  1 200 ? -18.556  24.918  -83.672  1.00 38.99  ? 181  ASN E O   1 
ATOM   7778  C  CB  . ASN E  1 200 ? -18.546  24.856  -80.340  1.00 37.09  ? 181  ASN E CB  1 
ATOM   7779  C  CG  . ASN E  1 200 ? -18.970  25.500  -79.047  1.00 47.31  ? 181  ASN E CG  1 
ATOM   7780  O  OD1 . ASN E  1 200 ? -18.162  26.148  -78.360  1.00 50.68  ? 181  ASN E OD1 1 
ATOM   7781  N  ND2 . ASN E  1 200 ? -20.243  25.325  -78.695  1.00 48.65  ? 181  ASN E ND2 1 
ATOM   7782  N  N   . SER E  1 201 ? -16.575  24.696  -82.616  1.00 36.59  ? 182  SER E N   1 
ATOM   7783  C  CA  . SER E  1 201 ? -15.941  23.956  -83.689  1.00 32.81  ? 182  SER E CA  1 
ATOM   7784  C  C   . SER E  1 201 ? -15.122  22.863  -83.049  1.00 32.10  ? 182  SER E C   1 
ATOM   7785  O  O   . SER E  1 201 ? -14.117  23.140  -82.401  1.00 34.45  ? 182  SER E O   1 
ATOM   7786  C  CB  . SER E  1 201 ? -15.035  24.869  -84.506  1.00 35.12  ? 182  SER E CB  1 
ATOM   7787  O  OG  . SER E  1 201 ? -14.473  24.174  -85.608  1.00 40.63  ? 182  SER E OG  1 
ATOM   7788  N  N   . VAL E  1 202 ? -15.556  21.618  -83.230  1.00 28.93  ? 183  VAL E N   1 
ATOM   7789  C  CA  . VAL E  1 202 ? -14.983  20.517  -82.480  1.00 25.33  ? 183  VAL E CA  1 
ATOM   7790  C  C   . VAL E  1 202 ? -14.339  19.504  -83.417  1.00 32.45  ? 183  VAL E C   1 
ATOM   7791  O  O   . VAL E  1 202 ? -14.874  19.214  -84.491  1.00 45.24  ? 183  VAL E O   1 
ATOM   7792  C  CB  . VAL E  1 202 ? -16.067  19.816  -81.599  1.00 26.99  ? 183  VAL E CB  1 
ATOM   7793  C  CG1 . VAL E  1 202 ? -15.498  18.609  -80.862  1.00 17.41  ? 183  VAL E CG1 1 
ATOM   7794  C  CG2 . VAL E  1 202 ? -16.690  20.797  -80.633  1.00 17.22  ? 183  VAL E CG2 1 
ATOM   7795  N  N   . THR E  1 203 ? -13.196  18.961  -83.001  1.00 25.61  ? 184  THR E N   1 
ATOM   7796  C  CA  . THR E  1 203 ? -12.598  17.842  -83.690  1.00 18.28  ? 184  THR E CA  1 
ATOM   7797  C  C   . THR E  1 203 ? -12.920  16.546  -82.974  1.00 27.71  ? 184  THR E C   1 
ATOM   7798  O  O   . THR E  1 203 ? -12.830  16.476  -81.751  1.00 36.82  ? 184  THR E O   1 
ATOM   7799  C  CB  . THR E  1 203 ? -11.109  18.033  -83.830  1.00 28.46  ? 184  THR E CB  1 
ATOM   7800  O  OG1 . THR E  1 203 ? -10.894  19.303  -84.460  1.00 25.55  ? 184  THR E OG1 1 
ATOM   7801  C  CG2 . THR E  1 203 ? -10.507  16.913  -84.721  1.00 65.44  ? 184  THR E CG2 1 
ATOM   7802  N  N   . TYR E  1 204 ? -13.306  15.529  -83.742  1.00 20.67  ? 185  TYR E N   1 
ATOM   7803  C  CA  . TYR E  1 204 ? -13.673  14.221  -83.203  1.00 21.28  ? 185  TYR E CA  1 
ATOM   7804  C  C   . TYR E  1 204 ? -12.617  13.180  -83.555  1.00 27.76  ? 185  TYR E C   1 
ATOM   7805  O  O   . TYR E  1 204 ? -11.912  13.345  -84.534  1.00 32.85  ? 185  TYR E O   1 
ATOM   7806  C  CB  . TYR E  1 204 ? -15.065  13.805  -83.719  1.00 18.08  ? 185  TYR E CB  1 
ATOM   7807  C  CG  . TYR E  1 204 ? -16.140  14.778  -83.299  1.00 22.16  ? 185  TYR E CG  1 
ATOM   7808  C  CD1 . TYR E  1 204 ? -16.333  15.973  -83.989  1.00 25.76  ? 185  TYR E CD1 1 
ATOM   7809  C  CD2 . TYR E  1 204 ? -16.947  14.517  -82.193  1.00 24.91  ? 185  TYR E CD2 1 
ATOM   7810  C  CE1 . TYR E  1 204 ? -17.327  16.880  -83.594  1.00 32.12  ? 185  TYR E CE1 1 
ATOM   7811  C  CE2 . TYR E  1 204 ? -17.931  15.413  -81.791  1.00 27.13  ? 185  TYR E CE2 1 
ATOM   7812  C  CZ  . TYR E  1 204 ? -18.122  16.590  -82.486  1.00 28.39  ? 185  TYR E CZ  1 
ATOM   7813  O  OH  . TYR E  1 204 ? -19.096  17.477  -82.069  1.00 29.78  ? 185  TYR E OH  1 
ATOM   7814  N  N   . SER E  1 205 ? -12.517  12.122  -82.753  1.00 34.99  ? 186  SER E N   1 
ATOM   7815  C  CA  . SER E  1 205 ? -11.485  11.102  -82.912  1.00 35.17  ? 186  SER E CA  1 
ATOM   7816  C  C   . SER E  1 205 ? -11.508  10.476  -84.287  1.00 36.91  ? 186  SER E C   1 
ATOM   7817  O  O   . SER E  1 205 ? -10.455  10.200  -84.868  1.00 37.21  ? 186  SER E O   1 
ATOM   7818  C  CB  . SER E  1 205 ? -11.682  10.016  -81.867  1.00 41.08  ? 186  SER E CB  1 
ATOM   7819  O  OG  . SER E  1 205 ? -11.535  10.579  -80.581  1.00 46.66  ? 186  SER E OG  1 
ATOM   7820  N  N   . CYS E  1 206 ? -12.719  10.272  -84.804  1.00 37.15  ? 187  CYS E N   1 
ATOM   7821  C  CA  . CYS E  1 206 ? -12.937  9.540   -86.057  1.00 36.06  ? 187  CYS E CA  1 
ATOM   7822  C  C   . CYS E  1 206 ? -12.280  10.225  -87.268  1.00 38.35  ? 187  CYS E C   1 
ATOM   7823  O  O   . CYS E  1 206 ? -11.756  9.573   -88.165  1.00 41.04  ? 187  CYS E O   1 
ATOM   7824  C  CB  . CYS E  1 206 ? -14.452  9.369   -86.314  1.00 29.07  ? 187  CYS E CB  1 
ATOM   7825  S  SG  . CYS E  1 206 ? -15.270  10.843  -86.992  1.00 96.02  ? 187  CYS E SG  1 
ATOM   7826  N  N   . CYS E  1 207 ? -12.311  11.551  -87.276  1.00 38.10  ? 188  CYS E N   1 
ATOM   7827  C  CA  . CYS E  1 207 ? -12.068  12.320  -88.488  1.00 32.76  ? 188  CYS E CA  1 
ATOM   7828  C  C   . CYS E  1 207 ? -11.100  13.459  -88.212  1.00 40.48  ? 188  CYS E C   1 
ATOM   7829  O  O   . CYS E  1 207 ? -11.032  13.992  -87.093  1.00 42.61  ? 188  CYS E O   1 
ATOM   7830  C  CB  . CYS E  1 207 ? -13.392  12.877  -89.017  1.00 27.08  ? 188  CYS E CB  1 
ATOM   7831  S  SG  . CYS E  1 207 ? -14.834  11.746  -88.804  1.00 55.60  ? 188  CYS E SG  1 
ATOM   7832  N  N   . PRO E  1 208 ? -10.345  13.841  -89.247  1.00 44.67  ? 189  PRO E N   1 
ATOM   7833  C  CA  . PRO E  1 208 ? -9.319   14.892  -89.139  1.00 44.44  ? 189  PRO E CA  1 
ATOM   7834  C  C   . PRO E  1 208 ? -9.855   16.322  -89.192  1.00 33.83  ? 189  PRO E C   1 
ATOM   7835  O  O   . PRO E  1 208 ? -9.153   17.254  -88.781  1.00 27.87  ? 189  PRO E O   1 
ATOM   7836  C  CB  . PRO E  1 208 ? -8.425   14.636  -90.375  1.00 39.57  ? 189  PRO E CB  1 
ATOM   7837  C  CG  . PRO E  1 208 ? -9.333   13.995  -91.369  1.00 29.68  ? 189  PRO E CG  1 
ATOM   7838  C  CD  . PRO E  1 208 ? -10.345  13.190  -90.578  1.00 36.46  ? 189  PRO E CD  1 
ATOM   7839  N  N   . GLU E  1 209 ? -11.066  16.497  -89.708  1.00 31.72  ? 190  GLU E N   1 
ATOM   7840  C  CA  . GLU E  1 209 ? -11.632  17.836  -89.884  1.00 29.73  ? 190  GLU E CA  1 
ATOM   7841  C  C   . GLU E  1 209 ? -12.490  18.236  -88.704  1.00 29.95  ? 190  GLU E C   1 
ATOM   7842  O  O   . GLU E  1 209 ? -12.879  17.395  -87.878  1.00 42.63  ? 190  GLU E O   1 
ATOM   7843  C  CB  . GLU E  1 209 ? -12.481  17.918  -91.149  1.00 31.45  ? 190  GLU E CB  1 
ATOM   7844  C  CG  . GLU E  1 209 ? -11.842  17.330  -92.378  1.00 40.34  ? 190  GLU E CG  1 
ATOM   7845  C  CD  . GLU E  1 209 ? -12.117  15.828  -92.554  1.00 54.19  ? 190  GLU E CD  1 
ATOM   7846  O  OE1 . GLU E  1 209 ? -12.788  15.209  -91.687  1.00 53.99  ? 190  GLU E OE1 1 
ATOM   7847  O  OE2 . GLU E  1 209 ? -11.662  15.268  -93.584  1.00 63.46  ? 190  GLU E OE2 1 
ATOM   7848  N  N   . ALA E  1 210 ? -12.769  19.530  -88.617  1.00 28.00  ? 191  ALA E N   1 
ATOM   7849  C  CA  . ALA E  1 210 ? -13.552  20.066  -87.512  1.00 29.22  ? 191  ALA E CA  1 
ATOM   7850  C  C   . ALA E  1 210 ? -15.013  20.221  -87.922  1.00 35.46  ? 191  ALA E C   1 
ATOM   7851  O  O   . ALA E  1 210 ? -15.333  20.691  -89.029  1.00 25.10  ? 191  ALA E O   1 
ATOM   7852  C  CB  . ALA E  1 210 ? -12.990  21.395  -87.064  1.00 26.58  ? 191  ALA E CB  1 
ATOM   7853  N  N   . TYR E  1 211 ? -15.896  19.835  -87.014  1.00 25.03  ? 192  TYR E N   1 
ATOM   7854  C  CA  . TYR E  1 211 ? -17.325  19.959  -87.229  1.00 25.00  ? 192  TYR E CA  1 
ATOM   7855  C  C   . TYR E  1 211 ? -17.864  21.074  -86.360  1.00 39.37  ? 192  TYR E C   1 
ATOM   7856  O  O   . TYR E  1 211 ? -17.536  21.177  -85.156  1.00 43.85  ? 192  TYR E O   1 
ATOM   7857  C  CB  . TYR E  1 211 ? -18.036  18.634  -86.914  1.00 30.95  ? 192  TYR E CB  1 
ATOM   7858  C  CG  . TYR E  1 211 ? -17.712  17.535  -87.893  1.00 29.16  ? 192  TYR E CG  1 
ATOM   7859  C  CD1 . TYR E  1 211 ? -16.465  16.924  -87.896  1.00 31.36  ? 192  TYR E CD1 1 
ATOM   7860  C  CD2 . TYR E  1 211 ? -18.642  17.124  -88.828  1.00 33.54  ? 192  TYR E CD2 1 
ATOM   7861  C  CE1 . TYR E  1 211 ? -16.157  15.925  -88.792  1.00 35.08  ? 192  TYR E CE1 1 
ATOM   7862  C  CE2 . TYR E  1 211 ? -18.343  16.121  -89.745  1.00 37.70  ? 192  TYR E CE2 1 
ATOM   7863  C  CZ  . TYR E  1 211 ? -17.100  15.527  -89.724  1.00 42.68  ? 192  TYR E CZ  1 
ATOM   7864  O  OH  . TYR E  1 211 ? -16.806  14.532  -90.637  1.00 48.24  ? 192  TYR E OH  1 
ATOM   7865  N  N   . GLU E  1 212 ? -18.685  21.921  -86.962  1.00 36.01  ? 193  GLU E N   1 
ATOM   7866  C  CA  . GLU E  1 212 ? -19.285  23.035  -86.229  1.00 35.58  ? 193  GLU E CA  1 
ATOM   7867  C  C   . GLU E  1 212 ? -20.603  22.649  -85.571  1.00 34.41  ? 193  GLU E C   1 
ATOM   7868  O  O   . GLU E  1 212 ? -21.332  21.765  -86.057  1.00 34.50  ? 193  GLU E O   1 
ATOM   7869  C  CB  . GLU E  1 212 ? -19.488  24.240  -87.153  1.00 25.82  ? 193  GLU E CB  1 
ATOM   7870  C  CG  . GLU E  1 212 ? -18.208  24.752  -87.758  1.00 25.92  ? 193  GLU E CG  1 
ATOM   7871  C  CD  . GLU E  1 212 ? -18.369  26.119  -88.375  1.00 40.00  ? 193  GLU E CD  1 
ATOM   7872  O  OE1 . GLU E  1 212 ? -19.520  26.618  -88.416  1.00 26.23  ? 193  GLU E OE1 1 
ATOM   7873  O  OE2 . GLU E  1 212 ? -17.340  26.691  -88.808  1.00 38.58  ? 193  GLU E OE2 1 
ATOM   7874  N  N   . ASP E  1 213 ? -20.900  23.310  -84.458  1.00 40.02  ? 194  ASP E N   1 
ATOM   7875  C  CA  . ASP E  1 213 ? -22.181  23.112  -83.752  1.00 47.47  ? 194  ASP E CA  1 
ATOM   7876  C  C   . ASP E  1 213 ? -22.641  24.413  -83.113  1.00 41.48  ? 194  ASP E C   1 
ATOM   7877  O  O   . ASP E  1 213 ? -21.861  25.350  -82.924  1.00 26.22  ? 194  ASP E O   1 
ATOM   7878  C  CB  . ASP E  1 213 ? -22.110  22.004  -82.683  1.00 52.64  ? 194  ASP E CB  1 
ATOM   7879  C  CG  . ASP E  1 213 ? -21.248  22.397  -81.490  1.00 63.29  ? 194  ASP E CG  1 
ATOM   7880  O  OD1 . ASP E  1 213 ? -21.718  23.182  -80.638  1.00 65.65  ? 194  ASP E OD1 1 
ATOM   7881  O  OD2 . ASP E  1 213 ? -20.094  21.921  -81.399  1.00 70.15  ? 194  ASP E OD2 1 
ATOM   7882  N  N   . VAL E  1 214 ? -23.924  24.476  -82.805  1.00 35.70  ? 195  VAL E N   1 
ATOM   7883  C  CA  . VAL E  1 214 ? -24.430  25.588  -82.038  1.00 31.89  ? 195  VAL E CA  1 
ATOM   7884  C  C   . VAL E  1 214 ? -24.871  25.012  -80.704  1.00 31.36  ? 195  VAL E C   1 
ATOM   7885  O  O   . VAL E  1 214 ? -25.540  23.972  -80.656  1.00 30.90  ? 195  VAL E O   1 
ATOM   7886  C  CB  . VAL E  1 214 ? -25.585  26.298  -82.760  1.00 34.30  ? 195  VAL E CB  1 
ATOM   7887  C  CG1 . VAL E  1 214 ? -26.262  27.292  -81.842  1.00 36.66  ? 195  VAL E CG1 1 
ATOM   7888  C  CG2 . VAL E  1 214 ? -25.071  27.018  -83.980  1.00 38.70  ? 195  VAL E CG2 1 
ATOM   7889  N  N   . GLU E  1 215 ? -24.462  25.663  -79.622  1.00 36.25  ? 196  GLU E N   1 
ATOM   7890  C  CA  . GLU E  1 215 ? -24.969  25.309  -78.291  1.00 48.17  ? 196  GLU E CA  1 
ATOM   7891  C  C   . GLU E  1 215 ? -25.985  26.342  -77.849  1.00 46.98  ? 196  GLU E C   1 
ATOM   7892  O  O   . GLU E  1 215 ? -25.645  27.489  -77.554  1.00 59.40  ? 196  GLU E O   1 
ATOM   7893  C  CB  . GLU E  1 215 ? -23.844  25.159  -77.241  1.00 52.09  ? 196  GLU E CB  1 
ATOM   7894  C  CG  . GLU E  1 215 ? -23.172  23.786  -77.260  1.00 61.14  ? 196  GLU E CG  1 
ATOM   7895  C  CD  . GLU E  1 215 ? -21.930  23.706  -76.390  1.00 74.10  ? 196  GLU E CD  1 
ATOM   7896  O  OE1 . GLU E  1 215 ? -21.616  24.697  -75.679  1.00 80.80  ? 196  GLU E OE1 1 
ATOM   7897  O  OE2 . GLU E  1 215 ? -21.266  22.644  -76.426  1.00 76.46  ? 196  GLU E OE2 1 
ATOM   7898  N  N   . VAL E  1 216 ? -27.242  25.939  -77.826  1.00 33.78  ? 197  VAL E N   1 
ATOM   7899  C  CA  . VAL E  1 216 ? -28.277  26.786  -77.273  1.00 30.13  ? 197  VAL E CA  1 
ATOM   7900  C  C   . VAL E  1 216 ? -28.432  26.482  -75.798  1.00 33.51  ? 197  VAL E C   1 
ATOM   7901  O  O   . VAL E  1 216 ? -28.742  25.350  -75.431  1.00 32.25  ? 197  VAL E O   1 
ATOM   7902  C  CB  . VAL E  1 216 ? -29.580  26.513  -77.958  1.00 34.49  ? 197  VAL E CB  1 
ATOM   7903  C  CG1 . VAL E  1 216 ? -30.677  27.386  -77.370  1.00 26.79  ? 197  VAL E CG1 1 
ATOM   7904  C  CG2 . VAL E  1 216 ? -29.417  26.712  -79.465  1.00 35.36  ? 197  VAL E CG2 1 
ATOM   7905  N  N   . SER E  1 217 ? -28.196  27.488  -74.955  1.00 40.62  ? 198  SER E N   1 
ATOM   7906  C  CA  . SER E  1 217 ? -28.400  27.370  -73.503  1.00 34.69  ? 198  SER E CA  1 
ATOM   7907  C  C   . SER E  1 217 ? -29.770  27.878  -73.076  1.00 31.34  ? 198  SER E C   1 
ATOM   7908  O  O   . SER E  1 217 ? -30.069  29.071  -73.175  1.00 29.90  ? 198  SER E O   1 
ATOM   7909  C  CB  . SER E  1 217 ? -27.314  28.130  -72.762  1.00 32.74  ? 198  SER E CB  1 
ATOM   7910  O  OG  . SER E  1 217 ? -26.072  27.491  -72.973  1.00 31.63  ? 198  SER E OG  1 
ATOM   7911  N  N   . LEU E  1 218 ? -30.602  26.954  -72.617  1.00 33.76  ? 199  LEU E N   1 
ATOM   7912  C  CA  . LEU E  1 218 ? -31.947  27.283  -72.171  1.00 36.36  ? 199  LEU E CA  1 
ATOM   7913  C  C   . LEU E  1 218 ? -31.966  27.427  -70.650  1.00 44.95  ? 199  LEU E C   1 
ATOM   7914  O  O   . LEU E  1 218 ? -31.825  26.447  -69.914  1.00 52.83  ? 199  LEU E O   1 
ATOM   7915  C  CB  . LEU E  1 218 ? -32.926  26.198  -72.612  1.00 31.28  ? 199  LEU E CB  1 
ATOM   7916  C  CG  . LEU E  1 218 ? -34.382  26.358  -72.182  1.00 34.94  ? 199  LEU E CG  1 
ATOM   7917  C  CD1 . LEU E  1 218 ? -34.980  27.610  -72.814  1.00 40.97  ? 199  LEU E CD1 1 
ATOM   7918  C  CD2 . LEU E  1 218 ? -35.180  25.120  -72.561  1.00 35.59  ? 199  LEU E CD2 1 
ATOM   7919  N  N   . ASN E  1 219 ? -32.120  28.659  -70.179  1.00 44.20  ? 200  ASN E N   1 
ATOM   7920  C  CA  . ASN E  1 219 ? -32.234  28.916  -68.753  1.00 41.12  ? 200  ASN E CA  1 
ATOM   7921  C  C   . ASN E  1 219 ? -33.703  29.039  -68.363  1.00 41.67  ? 200  ASN E C   1 
ATOM   7922  O  O   . ASN E  1 219 ? -34.399  30.000  -68.745  1.00 43.79  ? 200  ASN E O   1 
ATOM   7923  C  CB  . ASN E  1 219 ? -31.457  30.170  -68.354  1.00 39.87  ? 200  ASN E CB  1 
ATOM   7924  C  CG  . ASN E  1 219 ? -31.562  30.467  -66.860  1.00 40.33  ? 200  ASN E CG  1 
ATOM   7925  O  OD1 . ASN E  1 219 ? -31.695  31.626  -66.455  1.00 42.13  ? 200  ASN E OD1 1 
ATOM   7926  N  ND2 . ASN E  1 219 ? -31.511  29.408  -66.031  1.00 35.63  ? 200  ASN E ND2 1 
ATOM   7927  N  N   . PHE E  1 220 ? -34.177  28.051  -67.612  1.00 35.87  ? 201  PHE E N   1 
ATOM   7928  C  CA  . PHE E  1 220 ? -35.586  27.995  -67.262  1.00 36.77  ? 201  PHE E CA  1 
ATOM   7929  C  C   . PHE E  1 220 ? -35.788  27.559  -65.808  1.00 39.85  ? 201  PHE E C   1 
ATOM   7930  O  O   . PHE E  1 220 ? -34.861  27.059  -65.165  1.00 40.93  ? 201  PHE E O   1 
ATOM   7931  C  CB  . PHE E  1 220 ? -36.301  27.031  -68.197  1.00 32.72  ? 201  PHE E CB  1 
ATOM   7932  C  CG  . PHE E  1 220 ? -35.948  25.599  -67.963  1.00 32.59  ? 201  PHE E CG  1 
ATOM   7933  C  CD1 . PHE E  1 220 ? -34.698  25.111  -68.326  1.00 36.00  ? 201  PHE E CD1 1 
ATOM   7934  C  CD2 . PHE E  1 220 ? -36.868  24.729  -67.398  1.00 36.60  ? 201  PHE E CD2 1 
ATOM   7935  C  CE1 . PHE E  1 220 ? -34.369  23.777  -68.134  1.00 36.66  ? 201  PHE E CE1 1 
ATOM   7936  C  CE2 . PHE E  1 220 ? -36.553  23.392  -67.200  1.00 42.90  ? 201  PHE E CE2 1 
ATOM   7937  C  CZ  . PHE E  1 220 ? -35.299  22.915  -67.569  1.00 42.45  ? 201  PHE E CZ  1 
ATOM   7938  N  N   . ARG E  1 221 ? -37.001  27.747  -65.296  1.00 38.00  ? 202  ARG E N   1 
ATOM   7939  C  CA  . ARG E  1 221 ? -37.329  27.316  -63.941  1.00 40.89  ? 202  ARG E CA  1 
ATOM   7940  C  C   . ARG E  1 221 ? -38.804  26.977  -63.810  1.00 42.36  ? 202  ARG E C   1 
ATOM   7941  O  O   . ARG E  1 221 ? -39.626  27.337  -64.673  1.00 40.35  ? 202  ARG E O   1 
ATOM   7942  C  CB  . ARG E  1 221 ? -36.967  28.392  -62.913  1.00 45.08  ? 202  ARG E CB  1 
ATOM   7943  C  CG  . ARG E  1 221 ? -37.922  29.578  -62.913  1.00 47.62  ? 202  ARG E CG  1 
ATOM   7944  C  CD  . ARG E  1 221 ? -37.573  30.623  -61.857  1.00 49.87  ? 202  ARG E CD  1 
ATOM   7945  N  NE  . ARG E  1 221 ? -38.399  31.815  -62.049  1.00 53.34  ? 202  ARG E NE  1 
ATOM   7946  C  CZ  . ARG E  1 221 ? -38.008  33.056  -61.776  1.00 57.53  ? 202  ARG E CZ  1 
ATOM   7947  N  NH1 . ARG E  1 221 ? -36.795  33.279  -61.281  1.00 59.51  ? 202  ARG E NH1 1 
ATOM   7948  N  NH2 . ARG E  1 221 ? -38.833  34.075  -61.999  1.00 58.58  ? 202  ARG E NH2 1 
ATOM   7949  N  N   . LYS E  1 222 ? -39.125  26.294  -62.711  1.00 41.67  ? 203  LYS E N   1 
ATOM   7950  C  CA  . LYS E  1 222 ? -40.499  25.923  -62.408  1.00 43.45  ? 203  LYS E CA  1 
ATOM   7951  C  C   . LYS E  1 222 ? -41.246  27.102  -61.830  1.00 45.17  ? 203  LYS E C   1 
ATOM   7952  O  O   . LYS E  1 222 ? -40.770  27.722  -60.892  1.00 42.92  ? 203  LYS E O   1 
ATOM   7953  C  CB  . LYS E  1 222 ? -40.548  24.796  -61.393  1.00 46.97  ? 203  LYS E CB  1 
ATOM   7954  C  CG  . LYS E  1 222 ? -41.966  24.334  -61.099  1.00 59.62  ? 203  LYS E CG  1 
ATOM   7955  C  CD  . LYS E  1 222 ? -41.961  22.979  -60.403  1.00 72.29  ? 203  LYS E CD  1 
ATOM   7956  C  CE  . LYS E  1 222 ? -43.333  22.310  -60.421  1.00 80.94  ? 203  LYS E CE  1 
ATOM   7957  N  NZ  . LYS E  1 222 ? -43.292  21.039  -59.632  1.00 88.15  ? 203  LYS E NZ  1 
ATOM   7958  N  N   . LYS E  1 223 ? -42.417  27.411  -62.379  1.00 50.46  ? 204  LYS E N   1 
ATOM   7959  C  CA  . LYS E  1 223 ? -43.244  28.487  -61.832  1.00 49.25  ? 204  LYS E CA  1 
ATOM   7960  C  C   . LYS E  1 223 ? -43.650  28.256  -60.365  1.00 53.32  ? 204  LYS E C   1 
ATOM   7961  O  O   . LYS E  1 223 ? -43.698  27.106  -59.897  1.00 50.53  ? 204  LYS E O   1 
ATOM   7962  C  CB  . LYS E  1 223 ? -44.498  28.682  -62.682  1.00 41.38  ? 204  LYS E CB  1 
ATOM   7963  C  CG  . LYS E  1 223 ? -44.238  29.238  -64.050  1.00 42.34  ? 204  LYS E CG  1 
ATOM   7964  C  CD  . LYS E  1 223 ? -45.518  29.167  -64.858  1.00 47.33  ? 204  LYS E CD  1 
ATOM   7965  C  CE  . LYS E  1 223 ? -45.367  29.789  -66.217  1.00 51.45  ? 204  LYS E CE  1 
ATOM   7966  N  NZ  . LYS E  1 223 ? -46.481  29.357  -67.118  1.00 54.54  ? 204  LYS E NZ  1 
ATOM   7967  N  N   . GLY E  1 224 ? -43.940  29.356  -59.659  1.00 58.44  ? 205  GLY E N   1 
ATOM   7968  C  CA  . GLY E  1 224 ? -44.492  29.308  -58.316  1.00 62.82  ? 205  GLY E CA  1 
ATOM   7969  C  C   . GLY E  1 224 ? -45.791  30.090  -58.209  1.00 70.07  ? 205  GLY E C   1 
ATOM   7970  O  O   . GLY E  1 224 ? -46.214  30.488  -57.115  1.00 76.34  ? 205  GLY E O   1 
ATOM   7971  N  N   . LEU F  1 20  ? -14.499  -6.916  -111.207 1.00 38.10  ? 1    LEU F N   1 
ATOM   7972  C  CA  . LEU F  1 20  ? -15.361  -6.486  -112.307 1.00 39.78  ? 1    LEU F CA  1 
ATOM   7973  C  C   . LEU F  1 20  ? -15.356  -7.492  -113.440 1.00 44.23  ? 1    LEU F C   1 
ATOM   7974  O  O   . LEU F  1 20  ? -14.291  -7.893  -113.907 1.00 52.98  ? 1    LEU F O   1 
ATOM   7975  C  CB  . LEU F  1 20  ? -14.893  -5.139  -112.863 1.00 35.87  ? 1    LEU F CB  1 
ATOM   7976  C  CG  . LEU F  1 20  ? -15.226  -3.886  -112.068 1.00 39.50  ? 1    LEU F CG  1 
ATOM   7977  C  CD1 . LEU F  1 20  ? -14.704  -2.661  -112.757 1.00 35.60  ? 1    LEU F CD1 1 
ATOM   7978  C  CD2 . LEU F  1 20  ? -16.716  -3.771  -111.843 1.00 47.58  ? 1    LEU F CD2 1 
ATOM   7979  N  N   . ASP F  1 21  ? -16.537  -7.896  -113.894 1.00 39.32  ? 2    ASP F N   1 
ATOM   7980  C  CA  . ASP F  1 21  ? -16.637  -8.596  -115.175 1.00 41.08  ? 2    ASP F CA  1 
ATOM   7981  C  C   . ASP F  1 21  ? -17.352  -7.732  -116.237 1.00 32.31  ? 2    ASP F C   1 
ATOM   7982  O  O   . ASP F  1 21  ? -17.729  -6.593  -115.946 1.00 29.16  ? 2    ASP F O   1 
ATOM   7983  C  CB  . ASP F  1 21  ? -17.304  -9.970  -115.010 1.00 47.57  ? 2    ASP F CB  1 
ATOM   7984  C  CG  . ASP F  1 21  ? -18.677  -9.885  -114.374 1.00 50.85  ? 2    ASP F CG  1 
ATOM   7985  O  OD1 . ASP F  1 21  ? -19.235  -8.772  -114.299 1.00 48.96  ? 2    ASP F OD1 1 
ATOM   7986  O  OD2 . ASP F  1 21  ? -19.211  -10.941 -113.966 1.00 56.01  ? 2    ASP F OD2 1 
ATOM   7987  N  N   . ARG F  1 22  ? -17.536  -8.274  -117.445 1.00 27.38  ? 3    ARG F N   1 
ATOM   7988  C  CA  . ARG F  1 22  ? -18.157  -7.522  -118.536 1.00 28.22  ? 3    ARG F CA  1 
ATOM   7989  C  C   . ARG F  1 22  ? -19.513  -6.989  -118.132 1.00 34.55  ? 3    ARG F C   1 
ATOM   7990  O  O   . ARG F  1 22  ? -19.817  -5.803  -118.356 1.00 35.87  ? 3    ARG F O   1 
ATOM   7991  C  CB  . ARG F  1 22  ? -18.299  -8.376  -119.807 1.00 26.43  ? 3    ARG F CB  1 
ATOM   7992  C  CG  . ARG F  1 22  ? -17.076  -8.387  -120.680 1.00 24.56  ? 3    ARG F CG  1 
ATOM   7993  C  CD  . ARG F  1 22  ? -17.135  -9.435  -121.754 1.00 29.90  ? 3    ARG F CD  1 
ATOM   7994  N  NE  . ARG F  1 22  ? -15.837  -9.526  -122.420 1.00 46.05  ? 3    ARG F NE  1 
ATOM   7995  C  CZ  . ARG F  1 22  ? -14.901  -10.412 -122.101 1.00 58.66  ? 3    ARG F CZ  1 
ATOM   7996  N  NH1 . ARG F  1 22  ? -15.139  -11.299 -121.138 1.00 62.42  ? 3    ARG F NH1 1 
ATOM   7997  N  NH2 . ARG F  1 22  ? -13.738  -10.416 -122.751 1.00 62.46  ? 3    ARG F NH2 1 
ATOM   7998  N  N   . ALA F  1 23  ? -20.319  -7.872  -117.536 1.00 34.71  ? 4    ALA F N   1 
ATOM   7999  C  CA  . ALA F  1 23  ? -21.678  -7.520  -117.106 1.00 33.54  ? 4    ALA F CA  1 
ATOM   8000  C  C   . ALA F  1 23  ? -21.689  -6.261  -116.223 1.00 31.79  ? 4    ALA F C   1 
ATOM   8001  O  O   . ALA F  1 23  ? -22.495  -5.354  -116.428 1.00 29.67  ? 4    ALA F O   1 
ATOM   8002  C  CB  . ALA F  1 23  ? -22.336  -8.694  -116.386 1.00 30.05  ? 4    ALA F CB  1 
ATOM   8003  N  N   . ASP F  1 24  ? -20.777  -6.202  -115.261 1.00 30.14  ? 5    ASP F N   1 
ATOM   8004  C  CA  . ASP F  1 24  ? -20.709  -5.069  -114.354 1.00 34.65  ? 5    ASP F CA  1 
ATOM   8005  C  C   . ASP F  1 24  ? -20.298  -3.784  -115.070 1.00 36.67  ? 5    ASP F C   1 
ATOM   8006  O  O   . ASP F  1 24  ? -20.901  -2.727  -114.858 1.00 20.15  ? 5    ASP F O   1 
ATOM   8007  C  CB  . ASP F  1 24  ? -19.731  -5.359  -113.209 1.00 39.58  ? 5    ASP F CB  1 
ATOM   8008  C  CG  . ASP F  1 24  ? -20.162  -6.533  -112.334 1.00 45.23  ? 5    ASP F CG  1 
ATOM   8009  O  OD1 . ASP F  1 24  ? -21.391  -6.751  -112.169 1.00 46.93  ? 5    ASP F OD1 1 
ATOM   8010  O  OD2 . ASP F  1 24  ? -19.252  -7.226  -111.804 1.00 45.88  ? 5    ASP F OD2 1 
ATOM   8011  N  N   . ILE F  1 25  ? -19.268  -3.889  -115.913 1.00 35.82  ? 6    ILE F N   1 
ATOM   8012  C  CA  . ILE F  1 25  ? -18.732  -2.749  -116.667 1.00 29.33  ? 6    ILE F CA  1 
ATOM   8013  C  C   . ILE F  1 25  ? -19.783  -2.142  -117.588 1.00 29.10  ? 6    ILE F C   1 
ATOM   8014  O  O   . ILE F  1 25  ? -19.972  -0.927  -117.648 1.00 32.84  ? 6    ILE F O   1 
ATOM   8015  C  CB  . ILE F  1 25  ? -17.500  -3.161  -117.507 1.00 26.36  ? 6    ILE F CB  1 
ATOM   8016  C  CG1 . ILE F  1 25  ? -16.352  -3.567  -116.585 1.00 27.73  ? 6    ILE F CG1 1 
ATOM   8017  C  CG2 . ILE F  1 25  ? -17.077  -2.024  -118.411 1.00 27.63  ? 6    ILE F CG2 1 
ATOM   8018  C  CD1 . ILE F  1 25  ? -15.183  -4.203  -117.287 1.00 34.69  ? 6    ILE F CD1 1 
ATOM   8019  N  N   . LEU F  1 26  ? -20.482  -3.007  -118.298 1.00 25.83  ? 7    LEU F N   1 
ATOM   8020  C  CA  . LEU F  1 26  ? -21.550  -2.572  -119.166 1.00 24.49  ? 7    LEU F CA  1 
ATOM   8021  C  C   . LEU F  1 26  ? -22.703  -1.949  -118.388 1.00 23.91  ? 7    LEU F C   1 
ATOM   8022  O  O   . LEU F  1 26  ? -23.275  -0.938  -118.797 1.00 25.13  ? 7    LEU F O   1 
ATOM   8023  C  CB  . LEU F  1 26  ? -22.024  -3.749  -120.019 1.00 23.97  ? 7    LEU F CB  1 
ATOM   8024  C  CG  . LEU F  1 26  ? -20.952  -4.138  -121.031 1.00 22.89  ? 7    LEU F CG  1 
ATOM   8025  C  CD1 . LEU F  1 26  ? -21.177  -5.561  -121.519 1.00 23.28  ? 7    LEU F CD1 1 
ATOM   8026  C  CD2 . LEU F  1 26  ? -20.934  -3.130  -122.201 1.00 26.01  ? 7    LEU F CD2 1 
ATOM   8027  N  N   . TYR F  1 27  ? -23.037  -2.548  -117.260 1.00 28.91  ? 8    TYR F N   1 
ATOM   8028  C  CA  . TYR F  1 27  ? -24.049  -1.988  -116.378 1.00 28.59  ? 8    TYR F CA  1 
ATOM   8029  C  C   . TYR F  1 27  ? -23.659  -0.582  -115.919 1.00 31.36  ? 8    TYR F C   1 
ATOM   8030  O  O   . TYR F  1 27  ? -24.468  0.339   -116.009 1.00 28.66  ? 8    TYR F O   1 
ATOM   8031  C  CB  . TYR F  1 27  ? -24.256  -2.904  -115.170 1.00 31.14  ? 8    TYR F CB  1 
ATOM   8032  C  CG  . TYR F  1 27  ? -25.261  -2.388  -114.168 1.00 37.34  ? 8    TYR F CG  1 
ATOM   8033  C  CD1 . TYR F  1 27  ? -26.625  -2.492  -114.408 1.00 45.01  ? 8    TYR F CD1 1 
ATOM   8034  C  CD2 . TYR F  1 27  ? -24.847  -1.809  -112.974 1.00 41.42  ? 8    TYR F CD2 1 
ATOM   8035  C  CE1 . TYR F  1 27  ? -27.554  -2.022  -113.486 1.00 50.44  ? 8    TYR F CE1 1 
ATOM   8036  C  CE2 . TYR F  1 27  ? -25.765  -1.341  -112.044 1.00 49.43  ? 8    TYR F CE2 1 
ATOM   8037  C  CZ  . TYR F  1 27  ? -27.116  -1.450  -112.301 1.00 53.03  ? 8    TYR F CZ  1 
ATOM   8038  O  OH  . TYR F  1 27  ? -28.019  -0.984  -111.364 1.00 53.47  ? 8    TYR F OH  1 
ATOM   8039  N  N   . ASN F  1 28  ? -22.428  -0.402  -115.439 1.00 34.46  ? 9    ASN F N   1 
ATOM   8040  C  CA  . ASN F  1 28  ? -21.995  0.934   -114.990 1.00 35.85  ? 9    ASN F CA  1 
ATOM   8041  C  C   . ASN F  1 28  ? -22.042  1.944   -116.125 1.00 39.23  ? 9    ASN F C   1 
ATOM   8042  O  O   . ASN F  1 28  ? -22.509  3.068   -115.943 1.00 40.57  ? 9    ASN F O   1 
ATOM   8043  C  CB  . ASN F  1 28  ? -20.588  0.911   -114.391 1.00 36.22  ? 9    ASN F CB  1 
ATOM   8044  C  CG  . ASN F  1 28  ? -20.478  -0.011  -113.184 1.00 41.44  ? 9    ASN F CG  1 
ATOM   8045  O  OD1 . ASN F  1 28  ? -21.462  -0.248  -112.457 1.00 43.09  ? 9    ASN F OD1 1 
ATOM   8046  N  ND2 . ASN F  1 28  ? -19.267  -0.536  -112.958 1.00 41.00  ? 9    ASN F ND2 1 
ATOM   8047  N  N   . ILE F  1 29  ? -21.576  1.560   -117.302 1.00 38.12  ? 10   ILE F N   1 
ATOM   8048  C  CA  . ILE F  1 29  ? -21.543  2.440   -118.449 1.00 29.47  ? 10   ILE F CA  1 
ATOM   8049  C  C   . ILE F  1 29  ? -22.924  2.884   -118.834 1.00 27.36  ? 10   ILE F C   1 
ATOM   8050  O  O   . ILE F  1 29  ? -23.153  4.026   -119.059 1.00 25.35  ? 10   ILE F O   1 
ATOM   8051  C  CB  . ILE F  1 29  ? -20.855  1.726   -119.637 1.00 30.55  ? 10   ILE F CB  1 
ATOM   8052  C  CG1 . ILE F  1 29  ? -19.367  1.710   -119.425 1.00 19.78  ? 10   ILE F CG1 1 
ATOM   8053  C  CG2 . ILE F  1 29  ? -21.102  2.403   -120.965 1.00 19.98  ? 10   ILE F CG2 1 
ATOM   8054  C  CD1 . ILE F  1 29  ? -18.617  0.956   -120.471 1.00 19.57  ? 10   ILE F CD1 1 
ATOM   8055  N  N   . ARG F  1 30  ? -23.847  1.964   -118.886 1.00 30.12  ? 11   ARG F N   1 
ATOM   8056  C  CA  . ARG F  1 30  ? -25.185  2.260   -119.288 1.00 31.93  ? 11   ARG F CA  1 
ATOM   8057  C  C   . ARG F  1 30  ? -25.882  3.160   -118.302 1.00 37.09  ? 11   ARG F C   1 
ATOM   8058  O  O   . ARG F  1 30  ? -26.569  4.062   -118.673 1.00 42.66  ? 11   ARG F O   1 
ATOM   8059  C  CB  . ARG F  1 30  ? -25.906  0.954   -119.426 1.00 36.61  ? 11   ARG F CB  1 
ATOM   8060  C  CG  . ARG F  1 30  ? -27.295  0.996   -120.000 1.00 47.70  ? 11   ARG F CG  1 
ATOM   8061  C  CD  . ARG F  1 30  ? -28.120  -0.134  -119.418 1.00 62.52  ? 11   ARG F CD  1 
ATOM   8062  N  NE  . ARG F  1 30  ? -27.328  -1.352  -119.311 1.00 74.58  ? 11   ARG F NE  1 
ATOM   8063  C  CZ  . ARG F  1 30  ? -27.692  -2.465  -118.696 1.00 81.80  ? 11   ARG F CZ  1 
ATOM   8064  N  NH1 . ARG F  1 30  ? -28.872  -2.557  -118.123 1.00 82.37  ? 11   ARG F NH1 1 
ATOM   8065  N  NH2 . ARG F  1 30  ? -26.865  -3.492  -118.680 1.00 83.55  ? 11   ARG F NH2 1 
ATOM   8066  N  N   . GLN F  1 31  ? -25.711  2.883   -117.029 1.00 35.04  ? 12   GLN F N   1 
ATOM   8067  C  CA  . GLN F  1 31  ? -26.245  3.700   -115.975 1.00 34.63  ? 12   GLN F CA  1 
ATOM   8068  C  C   . GLN F  1 31  ? -25.652  5.080   -115.852 1.00 41.99  ? 12   GLN F C   1 
ATOM   8069  O  O   . GLN F  1 31  ? -26.345  6.022   -115.583 1.00 44.67  ? 12   GLN F O   1 
ATOM   8070  C  CB  . GLN F  1 31  ? -26.133  2.993   -114.647 1.00 32.03  ? 12   GLN F CB  1 
ATOM   8071  C  CG  . GLN F  1 31  ? -26.959  1.758   -114.513 1.00 34.89  ? 12   GLN F CG  1 
ATOM   8072  C  CD  . GLN F  1 31  ? -28.393  2.025   -114.675 1.00 43.60  ? 12   GLN F CD  1 
ATOM   8073  O  OE1 . GLN F  1 31  ? -28.985  1.607   -115.618 1.00 52.48  ? 12   GLN F OE1 1 
ATOM   8074  N  NE2 . GLN F  1 31  ? -28.961  2.732   -113.763 1.00 49.25  ? 12   GLN F NE2 1 
ATOM   8075  N  N   . THR F  1 32  ? -24.360  5.201   -116.014 1.00 44.13  ? 13   THR F N   1 
ATOM   8076  C  CA  . THR F  1 32  ? -23.677  6.456   -115.692 1.00 47.07  ? 13   THR F CA  1 
ATOM   8077  C  C   . THR F  1 32  ? -23.138  7.259   -116.860 1.00 54.60  ? 13   THR F C   1 
ATOM   8078  O  O   . THR F  1 32  ? -22.822  8.436   -116.689 1.00 61.34  ? 13   THR F O   1 
ATOM   8079  C  CB  . THR F  1 32  ? -22.504  6.256   -114.725 1.00 36.90  ? 13   THR F CB  1 
ATOM   8080  O  OG1 . THR F  1 32  ? -21.566  5.344   -115.303 1.00 35.94  ? 13   THR F OG1 1 
ATOM   8081  C  CG2 . THR F  1 32  ? -23.010  5.747   -113.397 1.00 37.92  ? 13   THR F CG2 1 
ATOM   8082  N  N   . SER F  1 33  ? -22.980  6.644   -118.026 1.00 55.98  ? 14   SER F N   1 
ATOM   8083  C  CA  . SER F  1 33  ? -22.478  7.420   -119.150 1.00 54.07  ? 14   SER F CA  1 
ATOM   8084  C  C   . SER F  1 33  ? -23.570  8.413   -119.502 1.00 55.87  ? 14   SER F C   1 
ATOM   8085  O  O   . SER F  1 33  ? -24.769  8.144   -119.300 1.00 61.03  ? 14   SER F O   1 
ATOM   8086  C  CB  . SER F  1 33  ? -22.119  6.547   -120.349 1.00 49.64  ? 14   SER F CB  1 
ATOM   8087  O  OG  . SER F  1 33  ? -23.241  6.390   -121.193 1.00 53.24  ? 14   SER F OG  1 
ATOM   8088  N  N   . ARG F  1 34  ? -23.152  9.573   -119.984 1.00 46.38  ? 15   ARG F N   1 
ATOM   8089  C  CA  . ARG F  1 34  ? -24.098  10.615  -120.336 1.00 40.11  ? 15   ARG F CA  1 
ATOM   8090  C  C   . ARG F  1 34  ? -23.963  10.921  -121.828 1.00 30.83  ? 15   ARG F C   1 
ATOM   8091  O  O   . ARG F  1 34  ? -23.153  11.790  -122.215 1.00 27.70  ? 15   ARG F O   1 
ATOM   8092  C  CB  . ARG F  1 34  ? -23.805  11.847  -119.495 1.00 33.78  ? 15   ARG F CB  1 
ATOM   8093  C  CG  . ARG F  1 34  ? -23.923  11.624  -118.025 1.00 33.28  ? 15   ARG F CG  1 
ATOM   8094  C  CD  . ARG F  1 34  ? -25.381  11.767  -117.579 1.00 43.93  ? 15   ARG F CD  1 
ATOM   8095  N  NE  . ARG F  1 34  ? -25.935  13.038  -118.032 1.00 49.00  ? 15   ARG F NE  1 
ATOM   8096  C  CZ  . ARG F  1 34  ? -25.870  14.173  -117.341 1.00 48.95  ? 15   ARG F CZ  1 
ATOM   8097  N  NH1 . ARG F  1 34  ? -25.292  14.182  -116.137 1.00 44.79  ? 15   ARG F NH1 1 
ATOM   8098  N  NH2 . ARG F  1 34  ? -26.385  15.289  -117.854 1.00 47.07  ? 15   ARG F NH2 1 
ATOM   8099  N  N   . PRO F  1 35  ? -24.729  10.189  -122.666 1.00 24.35  ? 16   PRO F N   1 
ATOM   8100  C  CA  . PRO F  1 35  ? -24.604  10.249  -124.147 1.00 29.86  ? 16   PRO F CA  1 
ATOM   8101  C  C   . PRO F  1 35  ? -24.782  11.651  -124.694 1.00 24.87  ? 16   PRO F C   1 
ATOM   8102  O  O   . PRO F  1 35  ? -24.211  11.976  -125.711 1.00 31.89  ? 16   PRO F O   1 
ATOM   8103  C  CB  . PRO F  1 35  ? -25.746  9.353   -124.648 1.00 25.87  ? 16   PRO F CB  1 
ATOM   8104  C  CG  . PRO F  1 35  ? -26.079  8.484   -123.482 1.00 28.09  ? 16   PRO F CG  1 
ATOM   8105  C  CD  . PRO F  1 35  ? -25.789  9.266   -122.238 1.00 24.46  ? 16   PRO F CD  1 
ATOM   8106  N  N   . ASP F  1 36  ? -25.555  12.462  -123.987 1.00 27.03  ? 17   ASP F N   1 
ATOM   8107  C  CA  . ASP F  1 36  ? -25.819  13.841  -124.350 1.00 27.84  ? 17   ASP F CA  1 
ATOM   8108  C  C   . ASP F  1 36  ? -24.646  14.776  -124.025 1.00 28.85  ? 17   ASP F C   1 
ATOM   8109  O  O   . ASP F  1 36  ? -24.616  15.931  -124.473 1.00 35.41  ? 17   ASP F O   1 
ATOM   8110  C  CB  . ASP F  1 36  ? -27.117  14.312  -123.655 1.00 24.28  ? 17   ASP F CB  1 
ATOM   8111  C  CG  . ASP F  1 36  ? -27.145  13.979  -122.126 1.00 79.26  ? 17   ASP F CG  1 
ATOM   8112  O  OD1 . ASP F  1 36  ? -26.725  12.858  -121.722 1.00 76.52  ? 17   ASP F OD1 1 
ATOM   8113  O  OD2 . ASP F  1 36  ? -27.601  14.838  -121.323 1.00 78.23  ? 17   ASP F OD2 1 
ATOM   8114  N  N   . VAL F  1 37  ? -23.679  14.280  -123.259 1.00 26.73  ? 18   VAL F N   1 
ATOM   8115  C  CA  . VAL F  1 37  ? -22.675  15.154  -122.645 1.00 25.41  ? 18   VAL F CA  1 
ATOM   8116  C  C   . VAL F  1 37  ? -21.294  14.914  -123.218 1.00 25.83  ? 18   VAL F C   1 
ATOM   8117  O  O   . VAL F  1 37  ? -20.708  13.842  -123.069 1.00 29.90  ? 18   VAL F O   1 
ATOM   8118  C  CB  . VAL F  1 37  ? -22.625  14.982  -121.107 1.00 28.16  ? 18   VAL F CB  1 
ATOM   8119  C  CG1 . VAL F  1 37  ? -21.562  15.906  -120.501 1.00 29.10  ? 18   VAL F CG1 1 
ATOM   8120  C  CG2 . VAL F  1 37  ? -24.007  15.218  -120.475 1.00 24.10  ? 18   VAL F CG2 1 
ATOM   8121  N  N   . ILE F  1 38  ? -20.776  15.926  -123.883 1.00 28.83  ? 19   ILE F N   1 
ATOM   8122  C  CA  . ILE F  1 38  ? -19.451  15.842  -124.449 1.00 29.04  ? 19   ILE F CA  1 
ATOM   8123  C  C   . ILE F  1 38  ? -18.427  15.718  -123.318 1.00 27.60  ? 19   ILE F C   1 
ATOM   8124  O  O   . ILE F  1 38  ? -18.410  16.531  -122.399 1.00 25.94  ? 19   ILE F O   1 
ATOM   8125  C  CB  . ILE F  1 38  ? -19.189  17.048  -125.371 1.00 27.37  ? 19   ILE F CB  1 
ATOM   8126  C  CG1 . ILE F  1 38  ? -17.796  16.983  -125.986 1.00 37.29  ? 19   ILE F CG1 1 
ATOM   8127  C  CG2 . ILE F  1 38  ? -19.397  18.348  -124.639 1.00 23.67  ? 19   ILE F CG2 1 
ATOM   8128  C  CD1 . ILE F  1 38  ? -17.591  17.973  -127.125 1.00 39.97  ? 19   ILE F CD1 1 
ATOM   8129  N  N   . PRO F  1 39  ? -17.635  14.685  -123.400 1.00 32.87  ? 20   PRO F N   1 
ATOM   8130  C  CA  . PRO F  1 39  ? -16.705  14.352  -122.368 1.00 36.84  ? 20   PRO F CA  1 
ATOM   8131  C  C   . PRO F  1 39  ? -15.556  15.278  -122.496 1.00 52.01  ? 20   PRO F C   1 
ATOM   8132  O  O   . PRO F  1 39  ? -14.421  14.862  -122.595 1.00 58.88  ? 20   PRO F O   1 
ATOM   8133  C  CB  . PRO F  1 39  ? -16.307  12.953  -122.765 1.00 36.69  ? 20   PRO F CB  1 
ATOM   8134  C  CG  . PRO F  1 39  ? -16.254  13.015  -124.207 1.00 31.76  ? 20   PRO F CG  1 
ATOM   8135  C  CD  . PRO F  1 39  ? -17.344  13.933  -124.615 1.00 34.32  ? 20   PRO F CD  1 
ATOM   8136  N  N   . THR F  1 40  ? -15.849  16.560  -122.521 1.00 58.19  ? 21   THR F N   1 
ATOM   8137  C  CA  . THR F  1 40  ? -14.790  17.532  -122.626 1.00 61.57  ? 21   THR F CA  1 
ATOM   8138  C  C   . THR F  1 40  ? -14.005  17.668  -121.363 1.00 68.55  ? 21   THR F C   1 
ATOM   8139  O  O   . THR F  1 40  ? -14.580  17.835  -120.323 1.00 70.58  ? 21   THR F O   1 
ATOM   8140  C  CB  . THR F  1 40  ? -15.324  18.906  -122.927 1.00 59.63  ? 21   THR F CB  1 
ATOM   8141  O  OG1 . THR F  1 40  ? -14.206  19.769  -123.072 1.00 64.45  ? 21   THR F OG1 1 
ATOM   8142  C  CG2 . THR F  1 40  ? -16.206  19.400  -121.812 1.00 52.71  ? 21   THR F CG2 1 
ATOM   8143  N  N   . GLN F  1 41  ? -12.693  17.684  -121.477 1.00 73.25  ? 22   GLN F N   1 
ATOM   8144  C  CA  . GLN F  1 41  ? -11.829  17.937  -120.351 1.00 78.57  ? 22   GLN F CA  1 
ATOM   8145  C  C   . GLN F  1 41  ? -11.923  19.416  -120.018 1.00 86.98  ? 22   GLN F C   1 
ATOM   8146  O  O   . GLN F  1 41  ? -10.985  20.023  -119.518 1.00 89.71  ? 22   GLN F O   1 
ATOM   8147  C  CB  . GLN F  1 41  ? -10.387  17.573  -120.696 1.00 77.95  ? 22   GLN F CB  1 
ATOM   8148  C  CG  . GLN F  1 41  ? -10.210  16.667  -121.913 1.00 75.12  ? 22   GLN F CG  1 
ATOM   8149  C  CD  . GLN F  1 41  ? -8.853   16.023  -121.982 1.00 71.53  ? 22   GLN F CD  1 
ATOM   8150  O  OE1 . GLN F  1 41  ? -8.733   14.813  -121.995 1.00 69.71  ? 22   GLN F OE1 1 
ATOM   8151  N  NE2 . GLN F  1 41  ? -7.827   16.828  -122.015 1.00 70.60  ? 22   GLN F NE2 1 
ATOM   8152  N  N   . ARG F  1 44  ? -11.063  21.975  -122.277 1.00 73.45  ? 25   ARG F N   1 
ATOM   8153  C  CA  . ARG F  1 44  ? -10.180  21.690  -123.396 1.00 72.22  ? 25   ARG F CA  1 
ATOM   8154  C  C   . ARG F  1 44  ? -10.899  20.730  -124.328 1.00 62.20  ? 25   ARG F C   1 
ATOM   8155  O  O   . ARG F  1 44  ? -11.767  19.963  -123.903 1.00 56.43  ? 25   ARG F O   1 
ATOM   8156  C  CB  . ARG F  1 44  ? -8.877   21.044  -122.926 1.00 76.34  ? 25   ARG F CB  1 
ATOM   8157  C  CG  . ARG F  1 44  ? -8.006   21.898  -122.046 1.00 78.57  ? 25   ARG F CG  1 
ATOM   8158  C  CD  . ARG F  1 44  ? -6.684   21.191  -121.895 0.88 81.16  ? 25   ARG F CD  1 
ATOM   8159  N  NE  . ARG F  1 44  ? -6.335   20.497  -123.133 0.57 81.98  ? 25   ARG F NE  1 
ATOM   8160  C  CZ  . ARG F  1 44  ? -5.122   20.031  -123.410 0.31 83.23  ? 25   ARG F CZ  1 
ATOM   8161  N  NH1 . ARG F  1 44  ? -4.137   20.193  -122.538 1.00 85.35  ? 25   ARG F NH1 1 
ATOM   8162  N  NH2 . ARG F  1 44  ? -4.891   19.412  -124.560 0.63 81.83  ? 25   ARG F NH2 1 
ATOM   8163  N  N   . PRO F  1 45  ? -10.529  20.757  -125.607 1.00 57.86  ? 26   PRO F N   1 
ATOM   8164  C  CA  . PRO F  1 45  ? -11.310  20.005  -126.596 1.00 55.18  ? 26   PRO F CA  1 
ATOM   8165  C  C   . PRO F  1 45  ? -11.073  18.497  -126.579 1.00 50.63  ? 26   PRO F C   1 
ATOM   8166  O  O   . PRO F  1 45  ? -9.972   18.012  -126.299 1.00 52.06  ? 26   PRO F O   1 
ATOM   8167  C  CB  . PRO F  1 45  ? -10.821  20.582  -127.923 1.00 53.08  ? 26   PRO F CB  1 
ATOM   8168  C  CG  . PRO F  1 45  ? -9.425   21.029  -127.628 1.00 51.23  ? 26   PRO F CG  1 
ATOM   8169  C  CD  . PRO F  1 45  ? -9.467   21.564  -126.231 1.00 53.14  ? 26   PRO F CD  1 
ATOM   8170  N  N   . VAL F  1 46  ? -12.131  17.758  -126.877 1.00 31.40  ? 27   VAL F N   1 
ATOM   8171  C  CA  . VAL F  1 46  ? -12.021  16.324  -127.072 1.00 30.81  ? 27   VAL F CA  1 
ATOM   8172  C  C   . VAL F  1 46  ? -11.297  16.130  -128.401 1.00 29.41  ? 27   VAL F C   1 
ATOM   8173  O  O   . VAL F  1 46  ? -11.735  16.648  -129.435 1.00 23.43  ? 27   VAL F O   1 
ATOM   8174  C  CB  . VAL F  1 46  ? -13.421  15.661  -127.178 1.00 20.18  ? 27   VAL F CB  1 
ATOM   8175  C  CG1 . VAL F  1 46  ? -13.300  14.150  -127.389 1.00 22.63  ? 27   VAL F CG1 1 
ATOM   8176  C  CG2 . VAL F  1 46  ? -14.242  15.975  -125.986 1.00 18.79  ? 27   VAL F CG2 1 
ATOM   8177  N  N   . ALA F  1 47  ? -10.199  15.382  -128.357 1.00 27.67  ? 28   ALA F N   1 
ATOM   8178  C  CA  . ALA F  1 47  ? -9.431   15.074  -129.544 1.00 27.80  ? 28   ALA F CA  1 
ATOM   8179  C  C   . ALA F  1 47  ? -10.022  13.869  -130.291 1.00 30.92  ? 28   ALA F C   1 
ATOM   8180  O  O   . ALA F  1 47  ? -9.949   12.745  -129.819 1.00 33.86  ? 28   ALA F O   1 
ATOM   8181  C  CB  . ALA F  1 47  ? -7.966   14.816  -129.182 1.00 25.71  ? 28   ALA F CB  1 
ATOM   8182  N  N   . VAL F  1 48  ? -10.569  14.115  -131.479 1.00 34.50  ? 29   VAL F N   1 
ATOM   8183  C  CA  . VAL F  1 48  ? -11.189  13.072  -132.291 1.00 32.76  ? 29   VAL F CA  1 
ATOM   8184  C  C   . VAL F  1 48  ? -10.329  12.729  -133.495 1.00 31.34  ? 29   VAL F C   1 
ATOM   8185  O  O   . VAL F  1 48  ? -10.056  13.596  -134.327 1.00 32.45  ? 29   VAL F O   1 
ATOM   8186  C  CB  . VAL F  1 48  ? -12.628  13.484  -132.760 1.00 27.37  ? 29   VAL F CB  1 
ATOM   8187  C  CG1 . VAL F  1 48  ? -13.241  12.415  -133.584 1.00 24.00  ? 29   VAL F CG1 1 
ATOM   8188  C  CG2 . VAL F  1 48  ? -13.556  13.787  -131.539 1.00 14.83  ? 29   VAL F CG2 1 
ATOM   8189  N  N   . SER F  1 49  ? -9.891   11.469  -133.559 1.00 32.84  ? 30   SER F N   1 
ATOM   8190  C  CA  . SER F  1 49  ? -9.224   10.904  -134.732 1.00 37.43  ? 30   SER F CA  1 
ATOM   8191  C  C   . SER F  1 49  ? -10.251  10.420  -135.734 1.00 42.16  ? 30   SER F C   1 
ATOM   8192  O  O   . SER F  1 49  ? -11.193  9.699   -135.376 1.00 41.48  ? 30   SER F O   1 
ATOM   8193  C  CB  . SER F  1 49  ? -8.364   9.695   -134.353 1.00 37.60  ? 30   SER F CB  1 
ATOM   8194  O  OG  . SER F  1 49  ? -7.113   10.099  -133.853 1.00 39.38  ? 30   SER F OG  1 
ATOM   8195  N  N   . VAL F  1 50  ? -10.054  10.797  -136.993 1.00 44.14  ? 31   VAL F N   1 
ATOM   8196  C  CA  . VAL F  1 50  ? -10.883  10.304  -138.083 1.00 42.89  ? 31   VAL F CA  1 
ATOM   8197  C  C   . VAL F  1 50  ? -9.968   9.709   -139.138 1.00 45.72  ? 31   VAL F C   1 
ATOM   8198  O  O   . VAL F  1 50  ? -8.970   10.315  -139.533 1.00 46.89  ? 31   VAL F O   1 
ATOM   8199  C  CB  . VAL F  1 50  ? -11.727  11.429  -138.713 1.00 44.07  ? 31   VAL F CB  1 
ATOM   8200  C  CG1 . VAL F  1 50  ? -12.718  10.854  -139.714 1.00 41.16  ? 31   VAL F CG1 1 
ATOM   8201  C  CG2 . VAL F  1 50  ? -12.452  12.227  -137.633 1.00 43.72  ? 31   VAL F CG2 1 
ATOM   8202  N  N   . SER F  1 51  ? -10.310  8.511   -139.587 1.00 48.24  ? 32   SER F N   1 
ATOM   8203  C  CA  . SER F  1 51  ? -9.535   7.829   -140.613 1.00 44.12  ? 32   SER F CA  1 
ATOM   8204  C  C   . SER F  1 51  ? -10.494  7.018   -141.474 1.00 42.72  ? 32   SER F C   1 
ATOM   8205  O  O   . SER F  1 51  ? -11.126  6.080   -140.987 1.00 47.74  ? 32   SER F O   1 
ATOM   8206  C  CB  . SER F  1 51  ? -8.485   6.935   -139.945 1.00 45.17  ? 32   SER F CB  1 
ATOM   8207  O  OG  . SER F  1 51  ? -7.986   5.939   -140.818 1.00 48.40  ? 32   SER F OG  1 
ATOM   8208  N  N   . LEU F  1 52  ? -10.629  7.395   -142.743 1.00 38.44  ? 33   LEU F N   1 
ATOM   8209  C  CA  . LEU F  1 52  ? -11.496  6.654   -143.665 1.00 26.31  ? 33   LEU F CA  1 
ATOM   8210  C  C   . LEU F  1 52  ? -10.717  5.510   -144.296 1.00 25.75  ? 33   LEU F C   1 
ATOM   8211  O  O   . LEU F  1 52  ? -9.625   5.708   -144.812 1.00 32.03  ? 33   LEU F O   1 
ATOM   8212  C  CB  . LEU F  1 52  ? -12.043  7.568   -144.751 1.00 20.70  ? 33   LEU F CB  1 
ATOM   8213  C  CG  . LEU F  1 52  ? -12.748  8.827   -144.287 1.00 23.95  ? 33   LEU F CG  1 
ATOM   8214  C  CD1 . LEU F  1 52  ? -13.427  9.530   -145.473 1.00 29.57  ? 33   LEU F CD1 1 
ATOM   8215  C  CD2 . LEU F  1 52  ? -13.741  8.488   -143.176 1.00 27.93  ? 33   LEU F CD2 1 
ATOM   8216  N  N   . LYS F  1 53  ? -11.269  4.310   -144.222 1.00 28.53  ? 34   LYS F N   1 
ATOM   8217  C  CA  . LYS F  1 53  ? -10.681  3.142   -144.870 1.00 33.51  ? 34   LYS F CA  1 
ATOM   8218  C  C   . LYS F  1 53  ? -11.620  2.783   -146.004 1.00 32.84  ? 34   LYS F C   1 
ATOM   8219  O  O   . LYS F  1 53  ? -12.728  2.281   -145.771 1.00 34.30  ? 34   LYS F O   1 
ATOM   8220  C  CB  . LYS F  1 53  ? -10.567  1.951   -143.909 1.00 45.87  ? 34   LYS F CB  1 
ATOM   8221  C  CG  . LYS F  1 53  ? -9.971   2.275   -142.544 1.00 63.50  ? 34   LYS F CG  1 
ATOM   8222  C  CD  . LYS F  1 53  ? -8.459   2.355   -142.604 1.00 72.64  ? 34   LYS F CD  1 
ATOM   8223  C  CE  . LYS F  1 53  ? -7.866   2.628   -141.230 1.00 76.11  ? 34   LYS F CE  1 
ATOM   8224  N  NZ  . LYS F  1 53  ? -6.374   2.527   -141.272 1.00 79.38  ? 34   LYS F NZ  1 
ATOM   8225  N  N   . PHE F  1 54  ? -11.187  3.042   -147.233 1.00 30.46  ? 35   PHE F N   1 
ATOM   8226  C  CA  . PHE F  1 54  ? -12.077  2.847   -148.356 1.00 24.81  ? 35   PHE F CA  1 
ATOM   8227  C  C   . PHE F  1 54  ? -12.233  1.385   -148.690 1.00 25.82  ? 35   PHE F C   1 
ATOM   8228  O  O   . PHE F  1 54  ? -11.260  0.652   -148.764 1.00 33.55  ? 35   PHE F O   1 
ATOM   8229  C  CB  . PHE F  1 54  ? -11.624  3.683   -149.534 1.00 21.01  ? 35   PHE F CB  1 
ATOM   8230  C  CG  . PHE F  1 54  ? -11.750  5.164   -149.284 1.00 26.70  ? 35   PHE F CG  1 
ATOM   8231  C  CD1 . PHE F  1 54  ? -12.970  5.824   -149.488 1.00 26.31  ? 35   PHE F CD1 1 
ATOM   8232  C  CD2 . PHE F  1 54  ? -10.664  5.894   -148.812 1.00 32.05  ? 35   PHE F CD2 1 
ATOM   8233  C  CE1 . PHE F  1 54  ? -13.102  7.204   -149.235 1.00 25.97  ? 35   PHE F CE1 1 
ATOM   8234  C  CE2 . PHE F  1 54  ? -10.779  7.272   -148.555 1.00 34.30  ? 35   PHE F CE2 1 
ATOM   8235  C  CZ  . PHE F  1 54  ? -12.009  7.924   -148.761 1.00 31.80  ? 35   PHE F CZ  1 
ATOM   8236  N  N   . ILE F  1 55  ? -13.477  0.963   -148.858 1.00 22.10  ? 36   ILE F N   1 
ATOM   8237  C  CA  . ILE F  1 55  ? -13.779  -0.432  -149.141 1.00 23.62  ? 36   ILE F CA  1 
ATOM   8238  C  C   . ILE F  1 55  ? -14.225  -0.600  -150.597 1.00 29.76  ? 36   ILE F C   1 
ATOM   8239  O  O   . ILE F  1 55  ? -13.858  -1.556  -151.282 1.00 36.33  ? 36   ILE F O   1 
ATOM   8240  C  CB  . ILE F  1 55  ? -14.907  -0.925  -148.205 1.00 23.61  ? 36   ILE F CB  1 
ATOM   8241  C  CG1 . ILE F  1 55  ? -14.604  -0.559  -146.743 1.00 21.24  ? 36   ILE F CG1 1 
ATOM   8242  C  CG2 . ILE F  1 55  ? -15.150  -2.411  -148.378 1.00 21.44  ? 36   ILE F CG2 1 
ATOM   8243  C  CD1 . ILE F  1 55  ? -13.292  -1.129  -146.205 1.00 21.92  ? 36   ILE F CD1 1 
ATOM   8244  N  N   . ASN F  1 56  ? -15.026  0.335   -151.074 1.00 31.78  ? 37   ASN F N   1 
ATOM   8245  C  CA  . ASN F  1 56  ? -15.517  0.246   -152.436 1.00 33.69  ? 37   ASN F CA  1 
ATOM   8246  C  C   . ASN F  1 56  ? -15.939  1.583   -153.026 1.00 35.06  ? 37   ASN F C   1 
ATOM   8247  O  O   . ASN F  1 56  ? -16.307  2.519   -152.293 1.00 36.14  ? 37   ASN F O   1 
ATOM   8248  C  CB  . ASN F  1 56  ? -16.676  -0.747  -152.507 1.00 34.72  ? 37   ASN F CB  1 
ATOM   8249  C  CG  . ASN F  1 56  ? -16.704  -1.507  -153.807 1.00 37.12  ? 37   ASN F CG  1 
ATOM   8250  O  OD1 . ASN F  1 56  ? -16.415  -0.951  -154.877 1.00 34.72  ? 37   ASN F OD1 1 
ATOM   8251  N  ND2 . ASN F  1 56  ? -17.044  -2.796  -153.726 1.00 34.98  ? 37   ASN F ND2 1 
ATOM   8252  N  N   . ILE F  1 57  ? -15.870  1.673   -154.354 1.00 34.87  ? 38   ILE F N   1 
ATOM   8253  C  CA  . ILE F  1 57  ? -16.409  2.821   -155.077 1.00 30.12  ? 38   ILE F CA  1 
ATOM   8254  C  C   . ILE F  1 57  ? -17.403  2.273   -156.061 1.00 32.66  ? 38   ILE F C   1 
ATOM   8255  O  O   . ILE F  1 57  ? -17.051  1.428   -156.870 1.00 41.51  ? 38   ILE F O   1 
ATOM   8256  C  CB  . ILE F  1 57  ? -15.323  3.602   -155.780 1.00 26.77  ? 38   ILE F CB  1 
ATOM   8257  C  CG1 . ILE F  1 57  ? -14.337  4.154   -154.747 1.00 23.00  ? 38   ILE F CG1 1 
ATOM   8258  C  CG2 . ILE F  1 57  ? -15.935  4.729   -156.610 1.00 33.07  ? 38   ILE F CG2 1 
ATOM   8259  C  CD1 . ILE F  1 57  ? -13.094  4.824   -155.345 1.00 25.22  ? 38   ILE F CD1 1 
ATOM   8260  N  N   . LEU F  1 58  ? -18.646  2.734   -155.984 1.00 35.37  ? 39   LEU F N   1 
ATOM   8261  C  CA  . LEU F  1 58  ? -19.732  1.997   -156.617 1.00 43.86  ? 39   LEU F CA  1 
ATOM   8262  C  C   . LEU F  1 58  ? -20.375  2.626   -157.853 1.00 40.71  ? 39   LEU F C   1 
ATOM   8263  O  O   . LEU F  1 58  ? -20.717  1.906   -158.797 1.00 47.40  ? 39   LEU F O   1 
ATOM   8264  C  CB  . LEU F  1 58  ? -20.815  1.668   -155.594 1.00 45.26  ? 39   LEU F CB  1 
ATOM   8265  C  CG  . LEU F  1 58  ? -20.398  0.741   -154.467 1.00 52.89  ? 39   LEU F CG  1 
ATOM   8266  C  CD1 . LEU F  1 58  ? -21.550  0.563   -153.474 1.00 53.92  ? 39   LEU F CD1 1 
ATOM   8267  C  CD2 . LEU F  1 58  ? -19.949  -0.599  -155.043 1.00 57.40  ? 39   LEU F CD2 1 
ATOM   8268  N  N   . GLU F  1 59  ? -20.585  3.938   -157.853 1.00 27.19  ? 40   GLU F N   1 
ATOM   8269  C  CA  . GLU F  1 59  ? -21.470  4.468   -158.886 1.00 36.26  ? 40   GLU F CA  1 
ATOM   8270  C  C   . GLU F  1 59  ? -21.096  5.839   -159.466 1.00 45.17  ? 40   GLU F C   1 
ATOM   8271  O  O   . GLU F  1 59  ? -21.893  6.771   -159.384 1.00 54.03  ? 40   GLU F O   1 
ATOM   8272  C  CB  . GLU F  1 59  ? -22.914  4.482   -158.380 1.00 42.85  ? 40   GLU F CB  1 
ATOM   8273  C  CG  . GLU F  1 59  ? -23.945  4.464   -159.508 1.00 61.79  ? 40   GLU F CG  1 
ATOM   8274  C  CD  . GLU F  1 59  ? -24.832  3.213   -159.506 1.00 72.80  ? 40   GLU F CD  1 
ATOM   8275  O  OE1 . GLU F  1 59  ? -25.049  2.638   -158.403 1.00 71.79  ? 40   GLU F OE1 1 
ATOM   8276  O  OE2 . GLU F  1 59  ? -25.309  2.826   -160.611 1.00 73.46  ? 40   GLU F OE2 1 
ATOM   8277  N  N   . VAL F  1 60  ? -19.910  5.948   -160.074 1.00 35.85  ? 41   VAL F N   1 
ATOM   8278  C  CA  . VAL F  1 60  ? -19.341  7.237   -160.447 1.00 35.13  ? 41   VAL F CA  1 
ATOM   8279  C  C   . VAL F  1 60  ? -20.186  7.881   -161.554 1.00 36.35  ? 41   VAL F C   1 
ATOM   8280  O  O   . VAL F  1 60  ? -20.717  7.168   -162.412 1.00 29.81  ? 41   VAL F O   1 
ATOM   8281  C  CB  . VAL F  1 60  ? -17.868  7.058   -160.882 1.00 39.82  ? 41   VAL F CB  1 
ATOM   8282  C  CG1 . VAL F  1 60  ? -17.457  8.129   -161.863 1.00 45.26  ? 41   VAL F CG1 1 
ATOM   8283  C  CG2 . VAL F  1 60  ? -16.943  7.031   -159.685 1.00 41.18  ? 41   VAL F CG2 1 
ATOM   8284  N  N   . ASN F  1 61  ? -20.351  9.206   -161.494 1.00 38.15  ? 42   ASN F N   1 
ATOM   8285  C  CA  . ASN F  1 61  ? -21.029  9.968   -162.536 1.00 32.69  ? 42   ASN F CA  1 
ATOM   8286  C  C   . ASN F  1 61  ? -20.255  11.252  -162.827 1.00 40.09  ? 42   ASN F C   1 
ATOM   8287  O  O   . ASN F  1 61  ? -20.340  12.241  -162.082 1.00 42.19  ? 42   ASN F O   1 
ATOM   8288  C  CB  . ASN F  1 61  ? -22.478  10.275  -162.147 1.00 31.03  ? 42   ASN F CB  1 
ATOM   8289  C  CG  . ASN F  1 61  ? -23.304  10.834  -163.320 1.00 37.41  ? 42   ASN F CG  1 
ATOM   8290  O  OD1 . ASN F  1 61  ? -22.828  11.669  -164.096 1.00 44.43  ? 42   ASN F OD1 1 
ATOM   8291  N  ND2 . ASN F  1 61  ? -24.548  10.361  -163.451 1.00 32.66  ? 42   ASN F ND2 1 
ATOM   8292  N  N   . GLU F  1 62  ? -19.501  11.227  -163.922 1.00 42.85  ? 43   GLU F N   1 
ATOM   8293  C  CA  . GLU F  1 62  ? -18.623  12.340  -164.275 1.00 37.15  ? 43   GLU F CA  1 
ATOM   8294  C  C   . GLU F  1 62  ? -19.409  13.565  -164.722 1.00 31.60  ? 43   GLU F C   1 
ATOM   8295  O  O   . GLU F  1 62  ? -18.928  14.699  -164.578 1.00 34.59  ? 43   GLU F O   1 
ATOM   8296  C  CB  . GLU F  1 62  ? -17.611  11.916  -165.341 1.00 38.17  ? 43   GLU F CB  1 
ATOM   8297  C  CG  . GLU F  1 62  ? -16.410  12.839  -165.455 1.00 40.59  ? 43   GLU F CG  1 
ATOM   8298  C  CD  . GLU F  1 62  ? -15.270  12.233  -166.286 1.00 44.05  ? 43   GLU F CD  1 
ATOM   8299  O  OE1 . GLU F  1 62  ? -15.457  11.095  -166.806 1.00 43.92  ? 43   GLU F OE1 1 
ATOM   8300  O  OE2 . GLU F  1 62  ? -14.190  12.887  -166.394 1.00 40.36  ? 43   GLU F OE2 1 
ATOM   8301  N  N   . ILE F  1 63  ? -20.623  13.342  -165.231 1.00 30.09  ? 44   ILE F N   1 
ATOM   8302  C  CA  . ILE F  1 63  ? -21.509  14.450  -165.604 1.00 42.09  ? 44   ILE F CA  1 
ATOM   8303  C  C   . ILE F  1 63  ? -22.011  15.206  -164.382 1.00 43.90  ? 44   ILE F C   1 
ATOM   8304  O  O   . ILE F  1 63  ? -21.785  16.406  -164.259 1.00 55.75  ? 44   ILE F O   1 
ATOM   8305  C  CB  . ILE F  1 63  ? -22.732  13.981  -166.405 1.00 48.29  ? 44   ILE F CB  1 
ATOM   8306  C  CG1 . ILE F  1 63  ? -22.283  13.203  -167.635 1.00 50.58  ? 44   ILE F CG1 1 
ATOM   8307  C  CG2 . ILE F  1 63  ? -23.608  15.180  -166.772 1.00 52.87  ? 44   ILE F CG2 1 
ATOM   8308  C  CD1 . ILE F  1 63  ? -21.291  13.968  -168.514 1.00 55.47  ? 44   ILE F CD1 1 
ATOM   8309  N  N   . THR F  1 64  ? -22.690  14.494  -163.488 1.00 38.58  ? 45   THR F N   1 
ATOM   8310  C  CA  . THR F  1 64  ? -23.269  15.102  -162.290 1.00 40.08  ? 45   THR F CA  1 
ATOM   8311  C  C   . THR F  1 64  ? -22.255  15.385  -161.153 1.00 37.45  ? 45   THR F C   1 
ATOM   8312  O  O   . THR F  1 64  ? -22.586  16.092  -160.194 1.00 35.55  ? 45   THR F O   1 
ATOM   8313  C  CB  . THR F  1 64  ? -24.430  14.266  -161.726 1.00 36.45  ? 45   THR F CB  1 
ATOM   8314  O  OG1 . THR F  1 64  ? -23.921  13.036  -161.184 1.00 49.50  ? 45   THR F OG1 1 
ATOM   8315  C  CG2 . THR F  1 64  ? -25.414  13.960  -162.804 1.00 28.13  ? 45   THR F CG2 1 
ATOM   8316  N  N   . ASN F  1 65  ? -21.040  14.840  -161.269 1.00 32.92  ? 46   ASN F N   1 
ATOM   8317  C  CA  . ASN F  1 65  ? -20.024  15.015  -160.238 1.00 31.42  ? 46   ASN F CA  1 
ATOM   8318  C  C   . ASN F  1 65  ? -20.460  14.418  -158.879 1.00 40.76  ? 46   ASN F C   1 
ATOM   8319  O  O   . ASN F  1 65  ? -20.371  15.053  -157.812 1.00 39.02  ? 46   ASN F O   1 
ATOM   8320  C  CB  . ASN F  1 65  ? -19.644  16.488  -160.097 1.00 28.02  ? 46   ASN F CB  1 
ATOM   8321  C  CG  . ASN F  1 65  ? -18.352  16.827  -160.792 1.00 27.24  ? 46   ASN F CG  1 
ATOM   8322  O  OD1 . ASN F  1 65  ? -17.499  15.963  -161.024 1.00 31.98  ? 46   ASN F OD1 1 
ATOM   8323  N  ND2 . ASN F  1 65  ? -18.190  18.101  -161.122 1.00 25.70  ? 46   ASN F ND2 1 
ATOM   8324  N  N   . GLU F  1 66  ? -20.927  13.177  -158.947 1.00 45.83  ? 47   GLU F N   1 
ATOM   8325  C  CA  . GLU F  1 66  ? -21.396  12.453  -157.784 1.00 46.34  ? 47   GLU F CA  1 
ATOM   8326  C  C   . GLU F  1 66  ? -20.758  11.055  -157.731 1.00 48.82  ? 47   GLU F C   1 
ATOM   8327  O  O   . GLU F  1 66  ? -20.633  10.374  -158.756 1.00 49.20  ? 47   GLU F O   1 
ATOM   8328  C  CB  . GLU F  1 66  ? -22.926  12.366  -157.812 1.00 42.02  ? 47   GLU F CB  1 
ATOM   8329  C  CG  . GLU F  1 66  ? -23.607  13.721  -157.920 1.00 43.16  ? 47   GLU F CG  1 
ATOM   8330  C  CD  . GLU F  1 66  ? -25.124  13.617  -158.050 1.00 48.08  ? 47   GLU F CD  1 
ATOM   8331  O  OE1 . GLU F  1 66  ? -25.685  12.515  -157.814 1.00 43.88  ? 47   GLU F OE1 1 
ATOM   8332  O  OE2 . GLU F  1 66  ? -25.757  14.647  -158.393 1.00 50.57  ? 47   GLU F OE2 1 
ATOM   8333  N  N   . VAL F  1 67  ? -20.329  10.644  -156.538 1.00 45.31  ? 48   VAL F N   1 
ATOM   8334  C  CA  . VAL F  1 67  ? -19.790  9.302   -156.350 1.00 44.33  ? 48   VAL F CA  1 
ATOM   8335  C  C   . VAL F  1 67  ? -20.495  8.586   -155.197 1.00 42.21  ? 48   VAL F C   1 
ATOM   8336  O  O   . VAL F  1 67  ? -21.000  9.213   -154.279 1.00 39.47  ? 48   VAL F O   1 
ATOM   8337  C  CB  . VAL F  1 67  ? -18.265  9.307   -156.091 1.00 41.59  ? 48   VAL F CB  1 
ATOM   8338  C  CG1 . VAL F  1 67  ? -17.541  9.917   -157.237 1.00 46.25  ? 48   VAL F CG1 1 
ATOM   8339  C  CG2 . VAL F  1 67  ? -17.952  10.082  -154.854 1.00 37.72  ? 48   VAL F CG2 1 
ATOM   8340  N  N   . ASP F  1 68  ? -20.521  7.262   -155.263 1.00 45.37  ? 49   ASP F N   1 
ATOM   8341  C  CA  . ASP F  1 68  ? -21.124  6.434   -154.224 1.00 39.88  ? 49   ASP F CA  1 
ATOM   8342  C  C   . ASP F  1 68  ? -19.982  5.619   -153.637 1.00 30.68  ? 49   ASP F C   1 
ATOM   8343  O  O   . ASP F  1 68  ? -19.345  4.818   -154.325 1.00 37.08  ? 49   ASP F O   1 
ATOM   8344  C  CB  . ASP F  1 68  ? -22.149  5.514   -154.869 1.00 48.24  ? 49   ASP F CB  1 
ATOM   8345  C  CG  . ASP F  1 68  ? -23.264  5.126   -153.935 1.00 50.31  ? 49   ASP F CG  1 
ATOM   8346  O  OD1 . ASP F  1 68  ? -22.968  4.431   -152.942 1.00 60.75  ? 49   ASP F OD1 1 
ATOM   8347  O  OD2 . ASP F  1 68  ? -24.441  5.477   -154.209 1.00 45.26  ? 49   ASP F OD2 1 
ATOM   8348  N  N   . VAL F  1 69  ? -19.688  5.852   -152.371 1.00 28.68  ? 50   VAL F N   1 
ATOM   8349  C  CA  . VAL F  1 69  ? -18.524  5.236   -151.737 1.00 28.52  ? 50   VAL F CA  1 
ATOM   8350  C  C   . VAL F  1 69  ? -18.912  4.402   -150.523 1.00 29.62  ? 50   VAL F C   1 
ATOM   8351  O  O   . VAL F  1 69  ? -19.837  4.750   -149.784 1.00 30.94  ? 50   VAL F O   1 
ATOM   8352  C  CB  . VAL F  1 69  ? -17.536  6.300   -151.265 1.00 30.25  ? 50   VAL F CB  1 
ATOM   8353  C  CG1 . VAL F  1 69  ? -16.262  5.641   -150.741 1.00 25.18  ? 50   VAL F CG1 1 
ATOM   8354  C  CG2 . VAL F  1 69  ? -17.227  7.267   -152.385 1.00 35.87  ? 50   VAL F CG2 1 
ATOM   8355  N  N   . VAL F  1 70  ? -18.205  3.292   -150.333 1.00 30.41  ? 51   VAL F N   1 
ATOM   8356  C  CA  . VAL F  1 70  ? -18.319  2.498   -149.123 1.00 27.33  ? 51   VAL F CA  1 
ATOM   8357  C  C   . VAL F  1 70  ? -16.986  2.565   -148.390 1.00 29.12  ? 51   VAL F C   1 
ATOM   8358  O  O   . VAL F  1 70  ? -15.934  2.273   -148.973 1.00 29.25  ? 51   VAL F O   1 
ATOM   8359  C  CB  . VAL F  1 70  ? -18.667  1.045   -149.430 1.00 26.52  ? 51   VAL F CB  1 
ATOM   8360  C  CG1 . VAL F  1 70  ? -18.519  0.177   -148.170 1.00 31.90  ? 51   VAL F CG1 1 
ATOM   8361  C  CG2 . VAL F  1 70  ? -20.086  0.964   -149.954 1.00 25.55  ? 51   VAL F CG2 1 
ATOM   8362  N  N   . PHE F  1 71  ? -17.035  2.943   -147.109 1.00 22.57  ? 52   PHE F N   1 
ATOM   8363  C  CA  . PHE F  1 71  ? -15.820  3.187   -146.313 1.00 16.09  ? 52   PHE F CA  1 
ATOM   8364  C  C   . PHE F  1 71  ? -16.066  2.999   -144.839 1.00 19.79  ? 52   PHE F C   1 
ATOM   8365  O  O   . PHE F  1 71  ? -17.168  3.260   -144.350 1.00 19.31  ? 52   PHE F O   1 
ATOM   8366  C  CB  . PHE F  1 71  ? -15.308  4.614   -146.519 1.00 16.00  ? 52   PHE F CB  1 
ATOM   8367  C  CG  . PHE F  1 71  ? -16.302  5.674   -146.144 1.00 15.50  ? 52   PHE F CG  1 
ATOM   8368  C  CD1 . PHE F  1 71  ? -17.341  6.024   -147.007 1.00 25.13  ? 52   PHE F CD1 1 
ATOM   8369  C  CD2 . PHE F  1 71  ? -16.206  6.320   -144.938 1.00 22.77  ? 52   PHE F CD2 1 
ATOM   8370  C  CE1 . PHE F  1 71  ? -18.274  6.996   -146.662 1.00 25.65  ? 52   PHE F CE1 1 
ATOM   8371  C  CE2 . PHE F  1 71  ? -17.134  7.302   -144.584 1.00 25.85  ? 52   PHE F CE2 1 
ATOM   8372  C  CZ  . PHE F  1 71  ? -18.166  7.643   -145.455 1.00 25.13  ? 52   PHE F CZ  1 
ATOM   8373  N  N   . TRP F  1 72  ? -15.032  2.537   -144.138 1.00 23.97  ? 53   TRP F N   1 
ATOM   8374  C  CA  . TRP F  1 72  ? -15.057  2.438   -142.680 1.00 24.55  ? 53   TRP F CA  1 
ATOM   8375  C  C   . TRP F  1 72  ? -14.695  3.799   -142.140 1.00 26.49  ? 53   TRP F C   1 
ATOM   8376  O  O   . TRP F  1 72  ? -13.607  4.317   -142.423 1.00 23.80  ? 53   TRP F O   1 
ATOM   8377  C  CB  . TRP F  1 72  ? -14.019  1.443   -142.173 1.00 23.93  ? 53   TRP F CB  1 
ATOM   8378  C  CG  . TRP F  1 72  ? -14.252  0.044   -142.608 1.00 23.27  ? 53   TRP F CG  1 
ATOM   8379  C  CD1 . TRP F  1 72  ? -15.258  -0.417  -143.415 1.00 20.13  ? 53   TRP F CD1 1 
ATOM   8380  C  CD2 . TRP F  1 72  ? -13.472  -1.101  -142.240 1.00 24.98  ? 53   TRP F CD2 1 
ATOM   8381  N  NE1 . TRP F  1 72  ? -15.142  -1.783  -143.575 1.00 23.45  ? 53   TRP F NE1 1 
ATOM   8382  C  CE2 . TRP F  1 72  ? -14.055  -2.226  -142.867 1.00 26.33  ? 53   TRP F CE2 1 
ATOM   8383  C  CE3 . TRP F  1 72  ? -12.322  -1.281  -141.463 1.00 27.56  ? 53   TRP F CE3 1 
ATOM   8384  C  CZ2 . TRP F  1 72  ? -13.534  -3.521  -142.722 1.00 29.27  ? 53   TRP F CZ2 1 
ATOM   8385  C  CZ3 . TRP F  1 72  ? -11.797  -2.573  -141.317 1.00 28.06  ? 53   TRP F CZ3 1 
ATOM   8386  C  CH2 . TRP F  1 72  ? -12.404  -3.674  -141.943 1.00 27.23  ? 53   TRP F CH2 1 
ATOM   8387  N  N   . GLN F  1 73  ? -15.602  4.387   -141.370 1.00 24.51  ? 54   GLN F N   1 
ATOM   8388  C  CA  . GLN F  1 73  ? -15.296  5.649   -140.734 1.00 25.95  ? 54   GLN F CA  1 
ATOM   8389  C  C   . GLN F  1 73  ? -14.741  5.402   -139.340 1.00 27.75  ? 54   GLN F C   1 
ATOM   8390  O  O   . GLN F  1 73  ? -15.453  5.531   -138.346 1.00 29.77  ? 54   GLN F O   1 
ATOM   8391  C  CB  . GLN F  1 73  ? -16.544  6.520   -140.671 1.00 32.48  ? 54   GLN F CB  1 
ATOM   8392  C  CG  . GLN F  1 73  ? -16.273  7.984   -140.321 1.00 33.66  ? 54   GLN F CG  1 
ATOM   8393  C  CD  . GLN F  1 73  ? -17.466  8.870   -140.623 1.00 37.61  ? 54   GLN F CD  1 
ATOM   8394  O  OE1 . GLN F  1 73  ? -17.900  8.974   -141.770 1.00 42.57  ? 54   GLN F OE1 1 
ATOM   8395  N  NE2 . GLN F  1 73  ? -18.017  9.492   -139.595 1.00 40.39  ? 54   GLN F NE2 1 
ATOM   8396  N  N   . GLN F  1 74  ? -13.462  5.053   -139.268 1.00 30.15  ? 55   GLN F N   1 
ATOM   8397  C  CA  . GLN F  1 74  ? -12.804  4.816   -137.979 1.00 32.14  ? 55   GLN F CA  1 
ATOM   8398  C  C   . GLN F  1 74  ? -12.676  6.104   -137.151 1.00 30.83  ? 55   GLN F C   1 
ATOM   8399  O  O   . GLN F  1 74  ? -11.932  7.024   -137.499 1.00 36.14  ? 55   GLN F O   1 
ATOM   8400  C  CB  . GLN F  1 74  ? -11.429  4.189   -138.187 1.00 39.10  ? 55   GLN F CB  1 
ATOM   8401  C  CG  . GLN F  1 74  ? -10.697  3.919   -136.895 1.00 49.92  ? 55   GLN F CG  1 
ATOM   8402  C  CD  . GLN F  1 74  ? -9.278   3.410   -137.112 1.00 60.08  ? 55   GLN F CD  1 
ATOM   8403  O  OE1 . GLN F  1 74  ? -9.071   2.260   -137.493 1.00 65.05  ? 55   GLN F OE1 1 
ATOM   8404  N  NE2 . GLN F  1 74  ? -8.295   4.267   -136.861 1.00 63.08  ? 55   GLN F NE2 1 
ATOM   8405  N  N   . THR F  1 75  ? -13.428  6.162   -136.064 1.00 26.79  ? 56   THR F N   1 
ATOM   8406  C  CA  . THR F  1 75  ? -13.464  7.333   -135.199 1.00 28.20  ? 56   THR F CA  1 
ATOM   8407  C  C   . THR F  1 75  ? -12.957  6.997   -133.774 1.00 25.37  ? 56   THR F C   1 
ATOM   8408  O  O   . THR F  1 75  ? -13.387  6.026   -133.138 1.00 15.22  ? 56   THR F O   1 
ATOM   8409  C  CB  . THR F  1 75  ? -14.891  7.897   -135.133 1.00 34.55  ? 56   THR F CB  1 
ATOM   8410  O  OG1 . THR F  1 75  ? -15.454  7.952   -136.453 1.00 38.71  ? 56   THR F OG1 1 
ATOM   8411  C  CG2 . THR F  1 75  ? -14.878  9.288   -134.548 1.00 35.48  ? 56   THR F CG2 1 
ATOM   8412  N  N   . THR F  1 76  ? -12.019  7.784   -133.274 1.00 30.20  ? 57   THR F N   1 
ATOM   8413  C  CA  . THR F  1 76  ? -11.409  7.460   -131.995 1.00 31.69  ? 57   THR F CA  1 
ATOM   8414  C  C   . THR F  1 76  ? -11.320  8.686   -131.107 1.00 28.32  ? 57   THR F C   1 
ATOM   8415  O  O   . THR F  1 76  ? -10.880  9.752   -131.524 1.00 35.07  ? 57   THR F O   1 
ATOM   8416  C  CB  . THR F  1 76  ? -10.000  6.868   -132.182 1.00 42.79  ? 57   THR F CB  1 
ATOM   8417  O  OG1 . THR F  1 76  ? -10.064  5.729   -133.058 1.00 53.00  ? 57   THR F OG1 1 
ATOM   8418  C  CG2 . THR F  1 76  ? -9.416   6.431   -130.838 1.00 39.25  ? 57   THR F CG2 1 
ATOM   8419  N  N   . TRP F  1 77  ? -11.736  8.534   -129.866 1.00 21.40  ? 58   TRP F N   1 
ATOM   8420  C  CA  . TRP F  1 77  ? -11.622  9.629   -128.918 1.00 23.77  ? 58   TRP F CA  1 
ATOM   8421  C  C   . TRP F  1 77  ? -11.527  9.100   -127.489 1.00 36.01  ? 58   TRP F C   1 
ATOM   8422  O  O   . TRP F  1 77  ? -11.480  7.880   -127.234 1.00 36.25  ? 58   TRP F O   1 
ATOM   8423  C  CB  . TRP F  1 77  ? -12.818  10.572  -129.038 1.00 24.41  ? 58   TRP F CB  1 
ATOM   8424  C  CG  . TRP F  1 77  ? -14.134  9.924   -128.633 1.00 30.20  ? 58   TRP F CG  1 
ATOM   8425  C  CD1 . TRP F  1 77  ? -14.758  10.024  -127.416 1.00 34.95  ? 58   TRP F CD1 1 
ATOM   8426  C  CD2 . TRP F  1 77  ? -14.975  9.085   -129.446 1.00 30.39  ? 58   TRP F CD2 1 
ATOM   8427  N  NE1 . TRP F  1 77  ? -15.933  9.312   -127.426 1.00 37.96  ? 58   TRP F NE1 1 
ATOM   8428  C  CE2 . TRP F  1 77  ? -16.093  8.726   -128.657 1.00 34.78  ? 58   TRP F CE2 1 
ATOM   8429  C  CE3 . TRP F  1 77  ? -14.896  8.612   -130.759 1.00 29.05  ? 58   TRP F CE3 1 
ATOM   8430  C  CZ2 . TRP F  1 77  ? -17.127  7.912   -129.143 1.00 28.19  ? 58   TRP F CZ2 1 
ATOM   8431  C  CZ3 . TRP F  1 77  ? -15.917  7.794   -131.237 1.00 28.56  ? 58   TRP F CZ3 1 
ATOM   8432  C  CH2 . TRP F  1 77  ? -17.016  7.449   -130.424 1.00 26.91  ? 58   TRP F CH2 1 
ATOM   8433  N  N   . SER F  1 78  ? -11.531  10.001  -126.535 1.00 38.82  ? 59   SER F N   1 
ATOM   8434  C  CA  . SER F  1 78  ? -11.339  9.640   -125.159 1.00 34.38  ? 59   SER F CA  1 
ATOM   8435  C  C   . SER F  1 78  ? -12.434  10.138  -124.269 1.00 31.39  ? 59   SER F C   1 
ATOM   8436  O  O   . SER F  1 78  ? -12.723  11.288  -124.285 1.00 37.38  ? 59   SER F O   1 
ATOM   8437  C  CB  . SER F  1 78  ? -10.049  10.262  -124.702 1.00 32.66  ? 59   SER F CB  1 
ATOM   8438  O  OG  . SER F  1 78  ? -9.464   9.506   -123.699 1.00 44.34  ? 59   SER F OG  1 
ATOM   8439  N  N   . ASP F  1 79  ? -13.030  9.260   -123.480 1.00 39.86  ? 60   ASP F N   1 
ATOM   8440  C  CA  . ASP F  1 79  ? -13.885  9.637   -122.360 1.00 41.23  ? 60   ASP F CA  1 
ATOM   8441  C  C   . ASP F  1 79  ? -13.405  8.909   -121.105 1.00 38.76  ? 60   ASP F C   1 
ATOM   8442  O  O   . ASP F  1 79  ? -13.647  7.753   -120.957 1.00 33.35  ? 60   ASP F O   1 
ATOM   8443  C  CB  . ASP F  1 79  ? -15.321  9.246   -122.688 1.00 44.02  ? 60   ASP F CB  1 
ATOM   8444  C  CG  . ASP F  1 79  ? -16.334  9.927   -121.831 1.00 46.09  ? 60   ASP F CG  1 
ATOM   8445  O  OD1 . ASP F  1 79  ? -15.983  10.427  -120.789 1.00 46.17  ? 60   ASP F OD1 1 
ATOM   8446  O  OD2 . ASP F  1 79  ? -17.502  9.952   -122.170 1.00 45.25  ? 60   ASP F OD2 1 
ATOM   8447  N  N   . ARG F  1 80  ? -12.757  9.594   -120.181 1.00 42.37  ? 61   ARG F N   1 
ATOM   8448  C  CA  . ARG F  1 80  ? -12.127  8.910   -119.057 1.00 48.22  ? 61   ARG F CA  1 
ATOM   8449  C  C   . ARG F  1 80  ? -13.051  8.618   -117.933 1.00 41.53  ? 61   ARG F C   1 
ATOM   8450  O  O   . ARG F  1 80  ? -12.740  7.876   -117.046 1.00 34.09  ? 61   ARG F O   1 
ATOM   8451  C  CB  . ARG F  1 80  ? -10.895  9.626   -118.579 1.00 65.14  ? 61   ARG F CB  1 
ATOM   8452  C  CG  . ARG F  1 80  ? -9.812   9.561   -119.614 1.00 81.74  ? 61   ARG F CG  1 
ATOM   8453  C  CD  . ARG F  1 80  ? -8.415   9.624   -119.045 1.00 92.52  ? 61   ARG F CD  1 
ATOM   8454  N  NE  . ARG F  1 80  ? -7.455   9.517   -120.137 1.00 102.76 ? 61   ARG F NE  1 
ATOM   8455  C  CZ  . ARG F  1 80  ? -7.222   10.479  -121.017 1.00 108.45 ? 61   ARG F CZ  1 
ATOM   8456  N  NH1 . ARG F  1 80  ? -7.861   11.627  -120.918 1.00 112.23 ? 61   ARG F NH1 1 
ATOM   8457  N  NH2 . ARG F  1 80  ? -6.352   10.299  -121.991 1.00 106.84 ? 61   ARG F NH2 1 
ATOM   8458  N  N   . THR F  1 81  ? -14.225  9.180   -118.025 1.00 40.28  ? 62   THR F N   1 
ATOM   8459  C  CA  . THR F  1 81  ? -15.296  8.818   -117.174 1.00 35.76  ? 62   THR F CA  1 
ATOM   8460  C  C   . THR F  1 81  ? -15.833  7.442   -117.466 1.00 44.42  ? 62   THR F C   1 
ATOM   8461  O  O   . THR F  1 81  ? -16.588  6.920   -116.693 1.00 53.39  ? 62   THR F O   1 
ATOM   8462  C  CB  . THR F  1 81  ? -16.404  9.806   -117.328 1.00 62.04  ? 62   THR F CB  1 
ATOM   8463  O  OG1 . THR F  1 81  ? -16.777  9.872   -118.698 1.00 59.77  ? 62   THR F OG1 1 
ATOM   8464  C  CG2 . THR F  1 81  ? -15.921  11.145  -116.891 1.00 62.42  ? 62   THR F CG2 1 
ATOM   8465  N  N   . LEU F  1 82  ? -15.497  6.868   -118.602 1.00 43.00  ? 63   LEU F N   1 
ATOM   8466  C  CA  . LEU F  1 82  ? -15.851  5.511   -118.876 1.00 35.12  ? 63   LEU F CA  1 
ATOM   8467  C  C   . LEU F  1 82  ? -14.822  4.552   -118.347 1.00 37.93  ? 63   LEU F C   1 
ATOM   8468  O  O   . LEU F  1 82  ? -15.011  3.375   -118.366 1.00 39.79  ? 63   LEU F O   1 
ATOM   8469  C  CB  . LEU F  1 82  ? -16.030  5.312   -120.358 1.00 29.04  ? 63   LEU F CB  1 
ATOM   8470  C  CG  . LEU F  1 82  ? -17.177  6.096   -120.923 1.00 32.48  ? 63   LEU F CG  1 
ATOM   8471  C  CD1 . LEU F  1 82  ? -17.309  5.880   -122.394 1.00 34.54  ? 63   LEU F CD1 1 
ATOM   8472  C  CD2 . LEU F  1 82  ? -18.448  5.749   -120.220 1.00 34.46  ? 63   LEU F CD2 1 
ATOM   8473  N  N   . ALA F  1 83  ? -13.745  5.070   -117.817 1.00 36.46  ? 64   ALA F N   1 
ATOM   8474  C  CA  . ALA F  1 83  ? -12.616  4.260   -117.445 1.00 36.04  ? 64   ALA F CA  1 
ATOM   8475  C  C   . ALA F  1 83  ? -12.921  3.369   -116.284 1.00 37.55  ? 64   ALA F C   1 
ATOM   8476  O  O   . ALA F  1 83  ? -13.844  3.600   -115.559 1.00 40.75  ? 64   ALA F O   1 
ATOM   8477  C  CB  . ALA F  1 83  ? -11.453  5.151   -117.105 1.00 32.33  ? 64   ALA F CB  1 
ATOM   8478  N  N   . TRP F  1 84  ? -12.152  2.314   -116.145 1.00 35.56  ? 65   TRP F N   1 
ATOM   8479  C  CA  . TRP F  1 84  ? -12.279  1.414   -114.997 1.00 40.63  ? 65   TRP F CA  1 
ATOM   8480  C  C   . TRP F  1 84  ? -10.969  0.724   -114.661 1.00 53.00  ? 65   TRP F C   1 
ATOM   8481  O  O   . TRP F  1 84  ? -10.053  0.644   -115.492 1.00 52.33  ? 65   TRP F O   1 
ATOM   8482  C  CB  . TRP F  1 84  ? -13.358  0.357   -115.214 1.00 35.12  ? 65   TRP F CB  1 
ATOM   8483  C  CG  . TRP F  1 84  ? -13.015  -0.697  -116.248 1.00 33.85  ? 65   TRP F CG  1 
ATOM   8484  C  CD1 . TRP F  1 84  ? -12.355  -1.871  -116.038 1.00 32.02  ? 65   TRP F CD1 1 
ATOM   8485  C  CD2 . TRP F  1 84  ? -13.354  -0.667  -117.663 1.00 32.98  ? 65   TRP F CD2 1 
ATOM   8486  N  NE1 . TRP F  1 84  ? -12.248  -2.574  -117.219 1.00 24.76  ? 65   TRP F NE1 1 
ATOM   8487  C  CE2 . TRP F  1 84  ? -12.839  -1.878  -118.202 1.00 36.32  ? 65   TRP F CE2 1 
ATOM   8488  C  CE3 . TRP F  1 84  ? -14.018  0.250   -118.473 1.00 24.10  ? 65   TRP F CE3 1 
ATOM   8489  C  CZ2 . TRP F  1 84  ? -13.002  -2.163  -119.581 1.00 24.07  ? 65   TRP F CZ2 1 
ATOM   8490  C  CZ3 . TRP F  1 84  ? -14.155  -0.047  -119.818 1.00 23.77  ? 65   TRP F CZ3 1 
ATOM   8491  C  CH2 . TRP F  1 84  ? -13.645  -1.245  -120.359 1.00 37.48  ? 65   TRP F CH2 1 
ATOM   8492  N  N   . ASN F  1 85  ? -10.894  0.228   -113.427 1.00 65.02  ? 66   ASN F N   1 
ATOM   8493  C  CA  . ASN F  1 85  ? -9.714   -0.468  -112.934 1.00 68.89  ? 66   ASN F CA  1 
ATOM   8494  C  C   . ASN F  1 85  ? -9.643   -1.857  -113.565 1.00 67.17  ? 66   ASN F C   1 
ATOM   8495  O  O   . ASN F  1 85  ? -10.421  -2.744  -113.213 1.00 66.20  ? 66   ASN F O   1 
ATOM   8496  C  CB  . ASN F  1 85  ? -9.762   -0.556  -111.404 1.00 70.61  ? 66   ASN F CB  1 
ATOM   8497  C  CG  . ASN F  1 85  ? -8.448   -1.013  -110.803 1.00 78.48  ? 66   ASN F CG  1 
ATOM   8498  O  OD1 . ASN F  1 85  ? -7.624   -1.625  -111.486 1.00 79.11  ? 66   ASN F OD1 1 
ATOM   8499  N  ND2 . ASN F  1 85  ? -8.245   -0.723  -109.513 1.00 84.01  ? 66   ASN F ND2 1 
ATOM   8500  N  N   . SER F  1 86  ? -8.713   -2.045  -114.497 1.00 66.01  ? 67   SER F N   1 
ATOM   8501  C  CA  . SER F  1 86  ? -8.661   -3.280  -115.278 1.00 66.36  ? 67   SER F CA  1 
ATOM   8502  C  C   . SER F  1 86  ? -7.751   -4.348  -114.677 1.00 69.01  ? 67   SER F C   1 
ATOM   8503  O  O   . SER F  1 86  ? -7.332   -5.270  -115.374 1.00 72.46  ? 67   SER F O   1 
ATOM   8504  C  CB  . SER F  1 86  ? -8.200   -2.993  -116.711 1.00 64.33  ? 67   SER F CB  1 
ATOM   8505  O  OG  . SER F  1 86  ? -6.787   -2.872  -116.780 1.00 62.31  ? 67   SER F OG  1 
ATOM   8506  N  N   . SER F  1 87  ? -7.437   -4.219  -113.396 1.00 69.76  ? 68   SER F N   1 
ATOM   8507  C  CA  . SER F  1 87  ? -6.531   -5.152  -112.739 1.00 73.63  ? 68   SER F CA  1 
ATOM   8508  C  C   . SER F  1 87  ? -6.947   -6.609  -112.949 1.00 67.29  ? 68   SER F C   1 
ATOM   8509  O  O   . SER F  1 87  ? -6.157   -7.418  -113.428 1.00 71.09  ? 68   SER F O   1 
ATOM   8510  C  CB  . SER F  1 87  ? -6.425   -4.830  -111.240 1.00 83.81  ? 68   SER F CB  1 
ATOM   8511  O  OG  . SER F  1 87  ? -7.709   -4.644  -110.658 1.00 87.47  ? 68   SER F OG  1 
ATOM   8512  N  N   . HIS F  1 88  ? -8.185   -6.941  -112.600 1.00 59.48  ? 69   HIS F N   1 
ATOM   8513  C  CA  . HIS F  1 88  ? -8.668   -8.305  -112.784 1.00 65.67  ? 69   HIS F CA  1 
ATOM   8514  C  C   . HIS F  1 88  ? -9.943   -8.274  -113.605 1.00 66.78  ? 69   HIS F C   1 
ATOM   8515  O  O   . HIS F  1 88  ? -10.909  -8.967  -113.317 1.00 70.31  ? 69   HIS F O   1 
ATOM   8516  C  CB  . HIS F  1 88  ? -8.903   -8.983  -111.431 1.00 79.27  ? 69   HIS F CB  1 
ATOM   8517  C  CG  . HIS F  1 88  ? -7.669   -9.079  -110.580 1.00 88.10  ? 69   HIS F CG  1 
ATOM   8518  N  ND1 . HIS F  1 88  ? -7.260   -8.068  -109.730 1.00 88.61  ? 69   HIS F ND1 1 
ATOM   8519  C  CD2 . HIS F  1 88  ? -6.740   -10.060 -110.468 1.00 86.79  ? 69   HIS F CD2 1 
ATOM   8520  C  CE1 . HIS F  1 88  ? -6.138   -8.424  -109.132 1.00 85.52  ? 69   HIS F CE1 1 
ATOM   8521  N  NE2 . HIS F  1 88  ? -5.802   -9.629  -109.562 1.00 85.73  ? 69   HIS F NE2 1 
ATOM   8522  N  N   . SER F  1 89  ? -9.927   -7.455  -114.645 1.00 64.72  ? 70   SER F N   1 
ATOM   8523  C  CA  . SER F  1 89  ? -11.115  -7.176  -115.419 1.00 59.45  ? 70   SER F CA  1 
ATOM   8524  C  C   . SER F  1 89  ? -10.707  -7.224  -116.874 1.00 52.30  ? 70   SER F C   1 
ATOM   8525  O  O   . SER F  1 89  ? -9.508   -7.246  -117.168 1.00 47.70  ? 70   SER F O   1 
ATOM   8526  C  CB  . SER F  1 89  ? -11.631  -5.775  -115.065 1.00 67.44  ? 70   SER F CB  1 
ATOM   8527  O  OG  . SER F  1 89  ? -11.784  -5.623  -113.662 1.00 73.29  ? 70   SER F OG  1 
ATOM   8528  N  N   . PRO F  1 90  ? -11.698  -7.253  -117.792 1.00 51.05  ? 71   PRO F N   1 
ATOM   8529  C  CA  . PRO F  1 90  ? -11.445  -7.099  -119.235 1.00 44.93  ? 71   PRO F CA  1 
ATOM   8530  C  C   . PRO F  1 90  ? -10.810  -5.750  -119.544 1.00 39.32  ? 71   PRO F C   1 
ATOM   8531  O  O   . PRO F  1 90  ? -11.091  -4.791  -118.827 1.00 36.36  ? 71   PRO F O   1 
ATOM   8532  C  CB  . PRO F  1 90  ? -12.851  -7.139  -119.838 1.00 45.44  ? 71   PRO F CB  1 
ATOM   8533  C  CG  . PRO F  1 90  ? -13.658  -7.930  -118.867 1.00 47.80  ? 71   PRO F CG  1 
ATOM   8534  C  CD  . PRO F  1 90  ? -13.108  -7.592  -117.513 1.00 50.26  ? 71   PRO F CD  1 
ATOM   8535  N  N   . ASP F  1 91  ? -9.989   -5.679  -120.591 1.00 43.74  ? 72   ASP F N   1 
ATOM   8536  C  CA  . ASP F  1 91  ? -9.365   -4.425  -121.019 1.00 51.77  ? 72   ASP F CA  1 
ATOM   8537  C  C   . ASP F  1 91  ? -10.288  -3.625  -121.927 1.00 49.46  ? 72   ASP F C   1 
ATOM   8538  O  O   . ASP F  1 91  ? -10.086  -2.424  -122.150 1.00 48.07  ? 72   ASP F O   1 
ATOM   8539  C  CB  . ASP F  1 91  ? -8.081   -4.709  -121.788 1.00 65.65  ? 72   ASP F CB  1 
ATOM   8540  C  CG  . ASP F  1 91  ? -7.290   -5.841  -121.190 1.00 81.00  ? 72   ASP F CG  1 
ATOM   8541  O  OD1 . ASP F  1 91  ? -7.236   -5.920  -119.943 1.00 86.35  ? 72   ASP F OD1 1 
ATOM   8542  O  OD2 . ASP F  1 91  ? -6.733   -6.655  -121.966 1.00 85.59  ? 72   ASP F OD2 1 
ATOM   8543  N  N   . GLN F  1 92  ? -11.309  -4.297  -122.443 1.00 41.26  ? 73   GLN F N   1 
ATOM   8544  C  CA  . GLN F  1 92  ? -12.129  -3.739  -123.507 1.00 39.39  ? 73   GLN F CA  1 
ATOM   8545  C  C   . GLN F  1 92  ? -13.520  -4.340  -123.493 1.00 26.85  ? 73   GLN F C   1 
ATOM   8546  O  O   . GLN F  1 92  ? -13.674  -5.531  -123.235 1.00 29.03  ? 73   GLN F O   1 
ATOM   8547  C  CB  . GLN F  1 92  ? -11.460  -4.061  -124.845 1.00 46.22  ? 73   GLN F CB  1 
ATOM   8548  C  CG  . GLN F  1 92  ? -12.093  -3.448  -126.058 1.00 50.54  ? 73   GLN F CG  1 
ATOM   8549  C  CD  . GLN F  1 92  ? -11.405  -3.900  -127.331 1.00 55.98  ? 73   GLN F CD  1 
ATOM   8550  O  OE1 . GLN F  1 92  ? -11.665  -4.999  -127.817 1.00 63.91  ? 73   GLN F OE1 1 
ATOM   8551  N  NE2 . GLN F  1 92  ? -10.516  -3.057  -127.876 1.00 53.14  ? 73   GLN F NE2 1 
ATOM   8552  N  N   . VAL F  1 93  ? -14.531  -3.523  -123.774 1.00 20.64  ? 74   VAL F N   1 
ATOM   8553  C  CA  . VAL F  1 93  ? -15.882  -4.041  -124.025 1.00 19.91  ? 74   VAL F CA  1 
ATOM   8554  C  C   . VAL F  1 93  ? -16.491  -3.435  -125.289 1.00 26.93  ? 74   VAL F C   1 
ATOM   8555  O  O   . VAL F  1 93  ? -15.981  -2.455  -125.828 1.00 36.18  ? 74   VAL F O   1 
ATOM   8556  C  CB  . VAL F  1 93  ? -16.822  -3.754  -122.862 1.00 22.95  ? 74   VAL F CB  1 
ATOM   8557  C  CG1 . VAL F  1 93  ? -16.429  -4.568  -121.643 1.00 23.75  ? 74   VAL F CG1 1 
ATOM   8558  C  CG2 . VAL F  1 93  ? -16.819  -2.253  -122.553 1.00 26.55  ? 74   VAL F CG2 1 
ATOM   8559  N  N   . SER F  1 94  ? -17.581  -4.027  -125.759 1.00 28.07  ? 75   SER F N   1 
ATOM   8560  C  CA  . SER F  1 94  ? -18.310  -3.490  -126.894 1.00 13.83  ? 75   SER F CA  1 
ATOM   8561  C  C   . SER F  1 94  ? -19.584  -2.920  -126.362 1.00 13.41  ? 75   SER F C   1 
ATOM   8562  O  O   . SER F  1 94  ? -20.324  -3.582  -125.655 1.00 33.39  ? 75   SER F O   1 
ATOM   8563  C  CB  . SER F  1 94  ? -18.609  -4.573  -127.974 1.00 13.87  ? 75   SER F CB  1 
ATOM   8564  O  OG  . SER F  1 94  ? -17.430  -4.981  -128.650 1.00 21.57  ? 75   SER F OG  1 
ATOM   8565  N  N   . VAL F  1 95  ? -19.853  -1.681  -126.718 1.00 23.98  ? 76   VAL F N   1 
ATOM   8566  C  CA  . VAL F  1 95  ? -20.987  -0.967  -126.157 1.00 23.42  ? 76   VAL F CA  1 
ATOM   8567  C  C   . VAL F  1 95  ? -21.808  -0.401  -127.312 1.00 24.78  ? 76   VAL F C   1 
ATOM   8568  O  O   . VAL F  1 95  ? -21.247  0.128   -128.269 1.00 30.79  ? 76   VAL F O   1 
ATOM   8569  C  CB  . VAL F  1 95  ? -20.481  0.212   -125.242 1.00 23.25  ? 76   VAL F CB  1 
ATOM   8570  C  CG1 . VAL F  1 95  ? -21.637  0.951   -124.580 1.00 20.53  ? 76   VAL F CG1 1 
ATOM   8571  C  CG2 . VAL F  1 95  ? -19.471  -0.271  -124.216 1.00 13.23  ? 76   VAL F CG2 1 
ATOM   8572  N  N   . PRO F  1 96  ? -23.137  -0.503  -127.220 1.00 21.18  ? 77   PRO F N   1 
ATOM   8573  C  CA  . PRO F  1 96  ? -24.034  0.162   -128.180 1.00 14.72  ? 77   PRO F CA  1 
ATOM   8574  C  C   . PRO F  1 96  ? -23.812  1.682   -128.162 1.00 14.48  ? 77   PRO F C   1 
ATOM   8575  O  O   . PRO F  1 96  ? -23.762  2.288   -127.098 1.00 17.17  ? 77   PRO F O   1 
ATOM   8576  C  CB  . PRO F  1 96  ? -25.436  -0.151  -127.626 1.00 12.15  ? 77   PRO F CB  1 
ATOM   8577  C  CG  . PRO F  1 96  ? -25.262  -1.352  -126.769 1.00 25.59  ? 77   PRO F CG  1 
ATOM   8578  C  CD  . PRO F  1 96  ? -23.872  -1.245  -126.178 1.00 23.21  ? 77   PRO F CD  1 
ATOM   8579  N  N   . ILE F  1 97  ? -23.684  2.308   -129.324 1.00 24.35  ? 78   ILE F N   1 
ATOM   8580  C  CA  . ILE F  1 97  ? -23.373  3.736   -129.329 1.00 29.14  ? 78   ILE F CA  1 
ATOM   8581  C  C   . ILE F  1 97  ? -24.473  4.593   -128.686 1.00 27.67  ? 78   ILE F C   1 
ATOM   8582  O  O   . ILE F  1 97  ? -24.214  5.702   -128.210 1.00 25.31  ? 78   ILE F O   1 
ATOM   8583  C  CB  . ILE F  1 97  ? -23.009  4.270   -130.724 1.00 18.86  ? 78   ILE F CB  1 
ATOM   8584  C  CG1 . ILE F  1 97  ? -24.182  4.134   -131.667 1.00 15.81  ? 78   ILE F CG1 1 
ATOM   8585  C  CG2 . ILE F  1 97  ? -21.755  3.581   -131.228 1.00 20.59  ? 78   ILE F CG2 1 
ATOM   8586  C  CD1 . ILE F  1 97  ? -24.021  4.898   -132.929 1.00 13.73  ? 78   ILE F CD1 1 
ATOM   8587  N  N   . SER F  1 98  ? -25.692  4.071   -128.648 1.00 23.85  ? 79   SER F N   1 
ATOM   8588  C  CA  . SER F  1 98  ? -26.785  4.782   -127.985 1.00 24.29  ? 79   SER F CA  1 
ATOM   8589  C  C   . SER F  1 98  ? -26.529  4.939   -126.473 1.00 29.73  ? 79   SER F C   1 
ATOM   8590  O  O   . SER F  1 98  ? -27.155  5.757   -125.808 1.00 32.63  ? 79   SER F O   1 
ATOM   8591  C  CB  . SER F  1 98  ? -28.111  4.061   -128.240 1.00 29.62  ? 79   SER F CB  1 
ATOM   8592  O  OG  . SER F  1 98  ? -28.013  2.693   -127.887 1.00 40.69  ? 79   SER F OG  1 
ATOM   8593  N  N   . SER F  1 99  ? -25.594  4.162   -125.939 1.00 28.02  ? 80   SER F N   1 
ATOM   8594  C  CA  . SER F  1 99  ? -25.219  4.274   -124.532 1.00 31.08  ? 80   SER F CA  1 
ATOM   8595  C  C   . SER F  1 99  ? -23.956  5.123   -124.326 1.00 34.11  ? 80   SER F C   1 
ATOM   8596  O  O   . SER F  1 99  ? -23.448  5.219   -123.218 1.00 35.79  ? 80   SER F O   1 
ATOM   8597  C  CB  . SER F  1 99  ? -24.982  2.876   -123.920 1.00 33.20  ? 80   SER F CB  1 
ATOM   8598  O  OG  . SER F  1 99  ? -26.168  2.097   -123.882 1.00 34.94  ? 80   SER F OG  1 
ATOM   8599  N  N   . LEU F  1 100 ? -23.425  5.717   -125.391 1.00 32.13  ? 81   LEU F N   1 
ATOM   8600  C  CA  . LEU F  1 100 ? -22.196  6.506   -125.273 1.00 24.22  ? 81   LEU F CA  1 
ATOM   8601  C  C   . LEU F  1 100 ? -22.370  7.870   -125.885 1.00 25.31  ? 81   LEU F C   1 
ATOM   8602  O  O   . LEU F  1 100 ? -23.213  8.071   -126.757 1.00 32.03  ? 81   LEU F O   1 
ATOM   8603  C  CB  . LEU F  1 100 ? -21.039  5.851   -126.015 1.00 20.93  ? 81   LEU F CB  1 
ATOM   8604  C  CG  . LEU F  1 100 ? -20.549  4.504   -125.539 1.00 24.51  ? 81   LEU F CG  1 
ATOM   8605  C  CD1 . LEU F  1 100 ? -19.515  3.993   -126.548 1.00 13.82  ? 81   LEU F CD1 1 
ATOM   8606  C  CD2 . LEU F  1 100 ? -19.982  4.643   -124.161 1.00 22.35  ? 81   LEU F CD2 1 
ATOM   8607  N  N   . TRP F  1 101 ? -21.544  8.811   -125.456 1.00 23.48  ? 82   TRP F N   1 
ATOM   8608  C  CA  . TRP F  1 101 ? -21.459  10.037  -126.204 1.00 28.86  ? 82   TRP F CA  1 
ATOM   8609  C  C   . TRP F  1 101 ? -20.615  9.789   -127.446 1.00 27.63  ? 82   TRP F C   1 
ATOM   8610  O  O   . TRP F  1 101 ? -19.598  9.099   -127.407 1.00 24.82  ? 82   TRP F O   1 
ATOM   8611  C  CB  . TRP F  1 101 ? -20.837  11.148  -125.389 1.00 28.58  ? 82   TRP F CB  1 
ATOM   8612  C  CG  . TRP F  1 101 ? -20.618  12.392  -126.199 1.00 28.24  ? 82   TRP F CG  1 
ATOM   8613  C  CD1 . TRP F  1 101 ? -21.477  13.449  -126.334 1.00 24.71  ? 82   TRP F CD1 1 
ATOM   8614  C  CD2 . TRP F  1 101 ? -19.463  12.707  -126.997 1.00 24.22  ? 82   TRP F CD2 1 
ATOM   8615  N  NE1 . TRP F  1 101 ? -20.915  14.412  -127.137 1.00 22.24  ? 82   TRP F NE1 1 
ATOM   8616  C  CE2 . TRP F  1 101 ? -19.682  13.985  -127.554 1.00 20.30  ? 82   TRP F CE2 1 
ATOM   8617  C  CE3 . TRP F  1 101 ? -18.274  12.035  -127.284 1.00 22.96  ? 82   TRP F CE3 1 
ATOM   8618  C  CZ2 . TRP F  1 101 ? -18.753  14.598  -128.397 1.00 15.10  ? 82   TRP F CZ2 1 
ATOM   8619  C  CZ3 . TRP F  1 101 ? -17.340  12.661  -128.096 1.00 24.36  ? 82   TRP F CZ3 1 
ATOM   8620  C  CH2 . TRP F  1 101 ? -17.592  13.924  -128.656 1.00 23.29  ? 82   TRP F CH2 1 
ATOM   8621  N  N   . VAL F  1 102 ? -21.041  10.382  -128.545 1.00 25.51  ? 83   VAL F N   1 
ATOM   8622  C  CA  . VAL F  1 102 ? -20.406  10.142  -129.821 1.00 29.88  ? 83   VAL F CA  1 
ATOM   8623  C  C   . VAL F  1 102 ? -20.249  11.486  -130.483 1.00 25.76  ? 83   VAL F C   1 
ATOM   8624  O  O   . VAL F  1 102 ? -21.186  12.295  -130.452 1.00 20.96  ? 83   VAL F O   1 
ATOM   8625  C  CB  . VAL F  1 102 ? -21.241  9.134   -130.714 1.00 17.53  ? 83   VAL F CB  1 
ATOM   8626  C  CG1 . VAL F  1 102 ? -20.898  9.260   -132.160 1.00 14.74  ? 83   VAL F CG1 1 
ATOM   8627  C  CG2 . VAL F  1 102 ? -21.005  7.695   -130.250 1.00 14.26  ? 83   VAL F CG2 1 
ATOM   8628  N  N   . PRO F  1 103 ? -19.063  11.734  -131.081 1.00 26.21  ? 84   PRO F N   1 
ATOM   8629  C  CA  . PRO F  1 103 ? -18.857  12.995  -131.820 1.00 27.07  ? 84   PRO F CA  1 
ATOM   8630  C  C   . PRO F  1 103 ? -19.874  13.152  -132.951 1.00 23.96  ? 84   PRO F C   1 
ATOM   8631  O  O   . PRO F  1 103 ? -20.199  12.182  -133.647 1.00 27.00  ? 84   PRO F O   1 
ATOM   8632  C  CB  . PRO F  1 103 ? -17.426  12.883  -132.355 1.00 28.87  ? 84   PRO F CB  1 
ATOM   8633  C  CG  . PRO F  1 103 ? -17.035  11.419  -132.164 1.00 29.65  ? 84   PRO F CG  1 
ATOM   8634  C  CD  . PRO F  1 103 ? -17.851  10.891  -131.033 1.00 24.36  ? 84   PRO F CD  1 
ATOM   8635  N  N   . ASP F  1 104 ? -20.401  14.362  -133.099 1.00 17.60  ? 85   ASP F N   1 
ATOM   8636  C  CA  . ASP F  1 104 ? -21.417  14.639  -134.123 1.00 25.03  ? 85   ASP F CA  1 
ATOM   8637  C  C   . ASP F  1 104 ? -20.813  14.903  -135.509 1.00 24.11  ? 85   ASP F C   1 
ATOM   8638  O  O   . ASP F  1 104 ? -21.063  15.961  -136.115 1.00 15.99  ? 85   ASP F O   1 
ATOM   8639  C  CB  . ASP F  1 104 ? -22.336  15.803  -133.698 1.00 32.61  ? 85   ASP F CB  1 
ATOM   8640  C  CG  . ASP F  1 104 ? -21.583  17.144  -133.537 1.00 38.49  ? 85   ASP F CG  1 
ATOM   8641  O  OD1 . ASP F  1 104 ? -20.331  17.161  -133.383 1.00 31.64  ? 85   ASP F OD1 1 
ATOM   8642  O  OD2 . ASP F  1 104 ? -22.265  18.193  -133.547 1.00 43.91  ? 85   ASP F OD2 1 
ATOM   8643  N  N   . LEU F  1 105 ? -20.012  13.952  -135.996 1.00 18.26  ? 86   LEU F N   1 
ATOM   8644  C  CA  . LEU F  1 105 ? -19.335  14.135  -137.279 1.00 27.06  ? 86   LEU F CA  1 
ATOM   8645  C  C   . LEU F  1 105 ? -20.331  14.139  -138.443 1.00 32.71  ? 86   LEU F C   1 
ATOM   8646  O  O   . LEU F  1 105 ? -21.337  13.422  -138.431 1.00 33.84  ? 86   LEU F O   1 
ATOM   8647  C  CB  . LEU F  1 105 ? -18.255  13.065  -137.477 1.00 24.20  ? 86   LEU F CB  1 
ATOM   8648  C  CG  . LEU F  1 105 ? -17.116  13.087  -136.449 1.00 26.46  ? 86   LEU F CG  1 
ATOM   8649  C  CD1 . LEU F  1 105 ? -16.030  12.102  -136.849 1.00 29.36  ? 86   LEU F CD1 1 
ATOM   8650  C  CD2 . LEU F  1 105 ? -16.509  14.487  -136.206 1.00 17.09  ? 86   LEU F CD2 1 
ATOM   8651  N  N   . ALA F  1 106 ? -20.064  14.970  -139.439 1.00 37.42  ? 87   ALA F N   1 
ATOM   8652  C  CA  . ALA F  1 106 ? -20.852  14.950  -140.685 1.00 35.13  ? 87   ALA F CA  1 
ATOM   8653  C  C   . ALA F  1 106 ? -19.946  15.173  -141.877 1.00 25.74  ? 87   ALA F C   1 
ATOM   8654  O  O   . ALA F  1 106 ? -18.931  15.873  -141.776 1.00 26.25  ? 87   ALA F O   1 
ATOM   8655  C  CB  . ALA F  1 106 ? -21.967  15.998  -140.655 1.00 36.17  ? 87   ALA F CB  1 
ATOM   8656  N  N   . ALA F  1 107 ? -20.292  14.556  -143.002 1.00 26.83  ? 88   ALA F N   1 
ATOM   8657  C  CA  . ALA F  1 107 ? -19.611  14.833  -144.274 1.00 19.14  ? 88   ALA F CA  1 
ATOM   8658  C  C   . ALA F  1 107 ? -20.334  16.002  -144.944 1.00 17.96  ? 88   ALA F C   1 
ATOM   8659  O  O   . ALA F  1 107 ? -21.520  15.893  -145.330 1.00 17.73  ? 88   ALA F O   1 
ATOM   8660  C  CB  . ALA F  1 107 ? -19.651  13.635  -145.134 1.00 19.69  ? 88   ALA F CB  1 
ATOM   8661  N  N   . TYR F  1 108 ? -19.621  17.118  -145.064 1.00 23.59  ? 89   TYR F N   1 
ATOM   8662  C  CA  . TYR F  1 108 ? -20.202  18.368  -145.564 1.00 30.29  ? 89   TYR F CA  1 
ATOM   8663  C  C   . TYR F  1 108 ? -20.731  18.255  -146.960 1.00 33.20  ? 89   TYR F C   1 
ATOM   8664  O  O   . TYR F  1 108 ? -21.737  18.886  -147.282 1.00 38.43  ? 89   TYR F O   1 
ATOM   8665  C  CB  . TYR F  1 108 ? -19.194  19.527  -145.474 1.00 35.19  ? 89   TYR F CB  1 
ATOM   8666  C  CG  . TYR F  1 108 ? -19.096  20.092  -144.076 1.00 38.28  ? 89   TYR F CG  1 
ATOM   8667  C  CD1 . TYR F  1 108 ? -18.491  19.366  -143.059 1.00 39.62  ? 89   TYR F CD1 1 
ATOM   8668  C  CD2 . TYR F  1 108 ? -19.634  21.330  -143.762 1.00 42.04  ? 89   TYR F CD2 1 
ATOM   8669  C  CE1 . TYR F  1 108 ? -18.403  19.865  -141.773 1.00 42.27  ? 89   TYR F CE1 1 
ATOM   8670  C  CE2 . TYR F  1 108 ? -19.546  21.844  -142.462 1.00 44.51  ? 89   TYR F CE2 1 
ATOM   8671  C  CZ  . TYR F  1 108 ? -18.928  21.105  -141.474 1.00 40.25  ? 89   TYR F CZ  1 
ATOM   8672  O  OH  . TYR F  1 108 ? -18.839  21.590  -140.181 1.00 34.59  ? 89   TYR F OH  1 
ATOM   8673  N  N   . ASN F  1 109 ? -20.059  17.446  -147.783 1.00 35.05  ? 90   ASN F N   1 
ATOM   8674  C  CA  . ASN F  1 109 ? -20.414  17.322  -149.205 1.00 33.88  ? 90   ASN F CA  1 
ATOM   8675  C  C   . ASN F  1 109 ? -21.151  16.018  -149.499 1.00 35.70  ? 90   ASN F C   1 
ATOM   8676  O  O   . ASN F  1 109 ? -21.231  15.564  -150.644 1.00 37.89  ? 90   ASN F O   1 
ATOM   8677  C  CB  . ASN F  1 109 ? -19.174  17.476  -150.100 1.00 30.35  ? 90   ASN F CB  1 
ATOM   8678  C  CG  . ASN F  1 109 ? -18.061  16.516  -149.723 1.00 30.60  ? 90   ASN F CG  1 
ATOM   8679  O  OD1 . ASN F  1 109 ? -17.835  16.254  -148.552 1.00 35.15  ? 90   ASN F OD1 1 
ATOM   8680  N  ND2 . ASN F  1 109 ? -17.389  15.965  -150.712 1.00 28.80  ? 90   ASN F ND2 1 
ATOM   8681  N  N   . ALA F  1 110 ? -21.678  15.403  -148.446 1.00 34.33  ? 91   ALA F N   1 
ATOM   8682  C  CA  . ALA F  1 110 ? -22.537  14.236  -148.602 1.00 30.20  ? 91   ALA F CA  1 
ATOM   8683  C  C   . ALA F  1 110 ? -23.897  14.706  -149.105 1.00 28.00  ? 91   ALA F C   1 
ATOM   8684  O  O   . ALA F  1 110 ? -24.356  15.799  -148.753 1.00 31.13  ? 91   ALA F O   1 
ATOM   8685  C  CB  . ALA F  1 110 ? -22.683  13.517  -147.275 1.00 34.24  ? 91   ALA F CB  1 
ATOM   8686  N  N   . ILE F  1 111 ? -24.537  13.891  -149.933 1.00 23.77  ? 92   ILE F N   1 
ATOM   8687  C  CA  . ILE F  1 111 ? -25.801  14.295  -150.549 1.00 25.38  ? 92   ILE F CA  1 
ATOM   8688  C  C   . ILE F  1 111 ? -26.814  13.198  -150.342 1.00 25.17  ? 92   ILE F C   1 
ATOM   8689  O  O   . ILE F  1 111 ? -27.914  13.247  -150.873 1.00 27.50  ? 92   ILE F O   1 
ATOM   8690  C  CB  . ILE F  1 111 ? -25.686  14.619  -152.065 1.00 18.05  ? 92   ILE F CB  1 
ATOM   8691  C  CG1 . ILE F  1 111 ? -25.218  13.382  -152.843 1.00 29.48  ? 92   ILE F CG1 1 
ATOM   8692  C  CG2 . ILE F  1 111 ? -24.755  15.776  -152.294 1.00 18.45  ? 92   ILE F CG2 1 
ATOM   8693  C  CD1 . ILE F  1 111 ? -25.169  13.551  -154.369 1.00 32.36  ? 92   ILE F CD1 1 
ATOM   8694  N  N   . SER F  1 112 ? -26.417  12.181  -149.593 1.00 29.11  ? 93   SER F N   1 
ATOM   8695  C  CA  . SER F  1 112 ? -27.372  11.218  -149.029 1.00 29.80  ? 93   SER F CA  1 
ATOM   8696  C  C   . SER F  1 112 ? -27.085  11.076  -147.533 1.00 24.26  ? 93   SER F C   1 
ATOM   8697  O  O   . SER F  1 112 ? -25.955  11.312  -147.086 1.00 27.04  ? 93   SER F O   1 
ATOM   8698  C  CB  . SER F  1 112 ? -27.231  9.868   -149.712 1.00 32.42  ? 93   SER F CB  1 
ATOM   8699  O  OG  . SER F  1 112 ? -26.009  9.255   -149.347 1.00 36.02  ? 93   SER F OG  1 
ATOM   8700  N  N   . LYS F  1 113 ? -28.078  10.707  -146.736 1.00 27.26  ? 94   LYS F N   1 
ATOM   8701  C  CA  . LYS F  1 113 ? -27.732  10.412  -145.339 1.00 39.84  ? 94   LYS F CA  1 
ATOM   8702  C  C   . LYS F  1 113 ? -26.909  9.118   -145.246 1.00 39.78  ? 94   LYS F C   1 
ATOM   8703  O  O   . LYS F  1 113 ? -27.043  8.232   -146.098 1.00 37.83  ? 94   LYS F O   1 
ATOM   8704  C  CB  . LYS F  1 113 ? -28.924  10.457  -144.378 1.00 44.38  ? 94   LYS F CB  1 
ATOM   8705  C  CG  . LYS F  1 113 ? -29.980  9.423   -144.589 1.00 55.88  ? 94   LYS F CG  1 
ATOM   8706  C  CD  . LYS F  1 113 ? -31.211  9.798   -143.763 1.00 64.81  ? 94   LYS F CD  1 
ATOM   8707  C  CE  . LYS F  1 113 ? -30.852  10.015  -142.287 1.00 68.78  ? 94   LYS F CE  1 
ATOM   8708  N  NZ  . LYS F  1 113 ? -32.010  10.479  -141.451 1.00 68.90  ? 94   LYS F NZ  1 
ATOM   8709  N  N   . PRO F  1 114 ? -25.992  9.049   -144.261 1.00 38.46  ? 95   PRO F N   1 
ATOM   8710  C  CA  . PRO F  1 114 ? -25.100  7.886   -144.199 1.00 35.40  ? 95   PRO F CA  1 
ATOM   8711  C  C   . PRO F  1 114 ? -25.881  6.604   -143.935 1.00 37.41  ? 95   PRO F C   1 
ATOM   8712  O  O   . PRO F  1 114 ? -26.676  6.572   -142.988 1.00 35.59  ? 95   PRO F O   1 
ATOM   8713  C  CB  . PRO F  1 114 ? -24.171  8.204   -143.023 1.00 27.93  ? 95   PRO F CB  1 
ATOM   8714  C  CG  . PRO F  1 114 ? -24.907  9.257   -142.224 1.00 31.32  ? 95   PRO F CG  1 
ATOM   8715  C  CD  . PRO F  1 114 ? -25.671  10.052  -143.229 1.00 33.44  ? 95   PRO F CD  1 
ATOM   8716  N  N   . GLU F  1 115 ? -25.676  5.592   -144.789 1.00 31.53  ? 96   GLU F N   1 
ATOM   8717  C  CA  . GLU F  1 115 ? -26.250  4.282   -144.585 1.00 25.34  ? 96   GLU F CA  1 
ATOM   8718  C  C   . GLU F  1 115 ? -25.218  3.475   -143.820 1.00 28.29  ? 96   GLU F C   1 
ATOM   8719  O  O   . GLU F  1 115 ? -24.169  3.114   -144.374 1.00 22.94  ? 96   GLU F O   1 
ATOM   8720  C  CB  . GLU F  1 115 ? -26.564  3.620   -145.915 1.00 31.64  ? 96   GLU F CB  1 
ATOM   8721  C  CG  . GLU F  1 115 ? -27.361  2.313   -145.859 1.00 45.68  ? 96   GLU F CG  1 
ATOM   8722  C  CD  . GLU F  1 115 ? -27.582  1.688   -147.258 1.00 59.57  ? 96   GLU F CD  1 
ATOM   8723  O  OE1 . GLU F  1 115 ? -27.205  2.333   -148.266 1.00 64.17  ? 96   GLU F OE1 1 
ATOM   8724  O  OE2 . GLU F  1 115 ? -28.124  0.554   -147.356 1.00 62.82  ? 96   GLU F OE2 1 
ATOM   8725  N  N   . VAL F  1 116 ? -25.509  3.217   -142.540 1.00 32.24  ? 97   VAL F N   1 
ATOM   8726  C  CA  . VAL F  1 116 ? -24.625  2.409   -141.697 1.00 29.93  ? 97   VAL F CA  1 
ATOM   8727  C  C   . VAL F  1 116 ? -24.910  0.943   -141.952 1.00 27.96  ? 97   VAL F C   1 
ATOM   8728  O  O   . VAL F  1 116 ? -26.034  0.479   -141.760 1.00 30.81  ? 97   VAL F O   1 
ATOM   8729  C  CB  . VAL F  1 116 ? -24.776  2.755   -140.208 1.00 25.49  ? 97   VAL F CB  1 
ATOM   8730  C  CG1 . VAL F  1 116 ? -23.778  1.972   -139.385 1.00 21.01  ? 97   VAL F CG1 1 
ATOM   8731  C  CG2 . VAL F  1 116 ? -24.563  4.227   -140.040 1.00 14.87  ? 97   VAL F CG2 1 
ATOM   8732  N  N   . LEU F  1 117 ? -23.878  0.225   -142.386 1.00 25.91  ? 98   LEU F N   1 
ATOM   8733  C  CA  . LEU F  1 117 ? -24.029  -1.145  -142.854 1.00 24.09  ? 98   LEU F CA  1 
ATOM   8734  C  C   . LEU F  1 117 ? -23.735  -2.159  -141.766 1.00 29.16  ? 98   LEU F C   1 
ATOM   8735  O  O   . LEU F  1 117 ? -24.072  -3.335  -141.895 1.00 39.92  ? 98   LEU F O   1 
ATOM   8736  C  CB  . LEU F  1 117 ? -23.069  -1.392  -144.013 1.00 23.36  ? 98   LEU F CB  1 
ATOM   8737  C  CG  . LEU F  1 117 ? -23.137  -0.505  -145.249 1.00 19.74  ? 98   LEU F CG  1 
ATOM   8738  C  CD1 . LEU F  1 117 ? -22.011  -0.899  -146.192 1.00 16.47  ? 98   LEU F CD1 1 
ATOM   8739  C  CD2 . LEU F  1 117 ? -24.496  -0.614  -145.935 1.00 20.70  ? 98   LEU F CD2 1 
ATOM   8740  N  N   . THR F  1 118 ? -23.092  -1.701  -140.703 1.00 27.01  ? 99   THR F N   1 
ATOM   8741  C  CA  . THR F  1 118 ? -22.607  -2.606  -139.677 1.00 27.91  ? 99   THR F CA  1 
ATOM   8742  C  C   . THR F  1 118 ? -23.310  -2.394  -138.340 1.00 22.03  ? 99   THR F C   1 
ATOM   8743  O  O   . THR F  1 118 ? -23.938  -1.348  -138.163 1.00 15.89  ? 99   THR F O   1 
ATOM   8744  C  CB  . THR F  1 118 ? -21.119  -2.403  -139.519 1.00 27.02  ? 99   THR F CB  1 
ATOM   8745  O  OG1 . THR F  1 118 ? -20.857  -0.999  -139.526 1.00 25.10  ? 99   THR F OG1 1 
ATOM   8746  C  CG2 . THR F  1 118 ? -20.414  -3.052  -140.678 1.00 28.38  ? 99   THR F CG2 1 
ATOM   8747  N  N   . PRO F  1 119 ? -23.229  -3.396  -137.418 1.00 25.52  ? 100  PRO F N   1 
ATOM   8748  C  CA  . PRO F  1 119 ? -23.766  -3.246  -136.048 1.00 26.90  ? 100  PRO F CA  1 
ATOM   8749  C  C   . PRO F  1 119 ? -23.198  -1.992  -135.356 1.00 26.02  ? 100  PRO F C   1 
ATOM   8750  O  O   . PRO F  1 119 ? -21.981  -1.767  -135.363 1.00 25.16  ? 100  PRO F O   1 
ATOM   8751  C  CB  . PRO F  1 119 ? -23.290  -4.527  -135.342 1.00 23.30  ? 100  PRO F CB  1 
ATOM   8752  C  CG  . PRO F  1 119 ? -23.246  -5.550  -136.450 1.00 21.83  ? 100  PRO F CG  1 
ATOM   8753  C  CD  . PRO F  1 119 ? -22.700  -4.759  -137.639 1.00 21.76  ? 100  PRO F CD  1 
ATOM   8754  N  N   . GLN F  1 120 ? -24.068  -1.161  -134.793 1.00 33.06  ? 101  GLN F N   1 
ATOM   8755  C  CA  . GLN F  1 120 ? -23.611  0.101   -134.202 1.00 37.64  ? 101  GLN F CA  1 
ATOM   8756  C  C   . GLN F  1 120 ? -23.090  -0.063  -132.771 1.00 31.93  ? 101  GLN F C   1 
ATOM   8757  O  O   . GLN F  1 120 ? -23.733  0.343   -131.808 1.00 28.99  ? 101  GLN F O   1 
ATOM   8758  C  CB  . GLN F  1 120 ? -24.703  1.158   -134.312 1.00 35.43  ? 101  GLN F CB  1 
ATOM   8759  C  CG  . GLN F  1 120 ? -25.151  1.299   -135.744 1.00 36.39  ? 101  GLN F CG  1 
ATOM   8760  C  CD  . GLN F  1 120 ? -26.214  2.342   -135.933 1.00 46.23  ? 101  GLN F CD  1 
ATOM   8761  O  OE1 . GLN F  1 120 ? -26.277  3.319   -135.187 1.00 54.39  ? 101  GLN F OE1 1 
ATOM   8762  N  NE2 . GLN F  1 120 ? -27.068  2.141   -136.934 1.00 44.69  ? 101  GLN F NE2 1 
ATOM   8763  N  N   . LEU F  1 121 ? -21.914  -0.681  -132.681 1.00 30.64  ? 102  LEU F N   1 
ATOM   8764  C  CA  . LEU F  1 121 ? -21.208  -0.926  -131.433 1.00 28.01  ? 102  LEU F CA  1 
ATOM   8765  C  C   . LEU F  1 121 ? -19.835  -0.244  -131.453 1.00 24.52  ? 102  LEU F C   1 
ATOM   8766  O  O   . LEU F  1 121 ? -19.158  -0.183  -132.494 1.00 25.64  ? 102  LEU F O   1 
ATOM   8767  C  CB  . LEU F  1 121 ? -21.020  -2.426  -131.233 1.00 25.92  ? 102  LEU F CB  1 
ATOM   8768  C  CG  . LEU F  1 121 ? -22.291  -3.267  -131.130 1.00 29.04  ? 102  LEU F CG  1 
ATOM   8769  C  CD1 . LEU F  1 121 ? -21.929  -4.755  -131.090 1.00 33.73  ? 102  LEU F CD1 1 
ATOM   8770  C  CD2 . LEU F  1 121 ? -23.036  -2.875  -129.874 1.00 33.86  ? 102  LEU F CD2 1 
ATOM   8771  N  N   . ALA F  1 122 ? -19.419  0.262   -130.300 1.00 18.87  ? 103  ALA F N   1 
ATOM   8772  C  CA  . ALA F  1 122 ? -18.088  0.842   -130.177 1.00 23.79  ? 103  ALA F CA  1 
ATOM   8773  C  C   . ALA F  1 122 ? -17.221  0.022   -129.227 1.00 29.50  ? 103  ALA F C   1 
ATOM   8774  O  O   . ALA F  1 122 ? -17.726  -0.758  -128.403 1.00 32.54  ? 103  ALA F O   1 
ATOM   8775  C  CB  . ALA F  1 122 ? -18.182  2.286   -129.699 1.00 21.79  ? 103  ALA F CB  1 
ATOM   8776  N  N   . HIS F  1 123 ? -15.912  0.197   -129.346 1.00 25.67  ? 104  HIS F N   1 
ATOM   8777  C  CA  . HIS F  1 123 ? -14.990  -0.330  -128.351 1.00 24.55  ? 104  HIS F CA  1 
ATOM   8778  C  C   . HIS F  1 123 ? -14.801  0.707   -127.238 1.00 27.35  ? 104  HIS F C   1 
ATOM   8779  O  O   . HIS F  1 123 ? -14.521  1.895   -127.501 1.00 32.51  ? 104  HIS F O   1 
ATOM   8780  C  CB  . HIS F  1 123 ? -13.616  -0.603  -128.965 1.00 24.63  ? 104  HIS F CB  1 
ATOM   8781  C  CG  . HIS F  1 123 ? -13.510  -1.909  -129.660 1.00 25.82  ? 104  HIS F CG  1 
ATOM   8782  N  ND1 . HIS F  1 123 ? -14.537  -2.831  -129.698 1.00 24.15  ? 104  HIS F ND1 1 
ATOM   8783  C  CD2 . HIS F  1 123 ? -12.487  -2.466  -130.370 1.00 32.00  ? 104  HIS F CD2 1 
ATOM   8784  C  CE1 . HIS F  1 123 ? -14.160  -3.884  -130.388 1.00 26.45  ? 104  HIS F CE1 1 
ATOM   8785  N  NE2 . HIS F  1 123 ? -12.912  -3.688  -130.807 1.00 31.48  ? 104  HIS F NE2 1 
ATOM   8786  N  N   . VAL F  1 124 ? -14.936  0.262   -125.997 1.00 22.81  ? 105  VAL F N   1 
ATOM   8787  C  CA  . VAL F  1 124 ? -14.459  1.065   -124.877 1.00 25.62  ? 105  VAL F CA  1 
ATOM   8788  C  C   . VAL F  1 124 ? -13.317  0.317   -124.195 1.00 27.47  ? 105  VAL F C   1 
ATOM   8789  O  O   . VAL F  1 124 ? -13.473  -0.840  -123.773 1.00 30.48  ? 105  VAL F O   1 
ATOM   8790  C  CB  . VAL F  1 124 ? -15.579  1.402   -123.890 1.00 23.24  ? 105  VAL F CB  1 
ATOM   8791  C  CG1 . VAL F  1 124 ? -15.070  2.374   -122.814 1.00 21.54  ? 105  VAL F CG1 1 
ATOM   8792  C  CG2 . VAL F  1 124 ? -16.748  2.003   -124.630 1.00 24.12  ? 105  VAL F CG2 1 
ATOM   8793  N  N   . VAL F  1 125 ? -12.159  0.964   -124.123 1.00 25.36  ? 106  VAL F N   1 
ATOM   8794  C  CA  . VAL F  1 125 ? -11.003  0.371   -123.455 1.00 31.20  ? 106  VAL F CA  1 
ATOM   8795  C  C   . VAL F  1 125 ? -10.976  0.891   -122.024 1.00 30.68  ? 106  VAL F C   1 
ATOM   8796  O  O   . VAL F  1 125 ? -11.495  1.980   -121.767 1.00 29.87  ? 106  VAL F O   1 
ATOM   8797  C  CB  . VAL F  1 125 ? -9.687   0.724   -124.200 1.00 44.01  ? 106  VAL F CB  1 
ATOM   8798  C  CG1 . VAL F  1 125 ? -8.512   -0.060  -123.634 1.00 44.85  ? 106  VAL F CG1 1 
ATOM   8799  C  CG2 . VAL F  1 125 ? -9.829   0.421   -125.657 1.00 41.15  ? 106  VAL F CG2 1 
ATOM   8800  N  N   . SER F  1 126 ? -10.367  0.131   -121.109 1.00 33.51  ? 107  SER F N   1 
ATOM   8801  C  CA  . SER F  1 126 ? -10.391  0.442   -119.663 1.00 37.32  ? 107  SER F CA  1 
ATOM   8802  C  C   . SER F  1 126 ? -9.852   1.827   -119.296 1.00 37.07  ? 107  SER F C   1 
ATOM   8803  O  O   . SER F  1 126 ? -10.260  2.401   -118.280 1.00 35.83  ? 107  SER F O   1 
ATOM   8804  C  CB  . SER F  1 126 ? -9.649   -0.621  -118.861 1.00 41.07  ? 107  SER F CB  1 
ATOM   8805  O  OG  . SER F  1 126 ? -8.279   -0.680  -119.241 1.00 46.50  ? 107  SER F OG  1 
ATOM   8806  N  N   . ASP F  1 127 ? -8.946   2.358   -120.124 1.00 39.89  ? 108  ASP F N   1 
ATOM   8807  C  CA  . ASP F  1 127 ? -8.439   3.729   -119.948 1.00 41.40  ? 108  ASP F CA  1 
ATOM   8808  C  C   . ASP F  1 127 ? -9.419   4.823   -120.394 1.00 41.66  ? 108  ASP F C   1 
ATOM   8809  O  O   . ASP F  1 127 ? -9.167   6.004   -120.175 1.00 49.24  ? 108  ASP F O   1 
ATOM   8810  C  CB  . ASP F  1 127 ? -7.091   3.922   -120.645 1.00 43.05  ? 108  ASP F CB  1 
ATOM   8811  C  CG  . ASP F  1 127 ? -7.146   3.633   -122.128 1.00 51.60  ? 108  ASP F CG  1 
ATOM   8812  O  OD1 . ASP F  1 127 ? -8.164   3.094   -122.589 1.00 61.05  ? 108  ASP F OD1 1 
ATOM   8813  O  OD2 . ASP F  1 127 ? -6.162   3.929   -122.837 1.00 55.04  ? 108  ASP F OD2 1 
ATOM   8814  N  N   . GLY F  1 128 ? -10.536  4.431   -121.008 1.00 34.66  ? 109  GLY F N   1 
ATOM   8815  C  CA  . GLY F  1 128 ? -11.531  5.385   -121.464 1.00 30.79  ? 109  GLY F CA  1 
ATOM   8816  C  C   . GLY F  1 128 ? -11.400  5.746   -122.939 1.00 30.08  ? 109  GLY F C   1 
ATOM   8817  O  O   . GLY F  1 128 ? -12.077  6.644   -123.444 1.00 30.93  ? 109  GLY F O   1 
ATOM   8818  N  N   . GLU F  1 129 ? -10.518  5.064   -123.648 1.00 30.21  ? 110  GLU F N   1 
ATOM   8819  C  CA  . GLU F  1 129 ? -10.413  5.322   -125.068 1.00 38.87  ? 110  GLU F CA  1 
ATOM   8820  C  C   . GLU F  1 129 ? -11.598  4.658   -125.766 1.00 37.37  ? 110  GLU F C   1 
ATOM   8821  O  O   . GLU F  1 129 ? -11.915  3.486   -125.509 1.00 31.44  ? 110  GLU F O   1 
ATOM   8822  C  CB  . GLU F  1 129 ? -9.103   4.794   -125.625 1.00 49.47  ? 110  GLU F CB  1 
ATOM   8823  C  CG  . GLU F  1 129 ? -9.113   4.662   -127.130 1.00 63.26  ? 110  GLU F CG  1 
ATOM   8824  C  CD  . GLU F  1 129 ? -8.062   3.679   -127.623 1.00 79.92  ? 110  GLU F CD  1 
ATOM   8825  O  OE1 . GLU F  1 129 ? -7.099   3.411   -126.865 1.00 85.42  ? 110  GLU F OE1 1 
ATOM   8826  O  OE2 . GLU F  1 129 ? -8.195   3.170   -128.762 1.00 85.54  ? 110  GLU F OE2 1 
ATOM   8827  N  N   . VAL F  1 130 ? -12.277  5.428   -126.613 1.00 15.95  ? 111  VAL F N   1 
ATOM   8828  C  CA  . VAL F  1 130 ? -13.410  4.913   -127.375 1.00 15.72  ? 111  VAL F CA  1 
ATOM   8829  C  C   . VAL F  1 130 ? -13.106  4.857   -128.878 1.00 25.87  ? 111  VAL F C   1 
ATOM   8830  O  O   . VAL F  1 130 ? -12.602  5.821   -129.478 1.00 25.37  ? 111  VAL F O   1 
ATOM   8831  C  CB  . VAL F  1 130 ? -14.662  5.762   -127.151 1.00 15.38  ? 111  VAL F CB  1 
ATOM   8832  C  CG1 . VAL F  1 130 ? -15.851  5.088   -127.783 1.00 15.10  ? 111  VAL F CG1 1 
ATOM   8833  C  CG2 . VAL F  1 130 ? -14.916  5.949   -125.675 1.00 26.10  ? 111  VAL F CG2 1 
ATOM   8834  N  N   . GLN F  1 131 ? -13.380  3.714   -129.486 1.00 32.21  ? 112  GLN F N   1 
ATOM   8835  C  CA  . GLN F  1 131 ? -13.279  3.614   -130.938 1.00 35.55  ? 112  GLN F CA  1 
ATOM   8836  C  C   . GLN F  1 131 ? -14.605  3.143   -131.519 1.00 31.15  ? 112  GLN F C   1 
ATOM   8837  O  O   . GLN F  1 131 ? -15.224  2.222   -131.003 1.00 33.53  ? 112  GLN F O   1 
ATOM   8838  C  CB  . GLN F  1 131 ? -12.167  2.659   -131.351 1.00 39.45  ? 112  GLN F CB  1 
ATOM   8839  C  CG  . GLN F  1 131 ? -11.926  2.658   -132.852 1.00 46.21  ? 112  GLN F CG  1 
ATOM   8840  C  CD  . GLN F  1 131 ? -10.639  1.953   -133.248 1.00 49.17  ? 112  GLN F CD  1 
ATOM   8841  O  OE1 . GLN F  1 131 ? -10.635  0.744   -133.502 1.00 51.32  ? 112  GLN F OE1 1 
ATOM   8842  N  NE2 . GLN F  1 131 ? -9.542   2.710   -133.322 1.00 46.92  ? 112  GLN F NE2 1 
ATOM   8843  N  N   . TYR F  1 132 ? -15.051  3.800   -132.574 1.00 22.64  ? 113  TYR F N   1 
ATOM   8844  C  CA  . TYR F  1 132 ? -16.256  3.398   -133.288 1.00 21.45  ? 113  TYR F CA  1 
ATOM   8845  C  C   . TYR F  1 132 ? -15.927  3.418   -134.802 1.00 24.61  ? 113  TYR F C   1 
ATOM   8846  O  O   . TYR F  1 132 ? -15.475  4.443   -135.356 1.00 21.91  ? 113  TYR F O   1 
ATOM   8847  C  CB  . TYR F  1 132 ? -17.413  4.348   -132.930 1.00 24.67  ? 113  TYR F CB  1 
ATOM   8848  C  CG  . TYR F  1 132 ? -18.696  4.130   -133.708 1.00 24.98  ? 113  TYR F CG  1 
ATOM   8849  C  CD1 . TYR F  1 132 ? -19.252  2.869   -133.799 1.00 15.04  ? 113  TYR F CD1 1 
ATOM   8850  C  CD2 . TYR F  1 132 ? -19.363  5.202   -134.335 1.00 20.21  ? 113  TYR F CD2 1 
ATOM   8851  C  CE1 . TYR F  1 132 ? -20.435  2.663   -134.518 1.00 26.66  ? 113  TYR F CE1 1 
ATOM   8852  C  CE2 . TYR F  1 132 ? -20.547  5.007   -135.045 1.00 18.29  ? 113  TYR F CE2 1 
ATOM   8853  C  CZ  . TYR F  1 132 ? -21.079  3.734   -135.143 1.00 24.74  ? 113  TYR F CZ  1 
ATOM   8854  O  OH  . TYR F  1 132 ? -22.258  3.536   -135.857 1.00 30.69  ? 113  TYR F OH  1 
ATOM   8855  N  N   . THR F  1 133 ? -16.133  2.277   -135.457 1.00 18.58  ? 114  THR F N   1 
ATOM   8856  C  CA  . THR F  1 133 ? -15.758  2.132   -136.857 1.00 19.00  ? 114  THR F CA  1 
ATOM   8857  C  C   . THR F  1 133 ? -16.891  1.520   -137.674 1.00 20.88  ? 114  THR F C   1 
ATOM   8858  O  O   . THR F  1 133 ? -16.853  0.344   -138.050 1.00 24.51  ? 114  THR F O   1 
ATOM   8859  C  CB  . THR F  1 133 ? -14.476  1.309   -137.008 1.00 20.66  ? 114  THR F CB  1 
ATOM   8860  O  OG1 . THR F  1 133 ? -13.483  1.796   -136.092 1.00 22.81  ? 114  THR F OG1 1 
ATOM   8861  C  CG2 . THR F  1 133 ? -13.944  1.409   -138.435 1.00 25.35  ? 114  THR F CG2 1 
ATOM   8862  N  N   . PRO F  1 134 ? -17.929  2.316   -137.937 1.00 20.93  ? 115  PRO F N   1 
ATOM   8863  C  CA  . PRO F  1 134 ? -18.999  1.794   -138.778 1.00 24.32  ? 115  PRO F CA  1 
ATOM   8864  C  C   . PRO F  1 134 ? -18.560  1.745   -140.253 1.00 27.41  ? 115  PRO F C   1 
ATOM   8865  O  O   . PRO F  1 134 ? -17.730  2.559   -140.722 1.00 25.00  ? 115  PRO F O   1 
ATOM   8866  C  CB  . PRO F  1 134 ? -20.107  2.831   -138.591 1.00 22.55  ? 115  PRO F CB  1 
ATOM   8867  C  CG  . PRO F  1 134 ? -19.354  4.107   -138.389 1.00 20.89  ? 115  PRO F CG  1 
ATOM   8868  C  CD  . PRO F  1 134 ? -18.174  3.713   -137.538 1.00 23.44  ? 115  PRO F CD  1 
ATOM   8869  N  N   . SER F  1 135 ? -19.096  0.764   -140.971 1.00 25.09  ? 116  SER F N   1 
ATOM   8870  C  CA  . SER F  1 135 ? -18.956  0.743   -142.414 1.00 29.55  ? 116  SER F CA  1 
ATOM   8871  C  C   . SER F  1 135 ? -20.130  1.529   -142.987 1.00 26.69  ? 116  SER F C   1 
ATOM   8872  O  O   . SER F  1 135 ? -21.293  1.214   -142.716 1.00 24.67  ? 116  SER F O   1 
ATOM   8873  C  CB  . SER F  1 135 ? -18.925  -0.682  -142.968 1.00 29.85  ? 116  SER F CB  1 
ATOM   8874  O  OG  . SER F  1 135 ? -18.589  -0.685  -144.354 1.00 39.37  ? 116  SER F OG  1 
ATOM   8875  N  N   . ILE F  1 136 ? -19.810  2.557   -143.766 1.00 23.64  ? 117  ILE F N   1 
ATOM   8876  C  CA  . ILE F  1 136 ? -20.820  3.453   -144.303 1.00 29.61  ? 117  ILE F CA  1 
ATOM   8877  C  C   . ILE F  1 136 ? -20.851  3.457   -145.838 1.00 29.40  ? 117  ILE F C   1 
ATOM   8878  O  O   . ILE F  1 136 ? -19.810  3.494   -146.504 1.00 28.84  ? 117  ILE F O   1 
ATOM   8879  C  CB  . ILE F  1 136 ? -20.582  4.875   -143.784 1.00 33.85  ? 117  ILE F CB  1 
ATOM   8880  C  CG1 . ILE F  1 136 ? -20.723  4.893   -142.256 1.00 38.38  ? 117  ILE F CG1 1 
ATOM   8881  C  CG2 . ILE F  1 136 ? -21.535  5.850   -144.441 1.00 31.07  ? 117  ILE F CG2 1 
ATOM   8882  C  CD1 . ILE F  1 136 ? -20.309  6.193   -141.604 1.00 38.03  ? 117  ILE F CD1 1 
ATOM   8883  N  N   . ARG F  1 137 ? -22.052  3.382   -146.394 1.00 27.03  ? 118  ARG F N   1 
ATOM   8884  C  CA  . ARG F  1 137 ? -22.243  3.686   -147.798 1.00 21.53  ? 118  ARG F CA  1 
ATOM   8885  C  C   . ARG F  1 137 ? -22.869  5.069   -147.907 1.00 23.42  ? 118  ARG F C   1 
ATOM   8886  O  O   . ARG F  1 137 ? -23.855  5.374   -147.229 1.00 34.63  ? 118  ARG F O   1 
ATOM   8887  C  CB  . ARG F  1 137 ? -23.132  2.663   -148.478 1.00 26.51  ? 118  ARG F CB  1 
ATOM   8888  C  CG  . ARG F  1 137 ? -23.338  3.002   -149.954 1.00 38.83  ? 118  ARG F CG  1 
ATOM   8889  C  CD  . ARG F  1 137 ? -24.066  1.927   -150.711 1.00 35.77  ? 118  ARG F CD  1 
ATOM   8890  N  NE  . ARG F  1 137 ? -24.317  2.346   -152.078 1.00 36.16  ? 118  ARG F NE  1 
ATOM   8891  C  CZ  . ARG F  1 137 ? -24.683  1.532   -153.070 1.00 43.83  ? 118  ARG F CZ  1 
ATOM   8892  N  NH1 . ARG F  1 137 ? -24.836  0.228   -152.856 1.00 43.60  ? 118  ARG F NH1 1 
ATOM   8893  N  NH2 . ARG F  1 137 ? -24.887  2.029   -154.288 1.00 44.27  ? 118  ARG F NH2 1 
ATOM   8894  N  N   . GLN F  1 138 ? -22.294  5.919   -148.745 1.00 19.61  ? 119  GLN F N   1 
ATOM   8895  C  CA  . GLN F  1 138 ? -22.775  7.297   -148.829 1.00 23.93  ? 119  GLN F CA  1 
ATOM   8896  C  C   . GLN F  1 138 ? -22.446  7.967   -150.182 1.00 29.51  ? 119  GLN F C   1 
ATOM   8897  O  O   . GLN F  1 138 ? -21.420  7.678   -150.815 1.00 25.57  ? 119  GLN F O   1 
ATOM   8898  C  CB  . GLN F  1 138 ? -22.210  8.109   -147.656 1.00 20.01  ? 119  GLN F CB  1 
ATOM   8899  C  CG  . GLN F  1 138 ? -22.938  9.390   -147.418 1.00 27.21  ? 119  GLN F CG  1 
ATOM   8900  C  CD  . GLN F  1 138 ? -22.524  10.059  -146.146 1.00 30.39  ? 119  GLN F CD  1 
ATOM   8901  O  OE1 . GLN F  1 138 ? -21.410  9.837   -145.640 1.00 29.27  ? 119  GLN F OE1 1 
ATOM   8902  N  NE2 . GLN F  1 138 ? -23.423  10.881  -145.602 1.00 34.20  ? 119  GLN F NE2 1 
ATOM   8903  N  N   . ARG F  1 139 ? -23.326  8.866   -150.619 1.00 32.70  ? 120  ARG F N   1 
ATOM   8904  C  CA  A ARG F  1 139 ? -23.081  9.605   -151.852 0.56 30.95  ? 120  ARG F CA  1 
ATOM   8905  C  CA  B ARG F  1 139 ? -23.135  9.637   -151.849 0.44 30.95  ? 120  ARG F CA  1 
ATOM   8906  C  C   . ARG F  1 139 ? -22.507  10.994  -151.567 1.00 30.85  ? 120  ARG F C   1 
ATOM   8907  O  O   . ARG F  1 139 ? -22.920  11.708  -150.628 1.00 32.75  ? 120  ARG F O   1 
ATOM   8908  C  CB  A ARG F  1 139 ? -24.347  9.657   -152.711 0.56 30.47  ? 120  ARG F CB  1 
ATOM   8909  C  CB  B ARG F  1 139 ? -24.464  9.857   -152.571 0.44 30.18  ? 120  ARG F CB  1 
ATOM   8910  C  CG  A ARG F  1 139 ? -25.240  8.454   -152.421 0.56 32.15  ? 120  ARG F CG  1 
ATOM   8911  C  CG  B ARG F  1 139 ? -24.835  8.753   -153.524 0.44 30.75  ? 120  ARG F CG  1 
ATOM   8912  C  CD  A ARG F  1 139 ? -26.445  8.278   -153.358 0.56 32.20  ? 120  ARG F CD  1 
ATOM   8913  C  CD  B ARG F  1 139 ? -24.080  8.877   -154.814 0.44 26.20  ? 120  ARG F CD  1 
ATOM   8914  N  NE  A ARG F  1 139 ? -27.595  7.714   -152.644 0.56 29.10  ? 120  ARG F NE  1 
ATOM   8915  N  NE  B ARG F  1 139 ? -24.876  9.502   -155.870 0.44 24.96  ? 120  ARG F NE  1 
ATOM   8916  C  CZ  A ARG F  1 139 ? -27.604  6.552   -151.985 0.56 32.71  ? 120  ARG F CZ  1 
ATOM   8917  C  CZ  B ARG F  1 139 ? -24.690  9.282   -157.176 0.44 25.52  ? 120  ARG F CZ  1 
ATOM   8918  N  NH1 A ARG F  1 139 ? -26.516  5.770   -151.924 0.56 17.00  ? 120  ARG F NH1 1 
ATOM   8919  N  NH1 B ARG F  1 139 ? -23.747  8.451   -157.588 0.44 19.26  ? 120  ARG F NH1 1 
ATOM   8920  N  NH2 A ARG F  1 139 ? -28.721  6.173   -151.368 0.56 29.21  ? 120  ARG F NH2 1 
ATOM   8921  N  NH2 B ARG F  1 139 ? -25.452  9.884   -158.073 0.44 24.81  ? 120  ARG F NH2 1 
ATOM   8922  N  N   . PHE F  1 140 ? -21.525  11.350  -152.378 1.00 27.80  ? 121  PHE F N   1 
ATOM   8923  C  CA  . PHE F  1 140 ? -20.851  12.617  -152.243 1.00 28.35  ? 121  PHE F CA  1 
ATOM   8924  C  C   . PHE F  1 140 ? -20.885  13.412  -153.521 1.00 33.01  ? 121  PHE F C   1 
ATOM   8925  O  O   . PHE F  1 140 ? -20.866  12.861  -154.624 1.00 32.98  ? 121  PHE F O   1 
ATOM   8926  C  CB  . PHE F  1 140 ? -19.397  12.396  -151.832 1.00 30.35  ? 121  PHE F CB  1 
ATOM   8927  C  CG  . PHE F  1 140 ? -19.254  11.699  -150.520 1.00 41.94  ? 121  PHE F CG  1 
ATOM   8928  C  CD1 . PHE F  1 140 ? -19.394  12.397  -149.332 1.00 40.82  ? 121  PHE F CD1 1 
ATOM   8929  C  CD2 . PHE F  1 140 ? -19.010  10.331  -150.466 1.00 50.17  ? 121  PHE F CD2 1 
ATOM   8930  C  CE1 . PHE F  1 140 ? -19.267  11.753  -148.113 1.00 35.30  ? 121  PHE F CE1 1 
ATOM   8931  C  CE2 . PHE F  1 140 ? -18.886  9.676   -149.241 1.00 42.83  ? 121  PHE F CE2 1 
ATOM   8932  C  CZ  . PHE F  1 140 ? -19.011  10.393  -148.069 1.00 36.17  ? 121  PHE F CZ  1 
ATOM   8933  N  N   . SER F  1 141 ? -20.923  14.726  -153.354 1.00 35.54  ? 122  SER F N   1 
ATOM   8934  C  CA  . SER F  1 141 ? -20.748  15.658  -154.444 1.00 26.53  ? 122  SER F CA  1 
ATOM   8935  C  C   . SER F  1 141 ? -19.283  16.067  -154.418 1.00 33.22  ? 122  SER F C   1 
ATOM   8936  O  O   . SER F  1 141 ? -18.824  16.694  -153.459 1.00 39.64  ? 122  SER F O   1 
ATOM   8937  C  CB  . SER F  1 141 ? -21.644  16.867  -154.220 1.00 24.54  ? 122  SER F CB  1 
ATOM   8938  O  OG  . SER F  1 141 ? -21.057  18.050  -154.749 1.00 35.05  ? 122  SER F OG  1 
ATOM   8939  N  N   . CYS F  1 142 ? -18.542  15.704  -155.455 1.00 31.13  ? 123  CYS F N   1 
ATOM   8940  C  CA  . CYS F  1 142 ? -17.122  16.063  -155.506 1.00 35.94  ? 123  CYS F CA  1 
ATOM   8941  C  C   . CYS F  1 142 ? -16.597  16.043  -156.941 1.00 33.45  ? 123  CYS F C   1 
ATOM   8942  O  O   . CYS F  1 142 ? -17.336  15.710  -157.859 1.00 30.64  ? 123  CYS F O   1 
ATOM   8943  C  CB  . CYS F  1 142 ? -16.316  15.111  -154.623 1.00 33.63  ? 123  CYS F CB  1 
ATOM   8944  S  SG  . CYS F  1 142 ? -16.666  13.379  -155.003 1.00 75.69  ? 123  CYS F SG  1 
ATOM   8945  N  N   . ASP F  1 143 ? -15.321  16.381  -157.118 1.00 31.51  ? 124  ASP F N   1 
ATOM   8946  C  CA  . ASP F  1 143 ? -14.734  16.472  -158.445 1.00 38.57  ? 124  ASP F CA  1 
ATOM   8947  C  C   . ASP F  1 143 ? -14.389  15.098  -159.012 1.00 41.68  ? 124  ASP F C   1 
ATOM   8948  O  O   . ASP F  1 143 ? -13.448  14.452  -158.553 1.00 44.05  ? 124  ASP F O   1 
ATOM   8949  C  CB  . ASP F  1 143 ? -13.492  17.353  -158.414 1.00 43.94  ? 124  ASP F CB  1 
ATOM   8950  C  CG  . ASP F  1 143 ? -12.989  17.706  -159.806 1.00 52.14  ? 124  ASP F CG  1 
ATOM   8951  O  OD1 . ASP F  1 143 ? -13.754  17.584  -160.796 1.00 51.37  ? 124  ASP F OD1 1 
ATOM   8952  O  OD2 . ASP F  1 143 ? -11.814  18.114  -159.895 1.00 54.81  ? 124  ASP F OD2 1 
ATOM   8953  N  N   . VAL F  1 144 ? -15.149  14.673  -160.023 1.00 38.07  ? 125  VAL F N   1 
ATOM   8954  C  CA  . VAL F  1 144 ? -15.007  13.344  -160.615 1.00 36.52  ? 125  VAL F CA  1 
ATOM   8955  C  C   . VAL F  1 144 ? -14.322  13.430  -161.995 1.00 36.74  ? 125  VAL F C   1 
ATOM   8956  O  O   . VAL F  1 144 ? -14.106  12.424  -162.687 1.00 31.82  ? 125  VAL F O   1 
ATOM   8957  C  CB  . VAL F  1 144 ? -16.373  12.655  -160.719 1.00 35.66  ? 125  VAL F CB  1 
ATOM   8958  C  CG1 . VAL F  1 144 ? -16.211  11.177  -161.001 1.00 31.09  ? 125  VAL F CG1 1 
ATOM   8959  C  CG2 . VAL F  1 144 ? -17.134  12.840  -159.421 1.00 40.04  ? 125  VAL F CG2 1 
ATOM   8960  N  N   . SER F  1 145 ? -13.961  14.647  -162.377 1.00 38.26  ? 126  SER F N   1 
ATOM   8961  C  CA  . SER F  1 145 ? -13.301  14.867  -163.649 1.00 35.03  ? 126  SER F CA  1 
ATOM   8962  C  C   . SER F  1 145 ? -11.956  14.127  -163.703 1.00 39.21  ? 126  SER F C   1 
ATOM   8963  O  O   . SER F  1 145 ? -11.146  14.204  -162.775 1.00 43.13  ? 126  SER F O   1 
ATOM   8964  C  CB  . SER F  1 145 ? -13.123  16.363  -163.902 1.00 33.19  ? 126  SER F CB  1 
ATOM   8965  O  OG  . SER F  1 145 ? -12.090  16.903  -163.088 1.00 38.40  ? 126  SER F OG  1 
ATOM   8966  N  N   . GLY F  1 146 ? -11.742  13.386  -164.791 1.00 40.58  ? 127  GLY F N   1 
ATOM   8967  C  CA  . GLY F  1 146 ? -10.483  12.694  -165.015 1.00 42.67  ? 127  GLY F CA  1 
ATOM   8968  C  C   . GLY F  1 146 ? -10.486  11.274  -164.499 1.00 46.84  ? 127  GLY F C   1 
ATOM   8969  O  O   . GLY F  1 146 ? -9.458   10.598  -164.497 1.00 52.13  ? 127  GLY F O   1 
ATOM   8970  N  N   . VAL F  1 147 ? -11.652  10.817  -164.056 1.00 44.92  ? 128  VAL F N   1 
ATOM   8971  C  CA  . VAL F  1 147 ? -11.769  9.487   -163.466 1.00 46.06  ? 128  VAL F CA  1 
ATOM   8972  C  C   . VAL F  1 147 ? -11.317  8.414   -164.458 1.00 47.92  ? 128  VAL F C   1 
ATOM   8973  O  O   . VAL F  1 147 ? -10.792  7.353   -164.073 1.00 38.31  ? 128  VAL F O   1 
ATOM   8974  C  CB  . VAL F  1 147 ? -13.225  9.213   -162.959 1.00 30.92  ? 128  VAL F CB  1 
ATOM   8975  C  CG1 . VAL F  1 147 ? -14.227  9.316   -164.090 1.00 31.31  ? 128  VAL F CG1 1 
ATOM   8976  C  CG2 . VAL F  1 147 ? -13.328  7.850   -162.280 1.00 25.39  ? 128  VAL F CG2 1 
ATOM   8977  N  N   . ASP F  1 148 ? -11.498  8.724   -165.745 1.00 51.51  ? 129  ASP F N   1 
ATOM   8978  C  CA  . ASP F  1 148 ? -11.226  7.770   -166.806 1.00 47.56  ? 129  ASP F CA  1 
ATOM   8979  C  C   . ASP F  1 148 ? -9.843   7.957   -167.415 1.00 50.02  ? 129  ASP F C   1 
ATOM   8980  O  O   . ASP F  1 148 ? -9.502   7.302   -168.399 1.00 56.43  ? 129  ASP F O   1 
ATOM   8981  C  CB  . ASP F  1 148 ? -12.309  7.829   -167.882 1.00 52.77  ? 129  ASP F CB  1 
ATOM   8982  C  CG  . ASP F  1 148 ? -12.822  6.444   -168.270 1.00 64.99  ? 129  ASP F CG  1 
ATOM   8983  O  OD1 . ASP F  1 148 ? -12.010  5.488   -168.319 1.00 67.13  ? 129  ASP F OD1 1 
ATOM   8984  O  OD2 . ASP F  1 148 ? -14.041  6.304   -168.517 1.00 70.51  ? 129  ASP F OD2 1 
ATOM   8985  N  N   . THR F  1 149 ? -9.044   8.841   -166.823 1.00 49.46  ? 130  THR F N   1 
ATOM   8986  C  CA  . THR F  1 149 ? -7.666   9.052   -167.267 1.00 49.20  ? 130  THR F CA  1 
ATOM   8987  C  C   . THR F  1 149 ? -6.687   8.283   -166.389 1.00 49.23  ? 130  THR F C   1 
ATOM   8988  O  O   . THR F  1 149 ? -7.098   7.605   -165.442 1.00 47.08  ? 130  THR F O   1 
ATOM   8989  C  CB  . THR F  1 149 ? -7.289   10.539  -167.262 1.00 49.75  ? 130  THR F CB  1 
ATOM   8990  O  OG1 . THR F  1 149 ? -6.944   10.949  -165.928 1.00 54.17  ? 130  THR F OG1 1 
ATOM   8991  C  CG2 . THR F  1 149 ? -8.442   11.369  -167.792 1.00 45.16  ? 130  THR F CG2 1 
ATOM   8992  N  N   . GLU F  1 150 ? -5.396   8.394   -166.707 1.00 52.00  ? 131  GLU F N   1 
ATOM   8993  C  CA  . GLU F  1 150 ? -4.364   7.650   -165.992 1.00 54.26  ? 131  GLU F CA  1 
ATOM   8994  C  C   . GLU F  1 150 ? -3.991   8.317   -164.653 1.00 54.80  ? 131  GLU F C   1 
ATOM   8995  O  O   . GLU F  1 150 ? -3.570   7.638   -163.708 1.00 52.30  ? 131  GLU F O   1 
ATOM   8996  C  CB  . GLU F  1 150 ? -3.134   7.427   -166.896 1.00 55.02  ? 131  GLU F CB  1 
ATOM   8997  C  CG  . GLU F  1 150 ? -2.369   6.074   -166.685 1.00 94.40  ? 131  GLU F CG  1 
ATOM   8998  C  CD  . GLU F  1 150 ? -3.223   4.799   -166.919 1.00 85.66  ? 131  GLU F CD  1 
ATOM   8999  O  OE1 . GLU F  1 150 ? -4.255   4.882   -167.633 1.00 88.67  ? 131  GLU F OE1 1 
ATOM   9000  O  OE2 . GLU F  1 150 ? -2.852   3.711   -166.392 1.00 78.39  ? 131  GLU F OE2 1 
ATOM   9001  N  N   . SER F  1 151 ? -4.168   9.637   -164.573 1.00 55.76  ? 132  SER F N   1 
ATOM   9002  C  CA  . SER F  1 151 ? -3.883   10.392  -163.347 1.00 54.87  ? 132  SER F CA  1 
ATOM   9003  C  C   . SER F  1 151 ? -5.077   10.338  -162.390 1.00 50.92  ? 132  SER F C   1 
ATOM   9004  O  O   . SER F  1 151 ? -4.941   10.598  -161.187 1.00 53.85  ? 132  SER F O   1 
ATOM   9005  C  CB  . SER F  1 151 ? -3.532   11.839  -163.677 1.00 51.93  ? 132  SER F CB  1 
ATOM   9006  O  OG  . SER F  1 151 ? -4.624   12.454  -164.333 1.00 51.68  ? 132  SER F OG  1 
ATOM   9007  N  N   . GLY F  1 152 ? -6.240   9.995   -162.946 1.00 42.02  ? 133  GLY F N   1 
ATOM   9008  C  CA  . GLY F  1 152 ? -7.443   9.740   -162.177 1.00 35.33  ? 133  GLY F CA  1 
ATOM   9009  C  C   . GLY F  1 152 ? -8.164   10.994  -161.723 1.00 39.83  ? 133  GLY F C   1 
ATOM   9010  O  O   . GLY F  1 152 ? -7.722   12.110  -162.009 1.00 36.68  ? 133  GLY F O   1 
ATOM   9011  N  N   . ALA F  1 153 ? -9.287   10.799  -161.028 1.00 46.42  ? 134  ALA F N   1 
ATOM   9012  C  CA  . ALA F  1 153 ? -10.017  11.891  -160.379 1.00 46.36  ? 134  ALA F CA  1 
ATOM   9013  C  C   . ALA F  1 153 ? -9.544   12.036  -158.932 1.00 46.38  ? 134  ALA F C   1 
ATOM   9014  O  O   . ALA F  1 153 ? -9.018   11.085  -158.333 1.00 51.02  ? 134  ALA F O   1 
ATOM   9015  C  CB  . ALA F  1 153 ? -11.524  11.644  -160.426 1.00 40.05  ? 134  ALA F CB  1 
ATOM   9016  N  N   . THR F  1 154 ? -9.722   13.227  -158.372 1.00 41.68  ? 135  THR F N   1 
ATOM   9017  C  CA  . THR F  1 154 ? -9.439   13.425  -156.951 1.00 39.16  ? 135  THR F CA  1 
ATOM   9018  C  C   . THR F  1 154 ? -10.669  13.951  -156.222 1.00 34.42  ? 135  THR F C   1 
ATOM   9019  O  O   . THR F  1 154 ? -10.982  15.140  -156.299 1.00 30.72  ? 135  THR F O   1 
ATOM   9020  C  CB  . THR F  1 154 ? -8.236   14.358  -156.693 1.00 38.31  ? 135  THR F CB  1 
ATOM   9021  O  OG1 . THR F  1 154 ? -7.055   13.812  -157.291 1.00 36.13  ? 135  THR F OG1 1 
ATOM   9022  C  CG2 . THR F  1 154 ? -7.986   14.493  -155.189 1.00 43.07  ? 135  THR F CG2 1 
ATOM   9023  N  N   . CYS F  1 155 ? -11.361  13.044  -155.530 1.00 34.64  ? 136  CYS F N   1 
ATOM   9024  C  CA  . CYS F  1 155 ? -12.557  13.383  -154.777 1.00 38.81  ? 136  CYS F CA  1 
ATOM   9025  C  C   . CYS F  1 155 ? -12.209  13.781  -153.333 1.00 42.02  ? 136  CYS F C   1 
ATOM   9026  O  O   . CYS F  1 155 ? -11.596  13.005  -152.585 1.00 39.09  ? 136  CYS F O   1 
ATOM   9027  C  CB  . CYS F  1 155 ? -13.546  12.208  -154.788 1.00 36.01  ? 136  CYS F CB  1 
ATOM   9028  S  SG  . CYS F  1 155 ? -15.128  12.555  -153.946 1.00 79.99  ? 136  CYS F SG  1 
ATOM   9029  N  N   . ARG F  1 156 ? -12.615  14.990  -152.956 1.00 43.84  ? 137  ARG F N   1 
ATOM   9030  C  CA  . ARG F  1 156 ? -12.300  15.549  -151.648 1.00 50.06  ? 137  ARG F CA  1 
ATOM   9031  C  C   . ARG F  1 156 ? -13.505  15.417  -150.697 1.00 47.39  ? 137  ARG F C   1 
ATOM   9032  O  O   . ARG F  1 156 ? -14.582  15.949  -150.952 1.00 50.10  ? 137  ARG F O   1 
ATOM   9033  C  CB  . ARG F  1 156 ? -11.878  17.018  -151.820 1.00 55.49  ? 137  ARG F CB  1 
ATOM   9034  C  CG  . ARG F  1 156 ? -11.157  17.654  -150.652 1.00 59.78  ? 137  ARG F CG  1 
ATOM   9035  C  CD  . ARG F  1 156 ? -10.785  19.109  -150.959 1.00 65.73  ? 137  ARG F CD  1 
ATOM   9036  N  NE  . ARG F  1 156 ? -11.957  19.970  -151.151 1.00 69.12  ? 137  ARG F NE  1 
ATOM   9037  C  CZ  . ARG F  1 156 ? -12.328  20.509  -152.318 1.00 67.17  ? 137  ARG F CZ  1 
ATOM   9038  N  NH1 . ARG F  1 156 ? -11.615  20.284  -153.420 1.00 67.94  ? 137  ARG F NH1 1 
ATOM   9039  N  NH2 . ARG F  1 156 ? -13.417  21.275  -152.385 1.00 61.88  ? 137  ARG F NH2 1 
ATOM   9040  N  N   . ILE F  1 157 ? -13.323  14.697  -149.600 1.00 41.77  ? 138  ILE F N   1 
ATOM   9041  C  CA  . ILE F  1 157 ? -14.406  14.500  -148.637 1.00 39.04  ? 138  ILE F CA  1 
ATOM   9042  C  C   . ILE F  1 157 ? -14.164  15.249  -147.319 1.00 40.83  ? 138  ILE F C   1 
ATOM   9043  O  O   . ILE F  1 157 ? -13.160  15.020  -146.630 1.00 45.66  ? 138  ILE F O   1 
ATOM   9044  C  CB  . ILE F  1 157 ? -14.618  13.015  -148.329 1.00 31.50  ? 138  ILE F CB  1 
ATOM   9045  C  CG1 . ILE F  1 157 ? -15.170  12.297  -149.563 1.00 29.38  ? 138  ILE F CG1 1 
ATOM   9046  C  CG2 . ILE F  1 157 ? -15.543  12.837  -147.118 1.00 26.78  ? 138  ILE F CG2 1 
ATOM   9047  C  CD1 . ILE F  1 157 ? -15.229  10.780  -149.406 1.00 22.98  ? 138  ILE F CD1 1 
ATOM   9048  N  N   . LYS F  1 158 ? -15.096  16.133  -146.967 1.00 33.80  ? 139  LYS F N   1 
ATOM   9049  C  CA  . LYS F  1 158 ? -14.926  17.034  -145.835 1.00 31.18  ? 139  LYS F CA  1 
ATOM   9050  C  C   . LYS F  1 158 ? -15.741  16.557  -144.627 1.00 33.87  ? 139  LYS F C   1 
ATOM   9051  O  O   . LYS F  1 158 ? -16.975  16.571  -144.653 1.00 33.47  ? 139  LYS F O   1 
ATOM   9052  C  CB  . LYS F  1 158 ? -15.346  18.452  -146.236 1.00 25.81  ? 139  LYS F CB  1 
ATOM   9053  C  CG  . LYS F  1 158 ? -15.159  19.494  -145.161 1.00 24.27  ? 139  LYS F CG  1 
ATOM   9054  C  CD  . LYS F  1 158 ? -15.765  20.810  -145.597 1.00 22.71  ? 139  LYS F CD  1 
ATOM   9055  C  CE  . LYS F  1 158 ? -15.792  21.829  -144.462 1.00 31.03  ? 139  LYS F CE  1 
ATOM   9056  N  NZ  . LYS F  1 158 ? -16.466  23.104  -144.908 1.00 35.15  ? 139  LYS F NZ  1 
ATOM   9057  N  N   . ILE F  1 159 ? -15.045  16.137  -143.571 1.00 33.21  ? 140  ILE F N   1 
ATOM   9058  C  CA  . ILE F  1 159 ? -15.688  15.589  -142.371 1.00 25.67  ? 140  ILE F CA  1 
ATOM   9059  C  C   . ILE F  1 159 ? -15.314  16.384  -141.136 1.00 30.54  ? 140  ILE F C   1 
ATOM   9060  O  O   . ILE F  1 159 ? -14.128  16.582  -140.860 1.00 37.27  ? 140  ILE F O   1 
ATOM   9061  C  CB  . ILE F  1 159 ? -15.270  14.133  -142.142 1.00 21.57  ? 140  ILE F CB  1 
ATOM   9062  C  CG1 . ILE F  1 159 ? -15.763  13.269  -143.289 1.00 24.76  ? 140  ILE F CG1 1 
ATOM   9063  C  CG2 . ILE F  1 159 ? -15.828  13.613  -140.824 1.00 26.01  ? 140  ILE F CG2 1 
ATOM   9064  C  CD1 . ILE F  1 159 ? -15.545  11.797  -143.078 1.00 26.87  ? 140  ILE F CD1 1 
ATOM   9065  N  N   . GLY F  1 160 ? -16.317  16.840  -140.392 1.00 28.52  ? 141  GLY F N   1 
ATOM   9066  C  CA  . GLY F  1 160 ? -16.061  17.557  -139.150 1.00 27.83  ? 141  GLY F CA  1 
ATOM   9067  C  C   . GLY F  1 160 ? -17.250  17.514  -138.215 1.00 25.95  ? 141  GLY F C   1 
ATOM   9068  O  O   . GLY F  1 160 ? -18.304  17.003  -138.576 1.00 21.11  ? 141  GLY F O   1 
ATOM   9069  N  N   . SER F  1 161 ? -17.079  18.021  -136.996 1.00 29.65  ? 142  SER F N   1 
ATOM   9070  C  CA  . SER F  1 161 ? -18.198  18.159  -136.064 1.00 21.92  ? 142  SER F CA  1 
ATOM   9071  C  C   . SER F  1 161 ? -19.189  19.165  -136.609 1.00 26.37  ? 142  SER F C   1 
ATOM   9072  O  O   . SER F  1 161 ? -18.821  20.270  -137.042 1.00 39.19  ? 142  SER F O   1 
ATOM   9073  C  CB  . SER F  1 161 ? -17.703  18.671  -134.706 1.00 25.20  ? 142  SER F CB  1 
ATOM   9074  O  OG  . SER F  1 161 ? -18.761  19.210  -133.920 1.00 21.91  ? 142  SER F OG  1 
ATOM   9075  N  N   . TRP F  1 162 ? -20.460  18.812  -136.562 1.00 22.64  ? 143  TRP F N   1 
ATOM   9076  C  CA  . TRP F  1 162 ? -21.497  19.716  -137.057 1.00 23.42  ? 143  TRP F CA  1 
ATOM   9077  C  C   . TRP F  1 162 ? -21.758  20.867  -136.093 1.00 32.71  ? 143  TRP F C   1 
ATOM   9078  O  O   . TRP F  1 162 ? -21.980  21.993  -136.520 1.00 44.33  ? 143  TRP F O   1 
ATOM   9079  C  CB  . TRP F  1 162 ? -22.799  18.945  -137.347 1.00 24.71  ? 143  TRP F CB  1 
ATOM   9080  C  CG  . TRP F  1 162 ? -23.745  19.653  -138.274 1.00 28.81  ? 143  TRP F CG  1 
ATOM   9081  C  CD1 . TRP F  1 162 ? -24.988  20.143  -137.973 1.00 31.68  ? 143  TRP F CD1 1 
ATOM   9082  C  CD2 . TRP F  1 162 ? -23.517  19.955  -139.663 1.00 30.71  ? 143  TRP F CD2 1 
ATOM   9083  N  NE1 . TRP F  1 162 ? -25.551  20.717  -139.097 1.00 28.53  ? 143  TRP F NE1 1 
ATOM   9084  C  CE2 . TRP F  1 162 ? -24.672  20.628  -140.126 1.00 32.71  ? 143  TRP F CE2 1 
ATOM   9085  C  CE3 . TRP F  1 162 ? -22.456  19.722  -140.541 1.00 26.34  ? 143  TRP F CE3 1 
ATOM   9086  C  CZ2 . TRP F  1 162 ? -24.776  21.072  -141.456 1.00 35.83  ? 143  TRP F CZ2 1 
ATOM   9087  C  CZ3 . TRP F  1 162 ? -22.567  20.167  -141.847 1.00 23.60  ? 143  TRP F CZ3 1 
ATOM   9088  C  CH2 . TRP F  1 162 ? -23.721  20.832  -142.296 1.00 27.69  ? 143  TRP F CH2 1 
ATOM   9089  N  N   . THR F  1 163 ? -21.744  20.595  -134.790 1.00 31.21  ? 144  THR F N   1 
ATOM   9090  C  CA  . THR F  1 163 ? -22.154  21.622  -133.836 1.00 30.23  ? 144  THR F CA  1 
ATOM   9091  C  C   . THR F  1 163 ? -21.107  22.003  -132.801 1.00 29.96  ? 144  THR F C   1 
ATOM   9092  O  O   . THR F  1 163 ? -21.318  22.915  -132.002 1.00 33.15  ? 144  THR F O   1 
ATOM   9093  C  CB  . THR F  1 163 ? -23.477  21.252  -133.109 1.00 32.63  ? 144  THR F CB  1 
ATOM   9094  O  OG1 . THR F  1 163 ? -23.239  20.208  -132.148 1.00 33.59  ? 144  THR F OG1 1 
ATOM   9095  C  CG2 . THR F  1 163 ? -24.531  20.813  -134.104 1.00 33.52  ? 144  THR F CG2 1 
ATOM   9096  N  N   . HIS F  1 164 ? -19.984  21.305  -132.782 1.00 27.87  ? 145  HIS F N   1 
ATOM   9097  C  CA  . HIS F  1 164 ? -18.980  21.636  -131.770 1.00 30.25  ? 145  HIS F CA  1 
ATOM   9098  C  C   . HIS F  1 164 ? -17.789  22.321  -132.446 1.00 36.20  ? 145  HIS F C   1 
ATOM   9099  O  O   . HIS F  1 164 ? -17.249  21.825  -133.455 1.00 32.11  ? 145  HIS F O   1 
ATOM   9100  C  CB  . HIS F  1 164 ? -18.533  20.405  -130.950 1.00 24.86  ? 145  HIS F CB  1 
ATOM   9101  C  CG  . HIS F  1 164 ? -19.623  19.798  -130.120 1.00 27.08  ? 145  HIS F CG  1 
ATOM   9102  N  ND1 . HIS F  1 164 ? -20.054  20.362  -128.942 1.00 28.47  ? 145  HIS F ND1 1 
ATOM   9103  C  CD2 . HIS F  1 164 ? -20.361  18.672  -130.293 1.00 30.72  ? 145  HIS F CD2 1 
ATOM   9104  C  CE1 . HIS F  1 164 ? -21.020  19.617  -128.422 1.00 23.60  ? 145  HIS F CE1 1 
ATOM   9105  N  NE2 . HIS F  1 164 ? -21.220  18.585  -129.216 1.00 31.55  ? 145  HIS F NE2 1 
ATOM   9106  N  N   . HIS F  1 165 ? -17.400  23.470  -131.890 1.00 35.98  ? 146  HIS F N   1 
ATOM   9107  C  CA  . HIS F  1 165 ? -16.280  24.243  -132.413 1.00 30.49  ? 146  HIS F CA  1 
ATOM   9108  C  C   . HIS F  1 165 ? -14.933  23.738  -131.868 1.00 29.47  ? 146  HIS F C   1 
ATOM   9109  O  O   . HIS F  1 165 ? -14.879  22.762  -131.108 1.00 26.30  ? 146  HIS F O   1 
ATOM   9110  C  CB  . HIS F  1 165 ? -16.475  25.745  -132.173 1.00 30.24  ? 146  HIS F CB  1 
ATOM   9111  C  CG  . HIS F  1 165 ? -16.626  26.113  -130.730 1.00 39.03  ? 146  HIS F CG  1 
ATOM   9112  N  ND1 . HIS F  1 165 ? -15.594  26.008  -129.820 1.00 41.81  ? 146  HIS F ND1 1 
ATOM   9113  C  CD2 . HIS F  1 165 ? -17.689  26.596  -130.041 1.00 39.06  ? 146  HIS F CD2 1 
ATOM   9114  C  CE1 . HIS F  1 165 ? -16.017  26.404  -128.633 1.00 39.21  ? 146  HIS F CE1 1 
ATOM   9115  N  NE2 . HIS F  1 165 ? -17.284  26.769  -128.742 1.00 37.68  ? 146  HIS F NE2 1 
ATOM   9116  N  N   . SER F  1 166 ? -13.854  24.398  -132.280 1.00 35.05  ? 147  SER F N   1 
ATOM   9117  C  CA  . SER F  1 166 ? -12.491  23.897  -132.092 1.00 42.78  ? 147  SER F CA  1 
ATOM   9118  C  C   . SER F  1 166 ? -12.115  23.730  -130.633 1.00 43.33  ? 147  SER F C   1 
ATOM   9119  O  O   . SER F  1 166 ? -11.224  22.947  -130.304 1.00 41.96  ? 147  SER F O   1 
ATOM   9120  C  CB  . SER F  1 166 ? -11.478  24.821  -132.779 1.00 52.85  ? 147  SER F CB  1 
ATOM   9121  O  OG  . SER F  1 166 ? -11.559  26.147  -132.261 1.00 58.15  ? 147  SER F OG  1 
ATOM   9122  N  N   . ARG F  1 167 ? -12.796  24.467  -129.763 1.00 46.01  ? 148  ARG F N   1 
ATOM   9123  C  CA  . ARG F  1 167 ? -12.513  24.405  -128.332 1.00 53.44  ? 148  ARG F CA  1 
ATOM   9124  C  C   . ARG F  1 167 ? -13.240  23.247  -127.625 1.00 49.50  ? 148  ARG F C   1 
ATOM   9125  O  O   . ARG F  1 167 ? -12.857  22.818  -126.521 1.00 46.28  ? 148  ARG F O   1 
ATOM   9126  C  CB  . ARG F  1 167 ? -12.789  25.756  -127.662 1.00 59.23  ? 148  ARG F CB  1 
ATOM   9127  C  CG  . ARG F  1 167 ? -11.750  26.809  -127.995 1.00 67.59  ? 148  ARG F CG  1 
ATOM   9128  C  CD  . ARG F  1 167 ? -11.885  28.018  -127.089 1.00 83.43  ? 148  ARG F CD  1 
ATOM   9129  N  NE  . ARG F  1 167 ? -13.045  28.850  -127.422 1.00 95.53  ? 148  ARG F NE  1 
ATOM   9130  C  CZ  . ARG F  1 167 ? -14.221  28.809  -126.794 1.00 99.36  ? 148  ARG F CZ  1 
ATOM   9131  N  NH1 . ARG F  1 167 ? -14.417  27.969  -125.781 1.00 98.55  ? 148  ARG F NH1 1 
ATOM   9132  N  NH2 . ARG F  1 167 ? -15.207  29.614  -127.183 1.00 99.88  ? 148  ARG F NH2 1 
ATOM   9133  N  N   . GLU F  1 168 ? -14.267  22.729  -128.289 1.00 42.22  ? 149  GLU F N   1 
ATOM   9134  C  CA  . GLU F  1 168 ? -14.989  21.568  -127.798 1.00 37.81  ? 149  GLU F CA  1 
ATOM   9135  C  C   . GLU F  1 168 ? -14.565  20.288  -128.511 1.00 41.28  ? 149  GLU F C   1 
ATOM   9136  O  O   . GLU F  1 168 ? -14.338  19.264  -127.855 1.00 45.75  ? 149  GLU F O   1 
ATOM   9137  C  CB  . GLU F  1 168 ? -16.489  21.799  -127.916 1.00 36.44  ? 149  GLU F CB  1 
ATOM   9138  C  CG  . GLU F  1 168 ? -16.972  22.924  -127.044 1.00 43.36  ? 149  GLU F CG  1 
ATOM   9139  C  CD  . GLU F  1 168 ? -18.368  23.392  -127.393 1.00 53.45  ? 149  GLU F CD  1 
ATOM   9140  O  OE1 . GLU F  1 168 ? -18.858  23.081  -128.504 1.00 51.76  ? 149  GLU F OE1 1 
ATOM   9141  O  OE2 . GLU F  1 168 ? -18.971  24.091  -126.546 1.00 63.31  ? 149  GLU F OE2 1 
ATOM   9142  N  N   . ILE F  1 169 ? -14.460  20.340  -129.842 1.00 38.72  ? 150  ILE F N   1 
ATOM   9143  C  CA  . ILE F  1 169 ? -13.999  19.180  -130.610 1.00 36.84  ? 150  ILE F CA  1 
ATOM   9144  C  C   . ILE F  1 169 ? -12.905  19.550  -131.590 1.00 34.39  ? 150  ILE F C   1 
ATOM   9145  O  O   . ILE F  1 169 ? -13.076  20.475  -132.375 1.00 38.04  ? 150  ILE F O   1 
ATOM   9146  C  CB  . ILE F  1 169 ? -15.144  18.493  -131.391 1.00 34.17  ? 150  ILE F CB  1 
ATOM   9147  C  CG1 . ILE F  1 169 ? -16.104  17.793  -130.432 1.00 36.52  ? 150  ILE F CG1 1 
ATOM   9148  C  CG2 . ILE F  1 169 ? -14.582  17.463  -132.382 1.00 30.63  ? 150  ILE F CG2 1 
ATOM   9149  C  CD1 . ILE F  1 169 ? -17.163  16.957  -131.133 1.00 38.52  ? 150  ILE F CD1 1 
ATOM   9150  N  N   . SER F  1 170 ? -11.782  18.835  -131.538 1.00 33.91  ? 151  SER F N   1 
ATOM   9151  C  CA  . SER F  1 170 ? -10.756  18.968  -132.568 1.00 38.45  ? 151  SER F CA  1 
ATOM   9152  C  C   . SER F  1 170 ? -10.648  17.651  -133.347 1.00 40.63  ? 151  SER F C   1 
ATOM   9153  O  O   . SER F  1 170 ? -10.625  16.560  -132.758 1.00 41.78  ? 151  SER F O   1 
ATOM   9154  C  CB  . SER F  1 170 ? -9.413   19.381  -131.970 1.00 42.21  ? 151  SER F CB  1 
ATOM   9155  O  OG  . SER F  1 170 ? -8.844   18.314  -131.246 1.00 50.79  ? 151  SER F OG  1 
ATOM   9156  N  N   . VAL F  1 171 ? -10.623  17.750  -134.677 1.00 37.59  ? 152  VAL F N   1 
ATOM   9157  C  CA  . VAL F  1 171 ? -10.416  16.568  -135.525 1.00 39.14  ? 152  VAL F CA  1 
ATOM   9158  C  C   . VAL F  1 171 ? -8.987   16.466  -136.094 1.00 40.37  ? 152  VAL F C   1 
ATOM   9159  O  O   . VAL F  1 171 ? -8.382   17.467  -136.488 1.00 37.06  ? 152  VAL F O   1 
ATOM   9160  C  CB  . VAL F  1 171 ? -11.407  16.534  -136.689 1.00 39.33  ? 152  VAL F CB  1 
ATOM   9161  C  CG1 . VAL F  1 171 ? -12.812  16.271  -136.185 1.00 42.62  ? 152  VAL F CG1 1 
ATOM   9162  C  CG2 . VAL F  1 171 ? -11.355  17.836  -137.446 1.00 37.28  ? 152  VAL F CG2 1 
ATOM   9163  N  N   . ASP F  1 172 ? -8.449   15.253  -136.115 1.00 43.95  ? 153  ASP F N   1 
ATOM   9164  C  CA  . ASP F  1 172 ? -7.110   15.024  -136.625 1.00 51.64  ? 153  ASP F CA  1 
ATOM   9165  C  C   . ASP F  1 172 ? -7.090   13.740  -137.438 1.00 54.78  ? 153  ASP F C   1 
ATOM   9166  O  O   . ASP F  1 172 ? -7.830   12.802  -137.149 1.00 51.56  ? 153  ASP F O   1 
ATOM   9167  C  CB  . ASP F  1 172 ? -6.099   14.946  -135.481 1.00 64.31  ? 153  ASP F CB  1 
ATOM   9168  C  CG  . ASP F  1 172 ? -5.996   16.245  -134.713 1.00 82.94  ? 153  ASP F CG  1 
ATOM   9169  O  OD1 . ASP F  1 172 ? -5.318   17.173  -135.220 1.00 88.28  ? 153  ASP F OD1 1 
ATOM   9170  O  OD2 . ASP F  1 172 ? -6.593   16.339  -133.609 1.00 90.68  ? 153  ASP F OD2 1 
ATOM   9171  N  N   . PRO F  1 173 ? -6.261   13.705  -138.484 1.00 65.83  ? 154  PRO F N   1 
ATOM   9172  C  CA  . PRO F  1 173 ? -6.015   12.477  -139.252 1.00 64.80  ? 154  PRO F CA  1 
ATOM   9173  C  C   . PRO F  1 173 ? -5.217   11.464  -138.427 1.00 61.84  ? 154  PRO F C   1 
ATOM   9174  O  O   . PRO F  1 173 ? -4.657   11.825  -137.390 1.00 66.75  ? 154  PRO F O   1 
ATOM   9175  C  CB  . PRO F  1 173 ? -5.164   12.974  -140.423 1.00 71.13  ? 154  PRO F CB  1 
ATOM   9176  C  CG  . PRO F  1 173 ? -5.449   14.468  -140.508 1.00 72.08  ? 154  PRO F CG  1 
ATOM   9177  C  CD  . PRO F  1 173 ? -5.628   14.888  -139.094 1.00 70.24  ? 154  PRO F CD  1 
ATOM   9178  N  N   . THR F  1 174 ? -5.160   10.216  -138.876 1.00 55.71  ? 155  THR F N   1 
ATOM   9179  C  CA  . THR F  1 174 ? -4.418   9.170   -138.158 1.00 52.63  ? 155  THR F CA  1 
ATOM   9180  C  C   . THR F  1 174 ? -3.013   8.924   -138.717 1.00 55.29  ? 155  THR F C   1 
ATOM   9181  O  O   . THR F  1 174 ? -2.021   8.938   -137.981 1.00 51.90  ? 155  THR F O   1 
ATOM   9182  C  CB  . THR F  1 174 ? -5.192   7.844   -138.188 1.00 53.03  ? 155  THR F CB  1 
ATOM   9183  O  OG1 . THR F  1 174 ? -6.317   7.935   -137.313 1.00 52.99  ? 155  THR F OG1 1 
ATOM   9184  C  CG2 . THR F  1 174 ? -4.310   6.687   -137.753 1.00 55.05  ? 155  THR F CG2 1 
ATOM   9185  N  N   . GLU F  1 182 ? -6.283   -0.342  -148.492 1.00 77.35  ? 163  GLU F N   1 
ATOM   9186  C  CA  . GLU F  1 182 ? -5.809   -1.550  -147.822 1.00 62.43  ? 163  GLU F CA  1 
ATOM   9187  C  C   . GLU F  1 182 ? -6.842   -2.630  -147.769 1.00 48.72  ? 163  GLU F C   1 
ATOM   9188  O  O   . GLU F  1 182 ? -6.538   -3.762  -147.923 1.00 53.13  ? 163  GLU F O   1 
ATOM   9189  C  CB  . GLU F  1 182 ? -5.355   -1.273  -146.394 1.00 66.33  ? 163  GLU F CB  1 
ATOM   9190  C  CG  . GLU F  1 182 ? -4.939   -2.540  -145.649 1.00 67.30  ? 163  GLU F CG  1 
ATOM   9191  C  CD  . GLU F  1 182 ? -4.641   -2.337  -144.190 1.00 58.59  ? 163  GLU F CD  1 
ATOM   9192  O  OE1 . GLU F  1 182 ? -5.121   -1.370  -143.636 1.00 61.63  ? 163  GLU F OE1 1 
ATOM   9193  O  OE2 . GLU F  1 182 ? -3.939   -3.145  -143.595 1.00 51.37  ? 163  GLU F OE2 1 
ATOM   9194  N  N   . TYR F  1 183 ? -8.069   -2.270  -147.505 1.00 38.18  ? 164  TYR F N   1 
ATOM   9195  C  CA  . TYR F  1 183 ? -9.146   -3.215  -147.471 1.00 33.80  ? 164  TYR F CA  1 
ATOM   9196  C  C   . TYR F  1 183 ? -10.079  -3.035  -148.645 1.00 30.49  ? 164  TYR F C   1 
ATOM   9197  O  O   . TYR F  1 183 ? -11.196  -3.482  -148.607 1.00 25.73  ? 164  TYR F O   1 
ATOM   9198  C  CB  . TYR F  1 183 ? -9.916   -3.085  -146.182 1.00 37.85  ? 164  TYR F CB  1 
ATOM   9199  C  CG  . TYR F  1 183 ? -9.112   -3.233  -144.950 1.00 36.96  ? 164  TYR F CG  1 
ATOM   9200  C  CD1 . TYR F  1 183 ? -8.478   -4.395  -144.651 1.00 34.15  ? 164  TYR F CD1 1 
ATOM   9201  C  CD2 . TYR F  1 183 ? -9.019   -2.221  -144.071 1.00 42.92  ? 164  TYR F CD2 1 
ATOM   9202  C  CE1 . TYR F  1 183 ? -7.750   -4.531  -143.508 1.00 36.17  ? 164  TYR F CE1 1 
ATOM   9203  C  CE2 . TYR F  1 183 ? -8.296   -2.355  -142.931 1.00 49.81  ? 164  TYR F CE2 1 
ATOM   9204  C  CZ  . TYR F  1 183 ? -7.673   -3.517  -142.661 1.00 43.62  ? 164  TYR F CZ  1 
ATOM   9205  O  OH  . TYR F  1 183 ? -6.959   -3.631  -141.534 1.00 45.98  ? 164  TYR F OH  1 
ATOM   9206  N  N   . PHE F  1 184 ? -9.590   -2.355  -149.668 1.00 30.77  ? 165  PHE F N   1 
ATOM   9207  C  CA  . PHE F  1 184 ? -10.342  -1.994  -150.844 1.00 28.06  ? 165  PHE F CA  1 
ATOM   9208  C  C   . PHE F  1 184 ? -10.663  -3.165  -151.743 1.00 26.94  ? 165  PHE F C   1 
ATOM   9209  O  O   . PHE F  1 184 ? -9.821   -3.964  -152.005 1.00 25.01  ? 165  PHE F O   1 
ATOM   9210  C  CB  . PHE F  1 184 ? -9.611   -0.903  -151.606 1.00 23.92  ? 165  PHE F CB  1 
ATOM   9211  C  CG  . PHE F  1 184 ? -10.419  -0.248  -152.661 1.00 23.77  ? 165  PHE F CG  1 
ATOM   9212  C  CD1 . PHE F  1 184 ? -11.363  0.668   -152.345 1.00 25.50  ? 165  PHE F CD1 1 
ATOM   9213  C  CD2 . PHE F  1 184 ? -10.202  -0.539  -153.965 1.00 22.30  ? 165  PHE F CD2 1 
ATOM   9214  C  CE1 . PHE F  1 184 ? -12.105  1.257   -153.304 1.00 30.49  ? 165  PHE F CE1 1 
ATOM   9215  C  CE2 . PHE F  1 184 ? -10.933  0.047   -154.940 1.00 26.21  ? 165  PHE F CE2 1 
ATOM   9216  C  CZ  . PHE F  1 184 ? -11.890  0.947   -154.610 1.00 28.93  ? 165  PHE F CZ  1 
ATOM   9217  N  N   . SER F  1 185 ? -11.904  -3.241  -152.198 1.00 20.87  ? 166  SER F N   1 
ATOM   9218  C  CA  . SER F  1 185 ? -12.355  -4.369  -153.000 1.00 30.81  ? 166  SER F CA  1 
ATOM   9219  C  C   . SER F  1 185 ? -11.624  -4.488  -154.330 1.00 35.74  ? 166  SER F C   1 
ATOM   9220  O  O   . SER F  1 185 ? -11.574  -3.543  -155.117 1.00 38.93  ? 166  SER F O   1 
ATOM   9221  C  CB  . SER F  1 185 ? -13.851  -4.254  -153.281 1.00 40.82  ? 166  SER F CB  1 
ATOM   9222  O  OG  . SER F  1 185 ? -14.315  -5.404  -153.976 1.00 44.23  ? 166  SER F OG  1 
ATOM   9223  N  N   . GLN F  1 186 ? -11.082  -5.667  -154.596 1.00 38.24  ? 167  GLN F N   1 
ATOM   9224  C  CA  . GLN F  1 186 ? -10.448  -5.921  -155.886 1.00 36.77  ? 167  GLN F CA  1 
ATOM   9225  C  C   . GLN F  1 186 ? -11.502  -6.038  -156.979 1.00 34.86  ? 167  GLN F C   1 
ATOM   9226  O  O   . GLN F  1 186 ? -11.176  -6.031  -158.152 1.00 36.43  ? 167  GLN F O   1 
ATOM   9227  C  CB  . GLN F  1 186 ? -9.618   -7.201  -155.833 1.00 37.01  ? 167  GLN F CB  1 
ATOM   9228  C  CG  . GLN F  1 186 ? -10.434  -8.441  -155.523 1.00 44.24  ? 167  GLN F CG  1 
ATOM   9229  C  CD  . GLN F  1 186 ? -9.590   -9.696  -155.470 1.00 56.51  ? 167  GLN F CD  1 
ATOM   9230  O  OE1 . GLN F  1 186 ? -9.661   -10.481 -154.511 1.00 56.00  ? 167  GLN F OE1 1 
ATOM   9231  N  NE2 . GLN F  1 186 ? -8.787   -9.904  -156.511 1.00 66.80  ? 167  GLN F NE2 1 
ATOM   9232  N  N   . TYR F  1 187 ? -12.769  -6.149  -156.593 1.00 32.26  ? 168  TYR F N   1 
ATOM   9233  C  CA  . TYR F  1 187 ? -13.835  -6.341  -157.569 1.00 25.16  ? 168  TYR F CA  1 
ATOM   9234  C  C   . TYR F  1 187 ? -14.517  -5.035  -157.986 1.00 29.67  ? 168  TYR F C   1 
ATOM   9235  O  O   . TYR F  1 187 ? -15.490  -5.030  -158.748 1.00 33.80  ? 168  TYR F O   1 
ATOM   9236  C  CB  . TYR F  1 187 ? -14.849  -7.372  -157.053 1.00 23.20  ? 168  TYR F CB  1 
ATOM   9237  C  CG  . TYR F  1 187 ? -14.172  -8.674  -156.711 1.00 27.94  ? 168  TYR F CG  1 
ATOM   9238  C  CD1 . TYR F  1 187 ? -13.503  -9.404  -157.688 1.00 25.02  ? 168  TYR F CD1 1 
ATOM   9239  C  CD2 . TYR F  1 187 ? -14.171  -9.162  -155.411 1.00 29.36  ? 168  TYR F CD2 1 
ATOM   9240  C  CE1 . TYR F  1 187 ? -12.848  -10.590 -157.380 1.00 31.97  ? 168  TYR F CE1 1 
ATOM   9241  C  CE2 . TYR F  1 187 ? -13.522  -10.347 -155.093 1.00 33.61  ? 168  TYR F CE2 1 
ATOM   9242  C  CZ  . TYR F  1 187 ? -12.865  -11.065 -156.085 1.00 35.42  ? 168  TYR F CZ  1 
ATOM   9243  O  OH  . TYR F  1 187 ? -12.217  -12.250 -155.797 1.00 35.11  ? 168  TYR F OH  1 
ATOM   9244  N  N   . SER F  1 188 ? -14.012  -3.921  -157.483 1.00 28.04  ? 169  SER F N   1 
ATOM   9245  C  CA  . SER F  1 188 ? -14.526  -2.628  -157.896 1.00 26.83  ? 169  SER F CA  1 
ATOM   9246  C  C   . SER F  1 188 ? -14.072  -2.346  -159.330 1.00 28.28  ? 169  SER F C   1 
ATOM   9247  O  O   . SER F  1 188 ? -13.063  -2.881  -159.796 1.00 32.16  ? 169  SER F O   1 
ATOM   9248  C  CB  . SER F  1 188 ? -13.995  -1.533  -156.962 1.00 32.49  ? 169  SER F CB  1 
ATOM   9249  O  OG  . SER F  1 188 ? -14.459  -0.246  -157.340 1.00 31.61  ? 169  SER F OG  1 
ATOM   9250  N  N   . ARG F  1 189 ? -14.797  -1.477  -160.025 1.00 26.48  ? 170  ARG F N   1 
ATOM   9251  C  CA  . ARG F  1 189 ? -14.418  -1.085  -161.375 1.00 29.70  ? 170  ARG F CA  1 
ATOM   9252  C  C   . ARG F  1 189 ? -13.235  -0.141  -161.331 1.00 32.22  ? 170  ARG F C   1 
ATOM   9253  O  O   . ARG F  1 189 ? -12.560  0.100   -162.330 1.00 41.46  ? 170  ARG F O   1 
ATOM   9254  C  CB  . ARG F  1 189 ? -15.595  -0.414  -162.076 1.00 34.79  ? 170  ARG F CB  1 
ATOM   9255  C  CG  . ARG F  1 189 ? -16.819  -1.304  -162.183 1.00 44.19  ? 170  ARG F CG  1 
ATOM   9256  C  CD  . ARG F  1 189 ? -17.462  -1.218  -163.556 1.00 48.78  ? 170  ARG F CD  1 
ATOM   9257  N  NE  . ARG F  1 189 ? -18.134  0.051   -163.810 1.00 49.37  ? 170  ARG F NE  1 
ATOM   9258  C  CZ  . ARG F  1 189 ? -18.265  0.581   -165.022 1.00 50.11  ? 170  ARG F CZ  1 
ATOM   9259  N  NH1 . ARG F  1 189 ? -17.753  -0.048  -166.073 1.00 51.82  ? 170  ARG F NH1 1 
ATOM   9260  N  NH2 . ARG F  1 189 ? -18.896  1.733   -165.185 1.00 49.47  ? 170  ARG F NH2 1 
ATOM   9261  N  N   . PHE F  1 190 ? -12.980  0.376   -160.146 1.00 33.23  ? 171  PHE F N   1 
ATOM   9262  C  CA  . PHE F  1 190 ? -12.038  1.452   -159.968 1.00 31.29  ? 171  PHE F CA  1 
ATOM   9263  C  C   . PHE F  1 190 ? -10.951  0.955   -159.078 1.00 28.79  ? 171  PHE F C   1 
ATOM   9264  O  O   . PHE F  1 190 ? -11.037  -0.141  -158.527 1.00 28.40  ? 171  PHE F O   1 
ATOM   9265  C  CB  . PHE F  1 190 ? -12.737  2.634   -159.290 1.00 37.61  ? 171  PHE F CB  1 
ATOM   9266  C  CG  . PHE F  1 190 ? -13.923  3.145   -160.062 1.00 35.07  ? 171  PHE F CG  1 
ATOM   9267  C  CD1 . PHE F  1 190 ? -15.195  2.600   -159.856 1.00 36.42  ? 171  PHE F CD1 1 
ATOM   9268  C  CD2 . PHE F  1 190 ? -13.762  4.141   -161.024 1.00 29.88  ? 171  PHE F CD2 1 
ATOM   9269  C  CE1 . PHE F  1 190 ? -16.289  3.047   -160.593 1.00 37.71  ? 171  PHE F CE1 1 
ATOM   9270  C  CE2 . PHE F  1 190 ? -14.840  4.593   -161.768 1.00 28.63  ? 171  PHE F CE2 1 
ATOM   9271  C  CZ  . PHE F  1 190 ? -16.108  4.048   -161.550 1.00 35.38  ? 171  PHE F CZ  1 
ATOM   9272  N  N   . GLU F  1 191 ? -9.925   1.773   -158.942 1.00 31.09  ? 172  GLU F N   1 
ATOM   9273  C  CA  . GLU F  1 191 ? -8.780   1.436   -158.118 1.00 37.51  ? 172  GLU F CA  1 
ATOM   9274  C  C   . GLU F  1 191 ? -8.278   2.737   -157.503 1.00 38.58  ? 172  GLU F C   1 
ATOM   9275  O  O   . GLU F  1 191 ? -8.513   3.820   -158.040 1.00 36.75  ? 172  GLU F O   1 
ATOM   9276  C  CB  . GLU F  1 191 ? -7.686   0.750   -158.939 1.00 39.95  ? 172  GLU F CB  1 
ATOM   9277  C  CG  . GLU F  1 191 ? -7.215   1.589   -160.131 1.00 48.45  ? 172  GLU F CG  1 
ATOM   9278  C  CD  . GLU F  1 191 ? -6.060   0.953   -160.861 1.00 48.72  ? 172  GLU F CD  1 
ATOM   9279  O  OE1 . GLU F  1 191 ? -5.685   -0.180  -160.480 1.00 48.18  ? 172  GLU F OE1 1 
ATOM   9280  O  OE2 . GLU F  1 191 ? -5.533   1.590   -161.802 1.00 49.22  ? 172  GLU F OE2 1 
ATOM   9281  N  N   . ILE F  1 192 ? -7.630   2.626   -156.354 1.00 37.87  ? 173  ILE F N   1 
ATOM   9282  C  CA  . ILE F  1 192 ? -7.198   3.801   -155.640 1.00 40.92  ? 173  ILE F CA  1 
ATOM   9283  C  C   . ILE F  1 192 ? -5.714   4.062   -155.876 1.00 42.54  ? 173  ILE F C   1 
ATOM   9284  O  O   . ILE F  1 192 ? -4.866   3.188   -155.664 1.00 45.66  ? 173  ILE F O   1 
ATOM   9285  C  CB  . ILE F  1 192 ? -7.474   3.651   -154.143 1.00 45.71  ? 173  ILE F CB  1 
ATOM   9286  C  CG1 . ILE F  1 192 ? -8.973   3.483   -153.913 1.00 45.34  ? 173  ILE F CG1 1 
ATOM   9287  C  CG2 . ILE F  1 192 ? -6.922   4.849   -153.366 1.00 49.80  ? 173  ILE F CG2 1 
ATOM   9288  C  CD1 . ILE F  1 192 ? -9.361   3.519   -152.449 1.00 46.68  ? 173  ILE F CD1 1 
ATOM   9289  N  N   . LEU F  1 193 ? -5.406   5.281   -156.295 1.00 42.07  ? 174  LEU F N   1 
ATOM   9290  C  CA  . LEU F  1 193 ? -4.021   5.658   -156.568 1.00 45.68  ? 174  LEU F CA  1 
ATOM   9291  C  C   . LEU F  1 193 ? -3.360   6.223   -155.333 1.00 47.84  ? 174  LEU F C   1 
ATOM   9292  O  O   . LEU F  1 193 ? -2.241   5.849   -154.995 1.00 48.85  ? 174  LEU F O   1 
ATOM   9293  C  CB  . LEU F  1 193 ? -3.949   6.675   -157.707 1.00 43.46  ? 174  LEU F CB  1 
ATOM   9294  C  CG  . LEU F  1 193 ? -4.718   6.252   -158.967 1.00 37.87  ? 174  LEU F CG  1 
ATOM   9295  C  CD1 . LEU F  1 193 ? -4.697   7.309   -160.026 1.00 34.18  ? 174  LEU F CD1 1 
ATOM   9296  C  CD2 . LEU F  1 193 ? -4.178   4.936   -159.525 1.00 35.12  ? 174  LEU F CD2 1 
ATOM   9297  N  N   . ASP F  1 194 ? -4.063   7.124   -154.658 1.00 53.53  ? 175  ASP F N   1 
ATOM   9298  C  CA  . ASP F  1 194 ? -3.540   7.727   -153.442 1.00 57.28  ? 175  ASP F CA  1 
ATOM   9299  C  C   . ASP F  1 194 ? -4.645   8.280   -152.536 1.00 55.69  ? 175  ASP F C   1 
ATOM   9300  O  O   . ASP F  1 194 ? -5.695   8.715   -153.021 1.00 57.45  ? 175  ASP F O   1 
ATOM   9301  C  CB  . ASP F  1 194 ? -2.560   8.833   -153.808 1.00 61.02  ? 175  ASP F CB  1 
ATOM   9302  C  CG  . ASP F  1 194 ? -1.649   9.214   -152.652 1.00 69.36  ? 175  ASP F CG  1 
ATOM   9303  O  OD1 . ASP F  1 194 ? -1.409   8.363   -151.767 1.00 71.43  ? 175  ASP F OD1 1 
ATOM   9304  O  OD2 . ASP F  1 194 ? -1.161   10.366  -152.640 1.00 73.05  ? 175  ASP F OD2 1 
ATOM   9305  N  N   . VAL F  1 195 ? -4.405   8.247   -151.223 1.00 50.33  ? 176  VAL F N   1 
ATOM   9306  C  CA  . VAL F  1 195 ? -5.285   8.900   -150.254 1.00 43.14  ? 176  VAL F CA  1 
ATOM   9307  C  C   . VAL F  1 195 ? -4.470   9.844   -149.404 1.00 43.59  ? 176  VAL F C   1 
ATOM   9308  O  O   . VAL F  1 195 ? -3.530   9.420   -148.738 1.00 50.39  ? 176  VAL F O   1 
ATOM   9309  C  CB  . VAL F  1 195 ? -5.981   7.899   -149.308 1.00 43.55  ? 176  VAL F CB  1 
ATOM   9310  C  CG1 . VAL F  1 195 ? -6.888   8.642   -148.341 1.00 24.14  ? 176  VAL F CG1 1 
ATOM   9311  C  CG2 . VAL F  1 195 ? -6.777   6.876   -150.096 1.00 46.64  ? 176  VAL F CG2 1 
ATOM   9312  N  N   . THR F  1 196 ? -4.826   11.123  -149.427 1.00 40.69  ? 177  THR F N   1 
ATOM   9313  C  CA  . THR F  1 196 ? -4.159   12.113  -148.584 1.00 39.27  ? 177  THR F CA  1 
ATOM   9314  C  C   . THR F  1 196 ? -5.174   12.770  -147.668 1.00 36.89  ? 177  THR F C   1 
ATOM   9315  O  O   . THR F  1 196 ? -6.338   12.913  -148.027 1.00 40.66  ? 177  THR F O   1 
ATOM   9316  C  CB  . THR F  1 196 ? -3.420   13.199