data_4UN7
# 
_entry.id   4UN7 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4UN7         
PDBE  EBI-60743    
WWPDB D_1290060743 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4UN6 unspecified 'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 10 DAYS INCUBATION IN 5MM MN (STATE 7)' 
PDB 4UN8 unspecified 'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 1H INCUBATION IN 5MM MN (STATE 2)'      
PDB 4UN9 unspecified 'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 8H INCUBATION IN 5MM MN (STATE 3)'      
PDB 4UNA unspecified 'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 2 DAYS INCUBATION IN 5MM MN (STATE 4)'  
PDB 4UNB unspecified 'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 6 DAYS INCUBATION IN 5MM MN (STATE 5)'  
PDB 4UNC unspecified 'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 8 DAYS INCUBATION IN 5MM MN (STATE 6)'  
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4UN7 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-05-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Molina, R.'     1 
'Stella, S.'     2 
'Redondo, P.'    3 
'Gomez, H.'      4 
'Marcaida, M.J.' 5 
'Orozco, M.'     6 
'Prieto, J.'     7 
'Montoya, G.'    8 
# 
_citation.id                        primary 
_citation.title                     'Visualizing Phosphodiester-Bond Hydrolysis by an Endonuclease.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            22 
_citation.page_first                65 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25486305 
_citation.pdbx_database_id_DOI      10.1038/NSMB.2932 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Molina, R.'     1 
primary 'Stella, S.'     2 
primary 'Redondo, P.'    3 
primary 'Gomez, H.'      4 
primary 'Marcaida, M.J.' 5 
primary 'Orozco, M.'     6 
primary 'Prieto, J.'     7 
primary 'Montoya, G.'    8 
# 
_cell.entry_id           4UN7 
_cell.length_a           106.570 
_cell.length_b           70.347 
_cell.length_c           106.601 
_cell.angle_alpha        90.00 
_cell.angle_beta         119.89 
_cell.angle_gamma        90.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4UN7 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HOMING ENDONUCLEASE I-DMOI' 23265.057 2  3.1.-.- ? ? ? 
2 polymer     syn 25MER                        7707.932  3  ?       ? ? ? 
3 polymer     syn 25MER                        7654.926  3  ?       ? ? ? 
4 polymer     man 'HOMING ENDONUCLEASE I-DMOI' 23280.068 1  3.1.-.- ? ? ? 
5 non-polymer syn 'ZINC ION'                   65.409    3  ?       ? ? ? 
6 water       nat water                        18.015    96 ?       ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;AHNNENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYEL
RVSSKKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGV
YVLNISLRDRIKFVHTILSSHLNPLPPEAAALEHHHHHH
;
;AHNNENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYEL
RVSSKKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGV
YVLNISLRDRIKFVHTILSSHLNPLPPEAAALEHHHHHH
;
A,D   ? 
2 polydeoxyribonucleotide no no 
;(DG)(DC)(DC)(DT)(DT)(DG)(DC)(DC)(DG)(DG)(DG)(DT)(DA)(DA)(DG)(DT)(DT)(DC)(DC)(DG)
(DG)(DC)(DG)(DC)(DG)
;
GCCTTGCCGGGTAAGTTCCGGCGCG B,E,H ? 
3 polydeoxyribonucleotide no no 
;(DC)(DG)(DC)(DG)(DC)(DC)(DG)(DG)(DA)(DA)(DC)(DT)(DT)(DA)(DC)(DC)(DC)(DG)(DG)(DC)
(DA)(DA)(DG)(DG)(DC)
;
CGCGCCGGAACTTACCCGGCAAGGC C,F,I ? 
4 'polypeptide(L)'        no no 
;AHNNEEVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYEL
RVSSKKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGV
YVLNISLRDRIKFVHTILSSHLNPLPPEAAALEHHHHHH
;
;AHNNEEVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYEL
RVSSKKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGV
YVLNISLRDRIKFVHTILSSHLNPLPPEAAALEHHHHHH
;
G     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   HIS n 
1 3   ASN n 
1 4   ASN n 
1 5   GLU n 
1 6   ASN n 
1 7   VAL n 
1 8   SER n 
1 9   GLY n 
1 10  ILE n 
1 11  SER n 
1 12  ALA n 
1 13  TYR n 
1 14  LEU n 
1 15  LEU n 
1 16  GLY n 
1 17  LEU n 
1 18  ILE n 
1 19  ILE n 
1 20  GLY n 
1 21  ASP n 
1 22  GLY n 
1 23  GLY n 
1 24  LEU n 
1 25  TYR n 
1 26  LYS n 
1 27  LEU n 
1 28  LYS n 
1 29  TYR n 
1 30  LYS n 
1 31  GLY n 
1 32  ASN n 
1 33  ARG n 
1 34  SER n 
1 35  GLU n 
1 36  TYR n 
1 37  ARG n 
1 38  VAL n 
1 39  VAL n 
1 40  ILE n 
1 41  THR n 
1 42  GLN n 
1 43  LYS n 
1 44  SER n 
1 45  GLU n 
1 46  ASN n 
1 47  LEU n 
1 48  ILE n 
1 49  LYS n 
1 50  GLN n 
1 51  HIS n 
1 52  ILE n 
1 53  ALA n 
1 54  PRO n 
1 55  LEU n 
1 56  MET n 
1 57  GLN n 
1 58  PHE n 
1 59  LEU n 
1 60  ILE n 
1 61  ASP n 
1 62  GLU n 
1 63  LEU n 
1 64  ASN n 
1 65  VAL n 
1 66  LYS n 
1 67  SER n 
1 68  LYS n 
1 69  ILE n 
1 70  GLN n 
1 71  ILE n 
1 72  VAL n 
1 73  LYS n 
1 74  GLY n 
1 75  ASP n 
1 76  THR n 
1 77  ARG n 
1 78  TYR n 
1 79  GLU n 
1 80  LEU n 
1 81  ARG n 
1 82  VAL n 
1 83  SER n 
1 84  SER n 
1 85  LYS n 
1 86  LYS n 
1 87  LEU n 
1 88  TYR n 
1 89  TYR n 
1 90  TYR n 
1 91  PHE n 
1 92  ALA n 
1 93  ASN n 
1 94  MET n 
1 95  LEU n 
1 96  GLU n 
1 97  ARG n 
1 98  ILE n 
1 99  ARG n 
1 100 LEU n 
1 101 PHE n 
1 102 ASN n 
1 103 MET n 
1 104 ARG n 
1 105 GLU n 
1 106 GLN n 
1 107 ILE n 
1 108 ALA n 
1 109 PHE n 
1 110 ILE n 
1 111 LYS n 
1 112 GLY n 
1 113 LEU n 
1 114 TYR n 
1 115 VAL n 
1 116 ALA n 
1 117 GLU n 
1 118 GLY n 
1 119 ASP n 
1 120 LYS n 
1 121 THR n 
1 122 LEU n 
1 123 LYS n 
1 124 ARG n 
1 125 LEU n 
1 126 ARG n 
1 127 ILE n 
1 128 TRP n 
1 129 ASN n 
1 130 LYS n 
1 131 ASN n 
1 132 LYS n 
1 133 ALA n 
1 134 LEU n 
1 135 LEU n 
1 136 GLU n 
1 137 ILE n 
1 138 VAL n 
1 139 SER n 
1 140 ARG n 
1 141 TRP n 
1 142 LEU n 
1 143 ASN n 
1 144 ASN n 
1 145 LEU n 
1 146 GLY n 
1 147 VAL n 
1 148 ARG n 
1 149 ASN n 
1 150 THR n 
1 151 ILE n 
1 152 HIS n 
1 153 LEU n 
1 154 ASP n 
1 155 ASP n 
1 156 HIS n 
1 157 ARG n 
1 158 HIS n 
1 159 GLY n 
1 160 VAL n 
1 161 TYR n 
1 162 VAL n 
1 163 LEU n 
1 164 ASN n 
1 165 ILE n 
1 166 SER n 
1 167 LEU n 
1 168 ARG n 
1 169 ASP n 
1 170 ARG n 
1 171 ILE n 
1 172 LYS n 
1 173 PHE n 
1 174 VAL n 
1 175 HIS n 
1 176 THR n 
1 177 ILE n 
1 178 LEU n 
1 179 SER n 
1 180 SER n 
1 181 HIS n 
1 182 LEU n 
1 183 ASN n 
1 184 PRO n 
1 185 LEU n 
1 186 PRO n 
1 187 PRO n 
1 188 GLU n 
1 189 ALA n 
1 190 ALA n 
1 191 ALA n 
1 192 LEU n 
1 193 GLU n 
1 194 HIS n 
1 195 HIS n 
1 196 HIS n 
1 197 HIS n 
1 198 HIS n 
1 199 HIS n 
2 1   DG  n 
2 2   DC  n 
2 3   DC  n 
2 4   DT  n 
2 5   DT  n 
2 6   DG  n 
2 7   DC  n 
2 8   DC  n 
2 9   DG  n 
2 10  DG  n 
2 11  DG  n 
2 12  DT  n 
2 13  DA  n 
2 14  DA  n 
2 15  DG  n 
2 16  DT  n 
2 17  DT  n 
2 18  DC  n 
2 19  DC  n 
2 20  DG  n 
2 21  DG  n 
2 22  DC  n 
2 23  DG  n 
2 24  DC  n 
2 25  DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DC  n 
3 6   DC  n 
3 7   DG  n 
3 8   DG  n 
3 9   DA  n 
3 10  DA  n 
3 11  DC  n 
3 12  DT  n 
3 13  DT  n 
3 14  DA  n 
3 15  DC  n 
3 16  DC  n 
3 17  DC  n 
3 18  DG  n 
3 19  DG  n 
3 20  DC  n 
3 21  DA  n 
3 22  DA  n 
3 23  DG  n 
3 24  DG  n 
3 25  DC  n 
4 1   ALA n 
4 2   HIS n 
4 3   ASN n 
4 4   ASN n 
4 5   GLU n 
4 6   GLU n 
4 7   VAL n 
4 8   SER n 
4 9   GLY n 
4 10  ILE n 
4 11  SER n 
4 12  ALA n 
4 13  TYR n 
4 14  LEU n 
4 15  LEU n 
4 16  GLY n 
4 17  LEU n 
4 18  ILE n 
4 19  ILE n 
4 20  GLY n 
4 21  ASP n 
4 22  GLY n 
4 23  GLY n 
4 24  LEU n 
4 25  TYR n 
4 26  LYS n 
4 27  LEU n 
4 28  LYS n 
4 29  TYR n 
4 30  LYS n 
4 31  GLY n 
4 32  ASN n 
4 33  ARG n 
4 34  SER n 
4 35  GLU n 
4 36  TYR n 
4 37  ARG n 
4 38  VAL n 
4 39  VAL n 
4 40  ILE n 
4 41  THR n 
4 42  GLN n 
4 43  LYS n 
4 44  SER n 
4 45  GLU n 
4 46  ASN n 
4 47  LEU n 
4 48  ILE n 
4 49  LYS n 
4 50  GLN n 
4 51  HIS n 
4 52  ILE n 
4 53  ALA n 
4 54  PRO n 
4 55  LEU n 
4 56  MET n 
4 57  GLN n 
4 58  PHE n 
4 59  LEU n 
4 60  ILE n 
4 61  ASP n 
4 62  GLU n 
4 63  LEU n 
4 64  ASN n 
4 65  VAL n 
4 66  LYS n 
4 67  SER n 
4 68  LYS n 
4 69  ILE n 
4 70  GLN n 
4 71  ILE n 
4 72  VAL n 
4 73  LYS n 
4 74  GLY n 
4 75  ASP n 
4 76  THR n 
4 77  ARG n 
4 78  TYR n 
4 79  GLU n 
4 80  LEU n 
4 81  ARG n 
4 82  VAL n 
4 83  SER n 
4 84  SER n 
4 85  LYS n 
4 86  LYS n 
4 87  LEU n 
4 88  TYR n 
4 89  TYR n 
4 90  TYR n 
4 91  PHE n 
4 92  ALA n 
4 93  ASN n 
4 94  MET n 
4 95  LEU n 
4 96  GLU n 
4 97  ARG n 
4 98  ILE n 
4 99  ARG n 
4 100 LEU n 
4 101 PHE n 
4 102 ASN n 
4 103 MET n 
4 104 ARG n 
4 105 GLU n 
4 106 GLN n 
4 107 ILE n 
4 108 ALA n 
4 109 PHE n 
4 110 ILE n 
4 111 LYS n 
4 112 GLY n 
4 113 LEU n 
4 114 TYR n 
4 115 VAL n 
4 116 ALA n 
4 117 GLU n 
4 118 GLY n 
4 119 ASP n 
4 120 LYS n 
4 121 THR n 
4 122 LEU n 
4 123 LYS n 
4 124 ARG n 
4 125 LEU n 
4 126 ARG n 
4 127 ILE n 
4 128 TRP n 
4 129 ASN n 
4 130 LYS n 
4 131 ASN n 
4 132 LYS n 
4 133 ALA n 
4 134 LEU n 
4 135 LEU n 
4 136 GLU n 
4 137 ILE n 
4 138 VAL n 
4 139 SER n 
4 140 ARG n 
4 141 TRP n 
4 142 LEU n 
4 143 ASN n 
4 144 ASN n 
4 145 LEU n 
4 146 GLY n 
4 147 VAL n 
4 148 ARG n 
4 149 ASN n 
4 150 THR n 
4 151 ILE n 
4 152 HIS n 
4 153 LEU n 
4 154 ASP n 
4 155 ASP n 
4 156 HIS n 
4 157 ARG n 
4 158 HIS n 
4 159 GLY n 
4 160 VAL n 
4 161 TYR n 
4 162 VAL n 
4 163 LEU n 
4 164 ASN n 
4 165 ILE n 
4 166 SER n 
4 167 LEU n 
4 168 ARG n 
4 169 ASP n 
4 170 ARG n 
4 171 ILE n 
4 172 LYS n 
4 173 PHE n 
4 174 VAL n 
4 175 HIS n 
4 176 THR n 
4 177 ILE n 
4 178 LEU n 
4 179 SER n 
4 180 SER n 
4 181 HIS n 
4 182 LEU n 
4 183 ASN n 
4 184 PRO n 
4 185 LEU n 
4 186 PRO n 
4 187 PRO n 
4 188 GLU n 
4 189 ALA n 
4 190 ALA n 
4 191 ALA n 
4 192 LEU n 
4 193 GLU n 
4 194 HIS n 
4 195 HIS n 
4 196 HIS n 
4 197 HIS n 
4 198 HIS n 
4 199 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'DESULFUROCOCCUS MOBILIS' 2274 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 
'BL21(DE3)' 'ROSETTA PLYSS' ? ? ? ? ? ? PLASMID PET24D ? ? ? ? ? 
4 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'DESULFUROCOCCUS MOBILIS' 2274 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 469008 ? ? ? ? ? ? 
'BL21(DE3)' 'ROSETTA PLYSS' ? ? ? ? ? ? PLASMID PET24D ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
3 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP DMO1_DESMO 1 ? ? P21505 ? 
2 UNP DMO1_DESMO 4 ? ? P21505 ? 
3 PDB 4UN7       2 ? ? 4UN7   ? 
4 PDB 4UN7       3 ? ? 4UN7   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4UN7 A 2 ? 188 ? P21505 2 ? 188 ? 2 188 
2 1 4UN7 D 2 ? 188 ? P21505 2 ? 188 ? 2 188 
3 2 4UN7 G 2 ? 188 ? P21505 2 ? 188 ? 2 188 
4 3 4UN7 B 1 ? 25  ? 4UN7   1 ? 25  ? 1 25  
5 3 4UN7 E 1 ? 25  ? 4UN7   1 ? 25  ? 1 25  
6 3 4UN7 H 1 ? 25  ? 4UN7   1 ? 25  ? 1 25  
7 4 4UN7 C 1 ? 25  ? 4UN7   1 ? 25  ? 1 25  
8 4 4UN7 F 1 ? 25  ? 4UN7   1 ? 25  ? 1 25  
9 4 4UN7 I 1 ? 25  ? 4UN7   1 ? 25  ? 1 25  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4UN7 ALA A 1   ? UNP P21505 ?   ? 'expression tag' 1   1  
1 4UN7 ALA A 189 ? UNP P21505 ?   ? 'expression tag' 189 2  
1 4UN7 ALA A 190 ? UNP P21505 ?   ? 'expression tag' 190 3  
1 4UN7 ALA A 191 ? UNP P21505 ?   ? 'expression tag' 191 4  
1 4UN7 LEU A 192 ? UNP P21505 ?   ? 'expression tag' 192 5  
1 4UN7 GLU A 193 ? UNP P21505 ?   ? 'expression tag' 193 6  
1 4UN7 HIS A 194 ? UNP P21505 ?   ? 'expression tag' 194 7  
1 4UN7 HIS A 195 ? UNP P21505 ?   ? 'expression tag' 195 8  
1 4UN7 HIS A 196 ? UNP P21505 ?   ? 'expression tag' 196 9  
1 4UN7 HIS A 197 ? UNP P21505 ?   ? 'expression tag' 197 10 
1 4UN7 HIS A 198 ? UNP P21505 ?   ? 'expression tag' 198 11 
1 4UN7 HIS A 199 ? UNP P21505 ?   ? 'expression tag' 199 12 
2 4UN7 ALA D 1   ? UNP P21505 ?   ? 'expression tag' 1   13 
2 4UN7 ALA D 189 ? UNP P21505 ?   ? 'expression tag' 189 14 
2 4UN7 ALA D 190 ? UNP P21505 ?   ? 'expression tag' 190 15 
2 4UN7 ALA D 191 ? UNP P21505 ?   ? 'expression tag' 191 16 
2 4UN7 LEU D 192 ? UNP P21505 ?   ? 'expression tag' 192 17 
2 4UN7 GLU D 193 ? UNP P21505 ?   ? 'expression tag' 193 18 
2 4UN7 HIS D 194 ? UNP P21505 ?   ? 'expression tag' 194 19 
2 4UN7 HIS D 195 ? UNP P21505 ?   ? 'expression tag' 195 20 
2 4UN7 HIS D 196 ? UNP P21505 ?   ? 'expression tag' 196 21 
2 4UN7 HIS D 197 ? UNP P21505 ?   ? 'expression tag' 197 22 
2 4UN7 HIS D 198 ? UNP P21505 ?   ? 'expression tag' 198 23 
2 4UN7 HIS D 199 ? UNP P21505 ?   ? 'expression tag' 199 24 
3 4UN7 ALA G 1   ? UNP P21505 ?   ? 'expression tag' 1   25 
3 4UN7 GLU G 6   ? UNP P21505 ASN 6 conflict         6   26 
3 4UN7 ALA G 189 ? UNP P21505 ?   ? 'expression tag' 189 27 
3 4UN7 ALA G 190 ? UNP P21505 ?   ? 'expression tag' 190 28 
3 4UN7 ALA G 191 ? UNP P21505 ?   ? 'expression tag' 191 29 
3 4UN7 LEU G 192 ? UNP P21505 ?   ? 'expression tag' 192 30 
3 4UN7 GLU G 193 ? UNP P21505 ?   ? 'expression tag' 193 31 
3 4UN7 HIS G 194 ? UNP P21505 ?   ? 'expression tag' 194 32 
3 4UN7 HIS G 195 ? UNP P21505 ?   ? 'expression tag' 195 33 
3 4UN7 HIS G 196 ? UNP P21505 ?   ? 'expression tag' 196 34 
3 4UN7 HIS G 197 ? UNP P21505 ?   ? 'expression tag' 197 35 
3 4UN7 HIS G 198 ? UNP P21505 ?   ? 'expression tag' 198 36 
3 4UN7 HIS G 199 ? UNP P21505 ?   ? 'expression tag' 199 37 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.entry_id          4UN7 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.density_percent_sol   52 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 6' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.89 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             1.89 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4UN7 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             46.21 
_reflns.d_resolution_high            2.70 
_reflns.number_obs                   37832 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.07 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        12.50 
_reflns.B_iso_Wilson_estimate        67.72 
_reflns.pdbx_redundancy              4.6 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.70 
_reflns_shell.d_res_low              2.85 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           0.64 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        4.4 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4UN7 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     37807 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.14 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.195 
_refine.ls_d_res_high                            2.700 
_refine.ls_percent_reflns_obs                    98.56 
_refine.ls_R_factor_obs                          0.1802 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1773 
_refine.ls_R_factor_R_free                       0.2319 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.3 
_refine.ls_number_reflns_R_free                  3824 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2VS7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.33 
_refine.pdbx_overall_phase_error                 23.99 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4551 
_refine_hist.pdbx_number_atoms_nucleic_acid   3057 
_refine_hist.pdbx_number_atoms_ligand         3 
_refine_hist.number_atoms_solvent             96 
_refine_hist.number_atoms_total               7707 
_refine_hist.d_res_high                       2.700 
_refine_hist.d_res_low                        46.195 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.009  ? ? 8151  'X-RAY DIFFRACTION' ? 
f_angle_d          1.192  ? ? 11646 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 23.724 ? ? 3301  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.051  ? ? 1306  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.006  ? ? 969   'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.7000 2.7342  2511 0.3078 97.00  0.3358 . . 135 . . 
'X-RAY DIFFRACTION' . 2.7342 2.7702  2561 0.2795 98.00  0.3146 . . 141 . . 
'X-RAY DIFFRACTION' . 2.7702 2.8081  2556 0.2644 97.00  0.3243 . . 126 . . 
'X-RAY DIFFRACTION' . 2.8081 2.8482  2526 0.2442 98.00  0.2668 . . 146 . . 
'X-RAY DIFFRACTION' . 2.8482 2.8907  2588 0.2348 99.00  0.2822 . . 153 . . 
'X-RAY DIFFRACTION' . 2.8907 2.9359  2512 0.2278 98.00  0.2440 . . 138 . . 
'X-RAY DIFFRACTION' . 2.9359 2.9840  2527 0.2122 98.00  0.3098 . . 136 . . 
'X-RAY DIFFRACTION' . 2.9840 3.0355  2622 0.2055 98.00  0.2772 . . 148 . . 
'X-RAY DIFFRACTION' . 3.0355 3.0906  2458 0.1966 97.00  0.3040 . . 147 . . 
'X-RAY DIFFRACTION' . 3.0906 3.1501  2527 0.1886 98.00  0.2539 . . 143 . . 
'X-RAY DIFFRACTION' . 3.1501 3.2144  2482 0.1768 97.00  0.2273 . . 143 . . 
'X-RAY DIFFRACTION' . 3.2144 3.2842  2550 0.1547 99.00  0.2150 . . 152 . . 
'X-RAY DIFFRACTION' . 3.2842 3.3606  2587 0.1573 98.00  0.2679 . . 142 . . 
'X-RAY DIFFRACTION' . 3.3606 3.4446  2510 0.1490 99.00  0.2615 . . 135 . . 
'X-RAY DIFFRACTION' . 3.4446 3.5377  2582 0.1577 99.00  0.2543 . . 142 . . 
'X-RAY DIFFRACTION' . 3.5377 3.6418  2536 0.1579 99.00  0.2176 . . 148 . . 
'X-RAY DIFFRACTION' . 3.6418 3.7593  2657 0.1783 99.00  0.2562 . . 133 . . 
'X-RAY DIFFRACTION' . 3.7593 3.8936  2457 0.1854 99.00  0.2339 . . 142 . . 
'X-RAY DIFFRACTION' . 3.8936 4.0494  2557 0.1724 99.00  0.2399 . . 132 . . 
'X-RAY DIFFRACTION' . 4.0494 4.2336  2591 0.1643 99.00  0.2459 . . 142 . . 
'X-RAY DIFFRACTION' . 4.2336 4.4566  2579 0.1606 100.00 0.2251 . . 135 . . 
'X-RAY DIFFRACTION' . 4.4566 4.7356  2592 0.1575 99.00  0.1995 . . 143 . . 
'X-RAY DIFFRACTION' . 4.7356 5.1008  2601 0.1631 99.00  0.2004 . . 142 . . 
'X-RAY DIFFRACTION' . 5.1008 5.6133  2532 0.1754 99.00  0.1885 . . 150 . . 
'X-RAY DIFFRACTION' . 5.6133 6.4237  2537 0.1790 98.00  0.2267 . . 140 . . 
'X-RAY DIFFRACTION' . 6.4237 8.0861  2564 0.1890 100.00 0.2134 . . 144 . . 
'X-RAY DIFFRACTION' . 8.0861 46.2017 2543 0.1789 99.00  0.2069 . . 146 . . 
# 
_struct.entry_id                  4UN7 
_struct.title                     
'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA BEFORE INCUBATION IN 5MM MN (STATE 1)' 
_struct.pdbx_descriptor           'HOMING ENDONUCLEASE I-DMOI (E.C.3.1.-.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4UN7 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'HYDROLASE-DNA COMPLEX, CATALYSIS, PROTEIN-DNA INTERACTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 2 ? 
I N N 3 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
M N N 6 ? 
N N N 6 ? 
O N N 6 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
U N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 4   ? ASP A 21  ? ASN A 4   ASP A 21  1 ? 18 
HELX_P HELX_P2  2  SER A 44  ? HIS A 51  ? SER A 44  HIS A 51  1 ? 8  
HELX_P HELX_P3  3  HIS A 51  ? LEU A 63  ? HIS A 51  LEU A 63  1 ? 13 
HELX_P HELX_P4  4  SER A 84  ? ARG A 97  ? SER A 84  ARG A 97  1 ? 14 
HELX_P HELX_P5  5  ILE A 98  ? PHE A 101 ? ILE A 98  PHE A 101 5 ? 4  
HELX_P HELX_P6  6  ASN A 102 ? GLY A 118 ? ASN A 102 GLY A 118 1 ? 17 
HELX_P HELX_P7  7  ASN A 131 ? ASN A 144 ? ASN A 131 ASN A 144 1 ? 14 
HELX_P HELX_P8  8  ASP A 169 ? ILE A 177 ? ASP A 169 ILE A 177 1 ? 9  
HELX_P HELX_P9  9  ASN D 6   ? ASP D 21  ? ASN D 6   ASP D 21  1 ? 16 
HELX_P HELX_P10 10 SER D 44  ? HIS D 51  ? SER D 44  HIS D 51  1 ? 8  
HELX_P HELX_P11 11 HIS D 51  ? LEU D 63  ? HIS D 51  LEU D 63  1 ? 13 
HELX_P HELX_P12 12 SER D 84  ? ARG D 97  ? SER D 84  ARG D 97  1 ? 14 
HELX_P HELX_P13 13 ILE D 98  ? PHE D 101 ? ILE D 98  PHE D 101 5 ? 4  
HELX_P HELX_P14 14 ASN D 102 ? GLY D 118 ? ASN D 102 GLY D 118 1 ? 17 
HELX_P HELX_P15 15 ASN D 131 ? LEU D 145 ? ASN D 131 LEU D 145 1 ? 15 
HELX_P HELX_P16 16 ASP D 169 ? ILE D 177 ? ASP D 169 ILE D 177 1 ? 9  
HELX_P HELX_P17 17 PRO D 186 ? HIS D 195 ? PRO D 186 HIS D 195 1 ? 10 
HELX_P HELX_P18 18 GLU G 5   ? ASP G 21  ? GLU G 5   ASP G 21  1 ? 17 
HELX_P HELX_P19 19 SER G 44  ? HIS G 51  ? SER G 44  HIS G 51  1 ? 8  
HELX_P HELX_P20 20 HIS G 51  ? ASN G 64  ? HIS G 51  ASN G 64  1 ? 14 
HELX_P HELX_P21 21 SER G 84  ? ARG G 97  ? SER G 84  ARG G 97  1 ? 14 
HELX_P HELX_P22 22 ILE G 98  ? PHE G 101 ? ILE G 98  PHE G 101 5 ? 4  
HELX_P HELX_P23 23 ASN G 102 ? GLY G 118 ? ASN G 102 GLY G 118 1 ? 17 
HELX_P HELX_P24 24 ASN G 131 ? LEU G 145 ? ASN G 131 LEU G 145 1 ? 15 
HELX_P HELX_P25 25 ASP G 169 ? ILE G 177 ? ASP G 169 ILE G 177 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? J ZN .  ZN ? ? ? 1_555 C DC  16  OP2 ? ? A ZN 1188 C DC  16   1_555 ? ? ? ? ? ? ?            2.313 ? 
metalc2   metalc ? ? J ZN .  ZN ? ? ? 1_555 A ASP 21  OD2 ? ? A ZN 1188 A ASP 21   1_555 ? ? ? ? ? ? ?            2.629 ? 
metalc3   metalc ? ? J ZN .  ZN ? ? ? 1_555 B DA  14  OP1 ? ? A ZN 1188 B DA  14   1_555 ? ? ? ? ? ? ?            2.198 ? 
metalc4   metalc ? ? J ZN .  ZN ? ? ? 1_555 M HOH .   O   ? ? A ZN 1188 A HOH 2005 1_555 ? ? ? ? ? ? ?            2.617 ? 
metalc5   metalc ? ? J ZN .  ZN ? ? ? 1_555 A ALA 116 O   ? ? A ZN 1188 A ALA 116  1_555 ? ? ? ? ? ? ?            2.473 ? 
metalc6   metalc ? ? K ZN .  ZN ? ? ? 1_555 D ASP 21  OD2 ? ? D ZN 1197 D ASP 21   1_555 ? ? ? ? ? ? ?            2.616 ? 
metalc7   metalc ? ? K ZN .  ZN ? ? ? 1_555 F DC  16  OP2 ? ? D ZN 1197 F DC  16   1_555 ? ? ? ? ? ? ?            2.360 ? 
metalc8   metalc ? ? K ZN .  ZN ? ? ? 1_555 E DA  14  OP1 ? ? D ZN 1197 E DA  14   1_555 ? ? ? ? ? ? ?            2.425 ? 
metalc9   metalc ? ? K ZN .  ZN ? ? ? 1_555 P HOH .   O   ? ? D ZN 1197 D HOH 2003 1_555 ? ? ? ? ? ? ?            2.393 ? 
metalc10  metalc ? ? K ZN .  ZN ? ? ? 1_555 D ALA 116 O   ? ? D ZN 1197 D ALA 116  1_555 ? ? ? ? ? ? ?            2.552 ? 
metalc11  metalc ? ? L ZN .  ZN ? ? ? 1_555 G ASP 21  OD2 ? ? G ZN 1182 G ASP 21   1_555 ? ? ? ? ? ? ?            2.651 ? 
metalc12  metalc ? ? L ZN .  ZN ? ? ? 1_555 G ALA 116 O   ? ? G ZN 1182 G ALA 116  1_555 ? ? ? ? ? ? ?            2.411 ? 
metalc13  metalc ? ? L ZN .  ZN ? ? ? 1_555 I DC  16  OP2 ? ? G ZN 1182 I DC  16   1_555 ? ? ? ? ? ? ?            2.313 ? 
metalc14  metalc ? ? L ZN .  ZN ? ? ? 1_555 H DA  14  OP1 ? ? G ZN 1182 H DA  14   1_555 ? ? ? ? ? ? ?            2.449 ? 
hydrog1   hydrog ? ? B DG 1  N1 ? ? ? 1_555 C DC  25  N3  ? ? B DG 1    C DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ? ? B DG 1  N2 ? ? ? 1_555 C DC  25  O2  ? ? B DG 1    C DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ? ? B DG 1  O6 ? ? ? 1_555 C DC  25  N4  ? ? B DG 1    C DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ? ? B DC 2  N3 ? ? ? 1_555 C DG  24  N1  ? ? B DC 2    C DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ? ? B DC 2  N4 ? ? ? 1_555 C DG  24  O6  ? ? B DC 2    C DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ? ? B DC 2  O2 ? ? ? 1_555 C DG  24  N2  ? ? B DC 2    C DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ? ? B DC 3  N3 ? ? ? 1_555 C DG  23  N1  ? ? B DC 3    C DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ? ? B DC 3  N4 ? ? ? 1_555 C DG  23  O6  ? ? B DC 3    C DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ? ? B DC 3  O2 ? ? ? 1_555 C DG  23  N2  ? ? B DC 3    C DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ? ? B DT 4  N3 ? ? ? 1_555 C DA  22  N1  ? ? B DT 4    C DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ? ? B DT 4  O4 ? ? ? 1_555 C DA  22  N6  ? ? B DT 4    C DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ? ? B DT 5  N3 ? ? ? 1_555 C DA  21  N1  ? ? B DT 5    C DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ? ? B DT 5  O4 ? ? ? 1_555 C DA  21  N6  ? ? B DT 5    C DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ? ? B DG 6  N1 ? ? ? 1_555 C DC  20  N3  ? ? B DG 6    C DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ? ? B DG 6  N2 ? ? ? 1_555 C DC  20  O2  ? ? B DG 6    C DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ? ? B DG 6  O6 ? ? ? 1_555 C DC  20  N4  ? ? B DG 6    C DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ? ? B DC 7  N3 ? ? ? 1_555 C DG  19  N1  ? ? B DC 7    C DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ? ? B DC 7  N4 ? ? ? 1_555 C DG  19  O6  ? ? B DC 7    C DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ? ? B DC 7  O2 ? ? ? 1_555 C DG  19  N2  ? ? B DC 7    C DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ? ? B DC 8  N3 ? ? ? 1_555 C DG  18  N1  ? ? B DC 8    C DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ? ? B DC 8  N4 ? ? ? 1_555 C DG  18  O6  ? ? B DC 8    C DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ? ? B DC 8  O2 ? ? ? 1_555 C DG  18  N2  ? ? B DC 8    C DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ? ? B DG 9  N1 ? ? ? 1_555 C DC  17  N3  ? ? B DG 9    C DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ? ? B DG 9  N2 ? ? ? 1_555 C DC  17  O2  ? ? B DG 9    C DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ? ? B DG 9  O6 ? ? ? 1_555 C DC  17  N4  ? ? B DG 9    C DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ? ? B DG 10 N1 ? ? ? 1_555 C DC  16  N3  ? ? B DG 10   C DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ? ? B DG 10 N2 ? ? ? 1_555 C DC  16  O2  ? ? B DG 10   C DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ? ? B DG 10 O6 ? ? ? 1_555 C DC  16  N4  ? ? B DG 10   C DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ? ? B DG 11 N1 ? ? ? 1_555 C DC  15  N3  ? ? B DG 11   C DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ? ? B DG 11 N2 ? ? ? 1_555 C DC  15  O2  ? ? B DG 11   C DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ? ? B DG 11 O6 ? ? ? 1_555 C DC  15  N4  ? ? B DG 11   C DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ? ? B DT 12 N3 ? ? ? 1_555 C DA  14  N1  ? ? B DT 12   C DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ? ? B DT 12 O4 ? ? ? 1_555 C DA  14  N6  ? ? B DT 12   C DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ? ? B DA 13 N1 ? ? ? 1_555 C DT  13  N3  ? ? B DA 13   C DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ? ? B DA 13 N6 ? ? ? 1_555 C DT  13  O4  ? ? B DA 13   C DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ? ? B DA 14 N1 ? ? ? 1_555 C DT  12  N3  ? ? B DA 14   C DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ? ? B DA 14 N6 ? ? ? 1_555 C DT  12  O4  ? ? B DA 14   C DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ? ? B DG 15 N1 ? ? ? 1_555 C DC  11  N3  ? ? B DG 15   C DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ? ? B DG 15 N2 ? ? ? 1_555 C DC  11  O2  ? ? B DG 15   C DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ? ? B DG 15 O6 ? ? ? 1_555 C DC  11  N4  ? ? B DG 15   C DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ? ? B DT 16 N3 ? ? ? 1_555 C DA  10  N1  ? ? B DT 16   C DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ? ? B DT 16 O4 ? ? ? 1_555 C DA  10  N6  ? ? B DT 16   C DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ? ? B DT 17 N3 ? ? ? 1_555 C DA  9   N1  ? ? B DT 17   C DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ? ? B DT 17 O4 ? ? ? 1_555 C DA  9   N6  ? ? B DT 17   C DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ? ? B DC 18 N3 ? ? ? 1_555 C DG  8   N1  ? ? B DC 18   C DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ? ? B DC 18 N4 ? ? ? 1_555 C DG  8   O6  ? ? B DC 18   C DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ? ? B DC 18 O2 ? ? ? 1_555 C DG  8   N2  ? ? B DC 18   C DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ? ? B DC 19 N3 ? ? ? 1_555 C DG  7   N1  ? ? B DC 19   C DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ? ? B DC 19 N4 ? ? ? 1_555 C DG  7   O6  ? ? B DC 19   C DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ? ? B DC 19 O2 ? ? ? 1_555 C DG  7   N2  ? ? B DC 19   C DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ? ? B DG 20 N1 ? ? ? 1_555 C DC  6   N3  ? ? B DG 20   C DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ? ? B DG 20 N2 ? ? ? 1_555 C DC  6   O2  ? ? B DG 20   C DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ? ? B DG 20 O6 ? ? ? 1_555 C DC  6   N4  ? ? B DG 20   C DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ? ? B DG 21 N1 ? ? ? 1_555 C DC  5   N3  ? ? B DG 21   C DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ? ? B DG 21 N2 ? ? ? 1_555 C DC  5   O2  ? ? B DG 21   C DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ? ? B DG 21 O6 ? ? ? 1_555 C DC  5   N4  ? ? B DG 21   C DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ? ? B DC 22 N3 ? ? ? 1_555 C DG  4   N1  ? ? B DC 22   C DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ? ? B DC 22 N4 ? ? ? 1_555 C DG  4   O6  ? ? B DC 22   C DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ? ? B DC 22 O2 ? ? ? 1_555 C DG  4   N2  ? ? B DC 22   C DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ? ? B DG 23 N1 ? ? ? 1_555 C DC  3   N3  ? ? B DG 23   C DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ? ? B DG 23 N2 ? ? ? 1_555 C DC  3   O2  ? ? B DG 23   C DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ? ? B DG 23 O6 ? ? ? 1_555 C DC  3   N4  ? ? B DG 23   C DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ? ? B DC 24 N3 ? ? ? 1_555 C DG  2   N1  ? ? B DC 24   C DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ? ? B DC 24 N4 ? ? ? 1_555 C DG  2   O6  ? ? B DC 24   C DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ? ? B DC 24 O2 ? ? ? 1_555 C DG  2   N2  ? ? B DC 24   C DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ? ? B DG 25 N1 ? ? ? 1_555 C DC  1   N3  ? ? B DG 25   C DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ? ? B DG 25 N2 ? ? ? 1_555 C DC  1   O2  ? ? B DG 25   C DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ? ? B DG 25 O6 ? ? ? 1_555 C DC  1   N4  ? ? B DG 25   C DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ? ? E DG 1  N2 ? ? ? 1_555 F DC  25  O2  ? ? E DG 1    F DC  25   1_555 ? ? ? ? ? ? 'DG-DC PAIR' ?     ? 
hydrog70  hydrog ? ? E DC 2  N3 ? ? ? 1_555 F DG  24  N1  ? ? E DC 2    F DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ? ? E DC 2  N4 ? ? ? 1_555 F DG  24  O6  ? ? E DC 2    F DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ? ? E DC 2  O2 ? ? ? 1_555 F DG  24  N2  ? ? E DC 2    F DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ? ? E DC 3  N3 ? ? ? 1_555 F DG  23  N1  ? ? E DC 3    F DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ? ? E DC 3  N4 ? ? ? 1_555 F DG  23  O6  ? ? E DC 3    F DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ? ? E DC 3  O2 ? ? ? 1_555 F DG  23  N2  ? ? E DC 3    F DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ? ? E DT 4  N3 ? ? ? 1_555 F DA  22  N1  ? ? E DT 4    F DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ? ? E DT 4  O4 ? ? ? 1_555 F DA  22  N6  ? ? E DT 4    F DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ? ? E DT 5  N3 ? ? ? 1_555 F DA  21  N1  ? ? E DT 5    F DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ? ? E DT 5  O4 ? ? ? 1_555 F DA  21  N6  ? ? E DT 5    F DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ? ? E DG 6  N1 ? ? ? 1_555 F DC  20  N3  ? ? E DG 6    F DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ? ? E DG 6  N2 ? ? ? 1_555 F DC  20  O2  ? ? E DG 6    F DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ? ? E DG 6  O6 ? ? ? 1_555 F DC  20  N4  ? ? E DG 6    F DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ? ? E DC 7  N3 ? ? ? 1_555 F DG  19  N1  ? ? E DC 7    F DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ? ? E DC 7  N4 ? ? ? 1_555 F DG  19  O6  ? ? E DC 7    F DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ? ? E DC 7  O2 ? ? ? 1_555 F DG  19  N2  ? ? E DC 7    F DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ? ? E DC 8  N3 ? ? ? 1_555 F DG  18  N1  ? ? E DC 8    F DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ? ? E DC 8  N4 ? ? ? 1_555 F DG  18  O6  ? ? E DC 8    F DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ? ? E DC 8  O2 ? ? ? 1_555 F DG  18  N2  ? ? E DC 8    F DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ? ? E DG 9  N1 ? ? ? 1_555 F DC  17  N3  ? ? E DG 9    F DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ? ? E DG 9  N2 ? ? ? 1_555 F DC  17  O2  ? ? E DG 9    F DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ? ? E DG 9  O6 ? ? ? 1_555 F DC  17  N4  ? ? E DG 9    F DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ? ? E DG 10 N1 ? ? ? 1_555 F DC  16  N3  ? ? E DG 10   F DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ? ? E DG 10 N2 ? ? ? 1_555 F DC  16  O2  ? ? E DG 10   F DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ? ? E DG 10 O6 ? ? ? 1_555 F DC  16  N4  ? ? E DG 10   F DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ? ? E DG 11 N1 ? ? ? 1_555 F DC  15  N3  ? ? E DG 11   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ? ? E DG 11 N2 ? ? ? 1_555 F DC  15  O2  ? ? E DG 11   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ? ? E DG 11 O6 ? ? ? 1_555 F DC  15  N4  ? ? E DG 11   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ? ? E DT 12 N3 ? ? ? 1_555 F DA  14  N1  ? ? E DT 12   F DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ? ? E DT 12 O4 ? ? ? 1_555 F DA  14  N6  ? ? E DT 12   F DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ? ? E DA 13 N1 ? ? ? 1_555 F DT  13  N3  ? ? E DA 13   F DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ? ? E DA 13 N6 ? ? ? 1_555 F DT  13  O4  ? ? E DA 13   F DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ? ? E DA 14 N1 ? ? ? 1_555 F DT  12  N3  ? ? E DA 14   F DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ? ? E DA 14 N6 ? ? ? 1_555 F DT  12  O4  ? ? E DA 14   F DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ? ? E DG 15 N1 ? ? ? 1_555 F DC  11  N3  ? ? E DG 15   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ? ? E DG 15 N2 ? ? ? 1_555 F DC  11  O2  ? ? E DG 15   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ? ? E DG 15 O6 ? ? ? 1_555 F DC  11  N4  ? ? E DG 15   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ? ? E DT 16 N3 ? ? ? 1_555 F DA  10  N1  ? ? E DT 16   F DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ? ? E DT 16 O4 ? ? ? 1_555 F DA  10  N6  ? ? E DT 16   F DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog109 hydrog ? ? E DT 17 N3 ? ? ? 1_555 F DA  9   N1  ? ? E DT 17   F DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog110 hydrog ? ? E DT 17 O4 ? ? ? 1_555 F DA  9   N6  ? ? E DT 17   F DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog111 hydrog ? ? E DC 18 N3 ? ? ? 1_555 F DG  8   N1  ? ? E DC 18   F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog112 hydrog ? ? E DC 18 N4 ? ? ? 1_555 F DG  8   O6  ? ? E DC 18   F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog113 hydrog ? ? E DC 18 O2 ? ? ? 1_555 F DG  8   N2  ? ? E DC 18   F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog114 hydrog ? ? E DC 19 N3 ? ? ? 1_555 F DG  7   N1  ? ? E DC 19   F DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog115 hydrog ? ? E DC 19 N4 ? ? ? 1_555 F DG  7   O6  ? ? E DC 19   F DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog116 hydrog ? ? E DC 19 O2 ? ? ? 1_555 F DG  7   N2  ? ? E DC 19   F DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog117 hydrog ? ? E DG 20 N1 ? ? ? 1_555 F DC  6   N3  ? ? E DG 20   F DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog118 hydrog ? ? E DG 20 N2 ? ? ? 1_555 F DC  6   O2  ? ? E DG 20   F DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog119 hydrog ? ? E DG 20 O6 ? ? ? 1_555 F DC  6   N4  ? ? E DG 20   F DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog120 hydrog ? ? E DG 21 N1 ? ? ? 1_555 F DC  5   N3  ? ? E DG 21   F DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog121 hydrog ? ? E DG 21 N2 ? ? ? 1_555 F DC  5   O2  ? ? E DG 21   F DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog122 hydrog ? ? E DG 21 O6 ? ? ? 1_555 F DC  5   N4  ? ? E DG 21   F DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog123 hydrog ? ? E DC 22 N3 ? ? ? 1_555 F DG  4   N1  ? ? E DC 22   F DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog124 hydrog ? ? E DC 22 N4 ? ? ? 1_555 F DG  4   O6  ? ? E DC 22   F DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog125 hydrog ? ? E DC 22 O2 ? ? ? 1_555 F DG  4   N2  ? ? E DC 22   F DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog126 hydrog ? ? E DG 23 N1 ? ? ? 1_555 F DC  3   N3  ? ? E DG 23   F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog127 hydrog ? ? E DG 23 N2 ? ? ? 1_555 F DC  3   O2  ? ? E DG 23   F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog128 hydrog ? ? E DG 23 O6 ? ? ? 1_555 F DC  3   N4  ? ? E DG 23   F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog129 hydrog ? ? E DC 24 N3 ? ? ? 1_555 F DG  2   N1  ? ? E DC 24   F DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog130 hydrog ? ? E DC 24 N4 ? ? ? 1_555 F DG  2   O6  ? ? E DC 24   F DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog131 hydrog ? ? E DC 24 O2 ? ? ? 1_555 F DG  2   N2  ? ? E DC 24   F DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog132 hydrog ? ? E DG 25 N1 ? ? ? 1_555 F DC  1   N3  ? ? E DG 25   F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog133 hydrog ? ? E DG 25 N2 ? ? ? 1_555 F DC  1   O2  ? ? E DG 25   F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog134 hydrog ? ? E DG 25 O6 ? ? ? 1_555 F DC  1   N4  ? ? E DG 25   F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog135 hydrog ? ? H DG 1  N1 ? ? ? 1_555 I DC  25  N3  ? ? H DG 1    I DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog136 hydrog ? ? H DG 1  N2 ? ? ? 1_555 I DC  25  O2  ? ? H DG 1    I DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog137 hydrog ? ? H DG 1  O6 ? ? ? 1_555 I DC  25  N4  ? ? H DG 1    I DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog138 hydrog ? ? H DC 2  N3 ? ? ? 1_555 I DG  24  N1  ? ? H DC 2    I DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog139 hydrog ? ? H DC 2  N4 ? ? ? 1_555 I DG  24  O6  ? ? H DC 2    I DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog140 hydrog ? ? H DC 2  O2 ? ? ? 1_555 I DG  24  N2  ? ? H DC 2    I DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog141 hydrog ? ? H DC 3  N3 ? ? ? 1_555 I DG  23  N1  ? ? H DC 3    I DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog142 hydrog ? ? H DC 3  N4 ? ? ? 1_555 I DG  23  O6  ? ? H DC 3    I DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog143 hydrog ? ? H DC 3  O2 ? ? ? 1_555 I DG  23  N2  ? ? H DC 3    I DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog144 hydrog ? ? H DT 4  N3 ? ? ? 1_555 I DA  22  N1  ? ? H DT 4    I DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog145 hydrog ? ? H DT 4  O4 ? ? ? 1_555 I DA  22  N6  ? ? H DT 4    I DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog146 hydrog ? ? H DT 5  N3 ? ? ? 1_555 I DA  21  N1  ? ? H DT 5    I DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog147 hydrog ? ? H DT 5  O4 ? ? ? 1_555 I DA  21  N6  ? ? H DT 5    I DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog148 hydrog ? ? H DG 6  N1 ? ? ? 1_555 I DC  20  N3  ? ? H DG 6    I DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog149 hydrog ? ? H DG 6  N2 ? ? ? 1_555 I DC  20  O2  ? ? H DG 6    I DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog150 hydrog ? ? H DG 6  O6 ? ? ? 1_555 I DC  20  N4  ? ? H DG 6    I DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog151 hydrog ? ? H DC 7  N3 ? ? ? 1_555 I DG  19  N1  ? ? H DC 7    I DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog152 hydrog ? ? H DC 7  N4 ? ? ? 1_555 I DG  19  O6  ? ? H DC 7    I DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog153 hydrog ? ? H DC 7  O2 ? ? ? 1_555 I DG  19  N2  ? ? H DC 7    I DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog154 hydrog ? ? H DC 8  N3 ? ? ? 1_555 I DG  18  N1  ? ? H DC 8    I DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog155 hydrog ? ? H DC 8  N4 ? ? ? 1_555 I DG  18  O6  ? ? H DC 8    I DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog156 hydrog ? ? H DC 8  O2 ? ? ? 1_555 I DG  18  N2  ? ? H DC 8    I DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog157 hydrog ? ? H DG 9  N1 ? ? ? 1_555 I DC  17  N3  ? ? H DG 9    I DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog158 hydrog ? ? H DG 9  N2 ? ? ? 1_555 I DC  17  O2  ? ? H DG 9    I DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog159 hydrog ? ? H DG 9  O6 ? ? ? 1_555 I DC  17  N4  ? ? H DG 9    I DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog160 hydrog ? ? H DG 10 N1 ? ? ? 1_555 I DC  16  N3  ? ? H DG 10   I DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog161 hydrog ? ? H DG 10 N2 ? ? ? 1_555 I DC  16  O2  ? ? H DG 10   I DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog162 hydrog ? ? H DG 10 O6 ? ? ? 1_555 I DC  16  N4  ? ? H DG 10   I DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog163 hydrog ? ? H DG 11 N1 ? ? ? 1_555 I DC  15  N3  ? ? H DG 11   I DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog164 hydrog ? ? H DG 11 N2 ? ? ? 1_555 I DC  15  O2  ? ? H DG 11   I DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog165 hydrog ? ? H DG 11 O6 ? ? ? 1_555 I DC  15  N4  ? ? H DG 11   I DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog166 hydrog ? ? H DT 12 N3 ? ? ? 1_555 I DA  14  N1  ? ? H DT 12   I DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog167 hydrog ? ? H DT 12 O4 ? ? ? 1_555 I DA  14  N6  ? ? H DT 12   I DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog168 hydrog ? ? H DA 13 N1 ? ? ? 1_555 I DT  13  N3  ? ? H DA 13   I DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog169 hydrog ? ? H DA 13 N6 ? ? ? 1_555 I DT  13  O4  ? ? H DA 13   I DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog170 hydrog ? ? H DA 14 N1 ? ? ? 1_555 I DT  12  N3  ? ? H DA 14   I DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog171 hydrog ? ? H DA 14 N6 ? ? ? 1_555 I DT  12  O4  ? ? H DA 14   I DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog172 hydrog ? ? H DG 15 N1 ? ? ? 1_555 I DC  11  N3  ? ? H DG 15   I DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog173 hydrog ? ? H DG 15 N2 ? ? ? 1_555 I DC  11  O2  ? ? H DG 15   I DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog174 hydrog ? ? H DG 15 O6 ? ? ? 1_555 I DC  11  N4  ? ? H DG 15   I DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog175 hydrog ? ? H DT 16 N3 ? ? ? 1_555 I DA  10  N1  ? ? H DT 16   I DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog176 hydrog ? ? H DT 16 O4 ? ? ? 1_555 I DA  10  N6  ? ? H DT 16   I DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog177 hydrog ? ? H DT 17 N3 ? ? ? 1_555 I DA  9   N1  ? ? H DT 17   I DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog178 hydrog ? ? H DT 17 O4 ? ? ? 1_555 I DA  9   N6  ? ? H DT 17   I DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog179 hydrog ? ? H DC 18 N3 ? ? ? 1_555 I DG  8   N1  ? ? H DC 18   I DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog180 hydrog ? ? H DC 18 N4 ? ? ? 1_555 I DG  8   O6  ? ? H DC 18   I DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog181 hydrog ? ? H DC 18 O2 ? ? ? 1_555 I DG  8   N2  ? ? H DC 18   I DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog182 hydrog ? ? H DC 19 N3 ? ? ? 1_555 I DG  7   N1  ? ? H DC 19   I DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog183 hydrog ? ? H DC 19 N4 ? ? ? 1_555 I DG  7   O6  ? ? H DC 19   I DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog184 hydrog ? ? H DC 19 O2 ? ? ? 1_555 I DG  7   N2  ? ? H DC 19   I DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog185 hydrog ? ? H DG 20 N1 ? ? ? 1_555 I DC  6   N3  ? ? H DG 20   I DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog186 hydrog ? ? H DG 20 N2 ? ? ? 1_555 I DC  6   O2  ? ? H DG 20   I DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog187 hydrog ? ? H DG 20 O6 ? ? ? 1_555 I DC  6   N4  ? ? H DG 20   I DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog188 hydrog ? ? H DG 21 N1 ? ? ? 1_555 I DC  5   N3  ? ? H DG 21   I DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog189 hydrog ? ? H DG 21 N2 ? ? ? 1_555 I DC  5   O2  ? ? H DG 21   I DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog190 hydrog ? ? H DG 21 O6 ? ? ? 1_555 I DC  5   N4  ? ? H DG 21   I DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog191 hydrog ? ? H DC 22 N3 ? ? ? 1_555 I DG  4   N1  ? ? H DC 22   I DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog192 hydrog ? ? H DC 22 N4 ? ? ? 1_555 I DG  4   O6  ? ? H DC 22   I DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog193 hydrog ? ? H DC 22 O2 ? ? ? 1_555 I DG  4   N2  ? ? H DC 22   I DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog194 hydrog ? ? H DG 23 N1 ? ? ? 1_555 I DC  3   N3  ? ? H DG 23   I DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog195 hydrog ? ? H DG 23 N2 ? ? ? 1_555 I DC  3   O2  ? ? H DG 23   I DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog196 hydrog ? ? H DG 23 O6 ? ? ? 1_555 I DC  3   N4  ? ? H DG 23   I DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog197 hydrog ? ? H DC 24 N3 ? ? ? 1_555 I DG  2   N1  ? ? H DC 24   I DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog198 hydrog ? ? H DC 24 N4 ? ? ? 1_555 I DG  2   O6  ? ? H DC 24   I DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog199 hydrog ? ? H DC 24 O2 ? ? ? 1_555 I DG  2   N2  ? ? H DC 24   I DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog200 hydrog ? ? H DG 25 N1 ? ? ? 1_555 I DC  1   N3  ? ? H DG 25   I DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog201 hydrog ? ? H DG 25 N2 ? ? ? 1_555 I DC  1   O2  ? ? H DG 25   I DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog202 hydrog ? ? H DG 25 O6 ? ? ? 1_555 I DC  1   N4  ? ? H DG 25   I DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 31 A . ? GLY 31 A ASN 32 A ? ASN 32 A 1 -24.06 
2 LYS 30 D . ? LYS 30 D GLY 31 D ? GLY 31 D 1 -5.94  
3 GLY 31 D . ? GLY 31 D ASN 32 D ? ASN 32 D 1 -15.62 
4 LYS 30 G . ? LYS 30 G GLY 31 G ? GLY 31 G 1 -15.38 
5 GLY 31 G . ? GLY 31 G ASN 32 G ? ASN 32 G 1 -23.96 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 3 ? 
DA ? 4 ? 
DB ? 3 ? 
GA ? 4 ? 
GB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
GA 1 2 ? anti-parallel 
GA 2 3 ? anti-parallel 
GA 3 4 ? anti-parallel 
GB 1 2 ? anti-parallel 
GB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLY A 22  ? LYS A 28  ? GLY A 22  LYS A 28  
AA 2 SER A 34  ? GLN A 42  ? SER A 34  GLN A 42  
AA 3 TYR A 78  ? SER A 83  ? TYR A 78  SER A 83  
AA 4 ILE A 69  ? LYS A 73  ? ILE A 69  LYS A 73  
AB 1 LEU A 125 ? ASN A 129 ? LEU A 125 ASN A 129 
AB 2 VAL A 160 ? ILE A 165 ? VAL A 160 ILE A 165 
AB 3 ASN A 149 ? ASP A 155 ? ASN A 149 ASP A 155 
DA 1 GLY D 22  ? LYS D 28  ? GLY D 22  LYS D 28  
DA 2 SER D 34  ? GLN D 42  ? SER D 34  GLN D 42  
DA 3 TYR D 78  ? SER D 83  ? TYR D 78  SER D 83  
DA 4 ILE D 69  ? LYS D 73  ? ILE D 69  LYS D 73  
DB 1 LEU D 125 ? ASN D 129 ? LEU D 125 ASN D 129 
DB 2 VAL D 160 ? ILE D 165 ? VAL D 160 ILE D 165 
DB 3 ASN D 149 ? ASP D 155 ? ASN D 149 ASP D 155 
GA 1 GLY G 22  ? LYS G 28  ? GLY G 22  LYS G 28  
GA 2 SER G 34  ? GLN G 42  ? SER G 34  GLN G 42  
GA 3 TYR G 78  ? SER G 83  ? TYR G 78  SER G 83  
GA 4 ILE G 69  ? LYS G 73  ? ILE G 69  LYS G 73  
GB 1 LEU G 125 ? ASN G 129 ? LEU G 125 ASN G 129 
GB 2 VAL G 160 ? ILE G 165 ? VAL G 160 ILE G 165 
GB 3 ASN G 149 ? ASP G 155 ? ASN G 149 ASP G 155 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 27  ? N LEU A 27  O GLU A 35  ? O GLU A 35  
AA 2 3 N GLN A 42  ? N GLN A 42  O TYR A 78  ? O TYR A 78  
AA 3 4 N ARG A 81  ? N ARG A 81  O GLN A 70  ? O GLN A 70  
AB 1 2 N ASN A 129 ? N ASN A 129 O TYR A 161 ? O TYR A 161 
AB 2 3 N ASN A 164 ? N ASN A 164 O THR A 150 ? O THR A 150 
DA 1 2 N LEU D 27  ? N LEU D 27  O GLU D 35  ? O GLU D 35  
DA 2 3 N GLN D 42  ? N GLN D 42  O TYR D 78  ? O TYR D 78  
DA 3 4 N ARG D 81  ? N ARG D 81  O GLN D 70  ? O GLN D 70  
DB 1 2 N ASN D 129 ? N ASN D 129 O TYR D 161 ? O TYR D 161 
DB 2 3 N ASN D 164 ? N ASN D 164 O THR D 150 ? O THR D 150 
GA 1 2 N LEU G 27  ? N LEU G 27  O GLU G 35  ? O GLU G 35  
GA 2 3 N GLN G 42  ? N GLN G 42  O TYR G 78  ? O TYR G 78  
GA 3 4 N ARG G 81  ? N ARG G 81  O GLN G 70  ? O GLN G 70  
GB 1 2 N ASN G 129 ? N ASN G 129 O TYR G 161 ? O TYR G 161 
GB 2 3 N ASN G 164 ? N ASN G 164 O THR G 150 ? O THR G 150 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 1188' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ZN D 1197' 
AC3 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE ZN G 1182' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 ASP A 21  ? ASP A 21   . ? 1_555 ? 
2  AC1 5 ALA A 116 ? ALA A 116  . ? 1_555 ? 
3  AC1 5 HOH M .   ? HOH A 2005 . ? 1_555 ? 
4  AC1 5 DA  B 14  ? DA  B 14   . ? 1_555 ? 
5  AC1 5 DC  C 16  ? DC  C 16   . ? 1_555 ? 
6  AC2 6 ASP D 21  ? ASP D 21   . ? 1_555 ? 
7  AC2 6 ALA D 116 ? ALA D 116  . ? 1_555 ? 
8  AC2 6 HOH P .   ? HOH D 2003 . ? 1_555 ? 
9  AC2 6 HOH P .   ? HOH D 2018 . ? 1_555 ? 
10 AC2 6 DA  E 14  ? DA  E 14   . ? 1_555 ? 
11 AC2 6 DC  F 16  ? DC  F 16   . ? 1_555 ? 
12 AC3 6 ASP G 21  ? ASP G 21   . ? 1_555 ? 
13 AC3 6 GLN G 42  ? GLN G 42   . ? 1_555 ? 
14 AC3 6 ALA G 116 ? ALA G 116  . ? 1_555 ? 
15 AC3 6 HOH S .   ? HOH G 2005 . ? 1_555 ? 
16 AC3 6 DA  H 14  ? DA  H 14   . ? 1_555 ? 
17 AC3 6 DC  I 16  ? DC  I 16   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4UN7 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4UN7 
_atom_sites.fract_transf_matrix[1][1]   0.009384 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005394 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014215 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010820 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASN A 1 4   ? -3.669  13.968  3.321   1.00 114.81 ? 4    ASN A N     1 
ATOM   2    C  CA    . ASN A 1 4   ? -4.049  14.976  4.274   1.00 122.71 ? 4    ASN A CA    1 
ATOM   3    C  C     . ASN A 1 4   ? -3.502  14.569  5.658   1.00 118.75 ? 4    ASN A C     1 
ATOM   4    O  O     . ASN A 1 4   ? -4.008  13.636  6.261   1.00 111.15 ? 4    ASN A O     1 
ATOM   5    C  CB    . ASN A 1 4   ? -5.589  15.168  4.279   1.00 128.20 ? 4    ASN A CB    1 
ATOM   6    C  CG    . ASN A 1 4   ? -5.973  16.591  4.680   1.00 130.14 ? 4    ASN A CG    1 
ATOM   7    O  OD1   . ASN A 1 4   ? -5.209  17.529  4.378   1.00 130.33 ? 4    ASN A OD1   1 
ATOM   8    N  ND2   . ASN A 1 4   ? -7.091  16.767  5.384   1.00 132.57 ? 4    ASN A ND2   1 
ATOM   9    N  N     . GLU A 1 5   ? -2.477  15.285  6.138   1.00 128.97 ? 5    GLU A N     1 
ATOM   10   C  CA    . GLU A 1 5   ? -1.623  14.841  7.258   1.00 120.60 ? 5    GLU A CA    1 
ATOM   11   C  C     . GLU A 1 5   ? -2.302  14.951  8.631   1.00 115.78 ? 5    GLU A C     1 
ATOM   12   O  O     . GLU A 1 5   ? -2.121  14.062  9.485   1.00 110.05 ? 5    GLU A O     1 
ATOM   13   C  CB    . GLU A 1 5   ? -0.307  15.622  7.262   1.00 122.45 ? 5    GLU A CB    1 
ATOM   14   C  CG    . GLU A 1 5   ? -0.449  17.156  6.995   1.00 137.64 ? 5    GLU A CG    1 
ATOM   15   C  CD    . GLU A 1 5   ? -0.489  17.545  5.505   1.00 139.18 ? 5    GLU A CD    1 
ATOM   16   O  OE1   . GLU A 1 5   ? -0.148  16.698  4.643   1.00 138.72 ? 5    GLU A OE1   1 
ATOM   17   O  OE2   . GLU A 1 5   ? -0.833  18.712  5.201   1.00 133.34 ? 5    GLU A OE2   1 
ATOM   18   N  N     . ASN A 1 6   ? -2.944  16.111  8.822   1.00 134.80 ? 6    ASN A N     1 
ATOM   19   C  CA    . ASN A 1 6   ? -4.192  16.304  9.563   1.00 134.32 ? 6    ASN A CA    1 
ATOM   20   C  C     . ASN A 1 6   ? -4.782  15.054  10.265  1.00 124.90 ? 6    ASN A C     1 
ATOM   21   O  O     . ASN A 1 6   ? -4.658  14.813  11.493  1.00 118.37 ? 6    ASN A O     1 
ATOM   22   C  CB    . ASN A 1 6   ? -5.296  16.821  8.579   1.00 142.59 ? 6    ASN A CB    1 
ATOM   23   C  CG    . ASN A 1 6   ? -4.791  17.775  7.492   1.00 148.38 ? 6    ASN A CG    1 
ATOM   24   O  OD1   . ASN A 1 6   ? -4.118  17.349  6.578   1.00 143.92 ? 6    ASN A OD1   1 
ATOM   25   N  ND2   . ASN A 1 6   ? -5.332  18.999  7.470   1.00 140.56 ? 6    ASN A ND2   1 
ATOM   26   N  N     . VAL A 1 7   ? -5.402  14.268  9.389   1.00 87.39  ? 7    VAL A N     1 
ATOM   27   C  CA    . VAL A 1 7   ? -6.365  13.239  9.668   1.00 77.80  ? 7    VAL A CA    1 
ATOM   28   C  C     . VAL A 1 7   ? -5.699  11.897  9.811   1.00 69.23  ? 7    VAL A C     1 
ATOM   29   O  O     . VAL A 1 7   ? -6.039  11.143  10.719  1.00 71.57  ? 7    VAL A O     1 
ATOM   30   C  CB    . VAL A 1 7   ? -7.398  13.237  8.554   1.00 78.66  ? 7    VAL A CB    1 
ATOM   31   C  CG1   . VAL A 1 7   ? -8.055  11.900  8.396   1.00 79.11  ? 7    VAL A CG1   1 
ATOM   32   C  CG2   . VAL A 1 7   ? -8.403  14.330  8.804   1.00 75.60  ? 7    VAL A CG2   1 
ATOM   33   N  N     . SER A 1 8   ? -4.725  11.625  8.947   1.00 69.12  ? 8    SER A N     1 
ATOM   34   C  CA    . SER A 1 8   ? -3.876  10.438  9.076   1.00 73.87  ? 8    SER A CA    1 
ATOM   35   C  C     . SER A 1 8   ? -3.352  10.293  10.518  1.00 69.08  ? 8    SER A C     1 
ATOM   36   O  O     . SER A 1 8   ? -3.426  9.220   11.117  1.00 63.74  ? 8    SER A O     1 
ATOM   37   C  CB    . SER A 1 8   ? -2.698  10.497  8.091   1.00 65.34  ? 8    SER A CB    1 
ATOM   38   O  OG    . SER A 1 8   ? -1.872  11.598  8.385   1.00 70.17  ? 8    SER A OG    1 
ATOM   39   N  N     . GLY A 1 9   ? -2.875  11.398  11.082  1.00 61.43  ? 9    GLY A N     1 
ATOM   40   C  CA    . GLY A 1 9   ? -2.350  11.415  12.430  1.00 57.64  ? 9    GLY A CA    1 
ATOM   41   C  C     . GLY A 1 9   ? -3.378  11.101  13.492  1.00 56.89  ? 9    GLY A C     1 
ATOM   42   O  O     . GLY A 1 9   ? -3.149  10.274  14.376  1.00 58.10  ? 9    GLY A O     1 
ATOM   43   N  N     . ILE A 1 10  ? -4.510  11.779  13.425  1.00 60.06  ? 10   ILE A N     1 
ATOM   44   C  CA    . ILE A 1 10  ? -5.619  11.505  14.332  1.00 55.74  ? 10   ILE A CA    1 
ATOM   45   C  C     . ILE A 1 10  ? -6.185  10.107  14.045  1.00 54.79  ? 10   ILE A C     1 
ATOM   46   O  O     . ILE A 1 10  ? -6.653  9.421   14.949  1.00 52.00  ? 10   ILE A O     1 
ATOM   47   C  CB    . ILE A 1 10  ? -6.714  12.592  14.205  1.00 59.15  ? 10   ILE A CB    1 
ATOM   48   C  CG1   . ILE A 1 10  ? -6.334  13.819  15.032  1.00 53.08  ? 10   ILE A CG1   1 
ATOM   49   C  CG2   . ILE A 1 10  ? -8.076  12.080  14.655  1.00 58.11  ? 10   ILE A CG2   1 
ATOM   50   C  CD1   . ILE A 1 10  ? -7.332  14.951  14.946  1.00 50.54  ? 10   ILE A CD1   1 
ATOM   51   N  N     . SER A 1 11  ? -6.122  9.665   12.795  1.00 60.80  ? 11   SER A N     1 
ATOM   52   C  CA    . SER A 1 11  ? -6.617  8.330   12.464  1.00 62.89  ? 11   SER A CA    1 
ATOM   53   C  C     . SER A 1 11  ? -5.750  7.292   13.140  1.00 62.10  ? 11   SER A C     1 
ATOM   54   O  O     . SER A 1 11  ? -6.248  6.316   13.699  1.00 60.70  ? 11   SER A O     1 
ATOM   55   C  CB    . SER A 1 11  ? -6.621  8.080   10.954  1.00 65.48  ? 11   SER A CB    1 
ATOM   56   O  OG    . SER A 1 11  ? -7.498  8.962   10.287  1.00 66.19  ? 11   SER A OG    1 
ATOM   57   N  N     . ALA A 1 12  ? -4.443  7.517   13.063  1.00 58.75  ? 12   ALA A N     1 
ATOM   58   C  CA    . ALA A 1 12  ? -3.458  6.614   13.624  1.00 52.87  ? 12   ALA A CA    1 
ATOM   59   C  C     . ALA A 1 12  ? -3.664  6.531   15.118  1.00 50.13  ? 12   ALA A C     1 
ATOM   60   O  O     . ALA A 1 12  ? -3.708  5.448   15.696  1.00 46.84  ? 12   ALA A O     1 
ATOM   61   C  CB    . ALA A 1 12  ? -2.056  7.089   13.297  1.00 55.99  ? 12   ALA A CB    1 
ATOM   62   N  N     . TYR A 1 13  ? -3.805  7.694   15.735  1.00 45.92  ? 13   TYR A N     1 
ATOM   63   C  CA    . TYR A 1 13  ? -4.061  7.761   17.158  1.00 46.90  ? 13   TYR A CA    1 
ATOM   64   C  C     . TYR A 1 13  ? -5.336  7.004   17.561  1.00 50.51  ? 13   TYR A C     1 
ATOM   65   O  O     . TYR A 1 13  ? -5.347  6.267   18.547  1.00 50.89  ? 13   TYR A O     1 
ATOM   66   C  CB    . TYR A 1 13  ? -4.149  9.212   17.599  1.00 44.22  ? 13   TYR A CB    1 
ATOM   67   C  CG    . TYR A 1 13  ? -4.506  9.364   19.049  1.00 47.52  ? 13   TYR A CG    1 
ATOM   68   C  CD1   . TYR A 1 13  ? -3.547  9.194   20.038  1.00 44.41  ? 13   TYR A CD1   1 
ATOM   69   C  CD2   . TYR A 1 13  ? -5.801  9.686   19.435  1.00 48.24  ? 13   TYR A CD2   1 
ATOM   70   C  CE1   . TYR A 1 13  ? -3.870  9.335   21.366  1.00 47.32  ? 13   TYR A CE1   1 
ATOM   71   C  CE2   . TYR A 1 13  ? -6.135  9.827   20.766  1.00 46.91  ? 13   TYR A CE2   1 
ATOM   72   C  CZ    . TYR A 1 13  ? -5.161  9.654   21.725  1.00 51.31  ? 13   TYR A CZ    1 
ATOM   73   O  OH    . TYR A 1 13  ? -5.488  9.792   23.052  1.00 57.43  ? 13   TYR A OH    1 
ATOM   74   N  N     . LEU A 1 14  ? -6.409  7.176   16.801  1.00 51.27  ? 14   LEU A N     1 
ATOM   75   C  CA    . LEU A 1 14  ? -7.648  6.484   17.108  1.00 47.67  ? 14   LEU A CA    1 
ATOM   76   C  C     . LEU A 1 14  ? -7.508  4.983   16.839  1.00 48.58  ? 14   LEU A C     1 
ATOM   77   O  O     . LEU A 1 14  ? -8.077  4.156   17.556  1.00 48.98  ? 14   LEU A O     1 
ATOM   78   C  CB    . LEU A 1 14  ? -8.797  7.071   16.298  1.00 47.87  ? 14   LEU A CB    1 
ATOM   79   C  CG    . LEU A 1 14  ? -9.232  8.496   16.640  1.00 50.64  ? 14   LEU A CG    1 
ATOM   80   C  CD1   . LEU A 1 14  ? -10.093 9.092   15.497  1.00 44.14  ? 14   LEU A CD1   1 
ATOM   81   C  CD2   . LEU A 1 14  ? -9.971  8.527   17.990  1.00 48.27  ? 14   LEU A CD2   1 
ATOM   82   N  N     . LEU A 1 15  ? -6.745  4.622   15.816  1.00 43.12  ? 15   LEU A N     1 
ATOM   83   C  CA    . LEU A 1 15  ? -6.554  3.212   15.518  1.00 47.95  ? 15   LEU A CA    1 
ATOM   84   C  C     . LEU A 1 15  ? -5.814  2.520   16.655  1.00 52.14  ? 15   LEU A C     1 
ATOM   85   O  O     . LEU A 1 15  ? -6.057  1.352   16.940  1.00 51.04  ? 15   LEU A O     1 
ATOM   86   C  CB    . LEU A 1 15  ? -5.803  3.038   14.208  1.00 47.92  ? 15   LEU A CB    1 
ATOM   87   C  CG    . LEU A 1 15  ? -5.564  1.615   13.731  1.00 49.74  ? 15   LEU A CG    1 
ATOM   88   C  CD1   . LEU A 1 15  ? -6.891  0.886   13.445  1.00 44.11  ? 15   LEU A CD1   1 
ATOM   89   C  CD2   . LEU A 1 15  ? -4.700  1.668   12.480  1.00 54.60  ? 15   LEU A CD2   1 
ATOM   90   N  N     . GLY A 1 16  ? -4.923  3.254   17.313  1.00 48.61  ? 16   GLY A N     1 
ATOM   91   C  CA    . GLY A 1 16  ? -4.271  2.759   18.504  1.00 46.98  ? 16   GLY A CA    1 
ATOM   92   C  C     . GLY A 1 16  ? -5.238  2.540   19.655  1.00 49.03  ? 16   GLY A C     1 
ATOM   93   O  O     . GLY A 1 16  ? -5.110  1.586   20.417  1.00 50.39  ? 16   GLY A O     1 
ATOM   94   N  N     . LEU A 1 17  ? -6.207  3.433   19.795  1.00 51.75  ? 17   LEU A N     1 
ATOM   95   C  CA    . LEU A 1 17  ? -7.228  3.272   20.823  1.00 47.36  ? 17   LEU A CA    1 
ATOM   96   C  C     . LEU A 1 17  ? -8.168  2.107   20.514  1.00 46.63  ? 17   LEU A C     1 
ATOM   97   O  O     . LEU A 1 17  ? -8.517  1.337   21.406  1.00 43.87  ? 17   LEU A O     1 
ATOM   98   C  CB    . LEU A 1 17  ? -8.023  4.563   20.983  1.00 48.27  ? 17   LEU A CB    1 
ATOM   99   C  CG    . LEU A 1 17  ? -7.285  5.721   21.642  1.00 48.31  ? 17   LEU A CG    1 
ATOM   100  C  CD1   . LEU A 1 17  ? -8.169  6.964   21.664  1.00 48.81  ? 17   LEU A CD1   1 
ATOM   101  C  CD2   . LEU A 1 17  ? -6.862  5.321   23.039  1.00 46.01  ? 17   LEU A CD2   1 
ATOM   102  N  N     . ILE A 1 18  ? -8.580  1.998   19.252  1.00 44.15  ? 18   ILE A N     1 
ATOM   103  C  CA    . ILE A 1 18  ? -9.408  0.883   18.796  1.00 43.83  ? 18   ILE A CA    1 
ATOM   104  C  C     . ILE A 1 18  ? -8.718  -0.450  19.110  1.00 47.29  ? 18   ILE A C     1 
ATOM   105  O  O     . ILE A 1 18  ? -9.233  -1.247  19.894  1.00 46.88  ? 18   ILE A O     1 
ATOM   106  C  CB    . ILE A 1 18  ? -9.715  0.988   17.269  1.00 41.30  ? 18   ILE A CB    1 
ATOM   107  C  CG1   . ILE A 1 18  ? -10.470 2.273   16.961  1.00 48.55  ? 18   ILE A CG1   1 
ATOM   108  C  CG2   . ILE A 1 18  ? -10.568 -0.155  16.778  1.00 36.03  ? 18   ILE A CG2   1 
ATOM   109  C  CD1   . ILE A 1 18  ? -10.578 2.552   15.480  1.00 45.47  ? 18   ILE A CD1   1 
ATOM   110  N  N     . ILE A 1 19  ? -7.552  -0.673  18.506  1.00 40.27  ? 19   ILE A N     1 
ATOM   111  C  CA    . ILE A 1 19  ? -6.748  -1.862  18.754  1.00 44.20  ? 19   ILE A CA    1 
ATOM   112  C  C     . ILE A 1 19  ? -6.454  -2.096  20.240  1.00 46.79  ? 19   ILE A C     1 
ATOM   113  O  O     . ILE A 1 19  ? -6.483  -3.223  20.722  1.00 47.83  ? 19   ILE A O     1 
ATOM   114  C  CB    . ILE A 1 19  ? -5.407  -1.778  17.978  1.00 47.69  ? 19   ILE A CB    1 
ATOM   115  C  CG1   . ILE A 1 19  ? -5.659  -1.905  16.488  1.00 51.18  ? 19   ILE A CG1   1 
ATOM   116  C  CG2   . ILE A 1 19  ? -4.455  -2.867  18.390  1.00 47.53  ? 19   ILE A CG2   1 
ATOM   117  C  CD1   . ILE A 1 19  ? -6.370  -3.196  16.123  1.00 58.73  ? 19   ILE A CD1   1 
ATOM   118  N  N     . GLY A 1 20  ? -6.162  -1.038  20.973  1.00 45.87  ? 20   GLY A N     1 
ATOM   119  C  CA    . GLY A 1 20  ? -5.839  -1.188  22.381  1.00 50.59  ? 20   GLY A CA    1 
ATOM   120  C  C     . GLY A 1 20  ? -7.023  -1.421  23.316  1.00 54.98  ? 20   GLY A C     1 
ATOM   121  O  O     . GLY A 1 20  ? -6.920  -2.176  24.286  1.00 58.12  ? 20   GLY A O     1 
ATOM   122  N  N     . ASP A 1 21  ? -8.150  -0.781  23.022  1.00 49.35  ? 21   ASP A N     1 
ATOM   123  C  CA    . ASP A 1 21  ? -9.278  -0.750  23.943  1.00 47.24  ? 21   ASP A CA    1 
ATOM   124  C  C     . ASP A 1 21  ? -10.642 -0.920  23.278  1.00 52.80  ? 21   ASP A C     1 
ATOM   125  O  O     . ASP A 1 21  ? -11.659 -0.482  23.813  1.00 48.54  ? 21   ASP A O     1 
ATOM   126  C  CB    . ASP A 1 21  ? -9.283  0.561   24.702  1.00 47.40  ? 21   ASP A CB    1 
ATOM   127  C  CG    . ASP A 1 21  ? -8.597  0.464   26.031  1.00 52.27  ? 21   ASP A CG    1 
ATOM   128  O  OD1   . ASP A 1 21  ? -8.419  -0.654  26.528  1.00 55.61  ? 21   ASP A OD1   1 
ATOM   129  O  OD2   . ASP A 1 21  ? -8.259  1.518   26.603  1.00 55.94  ? 21   ASP A OD2   1 
ATOM   130  N  N     . GLY A 1 22  ? -10.671 -1.536  22.106  1.00 51.18  ? 22   GLY A N     1 
ATOM   131  C  CA    . GLY A 1 22  ? -11.925 -1.699  21.410  1.00 46.46  ? 22   GLY A CA    1 
ATOM   132  C  C     . GLY A 1 22  ? -11.862 -2.782  20.360  1.00 47.05  ? 22   GLY A C     1 
ATOM   133  O  O     . GLY A 1 22  ? -11.349 -3.884  20.587  1.00 43.95  ? 22   GLY A O     1 
ATOM   134  N  N     . GLY A 1 23  ? -12.395 -2.467  19.192  1.00 43.33  ? 23   GLY A N     1 
ATOM   135  C  CA    . GLY A 1 23  ? -12.465 -3.458  18.146  1.00 47.19  ? 23   GLY A CA    1 
ATOM   136  C  C     . GLY A 1 23  ? -12.997 -2.950  16.832  1.00 46.25  ? 23   GLY A C     1 
ATOM   137  O  O     . GLY A 1 23  ? -13.545 -1.849  16.715  1.00 46.89  ? 23   GLY A O     1 
ATOM   138  N  N     . LEU A 1 24  ? -12.814 -3.786  15.829  1.00 40.96  ? 24   LEU A N     1 
ATOM   139  C  CA    . LEU A 1 24  ? -13.420 -3.590  14.541  1.00 39.59  ? 24   LEU A CA    1 
ATOM   140  C  C     . LEU A 1 24  ? -14.355 -4.762  14.311  1.00 45.74  ? 24   LEU A C     1 
ATOM   141  O  O     . LEU A 1 24  ? -13.914 -5.899  14.260  1.00 45.11  ? 24   LEU A O     1 
ATOM   142  C  CB    . LEU A 1 24  ? -12.351 -3.505  13.471  1.00 36.03  ? 24   LEU A CB    1 
ATOM   143  C  CG    . LEU A 1 24  ? -11.516 -2.236  13.642  1.00 43.64  ? 24   LEU A CG    1 
ATOM   144  C  CD1   . LEU A 1 24  ? -10.413 -2.249  12.614  1.00 41.91  ? 24   LEU A CD1   1 
ATOM   145  C  CD2   . LEU A 1 24  ? -12.397 -0.972  13.506  1.00 40.82  ? 24   LEU A CD2   1 
ATOM   146  N  N     . TYR A 1 25  ? -15.650 -4.516  14.186  1.00 47.47  ? 25   TYR A N     1 
ATOM   147  C  CA    . TYR A 1 25  ? -16.553 -5.658  14.128  1.00 47.83  ? 25   TYR A CA    1 
ATOM   148  C  C     . TYR A 1 25  ? -17.407 -5.695  12.871  1.00 50.20  ? 25   TYR A C     1 
ATOM   149  O  O     . TYR A 1 25  ? -18.082 -4.721  12.525  1.00 50.05  ? 25   TYR A O     1 
ATOM   150  C  CB    . TYR A 1 25  ? -17.437 -5.688  15.385  1.00 47.21  ? 25   TYR A CB    1 
ATOM   151  C  CG    . TYR A 1 25  ? -16.628 -5.670  16.679  1.00 48.78  ? 25   TYR A CG    1 
ATOM   152  C  CD1   . TYR A 1 25  ? -15.747 -6.705  16.986  1.00 46.69  ? 25   TYR A CD1   1 
ATOM   153  C  CD2   . TYR A 1 25  ? -16.739 -4.614  17.584  1.00 48.83  ? 25   TYR A CD2   1 
ATOM   154  C  CE1   . TYR A 1 25  ? -15.012 -6.701  18.155  1.00 49.54  ? 25   TYR A CE1   1 
ATOM   155  C  CE2   . TYR A 1 25  ? -16.010 -4.596  18.767  1.00 44.68  ? 25   TYR A CE2   1 
ATOM   156  C  CZ    . TYR A 1 25  ? -15.148 -5.641  19.041  1.00 51.51  ? 25   TYR A CZ    1 
ATOM   157  O  OH    . TYR A 1 25  ? -14.418 -5.624  20.194  1.00 47.32  ? 25   TYR A OH    1 
ATOM   158  N  N     . LYS A 1 26  ? -17.350 -6.835  12.186  1.00 56.76  ? 26   LYS A N     1 
ATOM   159  C  CA    . LYS A 1 26  ? -18.248 -7.132  11.069  1.00 58.66  ? 26   LYS A CA    1 
ATOM   160  C  C     . LYS A 1 26  ? -19.304 -8.143  11.482  1.00 59.75  ? 26   LYS A C     1 
ATOM   161  O  O     . LYS A 1 26  ? -19.029 -9.334  11.508  1.00 62.77  ? 26   LYS A O     1 
ATOM   162  C  CB    . LYS A 1 26  ? -17.455 -7.677  9.885   1.00 65.66  ? 26   LYS A CB    1 
ATOM   163  C  CG    . LYS A 1 26  ? -18.225 -7.724  8.580   1.00 69.75  ? 26   LYS A CG    1 
ATOM   164  C  CD    . LYS A 1 26  ? -17.274 -7.807  7.392   1.00 77.39  ? 26   LYS A CD    1 
ATOM   165  C  CE    . LYS A 1 26  ? -17.880 -8.636  6.244   1.00 84.46  ? 26   LYS A CE    1 
ATOM   166  N  NZ    . LYS A 1 26  ? -17.822 -10.112 6.526   1.00 95.87  ? 26   LYS A NZ    1 
ATOM   167  N  N     . LEU A 1 27  ? -20.500 -7.684  11.811  1.00 52.31  ? 27   LEU A N     1 
ATOM   168  C  CA    . LEU A 1 27  ? -21.554 -8.590  12.275  1.00 56.71  ? 27   LEU A CA    1 
ATOM   169  C  C     . LEU A 1 27  ? -22.481 -9.051  11.137  1.00 61.23  ? 27   LEU A C     1 
ATOM   170  O  O     . LEU A 1 27  ? -22.845 -8.260  10.264  1.00 60.53  ? 27   LEU A O     1 
ATOM   171  C  CB    . LEU A 1 27  ? -22.413 -7.918  13.352  1.00 54.83  ? 27   LEU A CB    1 
ATOM   172  C  CG    . LEU A 1 27  ? -21.868 -7.384  14.685  1.00 54.24  ? 27   LEU A CG    1 
ATOM   173  C  CD1   . LEU A 1 27  ? -21.088 -8.434  15.435  1.00 55.82  ? 27   LEU A CD1   1 
ATOM   174  C  CD2   . LEU A 1 27  ? -21.065 -6.093  14.516  1.00 48.10  ? 27   LEU A CD2   1 
ATOM   175  N  N     . LYS A 1 28  ? -22.882 -10.319 11.163  1.00 64.48  ? 28   LYS A N     1 
ATOM   176  C  CA    . LYS A 1 28  ? -23.884 -10.829 10.218  1.00 58.69  ? 28   LYS A CA    1 
ATOM   177  C  C     . LYS A 1 28  ? -25.149 -11.266 10.962  1.00 62.03  ? 28   LYS A C     1 
ATOM   178  O  O     . LYS A 1 28  ? -25.179 -12.328 11.576  1.00 62.64  ? 28   LYS A O     1 
ATOM   179  C  CB    . LYS A 1 28  ? -23.333 -11.997 9.380   1.00 50.78  ? 28   LYS A CB    1 
ATOM   180  C  CG    . LYS A 1 28  ? -22.110 -11.655 8.558   1.00 66.21  ? 28   LYS A CG    1 
ATOM   181  C  CD    . LYS A 1 28  ? -22.481 -10.983 7.229   1.00 77.99  ? 28   LYS A CD    1 
ATOM   182  C  CE    . LYS A 1 28  ? -21.309 -10.177 6.629   1.00 82.14  ? 28   LYS A CE    1 
ATOM   183  N  NZ    . LYS A 1 28  ? -21.580 -9.779  5.214   1.00 94.10  ? 28   LYS A NZ    1 
ATOM   184  N  N     . TYR A 1 29  ? -26.195 -10.447 10.896  1.00 62.96  ? 29   TYR A N     1 
ATOM   185  C  CA    . TYR A 1 29  ? -27.440 -10.726 11.612  1.00 59.21  ? 29   TYR A CA    1 
ATOM   186  C  C     . TYR A 1 29  ? -28.379 -11.558 10.753  1.00 60.46  ? 29   TYR A C     1 
ATOM   187  O  O     . TYR A 1 29  ? -28.159 -11.694 9.556   1.00 62.91  ? 29   TYR A O     1 
ATOM   188  C  CB    . TYR A 1 29  ? -28.100 -9.421  12.025  1.00 57.51  ? 29   TYR A CB    1 
ATOM   189  C  CG    . TYR A 1 29  ? -27.243 -8.594  12.958  1.00 58.08  ? 29   TYR A CG    1 
ATOM   190  C  CD1   . TYR A 1 29  ? -26.482 -9.193  13.957  1.00 52.06  ? 29   TYR A CD1   1 
ATOM   191  C  CD2   . TYR A 1 29  ? -27.188 -7.210  12.831  1.00 57.96  ? 29   TYR A CD2   1 
ATOM   192  C  CE1   . TYR A 1 29  ? -25.720 -8.435  14.809  1.00 51.21  ? 29   TYR A CE1   1 
ATOM   193  C  CE2   . TYR A 1 29  ? -26.419 -6.446  13.671  1.00 56.55  ? 29   TYR A CE2   1 
ATOM   194  C  CZ    . TYR A 1 29  ? -25.677 -7.059  14.654  1.00 55.63  ? 29   TYR A CZ    1 
ATOM   195  O  OH    . TYR A 1 29  ? -24.908 -6.265  15.479  1.00 53.89  ? 29   TYR A OH    1 
ATOM   196  N  N     . LYS A 1 30  ? -29.415 -12.141 11.336  1.00 71.50  ? 30   LYS A N     1 
ATOM   197  C  CA    . LYS A 1 30  ? -30.375 -12.805 10.461  1.00 83.93  ? 30   LYS A CA    1 
ATOM   198  C  C     . LYS A 1 30  ? -31.247 -11.703 9.875   1.00 79.34  ? 30   LYS A C     1 
ATOM   199  O  O     . LYS A 1 30  ? -31.670 -10.792 10.598  1.00 71.98  ? 30   LYS A O     1 
ATOM   200  C  CB    . LYS A 1 30  ? -31.217 -13.861 11.177  1.00 84.13  ? 30   LYS A CB    1 
ATOM   201  C  CG    . LYS A 1 30  ? -31.860 -14.847 10.184  1.00 111.06 ? 30   LYS A CG    1 
ATOM   202  C  CD    . LYS A 1 30  ? -31.079 -14.887 8.849   1.00 102.62 ? 30   LYS A CD    1 
ATOM   203  C  CE    . LYS A 1 30  ? -31.747 -15.763 7.806   1.00 99.95  ? 30   LYS A CE    1 
ATOM   204  N  NZ    . LYS A 1 30  ? -33.002 -15.134 7.315   1.00 98.24  ? 30   LYS A NZ    1 
ATOM   205  N  N     . GLY A 1 31  ? -31.491 -11.775 8.564   1.00 88.72  ? 31   GLY A N     1 
ATOM   206  C  CA    . GLY A 1 31  ? -32.071 -10.647 7.865   1.00 84.52  ? 31   GLY A CA    1 
ATOM   207  C  C     . GLY A 1 31  ? -32.139 -10.520 6.346   1.00 79.58  ? 31   GLY A C     1 
ATOM   208  O  O     . GLY A 1 31  ? -33.078 -9.879  5.899   1.00 82.84  ? 31   GLY A O     1 
ATOM   209  N  N     . ASN A 1 32  ? -31.154 -10.944 5.546   1.00 67.76  ? 32   ASN A N     1 
ATOM   210  C  CA    . ASN A 1 32  ? -29.751 -11.109 5.913   1.00 66.07  ? 32   ASN A CA    1 
ATOM   211  C  C     . ASN A 1 32  ? -29.129 -9.781  6.299   1.00 66.10  ? 32   ASN A C     1 
ATOM   212  O  O     . ASN A 1 32  ? -28.435 -9.172  5.479   1.00 59.07  ? 32   ASN A O     1 
ATOM   213  C  CB    . ASN A 1 32  ? -28.922 -11.647 4.741   1.00 66.19  ? 32   ASN A CB    1 
ATOM   214  C  CG    . ASN A 1 32  ? -29.542 -12.841 4.060   1.00 68.01  ? 32   ASN A CG    1 
ATOM   215  O  OD1   . ASN A 1 32  ? -30.571 -13.358 4.482   1.00 83.36  ? 32   ASN A OD1   1 
ATOM   216  N  ND2   . ASN A 1 32  ? -28.915 -13.281 2.986   1.00 68.63  ? 32   ASN A ND2   1 
ATOM   217  N  N     . ARG A 1 33  ? -29.354 -9.317  7.519   1.00 58.56  ? 33   ARG A N     1 
ATOM   218  C  CA    . ARG A 1 33  ? -28.823 -8.025  7.912   1.00 59.58  ? 33   ARG A CA    1 
ATOM   219  C  C     . ARG A 1 33  ? -27.353 -8.044  8.356   1.00 67.44  ? 33   ARG A C     1 
ATOM   220  O  O     . ARG A 1 33  ? -26.788 -9.076  8.750   1.00 61.91  ? 33   ARG A O     1 
ATOM   221  C  CB    . ARG A 1 33  ? -29.685 -7.448  9.015   1.00 61.03  ? 33   ARG A CB    1 
ATOM   222  C  CG    . ARG A 1 33  ? -31.116 -7.269  8.591   1.00 59.67  ? 33   ARG A CG    1 
ATOM   223  C  CD    . ARG A 1 33  ? -31.997 -7.052  9.779   1.00 51.60  ? 33   ARG A CD    1 
ATOM   224  N  NE    . ARG A 1 33  ? -31.848 -8.140  10.732  1.00 58.45  ? 33   ARG A NE    1 
ATOM   225  C  CZ    . ARG A 1 33  ? -31.496 -7.960  11.999  1.00 64.21  ? 33   ARG A CZ    1 
ATOM   226  N  NH1   . ARG A 1 33  ? -31.256 -6.734  12.466  1.00 58.48  ? 33   ARG A NH1   1 
ATOM   227  N  NH2   . ARG A 1 33  ? -31.385 -9.007  12.802  1.00 70.15  ? 33   ARG A NH2   1 
ATOM   228  N  N     . SER A 1 34  ? -26.729 -6.882  8.274   1.00 64.04  ? 34   SER A N     1 
ATOM   229  C  CA    . SER A 1 34  ? -25.341 -6.784  8.661   1.00 58.40  ? 34   SER A CA    1 
ATOM   230  C  C     . SER A 1 34  ? -25.123 -5.545  9.525   1.00 55.68  ? 34   SER A C     1 
ATOM   231  O  O     . SER A 1 34  ? -26.019 -4.711  9.676   1.00 53.91  ? 34   SER A O     1 
ATOM   232  C  CB    . SER A 1 34  ? -24.454 -6.755  7.422   1.00 52.50  ? 34   SER A CB    1 
ATOM   233  O  OG    . SER A 1 34  ? -24.572 -5.525  6.743   1.00 49.54  ? 34   SER A OG    1 
ATOM   234  N  N     . GLU A 1 35  ? -23.946 -5.454  10.127  1.00 54.28  ? 35   GLU A N     1 
ATOM   235  C  CA    . GLU A 1 35  ? -23.529 -4.223  10.776  1.00 55.36  ? 35   GLU A CA    1 
ATOM   236  C  C     . GLU A 1 35  ? -22.001 -4.142  10.786  1.00 52.12  ? 35   GLU A C     1 
ATOM   237  O  O     . GLU A 1 35  ? -21.306 -5.159  10.694  1.00 51.97  ? 35   GLU A O     1 
ATOM   238  C  CB    . GLU A 1 35  ? -24.101 -4.129  12.194  1.00 52.70  ? 35   GLU A CB    1 
ATOM   239  C  CG    . GLU A 1 35  ? -24.189 -2.708  12.708  1.00 51.13  ? 35   GLU A CG    1 
ATOM   240  C  CD    . GLU A 1 35  ? -24.638 -2.633  14.152  1.00 53.10  ? 35   GLU A CD    1 
ATOM   241  O  OE1   . GLU A 1 35  ? -25.093 -3.673  14.687  1.00 50.82  ? 35   GLU A OE1   1 
ATOM   242  O  OE2   . GLU A 1 35  ? -24.522 -1.534  14.746  1.00 50.18  ? 35   GLU A OE2   1 
ATOM   243  N  N     . TYR A 1 36  ? -21.492 -2.921  10.855  1.00 46.28  ? 36   TYR A N     1 
ATOM   244  C  CA    . TYR A 1 36  ? -20.063 -2.674  10.866  1.00 47.37  ? 36   TYR A CA    1 
ATOM   245  C  C     . TYR A 1 36  ? -19.772 -1.715  11.995  1.00 52.10  ? 36   TYR A C     1 
ATOM   246  O  O     . TYR A 1 36  ? -20.318 -0.605  12.040  1.00 49.15  ? 36   TYR A O     1 
ATOM   247  C  CB    . TYR A 1 36  ? -19.575 -2.095  9.536   1.00 49.14  ? 36   TYR A CB    1 
ATOM   248  C  CG    . TYR A 1 36  ? -19.831 -2.981  8.335   1.00 51.87  ? 36   TYR A CG    1 
ATOM   249  C  CD1   . TYR A 1 36  ? -21.102 -3.069  7.776   1.00 50.11  ? 36   TYR A CD1   1 
ATOM   250  C  CD2   . TYR A 1 36  ? -18.803 -3.718  7.746   1.00 51.52  ? 36   TYR A CD2   1 
ATOM   251  C  CE1   . TYR A 1 36  ? -21.354 -3.865  6.675   1.00 46.97  ? 36   TYR A CE1   1 
ATOM   252  C  CE2   . TYR A 1 36  ? -19.051 -4.526  6.634   1.00 56.87  ? 36   TYR A CE2   1 
ATOM   253  C  CZ    . TYR A 1 36  ? -20.339 -4.591  6.108   1.00 54.60  ? 36   TYR A CZ    1 
ATOM   254  O  OH    . TYR A 1 36  ? -20.631 -5.372  5.012   1.00 58.05  ? 36   TYR A OH    1 
ATOM   255  N  N     . ARG A 1 37  ? -18.924 -2.137  12.922  1.00 51.06  ? 37   ARG A N     1 
ATOM   256  C  CA    . ARG A 1 37  ? -18.696 -1.311  14.088  1.00 52.49  ? 37   ARG A CA    1 
ATOM   257  C  C     . ARG A 1 37  ? -17.240 -0.934  14.250  1.00 52.64  ? 37   ARG A C     1 
ATOM   258  O  O     . ARG A 1 37  ? -16.356 -1.780  14.118  1.00 50.71  ? 37   ARG A O     1 
ATOM   259  C  CB    . ARG A 1 37  ? -19.201 -2.023  15.341  1.00 51.39  ? 37   ARG A CB    1 
ATOM   260  C  CG    . ARG A 1 37  ? -20.698 -2.052  15.413  1.00 53.95  ? 37   ARG A CG    1 
ATOM   261  C  CD    . ARG A 1 37  ? -21.171 -2.681  16.678  1.00 57.35  ? 37   ARG A CD    1 
ATOM   262  N  NE    . ARG A 1 37  ? -22.624 -2.688  16.725  1.00 61.69  ? 37   ARG A NE    1 
ATOM   263  C  CZ    . ARG A 1 37  ? -23.336 -3.257  17.686  1.00 63.26  ? 37   ARG A CZ    1 
ATOM   264  N  NH1   . ARG A 1 37  ? -22.719 -3.857  18.701  1.00 58.74  ? 37   ARG A NH1   1 
ATOM   265  N  NH2   . ARG A 1 37  ? -24.661 -3.220  17.625  1.00 57.82  ? 37   ARG A NH2   1 
ATOM   266  N  N     . VAL A 1 38  ? -17.013 0.352   14.510  1.00 46.93  ? 38   VAL A N     1 
ATOM   267  C  CA    . VAL A 1 38  ? -15.735 0.855   14.990  1.00 46.22  ? 38   VAL A CA    1 
ATOM   268  C  C     . VAL A 1 38  ? -15.948 1.137   16.465  1.00 47.70  ? 38   VAL A C     1 
ATOM   269  O  O     . VAL A 1 38  ? -16.773 1.983   16.799  1.00 48.37  ? 38   VAL A O     1 
ATOM   270  C  CB    . VAL A 1 38  ? -15.284 2.151   14.257  1.00 42.86  ? 38   VAL A CB    1 
ATOM   271  C  CG1   . VAL A 1 38  ? -14.062 2.724   14.907  1.00 44.54  ? 38   VAL A CG1   1 
ATOM   272  C  CG2   . VAL A 1 38  ? -15.037 1.912   12.766  1.00 44.00  ? 38   VAL A CG2   1 
ATOM   273  N  N     . VAL A 1 39  ? -15.225 0.434   17.340  1.00 48.74  ? 39   VAL A N     1 
ATOM   274  C  CA    . VAL A 1 39  ? -15.435 0.521   18.798  1.00 46.05  ? 39   VAL A CA    1 
ATOM   275  C  C     . VAL A 1 39  ? -14.180 0.866   19.625  1.00 44.41  ? 39   VAL A C     1 
ATOM   276  O  O     . VAL A 1 39  ? -13.118 0.323   19.401  1.00 48.56  ? 39   VAL A O     1 
ATOM   277  C  CB    . VAL A 1 39  ? -15.997 -0.805  19.343  1.00 44.26  ? 39   VAL A CB    1 
ATOM   278  C  CG1   . VAL A 1 39  ? -16.012 -0.801  20.853  1.00 41.20  ? 39   VAL A CG1   1 
ATOM   279  C  CG2   . VAL A 1 39  ? -17.384 -1.041  18.795  1.00 49.08  ? 39   VAL A CG2   1 
ATOM   280  N  N     . ILE A 1 40  ? -14.345 1.763   20.590  1.00 46.97  ? 40   ILE A N     1 
ATOM   281  C  CA    . ILE A 1 40  ? -13.366 2.115   21.599  1.00 35.95  ? 40   ILE A CA    1 
ATOM   282  C  C     . ILE A 1 40  ? -14.101 2.067   22.932  1.00 43.47  ? 40   ILE A C     1 
ATOM   283  O  O     . ILE A 1 40  ? -15.029 2.835   23.118  1.00 49.85  ? 40   ILE A O     1 
ATOM   284  C  CB    . ILE A 1 40  ? -12.814 3.536   21.387  1.00 40.59  ? 40   ILE A CB    1 
ATOM   285  C  CG1   . ILE A 1 40  ? -12.202 3.687   19.992  1.00 41.85  ? 40   ILE A CG1   1 
ATOM   286  C  CG2   . ILE A 1 40  ? -11.806 3.896   22.477  1.00 47.09  ? 40   ILE A CG2   1 
ATOM   287  C  CD1   . ILE A 1 40  ? -11.464 4.978   19.763  1.00 37.79  ? 40   ILE A CD1   1 
ATOM   288  N  N     . THR A 1 41  ? -13.749 1.176   23.854  1.00 53.87  ? 41   THR A N     1 
ATOM   289  C  CA    . THR A 1 41  ? -14.439 1.175   25.143  1.00 55.31  ? 41   THR A CA    1 
ATOM   290  C  C     . THR A 1 41  ? -13.504 1.808   26.180  1.00 63.34  ? 41   THR A C     1 
ATOM   291  O  O     . THR A 1 41  ? -12.287 1.726   26.028  1.00 57.88  ? 41   THR A O     1 
ATOM   292  C  CB    . THR A 1 41  ? -14.839 -0.243  25.627  1.00 57.54  ? 41   THR A CB    1 
ATOM   293  O  OG1   . THR A 1 41  ? -13.680 -1.075  25.726  1.00 60.16  ? 41   THR A OG1   1 
ATOM   294  C  CG2   . THR A 1 41  ? -15.770 -0.910  24.653  1.00 56.84  ? 41   THR A CG2   1 
ATOM   295  N  N     . GLN A 1 42  ? -14.056 2.459   27.216  1.00 68.14  ? 42   GLN A N     1 
ATOM   296  C  CA    . GLN A 1 42  ? -13.228 2.866   28.371  1.00 68.14  ? 42   GLN A CA    1 
ATOM   297  C  C     . GLN A 1 42  ? -14.033 3.198   29.614  1.00 68.14  ? 42   GLN A C     1 
ATOM   298  O  O     . GLN A 1 42  ? -15.186 3.688   29.479  1.00 68.14  ? 42   GLN A O     1 
ATOM   299  C  CB    . GLN A 1 42  ? -12.311 4.065   27.976  1.00 58.14  ? 42   GLN A CB    1 
ATOM   300  C  CG    . GLN A 1 42  ? -10.894 3.863   28.762  1.00 58.14  ? 42   GLN A CG    1 
ATOM   301  C  CD    . GLN A 1 42  ? -9.819  4.620   28.111  1.00 58.14  ? 42   GLN A CD    1 
ATOM   302  O  OE1   . GLN A 1 42  ? -10.099 5.284   27.066  1.00 58.14  ? 42   GLN A OE1   1 
ATOM   303  N  NE2   . GLN A 1 42  ? -8.622  4.705   28.751  1.00 58.14  ? 42   GLN A NE2   1 
ATOM   304  N  N     . LYS A 1 43  ? -13.483 2.951   30.804  1.00 69.68  ? 43   LYS A N     1 
ATOM   305  C  CA    . LYS A 1 43  ? -14.252 3.142   32.049  1.00 75.38  ? 43   LYS A CA    1 
ATOM   306  C  C     . LYS A 1 43  ? -14.597 4.616   32.291  1.00 75.63  ? 43   LYS A C     1 
ATOM   307  O  O     . LYS A 1 43  ? -15.653 4.920   32.833  1.00 84.76  ? 43   LYS A O     1 
ATOM   308  C  CB    . LYS A 1 43  ? -13.479 2.594   33.259  1.00 75.52  ? 43   LYS A CB    1 
ATOM   309  C  CG    . LYS A 1 43  ? -14.216 2.691   34.601  1.00 84.85  ? 43   LYS A CG    1 
ATOM   310  C  CD    . LYS A 1 43  ? -13.322 2.196   35.732  1.00 85.94  ? 43   LYS A CD    1 
ATOM   311  C  CE    . LYS A 1 43  ? -13.970 2.264   37.108  1.00 99.12  ? 43   LYS A CE    1 
ATOM   312  N  NZ    . LYS A 1 43  ? -13.028 1.794   38.175  1.00 97.38  ? 43   LYS A NZ    1 
ATOM   313  N  N     . SER A 1 44  ? -13.713 5.511   31.856  1.00 57.13  ? 44   SER A N     1 
ATOM   314  C  CA    . SER A 1 44  ? -13.775 6.945   32.146  1.00 59.21  ? 44   SER A CA    1 
ATOM   315  C  C     . SER A 1 44  ? -14.624 7.803   31.192  1.00 70.87  ? 44   SER A C     1 
ATOM   316  O  O     . SER A 1 44  ? -14.166 8.159   30.094  1.00 69.24  ? 44   SER A O     1 
ATOM   317  C  CB    . SER A 1 44  ? -12.343 7.488   32.165  1.00 65.14  ? 44   SER A CB    1 
ATOM   318  O  OG    . SER A 1 44  ? -12.281 8.786   31.612  1.00 64.12  ? 44   SER A OG    1 
ATOM   319  N  N     . GLU A 1 45  ? -15.822 8.180   31.649  1.00 150.06 ? 45   GLU A N     1 
ATOM   320  C  CA    . GLU A 1 45  ? -16.824 8.869   30.825  1.00 148.24 ? 45   GLU A CA    1 
ATOM   321  C  C     . GLU A 1 45  ? -16.264 10.130  30.237  1.00 142.92 ? 45   GLU A C     1 
ATOM   322  O  O     . GLU A 1 45  ? -16.616 10.559  29.147  1.00 141.67 ? 45   GLU A O     1 
ATOM   323  C  CB    . GLU A 1 45  ? -18.064 9.252   31.659  1.00 90.90  ? 45   GLU A CB    1 
ATOM   324  C  CG    . GLU A 1 45  ? -19.142 10.114  30.873  1.00 90.90  ? 45   GLU A CG    1 
ATOM   325  C  CD    . GLU A 1 45  ? -20.314 10.339  31.800  1.00 90.90  ? 45   GLU A CD    1 
ATOM   326  O  OE1   . GLU A 1 45  ? -20.093 10.249  33.078  1.00 90.90  ? 45   GLU A OE1   1 
ATOM   327  O  OE2   . GLU A 1 45  ? -21.496 10.507  31.273  1.00 90.90  ? 45   GLU A OE2   1 
ATOM   328  N  N     . ASN A 1 46  ? -15.400 10.738  31.018  1.00 72.91  ? 46   ASN A N     1 
ATOM   329  C  CA    A ASN A 1 46  ? -14.819 12.030  30.723  0.44 78.60  ? 46   ASN A CA    1 
ATOM   330  C  CA    B ASN A 1 46  ? -14.899 12.041  30.660  0.56 78.75  ? 46   ASN A CA    1 
ATOM   331  C  C     . ASN A 1 46  ? -13.867 11.945  29.556  1.00 80.47  ? 46   ASN A C     1 
ATOM   332  O  O     . ASN A 1 46  ? -13.771 12.841  28.729  1.00 86.63  ? 46   ASN A O     1 
ATOM   333  C  CB    A ASN A 1 46  ? -14.059 12.512  31.943  0.44 81.81  ? 46   ASN A CB    1 
ATOM   334  C  CB    B ASN A 1 46  ? -14.323 12.736  31.889  0.56 81.85  ? 46   ASN A CB    1 
ATOM   335  C  CG    A ASN A 1 46  ? -13.747 13.991  31.912  0.44 82.51  ? 46   ASN A CG    1 
ATOM   336  C  CG    B ASN A 1 46  ? -15.296 12.754  33.042  0.56 83.46  ? 46   ASN A CG    1 
ATOM   337  O  OD1   A ASN A 1 46  ? -12.792 14.438  31.281  0.44 83.17  ? 46   ASN A OD1   1 
ATOM   338  O  OD1   B ASN A 1 46  ? -15.268 11.871  33.903  0.56 81.03  ? 46   ASN A OD1   1 
ATOM   339  N  ND2   A ASN A 1 46  ? -14.477 14.739  32.710  0.44 84.27  ? 46   ASN A ND2   1 
ATOM   340  N  ND2   B ASN A 1 46  ? -16.199 13.738  33.043  0.56 78.76  ? 46   ASN A ND2   1 
ATOM   341  N  N     . LEU A 1 47  ? -13.118 10.854  29.530  1.00 70.74  ? 47   LEU A N     1 
ATOM   342  C  CA    . LEU A 1 47  ? -12.110 10.692  28.503  1.00 72.54  ? 47   LEU A CA    1 
ATOM   343  C  C     . LEU A 1 47  ? -12.823 10.389  27.193  1.00 67.16  ? 47   LEU A C     1 
ATOM   344  O  O     . LEU A 1 47  ? -12.470 10.916  26.132  1.00 68.84  ? 47   LEU A O     1 
ATOM   345  C  CB    . LEU A 1 47  ? -11.124 9.583   28.894  1.00 71.20  ? 47   LEU A CB    1 
ATOM   346  C  CG    . LEU A 1 47  ? -10.010 9.176   27.939  1.00 65.03  ? 47   LEU A CG    1 
ATOM   347  C  CD1   . LEU A 1 47  ? -9.120  10.367  27.637  1.00 74.72  ? 47   LEU A CD1   1 
ATOM   348  C  CD2   . LEU A 1 47  ? -9.222  8.018   28.522  1.00 70.15  ? 47   LEU A CD2   1 
ATOM   349  N  N     . ILE A 1 48  ? -13.850 9.552   27.282  1.00 65.06  ? 48   ILE A N     1 
ATOM   350  C  CA    . ILE A 1 48  ? -14.617 9.175   26.099  1.00 65.98  ? 48   ILE A CA    1 
ATOM   351  C  C     . ILE A 1 48  ? -15.433 10.330  25.498  1.00 65.48  ? 48   ILE A C     1 
ATOM   352  O  O     . ILE A 1 48  ? -15.468 10.477  24.271  1.00 62.01  ? 48   ILE A O     1 
ATOM   353  C  CB    . ILE A 1 48  ? -15.536 7.990   26.401  1.00 56.30  ? 48   ILE A CB    1 
ATOM   354  C  CG1   . ILE A 1 48  ? -14.865 6.718   25.915  1.00 54.74  ? 48   ILE A CG1   1 
ATOM   355  C  CG2   . ILE A 1 48  ? -16.850 8.133   25.683  1.00 63.53  ? 48   ILE A CG2   1 
ATOM   356  C  CD1   . ILE A 1 48  ? -15.674 5.478   26.083  1.00 60.53  ? 48   ILE A CD1   1 
ATOM   357  N  N     . LYS A 1 49  ? -16.060 11.158  26.337  1.00 69.81  ? 49   LYS A N     1 
ATOM   358  C  CA    . LYS A 1 49  ? -16.885 12.247  25.810  1.00 70.16  ? 49   LYS A CA    1 
ATOM   359  C  C     . LYS A 1 49  ? -16.082 13.488  25.459  1.00 72.45  ? 49   LYS A C     1 
ATOM   360  O  O     . LYS A 1 49  ? -16.407 14.167  24.495  1.00 77.85  ? 49   LYS A O     1 
ATOM   361  C  CB    . LYS A 1 49  ? -18.008 12.610  26.788  1.00 69.66  ? 49   LYS A CB    1 
ATOM   362  C  CG    . LYS A 1 49  ? -19.112 11.534  26.856  1.00 70.17  ? 49   LYS A CG    1 
ATOM   363  C  CD    . LYS A 1 49  ? -20.269 11.902  27.782  1.00 64.23  ? 49   LYS A CD    1 
ATOM   364  C  CE    . LYS A 1 49  ? -21.142 10.688  28.086  1.00 72.01  ? 49   LYS A CE    1 
ATOM   365  N  NZ    . LYS A 1 49  ? -22.314 11.000  28.970  1.00 79.49  ? 49   LYS A NZ    1 
ATOM   366  N  N     . GLN A 1 50  ? -15.027 13.784  26.209  1.00 77.31  ? 50   GLN A N     1 
ATOM   367  C  CA    . GLN A 1 50  ? -14.329 15.055  26.027  1.00 70.65  ? 50   GLN A CA    1 
ATOM   368  C  C     . GLN A 1 50  ? -13.056 14.992  25.180  1.00 76.10  ? 50   GLN A C     1 
ATOM   369  O  O     . GLN A 1 50  ? -12.588 16.014  24.677  1.00 80.91  ? 50   GLN A O     1 
ATOM   370  C  CB    . GLN A 1 50  ? -13.995 15.668  27.384  1.00 78.95  ? 50   GLN A CB    1 
ATOM   371  C  CG    . GLN A 1 50  ? -15.151 16.270  28.117  1.00 89.41  ? 50   GLN A CG    1 
ATOM   372  C  CD    . GLN A 1 50  ? -14.758 16.813  29.479  1.00 100.41 ? 50   GLN A CD    1 
ATOM   373  O  OE1   . GLN A 1 50  ? -13.803 17.591  29.628  1.00 101.14 ? 50   GLN A OE1   1 
ATOM   374  N  NE2   . GLN A 1 50  ? -15.541 16.476  30.461  1.00 102.91 ? 50   GLN A NE2   1 
ATOM   375  N  N     . HIS A 1 51  ? -12.491 13.810  24.981  1.00 76.69  ? 51   HIS A N     1 
ATOM   376  C  CA    . HIS A 1 51  ? -11.289 13.750  24.156  1.00 67.55  ? 51   HIS A CA    1 
ATOM   377  C  C     . HIS A 1 51  ? -11.440 12.804  22.968  1.00 68.27  ? 51   HIS A C     1 
ATOM   378  O  O     . HIS A 1 51  ? -11.168 13.178  21.823  1.00 67.13  ? 51   HIS A O     1 
ATOM   379  C  CB    . HIS A 1 51  ? -10.091 13.388  25.033  1.00 74.57  ? 51   HIS A CB    1 
ATOM   380  C  CG    . HIS A 1 51  ? -9.814  14.420  26.081  1.00 86.07  ? 51   HIS A CG    1 
ATOM   381  N  ND1   . HIS A 1 51  ? -9.273  15.654  25.781  1.00 82.95  ? 51   HIS A ND1   1 
ATOM   382  C  CD2   . HIS A 1 51  ? -10.069 14.432  27.412  1.00 86.42  ? 51   HIS A CD2   1 
ATOM   383  C  CE1   . HIS A 1 51  ? -9.179  16.370  26.888  1.00 87.93  ? 51   HIS A CE1   1 
ATOM   384  N  NE2   . HIS A 1 51  ? -9.655  15.652  27.892  1.00 91.55  ? 51   HIS A NE2   1 
ATOM   385  N  N     . ILE A 1 52  ? -11.932 11.600  23.217  1.00 66.59  ? 52   ILE A N     1 
ATOM   386  C  CA    . ILE A 1 52  ? -12.031 10.639  22.133  1.00 62.40  ? 52   ILE A CA    1 
ATOM   387  C  C     . ILE A 1 52  ? -13.164 11.020  21.171  1.00 59.94  ? 52   ILE A C     1 
ATOM   388  O  O     . ILE A 1 52  ? -12.908 11.176  19.982  1.00 64.72  ? 52   ILE A O     1 
ATOM   389  C  CB    . ILE A 1 52  ? -12.196 9.207   22.674  1.00 58.17  ? 52   ILE A CB    1 
ATOM   390  C  CG1   . ILE A 1 52  ? -11.029 8.885   23.604  1.00 57.92  ? 52   ILE A CG1   1 
ATOM   391  C  CG2   . ILE A 1 52  ? -12.194 8.220   21.547  1.00 50.44  ? 52   ILE A CG2   1 
ATOM   392  C  CD1   . ILE A 1 52  ? -11.208 7.641   24.456  1.00 64.00  ? 52   ILE A CD1   1 
ATOM   393  N  N     . ALA A 1 53  ? -14.382 11.227  21.674  1.00 58.73  ? 53   ALA A N     1 
ATOM   394  C  CA    . ALA A 1 53  ? -15.527 11.606  20.824  1.00 50.84  ? 53   ALA A CA    1 
ATOM   395  C  C     . ALA A 1 53  ? -15.292 12.851  19.949  1.00 53.34  ? 53   ALA A C     1 
ATOM   396  O  O     . ALA A 1 53  ? -15.642 12.843  18.775  1.00 52.50  ? 53   ALA A O     1 
ATOM   397  C  CB    . ALA A 1 53  ? -16.753 11.802  21.668  1.00 50.67  ? 53   ALA A CB    1 
ATOM   398  N  N     . PRO A 1 54  ? -14.686 13.920  20.498  1.00 59.76  ? 54   PRO A N     1 
ATOM   399  C  CA    . PRO A 1 54  ? -14.377 15.023  19.574  1.00 52.90  ? 54   PRO A CA    1 
ATOM   400  C  C     . PRO A 1 54  ? -13.446 14.647  18.433  1.00 60.06  ? 54   PRO A C     1 
ATOM   401  O  O     . PRO A 1 54  ? -13.685 15.079  17.300  1.00 60.76  ? 54   PRO A O     1 
ATOM   402  C  CB    . PRO A 1 54  ? -13.717 16.052  20.478  1.00 52.77  ? 54   PRO A CB    1 
ATOM   403  C  CG    . PRO A 1 54  ? -14.396 15.819  21.810  1.00 60.63  ? 54   PRO A CG    1 
ATOM   404  C  CD    . PRO A 1 54  ? -14.543 14.334  21.909  1.00 55.90  ? 54   PRO A CD    1 
ATOM   405  N  N     . LEU A 1 55  ? -12.406 13.862  18.718  1.00 63.33  ? 55   LEU A N     1 
ATOM   406  C  CA    . LEU A 1 55  ? -11.477 13.424  17.678  1.00 52.34  ? 55   LEU A CA    1 
ATOM   407  C  C     . LEU A 1 55  ? -12.185 12.559  16.645  1.00 58.32  ? 55   LEU A C     1 
ATOM   408  O  O     . LEU A 1 55  ? -12.054 12.769  15.434  1.00 55.98  ? 55   LEU A O     1 
ATOM   409  C  CB    . LEU A 1 55  ? -10.321 12.652  18.282  1.00 56.80  ? 55   LEU A CB    1 
ATOM   410  C  CG    . LEU A 1 55  ? -9.301  13.422  19.114  1.00 59.53  ? 55   LEU A CG    1 
ATOM   411  C  CD1   . LEU A 1 55  ? -8.186  12.476  19.551  1.00 52.60  ? 55   LEU A CD1   1 
ATOM   412  C  CD2   . LEU A 1 55  ? -8.743  14.563  18.308  1.00 55.37  ? 55   LEU A CD2   1 
ATOM   413  N  N     . MET A 1 56  ? -12.946 11.584  17.130  1.00 57.30  ? 56   MET A N     1 
ATOM   414  C  CA    . MET A 1 56  ? -13.717 10.723  16.246  1.00 58.68  ? 56   MET A CA    1 
ATOM   415  C  C     . MET A 1 56  ? -14.689 11.538  15.392  1.00 62.77  ? 56   MET A C     1 
ATOM   416  O  O     . MET A 1 56  ? -14.840 11.270  14.192  1.00 58.78  ? 56   MET A O     1 
ATOM   417  C  CB    . MET A 1 56  ? -14.477 9.661   17.042  1.00 46.62  ? 56   MET A CB    1 
ATOM   418  C  CG    . MET A 1 56  ? -15.218 8.683   16.157  1.00 48.01  ? 56   MET A CG    1 
ATOM   419  S  SD    . MET A 1 56  ? -14.136 7.731   15.075  1.00 58.72  ? 56   MET A SD    1 
ATOM   420  C  CE    . MET A 1 56  ? -13.564 6.453   16.220  1.00 35.17  ? 56   MET A CE    1 
ATOM   421  N  N     . GLN A 1 57  ? -15.328 12.539  16.006  1.00 66.67  ? 57   GLN A N     1 
ATOM   422  C  CA    . GLN A 1 57  ? -16.294 13.380  15.300  1.00 65.34  ? 57   GLN A CA    1 
ATOM   423  C  C     . GLN A 1 57  ? -15.646 14.121  14.148  1.00 63.03  ? 57   GLN A C     1 
ATOM   424  O  O     . GLN A 1 57  ? -16.137 14.103  13.031  1.00 70.23  ? 57   GLN A O     1 
ATOM   425  C  CB    . GLN A 1 57  ? -16.937 14.392  16.240  1.00 67.48  ? 57   GLN A CB    1 
ATOM   426  C  CG    . GLN A 1 57  ? -18.053 15.210  15.586  1.00 69.21  ? 57   GLN A CG    1 
ATOM   427  C  CD    . GLN A 1 57  ? -19.247 14.356  15.192  1.00 69.28  ? 57   GLN A CD    1 
ATOM   428  O  OE1   . GLN A 1 57  ? -19.894 13.725  16.046  1.00 64.63  ? 57   GLN A OE1   1 
ATOM   429  N  NE2   . GLN A 1 57  ? -19.547 14.327  13.893  1.00 65.12  ? 57   GLN A NE2   1 
ATOM   430  N  N     . PHE A 1 58  ? -14.546 14.789  14.447  1.00 60.46  ? 58   PHE A N     1 
ATOM   431  C  CA    . PHE A 1 58  ? -13.777 15.487  13.439  1.00 62.45  ? 58   PHE A CA    1 
ATOM   432  C  C     . PHE A 1 58  ? -13.523 14.557  12.250  1.00 63.20  ? 58   PHE A C     1 
ATOM   433  O  O     . PHE A 1 58  ? -13.873 14.875  11.120  1.00 61.87  ? 58   PHE A O     1 
ATOM   434  C  CB    . PHE A 1 58  ? -12.460 15.993  14.048  1.00 64.52  ? 58   PHE A CB    1 
ATOM   435  C  CG    . PHE A 1 58  ? -11.505 16.557  13.042  1.00 67.05  ? 58   PHE A CG    1 
ATOM   436  C  CD1   . PHE A 1 58  ? -11.648 17.861  12.585  1.00 72.53  ? 58   PHE A CD1   1 
ATOM   437  C  CD2   . PHE A 1 58  ? -10.475 15.782  12.538  1.00 65.03  ? 58   PHE A CD2   1 
ATOM   438  C  CE1   . PHE A 1 58  ? -10.771 18.387  11.644  1.00 74.61  ? 58   PHE A CE1   1 
ATOM   439  C  CE2   . PHE A 1 58  ? -9.594  16.297  11.592  1.00 72.19  ? 58   PHE A CE2   1 
ATOM   440  C  CZ    . PHE A 1 58  ? -9.743  17.601  11.146  1.00 76.91  ? 58   PHE A CZ    1 
ATOM   441  N  N     . LEU A 1 59  ? -12.934 13.396  12.533  1.00 67.23  ? 59   LEU A N     1 
ATOM   442  C  CA    . LEU A 1 59  ? -12.605 12.399  11.518  1.00 56.40  ? 59   LEU A CA    1 
ATOM   443  C  C     . LEU A 1 59  ? -13.812 12.055  10.684  1.00 55.60  ? 59   LEU A C     1 
ATOM   444  O  O     . LEU A 1 59  ? -13.752 12.063  9.456   1.00 60.39  ? 59   LEU A O     1 
ATOM   445  C  CB    . LEU A 1 59  ? -12.058 11.132  12.172  1.00 52.04  ? 59   LEU A CB    1 
ATOM   446  C  CG    . LEU A 1 59  ? -11.722 9.989   11.226  1.00 43.36  ? 59   LEU A CG    1 
ATOM   447  C  CD1   . LEU A 1 59  ? -10.672 10.428  10.225  1.00 50.65  ? 59   LEU A CD1   1 
ATOM   448  C  CD2   . LEU A 1 59  ? -11.231 8.820   12.009  1.00 49.85  ? 59   LEU A CD2   1 
ATOM   449  N  N     . ILE A 1 60  ? -14.911 11.751  11.365  1.00 64.48  ? 60   ILE A N     1 
ATOM   450  C  CA    . ILE A 1 60  ? -16.183 11.462  10.697  1.00 70.54  ? 60   ILE A CA    1 
ATOM   451  C  C     . ILE A 1 60  ? -16.641 12.596  9.764   1.00 66.90  ? 60   ILE A C     1 
ATOM   452  O  O     . ILE A 1 60  ? -16.860 12.372  8.572   1.00 67.49  ? 60   ILE A O     1 
ATOM   453  C  CB    . ILE A 1 60  ? -17.289 11.179  11.718  1.00 66.53  ? 60   ILE A CB    1 
ATOM   454  C  CG1   . ILE A 1 60  ? -17.079 9.808   12.344  1.00 65.15  ? 60   ILE A CG1   1 
ATOM   455  C  CG2   . ILE A 1 60  ? -18.621 11.179  11.053  1.00 66.62  ? 60   ILE A CG2   1 
ATOM   456  C  CD1   . ILE A 1 60  ? -18.064 9.516   13.450  1.00 67.08  ? 60   ILE A CD1   1 
ATOM   457  N  N     . ASP A 1 61  ? -16.758 13.804  10.310  1.00 59.48  ? 61   ASP A N     1 
ATOM   458  C  CA    . ASP A 1 61  ? -17.145 14.984  9.541   1.00 61.77  ? 61   ASP A CA    1 
ATOM   459  C  C     . ASP A 1 61  ? -16.293 15.181  8.292   1.00 65.48  ? 61   ASP A C     1 
ATOM   460  O  O     . ASP A 1 61  ? -16.786 15.616  7.241   1.00 71.83  ? 61   ASP A O     1 
ATOM   461  C  CB    . ASP A 1 61  ? -17.076 16.231  10.428  1.00 57.05  ? 61   ASP A CB    1 
ATOM   462  C  CG    . ASP A 1 61  ? -18.085 16.184  11.559  1.00 64.87  ? 61   ASP A CG    1 
ATOM   463  O  OD1   . ASP A 1 61  ? -19.052 15.410  11.437  1.00 63.29  ? 61   ASP A OD1   1 
ATOM   464  O  OD2   . ASP A 1 61  ? -17.926 16.903  12.568  1.00 69.98  ? 61   ASP A OD2   1 
ATOM   465  N  N     . GLU A 1 62  ? -15.022 14.822  8.417   1.00 73.25  ? 62   GLU A N     1 
ATOM   466  C  CA    . GLU A 1 62  ? -14.024 15.043  7.387   1.00 69.69  ? 62   GLU A CA    1 
ATOM   467  C  C     . GLU A 1 62  ? -13.993 13.919  6.353   1.00 70.47  ? 62   GLU A C     1 
ATOM   468  O  O     . GLU A 1 62  ? -13.473 14.091  5.253   1.00 75.10  ? 62   GLU A O     1 
ATOM   469  C  CB    . GLU A 1 62  ? -12.647 15.192  8.044   1.00 73.97  ? 62   GLU A CB    1 
ATOM   470  C  CG    . GLU A 1 62  ? -11.554 15.794  7.156   1.00 84.83  ? 62   GLU A CG    1 
ATOM   471  C  CD    . GLU A 1 62  ? -11.614 17.312  7.076   1.00 91.26  ? 62   GLU A CD    1 
ATOM   472  O  OE1   . GLU A 1 62  ? -12.163 17.946  8.013   1.00 84.12  ? 62   GLU A OE1   1 
ATOM   473  O  OE2   . GLU A 1 62  ? -11.102 17.862  6.073   1.00 94.56  ? 62   GLU A OE2   1 
ATOM   474  N  N     . LEU A 1 63  ? -14.523 12.754  6.705   1.00 73.00  ? 63   LEU A N     1 
ATOM   475  C  CA    . LEU A 1 63  ? -14.579 11.653  5.746   1.00 73.59  ? 63   LEU A CA    1 
ATOM   476  C  C     . LEU A 1 63  ? -15.971 11.582  5.140   1.00 76.95  ? 63   LEU A C     1 
ATOM   477  O  O     . LEU A 1 63  ? -16.274 10.690  4.345   1.00 75.05  ? 63   LEU A O     1 
ATOM   478  C  CB    . LEU A 1 63  ? -14.216 10.323  6.406   1.00 72.13  ? 63   LEU A CB    1 
ATOM   479  C  CG    . LEU A 1 63  ? -12.748 10.073  6.734   1.00 71.11  ? 63   LEU A CG    1 
ATOM   480  C  CD1   . LEU A 1 63  ? -12.550 8.639   7.257   1.00 64.18  ? 63   LEU A CD1   1 
ATOM   481  C  CD2   . LEU A 1 63  ? -11.902 10.328  5.511   1.00 60.71  ? 63   LEU A CD2   1 
ATOM   482  N  N     . ASN A 1 64  ? -16.793 12.558  5.513   1.00 72.75  ? 64   ASN A N     1 
ATOM   483  C  CA    . ASN A 1 64  ? -18.204 12.590  5.180   1.00 72.15  ? 64   ASN A CA    1 
ATOM   484  C  C     . ASN A 1 64  ? -18.847 11.242  5.465   1.00 75.67  ? 64   ASN A C     1 
ATOM   485  O  O     . ASN A 1 64  ? -19.423 10.601  4.590   1.00 77.07  ? 64   ASN A O     1 
ATOM   486  C  CB    . ASN A 1 64  ? -18.435 13.002  3.726   1.00 78.72  ? 64   ASN A CB    1 
ATOM   487  C  CG    . ASN A 1 64  ? -19.818 13.628  3.515   1.00 95.04  ? 64   ASN A CG    1 
ATOM   488  O  OD1   . ASN A 1 64  ? -20.374 14.285  4.417   1.00 89.66  ? 64   ASN A OD1   1 
ATOM   489  N  ND2   . ASN A 1 64  ? -20.394 13.398  2.333   1.00 88.47  ? 64   ASN A ND2   1 
ATOM   490  N  N     . VAL A 1 65  ? -18.707 10.820  6.712   1.00 74.74  ? 65   VAL A N     1 
ATOM   491  C  CA    . VAL A 1 65  ? -19.403 9.662   7.245   1.00 73.77  ? 65   VAL A CA    1 
ATOM   492  C  C     . VAL A 1 65  ? -20.664 10.175  7.921   1.00 68.95  ? 65   VAL A C     1 
ATOM   493  O  O     . VAL A 1 65  ? -20.588 11.116  8.711   1.00 76.41  ? 65   VAL A O     1 
ATOM   494  C  CB    . VAL A 1 65  ? -18.516 8.894   8.248   1.00 64.39  ? 65   VAL A CB    1 
ATOM   495  C  CG1   . VAL A 1 65  ? -19.342 7.931   9.069   1.00 59.80  ? 65   VAL A CG1   1 
ATOM   496  C  CG2   . VAL A 1 65  ? -17.360 8.189   7.520   1.00 60.54  ? 65   VAL A CG2   1 
ATOM   497  N  N     . LYS A 1 66  ? -21.822 9.593   7.611   1.00 66.58  ? 66   LYS A N     1 
ATOM   498  C  CA    . LYS A 1 66  ? -23.077 10.158  8.123   1.00 73.06  ? 66   LYS A CA    1 
ATOM   499  C  C     . LYS A 1 66  ? -23.572 9.456   9.382   1.00 76.48  ? 66   LYS A C     1 
ATOM   500  O  O     . LYS A 1 66  ? -24.595 9.843   9.951   1.00 80.67  ? 66   LYS A O     1 
ATOM   501  C  CB    . LYS A 1 66  ? -24.186 10.131  7.050   1.00 79.27  ? 66   LYS A CB    1 
ATOM   502  C  CG    . LYS A 1 66  ? -23.886 10.923  5.772   1.00 74.19  ? 66   LYS A CG    1 
ATOM   503  C  CD    . LYS A 1 66  ? -23.667 12.411  6.056   1.00 85.44  ? 66   LYS A CD    1 
ATOM   504  C  CE    . LYS A 1 66  ? -23.380 13.193  4.763   1.00 106.82 ? 66   LYS A CE    1 
ATOM   505  N  NZ    . LYS A 1 66  ? -23.105 14.654  4.976   1.00 103.89 ? 66   LYS A NZ    1 
ATOM   506  N  N     . SER A 1 67  ? -22.857 8.433   9.831   1.00 66.85  ? 67   SER A N     1 
ATOM   507  C  CA    . SER A 1 67  ? -23.271 7.732   11.037  1.00 52.55  ? 67   SER A CA    1 
ATOM   508  C  C     . SER A 1 67  ? -23.112 8.612   12.275  1.00 59.87  ? 67   SER A C     1 
ATOM   509  O  O     . SER A 1 67  ? -22.408 9.632   12.268  1.00 60.95  ? 67   SER A O     1 
ATOM   510  C  CB    . SER A 1 67  ? -22.485 6.433   11.214  1.00 57.50  ? 67   SER A CB    1 
ATOM   511  O  OG    . SER A 1 67  ? -22.776 5.478   10.205  1.00 56.13  ? 67   SER A OG    1 
ATOM   512  N  N     . LYS A 1 68  ? -23.796 8.202   13.335  1.00 59.17  ? 68   LYS A N     1 
ATOM   513  C  CA    . LYS A 1 68  ? -23.757 8.865   14.631  1.00 54.99  ? 68   LYS A CA    1 
ATOM   514  C  C     . LYS A 1 68  ? -22.658 8.277   15.558  1.00 58.86  ? 68   LYS A C     1 
ATOM   515  O  O     . LYS A 1 68  ? -22.317 7.091   15.486  1.00 50.35  ? 68   LYS A O     1 
ATOM   516  C  CB    . LYS A 1 68  ? -25.144 8.736   15.281  1.00 51.13  ? 68   LYS A CB    1 
ATOM   517  C  CG    . LYS A 1 68  ? -25.182 8.992   16.774  1.00 61.77  ? 68   LYS A CG    1 
ATOM   518  C  CD    . LYS A 1 68  ? -26.527 8.662   17.379  1.00 60.30  ? 68   LYS A CD    1 
ATOM   519  C  CE    . LYS A 1 68  ? -26.583 9.083   18.843  1.00 64.29  ? 68   LYS A CE    1 
ATOM   520  N  NZ    . LYS A 1 68  ? -27.981 9.108   19.365  1.00 74.43  ? 68   LYS A NZ    1 
ATOM   521  N  N     . ILE A 1 69  ? -22.102 9.096   16.441  1.00 62.19  ? 69   ILE A N     1 
ATOM   522  C  CA    . ILE A 1 69  ? -21.245 8.542   17.475  1.00 55.57  ? 69   ILE A CA    1 
ATOM   523  C  C     . ILE A 1 69  ? -22.110 8.087   18.645  1.00 53.87  ? 69   ILE A C     1 
ATOM   524  O  O     . ILE A 1 69  ? -22.503 8.894   19.469  1.00 65.02  ? 69   ILE A O     1 
ATOM   525  C  CB    . ILE A 1 69  ? -20.184 9.552   17.967  1.00 52.44  ? 69   ILE A CB    1 
ATOM   526  C  CG1   . ILE A 1 69  ? -19.172 9.869   16.867  1.00 53.92  ? 69   ILE A CG1   1 
ATOM   527  C  CG2   . ILE A 1 69  ? -19.430 8.989   19.148  1.00 59.32  ? 69   ILE A CG2   1 
ATOM   528  C  CD1   . ILE A 1 69  ? -18.111 10.894  17.293  1.00 50.88  ? 69   ILE A CD1   1 
ATOM   529  N  N     . GLN A 1 70  ? -22.426 6.803   18.708  1.00 52.36  ? 70   GLN A N     1 
ATOM   530  C  CA    . GLN A 1 70  ? -23.101 6.247   19.882  1.00 53.85  ? 70   GLN A CA    1 
ATOM   531  C  C     . GLN A 1 70  ? -22.190 6.194   21.117  1.00 62.74  ? 70   GLN A C     1 
ATOM   532  O  O     . GLN A 1 70  ? -20.993 5.937   21.004  1.00 64.29  ? 70   GLN A O     1 
ATOM   533  C  CB    . GLN A 1 70  ? -23.622 4.849   19.570  1.00 51.41  ? 70   GLN A CB    1 
ATOM   534  C  CG    . GLN A 1 70  ? -24.472 4.816   18.314  1.00 47.11  ? 70   GLN A CG    1 
ATOM   535  C  CD    . GLN A 1 70  ? -25.087 3.472   18.066  1.00 48.76  ? 70   GLN A CD    1 
ATOM   536  O  OE1   . GLN A 1 70  ? -25.759 2.915   18.927  1.00 56.68  ? 70   GLN A OE1   1 
ATOM   537  N  NE2   . GLN A 1 70  ? -24.834 2.920   16.890  1.00 50.65  ? 70   GLN A NE2   1 
ATOM   538  N  N     . ILE A 1 71  ? -22.752 6.456   22.293  1.00 61.73  ? 71   ILE A N     1 
ATOM   539  C  CA    . ILE A 1 71  ? -22.025 6.277   23.542  1.00 51.43  ? 71   ILE A CA    1 
ATOM   540  C  C     . ILE A 1 71  ? -22.891 5.477   24.514  1.00 58.97  ? 71   ILE A C     1 
ATOM   541  O  O     . ILE A 1 71  ? -23.769 6.014   25.174  1.00 60.36  ? 71   ILE A O     1 
ATOM   542  C  CB    . ILE A 1 71  ? -21.611 7.613   24.158  1.00 47.07  ? 71   ILE A CB    1 
ATOM   543  C  CG1   . ILE A 1 71  ? -20.666 8.357   23.212  1.00 55.94  ? 71   ILE A CG1   1 
ATOM   544  C  CG2   . ILE A 1 71  ? -20.891 7.396   25.462  1.00 50.63  ? 71   ILE A CG2   1 
ATOM   545  C  CD1   . ILE A 1 71  ? -20.024 9.569   23.809  1.00 52.05  ? 71   ILE A CD1   1 
ATOM   546  N  N     . VAL A 1 72  ? -22.637 4.176   24.574  1.00 58.93  ? 72   VAL A N     1 
ATOM   547  C  CA    . VAL A 1 72  ? -23.449 3.264   25.344  1.00 55.62  ? 72   VAL A CA    1 
ATOM   548  C  C     . VAL A 1 72  ? -22.849 3.005   26.713  1.00 64.59  ? 72   VAL A C     1 
ATOM   549  O  O     . VAL A 1 72  ? -21.689 2.640   26.830  1.00 67.15  ? 72   VAL A O     1 
ATOM   550  C  CB    . VAL A 1 72  ? -23.624 1.934   24.603  1.00 59.24  ? 72   VAL A CB    1 
ATOM   551  C  CG1   . VAL A 1 72  ? -24.303 0.897   25.496  1.00 56.58  ? 72   VAL A CG1   1 
ATOM   552  C  CG2   . VAL A 1 72  ? -24.422 2.158   23.335  1.00 58.96  ? 72   VAL A CG2   1 
ATOM   553  N  N     . LYS A 1 73  ? -23.658 3.212   27.746  1.00 83.67  ? 73   LYS A N     1 
ATOM   554  C  CA    . LYS A 1 73  ? -23.264 2.977   29.124  1.00 76.28  ? 73   LYS A CA    1 
ATOM   555  C  C     . LYS A 1 73  ? -23.498 1.513   29.429  1.00 73.99  ? 73   LYS A C     1 
ATOM   556  O  O     . LYS A 1 73  ? -24.617 1.115   29.720  1.00 93.10  ? 73   LYS A O     1 
ATOM   557  C  CB    . LYS A 1 73  ? -24.069 3.862   30.092  1.00 83.77  ? 73   LYS A CB    1 
ATOM   558  C  CG    . LYS A 1 73  ? -25.003 4.933   29.430  1.00 94.40  ? 73   LYS A CG    1 
ATOM   559  C  CD    . LYS A 1 73  ? -24.209 6.149   28.887  1.00 91.24  ? 73   LYS A CD    1 
ATOM   560  C  CE    . LYS A 1 73  ? -25.079 7.277   28.310  1.00 96.61  ? 73   LYS A CE    1 
ATOM   561  N  NZ    . LYS A 1 73  ? -24.223 8.495   28.086  1.00 88.59  ? 73   LYS A NZ    1 
ATOM   562  N  N     . GLY A 1 74  ? -22.466 0.698   29.316  1.00 57.09  ? 74   GLY A N     1 
ATOM   563  C  CA    . GLY A 1 74  ? -22.549 -0.683  29.758  1.00 62.56  ? 74   GLY A CA    1 
ATOM   564  C  C     . GLY A 1 74  ? -22.237 -0.709  31.242  1.00 72.30  ? 74   GLY A C     1 
ATOM   565  O  O     . GLY A 1 74  ? -21.932 0.336   31.832  1.00 66.05  ? 74   GLY A O     1 
ATOM   566  N  N     . ASP A 1 75  ? -22.302 -1.887  31.855  1.00 79.36  ? 75   ASP A N     1 
ATOM   567  C  CA    . ASP A 1 75  ? -22.152 -1.957  33.299  1.00 81.20  ? 75   ASP A CA    1 
ATOM   568  C  C     . ASP A 1 75  ? -20.703 -1.684  33.712  1.00 83.38  ? 75   ASP A C     1 
ATOM   569  O  O     . ASP A 1 75  ? -20.449 -0.815  34.552  1.00 86.07  ? 75   ASP A O     1 
ATOM   570  C  CB    . ASP A 1 75  ? -22.633 -3.313  33.825  1.00 95.79  ? 75   ASP A CB    1 
ATOM   571  C  CG    . ASP A 1 75  ? -23.544 -3.179  35.057  1.00 107.30 ? 75   ASP A CG    1 
ATOM   572  O  OD1   . ASP A 1 75  ? -24.192 -2.113  35.221  1.00 101.75 ? 75   ASP A OD1   1 
ATOM   573  O  OD2   . ASP A 1 75  ? -23.622 -4.145  35.851  1.00 105.69 ? 75   ASP A OD2   1 
ATOM   574  N  N     . THR A 1 76  ? -19.748 -2.389  33.111  1.00 74.22  ? 76   THR A N     1 
ATOM   575  C  CA    . THR A 1 76  ? -18.352 -2.195  33.510  1.00 67.31  ? 76   THR A CA    1 
ATOM   576  C  C     . THR A 1 76  ? -17.594 -1.169  32.666  1.00 68.47  ? 76   THR A C     1 
ATOM   577  O  O     . THR A 1 76  ? -16.411 -0.934  32.909  1.00 72.27  ? 76   THR A O     1 
ATOM   578  C  CB    . THR A 1 76  ? -17.535 -3.519  33.465  1.00 59.91  ? 76   THR A CB    1 
ATOM   579  O  OG1   . THR A 1 76  ? -17.338 -3.934  32.112  1.00 66.83  ? 76   THR A OG1   1 
ATOM   580  C  CG2   . THR A 1 76  ? -18.227 -4.641  34.238  1.00 55.01  ? 76   THR A CG2   1 
ATOM   581  N  N     . ARG A 1 77  ? -18.253 -0.535  31.701  1.00 83.84  ? 77   ARG A N     1 
ATOM   582  C  CA    . ARG A 1 77  ? -17.498 0.139   30.639  1.00 88.05  ? 77   ARG A CA    1 
ATOM   583  C  C     . ARG A 1 77  ? -18.354 1.116   29.857  1.00 81.46  ? 77   ARG A C     1 
ATOM   584  O  O     . ARG A 1 77  ? -19.526 0.866   29.642  1.00 78.19  ? 77   ARG A O     1 
ATOM   585  C  CB    . ARG A 1 77  ? -16.926 -0.906  29.668  1.00 81.37  ? 77   ARG A CB    1 
ATOM   586  C  CG    . ARG A 1 77  ? -17.883 -1.212  28.505  1.00 85.61  ? 77   ARG A CG    1 
ATOM   587  C  CD    . ARG A 1 77  ? -17.693 -2.565  27.882  1.00 77.67  ? 77   ARG A CD    1 
ATOM   588  N  NE    . ARG A 1 77  ? -18.482 -2.806  26.668  1.00 79.53  ? 77   ARG A NE    1 
ATOM   589  C  CZ    . ARG A 1 77  ? -19.765 -2.510  26.492  1.00 82.90  ? 77   ARG A CZ    1 
ATOM   590  N  NH1   . ARG A 1 77  ? -20.492 -1.948  27.453  1.00 84.69  ? 77   ARG A NH1   1 
ATOM   591  N  NH2   . ARG A 1 77  ? -20.347 -2.797  25.335  1.00 85.98  ? 77   ARG A NH2   1 
ATOM   592  N  N     . TYR A 1 78  ? -17.784 2.236   29.436  1.00 67.59  ? 78   TYR A N     1 
ATOM   593  C  CA    . TYR A 1 78  ? -18.432 3.022   28.395  1.00 64.82  ? 78   TYR A CA    1 
ATOM   594  C  C     . TYR A 1 78  ? -17.967 2.566   27.011  1.00 68.45  ? 78   TYR A C     1 
ATOM   595  O  O     . TYR A 1 78  ? -16.814 2.160   26.841  1.00 66.91  ? 78   TYR A O     1 
ATOM   596  C  CB    . TYR A 1 78  ? -18.154 4.510   28.576  1.00 65.60  ? 78   TYR A CB    1 
ATOM   597  C  CG    . TYR A 1 78  ? -19.031 5.165   29.612  1.00 80.94  ? 78   TYR A CG    1 
ATOM   598  C  CD1   . TYR A 1 78  ? -20.378 5.398   29.356  1.00 82.65  ? 78   TYR A CD1   1 
ATOM   599  C  CD2   . TYR A 1 78  ? -18.511 5.593   30.827  1.00 82.12  ? 78   TYR A CD2   1 
ATOM   600  C  CE1   . TYR A 1 78  ? -21.190 5.992   30.297  1.00 81.55  ? 78   TYR A CE1   1 
ATOM   601  C  CE2   . TYR A 1 78  ? -19.319 6.199   31.774  1.00 86.03  ? 78   TYR A CE2   1 
ATOM   602  C  CZ    . TYR A 1 78  ? -20.653 6.401   31.498  1.00 88.45  ? 78   TYR A CZ    1 
ATOM   603  O  OH    . TYR A 1 78  ? -21.466 7.005   32.424  1.00 100.54 ? 78   TYR A OH    1 
ATOM   604  N  N     . GLU A 1 79  ? -18.856 2.638   26.025  1.00 62.22  ? 79   GLU A N     1 
ATOM   605  C  CA    . GLU A 1 79  ? -18.541 2.195   24.669  1.00 55.10  ? 79   GLU A CA    1 
ATOM   606  C  C     . GLU A 1 79  ? -18.805 3.290   23.637  1.00 51.91  ? 79   GLU A C     1 
ATOM   607  O  O     . GLU A 1 79  ? -19.948 3.589   23.312  1.00 53.46  ? 79   GLU A O     1 
ATOM   608  C  CB    . GLU A 1 79  ? -19.348 0.935   24.303  1.00 49.41  ? 79   GLU A CB    1 
ATOM   609  C  CG    . GLU A 1 79  ? -19.061 0.374   22.909  1.00 45.16  ? 79   GLU A CG    1 
ATOM   610  C  CD    . GLU A 1 79  ? -20.026 -0.754  22.476  1.00 59.58  ? 79   GLU A CD    1 
ATOM   611  O  OE1   . GLU A 1 79  ? -20.869 -1.207  23.295  1.00 61.89  ? 79   GLU A OE1   1 
ATOM   612  O  OE2   . GLU A 1 79  ? -19.943 -1.189  21.300  1.00 51.05  ? 79   GLU A OE2   1 
ATOM   613  N  N     . LEU A 1 80  ? -17.749 3.902   23.119  1.00 53.62  ? 80   LEU A N     1 
ATOM   614  C  CA    . LEU A 1 80  ? -17.921 4.730   21.944  1.00 49.58  ? 80   LEU A CA    1 
ATOM   615  C  C     . LEU A 1 80  ? -18.069 3.767   20.771  1.00 54.68  ? 80   LEU A C     1 
ATOM   616  O  O     . LEU A 1 80  ? -17.252 2.861   20.582  1.00 48.40  ? 80   LEU A O     1 
ATOM   617  C  CB    . LEU A 1 80  ? -16.758 5.703   21.748  1.00 45.72  ? 80   LEU A CB    1 
ATOM   618  C  CG    . LEU A 1 80  ? -16.817 6.676   20.555  1.00 54.03  ? 80   LEU A CG    1 
ATOM   619  C  CD1   . LEU A 1 80  ? -16.126 7.999   20.855  1.00 52.15  ? 80   LEU A CD1   1 
ATOM   620  C  CD2   . LEU A 1 80  ? -16.203 6.061   19.309  1.00 54.29  ? 80   LEU A CD2   1 
ATOM   621  N  N     . ARG A 1 81  ? -19.140 3.965   20.004  1.00 62.62  ? 81   ARG A N     1 
ATOM   622  C  CA    . ARG A 1 81  ? -19.480 3.094   18.890  1.00 59.38  ? 81   ARG A CA    1 
ATOM   623  C  C     . ARG A 1 81  ? -19.917 3.902   17.673  1.00 58.91  ? 81   ARG A C     1 
ATOM   624  O  O     . ARG A 1 81  ? -20.832 4.703   17.766  1.00 59.67  ? 81   ARG A O     1 
ATOM   625  C  CB    . ARG A 1 81  ? -20.595 2.132   19.296  1.00 57.03  ? 81   ARG A CB    1 
ATOM   626  C  CG    . ARG A 1 81  ? -20.960 1.133   18.222  1.00 57.70  ? 81   ARG A CG    1 
ATOM   627  C  CD    . ARG A 1 81  ? -22.307 0.513   18.496  1.00 59.22  ? 81   ARG A CD    1 
ATOM   628  N  NE    . ARG A 1 81  ? -22.336 -0.238  19.743  1.00 64.78  ? 81   ARG A NE    1 
ATOM   629  C  CZ    . ARG A 1 81  ? -23.409 -0.874  20.193  1.00 61.72  ? 81   ARG A CZ    1 
ATOM   630  N  NH1   . ARG A 1 81  ? -24.532 -0.836  19.506  1.00 65.39  ? 81   ARG A NH1   1 
ATOM   631  N  NH2   . ARG A 1 81  ? -23.367 -1.549  21.322  1.00 62.97  ? 81   ARG A NH2   1 
ATOM   632  N  N     . VAL A 1 82  ? -19.251 3.701   16.540  1.00 54.53  ? 82   VAL A N     1 
ATOM   633  C  CA    . VAL A 1 82  ? -19.761 4.174   15.257  1.00 49.26  ? 82   VAL A CA    1 
ATOM   634  C  C     . VAL A 1 82  ? -20.150 2.983   14.396  1.00 53.03  ? 82   VAL A C     1 
ATOM   635  O  O     . VAL A 1 82  ? -19.307 2.157   14.044  1.00 48.40  ? 82   VAL A O     1 
ATOM   636  C  CB    . VAL A 1 82  ? -18.746 5.010   14.488  1.00 46.49  ? 82   VAL A CB    1 
ATOM   637  C  CG1   . VAL A 1 82  ? -19.416 5.639   13.286  1.00 49.66  ? 82   VAL A CG1   1 
ATOM   638  C  CG2   . VAL A 1 82  ? -18.135 6.079   15.384  1.00 48.28  ? 82   VAL A CG2   1 
ATOM   639  N  N     . SER A 1 83  ? -21.436 2.884   14.081  1.00 61.60  ? 83   SER A N     1 
ATOM   640  C  CA    . SER A 1 83  ? -21.928 1.851   13.174  1.00 58.52  ? 83   SER A CA    1 
ATOM   641  C  C     . SER A 1 83  ? -21.837 2.382   11.735  1.00 60.07  ? 83   SER A C     1 
ATOM   642  O  O     . SER A 1 83  ? -22.580 3.299   11.347  1.00 57.13  ? 83   SER A O     1 
ATOM   643  C  CB    . SER A 1 83  ? -23.359 1.456   13.542  1.00 60.67  ? 83   SER A CB    1 
ATOM   644  O  OG    . SER A 1 83  ? -23.726 0.220   12.960  1.00 58.43  ? 83   SER A OG    1 
ATOM   645  N  N     . SER A 1 84  ? -20.915 1.820   10.958  1.00 55.33  ? 84   SER A N     1 
ATOM   646  C  CA    . SER A 1 84  ? -20.548 2.405   9.667   1.00 55.20  ? 84   SER A CA    1 
ATOM   647  C  C     . SER A 1 84  ? -19.634 1.530   8.799   1.00 53.86  ? 84   SER A C     1 
ATOM   648  O  O     . SER A 1 84  ? -18.483 1.281   9.150   1.00 60.24  ? 84   SER A O     1 
ATOM   649  C  CB    . SER A 1 84  ? -19.862 3.749   9.896   1.00 55.04  ? 84   SER A CB    1 
ATOM   650  O  OG    . SER A 1 84  ? -19.292 4.218   8.687   1.00 60.71  ? 84   SER A OG    1 
ATOM   651  N  N     . LYS A 1 85  ? -20.141 1.069   7.666   1.00 44.67  ? 85   LYS A N     1 
ATOM   652  C  CA    . LYS A 1 85  ? -19.339 0.263   6.750   1.00 43.26  ? 85   LYS A CA    1 
ATOM   653  C  C     . LYS A 1 85  ? -18.131 1.057   6.245   1.00 47.55  ? 85   LYS A C     1 
ATOM   654  O  O     . LYS A 1 85  ? -17.019 0.538   6.186   1.00 50.99  ? 85   LYS A O     1 
ATOM   655  C  CB    . LYS A 1 85  ? -20.211 -0.216  5.588   1.00 45.02  ? 85   LYS A CB    1 
ATOM   656  C  CG    . LYS A 1 85  ? -19.494 -0.875  4.447   1.00 45.24  ? 85   LYS A CG    1 
ATOM   657  C  CD    . LYS A 1 85  ? -20.434 -1.828  3.726   1.00 48.73  ? 85   LYS A CD    1 
ATOM   658  C  CE    . LYS A 1 85  ? -19.777 -2.460  2.514   1.00 50.43  ? 85   LYS A CE    1 
ATOM   659  N  NZ    . LYS A 1 85  ? -20.710 -3.367  1.783   1.00 47.96  ? 85   LYS A NZ    1 
ATOM   660  N  N     . LYS A 1 86  ? -18.344 2.325   5.909   1.00 44.40  ? 86   LYS A N     1 
ATOM   661  C  CA    . LYS A 1 86  ? -17.265 3.142   5.404   1.00 45.17  ? 86   LYS A CA    1 
ATOM   662  C  C     . LYS A 1 86  ? -16.156 3.245   6.439   1.00 50.35  ? 86   LYS A C     1 
ATOM   663  O  O     . LYS A 1 86  ? -15.002 2.996   6.130   1.00 45.75  ? 86   LYS A O     1 
ATOM   664  C  CB    . LYS A 1 86  ? -17.744 4.545   5.035   1.00 46.10  ? 86   LYS A CB    1 
ATOM   665  C  CG    . LYS A 1 86  ? -16.693 5.311   4.253   1.00 55.42  ? 86   LYS A CG    1 
ATOM   666  C  CD    . LYS A 1 86  ? -17.079 6.742   3.910   1.00 65.00  ? 86   LYS A CD    1 
ATOM   667  C  CE    . LYS A 1 86  ? -15.927 7.436   3.164   1.00 63.35  ? 86   LYS A CE    1 
ATOM   668  N  NZ    . LYS A 1 86  ? -16.126 8.902   2.982   1.00 68.00  ? 86   LYS A NZ    1 
ATOM   669  N  N     . LEU A 1 87  ? -16.514 3.612   7.667   1.00 49.69  ? 87   LEU A N     1 
ATOM   670  C  CA    . LEU A 1 87  ? -15.535 3.854   8.718   1.00 46.82  ? 87   LEU A CA    1 
ATOM   671  C  C     . LEU A 1 87  ? -14.868 2.554   9.177   1.00 53.79  ? 87   LEU A C     1 
ATOM   672  O  O     . LEU A 1 87  ? -13.706 2.546   9.574   1.00 51.08  ? 87   LEU A O     1 
ATOM   673  C  CB    . LEU A 1 87  ? -16.188 4.559   9.914   1.00 44.80  ? 87   LEU A CB    1 
ATOM   674  C  CG    . LEU A 1 87  ? -15.179 5.193   10.883  1.00 47.40  ? 87   LEU A CG    1 
ATOM   675  C  CD1   . LEU A 1 87  ? -14.388 6.287   10.194  1.00 42.65  ? 87   LEU A CD1   1 
ATOM   676  C  CD2   . LEU A 1 87  ? -15.825 5.719   12.151  1.00 44.42  ? 87   LEU A CD2   1 
ATOM   677  N  N     . TYR A 1 88  ? -15.602 1.455   9.126   1.00 48.83  ? 88   TYR A N     1 
ATOM   678  C  CA    . TYR A 1 88  ? -15.033 0.171   9.474   1.00 41.56  ? 88   TYR A CA    1 
ATOM   679  C  C     . TYR A 1 88  ? -13.890 -0.185  8.526   1.00 48.79  ? 88   TYR A C     1 
ATOM   680  O  O     . TYR A 1 88  ? -12.789 -0.525  8.964   1.00 52.27  ? 88   TYR A O     1 
ATOM   681  C  CB    . TYR A 1 88  ? -16.111 -0.903  9.443   1.00 45.61  ? 88   TYR A CB    1 
ATOM   682  C  CG    . TYR A 1 88  ? -15.578 -2.302  9.402   1.00 51.64  ? 88   TYR A CG    1 
ATOM   683  C  CD1   . TYR A 1 88  ? -15.318 -2.930  8.185   1.00 52.09  ? 88   TYR A CD1   1 
ATOM   684  C  CD2   . TYR A 1 88  ? -15.332 -3.013  10.580  1.00 50.66  ? 88   TYR A CD2   1 
ATOM   685  C  CE1   . TYR A 1 88  ? -14.820 -4.225  8.137   1.00 53.64  ? 88   TYR A CE1   1 
ATOM   686  C  CE2   . TYR A 1 88  ? -14.831 -4.309  10.542  1.00 50.12  ? 88   TYR A CE2   1 
ATOM   687  C  CZ    . TYR A 1 88  ? -14.580 -4.910  9.319   1.00 53.35  ? 88   TYR A CZ    1 
ATOM   688  O  OH    . TYR A 1 88  ? -14.094 -6.196  9.272   1.00 55.63  ? 88   TYR A OH    1 
ATOM   689  N  N     . TYR A 1 89  ? -14.138 -0.110  7.223   1.00 45.31  ? 89   TYR A N     1 
ATOM   690  C  CA    . TYR A 1 89  ? -13.086 -0.409  6.252   1.00 44.05  ? 89   TYR A CA    1 
ATOM   691  C  C     . TYR A 1 89  ? -11.980 0.642   6.249   1.00 45.91  ? 89   TYR A C     1 
ATOM   692  O  O     . TYR A 1 89  ? -10.820 0.341   5.993   1.00 47.04  ? 89   TYR A O     1 
ATOM   693  C  CB    . TYR A 1 89  ? -13.679 -0.559  4.861   1.00 39.30  ? 89   TYR A CB    1 
ATOM   694  C  CG    . TYR A 1 89  ? -14.363 -1.888  4.701   1.00 46.82  ? 89   TYR A CG    1 
ATOM   695  C  CD1   . TYR A 1 89  ? -13.636 -3.072  4.798   1.00 44.81  ? 89   TYR A CD1   1 
ATOM   696  C  CD2   . TYR A 1 89  ? -15.721 -1.970  4.470   1.00 40.79  ? 89   TYR A CD2   1 
ATOM   697  C  CE1   . TYR A 1 89  ? -14.235 -4.295  4.668   1.00 40.45  ? 89   TYR A CE1   1 
ATOM   698  C  CE2   . TYR A 1 89  ? -16.339 -3.201  4.334   1.00 48.25  ? 89   TYR A CE2   1 
ATOM   699  C  CZ    . TYR A 1 89  ? -15.591 -4.361  4.435   1.00 49.34  ? 89   TYR A CZ    1 
ATOM   700  O  OH    . TYR A 1 89  ? -16.203 -5.588  4.297   1.00 55.80  ? 89   TYR A OH    1 
ATOM   701  N  N     . TYR A 1 90  ? -12.330 1.872   6.558   1.00 42.00  ? 90   TYR A N     1 
ATOM   702  C  CA    . TYR A 1 90  ? -11.332 2.900   6.607   1.00 42.63  ? 90   TYR A CA    1 
ATOM   703  C  C     . TYR A 1 90  ? -10.249 2.433   7.565   1.00 48.09  ? 90   TYR A C     1 
ATOM   704  O  O     . TYR A 1 90  ? -9.068  2.409   7.217   1.00 53.86  ? 90   TYR A O     1 
ATOM   705  C  CB    . TYR A 1 90  ? -11.937 4.232   7.037   1.00 45.71  ? 90   TYR A CB    1 
ATOM   706  C  CG    . TYR A 1 90  ? -10.908 5.289   7.292   1.00 46.58  ? 90   TYR A CG    1 
ATOM   707  C  CD1   . TYR A 1 90  ? -10.279 5.945   6.235   1.00 50.79  ? 90   TYR A CD1   1 
ATOM   708  C  CD2   . TYR A 1 90  ? -10.563 5.642   8.585   1.00 44.89  ? 90   TYR A CD2   1 
ATOM   709  C  CE1   . TYR A 1 90  ? -9.320  6.927   6.467   1.00 44.26  ? 90   TYR A CE1   1 
ATOM   710  C  CE2   . TYR A 1 90  ? -9.610  6.620   8.831   1.00 47.91  ? 90   TYR A CE2   1 
ATOM   711  C  CZ    . TYR A 1 90  ? -8.992  7.250   7.765   1.00 48.75  ? 90   TYR A CZ    1 
ATOM   712  O  OH    . TYR A 1 90  ? -8.050  8.210   8.011   1.00 58.16  ? 90   TYR A OH    1 
ATOM   713  N  N     . PHE A 1 91  ? -10.668 1.978   8.739   1.00 49.00  ? 91   PHE A N     1 
ATOM   714  C  CA    . PHE A 1 91  ? -9.725  1.536   9.758   1.00 47.83  ? 91   PHE A CA    1 
ATOM   715  C  C     . PHE A 1 91  ? -9.153  0.153   9.486   1.00 47.92  ? 91   PHE A C     1 
ATOM   716  O  O     . PHE A 1 91  ? -7.955  -0.052  9.635   1.00 48.36  ? 91   PHE A O     1 
ATOM   717  C  CB    . PHE A 1 91  ? -10.374 1.577   11.140  1.00 40.48  ? 91   PHE A CB    1 
ATOM   718  C  CG    . PHE A 1 91  ? -10.355 2.941   11.748  1.00 44.65  ? 91   PHE A CG    1 
ATOM   719  C  CD1   . PHE A 1 91  ? -9.129  3.569   12.016  1.00 43.18  ? 91   PHE A CD1   1 
ATOM   720  C  CD2   . PHE A 1 91  ? -11.544 3.616   12.031  1.00 41.65  ? 91   PHE A CD2   1 
ATOM   721  C  CE1   . PHE A 1 91  ? -9.086  4.844   12.563  1.00 42.09  ? 91   PHE A CE1   1 
ATOM   722  C  CE2   . PHE A 1 91  ? -11.516 4.887   12.594  1.00 42.83  ? 91   PHE A CE2   1 
ATOM   723  C  CZ    . PHE A 1 91  ? -10.286 5.507   12.855  1.00 47.99  ? 91   PHE A CZ    1 
ATOM   724  N  N     . ALA A 1 92  ? -9.984  -0.789  9.074   1.00 47.72  ? 92   ALA A N     1 
ATOM   725  C  CA    . ALA A 1 92  ? -9.464  -2.114  8.757   1.00 50.44  ? 92   ALA A CA    1 
ATOM   726  C  C     . ALA A 1 92  ? -8.372  -2.064  7.656   1.00 54.12  ? 92   ALA A C     1 
ATOM   727  O  O     . ALA A 1 92  ? -7.352  -2.737  7.758   1.00 60.05  ? 92   ALA A O     1 
ATOM   728  C  CB    . ALA A 1 92  ? -10.608 -3.050  8.351   1.00 44.12  ? 92   ALA A CB    1 
ATOM   729  N  N     . ASN A 1 93  ? -8.572  -1.255  6.624   1.00 55.26  ? 93   ASN A N     1 
ATOM   730  C  CA    . ASN A 1 93  ? -7.590  -1.142  5.552   1.00 52.88  ? 93   ASN A CA    1 
ATOM   731  C  C     . ASN A 1 93  ? -6.332  -0.458  6.044   1.00 58.90  ? 93   ASN A C     1 
ATOM   732  O  O     . ASN A 1 93  ? -5.219  -0.799  5.629   1.00 60.16  ? 93   ASN A O     1 
ATOM   733  C  CB    . ASN A 1 93  ? -8.165  -0.372  4.351   1.00 49.85  ? 93   ASN A CB    1 
ATOM   734  C  CG    . ASN A 1 93  ? -9.196  -1.175  3.582   1.00 53.44  ? 93   ASN A CG    1 
ATOM   735  O  OD1   . ASN A 1 93  ? -9.183  -2.409  3.604   1.00 65.80  ? 93   ASN A OD1   1 
ATOM   736  N  ND2   . ASN A 1 93  ? -10.105 -0.481  2.905   1.00 56.58  ? 93   ASN A ND2   1 
ATOM   737  N  N     . MET A 1 94  ? -6.512  0.517   6.928   1.00 45.75  ? 94   MET A N     1 
ATOM   738  C  CA    . MET A 1 94  ? -5.387  1.249   7.462   1.00 43.68  ? 94   MET A CA    1 
ATOM   739  C  C     . MET A 1 94  ? -4.550  0.332   8.342   1.00 56.31  ? 94   MET A C     1 
ATOM   740  O  O     . MET A 1 94  ? -3.325  0.437   8.399   1.00 54.01  ? 94   MET A O     1 
ATOM   741  C  CB    . MET A 1 94  ? -5.863  2.451   8.254   1.00 38.82  ? 94   MET A CB    1 
ATOM   742  C  CG    . MET A 1 94  ? -4.751  3.398   8.656   1.00 49.39  ? 94   MET A CG    1 
ATOM   743  S  SD    . MET A 1 94  ? -5.351  4.660   9.769   1.00 58.37  ? 94   MET A SD    1 
ATOM   744  C  CE    . MET A 1 94  ? -3.838  5.489   10.227  1.00 67.51  ? 94   MET A CE    1 
ATOM   745  N  N     . LEU A 1 95  ? -5.229  -0.570  9.040   1.00 57.96  ? 95   LEU A N     1 
ATOM   746  C  CA    . LEU A 1 95  ? -4.556  -1.541  9.882   1.00 58.23  ? 95   LEU A CA    1 
ATOM   747  C  C     . LEU A 1 95  ? -3.761  -2.529  9.027   1.00 55.11  ? 95   LEU A C     1 
ATOM   748  O  O     . LEU A 1 95  ? -2.704  -2.996  9.428   1.00 54.92  ? 95   LEU A O     1 
ATOM   749  C  CB    . LEU A 1 95  ? -5.573  -2.277  10.762  1.00 54.81  ? 95   LEU A CB    1 
ATOM   750  C  CG    . LEU A 1 95  ? -5.033  -3.413  11.634  1.00 48.95  ? 95   LEU A CG    1 
ATOM   751  C  CD1   . LEU A 1 95  ? -3.977  -2.924  12.608  1.00 43.03  ? 95   LEU A CD1   1 
ATOM   752  C  CD2   . LEU A 1 95  ? -6.179  -4.106  12.341  1.00 43.52  ? 95   LEU A CD2   1 
ATOM   753  N  N     . GLU A 1 96  ? -4.267  -2.847  7.848   1.00 57.62  ? 96   GLU A N     1 
ATOM   754  C  CA    . GLU A 1 96  ? -3.593  -3.811  6.993   1.00 60.66  ? 96   GLU A CA    1 
ATOM   755  C  C     . GLU A 1 96  ? -2.290  -3.222  6.458   1.00 56.95  ? 96   GLU A C     1 
ATOM   756  O  O     . GLU A 1 96  ? -1.363  -3.944  6.155   1.00 59.58  ? 96   GLU A O     1 
ATOM   757  C  CB    . GLU A 1 96  ? -4.507  -4.242  5.838   1.00 61.74  ? 96   GLU A CB    1 
ATOM   758  C  CG    . GLU A 1 96  ? -4.894  -5.722  5.868   1.00 75.26  ? 96   GLU A CG    1 
ATOM   759  C  CD    . GLU A 1 96  ? -5.372  -6.243  4.514   1.00 96.08  ? 96   GLU A CD    1 
ATOM   760  O  OE1   . GLU A 1 96  ? -6.514  -5.916  4.114   1.00 104.64 ? 96   GLU A OE1   1 
ATOM   761  O  OE2   . GLU A 1 96  ? -4.604  -6.985  3.852   1.00 101.23 ? 96   GLU A OE2   1 
ATOM   762  N  N     . ARG A 1 97  ? -2.233  -1.900  6.368   1.00 58.11  ? 97   ARG A N     1 
ATOM   763  C  CA    . ARG A 1 97  ? -1.103  -1.186  5.793   1.00 54.04  ? 97   ARG A CA    1 
ATOM   764  C  C     . ARG A 1 97  ? -0.246  -0.558  6.921   1.00 60.67  ? 97   ARG A C     1 
ATOM   765  O  O     . ARG A 1 97  ? 0.488   0.417   6.731   1.00 60.88  ? 97   ARG A O     1 
ATOM   766  C  CB    . ARG A 1 97  ? -1.644  -0.153  4.763   1.00 61.28  ? 97   ARG A CB    1 
ATOM   767  C  CG    . ARG A 1 97  ? -1.697  1.318   5.201   1.00 68.85  ? 97   ARG A CG    1 
ATOM   768  C  CD    . ARG A 1 97  ? -2.555  2.202   4.309   1.00 80.77  ? 97   ARG A CD    1 
ATOM   769  N  NE    . ARG A 1 97  ? -2.517  3.590   4.771   1.00 86.25  ? 97   ARG A NE    1 
ATOM   770  C  CZ    . ARG A 1 97  ? -1.549  4.454   4.472   1.00 97.09  ? 97   ARG A CZ    1 
ATOM   771  N  NH1   . ARG A 1 97  ? -0.546  4.083   3.681   1.00 94.34  ? 97   ARG A NH1   1 
ATOM   772  N  NH2   . ARG A 1 97  ? -1.595  5.696   4.946   1.00 88.45  ? 97   ARG A NH2   1 
ATOM   773  N  N     . ILE A 1 98  ? -0.308  -1.157  8.107   1.00 56.73  ? 98   ILE A N     1 
ATOM   774  C  CA    . ILE A 1 98  ? 0.306   -0.534  9.278   1.00 58.99  ? 98   ILE A CA    1 
ATOM   775  C  C     . ILE A 1 98  ? 1.839   -0.444  9.196   1.00 65.12  ? 98   ILE A C     1 
ATOM   776  O  O     . ILE A 1 98  ? 2.435   0.484   9.750   1.00 58.67  ? 98   ILE A O     1 
ATOM   777  C  CB    . ILE A 1 98  ? -0.087  -1.271  10.574  1.00 55.09  ? 98   ILE A CB    1 
ATOM   778  C  CG1   . ILE A 1 98  ? 0.360   -0.463  11.796  1.00 56.34  ? 98   ILE A CG1   1 
ATOM   779  C  CG2   . ILE A 1 98  ? 0.476   -2.683  10.593  1.00 50.33  ? 98   ILE A CG2   1 
ATOM   780  C  CD1   . ILE A 1 98  ? -0.108  -1.035  13.094  1.00 52.01  ? 98   ILE A CD1   1 
ATOM   781  N  N     . ARG A 1 99  ? 2.470   -1.381  8.492   1.00 59.64  ? 99   ARG A N     1 
ATOM   782  C  CA    . ARG A 1 99  ? 3.921   -1.344  8.324   1.00 67.56  ? 99   ARG A CA    1 
ATOM   783  C  C     . ARG A 1 99  ? 4.368   -0.118  7.524   1.00 71.79  ? 99   ARG A C     1 
ATOM   784  O  O     . ARG A 1 99  ? 5.464   0.422   7.756   1.00 73.31  ? 99   ARG A O     1 
ATOM   785  C  CB    . ARG A 1 99  ? 4.424   -2.636  7.665   1.00 63.11  ? 99   ARG A CB    1 
ATOM   786  C  CG    . ARG A 1 99  ? 4.409   -3.807  8.630   1.00 57.69  ? 99   ARG A CG    1 
ATOM   787  C  CD    . ARG A 1 99  ? 4.388   -5.151  7.949   1.00 54.47  ? 99   ARG A CD    1 
ATOM   788  N  NE    . ARG A 1 99  ? 4.084   -6.211  8.917   1.00 79.00  ? 99   ARG A NE    1 
ATOM   789  C  CZ    . ARG A 1 99  ? 2.861   -6.694  9.153   1.00 88.58  ? 99   ARG A CZ    1 
ATOM   790  N  NH1   . ARG A 1 99  ? 1.800   -6.232  8.488   1.00 80.25  ? 99   ARG A NH1   1 
ATOM   791  N  NH2   . ARG A 1 99  ? 2.693   -7.652  10.058  1.00 84.64  ? 99   ARG A NH2   1 
ATOM   792  N  N     . LEU A 1 100 ? 3.504   0.343   6.624   1.00 60.58  ? 100  LEU A N     1 
ATOM   793  C  CA    . LEU A 1 100 ? 3.819   1.489   5.773   1.00 61.44  ? 100  LEU A CA    1 
ATOM   794  C  C     . LEU A 1 100 ? 3.578   2.821   6.446   1.00 60.42  ? 100  LEU A C     1 
ATOM   795  O  O     . LEU A 1 100 ? 3.761   3.859   5.822   1.00 67.38  ? 100  LEU A O     1 
ATOM   796  C  CB    . LEU A 1 100 ? 3.006   1.446   4.484   1.00 62.47  ? 100  LEU A CB    1 
ATOM   797  C  CG    . LEU A 1 100 ? 3.152   0.144   3.703   1.00 69.87  ? 100  LEU A CG    1 
ATOM   798  C  CD1   . LEU A 1 100 ? 2.050   0.062   2.689   1.00 56.29  ? 100  LEU A CD1   1 
ATOM   799  C  CD2   . LEU A 1 100 ? 4.522   0.064   3.032   1.00 65.89  ? 100  LEU A CD2   1 
ATOM   800  N  N     . PHE A 1 101 ? 3.158   2.802   7.705   1.00 60.30  ? 101  PHE A N     1 
ATOM   801  C  CA    . PHE A 1 101 ? 2.966   4.048   8.449   1.00 60.72  ? 101  PHE A CA    1 
ATOM   802  C  C     . PHE A 1 101 ? 4.198   4.944   8.329   1.00 64.53  ? 101  PHE A C     1 
ATOM   803  O  O     . PHE A 1 101 ? 5.327   4.444   8.246   1.00 71.71  ? 101  PHE A O     1 
ATOM   804  C  CB    . PHE A 1 101 ? 2.686   3.773   9.937   1.00 63.74  ? 101  PHE A CB    1 
ATOM   805  C  CG    . PHE A 1 101 ? 1.244   3.482   10.259  1.00 64.38  ? 101  PHE A CG    1 
ATOM   806  C  CD1   . PHE A 1 101 ? 0.367   3.035   9.284   1.00 59.00  ? 101  PHE A CD1   1 
ATOM   807  C  CD2   . PHE A 1 101 ? 0.764   3.682   11.551  1.00 61.57  ? 101  PHE A CD2   1 
ATOM   808  C  CE1   . PHE A 1 101 ? -0.959  2.775   9.599   1.00 61.55  ? 101  PHE A CE1   1 
ATOM   809  C  CE2   . PHE A 1 101 ? -0.558  3.430   11.869  1.00 52.50  ? 101  PHE A CE2   1 
ATOM   810  C  CZ    . PHE A 1 101 ? -1.420  2.979   10.898  1.00 56.33  ? 101  PHE A CZ    1 
ATOM   811  N  N     . ASN A 1 102 ? 3.987   6.257   8.329   1.00 68.79  ? 102  ASN A N     1 
ATOM   812  C  CA    . ASN A 1 102 ? 5.103   7.197   8.385   1.00 74.69  ? 102  ASN A CA    1 
ATOM   813  C  C     . ASN A 1 102 ? 5.343   7.687   9.809   1.00 73.88  ? 102  ASN A C     1 
ATOM   814  O  O     . ASN A 1 102 ? 4.562   7.404   10.707  1.00 77.29  ? 102  ASN A O     1 
ATOM   815  C  CB    . ASN A 1 102 ? 4.872   8.388   7.443   1.00 70.57  ? 102  ASN A CB    1 
ATOM   816  C  CG    . ASN A 1 102 ? 3.607   9.149   7.756   1.00 74.83  ? 102  ASN A CG    1 
ATOM   817  O  OD1   . ASN A 1 102 ? 3.357   9.533   8.900   1.00 81.41  ? 102  ASN A OD1   1 
ATOM   818  N  ND2   . ASN A 1 102 ? 2.796   9.381   6.732   1.00 80.69  ? 102  ASN A ND2   1 
ATOM   819  N  N     . MET A 1 103 ? 6.412   8.444   10.006  1.00 76.89  ? 103  MET A N     1 
ATOM   820  C  CA    . MET A 1 103 ? 6.817   8.854   11.342  1.00 78.27  ? 103  MET A CA    1 
ATOM   821  C  C     . MET A 1 103 ? 5.741   9.640   12.109  1.00 75.07  ? 103  MET A C     1 
ATOM   822  O  O     . MET A 1 103 ? 5.700   9.613   13.342  1.00 77.12  ? 103  MET A O     1 
ATOM   823  C  CB    . MET A 1 103 ? 8.108   9.665   11.245  1.00 78.24  ? 103  MET A CB    1 
ATOM   824  C  CG    . MET A 1 103 ? 8.629   10.169  12.561  1.00 79.07  ? 103  MET A CG    1 
ATOM   825  S  SD    . MET A 1 103 ? 10.198  11.020  12.354  1.00 98.79  ? 103  MET A SD    1 
ATOM   826  C  CE    . MET A 1 103 ? 10.517  11.538  14.042  1.00 80.68  ? 103  MET A CE    1 
ATOM   827  N  N     . ARG A 1 104 ? 4.861   10.328  11.394  1.00 76.84  ? 104  ARG A N     1 
ATOM   828  C  CA    . ARG A 1 104 ? 3.792   11.067  12.060  1.00 80.76  ? 104  ARG A CA    1 
ATOM   829  C  C     . ARG A 1 104 ? 2.792   10.113  12.683  1.00 77.99  ? 104  ARG A C     1 
ATOM   830  O  O     . ARG A 1 104 ? 2.407   10.238  13.845  1.00 72.05  ? 104  ARG A O     1 
ATOM   831  C  CB    . ARG A 1 104 ? 3.077   11.979  11.078  1.00 77.06  ? 104  ARG A CB    1 
ATOM   832  C  CG    . ARG A 1 104 ? 2.620   13.268  11.700  1.00 82.52  ? 104  ARG A CG    1 
ATOM   833  C  CD    . ARG A 1 104 ? 1.725   14.014  10.743  1.00 94.58  ? 104  ARG A CD    1 
ATOM   834  N  NE    . ARG A 1 104 ? 1.521   15.385  11.182  1.00 106.07 ? 104  ARG A NE    1 
ATOM   835  C  CZ    . ARG A 1 104 ? 0.663   15.731  12.136  1.00 108.33 ? 104  ARG A CZ    1 
ATOM   836  N  NH1   . ARG A 1 104 ? -0.059  14.804  12.767  1.00 100.19 ? 104  ARG A NH1   1 
ATOM   837  N  NH2   . ARG A 1 104 ? 0.538   17.005  12.469  1.00 101.86 ? 104  ARG A NH2   1 
ATOM   838  N  N     . GLU A 1 105 ? 2.375   9.158   11.870  1.00 66.87  ? 105  GLU A N     1 
ATOM   839  C  CA    . GLU A 1 105 ? 1.422   8.148   12.261  1.00 66.52  ? 105  GLU A CA    1 
ATOM   840  C  C     . GLU A 1 105 ? 1.950   7.216   13.353  1.00 67.54  ? 105  GLU A C     1 
ATOM   841  O  O     . GLU A 1 105 ? 1.230   6.902   14.308  1.00 65.79  ? 105  GLU A O     1 
ATOM   842  C  CB    . GLU A 1 105 ? 1.023   7.364   11.022  1.00 60.96  ? 105  GLU A CB    1 
ATOM   843  C  CG    . GLU A 1 105 ? 0.204   8.203   10.072  1.00 66.77  ? 105  GLU A CG    1 
ATOM   844  C  CD    . GLU A 1 105 ? 0.095   7.578   8.722   1.00 70.79  ? 105  GLU A CD    1 
ATOM   845  O  OE1   . GLU A 1 105 ? 0.948   6.725   8.423   1.00 71.54  ? 105  GLU A OE1   1 
ATOM   846  O  OE2   . GLU A 1 105 ? -0.838  7.928   7.971   1.00 77.00  ? 105  GLU A OE2   1 
ATOM   847  N  N     . GLN A 1 106 ? 3.196   6.772   13.211  1.00 63.29  ? 106  GLN A N     1 
ATOM   848  C  CA    . GLN A 1 106 ? 3.792   5.864   14.178  1.00 56.69  ? 106  GLN A CA    1 
ATOM   849  C  C     . GLN A 1 106 ? 3.726   6.475   15.557  1.00 58.03  ? 106  GLN A C     1 
ATOM   850  O  O     . GLN A 1 106 ? 3.348   5.811   16.516  1.00 58.79  ? 106  GLN A O     1 
ATOM   851  C  CB    . GLN A 1 106 ? 5.242   5.546   13.809  1.00 63.35  ? 106  GLN A CB    1 
ATOM   852  C  CG    . GLN A 1 106 ? 5.462   5.004   12.406  1.00 66.67  ? 106  GLN A CG    1 
ATOM   853  C  CD    . GLN A 1 106 ? 6.937   4.808   12.095  1.00 71.17  ? 106  GLN A CD    1 
ATOM   854  O  OE1   . GLN A 1 106 ? 7.796   5.209   12.876  1.00 62.11  ? 106  GLN A OE1   1 
ATOM   855  N  NE2   . GLN A 1 106 ? 7.234   4.235   10.930  1.00 68.28  ? 106  GLN A NE2   1 
ATOM   856  N  N     . ILE A 1 107 ? 4.079   7.747   15.664  1.00 61.20  ? 107  ILE A N     1 
ATOM   857  C  CA    . ILE A 1 107 ? 4.064   8.383   16.969  1.00 62.32  ? 107  ILE A CA    1 
ATOM   858  C  C     . ILE A 1 107 ? 2.631   8.416   17.461  1.00 58.94  ? 107  ILE A C     1 
ATOM   859  O  O     . ILE A 1 107 ? 2.341   7.998   18.584  1.00 61.93  ? 107  ILE A O     1 
ATOM   860  C  CB    . ILE A 1 107 ? 4.671   9.805   16.941  1.00 67.06  ? 107  ILE A CB    1 
ATOM   861  C  CG1   . ILE A 1 107 ? 6.137   9.753   16.509  1.00 61.56  ? 107  ILE A CG1   1 
ATOM   862  C  CG2   . ILE A 1 107 ? 4.555   10.483  18.307  1.00 65.91  ? 107  ILE A CG2   1 
ATOM   863  C  CD1   . ILE A 1 107 ? 6.868   11.077  16.705  1.00 70.36  ? 107  ILE A CD1   1 
ATOM   864  N  N     . ALA A 1 108 ? 1.729   8.869   16.599  1.00 63.54  ? 108  ALA A N     1 
ATOM   865  C  CA    . ALA A 1 108 ? 0.321   8.918   16.950  1.00 57.98  ? 108  ALA A CA    1 
ATOM   866  C  C     . ALA A 1 108 ? -0.218  7.521   17.279  1.00 58.49  ? 108  ALA A C     1 
ATOM   867  O  O     . ALA A 1 108 ? -0.926  7.352   18.275  1.00 59.94  ? 108  ALA A O     1 
ATOM   868  C  CB    . ALA A 1 108 ? -0.463  9.538   15.844  1.00 64.98  ? 108  ALA A CB    1 
ATOM   869  N  N     . PHE A 1 109 ? 0.128   6.517   16.474  1.00 46.23  ? 109  PHE A N     1 
ATOM   870  C  CA    . PHE A 1 109 ? -0.310  5.159   16.791  1.00 47.96  ? 109  PHE A CA    1 
ATOM   871  C  C     . PHE A 1 109 ? 0.216   4.671   18.139  1.00 55.65  ? 109  PHE A C     1 
ATOM   872  O  O     . PHE A 1 109 ? -0.542  4.058   18.910  1.00 51.68  ? 109  PHE A O     1 
ATOM   873  C  CB    . PHE A 1 109 ? 0.097   4.173   15.705  1.00 42.29  ? 109  PHE A CB    1 
ATOM   874  C  CG    . PHE A 1 109 ? -0.367  2.762   15.963  1.00 45.25  ? 109  PHE A CG    1 
ATOM   875  C  CD1   . PHE A 1 109 ? -1.665  2.387   15.681  1.00 46.02  ? 109  PHE A CD1   1 
ATOM   876  C  CD2   . PHE A 1 109 ? 0.507   1.802   16.464  1.00 52.98  ? 109  PHE A CD2   1 
ATOM   877  C  CE1   . PHE A 1 109 ? -2.100  1.086   15.916  1.00 49.09  ? 109  PHE A CE1   1 
ATOM   878  C  CE2   . PHE A 1 109 ? 0.087   0.492   16.684  1.00 54.23  ? 109  PHE A CE2   1 
ATOM   879  C  CZ    . PHE A 1 109 ? -1.227  0.134   16.409  1.00 47.18  ? 109  PHE A CZ    1 
ATOM   880  N  N     . ILE A 1 110 ? 1.493   4.938   18.429  1.00 50.68  ? 110  ILE A N     1 
ATOM   881  C  CA    . ILE A 1 110 ? 2.075   4.501   19.694  1.00 43.38  ? 110  ILE A CA    1 
ATOM   882  C  C     . ILE A 1 110 ? 1.444   5.243   20.863  1.00 45.48  ? 110  ILE A C     1 
ATOM   883  O  O     . ILE A 1 110 ? 1.112   4.626   21.879  1.00 49.70  ? 110  ILE A O     1 
ATOM   884  C  CB    . ILE A 1 110 ? 3.589   4.694   19.725  1.00 49.97  ? 110  ILE A CB    1 
ATOM   885  C  CG1   . ILE A 1 110 ? 4.252   3.854   18.651  1.00 51.73  ? 110  ILE A CG1   1 
ATOM   886  C  CG2   . ILE A 1 110 ? 4.158   4.276   21.069  1.00 39.74  ? 110  ILE A CG2   1 
ATOM   887  C  CD1   . ILE A 1 110 ? 5.722   4.150   18.513  1.00 44.83  ? 110  ILE A CD1   1 
ATOM   888  N  N     . LYS A 1 111 ? 1.267   6.555   20.729  1.00 48.16  ? 111  LYS A N     1 
ATOM   889  C  CA    . LYS A 1 111 ? 0.554   7.319   21.763  1.00 51.33  ? 111  LYS A CA    1 
ATOM   890  C  C     . LYS A 1 111 ? -0.826  6.732   22.025  1.00 53.70  ? 111  LYS A C     1 
ATOM   891  O  O     . LYS A 1 111 ? -1.258  6.618   23.168  1.00 51.41  ? 111  LYS A O     1 
ATOM   892  C  CB    . LYS A 1 111 ? 0.401   8.792   21.378  1.00 53.81  ? 111  LYS A CB    1 
ATOM   893  C  CG    . LYS A 1 111 ? -0.368  9.593   22.427  1.00 60.03  ? 111  LYS A CG    1 
ATOM   894  C  CD    . LYS A 1 111 ? -0.537  11.081  22.072  1.00 70.27  ? 111  LYS A CD    1 
ATOM   895  C  CE    . LYS A 1 111 ? -1.235  11.851  23.213  1.00 74.30  ? 111  LYS A CE    1 
ATOM   896  N  NZ    . LYS A 1 111 ? -1.237  13.332  22.989  1.00 90.69  ? 111  LYS A NZ    1 
ATOM   897  N  N     . GLY A 1 112 ? -1.514  6.357   20.948  1.00 52.38  ? 112  GLY A N     1 
ATOM   898  C  CA    . GLY A 1 112 ? -2.828  5.762   21.069  1.00 52.67  ? 112  GLY A CA    1 
ATOM   899  C  C     . GLY A 1 112 ? -2.752  4.459   21.827  1.00 48.59  ? 112  GLY A C     1 
ATOM   900  O  O     . GLY A 1 112 ? -3.373  4.301   22.881  1.00 46.71  ? 112  GLY A O     1 
ATOM   901  N  N     . LEU A 1 113 ? -1.961  3.539   21.285  1.00 47.19  ? 113  LEU A N     1 
ATOM   902  C  CA    . LEU A 1 113 ? -1.733  2.229   21.894  1.00 46.10  ? 113  LEU A CA    1 
ATOM   903  C  C     . LEU A 1 113 ? -1.356  2.346   23.358  1.00 48.77  ? 113  LEU A C     1 
ATOM   904  O  O     . LEU A 1 113 ? -1.874  1.594   24.193  1.00 45.20  ? 113  LEU A O     1 
ATOM   905  C  CB    . LEU A 1 113 ? -0.648  1.475   21.139  1.00 48.09  ? 113  LEU A CB    1 
ATOM   906  C  CG    . LEU A 1 113 ? -0.553  -0.013  21.445  1.00 47.32  ? 113  LEU A CG    1 
ATOM   907  C  CD1   . LEU A 1 113 ? -1.827  -0.688  21.051  1.00 42.41  ? 113  LEU A CD1   1 
ATOM   908  C  CD2   . LEU A 1 113 ? 0.629   -0.631  20.706  1.00 50.46  ? 113  LEU A CD2   1 
ATOM   909  N  N     . TYR A 1 114 ? -0.481  3.304   23.677  1.00 47.15  ? 114  TYR A N     1 
ATOM   910  C  CA    . TYR A 1 114 ? -0.100  3.513   25.073  1.00 49.56  ? 114  TYR A CA    1 
ATOM   911  C  C     . TYR A 1 114 ? -1.246  4.004   25.981  1.00 49.70  ? 114  TYR A C     1 
ATOM   912  O  O     . TYR A 1 114 ? -1.435  3.464   27.056  1.00 53.18  ? 114  TYR A O     1 
ATOM   913  C  CB    . TYR A 1 114 ? 1.087   4.484   25.198  1.00 50.73  ? 114  TYR A CB    1 
ATOM   914  C  CG    . TYR A 1 114 ? 1.832   4.244   26.513  1.00 49.88  ? 114  TYR A CG    1 
ATOM   915  C  CD1   . TYR A 1 114 ? 1.406   4.825   27.697  1.00 45.82  ? 114  TYR A CD1   1 
ATOM   916  C  CD2   . TYR A 1 114 ? 2.910   3.360   26.574  1.00 52.12  ? 114  TYR A CD2   1 
ATOM   917  C  CE1   . TYR A 1 114 ? 2.052   4.572   28.893  1.00 49.49  ? 114  TYR A CE1   1 
ATOM   918  C  CE2   . TYR A 1 114 ? 3.562   3.090   27.773  1.00 51.69  ? 114  TYR A CE2   1 
ATOM   919  C  CZ    . TYR A 1 114 ? 3.134   3.698   28.927  1.00 54.89  ? 114  TYR A CZ    1 
ATOM   920  O  OH    . TYR A 1 114 ? 3.801   3.421   30.103  1.00 54.81  ? 114  TYR A OH    1 
ATOM   921  N  N     . VAL A 1 115 ? -1.985  5.027   25.569  1.00 44.04  ? 115  VAL A N     1 
ATOM   922  C  CA    . VAL A 1 115 ? -3.103  5.547   26.357  1.00 46.36  ? 115  VAL A CA    1 
ATOM   923  C  C     . VAL A 1 115 ? -4.134  4.442   26.634  1.00 53.01  ? 115  VAL A C     1 
ATOM   924  O  O     . VAL A 1 115 ? -4.872  4.494   27.596  1.00 52.90  ? 115  VAL A O     1 
ATOM   925  C  CB    . VAL A 1 115 ? -3.771  6.734   25.609  1.00 55.53  ? 115  VAL A CB    1 
ATOM   926  C  CG1   . VAL A 1 115 ? -5.060  7.216   26.276  1.00 54.55  ? 115  VAL A CG1   1 
ATOM   927  C  CG2   . VAL A 1 115 ? -2.784  7.863   25.429  1.00 48.16  ? 115  VAL A CG2   1 
ATOM   928  N  N     . ALA A 1 116 ? -4.172  3.433   25.781  1.00 58.19  ? 116  ALA A N     1 
ATOM   929  C  CA    . ALA A 1 116 ? -5.075  2.320   25.967  1.00 56.55  ? 116  ALA A CA    1 
ATOM   930  C  C     . ALA A 1 116 ? -4.427  1.164   26.752  1.00 55.32  ? 116  ALA A C     1 
ATOM   931  O  O     . ALA A 1 116 ? -5.029  0.601   27.657  1.00 60.66  ? 116  ALA A O     1 
ATOM   932  C  CB    . ALA A 1 116 ? -5.561  1.845   24.610  1.00 50.94  ? 116  ALA A CB    1 
ATOM   933  N  N     . GLU A 1 117 ? -3.194  0.819   26.410  1.00 53.90  ? 117  GLU A N     1 
ATOM   934  C  CA    . GLU A 1 117 ? -2.604  -0.413  26.904  1.00 54.35  ? 117  GLU A CA    1 
ATOM   935  C  C     . GLU A 1 117 ? -1.361  -0.255  27.752  1.00 54.82  ? 117  GLU A C     1 
ATOM   936  O  O     . GLU A 1 117 ? -0.773  -1.250  28.172  1.00 51.19  ? 117  GLU A O     1 
ATOM   937  C  CB    . GLU A 1 117 ? -2.267  -1.291  25.717  1.00 58.40  ? 117  GLU A CB    1 
ATOM   938  C  CG    . GLU A 1 117 ? -3.466  -1.548  24.837  1.00 58.12  ? 117  GLU A CG    1 
ATOM   939  C  CD    . GLU A 1 117 ? -4.106  -2.851  25.154  1.00 49.83  ? 117  GLU A CD    1 
ATOM   940  O  OE1   . GLU A 1 117 ? -4.769  -2.956  26.201  1.00 55.10  ? 117  GLU A OE1   1 
ATOM   941  O  OE2   . GLU A 1 117 ? -3.946  -3.763  24.342  1.00 45.63  ? 117  GLU A OE2   1 
ATOM   942  N  N     . GLY A 1 118 ? -0.960  0.990   27.991  1.00 54.79  ? 118  GLY A N     1 
ATOM   943  C  CA    . GLY A 1 118 ? 0.286   1.277   28.676  1.00 56.68  ? 118  GLY A CA    1 
ATOM   944  C  C     . GLY A 1 118 ? 0.243   1.334   30.190  1.00 56.06  ? 118  GLY A C     1 
ATOM   945  O  O     . GLY A 1 118 ? -0.808  1.425   30.804  1.00 55.83  ? 118  GLY A O     1 
ATOM   946  N  N     . ASP A 1 119 ? 1.418   1.245   30.790  1.00 65.15  ? 119  ASP A N     1 
ATOM   947  C  CA    . ASP A 1 119 ? 1.608   1.581   32.190  1.00 64.85  ? 119  ASP A CA    1 
ATOM   948  C  C     . ASP A 1 119 ? 1.284   3.052   32.385  1.00 66.07  ? 119  ASP A C     1 
ATOM   949  O  O     . ASP A 1 119 ? 1.949   3.901   31.810  1.00 79.48  ? 119  ASP A O     1 
ATOM   950  C  CB    . ASP A 1 119 ? 3.056   1.302   32.595  1.00 63.37  ? 119  ASP A CB    1 
ATOM   951  C  CG    . ASP A 1 119 ? 3.209   0.993   34.061  1.00 62.23  ? 119  ASP A CG    1 
ATOM   952  O  OD1   . ASP A 1 119 ? 2.948   1.891   34.892  1.00 55.81  ? 119  ASP A OD1   1 
ATOM   953  O  OD2   . ASP A 1 119 ? 3.631   -0.139  34.372  1.00 68.61  ? 119  ASP A OD2   1 
ATOM   954  N  N     . LYS A 1 120 ? 0.290   3.385   33.185  1.00 65.43  ? 120  LYS A N     1 
ATOM   955  C  CA    . LYS A 1 120 ? -0.123  4.782   33.205  1.00 78.60  ? 120  LYS A CA    1 
ATOM   956  C  C     . LYS A 1 120 ? 0.344   5.520   34.430  1.00 79.40  ? 120  LYS A C     1 
ATOM   957  O  O     . LYS A 1 120 ? 0.118   6.717   34.571  1.00 85.89  ? 120  LYS A O     1 
ATOM   958  C  CB    . LYS A 1 120 ? -1.630  4.870   33.054  1.00 76.46  ? 120  LYS A CB    1 
ATOM   959  C  CG    . LYS A 1 120 ? -1.947  4.359   31.699  1.00 90.80  ? 120  LYS A CG    1 
ATOM   960  C  CD    . LYS A 1 120 ? -3.374  4.337   31.390  1.00 97.36  ? 120  LYS A CD    1 
ATOM   961  C  CE    . LYS A 1 120 ? -3.506  3.692   30.056  1.00 91.81  ? 120  LYS A CE    1 
ATOM   962  N  NZ    . LYS A 1 120 ? -4.934  3.678   29.671  1.00 74.96  ? 120  LYS A NZ    1 
ATOM   963  N  N     . THR A 1 121 ? 1.030   4.796   35.296  1.00 65.46  ? 121  THR A N     1 
ATOM   964  C  CA    . THR A 1 121 ? 1.741   5.408   36.397  1.00 68.26  ? 121  THR A CA    1 
ATOM   965  C  C     . THR A 1 121 ? 3.024   6.071   35.890  1.00 64.99  ? 121  THR A C     1 
ATOM   966  O  O     . THR A 1 121 ? 3.534   6.989   36.512  1.00 70.20  ? 121  THR A O     1 
ATOM   967  C  CB    . THR A 1 121 ? 2.097   4.378   37.458  1.00 63.21  ? 121  THR A CB    1 
ATOM   968  O  OG1   . THR A 1 121 ? 3.160   3.574   36.960  1.00 58.23  ? 121  THR A OG1   1 
ATOM   969  C  CG2   . THR A 1 121 ? 0.898   3.476   37.746  1.00 62.00  ? 121  THR A CG2   1 
ATOM   970  N  N     . LEU A 1 122 ? 3.518   5.592   34.749  1.00 64.71  ? 122  LEU A N     1 
ATOM   971  C  CA    . LEU A 1 122 ? 4.800   5.994   34.149  1.00 66.71  ? 122  LEU A CA    1 
ATOM   972  C  C     . LEU A 1 122 ? 6.025   5.711   35.014  1.00 64.34  ? 122  LEU A C     1 
ATOM   973  O  O     . LEU A 1 122 ? 7.111   6.186   34.687  1.00 67.19  ? 122  LEU A O     1 
ATOM   974  C  CB    . LEU A 1 122 ? 4.810   7.484   33.777  1.00 69.09  ? 122  LEU A CB    1 
ATOM   975  C  CG    . LEU A 1 122 ? 3.802   8.037   32.769  1.00 72.50  ? 122  LEU A CG    1 
ATOM   976  C  CD1   . LEU A 1 122 ? 4.293   9.370   32.213  1.00 71.34  ? 122  LEU A CD1   1 
ATOM   977  C  CD2   . LEU A 1 122 ? 3.543   7.054   31.639  1.00 70.58  ? 122  LEU A CD2   1 
ATOM   978  N  N     . LYS A 1 123 ? 5.857   4.963   36.108  1.00 66.51  ? 123  LYS A N     1 
ATOM   979  C  CA    . LYS A 1 123 ? 6.996   4.520   36.908  1.00 64.61  ? 123  LYS A CA    1 
ATOM   980  C  C     . LYS A 1 123 ? 7.852   3.603   36.053  1.00 70.48  ? 123  LYS A C     1 
ATOM   981  O  O     . LYS A 1 123 ? 9.071   3.784   35.946  1.00 69.95  ? 123  LYS A O     1 
ATOM   982  C  CB    . LYS A 1 123 ? 6.550   3.818   38.185  1.00 63.08  ? 123  LYS A CB    1 
ATOM   983  C  CG    . LYS A 1 123 ? 5.520   4.598   38.977  1.00 73.43  ? 123  LYS A CG    1 
ATOM   984  C  CD    . LYS A 1 123 ? 5.200   3.923   40.309  1.00 77.70  ? 123  LYS A CD    1 
ATOM   985  C  CE    . LYS A 1 123 ? 3.926   4.499   40.925  1.00 83.11  ? 123  LYS A CE    1 
ATOM   986  N  NZ    . LYS A 1 123 ? 3.615   3.874   42.238  1.00 88.48  ? 123  LYS A NZ    1 
ATOM   987  N  N     . ARG A 1 124 ? 7.208   2.630   35.419  1.00 66.64  ? 124  ARG A N     1 
ATOM   988  C  CA    . ARG A 1 124 ? 7.829   1.981   34.280  1.00 62.64  ? 124  ARG A CA    1 
ATOM   989  C  C     . ARG A 1 124 ? 6.971   2.219   33.058  1.00 56.21  ? 124  ARG A C     1 
ATOM   990  O  O     . ARG A 1 124 ? 5.810   2.592   33.170  1.00 51.92  ? 124  ARG A O     1 
ATOM   991  C  CB    . ARG A 1 124 ? 8.035   0.494   34.522  1.00 55.62  ? 124  ARG A CB    1 
ATOM   992  C  CG    . ARG A 1 124 ? 7.935   0.122   35.953  1.00 63.74  ? 124  ARG A CG    1 
ATOM   993  C  CD    . ARG A 1 124 ? 8.044   -1.347  36.095  1.00 57.02  ? 124  ARG A CD    1 
ATOM   994  N  NE    . ARG A 1 124 ? 7.295   -1.781  37.259  1.00 58.34  ? 124  ARG A NE    1 
ATOM   995  C  CZ    . ARG A 1 124 ? 7.280   -3.029  37.702  1.00 65.24  ? 124  ARG A CZ    1 
ATOM   996  N  NH1   . ARG A 1 124 ? 8.011   -3.963  37.075  1.00 56.87  ? 124  ARG A NH1   1 
ATOM   997  N  NH2   . ARG A 1 124 ? 6.538   -3.330  38.769  1.00 67.46  ? 124  ARG A NH2   1 
ATOM   998  N  N     . LEU A 1 125 ? 7.579   2.019   31.897  1.00 54.97  ? 125  LEU A N     1 
ATOM   999  C  CA    . LEU A 1 125 ? 6.941   2.223   30.614  1.00 47.40  ? 125  LEU A CA    1 
ATOM   1000 C  C     . LEU A 1 125 ? 6.709   0.871   29.939  1.00 53.25  ? 125  LEU A C     1 
ATOM   1001 O  O     . LEU A 1 125 ? 7.625   0.251   29.395  1.00 50.70  ? 125  LEU A O     1 
ATOM   1002 C  CB    . LEU A 1 125 ? 7.797   3.136   29.767  1.00 46.82  ? 125  LEU A CB    1 
ATOM   1003 C  CG    . LEU A 1 125 ? 8.182   4.404   30.543  1.00 52.94  ? 125  LEU A CG    1 
ATOM   1004 C  CD1   . LEU A 1 125 ? 9.257   5.180   29.796  1.00 56.93  ? 125  LEU A CD1   1 
ATOM   1005 C  CD2   . LEU A 1 125 ? 6.978   5.293   30.830  1.00 60.67  ? 125  LEU A CD2   1 
ATOM   1006 N  N     . ARG A 1 126 ? 5.469   0.408   30.019  1.00 53.10  ? 126  ARG A N     1 
ATOM   1007 C  CA    . ARG A 1 126 ? 5.119   -0.940  29.626  1.00 50.01  ? 126  ARG A CA    1 
ATOM   1008 C  C     . ARG A 1 126 ? 3.858   -0.902  28.785  1.00 52.05  ? 126  ARG A C     1 
ATOM   1009 O  O     . ARG A 1 126 ? 2.939   -0.149  29.100  1.00 48.15  ? 126  ARG A O     1 
ATOM   1010 C  CB    . ARG A 1 126 ? 4.912   -1.818  30.863  1.00 52.58  ? 126  ARG A CB    1 
ATOM   1011 C  CG    . ARG A 1 126 ? 6.186   -2.091  31.658  1.00 49.58  ? 126  ARG A CG    1 
ATOM   1012 C  CD    . ARG A 1 126 ? 5.930   -3.011  32.837  1.00 45.91  ? 126  ARG A CD    1 
ATOM   1013 N  NE    . ARG A 1 126 ? 5.115   -2.366  33.858  1.00 44.61  ? 126  ARG A NE    1 
ATOM   1014 C  CZ    . ARG A 1 126 ? 4.604   -2.990  34.912  1.00 47.01  ? 126  ARG A CZ    1 
ATOM   1015 N  NH1   . ARG A 1 126 ? 4.808   -4.289  35.084  1.00 43.04  ? 126  ARG A NH1   1 
ATOM   1016 N  NH2   . ARG A 1 126 ? 3.872   -2.318  35.785  1.00 47.45  ? 126  ARG A NH2   1 
ATOM   1017 N  N     . ILE A 1 127 ? 3.821   -1.700  27.716  1.00 54.52  ? 127  ILE A N     1 
ATOM   1018 C  CA    . ILE A 1 127 ? 2.638   -1.836  26.865  1.00 50.08  ? 127  ILE A CA    1 
ATOM   1019 C  C     . ILE A 1 127 ? 2.275   -3.308  26.758  1.00 45.56  ? 127  ILE A C     1 
ATOM   1020 O  O     . ILE A 1 127 ? 3.097   -4.101  26.356  1.00 47.46  ? 127  ILE A O     1 
ATOM   1021 C  CB    . ILE A 1 127 ? 2.874   -1.273  25.442  1.00 50.22  ? 127  ILE A CB    1 
ATOM   1022 C  CG1   . ILE A 1 127 ? 3.328   0.184   25.505  1.00 55.80  ? 127  ILE A CG1   1 
ATOM   1023 C  CG2   . ILE A 1 127 ? 1.613   -1.352  24.623  1.00 49.89  ? 127  ILE A CG2   1 
ATOM   1024 C  CD1   . ILE A 1 127 ? 3.750   0.760   24.163  1.00 53.12  ? 127  ILE A CD1   1 
ATOM   1025 N  N     . TRP A 1 128 ? 1.053   -3.679  27.111  1.00 53.22  ? 128  TRP A N     1 
ATOM   1026 C  CA    . TRP A 1 128 ? 0.639   -5.086  27.043  1.00 54.27  ? 128  TRP A CA    1 
ATOM   1027 C  C     . TRP A 1 128 ? -0.255  -5.430  25.851  1.00 53.67  ? 128  TRP A C     1 
ATOM   1028 O  O     . TRP A 1 128 ? -1.198  -4.699  25.556  1.00 54.76  ? 128  TRP A O     1 
ATOM   1029 C  CB    . TRP A 1 128 ? -0.107  -5.470  28.314  1.00 54.06  ? 128  TRP A CB    1 
ATOM   1030 C  CG    . TRP A 1 128 ? 0.726   -5.473  29.537  1.00 53.26  ? 128  TRP A CG    1 
ATOM   1031 C  CD1   . TRP A 1 128 ? 1.462   -6.512  30.013  1.00 53.18  ? 128  TRP A CD1   1 
ATOM   1032 C  CD2   . TRP A 1 128 ? 0.897   -4.395  30.462  1.00 57.55  ? 128  TRP A CD2   1 
ATOM   1033 N  NE1   . TRP A 1 128 ? 2.083   -6.156  31.179  1.00 59.53  ? 128  TRP A NE1   1 
ATOM   1034 C  CE2   . TRP A 1 128 ? 1.755   -4.861  31.482  1.00 61.06  ? 128  TRP A CE2   1 
ATOM   1035 C  CE3   . TRP A 1 128 ? 0.413   -3.083  30.529  1.00 50.09  ? 128  TRP A CE3   1 
ATOM   1036 C  CZ2   . TRP A 1 128 ? 2.148   -4.060  32.557  1.00 55.35  ? 128  TRP A CZ2   1 
ATOM   1037 C  CZ3   . TRP A 1 128 ? 0.783   -2.294  31.607  1.00 55.37  ? 128  TRP A CZ3   1 
ATOM   1038 C  CH2   . TRP A 1 128 ? 1.654   -2.782  32.601  1.00 57.96  ? 128  TRP A CH2   1 
ATOM   1039 N  N     . ASN A 1 129 ? 0.022   -6.550  25.187  1.00 50.42  ? 129  ASN A N     1 
ATOM   1040 C  CA    . ASN A 1 129 ? -0.864  -7.051  24.136  1.00 50.16  ? 129  ASN A CA    1 
ATOM   1041 C  C     . ASN A 1 129 ? -0.591  -8.523  23.789  1.00 52.68  ? 129  ASN A C     1 
ATOM   1042 O  O     . ASN A 1 129 ? 0.547   -8.991  23.879  1.00 52.29  ? 129  ASN A O     1 
ATOM   1043 C  CB    . ASN A 1 129 ? -0.733  -6.193  22.885  1.00 45.17  ? 129  ASN A CB    1 
ATOM   1044 C  CG    . ASN A 1 129 ? -1.969  -6.243  22.023  1.00 52.74  ? 129  ASN A CG    1 
ATOM   1045 O  OD1   . ASN A 1 129 ? -2.063  -7.044  21.090  1.00 57.44  ? 129  ASN A OD1   1 
ATOM   1046 N  ND2   . ASN A 1 129 ? -2.934  -5.381  22.326  1.00 50.38  ? 129  ASN A ND2   1 
ATOM   1047 N  N     . LYS A 1 130 ? -1.626  -9.256  23.394  1.00 47.44  ? 130  LYS A N     1 
ATOM   1048 C  CA    . LYS A 1 130 ? -1.444  -10.658 23.027  1.00 45.80  ? 130  LYS A CA    1 
ATOM   1049 C  C     . LYS A 1 130 ? -0.830  -10.820 21.657  1.00 46.55  ? 130  LYS A C     1 
ATOM   1050 O  O     . LYS A 1 130 ? -0.298  -11.867 21.332  1.00 55.45  ? 130  LYS A O     1 
ATOM   1051 C  CB    . LYS A 1 130 ? -2.765  -11.401 23.066  1.00 40.25  ? 130  LYS A CB    1 
ATOM   1052 C  CG    . LYS A 1 130 ? -3.394  -11.399 24.428  1.00 49.45  ? 130  LYS A CG    1 
ATOM   1053 C  CD    . LYS A 1 130 ? -4.582  -12.331 24.472  1.00 57.22  ? 130  LYS A CD    1 
ATOM   1054 C  CE    . LYS A 1 130 ? -4.162  -13.747 24.141  1.00 58.71  ? 130  LYS A CE    1 
ATOM   1055 N  NZ    . LYS A 1 130 ? -5.123  -14.728 24.717  1.00 63.37  ? 130  LYS A NZ    1 
ATOM   1056 N  N     . ASN A 1 131 ? -0.915  -9.781  20.843  1.00 53.12  ? 131  ASN A N     1 
ATOM   1057 C  CA    . ASN A 1 131 ? -0.401  -9.849  19.491  1.00 49.98  ? 131  ASN A CA    1 
ATOM   1058 C  C     . ASN A 1 131 ? 1.065   -9.452  19.484  1.00 53.20  ? 131  ASN A C     1 
ATOM   1059 O  O     . ASN A 1 131 ? 1.399   -8.271  19.375  1.00 52.77  ? 131  ASN A O     1 
ATOM   1060 C  CB    . ASN A 1 131 ? -1.225  -8.951  18.555  1.00 57.02  ? 131  ASN A CB    1 
ATOM   1061 C  CG    . ASN A 1 131 ? -0.887  -9.149  17.064  1.00 57.80  ? 131  ASN A CG    1 
ATOM   1062 O  OD1   . ASN A 1 131 ? 0.215   -9.552  16.695  1.00 55.25  ? 131  ASN A OD1   1 
ATOM   1063 N  ND2   . ASN A 1 131 ? -1.851  -8.842  16.206  1.00 62.20  ? 131  ASN A ND2   1 
ATOM   1064 N  N     . LYS A 1 132 ? 1.937   -10.451 19.588  1.00 53.65  ? 132  LYS A N     1 
ATOM   1065 C  CA    . LYS A 1 132 ? 3.377   -10.218 19.588  1.00 54.46  ? 132  LYS A CA    1 
ATOM   1066 C  C     . LYS A 1 132 ? 3.848   -9.469  18.335  1.00 52.66  ? 132  LYS A C     1 
ATOM   1067 O  O     . LYS A 1 132 ? 4.656   -8.546  18.430  1.00 56.99  ? 132  LYS A O     1 
ATOM   1068 C  CB    . LYS A 1 132 ? 4.111   -11.559 19.734  1.00 57.39  ? 132  LYS A CB    1 
ATOM   1069 C  CG    . LYS A 1 132 ? 5.621   -11.494 19.659  1.00 57.11  ? 132  LYS A CG    1 
ATOM   1070 C  CD    . LYS A 1 132 ? 6.227   -12.823 20.077  1.00 65.73  ? 132  LYS A CD    1 
ATOM   1071 C  CE    . LYS A 1 132 ? 7.751   -12.732 20.175  1.00 71.56  ? 132  LYS A CE    1 
ATOM   1072 N  NZ    . LYS A 1 132 ? 8.348   -14.024 20.629  1.00 78.48  ? 132  LYS A NZ    1 
ATOM   1073 N  N     . ALA A 1 133 ? 3.329   -9.863  17.173  1.00 53.68  ? 133  ALA A N     1 
ATOM   1074 C  CA    . ALA A 1 133 ? 3.685   -9.246  15.887  1.00 56.20  ? 133  ALA A CA    1 
ATOM   1075 C  C     . ALA A 1 133 ? 3.458   -7.740  15.892  1.00 57.89  ? 133  ALA A C     1 
ATOM   1076 O  O     . ALA A 1 133 ? 4.282   -6.968  15.413  1.00 58.79  ? 133  ALA A O     1 
ATOM   1077 C  CB    . ALA A 1 133 ? 2.888   -9.879  14.768  1.00 47.79  ? 133  ALA A CB    1 
ATOM   1078 N  N     . LEU A 1 134 ? 2.320   -7.335  16.436  1.00 56.30  ? 134  LEU A N     1 
ATOM   1079 C  CA    . LEU A 1 134 ? 2.018   -5.929  16.606  1.00 52.56  ? 134  LEU A CA    1 
ATOM   1080 C  C     . LEU A 1 134 ? 3.095   -5.263  17.462  1.00 51.66  ? 134  LEU A C     1 
ATOM   1081 O  O     . LEU A 1 134 ? 3.609   -4.195  17.117  1.00 54.56  ? 134  LEU A O     1 
ATOM   1082 C  CB    . LEU A 1 134 ? 0.621   -5.762  17.231  1.00 47.82  ? 134  LEU A CB    1 
ATOM   1083 C  CG    . LEU A 1 134 ? 0.219   -4.362  17.714  1.00 48.83  ? 134  LEU A CG    1 
ATOM   1084 C  CD1   . LEU A 1 134 ? -0.099  -3.430  16.553  1.00 45.74  ? 134  LEU A CD1   1 
ATOM   1085 C  CD2   . LEU A 1 134 ? -0.935  -4.438  18.685  1.00 48.25  ? 134  LEU A CD2   1 
ATOM   1086 N  N     . LEU A 1 135 ? 3.449   -5.899  18.576  1.00 50.58  ? 135  LEU A N     1 
ATOM   1087 C  CA    . LEU A 1 135 ? 4.474   -5.343  19.458  1.00 48.78  ? 135  LEU A CA    1 
ATOM   1088 C  C     . LEU A 1 135 ? 5.842   -5.281  18.781  1.00 50.73  ? 135  LEU A C     1 
ATOM   1089 O  O     . LEU A 1 135 ? 6.585   -4.307  18.960  1.00 46.65  ? 135  LEU A O     1 
ATOM   1090 C  CB    . LEU A 1 135 ? 4.564   -6.141  20.746  1.00 44.10  ? 135  LEU A CB    1 
ATOM   1091 C  CG    . LEU A 1 135 ? 3.317   -5.958  21.609  1.00 47.29  ? 135  LEU A CG    1 
ATOM   1092 C  CD1   . LEU A 1 135 ? 3.578   -6.514  22.989  1.00 44.88  ? 135  LEU A CD1   1 
ATOM   1093 C  CD2   . LEU A 1 135 ? 2.894   -4.486  21.676  1.00 37.95  ? 135  LEU A CD2   1 
ATOM   1094 N  N     . GLU A 1 136 ? 6.165   -6.305  17.993  1.00 58.39  ? 136  GLU A N     1 
ATOM   1095 C  CA    . GLU A 1 136 ? 7.435   -6.328  17.280  1.00 60.71  ? 136  GLU A CA    1 
ATOM   1096 C  C     . GLU A 1 136 ? 7.513   -5.136  16.341  1.00 61.76  ? 136  GLU A C     1 
ATOM   1097 O  O     . GLU A 1 136 ? 8.591   -4.553  16.160  1.00 55.90  ? 136  GLU A O     1 
ATOM   1098 C  CB    . GLU A 1 136 ? 7.622   -7.643  16.513  1.00 65.20  ? 136  GLU A CB    1 
ATOM   1099 C  CG    . GLU A 1 136 ? 7.918   -8.842  17.413  1.00 69.46  ? 136  GLU A CG    1 
ATOM   1100 C  CD    . GLU A 1 136 ? 8.036   -10.155 16.649  1.00 74.23  ? 136  GLU A CD    1 
ATOM   1101 O  OE1   . GLU A 1 136 ? 7.601   -10.200 15.471  1.00 71.40  ? 136  GLU A OE1   1 
ATOM   1102 O  OE2   . GLU A 1 136 ? 8.558   -11.140 17.238  1.00 70.74  ? 136  GLU A OE2   1 
ATOM   1103 N  N     . ILE A 1 137 ? 6.366   -4.753  15.772  1.00 56.18  ? 137  ILE A N     1 
ATOM   1104 C  CA    . ILE A 1 137 ? 6.326   -3.604  14.868  1.00 56.03  ? 137  ILE A CA    1 
ATOM   1105 C  C     . ILE A 1 137 ? 6.550   -2.304  15.635  1.00 56.89  ? 137  ILE A C     1 
ATOM   1106 O  O     . ILE A 1 137 ? 7.360   -1.467  15.229  1.00 53.76  ? 137  ILE A O     1 
ATOM   1107 C  CB    . ILE A 1 137 ? 4.993   -3.521  14.094  1.00 58.89  ? 137  ILE A CB    1 
ATOM   1108 C  CG1   . ILE A 1 137 ? 4.875   -4.688  13.115  1.00 60.68  ? 137  ILE A CG1   1 
ATOM   1109 C  CG2   . ILE A 1 137 ? 4.896   -2.206  13.319  1.00 53.69  ? 137  ILE A CG2   1 
ATOM   1110 C  CD1   . ILE A 1 137 ? 3.532   -4.749  12.388  1.00 66.71  ? 137  ILE A CD1   1 
ATOM   1111 N  N     . VAL A 1 138 ? 5.835   -2.133  16.746  1.00 53.56  ? 138  VAL A N     1 
ATOM   1112 C  CA    . VAL A 1 138 ? 6.006   -0.936  17.565  1.00 50.31  ? 138  VAL A CA    1 
ATOM   1113 C  C     . VAL A 1 138 ? 7.459   -0.850  18.027  1.00 50.17  ? 138  VAL A C     1 
ATOM   1114 O  O     . VAL A 1 138 ? 8.032   0.242   18.119  1.00 49.89  ? 138  VAL A O     1 
ATOM   1115 C  CB    . VAL A 1 138 ? 5.021   -0.929  18.778  1.00 44.25  ? 138  VAL A CB    1 
ATOM   1116 C  CG1   . VAL A 1 138 ? 5.437   0.071   19.846  1.00 43.34  ? 138  VAL A CG1   1 
ATOM   1117 C  CG2   . VAL A 1 138 ? 3.652   -0.601  18.303  1.00 47.64  ? 138  VAL A CG2   1 
ATOM   1118 N  N     . SER A 1 139 ? 8.057   -2.014  18.281  1.00 56.81  ? 139  SER A N     1 
ATOM   1119 C  CA    . SER A 1 139 ? 9.435   -2.095  18.764  1.00 58.07  ? 139  SER A CA    1 
ATOM   1120 C  C     . SER A 1 139 ? 10.441  -1.470  17.794  1.00 61.28  ? 139  SER A C     1 
ATOM   1121 O  O     . SER A 1 139 ? 11.285  -0.649  18.194  1.00 55.77  ? 139  SER A O     1 
ATOM   1122 C  CB    . SER A 1 139 ? 9.820   -3.546  19.020  1.00 58.38  ? 139  SER A CB    1 
ATOM   1123 O  OG    . SER A 1 139 ? 11.059  -3.594  19.693  1.00 60.76  ? 139  SER A OG    1 
ATOM   1124 N  N     . ARG A 1 140 ? 10.338  -1.855  16.523  1.00 51.17  ? 140  ARG A N     1 
ATOM   1125 C  CA    . ARG A 1 140 ? 11.204  -1.298  15.492  1.00 53.26  ? 140  ARG A CA    1 
ATOM   1126 C  C     . ARG A 1 140 ? 11.019  0.195   15.330  1.00 57.23  ? 140  ARG A C     1 
ATOM   1127 O  O     . ARG A 1 140 ? 12.002  0.934   15.323  1.00 61.24  ? 140  ARG A O     1 
ATOM   1128 C  CB    . ARG A 1 140 ? 11.000  -2.025  14.171  1.00 50.43  ? 140  ARG A CB    1 
ATOM   1129 C  CG    . ARG A 1 140 ? 10.925  -3.519  14.389  1.00 56.55  ? 140  ARG A CG    1 
ATOM   1130 C  CD    . ARG A 1 140 ? 10.939  -4.323  13.127  1.00 65.46  ? 140  ARG A CD    1 
ATOM   1131 N  NE    . ARG A 1 140 ? 10.890  -5.757  13.410  1.00 77.84  ? 140  ARG A NE    1 
ATOM   1132 C  CZ    . ARG A 1 140 ? 9.905   -6.567  13.019  1.00 84.86  ? 140  ARG A CZ    1 
ATOM   1133 N  NH1   . ARG A 1 140 ? 8.878   -6.095  12.310  1.00 73.15  ? 140  ARG A NH1   1 
ATOM   1134 N  NH2   . ARG A 1 140 ? 9.950   -7.858  13.332  1.00 87.00  ? 140  ARG A NH2   1 
ATOM   1135 N  N     . TRP A 1 141 ? 9.782   0.660   15.252  1.00 58.71  ? 141  TRP A N     1 
ATOM   1136 C  CA    . TRP A 1 141 ? 9.564   2.098   15.221  1.00 59.04  ? 141  TRP A CA    1 
ATOM   1137 C  C     . TRP A 1 141 ? 10.229  2.777   16.418  1.00 64.94  ? 141  TRP A C     1 
ATOM   1138 O  O     . TRP A 1 141 ? 10.822  3.856   16.286  1.00 68.14  ? 141  TRP A O     1 
ATOM   1139 C  CB    . TRP A 1 141 ? 8.075   2.420   15.197  1.00 63.95  ? 141  TRP A CB    1 
ATOM   1140 C  CG    . TRP A 1 141 ? 7.359   1.908   13.990  1.00 65.19  ? 141  TRP A CG    1 
ATOM   1141 C  CD1   . TRP A 1 141 ? 7.914   1.461   12.819  1.00 65.85  ? 141  TRP A CD1   1 
ATOM   1142 C  CD2   . TRP A 1 141 ? 5.946   1.783   13.838  1.00 69.09  ? 141  TRP A CD2   1 
ATOM   1143 N  NE1   . TRP A 1 141 ? 6.924   1.064   11.945  1.00 74.12  ? 141  TRP A NE1   1 
ATOM   1144 C  CE2   . TRP A 1 141 ? 5.708   1.252   12.549  1.00 71.28  ? 141  TRP A CE2   1 
ATOM   1145 C  CE3   . TRP A 1 141 ? 4.858   2.066   14.663  1.00 63.42  ? 141  TRP A CE3   1 
ATOM   1146 C  CZ2   . TRP A 1 141 ? 4.429   1.011   12.075  1.00 65.03  ? 141  TRP A CZ2   1 
ATOM   1147 C  CZ3   . TRP A 1 141 ? 3.591   1.827   14.189  1.00 62.08  ? 141  TRP A CZ3   1 
ATOM   1148 C  CH2   . TRP A 1 141 ? 3.385   1.301   12.908  1.00 66.33  ? 141  TRP A CH2   1 
ATOM   1149 N  N     . LEU A 1 142 ? 10.146  2.140   17.583  1.00 60.81  ? 142  LEU A N     1 
ATOM   1150 C  CA    . LEU A 1 142 ? 10.756  2.709   18.776  1.00 64.08  ? 142  LEU A CA    1 
ATOM   1151 C  C     . LEU A 1 142 ? 12.287  2.664   18.667  1.00 67.95  ? 142  LEU A C     1 
ATOM   1152 O  O     . LEU A 1 142 ? 12.972  3.625   19.030  1.00 66.35  ? 142  LEU A O     1 
ATOM   1153 C  CB    . LEU A 1 142 ? 10.280  1.975   20.023  1.00 62.48  ? 142  LEU A CB    1 
ATOM   1154 C  CG    . LEU A 1 142 ? 8.860   2.238   20.531  1.00 65.26  ? 142  LEU A CG    1 
ATOM   1155 C  CD1   . LEU A 1 142 ? 8.495   1.180   21.562  1.00 56.82  ? 142  LEU A CD1   1 
ATOM   1156 C  CD2   . LEU A 1 142 ? 8.732   3.632   21.124  1.00 54.90  ? 142  LEU A CD2   1 
ATOM   1157 N  N     . ASN A 1 143 ? 12.819  1.553   18.158  1.00 64.71  ? 143  ASN A N     1 
ATOM   1158 C  CA    . ASN A 1 143 ? 14.259  1.449   17.912  1.00 66.21  ? 143  ASN A CA    1 
ATOM   1159 C  C     . ASN A 1 143 ? 14.757  2.518   16.934  1.00 66.61  ? 143  ASN A C     1 
ATOM   1160 O  O     . ASN A 1 143 ? 15.706  3.236   17.226  1.00 67.82  ? 143  ASN A O     1 
ATOM   1161 C  CB    . ASN A 1 143 ? 14.625  0.051   17.390  1.00 67.01  ? 143  ASN A CB    1 
ATOM   1162 C  CG    . ASN A 1 143 ? 14.807  -0.973  18.513  1.00 64.40  ? 143  ASN A CG    1 
ATOM   1163 O  OD1   . ASN A 1 143 ? 15.422  -0.681  19.542  1.00 63.99  ? 143  ASN A OD1   1 
ATOM   1164 N  ND2   . ASN A 1 143 ? 14.278  -2.181  18.313  1.00 63.69  ? 143  ASN A ND2   1 
ATOM   1165 N  N     . ASN A 1 144 ? 14.097  2.639   15.785  1.00 67.43  ? 144  ASN A N     1 
ATOM   1166 C  CA    . ASN A 1 144 ? 14.480  3.619   14.768  1.00 63.60  ? 144  ASN A CA    1 
ATOM   1167 C  C     . ASN A 1 144 ? 14.137  5.062   15.181  1.00 66.64  ? 144  ASN A C     1 
ATOM   1168 O  O     . ASN A 1 144 ? 14.244  5.997   14.386  1.00 66.36  ? 144  ASN A O     1 
ATOM   1169 C  CB    . ASN A 1 144 ? 13.821  3.274   13.420  1.00 61.84  ? 144  ASN A CB    1 
ATOM   1170 C  CG    . ASN A 1 144 ? 14.303  1.915   12.836  1.00 74.71  ? 144  ASN A CG    1 
ATOM   1171 O  OD1   . ASN A 1 144 ? 15.312  1.342   13.277  1.00 71.81  ? 144  ASN A OD1   1 
ATOM   1172 N  ND2   . ASN A 1 144 ? 13.576  1.410   11.833  1.00 70.71  ? 144  ASN A ND2   1 
ATOM   1173 N  N     . LEU A 1 145 ? 13.750  5.230   16.441  1.00 74.64  ? 145  LEU A N     1 
ATOM   1174 C  CA    . LEU A 1 145 ? 13.416  6.533   17.005  1.00 72.76  ? 145  LEU A CA    1 
ATOM   1175 C  C     . LEU A 1 145 ? 14.294  6.841   18.213  1.00 79.28  ? 145  LEU A C     1 
ATOM   1176 O  O     . LEU A 1 145 ? 14.067  7.822   18.933  1.00 79.81  ? 145  LEU A O     1 
ATOM   1177 C  CB    . LEU A 1 145 ? 11.947  6.573   17.429  1.00 74.49  ? 145  LEU A CB    1 
ATOM   1178 C  CG    . LEU A 1 145 ? 10.853  7.036   16.469  1.00 80.90  ? 145  LEU A CG    1 
ATOM   1179 C  CD1   . LEU A 1 145 ? 9.492   6.624   17.022  1.00 74.48  ? 145  LEU A CD1   1 
ATOM   1180 C  CD2   . LEU A 1 145 ? 10.915  8.555   16.296  1.00 78.65  ? 145  LEU A CD2   1 
ATOM   1181 N  N     . GLY A 1 146 ? 15.275  5.980   18.461  1.00 60.80  ? 146  GLY A N     1 
ATOM   1182 C  CA    . GLY A 1 146 ? 16.170  6.185   19.578  1.00 57.47  ? 146  GLY A CA    1 
ATOM   1183 C  C     . GLY A 1 146 ? 15.588  5.753   20.906  1.00 62.04  ? 146  GLY A C     1 
ATOM   1184 O  O     . GLY A 1 146 ? 15.938  6.303   21.952  1.00 63.45  ? 146  GLY A O     1 
ATOM   1185 N  N     . VAL A 1 147 ? 14.699  4.765   20.880  1.00 68.85  ? 147  VAL A N     1 
ATOM   1186 C  CA    . VAL A 1 147 ? 14.096  4.279   22.121  1.00 70.25  ? 147  VAL A CA    1 
ATOM   1187 C  C     . VAL A 1 147 ? 14.249  2.769   22.279  1.00 67.55  ? 147  VAL A C     1 
ATOM   1188 O  O     . VAL A 1 147 ? 13.623  1.988   21.567  1.00 66.90  ? 147  VAL A O     1 
ATOM   1189 C  CB    . VAL A 1 147 ? 12.614  4.632   22.199  1.00 65.90  ? 147  VAL A CB    1 
ATOM   1190 C  CG1   . VAL A 1 147 ? 12.067  4.258   23.575  1.00 67.53  ? 147  VAL A CG1   1 
ATOM   1191 C  CG2   . VAL A 1 147 ? 12.415  6.112   21.917  1.00 66.35  ? 147  VAL A CG2   1 
ATOM   1192 N  N     . ARG A 1 148 ? 15.091  2.371   23.221  1.00 66.24  ? 148  ARG A N     1 
ATOM   1193 C  CA    . ARG A 1 148 ? 15.398  0.968   23.440  1.00 63.67  ? 148  ARG A CA    1 
ATOM   1194 C  C     . ARG A 1 148 ? 14.274  0.271   24.191  1.00 59.27  ? 148  ARG A C     1 
ATOM   1195 O  O     . ARG A 1 148 ? 13.606  0.868   25.048  1.00 53.37  ? 148  ARG A O     1 
ATOM   1196 C  CB    . ARG A 1 148 ? 16.716  0.829   24.206  1.00 68.58  ? 148  ARG A CB    1 
ATOM   1197 C  CG    . ARG A 1 148 ? 17.950  1.261   23.433  1.00 73.83  ? 148  ARG A CG    1 
ATOM   1198 C  CD    . ARG A 1 148 ? 19.119  1.435   24.377  1.00 81.74  ? 148  ARG A CD    1 
ATOM   1199 N  NE    . ARG A 1 148 ? 19.215  2.800   24.895  1.00 78.59  ? 148  ARG A NE    1 
ATOM   1200 C  CZ    . ARG A 1 148 ? 19.992  3.162   25.914  1.00 77.66  ? 148  ARG A CZ    1 
ATOM   1201 N  NH1   . ARG A 1 148 ? 20.719  2.252   26.550  1.00 83.77  ? 148  ARG A NH1   1 
ATOM   1202 N  NH2   . ARG A 1 148 ? 20.027  4.425   26.316  1.00 71.64  ? 148  ARG A NH2   1 
ATOM   1203 N  N     . ASN A 1 149 ? 14.085  -1.007  23.882  1.00 44.48  ? 149  ASN A N     1 
ATOM   1204 C  CA    . ASN A 1 149 ? 12.926  -1.714  24.371  1.00 47.06  ? 149  ASN A CA    1 
ATOM   1205 C  C     . ASN A 1 149 ? 13.092  -3.206  24.184  1.00 48.34  ? 149  ASN A C     1 
ATOM   1206 O  O     . ASN A 1 149 ? 13.893  -3.649  23.377  1.00 50.35  ? 149  ASN A O     1 
ATOM   1207 C  CB    . ASN A 1 149 ? 11.661  -1.234  23.641  1.00 48.19  ? 149  ASN A CB    1 
ATOM   1208 C  CG    . ASN A 1 149 ? 11.682  -1.571  22.156  1.00 46.62  ? 149  ASN A CG    1 
ATOM   1209 O  OD1   . ASN A 1 149 ? 11.228  -2.644  21.745  1.00 46.79  ? 149  ASN A OD1   1 
ATOM   1210 N  ND2   . ASN A 1 149 ? 12.217  -0.663  21.346  1.00 44.44  ? 149  ASN A ND2   1 
ATOM   1211 N  N     . THR A 1 150 ? 12.315  -3.985  24.917  1.00 51.83  ? 150  THR A N     1 
ATOM   1212 C  CA    . THR A 1 150 ? 12.379  -5.427  24.797  1.00 53.34  ? 150  THR A CA    1 
ATOM   1213 C  C     . THR A 1 150 ? 10.971  -5.979  24.864  1.00 56.34  ? 150  THR A C     1 
ATOM   1214 O  O     . THR A 1 150 ? 10.070  -5.344  25.414  1.00 58.38  ? 150  THR A O     1 
ATOM   1215 C  CB    . THR A 1 150 ? 13.256  -6.073  25.916  1.00 61.63  ? 150  THR A CB    1 
ATOM   1216 O  OG1   . THR A 1 150 ? 12.764  -5.681  27.216  1.00 60.04  ? 150  THR A OG1   1 
ATOM   1217 C  CG2   . THR A 1 150 ? 14.744  -5.663  25.756  1.00 45.59  ? 150  THR A CG2   1 
ATOM   1218 N  N     . ILE A 1 151 ? 10.786  -7.162  24.296  1.00 50.78  ? 151  ILE A N     1 
ATOM   1219 C  CA    . ILE A 1 151 ? 9.497   -7.812  24.295  1.00 48.81  ? 151  ILE A CA    1 
ATOM   1220 C  C     . ILE A 1 151 ? 9.664   -9.161  24.957  1.00 50.87  ? 151  ILE A C     1 
ATOM   1221 O  O     . ILE A 1 151 ? 10.631  -9.872  24.693  1.00 51.00  ? 151  ILE A O     1 
ATOM   1222 C  CB    . ILE A 1 151 ? 8.952   -7.980  22.879  1.00 47.64  ? 151  ILE A CB    1 
ATOM   1223 C  CG1   . ILE A 1 151 ? 8.801   -6.614  22.200  1.00 44.93  ? 151  ILE A CG1   1 
ATOM   1224 C  CG2   . ILE A 1 151 ? 7.632   -8.745  22.897  1.00 43.24  ? 151  ILE A CG2   1 
ATOM   1225 C  CD1   . ILE A 1 151 ? 8.466   -6.715  20.706  1.00 41.39  ? 151  ILE A CD1   1 
ATOM   1226 N  N     A HIS A 1 152 ? 8.732   -9.480  25.850  0.33 50.47  ? 152  HIS A N     1 
ATOM   1227 N  N     B HIS A 1 152 ? 8.722   -9.526  25.810  0.67 49.92  ? 152  HIS A N     1 
ATOM   1228 C  CA    A HIS A 1 152 ? 8.744   -10.713 26.626  0.33 52.10  ? 152  HIS A CA    1 
ATOM   1229 C  CA    B HIS A 1 152 ? 8.739   -10.853 26.381  0.67 51.92  ? 152  HIS A CA    1 
ATOM   1230 C  C     A HIS A 1 152 ? 7.311   -11.222 26.815  0.33 53.38  ? 152  HIS A C     1 
ATOM   1231 C  C     B HIS A 1 152 ? 7.355   -11.204 26.913  0.67 52.92  ? 152  HIS A C     1 
ATOM   1232 O  O     A HIS A 1 152 ? 6.356   -10.487 26.573  0.33 53.03  ? 152  HIS A O     1 
ATOM   1233 O  O     B HIS A 1 152 ? 6.488   -10.345 27.024  0.67 53.52  ? 152  HIS A O     1 
ATOM   1234 C  CB    A HIS A 1 152 ? 9.402   -10.489 27.995  0.33 53.23  ? 152  HIS A CB    1 
ATOM   1235 C  CB    B HIS A 1 152 ? 9.798   -10.953 27.480  0.67 53.69  ? 152  HIS A CB    1 
ATOM   1236 C  CG    A HIS A 1 152 ? 10.900  -10.523 27.974  0.33 54.78  ? 152  HIS A CG    1 
ATOM   1237 C  CG    B HIS A 1 152 ? 9.382   -10.337 28.776  0.67 52.77  ? 152  HIS A CG    1 
ATOM   1238 N  ND1   A HIS A 1 152 ? 11.673  -9.382  27.982  0.33 55.34  ? 152  HIS A ND1   1 
ATOM   1239 N  ND1   B HIS A 1 152 ? 8.640   -11.021 29.716  0.67 52.46  ? 152  HIS A ND1   1 
ATOM   1240 C  CD2   A HIS A 1 152 ? 11.768  -11.563 27.968  0.33 56.77  ? 152  HIS A CD2   1 
ATOM   1241 C  CD2   B HIS A 1 152 ? 9.602   -9.105  29.290  0.67 53.64  ? 152  HIS A CD2   1 
ATOM   1242 C  CE1   A HIS A 1 152 ? 12.952  -9.717  27.970  0.33 52.63  ? 152  HIS A CE1   1 
ATOM   1243 C  CE1   B HIS A 1 152 ? 8.420   -10.235 30.754  0.67 55.80  ? 152  HIS A CE1   1 
ATOM   1244 N  NE2   A HIS A 1 152 ? 13.037  -11.034 27.964  0.33 55.58  ? 152  HIS A NE2   1 
ATOM   1245 N  NE2   B HIS A 1 152 ? 8.992   -9.066  30.521  0.67 58.60  ? 152  HIS A NE2   1 
ATOM   1246 N  N     . LEU A 1 153 ? 7.159   -12.474 27.239  1.00 55.86  ? 153  LEU A N     1 
ATOM   1247 C  CA    . LEU A 1 153 ? 5.860   -12.972 27.664  1.00 55.10  ? 153  LEU A CA    1 
ATOM   1248 C  C     . LEU A 1 153 ? 5.674   -12.605 29.127  1.00 59.49  ? 153  LEU A C     1 
ATOM   1249 O  O     . LEU A 1 153 ? 6.413   -13.068 29.988  1.00 69.59  ? 153  LEU A O     1 
ATOM   1250 C  CB    . LEU A 1 153 ? 5.755   -14.484 27.451  1.00 56.29  ? 153  LEU A CB    1 
ATOM   1251 C  CG    . LEU A 1 153 ? 4.412   -15.186 27.671  1.00 64.26  ? 153  LEU A CG    1 
ATOM   1252 C  CD1   . LEU A 1 153 ? 3.335   -14.688 26.699  1.00 62.84  ? 153  LEU A CD1   1 
ATOM   1253 C  CD2   . LEU A 1 153 ? 4.588   -16.686 27.548  1.00 57.57  ? 153  LEU A CD2   1 
ATOM   1254 N  N     . ASP A 1 154 ? 4.707   -11.741 29.405  1.00 59.55  ? 154  ASP A N     1 
ATOM   1255 C  CA    . ASP A 1 154 ? 4.504   -11.241 30.752  1.00 52.04  ? 154  ASP A CA    1 
ATOM   1256 C  C     . ASP A 1 154 ? 3.469   -12.107 31.464  1.00 52.85  ? 154  ASP A C     1 
ATOM   1257 O  O     . ASP A 1 154 ? 3.659   -12.466 32.608  1.00 55.84  ? 154  ASP A O     1 
ATOM   1258 C  CB    . ASP A 1 154 ? 4.083   -9.760  30.722  1.00 49.71  ? 154  ASP A CB    1 
ATOM   1259 C  CG    . ASP A 1 154 ? 4.066   -9.108  32.119  1.00 56.21  ? 154  ASP A CG    1 
ATOM   1260 O  OD1   . ASP A 1 154 ? 5.078   -9.182  32.854  1.00 54.24  ? 154  ASP A OD1   1 
ATOM   1261 O  OD2   . ASP A 1 154 ? 3.016   -8.531  32.493  1.00 58.63  ? 154  ASP A OD2   1 
ATOM   1262 N  N     . ASP A 1 155 ? 2.377   -12.443 30.786  1.00 61.89  ? 155  ASP A N     1 
ATOM   1263 C  CA    . ASP A 1 155 ? 1.325   -13.269 31.388  1.00 59.24  ? 155  ASP A CA    1 
ATOM   1264 C  C     . ASP A 1 155 ? 1.264   -14.650 30.778  1.00 63.96  ? 155  ASP A C     1 
ATOM   1265 O  O     . ASP A 1 155 ? 0.581   -14.846 29.774  1.00 67.19  ? 155  ASP A O     1 
ATOM   1266 C  CB    . ASP A 1 155 ? -0.051  -12.622 31.241  1.00 59.54  ? 155  ASP A CB    1 
ATOM   1267 C  CG    . ASP A 1 155 ? -1.075  -13.228 32.178  1.00 63.83  ? 155  ASP A CG    1 
ATOM   1268 O  OD1   . ASP A 1 155 ? -0.855  -14.366 32.620  1.00 70.13  ? 155  ASP A OD1   1 
ATOM   1269 O  OD2   . ASP A 1 155 ? -2.089  -12.570 32.496  1.00 66.06  ? 155  ASP A OD2   1 
ATOM   1270 N  N     . HIS A 1 156 ? 1.940   -15.607 31.406  1.00 62.59  ? 156  HIS A N     1 
ATOM   1271 C  CA    . HIS A 1 156 ? 1.943   -16.983 30.924  1.00 59.69  ? 156  HIS A CA    1 
ATOM   1272 C  C     . HIS A 1 156 ? 0.536   -17.592 30.950  1.00 59.92  ? 156  HIS A C     1 
ATOM   1273 O  O     . HIS A 1 156 ? 0.235   -18.476 30.151  1.00 57.01  ? 156  HIS A O     1 
ATOM   1274 C  CB    . HIS A 1 156 ? 2.923   -17.833 31.745  1.00 63.89  ? 156  HIS A CB    1 
ATOM   1275 C  CG    . HIS A 1 156 ? 4.363   -17.439 31.566  1.00 73.72  ? 156  HIS A CG    1 
ATOM   1276 N  ND1   . HIS A 1 156 ? 5.409   -18.239 31.959  1.00 73.07  ? 156  HIS A ND1   1 
ATOM   1277 C  CD2   . HIS A 1 156 ? 4.916   -16.324 31.024  1.00 70.91  ? 156  HIS A CD2   1 
ATOM   1278 C  CE1   . HIS A 1 156 ? 6.554   -17.638 31.665  1.00 73.51  ? 156  HIS A CE1   1 
ATOM   1279 N  NE2   . HIS A 1 156 ? 6.281   -16.479 31.100  1.00 68.59  ? 156  HIS A NE2   1 
ATOM   1280 N  N     . ARG A 1 157 ? -0.324  -17.103 31.841  1.00 46.57  ? 157  ARG A N     1 
ATOM   1281 C  CA    . ARG A 1 157 ? -1.697  -17.597 31.923  1.00 54.50  ? 157  ARG A CA    1 
ATOM   1282 C  C     . ARG A 1 157 ? -2.552  -17.281 30.674  1.00 58.42  ? 157  ARG A C     1 
ATOM   1283 O  O     . ARG A 1 157 ? -3.313  -18.137 30.200  1.00 54.95  ? 157  ARG A O     1 
ATOM   1284 C  CB    . ARG A 1 157 ? -2.413  -17.026 33.156  1.00 54.29  ? 157  ARG A CB    1 
ATOM   1285 C  CG    . ARG A 1 157 ? -1.636  -17.063 34.438  1.00 47.56  ? 157  ARG A CG    1 
ATOM   1286 C  CD    . ARG A 1 157 ? -2.252  -16.108 35.468  1.00 52.95  ? 157  ARG A CD    1 
ATOM   1287 N  NE    . ARG A 1 157 ? -2.021  -14.711 35.116  1.00 56.95  ? 157  ARG A NE    1 
ATOM   1288 C  CZ    . ARG A 1 157 ? -2.362  -13.674 35.873  1.00 59.02  ? 157  ARG A CZ    1 
ATOM   1289 N  NH1   . ARG A 1 157 ? -2.935  -13.870 37.053  1.00 53.40  ? 157  ARG A NH1   1 
ATOM   1290 N  NH2   . ARG A 1 157 ? -2.100  -12.437 35.458  1.00 54.61  ? 157  ARG A NH2   1 
ATOM   1291 N  N     . HIS A 1 158 ? -2.448  -16.054 30.160  1.00 63.46  ? 158  HIS A N     1 
ATOM   1292 C  CA    . HIS A 1 158 ? -3.306  -15.612 29.062  1.00 53.29  ? 158  HIS A CA    1 
ATOM   1293 C  C     . HIS A 1 158 ? -2.561  -15.273 27.799  1.00 55.03  ? 158  HIS A C     1 
ATOM   1294 O  O     . HIS A 1 158 ? -3.118  -14.631 26.920  1.00 62.62  ? 158  HIS A O     1 
ATOM   1295 C  CB    . HIS A 1 158 ? -4.103  -14.389 29.464  1.00 50.23  ? 158  HIS A CB    1 
ATOM   1296 C  CG    . HIS A 1 158 ? -4.947  -14.587 30.680  1.00 59.80  ? 158  HIS A CG    1 
ATOM   1297 N  ND1   . HIS A 1 158 ? -4.535  -14.208 31.941  1.00 61.42  ? 158  HIS A ND1   1 
ATOM   1298 C  CD2   . HIS A 1 158 ? -6.191  -15.102 30.827  1.00 56.02  ? 158  HIS A CD2   1 
ATOM   1299 C  CE1   . HIS A 1 158 ? -5.488  -14.486 32.813  1.00 60.34  ? 158  HIS A CE1   1 
ATOM   1300 N  NE2   . HIS A 1 158 ? -6.500  -15.036 32.163  1.00 58.81  ? 158  HIS A NE2   1 
ATOM   1301 N  N     . GLY A 1 159 ? -1.303  -15.679 27.703  1.00 56.28  ? 159  GLY A N     1 
ATOM   1302 C  CA    . GLY A 1 159 ? -0.522  -15.390 26.514  1.00 58.55  ? 159  GLY A CA    1 
ATOM   1303 C  C     . GLY A 1 159 ? -0.347  -13.909 26.223  1.00 58.07  ? 159  GLY A C     1 
ATOM   1304 O  O     . GLY A 1 159 ? -0.264  -13.524 25.061  1.00 62.49  ? 159  GLY A O     1 
ATOM   1305 N  N     . VAL A 1 160 ? -0.288  -13.080 27.263  1.00 43.71  ? 160  VAL A N     1 
ATOM   1306 C  CA    . VAL A 1 160 ? -0.106  -11.644 27.082  1.00 46.40  ? 160  VAL A CA    1 
ATOM   1307 C  C     . VAL A 1 160 ? 1.357   -11.208 27.097  1.00 49.03  ? 160  VAL A C     1 
ATOM   1308 O  O     . VAL A 1 160 ? 2.032   -11.311 28.121  1.00 49.03  ? 160  VAL A O     1 
ATOM   1309 C  CB    . VAL A 1 160 ? -0.814  -10.835 28.173  1.00 50.20  ? 160  VAL A CB    1 
ATOM   1310 C  CG1   . VAL A 1 160 ? -0.724  -9.351  27.845  1.00 47.08  ? 160  VAL A CG1   1 
ATOM   1311 C  CG2   . VAL A 1 160 ? -2.250  -11.274 28.327  1.00 51.23  ? 160  VAL A CG2   1 
ATOM   1312 N  N     . TYR A 1 161 ? 1.840   -10.688 25.976  1.00 50.18  ? 161  TYR A N     1 
ATOM   1313 C  CA    . TYR A 1 161 ? 3.197   -10.147 25.918  1.00 51.33  ? 161  TYR A CA    1 
ATOM   1314 C  C     . TYR A 1 161 ? 3.250   -8.723  26.475  1.00 49.53  ? 161  TYR A C     1 
ATOM   1315 O  O     . TYR A 1 161 ? 2.229   -8.051  26.620  1.00 52.75  ? 161  TYR A O     1 
ATOM   1316 C  CB    . TYR A 1 161 ? 3.727   -10.163 24.478  1.00 54.53  ? 161  TYR A CB    1 
ATOM   1317 C  CG    . TYR A 1 161 ? 3.836   -11.550 23.887  1.00 63.45  ? 161  TYR A CG    1 
ATOM   1318 C  CD1   . TYR A 1 161 ? 2.726   -12.178 23.300  1.00 61.08  ? 161  TYR A CD1   1 
ATOM   1319 C  CD2   . TYR A 1 161 ? 5.044   -12.245 23.926  1.00 58.38  ? 161  TYR A CD2   1 
ATOM   1320 C  CE1   . TYR A 1 161 ? 2.823   -13.449 22.774  1.00 60.69  ? 161  TYR A CE1   1 
ATOM   1321 C  CE2   . TYR A 1 161 ? 5.150   -13.517 23.396  1.00 61.40  ? 161  TYR A CE2   1 
ATOM   1322 C  CZ    . TYR A 1 161 ? 4.041   -14.116 22.825  1.00 64.84  ? 161  TYR A CZ    1 
ATOM   1323 O  OH    . TYR A 1 161 ? 4.161   -15.381 22.305  1.00 70.60  ? 161  TYR A OH    1 
ATOM   1324 N  N     . VAL A 1 162 ? 4.449   -8.266  26.777  1.00 42.88  ? 162  VAL A N     1 
ATOM   1325 C  CA    . VAL A 1 162 ? 4.666   -6.895  27.205  1.00 46.08  ? 162  VAL A CA    1 
ATOM   1326 C  C     . VAL A 1 162 ? 5.805   -6.322  26.371  1.00 49.95  ? 162  VAL A C     1 
ATOM   1327 O  O     . VAL A 1 162 ? 6.762   -7.037  26.039  1.00 47.31  ? 162  VAL A O     1 
ATOM   1328 C  CB    . VAL A 1 162 ? 5.007   -6.795  28.723  1.00 49.50  ? 162  VAL A CB    1 
ATOM   1329 C  CG1   . VAL A 1 162 ? 6.381   -7.385  29.015  1.00 44.75  ? 162  VAL A CG1   1 
ATOM   1330 C  CG2   . VAL A 1 162 ? 4.944   -5.353  29.212  1.00 51.33  ? 162  VAL A CG2   1 
ATOM   1331 N  N     . LEU A 1 163 ? 5.676   -5.055  25.990  1.00 46.34  ? 163  LEU A N     1 
ATOM   1332 C  CA    . LEU A 1 163 ? 6.783   -4.312  25.411  1.00 47.44  ? 163  LEU A CA    1 
ATOM   1333 C  C     . LEU A 1 163 ? 7.298   -3.345  26.475  1.00 49.57  ? 163  LEU A C     1 
ATOM   1334 O  O     . LEU A 1 163 ? 6.622   -2.379  26.827  1.00 47.51  ? 163  LEU A O     1 
ATOM   1335 C  CB    . LEU A 1 163 ? 6.359   -3.575  24.139  1.00 45.93  ? 163  LEU A CB    1 
ATOM   1336 C  CG    . LEU A 1 163 ? 7.455   -2.865  23.328  1.00 46.69  ? 163  LEU A CG    1 
ATOM   1337 C  CD1   . LEU A 1 163 ? 7.032   -2.688  21.861  1.00 47.40  ? 163  LEU A CD1   1 
ATOM   1338 C  CD2   . LEU A 1 163 ? 7.825   -1.518  23.920  1.00 47.86  ? 163  LEU A CD2   1 
ATOM   1339 N  N     . ASN A 1 164 ? 8.497   -3.619  26.992  1.00 57.38  ? 164  ASN A N     1 
ATOM   1340 C  CA    . ASN A 1 164 ? 9.087   -2.796  28.044  1.00 51.90  ? 164  ASN A CA    1 
ATOM   1341 C  C     . ASN A 1 164 ? 10.003  -1.763  27.435  1.00 52.54  ? 164  ASN A C     1 
ATOM   1342 O  O     . ASN A 1 164 ? 10.936  -2.105  26.715  1.00 57.43  ? 164  ASN A O     1 
ATOM   1343 C  CB    . ASN A 1 164 ? 9.844   -3.655  29.054  1.00 50.43  ? 164  ASN A CB    1 
ATOM   1344 C  CG    . ASN A 1 164 ? 10.332  -2.855  30.247  1.00 56.72  ? 164  ASN A CG    1 
ATOM   1345 O  OD1   . ASN A 1 164 ? 9.535   -2.432  31.087  1.00 58.76  ? 164  ASN A OD1   1 
ATOM   1346 N  ND2   . ASN A 1 164 ? 11.652  -2.655  30.339  1.00 57.98  ? 164  ASN A ND2   1 
ATOM   1347 N  N     . ILE A 1 165 ? 9.699   -0.497  27.688  1.00 50.48  ? 165  ILE A N     1 
ATOM   1348 C  CA    . ILE A 1 165 ? 10.503  0.606   27.188  1.00 50.36  ? 165  ILE A CA    1 
ATOM   1349 C  C     . ILE A 1 165 ? 11.549  0.910   28.223  1.00 54.72  ? 165  ILE A C     1 
ATOM   1350 O  O     . ILE A 1 165 ? 11.224  1.055   29.407  1.00 53.63  ? 165  ILE A O     1 
ATOM   1351 C  CB    . ILE A 1 165 ? 9.666   1.872   26.919  1.00 50.21  ? 165  ILE A CB    1 
ATOM   1352 C  CG1   . ILE A 1 165 ? 8.883   1.733   25.617  1.00 52.81  ? 165  ILE A CG1   1 
ATOM   1353 C  CG2   . ILE A 1 165 ? 10.537  3.100   26.876  1.00 51.12  ? 165  ILE A CG2   1 
ATOM   1354 C  CD1   . ILE A 1 165 ? 7.395   1.624   25.832  1.00 55.11  ? 165  ILE A CD1   1 
ATOM   1355 N  N     . SER A 1 166 ? 12.800  1.007   27.784  1.00 49.39  ? 166  SER A N     1 
ATOM   1356 C  CA    . SER A 1 166 ? 13.893  1.244   28.712  1.00 58.10  ? 166  SER A CA    1 
ATOM   1357 C  C     . SER A 1 166 ? 13.761  2.579   29.411  1.00 60.15  ? 166  SER A C     1 
ATOM   1358 O  O     . SER A 1 166 ? 13.593  3.613   28.763  1.00 60.31  ? 166  SER A O     1 
ATOM   1359 C  CB    . SER A 1 166 ? 15.237  1.185   27.991  1.00 63.81  ? 166  SER A CB    1 
ATOM   1360 O  OG    . SER A 1 166 ? 16.282  1.539   28.873  1.00 59.03  ? 166  SER A OG    1 
ATOM   1361 N  N     . LEU A 1 167 ? 13.865  2.555   30.734  1.00 59.72  ? 167  LEU A N     1 
ATOM   1362 C  CA    . LEU A 1 167 ? 13.856  3.781   31.512  1.00 59.61  ? 167  LEU A CA    1 
ATOM   1363 C  C     . LEU A 1 167 ? 15.066  4.669   31.173  1.00 70.53  ? 167  LEU A C     1 
ATOM   1364 O  O     . LEU A 1 167 ? 15.098  5.846   31.533  1.00 71.82  ? 167  LEU A O     1 
ATOM   1365 C  CB    . LEU A 1 167 ? 13.815  3.451   32.997  1.00 56.78  ? 167  LEU A CB    1 
ATOM   1366 C  CG    . LEU A 1 167 ? 12.526  2.716   33.373  1.00 63.37  ? 167  LEU A CG    1 
ATOM   1367 C  CD1   . LEU A 1 167 ? 12.491  2.353   34.845  1.00 65.93  ? 167  LEU A CD1   1 
ATOM   1368 C  CD2   . LEU A 1 167 ? 11.291  3.529   33.005  1.00 64.32  ? 167  LEU A CD2   1 
ATOM   1369 N  N     . ARG A 1 168 ? 16.063  4.115   30.485  1.00 67.11  ? 168  ARG A N     1 
ATOM   1370 C  CA    A ARG A 1 168 ? 17.185  4.922   30.022  0.44 68.54  ? 168  ARG A CA    1 
ATOM   1371 C  CA    B ARG A 1 168 ? 17.189  4.907   30.004  0.56 69.00  ? 168  ARG A CA    1 
ATOM   1372 C  C     . ARG A 1 168 ? 16.703  5.970   29.019  1.00 73.88  ? 168  ARG A C     1 
ATOM   1373 O  O     . ARG A 1 168 ? 16.986  7.161   29.168  1.00 70.76  ? 168  ARG A O     1 
ATOM   1374 C  CB    A ARG A 1 168 ? 18.271  4.041   29.402  0.44 68.80  ? 168  ARG A CB    1 
ATOM   1375 C  CB    B ARG A 1 168 ? 18.244  4.008   29.349  0.56 68.78  ? 168  ARG A CB    1 
ATOM   1376 C  CG    A ARG A 1 168 ? 19.620  4.116   30.120  0.44 74.17  ? 168  ARG A CG    1 
ATOM   1377 C  CG    B ARG A 1 168 ? 18.875  3.001   30.308  0.56 72.29  ? 168  ARG A CG    1 
ATOM   1378 C  CD    A ARG A 1 168 ? 19.468  3.922   31.625  0.44 74.84  ? 168  ARG A CD    1 
ATOM   1379 C  CD    B ARG A 1 168 ? 19.600  1.862   29.589  0.56 71.57  ? 168  ARG A CD    1 
ATOM   1380 N  NE    A ARG A 1 168 ? 20.741  3.945   32.345  0.44 69.62  ? 168  ARG A NE    1 
ATOM   1381 N  NE    B ARG A 1 168 ? 20.000  0.806   30.520  0.56 73.54  ? 168  ARG A NE    1 
ATOM   1382 C  CZ    A ARG A 1 168 ? 21.403  2.858   32.730  0.44 72.27  ? 168  ARG A CZ    1 
ATOM   1383 C  CZ    B ARG A 1 168 ? 19.872  -0.496  30.277  0.56 74.00  ? 168  ARG A CZ    1 
ATOM   1384 N  NH1   A ARG A 1 168 ? 20.927  1.649   32.454  0.44 66.57  ? 168  ARG A NH1   1 
ATOM   1385 N  NH1   B ARG A 1 168 ? 19.348  -0.909  29.127  0.56 64.44  ? 168  ARG A NH1   1 
ATOM   1386 N  NH2   A ARG A 1 168 ? 22.547  2.980   33.390  0.44 74.99  ? 168  ARG A NH2   1 
ATOM   1387 N  NH2   B ARG A 1 168 ? 20.260  -1.384  31.187  0.56 70.49  ? 168  ARG A NH2   1 
ATOM   1388 N  N     . ASP A 1 169 ? 15.956  5.535   28.011  1.00 71.98  ? 169  ASP A N     1 
ATOM   1389 C  CA    . ASP A 1 169 ? 15.384  6.462   27.039  1.00 68.77  ? 169  ASP A CA    1 
ATOM   1390 C  C     . ASP A 1 169 ? 14.043  7.048   27.512  1.00 63.75  ? 169  ASP A C     1 
ATOM   1391 O  O     . ASP A 1 169 ? 13.231  7.477   26.699  1.00 60.98  ? 169  ASP A O     1 
ATOM   1392 C  CB    . ASP A 1 169 ? 15.198  5.757   25.702  1.00 68.10  ? 169  ASP A CB    1 
ATOM   1393 C  CG    . ASP A 1 169 ? 16.478  5.147   25.190  1.00 73.96  ? 169  ASP A CG    1 
ATOM   1394 O  OD1   . ASP A 1 169 ? 17.438  5.908   24.938  1.00 85.00  ? 169  ASP A OD1   1 
ATOM   1395 O  OD2   . ASP A 1 169 ? 16.530  3.906   25.052  1.00 70.82  ? 169  ASP A OD2   1 
ATOM   1396 N  N     . ARG A 1 170 ? 13.838  7.074   28.826  1.00 59.93  ? 170  ARG A N     1 
ATOM   1397 C  CA    . ARG A 1 170 ? 12.572  7.469   29.433  1.00 60.26  ? 170  ARG A CA    1 
ATOM   1398 C  C     . ARG A 1 170 ? 12.025  8.775   28.899  1.00 65.36  ? 170  ARG A C     1 
ATOM   1399 O  O     . ARG A 1 170 ? 10.872  8.860   28.468  1.00 67.54  ? 170  ARG A O     1 
ATOM   1400 C  CB    . ARG A 1 170 ? 12.734  7.563   30.947  1.00 57.79  ? 170  ARG A CB    1 
ATOM   1401 C  CG    . ARG A 1 170 ? 11.798  8.512   31.635  1.00 66.33  ? 170  ARG A CG    1 
ATOM   1402 C  CD    . ARG A 1 170 ? 11.828  8.277   33.124  1.00 69.34  ? 170  ARG A CD    1 
ATOM   1403 N  NE    . ARG A 1 170 ? 10.701  7.460   33.548  1.00 74.08  ? 170  ARG A NE    1 
ATOM   1404 C  CZ    . ARG A 1 170 ? 10.689  6.727   34.653  1.00 77.28  ? 170  ARG A CZ    1 
ATOM   1405 N  NH1   . ARG A 1 170 ? 11.755  6.696   35.439  1.00 86.29  ? 170  ARG A NH1   1 
ATOM   1406 N  NH2   . ARG A 1 170 ? 9.621   6.008   34.964  1.00 74.62  ? 170  ARG A NH2   1 
ATOM   1407 N  N     . ILE A 1 171 ? 12.870  9.791   28.922  1.00 79.19  ? 171  ILE A N     1 
ATOM   1408 C  CA    . ILE A 1 171 ? 12.469  11.132  28.544  1.00 76.95  ? 171  ILE A CA    1 
ATOM   1409 C  C     . ILE A 1 171 ? 12.132  11.200  27.068  1.00 72.87  ? 171  ILE A C     1 
ATOM   1410 O  O     . ILE A 1 171 ? 11.072  11.704  26.689  1.00 75.37  ? 171  ILE A O     1 
ATOM   1411 C  CB    . ILE A 1 171 ? 13.581  12.134  28.881  1.00 77.88  ? 171  ILE A CB    1 
ATOM   1412 C  CG1   . ILE A 1 171 ? 13.724  12.230  30.408  1.00 77.10  ? 171  ILE A CG1   1 
ATOM   1413 C  CG2   . ILE A 1 171 ? 13.302  13.487  28.222  1.00 72.20  ? 171  ILE A CG2   1 
ATOM   1414 C  CD1   . ILE A 1 171 ? 15.124  12.551  30.893  1.00 80.72  ? 171  ILE A CD1   1 
ATOM   1415 N  N     . LYS A 1 172 ? 13.034  10.684  26.241  1.00 64.95  ? 172  LYS A N     1 
ATOM   1416 C  CA    . LYS A 1 172 ? 12.840  10.744  24.810  1.00 64.60  ? 172  LYS A CA    1 
ATOM   1417 C  C     . LYS A 1 172 ? 11.476  10.181  24.493  1.00 74.06  ? 172  LYS A C     1 
ATOM   1418 O  O     . LYS A 1 172 ? 10.734  10.771  23.719  1.00 69.00  ? 172  LYS A O     1 
ATOM   1419 C  CB    . LYS A 1 172 ? 13.927  9.984   24.053  1.00 63.63  ? 172  LYS A CB    1 
ATOM   1420 C  CG    . LYS A 1 172 ? 13.696  9.974   22.543  1.00 70.31  ? 172  LYS A CG    1 
ATOM   1421 C  CD    . LYS A 1 172 ? 14.885  9.426   21.769  1.00 72.16  ? 172  LYS A CD    1 
ATOM   1422 C  CE    . LYS A 1 172 ? 16.124  10.303  21.963  1.00 72.05  ? 172  LYS A CE    1 
ATOM   1423 N  NZ    . LYS A 1 172 ? 17.210  9.952   21.002  1.00 78.21  ? 172  LYS A NZ    1 
ATOM   1424 N  N     . PHE A 1 173 ? 11.131  9.072   25.149  1.00 75.52  ? 173  PHE A N     1 
ATOM   1425 C  CA    . PHE A 1 173 ? 9.860   8.391   24.908  1.00 69.73  ? 173  PHE A CA    1 
ATOM   1426 C  C     . PHE A 1 173 ? 8.664   9.242   25.314  1.00 71.33  ? 173  PHE A C     1 
ATOM   1427 O  O     . PHE A 1 173 ? 7.787   9.530   24.487  1.00 67.75  ? 173  PHE A O     1 
ATOM   1428 C  CB    . PHE A 1 173 ? 9.800   7.051   25.650  1.00 64.24  ? 173  PHE A CB    1 
ATOM   1429 C  CG    . PHE A 1 173 ? 8.501   6.343   25.474  1.00 54.17  ? 173  PHE A CG    1 
ATOM   1430 C  CD1   . PHE A 1 173 ? 8.164   5.796   24.248  1.00 58.43  ? 173  PHE A CD1   1 
ATOM   1431 C  CD2   . PHE A 1 173 ? 7.596   6.262   26.512  1.00 56.28  ? 173  PHE A CD2   1 
ATOM   1432 C  CE1   . PHE A 1 173 ? 6.949   5.158   24.068  1.00 51.70  ? 173  PHE A CE1   1 
ATOM   1433 C  CE2   . PHE A 1 173 ? 6.380   5.633   26.337  1.00 57.89  ? 173  PHE A CE2   1 
ATOM   1434 C  CZ    . PHE A 1 173 ? 6.058   5.077   25.116  1.00 52.55  ? 173  PHE A CZ    1 
ATOM   1435 N  N     . VAL A 1 174 ? 8.622   9.626   26.587  1.00 64.10  ? 174  VAL A N     1 
ATOM   1436 C  CA    . VAL A 1 174 ? 7.514   10.433  27.091  1.00 69.19  ? 174  VAL A CA    1 
ATOM   1437 C  C     . VAL A 1 174 ? 7.414   11.761  26.339  1.00 74.57  ? 174  VAL A C     1 
ATOM   1438 O  O     . VAL A 1 174 ? 6.333   12.152  25.887  1.00 75.40  ? 174  VAL A O     1 
ATOM   1439 C  CB    . VAL A 1 174 ? 7.647   10.706  28.603  1.00 69.08  ? 174  VAL A CB    1 
ATOM   1440 C  CG1   . VAL A 1 174 ? 6.610   11.708  29.047  1.00 67.41  ? 174  VAL A CG1   1 
ATOM   1441 C  CG2   . VAL A 1 174 ? 7.507   9.410   29.392  1.00 58.46  ? 174  VAL A CG2   1 
ATOM   1442 N  N     . HIS A 1 175 ? 8.545   12.438  26.176  1.00 78.87  ? 175  HIS A N     1 
ATOM   1443 C  CA    . HIS A 1 175 ? 8.538   13.751  25.549  1.00 80.16  ? 175  HIS A CA    1 
ATOM   1444 C  C     . HIS A 1 175 ? 8.227   13.709  24.047  1.00 75.91  ? 175  HIS A C     1 
ATOM   1445 O  O     . HIS A 1 175 ? 7.518   14.568  23.540  1.00 80.03  ? 175  HIS A O     1 
ATOM   1446 C  CB    . HIS A 1 175 ? 9.876   14.451  25.773  1.00 76.87  ? 175  HIS A CB    1 
ATOM   1447 C  CG    . HIS A 1 175 ? 9.931   15.821  25.182  1.00 76.38  ? 175  HIS A CG    1 
ATOM   1448 N  ND1   . HIS A 1 175 ? 9.239   16.886  25.716  1.00 87.93  ? 175  HIS A ND1   1 
ATOM   1449 C  CD2   . HIS A 1 175 ? 10.551  16.290  24.073  1.00 77.65  ? 175  HIS A CD2   1 
ATOM   1450 C  CE1   . HIS A 1 175 ? 9.449   17.959  24.976  1.00 83.21  ? 175  HIS A CE1   1 
ATOM   1451 N  NE2   . HIS A 1 175 ? 10.246  17.626  23.974  1.00 81.19  ? 175  HIS A NE2   1 
ATOM   1452 N  N     . THR A 1 176 ? 8.762   12.721  23.340  1.00 72.29  ? 176  THR A N     1 
ATOM   1453 C  CA    . THR A 1 176 ? 8.569   12.624  21.895  1.00 74.37  ? 176  THR A CA    1 
ATOM   1454 C  C     . THR A 1 176 ? 7.255   11.930  21.525  1.00 79.60  ? 176  THR A C     1 
ATOM   1455 O  O     . THR A 1 176 ? 6.607   12.290  20.537  1.00 86.59  ? 176  THR A O     1 
ATOM   1456 C  CB    . THR A 1 176 ? 9.748   11.861  21.206  1.00 74.70  ? 176  THR A CB    1 
ATOM   1457 O  OG1   . THR A 1 176 ? 10.943  12.647  21.266  1.00 76.90  ? 176  THR A OG1   1 
ATOM   1458 C  CG2   . THR A 1 176 ? 9.436   11.522  19.754  1.00 75.16  ? 176  THR A CG2   1 
ATOM   1459 N  N     . ILE A 1 177 ? 6.840   10.947  22.314  1.00 73.86  ? 177  ILE A N     1 
ATOM   1460 C  CA    . ILE A 1 177 ? 5.731   10.114  21.870  1.00 75.19  ? 177  ILE A CA    1 
ATOM   1461 C  C     . ILE A 1 177 ? 4.425   10.275  22.667  1.00 73.61  ? 177  ILE A C     1 
ATOM   1462 O  O     . ILE A 1 177 ? 3.383   10.550  22.067  1.00 69.60  ? 177  ILE A O     1 
ATOM   1463 C  CB    . ILE A 1 177 ? 6.170   8.644   21.851  1.00 73.27  ? 177  ILE A CB    1 
ATOM   1464 C  CG1   . ILE A 1 177 ? 7.041   8.418   20.614  1.00 69.35  ? 177  ILE A CG1   1 
ATOM   1465 C  CG2   . ILE A 1 177 ? 4.964   7.715   21.846  1.00 65.64  ? 177  ILE A CG2   1 
ATOM   1466 C  CD1   . ILE A 1 177 ? 7.757   7.100   20.571  1.00 70.61  ? 177  ILE A CD1   1 
ATOM   1467 N  N     . LEU A 1 178 ? 4.461   10.115  23.988  1.00 67.53  ? 178  LEU A N     1 
ATOM   1468 C  CA    . LEU A 1 178 ? 3.243   10.295  24.774  1.00 69.53  ? 178  LEU A CA    1 
ATOM   1469 C  C     . LEU A 1 178 ? 2.711   11.697  24.542  1.00 75.40  ? 178  LEU A C     1 
ATOM   1470 O  O     . LEU A 1 178 ? 1.759   11.878  23.798  1.00 80.70  ? 178  LEU A O     1 
ATOM   1471 C  CB    . LEU A 1 178 ? 3.475   10.044  26.268  1.00 68.81  ? 178  LEU A CB    1 
ATOM   1472 C  CG    . LEU A 1 178 ? 3.522   8.571   26.673  1.00 58.94  ? 178  LEU A CG    1 
ATOM   1473 C  CD1   . LEU A 1 178 ? 3.506   8.398   28.169  1.00 59.74  ? 178  LEU A CD1   1 
ATOM   1474 C  CD2   . LEU A 1 178 ? 2.364   7.833   26.057  1.00 59.32  ? 178  LEU A CD2   1 
ATOM   1475 N  N     . SER A 1 179 ? 3.339   12.695  25.145  1.00 99.90  ? 179  SER A N     1 
ATOM   1476 C  CA    . SER A 1 179 ? 2.929   14.073  24.914  1.00 102.80 ? 179  SER A CA    1 
ATOM   1477 C  C     . SER A 1 179 ? 4.108   14.975  25.207  1.00 106.68 ? 179  SER A C     1 
ATOM   1478 O  O     . SER A 1 179 ? 4.826   14.743  26.186  1.00 108.42 ? 179  SER A O     1 
ATOM   1479 C  CB    . SER A 1 179 ? 1.732   14.430  25.793  1.00 111.32 ? 179  SER A CB    1 
ATOM   1480 O  OG    . SER A 1 179 ? 0.951   15.455  25.198  1.00 121.06 ? 179  SER A OG    1 
ATOM   1481 N  N     . SER A 1 180 ? 4.327   15.992  24.372  1.00 108.37 ? 180  SER A N     1 
ATOM   1482 C  CA    . SER A 1 180 ? 5.518   16.851  24.531  1.00 107.50 ? 180  SER A CA    1 
ATOM   1483 C  C     . SER A 1 180 ? 5.386   17.853  25.701  1.00 106.53 ? 180  SER A C     1 
ATOM   1484 O  O     . SER A 1 180 ? 6.344   18.564  26.034  1.00 106.58 ? 180  SER A O     1 
ATOM   1485 C  CB    . SER A 1 180 ? 5.844   17.581  23.209  1.00 97.69  ? 180  SER A CB    1 
ATOM   1486 O  OG    . SER A 1 180 ? 4.680   17.897  22.450  1.00 100.90 ? 180  SER A OG    1 
ATOM   1487 N  N     . HIS A 1 181 ? 4.214   17.863  26.339  1.00 92.97  ? 181  HIS A N     1 
ATOM   1488 C  CA    . HIS A 1 181 ? 3.932   18.709  27.501  1.00 91.61  ? 181  HIS A CA    1 
ATOM   1489 C  C     . HIS A 1 181 ? 3.891   17.885  28.785  1.00 91.45  ? 181  HIS A C     1 
ATOM   1490 O  O     . HIS A 1 181 ? 3.712   18.428  29.878  1.00 94.02  ? 181  HIS A O     1 
ATOM   1491 C  CB    . HIS A 1 181 ? 2.594   19.435  27.323  1.00 96.13  ? 181  HIS A CB    1 
ATOM   1492 C  CG    . HIS A 1 181 ? 2.364   19.932  25.933  1.00 92.64  ? 181  HIS A CG    1 
ATOM   1493 N  ND1   . HIS A 1 181 ? 2.975   21.063  25.437  1.00 85.64  ? 181  HIS A ND1   1 
ATOM   1494 C  CD2   . HIS A 1 181 ? 1.617   19.432  24.920  1.00 90.41  ? 181  HIS A CD2   1 
ATOM   1495 C  CE1   . HIS A 1 181 ? 2.598   21.251  24.184  1.00 82.27  ? 181  HIS A CE1   1 
ATOM   1496 N  NE2   . HIS A 1 181 ? 1.781   20.271  23.843  1.00 87.23  ? 181  HIS A NE2   1 
ATOM   1497 N  N     . LEU A 1 182 ? 4.022   16.569  28.642  1.00 91.86  ? 182  LEU A N     1 
ATOM   1498 C  CA    . LEU A 1 182 ? 4.033   15.657  29.783  1.00 93.34  ? 182  LEU A CA    1 
ATOM   1499 C  C     . LEU A 1 182 ? 5.451   15.615  30.360  1.00 91.99  ? 182  LEU A C     1 
ATOM   1500 O  O     . LEU A 1 182 ? 6.432   15.637  29.612  1.00 93.73  ? 182  LEU A O     1 
ATOM   1501 C  CB    . LEU A 1 182 ? 3.544   14.254  29.360  1.00 92.57  ? 182  LEU A CB    1 
ATOM   1502 C  CG    . LEU A 1 182 ? 2.165   13.706  29.794  1.00 88.46  ? 182  LEU A CG    1 
ATOM   1503 C  CD1   . LEU A 1 182 ? 1.776   12.553  28.896  1.00 83.56  ? 182  LEU A CD1   1 
ATOM   1504 C  CD2   . LEU A 1 182 ? 2.124   13.239  31.258  1.00 84.80  ? 182  LEU A CD2   1 
ATOM   1505 N  N     . ASN A 1 183 ? 5.564   15.594  31.686  1.00 104.04 ? 183  ASN A N     1 
ATOM   1506 C  CA    . ASN A 1 183 ? 6.873   15.499  32.337  1.00 107.08 ? 183  ASN A CA    1 
ATOM   1507 C  C     . ASN A 1 183 ? 7.242   14.021  32.528  1.00 107.73 ? 183  ASN A C     1 
ATOM   1508 O  O     . ASN A 1 183 ? 6.533   13.282  33.221  1.00 107.11 ? 183  ASN A O     1 
ATOM   1509 C  CB    . ASN A 1 183 ? 6.878   16.254  33.683  1.00 101.99 ? 183  ASN A CB    1 
ATOM   1510 C  CG    . ASN A 1 183 ? 8.275   16.345  34.319  1.00 98.40  ? 183  ASN A CG    1 
ATOM   1511 O  OD1   . ASN A 1 183 ? 8.755   15.388  34.927  1.00 103.05 ? 183  ASN A OD1   1 
ATOM   1512 N  ND2   . ASN A 1 183 ? 8.910   17.509  34.204  1.00 92.04  ? 183  ASN A ND2   1 
ATOM   1513 N  N     . PRO A 1 184 ? 8.346   13.587  31.890  1.00 116.48 ? 184  PRO A N     1 
ATOM   1514 C  CA    . PRO A 1 184 ? 8.846   12.202  31.874  1.00 115.07 ? 184  PRO A CA    1 
ATOM   1515 C  C     . PRO A 1 184 ? 8.877   11.503  33.236  1.00 117.68 ? 184  PRO A C     1 
ATOM   1516 O  O     . PRO A 1 184 ? 8.564   10.309  33.311  1.00 113.65 ? 184  PRO A O     1 
ATOM   1517 C  CB    . PRO A 1 184 ? 10.266  12.362  31.328  1.00 112.02 ? 184  PRO A CB    1 
ATOM   1518 C  CG    . PRO A 1 184 ? 10.162  13.529  30.395  1.00 111.92 ? 184  PRO A CG    1 
ATOM   1519 C  CD    . PRO A 1 184 ? 9.168   14.475  31.043  1.00 112.09 ? 184  PRO A CD    1 
ATOM   1520 N  N     . LEU A 1 185 ? 9.256   12.229  34.286  1.00 108.06 ? 185  LEU A N     1 
ATOM   1521 C  CA    . LEU A 1 185 ? 9.348   11.645  35.621  1.00 107.32 ? 185  LEU A CA    1 
ATOM   1522 C  C     . LEU A 1 185 ? 8.223   12.117  36.529  1.00 111.45 ? 185  LEU A C     1 
ATOM   1523 O  O     . LEU A 1 185 ? 8.315   13.187  37.133  1.00 112.36 ? 185  LEU A O     1 
ATOM   1524 C  CB    . LEU A 1 185 ? 10.705  11.959  36.250  1.00 103.35 ? 185  LEU A CB    1 
ATOM   1525 C  CG    . LEU A 1 185 ? 11.848  11.164  35.620  1.00 101.05 ? 185  LEU A CG    1 
ATOM   1526 C  CD1   . LEU A 1 185 ? 12.757  12.055  34.767  1.00 100.68 ? 185  LEU A CD1   1 
ATOM   1527 C  CD2   . LEU A 1 185 ? 12.619  10.419  36.696  1.00 90.60  ? 185  LEU A CD2   1 
ATOM   1528 N  N     . PRO A 1 186 ? 7.166   11.295  36.642  1.00 126.30 ? 186  PRO A N     1 
ATOM   1529 C  CA    . PRO A 1 186 ? 5.914   11.605  37.347  1.00 125.85 ? 186  PRO A CA    1 
ATOM   1530 C  C     . PRO A 1 186 ? 6.032   11.706  38.867  1.00 127.98 ? 186  PRO A C     1 
ATOM   1531 O  O     . PRO A 1 186 ? 6.940   11.116  39.457  1.00 129.71 ? 186  PRO A O     1 
ATOM   1532 C  CB    . PRO A 1 186 ? 5.013   10.424  36.979  1.00 112.45 ? 186  PRO A CB    1 
ATOM   1533 C  CG    . PRO A 1 186 ? 5.965   9.299   36.792  1.00 108.75 ? 186  PRO A CG    1 
ATOM   1534 C  CD    . PRO A 1 186 ? 7.160   9.921   36.113  1.00 110.70 ? 186  PRO A CD    1 
ATOM   1535 N  N     . PRO A 1 187 ? 5.114   12.464  39.494  1.00 122.85 ? 187  PRO A N     1 
ATOM   1536 C  CA    . PRO A 1 187 ? 4.918   12.489  40.947  1.00 114.30 ? 187  PRO A CA    1 
ATOM   1537 C  C     . PRO A 1 187 ? 4.953   11.087  41.566  1.00 114.07 ? 187  PRO A C     1 
ATOM   1538 O  O     . PRO A 1 187 ? 5.977   10.692  42.121  1.00 116.33 ? 187  PRO A O     1 
ATOM   1539 C  CB    . PRO A 1 187 ? 3.526   13.117  41.103  1.00 109.76 ? 187  PRO A CB    1 
ATOM   1540 C  CG    . PRO A 1 187 ? 3.186   13.742  39.739  1.00 107.30 ? 187  PRO A CG    1 
ATOM   1541 C  CD    . PRO A 1 187 ? 4.364   13.546  38.833  1.00 115.27 ? 187  PRO A CD    1 
ATOM   1542 O  "O5'" . DG  B 2 1   ? 24.970  4.453   50.446  1.00 87.93  ? 1    DG  B "O5'" 1 
ATOM   1543 C  "C5'" . DG  B 2 1   ? 25.106  3.399   49.504  1.00 82.64  ? 1    DG  B "C5'" 1 
ATOM   1544 C  "C4'" . DG  B 2 1   ? 24.491  3.812   48.187  1.00 90.35  ? 1    DG  B "C4'" 1 
ATOM   1545 O  "O4'" . DG  B 2 1   ? 24.885  2.896   47.131  1.00 93.42  ? 1    DG  B "O4'" 1 
ATOM   1546 C  "C3'" . DG  B 2 1   ? 22.967  3.877   48.170  1.00 87.77  ? 1    DG  B "C3'" 1 
ATOM   1547 O  "O3'" . DG  B 2 1   ? 22.591  5.058   47.481  1.00 87.85  ? 1    DG  B "O3'" 1 
ATOM   1548 C  "C2'" . DG  B 2 1   ? 22.559  2.595   47.416  1.00 78.39  ? 1    DG  B "C2'" 1 
ATOM   1549 C  "C1'" . DG  B 2 1   ? 23.738  2.402   46.458  1.00 83.31  ? 1    DG  B "C1'" 1 
ATOM   1550 N  N9    . DG  B 2 1   ? 24.017  1.007   46.077  1.00 79.66  ? 1    DG  B N9    1 
ATOM   1551 C  C8    . DG  B 2 1   ? 23.907  -0.129  46.866  1.00 76.83  ? 1    DG  B C8    1 
ATOM   1552 N  N7    . DG  B 2 1   ? 24.254  -1.232  46.244  1.00 69.68  ? 1    DG  B N7    1 
ATOM   1553 C  C5    . DG  B 2 1   ? 24.646  -0.795  44.973  1.00 67.62  ? 1    DG  B C5    1 
ATOM   1554 C  C6    . DG  B 2 1   ? 25.126  -1.531  43.855  1.00 69.53  ? 1    DG  B C6    1 
ATOM   1555 O  O6    . DG  B 2 1   ? 25.314  -2.763  43.753  1.00 68.67  ? 1    DG  B O6    1 
ATOM   1556 N  N1    . DG  B 2 1   ? 25.396  -0.694  42.775  1.00 68.55  ? 1    DG  B N1    1 
ATOM   1557 C  C2    . DG  B 2 1   ? 25.218  0.673   42.768  1.00 70.56  ? 1    DG  B C2    1 
ATOM   1558 N  N2    . DG  B 2 1   ? 25.526  1.309   41.626  1.00 70.14  ? 1    DG  B N2    1 
ATOM   1559 N  N3    . DG  B 2 1   ? 24.774  1.370   43.800  1.00 66.38  ? 1    DG  B N3    1 
ATOM   1560 C  C4    . DG  B 2 1   ? 24.511  0.577   44.864  1.00 68.34  ? 1    DG  B C4    1 
ATOM   1561 P  P     . DC  B 2 2   ? 21.149  5.732   47.695  1.00 87.94  ? 2    DC  B P     1 
ATOM   1562 O  OP1   . DC  B 2 2   ? 21.326  7.123   48.172  1.00 88.19  ? 2    DC  B OP1   1 
ATOM   1563 O  OP2   . DC  B 2 2   ? 20.314  4.767   48.460  1.00 83.28  ? 2    DC  B OP2   1 
ATOM   1564 O  "O5'" . DC  B 2 2   ? 20.633  5.866   46.197  1.00 85.55  ? 2    DC  B "O5'" 1 
ATOM   1565 C  "C5'" . DC  B 2 2   ? 21.591  6.043   45.165  1.00 77.06  ? 2    DC  B "C5'" 1 
ATOM   1566 C  "C4'" . DC  B 2 2   ? 21.245  5.198   43.963  1.00 72.37  ? 2    DC  B "C4'" 1 
ATOM   1567 O  "O4'" . DC  B 2 2   ? 21.700  3.836   44.143  1.00 75.44  ? 2    DC  B "O4'" 1 
ATOM   1568 C  "C3'" . DC  B 2 2   ? 19.751  5.084   43.673  1.00 75.47  ? 2    DC  B "C3'" 1 
ATOM   1569 O  "O3'" . DC  B 2 2   ? 19.416  6.014   42.648  1.00 80.04  ? 2    DC  B "O3'" 1 
ATOM   1570 C  "C2'" . DC  B 2 2   ? 19.558  3.604   43.235  1.00 73.23  ? 2    DC  B "C2'" 1 
ATOM   1571 C  "C1'" . DC  B 2 2   ? 20.999  3.066   43.199  1.00 70.81  ? 2    DC  B "C1'" 1 
ATOM   1572 N  N1    . DC  B 2 2   ? 21.166  1.556   43.482  1.00 56.62  ? 2    DC  B N1    1 
ATOM   1573 C  C2    . DC  B 2 2   ? 21.685  0.721   42.473  1.00 62.14  ? 2    DC  B C2    1 
ATOM   1574 O  O2    . DC  B 2 2   ? 22.001  1.216   41.379  1.00 64.03  ? 2    DC  B O2    1 
ATOM   1575 N  N3    . DC  B 2 2   ? 21.834  -0.609  42.719  1.00 56.77  ? 2    DC  B N3    1 
ATOM   1576 C  C4    . DC  B 2 2   ? 21.486  -1.114  43.895  1.00 55.25  ? 2    DC  B C4    1 
ATOM   1577 N  N4    . DC  B 2 2   ? 21.647  -2.431  44.073  1.00 55.05  ? 2    DC  B N4    1 
ATOM   1578 C  C5    . DC  B 2 2   ? 20.954  -0.292  44.941  1.00 53.11  ? 2    DC  B C5    1 
ATOM   1579 C  C6    . DC  B 2 2   ? 20.812  1.026   44.693  1.00 57.46  ? 2    DC  B C6    1 
ATOM   1580 P  P     . DC  B 2 3   ? 17.896  6.212   42.149  1.00 101.20 ? 3    DC  B P     1 
ATOM   1581 O  OP1   . DC  B 2 3   ? 17.689  7.662   41.903  1.00 87.12  ? 3    DC  B OP1   1 
ATOM   1582 O  OP2   . DC  B 2 3   ? 16.952  5.514   43.067  1.00 79.74  ? 3    DC  B OP2   1 
ATOM   1583 O  "O5'" . DC  B 2 3   ? 17.910  5.464   40.733  1.00 88.48  ? 3    DC  B "O5'" 1 
ATOM   1584 C  "C5'" . DC  B 2 3   ? 19.150  5.294   40.023  1.00 75.31  ? 3    DC  B "C5'" 1 
ATOM   1585 C  "C4'" . DC  B 2 3   ? 19.076  4.087   39.097  1.00 79.48  ? 3    DC  B "C4'" 1 
ATOM   1586 O  "O4'" . DC  B 2 3   ? 19.426  2.883   39.814  1.00 77.86  ? 3    DC  B "O4'" 1 
ATOM   1587 C  "C3'" . DC  B 2 3   ? 17.695  3.833   38.492  1.00 78.39  ? 3    DC  B "C3'" 1 
ATOM   1588 O  "O3'" . DC  B 2 3   ? 17.747  4.105   37.122  1.00 78.40  ? 3    DC  B "O3'" 1 
ATOM   1589 C  "C2'" . DC  B 2 3   ? 17.394  2.346   38.772  1.00 73.35  ? 3    DC  B "C2'" 1 
ATOM   1590 C  "C1'" . DC  B 2 3   ? 18.739  1.796   39.248  1.00 73.55  ? 3    DC  B "C1'" 1 
ATOM   1591 N  N1    . DC  B 2 3   ? 18.630  0.693   40.288  1.00 70.22  ? 3    DC  B N1    1 
ATOM   1592 C  C2    . DC  B 2 3   ? 19.065  -0.599  39.966  1.00 66.21  ? 3    DC  B C2    1 
ATOM   1593 O  O2    . DC  B 2 3   ? 19.530  -0.807  38.837  1.00 63.75  ? 3    DC  B O2    1 
ATOM   1594 N  N3    . DC  B 2 3   ? 18.969  -1.586  40.904  1.00 61.41  ? 3    DC  B N3    1 
ATOM   1595 C  C4    . DC  B 2 3   ? 18.470  -1.310  42.116  1.00 60.72  ? 3    DC  B C4    1 
ATOM   1596 N  N4    . DC  B 2 3   ? 18.397  -2.310  43.011  1.00 60.02  ? 3    DC  B N4    1 
ATOM   1597 C  C5    . DC  B 2 3   ? 18.013  -0.001  42.460  1.00 54.88  ? 3    DC  B C5    1 
ATOM   1598 C  C6    . DC  B 2 3   ? 18.111  0.960   41.527  1.00 62.36  ? 3    DC  B C6    1 
ATOM   1599 P  P     . DT  B 2 4   ? 16.421  4.005   36.233  1.00 83.96  ? 4    DT  B P     1 
ATOM   1600 O  OP1   . DT  B 2 4   ? 16.556  4.951   35.099  1.00 76.14  ? 4    DT  B OP1   1 
ATOM   1601 O  OP2   . DT  B 2 4   ? 15.246  3.994   37.134  1.00 74.42  ? 4    DT  B OP2   1 
ATOM   1602 O  "O5'" . DT  B 2 4   ? 16.502  2.543   35.645  1.00 82.53  ? 4    DT  B "O5'" 1 
ATOM   1603 C  "C5'" . DT  B 2 4   ? 17.655  2.116   34.979  1.00 66.26  ? 4    DT  B "C5'" 1 
ATOM   1604 C  "C4'" . DT  B 2 4   ? 17.554  0.634   34.767  1.00 65.01  ? 4    DT  B "C4'" 1 
ATOM   1605 O  "O4'" . DT  B 2 4   ? 17.426  -0.002  36.044  1.00 64.17  ? 4    DT  B "O4'" 1 
ATOM   1606 C  "C3'" . DT  B 2 4   ? 16.316  0.192   33.975  1.00 63.32  ? 4    DT  B "C3'" 1 
ATOM   1607 O  "O3'" . DT  B 2 4   ? 16.727  -0.413  32.774  1.00 68.13  ? 4    DT  B "O3'" 1 
ATOM   1608 C  "C2'" . DT  B 2 4   ? 15.593  -0.801  34.904  1.00 58.44  ? 4    DT  B "C2'" 1 
ATOM   1609 C  "C1'" . DT  B 2 4   ? 16.712  -1.184  35.848  1.00 59.69  ? 4    DT  B "C1'" 1 
ATOM   1610 N  N1    . DT  B 2 4   ? 16.300  -1.697  37.174  1.00 56.69  ? 4    DT  B N1    1 
ATOM   1611 C  C2    . DT  B 2 4   ? 16.561  -3.002  37.467  1.00 58.56  ? 4    DT  B C2    1 
ATOM   1612 O  O2    . DT  B 2 4   ? 17.071  -3.761  36.671  1.00 63.41  ? 4    DT  B O2    1 
ATOM   1613 N  N3    . DT  B 2 4   ? 16.189  -3.403  38.719  1.00 59.03  ? 4    DT  B N3    1 
ATOM   1614 C  C4    . DT  B 2 4   ? 15.622  -2.633  39.699  1.00 61.14  ? 4    DT  B C4    1 
ATOM   1615 O  O4    . DT  B 2 4   ? 15.338  -3.092  40.800  1.00 62.60  ? 4    DT  B O4    1 
ATOM   1616 C  C5    . DT  B 2 4   ? 15.384  -1.247  39.335  1.00 58.63  ? 4    DT  B C5    1 
ATOM   1617 C  C7    . DT  B 2 4   ? 14.753  -0.306  40.311  1.00 53.47  ? 4    DT  B C7    1 
ATOM   1618 C  C6    . DT  B 2 4   ? 15.743  -0.848  38.104  1.00 56.42  ? 4    DT  B C6    1 
ATOM   1619 P  P     . DT  B 2 5   ? 15.628  -0.830  31.697  1.00 57.89  ? 5    DT  B P     1 
ATOM   1620 O  OP1   . DT  B 2 5   ? 16.233  -0.957  30.353  1.00 65.36  ? 5    DT  B OP1   1 
ATOM   1621 O  OP2   . DT  B 2 5   ? 14.494  0.108   31.908  1.00 59.32  ? 5    DT  B OP2   1 
ATOM   1622 O  "O5'" . DT  B 2 5   ? 15.189  -2.250  32.212  1.00 54.62  ? 5    DT  B "O5'" 1 
ATOM   1623 C  "C5'" . DT  B 2 5   ? 15.909  -3.379  31.874  1.00 50.51  ? 5    DT  B "C5'" 1 
ATOM   1624 C  "C4'" . DT  B 2 5   ? 15.329  -4.557  32.613  1.00 54.08  ? 5    DT  B "C4'" 1 
ATOM   1625 O  "O4'" . DT  B 2 5   ? 15.079  -4.177  33.979  1.00 58.50  ? 5    DT  B "O4'" 1 
ATOM   1626 C  "C3'" . DT  B 2 5   ? 13.977  -5.050  32.087  1.00 55.40  ? 5    DT  B "C3'" 1 
ATOM   1627 O  "O3'" . DT  B 2 5   ? 14.147  -6.331  31.530  1.00 63.85  ? 5    DT  B "O3'" 1 
ATOM   1628 C  "C2'" . DT  B 2 5   ? 13.078  -5.096  33.340  1.00 54.25  ? 5    DT  B "C2'" 1 
ATOM   1629 C  "C1'" . DT  B 2 5   ? 14.108  -5.039  34.460  1.00 58.48  ? 5    DT  B "C1'" 1 
ATOM   1630 N  N1    . DT  B 2 5   ? 13.585  -4.520  35.737  1.00 55.99  ? 5    DT  B N1    1 
ATOM   1631 C  C2    . DT  B 2 5   ? 13.512  -5.364  36.820  1.00 60.72  ? 5    DT  B C2    1 
ATOM   1632 O  O2    . DT  B 2 5   ? 13.883  -6.524  36.790  1.00 64.17  ? 5    DT  B O2    1 
ATOM   1633 N  N3    . DT  B 2 5   ? 12.998  -4.803  37.948  1.00 57.91  ? 5    DT  B N3    1 
ATOM   1634 C  C4    . DT  B 2 5   ? 12.559  -3.502  38.107  1.00 61.24  ? 5    DT  B C4    1 
ATOM   1635 O  O4    . DT  B 2 5   ? 12.115  -3.083  39.177  1.00 63.99  ? 5    DT  B O4    1 
ATOM   1636 C  C5    . DT  B 2 5   ? 12.668  -2.668  36.933  1.00 55.27  ? 5    DT  B C5    1 
ATOM   1637 C  C7    . DT  B 2 5   ? 12.223  -1.240  36.980  1.00 52.47  ? 5    DT  B C7    1 
ATOM   1638 C  C6    . DT  B 2 5   ? 13.170  -3.214  35.816  1.00 54.46  ? 5    DT  B C6    1 
ATOM   1639 P  P     . DG  B 2 6   ? 13.030  -6.968  30.567  1.00 63.67  ? 6    DG  B P     1 
ATOM   1640 O  OP1   . DG  B 2 6   ? 13.702  -7.169  29.260  1.00 65.87  ? 6    DG  B OP1   1 
ATOM   1641 O  OP2   . DG  B 2 6   ? 11.784  -6.194  30.683  1.00 61.49  ? 6    DG  B OP2   1 
ATOM   1642 O  "O5'" . DG  B 2 6   ? 12.762  -8.402  31.206  1.00 58.74  ? 6    DG  B "O5'" 1 
ATOM   1643 C  "C5'" . DG  B 2 6   ? 13.847  -9.298  31.385  1.00 58.04  ? 6    DG  B "C5'" 1 
ATOM   1644 C  "C4'" . DG  B 2 6   ? 13.526  -10.322 32.446  1.00 59.37  ? 6    DG  B "C4'" 1 
ATOM   1645 O  "O4'" . DG  B 2 6   ? 13.345  -9.664  33.734  1.00 63.77  ? 6    DG  B "O4'" 1 
ATOM   1646 C  "C3'" . DG  B 2 6   ? 12.246  -11.116 32.213  1.00 60.28  ? 6    DG  B "C3'" 1 
ATOM   1647 O  "O3'" . DG  B 2 6   ? 12.414  -12.403 32.754  1.00 64.43  ? 6    DG  B "O3'" 1 
ATOM   1648 C  "C2'" . DG  B 2 6   ? 11.241  -10.320 33.027  1.00 59.95  ? 6    DG  B "C2'" 1 
ATOM   1649 C  "C1'" . DG  B 2 6   ? 12.080  -10.020 34.253  1.00 61.61  ? 6    DG  B "C1'" 1 
ATOM   1650 N  N9    . DG  B 2 6   ? 11.576  -8.910  35.038  1.00 61.95  ? 6    DG  B N9    1 
ATOM   1651 C  C8    . DG  B 2 6   ? 11.360  -7.626  34.598  1.00 59.08  ? 6    DG  B C8    1 
ATOM   1652 N  N7    . DG  B 2 6   ? 10.907  -6.831  35.522  1.00 57.88  ? 6    DG  B N7    1 
ATOM   1653 C  C5    . DG  B 2 6   ? 10.813  -7.637  36.644  1.00 61.09  ? 6    DG  B C5    1 
ATOM   1654 C  C6    . DG  B 2 6   ? 10.386  -7.319  37.949  1.00 61.95  ? 6    DG  B C6    1 
ATOM   1655 O  O6    . DG  B 2 6   ? 9.985   -6.224  38.380  1.00 64.37  ? 6    DG  B O6    1 
ATOM   1656 N  N1    . DG  B 2 6   ? 10.454  -8.421  38.795  1.00 61.05  ? 6    DG  B N1    1 
ATOM   1657 C  C2    . DG  B 2 6   ? 10.879  -9.670  38.423  1.00 65.87  ? 6    DG  B C2    1 
ATOM   1658 N  N2    . DG  B 2 6   ? 10.865  -10.602 39.383  1.00 69.94  ? 6    DG  B N2    1 
ATOM   1659 N  N3    . DG  B 2 6   ? 11.285  -9.987  37.196  1.00 66.26  ? 6    DG  B N3    1 
ATOM   1660 C  C4    . DG  B 2 6   ? 11.226  -8.922  36.364  1.00 64.22  ? 6    DG  B C4    1 
ATOM   1661 P  P     . DC  B 2 7   ? 11.520  -13.646 32.276  1.00 72.39  ? 7    DC  B P     1 
ATOM   1662 O  OP1   . DC  B 2 7   ? 12.472  -14.715 31.905  1.00 85.03  ? 7    DC  B OP1   1 
ATOM   1663 O  OP2   . DC  B 2 7   ? 10.531  -13.234 31.257  1.00 66.53  ? 7    DC  B OP2   1 
ATOM   1664 O  "O5'" . DC  B 2 7   ? 10.778  -14.078 33.614  1.00 61.03  ? 7    DC  B "O5'" 1 
ATOM   1665 C  "C5'" . DC  B 2 7   ? 10.571  -13.128 34.587  1.00 62.58  ? 7    DC  B "C5'" 1 
ATOM   1666 C  "C4'" . DC  B 2 7   ? 10.078  -13.742 35.856  1.00 65.87  ? 7    DC  B "C4'" 1 
ATOM   1667 O  "O4'" . DC  B 2 7   ? 9.806   -12.674 36.806  1.00 74.08  ? 7    DC  B "O4'" 1 
ATOM   1668 C  "C3'" . DC  B 2 7   ? 8.778   -14.486 35.714  1.00 58.52  ? 7    DC  B "C3'" 1 
ATOM   1669 O  "O3'" . DC  B 2 7   ? 8.656   -15.409 36.777  1.00 72.12  ? 7    DC  B "O3'" 1 
ATOM   1670 C  "C2'" . DC  B 2 7   ? 7.771   -13.352 35.842  1.00 67.94  ? 7    DC  B "C2'" 1 
ATOM   1671 C  "C1'" . DC  B 2 7   ? 8.408   -12.513 36.950  1.00 66.65  ? 7    DC  B "C1'" 1 
ATOM   1672 N  N1    . DC  B 2 7   ? 8.063   -11.039 36.888  1.00 66.62  ? 7    DC  B N1    1 
ATOM   1673 C  C2    . DC  B 2 7   ? 7.634   -10.379 38.048  1.00 65.88  ? 7    DC  B C2    1 
ATOM   1674 O  O2    . DC  B 2 7   ? 7.554   -11.012 39.107  1.00 65.32  ? 7    DC  B O2    1 
ATOM   1675 N  N3    . DC  B 2 7   ? 7.310   -9.056  37.975  1.00 64.65  ? 7    DC  B N3    1 
ATOM   1676 C  C4    . DC  B 2 7   ? 7.398   -8.406  36.813  1.00 61.31  ? 7    DC  B C4    1 
ATOM   1677 N  N4    . DC  B 2 7   ? 7.071   -7.107  36.794  1.00 54.80  ? 7    DC  B N4    1 
ATOM   1678 C  C5    . DC  B 2 7   ? 7.832   -9.061  35.620  1.00 61.23  ? 7    DC  B C5    1 
ATOM   1679 C  C6    . DC  B 2 7   ? 8.148   -10.363 35.701  1.00 64.48  ? 7    DC  B C6    1 
ATOM   1680 P  P     . DC  B 2 8   ? 7.671   -16.677 36.660  1.00 96.32  ? 8    DC  B P     1 
ATOM   1681 O  OP1   . DC  B 2 8   ? 8.335   -17.748 37.445  1.00 84.48  ? 8    DC  B OP1   1 
ATOM   1682 O  OP2   . DC  B 2 8   ? 7.239   -16.861 35.240  1.00 75.97  ? 8    DC  B OP2   1 
ATOM   1683 O  "O5'" . DC  B 2 8   ? 6.352   -16.222 37.432  1.00 74.15  ? 8    DC  B "O5'" 1 
ATOM   1684 C  "C5'" . DC  B 2 8   ? 6.398   -15.942 38.787  1.00 70.06  ? 8    DC  B "C5'" 1 
ATOM   1685 C  "C4'" . DC  B 2 8   ? 5.105   -15.291 39.211  1.00 77.13  ? 8    DC  B "C4'" 1 
ATOM   1686 O  "O4'" . DC  B 2 8   ? 5.163   -13.873 38.908  1.00 76.87  ? 8    DC  B "O4'" 1 
ATOM   1687 C  "C3'" . DC  B 2 8   ? 3.856   -15.825 38.493  1.00 78.24  ? 8    DC  B "C3'" 1 
ATOM   1688 O  "O3'" . DC  B 2 8   ? 2.807   -16.077 39.437  1.00 84.56  ? 8    DC  B "O3'" 1 
ATOM   1689 C  "C2'" . DC  B 2 8   ? 3.492   -14.685 37.550  1.00 77.14  ? 8    DC  B "C2'" 1 
ATOM   1690 C  "C1'" . DC  B 2 8   ? 3.933   -13.489 38.369  1.00 75.64  ? 8    DC  B "C1'" 1 
ATOM   1691 N  N1    . DC  B 2 8   ? 4.122   -12.262 37.573  1.00 67.96  ? 8    DC  B N1    1 
ATOM   1692 C  C2    . DC  B 2 8   ? 3.864   -11.023 38.153  1.00 68.32  ? 8    DC  B C2    1 
ATOM   1693 O  O2    . DC  B 2 8   ? 3.495   -10.976 39.331  1.00 71.11  ? 8    DC  B O2    1 
ATOM   1694 N  N3    . DC  B 2 8   ? 4.032   -9.904  37.411  1.00 67.48  ? 8    DC  B N3    1 
ATOM   1695 C  C4    . DC  B 2 8   ? 4.428   -9.998  36.146  1.00 64.77  ? 8    DC  B C4    1 
ATOM   1696 N  N4    . DC  B 2 8   ? 4.567   -8.867  35.449  1.00 62.90  ? 8    DC  B N4    1 
ATOM   1697 C  C5    . DC  B 2 8   ? 4.686   -11.258 35.534  1.00 65.07  ? 8    DC  B C5    1 
ATOM   1698 C  C6    . DC  B 2 8   ? 4.519   -12.353 36.278  1.00 66.46  ? 8    DC  B C6    1 
ATOM   1699 P  P     . DG  B 2 9   ? 1.677   -17.186 39.128  1.00 78.44  ? 9    DG  B P     1 
ATOM   1700 O  OP1   . DG  B 2 9   ? 2.249   -18.517 39.455  1.00 77.73  ? 9    DG  B OP1   1 
ATOM   1701 O  OP2   . DG  B 2 9   ? 1.152   -16.980 37.761  1.00 72.08  ? 9    DG  B OP2   1 
ATOM   1702 O  "O5'" . DG  B 2 9   ? 0.525   -16.810 40.165  1.00 75.96  ? 9    DG  B "O5'" 1 
ATOM   1703 C  "C5'" . DG  B 2 9   ? 0.893   -16.461 41.480  1.00 78.17  ? 9    DG  B "C5'" 1 
ATOM   1704 C  "C4'" . DG  B 2 9   ? 0.016   -15.353 42.025  1.00 78.13  ? 9    DG  B "C4'" 1 
ATOM   1705 O  "O4'" . DG  B 2 9   ? 0.407   -14.073 41.460  1.00 79.19  ? 9    DG  B "O4'" 1 
ATOM   1706 C  "C3'" . DG  B 2 9   ? -1.474  -15.492 41.770  1.00 72.04  ? 9    DG  B "C3'" 1 
ATOM   1707 O  "O3'" . DG  B 2 9   ? -2.172  -14.989 42.894  1.00 83.49  ? 9    DG  B "O3'" 1 
ATOM   1708 C  "C2'" . DG  B 2 9   ? -1.686  -14.607 40.550  1.00 75.82  ? 9    DG  B "C2'" 1 
ATOM   1709 C  "C1'" . DG  B 2 9   ? -0.701  -13.479 40.811  1.00 74.20  ? 9    DG  B "C1'" 1 
ATOM   1710 N  N9    . DG  B 2 9   ? -0.224  -12.836 39.586  1.00 72.61  ? 9    DG  B N9    1 
ATOM   1711 C  C8    . DG  B 2 9   ? 0.315   -13.457 38.475  1.00 65.28  ? 9    DG  B C8    1 
ATOM   1712 N  N7    . DG  B 2 9   ? 0.651   -12.626 37.527  1.00 62.26  ? 9    DG  B N7    1 
ATOM   1713 C  C5    . DG  B 2 9   ? 0.314   -11.375 38.038  1.00 64.68  ? 9    DG  B C5    1 
ATOM   1714 C  C6    . DG  B 2 9   ? 0.445   -10.097 37.464  1.00 61.39  ? 9    DG  B C6    1 
ATOM   1715 O  O6    . DG  B 2 9   ? 0.909   -9.801  36.363  1.00 61.65  ? 9    DG  B O6    1 
ATOM   1716 N  N1    . DG  B 2 9   ? -0.018  -9.096  38.311  1.00 64.10  ? 9    DG  B N1    1 
ATOM   1717 C  C2    . DG  B 2 9   ? -0.542  -9.302  39.560  1.00 62.26  ? 9    DG  B C2    1 
ATOM   1718 N  N2    . DG  B 2 9   ? -0.930  -8.203  40.228  1.00 53.50  ? 9    DG  B N2    1 
ATOM   1719 N  N3    . DG  B 2 9   ? -0.680  -10.499 40.115  1.00 63.28  ? 9    DG  B N3    1 
ATOM   1720 C  C4    . DG  B 2 9   ? -0.224  -11.486 39.302  1.00 66.86  ? 9    DG  B C4    1 
ATOM   1721 P  P     . DG  B 2 10  ? -3.760  -15.182 43.031  1.00 90.37  ? 10   DG  B P     1 
ATOM   1722 O  OP1   . DG  B 2 10  ? -3.993  -15.744 44.382  1.00 100.86 ? 10   DG  B OP1   1 
ATOM   1723 O  OP2   . DG  B 2 10  ? -4.230  -15.940 41.849  1.00 82.72  ? 10   DG  B OP2   1 
ATOM   1724 O  "O5'" . DG  B 2 10  ? -4.315  -13.680 42.997  1.00 80.11  ? 10   DG  B "O5'" 1 
ATOM   1725 C  "C5'" . DG  B 2 10  ? -3.699  -12.704 43.823  1.00 77.75  ? 10   DG  B "C5'" 1 
ATOM   1726 C  "C4'" . DG  B 2 10  ? -4.371  -11.347 43.685  1.00 84.26  ? 10   DG  B "C4'" 1 
ATOM   1727 O  "O4'" . DG  B 2 10  ? -3.812  -10.617 42.559  1.00 79.19  ? 10   DG  B "O4'" 1 
ATOM   1728 C  "C3'" . DG  B 2 10  ? -5.877  -11.373 43.472  1.00 87.27  ? 10   DG  B "C3'" 1 
ATOM   1729 O  "O3'" . DG  B 2 10  ? -6.471  -10.301 44.205  1.00 91.09  ? 10   DG  B "O3'" 1 
ATOM   1730 C  "C2'" . DG  B 2 10  ? -6.017  -11.184 41.955  1.00 84.76  ? 10   DG  B "C2'" 1 
ATOM   1731 C  "C1'" . DG  B 2 10  ? -4.828  -10.283 41.632  1.00 81.50  ? 10   DG  B "C1'" 1 
ATOM   1732 N  N9    . DG  B 2 10  ? -4.281  -10.482 40.290  1.00 76.81  ? 10   DG  B N9    1 
ATOM   1733 C  C8    . DG  B 2 10  ? -3.892  -11.678 39.726  1.00 75.87  ? 10   DG  B C8    1 
ATOM   1734 N  N7    . DG  B 2 10  ? -3.424  -11.557 38.515  1.00 69.16  ? 10   DG  B N7    1 
ATOM   1735 C  C5    . DG  B 2 10  ? -3.486  -10.190 38.262  1.00 68.57  ? 10   DG  B C5    1 
ATOM   1736 C  C6    . DG  B 2 10  ? -3.112  -9.460  37.104  1.00 68.64  ? 10   DG  B C6    1 
ATOM   1737 O  O6    . DG  B 2 10  ? -2.623  -9.894  36.043  1.00 65.12  ? 10   DG  B O6    1 
ATOM   1738 N  N1    . DG  B 2 10  ? -3.358  -8.091  37.255  1.00 63.88  ? 10   DG  B N1    1 
ATOM   1739 C  C2    . DG  B 2 10  ? -3.887  -7.503  38.384  1.00 63.78  ? 10   DG  B C2    1 
ATOM   1740 N  N2    . DG  B 2 10  ? -4.039  -6.163  38.342  1.00 57.19  ? 10   DG  B N2    1 
ATOM   1741 N  N3    . DG  B 2 10  ? -4.237  -8.180  39.480  1.00 65.77  ? 10   DG  B N3    1 
ATOM   1742 C  C4    . DG  B 2 10  ? -4.013  -9.512  39.345  1.00 66.89  ? 10   DG  B C4    1 
ATOM   1743 P  P     . DG  B 2 11  ? -8.027  -10.340 44.600  1.00 98.39  ? 11   DG  B P     1 
ATOM   1744 O  OP1   . DG  B 2 11  ? -8.186  -9.434  45.760  1.00 90.08  ? 11   DG  B OP1   1 
ATOM   1745 O  OP2   . DG  B 2 11  ? -8.470  -11.752 44.639  1.00 87.33  ? 11   DG  B OP2   1 
ATOM   1746 O  "O5'" . DG  B 2 11  ? -8.743  -9.625  43.372  1.00 90.31  ? 11   DG  B "O5'" 1 
ATOM   1747 C  "C5'" . DG  B 2 11  ? -8.508  -8.252  43.154  1.00 84.81  ? 11   DG  B "C5'" 1 
ATOM   1748 C  "C4'" . DG  B 2 11  ? -8.941  -7.850  41.765  1.00 85.40  ? 11   DG  B "C4'" 1 
ATOM   1749 O  "O4'" . DG  B 2 11  ? -8.110  -8.498  40.763  1.00 89.55  ? 11   DG  B "O4'" 1 
ATOM   1750 C  "C3'" . DG  B 2 11  ? -10.383 -8.221  41.391  1.00 86.57  ? 11   DG  B "C3'" 1 
ATOM   1751 O  "O3'" . DG  B 2 11  ? -10.971 -7.112  40.773  1.00 86.48  ? 11   DG  B "O3'" 1 
ATOM   1752 C  "C2'" . DG  B 2 11  ? -10.192 -9.357  40.378  1.00 83.56  ? 11   DG  B "C2'" 1 
ATOM   1753 C  "C1'" . DG  B 2 11  ? -8.959  -8.834  39.695  1.00 83.27  ? 11   DG  B "C1'" 1 
ATOM   1754 N  N9    . DG  B 2 11  ? -8.282  -9.759  38.805  1.00 76.68  ? 11   DG  B N9    1 
ATOM   1755 C  C8    . DG  B 2 11  ? -8.219  -11.130 38.891  1.00 77.49  ? 11   DG  B C8    1 
ATOM   1756 N  N7    . DG  B 2 11  ? -7.522  -11.674 37.924  1.00 71.97  ? 11   DG  B N7    1 
ATOM   1757 C  C5    . DG  B 2 11  ? -7.102  -10.588 37.159  1.00 67.96  ? 11   DG  B C5    1 
ATOM   1758 C  C6    . DG  B 2 11  ? -6.304  -10.543 35.990  1.00 65.34  ? 11   DG  B C6    1 
ATOM   1759 O  O6    . DG  B 2 11  ? -5.790  -11.490 35.372  1.00 66.62  ? 11   DG  B O6    1 
ATOM   1760 N  N1    . DG  B 2 11  ? -6.120  -9.235  35.543  1.00 65.42  ? 11   DG  B N1    1 
ATOM   1761 C  C2    . DG  B 2 11  ? -6.639  -8.109  36.155  1.00 66.89  ? 11   DG  B C2    1 
ATOM   1762 N  N2    . DG  B 2 11  ? -6.359  -6.926  35.578  1.00 58.05  ? 11   DG  B N2    1 
ATOM   1763 N  N3    . DG  B 2 11  ? -7.374  -8.142  37.252  1.00 67.35  ? 11   DG  B N3    1 
ATOM   1764 C  C4    . DG  B 2 11  ? -7.562  -9.408  37.695  1.00 68.92  ? 11   DG  B C4    1 
ATOM   1765 P  P     . DT  B 2 12  ? -12.239 -6.392  41.428  1.00 87.66  ? 12   DT  B P     1 
ATOM   1766 O  OP1   . DT  B 2 12  ? -11.850 -5.975  42.797  1.00 88.96  ? 12   DT  B OP1   1 
ATOM   1767 O  OP2   . DT  B 2 12  ? -13.411 -7.255  41.118  1.00 81.17  ? 12   DT  B OP2   1 
ATOM   1768 O  "O5'" . DT  B 2 12  ? -12.376 -5.055  40.586  1.00 83.92  ? 12   DT  B "O5'" 1 
ATOM   1769 C  "C5'" . DT  B 2 12  ? -11.247 -4.231  40.417  1.00 80.32  ? 12   DT  B "C5'" 1 
ATOM   1770 C  "C4'" . DT  B 2 12  ? -10.938 -4.024  38.943  1.00 85.06  ? 12   DT  B "C4'" 1 
ATOM   1771 O  "O4'" . DT  B 2 12  ? -10.478 -5.259  38.323  1.00 82.61  ? 12   DT  B "O4'" 1 
ATOM   1772 C  "C3'" . DT  B 2 12  ? -12.111 -3.539  38.077  1.00 80.68  ? 12   DT  B "C3'" 1 
ATOM   1773 O  "O3'" . DT  B 2 12  ? -11.643 -2.511  37.289  1.00 79.18  ? 12   DT  B "O3'" 1 
ATOM   1774 C  "C2'" . DT  B 2 12  ? -12.433 -4.761  37.211  1.00 67.27  ? 12   DT  B "C2'" 1 
ATOM   1775 C  "C1'" . DT  B 2 12  ? -11.040 -5.310  37.029  1.00 73.33  ? 12   DT  B "C1'" 1 
ATOM   1776 N  N1    . DT  B 2 12  ? -10.985 -6.687  36.529  1.00 74.29  ? 12   DT  B N1    1 
ATOM   1777 C  C2    . DT  B 2 12  ? -10.205 -6.964  35.422  1.00 72.61  ? 12   DT  B C2    1 
ATOM   1778 O  O2    . DT  B 2 12  ? -9.564  -6.110  34.822  1.00 75.41  ? 12   DT  B O2    1 
ATOM   1779 N  N3    . DT  B 2 12  ? -10.206 -8.277  35.035  1.00 64.74  ? 12   DT  B N3    1 
ATOM   1780 C  C4    . DT  B 2 12  ? -10.903 -9.315  35.632  1.00 73.80  ? 12   DT  B C4    1 
ATOM   1781 O  O4    . DT  B 2 12  ? -10.848 -10.471 35.218  1.00 75.84  ? 12   DT  B O4    1 
ATOM   1782 C  C5    . DT  B 2 12  ? -11.694 -8.951  36.784  1.00 77.40  ? 12   DT  B C5    1 
ATOM   1783 C  C7    . DT  B 2 12  ? -12.482 -9.995  37.508  1.00 84.16  ? 12   DT  B C7    1 
ATOM   1784 C  C6    . DT  B 2 12  ? -11.692 -7.669  37.174  1.00 74.91  ? 12   DT  B C6    1 
ATOM   1785 P  P     . DA  B 2 13  ? -12.474 -1.161  37.090  1.00 79.35  ? 13   DA  B P     1 
ATOM   1786 O  OP1   . DA  B 2 13  ? -12.066 -0.241  38.175  1.00 77.89  ? 13   DA  B OP1   1 
ATOM   1787 O  OP2   . DA  B 2 13  ? -13.899 -1.522  36.889  1.00 76.60  ? 13   DA  B OP2   1 
ATOM   1788 O  "O5'" . DA  B 2 13  ? -11.870 -0.617  35.710  1.00 75.16  ? 13   DA  B "O5'" 1 
ATOM   1789 C  "C5'" . DA  B 2 13  ? -10.476 -0.822  35.431  1.00 59.75  ? 13   DA  B "C5'" 1 
ATOM   1790 C  "C4'" . DA  B 2 13  ? -10.238 -1.266  34.001  1.00 60.13  ? 13   DA  B "C4'" 1 
ATOM   1791 O  "O4'" . DA  B 2 13  ? -10.653 -2.645  33.809  1.00 74.36  ? 13   DA  B "O4'" 1 
ATOM   1792 C  "C3'" . DA  B 2 13  ? -10.989 -0.487  32.940  1.00 65.72  ? 13   DA  B "C3'" 1 
ATOM   1793 O  "O3'" . DA  B 2 13  ? -10.237 -0.533  31.766  1.00 53.71  ? 13   DA  B "O3'" 1 
ATOM   1794 C  "C2'" . DA  B 2 13  ? -12.273 -1.303  32.787  1.00 63.44  ? 13   DA  B "C2'" 1 
ATOM   1795 C  "C1'" . DA  B 2 13  ? -11.689 -2.695  32.819  1.00 60.55  ? 13   DA  B "C1'" 1 
ATOM   1796 N  N9    . DA  B 2 13  ? -12.630 -3.742  33.188  1.00 55.77  ? 13   DA  B N9    1 
ATOM   1797 C  C8    . DA  B 2 13  ? -13.713 -3.641  34.017  1.00 57.43  ? 13   DA  B C8    1 
ATOM   1798 N  N7    . DA  B 2 13  ? -14.347 -4.787  34.200  1.00 51.98  ? 13   DA  B N7    1 
ATOM   1799 C  C5    . DA  B 2 13  ? -13.620 -5.692  33.448  1.00 49.89  ? 13   DA  B C5    1 
ATOM   1800 C  C6    . DA  B 2 13  ? -13.768 -7.072  33.209  1.00 53.96  ? 13   DA  B C6    1 
ATOM   1801 N  N6    . DA  B 2 13  ? -14.746 -7.809  33.730  1.00 55.95  ? 13   DA  B N6    1 
ATOM   1802 N  N1    . DA  B 2 13  ? -12.863 -7.670  32.396  1.00 58.99  ? 13   DA  B N1    1 
ATOM   1803 C  C2    . DA  B 2 13  ? -11.874 -6.930  31.873  1.00 52.03  ? 13   DA  B C2    1 
ATOM   1804 N  N3    . DA  B 2 13  ? -11.638 -5.629  32.023  1.00 49.81  ? 13   DA  B N3    1 
ATOM   1805 C  C4    . DA  B 2 13  ? -12.555 -5.063  32.824  1.00 53.73  ? 13   DA  B C4    1 
ATOM   1806 P  P     . DA  B 2 14  ? -10.345 0.647   30.701  1.00 58.47  ? 14   DA  B P     1 
ATOM   1807 O  OP1   . DA  B 2 14  ? -9.069  0.663   29.958  1.00 63.72  ? 14   DA  B OP1   1 
ATOM   1808 O  OP2   . DA  B 2 14  ? -10.742 1.853   31.470  1.00 63.51  ? 14   DA  B OP2   1 
ATOM   1809 O  "O5'" . DA  B 2 14  ? -11.546 0.161   29.727  1.00 63.71  ? 14   DA  B "O5'" 1 
ATOM   1810 C  "C5'" . DA  B 2 14  ? -11.271 -0.479  28.450  1.00 53.60  ? 14   DA  B "C5'" 1 
ATOM   1811 C  "C4'" . DA  B 2 14  ? -10.760 -1.906  28.623  1.00 53.04  ? 14   DA  B "C4'" 1 
ATOM   1812 O  "O4'" . DA  B 2 14  ? -11.609 -2.634  29.553  1.00 53.70  ? 14   DA  B "O4'" 1 
ATOM   1813 C  "C3'" . DA  B 2 14  ? -10.718 -2.763  27.341  1.00 50.37  ? 14   DA  B "C3'" 1 
ATOM   1814 O  "O3'" . DA  B 2 14  ? -9.536  -3.560  27.335  1.00 49.94  ? 14   DA  B "O3'" 1 
ATOM   1815 C  "C2'" . DA  B 2 14  ? -11.968 -3.634  27.479  1.00 55.69  ? 14   DA  B "C2'" 1 
ATOM   1816 C  "C1'" . DA  B 2 14  ? -11.958 -3.879  28.976  1.00 53.83  ? 14   DA  B "C1'" 1 
ATOM   1817 N  N9    . DA  B 2 14  ? -13.240 -4.302  29.552  1.00 58.74  ? 14   DA  B N9    1 
ATOM   1818 C  C8    . DA  B 2 14  ? -14.103 -3.527  30.276  1.00 56.02  ? 14   DA  B C8    1 
ATOM   1819 N  N7    . DA  B 2 14  ? -15.158 -4.165  30.701  1.00 52.39  ? 14   DA  B N7    1 
ATOM   1820 C  C5    . DA  B 2 14  ? -14.978 -5.451  30.240  1.00 50.06  ? 14   DA  B C5    1 
ATOM   1821 C  C6    . DA  B 2 14  ? -15.752 -6.609  30.377  1.00 58.64  ? 14   DA  B C6    1 
ATOM   1822 N  N6    . DA  B 2 14  ? -16.918 -6.633  31.041  1.00 58.36  ? 14   DA  B N6    1 
ATOM   1823 N  N1    . DA  B 2 14  ? -15.292 -7.744  29.802  1.00 58.94  ? 14   DA  B N1    1 
ATOM   1824 C  C2    . DA  B 2 14  ? -14.123 -7.708  29.137  1.00 51.98  ? 14   DA  B C2    1 
ATOM   1825 N  N3    . DA  B 2 14  ? -13.311 -6.674  28.939  1.00 54.71  ? 14   DA  B N3    1 
ATOM   1826 C  C4    . DA  B 2 14  ? -13.800 -5.564  29.531  1.00 52.13  ? 14   DA  B C4    1 
ATOM   1827 P  P     . DG  B 2 15  ? -9.292  -4.609  26.154  1.00 53.51  ? 15   DG  B P     1 
ATOM   1828 O  OP1   . DG  B 2 15  ? -9.941  -5.888  26.561  1.00 65.60  ? 15   DG  B OP1   1 
ATOM   1829 O  OP2   . DG  B 2 15  ? -7.841  -4.650  25.876  1.00 51.01  ? 15   DG  B OP2   1 
ATOM   1830 O  "O5'" . DG  B 2 15  ? -10.155 -3.958  24.939  1.00 57.94  ? 15   DG  B "O5'" 1 
ATOM   1831 C  "C5'" . DG  B 2 15  ? -10.383 -4.662  23.675  1.00 48.56  ? 15   DG  B "C5'" 1 
ATOM   1832 C  "C4'" . DG  B 2 15  ? -11.214 -5.953  23.821  1.00 49.36  ? 15   DG  B "C4'" 1 
ATOM   1833 O  "O4'" . DG  B 2 15  ? -12.190 -5.877  24.918  1.00 52.85  ? 15   DG  B "O4'" 1 
ATOM   1834 C  "C3'" . DG  B 2 15  ? -12.017 -6.355  22.566  1.00 47.12  ? 15   DG  B "C3'" 1 
ATOM   1835 O  "O3'" . DG  B 2 15  ? -11.774 -7.695  22.253  1.00 42.99  ? 15   DG  B "O3'" 1 
ATOM   1836 C  "C2'" . DG  B 2 15  ? -13.469 -6.155  22.993  1.00 55.14  ? 15   DG  B "C2'" 1 
ATOM   1837 C  "C1'" . DG  B 2 15  ? -13.380 -6.503  24.464  1.00 58.42  ? 15   DG  B "C1'" 1 
ATOM   1838 N  N9    . DG  B 2 15  ? -14.541 -6.079  25.270  1.00 55.54  ? 15   DG  B N9    1 
ATOM   1839 C  C8    . DG  B 2 15  ? -14.874 -4.804  25.676  1.00 54.21  ? 15   DG  B C8    1 
ATOM   1840 N  N7    . DG  B 2 15  ? -15.952 -4.768  26.407  1.00 56.37  ? 15   DG  B N7    1 
ATOM   1841 C  C5    . DG  B 2 15  ? -16.367 -6.097  26.482  1.00 54.38  ? 15   DG  B C5    1 
ATOM   1842 C  C6    . DG  B 2 15  ? -17.480 -6.676  27.138  1.00 58.35  ? 15   DG  B C6    1 
ATOM   1843 O  O6    . DG  B 2 15  ? -18.351 -6.111  27.804  1.00 63.14  ? 15   DG  B O6    1 
ATOM   1844 N  N1    . DG  B 2 15  ? -17.537 -8.053  26.953  1.00 55.60  ? 15   DG  B N1    1 
ATOM   1845 C  C2    . DG  B 2 15  ? -16.634 -8.780  26.230  1.00 59.39  ? 15   DG  B C2    1 
ATOM   1846 N  N2    . DG  B 2 15  ? -16.843 -10.107 26.166  1.00 64.61  ? 15   DG  B N2    1 
ATOM   1847 N  N3    . DG  B 2 15  ? -15.576 -8.250  25.622  1.00 60.11  ? 15   DG  B N3    1 
ATOM   1848 C  C4    . DG  B 2 15  ? -15.516 -6.907  25.783  1.00 53.37  ? 15   DG  B C4    1 
ATOM   1849 P  P     . DT  B 2 16  ? -11.957 -8.212  20.757  1.00 49.79  ? 16   DT  B P     1 
ATOM   1850 O  OP1   . DT  B 2 16  ? -10.956 -9.256  20.463  1.00 54.88  ? 16   DT  B OP1   1 
ATOM   1851 O  OP2   . DT  B 2 16  ? -12.063 -6.996  19.919  1.00 47.46  ? 16   DT  B OP2   1 
ATOM   1852 O  "O5'" . DT  B 2 16  ? -13.379 -8.923  20.795  1.00 58.87  ? 16   DT  B "O5'" 1 
ATOM   1853 C  "C5'" . DT  B 2 16  ? -13.645 -9.920  21.759  1.00 58.92  ? 16   DT  B "C5'" 1 
ATOM   1854 C  "C4'" . DT  B 2 16  ? -14.985 -10.596 21.485  1.00 60.29  ? 16   DT  B "C4'" 1 
ATOM   1855 O  "O4'" . DT  B 2 16  ? -16.019 -10.031 22.320  1.00 58.21  ? 16   DT  B "O4'" 1 
ATOM   1856 C  "C3'" . DT  B 2 16  ? -15.500 -10.504 20.051  1.00 57.79  ? 16   DT  B "C3'" 1 
ATOM   1857 O  "O3'" . DT  B 2 16  ? -15.904 -11.782 19.666  1.00 55.49  ? 16   DT  B "O3'" 1 
ATOM   1858 C  "C2'" . DT  B 2 16  ? -16.684 -9.511  20.134  1.00 57.28  ? 16   DT  B "C2'" 1 
ATOM   1859 C  "C1'" . DT  B 2 16  ? -17.172 -9.728  21.548  1.00 58.40  ? 16   DT  B "C1'" 1 
ATOM   1860 N  N1    . DT  B 2 16  ? -17.787 -8.559  22.196  1.00 56.34  ? 16   DT  B N1    1 
ATOM   1861 C  C2    . DT  B 2 16  ? -18.851 -8.765  23.043  1.00 59.30  ? 16   DT  B C2    1 
ATOM   1862 O  O2    . DT  B 2 16  ? -19.368 -9.855  23.210  1.00 63.10  ? 16   DT  B O2    1 
ATOM   1863 N  N3    . DT  B 2 16  ? -19.312 -7.642  23.669  1.00 56.00  ? 16   DT  B N3    1 
ATOM   1864 C  C4    . DT  B 2 16  ? -18.811 -6.366  23.559  1.00 55.12  ? 16   DT  B C4    1 
ATOM   1865 O  O4    . DT  B 2 16  ? -19.284 -5.425  24.177  1.00 55.56  ? 16   DT  B O4    1 
ATOM   1866 C  C5    . DT  B 2 16  ? -17.679 -6.217  22.684  1.00 53.86  ? 16   DT  B C5    1 
ATOM   1867 C  C7    . DT  B 2 16  ? -17.063 -4.865  22.491  1.00 48.02  ? 16   DT  B C7    1 
ATOM   1868 C  C6    . DT  B 2 16  ? -17.212 -7.315  22.059  1.00 54.35  ? 16   DT  B C6    1 
ATOM   1869 P  P     . DT  B 2 17  ? -16.572 -12.057 18.242  1.00 58.26  ? 17   DT  B P     1 
ATOM   1870 O  OP1   . DT  B 2 17  ? -16.116 -13.398 17.846  1.00 57.58  ? 17   DT  B OP1   1 
ATOM   1871 O  OP2   . DT  B 2 17  ? -16.349 -10.958 17.289  1.00 60.23  ? 17   DT  B OP2   1 
ATOM   1872 O  "O5'" . DT  B 2 17  ? -18.106 -12.086 18.622  1.00 56.93  ? 17   DT  B "O5'" 1 
ATOM   1873 C  "C5'" . DT  B 2 17  ? -18.528 -12.937 19.644  1.00 55.57  ? 17   DT  B "C5'" 1 
ATOM   1874 C  "C4'" . DT  B 2 17  ? -20.021 -12.853 19.840  1.00 54.69  ? 17   DT  B "C4'" 1 
ATOM   1875 O  "O4'" . DT  B 2 17  ? -20.370 -11.629 20.533  1.00 64.03  ? 17   DT  B "O4'" 1 
ATOM   1876 C  "C3'" . DT  B 2 17  ? -20.866 -12.853 18.573  1.00 58.73  ? 17   DT  B "C3'" 1 
ATOM   1877 O  "O3'" . DT  B 2 17  ? -22.060 -13.547 18.865  1.00 76.24  ? 17   DT  B "O3'" 1 
ATOM   1878 C  "C2'" . DT  B 2 17  ? -21.152 -11.365 18.383  1.00 53.65  ? 17   DT  B "C2'" 1 
ATOM   1879 C  "C1'" . DT  B 2 17  ? -21.408 -10.986 19.822  1.00 56.38  ? 17   DT  B "C1'" 1 
ATOM   1880 N  N1    . DT  B 2 17  ? -21.328 -9.542  20.114  1.00 54.11  ? 17   DT  B N1    1 
ATOM   1881 C  C2    . DT  B 2 17  ? -22.141 -9.015  21.091  1.00 58.95  ? 17   DT  B C2    1 
ATOM   1882 O  O2    . DT  B 2 17  ? -22.960 -9.674  21.710  1.00 65.31  ? 17   DT  B O2    1 
ATOM   1883 N  N3    . DT  B 2 17  ? -21.971 -7.678  21.314  1.00 57.92  ? 17   DT  B N3    1 
ATOM   1884 C  C4    . DT  B 2 17  ? -21.076 -6.836  20.682  1.00 58.56  ? 17   DT  B C4    1 
ATOM   1885 O  O4    . DT  B 2 17  ? -20.995 -5.643  20.953  1.00 57.90  ? 17   DT  B O4    1 
ATOM   1886 C  C5    . DT  B 2 17  ? -20.248 -7.458  19.672  1.00 57.28  ? 17   DT  B C5    1 
ATOM   1887 C  C7    . DT  B 2 17  ? -19.241 -6.645  18.915  1.00 56.37  ? 17   DT  B C7    1 
ATOM   1888 C  C6    . DT  B 2 17  ? -20.411 -8.767  19.445  1.00 56.28  ? 17   DT  B C6    1 
ATOM   1889 P  P     . DC  B 2 18  ? -22.730 -14.577 17.831  1.00 83.17  ? 18   DC  B P     1 
ATOM   1890 O  OP1   . DC  B 2 18  ? -22.006 -15.868 17.816  1.00 73.14  ? 18   DC  B OP1   1 
ATOM   1891 O  OP2   . DC  B 2 18  ? -22.952 -13.840 16.555  1.00 66.65  ? 18   DC  B OP2   1 
ATOM   1892 O  "O5'" . DC  B 2 18  ? -24.136 -14.801 18.518  1.00 68.37  ? 18   DC  B "O5'" 1 
ATOM   1893 C  "C5'" . DC  B 2 18  ? -25.084 -13.813 18.363  1.00 72.79  ? 18   DC  B "C5'" 1 
ATOM   1894 C  "C4'" . DC  B 2 18  ? -25.856 -13.584 19.623  1.00 67.17  ? 18   DC  B "C4'" 1 
ATOM   1895 O  "O4'" . DC  B 2 18  ? -25.154 -12.620 20.446  1.00 66.30  ? 18   DC  B "O4'" 1 
ATOM   1896 C  "C3'" . DC  B 2 18  ? -27.229 -13.005 19.352  1.00 72.43  ? 18   DC  B "C3'" 1 
ATOM   1897 O  "O3'" . DC  B 2 18  ? -28.166 -14.067 19.350  1.00 76.67  ? 18   DC  B "O3'" 1 
ATOM   1898 C  "C2'" . DC  B 2 18  ? -27.448 -12.032 20.514  1.00 71.30  ? 18   DC  B "C2'" 1 
ATOM   1899 C  "C1'" . DC  B 2 18  ? -26.029 -11.566 20.829  1.00 68.62  ? 18   DC  B "C1'" 1 
ATOM   1900 N  N1    . DC  B 2 18  ? -25.607 -10.255 20.131  1.00 66.87  ? 18   DC  B N1    1 
ATOM   1901 C  C2    . DC  B 2 18  ? -26.029 -9.012  20.653  1.00 69.93  ? 18   DC  B C2    1 
ATOM   1902 O  O2    . DC  B 2 18  ? -26.751 -8.990  21.662  1.00 72.99  ? 18   DC  B O2    1 
ATOM   1903 N  N3    . DC  B 2 18  ? -25.638 -7.862  20.026  1.00 64.77  ? 18   DC  B N3    1 
ATOM   1904 C  C4    . DC  B 2 18  ? -24.856 -7.923  18.946  1.00 61.35  ? 18   DC  B C4    1 
ATOM   1905 N  N4    . DC  B 2 18  ? -24.491 -6.773  18.378  1.00 61.15  ? 18   DC  B N4    1 
ATOM   1906 C  C5    . DC  B 2 18  ? -24.416 -9.168  18.401  1.00 56.01  ? 18   DC  B C5    1 
ATOM   1907 C  C6    . DC  B 2 18  ? -24.805 -10.294 19.018  1.00 63.05  ? 18   DC  B C6    1 
ATOM   1908 P  P     . DC  B 2 19  ? -29.377 -14.118 18.298  1.00 84.95  ? 19   DC  B P     1 
ATOM   1909 O  OP1   . DC  B 2 19  ? -30.012 -15.423 18.591  1.00 82.56  ? 19   DC  B OP1   1 
ATOM   1910 O  OP2   . DC  B 2 19  ? -28.950 -13.819 16.905  1.00 70.09  ? 19   DC  B OP2   1 
ATOM   1911 O  "O5'" . DC  B 2 19  ? -30.335 -12.947 18.805  1.00 78.95  ? 19   DC  B "O5'" 1 
ATOM   1912 C  "C5'" . DC  B 2 19  ? -30.763 -12.944 20.155  1.00 75.82  ? 19   DC  B "C5'" 1 
ATOM   1913 C  "C4'" . DC  B 2 19  ? -31.340 -11.595 20.549  1.00 81.86  ? 19   DC  B "C4'" 1 
ATOM   1914 O  "O4'" . DC  B 2 19  ? -30.288 -10.610 20.634  1.00 78.91  ? 19   DC  B "O4'" 1 
ATOM   1915 C  "C3'" . DC  B 2 19  ? -32.350 -11.006 19.576  1.00 85.90  ? 19   DC  B "C3'" 1 
ATOM   1916 O  "O3'" . DC  B 2 19  ? -33.653 -11.557 19.849  1.00 89.71  ? 19   DC  B "O3'" 1 
ATOM   1917 C  "C2'" . DC  B 2 19  ? -32.283 -9.509  19.915  1.00 85.90  ? 19   DC  B "C2'" 1 
ATOM   1918 C  "C1'" . DC  B 2 19  ? -30.849 -9.319  20.450  1.00 79.95  ? 19   DC  B "C1'" 1 
ATOM   1919 N  N1    . DC  B 2 19  ? -29.959 -8.507  19.531  1.00 70.30  ? 19   DC  B N1    1 
ATOM   1920 C  C2    . DC  B 2 19  ? -29.932 -7.105  19.653  1.00 72.77  ? 19   DC  B C2    1 
ATOM   1921 O  O2    . DC  B 2 19  ? -30.626 -6.563  20.519  1.00 70.76  ? 19   DC  B O2    1 
ATOM   1922 N  N3    . DC  B 2 19  ? -29.133 -6.383  18.818  1.00 71.11  ? 19   DC  B N3    1 
ATOM   1923 C  C4    . DC  B 2 19  ? -28.388 -7.010  17.895  1.00 68.20  ? 19   DC  B C4    1 
ATOM   1924 N  N4    . DC  B 2 19  ? -27.617 -6.260  17.104  1.00 59.68  ? 19   DC  B N4    1 
ATOM   1925 C  C5    . DC  B 2 19  ? -28.405 -8.436  17.751  1.00 66.67  ? 19   DC  B C5    1 
ATOM   1926 C  C6    . DC  B 2 19  ? -29.194 -9.138  18.583  1.00 66.46  ? 19   DC  B C6    1 
ATOM   1927 P  P     . DG  B 2 20  ? -34.829 -11.560 18.747  1.00 99.55  ? 20   DG  B P     1 
ATOM   1928 O  OP1   . DG  B 2 20  ? -35.808 -12.559 19.232  1.00 100.35 ? 20   DG  B OP1   1 
ATOM   1929 O  OP2   . DG  B 2 20  ? -34.283 -11.685 17.376  1.00 91.60  ? 20   DG  B OP2   1 
ATOM   1930 O  "O5'" . DG  B 2 20  ? -35.460 -10.100 18.861  1.00 85.92  ? 20   DG  B "O5'" 1 
ATOM   1931 C  "C5'" . DG  B 2 20  ? -35.710 -9.514  20.135  1.00 78.06  ? 20   DG  B "C5'" 1 
ATOM   1932 C  "C4'" . DG  B 2 20  ? -35.995 -8.039  19.960  1.00 79.79  ? 20   DG  B "C4'" 1 
ATOM   1933 O  "O4'" . DG  B 2 20  ? -34.746 -7.335  19.703  1.00 91.28  ? 20   DG  B "O4'" 1 
ATOM   1934 C  "C3'" . DG  B 2 20  ? -36.912 -7.734  18.771  1.00 88.58  ? 20   DG  B "C3'" 1 
ATOM   1935 O  "O3'" . DG  B 2 20  ? -37.914 -6.806  19.113  1.00 97.73  ? 20   DG  B "O3'" 1 
ATOM   1936 C  "C2'" . DG  B 2 20  ? -35.983 -7.157  17.719  1.00 88.84  ? 20   DG  B "C2'" 1 
ATOM   1937 C  "C1'" . DG  B 2 20  ? -34.894 -6.514  18.558  1.00 88.69  ? 20   DG  B "C1'" 1 
ATOM   1938 N  N9    . DG  B 2 20  ? -33.633 -6.447  17.816  1.00 88.05  ? 20   DG  B N9    1 
ATOM   1939 C  C8    . DG  B 2 20  ? -33.010 -7.486  17.159  1.00 84.83  ? 20   DG  B C8    1 
ATOM   1940 N  N7    . DG  B 2 20  ? -31.920 -7.127  16.540  1.00 82.12  ? 20   DG  B N7    1 
ATOM   1941 C  C5    . DG  B 2 20  ? -31.826 -5.760  16.782  1.00 71.68  ? 20   DG  B C5    1 
ATOM   1942 C  C6    . DG  B 2 20  ? -30.859 -4.834  16.355  1.00 66.62  ? 20   DG  B C6    1 
ATOM   1943 O  O6    . DG  B 2 20  ? -29.859 -5.044  15.660  1.00 66.81  ? 20   DG  B O6    1 
ATOM   1944 N  N1    . DG  B 2 20  ? -31.139 -3.546  16.809  1.00 65.93  ? 20   DG  B N1    1 
ATOM   1945 C  C2    . DG  B 2 20  ? -32.217 -3.209  17.592  1.00 63.65  ? 20   DG  B C2    1 
ATOM   1946 N  N2    . DG  B 2 20  ? -32.326 -1.918  17.937  1.00 59.06  ? 20   DG  B N2    1 
ATOM   1947 N  N3    . DG  B 2 20  ? -33.132 -4.071  17.995  1.00 69.48  ? 20   DG  B N3    1 
ATOM   1948 C  C4    . DG  B 2 20  ? -32.877 -5.323  17.551  1.00 73.23  ? 20   DG  B C4    1 
ATOM   1949 P  P     . DG  B 2 21  ? -39.038 -6.448  18.027  1.00 85.68  ? 21   DG  B P     1 
ATOM   1950 O  OP1   . DG  B 2 21  ? -40.254 -6.078  18.784  1.00 81.28  ? 21   DG  B OP1   1 
ATOM   1951 O  OP2   . DG  B 2 21  ? -39.020 -7.564  17.038  1.00 81.70  ? 21   DG  B OP2   1 
ATOM   1952 O  "O5'" . DG  B 2 21  ? -38.486 -5.133  17.294  1.00 75.95  ? 21   DG  B "O5'" 1 
ATOM   1953 C  "C5'" . DG  B 2 21  ? -38.499 -3.898  17.970  1.00 73.45  ? 21   DG  B "C5'" 1 
ATOM   1954 C  "C4'" . DG  B 2 21  ? -37.605 -2.880  17.279  1.00 80.11  ? 21   DG  B "C4'" 1 
ATOM   1955 O  "O4'" . DG  B 2 21  ? -36.311 -3.443  16.961  1.00 83.02  ? 21   DG  B "O4'" 1 
ATOM   1956 C  "C3'" . DG  B 2 21  ? -38.105 -2.381  15.940  1.00 75.28  ? 21   DG  B "C3'" 1 
ATOM   1957 O  "O3'" . DG  B 2 21  ? -38.955 -1.288  16.117  1.00 82.29  ? 21   DG  B "O3'" 1 
ATOM   1958 C  "C2'" . DG  B 2 21  ? -36.821 -1.928  15.233  1.00 74.95  ? 21   DG  B "C2'" 1 
ATOM   1959 C  "C1'" . DG  B 2 21  ? -35.699 -2.540  16.057  1.00 70.31  ? 21   DG  B "C1'" 1 
ATOM   1960 N  N9    . DG  B 2 21  ? -34.725 -3.218  15.210  1.00 66.20  ? 21   DG  B N9    1 
ATOM   1961 C  C8    . DG  B 2 21  ? -34.691 -4.549  14.860  1.00 68.82  ? 21   DG  B C8    1 
ATOM   1962 N  N7    . DG  B 2 21  ? -33.705 -4.847  14.055  1.00 64.59  ? 21   DG  B N7    1 
ATOM   1963 C  C5    . DG  B 2 21  ? -33.058 -3.632  13.845  1.00 61.37  ? 21   DG  B C5    1 
ATOM   1964 C  C6    . DG  B 2 21  ? -31.918 -3.334  13.067  1.00 56.47  ? 21   DG  B C6    1 
ATOM   1965 O  O6    . DG  B 2 21  ? -31.235 -4.119  12.385  1.00 52.61  ? 21   DG  B O6    1 
ATOM   1966 N  N1    . DG  B 2 21  ? -31.585 -1.972  13.134  1.00 52.48  ? 21   DG  B N1    1 
ATOM   1967 C  C2    . DG  B 2 21  ? -32.280 -1.028  13.865  1.00 53.67  ? 21   DG  B C2    1 
ATOM   1968 N  N2    . DG  B 2 21  ? -31.822 0.236   13.806  1.00 51.06  ? 21   DG  B N2    1 
ATOM   1969 N  N3    . DG  B 2 21  ? -33.352 -1.301  14.598  1.00 57.51  ? 21   DG  B N3    1 
ATOM   1970 C  C4    . DG  B 2 21  ? -33.681 -2.618  14.539  1.00 61.65  ? 21   DG  B C4    1 
ATOM   1971 P  P     . DC  B 2 22  ? -39.738 -0.701  14.845  1.00 90.26  ? 22   DC  B P     1 
ATOM   1972 O  OP1   . DC  B 2 22  ? -40.659 0.365   15.318  1.00 86.31  ? 22   DC  B OP1   1 
ATOM   1973 O  OP2   . DC  B 2 22  ? -40.188 -1.889  14.074  1.00 76.99  ? 22   DC  B OP2   1 
ATOM   1974 O  "O5'" . DC  B 2 22  ? -38.623 0.027   13.974  1.00 68.55  ? 22   DC  B "O5'" 1 
ATOM   1975 C  "C5'" . DC  B 2 22  ? -38.156 1.282   14.359  1.00 70.80  ? 22   DC  B "C5'" 1 
ATOM   1976 C  "C4'" . DC  B 2 22  ? -37.151 1.767   13.352  1.00 74.28  ? 22   DC  B "C4'" 1 
ATOM   1977 O  "O4'" . DC  B 2 22  ? -36.186 0.716   13.118  1.00 76.41  ? 22   DC  B "O4'" 1 
ATOM   1978 C  "C3'" . DC  B 2 22  ? -37.744 2.107   11.983  1.00 75.22  ? 22   DC  B "C3'" 1 
ATOM   1979 O  "O3'" . DC  B 2 22  ? -37.489 3.461   11.676  1.00 79.05  ? 22   DC  B "O3'" 1 
ATOM   1980 C  "C2'" . DC  B 2 22  ? -37.029 1.157   11.005  1.00 78.53  ? 22   DC  B "C2'" 1 
ATOM   1981 C  "C1'" . DC  B 2 22  ? -35.785 0.758   11.777  1.00 72.64  ? 22   DC  B "C1'" 1 
ATOM   1982 N  N1    . DC  B 2 22  ? -35.250 -0.589  11.400  1.00 62.13  ? 22   DC  B N1    1 
ATOM   1983 C  C2    . DC  B 2 22  ? -34.043 -0.684  10.689  1.00 61.57  ? 22   DC  B C2    1 
ATOM   1984 O  O2    . DC  B 2 22  ? -33.436 0.361   10.379  1.00 61.55  ? 22   DC  B O2    1 
ATOM   1985 N  N3    . DC  B 2 22  ? -33.569 -1.920  10.360  1.00 56.96  ? 22   DC  B N3    1 
ATOM   1986 C  C4    . DC  B 2 22  ? -34.245 -3.014  10.711  1.00 56.61  ? 22   DC  B C4    1 
ATOM   1987 N  N4    . DC  B 2 22  ? -33.736 -4.200  10.360  1.00 57.73  ? 22   DC  B N4    1 
ATOM   1988 C  C5    . DC  B 2 22  ? -35.474 -2.940  11.437  1.00 61.09  ? 22   DC  B C5    1 
ATOM   1989 C  C6    . DC  B 2 22  ? -35.935 -1.718  11.759  1.00 63.35  ? 22   DC  B C6    1 
ATOM   1990 P  P     . DG  B 2 23  ? -37.976 4.057   10.272  1.00 86.68  ? 23   DG  B P     1 
ATOM   1991 O  OP1   . DG  B 2 23  ? -38.282 5.503   10.460  1.00 70.61  ? 23   DG  B OP1   1 
ATOM   1992 O  OP2   . DG  B 2 23  ? -38.974 3.086   9.758   1.00 73.84  ? 23   DG  B OP2   1 
ATOM   1993 O  "O5'" . DG  B 2 23  ? -36.686 3.940   9.334   1.00 76.55  ? 23   DG  B "O5'" 1 
ATOM   1994 C  "C5'" . DG  B 2 23  ? -35.494 4.608   9.700   1.00 70.60  ? 23   DG  B "C5'" 1 
ATOM   1995 C  "C4'" . DG  B 2 23  ? -34.460 4.495   8.600   1.00 73.10  ? 23   DG  B "C4'" 1 
ATOM   1996 O  "O4'" . DG  B 2 23  ? -33.977 3.121   8.499   1.00 76.18  ? 23   DG  B "O4'" 1 
ATOM   1997 C  "C3'" . DG  B 2 23  ? -34.960 4.873   7.214   1.00 69.03  ? 23   DG  B "C3'" 1 
ATOM   1998 O  "O3'" . DG  B 2 23  ? -33.960 5.595   6.568   1.00 71.42  ? 23   DG  B "O3'" 1 
ATOM   1999 C  "C2'" . DG  B 2 23  ? -35.200 3.516   6.540   1.00 66.38  ? 23   DG  B "C2'" 1 
ATOM   2000 C  "C1'" . DG  B 2 23  ? -34.109 2.656   7.169   1.00 63.85  ? 23   DG  B "C1'" 1 
ATOM   2001 N  N9    . DG  B 2 23  ? -34.433 1.229   7.225   1.00 60.92  ? 23   DG  B N9    1 
ATOM   2002 C  C8    . DG  B 2 23  ? -35.525 0.660   7.842   1.00 60.09  ? 23   DG  B C8    1 
ATOM   2003 N  N7    . DG  B 2 23  ? -35.552 -0.645  7.758   1.00 54.72  ? 23   DG  B N7    1 
ATOM   2004 C  C5    . DG  B 2 23  ? -34.398 -0.965  7.045   1.00 49.95  ? 23   DG  B C5    1 
ATOM   2005 C  C6    . DG  B 2 23  ? -33.900 -2.225  6.656   1.00 49.55  ? 23   DG  B C6    1 
ATOM   2006 O  O6    . DG  B 2 23  ? -34.398 -3.341  6.858   1.00 53.19  ? 23   DG  B O6    1 
ATOM   2007 N  N1    . DG  B 2 23  ? -32.701 -2.123  5.970   1.00 50.66  ? 23   DG  B N1    1 
ATOM   2008 C  C2    . DG  B 2 23  ? -32.062 -0.947  5.679   1.00 52.29  ? 23   DG  B C2    1 
ATOM   2009 N  N2    . DG  B 2 23  ? -30.915 -1.060  4.986   1.00 48.12  ? 23   DG  B N2    1 
ATOM   2010 N  N3    . DG  B 2 23  ? -32.519 0.259   6.035   1.00 51.88  ? 23   DG  B N3    1 
ATOM   2011 C  C4    . DG  B 2 23  ? -33.689 0.169   6.719   1.00 52.56  ? 23   DG  B C4    1 
ATOM   2012 P  P     . DC  B 2 24  ? -34.333 6.603   5.386   1.00 77.46  ? 24   DC  B P     1 
ATOM   2013 O  OP1   . DC  B 2 24  ? -33.559 7.848   5.598   1.00 77.92  ? 24   DC  B OP1   1 
ATOM   2014 O  OP2   . DC  B 2 24  ? -35.802 6.613   5.280   1.00 63.23  ? 24   DC  B OP2   1 
ATOM   2015 O  "O5'" . DC  B 2 24  ? -33.753 5.886   4.082   1.00 72.84  ? 24   DC  B "O5'" 1 
ATOM   2016 C  "C5'" . DC  B 2 24  ? -32.354 5.750   3.903   1.00 57.39  ? 24   DC  B "C5'" 1 
ATOM   2017 C  "C4'" . DC  B 2 24  ? -32.069 4.667   2.890   1.00 57.59  ? 24   DC  B "C4'" 1 
ATOM   2018 O  "O4'" . DC  B 2 24  ? -32.504 3.407   3.421   1.00 64.68  ? 24   DC  B "O4'" 1 
ATOM   2019 C  "C3'" . DC  B 2 24  ? -32.842 4.806   1.589   1.00 67.50  ? 24   DC  B "C3'" 1 
ATOM   2020 O  "O3'" . DC  B 2 24  ? -32.057 5.431   0.598   1.00 61.41  ? 24   DC  B "O3'" 1 
ATOM   2021 C  "C2'" . DC  B 2 24  ? -33.229 3.364   1.190   1.00 60.43  ? 24   DC  B "C2'" 1 
ATOM   2022 C  "C1'" . DC  B 2 24  ? -32.693 2.523   2.343   1.00 60.72  ? 24   DC  B "C1'" 1 
ATOM   2023 N  N1    . DC  B 2 24  ? -33.588 1.397   2.787   1.00 51.87  ? 24   DC  B N1    1 
ATOM   2024 C  C2    . DC  B 2 24  ? -33.243 0.083   2.454   1.00 51.11  ? 24   DC  B C2    1 
ATOM   2025 O  O2    . DC  B 2 24  ? -32.236 -0.116  1.763   1.00 48.44  ? 24   DC  B O2    1 
ATOM   2026 N  N3    . DC  B 2 24  ? -34.030 -0.934  2.879   1.00 47.21  ? 24   DC  B N3    1 
ATOM   2027 C  C4    . DC  B 2 24  ? -35.105 -0.673  3.616   1.00 45.63  ? 24   DC  B C4    1 
ATOM   2028 N  N4    . DC  B 2 24  ? -35.851 -1.708  4.008   1.00 47.27  ? 24   DC  B N4    1 
ATOM   2029 C  C5    . DC  B 2 24  ? -35.466 0.663   3.976   1.00 45.81  ? 24   DC  B C5    1 
ATOM   2030 C  C6    . DC  B 2 24  ? -34.689 1.656   3.545   1.00 45.66  ? 24   DC  B C6    1 
ATOM   2031 P  P     . DG  B 2 25  ? -32.812 6.089   -0.655  1.00 74.98  ? 25   DG  B P     1 
ATOM   2032 O  OP1   . DG  B 2 25  ? -31.985 7.223   -1.144  1.00 67.13  ? 25   DG  B OP1   1 
ATOM   2033 O  OP2   . DG  B 2 25  ? -34.225 6.296   -0.251  1.00 55.43  ? 25   DG  B OP2   1 
ATOM   2034 O  "O5'" . DG  B 2 25  ? -32.838 4.904   -1.734  1.00 67.07  ? 25   DG  B "O5'" 1 
ATOM   2035 C  "C5'" . DG  B 2 25  ? -31.626 4.356   -2.200  1.00 52.18  ? 25   DG  B "C5'" 1 
ATOM   2036 C  "C4'" . DG  B 2 25  ? -31.886 3.189   -3.130  1.00 51.78  ? 25   DG  B "C4'" 1 
ATOM   2037 O  "O4'" . DG  B 2 25  ? -32.383 2.067   -2.366  1.00 49.64  ? 25   DG  B "O4'" 1 
ATOM   2038 C  "C3'" . DG  B 2 25  ? -32.902 3.446   -4.237  1.00 50.08  ? 25   DG  B "C3'" 1 
ATOM   2039 O  "O3'" . DG  B 2 25  ? -32.398 2.956   -5.464  1.00 58.57  ? 25   DG  B "O3'" 1 
ATOM   2040 C  "C2'" . DG  B 2 25  ? -34.131 2.663   -3.791  1.00 45.29  ? 25   DG  B "C2'" 1 
ATOM   2041 C  "C1'" . DG  B 2 25  ? -33.533 1.542   -2.967  1.00 43.98  ? 25   DG  B "C1'" 1 
ATOM   2042 N  N9    . DG  B 2 25  ? -34.398 1.085   -1.897  1.00 46.32  ? 25   DG  B N9    1 
ATOM   2043 C  C8    . DG  B 2 25  ? -35.139 1.863   -1.050  1.00 46.67  ? 25   DG  B C8    1 
ATOM   2044 N  N7    . DG  B 2 25  ? -35.812 1.169   -0.166  1.00 49.89  ? 25   DG  B N7    1 
ATOM   2045 C  C5    . DG  B 2 25  ? -35.494 -0.150  -0.448  1.00 42.13  ? 25   DG  B C5    1 
ATOM   2046 C  C6    . DG  B 2 25  ? -35.942 -1.341  0.163   1.00 45.05  ? 25   DG  B C6    1 
ATOM   2047 O  O6    . DG  B 2 25  ? -36.730 -1.473  1.139   1.00 44.47  ? 25   DG  B O6    1 
ATOM   2048 N  N1    . DG  B 2 25  ? -35.381 -2.462  -0.441  1.00 42.62  ? 25   DG  B N1    1 
ATOM   2049 C  C2    . DG  B 2 25  ? -34.503 -2.434  -1.501  1.00 44.71  ? 25   DG  B C2    1 
ATOM   2050 N  N2    . DG  B 2 25  ? -34.063 -3.626  -1.942  1.00 47.18  ? 25   DG  B N2    1 
ATOM   2051 N  N3    . DG  B 2 25  ? -34.100 -1.324  -2.101  1.00 37.29  ? 25   DG  B N3    1 
ATOM   2052 C  C4    . DG  B 2 25  ? -34.624 -0.223  -1.512  1.00 43.69  ? 25   DG  B C4    1 
ATOM   2053 O  "O5'" . DC  C 3 1   ? -38.627 -10.460 -0.069  1.00 70.96  ? 1    DC  C "O5'" 1 
ATOM   2054 C  "C5'" . DC  C 3 1   ? -38.340 -10.699 -1.448  1.00 66.86  ? 1    DC  C "C5'" 1 
ATOM   2055 C  "C4'" . DC  C 3 1   ? -36.923 -10.261 -1.807  1.00 60.21  ? 1    DC  C "C4'" 1 
ATOM   2056 O  "O4'" . DC  C 3 1   ? -36.826 -8.809  -1.734  1.00 65.70  ? 1    DC  C "O4'" 1 
ATOM   2057 C  "C3'" . DC  C 3 1   ? -35.803 -10.796 -0.911  1.00 64.03  ? 1    DC  C "C3'" 1 
ATOM   2058 O  "O3'" . DC  C 3 1   ? -34.619 -10.971 -1.700  1.00 75.02  ? 1    DC  C "O3'" 1 
ATOM   2059 C  "C2'" . DC  C 3 1   ? -35.630 -9.658  0.102   1.00 65.01  ? 1    DC  C "C2'" 1 
ATOM   2060 C  "C1'" . DC  C 3 1   ? -35.817 -8.444  -0.802  1.00 58.23  ? 1    DC  C "C1'" 1 
ATOM   2061 N  N1    . DC  C 3 1   ? -36.267 -7.206  -0.104  1.00 50.12  ? 1    DC  C N1    1 
ATOM   2062 C  C2    . DC  C 3 1   ? -35.659 -5.986  -0.416  1.00 49.90  ? 1    DC  C C2    1 
ATOM   2063 O  O2    . DC  C 3 1   ? -34.747 -5.961  -1.246  1.00 48.03  ? 1    DC  C O2    1 
ATOM   2064 N  N3    . DC  C 3 1   ? -36.097 -4.860  0.197   1.00 52.08  ? 1    DC  C N3    1 
ATOM   2065 C  C4    . DC  C 3 1   ? -37.111 -4.919  1.070   1.00 45.57  ? 1    DC  C C4    1 
ATOM   2066 N  N4    . DC  C 3 1   ? -37.488 -3.780  1.657   1.00 44.32  ? 1    DC  C N4    1 
ATOM   2067 C  C5    . DC  C 3 1   ? -37.751 -6.149  1.396   1.00 35.43  ? 1    DC  C C5    1 
ATOM   2068 C  C6    . DC  C 3 1   ? -37.309 -7.257  0.782   1.00 49.87  ? 1    DC  C C6    1 
ATOM   2069 P  P     . DG  C 3 2   ? -33.494 -12.064 -1.319  1.00 74.29  ? 2    DG  C P     1 
ATOM   2070 O  OP1   . DG  C 3 2   ? -33.154 -12.773 -2.582  1.00 67.64  ? 2    DG  C OP1   1 
ATOM   2071 O  OP2   . DG  C 3 2   ? -33.953 -12.797 -0.106  1.00 58.90  ? 2    DG  C OP2   1 
ATOM   2072 O  "O5'" . DG  C 3 2   ? -32.215 -11.178 -0.963  1.00 63.13  ? 2    DG  C "O5'" 1 
ATOM   2073 C  "C5'" . DG  C 3 2   ? -31.682 -10.308 -1.950  1.00 63.51  ? 2    DG  C "C5'" 1 
ATOM   2074 C  "C4'" . DG  C 3 2   ? -30.830 -9.213  -1.325  1.00 60.41  ? 2    DG  C "C4'" 1 
ATOM   2075 O  "O4'" . DG  C 3 2   ? -31.674 -8.200  -0.721  1.00 62.44  ? 2    DG  C "O4'" 1 
ATOM   2076 C  "C3'" . DG  C 3 2   ? -29.866 -9.668  -0.227  1.00 56.09  ? 2    DG  C "C3'" 1 
ATOM   2077 O  "O3'" . DG  C 3 2   ? -28.600 -9.073  -0.456  1.00 68.19  ? 2    DG  C "O3'" 1 
ATOM   2078 C  "C2'" . DG  C 3 2   ? -30.503 -9.121  1.043   1.00 53.23  ? 2    DG  C "C2'" 1 
ATOM   2079 C  "C1'" . DG  C 3 2   ? -31.118 -7.839  0.510   1.00 56.09  ? 2    DG  C "C1'" 1 
ATOM   2080 N  N9    . DG  C 3 2   ? -32.162 -7.288  1.357   1.00 47.93  ? 2    DG  C N9    1 
ATOM   2081 C  C8    . DG  C 3 2   ? -33.065 -7.994  2.110   1.00 50.62  ? 2    DG  C C8    1 
ATOM   2082 N  N7    . DG  C 3 2   ? -33.890 -7.232  2.783   1.00 54.02  ? 2    DG  C N7    1 
ATOM   2083 C  C5    . DG  C 3 2   ? -33.500 -5.938  2.457   1.00 48.68  ? 2    DG  C C5    1 
ATOM   2084 C  C6    . DG  C 3 2   ? -34.031 -4.702  2.884   1.00 49.26  ? 2    DG  C C6    1 
ATOM   2085 O  O6    . DG  C 3 2   ? -34.969 -4.505  3.670   1.00 48.89  ? 2    DG  C O6    1 
ATOM   2086 N  N1    . DG  C 3 2   ? -33.350 -3.622  2.320   1.00 48.42  ? 2    DG  C N1    1 
ATOM   2087 C  C2    . DG  C 3 2   ? -32.288 -3.735  1.448   1.00 49.63  ? 2    DG  C C2    1 
ATOM   2088 N  N2    . DG  C 3 2   ? -31.764 -2.579  1.004   1.00 43.79  ? 2    DG  C N2    1 
ATOM   2089 N  N3    . DG  C 3 2   ? -31.778 -4.901  1.035   1.00 46.80  ? 2    DG  C N3    1 
ATOM   2090 C  C4    . DG  C 3 2   ? -32.432 -5.954  1.584   1.00 46.22  ? 2    DG  C C4    1 
ATOM   2091 P  P     . DC  C 3 3   ? -27.265 -9.754  0.109   1.00 62.22  ? 3    DC  C P     1 
ATOM   2092 O  OP1   . DC  C 3 3   ? -26.529 -10.338 -1.027  1.00 82.18  ? 3    DC  C OP1   1 
ATOM   2093 O  OP2   . DC  C 3 3   ? -27.567 -10.569 1.304   1.00 67.91  ? 3    DC  C OP2   1 
ATOM   2094 O  "O5'" . DC  C 3 3   ? -26.458 -8.543  0.685   1.00 66.21  ? 3    DC  C "O5'" 1 
ATOM   2095 C  "C5'" . DC  C 3 3   ? -26.710 -8.125  1.982   1.00 64.43  ? 3    DC  C "C5'" 1 
ATOM   2096 C  "C4'" . DC  C 3 3   ? -26.927 -6.639  1.994   1.00 60.94  ? 3    DC  C "C4'" 1 
ATOM   2097 O  "O4'" . DC  C 3 3   ? -28.325 -6.378  2.220   1.00 58.11  ? 3    DC  C "O4'" 1 
ATOM   2098 C  "C3'" . DC  C 3 3   ? -26.143 -5.904  3.074   1.00 52.52  ? 3    DC  C "C3'" 1 
ATOM   2099 O  "O3'" . DC  C 3 3   ? -25.157 -5.082  2.469   1.00 53.77  ? 3    DC  C "O3'" 1 
ATOM   2100 C  "C2'" . DC  C 3 3   ? -27.194 -5.077  3.828   1.00 60.38  ? 3    DC  C "C2'" 1 
ATOM   2101 C  "C1'" . DC  C 3 3   ? -28.466 -5.210  2.980   1.00 56.56  ? 3    DC  C "C1'" 1 
ATOM   2102 N  N1    . DC  C 3 3   ? -29.692 -5.342  3.818   1.00 50.01  ? 3    DC  C N1    1 
ATOM   2103 C  C2    . DC  C 3 3   ? -30.317 -4.195  4.269   1.00 53.41  ? 3    DC  C C2    1 
ATOM   2104 O  O2    . DC  C 3 3   ? -29.846 -3.093  3.941   1.00 58.16  ? 3    DC  C O2    1 
ATOM   2105 N  N3    . DC  C 3 3   ? -31.421 -4.311  5.051   1.00 51.53  ? 3    DC  C N3    1 
ATOM   2106 C  C4    . DC  C 3 3   ? -31.880 -5.521  5.389   1.00 55.01  ? 3    DC  C C4    1 
ATOM   2107 N  N4    . DC  C 3 3   ? -32.972 -5.584  6.173   1.00 54.85  ? 3    DC  C N4    1 
ATOM   2108 C  C5    . DC  C 3 3   ? -31.241 -6.717  4.940   1.00 49.94  ? 3    DC  C C5    1 
ATOM   2109 C  C6    . DC  C 3 3   ? -30.157 -6.580  4.171   1.00 51.81  ? 3    DC  C C6    1 
ATOM   2110 P  P     . DG  C 3 4   ? -23.941 -4.487  3.342   1.00 52.36  ? 4    DG  C P     1 
ATOM   2111 O  OP1   . DG  C 3 4   ? -22.978 -3.819  2.435   1.00 50.09  ? 4    DG  C OP1   1 
ATOM   2112 O  OP2   . DG  C 3 4   ? -23.487 -5.537  4.280   1.00 54.71  ? 4    DG  C OP2   1 
ATOM   2113 O  "O5'" . DG  C 3 4   ? -24.617 -3.333  4.206   1.00 49.88  ? 4    DG  C "O5'" 1 
ATOM   2114 C  "C5'" . DG  C 3 4   ? -24.610 -2.007  3.716   1.00 47.30  ? 4    DG  C "C5'" 1 
ATOM   2115 C  "C4'" . DG  C 3 4   ? -25.351 -1.084  4.658   1.00 49.12  ? 4    DG  C "C4'" 1 
ATOM   2116 O  "O4'" . DG  C 3 4   ? -26.553 -1.715  5.126   1.00 54.00  ? 4    DG  C "O4'" 1 
ATOM   2117 C  "C3'" . DG  C 3 4   ? -24.587 -0.673  5.911   1.00 48.79  ? 4    DG  C "C3'" 1 
ATOM   2118 O  "O3'" . DG  C 3 4   ? -24.551 0.700   5.928   1.00 50.78  ? 4    DG  C "O3'" 1 
ATOM   2119 C  "C2'" . DG  C 3 4   ? -25.437 -1.223  7.066   1.00 49.99  ? 4    DG  C "C2'" 1 
ATOM   2120 C  "C1'" . DG  C 3 4   ? -26.800 -1.272  6.422   1.00 54.94  ? 4    DG  C "C1'" 1 
ATOM   2121 N  N9    . DG  C 3 4   ? -27.718 -2.210  7.032   1.00 55.19  ? 4    DG  C N9    1 
ATOM   2122 C  C8    . DG  C 3 4   ? -27.625 -3.584  7.018   1.00 55.91  ? 4    DG  C C8    1 
ATOM   2123 N  N7    . DG  C 3 4   ? -28.620 -4.175  7.617   1.00 54.90  ? 4    DG  C N7    1 
ATOM   2124 C  C5    . DG  C 3 4   ? -29.430 -3.126  8.038   1.00 48.86  ? 4    DG  C C5    1 
ATOM   2125 C  C6    . DG  C 3 4   ? -30.645 -3.156  8.741   1.00 50.09  ? 4    DG  C C6    1 
ATOM   2126 O  O6    . DG  C 3 4   ? -31.269 -4.155  9.140   1.00 53.26  ? 4    DG  C O6    1 
ATOM   2127 N  N1    . DG  C 3 4   ? -31.140 -1.866  8.978   1.00 46.97  ? 4    DG  C N1    1 
ATOM   2128 C  C2    . DG  C 3 4   ? -30.529 -0.698  8.571   1.00 51.31  ? 4    DG  C C2    1 
ATOM   2129 N  N2    . DG  C 3 4   ? -31.160 0.450   8.883   1.00 51.49  ? 4    DG  C N2    1 
ATOM   2130 N  N3    . DG  C 3 4   ? -29.382 -0.661  7.898   1.00 47.35  ? 4    DG  C N3    1 
ATOM   2131 C  C4    . DG  C 3 4   ? -28.891 -1.909  7.676   1.00 50.70  ? 4    DG  C C4    1 
ATOM   2132 P  P     . DC  C 3 5   ? -23.808 1.484   7.094   1.00 48.88  ? 5    DC  C P     1 
ATOM   2133 O  OP1   . DC  C 3 5   ? -23.231 2.697   6.481   1.00 48.39  ? 5    DC  C OP1   1 
ATOM   2134 O  OP2   . DC  C 3 5   ? -22.889 0.550   7.799   1.00 57.73  ? 5    DC  C OP2   1 
ATOM   2135 O  "O5'" . DC  C 3 5   ? -24.992 1.842   8.076   1.00 49.15  ? 5    DC  C "O5'" 1 
ATOM   2136 C  "C5'" . DC  C 3 5   ? -24.822 2.849   9.020   1.00 53.71  ? 5    DC  C "C5'" 1 
ATOM   2137 C  "C4'" . DC  C 3 5   ? -26.159 3.215   9.624   1.00 54.07  ? 5    DC  C "C4'" 1 
ATOM   2138 O  "O4'" . DC  C 3 5   ? -27.039 2.074   9.564   1.00 47.42  ? 5    DC  C "O4'" 1 
ATOM   2139 C  "C3'" . DC  C 3 5   ? -26.095 3.645   11.079  1.00 51.43  ? 5    DC  C "C3'" 1 
ATOM   2140 O  "O3'" . DC  C 3 5   ? -26.821 4.808   11.239  1.00 42.80  ? 5    DC  C "O3'" 1 
ATOM   2141 C  "C2'" . DC  C 3 5   ? -26.714 2.480   11.843  1.00 51.84  ? 5    DC  C "C2'" 1 
ATOM   2142 C  "C1'" . DC  C 3 5   ? -27.650 1.879   10.811  1.00 46.35  ? 5    DC  C "C1'" 1 
ATOM   2143 N  N1    . DC  C 3 5   ? -27.859 0.423   10.978  1.00 46.40  ? 5    DC  C N1    1 
ATOM   2144 C  C2    . DC  C 3 5   ? -28.994 -0.045  11.656  1.00 50.79  ? 5    DC  C C2    1 
ATOM   2145 O  O2    . DC  C 3 5   ? -29.793 0.773   12.128  1.00 51.79  ? 5    DC  C O2    1 
ATOM   2146 N  N3    . DC  C 3 5   ? -29.175 -1.392  11.788  1.00 51.39  ? 5    DC  C N3    1 
ATOM   2147 C  C4    . DC  C 3 5   ? -28.278 -2.238  11.266  1.00 49.73  ? 5    DC  C C4    1 
ATOM   2148 N  N4    . DC  C 3 5   ? -28.495 -3.543  11.408  1.00 48.45  ? 5    DC  C N4    1 
ATOM   2149 C  C5    . DC  C 3 5   ? -27.127 -1.778  10.563  1.00 46.70  ? 5    DC  C C5    1 
ATOM   2150 C  C6    . DC  C 3 5   ? -26.957 -0.455  10.443  1.00 48.43  ? 5    DC  C C6    1 
ATOM   2151 P  P     . DC  C 3 6   ? -26.605 5.708   12.543  1.00 62.48  ? 6    DC  C P     1 
ATOM   2152 O  OP1   . DC  C 3 6   ? -27.340 6.949   12.255  1.00 59.79  ? 6    DC  C OP1   1 
ATOM   2153 O  OP2   . DC  C 3 6   ? -25.168 5.862   12.853  1.00 65.31  ? 6    DC  C OP2   1 
ATOM   2154 O  "O5'" . DC  C 3 6   ? -27.329 4.860   13.706  1.00 52.91  ? 6    DC  C "O5'" 1 
ATOM   2155 C  "C5'" . DC  C 3 6   ? -28.575 5.287   14.159  1.00 59.32  ? 6    DC  C "C5'" 1 
ATOM   2156 C  "C4'" . DC  C 3 6   ? -29.243 4.300   15.105  1.00 59.19  ? 6    DC  C "C4'" 1 
ATOM   2157 O  "O4'" . DC  C 3 6   ? -29.032 2.945   14.707  1.00 58.00  ? 6    DC  C "O4'" 1 
ATOM   2158 C  "C3'" . DC  C 3 6   ? -28.854 4.359   16.600  1.00 59.49  ? 6    DC  C "C3'" 1 
ATOM   2159 O  "O3'" . DC  C 3 6   ? -29.894 5.045   17.317  1.00 65.75  ? 6    DC  C "O3'" 1 
ATOM   2160 C  "C2'" . DC  C 3 6   ? -28.792 2.868   17.010  1.00 61.60  ? 6    DC  C "C2'" 1 
ATOM   2161 C  "C1'" . DC  C 3 6   ? -29.447 2.183   15.807  1.00 58.21  ? 6    DC  C "C1'" 1 
ATOM   2162 N  N1    . DC  C 3 6   ? -29.072 0.763   15.591  1.00 51.65  ? 6    DC  C N1    1 
ATOM   2163 C  C2    . DC  C 3 6   ? -29.827 -0.243  16.197  1.00 51.68  ? 6    DC  C C2    1 
ATOM   2164 O  O2    . DC  C 3 6   ? -30.768 0.076   16.924  1.00 49.94  ? 6    DC  C O2    1 
ATOM   2165 N  N3    . DC  C 3 6   ? -29.498 -1.538  15.975  1.00 53.56  ? 6    DC  C N3    1 
ATOM   2166 C  C4    . DC  C 3 6   ? -28.465 -1.831  15.184  1.00 54.29  ? 6    DC  C C4    1 
ATOM   2167 N  N4    . DC  C 3 6   ? -28.168 -3.123  14.987  1.00 53.56  ? 6    DC  C N4    1 
ATOM   2168 C  C5    . DC  C 3 6   ? -27.690 -0.813  14.553  1.00 51.57  ? 6    DC  C C5    1 
ATOM   2169 C  C6    . DC  C 3 6   ? -28.029 0.457   14.778  1.00 48.63  ? 6    DC  C C6    1 
ATOM   2170 P  P     . DG  C 3 7   ? -29.611 5.848   18.679  1.00 75.78  ? 7    DG  C P     1 
ATOM   2171 O  OP1   . DG  C 3 7   ? -30.749 6.780   18.823  1.00 67.50  ? 7    DG  C OP1   1 
ATOM   2172 O  OP2   . DG  C 3 7   ? -28.236 6.381   18.710  1.00 67.63  ? 7    DG  C OP2   1 
ATOM   2173 O  "O5'" . DG  C 3 7   ? -29.760 4.724   19.794  1.00 67.80  ? 7    DG  C "O5'" 1 
ATOM   2174 C  "C5'" . DG  C 3 7   ? -30.963 4.013   19.869  1.00 63.16  ? 7    DG  C "C5'" 1 
ATOM   2175 C  "C4'" . DG  C 3 7   ? -30.897 2.950   20.939  1.00 63.88  ? 7    DG  C "C4'" 1 
ATOM   2176 O  "O4'" . DG  C 3 7   ? -30.619 1.661   20.333  1.00 64.61  ? 7    DG  C "O4'" 1 
ATOM   2177 C  "C3'" . DG  C 3 7   ? -29.831 3.171   22.002  1.00 72.20  ? 7    DG  C "C3'" 1 
ATOM   2178 O  "O3'" . DG  C 3 7   ? -30.433 3.046   23.297  1.00 83.52  ? 7    DG  C "O3'" 1 
ATOM   2179 C  "C2'" . DG  C 3 7   ? -28.806 2.061   21.722  1.00 65.54  ? 7    DG  C "C2'" 1 
ATOM   2180 C  "C1'" . DG  C 3 7   ? -29.679 0.972   21.113  1.00 62.08  ? 7    DG  C "C1'" 1 
ATOM   2181 N  N9    . DG  C 3 7   ? -28.959 0.041   20.237  1.00 59.18  ? 7    DG  C N9    1 
ATOM   2182 C  C8    . DG  C 3 7   ? -27.941 0.350   19.361  1.00 55.92  ? 7    DG  C C8    1 
ATOM   2183 N  N7    . DG  C 3 7   ? -27.493 -0.688  18.696  1.00 56.19  ? 7    DG  C N7    1 
ATOM   2184 C  C5    . DG  C 3 7   ? -28.266 -1.753  19.153  1.00 50.96  ? 7    DG  C C5    1 
ATOM   2185 C  C6    . DG  C 3 7   ? -28.235 -3.123  18.792  1.00 52.54  ? 7    DG  C C6    1 
ATOM   2186 O  O6    . DG  C 3 7   ? -27.512 -3.686  17.978  1.00 57.04  ? 7    DG  C O6    1 
ATOM   2187 N  N1    . DG  C 3 7   ? -29.162 -3.864  19.492  1.00 57.63  ? 7    DG  C N1    1 
ATOM   2188 C  C2    . DG  C 3 7   ? -30.025 -3.355  20.422  1.00 59.51  ? 7    DG  C C2    1 
ATOM   2189 N  N2    . DG  C 3 7   ? -30.851 -4.238  20.982  1.00 60.57  ? 7    DG  C N2    1 
ATOM   2190 N  N3    . DG  C 3 7   ? -30.085 -2.065  20.771  1.00 52.95  ? 7    DG  C N3    1 
ATOM   2191 C  C4    . DG  C 3 7   ? -29.176 -1.325  20.098  1.00 52.82  ? 7    DG  C C4    1 
ATOM   2192 P  P     . DG  C 3 8   ? -29.576 3.297   24.633  1.00 85.69  ? 8    DG  C P     1 
ATOM   2193 O  OP1   . DG  C 3 8   ? -30.527 3.564   25.728  1.00 79.18  ? 8    DG  C OP1   1 
ATOM   2194 O  OP2   . DG  C 3 8   ? -28.526 4.299   24.330  1.00 82.88  ? 8    DG  C OP2   1 
ATOM   2195 O  "O5'" . DG  C 3 8   ? -28.923 1.868   24.915  1.00 73.62  ? 8    DG  C "O5'" 1 
ATOM   2196 C  "C5'" . DG  C 3 8   ? -29.562 1.010   25.794  1.00 72.04  ? 8    DG  C "C5'" 1 
ATOM   2197 C  "C4'" . DG  C 3 8   ? -29.645 -0.412  25.277  1.00 69.18  ? 8    DG  C "C4'" 1 
ATOM   2198 O  "O4'" . DG  C 3 8   ? -28.861 -0.627  24.097  1.00 73.42  ? 8    DG  C "O4'" 1 
ATOM   2199 C  "C3'" . DG  C 3 8   ? -29.130 -1.441  26.256  1.00 73.05  ? 8    DG  C "C3'" 1 
ATOM   2200 O  "O3'" . DG  C 3 8   ? -30.206 -1.922  27.003  1.00 87.75  ? 8    DG  C "O3'" 1 
ATOM   2201 C  "C2'" . DG  C 3 8   ? -28.494 -2.541  25.378  1.00 72.56  ? 8    DG  C "C2'" 1 
ATOM   2202 C  "C1'" . DG  C 3 8   ? -28.743 -2.029  23.966  1.00 70.31  ? 8    DG  C "C1'" 1 
ATOM   2203 N  N9    . DG  C 3 8   ? -27.695 -2.372  22.989  1.00 65.35  ? 8    DG  C N9    1 
ATOM   2204 C  C8    . DG  C 3 8   ? -26.840 -1.502  22.354  1.00 60.53  ? 8    DG  C C8    1 
ATOM   2205 N  N7    . DG  C 3 8   ? -26.023 -2.096  21.518  1.00 66.68  ? 8    DG  C N7    1 
ATOM   2206 C  C5    . DG  C 3 8   ? -26.357 -3.444  21.599  1.00 60.96  ? 8    DG  C C5    1 
ATOM   2207 C  C6    . DG  C 3 8   ? -25.809 -4.564  20.918  1.00 58.72  ? 8    DG  C C6    1 
ATOM   2208 O  O6    . DG  C 3 8   ? -24.904 -4.584  20.093  1.00 64.06  ? 8    DG  C O6    1 
ATOM   2209 N  N1    . DG  C 3 8   ? -26.422 -5.753  21.282  1.00 60.79  ? 8    DG  C N1    1 
ATOM   2210 C  C2    . DG  C 3 8   ? -27.441 -5.857  22.198  1.00 69.00  ? 8    DG  C C2    1 
ATOM   2211 N  N2    . DG  C 3 8   ? -27.904 -7.102  22.421  1.00 64.67  ? 8    DG  C N2    1 
ATOM   2212 N  N3    . DG  C 3 8   ? -27.979 -4.807  22.845  1.00 65.96  ? 8    DG  C N3    1 
ATOM   2213 C  C4    . DG  C 3 8   ? -27.387 -3.636  22.494  1.00 61.84  ? 8    DG  C C4    1 
ATOM   2214 P  P     . DA  C 3 9   ? -30.049 -2.077  28.585  1.00 103.51 ? 9    DA  C P     1 
ATOM   2215 O  OP1   . DA  C 3 9   ? -31.407 -2.164  29.167  1.00 108.79 ? 9    DA  C OP1   1 
ATOM   2216 O  OP2   . DA  C 3 9   ? -29.150 -0.988  29.033  1.00 81.20  ? 9    DA  C OP2   1 
ATOM   2217 O  "O5'" . DA  C 3 9   ? -29.344 -3.504  28.713  1.00 85.69  ? 9    DA  C "O5'" 1 
ATOM   2218 C  "C5'" . DA  C 3 9   ? -29.879 -4.595  27.971  1.00 89.00  ? 9    DA  C "C5'" 1 
ATOM   2219 C  "C4'" . DA  C 3 9   ? -28.878 -5.725  27.863  1.00 92.06  ? 9    DA  C "C4'" 1 
ATOM   2220 O  "O4'" . DA  C 3 9   ? -28.026 -5.543  26.687  1.00 92.08  ? 9    DA  C "O4'" 1 
ATOM   2221 C  "C3'" . DA  C 3 9   ? -27.930 -5.863  29.062  1.00 95.74  ? 9    DA  C "C3'" 1 
ATOM   2222 O  "O3'" . DA  C 3 9   ? -27.863 -7.217  29.424  1.00 107.86 ? 9    DA  C "O3'" 1 
ATOM   2223 C  "C2'" . DA  C 3 9   ? -26.590 -5.395  28.494  1.00 92.86  ? 9    DA  C "C2'" 1 
ATOM   2224 C  "C1'" . DA  C 3 9   ? -26.713 -5.875  27.053  1.00 88.53  ? 9    DA  C "C1'" 1 
ATOM   2225 N  N9    . DA  C 3 9   ? -25.743 -5.254  26.144  1.00 82.62  ? 9    DA  C N9    1 
ATOM   2226 C  C8    . DA  C 3 9   ? -25.273 -3.961  26.184  1.00 79.49  ? 9    DA  C C8    1 
ATOM   2227 N  N7    . DA  C 3 9   ? -24.365 -3.696  25.272  1.00 73.36  ? 9    DA  C N7    1 
ATOM   2228 C  C5    . DA  C 3 9   ? -24.212 -4.906  24.599  1.00 75.46  ? 9    DA  C C5    1 
ATOM   2229 C  C6    . DA  C 3 9   ? -23.392 -5.297  23.518  1.00 67.85  ? 9    DA  C C6    1 
ATOM   2230 N  N6    . DA  C 3 9   ? -22.538 -4.466  22.907  1.00 62.49  ? 9    DA  C N6    1 
ATOM   2231 N  N1    . DA  C 3 9   ? -23.485 -6.577  23.091  1.00 63.77  ? 9    DA  C N1    1 
ATOM   2232 C  C2    . DA  C 3 9   ? -24.336 -7.403  23.714  1.00 71.57  ? 9    DA  C C2    1 
ATOM   2233 N  N3    . DA  C 3 9   ? -25.160 -7.150  24.735  1.00 74.91  ? 9    DA  C N3    1 
ATOM   2234 C  C4    . DA  C 3 9   ? -25.048 -5.876  25.134  1.00 74.83  ? 9    DA  C C4    1 
ATOM   2235 P  P     . DA  C 3 10  ? -27.777 -7.691  30.958  1.00 100.19 ? 10   DA  C P     1 
ATOM   2236 O  OP1   . DA  C 3 10  ? -29.167 -7.674  31.470  1.00 102.75 ? 10   DA  C OP1   1 
ATOM   2237 O  OP2   . DA  C 3 10  ? -26.726 -6.940  31.689  1.00 89.53  ? 10   DA  C OP2   1 
ATOM   2238 O  "O5'" . DA  C 3 10  ? -27.363 -9.218  30.779  1.00 84.43  ? 10   DA  C "O5'" 1 
ATOM   2239 C  "C5'" . DA  C 3 10  ? -28.064 -10.000 29.811  1.00 92.24  ? 10   DA  C "C5'" 1 
ATOM   2240 C  "C4'" . DA  C 3 10  ? -27.133 -10.950 29.083  1.00 94.87  ? 10   DA  C "C4'" 1 
ATOM   2241 O  "O4'" . DA  C 3 10  ? -26.272 -10.213 28.174  1.00 91.58  ? 10   DA  C "O4'" 1 
ATOM   2242 C  "C3'" . DA  C 3 10  ? -26.214 -11.767 29.981  1.00 96.06  ? 10   DA  C "C3'" 1 
ATOM   2243 O  "O3'" . DA  C 3 10  ? -26.104 -13.087 29.456  1.00 91.44  ? 10   DA  C "O3'" 1 
ATOM   2244 C  "C2'" . DA  C 3 10  ? -24.885 -10.997 29.917  1.00 94.37  ? 10   DA  C "C2'" 1 
ATOM   2245 C  "C1'" . DA  C 3 10  ? -24.906 -10.450 28.490  1.00 94.02  ? 10   DA  C "C1'" 1 
ATOM   2246 N  N9    . DA  C 3 10  ? -24.168 -9.188  28.298  1.00 81.91  ? 10   DA  C N9    1 
ATOM   2247 C  C8    . DA  C 3 10  ? -24.307 -8.031  29.015  1.00 84.24  ? 10   DA  C C8    1 
ATOM   2248 N  N7    . DA  C 3 10  ? -23.543 -7.049  28.598  1.00 78.88  ? 10   DA  C N7    1 
ATOM   2249 C  C5    . DA  C 3 10  ? -22.867 -7.593  27.522  1.00 77.65  ? 10   DA  C C5    1 
ATOM   2250 C  C6    . DA  C 3 10  ? -21.907 -7.058  26.640  1.00 76.07  ? 10   DA  C C6    1 
ATOM   2251 N  N6    . DA  C 3 10  ? -21.456 -5.800  26.721  1.00 69.35  ? 10   DA  C N6    1 
ATOM   2252 N  N1    . DA  C 3 10  ? -21.425 -7.869  25.668  1.00 72.69  ? 10   DA  C N1    1 
ATOM   2253 C  C2    . DA  C 3 10  ? -21.884 -9.124  25.589  1.00 73.08  ? 10   DA  C C2    1 
ATOM   2254 N  N3    . DA  C 3 10  ? -22.784 -9.736  26.361  1.00 81.01  ? 10   DA  C N3    1 
ATOM   2255 C  C4    . DA  C 3 10  ? -23.242 -8.907  27.317  1.00 76.91  ? 10   DA  C C4    1 
ATOM   2256 P  P     . DC  C 3 11  ? -25.762 -14.322 30.423  1.00 98.19  ? 11   DC  C P     1 
ATOM   2257 O  OP1   . DC  C 3 11  ? -26.541 -15.497 29.973  1.00 99.76  ? 11   DC  C OP1   1 
ATOM   2258 O  OP2   . DC  C 3 11  ? -25.861 -13.847 31.824  1.00 94.43  ? 11   DC  C OP2   1 
ATOM   2259 O  "O5'" . DC  C 3 11  ? -24.243 -14.629 30.069  1.00 96.16  ? 11   DC  C "O5'" 1 
ATOM   2260 C  "C5'" . DC  C 3 11  ? -23.884 -14.799 28.716  1.00 92.11  ? 11   DC  C "C5'" 1 
ATOM   2261 C  "C4'" . DC  C 3 11  ? -22.456 -14.369 28.487  1.00 86.93  ? 11   DC  C "C4'" 1 
ATOM   2262 O  "O4'" . DC  C 3 11  ? -22.348 -12.938 28.544  1.00 87.43  ? 11   DC  C "O4'" 1 
ATOM   2263 C  "C3'" . DC  C 3 11  ? -21.458 -14.866 29.527  1.00 84.52  ? 11   DC  C "C3'" 1 
ATOM   2264 O  "O3'" . DC  C 3 11  ? -20.830 -16.049 29.047  1.00 90.25  ? 11   DC  C "O3'" 1 
ATOM   2265 C  "C2'" . DC  C 3 11  ? -20.461 -13.689 29.676  1.00 83.03  ? 11   DC  C "C2'" 1 
ATOM   2266 C  "C1'" . DC  C 3 11  ? -20.985 -12.674 28.655  1.00 84.69  ? 11   DC  C "C1'" 1 
ATOM   2267 N  N1    . DC  C 3 11  ? -20.769 -11.241 29.018  1.00 79.80  ? 11   DC  C N1    1 
ATOM   2268 C  C2    . DC  C 3 11  ? -19.910 -10.473 28.230  1.00 79.25  ? 11   DC  C C2    1 
ATOM   2269 O  O2    . DC  C 3 11  ? -19.361 -11.004 27.255  1.00 81.79  ? 11   DC  C O2    1 
ATOM   2270 N  N3    . DC  C 3 11  ? -19.710 -9.170  28.547  1.00 72.19  ? 11   DC  C N3    1 
ATOM   2271 C  C4    . DC  C 3 11  ? -20.320 -8.644  29.606  1.00 72.42  ? 11   DC  C C4    1 
ATOM   2272 N  N4    . DC  C 3 11  ? -20.079 -7.357  29.889  1.00 67.09  ? 11   DC  C N4    1 
ATOM   2273 C  C5    . DC  C 3 11  ? -21.201 -9.414  30.423  1.00 77.27  ? 11   DC  C C5    1 
ATOM   2274 C  C6    . DC  C 3 11  ? -21.396 -10.697 30.094  1.00 78.14  ? 11   DC  C C6    1 
ATOM   2275 P  P     . DT  C 3 12  ? -19.782 -16.850 29.964  1.00 99.37  ? 12   DT  C P     1 
ATOM   2276 O  OP1   . DT  C 3 12  ? -19.845 -18.279 29.585  1.00 90.83  ? 12   DT  C OP1   1 
ATOM   2277 O  OP2   . DT  C 3 12  ? -19.971 -16.409 31.370  1.00 91.88  ? 12   DT  C OP2   1 
ATOM   2278 O  "O5'" . DT  C 3 12  ? -18.362 -16.319 29.464  1.00 91.67  ? 12   DT  C "O5'" 1 
ATOM   2279 C  "C5'" . DT  C 3 12  ? -18.001 -16.433 28.093  1.00 86.43  ? 12   DT  C "C5'" 1 
ATOM   2280 C  "C4'" . DT  C 3 12  ? -16.778 -15.592 27.812  1.00 80.44  ? 12   DT  C "C4'" 1 
ATOM   2281 O  "O4'" . DT  C 3 12  ? -17.077 -14.216 28.142  1.00 79.01  ? 12   DT  C "O4'" 1 
ATOM   2282 C  "C3'" . DT  C 3 12  ? -15.538 -15.977 28.637  1.00 79.57  ? 12   DT  C "C3'" 1 
ATOM   2283 O  "O3'" . DT  C 3 12  ? -14.454 -16.320 27.767  1.00 84.25  ? 12   DT  C "O3'" 1 
ATOM   2284 C  "C2'" . DT  C 3 12  ? -15.236 -14.729 29.481  1.00 81.05  ? 12   DT  C "C2'" 1 
ATOM   2285 C  "C1'" . DT  C 3 12  ? -15.930 -13.626 28.695  1.00 83.73  ? 12   DT  C "C1'" 1 
ATOM   2286 N  N1    . DT  C 3 12  ? -16.345 -12.433 29.526  1.00 81.42  ? 12   DT  C N1    1 
ATOM   2287 C  C2    . DT  C 3 12  ? -15.820 -11.190 29.222  1.00 79.49  ? 12   DT  C C2    1 
ATOM   2288 O  O2    . DT  C 3 12  ? -15.028 -11.000 28.310  1.00 79.17  ? 12   DT  C O2    1 
ATOM   2289 N  N3    . DT  C 3 12  ? -16.258 -10.170 30.025  1.00 71.95  ? 12   DT  C N3    1 
ATOM   2290 C  C4    . DT  C 3 12  ? -17.142 -10.263 31.080  1.00 71.05  ? 12   DT  C C4    1 
ATOM   2291 O  O4    . DT  C 3 12  ? -17.473 -9.285  31.743  1.00 66.99  ? 12   DT  C O4    1 
ATOM   2292 C  C5    . DT  C 3 12  ? -17.650 -11.589 31.348  1.00 74.85  ? 12   DT  C C5    1 
ATOM   2293 C  C7    . DT  C 3 12  ? -18.617 -11.807 32.471  1.00 70.48  ? 12   DT  C C7    1 
ATOM   2294 C  C6    . DT  C 3 12  ? -17.233 -12.600 30.568  1.00 74.82  ? 12   DT  C C6    1 
ATOM   2295 P  P     . DT  C 3 13  ? -13.088 -16.959 28.344  1.00 91.49  ? 13   DT  C P     1 
ATOM   2296 O  OP1   . DT  C 3 13  ? -12.577 -17.916 27.328  1.00 79.68  ? 13   DT  C OP1   1 
ATOM   2297 O  OP2   . DT  C 3 13  ? -13.284 -17.400 29.740  1.00 81.30  ? 13   DT  C OP2   1 
ATOM   2298 O  "O5'" . DT  C 3 13  ? -12.103 -15.711 28.422  1.00 88.16  ? 13   DT  C "O5'" 1 
ATOM   2299 C  "C5'" . DT  C 3 13  ? -11.947 -14.872 27.296  1.00 81.61  ? 13   DT  C "C5'" 1 
ATOM   2300 C  "C4'" . DT  C 3 13  ? -11.053 -13.700 27.626  1.00 78.17  ? 13   DT  C "C4'" 1 
ATOM   2301 O  "O4'" . DT  C 3 13  ? -11.768 -12.770 28.471  1.00 75.33  ? 13   DT  C "O4'" 1 
ATOM   2302 C  "C3'" . DT  C 3 13  ? -9.766  -14.055 28.386  1.00 69.20  ? 13   DT  C "C3'" 1 
ATOM   2303 O  "O3'" . DT  C 3 13  ? -8.685  -13.261 27.897  1.00 64.53  ? 13   DT  C "O3'" 1 
ATOM   2304 C  "C2'" . DT  C 3 13  ? -10.116 -13.657 29.823  1.00 68.28  ? 13   DT  C "C2'" 1 
ATOM   2305 C  "C1'" . DT  C 3 13  ? -10.933 -12.414 29.547  1.00 70.72  ? 13   DT  C "C1'" 1 
ATOM   2306 N  N1    . DT  C 3 13  ? -11.798 -11.956 30.669  1.00 74.53  ? 13   DT  C N1    1 
ATOM   2307 C  C2    . DT  C 3 13  ? -11.721 -10.639 31.067  1.00 70.85  ? 13   DT  C C2    1 
ATOM   2308 O  O2    . DT  C 3 13  ? -10.951 -9.836  30.571  1.00 72.03  ? 13   DT  C O2    1 
ATOM   2309 N  N3    . DT  C 3 13  ? -12.574 -10.291 32.073  1.00 70.75  ? 13   DT  C N3    1 
ATOM   2310 C  C4    . DT  C 3 13  ? -13.484 -11.103 32.710  1.00 73.16  ? 13   DT  C C4    1 
ATOM   2311 O  O4    . DT  C 3 13  ? -14.204 -10.689 33.608  1.00 72.90  ? 13   DT  C O4    1 
ATOM   2312 C  C5    . DT  C 3 13  ? -13.530 -12.473 32.240  1.00 74.93  ? 13   DT  C C5    1 
ATOM   2313 C  C7    . DT  C 3 13  ? -14.483 -13.449 32.861  1.00 71.16  ? 13   DT  C C7    1 
ATOM   2314 C  C6    . DT  C 3 13  ? -12.700 -12.829 31.244  1.00 73.70  ? 13   DT  C C6    1 
ATOM   2315 P  P     . DA  C 3 14  ? -7.932  -13.599 26.513  1.00 69.70  ? 14   DA  C P     1 
ATOM   2316 O  OP1   . DA  C 3 14  ? -8.886  -13.920 25.429  1.00 73.53  ? 14   DA  C OP1   1 
ATOM   2317 O  OP2   . DA  C 3 14  ? -6.818  -14.520 26.822  1.00 62.32  ? 14   DA  C OP2   1 
ATOM   2318 O  "O5'" . DA  C 3 14  ? -7.314  -12.188 26.107  1.00 65.59  ? 14   DA  C "O5'" 1 
ATOM   2319 C  "C5'" . DA  C 3 14  ? -8.168  -11.169 25.659  1.00 53.39  ? 14   DA  C "C5'" 1 
ATOM   2320 C  "C4'" . DA  C 3 14  ? -7.726  -9.807  26.164  1.00 49.14  ? 14   DA  C "C4'" 1 
ATOM   2321 O  "O4'" . DA  C 3 14  ? -8.036  -9.666  27.567  1.00 51.77  ? 14   DA  C "O4'" 1 
ATOM   2322 C  "C3'" . DA  C 3 14  ? -6.258  -9.484  26.034  1.00 50.80  ? 14   DA  C "C3'" 1 
ATOM   2323 O  "O3'" . DA  C 3 14  ? -6.135  -8.097  25.762  1.00 52.24  ? 14   DA  C "O3'" 1 
ATOM   2324 C  "C2'" . DA  C 3 14  ? -5.712  -9.853  27.423  1.00 51.19  ? 14   DA  C "C2'" 1 
ATOM   2325 C  "C1'" . DA  C 3 14  ? -6.863  -9.434  28.320  1.00 54.55  ? 14   DA  C "C1'" 1 
ATOM   2326 N  N9    . DA  C 3 14  ? -7.026  -10.216 29.537  1.00 52.27  ? 14   DA  C N9    1 
ATOM   2327 C  C8    . DA  C 3 14  ? -6.767  -11.544 29.708  1.00 53.95  ? 14   DA  C C8    1 
ATOM   2328 N  N7    . DA  C 3 14  ? -7.095  -11.994 30.895  1.00 57.16  ? 14   DA  C N7    1 
ATOM   2329 C  C5    . DA  C 3 14  ? -7.625  -10.888 31.533  1.00 48.61  ? 14   DA  C C5    1 
ATOM   2330 C  C6    . DA  C 3 14  ? -8.152  -10.709 32.812  1.00 50.83  ? 14   DA  C C6    1 
ATOM   2331 N  N6    . DA  C 3 14  ? -8.234  -11.687 33.714  1.00 56.23  ? 14   DA  C N6    1 
ATOM   2332 N  N1    . DA  C 3 14  ? -8.604  -9.487  33.137  1.00 58.30  ? 14   DA  C N1    1 
ATOM   2333 C  C2    . DA  C 3 14  ? -8.522  -8.508  32.232  1.00 56.76  ? 14   DA  C C2    1 
ATOM   2334 N  N3    . DA  C 3 14  ? -8.035  -8.558  30.997  1.00 57.77  ? 14   DA  C N3    1 
ATOM   2335 C  C4    . DA  C 3 14  ? -7.600  -9.792  30.709  1.00 50.62  ? 14   DA  C C4    1 
ATOM   2336 P  P     . DC  C 3 15  ? -4.766  -7.488  25.171  1.00 52.87  ? 15   DC  C P     1 
ATOM   2337 O  OP1   . DC  C 3 15  ? -5.111  -6.124  24.702  1.00 50.62  ? 15   DC  C OP1   1 
ATOM   2338 O  OP2   . DC  C 3 15  ? -4.164  -8.438  24.215  1.00 48.54  ? 15   DC  C OP2   1 
ATOM   2339 O  "O5'" . DC  C 3 15  ? -3.795  -7.432  26.462  1.00 48.51  ? 15   DC  C "O5'" 1 
ATOM   2340 C  "C5'" . DC  C 3 15  ? -3.516  -6.202  27.122  1.00 47.38  ? 15   DC  C "C5'" 1 
ATOM   2341 C  "C4'" . DC  C 3 15  ? -4.660  -5.782  28.027  1.00 46.31  ? 15   DC  C "C4'" 1 
ATOM   2342 O  "O4'" . DC  C 3 15  ? -4.978  -6.860  28.926  1.00 46.74  ? 15   DC  C "O4'" 1 
ATOM   2343 C  "C3'" . DC  C 3 15  ? -4.377  -4.585  28.945  1.00 48.61  ? 15   DC  C "C3'" 1 
ATOM   2344 O  "O3'" . DC  C 3 15  ? -5.588  -3.933  29.195  1.00 47.78  ? 15   DC  C "O3'" 1 
ATOM   2345 C  "C2'" . DC  C 3 15  ? -3.878  -5.268  30.209  1.00 49.24  ? 15   DC  C "C2'" 1 
ATOM   2346 C  "C1'" . DC  C 3 15  ? -4.907  -6.370  30.257  1.00 51.99  ? 15   DC  C "C1'" 1 
ATOM   2347 N  N1    . DC  C 3 15  ? -4.609  -7.504  31.145  1.00 47.34  ? 15   DC  C N1    1 
ATOM   2348 C  C2    . DC  C 3 15  ? -5.217  -7.566  32.399  1.00 53.45  ? 15   DC  C C2    1 
ATOM   2349 O  O2    . DC  C 3 15  ? -5.932  -6.618  32.771  1.00 54.38  ? 15   DC  C O2    1 
ATOM   2350 N  N3    . DC  C 3 15  ? -4.983  -8.647  33.182  1.00 53.89  ? 15   DC  C N3    1 
ATOM   2351 C  C4    . DC  C 3 15  ? -4.194  -9.636  32.737  1.00 56.09  ? 15   DC  C C4    1 
ATOM   2352 N  N4    . DC  C 3 15  ? -3.981  -10.685 33.539  1.00 55.84  ? 15   DC  C N4    1 
ATOM   2353 C  C5    . DC  C 3 15  ? -3.585  -9.590  31.451  1.00 54.93  ? 15   DC  C C5    1 
ATOM   2354 C  C6    . DC  C 3 15  ? -3.823  -8.518  30.695  1.00 47.74  ? 15   DC  C C6    1 
ATOM   2355 P  P     . DC  C 3 16  ? -5.639  -2.562  30.020  1.00 53.07  ? 16   DC  C P     1 
ATOM   2356 O  OP1   . DC  C 3 16  ? -6.194  -2.850  31.370  1.00 51.94  ? 16   DC  C OP1   1 
ATOM   2357 O  OP2   . DC  C 3 16  ? -6.409  -1.682  29.133  1.00 52.51  ? 16   DC  C OP2   1 
ATOM   2358 O  "O5'" . DC  C 3 16  ? -4.088  -2.096  30.024  1.00 54.18  ? 16   DC  C "O5'" 1 
ATOM   2359 C  "C5'" . DC  C 3 16  ? -3.558  -1.149  30.977  1.00 53.00  ? 16   DC  C "C5'" 1 
ATOM   2360 C  "C4'" . DC  C 3 16  ? -3.523  -1.689  32.415  1.00 54.35  ? 16   DC  C "C4'" 1 
ATOM   2361 O  "O4'" . DC  C 3 16  ? -3.214  -3.093  32.469  1.00 55.81  ? 16   DC  C "O4'" 1 
ATOM   2362 C  "C3'" . DC  C 3 16  ? -2.513  -1.021  33.361  1.00 55.98  ? 16   DC  C "C3'" 1 
ATOM   2363 O  "O3'" . DC  C 3 16  ? -3.234  -0.125  34.204  1.00 50.84  ? 16   DC  C "O3'" 1 
ATOM   2364 C  "C2'" . DC  C 3 16  ? -1.871  -2.223  34.141  1.00 54.31  ? 16   DC  C "C2'" 1 
ATOM   2365 C  "C1'" . DC  C 3 16  ? -2.834  -3.353  33.794  1.00 52.91  ? 16   DC  C "C1'" 1 
ATOM   2366 N  N1    . DC  C 3 16  ? -2.334  -4.785  33.897  1.00 45.36  ? 16   DC  C N1    1 
ATOM   2367 C  C2    . DC  C 3 16  ? -2.726  -5.582  34.991  1.00 53.12  ? 16   DC  C C2    1 
ATOM   2368 O  O2    . DC  C 3 16  ? -3.402  -5.076  35.909  1.00 53.47  ? 16   DC  C O2    1 
ATOM   2369 N  N3    . DC  C 3 16  ? -2.334  -6.884  35.029  1.00 51.36  ? 16   DC  C N3    1 
ATOM   2370 C  C4    . DC  C 3 16  ? -1.608  -7.389  34.040  1.00 47.37  ? 16   DC  C C4    1 
ATOM   2371 N  N4    . DC  C 3 16  ? -1.240  -8.665  34.126  1.00 46.28  ? 16   DC  C N4    1 
ATOM   2372 C  C5    . DC  C 3 16  ? -1.220  -6.606  32.918  1.00 51.84  ? 16   DC  C C5    1 
ATOM   2373 C  C6    . DC  C 3 16  ? -1.616  -5.328  32.881  1.00 49.54  ? 16   DC  C C6    1 
ATOM   2374 P  P     . DC  C 3 17  ? -2.501  0.994   35.083  1.00 58.09  ? 17   DC  C P     1 
ATOM   2375 O  OP1   . DC  C 3 17  ? -3.471  2.080   35.329  1.00 72.67  ? 17   DC  C OP1   1 
ATOM   2376 O  OP2   . DC  C 3 17  ? -1.221  1.341   34.437  1.00 57.25  ? 17   DC  C OP2   1 
ATOM   2377 O  "O5'" . DC  C 3 17  ? -2.228  0.231   36.462  1.00 55.45  ? 17   DC  C "O5'" 1 
ATOM   2378 C  "C5'" . DC  C 3 17  ? -3.258  -0.519  37.050  1.00 46.99  ? 17   DC  C "C5'" 1 
ATOM   2379 C  "C4'" . DC  C 3 17  ? -2.762  -1.363  38.219  1.00 55.21  ? 17   DC  C "C4'" 1 
ATOM   2380 O  "O4'" . DC  C 3 17  ? -2.359  -2.670  37.758  1.00 64.23  ? 17   DC  C "O4'" 1 
ATOM   2381 C  "C3'" . DC  C 3 17  ? -1.578  -0.811  39.023  1.00 59.83  ? 17   DC  C "C3'" 1 
ATOM   2382 O  "O3'" . DC  C 3 17  ? -1.975  -0.641  40.391  1.00 65.41  ? 17   DC  C "O3'" 1 
ATOM   2383 C  "C2'" . DC  C 3 17  ? -0.484  -1.898  38.880  1.00 61.66  ? 17   DC  C "C2'" 1 
ATOM   2384 C  "C1'" . DC  C 3 17  ? -1.301  -3.140  38.566  1.00 56.02  ? 17   DC  C "C1'" 1 
ATOM   2385 N  N1    . DC  C 3 17  ? -0.569  -4.192  37.781  1.00 50.15  ? 17   DC  C N1    1 
ATOM   2386 C  C2    . DC  C 3 17  ? -0.520  -5.510  38.247  1.00 53.82  ? 17   DC  C C2    1 
ATOM   2387 O  O2    . DC  C 3 17  ? -1.043  -5.789  39.325  1.00 56.52  ? 17   DC  C O2    1 
ATOM   2388 N  N3    . DC  C 3 17  ? 0.114   -6.447  37.503  1.00 53.23  ? 17   DC  C N3    1 
ATOM   2389 C  C4    . DC  C 3 17  ? 0.674   -6.115  36.342  1.00 55.33  ? 17   DC  C C4    1 
ATOM   2390 N  N4    . DC  C 3 17  ? 1.297   -7.079  35.648  1.00 57.57  ? 17   DC  C N4    1 
ATOM   2391 C  C5    . DC  C 3 17  ? 0.629   -4.781  35.843  1.00 51.11  ? 17   DC  C C5    1 
ATOM   2392 C  C6    . DC  C 3 17  ? -0.010  -3.866  36.582  1.00 52.32  ? 17   DC  C C6    1 
ATOM   2393 P  P     . DG  C 3 18  ? -1.124  0.279   41.403  1.00 77.30  ? 18   DG  C P     1 
ATOM   2394 O  OP1   . DG  C 3 18  ? -2.063  0.677   42.478  1.00 62.77  ? 18   DG  C OP1   1 
ATOM   2395 O  OP2   . DG  C 3 18  ? -0.348  1.277   40.629  1.00 76.40  ? 18   DG  C OP2   1 
ATOM   2396 O  "O5'" . DG  C 3 18  ? -0.038  -0.715  42.023  1.00 69.04  ? 18   DG  C "O5'" 1 
ATOM   2397 C  "C5'" . DG  C 3 18  ? -0.460  -1.790  42.834  1.00 66.91  ? 18   DG  C "C5'" 1 
ATOM   2398 C  "C4'" . DG  C 3 18  ? 0.697   -2.711  43.118  1.00 70.28  ? 18   DG  C "C4'" 1 
ATOM   2399 O  "O4'" . DG  C 3 18  ? 0.955   -3.565  41.963  1.00 74.10  ? 18   DG  C "O4'" 1 
ATOM   2400 C  "C3'" . DG  C 3 18  ? 2.025   -1.998  43.414  1.00 71.94  ? 18   DG  C "C3'" 1 
ATOM   2401 O  "O3'" . DG  C 3 18  ? 2.715   -2.699  44.442  1.00 85.71  ? 18   DG  C "O3'" 1 
ATOM   2402 C  "C2'" . DG  C 3 18  ? 2.764   -2.150  42.099  1.00 71.28  ? 18   DG  C "C2'" 1 
ATOM   2403 C  "C1'" . DG  C 3 18  ? 2.336   -3.558  41.748  1.00 69.56  ? 18   DG  C "C1'" 1 
ATOM   2404 N  N9    . DG  C 3 18  ? 2.678   -3.942  40.385  1.00 65.66  ? 18   DG  C N9    1 
ATOM   2405 C  C8    . DG  C 3 18  ? 2.977   -3.093  39.340  1.00 62.40  ? 18   DG  C C8    1 
ATOM   2406 N  N7    . DG  C 3 18  ? 3.320   -3.716  38.248  1.00 61.37  ? 18   DG  C N7    1 
ATOM   2407 C  C5    . DG  C 3 18  ? 3.271   -5.064  38.597  1.00 62.58  ? 18   DG  C C5    1 
ATOM   2408 C  C6    . DG  C 3 18  ? 3.556   -6.213  37.825  1.00 60.11  ? 18   DG  C C6    1 
ATOM   2409 O  O6    . DG  C 3 18  ? 3.917   -6.270  36.639  1.00 60.63  ? 18   DG  C O6    1 
ATOM   2410 N  N1    . DG  C 3 18  ? 3.383   -7.384  38.561  1.00 61.92  ? 18   DG  C N1    1 
ATOM   2411 C  C2    . DG  C 3 18  ? 2.996   -7.437  39.881  1.00 61.89  ? 18   DG  C C2    1 
ATOM   2412 N  N2    . DG  C 3 18  ? 2.885   -8.660  40.416  1.00 59.92  ? 18   DG  C N2    1 
ATOM   2413 N  N3    . DG  C 3 18  ? 2.730   -6.367  40.619  1.00 61.31  ? 18   DG  C N3    1 
ATOM   2414 C  C4    . DG  C 3 18  ? 2.889   -5.219  39.913  1.00 62.55  ? 18   DG  C C4    1 
ATOM   2415 P  P     . DG  C 3 19  ? 3.373   -1.922  45.687  1.00 93.50  ? 19   DG  C P     1 
ATOM   2416 O  OP1   . DG  C 3 19  ? 2.241   -1.363  46.471  1.00 87.11  ? 19   DG  C OP1   1 
ATOM   2417 O  OP2   . DG  C 3 19  ? 4.471   -1.031  45.217  1.00 75.09  ? 19   DG  C OP2   1 
ATOM   2418 O  "O5'" . DG  C 3 19  ? 4.037   -3.110  46.510  1.00 78.69  ? 19   DG  C "O5'" 1 
ATOM   2419 C  "C5'" . DG  C 3 19  ? 3.253   -4.230  46.846  1.00 78.60  ? 19   DG  C "C5'" 1 
ATOM   2420 C  "C4'" . DG  C 3 19  ? 4.004   -5.501  46.535  1.00 77.34  ? 19   DG  C "C4'" 1 
ATOM   2421 O  "O4'" . DG  C 3 19  ? 4.039   -5.696  45.097  1.00 84.66  ? 19   DG  C "O4'" 1 
ATOM   2422 C  "C3'" . DG  C 3 19  ? 5.459   -5.495  47.000  1.00 86.27  ? 19   DG  C "C3'" 1 
ATOM   2423 O  "O3'" . DG  C 3 19  ? 5.734   -6.658  47.767  1.00 99.13  ? 19   DG  C "O3'" 1 
ATOM   2424 C  "C2'" . DG  C 3 19  ? 6.264   -5.476  45.698  1.00 86.88  ? 19   DG  C "C2'" 1 
ATOM   2425 C  "C1'" . DG  C 3 19  ? 5.311   -6.157  44.735  1.00 83.72  ? 19   DG  C "C1'" 1 
ATOM   2426 N  N9    . DG  C 3 19  ? 5.570   -5.819  43.339  1.00 72.86  ? 19   DG  C N9    1 
ATOM   2427 C  C8    . DG  C 3 19  ? 5.520   -4.573  42.764  1.00 72.54  ? 19   DG  C C8    1 
ATOM   2428 N  N7    . DG  C 3 19  ? 5.820   -4.581  41.493  1.00 74.56  ? 19   DG  C N7    1 
ATOM   2429 C  C5    . DG  C 3 19  ? 6.089   -5.919  41.212  1.00 66.40  ? 19   DG  C C5    1 
ATOM   2430 C  C6    . DG  C 3 19  ? 6.472   -6.541  40.000  1.00 64.20  ? 19   DG  C C6    1 
ATOM   2431 O  O6    . DG  C 3 19  ? 6.656   -6.023  38.889  1.00 62.71  ? 19   DG  C O6    1 
ATOM   2432 N  N1    . DG  C 3 19  ? 6.640   -7.910  40.158  1.00 67.01  ? 19   DG  C N1    1 
ATOM   2433 C  C2    . DG  C 3 19  ? 6.471   -8.589  41.333  1.00 65.56  ? 19   DG  C C2    1 
ATOM   2434 N  N2    . DG  C 3 19  ? 6.680   -9.912  41.287  1.00 67.80  ? 19   DG  C N2    1 
ATOM   2435 N  N3    . DG  C 3 19  ? 6.114   -8.021  42.471  1.00 63.47  ? 19   DG  C N3    1 
ATOM   2436 C  C4    . DG  C 3 19  ? 5.940   -6.689  42.337  1.00 65.81  ? 19   DG  C C4    1 
ATOM   2437 P  P     . DC  C 3 20  ? 6.990   -6.679  48.768  1.00 96.54  ? 20   DC  C P     1 
ATOM   2438 O  OP1   . DC  C 3 20  ? 6.508   -7.274  50.037  1.00 92.31  ? 20   DC  C OP1   1 
ATOM   2439 O  OP2   . DC  C 3 20  ? 7.653   -5.348  48.724  1.00 82.97  ? 20   DC  C OP2   1 
ATOM   2440 O  "O5'" . DC  C 3 20  ? 7.988   -7.713  48.093  1.00 88.25  ? 20   DC  C "O5'" 1 
ATOM   2441 C  "C5'" . DC  C 3 20  ? 7.551   -9.032  47.820  1.00 91.76  ? 20   DC  C "C5'" 1 
ATOM   2442 C  "C4'" . DC  C 3 20  ? 8.400   -9.649  46.729  1.00 89.83  ? 20   DC  C "C4'" 1 
ATOM   2443 O  "O4'" . DC  C 3 20  ? 8.176   -8.934  45.499  1.00 87.39  ? 20   DC  C "O4'" 1 
ATOM   2444 C  "C3'" . DC  C 3 20  ? 9.907   -9.571  46.978  1.00 89.79  ? 20   DC  C "C3'" 1 
ATOM   2445 O  "O3'" . DC  C 3 20  ? 10.399  -10.837 47.402  1.00 91.68  ? 20   DC  C "O3'" 1 
ATOM   2446 C  "C2'" . DC  C 3 20  ? 10.505  -9.160  45.620  1.00 89.55  ? 20   DC  C "C2'" 1 
ATOM   2447 C  "C1'" . DC  C 3 20  ? 9.298   -9.111  44.683  1.00 84.46  ? 20   DC  C "C1'" 1 
ATOM   2448 N  N1    . DC  C 3 20  ? 9.371   -7.992  43.693  1.00 74.73  ? 20   DC  C N1    1 
ATOM   2449 C  C2    . DC  C 3 20  ? 9.864   -8.253  42.413  1.00 73.60  ? 20   DC  C C2    1 
ATOM   2450 O  O2    . DC  C 3 20  ? 10.212  -9.413  42.127  1.00 74.91  ? 20   DC  C O2    1 
ATOM   2451 N  N3    . DC  C 3 20  ? 9.947   -7.231  41.519  1.00 70.34  ? 20   DC  C N3    1 
ATOM   2452 C  C4    . DC  C 3 20  ? 9.556   -6.004  41.866  1.00 67.85  ? 20   DC  C C4    1 
ATOM   2453 N  N4    . DC  C 3 20  ? 9.645   -5.037  40.946  1.00 62.73  ? 20   DC  C N4    1 
ATOM   2454 C  C5    . DC  C 3 20  ? 9.047   -5.718  43.169  1.00 70.02  ? 20   DC  C C5    1 
ATOM   2455 C  C6    . DC  C 3 20  ? 8.979   -6.732  44.045  1.00 71.52  ? 20   DC  C C6    1 
ATOM   2456 P  P     . DA  C 3 21  ? 11.934  -11.011 47.856  1.00 94.80  ? 21   DA  C P     1 
ATOM   2457 O  OP1   . DA  C 3 21  ? 12.001  -12.281 48.612  1.00 100.24 ? 21   DA  C OP1   1 
ATOM   2458 O  OP2   . DA  C 3 21  ? 12.458  -9.750  48.426  1.00 82.42  ? 21   DA  C OP2   1 
ATOM   2459 O  "O5'" . DA  C 3 21  ? 12.717  -11.202 46.491  1.00 89.20  ? 21   DA  C "O5'" 1 
ATOM   2460 C  "C5'" . DA  C 3 21  ? 12.507  -12.358 45.722  1.00 90.97  ? 21   DA  C "C5'" 1 
ATOM   2461 C  "C4'" . DA  C 3 21  ? 13.400  -12.326 44.509  1.00 89.60  ? 21   DA  C "C4'" 1 
ATOM   2462 O  "O4'" . DA  C 3 21  ? 13.044  -11.172 43.694  1.00 90.13  ? 21   DA  C "O4'" 1 
ATOM   2463 C  "C3'" . DA  C 3 21  ? 14.890  -12.181 44.823  1.00 83.12  ? 21   DA  C "C3'" 1 
ATOM   2464 O  "O3'" . DA  C 3 21  ? 15.630  -12.976 43.932  1.00 83.58  ? 21   DA  C "O3'" 1 
ATOM   2465 C  "C2'" . DA  C 3 21  ? 15.147  -10.688 44.596  1.00 85.12  ? 21   DA  C "C2'" 1 
ATOM   2466 C  "C1'" . DA  C 3 21  ? 14.199  -10.399 43.442  1.00 86.37  ? 21   DA  C "C1'" 1 
ATOM   2467 N  N9    . DA  C 3 21  ? 13.811  -8.991  43.310  1.00 79.46  ? 21   DA  C N9    1 
ATOM   2468 C  C8    . DA  C 3 21  ? 13.549  -8.100  44.317  1.00 77.99  ? 21   DA  C C8    1 
ATOM   2469 N  N7    . DA  C 3 21  ? 13.220  -6.897  43.889  1.00 76.18  ? 21   DA  C N7    1 
ATOM   2470 C  C5    . DA  C 3 21  ? 13.261  -7.011  42.504  1.00 70.35  ? 21   DA  C C5    1 
ATOM   2471 C  C6    . DA  C 3 21  ? 13.015  -6.089  41.457  1.00 63.99  ? 21   DA  C C6    1 
ATOM   2472 N  N6    . DA  C 3 21  ? 12.658  -4.814  41.656  1.00 61.62  ? 21   DA  C N6    1 
ATOM   2473 N  N1    . DA  C 3 21  ? 13.154  -6.531  40.191  1.00 68.25  ? 21   DA  C N1    1 
ATOM   2474 C  C2    . DA  C 3 21  ? 13.517  -7.805  39.986  1.00 73.12  ? 21   DA  C C2    1 
ATOM   2475 N  N3    . DA  C 3 21  ? 13.772  -8.762  40.881  1.00 74.16  ? 21   DA  C N3    1 
ATOM   2476 C  C4    . DA  C 3 21  ? 13.622  -8.296  42.133  1.00 73.76  ? 21   DA  C C4    1 
ATOM   2477 P  P     . DA  C 3 22  ? 17.153  -13.371 44.253  1.00 95.76  ? 22   DA  C P     1 
ATOM   2478 O  OP1   . DA  C 3 22  ? 17.177  -14.805 44.633  1.00 96.32  ? 22   DA  C OP1   1 
ATOM   2479 O  OP2   . DA  C 3 22  ? 17.743  -12.327 45.112  1.00 84.31  ? 22   DA  C OP2   1 
ATOM   2480 O  "O5'" . DA  C 3 22  ? 17.888  -13.207 42.848  1.00 92.23  ? 22   DA  C "O5'" 1 
ATOM   2481 C  "C5'" . DA  C 3 22  ? 17.412  -13.906 41.726  1.00 87.02  ? 22   DA  C "C5'" 1 
ATOM   2482 C  "C4'" . DA  C 3 22  ? 17.775  -13.164 40.469  1.00 81.50  ? 22   DA  C "C4'" 1 
ATOM   2483 O  "O4'" . DA  C 3 22  ? 17.217  -11.835 40.529  1.00 77.90  ? 22   DA  C "O4'" 1 
ATOM   2484 C  "C3'" . DA  C 3 22  ? 19.269  -12.983 40.245  1.00 78.04  ? 22   DA  C "C3'" 1 
ATOM   2485 O  "O3'" . DA  C 3 22  ? 19.571  -13.312 38.917  1.00 80.53  ? 22   DA  C "O3'" 1 
ATOM   2486 C  "C2'" . DA  C 3 22  ? 19.502  -11.493 40.522  1.00 82.00  ? 22   DA  C "C2'" 1 
ATOM   2487 C  "C1'" . DA  C 3 22  ? 18.175  -10.902 40.108  1.00 77.10  ? 22   DA  C "C1'" 1 
ATOM   2488 N  N9    . DA  C 3 22  ? 17.850  -9.623  40.739  1.00 76.39  ? 22   DA  C N9    1 
ATOM   2489 C  C8    . DA  C 3 22  ? 17.775  -9.357  42.078  1.00 73.03  ? 22   DA  C C8    1 
ATOM   2490 N  N7    . DA  C 3 22  ? 17.419  -8.122  42.354  1.00 71.52  ? 22   DA  C N7    1 
ATOM   2491 C  C5    . DA  C 3 22  ? 17.228  -7.543  41.110  1.00 69.48  ? 22   DA  C C5    1 
ATOM   2492 C  C6    . DA  C 3 22  ? 16.838  -6.246  40.711  1.00 65.60  ? 22   DA  C C6    1 
ATOM   2493 N  N6    . DA  C 3 22  ? 16.561  -5.254  41.566  1.00 63.71  ? 22   DA  C N6    1 
ATOM   2494 N  N1    . DA  C 3 22  ? 16.753  -6.005  39.391  1.00 67.88  ? 22   DA  C N1    1 
ATOM   2495 C  C2    . DA  C 3 22  ? 17.024  -6.993  38.529  1.00 72.56  ? 22   DA  C C2    1 
ATOM   2496 N  N3    . DA  C 3 22  ? 17.390  -8.245  38.780  1.00 74.66  ? 22   DA  C N3    1 
ATOM   2497 C  C4    . DA  C 3 22  ? 17.478  -8.458  40.104  1.00 75.13  ? 22   DA  C C4    1 
ATOM   2498 P  P     . DG  C 3 23  ? 21.092  -13.537 38.470  1.00 91.05  ? 23   DG  C P     1 
ATOM   2499 O  OP1   . DG  C 3 23  ? 21.069  -14.558 37.399  1.00 88.56  ? 23   DG  C OP1   1 
ATOM   2500 O  OP2   . DG  C 3 23  ? 21.899  -13.764 39.688  1.00 88.57  ? 23   DG  C OP2   1 
ATOM   2501 O  "O5'" . DG  C 3 23  ? 21.534  -12.111 37.889  1.00 89.44  ? 23   DG  C "O5'" 1 
ATOM   2502 C  "C5'" . DG  C 3 23  ? 20.840  -11.536 36.795  1.00 80.92  ? 23   DG  C "C5'" 1 
ATOM   2503 C  "C4'" . DG  C 3 23  ? 21.227  -10.079 36.617  1.00 78.08  ? 23   DG  C "C4'" 1 
ATOM   2504 O  "O4'" . DG  C 3 23  ? 20.545  -9.243  37.594  1.00 78.35  ? 23   DG  C "O4'" 1 
ATOM   2505 C  "C3'" . DG  C 3 23  ? 22.713  -9.761  36.798  1.00 78.38  ? 23   DG  C "C3'" 1 
ATOM   2506 O  "O3'" . DG  C 3 23  ? 23.054  -8.793  35.870  1.00 83.46  ? 23   DG  C "O3'" 1 
ATOM   2507 C  "C2'" . DG  C 3 23  ? 22.738  -9.145  38.194  1.00 82.59  ? 23   DG  C "C2'" 1 
ATOM   2508 C  "C1'" . DG  C 3 23  ? 21.490  -8.318  38.060  1.00 75.52  ? 23   DG  C "C1'" 1 
ATOM   2509 N  N9    . DG  C 3 23  ? 21.014  -7.665  39.273  1.00 71.35  ? 23   DG  C N9    1 
ATOM   2510 C  C8    . DG  C 3 23  ? 20.858  -8.207  40.525  1.00 71.10  ? 23   DG  C C8    1 
ATOM   2511 N  N7    . DG  C 3 23  ? 20.391  -7.352  41.405  1.00 71.17  ? 23   DG  C N7    1 
ATOM   2512 C  C5    . DG  C 3 23  ? 20.226  -6.174  40.680  1.00 68.38  ? 23   DG  C C5    1 
ATOM   2513 C  C6    . DG  C 3 23  ? 19.747  -4.902  41.087  1.00 67.41  ? 23   DG  C C6    1 
ATOM   2514 O  O6    . DG  C 3 23  ? 19.365  -4.547  42.212  1.00 66.40  ? 23   DG  C O6    1 
ATOM   2515 N  N1    . DG  C 3 23  ? 19.731  -3.992  40.029  1.00 64.59  ? 23   DG  C N1    1 
ATOM   2516 C  C2    . DG  C 3 23  ? 20.137  -4.274  38.744  1.00 67.92  ? 23   DG  C C2    1 
ATOM   2517 N  N2    . DG  C 3 23  ? 20.063  -3.268  37.860  1.00 63.13  ? 23   DG  C N2    1 
ATOM   2518 N  N3    . DG  C 3 23  ? 20.587  -5.458  38.351  1.00 70.61  ? 23   DG  C N3    1 
ATOM   2519 C  C4    . DG  C 3 23  ? 20.605  -6.355  39.369  1.00 70.47  ? 23   DG  C C4    1 
ATOM   2520 P  P     . DG  C 3 24  ? 24.204  -9.060  34.793  1.00 99.98  ? 24   DG  C P     1 
ATOM   2521 O  OP1   . DG  C 3 24  ? 23.581  -9.777  33.653  1.00 100.70 ? 24   DG  C OP1   1 
ATOM   2522 O  OP2   . DG  C 3 24  ? 25.356  -9.675  35.496  1.00 89.60  ? 24   DG  C OP2   1 
ATOM   2523 O  "O5'" . DG  C 3 24  ? 24.579  -7.579  34.314  1.00 91.35  ? 24   DG  C "O5'" 1 
ATOM   2524 C  "C5'" . DG  C 3 24  ? 23.555  -6.715  33.831  1.00 82.69  ? 24   DG  C "C5'" 1 
ATOM   2525 C  "C4'" . DG  C 3 24  ? 23.839  -5.279  34.223  1.00 87.98  ? 24   DG  C "C4'" 1 
ATOM   2526 O  "O4'" . DG  C 3 24  ? 23.290  -5.020  35.534  1.00 91.96  ? 24   DG  C "O4'" 1 
ATOM   2527 C  "C3'" . DG  C 3 24  ? 25.326  -4.913  34.296  1.00 91.12  ? 24   DG  C "C3'" 1 
ATOM   2528 O  "O3'" . DG  C 3 24  ? 25.597  -3.806  33.433  1.00 96.88  ? 24   DG  C "O3'" 1 
ATOM   2529 C  "C2'" . DG  C 3 24  ? 25.565  -4.569  35.779  1.00 80.98  ? 24   DG  C "C2'" 1 
ATOM   2530 C  "C1'" . DG  C 3 24  ? 24.172  -4.185  36.249  1.00 83.62  ? 24   DG  C "C1'" 1 
ATOM   2531 N  N9    . DG  C 3 24  ? 23.927  -4.370  37.693  1.00 76.36  ? 24   DG  C N9    1 
ATOM   2532 C  C8    . DG  C 3 24  ? 23.984  -5.547  38.411  1.00 70.84  ? 24   DG  C C8    1 
ATOM   2533 N  N7    . DG  C 3 24  ? 23.695  -5.397  39.680  1.00 71.62  ? 24   DG  C N7    1 
ATOM   2534 C  C5    . DG  C 3 24  ? 23.408  -4.038  39.808  1.00 64.57  ? 24   DG  C C5    1 
ATOM   2535 C  C6    . DG  C 3 24  ? 23.028  -3.288  40.947  1.00 66.96  ? 24   DG  C C6    1 
ATOM   2536 O  O6    . DG  C 3 24  ? 22.849  -3.687  42.110  1.00 71.16  ? 24   DG  C O6    1 
ATOM   2537 N  N1    . DG  C 3 24  ? 22.837  -1.941  40.638  1.00 67.15  ? 24   DG  C N1    1 
ATOM   2538 C  C2    . DG  C 3 24  ? 22.995  -1.387  39.390  1.00 65.58  ? 24   DG  C C2    1 
ATOM   2539 N  N2    . DG  C 3 24  ? 22.774  -0.060  39.290  1.00 62.33  ? 24   DG  C N2    1 
ATOM   2540 N  N3    . DG  C 3 24  ? 23.352  -2.077  38.318  1.00 63.58  ? 24   DG  C N3    1 
ATOM   2541 C  C4    . DG  C 3 24  ? 23.540  -3.393  38.599  1.00 67.98  ? 24   DG  C C4    1 
ATOM   2542 P  P     . DC  C 3 25  ? 27.085  -3.562  32.864  1.00 115.38 ? 25   DC  C P     1 
ATOM   2543 O  OP1   . DC  C 3 25  ? 26.961  -3.234  31.424  1.00 108.36 ? 25   DC  C OP1   1 
ATOM   2544 O  OP2   . DC  C 3 25  ? 27.979  -4.662  33.312  1.00 96.64  ? 25   DC  C OP2   1 
ATOM   2545 O  "O5'" . DC  C 3 25  ? 27.541  -2.222  33.600  1.00 97.53  ? 25   DC  C "O5'" 1 
ATOM   2546 C  "C5'" . DC  C 3 25  ? 26.775  -1.042  33.432  1.00 93.28  ? 25   DC  C "C5'" 1 
ATOM   2547 C  "C4'" . DC  C 3 25  ? 27.034  -0.075  34.568  1.00 87.30  ? 25   DC  C "C4'" 1 
ATOM   2548 O  "O4'" . DC  C 3 25  ? 26.476  -0.609  35.794  1.00 89.41  ? 25   DC  C "O4'" 1 
ATOM   2549 C  "C3'" . DC  C 3 25  ? 28.512  0.201   34.852  1.00 80.12  ? 25   DC  C "C3'" 1 
ATOM   2550 O  "O3'" . DC  C 3 25  ? 28.776  1.595   34.712  1.00 81.87  ? 25   DC  C "O3'" 1 
ATOM   2551 C  "C2'" . DC  C 3 25  ? 28.721  -0.282  36.299  1.00 80.39  ? 25   DC  C "C2'" 1 
ATOM   2552 C  "C1'" . DC  C 3 25  ? 27.307  -0.253  36.866  1.00 75.90  ? 25   DC  C "C1'" 1 
ATOM   2553 N  N1    . DC  C 3 25  ? 27.070  -1.225  37.982  1.00 70.31  ? 25   DC  C N1    1 
ATOM   2554 C  C2    . DC  C 3 25  ? 26.401  -0.803  39.137  1.00 67.38  ? 25   DC  C C2    1 
ATOM   2555 O  O2    . DC  C 3 25  ? 26.023  0.373   39.219  1.00 62.79  ? 25   DC  C O2    1 
ATOM   2556 N  N3    . DC  C 3 25  ? 26.187  -1.699  40.138  1.00 63.88  ? 25   DC  C N3    1 
ATOM   2557 C  C4    . DC  C 3 25  ? 26.610  -2.961  40.013  1.00 65.60  ? 25   DC  C C4    1 
ATOM   2558 N  N4    . DC  C 3 25  ? 26.373  -3.803  41.024  1.00 67.67  ? 25   DC  C N4    1 
ATOM   2559 C  C5    . DC  C 3 25  ? 27.292  -3.413  38.845  1.00 66.84  ? 25   DC  C C5    1 
ATOM   2560 C  C6    . DC  C 3 25  ? 27.496  -2.521  37.862  1.00 74.21  ? 25   DC  C C6    1 
ATOM   2561 N  N     . GLU D 1 5   ? -23.472 16.220  -33.092 1.00 121.35 ? 5    GLU D N     1 
ATOM   2562 C  CA    . GLU D 1 5   ? -23.138 16.248  -31.668 1.00 115.95 ? 5    GLU D CA    1 
ATOM   2563 C  C     . GLU D 1 5   ? -21.646 16.391  -31.444 1.00 118.00 ? 5    GLU D C     1 
ATOM   2564 O  O     . GLU D 1 5   ? -21.226 16.908  -30.397 1.00 120.97 ? 5    GLU D O     1 
ATOM   2565 C  CB    . GLU D 1 5   ? -23.629 14.982  -30.964 1.00 113.96 ? 5    GLU D CB    1 
ATOM   2566 C  CG    . GLU D 1 5   ? -24.736 15.187  -29.915 1.00 117.74 ? 5    GLU D CG    1 
ATOM   2567 C  CD    . GLU D 1 5   ? -24.384 16.158  -28.786 1.00 132.58 ? 5    GLU D CD    1 
ATOM   2568 O  OE1   . GLU D 1 5   ? -23.187 16.466  -28.570 1.00 131.57 ? 5    GLU D OE1   1 
ATOM   2569 O  OE2   . GLU D 1 5   ? -25.334 16.623  -28.115 1.00 137.75 ? 5    GLU D OE2   1 
ATOM   2570 N  N     . ASN D 1 6   ? -20.853 15.900  -32.401 1.00 88.60  ? 6    ASN D N     1 
ATOM   2571 C  CA    . ASN D 1 6   ? -19.393 16.046  -32.353 1.00 92.44  ? 6    ASN D CA    1 
ATOM   2572 C  C     . ASN D 1 6   ? -18.784 15.100  -31.298 1.00 87.25  ? 6    ASN D C     1 
ATOM   2573 O  O     . ASN D 1 6   ? -17.882 14.312  -31.607 1.00 81.40  ? 6    ASN D O     1 
ATOM   2574 C  CB    . ASN D 1 6   ? -19.030 17.531  -32.119 1.00 89.40  ? 6    ASN D CB    1 
ATOM   2575 C  CG    . ASN D 1 6   ? -17.574 17.753  -31.785 1.00 95.86  ? 6    ASN D CG    1 
ATOM   2576 O  OD1   . ASN D 1 6   ? -17.226 17.983  -30.627 1.00 99.26  ? 6    ASN D OD1   1 
ATOM   2577 N  ND2   . ASN D 1 6   ? -16.714 17.708  -32.800 1.00 99.06  ? 6    ASN D ND2   1 
ATOM   2578 N  N     . VAL D 1 7   ? -19.305 15.140  -30.074 1.00 74.13  ? 7    VAL D N     1 
ATOM   2579 C  CA    . VAL D 1 7   ? -19.030 14.086  -29.100 1.00 72.77  ? 7    VAL D CA    1 
ATOM   2580 C  C     . VAL D 1 7   ? -19.342 12.686  -29.657 1.00 62.44  ? 7    VAL D C     1 
ATOM   2581 O  O     . VAL D 1 7   ? -18.669 11.717  -29.340 1.00 69.18  ? 7    VAL D O     1 
ATOM   2582 C  CB    . VAL D 1 7   ? -19.838 14.294  -27.805 1.00 74.95  ? 7    VAL D CB    1 
ATOM   2583 C  CG1   . VAL D 1 7   ? -19.688 13.090  -26.855 1.00 76.68  ? 7    VAL D CG1   1 
ATOM   2584 C  CG2   . VAL D 1 7   ? -19.418 15.586  -27.127 1.00 84.31  ? 7    VAL D CG2   1 
ATOM   2585 N  N     . SER D 1 8   ? -20.348 12.581  -30.507 1.00 66.39  ? 8    SER D N     1 
ATOM   2586 C  CA    . SER D 1 8   ? -20.741 11.281  -31.020 1.00 65.06  ? 8    SER D CA    1 
ATOM   2587 C  C     . SER D 1 8   ? -19.943 10.917  -32.266 1.00 62.19  ? 8    SER D C     1 
ATOM   2588 O  O     . SER D 1 8   ? -19.843 9.745   -32.641 1.00 63.48  ? 8    SER D O     1 
ATOM   2589 C  CB    . SER D 1 8   ? -22.248 11.259  -31.312 1.00 62.40  ? 8    SER D CB    1 
ATOM   2590 O  OG    . SER D 1 8   ? -22.564 12.193  -32.321 1.00 71.33  ? 8    SER D OG    1 
ATOM   2591 N  N     . GLY D 1 9   ? -19.372 11.918  -32.915 1.00 70.23  ? 9    GLY D N     1 
ATOM   2592 C  CA    . GLY D 1 9   ? -18.580 11.650  -34.098 1.00 67.82  ? 9    GLY D CA    1 
ATOM   2593 C  C     . GLY D 1 9   ? -17.217 11.180  -33.650 1.00 64.63  ? 9    GLY D C     1 
ATOM   2594 O  O     . GLY D 1 9   ? -16.612 10.276  -34.234 1.00 65.36  ? 9    GLY D O     1 
ATOM   2595 N  N     . ILE D 1 10  ? -16.732 11.802  -32.589 1.00 53.68  ? 10   ILE D N     1 
ATOM   2596 C  CA    . ILE D 1 10  ? -15.436 11.444  -32.065 1.00 54.23  ? 10   ILE D CA    1 
ATOM   2597 C  C     . ILE D 1 10  ? -15.561 10.047  -31.489 1.00 53.93  ? 10   ILE D C     1 
ATOM   2598 O  O     . ILE D 1 10  ? -14.732 9.176   -31.760 1.00 50.62  ? 10   ILE D O     1 
ATOM   2599 C  CB    . ILE D 1 10  ? -14.951 12.473  -31.030 1.00 56.13  ? 10   ILE D CB    1 
ATOM   2600 C  CG1   . ILE D 1 10  ? -14.647 13.787  -31.743 1.00 56.78  ? 10   ILE D CG1   1 
ATOM   2601 C  CG2   . ILE D 1 10  ? -13.691 11.997  -30.319 1.00 53.14  ? 10   ILE D CG2   1 
ATOM   2602 C  CD1   . ILE D 1 10  ? -14.298 14.900  -30.811 1.00 72.32  ? 10   ILE D CD1   1 
ATOM   2603 N  N     . SER D 1 11  ? -16.627 9.837   -30.726 1.00 55.64  ? 11   SER D N     1 
ATOM   2604 C  CA    . SER D 1 11  ? -16.979 8.515   -30.229 1.00 53.91  ? 11   SER D CA    1 
ATOM   2605 C  C     . SER D 1 11  ? -16.935 7.464   -31.323 1.00 53.99  ? 11   SER D C     1 
ATOM   2606 O  O     . SER D 1 11  ? -16.305 6.425   -31.164 1.00 47.56  ? 11   SER D O     1 
ATOM   2607 C  CB    . SER D 1 11  ? -18.372 8.531   -29.599 1.00 53.19  ? 11   SER D CB    1 
ATOM   2608 O  OG    . SER D 1 11  ? -18.362 9.249   -28.376 1.00 58.76  ? 11   SER D OG    1 
ATOM   2609 N  N     . ALA D 1 12  ? -17.597 7.730   -32.441 1.00 50.34  ? 12   ALA D N     1 
ATOM   2610 C  CA    . ALA D 1 12  ? -17.669 6.714   -33.474 1.00 52.17  ? 12   ALA D CA    1 
ATOM   2611 C  C     . ALA D 1 12  ? -16.301 6.521   -34.159 1.00 47.62  ? 12   ALA D C     1 
ATOM   2612 O  O     . ALA D 1 12  ? -15.915 5.391   -34.463 1.00 43.90  ? 12   ALA D O     1 
ATOM   2613 C  CB    . ALA D 1 12  ? -18.772 7.054   -34.492 1.00 48.47  ? 12   ALA D CB    1 
ATOM   2614 N  N     . TYR D 1 13  ? -15.571 7.610   -34.385 1.00 47.42  ? 13   TYR D N     1 
ATOM   2615 C  CA    . TYR D 1 13  ? -14.187 7.522   -34.876 1.00 50.62  ? 13   TYR D CA    1 
ATOM   2616 C  C     . TYR D 1 13  ? -13.322 6.605   -34.005 1.00 48.22  ? 13   TYR D C     1 
ATOM   2617 O  O     . TYR D 1 13  ? -12.624 5.726   -34.507 1.00 43.59  ? 13   TYR D O     1 
ATOM   2618 C  CB    . TYR D 1 13  ? -13.541 8.907   -34.933 1.00 50.42  ? 13   TYR D CB    1 
ATOM   2619 C  CG    . TYR D 1 13  ? -12.131 8.903   -35.488 1.00 51.01  ? 13   TYR D CG    1 
ATOM   2620 C  CD1   . TYR D 1 13  ? -11.888 8.539   -36.806 1.00 53.99  ? 13   TYR D CD1   1 
ATOM   2621 C  CD2   . TYR D 1 13  ? -11.049 9.284   -34.708 1.00 50.45  ? 13   TYR D CD2   1 
ATOM   2622 C  CE1   . TYR D 1 13  ? -10.620 8.539   -37.325 1.00 53.39  ? 13   TYR D CE1   1 
ATOM   2623 C  CE2   . TYR D 1 13  ? -9.775  9.285   -35.217 1.00 48.46  ? 13   TYR D CE2   1 
ATOM   2624 C  CZ    . TYR D 1 13  ? -9.565  8.913   -36.527 1.00 52.09  ? 13   TYR D CZ    1 
ATOM   2625 O  OH    . TYR D 1 13  ? -8.292  8.904   -37.045 1.00 49.76  ? 13   TYR D OH    1 
ATOM   2626 N  N     . LEU D 1 14  ? -13.389 6.822   -32.694 1.00 46.78  ? 14   LEU D N     1 
ATOM   2627 C  CA    . LEU D 1 14  ? -12.630 6.047   -31.729 1.00 36.61  ? 14   LEU D CA    1 
ATOM   2628 C  C     . LEU D 1 14  ? -13.037 4.587   -31.719 1.00 41.56  ? 14   LEU D C     1 
ATOM   2629 O  O     . LEU D 1 14  ? -12.211 3.700   -31.473 1.00 40.45  ? 14   LEU D O     1 
ATOM   2630 C  CB    . LEU D 1 14  ? -12.798 6.640   -30.339 1.00 42.41  ? 14   LEU D CB    1 
ATOM   2631 C  CG    . LEU D 1 14  ? -12.132 8.002   -30.075 1.00 46.15  ? 14   LEU D CG    1 
ATOM   2632 C  CD1   . LEU D 1 14  ? -12.424 8.462   -28.650 1.00 38.18  ? 14   LEU D CD1   1 
ATOM   2633 C  CD2   . LEU D 1 14  ? -10.629 7.965   -30.337 1.00 39.57  ? 14   LEU D CD2   1 
ATOM   2634 N  N     . LEU D 1 15  ? -14.311 4.336   -32.004 1.00 47.77  ? 15   LEU D N     1 
ATOM   2635 C  CA    . LEU D 1 15  ? -14.844 2.976   -31.983 1.00 43.24  ? 15   LEU D CA    1 
ATOM   2636 C  C     . LEU D 1 15  ? -14.225 2.168   -33.105 1.00 45.02  ? 15   LEU D C     1 
ATOM   2637 O  O     . LEU D 1 15  ? -13.855 1.018   -32.902 1.00 44.86  ? 15   LEU D O     1 
ATOM   2638 C  CB    . LEU D 1 15  ? -16.368 2.979   -32.106 1.00 44.66  ? 15   LEU D CB    1 
ATOM   2639 C  CG    . LEU D 1 15  ? -17.047 1.640   -31.799 1.00 46.07  ? 15   LEU D CG    1 
ATOM   2640 C  CD1   . LEU D 1 15  ? -16.622 1.155   -30.416 1.00 41.29  ? 15   LEU D CD1   1 
ATOM   2641 C  CD2   . LEU D 1 15  ? -18.572 1.768   -31.876 1.00 41.64  ? 15   LEU D CD2   1 
ATOM   2642 N  N     . GLY D 1 16  ? -14.136 2.782   -34.288 1.00 53.16  ? 16   GLY D N     1 
ATOM   2643 C  CA    . GLY D 1 16  ? -13.466 2.195   -35.435 1.00 46.32  ? 16   GLY D CA    1 
ATOM   2644 C  C     . GLY D 1 16  ? -12.011 1.867   -35.115 1.00 56.01  ? 16   GLY D C     1 
ATOM   2645 O  O     . GLY D 1 16  ? -11.530 0.788   -35.452 1.00 57.49  ? 16   GLY D O     1 
ATOM   2646 N  N     . LEU D 1 17  ? -11.308 2.774   -34.441 1.00 45.23  ? 17   LEU D N     1 
ATOM   2647 C  CA    . LEU D 1 17  ? -9.939  2.479   -34.056 1.00 45.86  ? 17   LEU D CA    1 
ATOM   2648 C  C     . LEU D 1 17  ? -9.923  1.329   -33.050 1.00 44.24  ? 17   LEU D C     1 
ATOM   2649 O  O     . LEU D 1 17  ? -9.044  0.463   -33.105 1.00 42.01  ? 17   LEU D O     1 
ATOM   2650 C  CB    . LEU D 1 17  ? -9.234  3.715   -33.462 1.00 45.65  ? 17   LEU D CB    1 
ATOM   2651 C  CG    . LEU D 1 17  ? -9.074  4.997   -34.292 1.00 45.40  ? 17   LEU D CG    1 
ATOM   2652 C  CD1   . LEU D 1 17  ? -8.198  5.954   -33.530 1.00 47.88  ? 17   LEU D CD1   1 
ATOM   2653 C  CD2   . LEU D 1 17  ? -8.513  4.752   -35.691 1.00 46.05  ? 17   LEU D CD2   1 
ATOM   2654 N  N     . ILE D 1 18  ? -10.881 1.324   -32.125 1.00 42.46  ? 18   ILE D N     1 
ATOM   2655 C  CA    . ILE D 1 18  ? -10.909 0.283   -31.102 1.00 41.25  ? 18   ILE D CA    1 
ATOM   2656 C  C     . ILE D 1 18  ? -11.203 -1.078  -31.717 1.00 45.79  ? 18   ILE D C     1 
ATOM   2657 O  O     . ILE D 1 18  ? -10.508 -2.047  -31.445 1.00 47.19  ? 18   ILE D O     1 
ATOM   2658 C  CB    . ILE D 1 18  ? -11.947 0.579   -30.016 1.00 40.49  ? 18   ILE D CB    1 
ATOM   2659 C  CG1   . ILE D 1 18  ? -11.501 1.782   -29.192 1.00 44.54  ? 18   ILE D CG1   1 
ATOM   2660 C  CG2   . ILE D 1 18  ? -12.207 -0.672  -29.146 1.00 40.16  ? 18   ILE D CG2   1 
ATOM   2661 C  CD1   . ILE D 1 18  ? -12.581 2.391   -28.332 1.00 43.49  ? 18   ILE D CD1   1 
ATOM   2662 N  N     . ILE D 1 19  ? -12.228 -1.155  -32.556 1.00 46.12  ? 19   ILE D N     1 
ATOM   2663 C  CA    . ILE D 1 19  ? -12.565 -2.427  -33.183 1.00 53.86  ? 19   ILE D CA    1 
ATOM   2664 C  C     . ILE D 1 19  ? -11.484 -2.843  -34.167 1.00 50.86  ? 19   ILE D C     1 
ATOM   2665 O  O     . ILE D 1 19  ? -11.096 -4.004  -34.226 1.00 55.43  ? 19   ILE D O     1 
ATOM   2666 C  CB    . ILE D 1 19  ? -13.918 -2.379  -33.915 1.00 50.71  ? 19   ILE D CB    1 
ATOM   2667 C  CG1   . ILE D 1 19  ? -15.044 -2.088  -32.932 1.00 50.61  ? 19   ILE D CG1   1 
ATOM   2668 C  CG2   . ILE D 1 19  ? -14.170 -3.681  -34.594 1.00 49.38  ? 19   ILE D CG2   1 
ATOM   2669 C  CD1   . ILE D 1 19  ? -15.078 -3.037  -31.771 1.00 57.07  ? 19   ILE D CD1   1 
ATOM   2670 N  N     . GLY D 1 20  ? -11.003 -1.880  -34.940 1.00 50.34  ? 20   GLY D N     1 
ATOM   2671 C  CA    . GLY D 1 20  ? -9.918  -2.129  -35.868 1.00 48.28  ? 20   GLY D CA    1 
ATOM   2672 C  C     . GLY D 1 20  ? -8.620  -2.578  -35.225 1.00 51.85  ? 20   GLY D C     1 
ATOM   2673 O  O     . GLY D 1 20  ? -8.085  -3.608  -35.617 1.00 57.68  ? 20   GLY D O     1 
ATOM   2674 N  N     . ASP D 1 21  ? -8.123  -1.837  -34.232 1.00 44.78  ? 21   ASP D N     1 
ATOM   2675 C  CA    . ASP D 1 21  ? -6.750  -2.021  -33.770 1.00 46.33  ? 21   ASP D CA    1 
ATOM   2676 C  C     . ASP D 1 21  ? -6.588  -2.194  -32.259 1.00 49.63  ? 21   ASP D C     1 
ATOM   2677 O  O     . ASP D 1 21  ? -5.492  -2.002  -31.708 1.00 46.51  ? 21   ASP D O     1 
ATOM   2678 C  CB    . ASP D 1 21  ? -5.896  -0.837  -34.218 1.00 49.39  ? 21   ASP D CB    1 
ATOM   2679 C  CG    . ASP D 1 21  ? -5.203  -1.076  -35.544 1.00 48.91  ? 21   ASP D CG    1 
ATOM   2680 O  OD1   . ASP D 1 21  ? -5.136  -2.233  -36.026 1.00 53.61  ? 21   ASP D OD1   1 
ATOM   2681 O  OD2   . ASP D 1 21  ? -4.714  -0.084  -36.105 1.00 44.77  ? 21   ASP D OD2   1 
ATOM   2682 N  N     . GLY D 1 22  ? -7.676  -2.551  -31.591 1.00 43.83  ? 22   GLY D N     1 
ATOM   2683 C  CA    . GLY D 1 22  ? -7.638  -2.748  -30.160 1.00 41.25  ? 22   GLY D CA    1 
ATOM   2684 C  C     . GLY D 1 22  ? -8.765  -3.647  -29.718 1.00 40.23  ? 22   GLY D C     1 
ATOM   2685 O  O     . GLY D 1 22  ? -9.076  -4.641  -30.369 1.00 48.30  ? 22   GLY D O     1 
ATOM   2686 N  N     . GLY D 1 23  ? -9.401  -3.291  -28.617 1.00 38.58  ? 23   GLY D N     1 
ATOM   2687 C  CA    . GLY D 1 23  ? -10.480 -4.112  -28.120 1.00 37.66  ? 23   GLY D CA    1 
ATOM   2688 C  C     . GLY D 1 23  ? -11.160 -3.534  -26.904 1.00 41.60  ? 23   GLY D C     1 
ATOM   2689 O  O     . GLY D 1 23  ? -10.810 -2.470  -26.401 1.00 43.31  ? 23   GLY D O     1 
ATOM   2690 N  N     . LEU D 1 24  ? -12.153 -4.270  -26.440 1.00 43.00  ? 24   LEU D N     1 
ATOM   2691 C  CA    . LEU D 1 24  ? -12.922 -3.938  -25.266 1.00 41.46  ? 24   LEU D CA    1 
ATOM   2692 C  C     . LEU D 1 24  ? -12.862 -5.139  -24.362 1.00 45.79  ? 24   LEU D C     1 
ATOM   2693 O  O     . LEU D 1 24  ? -13.354 -6.204  -24.728 1.00 49.09  ? 24   LEU D O     1 
ATOM   2694 C  CB    . LEU D 1 24  ? -14.352 -3.622  -25.636 1.00 37.98  ? 24   LEU D CB    1 
ATOM   2695 C  CG    . LEU D 1 24  ? -14.468 -2.382  -26.496 1.00 44.69  ? 24   LEU D CG    1 
ATOM   2696 C  CD1   . LEU D 1 24  ? -15.923 -2.287  -26.955 1.00 40.90  ? 24   LEU D CD1   1 
ATOM   2697 C  CD2   . LEU D 1 24  ? -14.008 -1.129  -25.706 1.00 36.72  ? 24   LEU D CD2   1 
ATOM   2698 N  N     . TYR D 1 25  ? -12.264 -4.975  -23.188 1.00 46.10  ? 25   TYR D N     1 
ATOM   2699 C  CA    . TYR D 1 25  ? -11.947 -6.122  -22.354 1.00 47.44  ? 25   TYR D CA    1 
ATOM   2700 C  C     . TYR D 1 25  ? -12.559 -6.013  -20.970 1.00 46.67  ? 25   TYR D C     1 
ATOM   2701 O  O     . TYR D 1 25  ? -12.406 -4.999  -20.278 1.00 49.02  ? 25   TYR D O     1 
ATOM   2702 C  CB    . TYR D 1 25  ? -10.417 -6.296  -22.267 1.00 44.38  ? 25   TYR D CB    1 
ATOM   2703 C  CG    . TYR D 1 25  ? -9.789  -6.354  -23.642 1.00 43.68  ? 25   TYR D CG    1 
ATOM   2704 C  CD1   . TYR D 1 25  ? -10.047 -7.427  -24.498 1.00 39.95  ? 25   TYR D CD1   1 
ATOM   2705 C  CD2   . TYR D 1 25  ? -8.986  -5.317  -24.105 1.00 41.15  ? 25   TYR D CD2   1 
ATOM   2706 C  CE1   . TYR D 1 25  ? -9.493  -7.484  -25.761 1.00 41.69  ? 25   TYR D CE1   1 
ATOM   2707 C  CE2   . TYR D 1 25  ? -8.420  -5.360  -25.372 1.00 40.36  ? 25   TYR D CE2   1 
ATOM   2708 C  CZ    . TYR D 1 25  ? -8.681  -6.442  -26.192 1.00 45.49  ? 25   TYR D CZ    1 
ATOM   2709 O  OH    . TYR D 1 25  ? -8.136  -6.480  -27.446 1.00 47.90  ? 25   TYR D OH    1 
ATOM   2710 N  N     . LYS D 1 26  ? -13.250 -7.086  -20.592 1.00 51.57  ? 26   LYS D N     1 
ATOM   2711 C  CA    . LYS D 1 26  ? -13.805 -7.264  -19.251 1.00 49.71  ? 26   LYS D CA    1 
ATOM   2712 C  C     . LYS D 1 26  ? -12.941 -8.289  -18.539 1.00 51.83  ? 26   LYS D C     1 
ATOM   2713 O  O     . LYS D 1 26  ? -13.066 -9.471  -18.800 1.00 49.49  ? 26   LYS D O     1 
ATOM   2714 C  CB    . LYS D 1 26  ? -15.259 -7.731  -19.340 1.00 54.10  ? 26   LYS D CB    1 
ATOM   2715 C  CG    . LYS D 1 26  ? -16.029 -7.784  -18.043 1.00 58.04  ? 26   LYS D CG    1 
ATOM   2716 C  CD    . LYS D 1 26  ? -17.484 -8.153  -18.314 1.00 60.39  ? 26   LYS D CD    1 
ATOM   2717 C  CE    . LYS D 1 26  ? -18.336 -7.979  -17.063 1.00 77.84  ? 26   LYS D CE    1 
ATOM   2718 N  NZ    . LYS D 1 26  ? -17.686 -8.591  -15.865 1.00 72.42  ? 26   LYS D NZ    1 
ATOM   2719 N  N     . LEU D 1 27  ? -12.028 -7.840  -17.687 1.00 57.81  ? 27   LEU D N     1 
ATOM   2720 C  CA    . LEU D 1 27  ? -11.091 -8.759  -17.053 1.00 56.22  ? 27   LEU D CA    1 
ATOM   2721 C  C     . LEU D 1 27  ? -11.556 -9.160  -15.659 1.00 63.12  ? 27   LEU D C     1 
ATOM   2722 O  O     . LEU D 1 27  ? -12.005 -8.319  -14.888 1.00 67.51  ? 27   LEU D O     1 
ATOM   2723 C  CB    . LEU D 1 27  ? -9.702  -8.136  -16.945 1.00 56.76  ? 27   LEU D CB    1 
ATOM   2724 C  CG    . LEU D 1 27  ? -8.837  -7.936  -18.190 1.00 56.19  ? 27   LEU D CG    1 
ATOM   2725 C  CD1   . LEU D 1 27  ? -8.935  -9.124  -19.103 1.00 56.96  ? 27   LEU D CD1   1 
ATOM   2726 C  CD2   . LEU D 1 27  ? -9.196  -6.660  -18.906 1.00 53.69  ? 27   LEU D CD2   1 
ATOM   2727 N  N     . LYS D 1 28  ? -11.439 -10.438 -15.326 1.00 71.76  ? 28   LYS D N     1 
ATOM   2728 C  CA    . LYS D 1 28  ? -11.658 -10.860 -13.951 1.00 63.54  ? 28   LYS D CA    1 
ATOM   2729 C  C     . LYS D 1 28  ? -10.382 -11.465 -13.392 1.00 73.10  ? 28   LYS D C     1 
ATOM   2730 O  O     . LYS D 1 28  ? -9.851  -12.429 -13.933 1.00 74.75  ? 28   LYS D O     1 
ATOM   2731 C  CB    . LYS D 1 28  ? -12.814 -11.849 -13.842 1.00 69.79  ? 28   LYS D CB    1 
ATOM   2732 C  CG    . LYS D 1 28  ? -14.185 -11.160 -13.893 1.00 81.80  ? 28   LYS D CG    1 
ATOM   2733 C  CD    . LYS D 1 28  ? -14.837 -11.106 -12.496 1.00 80.24  ? 28   LYS D CD    1 
ATOM   2734 C  CE    . LYS D 1 28  ? -16.196 -10.410 -12.545 1.00 78.34  ? 28   LYS D CE    1 
ATOM   2735 N  NZ    . LYS D 1 28  ? -16.207 -9.387  -13.625 1.00 91.76  ? 28   LYS D NZ    1 
ATOM   2736 N  N     . TYR D 1 29  ? -9.899  -10.886 -12.298 1.00 64.85  ? 29   TYR D N     1 
ATOM   2737 C  CA    . TYR D 1 29  ? -8.693  -11.350 -11.645 1.00 56.39  ? 29   TYR D CA    1 
ATOM   2738 C  C     . TYR D 1 29  ? -8.973  -12.111 -10.363 1.00 64.93  ? 29   TYR D C     1 
ATOM   2739 O  O     . TYR D 1 29  ? -10.110 -12.375 -9.985  1.00 67.89  ? 29   TYR D O     1 
ATOM   2740 C  CB    . TYR D 1 29  ? -7.777  -10.176 -11.309 1.00 57.87  ? 29   TYR D CB    1 
ATOM   2741 C  CG    . TYR D 1 29  ? -7.461  -9.294  -12.476 1.00 55.07  ? 29   TYR D CG    1 
ATOM   2742 C  CD1   . TYR D 1 29  ? -7.171  -9.829  -13.707 1.00 55.98  ? 29   TYR D CD1   1 
ATOM   2743 C  CD2   . TYR D 1 29  ? -7.471  -7.919  -12.348 1.00 56.61  ? 29   TYR D CD2   1 
ATOM   2744 C  CE1   . TYR D 1 29  ? -6.888  -9.024  -14.775 1.00 55.64  ? 29   TYR D CE1   1 
ATOM   2745 C  CE2   . TYR D 1 29  ? -7.188  -7.108  -13.413 1.00 55.48  ? 29   TYR D CE2   1 
ATOM   2746 C  CZ    . TYR D 1 29  ? -6.902  -7.670  -14.626 1.00 53.28  ? 29   TYR D CZ    1 
ATOM   2747 O  OH    . TYR D 1 29  ? -6.614  -6.867  -15.692 1.00 56.28  ? 29   TYR D OH    1 
ATOM   2748 N  N     . LYS D 1 30  ? -7.881  -12.442 -9.698  1.00 100.21 ? 30   LYS D N     1 
ATOM   2749 C  CA    . LYS D 1 30  ? -7.885  -13.032 -8.381  1.00 96.37  ? 30   LYS D CA    1 
ATOM   2750 C  C     . LYS D 1 30  ? -7.754  -11.806 -7.502  1.00 99.42  ? 30   LYS D C     1 
ATOM   2751 O  O     . LYS D 1 30  ? -6.774  -11.061 -7.649  1.00 105.55 ? 30   LYS D O     1 
ATOM   2752 C  CB    . LYS D 1 30  ? -6.703  -14.002 -8.191  1.00 94.24  ? 30   LYS D CB    1 
ATOM   2753 C  CG    . LYS D 1 30  ? -5.943  -14.397 -9.495  1.00 109.37 ? 30   LYS D CG    1 
ATOM   2754 C  CD    . LYS D 1 30  ? -6.863  -14.975 -10.599 1.00 114.09 ? 30   LYS D CD    1 
ATOM   2755 C  CE    . LYS D 1 30  ? -6.185  -15.002 -11.957 1.00 110.50 ? 30   LYS D CE    1 
ATOM   2756 N  NZ    . LYS D 1 30  ? -7.163  -15.056 -13.094 1.00 110.54 ? 30   LYS D NZ    1 
ATOM   2757 N  N     . GLY D 1 31  ? -8.741  -11.519 -6.660  1.00 79.29  ? 31   GLY D N     1 
ATOM   2758 C  CA    . GLY D 1 31  ? -10.004 -12.226 -6.599  1.00 83.46  ? 31   GLY D CA    1 
ATOM   2759 C  C     . GLY D 1 31  ? -10.812 -11.538 -5.507  1.00 79.55  ? 31   GLY D C     1 
ATOM   2760 O  O     . GLY D 1 31  ? -10.251 -11.079 -4.516  1.00 84.60  ? 31   GLY D O     1 
ATOM   2761 N  N     . ASN D 1 32  ? -12.107 -11.367 -5.707  1.00 69.13  ? 32   ASN D N     1 
ATOM   2762 C  CA    . ASN D 1 32  ? -12.737 -11.490 -7.001  1.00 67.92  ? 32   ASN D CA    1 
ATOM   2763 C  C     . ASN D 1 32  ? -12.577 -10.157 -7.698  1.00 65.81  ? 32   ASN D C     1 
ATOM   2764 O  O     . ASN D 1 32  ? -13.568 -9.459  -7.924  1.00 70.02  ? 32   ASN D O     1 
ATOM   2765 C  CB    . ASN D 1 32  ? -14.221 -11.831 -6.854  1.00 62.00  ? 32   ASN D CB    1 
ATOM   2766 C  CG    . ASN D 1 32  ? -14.460 -13.006 -5.933  1.00 66.99  ? 32   ASN D CG    1 
ATOM   2767 O  OD1   . ASN D 1 32  ? -14.474 -12.854 -4.714  1.00 74.81  ? 32   ASN D OD1   1 
ATOM   2768 N  ND2   . ASN D 1 32  ? -14.674 -14.181 -6.508  1.00 73.72  ? 32   ASN D ND2   1 
ATOM   2769 N  N     . ARG D 1 33  ? -11.338 -9.778  -7.997  1.00 57.55  ? 33   ARG D N     1 
ATOM   2770 C  CA    . ARG D 1 33  ? -11.086 -8.471  -8.584  1.00 57.98  ? 33   ARG D CA    1 
ATOM   2771 C  C     . ARG D 1 33  ? -11.494 -8.418  -10.061 1.00 56.71  ? 33   ARG D C     1 
ATOM   2772 O  O     . ARG D 1 33  ? -11.843 -9.429  -10.664 1.00 57.07  ? 33   ARG D O     1 
ATOM   2773 C  CB    . ARG D 1 33  ? -9.618  -8.087  -8.442  1.00 58.97  ? 33   ARG D CB    1 
ATOM   2774 C  CG    . ARG D 1 33  ? -9.096  -8.045  -7.032  1.00 60.54  ? 33   ARG D CG    1 
ATOM   2775 C  CD    . ARG D 1 33  ? -7.601  -7.694  -7.020  1.00 58.00  ? 33   ARG D CD    1 
ATOM   2776 N  NE    . ARG D 1 33  ? -6.823  -8.604  -7.857  1.00 63.73  ? 33   ARG D NE    1 
ATOM   2777 C  CZ    . ARG D 1 33  ? -5.886  -8.210  -8.711  1.00 65.17  ? 33   ARG D CZ    1 
ATOM   2778 N  NH1   . ARG D 1 33  ? -5.602  -6.925  -8.828  1.00 59.64  ? 33   ARG D NH1   1 
ATOM   2779 N  NH2   . ARG D 1 33  ? -5.218  -9.098  -9.440  1.00 72.29  ? 33   ARG D NH2   1 
ATOM   2780 N  N     . SER D 1 34  ? -11.450 -7.229  -10.644 1.00 54.34  ? 34   SER D N     1 
ATOM   2781 C  CA    . SER D 1 34  ? -11.849 -7.077  -12.026 1.00 51.01  ? 34   SER D CA    1 
ATOM   2782 C  C     . SER D 1 34  ? -11.247 -5.837  -12.673 1.00 51.47  ? 34   SER D C     1 
ATOM   2783 O  O     . SER D 1 34  ? -10.680 -4.969  -12.006 1.00 49.75  ? 34   SER D O     1 
ATOM   2784 C  CB    . SER D 1 34  ? -13.368 -7.011  -12.123 1.00 49.64  ? 34   SER D CB    1 
ATOM   2785 O  OG    . SER D 1 34  ? -13.848 -5.833  -11.505 1.00 50.99  ? 34   SER D OG    1 
ATOM   2786 N  N     . GLU D 1 35  ? -11.383 -5.764  -13.988 1.00 51.77  ? 35   GLU D N     1 
ATOM   2787 C  CA    . GLU D 1 35  ? -10.978 -4.584  -14.726 1.00 49.03  ? 35   GLU D CA    1 
ATOM   2788 C  C     . GLU D 1 35  ? -11.848 -4.434  -15.965 1.00 51.81  ? 35   GLU D C     1 
ATOM   2789 O  O     . GLU D 1 35  ? -12.445 -5.411  -16.437 1.00 48.21  ? 35   GLU D O     1 
ATOM   2790 C  CB    . GLU D 1 35  ? -9.499  -4.662  -15.112 1.00 48.81  ? 35   GLU D CB    1 
ATOM   2791 C  CG    . GLU D 1 35  ? -8.911  -3.305  -15.352 1.00 49.09  ? 35   GLU D CG    1 
ATOM   2792 C  CD    . GLU D 1 35  ? -7.427  -3.339  -15.536 1.00 52.65  ? 35   GLU D CD    1 
ATOM   2793 O  OE1   . GLU D 1 35  ? -6.821  -4.410  -15.321 1.00 55.67  ? 35   GLU D OE1   1 
ATOM   2794 O  OE2   . GLU D 1 35  ? -6.870  -2.293  -15.914 1.00 52.69  ? 35   GLU D OE2   1 
ATOM   2795 N  N     . TYR D 1 36  ? -11.919 -3.209  -16.479 1.00 45.32  ? 36   TYR D N     1 
ATOM   2796 C  CA    . TYR D 1 36  ? -12.673 -2.905  -17.687 1.00 39.27  ? 36   TYR D CA    1 
ATOM   2797 C  C     . TYR D 1 36  ? -11.820 -2.035  -18.573 1.00 42.33  ? 36   TYR D C     1 
ATOM   2798 O  O     . TYR D 1 36  ? -11.532 -0.885  -18.219 1.00 40.80  ? 36   TYR D O     1 
ATOM   2799 C  CB    . TYR D 1 36  ? -13.975 -2.186  -17.352 1.00 42.04  ? 36   TYR D CB    1 
ATOM   2800 C  CG    . TYR D 1 36  ? -14.876 -2.971  -16.448 1.00 42.47  ? 36   TYR D CG    1 
ATOM   2801 C  CD1   . TYR D 1 36  ? -14.661 -2.984  -15.086 1.00 42.60  ? 36   TYR D CD1   1 
ATOM   2802 C  CD2   . TYR D 1 36  ? -15.933 -3.707  -16.955 1.00 40.13  ? 36   TYR D CD2   1 
ATOM   2803 C  CE1   . TYR D 1 36  ? -15.453 -3.693  -14.255 1.00 42.73  ? 36   TYR D CE1   1 
ATOM   2804 C  CE2   . TYR D 1 36  ? -16.738 -4.423  -16.130 1.00 44.09  ? 36   TYR D CE2   1 
ATOM   2805 C  CZ    . TYR D 1 36  ? -16.498 -4.410  -14.770 1.00 47.86  ? 36   TYR D CZ    1 
ATOM   2806 O  OH    . TYR D 1 36  ? -17.294 -5.121  -13.901 1.00 49.21  ? 36   TYR D OH    1 
ATOM   2807 N  N     . ARG D 1 37  ? -11.402 -2.559  -19.722 1.00 45.95  ? 37   ARG D N     1 
ATOM   2808 C  CA    . ARG D 1 37  ? -10.427 -1.814  -20.523 1.00 49.48  ? 37   ARG D CA    1 
ATOM   2809 C  C     . ARG D 1 37  ? -10.963 -1.400  -21.863 1.00 48.57  ? 37   ARG D C     1 
ATOM   2810 O  O     . ARG D 1 37  ? -11.668 -2.157  -22.522 1.00 46.06  ? 37   ARG D O     1 
ATOM   2811 C  CB    . ARG D 1 37  ? -9.144  -2.622  -20.747 1.00 44.74  ? 37   ARG D CB    1 
ATOM   2812 C  CG    . ARG D 1 37  ? -8.409  -2.939  -19.479 1.00 46.72  ? 37   ARG D CG    1 
ATOM   2813 C  CD    . ARG D 1 37  ? -7.041  -3.515  -19.750 1.00 55.03  ? 37   ARG D CD    1 
ATOM   2814 N  NE    . ARG D 1 37  ? -6.272  -3.539  -18.517 1.00 56.58  ? 37   ARG D NE    1 
ATOM   2815 C  CZ    . ARG D 1 37  ? -5.102  -4.133  -18.363 1.00 54.82  ? 37   ARG D CZ    1 
ATOM   2816 N  NH1   . ARG D 1 37  ? -4.511  -4.737  -19.382 1.00 57.09  ? 37   ARG D NH1   1 
ATOM   2817 N  NH2   . ARG D 1 37  ? -4.519  -4.094  -17.181 1.00 55.86  ? 37   ARG D NH2   1 
ATOM   2818 N  N     . VAL D 1 38  ? -10.599 -0.188  -22.252 1.00 46.14  ? 38   VAL D N     1 
ATOM   2819 C  CA    . VAL D 1 38  ? -10.800 0.305   -23.599 1.00 44.05  ? 38   VAL D CA    1 
ATOM   2820 C  C     . VAL D 1 38  ? -9.402  0.503   -24.140 1.00 44.82  ? 38   VAL D C     1 
ATOM   2821 O  O     . VAL D 1 38  ? -8.595  1.182   -23.505 1.00 43.73  ? 38   VAL D O     1 
ATOM   2822 C  CB    . VAL D 1 38  ? -11.600 1.613   -23.616 1.00 44.95  ? 38   VAL D CB    1 
ATOM   2823 C  CG1   . VAL D 1 38  ? -11.698 2.175   -25.018 1.00 44.70  ? 38   VAL D CG1   1 
ATOM   2824 C  CG2   . VAL D 1 38  ? -12.959 1.370   -23.040 1.00 46.86  ? 38   VAL D CG2   1 
ATOM   2825 N  N     . VAL D 1 39  ? -9.119  -0.109  -25.287 1.00 43.88  ? 39   VAL D N     1 
ATOM   2826 C  CA    . VAL D 1 39  ? -7.754  -0.273  -25.783 1.00 43.86  ? 39   VAL D CA    1 
ATOM   2827 C  C     . VAL D 1 39  ? -7.628  0.055   -27.257 1.00 41.93  ? 39   VAL D C     1 
ATOM   2828 O  O     . VAL D 1 39  ? -8.452  -0.353  -28.062 1.00 44.32  ? 39   VAL D O     1 
ATOM   2829 C  CB    . VAL D 1 39  ? -7.249  -1.739  -25.568 1.00 43.93  ? 39   VAL D CB    1 
ATOM   2830 C  CG1   . VAL D 1 39  ? -6.028  -2.022  -26.411 1.00 43.70  ? 39   VAL D CG1   1 
ATOM   2831 C  CG2   . VAL D 1 39  ? -6.961  -2.022  -24.097 1.00 39.73  ? 39   VAL D CG2   1 
ATOM   2832 N  N     . ILE D 1 40  ? -6.585  0.790   -27.608 1.00 51.22  ? 40   ILE D N     1 
ATOM   2833 C  CA    . ILE D 1 40  ? -6.194  0.960   -29.003 1.00 48.56  ? 40   ILE D CA    1 
ATOM   2834 C  C     . ILE D 1 40  ? -4.706  0.650   -29.065 1.00 49.05  ? 40   ILE D C     1 
ATOM   2835 O  O     . ILE D 1 40  ? -3.976  1.096   -28.191 1.00 50.99  ? 40   ILE D O     1 
ATOM   2836 C  CB    . ILE D 1 40  ? -6.479  2.390   -29.520 1.00 47.02  ? 40   ILE D CB    1 
ATOM   2837 C  CG1   . ILE D 1 40  ? -7.954  2.756   -29.270 1.00 51.03  ? 40   ILE D CG1   1 
ATOM   2838 C  CG2   . ILE D 1 40  ? -6.151  2.500   -31.011 1.00 42.61  ? 40   ILE D CG2   1 
ATOM   2839 C  CD1   . ILE D 1 40  ? -8.399  4.105   -29.874 1.00 47.59  ? 40   ILE D CD1   1 
ATOM   2840 N  N     . THR D 1 41  ? -4.246  -0.127  -30.049 1.00 44.34  ? 41   THR D N     1 
ATOM   2841 C  CA    . THR D 1 41  ? -2.805  -0.331  -30.203 1.00 45.09  ? 41   THR D CA    1 
ATOM   2842 C  C     . THR D 1 41  ? -2.338  0.146   -31.575 1.00 51.85  ? 41   THR D C     1 
ATOM   2843 O  O     . THR D 1 41  ? -3.118  0.150   -32.523 1.00 50.91  ? 41   THR D O     1 
ATOM   2844 C  CB    . THR D 1 41  ? -2.377  -1.804  -29.984 1.00 44.37  ? 41   THR D CB    1 
ATOM   2845 O  OG1   . THR D 1 41  ? -2.917  -2.643  -31.014 1.00 46.18  ? 41   THR D OG1   1 
ATOM   2846 C  CG2   . THR D 1 41  ? -2.786  -2.302  -28.595 1.00 40.98  ? 41   THR D CG2   1 
ATOM   2847 N  N     . GLN D 1 42  ? -1.070  0.579   -31.634 1.00 53.55  ? 42   GLN D N     1 
ATOM   2848 C  CA    . GLN D 1 42  ? -0.349  1.052   -32.840 1.00 53.09  ? 42   GLN D CA    1 
ATOM   2849 C  C     . GLN D 1 42  ? 1.163   0.956   -32.612 1.00 54.39  ? 42   GLN D C     1 
ATOM   2850 O  O     . GLN D 1 42  ? 1.649   1.177   -31.494 1.00 46.61  ? 42   GLN D O     1 
ATOM   2851 C  CB    . GLN D 1 42  ? -0.689  2.515   -33.197 1.00 48.70  ? 42   GLN D CB    1 
ATOM   2852 C  CG    . GLN D 1 42  ? -2.087  2.773   -33.671 1.00 56.48  ? 42   GLN D CG    1 
ATOM   2853 C  CD    . GLN D 1 42  ? -2.422  2.150   -35.006 1.00 55.35  ? 42   GLN D CD    1 
ATOM   2854 O  OE1   . GLN D 1 42  ? -1.671  2.255   -35.967 1.00 55.17  ? 42   GLN D OE1   1 
ATOM   2855 N  NE2   . GLN D 1 42  ? -3.531  1.438   -35.048 1.00 56.56  ? 42   GLN D NE2   1 
ATOM   2856 N  N     . LYS D 1 43  ? 1.908   0.660   -33.675 1.00 53.08  ? 43   LYS D N     1 
ATOM   2857 C  CA    . LYS D 1 43  ? 3.349   0.711   -33.566 1.00 60.52  ? 43   LYS D CA    1 
ATOM   2858 C  C     . LYS D 1 43  ? 3.828   2.147   -33.358 1.00 53.82  ? 43   LYS D C     1 
ATOM   2859 O  O     . LYS D 1 43  ? 4.712   2.401   -32.539 1.00 60.29  ? 43   LYS D O     1 
ATOM   2860 C  CB    . LYS D 1 43  ? 4.027   0.121   -34.797 1.00 63.06  ? 43   LYS D CB    1 
ATOM   2861 C  CG    . LYS D 1 43  ? 5.534   0.176   -34.650 1.00 65.82  ? 43   LYS D CG    1 
ATOM   2862 C  CD    . LYS D 1 43  ? 6.310   -0.364  -35.823 1.00 74.18  ? 43   LYS D CD    1 
ATOM   2863 C  CE    . LYS D 1 43  ? 7.289   -1.401  -35.311 1.00 77.33  ? 43   LYS D CE    1 
ATOM   2864 N  NZ    . LYS D 1 43  ? 7.519   -1.325  -33.828 1.00 80.98  ? 43   LYS D NZ    1 
ATOM   2865 N  N     . SER D 1 44  ? 3.223   3.076   -34.094 1.00 52.74  ? 44   SER D N     1 
ATOM   2866 C  CA    . SER D 1 44  ? 3.615   4.485   -34.076 1.00 45.76  ? 44   SER D CA    1 
ATOM   2867 C  C     . SER D 1 44  ? 3.262   5.166   -32.774 1.00 48.95  ? 44   SER D C     1 
ATOM   2868 O  O     . SER D 1 44  ? 2.100   5.297   -32.418 1.00 58.07  ? 44   SER D O     1 
ATOM   2869 C  CB    . SER D 1 44  ? 2.964   5.247   -35.228 1.00 47.21  ? 44   SER D CB    1 
ATOM   2870 O  OG    . SER D 1 44  ? 2.940   6.633   -34.947 1.00 55.63  ? 44   SER D OG    1 
ATOM   2871 N  N     . GLU D 1 45  ? 4.295   5.598   -32.070 1.00 67.59  ? 45   GLU D N     1 
ATOM   2872 C  CA    . GLU D 1 45  ? 4.152   6.347   -30.837 1.00 67.88  ? 45   GLU D CA    1 
ATOM   2873 C  C     . GLU D 1 45  ? 3.414   7.653   -31.108 1.00 66.87  ? 45   GLU D C     1 
ATOM   2874 O  O     . GLU D 1 45  ? 2.664   8.156   -30.267 1.00 62.57  ? 45   GLU D O     1 
ATOM   2875 C  CB    . GLU D 1 45  ? 5.537   6.625   -30.240 1.00 69.00  ? 45   GLU D CB    1 
ATOM   2876 C  CG    . GLU D 1 45  ? 5.542   7.027   -28.785 1.00 77.13  ? 45   GLU D CG    1 
ATOM   2877 C  CD    . GLU D 1 45  ? 6.934   7.368   -28.286 1.00 88.47  ? 45   GLU D CD    1 
ATOM   2878 O  OE1   . GLU D 1 45  ? 7.879   7.378   -29.105 1.00 87.04  ? 45   GLU D OE1   1 
ATOM   2879 O  OE2   . GLU D 1 45  ? 7.086   7.632   -27.075 1.00 94.05  ? 45   GLU D OE2   1 
ATOM   2880 N  N     . ASN D 1 46  ? 3.632   8.203   -32.295 1.00 62.93  ? 46   ASN D N     1 
ATOM   2881 C  CA    . ASN D 1 46  ? 3.126   9.529   -32.584 1.00 61.84  ? 46   ASN D CA    1 
ATOM   2882 C  C     . ASN D 1 46  ? 1.648   9.488   -32.788 1.00 63.81  ? 46   ASN D C     1 
ATOM   2883 O  O     . ASN D 1 46  ? 0.917   10.300  -32.216 1.00 67.68  ? 46   ASN D O     1 
ATOM   2884 C  CB    . ASN D 1 46  ? 3.806   10.132  -33.815 1.00 68.96  ? 46   ASN D CB    1 
ATOM   2885 C  CG    . ASN D 1 46  ? 5.122   10.805  -33.485 1.00 70.11  ? 46   ASN D CG    1 
ATOM   2886 O  OD1   . ASN D 1 46  ? 5.707   10.579  -32.422 1.00 70.84  ? 46   ASN D OD1   1 
ATOM   2887 N  ND2   . ASN D 1 46  ? 5.600   11.641  -34.400 1.00 77.92  ? 46   ASN D ND2   1 
ATOM   2888 N  N     . LEU D 1 47  ? 1.208   8.543   -33.611 1.00 65.38  ? 47   LEU D N     1 
ATOM   2889 C  CA    . LEU D 1 47  ? -0.212  8.420   -33.908 1.00 65.11  ? 47   LEU D CA    1 
ATOM   2890 C  C     . LEU D 1 47  ? -0.983  8.293   -32.601 1.00 59.74  ? 47   LEU D C     1 
ATOM   2891 O  O     . LEU D 1 47  ? -2.000  8.941   -32.405 1.00 61.68  ? 47   LEU D O     1 
ATOM   2892 C  CB    . LEU D 1 47  ? -0.493  7.230   -34.829 1.00 55.23  ? 47   LEU D CB    1 
ATOM   2893 C  CG    . LEU D 1 47  ? -1.975  7.202   -35.218 1.00 62.25  ? 47   LEU D CG    1 
ATOM   2894 C  CD1   . LEU D 1 47  ? -2.350  8.520   -35.851 1.00 63.70  ? 47   LEU D CD1   1 
ATOM   2895 C  CD2   . LEU D 1 47  ? -2.346  6.048   -36.147 1.00 60.43  ? 47   LEU D CD2   1 
ATOM   2896 N  N     . ILE D 1 48  ? -0.445  7.508   -31.684 1.00 47.56  ? 48   ILE D N     1 
ATOM   2897 C  CA    . ILE D 1 48  ? -1.101  7.284   -30.411 1.00 49.54  ? 48   ILE D CA    1 
ATOM   2898 C  C     . ILE D 1 48  ? -1.055  8.498   -29.479 1.00 50.67  ? 48   ILE D C     1 
ATOM   2899 O  O     . ILE D 1 48  ? -2.082  8.846   -28.908 1.00 54.24  ? 48   ILE D O     1 
ATOM   2900 C  CB    . ILE D 1 48  ? -0.497  6.039   -29.703 1.00 53.20  ? 48   ILE D CB    1 
ATOM   2901 C  CG1   . ILE D 1 48  ? -1.304  4.792   -30.078 1.00 55.30  ? 48   ILE D CG1   1 
ATOM   2902 C  CG2   . ILE D 1 48  ? -0.531  6.191   -28.204 1.00 54.00  ? 48   ILE D CG2   1 
ATOM   2903 C  CD1   . ILE D 1 48  ? -0.746  3.513   -29.522 1.00 62.15  ? 48   ILE D CD1   1 
ATOM   2904 N  N     . LYS D 1 49  ? 0.108   9.141   -29.316 1.00 54.77  ? 49   LYS D N     1 
ATOM   2905 C  CA    . LYS D 1 49  ? 0.230   10.272  -28.375 1.00 51.45  ? 49   LYS D CA    1 
ATOM   2906 C  C     . LYS D 1 49  ? -0.325  11.569  -28.950 1.00 52.56  ? 49   LYS D C     1 
ATOM   2907 O  O     . LYS D 1 49  ? -0.925  12.374  -28.232 1.00 51.11  ? 49   LYS D O     1 
ATOM   2908 C  CB    . LYS D 1 49  ? 1.686   10.515  -27.949 1.00 45.77  ? 49   LYS D CB    1 
ATOM   2909 C  CG    . LYS D 1 49  ? 2.281   9.492   -27.002 1.00 49.08  ? 49   LYS D CG    1 
ATOM   2910 C  CD    . LYS D 1 49  ? 3.669   9.910   -26.529 1.00 56.12  ? 49   LYS D CD    1 
ATOM   2911 C  CE    . LYS D 1 49  ? 4.491   8.726   -25.978 1.00 61.75  ? 49   LYS D CE    1 
ATOM   2912 N  NZ    . LYS D 1 49  ? 4.741   8.741   -24.515 1.00 69.50  ? 49   LYS D NZ    1 
ATOM   2913 N  N     . GLN D 1 50  ? -0.119  11.775  -30.244 1.00 51.80  ? 50   GLN D N     1 
ATOM   2914 C  CA    . GLN D 1 50  ? -0.471  13.048  -30.848 1.00 55.28  ? 50   GLN D CA    1 
ATOM   2915 C  C     . GLN D 1 50  ? -1.893  13.123  -31.410 1.00 53.40  ? 50   GLN D C     1 
ATOM   2916 O  O     . GLN D 1 50  ? -2.582  14.125  -31.227 1.00 55.20  ? 50   GLN D O     1 
ATOM   2917 C  CB    . GLN D 1 50  ? 0.539   13.388  -31.943 1.00 50.54  ? 50   GLN D CB    1 
ATOM   2918 C  CG    . GLN D 1 50  ? 1.934   13.575  -31.392 1.00 55.47  ? 50   GLN D CG    1 
ATOM   2919 C  CD    . GLN D 1 50  ? 2.963   13.806  -32.474 1.00 59.58  ? 50   GLN D CD    1 
ATOM   2920 O  OE1   . GLN D 1 50  ? 2.638   14.229  -33.587 1.00 64.95  ? 50   GLN D OE1   1 
ATOM   2921 N  NE2   . GLN D 1 50  ? 4.211   13.515  -32.159 1.00 59.24  ? 50   GLN D NE2   1 
ATOM   2922 N  N     . HIS D 1 51  ? -2.333  12.075  -32.094 1.00 61.03  ? 51   HIS D N     1 
ATOM   2923 C  CA    . HIS D 1 51  ? -3.627  12.108  -32.767 1.00 60.96  ? 51   HIS D CA    1 
ATOM   2924 C  C     . HIS D 1 51  ? -4.732  11.474  -31.900 1.00 63.80  ? 51   HIS D C     1 
ATOM   2925 O  O     . HIS D 1 51  ? -5.787  12.088  -31.660 1.00 62.75  ? 51   HIS D O     1 
ATOM   2926 C  CB    . HIS D 1 51  ? -3.516  11.406  -34.121 1.00 62.07  ? 51   HIS D CB    1 
ATOM   2927 C  CG    . HIS D 1 51  ? -4.815  11.289  -34.859 1.00 68.03  ? 51   HIS D CG    1 
ATOM   2928 N  ND1   . HIS D 1 51  ? -5.576  12.384  -35.208 1.00 72.74  ? 51   HIS D ND1   1 
ATOM   2929 C  CD2   . HIS D 1 51  ? -5.473  10.208  -35.339 1.00 63.44  ? 51   HIS D CD2   1 
ATOM   2930 C  CE1   . HIS D 1 51  ? -6.651  11.981  -35.859 1.00 65.22  ? 51   HIS D CE1   1 
ATOM   2931 N  NE2   . HIS D 1 51  ? -6.615  10.665  -35.947 1.00 61.55  ? 51   HIS D NE2   1 
ATOM   2932 N  N     . ILE D 1 52  ? -4.468  10.271  -31.397 1.00 51.09  ? 52   ILE D N     1 
ATOM   2933 C  CA    . ILE D 1 52  ? -5.493  9.487   -30.726 1.00 53.48  ? 52   ILE D CA    1 
ATOM   2934 C  C     . ILE D 1 52  ? -5.746  9.885   -29.268 1.00 55.44  ? 52   ILE D C     1 
ATOM   2935 O  O     . ILE D 1 52  ? -6.904  9.998   -28.845 1.00 53.76  ? 52   ILE D O     1 
ATOM   2936 C  CB    . ILE D 1 52  ? -5.153  7.984   -30.788 1.00 53.84  ? 52   ILE D CB    1 
ATOM   2937 C  CG1   . ILE D 1 52  ? -5.121  7.514   -32.245 1.00 55.46  ? 52   ILE D CG1   1 
ATOM   2938 C  CG2   . ILE D 1 52  ? -6.172  7.152   -30.002 1.00 56.00  ? 52   ILE D CG2   1 
ATOM   2939 C  CD1   . ILE D 1 52  ? -4.759  6.047   -32.387 1.00 60.35  ? 52   ILE D CD1   1 
ATOM   2940 N  N     . ALA D 1 53  ? -4.687  10.111  -28.497 1.00 47.16  ? 53   ALA D N     1 
ATOM   2941 C  CA    . ALA D 1 53  ? -4.882  10.424  -27.084 1.00 46.54  ? 53   ALA D CA    1 
ATOM   2942 C  C     . ALA D 1 53  ? -5.663  11.738  -26.841 1.00 51.30  ? 53   ALA D C     1 
ATOM   2943 O  O     . ALA D 1 53  ? -6.560  11.770  -25.995 1.00 44.64  ? 53   ALA D O     1 
ATOM   2944 C  CB    . ALA D 1 53  ? -3.563  10.453  -26.377 1.00 42.94  ? 53   ALA D CB    1 
ATOM   2945 N  N     . PRO D 1 54  ? -5.342  12.822  -27.575 1.00 52.70  ? 54   PRO D N     1 
ATOM   2946 C  CA    . PRO D 1 54  ? -6.185  14.020  -27.421 1.00 49.47  ? 54   PRO D CA    1 
ATOM   2947 C  C     . PRO D 1 54  ? -7.683  13.776  -27.595 1.00 53.96  ? 54   PRO D C     1 
ATOM   2948 O  O     . PRO D 1 54  ? -8.493  14.287  -26.805 1.00 50.81  ? 54   PRO D O     1 
ATOM   2949 C  CB    . PRO D 1 54  ? -5.669  14.934  -28.527 1.00 57.49  ? 54   PRO D CB    1 
ATOM   2950 C  CG    . PRO D 1 54  ? -4.211  14.590  -28.612 1.00 52.23  ? 54   PRO D CG    1 
ATOM   2951 C  CD    . PRO D 1 54  ? -4.140  13.106  -28.389 1.00 51.55  ? 54   PRO D CD    1 
ATOM   2952 N  N     . LEU D 1 55  ? -8.038  12.992  -28.613 1.00 52.56  ? 55   LEU D N     1 
ATOM   2953 C  CA    . LEU D 1 55  ? -9.426  12.611  -28.866 1.00 44.96  ? 55   LEU D CA    1 
ATOM   2954 C  C     . LEU D 1 55  ? -10.050 11.799  -27.720 1.00 46.45  ? 55   LEU D C     1 
ATOM   2955 O  O     . LEU D 1 55  ? -11.189 12.025  -27.335 1.00 49.20  ? 55   LEU D O     1 
ATOM   2956 C  CB    . LEU D 1 55  ? -9.500  11.827  -30.160 1.00 44.03  ? 55   LEU D CB    1 
ATOM   2957 C  CG    . LEU D 1 55  ? -9.199  12.706  -31.369 1.00 52.67  ? 55   LEU D CG    1 
ATOM   2958 C  CD1   . LEU D 1 55  ? -9.158  11.890  -32.650 1.00 57.20  ? 55   LEU D CD1   1 
ATOM   2959 C  CD2   . LEU D 1 55  ? -10.236 13.797  -31.470 1.00 47.40  ? 55   LEU D CD2   1 
ATOM   2960 N  N     . MET D 1 56  ? -9.294  10.867  -27.162 1.00 46.92  ? 56   MET D N     1 
ATOM   2961 C  CA    . MET D 1 56  ? -9.785  10.084  -26.041 1.00 48.99  ? 56   MET D CA    1 
ATOM   2962 C  C     . MET D 1 56  ? -9.909  10.953  -24.775 1.00 54.44  ? 56   MET D C     1 
ATOM   2963 O  O     . MET D 1 56  ? -10.866 10.810  -23.995 1.00 48.89  ? 56   MET D O     1 
ATOM   2964 C  CB    . MET D 1 56  ? -8.872  8.870   -25.790 1.00 44.54  ? 56   MET D CB    1 
ATOM   2965 C  CG    . MET D 1 56  ? -9.463  7.836   -24.841 1.00 47.54  ? 56   MET D CG    1 
ATOM   2966 S  SD    . MET D 1 56  ? -11.071 7.124   -25.391 1.00 53.49  ? 56   MET D SD    1 
ATOM   2967 C  CE    . MET D 1 56  ? -10.522 6.083   -26.757 1.00 47.54  ? 56   MET D CE    1 
ATOM   2968 N  N     . GLN D 1 57  ? -8.949  11.858  -24.582 1.00 57.53  ? 57   GLN D N     1 
ATOM   2969 C  CA    . GLN D 1 57  ? -8.959  12.733  -23.414 1.00 59.69  ? 57   GLN D CA    1 
ATOM   2970 C  C     . GLN D 1 57  ? -10.193 13.612  -23.454 1.00 57.61  ? 57   GLN D C     1 
ATOM   2971 O  O     . GLN D 1 57  ? -10.918 13.711  -22.465 1.00 56.85  ? 57   GLN D O     1 
ATOM   2972 C  CB    . GLN D 1 57  ? -7.694  13.600  -23.342 1.00 59.94  ? 57   GLN D CB    1 
ATOM   2973 C  CG    . GLN D 1 57  ? -7.583  14.397  -22.050 1.00 48.28  ? 57   GLN D CG    1 
ATOM   2974 C  CD    . GLN D 1 57  ? -7.552  13.490  -20.833 1.00 60.80  ? 57   GLN D CD    1 
ATOM   2975 O  OE1   . GLN D 1 57  ? -8.492  13.461  -20.038 1.00 62.33  ? 57   GLN D OE1   1 
ATOM   2976 N  NE2   . GLN D 1 57  ? -6.468  12.725  -20.690 1.00 53.53  ? 57   GLN D NE2   1 
ATOM   2977 N  N     . PHE D 1 58  ? -10.427 14.240  -24.603 1.00 51.57  ? 58   PHE D N     1 
ATOM   2978 C  CA    . PHE D 1 58  ? -11.633 15.020  -24.790 1.00 48.40  ? 58   PHE D CA    1 
ATOM   2979 C  C     . PHE D 1 58  ? -12.874 14.208  -24.376 1.00 58.73  ? 58   PHE D C     1 
ATOM   2980 O  O     . PHE D 1 58  ? -13.601 14.617  -23.461 1.00 61.85  ? 58   PHE D O     1 
ATOM   2981 C  CB    . PHE D 1 58  ? -11.745 15.500  -26.240 1.00 47.53  ? 58   PHE D CB    1 
ATOM   2982 C  CG    . PHE D 1 58  ? -13.020 16.252  -26.530 1.00 65.25  ? 58   PHE D CG    1 
ATOM   2983 C  CD1   . PHE D 1 58  ? -13.271 17.480  -25.926 1.00 69.42  ? 58   PHE D CD1   1 
ATOM   2984 C  CD2   . PHE D 1 58  ? -13.962 15.748  -27.417 1.00 67.06  ? 58   PHE D CD2   1 
ATOM   2985 C  CE1   . PHE D 1 58  ? -14.454 18.178  -26.185 1.00 66.07  ? 58   PHE D CE1   1 
ATOM   2986 C  CE2   . PHE D 1 58  ? -15.144 16.449  -27.679 1.00 68.65  ? 58   PHE D CE2   1 
ATOM   2987 C  CZ    . PHE D 1 58  ? -15.386 17.660  -27.056 1.00 60.42  ? 58   PHE D CZ    1 
ATOM   2988 N  N     . LEU D 1 59  ? -13.093 13.053  -25.015 1.00 55.48  ? 59   LEU D N     1 
ATOM   2989 C  CA    . LEU D 1 59  ? -14.239 12.192  -24.695 1.00 52.37  ? 59   LEU D CA    1 
ATOM   2990 C  C     . LEU D 1 59  ? -14.328 11.861  -23.208 1.00 52.90  ? 59   LEU D C     1 
ATOM   2991 O  O     . LEU D 1 59  ? -15.405 11.894  -22.622 1.00 54.87  ? 59   LEU D O     1 
ATOM   2992 C  CB    . LEU D 1 59  ? -14.192 10.894  -25.515 1.00 50.26  ? 59   LEU D CB    1 
ATOM   2993 C  CG    . LEU D 1 59  ? -15.325 9.880   -25.285 1.00 49.86  ? 59   LEU D CG    1 
ATOM   2994 C  CD1   . LEU D 1 59  ? -16.704 10.499  -25.579 1.00 53.59  ? 59   LEU D CD1   1 
ATOM   2995 C  CD2   . LEU D 1 59  ? -15.139 8.642   -26.133 1.00 41.61  ? 59   LEU D CD2   1 
ATOM   2996 N  N     . ILE D 1 60  ? -13.191 11.556  -22.599 1.00 58.89  ? 60   ILE D N     1 
ATOM   2997 C  CA    . ILE D 1 60  ? -13.130 11.298  -21.162 1.00 60.80  ? 60   ILE D CA    1 
ATOM   2998 C  C     . ILE D 1 60  ? -13.655 12.477  -20.343 1.00 64.34  ? 60   ILE D C     1 
ATOM   2999 O  O     . ILE D 1 60  ? -14.394 12.297  -19.359 1.00 63.51  ? 60   ILE D O     1 
ATOM   3000 C  CB    . ILE D 1 60  ? -11.691 10.992  -20.724 1.00 59.19  ? 60   ILE D CB    1 
ATOM   3001 C  CG1   . ILE D 1 60  ? -11.363 9.517   -20.923 1.00 55.23  ? 60   ILE D CG1   1 
ATOM   3002 C  CG2   . ILE D 1 60  ? -11.458 11.381  -19.285 1.00 60.12  ? 60   ILE D CG2   1 
ATOM   3003 C  CD1   . ILE D 1 60  ? -9.956  9.167   -20.420 1.00 58.55  ? 60   ILE D CD1   1 
ATOM   3004 N  N     . ASP D 1 61  ? -13.269 13.683  -20.757 1.00 63.63  ? 61   ASP D N     1 
ATOM   3005 C  CA    . ASP D 1 61  ? -13.686 14.898  -20.069 1.00 64.50  ? 61   ASP D CA    1 
ATOM   3006 C  C     . ASP D 1 61  ? -15.197 15.122  -20.201 1.00 67.75  ? 61   ASP D C     1 
ATOM   3007 O  O     . ASP D 1 61  ? -15.879 15.382  -19.207 1.00 72.30  ? 61   ASP D O     1 
ATOM   3008 C  CB    . ASP D 1 61  ? -12.909 16.105  -20.599 1.00 58.43  ? 61   ASP D CB    1 
ATOM   3009 C  CG    . ASP D 1 61  ? -11.423 16.043  -20.256 1.00 63.05  ? 61   ASP D CG    1 
ATOM   3010 O  OD1   . ASP D 1 61  ? -11.039 15.244  -19.365 1.00 57.76  ? 61   ASP D OD1   1 
ATOM   3011 O  OD2   . ASP D 1 61  ? -10.640 16.791  -20.890 1.00 66.63  ? 61   ASP D OD2   1 
ATOM   3012 N  N     . GLU D 1 62  ? -15.724 14.994  -21.414 1.00 65.24  ? 62   GLU D N     1 
ATOM   3013 C  CA    . GLU D 1 62  ? -17.160 15.163  -21.629 1.00 67.30  ? 62   GLU D CA    1 
ATOM   3014 C  C     . GLU D 1 62  ? -18.014 14.183  -20.815 1.00 66.51  ? 62   GLU D C     1 
ATOM   3015 O  O     . GLU D 1 62  ? -19.051 14.564  -20.281 1.00 68.79  ? 62   GLU D O     1 
ATOM   3016 C  CB    . GLU D 1 62  ? -17.494 15.033  -23.114 1.00 65.55  ? 62   GLU D CB    1 
ATOM   3017 C  CG    . GLU D 1 62  ? -16.754 16.035  -23.998 1.00 76.31  ? 62   GLU D CG    1 
ATOM   3018 C  CD    . GLU D 1 62  ? -17.103 17.480  -23.662 1.00 82.90  ? 62   GLU D CD    1 
ATOM   3019 O  OE1   . GLU D 1 62  ? -18.255 17.738  -23.256 1.00 83.03  ? 62   GLU D OE1   1 
ATOM   3020 O  OE2   . GLU D 1 62  ? -16.219 18.363  -23.786 1.00 87.19  ? 62   GLU D OE2   1 
ATOM   3021 N  N     . LEU D 1 63  ? -17.579 12.933  -20.702 1.00 62.40  ? 63   LEU D N     1 
ATOM   3022 C  CA    . LEU D 1 63  ? -18.363 11.934  -19.983 1.00 55.45  ? 63   LEU D CA    1 
ATOM   3023 C  C     . LEU D 1 63  ? -18.004 11.951  -18.515 1.00 60.22  ? 63   LEU D C     1 
ATOM   3024 O  O     . LEU D 1 63  ? -18.449 11.104  -17.749 1.00 62.39  ? 63   LEU D O     1 
ATOM   3025 C  CB    . LEU D 1 63  ? -18.135 10.534  -20.558 1.00 53.24  ? 63   LEU D CB    1 
ATOM   3026 C  CG    . LEU D 1 63  ? -18.309 10.354  -22.069 1.00 60.63  ? 63   LEU D CG    1 
ATOM   3027 C  CD1   . LEU D 1 63  ? -17.836 8.974   -22.514 1.00 49.02  ? 63   LEU D CD1   1 
ATOM   3028 C  CD2   . LEU D 1 63  ? -19.746 10.606  -22.501 1.00 47.38  ? 63   LEU D CD2   1 
ATOM   3029 N  N     . ASN D 1 64  ? -17.199 12.936  -18.136 1.00 70.56  ? 64   ASN D N     1 
ATOM   3030 C  CA    A ASN D 1 64  ? -16.656 13.044  -16.779 0.40 70.59  ? 64   ASN D CA    1 
ATOM   3031 C  CA    B ASN D 1 64  ? -16.699 13.043  -16.772 0.60 70.65  ? 64   ASN D CA    1 
ATOM   3032 C  C     . ASN D 1 64  ? -16.189 11.698  -16.248 1.00 68.98  ? 64   ASN D C     1 
ATOM   3033 O  O     . ASN D 1 64  ? -16.531 11.295  -15.138 1.00 69.11  ? 64   ASN D O     1 
ATOM   3034 C  CB    A ASN D 1 64  ? -17.674 13.659  -15.810 0.40 71.66  ? 64   ASN D CB    1 
ATOM   3035 C  CB    B ASN D 1 64  ? -17.789 13.614  -15.846 0.60 71.65  ? 64   ASN D CB    1 
ATOM   3036 C  CG    A ASN D 1 64  ? -17.017 14.192  -14.537 0.40 73.43  ? 64   ASN D CG    1 
ATOM   3037 C  CG    B ASN D 1 64  ? -17.777 15.147  -15.794 0.60 74.94  ? 64   ASN D CG    1 
ATOM   3038 O  OD1   A ASN D 1 64  ? -16.675 15.374  -14.444 0.40 76.10  ? 64   ASN D OD1   1 
ATOM   3039 O  OD1   B ASN D 1 64  ? -17.001 15.746  -15.045 0.60 78.65  ? 64   ASN D OD1   1 
ATOM   3040 N  ND2   A ASN D 1 64  ? -16.820 13.312  -13.560 0.40 68.63  ? 64   ASN D ND2   1 
ATOM   3041 N  ND2   B ASN D 1 64  ? -18.633 15.780  -16.593 0.60 69.15  ? 64   ASN D ND2   1 
ATOM   3042 N  N     . VAL D 1 65  ? -15.389 11.010  -17.058 1.00 61.30  ? 65   VAL D N     1 
ATOM   3043 C  CA    . VAL D 1 65  ? -14.785 9.745   -16.651 1.00 62.71  ? 65   VAL D CA    1 
ATOM   3044 C  C     . VAL D 1 65  ? -13.492 10.082  -15.925 1.00 60.87  ? 65   VAL D C     1 
ATOM   3045 O  O     . VAL D 1 65  ? -12.662 10.826  -16.432 1.00 60.27  ? 65   VAL D O     1 
ATOM   3046 C  CB    . VAL D 1 65  ? -14.532 8.804   -17.863 1.00 57.08  ? 65   VAL D CB    1 
ATOM   3047 C  CG1   . VAL D 1 65  ? -13.687 7.589   -17.464 1.00 54.67  ? 65   VAL D CG1   1 
ATOM   3048 C  CG2   . VAL D 1 65  ? -15.854 8.359   -18.460 1.00 47.38  ? 65   VAL D CG2   1 
ATOM   3049 N  N     . LYS D 1 66  ? -13.319 9.551   -14.726 1.00 68.98  ? 66   LYS D N     1 
ATOM   3050 C  CA    A LYS D 1 66  ? -12.194 9.952   -13.887 0.39 69.35  ? 66   LYS D CA    1 
ATOM   3051 C  CA    B LYS D 1 66  ? -12.190 9.952   -13.897 0.61 69.47  ? 66   LYS D CA    1 
ATOM   3052 C  C     . LYS D 1 66  ? -10.969 9.049   -14.075 1.00 68.00  ? 66   LYS D C     1 
ATOM   3053 O  O     . LYS D 1 66  ? -10.033 9.094   -13.281 1.00 74.85  ? 66   LYS D O     1 
ATOM   3054 C  CB    A LYS D 1 66  ? -12.628 9.967   -12.416 0.39 69.83  ? 66   LYS D CB    1 
ATOM   3055 C  CB    B LYS D 1 66  ? -12.616 9.976   -12.432 0.61 69.93  ? 66   LYS D CB    1 
ATOM   3056 C  CG    A LYS D 1 66  ? -11.761 10.814  -11.481 0.39 70.83  ? 66   LYS D CG    1 
ATOM   3057 C  CG    B LYS D 1 66  ? -13.954 10.658  -12.191 0.61 68.29  ? 66   LYS D CG    1 
ATOM   3058 C  CD    A LYS D 1 66  ? -12.253 10.716  -10.038 0.39 71.17  ? 66   LYS D CD    1 
ATOM   3059 C  CD    B LYS D 1 66  ? -13.892 12.140  -12.491 0.61 65.41  ? 66   LYS D CD    1 
ATOM   3060 C  CE    A LYS D 1 66  ? -11.157 11.060  -9.046  0.39 67.66  ? 66   LYS D CE    1 
ATOM   3061 C  CE    B LYS D 1 66  ? -15.246 12.794  -12.303 0.61 69.60  ? 66   LYS D CE    1 
ATOM   3062 N  NZ    A LYS D 1 66  ? -10.035 10.083  -9.106  0.39 61.71  ? 66   LYS D NZ    1 
ATOM   3063 N  NZ    B LYS D 1 66  ? -15.160 14.278  -12.335 0.61 69.58  ? 66   LYS D NZ    1 
ATOM   3064 N  N     . SER D 1 67  ? -10.966 8.229   -15.122 1.00 65.23  ? 67   SER D N     1 
ATOM   3065 C  CA    . SER D 1 67  ? -9.834  7.325   -15.353 1.00 64.37  ? 67   SER D CA    1 
ATOM   3066 C  C     . SER D 1 67  ? -8.784  8.025   -16.187 1.00 63.63  ? 67   SER D C     1 
ATOM   3067 O  O     . SER D 1 67  ? -9.102  8.941   -16.944 1.00 65.30  ? 67   SER D O     1 
ATOM   3068 C  CB    . SER D 1 67  ? -10.272 6.037   -16.056 1.00 62.09  ? 67   SER D CB    1 
ATOM   3069 O  OG    . SER D 1 67  ? -11.220 5.305   -15.300 1.00 62.45  ? 67   SER D OG    1 
ATOM   3070 N  N     . LYS D 1 68  ? -7.531  7.609   -16.080 1.00 56.66  ? 68   LYS D N     1 
ATOM   3071 C  CA    . LYS D 1 68  ? -6.536  8.274   -16.905 1.00 57.91  ? 68   LYS D CA    1 
ATOM   3072 C  C     . LYS D 1 68  ? -6.263  7.476   -18.171 1.00 58.98  ? 68   LYS D C     1 
ATOM   3073 O  O     . LYS D 1 68  ? -6.603  6.290   -18.268 1.00 47.30  ? 68   LYS D O     1 
ATOM   3074 C  CB    . LYS D 1 68  ? -5.240  8.523   -16.131 1.00 58.52  ? 68   LYS D CB    1 
ATOM   3075 C  CG    . LYS D 1 68  ? -4.534  7.283   -15.621 1.00 63.09  ? 68   LYS D CG    1 
ATOM   3076 C  CD    . LYS D 1 68  ? -3.376  7.688   -14.719 1.00 71.70  ? 68   LYS D CD    1 
ATOM   3077 C  CE    . LYS D 1 68  ? -2.378  8.584   -15.454 1.00 70.19  ? 68   LYS D CE    1 
ATOM   3078 N  NZ    . LYS D 1 68  ? -1.656  7.848   -16.529 1.00 64.78  ? 68   LYS D NZ    1 
ATOM   3079 N  N     . ILE D 1 69  ? -5.681  8.163   -19.151 1.00 61.34  ? 69   ILE D N     1 
ATOM   3080 C  CA    . ILE D 1 69  ? -5.255  7.547   -20.397 1.00 56.95  ? 69   ILE D CA    1 
ATOM   3081 C  C     . ILE D 1 69  ? -3.847  7.013   -20.222 1.00 60.34  ? 69   ILE D C     1 
ATOM   3082 O  O     . ILE D 1 69  ? -2.907  7.798   -20.129 1.00 61.07  ? 69   ILE D O     1 
ATOM   3083 C  CB    . ILE D 1 69  ? -5.255  8.546   -21.559 1.00 55.39  ? 69   ILE D CB    1 
ATOM   3084 C  CG1   . ILE D 1 69  ? -6.674  8.975   -21.911 1.00 57.96  ? 69   ILE D CG1   1 
ATOM   3085 C  CG2   . ILE D 1 69  ? -4.599  7.940   -22.773 1.00 59.58  ? 69   ILE D CG2   1 
ATOM   3086 C  CD1   . ILE D 1 69  ? -6.738  9.851   -23.147 1.00 56.31  ? 69   ILE D CD1   1 
ATOM   3087 N  N     . GLN D 1 70  ? -3.697  5.691   -20.161 1.00 57.15  ? 70   GLN D N     1 
ATOM   3088 C  CA    . GLN D 1 70  ? -2.373  5.084   -20.062 1.00 47.99  ? 70   GLN D CA    1 
ATOM   3089 C  C     . GLN D 1 70  ? -1.790  4.780   -21.435 1.00 51.64  ? 70   GLN D C     1 
ATOM   3090 O  O     . GLN D 1 70  ? -2.498  4.370   -22.354 1.00 57.09  ? 70   GLN D O     1 
ATOM   3091 C  CB    . GLN D 1 70  ? -2.430  3.802   -19.262 1.00 45.19  ? 70   GLN D CB    1 
ATOM   3092 C  CG    . GLN D 1 70  ? -3.179  3.911   -17.976 1.00 47.46  ? 70   GLN D CG    1 
ATOM   3093 C  CD    . GLN D 1 70  ? -3.193  2.597   -17.257 1.00 53.54  ? 70   GLN D CD    1 
ATOM   3094 O  OE1   . GLN D 1 70  ? -2.166  1.944   -17.129 1.00 59.41  ? 70   GLN D OE1   1 
ATOM   3095 N  NE2   . GLN D 1 70  ? -4.369  2.170   -16.823 1.00 58.22  ? 70   GLN D NE2   1 
ATOM   3096 N  N     . ILE D 1 71  ? -0.492  4.991   -21.569 1.00 51.44  ? 71   ILE D N     1 
ATOM   3097 C  CA    . ILE D 1 71  ? 0.244   4.563   -22.746 1.00 48.92  ? 71   ILE D CA    1 
ATOM   3098 C  C     . ILE D 1 71  ? 1.351   3.616   -22.296 1.00 51.38  ? 71   ILE D C     1 
ATOM   3099 O  O     . ILE D 1 71  ? 2.368   4.038   -21.767 1.00 57.71  ? 71   ILE D O     1 
ATOM   3100 C  CB    . ILE D 1 71  ? 0.846   5.735   -23.498 1.00 50.88  ? 71   ILE D CB    1 
ATOM   3101 C  CG1   . ILE D 1 71  ? -0.143  6.902   -23.547 1.00 46.06  ? 71   ILE D CG1   1 
ATOM   3102 C  CG2   . ILE D 1 71  ? 1.288   5.299   -24.895 1.00 52.43  ? 71   ILE D CG2   1 
ATOM   3103 C  CD1   . ILE D 1 71  ? -0.907  6.982   -24.799 1.00 53.98  ? 71   ILE D CD1   1 
ATOM   3104 N  N     . VAL D 1 72  ? 1.114   2.327   -22.457 1.00 51.75  ? 72   VAL D N     1 
ATOM   3105 C  CA    . VAL D 1 72  ? 2.116   1.324   -22.192 1.00 45.96  ? 72   VAL D CA    1 
ATOM   3106 C  C     . VAL D 1 72  ? 2.868   1.062   -23.492 1.00 51.86  ? 72   VAL D C     1 
ATOM   3107 O  O     . VAL D 1 72  ? 2.288   1.081   -24.570 1.00 54.83  ? 72   VAL D O     1 
ATOM   3108 C  CB    . VAL D 1 72  ? 1.487   0.022   -21.660 1.00 50.08  ? 72   VAL D CB    1 
ATOM   3109 C  CG1   . VAL D 1 72  ? 2.549   -1.026  -21.386 1.00 44.10  ? 72   VAL D CG1   1 
ATOM   3110 C  CG2   . VAL D 1 72  ? 0.679   0.303   -20.419 1.00 47.82  ? 72   VAL D CG2   1 
ATOM   3111 N  N     . LYS D 1 73  ? 4.174   0.857   -23.389 1.00 72.06  ? 73   LYS D N     1 
ATOM   3112 C  CA    . LYS D 1 73  ? 4.987   0.551   -24.544 1.00 65.81  ? 73   LYS D CA    1 
ATOM   3113 C  C     . LYS D 1 73  ? 5.344   -0.910  -24.419 1.00 66.41  ? 73   LYS D C     1 
ATOM   3114 O  O     . LYS D 1 73  ? 6.003   -1.309  -23.461 1.00 66.33  ? 73   LYS D O     1 
ATOM   3115 C  CB    . LYS D 1 73  ? 6.235   1.442   -24.609 1.00 68.10  ? 73   LYS D CB    1 
ATOM   3116 C  CG    . LYS D 1 73  ? 7.279   0.939   -25.589 1.00 75.15  ? 73   LYS D CG    1 
ATOM   3117 C  CD    . LYS D 1 73  ? 8.384   1.957   -25.853 1.00 71.15  ? 73   LYS D CD    1 
ATOM   3118 C  CE    . LYS D 1 73  ? 9.567   1.309   -26.594 1.00 79.67  ? 73   LYS D CE    1 
ATOM   3119 N  NZ    . LYS D 1 73  ? 9.150   0.695   -27.900 1.00 87.84  ? 73   LYS D NZ    1 
ATOM   3120 N  N     . GLY D 1 74  ? 4.849   -1.711  -25.358 1.00 57.29  ? 74   GLY D N     1 
ATOM   3121 C  CA    . GLY D 1 74  ? 5.128   -3.133  -25.388 1.00 53.32  ? 74   GLY D CA    1 
ATOM   3122 C  C     . GLY D 1 74  ? 6.272   -3.412  -26.343 1.00 57.69  ? 74   GLY D C     1 
ATOM   3123 O  O     . GLY D 1 74  ? 6.885   -2.484  -26.881 1.00 61.54  ? 74   GLY D O     1 
ATOM   3124 N  N     . ASP D 1 75  ? 6.542   -4.694  -26.556 1.00 56.95  ? 75   ASP D N     1 
ATOM   3125 C  CA    . ASP D 1 75  ? 7.627   -5.153  -27.410 1.00 60.63  ? 75   ASP D CA    1 
ATOM   3126 C  C     . ASP D 1 75  ? 7.379   -4.855  -28.888 1.00 66.36  ? 75   ASP D C     1 
ATOM   3127 O  O     . ASP D 1 75  ? 8.316   -4.560  -29.637 1.00 76.29  ? 75   ASP D O     1 
ATOM   3128 C  CB    . ASP D 1 75  ? 7.834   -6.658  -27.206 1.00 66.10  ? 75   ASP D CB    1 
ATOM   3129 C  CG    . ASP D 1 75  ? 6.564   -7.461  -27.481 1.00 74.37  ? 75   ASP D CG    1 
ATOM   3130 O  OD1   . ASP D 1 75  ? 5.491   -6.824  -27.606 1.00 80.49  ? 75   ASP D OD1   1 
ATOM   3131 O  OD2   . ASP D 1 75  ? 6.623   -8.716  -27.561 1.00 75.62  ? 75   ASP D OD2   1 
ATOM   3132 N  N     . THR D 1 76  ? 6.120   -4.934  -29.314 1.00 58.79  ? 76   THR D N     1 
ATOM   3133 C  CA    . THR D 1 76  ? 5.820   -4.794  -30.729 1.00 51.29  ? 76   THR D CA    1 
ATOM   3134 C  C     . THR D 1 76  ? 4.853   -3.655  -31.032 1.00 53.05  ? 76   THR D C     1 
ATOM   3135 O  O     . THR D 1 76  ? 4.550   -3.401  -32.195 1.00 58.22  ? 76   THR D O     1 
ATOM   3136 C  CB    . THR D 1 76  ? 5.229   -6.107  -31.317 1.00 56.33  ? 76   THR D CB    1 
ATOM   3137 O  OG1   . THR D 1 76  ? 3.876   -6.272  -30.885 1.00 58.97  ? 76   THR D OG1   1 
ATOM   3138 C  CG2   . THR D 1 76  ? 6.035   -7.323  -30.874 1.00 55.35  ? 76   THR D CG2   1 
ATOM   3139 N  N     . ARG D 1 77  ? 4.373   -2.949  -30.016 1.00 46.55  ? 77   ARG D N     1 
ATOM   3140 C  CA    . ARG D 1 77  ? 3.262   -2.017  -30.236 1.00 49.09  ? 77   ARG D CA    1 
ATOM   3141 C  C     . ARG D 1 77  ? 3.204   -1.136  -29.014 1.00 47.52  ? 77   ARG D C     1 
ATOM   3142 O  O     . ARG D 1 77  ? 3.633   -1.533  -27.928 1.00 49.89  ? 77   ARG D O     1 
ATOM   3143 C  CB    . ARG D 1 77  ? 1.925   -2.778  -30.411 1.00 47.63  ? 77   ARG D CB    1 
ATOM   3144 C  CG    . ARG D 1 77  ? 1.502   -3.184  -29.055 1.00 43.57  ? 77   ARG D CG    1 
ATOM   3145 C  CD    . ARG D 1 77  ? 0.823   -4.467  -28.842 1.00 45.11  ? 77   ARG D CD    1 
ATOM   3146 N  NE    . ARG D 1 77  ? 0.076   -4.553  -27.575 1.00 55.21  ? 77   ARG D NE    1 
ATOM   3147 C  CZ    . ARG D 1 77  ? 0.484   -4.084  -26.394 1.00 49.28  ? 77   ARG D CZ    1 
ATOM   3148 N  NH1   . ARG D 1 77  ? 1.581   -3.346  -26.250 1.00 46.74  ? 77   ARG D NH1   1 
ATOM   3149 N  NH2   . ARG D 1 77  ? -0.280  -4.281  -25.337 1.00 51.17  ? 77   ARG D NH2   1 
ATOM   3150 N  N     . TYR D 1 78  ? 2.695   0.070   -29.203 1.00 51.09  ? 78   TYR D N     1 
ATOM   3151 C  CA    . TYR D 1 78  ? 2.216   0.877   -28.095 1.00 51.73  ? 78   TYR D CA    1 
ATOM   3152 C  C     . TYR D 1 78  ? 0.752   0.547   -27.852 1.00 51.01  ? 78   TYR D C     1 
ATOM   3153 O  O     . TYR D 1 78  ? 0.017   0.205   -28.781 1.00 49.84  ? 78   TYR D O     1 
ATOM   3154 C  CB    . TYR D 1 78  ? 2.366   2.362   -28.388 1.00 53.17  ? 78   TYR D CB    1 
ATOM   3155 C  CG    . TYR D 1 78  ? 3.765   2.859   -28.313 1.00 55.92  ? 78   TYR D CG    1 
ATOM   3156 C  CD1   . TYR D 1 78  ? 4.594   2.830   -29.426 1.00 59.41  ? 78   TYR D CD1   1 
ATOM   3157 C  CD2   . TYR D 1 78  ? 4.264   3.366   -27.127 1.00 62.89  ? 78   TYR D CD2   1 
ATOM   3158 C  CE1   . TYR D 1 78  ? 5.891   3.289   -29.350 1.00 67.17  ? 78   TYR D CE1   1 
ATOM   3159 C  CE2   . TYR D 1 78  ? 5.557   3.828   -27.039 1.00 72.80  ? 78   TYR D CE2   1 
ATOM   3160 C  CZ    . TYR D 1 78  ? 6.371   3.787   -28.151 1.00 74.47  ? 78   TYR D CZ    1 
ATOM   3161 O  OH    . TYR D 1 78  ? 7.665   4.256   -28.055 1.00 79.33  ? 78   TYR D OH    1 
ATOM   3162 N  N     . GLU D 1 79  ? 0.329   0.665   -26.604 1.00 47.97  ? 79   GLU D N     1 
ATOM   3163 C  CA    . GLU D 1 79  ? -1.054  0.423   -26.263 1.00 46.16  ? 79   GLU D CA    1 
ATOM   3164 C  C     . GLU D 1 79  ? -1.572  1.658   -25.598 1.00 44.23  ? 79   GLU D C     1 
ATOM   3165 O  O     . GLU D 1 79  ? -0.975  2.125   -24.647 1.00 43.40  ? 79   GLU D O     1 
ATOM   3166 C  CB    . GLU D 1 79  ? -1.204  -0.774  -25.331 1.00 42.23  ? 79   GLU D CB    1 
ATOM   3167 C  CG    . GLU D 1 79  ? -2.626  -1.028  -24.870 1.00 43.31  ? 79   GLU D CG    1 
ATOM   3168 C  CD    . GLU D 1 79  ? -2.715  -1.947  -23.652 1.00 46.14  ? 79   GLU D CD    1 
ATOM   3169 O  OE1   . GLU D 1 79  ? -1.780  -2.740  -23.389 1.00 51.77  ? 79   GLU D OE1   1 
ATOM   3170 O  OE2   . GLU D 1 79  ? -3.732  -1.863  -22.932 1.00 45.53  ? 79   GLU D OE2   1 
ATOM   3171 N  N     . LEU D 1 80  ? -2.650  2.213   -26.134 1.00 45.06  ? 80   LEU D N     1 
ATOM   3172 C  CA    . LEU D 1 80  ? -3.391  3.239   -25.433 1.00 47.12  ? 80   LEU D CA    1 
ATOM   3173 C  C     . LEU D 1 80  ? -4.466  2.519   -24.668 1.00 45.19  ? 80   LEU D C     1 
ATOM   3174 O  O     . LEU D 1 80  ? -5.193  1.710   -25.224 1.00 46.68  ? 80   LEU D O     1 
ATOM   3175 C  CB    . LEU D 1 80  ? -3.987  4.265   -26.386 1.00 48.34  ? 80   LEU D CB    1 
ATOM   3176 C  CG    . LEU D 1 80  ? -4.822  5.371   -25.738 1.00 52.77  ? 80   LEU D CG    1 
ATOM   3177 C  CD1   . LEU D 1 80  ? -4.706  6.616   -26.587 1.00 52.26  ? 80   LEU D CD1   1 
ATOM   3178 C  CD2   . LEU D 1 80  ? -6.305  4.959   -25.573 1.00 48.62  ? 80   LEU D CD2   1 
ATOM   3179 N  N     . ARG D 1 81  ? -4.570  2.816   -23.390 1.00 43.96  ? 81   ARG D N     1 
ATOM   3180 C  CA    . ARG D 1 81  ? -5.465  2.075   -22.537 1.00 46.41  ? 81   ARG D CA    1 
ATOM   3181 C  C     . ARG D 1 81  ? -6.207  2.964   -21.548 1.00 54.40  ? 81   ARG D C     1 
ATOM   3182 O  O     . ARG D 1 81  ? -5.592  3.746   -20.815 1.00 50.87  ? 81   ARG D O     1 
ATOM   3183 C  CB    . ARG D 1 81  ? -4.683  1.020   -21.785 1.00 47.91  ? 81   ARG D CB    1 
ATOM   3184 C  CG    . ARG D 1 81  ? -5.461  0.414   -20.661 1.00 50.31  ? 81   ARG D CG    1 
ATOM   3185 C  CD    . ARG D 1 81  ? -4.526  -0.247  -19.715 1.00 50.58  ? 81   ARG D CD    1 
ATOM   3186 N  NE    . ARG D 1 81  ? -3.702  -1.237  -20.384 1.00 52.40  ? 81   ARG D NE    1 
ATOM   3187 C  CZ    . ARG D 1 81  ? -2.704  -1.875  -19.784 1.00 58.45  ? 81   ARG D CZ    1 
ATOM   3188 N  NH1   . ARG D 1 81  ? -2.417  -1.595  -18.516 1.00 53.98  ? 81   ARG D NH1   1 
ATOM   3189 N  NH2   . ARG D 1 81  ? -1.985  -2.777  -20.447 1.00 58.03  ? 81   ARG D NH2   1 
ATOM   3190 N  N     . VAL D 1 82  ? -7.532  2.844   -21.536 1.00 50.28  ? 82   VAL D N     1 
ATOM   3191 C  CA    . VAL D 1 82  ? -8.328  3.477   -20.497 1.00 48.24  ? 82   VAL D CA    1 
ATOM   3192 C  C     . VAL D 1 82  ? -8.986  2.416   -19.632 1.00 49.49  ? 82   VAL D C     1 
ATOM   3193 O  O     . VAL D 1 82  ? -9.819  1.635   -20.097 1.00 52.55  ? 82   VAL D O     1 
ATOM   3194 C  CB    . VAL D 1 82  ? -9.417  4.403   -21.058 1.00 42.58  ? 82   VAL D CB    1 
ATOM   3195 C  CG1   . VAL D 1 82  ? -10.094 5.148   -19.904 1.00 47.67  ? 82   VAL D CG1   1 
ATOM   3196 C  CG2   . VAL D 1 82  ? -8.825  5.381   -22.059 1.00 39.60  ? 82   VAL D CG2   1 
ATOM   3197 N  N     . SER D 1 83  ? -8.594  2.379   -18.369 1.00 50.06  ? 83   SER D N     1 
ATOM   3198 C  CA    . SER D 1 83  ? -9.212  1.465   -17.429 1.00 50.79  ? 83   SER D CA    1 
ATOM   3199 C  C     . SER D 1 83  ? -10.428 2.139   -16.789 1.00 53.71  ? 83   SER D C     1 
ATOM   3200 O  O     . SER D 1 83  ? -10.286 2.967   -15.884 1.00 58.39  ? 83   SER D O     1 
ATOM   3201 C  CB    . SER D 1 83  ? -8.203  1.032   -16.374 1.00 49.91  ? 83   SER D CB    1 
ATOM   3202 O  OG    . SER D 1 83  ? -8.659  -0.107  -15.675 1.00 47.62  ? 83   SER D OG    1 
ATOM   3203 N  N     . SER D 1 84  ? -11.614 1.790   -17.279 1.00 51.63  ? 84   SER D N     1 
ATOM   3204 C  CA    . SER D 1 84  ? -12.868 2.397   -16.827 1.00 49.83  ? 84   SER D CA    1 
ATOM   3205 C  C     . SER D 1 84  ? -14.103 1.559   -17.161 1.00 48.31  ? 84   SER D C     1 
ATOM   3206 O  O     . SER D 1 84  ? -14.435 1.365   -18.335 1.00 46.82  ? 84   SER D O     1 
ATOM   3207 C  CB    . SER D 1 84  ? -13.041 3.783   -17.440 1.00 51.75  ? 84   SER D CB    1 
ATOM   3208 O  OG    . SER D 1 84  ? -14.297 4.348   -17.071 1.00 55.86  ? 84   SER D OG    1 
ATOM   3209 N  N     . LYS D 1 85  ? -14.783 1.080   -16.124 1.00 43.91  ? 85   LYS D N     1 
ATOM   3210 C  CA    . LYS D 1 85  ? -16.046 0.392   -16.301 1.00 44.80  ? 85   LYS D CA    1 
ATOM   3211 C  C     . LYS D 1 85  ? -17.004 1.240   -17.115 1.00 46.57  ? 85   LYS D C     1 
ATOM   3212 O  O     . LYS D 1 85  ? -17.683 0.738   -18.020 1.00 46.90  ? 85   LYS D O     1 
ATOM   3213 C  CB    . LYS D 1 85  ? -16.679 0.059   -14.958 1.00 48.18  ? 85   LYS D CB    1 
ATOM   3214 C  CG    . LYS D 1 85  ? -18.010 -0.648  -15.087 1.00 45.79  ? 85   LYS D CG    1 
ATOM   3215 C  CD    . LYS D 1 85  ? -18.397 -1.286  -13.761 1.00 53.44  ? 85   LYS D CD    1 
ATOM   3216 C  CE    . LYS D 1 85  ? -19.647 -2.135  -13.868 1.00 41.73  ? 85   LYS D CE    1 
ATOM   3217 N  NZ    . LYS D 1 85  ? -20.014 -2.595  -12.505 1.00 46.22  ? 85   LYS D NZ    1 
ATOM   3218 N  N     . LYS D 1 86  ? -17.032 2.536   -16.823 1.00 38.52  ? 86   LYS D N     1 
ATOM   3219 C  CA    . LYS D 1 86  ? -17.969 3.403   -17.504 1.00 43.22  ? 86   LYS D CA    1 
ATOM   3220 C  C     . LYS D 1 86  ? -17.635 3.510   -18.988 1.00 50.09  ? 86   LYS D C     1 
ATOM   3221 O  O     . LYS D 1 86  ? -18.505 3.309   -19.847 1.00 46.17  ? 86   LYS D O     1 
ATOM   3222 C  CB    . LYS D 1 86  ? -17.992 4.778   -16.849 1.00 49.20  ? 86   LYS D CB    1 
ATOM   3223 C  CG    . LYS D 1 86  ? -18.987 5.735   -17.456 1.00 47.53  ? 86   LYS D CG    1 
ATOM   3224 C  CD    . LYS D 1 86  ? -18.960 7.058   -16.725 1.00 52.79  ? 86   LYS D CD    1 
ATOM   3225 C  CE    . LYS D 1 86  ? -20.056 7.980   -17.243 1.00 59.93  ? 86   LYS D CE    1 
ATOM   3226 N  NZ    . LYS D 1 86  ? -20.080 9.258   -16.483 1.00 70.19  ? 86   LYS D NZ    1 
ATOM   3227 N  N     . LEU D 1 87  ? -16.374 3.794   -19.303 1.00 47.36  ? 87   LEU D N     1 
ATOM   3228 C  CA    . LEU D 1 87  ? -16.001 3.965   -20.707 1.00 47.19  ? 87   LEU D CA    1 
ATOM   3229 C  C     . LEU D 1 87  ? -16.113 2.636   -21.478 1.00 48.89  ? 87   LEU D C     1 
ATOM   3230 O  O     . LEU D 1 87  ? -16.459 2.611   -22.669 1.00 42.40  ? 87   LEU D O     1 
ATOM   3231 C  CB    . LEU D 1 87  ? -14.592 4.546   -20.821 1.00 47.09  ? 87   LEU D CB    1 
ATOM   3232 C  CG    . LEU D 1 87  ? -14.341 5.209   -22.174 1.00 41.86  ? 87   LEU D CG    1 
ATOM   3233 C  CD1   . LEU D 1 87  ? -14.995 6.564   -22.217 1.00 41.70  ? 87   LEU D CD1   1 
ATOM   3234 C  CD2   . LEU D 1 87  ? -12.865 5.336   -22.438 1.00 43.76  ? 87   LEU D CD2   1 
ATOM   3235 N  N     . TYR D 1 88  ? -15.838 1.530   -20.794 1.00 43.43  ? 88   TYR D N     1 
ATOM   3236 C  CA    . TYR D 1 88  ? -16.053 0.224   -21.404 1.00 45.79  ? 88   TYR D CA    1 
ATOM   3237 C  C     . TYR D 1 88  ? -17.508 0.034   -21.845 1.00 45.62  ? 88   TYR D C     1 
ATOM   3238 O  O     . TYR D 1 88  ? -17.767 -0.322  -22.991 1.00 41.11  ? 88   TYR D O     1 
ATOM   3239 C  CB    . TYR D 1 88  ? -15.659 -0.890  -20.444 1.00 44.80  ? 88   TYR D CB    1 
ATOM   3240 C  CG    . TYR D 1 88  ? -16.067 -2.278  -20.891 1.00 48.24  ? 88   TYR D CG    1 
ATOM   3241 C  CD1   . TYR D 1 88  ? -15.239 -3.045  -21.717 1.00 46.37  ? 88   TYR D CD1   1 
ATOM   3242 C  CD2   . TYR D 1 88  ? -17.282 -2.834  -20.483 1.00 45.75  ? 88   TYR D CD2   1 
ATOM   3243 C  CE1   . TYR D 1 88  ? -15.604 -4.319  -22.110 1.00 43.10  ? 88   TYR D CE1   1 
ATOM   3244 C  CE2   . TYR D 1 88  ? -17.655 -4.115  -20.877 1.00 43.60  ? 88   TYR D CE2   1 
ATOM   3245 C  CZ    . TYR D 1 88  ? -16.809 -4.847  -21.681 1.00 43.52  ? 88   TYR D CZ    1 
ATOM   3246 O  OH    . TYR D 1 88  ? -17.176 -6.110  -22.056 1.00 49.54  ? 88   TYR D OH    1 
ATOM   3247 N  N     . TYR D 1 89  ? -18.458 0.260   -20.941 1.00 44.33  ? 89   TYR D N     1 
ATOM   3248 C  CA    . TYR D 1 89  ? -19.852 0.051   -21.318 1.00 42.10  ? 89   TYR D CA    1 
ATOM   3249 C  C     . TYR D 1 89  ? -20.350 1.170   -22.242 1.00 44.70  ? 89   TYR D C     1 
ATOM   3250 O  O     . TYR D 1 89  ? -21.217 0.939   -23.093 1.00 39.61  ? 89   TYR D O     1 
ATOM   3251 C  CB    . TYR D 1 89  ? -20.746 -0.086  -20.083 1.00 40.46  ? 89   TYR D CB    1 
ATOM   3252 C  CG    . TYR D 1 89  ? -20.699 -1.467  -19.467 1.00 40.42  ? 89   TYR D CG    1 
ATOM   3253 C  CD1   . TYR D 1 89  ? -21.191 -2.567  -20.153 1.00 40.70  ? 89   TYR D CD1   1 
ATOM   3254 C  CD2   . TYR D 1 89  ? -20.160 -1.675  -18.202 1.00 44.79  ? 89   TYR D CD2   1 
ATOM   3255 C  CE1   . TYR D 1 89  ? -21.132 -3.835  -19.614 1.00 39.49  ? 89   TYR D CE1   1 
ATOM   3256 C  CE2   . TYR D 1 89  ? -20.098 -2.951  -17.649 1.00 42.47  ? 89   TYR D CE2   1 
ATOM   3257 C  CZ    . TYR D 1 89  ? -20.592 -4.023  -18.364 1.00 40.34  ? 89   TYR D CZ    1 
ATOM   3258 O  OH    . TYR D 1 89  ? -20.538 -5.291  -17.833 1.00 51.88  ? 89   TYR D OH    1 
ATOM   3259 N  N     . TYR D 1 90  ? -19.792 2.369   -22.106 1.00 44.64  ? 90   TYR D N     1 
ATOM   3260 C  CA    . TYR D 1 90  ? -20.119 3.418   -23.056 1.00 39.70  ? 90   TYR D CA    1 
ATOM   3261 C  C     . TYR D 1 90  ? -19.856 2.930   -24.484 1.00 43.15  ? 90   TYR D C     1 
ATOM   3262 O  O     . TYR D 1 90  ? -20.726 2.996   -25.334 1.00 44.50  ? 90   TYR D O     1 
ATOM   3263 C  CB    . TYR D 1 90  ? -19.322 4.678   -22.769 1.00 38.49  ? 90   TYR D CB    1 
ATOM   3264 C  CG    . TYR D 1 90  ? -19.491 5.733   -23.824 1.00 43.65  ? 90   TYR D CG    1 
ATOM   3265 C  CD1   . TYR D 1 90  ? -20.598 6.579   -23.807 1.00 49.52  ? 90   TYR D CD1   1 
ATOM   3266 C  CD2   . TYR D 1 90  ? -18.554 5.898   -24.832 1.00 40.73  ? 90   TYR D CD2   1 
ATOM   3267 C  CE1   . TYR D 1 90  ? -20.774 7.564   -24.776 1.00 43.07  ? 90   TYR D CE1   1 
ATOM   3268 C  CE2   . TYR D 1 90  ? -18.721 6.875   -25.800 1.00 49.56  ? 90   TYR D CE2   1 
ATOM   3269 C  CZ    . TYR D 1 90  ? -19.838 7.704   -25.765 1.00 46.80  ? 90   TYR D CZ    1 
ATOM   3270 O  OH    . TYR D 1 90  ? -20.024 8.689   -26.707 1.00 51.05  ? 90   TYR D OH    1 
ATOM   3271 N  N     . PHE D 1 91  ? -18.674 2.385   -24.739 1.00 50.13  ? 91   PHE D N     1 
ATOM   3272 C  CA    . PHE D 1 91  ? -18.354 1.913   -26.089 1.00 48.78  ? 91   PHE D CA    1 
ATOM   3273 C  C     . PHE D 1 91  ? -19.054 0.613   -26.474 1.00 46.52  ? 91   PHE D C     1 
ATOM   3274 O  O     . PHE D 1 91  ? -19.433 0.446   -27.629 1.00 52.01  ? 91   PHE D O     1 
ATOM   3275 C  CB    . PHE D 1 91  ? -16.833 1.742   -26.259 1.00 45.15  ? 91   PHE D CB    1 
ATOM   3276 C  CG    . PHE D 1 91  ? -16.129 3.015   -26.585 1.00 41.46  ? 91   PHE D CG    1 
ATOM   3277 C  CD1   . PHE D 1 91  ? -16.341 3.640   -27.806 1.00 42.93  ? 91   PHE D CD1   1 
ATOM   3278 C  CD2   . PHE D 1 91  ? -15.272 3.601   -25.669 1.00 45.16  ? 91   PHE D CD2   1 
ATOM   3279 C  CE1   . PHE D 1 91  ? -15.713 4.814   -28.108 1.00 45.30  ? 91   PHE D CE1   1 
ATOM   3280 C  CE2   . PHE D 1 91  ? -14.625 4.772   -25.972 1.00 44.04  ? 91   PHE D CE2   1 
ATOM   3281 C  CZ    . PHE D 1 91  ? -14.849 5.385   -27.197 1.00 46.12  ? 91   PHE D CZ    1 
ATOM   3282 N  N     . ALA D 1 92  ? -19.211 -0.310  -25.529 1.00 41.70  ? 92   ALA D N     1 
ATOM   3283 C  CA    . ALA D 1 92  ? -19.865 -1.573  -25.839 1.00 43.94  ? 92   ALA D CA    1 
ATOM   3284 C  C     . ALA D 1 92  ? -21.322 -1.353  -26.197 1.00 45.98  ? 92   ALA D C     1 
ATOM   3285 O  O     . ALA D 1 92  ? -21.849 -2.052  -27.060 1.00 52.19  ? 92   ALA D O     1 
ATOM   3286 C  CB    . ALA D 1 92  ? -19.763 -2.545  -24.689 1.00 37.04  ? 92   ALA D CB    1 
ATOM   3287 N  N     . ASN D 1 93  ? -21.980 -0.403  -25.532 1.00 43.70  ? 93   ASN D N     1 
ATOM   3288 C  CA    . ASN D 1 93  ? -23.386 -0.127  -25.830 1.00 46.95  ? 93   ASN D CA    1 
ATOM   3289 C  C     . ASN D 1 93  ? -23.528 0.533   -27.185 1.00 51.94  ? 93   ASN D C     1 
ATOM   3290 O  O     . ASN D 1 93  ? -24.408 0.170   -27.966 1.00 55.74  ? 93   ASN D O     1 
ATOM   3291 C  CB    . ASN D 1 93  ? -24.030 0.734   -24.748 1.00 42.72  ? 93   ASN D CB    1 
ATOM   3292 C  CG    . ASN D 1 93  ? -24.139 0.010   -23.431 1.00 41.87  ? 93   ASN D CG    1 
ATOM   3293 O  OD1   . ASN D 1 93  ? -24.216 -1.219  -23.403 1.00 44.00  ? 93   ASN D OD1   1 
ATOM   3294 N  ND2   . ASN D 1 93  ? -24.143 0.759   -22.326 1.00 40.38  ? 93   ASN D ND2   1 
ATOM   3295 N  N     . MET D 1 94  ? -22.635 1.474   -27.475 1.00 50.39  ? 94   MET D N     1 
ATOM   3296 C  CA    . MET D 1 94  ? -22.590 2.094   -28.790 1.00 45.25  ? 94   MET D CA    1 
ATOM   3297 C  C     . MET D 1 94  ? -22.361 1.057   -29.885 1.00 54.11  ? 94   MET D C     1 
ATOM   3298 O  O     . MET D 1 94  ? -22.965 1.146   -30.948 1.00 57.45  ? 94   MET D O     1 
ATOM   3299 C  CB    . MET D 1 94  ? -21.507 3.155   -28.836 1.00 45.63  ? 94   MET D CB    1 
ATOM   3300 C  CG    . MET D 1 94  ? -21.488 3.955   -30.107 1.00 50.31  ? 94   MET D CG    1 
ATOM   3301 S  SD    . MET D 1 94  ? -20.160 5.166   -30.088 1.00 59.66  ? 94   MET D SD    1 
ATOM   3302 C  CE    . MET D 1 94  ? -20.668 6.241   -31.418 1.00 67.61  ? 94   MET D CE    1 
ATOM   3303 N  N     . LEU D 1 95  ? -21.506 0.065   -29.630 1.00 49.78  ? 95   LEU D N     1 
ATOM   3304 C  CA    . LEU D 1 95  ? -21.290 -1.027  -30.597 1.00 52.12  ? 95   LEU D CA    1 
ATOM   3305 C  C     . LEU D 1 95  ? -22.533 -1.925  -30.771 1.00 53.73  ? 95   LEU D C     1 
ATOM   3306 O  O     . LEU D 1 95  ? -22.806 -2.422  -31.864 1.00 53.84  ? 95   LEU D O     1 
ATOM   3307 C  CB    . LEU D 1 95  ? -20.100 -1.896  -30.181 1.00 47.39  ? 95   LEU D CB    1 
ATOM   3308 C  CG    . LEU D 1 95  ? -19.845 -3.083  -31.117 1.00 45.46  ? 95   LEU D CG    1 
ATOM   3309 C  CD1   . LEU D 1 95  ? -19.637 -2.616  -32.557 1.00 38.95  ? 95   LEU D CD1   1 
ATOM   3310 C  CD2   . LEU D 1 95  ? -18.677 -3.943  -30.648 1.00 46.11  ? 95   LEU D CD2   1 
ATOM   3311 N  N     . GLU D 1 96  ? -23.276 -2.137  -29.690 1.00 57.70  ? 96   GLU D N     1 
ATOM   3312 C  CA    . GLU D 1 96  ? -24.463 -2.971  -29.749 1.00 63.32  ? 96   GLU D CA    1 
ATOM   3313 C  C     . GLU D 1 96  ? -25.452 -2.360  -30.729 1.00 60.28  ? 96   GLU D C     1 
ATOM   3314 O  O     . GLU D 1 96  ? -26.057 -3.057  -31.540 1.00 59.25  ? 96   GLU D O     1 
ATOM   3315 C  CB    . GLU D 1 96  ? -25.090 -3.126  -28.358 1.00 64.98  ? 96   GLU D CB    1 
ATOM   3316 C  CG    . GLU D 1 96  ? -24.956 -4.524  -27.760 1.00 77.02  ? 96   GLU D CG    1 
ATOM   3317 C  CD    . GLU D 1 96  ? -25.213 -4.552  -26.253 1.00 92.22  ? 96   GLU D CD    1 
ATOM   3318 O  OE1   . GLU D 1 96  ? -25.700 -3.536  -25.707 1.00 85.05  ? 96   GLU D OE1   1 
ATOM   3319 O  OE2   . GLU D 1 96  ? -24.921 -5.588  -25.611 1.00 98.32  ? 96   GLU D OE2   1 
ATOM   3320 N  N     . ARG D 1 97  ? -25.594 -1.044  -30.667 1.00 57.42  ? 97   ARG D N     1 
ATOM   3321 C  CA    . ARG D 1 97  ? -26.517 -0.371  -31.552 1.00 59.77  ? 97   ARG D CA    1 
ATOM   3322 C  C     . ARG D 1 97  ? -25.787 0.349   -32.694 1.00 61.05  ? 97   ARG D C     1 
ATOM   3323 O  O     . ARG D 1 97  ? -26.132 1.475   -33.049 1.00 58.45  ? 97   ARG D O     1 
ATOM   3324 C  CB    . ARG D 1 97  ? -27.390 0.612   -30.769 1.00 59.41  ? 97   ARG D CB    1 
ATOM   3325 C  CG    . ARG D 1 97  ? -26.642 1.602   -29.932 1.00 59.43  ? 97   ARG D CG    1 
ATOM   3326 C  CD    . ARG D 1 97  ? -27.590 2.611   -29.352 1.00 62.60  ? 97   ARG D CD    1 
ATOM   3327 N  NE    . ARG D 1 97  ? -28.719 1.962   -28.700 1.00 71.01  ? 97   ARG D NE    1 
ATOM   3328 C  CZ    . ARG D 1 97  ? -29.991 2.319   -28.875 1.00 81.73  ? 97   ARG D CZ    1 
ATOM   3329 N  NH1   . ARG D 1 97  ? -30.294 3.329   -29.685 1.00 72.40  ? 97   ARG D NH1   1 
ATOM   3330 N  NH2   . ARG D 1 97  ? -30.964 1.668   -28.239 1.00 82.85  ? 97   ARG D NH2   1 
ATOM   3331 N  N     . ILE D 1 98  ? -24.797 -0.325  -33.279 1.00 57.37  ? 98   ILE D N     1 
ATOM   3332 C  CA    . ILE D 1 98  ? -24.048 0.205   -34.416 1.00 54.89  ? 98   ILE D CA    1 
ATOM   3333 C  C     . ILE D 1 98  ? -24.934 0.435   -35.633 1.00 55.96  ? 98   ILE D C     1 
ATOM   3334 O  O     . ILE D 1 98  ? -24.743 1.415   -36.339 1.00 58.09  ? 98   ILE D O     1 
ATOM   3335 C  CB    . ILE D 1 98  ? -22.864 -0.734  -34.799 1.00 58.87  ? 98   ILE D CB    1 
ATOM   3336 C  CG1   . ILE D 1 98  ? -22.073 -0.180  -35.989 1.00 55.87  ? 98   ILE D CG1   1 
ATOM   3337 C  CG2   . ILE D 1 98  ? -23.328 -2.165  -35.053 1.00 48.92  ? 98   ILE D CG2   1 
ATOM   3338 C  CD1   . ILE D 1 98  ? -20.588 -0.581  -35.963 1.00 52.72  ? 98   ILE D CD1   1 
ATOM   3339 N  N     . ARG D 1 99  ? -25.920 -0.437  -35.861 1.00 60.05  ? 99   ARG D N     1 
ATOM   3340 C  CA    . ARG D 1 99  ? -26.834 -0.297  -37.011 1.00 61.85  ? 99   ARG D CA    1 
ATOM   3341 C  C     . ARG D 1 99  ? -27.724 0.952   -36.965 1.00 62.00  ? 99   ARG D C     1 
ATOM   3342 O  O     . ARG D 1 99  ? -28.345 1.292   -37.960 1.00 56.28  ? 99   ARG D O     1 
ATOM   3343 C  CB    . ARG D 1 99  ? -27.731 -1.530  -37.146 1.00 51.34  ? 99   ARG D CB    1 
ATOM   3344 C  CG    . ARG D 1 99  ? -26.969 -2.793  -37.475 1.00 58.62  ? 99   ARG D CG    1 
ATOM   3345 C  CD    . ARG D 1 99  ? -27.817 -4.039  -37.296 1.00 46.97  ? 99   ARG D CD    1 
ATOM   3346 N  NE    . ARG D 1 99  ? -27.030 -5.256  -37.524 1.00 62.35  ? 99   ARG D NE    1 
ATOM   3347 C  CZ    . ARG D 1 99  ? -26.435 -5.965  -36.564 1.00 69.83  ? 99   ARG D CZ    1 
ATOM   3348 N  NH1   . ARG D 1 99  ? -26.523 -5.599  -35.288 1.00 65.66  ? 99   ARG D NH1   1 
ATOM   3349 N  NH2   . ARG D 1 99  ? -25.752 -7.055  -36.883 1.00 76.03  ? 99   ARG D NH2   1 
ATOM   3350 N  N     . LEU D 1 100 ? -27.769 1.635   -35.823 1.00 58.52  ? 100  LEU D N     1 
ATOM   3351 C  CA    . LEU D 1 100 ? -28.610 2.815   -35.672 1.00 57.89  ? 100  LEU D CA    1 
ATOM   3352 C  C     . LEU D 1 100 ? -27.838 4.119   -35.871 1.00 62.87  ? 100  LEU D C     1 
ATOM   3353 O  O     . LEU D 1 100 ? -28.377 5.206   -35.649 1.00 67.32  ? 100  LEU D O     1 
ATOM   3354 C  CB    . LEU D 1 100 ? -29.278 2.816   -34.294 1.00 57.40  ? 100  LEU D CB    1 
ATOM   3355 C  CG    . LEU D 1 100 ? -30.101 1.553   -33.986 1.00 60.31  ? 100  LEU D CG    1 
ATOM   3356 C  CD1   . LEU D 1 100 ? -30.560 1.498   -32.532 1.00 49.57  ? 100  LEU D CD1   1 
ATOM   3357 C  CD2   . LEU D 1 100 ? -31.273 1.440   -34.938 1.00 49.50  ? 100  LEU D CD2   1 
ATOM   3358 N  N     . PHE D 1 101 ? -26.583 4.014   -36.300 1.00 64.17  ? 101  PHE D N     1 
ATOM   3359 C  CA    . PHE D 1 101 ? -25.732 5.195   -36.483 1.00 61.46  ? 101  PHE D CA    1 
ATOM   3360 C  C     . PHE D 1 101 ? -26.286 6.197   -37.493 1.00 61.18  ? 101  PHE D C     1 
ATOM   3361 O  O     . PHE D 1 101 ? -26.721 5.817   -38.578 1.00 59.82  ? 101  PHE D O     1 
ATOM   3362 C  CB    . PHE D 1 101 ? -24.332 4.771   -36.927 1.00 60.44  ? 101  PHE D CB    1 
ATOM   3363 C  CG    . PHE D 1 101 ? -23.431 4.378   -35.799 1.00 57.57  ? 101  PHE D CG    1 
ATOM   3364 C  CD1   . PHE D 1 101 ? -23.945 4.129   -34.538 1.00 54.85  ? 101  PHE D CD1   1 
ATOM   3365 C  CD2   . PHE D 1 101 ? -22.069 4.272   -35.994 1.00 59.41  ? 101  PHE D CD2   1 
ATOM   3366 C  CE1   . PHE D 1 101 ? -23.116 3.788   -33.491 1.00 50.95  ? 101  PHE D CE1   1 
ATOM   3367 C  CE2   . PHE D 1 101 ? -21.235 3.929   -34.949 1.00 59.20  ? 101  PHE D CE2   1 
ATOM   3368 C  CZ    . PHE D 1 101 ? -21.768 3.683   -33.697 1.00 57.16  ? 101  PHE D CZ    1 
ATOM   3369 N  N     . ASN D 1 102 ? -26.258 7.480   -37.137 1.00 62.09  ? 102  ASN D N     1 
ATOM   3370 C  CA    . ASN D 1 102 ? -26.641 8.518   -38.083 1.00 55.19  ? 102  ASN D CA    1 
ATOM   3371 C  C     . ASN D 1 102 ? -25.503 8.727   -39.079 1.00 62.11  ? 102  ASN D C     1 
ATOM   3372 O  O     . ASN D 1 102 ? -24.476 8.051   -39.003 1.00 64.20  ? 102  ASN D O     1 
ATOM   3373 C  CB    . ASN D 1 102 ? -27.027 9.818   -37.358 1.00 56.00  ? 102  ASN D CB    1 
ATOM   3374 C  CG    . ASN D 1 102 ? -25.870 10.478  -36.633 1.00 57.51  ? 102  ASN D CG    1 
ATOM   3375 O  OD1   . ASN D 1 102 ? -24.732 10.435  -37.084 1.00 62.65  ? 102  ASN D OD1   1 
ATOM   3376 N  ND2   . ASN D 1 102 ? -26.168 11.131  -35.517 1.00 58.30  ? 102  ASN D ND2   1 
ATOM   3377 N  N     . MET D 1 103 ? -25.671 9.651   -40.013 1.00 65.37  ? 103  MET D N     1 
ATOM   3378 C  CA    . MET D 1 103 ? -24.733 9.735   -41.123 1.00 66.80  ? 103  MET D CA    1 
ATOM   3379 C  C     . MET D 1 103 ? -23.338 10.169  -40.657 1.00 67.10  ? 103  MET D C     1 
ATOM   3380 O  O     . MET D 1 103 ? -22.327 9.690   -41.181 1.00 66.82  ? 103  MET D O     1 
ATOM   3381 C  CB    . MET D 1 103 ? -25.262 10.693  -42.195 1.00 59.43  ? 103  MET D CB    1 
ATOM   3382 C  CG    . MET D 1 103 ? -24.519 10.610  -43.523 1.00 69.19  ? 103  MET D CG    1 
ATOM   3383 S  SD    . MET D 1 103 ? -24.929 11.996  -44.608 1.00 97.05  ? 103  MET D SD    1 
ATOM   3384 C  CE    . MET D 1 103 ? -23.538 11.987  -45.739 1.00 86.31  ? 103  MET D CE    1 
ATOM   3385 N  N     . ARG D 1 104 ? -23.283 11.076  -39.683 1.00 59.75  ? 104  ARG D N     1 
ATOM   3386 C  CA    . ARG D 1 104 ? -22.006 11.595  -39.215 1.00 59.64  ? 104  ARG D CA    1 
ATOM   3387 C  C     . ARG D 1 104 ? -21.236 10.480  -38.529 1.00 59.07  ? 104  ARG D C     1 
ATOM   3388 O  O     . ARG D 1 104 ? -20.082 10.239  -38.863 1.00 60.61  ? 104  ARG D O     1 
ATOM   3389 C  CB    . ARG D 1 104 ? -22.196 12.786  -38.280 1.00 63.04  ? 104  ARG D CB    1 
ATOM   3390 C  CG    . ARG D 1 104 ? -22.732 14.025  -38.978 1.00 72.20  ? 104  ARG D CG    1 
ATOM   3391 C  CD    . ARG D 1 104 ? -22.903 15.191  -38.018 1.00 75.80  ? 104  ARG D CD    1 
ATOM   3392 N  NE    . ARG D 1 104 ? -21.623 15.575  -37.436 1.00 93.66  ? 104  ARG D NE    1 
ATOM   3393 C  CZ    . ARG D 1 104 ? -21.314 16.804  -37.035 1.00 94.00  ? 104  ARG D CZ    1 
ATOM   3394 N  NH1   . ARG D 1 104 ? -22.204 17.783  -37.152 1.00 94.57  ? 104  ARG D NH1   1 
ATOM   3395 N  NH2   . ARG D 1 104 ? -20.113 17.053  -36.522 1.00 88.24  ? 104  ARG D NH2   1 
ATOM   3396 N  N     . GLU D 1 105 ? -21.898 9.783   -37.607 1.00 50.28  ? 105  GLU D N     1 
ATOM   3397 C  CA    . GLU D 1 105 ? -21.339 8.612   -36.951 1.00 47.15  ? 105  GLU D CA    1 
ATOM   3398 C  C     . GLU D 1 105 ? -20.891 7.538   -37.935 1.00 55.73  ? 105  GLU D C     1 
ATOM   3399 O  O     . GLU D 1 105 ? -19.872 6.860   -37.709 1.00 56.61  ? 105  GLU D O     1 
ATOM   3400 C  CB    . GLU D 1 105 ? -22.346 8.015   -35.980 1.00 44.41  ? 105  GLU D CB    1 
ATOM   3401 C  CG    . GLU D 1 105 ? -22.726 8.961   -34.885 1.00 52.37  ? 105  GLU D CG    1 
ATOM   3402 C  CD    . GLU D 1 105 ? -23.886 8.462   -34.052 1.00 53.82  ? 105  GLU D CD    1 
ATOM   3403 O  OE1   . GLU D 1 105 ? -24.748 7.719   -34.572 1.00 53.87  ? 105  GLU D OE1   1 
ATOM   3404 O  OE2   . GLU D 1 105 ? -23.944 8.838   -32.869 1.00 58.10  ? 105  GLU D OE2   1 
ATOM   3405 N  N     . GLN D 1 106 ? -21.641 7.362   -39.018 1.00 56.49  ? 106  GLN D N     1 
ATOM   3406 C  CA    . GLN D 1 106 ? -21.276 6.329   -39.989 1.00 64.18  ? 106  GLN D CA    1 
ATOM   3407 C  C     . GLN D 1 106 ? -19.961 6.656   -40.656 1.00 57.19  ? 106  GLN D C     1 
ATOM   3408 O  O     . GLN D 1 106 ? -19.115 5.794   -40.841 1.00 58.58  ? 106  GLN D O     1 
ATOM   3409 C  CB    . GLN D 1 106 ? -22.353 6.155   -41.052 1.00 64.48  ? 106  GLN D CB    1 
ATOM   3410 C  CG    . GLN D 1 106 ? -23.575 5.458   -40.552 1.00 65.09  ? 106  GLN D CG    1 
ATOM   3411 C  CD    . GLN D 1 106 ? -24.685 5.474   -41.562 1.00 65.77  ? 106  GLN D CD    1 
ATOM   3412 O  OE1   . GLN D 1 106 ? -24.448 5.385   -42.769 1.00 68.60  ? 106  GLN D OE1   1 
ATOM   3413 N  NE2   . GLN D 1 106 ? -25.910 5.618   -41.081 1.00 64.71  ? 106  GLN D NE2   1 
ATOM   3414 N  N     . ILE D 1 107 ? -19.804 7.916   -41.022 1.00 63.45  ? 107  ILE D N     1 
ATOM   3415 C  CA    . ILE D 1 107 ? -18.600 8.350   -41.700 1.00 70.26  ? 107  ILE D CA    1 
ATOM   3416 C  C     . ILE D 1 107 ? -17.407 8.252   -40.765 1.00 68.56  ? 107  ILE D C     1 
ATOM   3417 O  O     . ILE D 1 107 ? -16.350 7.726   -41.130 1.00 66.99  ? 107  ILE D O     1 
ATOM   3418 C  CB    . ILE D 1 107 ? -18.758 9.779   -42.220 1.00 74.09  ? 107  ILE D CB    1 
ATOM   3419 C  CG1   . ILE D 1 107 ? -19.691 9.781   -43.437 1.00 69.30  ? 107  ILE D CG1   1 
ATOM   3420 C  CG2   . ILE D 1 107 ? -17.405 10.382  -42.558 1.00 76.41  ? 107  ILE D CG2   1 
ATOM   3421 C  CD1   . ILE D 1 107 ? -20.119 11.168  -43.858 1.00 77.37  ? 107  ILE D CD1   1 
ATOM   3422 N  N     . ALA D 1 108 ? -17.601 8.747   -39.549 1.00 59.72  ? 108  ALA D N     1 
ATOM   3423 C  CA    . ALA D 1 108 ? -16.565 8.737   -38.541 1.00 59.17  ? 108  ALA D CA    1 
ATOM   3424 C  C     . ALA D 1 108 ? -16.045 7.315   -38.309 1.00 59.17  ? 108  ALA D C     1 
ATOM   3425 O  O     . ALA D 1 108 ? -14.836 7.082   -38.229 1.00 54.42  ? 108  ALA D O     1 
ATOM   3426 C  CB    . ALA D 1 108 ? -17.096 9.337   -37.250 1.00 52.78  ? 108  ALA D CB    1 
ATOM   3427 N  N     . PHE D 1 109 ? -16.968 6.365   -38.219 1.00 56.92  ? 109  PHE D N     1 
ATOM   3428 C  CA    . PHE D 1 109 ? -16.605 4.996   -37.913 1.00 50.93  ? 109  PHE D CA    1 
ATOM   3429 C  C     . PHE D 1 109 ? -15.848 4.409   -39.084 1.00 50.56  ? 109  PHE D C     1 
ATOM   3430 O  O     . PHE D 1 109 ? -14.861 3.706   -38.888 1.00 50.48  ? 109  PHE D O     1 
ATOM   3431 C  CB    . PHE D 1 109 ? -17.848 4.163   -37.593 1.00 51.40  ? 109  PHE D CB    1 
ATOM   3432 C  CG    . PHE D 1 109 ? -17.561 2.714   -37.311 1.00 44.56  ? 109  PHE D CG    1 
ATOM   3433 C  CD1   . PHE D 1 109 ? -17.097 2.316   -36.060 1.00 46.47  ? 109  PHE D CD1   1 
ATOM   3434 C  CD2   . PHE D 1 109 ? -17.782 1.744   -38.278 1.00 44.53  ? 109  PHE D CD2   1 
ATOM   3435 C  CE1   . PHE D 1 109 ? -16.843 0.966   -35.783 1.00 44.33  ? 109  PHE D CE1   1 
ATOM   3436 C  CE2   . PHE D 1 109 ? -17.535 0.395   -38.007 1.00 48.15  ? 109  PHE D CE2   1 
ATOM   3437 C  CZ    . PHE D 1 109 ? -17.059 0.006   -36.753 1.00 39.34  ? 109  PHE D CZ    1 
ATOM   3438 N  N     . ILE D 1 110 ? -16.301 4.706   -40.298 1.00 50.17  ? 110  ILE D N     1 
ATOM   3439 C  CA    . ILE D 1 110 ? -15.627 4.215   -41.486 1.00 49.60  ? 110  ILE D CA    1 
ATOM   3440 C  C     . ILE D 1 110 ? -14.204 4.762   -41.554 1.00 52.00  ? 110  ILE D C     1 
ATOM   3441 O  O     . ILE D 1 110 ? -13.268 4.043   -41.923 1.00 50.20  ? 110  ILE D O     1 
ATOM   3442 C  CB    . ILE D 1 110 ? -16.384 4.578   -42.743 1.00 53.75  ? 110  ILE D CB    1 
ATOM   3443 C  CG1   . ILE D 1 110 ? -17.692 3.807   -42.785 1.00 57.99  ? 110  ILE D CG1   1 
ATOM   3444 C  CG2   . ILE D 1 110 ? -15.574 4.239   -43.985 1.00 59.31  ? 110  ILE D CG2   1 
ATOM   3445 C  CD1   . ILE D 1 110 ? -18.538 4.132   -44.003 1.00 61.40  ? 110  ILE D CD1   1 
ATOM   3446 N  N     . LYS D 1 111 ? -14.030 6.020   -41.167 1.00 53.84  ? 111  LYS D N     1 
ATOM   3447 C  CA    . LYS D 1 111 ? -12.685 6.587   -41.103 1.00 54.21  ? 111  LYS D CA    1 
ATOM   3448 C  C     . LYS D 1 111 ? -11.770 5.901   -40.130 1.00 54.29  ? 111  LYS D C     1 
ATOM   3449 O  O     . LYS D 1 111 ? -10.669 5.491   -40.493 1.00 52.20  ? 111  LYS D O     1 
ATOM   3450 C  CB    . LYS D 1 111 ? -12.715 8.049   -40.720 1.00 66.46  ? 111  LYS D CB    1 
ATOM   3451 C  CG    . LYS D 1 111 ? -12.395 8.902   -41.866 1.00 69.48  ? 111  LYS D CG    1 
ATOM   3452 C  CD    . LYS D 1 111 ? -12.592 10.362  -41.588 1.00 75.82  ? 111  LYS D CD    1 
ATOM   3453 C  CE    . LYS D 1 111 ? -13.758 10.702  -40.707 1.00 88.98  ? 111  LYS D CE    1 
ATOM   3454 N  NZ    . LYS D 1 111 ? -13.781 12.202  -40.619 1.00 82.94  ? 111  LYS D NZ    1 
ATOM   3455 N  N     . GLY D 1 112 ? -12.222 5.815   -38.881 1.00 52.68  ? 112  GLY D N     1 
ATOM   3456 C  CA    . GLY D 1 112 ? -11.478 5.124   -37.848 1.00 50.48  ? 112  GLY D CA    1 
ATOM   3457 C  C     . GLY D 1 112 ? -11.124 3.714   -38.276 1.00 50.18  ? 112  GLY D C     1 
ATOM   3458 O  O     . GLY D 1 112 ? -9.957  3.326   -38.243 1.00 52.89  ? 112  GLY D O     1 
ATOM   3459 N  N     . LEU D 1 113 ? -12.136 2.964   -38.706 1.00 48.00  ? 113  LEU D N     1 
ATOM   3460 C  CA    . LEU D 1 113 ? -11.935 1.615   -39.220 1.00 46.94  ? 113  LEU D CA    1 
ATOM   3461 C  C     . LEU D 1 113 ? -10.926 1.588   -40.374 1.00 50.72  ? 113  LEU D C     1 
ATOM   3462 O  O     . LEU D 1 113 ? -10.155 0.626   -40.496 1.00 48.93  ? 113  LEU D O     1 
ATOM   3463 C  CB    . LEU D 1 113 ? -13.267 0.996   -39.671 1.00 45.27  ? 113  LEU D CB    1 
ATOM   3464 C  CG    . LEU D 1 113 ? -13.232 -0.535  -39.767 1.00 47.98  ? 113  LEU D CG    1 
ATOM   3465 C  CD1   . LEU D 1 113 ? -12.925 -1.135  -38.415 1.00 44.55  ? 113  LEU D CD1   1 
ATOM   3466 C  CD2   . LEU D 1 113 ? -14.530 -1.088  -40.288 1.00 47.06  ? 113  LEU D CD2   1 
ATOM   3467 N  N     . TYR D 1 114 ? -10.912 2.628   -41.214 0.98 48.05  ? 114  TYR D N     1 
ATOM   3468 C  CA    . TYR D 1 114 ? -9.946  2.639   -42.309 0.98 49.19  ? 114  TYR D CA    1 
ATOM   3469 C  C     . TYR D 1 114 ? -8.521  2.884   -41.783 0.98 49.29  ? 114  TYR D C     1 
ATOM   3470 O  O     . TYR D 1 114 ? -7.592  2.172   -42.159 0.98 45.78  ? 114  TYR D O     1 
ATOM   3471 C  CB    . TYR D 1 114 ? -10.303 3.667   -43.404 0.98 51.03  ? 114  TYR D CB    1 
ATOM   3472 C  CG    . TYR D 1 114 ? -9.674  3.234   -44.713 0.98 55.10  ? 114  TYR D CG    1 
ATOM   3473 C  CD1   . TYR D 1 114 ? -8.338  3.517   -44.983 1.00 48.69  ? 114  TYR D CD1   1 
ATOM   3474 C  CD2   . TYR D 1 114 ? -10.384 2.451   -45.631 1.00 49.45  ? 114  TYR D CD2   1 
ATOM   3475 C  CE1   . TYR D 1 114 ? -7.723  3.074   -46.143 1.00 54.16  ? 114  TYR D CE1   1 
ATOM   3476 C  CE2   . TYR D 1 114 ? -9.780  2.001   -46.801 1.00 56.72  ? 114  TYR D CE2   1 
ATOM   3477 C  CZ    . TYR D 1 114 ? -8.436  2.317   -47.052 0.98 59.42  ? 114  TYR D CZ    1 
ATOM   3478 O  OH    . TYR D 1 114 ? -7.801  1.886   -48.205 0.98 52.68  ? 114  TYR D OH    1 
ATOM   3479 N  N     . VAL D 1 115 ? -8.359  3.874   -40.908 1.00 47.00  ? 115  VAL D N     1 
ATOM   3480 C  CA    . VAL D 1 115 ? -7.066  4.166   -40.293 1.00 41.81  ? 115  VAL D CA    1 
ATOM   3481 C  C     . VAL D 1 115 ? -6.524  2.925   -39.594 1.00 48.79  ? 115  VAL D C     1 
ATOM   3482 O  O     . VAL D 1 115 ? -5.312  2.676   -39.571 1.00 52.04  ? 115  VAL D O     1 
ATOM   3483 C  CB    . VAL D 1 115 ? -7.159  5.307   -39.266 1.00 41.84  ? 115  VAL D CB    1 
ATOM   3484 C  CG1   . VAL D 1 115 ? -5.814  5.589   -38.706 1.00 39.78  ? 115  VAL D CG1   1 
ATOM   3485 C  CG2   . VAL D 1 115 ? -7.752  6.562   -39.882 1.00 46.57  ? 115  VAL D CG2   1 
ATOM   3486 N  N     . ALA D 1 116 ? -7.432  2.135   -39.036 1.00 49.93  ? 116  ALA D N     1 
ATOM   3487 C  CA    . ALA D 1 116 ? -7.052  0.901   -38.372 1.00 47.04  ? 116  ALA D CA    1 
ATOM   3488 C  C     . ALA D 1 116 ? -6.843  -0.267  -39.356 1.00 49.27  ? 116  ALA D C     1 
ATOM   3489 O  O     . ALA D 1 116 ? -5.814  -0.913  -39.341 1.00 55.30  ? 116  ALA D O     1 
ATOM   3490 C  CB    . ALA D 1 116 ? -8.105  0.538   -37.322 1.00 47.98  ? 116  ALA D CB    1 
ATOM   3491 N  N     . GLU D 1 117 ? -7.816  -0.549  -40.211 1.00 55.85  ? 117  GLU D N     1 
ATOM   3492 C  CA    . GLU D 1 117 ? -7.765  -1.779  -41.002 1.00 54.97  ? 117  GLU D CA    1 
ATOM   3493 C  C     . GLU D 1 117 ? -7.585  -1.568  -42.498 1.00 51.25  ? 117  GLU D C     1 
ATOM   3494 O  O     . GLU D 1 117 ? -7.681  -2.515  -43.257 1.00 51.79  ? 117  GLU D O     1 
ATOM   3495 C  CB    . GLU D 1 117 ? -9.045  -2.590  -40.786 1.00 53.65  ? 117  GLU D CB    1 
ATOM   3496 C  CG    . GLU D 1 117 ? -9.424  -2.798  -39.344 1.00 53.49  ? 117  GLU D CG    1 
ATOM   3497 C  CD    . GLU D 1 117 ? -8.823  -4.058  -38.751 1.00 57.54  ? 117  GLU D CD    1 
ATOM   3498 O  OE1   . GLU D 1 117 ? -7.579  -4.218  -38.823 1.00 61.18  ? 117  GLU D OE1   1 
ATOM   3499 O  OE2   . GLU D 1 117 ? -9.595  -4.880  -38.203 1.00 52.82  ? 117  GLU D OE2   1 
ATOM   3500 N  N     . GLY D 1 118 ? -7.345  -0.339  -42.930 1.00 50.78  ? 118  GLY D N     1 
ATOM   3501 C  CA    . GLY D 1 118 ? -7.349  -0.048  -44.348 1.00 50.42  ? 118  GLY D CA    1 
ATOM   3502 C  C     . GLY D 1 118 ? -6.012  -0.071  -45.067 1.00 59.81  ? 118  GLY D C     1 
ATOM   3503 O  O     . GLY D 1 118 ? -4.935  0.030   -44.455 1.00 58.05  ? 118  GLY D O     1 
ATOM   3504 N  N     . ASP D 1 119 ? -6.103  -0.211  -46.389 1.00 64.37  ? 119  ASP D N     1 
ATOM   3505 C  CA    . ASP D 1 119 ? -4.970  -0.044  -47.295 1.00 66.63  ? 119  ASP D CA    1 
ATOM   3506 C  C     . ASP D 1 119 ? -4.481  1.402   -47.201 1.00 63.52  ? 119  ASP D C     1 
ATOM   3507 O  O     . ASP D 1 119 ? -5.148  2.325   -47.677 1.00 62.55  ? 119  ASP D O     1 
ATOM   3508 C  CB    . ASP D 1 119 ? -5.387  -0.411  -48.731 1.00 65.46  ? 119  ASP D CB    1 
ATOM   3509 C  CG    . ASP D 1 119 ? -4.203  -0.532  -49.691 1.00 69.68  ? 119  ASP D CG    1 
ATOM   3510 O  OD1   . ASP D 1 119 ? -3.345  0.383   -49.728 1.00 66.44  ? 119  ASP D OD1   1 
ATOM   3511 O  OD2   . ASP D 1 119 ? -4.141  -1.558  -50.414 1.00 66.51  ? 119  ASP D OD2   1 
ATOM   3512 N  N     . LYS D 1 120 ? -3.332  1.614   -46.571 1.00 70.83  ? 120  LYS D N     1 
ATOM   3513 C  CA    . LYS D 1 120 ? -2.911  2.989   -46.295 1.00 77.55  ? 120  LYS D CA    1 
ATOM   3514 C  C     . LYS D 1 120 ? -2.263  3.698   -47.481 1.00 74.38  ? 120  LYS D C     1 
ATOM   3515 O  O     . LYS D 1 120 ? -2.166  4.923   -47.492 1.00 76.72  ? 120  LYS D O     1 
ATOM   3516 C  CB    . LYS D 1 120 ? -1.984  3.020   -45.080 1.00 70.95  ? 120  LYS D CB    1 
ATOM   3517 C  CG    . LYS D 1 120 ? -2.735  2.652   -43.821 1.00 80.38  ? 120  LYS D CG    1 
ATOM   3518 C  CD    . LYS D 1 120 ? -2.057  3.143   -42.565 1.00 90.90  ? 120  LYS D CD    1 
ATOM   3519 C  CE    . LYS D 1 120 ? -1.989  2.012   -41.560 1.00 92.56  ? 120  LYS D CE    1 
ATOM   3520 N  NZ    . LYS D 1 120 ? -3.153  1.080   -41.749 1.00 80.89  ? 120  LYS D NZ    1 
ATOM   3521 N  N     . THR D 1 121 ? -1.854  2.937   -48.489 1.00 58.61  ? 121  THR D N     1 
ATOM   3522 C  CA    . THR D 1 121 ? -1.260  3.523   -49.679 1.00 58.00  ? 121  THR D CA    1 
ATOM   3523 C  C     . THR D 1 121 ? -2.280  4.370   -50.437 1.00 59.32  ? 121  THR D C     1 
ATOM   3524 O  O     . THR D 1 121 ? -1.918  5.342   -51.088 1.00 61.14  ? 121  THR D O     1 
ATOM   3525 C  CB    . THR D 1 121 ? -0.706  2.445   -50.612 1.00 56.95  ? 121  THR D CB    1 
ATOM   3526 O  OG1   . THR D 1 121 ? -1.783  1.835   -51.322 1.00 57.63  ? 121  THR D OG1   1 
ATOM   3527 C  CG2   . THR D 1 121 ? 0.041   1.382   -49.808 1.00 53.66  ? 121  THR D CG2   1 
ATOM   3528 N  N     . LEU D 1 122 ? -3.552  3.988   -50.319 1.00 73.99  ? 122  LEU D N     1 
ATOM   3529 C  CA    . LEU D 1 122 ? -4.686  4.540   -51.084 1.00 74.17  ? 122  LEU D CA    1 
ATOM   3530 C  C     . LEU D 1 122 ? -4.576  4.209   -52.574 1.00 78.87  ? 122  LEU D C     1 
ATOM   3531 O  O     . LEU D 1 122 ? -5.421  4.630   -53.373 1.00 80.18  ? 122  LEU D O     1 
ATOM   3532 C  CB    . LEU D 1 122 ? -4.825  6.058   -50.895 1.00 70.47  ? 122  LEU D CB    1 
ATOM   3533 C  CG    . LEU D 1 122 ? -4.968  6.601   -49.468 1.00 80.15  ? 122  LEU D CG    1 
ATOM   3534 C  CD1   . LEU D 1 122 ? -5.028  8.129   -49.477 1.00 72.37  ? 122  LEU D CD1   1 
ATOM   3535 C  CD2   . LEU D 1 122 ? -6.176  5.998   -48.736 1.00 71.86  ? 122  LEU D CD2   1 
ATOM   3536 N  N     . LYS D 1 123 ? -3.541  3.454   -52.944 1.00 76.64  ? 123  LYS D N     1 
ATOM   3537 C  CA    . LYS D 1 123 ? -3.430  2.948   -54.303 1.00 75.77  ? 123  LYS D CA    1 
ATOM   3538 C  C     . LYS D 1 123 ? -4.614  2.023   -54.553 1.00 79.16  ? 123  LYS D C     1 
ATOM   3539 O  O     . LYS D 1 123 ? -5.252  2.089   -55.604 1.00 88.96  ? 123  LYS D O     1 
ATOM   3540 C  CB    . LYS D 1 123 ? -2.093  2.243   -54.526 1.00 73.41  ? 123  LYS D CB    1 
ATOM   3541 C  CG    . LYS D 1 123 ? -0.974  3.232   -54.813 1.00 82.53  ? 123  LYS D CG    1 
ATOM   3542 C  CD    . LYS D 1 123 ? 0.379   2.721   -54.371 1.00 83.49  ? 123  LYS D CD    1 
ATOM   3543 C  CE    . LYS D 1 123 ? 1.401   3.849   -54.330 1.00 85.94  ? 123  LYS D CE    1 
ATOM   3544 N  NZ    . LYS D 1 123 ? 2.697   3.421   -53.717 1.00 94.21  ? 123  LYS D NZ    1 
ATOM   3545 N  N     . ARG D 1 124 ? -4.928  1.185   -53.570 1.00 76.44  ? 124  ARG D N     1 
ATOM   3546 C  CA    . ARG D 1 124 ? -6.195  0.451   -53.562 1.00 75.74  ? 124  ARG D CA    1 
ATOM   3547 C  C     . ARG D 1 124 ? -6.956  0.827   -52.292 1.00 67.84  ? 124  ARG D C     1 
ATOM   3548 O  O     . ARG D 1 124 ? -6.356  1.294   -51.328 1.00 69.96  ? 124  ARG D O     1 
ATOM   3549 C  CB    . ARG D 1 124 ? -5.939  -1.053  -53.660 1.00 68.63  ? 124  ARG D CB    1 
ATOM   3550 C  CG    . ARG D 1 124 ? -4.849  -1.337  -54.682 1.00 76.01  ? 124  ARG D CG    1 
ATOM   3551 C  CD    . ARG D 1 124 ? -4.231  -2.705  -54.559 1.00 72.82  ? 124  ARG D CD    1 
ATOM   3552 N  NE    . ARG D 1 124 ? -5.176  -3.755  -54.902 1.00 72.69  ? 124  ARG D NE    1 
ATOM   3553 C  CZ    . ARG D 1 124 ? -4.827  -5.023  -55.078 1.00 71.99  ? 124  ARG D CZ    1 
ATOM   3554 N  NH1   . ARG D 1 124 ? -3.552  -5.378  -54.947 1.00 59.44  ? 124  ARG D NH1   1 
ATOM   3555 N  NH2   . ARG D 1 124 ? -5.757  -5.928  -55.384 1.00 78.30  ? 124  ARG D NH2   1 
ATOM   3556 N  N     . LEU D 1 125 ? -8.271  0.667   -52.290 1.00 68.92  ? 125  LEU D N     1 
ATOM   3557 C  CA    . LEU D 1 125 ? -9.034  1.025   -51.096 1.00 73.32  ? 125  LEU D CA    1 
ATOM   3558 C  C     . LEU D 1 125 ? -9.650  -0.230  -50.492 1.00 69.73  ? 125  LEU D C     1 
ATOM   3559 O  O     . LEU D 1 125 ? -10.748 -0.643  -50.865 1.00 71.43  ? 125  LEU D O     1 
ATOM   3560 C  CB    . LEU D 1 125 ? -10.107 2.071   -51.424 1.00 67.22  ? 125  LEU D CB    1 
ATOM   3561 C  CG    . LEU D 1 125 ? -9.590  3.288   -52.210 1.00 69.54  ? 125  LEU D CG    1 
ATOM   3562 C  CD1   . LEU D 1 125 ? -10.731 4.163   -52.687 1.00 64.70  ? 125  LEU D CD1   1 
ATOM   3563 C  CD2   . LEU D 1 125 ? -8.573  4.111   -51.410 1.00 66.61  ? 125  LEU D CD2   1 
ATOM   3564 N  N     . ARG D 1 126 ? -8.920  -0.837  -49.562 1.00 65.68  ? 126  ARG D N     1 
ATOM   3565 C  CA    . ARG D 1 126 ? -9.321  -2.113  -48.984 1.00 69.49  ? 126  ARG D CA    1 
ATOM   3566 C  C     . ARG D 1 126 ? -9.408  -2.052  -47.453 1.00 63.60  ? 126  ARG D C     1 
ATOM   3567 O  O     . ARG D 1 126 ? -8.638  -1.350  -46.810 1.00 62.61  ? 126  ARG D O     1 
ATOM   3568 C  CB    . ARG D 1 126 ? -8.336  -3.205  -49.411 1.00 66.44  ? 126  ARG D CB    1 
ATOM   3569 C  CG    . ARG D 1 126 ? -8.199  -3.361  -50.903 1.00 63.07  ? 126  ARG D CG    1 
ATOM   3570 C  CD    . ARG D 1 126 ? -7.111  -4.365  -51.232 1.00 65.95  ? 126  ARG D CD    1 
ATOM   3571 N  NE    . ARG D 1 126 ? -5.769  -3.830  -51.042 1.00 63.94  ? 126  ARG D NE    1 
ATOM   3572 C  CZ    . ARG D 1 126 ? -4.667  -4.570  -51.096 1.00 68.76  ? 126  ARG D CZ    1 
ATOM   3573 N  NH1   . ARG D 1 126 ? -4.763  -5.872  -51.326 1.00 63.38  ? 126  ARG D NH1   1 
ATOM   3574 N  NH2   . ARG D 1 126 ? -3.472  -4.016  -50.911 1.00 61.32  ? 126  ARG D NH2   1 
ATOM   3575 N  N     . ILE D 1 127 ? -10.352 -2.796  -46.884 1.00 62.12  ? 127  ILE D N     1 
ATOM   3576 C  CA    . ILE D 1 127 ? -10.480 -2.934  -45.435 1.00 61.21  ? 127  ILE D CA    1 
ATOM   3577 C  C     . ILE D 1 127 ? -10.556 -4.403  -45.060 1.00 57.28  ? 127  ILE D C     1 
ATOM   3578 O  O     . ILE D 1 127 ? -11.431 -5.119  -45.541 1.00 53.92  ? 127  ILE D O     1 
ATOM   3579 C  CB    . ILE D 1 127 ? -11.735 -2.228  -44.897 1.00 59.88  ? 127  ILE D CB    1 
ATOM   3580 C  CG1   . ILE D 1 127 ? -11.817 -0.797  -45.415 1.00 64.77  ? 127  ILE D CG1   1 
ATOM   3581 C  CG2   . ILE D 1 127 ? -11.726 -2.205  -43.394 1.00 57.20  ? 127  ILE D CG2   1 
ATOM   3582 C  CD1   . ILE D 1 127 ? -13.114 -0.112  -45.020 1.00 61.65  ? 127  ILE D CD1   1 
ATOM   3583 N  N     . TRP D 1 128 ? -9.651  -4.858  -44.201 0.98 53.92  ? 128  TRP D N     1 
ATOM   3584 C  CA    . TRP D 1 128 ? -9.649  -6.266  -43.795 0.98 58.11  ? 128  TRP D CA    1 
ATOM   3585 C  C     . TRP D 1 128 ? -10.316 -6.461  -42.439 0.98 58.75  ? 128  TRP D C     1 
ATOM   3586 O  O     . TRP D 1 128 ? -10.157 -5.637  -41.544 0.98 58.55  ? 128  TRP D O     1 
ATOM   3587 C  CB    . TRP D 1 128 ? -8.215  -6.827  -43.749 0.98 54.76  ? 128  TRP D CB    1 
ATOM   3588 C  CG    . TRP D 1 128 ? -7.549  -6.922  -45.092 0.98 58.24  ? 128  TRP D CG    1 
ATOM   3589 C  CD1   . TRP D 1 128 ? -7.567  -7.989  -45.945 1.00 64.03  ? 128  TRP D CD1   1 
ATOM   3590 C  CD2   . TRP D 1 128 ? -6.782  -5.901  -45.741 1.00 54.33  ? 128  TRP D CD2   1 
ATOM   3591 N  NE1   . TRP D 1 128 ? -6.854  -7.698  -47.084 1.00 62.86  ? 128  TRP D NE1   1 
ATOM   3592 C  CE2   . TRP D 1 128 ? -6.364  -6.423  -46.987 1.00 59.65  ? 128  TRP D CE2   1 
ATOM   3593 C  CE3   . TRP D 1 128 ? -6.406  -4.602  -45.397 1.00 56.47  ? 128  TRP D CE3   1 
ATOM   3594 C  CZ2   . TRP D 1 128 ? -5.588  -5.683  -47.885 1.00 58.21  ? 128  TRP D CZ2   1 
ATOM   3595 C  CZ3   . TRP D 1 128 ? -5.637  -3.869  -46.290 1.00 61.23  ? 128  TRP D CZ3   1 
ATOM   3596 C  CH2   . TRP D 1 128 ? -5.237  -4.413  -47.520 1.00 60.31  ? 128  TRP D CH2   1 
ATOM   3597 N  N     . ASN D 1 129 ? -11.053 -7.557  -42.294 1.00 52.95  ? 129  ASN D N     1 
ATOM   3598 C  CA    . ASN D 1 129 ? -11.575 -7.968  -40.999 1.00 53.67  ? 129  ASN D CA    1 
ATOM   3599 C  C     . ASN D 1 129 ? -12.075 -9.412  -41.057 1.00 60.07  ? 129  ASN D C     1 
ATOM   3600 O  O     . ASN D 1 129 ? -12.519 -9.867  -42.113 1.00 60.87  ? 129  ASN D O     1 
ATOM   3601 C  CB    . ASN D 1 129 ? -12.706 -7.037  -40.565 1.00 57.35  ? 129  ASN D CB    1 
ATOM   3602 C  CG    . ASN D 1 129 ? -12.832 -6.937  -39.067 1.00 52.74  ? 129  ASN D CG    1 
ATOM   3603 O  OD1   . ASN D 1 129 ? -13.471 -7.777  -38.424 1.00 49.70  ? 129  ASN D OD1   1 
ATOM   3604 N  ND2   . ASN D 1 129 ? -12.240 -5.899  -38.502 1.00 51.02  ? 129  ASN D ND2   1 
ATOM   3605 N  N     . LYS D 1 130 ? -12.025 -10.135 -39.939 1.00 55.13  ? 130  LYS D N     1 
ATOM   3606 C  CA    . LYS D 1 130 ? -12.576 -11.493 -39.916 1.00 51.03  ? 130  LYS D CA    1 
ATOM   3607 C  C     . LYS D 1 130 ? -14.062 -11.513 -39.660 1.00 50.49  ? 130  LYS D C     1 
ATOM   3608 O  O     . LYS D 1 130 ? -14.690 -12.548 -39.816 1.00 59.43  ? 130  LYS D O     1 
ATOM   3609 C  CB    . LYS D 1 130 ? -11.895 -12.361 -38.867 1.00 54.24  ? 130  LYS D CB    1 
ATOM   3610 C  CG    . LYS D 1 130 ? -10.472 -12.702 -39.192 1.00 53.85  ? 130  LYS D CG    1 
ATOM   3611 C  CD    . LYS D 1 130 ? -9.928  -13.715 -38.218 1.00 59.03  ? 130  LYS D CD    1 
ATOM   3612 C  CE    . LYS D 1 130 ? -10.831 -14.920 -38.128 1.00 57.12  ? 130  LYS D CE    1 
ATOM   3613 N  NZ    . LYS D 1 130 ? -10.134 -16.086 -37.510 1.00 67.75  ? 130  LYS D NZ    1 
ATOM   3614 N  N     . ASN D 1 131 ? -14.613 -10.373 -39.260 1.00 55.24  ? 131  ASN D N     1 
ATOM   3615 C  CA    . ASN D 1 131 ? -16.041 -10.236 -38.984 1.00 56.99  ? 131  ASN D CA    1 
ATOM   3616 C  C     . ASN D 1 131 ? -16.807 -9.776  -40.224 1.00 62.56  ? 131  ASN D C     1 
ATOM   3617 O  O     . ASN D 1 131 ? -16.870 -8.572  -40.517 1.00 60.28  ? 131  ASN D O     1 
ATOM   3618 C  CB    . ASN D 1 131 ? -16.247 -9.246  -37.835 1.00 59.66  ? 131  ASN D CB    1 
ATOM   3619 C  CG    . ASN D 1 131 ? -17.674 -9.217  -37.312 1.00 59.41  ? 131  ASN D CG    1 
ATOM   3620 O  OD1   . ASN D 1 131 ? -18.633 -9.533  -38.015 1.00 57.52  ? 131  ASN D OD1   1 
ATOM   3621 N  ND2   . ASN D 1 131 ? -17.818 -8.799  -36.067 1.00 65.13  ? 131  ASN D ND2   1 
ATOM   3622 N  N     . LYS D 1 132 ? -17.414 -10.727 -40.932 1.00 63.31  ? 132  LYS D N     1 
ATOM   3623 C  CA    . LYS D 1 132 ? -18.036 -10.436 -42.221 1.00 60.19  ? 132  LYS D CA    1 
ATOM   3624 C  C     . LYS D 1 132 ? -19.291 -9.596  -42.010 1.00 63.46  ? 132  LYS D C     1 
ATOM   3625 O  O     . LYS D 1 132 ? -19.637 -8.744  -42.842 1.00 66.50  ? 132  LYS D O     1 
ATOM   3626 C  CB    . LYS D 1 132 ? -18.344 -11.740 -42.970 1.00 63.84  ? 132  LYS D CB    1 
ATOM   3627 C  CG    . LYS D 1 132 ? -19.096 -11.620 -44.298 1.00 67.42  ? 132  LYS D CG    1 
ATOM   3628 C  CD    . LYS D 1 132 ? -19.267 -13.007 -44.961 1.00 79.27  ? 132  LYS D CD    1 
ATOM   3629 C  CE    . LYS D 1 132 ? -20.602 -13.154 -45.731 1.00 87.54  ? 132  LYS D CE    1 
ATOM   3630 N  NZ    . LYS D 1 132 ? -20.856 -14.530 -46.281 1.00 82.95  ? 132  LYS D NZ    1 
ATOM   3631 N  N     . ALA D 1 133 ? -19.960 -9.811  -40.884 1.00 50.58  ? 133  ALA D N     1 
ATOM   3632 C  CA    . ALA D 1 133 ? -21.191 -9.085  -40.612 1.00 50.95  ? 133  ALA D CA    1 
ATOM   3633 C  C     . ALA D 1 133 ? -20.911 -7.595  -40.472 1.00 57.56  ? 133  ALA D C     1 
ATOM   3634 O  O     . ALA D 1 133 ? -21.741 -6.745  -40.814 1.00 56.09  ? 133  ALA D O     1 
ATOM   3635 C  CB    . ALA D 1 133 ? -21.838 -9.614  -39.373 1.00 46.15  ? 133  ALA D CB    1 
ATOM   3636 N  N     . LEU D 1 134 ? -19.724 -7.284  -39.967 1.00 57.40  ? 134  LEU D N     1 
ATOM   3637 C  CA    . LEU D 1 134 ? -19.341 -5.910  -39.747 1.00 57.61  ? 134  LEU D CA    1 
ATOM   3638 C  C     . LEU D 1 134 ? -19.043 -5.229  -41.081 1.00 58.72  ? 134  LEU D C     1 
ATOM   3639 O  O     . LEU D 1 134 ? -19.430 -4.076  -41.303 1.00 57.53  ? 134  LEU D O     1 
ATOM   3640 C  CB    . LEU D 1 134 ? -18.127 -5.844  -38.816 1.00 58.77  ? 134  LEU D CB    1 
ATOM   3641 C  CG    . LEU D 1 134 ? -17.535 -4.451  -38.573 1.00 56.42  ? 134  LEU D CG    1 
ATOM   3642 C  CD1   . LEU D 1 134 ? -18.360 -3.669  -37.550 1.00 58.40  ? 134  LEU D CD1   1 
ATOM   3643 C  CD2   . LEU D 1 134 ? -16.101 -4.569  -38.144 1.00 50.71  ? 134  LEU D CD2   1 
ATOM   3644 N  N     . LEU D 1 135 ? -18.352 -5.943  -41.966 1.00 48.10  ? 135  LEU D N     1 
ATOM   3645 C  CA    . LEU D 1 135 ? -18.033 -5.395  -43.273 1.00 49.62  ? 135  LEU D CA    1 
ATOM   3646 C  C     . LEU D 1 135 ? -19.324 -5.166  -44.055 1.00 57.18  ? 135  LEU D C     1 
ATOM   3647 O  O     . LEU D 1 135 ? -19.476 -4.140  -44.728 1.00 53.11  ? 135  LEU D O     1 
ATOM   3648 C  CB    . LEU D 1 135 ? -17.075 -6.324  -44.025 1.00 49.73  ? 135  LEU D CB    1 
ATOM   3649 C  CG    . LEU D 1 135 ? -15.714 -6.478  -43.313 1.00 53.41  ? 135  LEU D CG    1 
ATOM   3650 C  CD1   . LEU D 1 135 ? -14.773 -7.457  -44.019 1.00 51.64  ? 135  LEU D CD1   1 
ATOM   3651 C  CD2   . LEU D 1 135 ? -15.010 -5.125  -43.099 1.00 44.16  ? 135  LEU D CD2   1 
ATOM   3652 N  N     . GLU D 1 136 ? -20.257 -6.116  -43.934 1.00 70.82  ? 136  GLU D N     1 
ATOM   3653 C  CA    . GLU D 1 136 ? -21.580 -6.021  -44.553 1.00 66.94  ? 136  GLU D CA    1 
ATOM   3654 C  C     . GLU D 1 136 ? -22.332 -4.760  -44.149 1.00 70.29  ? 136  GLU D C     1 
ATOM   3655 O  O     . GLU D 1 136 ? -22.825 -4.026  -45.008 1.00 68.73  ? 136  GLU D O     1 
ATOM   3656 C  CB    . GLU D 1 136 ? -22.410 -7.256  -44.211 1.00 71.75  ? 136  GLU D CB    1 
ATOM   3657 C  CG    . GLU D 1 136 ? -21.949 -8.504  -44.955 1.00 79.32  ? 136  GLU D CG    1 
ATOM   3658 C  CD    . GLU D 1 136 ? -22.686 -9.781  -44.550 1.00 84.95  ? 136  GLU D CD    1 
ATOM   3659 O  OE1   . GLU D 1 136 ? -23.515 -9.764  -43.609 1.00 80.88  ? 136  GLU D OE1   1 
ATOM   3660 O  OE2   . GLU D 1 136 ? -22.446 -10.810 -45.208 1.00 90.38  ? 136  GLU D OE2   1 
ATOM   3661 N  N     . ILE D 1 137 ? -22.411 -4.508  -42.845 1.00 63.31  ? 137  ILE D N     1 
ATOM   3662 C  CA    . ILE D 1 137 ? -22.925 -3.235  -42.347 1.00 63.91  ? 137  ILE D CA    1 
ATOM   3663 C  C     . ILE D 1 137 ? -22.171 -2.049  -42.973 1.00 61.97  ? 137  ILE D C     1 
ATOM   3664 O  O     . ILE D 1 137 ? -22.786 -1.106  -43.472 1.00 65.76  ? 137  ILE D O     1 
ATOM   3665 C  CB    . ILE D 1 137 ? -22.818 -3.143  -40.804 1.00 61.13  ? 137  ILE D CB    1 
ATOM   3666 C  CG1   . ILE D 1 137 ? -23.683 -4.216  -40.140 1.00 62.30  ? 137  ILE D CG1   1 
ATOM   3667 C  CG2   . ILE D 1 137 ? -23.230 -1.767  -40.320 1.00 54.84  ? 137  ILE D CG2   1 
ATOM   3668 C  CD1   . ILE D 1 137 ? -23.364 -4.438  -38.679 1.00 57.72  ? 137  ILE D CD1   1 
ATOM   3669 N  N     . VAL D 1 138 ? -20.843 -2.096  -42.957 1.00 56.57  ? 138  VAL D N     1 
ATOM   3670 C  CA    . VAL D 1 138 ? -20.072 -0.984  -43.498 1.00 61.66  ? 138  VAL D CA    1 
ATOM   3671 C  C     . VAL D 1 138 ? -20.360 -0.895  -44.995 1.00 58.34  ? 138  VAL D C     1 
ATOM   3672 O  O     . VAL D 1 138 ? -20.510 0.202   -45.543 1.00 61.02  ? 138  VAL D O     1 
ATOM   3673 C  CB    . VAL D 1 138 ? -18.536 -1.131  -43.206 1.00 55.76  ? 138  VAL D CB    1 
ATOM   3674 C  CG1   . VAL D 1 138 ? -17.719 -0.020  -43.882 1.00 44.00  ? 138  VAL D CG1   1 
ATOM   3675 C  CG2   . VAL D 1 138 ? -18.279 -1.124  -41.700 1.00 50.59  ? 138  VAL D CG2   1 
ATOM   3676 N  N     . SER D 1 139 ? -20.482 -2.053  -45.638 1.00 59.10  ? 139  SER D N     1 
ATOM   3677 C  CA    . SER D 1 139 ? -20.824 -2.122  -47.062 1.00 65.80  ? 139  SER D CA    1 
ATOM   3678 C  C     . SER D 1 139 ? -22.159 -1.434  -47.420 1.00 62.83  ? 139  SER D C     1 
ATOM   3679 O  O     . SER D 1 139 ? -22.262 -0.757  -48.449 1.00 60.95  ? 139  SER D O     1 
ATOM   3680 C  CB    . SER D 1 139 ? -20.872 -3.576  -47.513 1.00 59.14  ? 139  SER D CB    1 
ATOM   3681 O  OG    . SER D 1 139 ? -21.197 -3.640  -48.878 1.00 62.54  ? 139  SER D OG    1 
ATOM   3682 N  N     . ARG D 1 140 ? -23.168 -1.603  -46.570 1.00 55.56  ? 140  ARG D N     1 
ATOM   3683 C  CA    . ARG D 1 140 ? -24.466 -0.990  -46.818 1.00 62.92  ? 140  ARG D CA    1 
ATOM   3684 C  C     . ARG D 1 140 ? -24.417 0.526   -46.615 1.00 63.04  ? 140  ARG D C     1 
ATOM   3685 O  O     . ARG D 1 140 ? -25.117 1.266   -47.306 1.00 70.04  ? 140  ARG D O     1 
ATOM   3686 C  CB    . ARG D 1 140 ? -25.559 -1.625  -45.932 1.00 61.70  ? 140  ARG D CB    1 
ATOM   3687 C  CG    . ARG D 1 140 ? -25.597 -3.158  -45.972 1.00 57.05  ? 140  ARG D CG    1 
ATOM   3688 C  CD    . ARG D 1 140 ? -26.727 -3.765  -45.138 1.00 73.01  ? 140  ARG D CD    1 
ATOM   3689 N  NE    . ARG D 1 140 ? -26.228 -4.526  -43.982 1.00 90.08  ? 140  ARG D NE    1 
ATOM   3690 C  CZ    . ARG D 1 140 ? -26.988 -5.244  -43.149 1.00 90.02  ? 140  ARG D CZ    1 
ATOM   3691 N  NH1   . ARG D 1 140 ? -28.302 -5.323  -43.348 1.00 95.83  ? 140  ARG D NH1   1 
ATOM   3692 N  NH2   . ARG D 1 140 ? -26.432 -5.894  -42.121 1.00 82.99  ? 140  ARG D NH2   1 
ATOM   3693 N  N     . TRP D 1 141 ? -23.594 0.996   -45.684 0.96 68.14  ? 141  TRP D N     1 
ATOM   3694 C  CA    . TRP D 1 141 ? -23.440 2.439   -45.481 0.96 67.84  ? 141  TRP D CA    1 
ATOM   3695 C  C     . TRP D 1 141 ? -22.755 3.077   -46.676 0.96 68.60  ? 141  TRP D C     1 
ATOM   3696 O  O     . TRP D 1 141 ? -23.086 4.191   -47.091 0.96 63.94  ? 141  TRP D O     1 
ATOM   3697 C  CB    . TRP D 1 141 ? -22.624 2.746   -44.232 0.96 66.52  ? 141  TRP D CB    1 
ATOM   3698 C  CG    . TRP D 1 141 ? -23.264 2.368   -42.944 0.96 69.33  ? 141  TRP D CG    1 
ATOM   3699 C  CD1   . TRP D 1 141 ? -24.549 1.971   -42.748 1.00 67.25  ? 141  TRP D CD1   1 
ATOM   3700 C  CD2   . TRP D 1 141 ? -22.632 2.345   -41.664 1.00 67.14  ? 141  TRP D CD2   1 
ATOM   3701 N  NE1   . TRP D 1 141 ? -24.761 1.705   -41.419 1.00 72.99  ? 141  TRP D NE1   1 
ATOM   3702 C  CE2   . TRP D 1 141 ? -23.597 1.927   -40.733 1.00 64.51  ? 141  TRP D CE2   1 
ATOM   3703 C  CE3   . TRP D 1 141 ? -21.340 2.639   -41.217 1.00 63.45  ? 141  TRP D CE3   1 
ATOM   3704 C  CZ2   . TRP D 1 141 ? -23.318 1.792   -39.383 1.00 62.14  ? 141  TRP D CZ2   1 
ATOM   3705 C  CZ3   . TRP D 1 141 ? -21.061 2.506   -39.882 1.00 69.83  ? 141  TRP D CZ3   1 
ATOM   3706 C  CH2   . TRP D 1 141 ? -22.047 2.084   -38.973 1.00 68.23  ? 141  TRP D CH2   1 
ATOM   3707 N  N     . LEU D 1 142 ? -21.776 2.360   -47.214 1.00 63.64  ? 142  LEU D N     1 
ATOM   3708 C  CA    . LEU D 1 142 ? -21.018 2.848   -48.349 1.00 66.98  ? 142  LEU D CA    1 
ATOM   3709 C  C     . LEU D 1 142 ? -21.895 2.904   -49.612 1.00 68.89  ? 142  LEU D C     1 
ATOM   3710 O  O     . LEU D 1 142 ? -21.785 3.832   -50.411 1.00 67.10  ? 142  LEU D O     1 
ATOM   3711 C  CB    . LEU D 1 142 ? -19.776 1.973   -48.569 1.00 62.33  ? 142  LEU D CB    1 
ATOM   3712 C  CG    . LEU D 1 142 ? -18.606 2.153   -47.594 1.00 60.82  ? 142  LEU D CG    1 
ATOM   3713 C  CD1   . LEU D 1 142 ? -17.459 1.219   -47.942 1.00 61.44  ? 142  LEU D CD1   1 
ATOM   3714 C  CD2   . LEU D 1 142 ? -18.122 3.586   -47.587 1.00 55.61  ? 142  LEU D CD2   1 
ATOM   3715 N  N     . ASN D 1 143 ? -22.766 1.917   -49.794 1.00 71.87  ? 143  ASN D N     1 
ATOM   3716 C  CA    . ASN D 1 143 ? -23.687 1.956   -50.923 1.00 72.00  ? 143  ASN D CA    1 
ATOM   3717 C  C     . ASN D 1 143 ? -24.605 3.170   -50.857 1.00 72.88  ? 143  ASN D C     1 
ATOM   3718 O  O     . ASN D 1 143 ? -24.695 3.926   -51.824 1.00 74.24  ? 143  ASN D O     1 
ATOM   3719 C  CB    . ASN D 1 143 ? -24.488 0.658   -51.005 1.00 63.99  ? 143  ASN D CB    1 
ATOM   3720 C  CG    . ASN D 1 143 ? -23.733 -0.420  -51.763 1.00 72.63  ? 143  ASN D CG    1 
ATOM   3721 O  OD1   . ASN D 1 143 ? -23.107 -0.126  -52.780 1.00 81.09  ? 143  ASN D OD1   1 
ATOM   3722 N  ND2   . ASN D 1 143 ? -23.760 -1.658  -51.269 1.00 70.54  ? 143  ASN D ND2   1 
ATOM   3723 N  N     . ASN D 1 144 ? -25.243 3.386   -49.710 1.00 62.97  ? 144  ASN D N     1 
ATOM   3724 C  CA    . ASN D 1 144 ? -26.096 4.555   -49.522 1.00 67.24  ? 144  ASN D CA    1 
ATOM   3725 C  C     . ASN D 1 144 ? -25.279 5.838   -49.803 1.00 67.74  ? 144  ASN D C     1 
ATOM   3726 O  O     . ASN D 1 144 ? -25.811 6.822   -50.306 1.00 76.27  ? 144  ASN D O     1 
ATOM   3727 C  CB    . ASN D 1 144 ? -26.711 4.522   -48.099 1.00 73.74  ? 144  ASN D CB    1 
ATOM   3728 C  CG    . ASN D 1 144 ? -27.323 5.873   -47.634 1.00 83.52  ? 144  ASN D CG    1 
ATOM   3729 O  OD1   . ASN D 1 144 ? -27.447 6.832   -48.387 1.00 93.75  ? 144  ASN D OD1   1 
ATOM   3730 N  ND2   . ASN D 1 144 ? -27.722 5.921   -46.367 1.00 87.97  ? 144  ASN D ND2   1 
ATOM   3731 N  N     . LEU D 1 145 ? -23.979 5.818   -49.531 1.00 69.47  ? 145  LEU D N     1 
ATOM   3732 C  CA    . LEU D 1 145 ? -23.150 7.008   -49.736 1.00 68.00  ? 145  LEU D CA    1 
ATOM   3733 C  C     . LEU D 1 145 ? -22.649 7.105   -51.179 1.00 71.41  ? 145  LEU D C     1 
ATOM   3734 O  O     . LEU D 1 145 ? -21.828 7.964   -51.517 1.00 67.54  ? 145  LEU D O     1 
ATOM   3735 C  CB    . LEU D 1 145 ? -21.964 7.005   -48.765 1.00 66.72  ? 145  LEU D CB    1 
ATOM   3736 C  CG    . LEU D 1 145 ? -22.253 7.428   -47.321 1.00 65.27  ? 145  LEU D CG    1 
ATOM   3737 C  CD1   . LEU D 1 145 ? -21.004 7.274   -46.470 1.00 69.27  ? 145  LEU D CD1   1 
ATOM   3738 C  CD2   . LEU D 1 145 ? -22.777 8.856   -47.260 1.00 56.71  ? 145  LEU D CD2   1 
ATOM   3739 N  N     . GLY D 1 146 ? -23.143 6.208   -52.026 1.00 73.05  ? 146  GLY D N     1 
ATOM   3740 C  CA    . GLY D 1 146 ? -22.803 6.233   -53.432 1.00 75.71  ? 146  GLY D CA    1 
ATOM   3741 C  C     . GLY D 1 146 ? -21.393 5.762   -53.717 1.00 81.68  ? 146  GLY D C     1 
ATOM   3742 O  O     . GLY D 1 146 ? -20.757 6.236   -54.657 1.00 89.45  ? 146  GLY D O     1 
ATOM   3743 N  N     . VAL D 1 147 ? -20.907 4.824   -52.908 1.00 79.60  ? 147  VAL D N     1 
ATOM   3744 C  CA    . VAL D 1 147 ? -19.578 4.252   -53.099 1.00 81.71  ? 147  VAL D CA    1 
ATOM   3745 C  C     . VAL D 1 147 ? -19.698 2.746   -53.324 1.00 79.06  ? 147  VAL D C     1 
ATOM   3746 O  O     . VAL D 1 147 ? -20.080 1.997   -52.422 1.00 78.51  ? 147  VAL D O     1 
ATOM   3747 C  CB    . VAL D 1 147 ? -18.655 4.542   -51.893 1.00 71.75  ? 147  VAL D CB    1 
ATOM   3748 C  CG1   . VAL D 1 147 ? -17.302 3.894   -52.098 1.00 69.73  ? 147  VAL D CG1   1 
ATOM   3749 C  CG2   . VAL D 1 147 ? -18.504 6.035   -51.700 1.00 68.21  ? 147  VAL D CG2   1 
ATOM   3750 N  N     . ARG D 1 148 ? -19.389 2.310   -54.538 1.00 76.23  ? 148  ARG D N     1 
ATOM   3751 C  CA    . ARG D 1 148 ? -19.596 0.919   -54.914 1.00 76.17  ? 148  ARG D CA    1 
ATOM   3752 C  C     . ARG D 1 148 ? -18.526 0.054   -54.276 1.00 73.13  ? 148  ARG D C     1 
ATOM   3753 O  O     . ARG D 1 148 ? -17.374 0.467   -54.176 1.00 77.54  ? 148  ARG D O     1 
ATOM   3754 C  CB    . ARG D 1 148 ? -19.595 0.770   -56.441 1.00 78.86  ? 148  ARG D CB    1 
ATOM   3755 C  CG    . ARG D 1 148 ? -20.929 1.121   -57.097 1.00 78.96  ? 148  ARG D CG    1 
ATOM   3756 C  CD    . ARG D 1 148 ? -20.763 1.456   -58.567 1.00 85.53  ? 148  ARG D CD    1 
ATOM   3757 N  NE    . ARG D 1 148 ? -20.146 2.767   -58.740 1.00 89.54  ? 148  ARG D NE    1 
ATOM   3758 C  CZ    . ARG D 1 148 ? -19.839 3.306   -59.915 1.00 93.37  ? 148  ARG D CZ    1 
ATOM   3759 N  NH1   . ARG D 1 148 ? -20.091 2.647   -61.036 1.00 101.15 ? 148  ARG D NH1   1 
ATOM   3760 N  NH2   . ARG D 1 148 ? -19.273 4.505   -59.967 1.00 92.61  ? 148  ARG D NH2   1 
ATOM   3761 N  N     . ASN D 1 149 ? -18.901 -1.147  -53.848 1.00 64.60  ? 149  ASN D N     1 
ATOM   3762 C  CA    . ASN D 1 149 ? -17.951 -2.012  -53.156 1.00 66.15  ? 149  ASN D CA    1 
ATOM   3763 C  C     . ASN D 1 149 ? -18.318 -3.488  -53.166 1.00 61.97  ? 149  ASN D C     1 
ATOM   3764 O  O     . ASN D 1 149 ? -19.439 -3.863  -53.506 1.00 67.87  ? 149  ASN D O     1 
ATOM   3765 C  CB    . ASN D 1 149 ? -17.788 -1.542  -51.707 1.00 72.24  ? 149  ASN D CB    1 
ATOM   3766 C  CG    . ASN D 1 149 ? -19.050 -1.722  -50.884 1.00 63.06  ? 149  ASN D CG    1 
ATOM   3767 O  OD1   . ASN D 1 149 ? -19.264 -2.782  -50.301 1.00 61.80  ? 149  ASN D OD1   1 
ATOM   3768 N  ND2   . ASN D 1 149 ? -19.892 -0.686  -50.833 1.00 60.00  ? 149  ASN D ND2   1 
ATOM   3769 N  N     . THR D 1 150 ? -17.363 -4.325  -52.774 0.99 70.90  ? 150  THR D N     1 
ATOM   3770 C  CA    . THR D 1 150 ? -17.559 -5.770  -52.767 0.99 71.61  ? 150  THR D CA    1 
ATOM   3771 C  C     . THR D 1 150 ? -16.880 -6.410  -51.565 0.99 70.72  ? 150  THR D C     1 
ATOM   3772 O  O     . THR D 1 150 ? -15.826 -5.956  -51.129 0.99 74.76  ? 150  THR D O     1 
ATOM   3773 C  CB    . THR D 1 150 ? -17.007 -6.423  -54.059 0.99 75.49  ? 150  THR D CB    1 
ATOM   3774 O  OG1   . THR D 1 150 ? -15.631 -6.044  -54.251 1.00 78.08  ? 150  THR D OG1   1 
ATOM   3775 C  CG2   . THR D 1 150 ? -17.823 -5.992  -55.281 1.00 64.37  ? 150  THR D CG2   1 
ATOM   3776 N  N     . ILE D 1 151 ? -17.474 -7.474  -51.036 1.00 59.72  ? 151  ILE D N     1 
ATOM   3777 C  CA    . ILE D 1 151 ? -16.840 -8.237  -49.959 1.00 60.14  ? 151  ILE D CA    1 
ATOM   3778 C  C     . ILE D 1 151 ? -16.457 -9.640  -50.420 1.00 59.64  ? 151  ILE D C     1 
ATOM   3779 O  O     . ILE D 1 151 ? -17.287 -10.348 -50.980 1.00 66.93  ? 151  ILE D O     1 
ATOM   3780 C  CB    . ILE D 1 151 ? -17.767 -8.379  -48.734 1.00 58.20  ? 151  ILE D CB    1 
ATOM   3781 C  CG1   . ILE D 1 151 ? -18.352 -7.032  -48.322 1.00 58.24  ? 151  ILE D CG1   1 
ATOM   3782 C  CG2   . ILE D 1 151 ? -17.031 -9.016  -47.575 1.00 57.16  ? 151  ILE D CG2   1 
ATOM   3783 C  CD1   . ILE D 1 151 ? -19.269 -7.142  -47.133 1.00 51.51  ? 151  ILE D CD1   1 
ATOM   3784 N  N     . HIS D 1 152 ? -15.217 -10.048 -50.174 1.00 55.83  ? 152  HIS D N     1 
ATOM   3785 C  CA    A HIS D 1 152 ? -14.732 -11.380 -50.533 0.46 62.09  ? 152  HIS D CA    1 
ATOM   3786 C  CA    B HIS D 1 152 ? -14.821 -11.417 -50.474 0.54 62.02  ? 152  HIS D CA    1 
ATOM   3787 C  C     . HIS D 1 152 ? -13.800 -11.927 -49.461 1.00 66.17  ? 152  HIS D C     1 
ATOM   3788 O  O     . HIS D 1 152 ? -13.209 -11.156 -48.707 1.00 63.64  ? 152  HIS D O     1 
ATOM   3789 C  CB    A HIS D 1 152 ? -13.981 -11.346 -51.862 0.46 65.32  ? 152  HIS D CB    1 
ATOM   3790 C  CB    B HIS D 1 152 ? -14.278 -11.521 -51.908 0.54 65.19  ? 152  HIS D CB    1 
ATOM   3791 C  CG    A HIS D 1 152 ? -14.805 -10.874 -53.014 0.46 64.55  ? 152  HIS D CG    1 
ATOM   3792 C  CG    B HIS D 1 152 ? -12.796 -11.323 -52.028 0.54 66.53  ? 152  HIS D CG    1 
ATOM   3793 N  ND1   A HIS D 1 152 ? -15.530 -11.734 -53.810 0.46 62.92  ? 152  HIS D ND1   1 
ATOM   3794 N  ND1   B HIS D 1 152 ? -11.892 -12.354 -51.879 0.54 63.01  ? 152  HIS D ND1   1 
ATOM   3795 C  CD2   A HIS D 1 152 ? -15.011 -9.632  -53.512 0.46 64.54  ? 152  HIS D CD2   1 
ATOM   3796 C  CD2   B HIS D 1 152 ? -12.062 -10.220 -52.314 0.54 67.72  ? 152  HIS D CD2   1 
ATOM   3797 C  CE1   A HIS D 1 152 ? -16.152 -11.041 -54.746 0.46 66.56  ? 152  HIS D CE1   1 
ATOM   3798 C  CE1   B HIS D 1 152 ? -10.666 -11.891 -52.055 0.54 67.20  ? 152  HIS D CE1   1 
ATOM   3799 N  NE2   A HIS D 1 152 ? -15.854 -9.764  -54.587 0.46 67.42  ? 152  HIS D NE2   1 
ATOM   3800 N  NE2   B HIS D 1 152 ? -10.741 -10.599 -52.317 0.54 67.36  ? 152  HIS D NE2   1 
ATOM   3801 N  N     . LEU D 1 153 ? -13.624 -13.244 -49.427 1.00 66.13  ? 153  LEU D N     1 
ATOM   3802 C  CA    . LEU D 1 153 ? -12.712 -13.847 -48.474 1.00 68.14  ? 153  LEU D CA    1 
ATOM   3803 C  C     . LEU D 1 153 ? -11.282 -13.758 -48.987 1.00 71.43  ? 153  LEU D C     1 
ATOM   3804 O  O     . LEU D 1 153 ? -10.853 -14.577 -49.796 1.00 75.69  ? 153  LEU D O     1 
ATOM   3805 C  CB    . LEU D 1 153 ? -13.092 -15.300 -48.201 1.00 67.15  ? 153  LEU D CB    1 
ATOM   3806 C  CG    . LEU D 1 153 ? -12.175 -16.041 -47.221 1.00 76.38  ? 153  LEU D CG    1 
ATOM   3807 C  CD1   . LEU D 1 153 ? -12.288 -15.481 -45.808 1.00 74.09  ? 153  LEU D CD1   1 
ATOM   3808 C  CD2   . LEU D 1 153 ? -12.449 -17.533 -47.239 1.00 77.86  ? 153  LEU D CD2   1 
ATOM   3809 N  N     . ASP D 1 154 ? -10.545 -12.768 -48.498 1.00 74.97  ? 154  ASP D N     1 
ATOM   3810 C  CA    . ASP D 1 154 ? -9.207  -12.467 -49.003 1.00 74.51  ? 154  ASP D CA    1 
ATOM   3811 C  C     . ASP D 1 154 ? -8.145  -13.447 -48.490 1.00 75.95  ? 154  ASP D C     1 
ATOM   3812 O  O     . ASP D 1 154 ? -7.355  -13.976 -49.268 1.00 81.18  ? 154  ASP D O     1 
ATOM   3813 C  CB    . ASP D 1 154 ? -8.836  -11.030 -48.641 1.00 71.90  ? 154  ASP D CB    1 
ATOM   3814 C  CG    . ASP D 1 154 ? -7.453  -10.646 -49.112 1.00 79.46  ? 154  ASP D CG    1 
ATOM   3815 O  OD1   . ASP D 1 154 ? -7.287  -10.387 -50.323 1.00 85.07  ? 154  ASP D OD1   1 
ATOM   3816 O  OD2   . ASP D 1 154 ? -6.534  -10.583 -48.267 1.00 83.49  ? 154  ASP D OD2   1 
ATOM   3817 N  N     . ASP D 1 155 ? -8.134  -13.697 -47.186 1.00 75.19  ? 155  ASP D N     1 
ATOM   3818 C  CA    . ASP D 1 155 ? -7.230  -14.682 -46.604 1.00 72.90  ? 155  ASP D CA    1 
ATOM   3819 C  C     . ASP D 1 155 ? -7.951  -15.986 -46.255 1.00 81.34  ? 155  ASP D C     1 
ATOM   3820 O  O     . ASP D 1 155 ? -8.810  -16.000 -45.379 1.00 83.97  ? 155  ASP D O     1 
ATOM   3821 C  CB    . ASP D 1 155 ? -6.571  -14.112 -45.355 1.00 69.92  ? 155  ASP D CB    1 
ATOM   3822 C  CG    . ASP D 1 155 ? -5.462  -14.995 -44.829 1.00 79.55  ? 155  ASP D CG    1 
ATOM   3823 O  OD1   . ASP D 1 155 ? -5.480  -16.213 -45.106 1.00 81.69  ? 155  ASP D OD1   1 
ATOM   3824 O  OD2   . ASP D 1 155 ? -4.568  -14.471 -44.132 1.00 78.75  ? 155  ASP D OD2   1 
ATOM   3825 N  N     . HIS D 1 156 ? -7.579  -17.082 -46.914 1.00 86.07  ? 156  HIS D N     1 
ATOM   3826 C  CA    A HIS D 1 156 ? -8.201  -18.376 -46.628 0.56 81.87  ? 156  HIS D CA    1 
ATOM   3827 C  CA    B HIS D 1 156 ? -8.166  -18.396 -46.656 0.44 81.84  ? 156  HIS D CA    1 
ATOM   3828 C  C     . HIS D 1 156 ? -7.508  -19.085 -45.466 1.00 79.27  ? 156  HIS D C     1 
ATOM   3829 O  O     . HIS D 1 156 ? -8.033  -20.059 -44.934 1.00 84.22  ? 156  HIS D O     1 
ATOM   3830 C  CB    A HIS D 1 156 ? -8.191  -19.286 -47.866 0.56 83.08  ? 156  HIS D CB    1 
ATOM   3831 C  CB    B HIS D 1 156 ? -8.038  -19.292 -47.892 0.44 83.08  ? 156  HIS D CB    1 
ATOM   3832 C  CG    A HIS D 1 156 ? -9.402  -19.146 -48.738 0.56 81.39  ? 156  HIS D CG    1 
ATOM   3833 C  CG    B HIS D 1 156 ? -6.619  -19.595 -48.270 0.44 83.72  ? 156  HIS D CG    1 
ATOM   3834 N  ND1   A HIS D 1 156 ? -9.531  -18.147 -49.680 0.56 83.51  ? 156  HIS D ND1   1 
ATOM   3835 N  ND1   B HIS D 1 156 ? -5.960  -20.729 -47.847 0.44 80.98  ? 156  HIS D ND1   1 
ATOM   3836 C  CD2   A HIS D 1 156 ? -10.534 -19.884 -48.817 0.56 80.52  ? 156  HIS D CD2   1 
ATOM   3837 C  CD2   B HIS D 1 156 ? -5.729  -18.903 -49.021 0.44 85.15  ? 156  HIS D CD2   1 
ATOM   3838 C  CE1   A HIS D 1 156 ? -10.693 -18.272 -50.296 0.56 80.94  ? 156  HIS D CE1   1 
ATOM   3839 C  CE1   B HIS D 1 156 ? -4.729  -20.727 -48.326 0.44 81.60  ? 156  HIS D CE1   1 
ATOM   3840 N  NE2   A HIS D 1 156 ? -11.320 -19.319 -49.792 0.56 83.83  ? 156  HIS D NE2   1 
ATOM   3841 N  NE2   B HIS D 1 156 ? -4.563  -19.629 -49.042 0.44 85.40  ? 156  HIS D NE2   1 
ATOM   3842 N  N     . ARG D 1 157 ? -6.340  -18.589 -45.067 1.00 73.12  ? 157  ARG D N     1 
ATOM   3843 C  CA    . ARG D 1 157 ? -5.567  -19.229 -43.999 1.00 75.28  ? 157  ARG D CA    1 
ATOM   3844 C  C     . ARG D 1 157 ? -6.079  -18.883 -42.608 1.00 78.47  ? 157  ARG D C     1 
ATOM   3845 O  O     . ARG D 1 157 ? -5.897  -19.645 -41.658 1.00 81.49  ? 157  ARG D O     1 
ATOM   3846 C  CB    . ARG D 1 157 ? -4.090  -18.836 -44.086 1.00 68.94  ? 157  ARG D CB    1 
ATOM   3847 C  CG    . ARG D 1 157 ? -3.503  -18.868 -45.474 1.00 74.51  ? 157  ARG D CG    1 
ATOM   3848 C  CD    . ARG D 1 157 ? -2.173  -18.136 -45.507 1.00 74.64  ? 157  ARG D CD    1 
ATOM   3849 N  NE    . ARG D 1 157 ? -2.352  -16.688 -45.448 1.00 73.40  ? 157  ARG D NE    1 
ATOM   3850 C  CZ    . ARG D 1 157 ? -1.355  -15.807 -45.411 1.00 75.64  ? 157  ARG D CZ    1 
ATOM   3851 N  NH1   . ARG D 1 157 ? -0.092  -16.222 -45.436 1.00 70.08  ? 157  ARG D NH1   1 
ATOM   3852 N  NH2   . ARG D 1 157 ? -1.621  -14.506 -45.362 1.00 72.14  ? 157  ARG D NH2   1 
ATOM   3853 N  N     . HIS D 1 158 ? -6.699  -17.717 -42.485 1.00 74.83  ? 158  HIS D N     1 
ATOM   3854 C  CA    . HIS D 1 158 ? -7.075  -17.203 -41.180 1.00 74.50  ? 158  HIS D CA    1 
ATOM   3855 C  C     . HIS D 1 158 ? -8.542  -16.820 -41.181 1.00 65.84  ? 158  HIS D C     1 
ATOM   3856 O  O     . HIS D 1 158 ? -9.136  -16.567 -40.141 1.00 70.54  ? 158  HIS D O     1 
ATOM   3857 C  CB    . HIS D 1 158 ? -6.200  -15.999 -40.800 1.00 69.37  ? 158  HIS D CB    1 
ATOM   3858 C  CG    . HIS D 1 158 ? -4.753  -16.333 -40.613 1.00 67.12  ? 158  HIS D CG    1 
ATOM   3859 N  ND1   . HIS D 1 158 ? -3.790  -16.023 -41.548 1.00 72.49  ? 158  HIS D ND1   1 
ATOM   3860 C  CD2   . HIS D 1 158 ? -4.102  -16.945 -39.594 1.00 69.00  ? 158  HIS D CD2   1 
ATOM   3861 C  CE1   . HIS D 1 158 ? -2.608  -16.430 -41.117 1.00 68.08  ? 158  HIS D CE1   1 
ATOM   3862 N  NE2   . HIS D 1 158 ? -2.771  -16.994 -39.934 1.00 66.07  ? 158  HIS D NE2   1 
ATOM   3863 N  N     . GLY D 1 159 ? -9.123  -16.768 -42.364 1.00 63.81  ? 159  GLY D N     1 
ATOM   3864 C  CA    . GLY D 1 159 ? -10.536 -16.493 -42.473 1.00 64.93  ? 159  GLY D CA    1 
ATOM   3865 C  C     . GLY D 1 159 ? -10.819 -15.016 -42.423 1.00 69.12  ? 159  GLY D C     1 
ATOM   3866 O  O     . GLY D 1 159 ? -11.759 -14.573 -41.762 1.00 75.32  ? 159  GLY D O     1 
ATOM   3867 N  N     . VAL D 1 160 ? -10.010 -14.242 -43.129 1.00 62.63  ? 160  VAL D N     1 
ATOM   3868 C  CA    . VAL D 1 160 ? -10.165 -12.801 -43.077 1.00 61.26  ? 160  VAL D CA    1 
ATOM   3869 C  C     . VAL D 1 160 ? -10.789 -12.270 -44.346 1.00 60.15  ? 160  VAL D C     1 
ATOM   3870 O  O     . VAL D 1 160 ? -10.244 -12.437 -45.430 1.00 65.13  ? 160  VAL D O     1 
ATOM   3871 C  CB    . VAL D 1 160 ? -8.825  -12.107 -42.854 1.00 64.38  ? 160  VAL D CB    1 
ATOM   3872 C  CG1   . VAL D 1 160 ? -9.051  -10.623 -42.519 1.00 54.21  ? 160  VAL D CG1   1 
ATOM   3873 C  CG2   . VAL D 1 160 ? -8.046  -12.832 -41.768 1.00 56.03  ? 160  VAL D CG2   1 
ATOM   3874 N  N     . TYR D 1 161 ? -11.933 -11.621 -44.213 0.99 65.53  ? 161  TYR D N     1 
ATOM   3875 C  CA    . TYR D 1 161 ? -12.591 -11.057 -45.382 0.99 70.30  ? 161  TYR D CA    1 
ATOM   3876 C  C     . TYR D 1 161 ? -12.028 -9.677  -45.701 0.99 66.00  ? 161  TYR D C     1 
ATOM   3877 O  O     . TYR D 1 161 ? -11.315 -9.082  -44.895 0.99 66.44  ? 161  TYR D O     1 
ATOM   3878 C  CB    . TYR D 1 161 ? -14.106 -10.980 -45.169 0.99 68.61  ? 161  TYR D CB    1 
ATOM   3879 C  CG    . TYR D 1 161 ? -14.742 -12.320 -44.892 0.99 69.76  ? 161  TYR D CG    1 
ATOM   3880 C  CD1   . TYR D 1 161 ? -14.697 -12.886 -43.623 1.00 73.20  ? 161  TYR D CD1   1 
ATOM   3881 C  CD2   . TYR D 1 161 ? -15.382 -13.024 -45.897 1.00 73.63  ? 161  TYR D CD2   1 
ATOM   3882 C  CE1   . TYR D 1 161 ? -15.275 -14.114 -43.366 1.00 74.54  ? 161  TYR D CE1   1 
ATOM   3883 C  CE2   . TYR D 1 161 ? -15.964 -14.249 -45.647 1.00 73.61  ? 161  TYR D CE2   1 
ATOM   3884 C  CZ    . TYR D 1 161 ? -15.906 -14.788 -44.384 0.99 72.38  ? 161  TYR D CZ    1 
ATOM   3885 O  OH    . TYR D 1 161 ? -16.479 -16.009 -44.136 0.99 74.04  ? 161  TYR D OH    1 
ATOM   3886 N  N     . VAL D 1 162 ? -12.343 -9.175  -46.888 1.00 60.62  ? 162  VAL D N     1 
ATOM   3887 C  CA    . VAL D 1 162 ? -11.959 -7.826  -47.246 1.00 56.43  ? 162  VAL D CA    1 
ATOM   3888 C  C     . VAL D 1 162 ? -13.155 -7.145  -47.878 1.00 58.11  ? 162  VAL D C     1 
ATOM   3889 O  O     . VAL D 1 162 ? -13.948 -7.775  -48.564 1.00 61.37  ? 162  VAL D O     1 
ATOM   3890 C  CB    . VAL D 1 162 ? -10.746 -7.797  -48.208 1.00 63.07  ? 162  VAL D CB    1 
ATOM   3891 C  CG1   . VAL D 1 162 ? -11.088 -8.439  -49.547 1.00 60.80  ? 162  VAL D CG1   1 
ATOM   3892 C  CG2   . VAL D 1 162 ? -10.236 -6.369  -48.395 1.00 60.43  ? 162  VAL D CG2   1 
ATOM   3893 N  N     . LEU D 1 163 ? -13.324 -5.867  -47.578 1.00 67.58  ? 163  LEU D N     1 
ATOM   3894 C  CA    . LEU D 1 163 ? -14.253 -5.037  -48.308 1.00 62.30  ? 163  LEU D CA    1 
ATOM   3895 C  C     . LEU D 1 163 ? -13.382 -4.296  -49.291 1.00 66.62  ? 163  LEU D C     1 
ATOM   3896 O  O     . LEU D 1 163 ? -12.407 -3.654  -48.881 1.00 65.71  ? 163  LEU D O     1 
ATOM   3897 C  CB    . LEU D 1 163 ? -15.021 -4.085  -47.384 1.00 59.97  ? 163  LEU D CB    1 
ATOM   3898 C  CG    . LEU D 1 163 ? -16.140 -3.204  -47.967 1.00 67.62  ? 163  LEU D CG    1 
ATOM   3899 C  CD1   . LEU D 1 163 ? -17.140 -2.857  -46.891 1.00 64.94  ? 163  LEU D CD1   1 
ATOM   3900 C  CD2   . LEU D 1 163 ? -15.605 -1.919  -48.581 1.00 66.41  ? 163  LEU D CD2   1 
ATOM   3901 N  N     . ASN D 1 164 ? -13.688 -4.430  -50.582 1.00 68.52  ? 164  ASN D N     1 
ATOM   3902 C  CA    . ASN D 1 164 ? -12.965 -3.701  -51.617 1.00 63.28  ? 164  ASN D CA    1 
ATOM   3903 C  C     . ASN D 1 164 ? -13.814 -2.551  -52.099 1.00 68.18  ? 164  ASN D C     1 
ATOM   3904 O  O     . ASN D 1 164 ? -14.987 -2.729  -52.426 1.00 66.93  ? 164  ASN D O     1 
ATOM   3905 C  CB    . ASN D 1 164 ? -12.581 -4.609  -52.782 1.00 67.55  ? 164  ASN D CB    1 
ATOM   3906 C  CG    . ASN D 1 164 ? -11.575 -3.954  -53.730 1.00 79.41  ? 164  ASN D CG    1 
ATOM   3907 O  OD1   . ASN D 1 164 ? -10.412 -3.728  -53.375 1.00 79.96  ? 164  ASN D OD1   1 
ATOM   3908 N  ND2   . ASN D 1 164 ? -12.018 -3.660  -54.947 1.00 81.68  ? 164  ASN D ND2   1 
ATOM   3909 N  N     . ILE D 1 165 ? -13.223 -1.362  -52.097 1.00 69.86  ? 165  ILE D N     1 
ATOM   3910 C  CA    . ILE D 1 165 ? -13.887 -0.170  -52.595 1.00 71.75  ? 165  ILE D CA    1 
ATOM   3911 C  C     . ILE D 1 165 ? -13.462 0.029   -54.039 1.00 76.84  ? 165  ILE D C     1 
ATOM   3912 O  O     . ILE D 1 165 ? -12.268 0.049   -54.340 1.00 84.29  ? 165  ILE D O     1 
ATOM   3913 C  CB    . ILE D 1 165 ? -13.545 1.079   -51.759 1.00 67.32  ? 165  ILE D CB    1 
ATOM   3914 C  CG1   . ILE D 1 165 ? -14.337 1.086   -50.452 1.00 72.90  ? 165  ILE D CG1   1 
ATOM   3915 C  CG2   . ILE D 1 165 ? -13.863 2.336   -52.518 1.00 64.23  ? 165  ILE D CG2   1 
ATOM   3916 C  CD1   . ILE D 1 165 ? -13.482 0.917   -49.214 1.00 72.15  ? 165  ILE D CD1   1 
ATOM   3917 N  N     . SER D 1 166 ? -14.439 0.151   -54.933 1.00 78.01  ? 166  SER D N     1 
ATOM   3918 C  CA    . SER D 1 166 ? -14.152 0.328   -56.348 1.00 80.84  ? 166  SER D CA    1 
ATOM   3919 C  C     . SER D 1 166 ? -13.394 1.624   -56.617 1.00 81.44  ? 166  SER D C     1 
ATOM   3920 O  O     . SER D 1 166 ? -13.733 2.689   -56.089 1.00 77.57  ? 166  SER D O     1 
ATOM   3921 C  CB    . SER D 1 166 ? -15.442 0.306   -57.172 1.00 80.57  ? 166  SER D CB    1 
ATOM   3922 O  OG    . SER D 1 166 ? -15.139 0.287   -58.558 1.00 76.99  ? 166  SER D OG    1 
ATOM   3923 N  N     . LEU D 1 167 ? -12.365 1.524   -57.451 1.00 88.77  ? 167  LEU D N     1 
ATOM   3924 C  CA    . LEU D 1 167 ? -11.587 2.687   -57.855 1.00 86.05  ? 167  LEU D CA    1 
ATOM   3925 C  C     . LEU D 1 167 ? -12.406 3.590   -58.779 1.00 82.98  ? 167  LEU D C     1 
ATOM   3926 O  O     . LEU D 1 167 ? -12.023 4.728   -59.044 1.00 87.30  ? 167  LEU D O     1 
ATOM   3927 C  CB    . LEU D 1 167 ? -10.293 2.238   -58.529 1.00 87.34  ? 167  LEU D CB    1 
ATOM   3928 C  CG    . LEU D 1 167 ? -9.500  1.246   -57.683 1.00 84.33  ? 167  LEU D CG    1 
ATOM   3929 C  CD1   . LEU D 1 167 ? -8.294  0.717   -58.432 1.00 84.43  ? 167  LEU D CD1   1 
ATOM   3930 C  CD2   . LEU D 1 167 ? -9.072  1.916   -56.397 1.00 82.28  ? 167  LEU D CD2   1 
ATOM   3931 N  N     . ARG D 1 168 ? -13.543 3.080   -59.251 1.00 97.39  ? 168  ARG D N     1 
ATOM   3932 C  CA    . ARG D 1 168 ? -14.512 3.896   -59.979 1.00 105.51 ? 168  ARG D CA    1 
ATOM   3933 C  C     . ARG D 1 168 ? -15.171 4.926   -59.062 1.00 105.11 ? 168  ARG D C     1 
ATOM   3934 O  O     . ARG D 1 168 ? -15.974 5.741   -59.521 1.00 113.67 ? 168  ARG D O     1 
ATOM   3935 C  CB    . ARG D 1 168 ? -15.601 3.027   -60.636 1.00 106.23 ? 168  ARG D CB    1 
ATOM   3936 C  CG    . ARG D 1 168 ? -15.081 1.925   -61.560 1.00 111.43 ? 168  ARG D CG    1 
ATOM   3937 C  CD    . ARG D 1 168 ? -15.838 1.876   -62.900 1.00 121.73 ? 168  ARG D CD    1 
ATOM   3938 N  NE    . ARG D 1 168 ? -16.335 3.192   -63.313 1.00 129.57 ? 168  ARG D NE    1 
ATOM   3939 C  CZ    . ARG D 1 168 ? -17.007 3.430   -64.437 1.00 126.23 ? 168  ARG D CZ    1 
ATOM   3940 N  NH1   . ARG D 1 168 ? -17.252 2.445   -65.293 1.00 129.57 ? 168  ARG D NH1   1 
ATOM   3941 N  NH2   . ARG D 1 168 ? -17.417 4.661   -64.717 1.00 127.94 ? 168  ARG D NH2   1 
ATOM   3942 N  N     . ASP D 1 169 ? -14.850 4.881   -57.770 1.00 85.02  ? 169  ASP D N     1 
ATOM   3943 C  CA    . ASP D 1 169 ? -15.425 5.820   -56.816 1.00 83.96  ? 169  ASP D CA    1 
ATOM   3944 C  C     . ASP D 1 169 ? -14.360 6.382   -55.883 1.00 81.88  ? 169  ASP D C     1 
ATOM   3945 O  O     . ASP D 1 169 ? -14.677 7.102   -54.935 1.00 81.58  ? 169  ASP D O     1 
ATOM   3946 C  CB    . ASP D 1 169 ? -16.547 5.152   -56.009 1.00 89.49  ? 169  ASP D CB    1 
ATOM   3947 C  CG    . ASP D 1 169 ? -17.808 4.896   -56.842 1.00 90.99  ? 169  ASP D CG    1 
ATOM   3948 O  OD1   . ASP D 1 169 ? -18.240 5.804   -57.593 1.00 89.64  ? 169  ASP D OD1   1 
ATOM   3949 O  OD2   . ASP D 1 169 ? -18.369 3.784   -56.735 1.00 88.20  ? 169  ASP D OD2   1 
ATOM   3950 N  N     . ARG D 1 170 ? -13.101 6.063   -56.184 1.00 88.71  ? 170  ARG D N     1 
ATOM   3951 C  CA    . ARG D 1 170 ? -11.948 6.507   -55.401 1.00 86.20  ? 170  ARG D CA    1 
ATOM   3952 C  C     . ARG D 1 170 ? -12.065 7.935   -54.883 1.00 88.39  ? 170  ARG D C     1 
ATOM   3953 O  O     . ARG D 1 170 ? -11.900 8.177   -53.691 1.00 93.94  ? 170  ARG D O     1 
ATOM   3954 C  CB    . ARG D 1 170 ? -10.661 6.375   -56.224 1.00 92.55  ? 170  ARG D CB    1 
ATOM   3955 C  CG    . ARG D 1 170 ? -9.492  7.217   -55.698 1.00 96.21  ? 170  ARG D CG    1 
ATOM   3956 C  CD    . ARG D 1 170 ? -8.136  6.614   -56.048 1.00 91.78  ? 170  ARG D CD    1 
ATOM   3957 N  NE    . ARG D 1 170 ? -8.195  5.874   -57.303 1.00 101.01 ? 170  ARG D NE    1 
ATOM   3958 C  CZ    . ARG D 1 170 ? -7.750  6.339   -58.468 1.00 104.83 ? 170  ARG D CZ    1 
ATOM   3959 N  NH1   . ARG D 1 170 ? -7.210  7.554   -58.541 1.00 103.87 ? 170  ARG D NH1   1 
ATOM   3960 N  NH2   . ARG D 1 170 ? -7.851  5.591   -59.564 1.00 89.24  ? 170  ARG D NH2   1 
ATOM   3961 N  N     . ILE D 1 171 ? -12.370 8.874   -55.769 1.00 82.85  ? 171  ILE D N     1 
ATOM   3962 C  CA    . ILE D 1 171 ? -12.383 10.284  -55.393 1.00 81.45  ? 171  ILE D CA    1 
ATOM   3963 C  C     . ILE D 1 171 ? -13.528 10.590  -54.433 1.00 78.92  ? 171  ILE D C     1 
ATOM   3964 O  O     . ILE D 1 171 ? -13.351 11.341  -53.468 1.00 76.90  ? 171  ILE D O     1 
ATOM   3965 C  CB    . ILE D 1 171 ? -12.462 11.205  -56.643 1.00 83.74  ? 171  ILE D CB    1 
ATOM   3966 C  CG1   . ILE D 1 171 ? -11.057 11.482  -57.187 1.00 81.31  ? 171  ILE D CG1   1 
ATOM   3967 C  CG2   . ILE D 1 171 ? -13.123 12.539  -56.316 1.00 75.22  ? 171  ILE D CG2   1 
ATOM   3968 C  CD1   . ILE D 1 171 ? -10.394 10.299  -57.841 1.00 81.79  ? 171  ILE D CD1   1 
ATOM   3969 N  N     . LYS D 1 172 ? -14.694 10.002  -54.672 1.00 78.26  ? 172  LYS D N     1 
ATOM   3970 C  CA    . LYS D 1 172 ? -15.811 10.228  -53.768 1.00 79.11  ? 172  LYS D CA    1 
ATOM   3971 C  C     . LYS D 1 172 ? -15.457 9.706   -52.377 1.00 81.41  ? 172  LYS D C     1 
ATOM   3972 O  O     . LYS D 1 172 ? -15.632 10.398  -51.369 1.00 74.81  ? 172  LYS D O     1 
ATOM   3973 C  CB    . LYS D 1 172 ? -17.091 9.556   -54.274 1.00 80.12  ? 172  LYS D CB    1 
ATOM   3974 C  CG    . LYS D 1 172 ? -18.212 9.558   -53.234 1.00 78.73  ? 172  LYS D CG    1 
ATOM   3975 C  CD    . LYS D 1 172 ? -19.491 8.946   -53.755 1.00 76.25  ? 172  LYS D CD    1 
ATOM   3976 C  CE    . LYS D 1 172 ? -20.301 9.931   -54.569 1.00 81.96  ? 172  LYS D CE    1 
ATOM   3977 N  NZ    . LYS D 1 172 ? -21.599 9.328   -54.990 1.00 82.44  ? 172  LYS D NZ    1 
ATOM   3978 N  N     . PHE D 1 173 ? -14.936 8.484   -52.338 1.00 81.76  ? 173  PHE D N     1 
ATOM   3979 C  CA    . PHE D 1 173 ? -14.591 7.842   -51.079 1.00 80.45  ? 173  PHE D CA    1 
ATOM   3980 C  C     . PHE D 1 173 ? -13.556 8.640   -50.285 1.00 81.61  ? 173  PHE D C     1 
ATOM   3981 O  O     . PHE D 1 173 ? -13.750 8.911   -49.101 1.00 80.17  ? 173  PHE D O     1 
ATOM   3982 C  CB    . PHE D 1 173 ? -14.074 6.425   -51.329 1.00 77.73  ? 173  PHE D CB    1 
ATOM   3983 C  CG    . PHE D 1 173 ? -13.667 5.710   -50.079 1.00 76.00  ? 173  PHE D CG    1 
ATOM   3984 C  CD1   . PHE D 1 173 ? -14.621 5.194   -49.221 1.00 73.68  ? 173  PHE D CD1   1 
ATOM   3985 C  CD2   . PHE D 1 173 ? -12.334 5.567   -49.753 1.00 77.78  ? 173  PHE D CD2   1 
ATOM   3986 C  CE1   . PHE D 1 173 ? -14.253 4.537   -48.065 1.00 72.20  ? 173  PHE D CE1   1 
ATOM   3987 C  CE2   . PHE D 1 173 ? -11.960 4.919   -48.589 1.00 76.25  ? 173  PHE D CE2   1 
ATOM   3988 C  CZ    . PHE D 1 173 ? -12.925 4.400   -47.749 1.00 72.95  ? 173  PHE D CZ    1 
ATOM   3989 N  N     . VAL D 1 174 ? -12.462 9.025   -50.931 1.00 70.07  ? 174  VAL D N     1 
ATOM   3990 C  CA    . VAL D 1 174 ? -11.372 9.655   -50.205 1.00 69.87  ? 174  VAL D CA    1 
ATOM   3991 C  C     . VAL D 1 174 ? -11.719 11.083  -49.791 1.00 74.93  ? 174  VAL D C     1 
ATOM   3992 O  O     . VAL D 1 174 ? -11.207 11.588  -48.795 1.00 81.33  ? 174  VAL D O     1 
ATOM   3993 C  CB    . VAL D 1 174 ? -10.068 9.652   -51.035 1.00 72.37  ? 174  VAL D CB    1 
ATOM   3994 C  CG1   . VAL D 1 174 ? -8.925  10.313  -50.264 1.00 65.18  ? 174  VAL D CG1   1 
ATOM   3995 C  CG2   . VAL D 1 174 ? -9.695  8.230   -51.415 1.00 73.56  ? 174  VAL D CG2   1 
ATOM   3996 N  N     . HIS D 1 175 ? -12.601 11.742  -50.531 1.00 92.28  ? 175  HIS D N     1 
ATOM   3997 C  CA    . HIS D 1 175 ? -12.870 13.138  -50.216 1.00 89.77  ? 175  HIS D CA    1 
ATOM   3998 C  C     . HIS D 1 175 ? -14.121 13.288  -49.358 1.00 90.16  ? 175  HIS D C     1 
ATOM   3999 O  O     . HIS D 1 175 ? -14.131 14.065  -48.405 1.00 92.03  ? 175  HIS D O     1 
ATOM   4000 C  CB    . HIS D 1 175 ? -12.987 13.976  -51.494 1.00 94.03  ? 175  HIS D CB    1 
ATOM   4001 C  CG    . HIS D 1 175 ? -12.766 15.442  -51.267 1.00 102.74 ? 175  HIS D CG    1 
ATOM   4002 N  ND1   . HIS D 1 175 ? -13.681 16.404  -51.642 1.00 104.94 ? 175  HIS D ND1   1 
ATOM   4003 C  CD2   . HIS D 1 175 ? -11.742 16.108  -50.678 1.00 102.54 ? 175  HIS D CD2   1 
ATOM   4004 C  CE1   . HIS D 1 175 ? -13.226 17.598  -51.305 1.00 102.65 ? 175  HIS D CE1   1 
ATOM   4005 N  NE2   . HIS D 1 175 ? -12.051 17.447  -50.719 1.00 107.70 ? 175  HIS D NE2   1 
ATOM   4006 N  N     . THR D 1 176 ? -15.174 12.548  -49.678 1.00 83.73  ? 176  THR D N     1 
ATOM   4007 C  CA    . THR D 1 176 ? -16.416 12.688  -48.930 1.00 85.19  ? 176  THR D CA    1 
ATOM   4008 C  C     . THR D 1 176 ? -16.310 12.033  -47.565 1.00 85.19  ? 176  THR D C     1 
ATOM   4009 O  O     . THR D 1 176 ? -16.868 12.528  -46.584 1.00 89.19  ? 176  THR D O     1 
ATOM   4010 C  CB    . THR D 1 176 ? -17.614 12.085  -49.699 1.00 86.40  ? 176  THR D CB    1 
ATOM   4011 O  OG1   . THR D 1 176 ? -17.864 12.869  -50.870 1.00 83.07  ? 176  THR D OG1   1 
ATOM   4012 C  CG2   . THR D 1 176 ? -18.878 12.063  -48.834 1.00 94.18  ? 176  THR D CG2   1 
ATOM   4013 N  N     . ILE D 1 177 ? -15.571 10.932  -47.500 1.00 87.06  ? 177  ILE D N     1 
ATOM   4014 C  CA    . ILE D 1 177 ? -15.511 10.131  -46.282 1.00 88.03  ? 177  ILE D CA    1 
ATOM   4015 C  C     . ILE D 1 177 ? -14.209 10.348  -45.484 1.00 88.87  ? 177  ILE D C     1 
ATOM   4016 O  O     . ILE D 1 177 ? -14.272 10.869  -44.366 1.00 89.90  ? 177  ILE D O     1 
ATOM   4017 C  CB    . ILE D 1 177 ? -15.716 8.636   -46.619 1.00 81.26  ? 177  ILE D CB    1 
ATOM   4018 C  CG1   . ILE D 1 177 ? -17.078 8.464   -47.288 1.00 87.57  ? 177  ILE D CG1   1 
ATOM   4019 C  CG2   . ILE D 1 177 ? -15.646 7.772   -45.377 1.00 75.75  ? 177  ILE D CG2   1 
ATOM   4020 C  CD1   . ILE D 1 177 ? -17.442 7.041   -47.569 1.00 90.58  ? 177  ILE D CD1   1 
ATOM   4021 N  N     . LEU D 1 178 ? -13.046 9.983   -46.038 1.00 73.48  ? 178  LEU D N     1 
ATOM   4022 C  CA    . LEU D 1 178 ? -11.776 10.171  -45.316 1.00 72.20  ? 178  LEU D CA    1 
ATOM   4023 C  C     . LEU D 1 178 ? -11.458 11.636  -45.009 1.00 75.90  ? 178  LEU D C     1 
ATOM   4024 O  O     . LEU D 1 178 ? -10.804 11.930  -44.005 1.00 75.51  ? 178  LEU D O     1 
ATOM   4025 C  CB    . LEU D 1 178 ? -10.602 9.561   -46.086 1.00 63.26  ? 178  LEU D CB    1 
ATOM   4026 C  CG    . LEU D 1 178 ? -10.621 8.047   -46.268 1.00 67.90  ? 178  LEU D CG    1 
ATOM   4027 C  CD1   . LEU D 1 178 ? -9.303  7.545   -46.842 1.00 56.39  ? 178  LEU D CD1   1 
ATOM   4028 C  CD2   . LEU D 1 178 ? -10.917 7.386   -44.940 1.00 64.67  ? 178  LEU D CD2   1 
ATOM   4029 N  N     . SER D 1 179 ? -11.924 12.551  -45.861 1.00 76.42  ? 179  SER D N     1 
ATOM   4030 C  CA    . SER D 1 179 ? -11.648 13.977  -45.678 1.00 74.45  ? 179  SER D CA    1 
ATOM   4031 C  C     . SER D 1 179 ? -12.830 14.802  -45.166 1.00 76.88  ? 179  SER D C     1 
ATOM   4032 O  O     . SER D 1 179 ? -12.851 16.016  -45.349 1.00 82.01  ? 179  SER D O     1 
ATOM   4033 C  CB    . SER D 1 179 ? -11.150 14.589  -46.986 1.00 71.40  ? 179  SER D CB    1 
ATOM   4034 O  OG    . SER D 1 179 ? -9.901  14.048  -47.351 1.00 67.30  ? 179  SER D OG    1 
ATOM   4035 N  N     . SER D 1 180 ? -13.799 14.161  -44.518 1.00 75.56  ? 180  SER D N     1 
ATOM   4036 C  CA    . SER D 1 180 ? -14.881 14.909  -43.877 1.00 79.92  ? 180  SER D CA    1 
ATOM   4037 C  C     . SER D 1 180 ? -14.395 15.732  -42.676 1.00 89.02  ? 180  SER D C     1 
ATOM   4038 O  O     . SER D 1 180 ? -13.579 15.261  -41.868 1.00 89.68  ? 180  SER D O     1 
ATOM   4039 C  CB    . SER D 1 180 ? -15.999 13.971  -43.424 1.00 84.16  ? 180  SER D CB    1 
ATOM   4040 O  OG    . SER D 1 180 ? -17.069 14.712  -42.850 1.00 83.34  ? 180  SER D OG    1 
ATOM   4041 N  N     . HIS D 1 181 ? -14.918 16.953  -42.555 1.00 94.97  ? 181  HIS D N     1 
ATOM   4042 C  CA    . HIS D 1 181 ? -14.562 17.850  -41.455 1.00 93.43  ? 181  HIS D CA    1 
ATOM   4043 C  C     . HIS D 1 181 ? -15.648 17.931  -40.368 1.00 98.05  ? 181  HIS D C     1 
ATOM   4044 O  O     . HIS D 1 181 ? -15.668 18.865  -39.554 1.00 93.43  ? 181  HIS D O     1 
ATOM   4045 C  CB    . HIS D 1 181 ? -14.257 19.247  -42.000 1.00 97.04  ? 181  HIS D CB    1 
ATOM   4046 C  CG    . HIS D 1 181 ? -12.971 19.328  -42.768 1.00 101.27 ? 181  HIS D CG    1 
ATOM   4047 N  ND1   . HIS D 1 181 ? -12.723 18.568  -43.893 1.00 99.25  ? 181  HIS D ND1   1 
ATOM   4048 C  CD2   . HIS D 1 181 ? -11.853 20.066  -42.559 1.00 99.71  ? 181  HIS D CD2   1 
ATOM   4049 C  CE1   . HIS D 1 181 ? -11.514 18.842  -44.349 1.00 102.62 ? 181  HIS D CE1   1 
ATOM   4050 N  NE2   . HIS D 1 181 ? -10.964 19.747  -43.559 1.00 103.37 ? 181  HIS D NE2   1 
ATOM   4051 N  N     . LEU D 1 182 ? -16.539 16.942  -40.357 1.00 109.25 ? 182  LEU D N     1 
ATOM   4052 C  CA    . LEU D 1 182 ? -17.600 16.854  -39.355 1.00 108.73 ? 182  LEU D CA    1 
ATOM   4053 C  C     . LEU D 1 182 ? -17.105 16.136  -38.093 1.00 107.47 ? 182  LEU D C     1 
ATOM   4054 O  O     . LEU D 1 182 ? -17.730 16.196  -37.026 1.00 108.43 ? 182  LEU D O     1 
ATOM   4055 C  CB    . LEU D 1 182 ? -18.817 16.118  -39.933 1.00 112.04 ? 182  LEU D CB    1 
ATOM   4056 C  CG    . LEU D 1 182 ? -19.375 16.481  -41.316 1.00 114.03 ? 182  LEU D CG    1 
ATOM   4057 C  CD1   . LEU D 1 182 ? -20.538 15.544  -41.679 1.00 102.17 ? 182  LEU D CD1   1 
ATOM   4058 C  CD2   . LEU D 1 182 ? -19.819 17.938  -41.365 1.00 108.01 ? 182  LEU D CD2   1 
ATOM   4059 N  N     . ASN D 1 183 ? -15.972 15.460  -38.246 1.00 92.28  ? 183  ASN D N     1 
ATOM   4060 C  CA    . ASN D 1 183 ? -15.416 14.553  -37.247 1.00 90.64  ? 183  ASN D CA    1 
ATOM   4061 C  C     . ASN D 1 183 ? -13.923 14.423  -37.507 1.00 89.92  ? 183  ASN D C     1 
ATOM   4062 O  O     . ASN D 1 183 ? -13.473 14.736  -38.612 1.00 91.85  ? 183  ASN D O     1 
ATOM   4063 C  CB    . ASN D 1 183 ? -16.112 13.189  -37.310 1.00 89.30  ? 183  ASN D CB    1 
ATOM   4064 C  CG    . ASN D 1 183 ? -16.542 12.821  -38.715 1.00 89.59  ? 183  ASN D CG    1 
ATOM   4065 O  OD1   . ASN D 1 183 ? -15.749 12.871  -39.658 1.00 94.72  ? 183  ASN D OD1   1 
ATOM   4066 N  ND2   . ASN D 1 183 ? -17.809 12.440  -38.862 1.00 85.92  ? 183  ASN D ND2   1 
ATOM   4067 N  N     . PRO D 1 184 ? -13.151 13.972  -36.500 1.00 89.75  ? 184  PRO D N     1 
ATOM   4068 C  CA    . PRO D 1 184 ? -11.681 13.969  -36.592 1.00 82.74  ? 184  PRO D CA    1 
ATOM   4069 C  C     . PRO D 1 184 ? -11.127 13.455  -37.911 1.00 85.59  ? 184  PRO D C     1 
ATOM   4070 O  O     . PRO D 1 184 ? -11.469 12.353  -38.330 1.00 82.61  ? 184  PRO D O     1 
ATOM   4071 C  CB    . PRO D 1 184 ? -11.271 13.037  -35.457 1.00 77.23  ? 184  PRO D CB    1 
ATOM   4072 C  CG    . PRO D 1 184 ? -12.323 13.267  -34.418 1.00 83.43  ? 184  PRO D CG    1 
ATOM   4073 C  CD    . PRO D 1 184 ? -13.614 13.507  -35.175 1.00 80.77  ? 184  PRO D CD    1 
ATOM   4074 N  N     . LEU D 1 185 ? -10.289 14.258  -38.561 1.00 92.05  ? 185  LEU D N     1 
ATOM   4075 C  CA    . LEU D 1 185 ? -9.628  13.805  -39.776 1.00 91.52  ? 185  LEU D CA    1 
ATOM   4076 C  C     . LEU D 1 185 ? -8.437  12.932  -39.438 1.00 91.45  ? 185  LEU D C     1 
ATOM   4077 O  O     . LEU D 1 185 ? -7.646  13.259  -38.546 1.00 87.21  ? 185  LEU D O     1 
ATOM   4078 C  CB    . LEU D 1 185 ? -9.177  14.980  -40.649 1.00 92.67  ? 185  LEU D CB    1 
ATOM   4079 C  CG    . LEU D 1 185 ? -10.317 15.672  -41.405 1.00 103.55 ? 185  LEU D CG    1 
ATOM   4080 C  CD1   . LEU D 1 185 ? -10.645 17.043  -40.803 1.00 107.19 ? 185  LEU D CD1   1 
ATOM   4081 C  CD2   . LEU D 1 185 ? -10.037 15.756  -42.913 1.00 102.69 ? 185  LEU D CD2   1 
ATOM   4082 N  N     . PRO D 1 186 ? -8.320  11.802  -40.148 1.00 92.44  ? 186  PRO D N     1 
ATOM   4083 C  CA    . PRO D 1 186 ? -7.148  10.922  -40.162 1.00 86.23  ? 186  PRO D CA    1 
ATOM   4084 C  C     . PRO D 1 186 ? -5.884  11.687  -40.544 1.00 90.90  ? 186  PRO D C     1 
ATOM   4085 O  O     . PRO D 1 186 ? -5.963  12.762  -41.142 1.00 86.22  ? 186  PRO D O     1 
ATOM   4086 C  CB    . PRO D 1 186 ? -7.500  9.873   -41.229 1.00 91.71  ? 186  PRO D CB    1 
ATOM   4087 C  CG    . PRO D 1 186 ? -8.692  10.424  -41.970 1.00 90.11  ? 186  PRO D CG    1 
ATOM   4088 C  CD    . PRO D 1 186 ? -9.413  11.272  -40.979 1.00 89.88  ? 186  PRO D CD    1 
ATOM   4089 N  N     . PRO D 1 187 ? -4.719  11.139  -40.190 1.00 83.36  ? 187  PRO D N     1 
ATOM   4090 C  CA    . PRO D 1 187 ? -3.448  11.816  -40.472 1.00 86.77  ? 187  PRO D CA    1 
ATOM   4091 C  C     . PRO D 1 187 ? -3.099  11.910  -41.964 1.00 92.44  ? 187  PRO D C     1 
ATOM   4092 O  O     . PRO D 1 187 ? -2.535  12.924  -42.390 1.00 94.81  ? 187  PRO D O     1 
ATOM   4093 C  CB    . PRO D 1 187 ? -2.430  10.950  -39.728 1.00 76.42  ? 187  PRO D CB    1 
ATOM   4094 C  CG    . PRO D 1 187 ? -3.227  10.324  -38.636 1.00 75.83  ? 187  PRO D CG    1 
ATOM   4095 C  CD    . PRO D 1 187 ? -4.544  10.010  -39.265 1.00 76.03  ? 187  PRO D CD    1 
ATOM   4096 N  N     . GLU D 1 188 ? -3.424  10.885  -42.747 1.00 96.34  ? 188  GLU D N     1 
ATOM   4097 C  CA    . GLU D 1 188 ? -3.080  10.899  -44.165 1.00 93.12  ? 188  GLU D CA    1 
ATOM   4098 C  C     . GLU D 1 188 ? -4.060  11.755  -44.951 1.00 95.43  ? 188  GLU D C     1 
ATOM   4099 O  O     . GLU D 1 188 ? -3.789  12.113  -46.091 1.00 99.30  ? 188  GLU D O     1 
ATOM   4100 C  CB    . GLU D 1 188 ? -3.013  9.474   -44.720 1.00 85.32  ? 188  GLU D CB    1 
ATOM   4101 C  CG    . GLU D 1 188 ? -1.849  8.676   -44.123 1.00 95.03  ? 188  GLU D CG    1 
ATOM   4102 C  CD    . GLU D 1 188 ? -1.703  7.266   -44.683 1.00 95.47  ? 188  GLU D CD    1 
ATOM   4103 O  OE1   . GLU D 1 188 ? -2.588  6.816   -45.443 1.00 89.29  ? 188  GLU D OE1   1 
ATOM   4104 O  OE2   . GLU D 1 188 ? -0.684  6.609   -44.365 1.00 103.69 ? 188  GLU D OE2   1 
ATOM   4105 N  N     . ALA D 1 189 ? -5.183  12.102  -44.325 1.00 79.72  ? 189  ALA D N     1 
ATOM   4106 C  CA    . ALA D 1 189 ? -6.144  13.033  -44.914 1.00 80.91  ? 189  ALA D CA    1 
ATOM   4107 C  C     . ALA D 1 189 ? -5.728  14.476  -44.644 1.00 82.89  ? 189  ALA D C     1 
ATOM   4108 O  O     . ALA D 1 189 ? -5.588  15.270  -45.573 1.00 88.01  ? 189  ALA D O     1 
ATOM   4109 C  CB    . ALA D 1 189 ? -7.551  12.772  -44.374 1.00 74.53  ? 189  ALA D CB    1 
ATOM   4110 N  N     . ALA D 1 190 ? -5.532  14.802  -43.367 1.00 93.55  ? 190  ALA D N     1 
ATOM   4111 C  CA    . ALA D 1 190 ? -5.079  16.128  -42.941 1.00 92.69  ? 190  ALA D CA    1 
ATOM   4112 C  C     . ALA D 1 190 ? -3.799  16.547  -43.662 1.00 95.85  ? 190  ALA D C     1 
ATOM   4113 O  O     . ALA D 1 190 ? -3.608  17.724  -43.966 1.00 96.86  ? 190  ALA D O     1 
ATOM   4114 C  CB    . ALA D 1 190 ? -4.864  16.151  -41.435 1.00 88.46  ? 190  ALA D CB    1 
ATOM   4115 N  N     . ALA D 1 191 ? -2.932  15.572  -43.932 1.00 106.55 ? 191  ALA D N     1 
ATOM   4116 C  CA    . ALA D 1 191 ? -1.712  15.791  -44.707 1.00 106.84 ? 191  ALA D CA    1 
ATOM   4117 C  C     . ALA D 1 191 ? -2.019  16.202  -46.148 1.00 111.26 ? 191  ALA D C     1 
ATOM   4118 O  O     . ALA D 1 191 ? -1.308  17.025  -46.733 1.00 112.76 ? 191  ALA D O     1 
ATOM   4119 C  CB    . ALA D 1 191 ? -0.845  14.534  -44.694 1.00 101.95 ? 191  ALA D CB    1 
ATOM   4120 N  N     . LEU D 1 192 ? -3.083  15.627  -46.707 1.00 96.13  ? 192  LEU D N     1 
ATOM   4121 C  CA    . LEU D 1 192 ? -3.444  15.839  -48.107 1.00 95.88  ? 192  LEU D CA    1 
ATOM   4122 C  C     . LEU D 1 192 ? -4.162  17.168  -48.374 1.00 99.77  ? 192  LEU D C     1 
ATOM   4123 O  O     . LEU D 1 192 ? -4.556  17.436  -49.510 1.00 109.62 ? 192  LEU D O     1 
ATOM   4124 C  CB    . LEU D 1 192 ? -4.320  14.679  -48.600 1.00 98.90  ? 192  LEU D CB    1 
ATOM   4125 C  CG    . LEU D 1 192 ? -3.628  13.378  -49.024 1.00 94.36  ? 192  LEU D CG    1 
ATOM   4126 C  CD1   . LEU D 1 192 ? -4.653  12.273  -49.305 1.00 78.88  ? 192  LEU D CD1   1 
ATOM   4127 C  CD2   . LEU D 1 192 ? -2.733  13.617  -50.235 1.00 86.02  ? 192  LEU D CD2   1 
ATOM   4128 N  N     . GLU D 1 193 ? -4.345  18.000  -47.352 1.00 95.41  ? 193  GLU D N     1 
ATOM   4129 C  CA    . GLU D 1 193 ? -5.009  19.280  -47.583 1.00 101.10 ? 193  GLU D CA    1 
ATOM   4130 C  C     . GLU D 1 193 ? -4.182  20.485  -47.126 1.00 96.29  ? 193  GLU D C     1 
ATOM   4131 O  O     . GLU D 1 193 ? -4.457  21.614  -47.528 1.00 98.24  ? 193  GLU D O     1 
ATOM   4132 C  CB    . GLU D 1 193 ? -6.394  19.299  -46.921 1.00 95.10  ? 193  GLU D CB    1 
ATOM   4133 C  CG    . GLU D 1 193 ? -6.404  19.171  -45.420 1.00 94.35  ? 193  GLU D CG    1 
ATOM   4134 C  CD    . GLU D 1 193 ? -7.770  19.478  -44.835 1.00 101.69 ? 193  GLU D CD    1 
ATOM   4135 O  OE1   . GLU D 1 193 ? -8.513  20.276  -45.442 1.00 98.08  ? 193  GLU D OE1   1 
ATOM   4136 O  OE2   . GLU D 1 193 ? -8.108  18.914  -43.772 1.00 108.01 ? 193  GLU D OE2   1 
ATOM   4137 N  N     . HIS D 1 194 ? -3.174  20.254  -46.291 1.00 116.60 ? 194  HIS D N     1 
ATOM   4138 C  CA    . HIS D 1 194 ? -2.162  21.281  -46.039 1.00 116.64 ? 194  HIS D CA    1 
ATOM   4139 C  C     . HIS D 1 194 ? -1.016  21.062  -47.016 1.00 118.49 ? 194  HIS D C     1 
ATOM   4140 O  O     . HIS D 1 194 ? -0.097  21.879  -47.107 1.00 117.64 ? 194  HIS D O     1 
ATOM   4141 C  CB    . HIS D 1 194 ? -1.643  21.235  -44.603 1.00 109.02 ? 194  HIS D CB    1 
ATOM   4142 C  CG    . HIS D 1 194 ? -2.660  21.596  -43.565 1.00 107.56 ? 194  HIS D CG    1 
ATOM   4143 N  ND1   . HIS D 1 194 ? -3.708  20.765  -43.224 1.00 107.11 ? 194  HIS D ND1   1 
ATOM   4144 C  CD2   . HIS D 1 194 ? -2.776  22.689  -42.772 1.00 101.92 ? 194  HIS D CD2   1 
ATOM   4145 C  CE1   . HIS D 1 194 ? -4.434  21.336  -42.280 1.00 98.91  ? 194  HIS D CE1   1 
ATOM   4146 N  NE2   . HIS D 1 194 ? -3.891  22.504  -41.987 1.00 97.77  ? 194  HIS D NE2   1 
ATOM   4147 N  N     . HIS D 1 195 ? -1.100  19.942  -47.737 1.00 107.10 ? 195  HIS D N     1 
ATOM   4148 C  CA    . HIS D 1 195 ? -0.101  19.500  -48.712 1.00 105.36 ? 195  HIS D CA    1 
ATOM   4149 C  C     . HIS D 1 195 ? 1.319   19.510  -48.124 1.00 106.22 ? 195  HIS D C     1 
ATOM   4150 O  O     . HIS D 1 195 ? 1.632   18.770  -47.181 1.00 93.88  ? 195  HIS D O     1 
ATOM   4151 C  CB    . HIS D 1 195 ? -0.156  20.356  -49.998 1.00 106.27 ? 195  HIS D CB    1 
ATOM   4152 C  CG    . HIS D 1 195 ? -1.540  20.778  -50.414 1.00 115.11 ? 195  HIS D CG    1 
ATOM   4153 N  ND1   . HIS D 1 195 ? -2.277  21.727  -49.734 1.00 120.38 ? 195  HIS D ND1   1 
ATOM   4154 C  CD2   . HIS D 1 195 ? -2.326  20.361  -51.437 1.00 112.29 ? 195  HIS D CD2   1 
ATOM   4155 C  CE1   . HIS D 1 195 ? -3.447  21.888  -50.329 1.00 117.03 ? 195  HIS D CE1   1 
ATOM   4156 N  NE2   . HIS D 1 195 ? -3.504  21.067  -51.362 1.00 114.53 ? 195  HIS D NE2   1 
ATOM   4157 O  "O5'" . DG  E 2 1   ? -1.106  -3.161  -76.857 1.00 98.23  ? 1    DG  E "O5'" 1 
ATOM   4158 C  "C5'" . DG  E 2 1   ? -0.597  -1.896  -76.433 1.00 99.76  ? 1    DG  E "C5'" 1 
ATOM   4159 C  "C4'" . DG  E 2 1   ? -1.463  -1.305  -75.330 1.00 100.48 ? 1    DG  E "C4'" 1 
ATOM   4160 O  "O4'" . DG  E 2 1   ? -2.689  -2.087  -75.187 1.00 96.50  ? 1    DG  E "O4'" 1 
ATOM   4161 C  "C3'" . DG  E 2 1   ? -0.830  -1.279  -73.931 1.00 103.81 ? 1    DG  E "C3'" 1 
ATOM   4162 O  "O3'" . DG  E 2 1   ? -1.310  -0.128  -73.218 1.00 109.31 ? 1    DG  E "O3'" 1 
ATOM   4163 C  "C2'" . DG  E 2 1   ? -1.368  -2.575  -73.315 1.00 100.39 ? 1    DG  E "C2'" 1 
ATOM   4164 C  "C1'" . DG  E 2 1   ? -2.797  -2.532  -73.841 1.00 100.47 ? 1    DG  E "C1'" 1 
ATOM   4165 N  N9    . DG  E 2 1   ? -3.505  -3.810  -73.827 1.00 92.40  ? 1    DG  E N9    1 
ATOM   4166 C  C8    . DG  E 2 1   ? -2.968  -5.079  -73.951 1.00 88.57  ? 1    DG  E C8    1 
ATOM   4167 N  N7    . DG  E 2 1   ? -3.875  -6.032  -73.919 1.00 87.61  ? 1    DG  E N7    1 
ATOM   4168 C  C5    . DG  E 2 1   ? -5.085  -5.347  -73.772 1.00 89.04  ? 1    DG  E C5    1 
ATOM   4169 C  C6    . DG  E 2 1   ? -6.418  -5.839  -73.681 1.00 90.62  ? 1    DG  E C6    1 
ATOM   4170 O  O6    . DG  E 2 1   ? -6.813  -7.022  -73.715 1.00 90.89  ? 1    DG  E O6    1 
ATOM   4171 N  N1    . DG  E 2 1   ? -7.342  -4.793  -73.530 1.00 84.11  ? 1    DG  E N1    1 
ATOM   4172 C  C2    . DG  E 2 1   ? -7.022  -3.453  -73.482 1.00 80.44  ? 1    DG  E C2    1 
ATOM   4173 N  N2    . DG  E 2 1   ? -8.050  -2.602  -73.336 1.00 79.74  ? 1    DG  E N2    1 
ATOM   4174 N  N3    . DG  E 2 1   ? -5.781  -2.979  -73.571 1.00 81.16  ? 1    DG  E N3    1 
ATOM   4175 C  C4    . DG  E 2 1   ? -4.869  -3.978  -73.716 1.00 88.56  ? 1    DG  E C4    1 
ATOM   4176 P  P     . DC  E 2 2   ? -0.330  0.761   -72.302 1.00 110.94 ? 2    DC  E P     1 
ATOM   4177 O  OP1   . DC  E 2 2   ? 0.142   1.916   -73.103 1.00 108.85 ? 2    DC  E OP1   1 
ATOM   4178 O  OP2   . DC  E 2 2   ? 0.632   -0.161  -71.650 1.00 100.72 ? 2    DC  E OP2   1 
ATOM   4179 O  "O5'" . DC  E 2 2   ? -1.306  1.349   -71.183 1.00 103.85 ? 2    DC  E "O5'" 1 
ATOM   4180 C  "C5'" . DC  E 2 2   ? -2.586  1.846   -71.559 1.00 103.24 ? 2    DC  E "C5'" 1 
ATOM   4181 C  "C4'" . DC  E 2 2   ? -3.665  1.364   -70.599 1.00 101.80 ? 2    DC  E "C4'" 1 
ATOM   4182 O  "O4'" . DC  E 2 2   ? -4.085  0.034   -70.945 1.00 98.08  ? 2    DC  E "O4'" 1 
ATOM   4183 C  "C3'" . DC  E 2 2   ? -3.239  1.269   -69.138 1.00 98.99  ? 2    DC  E "C3'" 1 
ATOM   4184 O  "O3'" . DC  E 2 2   ? -3.635  2.452   -68.450 1.00 100.71 ? 2    DC  E "O3'" 1 
ATOM   4185 C  "C2'" . DC  E 2 2   ? -3.974  0.017   -68.612 1.00 89.96  ? 2    DC  E "C2'" 1 
ATOM   4186 C  "C1'" . DC  E 2 2   ? -4.749  -0.492  -69.830 1.00 88.05  ? 2    DC  E "C1'" 1 
ATOM   4187 N  N1    . DC  E 2 2   ? -4.789  -1.989  -69.947 1.00 79.33  ? 2    DC  E N1    1 
ATOM   4188 C  C2    . DC  E 2 2   ? -6.029  -2.656  -69.994 1.00 80.06  ? 2    DC  E C2    1 
ATOM   4189 O  O2    . DC  E 2 2   ? -7.083  -1.996  -69.939 1.00 87.10  ? 2    DC  E O2    1 
ATOM   4190 N  N3    . DC  E 2 2   ? -6.042  -4.014  -70.099 1.00 80.25  ? 2    DC  E N3    1 
ATOM   4191 C  C4    . DC  E 2 2   ? -4.891  -4.697  -70.147 1.00 84.73  ? 2    DC  E C4    1 
ATOM   4192 N  N4    . DC  E 2 2   ? -4.959  -6.035  -70.251 1.00 82.18  ? 2    DC  E N4    1 
ATOM   4193 C  C5    . DC  E 2 2   ? -3.621  -4.036  -70.101 1.00 82.28  ? 2    DC  E C5    1 
ATOM   4194 C  C6    . DC  E 2 2   ? -3.619  -2.696  -70.003 1.00 84.22  ? 2    DC  E C6    1 
ATOM   4195 P  P     . DC  E 2 3   ? -3.432  2.586   -66.861 1.00 104.32 ? 3    DC  E P     1 
ATOM   4196 O  OP1   . DC  E 2 3   ? -3.429  4.033   -66.515 1.00 96.65  ? 3    DC  E OP1   1 
ATOM   4197 O  OP2   . DC  E 2 3   ? -2.314  1.696   -66.464 1.00 97.77  ? 3    DC  E OP2   1 
ATOM   4198 O  "O5'" . DC  E 2 3   ? -4.760  1.944   -66.266 1.00 99.95  ? 3    DC  E "O5'" 1 
ATOM   4199 C  "C5'" . DC  E 2 3   ? -6.019  2.411   -66.706 1.00 95.85  ? 3    DC  E "C5'" 1 
ATOM   4200 C  "C4'" . DC  E 2 3   ? -7.122  1.594   -66.074 1.00 88.73  ? 3    DC  E "C4'" 1 
ATOM   4201 O  "O4'" . DC  E 2 3   ? -7.070  0.250   -66.595 1.00 87.15  ? 3    DC  E "O4'" 1 
ATOM   4202 C  "C3'" . DC  E 2 3   ? -7.032  1.483   -64.555 1.00 86.52  ? 3    DC  E "C3'" 1 
ATOM   4203 O  "O3'" . DC  E 2 3   ? -8.243  1.918   -63.982 1.00 82.97  ? 3    DC  E "O3'" 1 
ATOM   4204 C  "C2'" . DC  E 2 3   ? -6.755  -0.005  -64.287 1.00 81.69  ? 3    DC  E "C2'" 1 
ATOM   4205 C  "C1'" . DC  E 2 3   ? -7.256  -0.677  -65.558 1.00 81.58  ? 3    DC  E "C1'" 1 
ATOM   4206 N  N1    . DC  E 2 3   ? -6.502  -1.906  -65.922 1.00 76.31  ? 3    DC  E N1    1 
ATOM   4207 C  C2    . DC  E 2 3   ? -7.195  -3.106  -66.144 1.00 76.99  ? 3    DC  E C2    1 
ATOM   4208 O  O2    . DC  E 2 3   ? -8.431  -3.127  -66.014 1.00 77.62  ? 3    DC  E O2    1 
ATOM   4209 N  N3    . DC  E 2 3   ? -6.485  -4.219  -66.488 1.00 78.83  ? 3    DC  E N3    1 
ATOM   4210 C  C4    . DC  E 2 3   ? -5.151  -4.151  -66.609 1.00 71.10  ? 3    DC  E C4    1 
ATOM   4211 N  N4    . DC  E 2 3   ? -4.498  -5.263  -66.951 1.00 70.54  ? 3    DC  E N4    1 
ATOM   4212 C  C5    . DC  E 2 3   ? -4.436  -2.935  -66.395 1.00 66.41  ? 3    DC  E C5    1 
ATOM   4213 C  C6    . DC  E 2 3   ? -5.144  -1.849  -66.058 1.00 71.06  ? 3    DC  E C6    1 
ATOM   4214 P  P     . DT  E 2 4   ? -8.392  2.062   -62.391 1.00 93.59  ? 4    DT  E P     1 
ATOM   4215 O  OP1   . DT  E 2 4   ? -9.300  3.212   -62.155 1.00 99.72  ? 4    DT  E OP1   1 
ATOM   4216 O  OP2   . DT  E 2 4   ? -7.063  2.031   -61.742 1.00 93.75  ? 4    DT  E OP2   1 
ATOM   4217 O  "O5'" . DT  E 2 4   ? -9.154  0.733   -61.990 1.00 80.35  ? 4    DT  E "O5'" 1 
ATOM   4218 C  "C5'" . DT  E 2 4   ? -10.451 0.527   -62.474 1.00 85.59  ? 4    DT  E "C5'" 1 
ATOM   4219 C  "C4'" . DT  E 2 4   ? -10.835 -0.914  -62.303 1.00 83.11  ? 4    DT  E "C4'" 1 
ATOM   4220 O  "O4'" . DT  E 2 4   ? -9.811  -1.744  -62.883 1.00 85.30  ? 4    DT  E "O4'" 1 
ATOM   4221 C  "C3'" . DT  E 2 4   ? -10.960 -1.367  -60.846 1.00 86.35  ? 4    DT  E "C3'" 1 
ATOM   4222 O  "O3'" . DT  E 2 4   ? -12.304 -1.737  -60.575 1.00 85.82  ? 4    DT  E "O3'" 1 
ATOM   4223 C  "C2'" . DT  E 2 4   ? -9.997  -2.566  -60.730 1.00 77.74  ? 4    DT  E "C2'" 1 
ATOM   4224 C  "C1'" . DT  E 2 4   ? -9.790  -2.950  -62.182 1.00 78.18  ? 4    DT  E "C1'" 1 
ATOM   4225 N  N1    . DT  E 2 4   ? -8.506  -3.623  -62.454 1.00 76.04  ? 4    DT  E N1    1 
ATOM   4226 C  C2    . DT  E 2 4   ? -8.527  -4.950  -62.781 1.00 80.62  ? 4    DT  E C2    1 
ATOM   4227 O  O2    . DT  E 2 4   ? -9.561  -5.598  -62.844 1.00 83.72  ? 4    DT  E O2    1 
ATOM   4228 N  N3    . DT  E 2 4   ? -7.294  -5.502  -63.025 1.00 77.85  ? 4    DT  E N3    1 
ATOM   4229 C  C4    . DT  E 2 4   ? -6.065  -4.863  -62.978 1.00 79.08  ? 4    DT  E C4    1 
ATOM   4230 O  O4    . DT  E 2 4   ? -5.009  -5.446  -63.217 1.00 79.82  ? 4    DT  E O4    1 
ATOM   4231 C  C5    . DT  E 2 4   ? -6.112  -3.462  -62.630 1.00 75.75  ? 4    DT  E C5    1 
ATOM   4232 C  C7    . DT  E 2 4   ? -4.841  -2.669  -62.550 1.00 65.23  ? 4    DT  E C7    1 
ATOM   4233 C  C6    . DT  E 2 4   ? -7.319  -2.911  -62.387 1.00 75.69  ? 4    DT  E C6    1 
ATOM   4234 P  P     . DT  E 2 5   ? -12.766 -2.059  -59.072 1.00 72.93  ? 5    DT  E P     1 
ATOM   4235 O  OP1   . DT  E 2 5   ? -14.245 -1.993  -59.087 1.00 71.13  ? 5    DT  E OP1   1 
ATOM   4236 O  OP2   . DT  E 2 5   ? -12.017 -1.179  -58.145 1.00 74.41  ? 5    DT  E OP2   1 
ATOM   4237 O  "O5'" . DT  E 2 5   ? -12.254 -3.557  -58.831 1.00 56.02  ? 5    DT  E "O5'" 1 
ATOM   4238 C  "C5'" . DT  E 2 5   ? -12.899 -4.639  -59.469 1.00 61.07  ? 5    DT  E "C5'" 1 
ATOM   4239 C  "C4'" . DT  E 2 5   ? -12.155 -5.940  -59.216 1.00 73.32  ? 5    DT  E "C4'" 1 
ATOM   4240 O  "O4'" . DT  E 2 5   ? -10.812 -5.866  -59.767 1.00 80.26  ? 5    DT  E "O4'" 1 
ATOM   4241 C  "C3'" . DT  E 2 5   ? -11.974 -6.318  -57.740 1.00 73.67  ? 5    DT  E "C3'" 1 
ATOM   4242 O  "O3'" . DT  E 2 5   ? -12.382 -7.654  -57.533 1.00 71.12  ? 5    DT  E "O3'" 1 
ATOM   4243 C  "C2'" . DT  E 2 5   ? -10.468 -6.165  -57.511 1.00 75.29  ? 5    DT  E "C2'" 1 
ATOM   4244 C  "C1'" . DT  E 2 5   ? -9.944  -6.528  -58.884 1.00 72.94  ? 5    DT  E "C1'" 1 
ATOM   4245 N  N1    . DT  E 2 5   ? -8.546  -6.081  -59.139 1.00 71.26  ? 5    DT  E N1    1 
ATOM   4246 C  C2    . DT  E 2 5   ? -7.663  -6.964  -59.706 1.00 73.57  ? 5    DT  E C2    1 
ATOM   4247 O  O2    . DT  E 2 5   ? -7.971  -8.098  -60.021 1.00 74.47  ? 5    DT  E O2    1 
ATOM   4248 N  N3    . DT  E 2 5   ? -6.397  -6.467  -59.897 1.00 75.03  ? 5    DT  E N3    1 
ATOM   4249 C  C4    . DT  E 2 5   ? -5.940  -5.197  -59.580 1.00 71.63  ? 5    DT  E C4    1 
ATOM   4250 O  O4    . DT  E 2 5   ? -4.785  -4.837  -59.794 1.00 72.31  ? 5    DT  E O4    1 
ATOM   4251 C  C5    . DT  E 2 5   ? -6.916  -4.323  -58.987 1.00 65.82  ? 5    DT  E C5    1 
ATOM   4252 C  C7    . DT  E 2 5   ? -6.535  -2.929  -58.607 1.00 64.62  ? 5    DT  E C7    1 
ATOM   4253 C  C6    . DT  E 2 5   ? -8.157  -4.800  -58.790 1.00 72.41  ? 5    DT  E C6    1 
ATOM   4254 P  P     . DG  E 2 6   ? -13.163 -8.044  -56.188 1.00 95.93  ? 6    DG  E P     1 
ATOM   4255 O  OP1   . DG  E 2 6   ? -14.547 -7.549  -56.334 1.00 78.11  ? 6    DG  E OP1   1 
ATOM   4256 O  OP2   . DG  E 2 6   ? -12.340 -7.579  -55.038 1.00 97.30  ? 6    DG  E OP2   1 
ATOM   4257 O  "O5'" . DG  E 2 6   ? -13.155 -9.643  -56.189 1.00 84.46  ? 6    DG  E "O5'" 1 
ATOM   4258 C  "C5'" . DG  E 2 6   ? -13.325 -10.350 -57.389 1.00 81.66  ? 6    DG  E "C5'" 1 
ATOM   4259 C  "C4'" . DG  E 2 6   ? -12.285 -11.440 -57.507 1.00 84.39  ? 6    DG  E "C4'" 1 
ATOM   4260 O  "O4'" . DG  E 2 6   ? -11.020 -10.860 -57.908 1.00 87.49  ? 6    DG  E "O4'" 1 
ATOM   4261 C  "C3'" . DG  E 2 6   ? -12.012 -12.221 -56.218 1.00 87.48  ? 6    DG  E "C3'" 1 
ATOM   4262 O  "O3'" . DG  E 2 6   ? -11.978 -13.608 -56.511 1.00 90.27  ? 6    DG  E "O3'" 1 
ATOM   4263 C  "C2'" . DG  E 2 6   ? -10.640 -11.705 -55.762 1.00 91.46  ? 6    DG  E "C2'" 1 
ATOM   4264 C  "C1'" . DG  E 2 6   ? -9.984  -11.364 -57.090 1.00 94.42  ? 6    DG  E "C1'" 1 
ATOM   4265 N  N9    . DG  E 2 6   ? -8.944  -10.338 -57.001 1.00 90.30  ? 6    DG  E N9    1 
ATOM   4266 C  C8    . DG  E 2 6   ? -9.103  -9.039  -56.579 1.00 86.49  ? 6    DG  E C8    1 
ATOM   4267 N  N7    . DG  E 2 6   ? -8.003  -8.336  -56.625 1.00 85.38  ? 6    DG  E N7    1 
ATOM   4268 C  C5    . DG  E 2 6   ? -7.055  -9.222  -57.126 1.00 84.77  ? 6    DG  E C5    1 
ATOM   4269 C  C6    . DG  E 2 6   ? -5.681  -9.027  -57.399 1.00 87.65  ? 6    DG  E C6    1 
ATOM   4270 O  O6    . DG  E 2 6   ? -5.000  -8.000  -57.247 1.00 88.85  ? 6    DG  E O6    1 
ATOM   4271 N  N1    . DG  E 2 6   ? -5.088  -10.177 -57.899 1.00 87.14  ? 6    DG  E N1    1 
ATOM   4272 C  C2    . DG  E 2 6   ? -5.731  -11.366 -58.109 1.00 87.93  ? 6    DG  E C2    1 
ATOM   4273 N  N2    . DG  E 2 6   ? -4.977  -12.360 -58.601 1.00 92.05  ? 6    DG  E N2    1 
ATOM   4274 N  N3    . DG  E 2 6   ? -7.019  -11.572 -57.857 1.00 86.73  ? 6    DG  E N3    1 
ATOM   4275 C  C4    . DG  E 2 6   ? -7.617  -10.458 -57.367 1.00 87.07  ? 6    DG  E C4    1 
ATOM   4276 P  P     . DC  E 2 7   ? -11.923 -14.693 -55.330 1.00 102.19 ? 7    DC  E P     1 
ATOM   4277 O  OP1   . DC  E 2 7   ? -12.533 -15.936 -55.855 1.00 101.34 ? 7    DC  E OP1   1 
ATOM   4278 O  OP2   . DC  E 2 7   ? -12.515 -14.087 -54.117 1.00 95.97  ? 7    DC  E OP2   1 
ATOM   4279 O  "O5'" . DC  E 2 7   ? -10.354 -14.943 -55.132 1.00 82.14  ? 7    DC  E "O5'" 1 
ATOM   4280 C  "C5'" . DC  E 2 7   ? -9.682  -15.737 -56.067 1.00 87.52  ? 7    DC  E "C5'" 1 
ATOM   4281 C  "C4'" . DC  E 2 7   ? -8.190  -15.729 -55.834 1.00 93.21  ? 7    DC  E "C4'" 1 
ATOM   4282 O  "O4'" . DC  E 2 7   ? -7.699  -14.380 -55.845 1.00 90.82  ? 7    DC  E "O4'" 1 
ATOM   4283 C  "C3'" . DC  E 2 7   ? -7.721  -16.321 -54.496 1.00 102.18 ? 7    DC  E "C3'" 1 
ATOM   4284 O  "O3'" . DC  E 2 7   ? -7.145  -17.629 -54.698 1.00 110.95 ? 7    DC  E "O3'" 1 
ATOM   4285 C  "C2'" . DC  E 2 7   ? -6.669  -15.312 -53.988 1.00 100.54 ? 7    DC  E "C2'" 1 
ATOM   4286 C  "C1'" . DC  E 2 7   ? -6.454  -14.419 -55.202 1.00 97.41  ? 7    DC  E "C1'" 1 
ATOM   4287 N  N1    . DC  E 2 7   ? -6.009  -13.034 -54.867 1.00 91.55  ? 7    DC  E N1    1 
ATOM   4288 C  C2    . DC  E 2 7   ? -4.682  -12.685 -55.091 1.00 87.01  ? 7    DC  E C2    1 
ATOM   4289 O  O2    . DC  E 2 7   ? -3.918  -13.528 -55.562 1.00 92.05  ? 7    DC  E O2    1 
ATOM   4290 N  N3    . DC  E 2 7   ? -4.271  -11.432 -54.793 1.00 85.05  ? 7    DC  E N3    1 
ATOM   4291 C  C4    . DC  E 2 7   ? -5.131  -10.550 -54.291 1.00 81.82  ? 7    DC  E C4    1 
ATOM   4292 N  N4    . DC  E 2 7   ? -4.674  -9.325  -54.014 1.00 75.64  ? 7    DC  E N4    1 
ATOM   4293 C  C5    . DC  E 2 7   ? -6.498  -10.886 -54.047 1.00 82.19  ? 7    DC  E C5    1 
ATOM   4294 C  C6    . DC  E 2 7   ? -6.891  -12.129 -54.348 1.00 88.38  ? 7    DC  E C6    1 
ATOM   4295 P  P     . DC  E 2 8   ? -6.611  -18.493 -53.445 1.00 112.19 ? 8    DC  E P     1 
ATOM   4296 O  OP1   . DC  E 2 8   ? -6.416  -19.896 -53.877 1.00 109.72 ? 8    DC  E OP1   1 
ATOM   4297 O  OP2   . DC  E 2 8   ? -7.466  -18.187 -52.274 1.00 101.30 ? 8    DC  E OP2   1 
ATOM   4298 O  "O5'" . DC  E 2 8   ? -5.172  -17.885 -53.153 1.00 102.35 ? 8    DC  E "O5'" 1 
ATOM   4299 C  "C5'" . DC  E 2 8   ? -4.165  -17.958 -54.135 1.00 103.31 ? 8    DC  E "C5'" 1 
ATOM   4300 C  "C4'" . DC  E 2 8   ? -2.871  -17.402 -53.583 1.00 105.12 ? 8    DC  E "C4'" 1 
ATOM   4301 O  "O4'" . DC  E 2 8   ? -2.932  -15.958 -53.577 1.00 102.07 ? 8    DC  E "O4'" 1 
ATOM   4302 C  "C3'" . DC  E 2 8   ? -2.565  -17.825 -52.143 1.00 100.81 ? 8    DC  E "C3'" 1 
ATOM   4303 O  "O3'" . DC  E 2 8   ? -1.308  -18.457 -52.090 1.00 104.59 ? 8    DC  E "O3'" 1 
ATOM   4304 C  "C2'" . DC  E 2 8   ? -2.567  -16.512 -51.354 1.00 98.84  ? 8    DC  E "C2'" 1 
ATOM   4305 C  "C1'" . DC  E 2 8   ? -2.291  -15.480 -52.431 1.00 93.86  ? 8    DC  E "C1'" 1 
ATOM   4306 N  N1    . DC  E 2 8   ? -2.840  -14.130 -52.111 1.00 88.73  ? 8    DC  E N1    1 
ATOM   4307 C  C2    . DC  E 2 8   ? -2.003  -13.018 -52.174 1.00 85.73  ? 8    DC  E C2    1 
ATOM   4308 O  O2    . DC  E 2 8   ? -0.824  -13.173 -52.499 1.00 89.34  ? 8    DC  E O2    1 
ATOM   4309 N  N3    . DC  E 2 8   ? -2.505  -11.798 -51.880 1.00 84.64  ? 8    DC  E N3    1 
ATOM   4310 C  C4    . DC  E 2 8   ? -3.780  -11.669 -51.530 1.00 84.76  ? 8    DC  E C4    1 
ATOM   4311 N  N4    . DC  E 2 8   ? -4.224  -10.441 -51.246 1.00 79.03  ? 8    DC  E N4    1 
ATOM   4312 C  C5    . DC  E 2 8   ? -4.656  -12.791 -51.455 1.00 89.71  ? 8    DC  E C5    1 
ATOM   4313 C  C6    . DC  E 2 8   ? -4.146  -13.995 -51.750 1.00 89.67  ? 8    DC  E C6    1 
ATOM   4314 P  P     . DG  E 2 9   ? -0.935  -19.427 -50.867 1.00 102.97 ? 9    DG  E P     1 
ATOM   4315 O  OP1   . DG  E 2 9   ? -0.675  -20.757 -51.452 1.00 113.17 ? 9    DG  E OP1   1 
ATOM   4316 O  OP2   . DG  E 2 9   ? -1.954  -19.294 -49.799 1.00 102.09 ? 9    DG  E OP2   1 
ATOM   4317 O  "O5'" . DG  E 2 9   ? 0.450   -18.836 -50.355 1.00 96.19  ? 9    DG  E "O5'" 1 
ATOM   4318 C  "C5'" . DG  E 2 9   ? 1.487   -18.626 -51.288 1.00 98.06  ? 9    DG  E "C5'" 1 
ATOM   4319 C  "C4'" . DG  E 2 9   ? 2.459   -17.576 -50.795 1.00 94.21  ? 9    DG  E "C4'" 1 
ATOM   4320 O  "O4'" . DG  E 2 9   ? 1.802   -16.283 -50.722 1.00 97.54  ? 9    DG  E "O4'" 1 
ATOM   4321 C  "C3'" . DG  E 2 9   ? 3.038   -17.835 -49.415 1.00 92.35  ? 9    DG  E "C3'" 1 
ATOM   4322 O  "O3'" . DG  E 2 9   ? 4.395   -17.477 -49.422 1.00 94.73  ? 9    DG  E "O3'" 1 
ATOM   4323 C  "C2'" . DG  E 2 9   ? 2.211   -16.918 -48.509 1.00 91.55  ? 9    DG  E "C2'" 1 
ATOM   4324 C  "C1'" . DG  E 2 9   ? 1.948   -15.735 -49.424 1.00 89.01  ? 9    DG  E "C1'" 1 
ATOM   4325 N  N9    . DG  E 2 9   ? 0.722   -15.005 -49.108 1.00 81.42  ? 9    DG  E N9    1 
ATOM   4326 C  C8    . DG  E 2 9   ? -0.515  -15.546 -48.854 1.00 87.10  ? 9    DG  E C8    1 
ATOM   4327 N  N7    . DG  E 2 9   ? -1.438  -14.654 -48.632 1.00 86.65  ? 9    DG  E N7    1 
ATOM   4328 C  C5    . DG  E 2 9   ? -0.775  -13.441 -48.753 1.00 77.68  ? 9    DG  E C5    1 
ATOM   4329 C  C6    . DG  E 2 9   ? -1.262  -12.123 -48.617 1.00 77.34  ? 9    DG  E C6    1 
ATOM   4330 O  O6    . DG  E 2 9   ? -2.417  -11.752 -48.355 1.00 79.76  ? 9    DG  E O6    1 
ATOM   4331 N  N1    . DG  E 2 9   ? -0.260  -11.181 -48.824 1.00 79.23  ? 9    DG  E N1    1 
ATOM   4332 C  C2    . DG  E 2 9   ? 1.045   -11.474 -49.120 1.00 76.77  ? 9    DG  E C2    1 
ATOM   4333 N  N2    . DG  E 2 9   ? 1.860   -10.426 -49.281 1.00 68.33  ? 9    DG  E N2    1 
ATOM   4334 N  N3    . DG  E 2 9   ? 1.517   -12.708 -49.248 1.00 79.42  ? 9    DG  E N3    1 
ATOM   4335 C  C4    . DG  E 2 9   ? 0.554   -13.638 -49.053 1.00 76.48  ? 9    DG  E C4    1 
ATOM   4336 P  P     . DG  E 2 10  ? 5.331   -17.818 -48.170 1.00 103.25 ? 10   DG  E P     1 
ATOM   4337 O  OP1   . DG  E 2 10  ? 6.550   -18.480 -48.691 1.00 105.94 ? 10   DG  E OP1   1 
ATOM   4338 O  OP2   . DG  E 2 10  ? 4.497   -18.531 -47.175 1.00 93.00  ? 10   DG  E OP2   1 
ATOM   4339 O  "O5'" . DG  E 2 10  ? 5.725   -16.373 -47.611 1.00 89.61  ? 10   DG  E "O5'" 1 
ATOM   4340 C  "C5'" . DG  E 2 10  ? 6.277   -15.399 -48.491 1.00 88.04  ? 10   DG  E "C5'" 1 
ATOM   4341 C  "C4'" . DG  E 2 10  ? 6.560   -14.095 -47.760 1.00 91.10  ? 10   DG  E "C4'" 1 
ATOM   4342 O  "O4'" . DG  E 2 10  ? 5.337   -13.318 -47.636 1.00 88.31  ? 10   DG  E "O4'" 1 
ATOM   4343 C  "C3'" . DG  E 2 10  ? 7.110   -14.245 -46.342 1.00 91.31  ? 10   DG  E "C3'" 1 
ATOM   4344 O  "O3'" . DG  E 2 10  ? 8.059   -13.224 -46.096 1.00 86.62  ? 10   DG  E "O3'" 1 
ATOM   4345 C  "C2'" . DG  E 2 10  ? 5.861   -14.076 -45.468 1.00 87.78  ? 10   DG  E "C2'" 1 
ATOM   4346 C  "C1'" . DG  E 2 10  ? 5.077   -13.040 -46.267 1.00 89.58  ? 10   DG  E "C1'" 1 
ATOM   4347 N  N9    . DG  E 2 10  ? 3.627   -13.089 -46.063 1.00 82.48  ? 10   DG  E N9    1 
ATOM   4348 C  C8    . DG  E 2 10  ? 2.827   -14.203 -46.075 1.00 78.88  ? 10   DG  E C8    1 
ATOM   4349 N  N7    . DG  E 2 10  ? 1.567   -13.942 -45.889 1.00 75.11  ? 10   DG  E N7    1 
ATOM   4350 C  C5    . DG  E 2 10  ? 1.523   -12.562 -45.755 1.00 75.17  ? 10   DG  E C5    1 
ATOM   4351 C  C6    . DG  E 2 10  ? 0.421   -11.706 -45.535 1.00 71.49  ? 10   DG  E C6    1 
ATOM   4352 O  O6    . DG  E 2 10  ? -0.771  -12.011 -45.417 1.00 66.98  ? 10   DG  E O6    1 
ATOM   4353 N  N1    . DG  E 2 10  ? 0.811   -10.374 -45.458 1.00 70.68  ? 10   DG  E N1    1 
ATOM   4354 C  C2    . DG  E 2 10  ? 2.108   -9.925  -45.575 1.00 73.05  ? 10   DG  E C2    1 
ATOM   4355 N  N2    . DG  E 2 10  ? 2.292   -8.597  -45.470 1.00 69.96  ? 10   DG  E N2    1 
ATOM   4356 N  N3    . DG  E 2 10  ? 3.150   -10.719 -45.780 1.00 76.27  ? 10   DG  E N3    1 
ATOM   4357 C  C4    . DG  E 2 10  ? 2.782   -12.020 -45.862 1.00 76.04  ? 10   DG  E C4    1 
ATOM   4358 P  P     . DG  E 2 11  ? 9.214   -13.442 -45.009 1.00 94.55  ? 11   DG  E P     1 
ATOM   4359 O  OP1   . DG  E 2 11  ? 10.455  -12.835 -45.545 1.00 101.33 ? 11   DG  E OP1   1 
ATOM   4360 O  OP2   . DG  E 2 11  ? 9.171   -14.861 -44.593 1.00 86.46  ? 11   DG  E OP2   1 
ATOM   4361 O  "O5'" . DG  E 2 11  ? 8.725   -12.593 -43.745 1.00 97.80  ? 11   DG  E "O5'" 1 
ATOM   4362 C  "C5'" . DG  E 2 11  ? 8.517   -11.179 -43.845 1.00 87.49  ? 11   DG  E "C5'" 1 
ATOM   4363 C  "C4'" . DG  E 2 11  ? 7.701   -10.671 -42.662 1.00 85.36  ? 11   DG  E "C4'" 1 
ATOM   4364 O  "O4'" . DG  E 2 11  ? 6.285   -10.989 -42.863 1.00 87.27  ? 11   DG  E "O4'" 1 
ATOM   4365 C  "C3'" . DG  E 2 11  ? 8.061   -11.285 -41.295 1.00 82.81  ? 11   DG  E "C3'" 1 
ATOM   4366 O  "O3'" . DG  E 2 11  ? 7.904   -10.315 -40.295 1.00 81.43  ? 11   DG  E "O3'" 1 
ATOM   4367 C  "C2'" . DG  E 2 11  ? 6.968   -12.345 -41.135 1.00 85.08  ? 11   DG  E "C2'" 1 
ATOM   4368 C  "C1'" . DG  E 2 11  ? 5.799   -11.548 -41.669 1.00 76.84  ? 11   DG  E "C1'" 1 
ATOM   4369 N  N9    . DG  E 2 11  ? 4.588   -12.309 -41.931 1.00 78.22  ? 11   DG  E N9    1 
ATOM   4370 C  C8    . DG  E 2 11  ? 4.466   -13.661 -42.098 1.00 79.67  ? 11   DG  E C8    1 
ATOM   4371 N  N7    . DG  E 2 11  ? 3.229   -14.049 -42.296 1.00 80.74  ? 11   DG  E N7    1 
ATOM   4372 C  C5    . DG  E 2 11  ? 2.490   -12.875 -42.248 1.00 72.55  ? 11   DG  E C5    1 
ATOM   4373 C  C6    . DG  E 2 11  ? 1.097   -12.654 -42.400 1.00 73.33  ? 11   DG  E C6    1 
ATOM   4374 O  O6    . DG  E 2 11  ? 0.192   -13.484 -42.616 1.00 73.95  ? 11   DG  E O6    1 
ATOM   4375 N  N1    . DG  E 2 11  ? 0.781   -11.306 -42.278 1.00 72.10  ? 11   DG  E N1    1 
ATOM   4376 C  C2    . DG  E 2 11  ? 1.682   -10.303 -42.040 1.00 67.23  ? 11   DG  E C2    1 
ATOM   4377 N  N2    . DG  E 2 11  ? 1.183   -9.069  -41.953 1.00 76.00  ? 11   DG  E N2    1 
ATOM   4378 N  N3    . DG  E 2 11  ? 2.976   -10.490 -41.909 1.00 74.24  ? 11   DG  E N3    1 
ATOM   4379 C  C4    . DG  E 2 11  ? 3.312   -11.797 -42.023 1.00 79.79  ? 11   DG  E C4    1 
ATOM   4380 P  P     . DT  E 2 12  ? 9.134   -9.497  -39.675 1.00 95.64  ? 12   DT  E P     1 
ATOM   4381 O  OP1   . DT  E 2 12  ? 10.103  -9.160  -40.741 1.00 88.48  ? 12   DT  E OP1   1 
ATOM   4382 O  OP2   . DT  E 2 12  ? 9.548   -10.213 -38.440 1.00 94.29  ? 12   DT  E OP2   1 
ATOM   4383 O  "O5'" . DT  E 2 12  ? 8.429   -8.136  -39.227 1.00 86.29  ? 12   DT  E "O5'" 1 
ATOM   4384 C  "C5'" . DT  E 2 12  ? 7.678   -7.399  -40.186 1.00 80.78  ? 12   DT  E "C5'" 1 
ATOM   4385 C  "C4'" . DT  E 2 12  ? 6.391   -6.840  -39.596 1.00 74.84  ? 12   DT  E "C4'" 1 
ATOM   4386 O  "O4'" . DT  E 2 12  ? 5.303   -7.804  -39.712 1.00 80.03  ? 12   DT  E "O4'" 1 
ATOM   4387 C  "C3'" . DT  E 2 12  ? 6.431   -6.474  -38.121 1.00 74.60  ? 12   DT  E "C3'" 1 
ATOM   4388 O  "O3'" . DT  E 2 12  ? 5.549   -5.437  -37.941 1.00 69.76  ? 12   DT  E "O3'" 1 
ATOM   4389 C  "C2'" . DT  E 2 12  ? 5.861   -7.732  -37.472 1.00 70.68  ? 12   DT  E "C2'" 1 
ATOM   4390 C  "C1'" . DT  E 2 12  ? 4.725   -7.986  -38.429 1.00 68.31  ? 12   DT  E "C1'" 1 
ATOM   4391 N  N1    . DT  E 2 12  ? 4.169   -9.334  -38.365 1.00 68.09  ? 12   DT  E N1    1 
ATOM   4392 C  C2    . DT  E 2 12  ? 2.819   -9.501  -38.526 1.00 69.69  ? 12   DT  E C2    1 
ATOM   4393 O  O2    . DT  E 2 12  ? 2.048   -8.567  -38.702 1.00 70.38  ? 12   DT  E O2    1 
ATOM   4394 N  N3    . DT  E 2 12  ? 2.398   -10.805 -38.472 1.00 71.07  ? 12   DT  E N3    1 
ATOM   4395 C  C4    . DT  E 2 12  ? 3.188   -11.927 -38.280 1.00 70.43  ? 12   DT  E C4    1 
ATOM   4396 O  O4    . DT  E 2 12  ? 2.727   -13.058 -38.246 1.00 72.24  ? 12   DT  E O4    1 
ATOM   4397 C  C5    . DT  E 2 12  ? 4.592   -11.673 -38.124 1.00 73.87  ? 12   DT  E C5    1 
ATOM   4398 C  C7    . DT  E 2 12  ? 5.541   -12.807 -37.909 1.00 78.80  ? 12   DT  E C7    1 
ATOM   4399 C  C6    . DT  E 2 12  ? 5.011   -10.405 -38.178 1.00 76.65  ? 12   DT  E C6    1 
ATOM   4400 P  P     . DA  E 2 13  ? 6.061   -3.962  -37.630 1.00 65.14  ? 13   DA  E P     1 
ATOM   4401 O  OP1   . DA  E 2 13  ? 6.734   -3.431  -38.835 1.00 65.25  ? 13   DA  E OP1   1 
ATOM   4402 O  OP2   . DA  E 2 13  ? 6.739   -4.086  -36.318 1.00 59.61  ? 13   DA  E OP2   1 
ATOM   4403 O  "O5'" . DA  E 2 13  ? 4.680   -3.165  -37.490 1.00 68.56  ? 13   DA  E "O5'" 1 
ATOM   4404 C  "C5'" . DA  E 2 13  ? 3.694   -3.268  -38.542 1.00 54.35  ? 13   DA  E "C5'" 1 
ATOM   4405 C  "C4'" . DA  E 2 13  ? 2.288   -3.526  -37.995 1.00 55.30  ? 13   DA  E "C4'" 1 
ATOM   4406 O  "O4'" . DA  E 2 13  ? 2.175   -4.880  -37.489 1.00 56.93  ? 13   DA  E "O4'" 1 
ATOM   4407 C  "C3'" . DA  E 2 13  ? 1.824   -2.627  -36.851 1.00 54.02  ? 13   DA  E "C3'" 1 
ATOM   4408 O  "O3'" . DA  E 2 13  ? 0.402   -2.400  -36.972 1.00 52.50  ? 13   DA  E "O3'" 1 
ATOM   4409 C  "C2'" . DA  E 2 13  ? 2.166   -3.461  -35.618 1.00 49.28  ? 13   DA  E "C2'" 1 
ATOM   4410 C  "C1'" . DA  E 2 13  ? 1.813   -4.849  -36.119 1.00 51.72  ? 13   DA  E "C1'" 1 
ATOM   4411 N  N9    . DA  E 2 13  ? 2.510   -5.939  -35.448 1.00 53.13  ? 13   DA  E N9    1 
ATOM   4412 C  C8    . DA  E 2 13  ? 3.749   -5.914  -34.867 1.00 53.58  ? 13   DA  E C8    1 
ATOM   4413 N  N7    . DA  E 2 13  ? 4.118   -7.075  -34.364 1.00 51.97  ? 13   DA  E N7    1 
ATOM   4414 C  C5    . DA  E 2 13  ? 3.054   -7.913  -34.648 1.00 52.52  ? 13   DA  E C5    1 
ATOM   4415 C  C6    . DA  E 2 13  ? 2.809   -9.280  -34.381 1.00 58.43  ? 13   DA  E C6    1 
ATOM   4416 N  N6    . DA  E 2 13  ? 3.666   -10.070 -33.733 1.00 54.30  ? 13   DA  E N6    1 
ATOM   4417 N  N1    . DA  E 2 13  ? 1.626   -9.801  -34.805 1.00 58.37  ? 13   DA  E N1    1 
ATOM   4418 C  C2    . DA  E 2 13  ? 0.759   -9.007  -35.444 1.00 49.69  ? 13   DA  E C2    1 
ATOM   4419 N  N3    . DA  E 2 13  ? 0.878   -7.721  -35.746 1.00 48.36  ? 13   DA  E N3    1 
ATOM   4420 C  C4    . DA  E 2 13  ? 2.057   -7.228  -35.321 1.00 49.57  ? 13   DA  E C4    1 
ATOM   4421 P  P     . DA  E 2 14  ? -0.269  -1.165  -36.203 1.00 50.98  ? 14   DA  E P     1 
ATOM   4422 O  OP1   . DA  E 2 14  ? -1.539  -0.830  -36.844 1.00 53.30  ? 14   DA  E OP1   1 
ATOM   4423 O  OP2   . DA  E 2 14  ? 0.766   -0.113  -36.078 1.00 55.90  ? 14   DA  E OP2   1 
ATOM   4424 O  "O5'" . DA  E 2 14  ? -0.490  -1.745  -34.725 1.00 51.38  ? 14   DA  E "O5'" 1 
ATOM   4425 C  "C5'" . DA  E 2 14  ? -1.755  -2.200  -34.302 1.00 51.05  ? 14   DA  E "C5'" 1 
ATOM   4426 C  "C4'" . DA  E 2 14  ? -2.063  -3.597  -34.823 1.00 52.05  ? 14   DA  E "C4'" 1 
ATOM   4427 O  "O4'" . DA  E 2 14  ? -0.954  -4.489  -34.545 1.00 45.27  ? 14   DA  E "O4'" 1 
ATOM   4428 C  "C3'" . DA  E 2 14  ? -3.296  -4.252  -34.181 1.00 45.50  ? 14   DA  E "C3'" 1 
ATOM   4429 O  "O3'" . DA  E 2 14  ? -4.063  -4.961  -35.174 1.00 39.84  ? 14   DA  E "O3'" 1 
ATOM   4430 C  "C2'" . DA  E 2 14  ? -2.670  -5.189  -33.137 1.00 45.94  ? 14   DA  E "C2'" 1 
ATOM   4431 C  "C1'" . DA  E 2 14  ? -1.448  -5.648  -33.902 1.00 47.53  ? 14   DA  E "C1'" 1 
ATOM   4432 N  N9    . DA  E 2 14  ? -0.364  -6.231  -33.086 1.00 48.94  ? 14   DA  E N9    1 
ATOM   4433 C  C8    . DA  E 2 14  ? 0.777   -5.609  -32.688 1.00 47.03  ? 14   DA  E C8    1 
ATOM   4434 N  N7    . DA  E 2 14  ? 1.589   -6.373  -32.016 1.00 45.22  ? 14   DA  E N7    1 
ATOM   4435 C  C5    . DA  E 2 14  ? 0.950   -7.591  -31.973 1.00 47.16  ? 14   DA  E C5    1 
ATOM   4436 C  C6    . DA  E 2 14  ? 1.311   -8.835  -31.399 1.00 54.03  ? 14   DA  E C6    1 
ATOM   4437 N  N6    . DA  E 2 14  ? 2.458   -9.034  -30.739 1.00 46.43  ? 14   DA  E N6    1 
ATOM   4438 N  N1    . DA  E 2 14  ? 0.442   -9.861  -31.530 1.00 51.12  ? 14   DA  E N1    1 
ATOM   4439 C  C2    . DA  E 2 14  ? -0.695  -9.655  -32.205 1.00 53.53  ? 14   DA  E C2    1 
ATOM   4440 N  N3    . DA  E 2 14  ? -1.139  -8.536  -32.789 1.00 51.04  ? 14   DA  E N3    1 
ATOM   4441 C  C4    . DA  E 2 14  ? -0.255  -7.531  -32.632 1.00 45.32  ? 14   DA  E C4    1 
ATOM   4442 P  P     . DG  E 2 15  ? -5.127  -6.065  -34.706 1.00 48.40  ? 15   DG  E P     1 
ATOM   4443 O  OP1   . DG  E 2 15  ? -4.381  -7.293  -34.305 1.00 57.27  ? 15   DG  E OP1   1 
ATOM   4444 O  OP2   . DG  E 2 15  ? -6.177  -6.185  -35.739 1.00 45.43  ? 15   DG  E OP2   1 
ATOM   4445 O  "O5'" . DG  E 2 15  ? -5.696  -5.390  -33.370 1.00 54.85  ? 15   DG  E "O5'" 1 
ATOM   4446 C  "C5'" . DG  E 2 15  ? -6.715  -5.983  -32.607 1.00 46.64  ? 15   DG  E "C5'" 1 
ATOM   4447 C  "C4'" . DG  E 2 15  ? -6.239  -7.203  -31.826 1.00 47.71  ? 15   DG  E "C4'" 1 
ATOM   4448 O  "O4'" . DG  E 2 15  ? -4.819  -7.174  -31.516 1.00 48.55  ? 15   DG  E "O4'" 1 
ATOM   4449 C  "C3'" . DG  E 2 15  ? -6.947  -7.408  -30.488 1.00 49.40  ? 15   DG  E "C3'" 1 
ATOM   4450 O  "O3'" . DG  E 2 15  ? -7.439  -8.712  -30.460 1.00 54.93  ? 15   DG  E "O3'" 1 
ATOM   4451 C  "C2'" . DG  E 2 15  ? -5.836  -7.215  -29.456 1.00 45.56  ? 15   DG  E "C2'" 1 
ATOM   4452 C  "C1'" . DG  E 2 15  ? -4.682  -7.768  -30.235 1.00 47.37  ? 15   DG  E "C1'" 1 
ATOM   4453 N  N9    . DG  E 2 15  ? -3.374  -7.470  -29.680 1.00 44.57  ? 15   DG  E N9    1 
ATOM   4454 C  C8    . DG  E 2 15  ? -2.709  -6.270  -29.712 1.00 47.45  ? 15   DG  E C8    1 
ATOM   4455 N  N7    . DG  E 2 15  ? -1.536  -6.320  -29.163 1.00 45.48  ? 15   DG  E N7    1 
ATOM   4456 C  C5    . DG  E 2 15  ? -1.401  -7.640  -28.753 1.00 49.25  ? 15   DG  E C5    1 
ATOM   4457 C  C6    . DG  E 2 15  ? -0.325  -8.301  -28.094 1.00 48.95  ? 15   DG  E C6    1 
ATOM   4458 O  O6    . DG  E 2 15  ? 0.769   -7.838  -27.736 1.00 45.14  ? 15   DG  E O6    1 
ATOM   4459 N  N1    . DG  E 2 15  ? -0.612  -9.641  -27.861 1.00 49.62  ? 15   DG  E N1    1 
ATOM   4460 C  C2    . DG  E 2 15  ? -1.773  -10.267 -28.211 1.00 47.33  ? 15   DG  E C2    1 
ATOM   4461 N  N2    . DG  E 2 15  ? -1.857  -11.561 -27.901 1.00 51.88  ? 15   DG  E N2    1 
ATOM   4462 N  N3    . DG  E 2 15  ? -2.781  -9.670  -28.842 1.00 52.32  ? 15   DG  E N3    1 
ATOM   4463 C  C4    . DG  E 2 15  ? -2.527  -8.358  -29.071 1.00 47.97  ? 15   DG  E C4    1 
ATOM   4464 P  P     . DT  E 2 16  ? -8.835  -9.026  -29.758 1.00 50.60  ? 16   DT  E P     1 
ATOM   4465 O  OP1   . DT  E 2 16  ? -9.621  -9.812  -30.740 1.00 49.40  ? 16   DT  E OP1   1 
ATOM   4466 O  OP2   . DT  E 2 16  ? -9.395  -7.756  -29.239 1.00 44.33  ? 16   DT  E OP2   1 
ATOM   4467 O  "O5'" . DT  E 2 16  ? -8.380  -9.923  -28.513 1.00 48.68  ? 16   DT  E "O5'" 1 
ATOM   4468 C  "C5'" . DT  E 2 16  ? -7.571  -11.053 -28.740 1.00 50.12  ? 16   DT  E "C5'" 1 
ATOM   4469 C  "C4'" . DT  E 2 16  ? -6.890  -11.522 -27.463 1.00 52.97  ? 16   DT  E "C4'" 1 
ATOM   4470 O  "O4'" . DT  E 2 16  ? -5.714  -10.737 -27.216 1.00 52.59  ? 16   DT  E "O4'" 1 
ATOM   4471 C  "C3'" . DT  E 2 16  ? -7.732  -11.430 -26.192 1.00 49.15  ? 16   DT  E "C3'" 1 
ATOM   4472 O  "O3'" . DT  E 2 16  ? -7.962  -12.729 -25.720 1.00 52.94  ? 16   DT  E "O3'" 1 
ATOM   4473 C  "C2'" . DT  E 2 16  ? -6.877  -10.582 -25.205 1.00 46.56  ? 16   DT  E "C2'" 1 
ATOM   4474 C  "C1'" . DT  E 2 16  ? -5.498  -10.691 -25.829 1.00 50.35  ? 16   DT  E "C1'" 1 
ATOM   4475 N  N1    . DT  E 2 16  ? -4.545  -9.580  -25.588 1.00 47.58  ? 16   DT  E N1    1 
ATOM   4476 C  C2    . DT  E 2 16  ? -3.322  -9.890  -25.053 1.00 52.64  ? 16   DT  E C2    1 
ATOM   4477 O  O2    . DT  E 2 16  ? -3.034  -11.004 -24.677 1.00 59.78  ? 16   DT  E O2    1 
ATOM   4478 N  N3    . DT  E 2 16  ? -2.454  -8.851  -24.939 1.00 51.49  ? 16   DT  E N3    1 
ATOM   4479 C  C4    . DT  E 2 16  ? -2.657  -7.550  -25.321 1.00 51.77  ? 16   DT  E C4    1 
ATOM   4480 O  O4    . DT  E 2 16  ? -1.794  -6.684  -25.172 1.00 53.80  ? 16   DT  E O4    1 
ATOM   4481 C  C5    . DT  E 2 16  ? -3.953  -7.273  -25.913 1.00 50.01  ? 16   DT  E C5    1 
ATOM   4482 C  C7    . DT  E 2 16  ? -4.287  -5.876  -26.372 1.00 43.87  ? 16   DT  E C7    1 
ATOM   4483 C  C6    . DT  E 2 16  ? -4.825  -8.305  -26.038 1.00 47.39  ? 16   DT  E C6    1 
ATOM   4484 P  P     . DT  E 2 17  ? -8.898  -12.955 -24.443 1.00 52.46  ? 17   DT  E P     1 
ATOM   4485 O  OP1   . DT  E 2 17  ? -9.532  -14.273 -24.535 1.00 55.61  ? 17   DT  E OP1   1 
ATOM   4486 O  OP2   . DT  E 2 17  ? -9.783  -11.785 -24.330 1.00 51.76  ? 17   DT  E OP2   1 
ATOM   4487 O  "O5'" . DT  E 2 17  ? -7.851  -12.963 -23.247 1.00 48.32  ? 17   DT  E "O5'" 1 
ATOM   4488 C  "C5'" . DT  E 2 17  ? -6.955  -14.021 -23.138 1.00 53.59  ? 17   DT  E "C5'" 1 
ATOM   4489 C  "C4'" . DT  E 2 17  ? -6.016  -13.794 -21.987 1.00 53.96  ? 17   DT  E "C4'" 1 
ATOM   4490 O  "O4'" . DT  E 2 17  ? -5.190  -12.631 -22.259 1.00 54.39  ? 17   DT  E "O4'" 1 
ATOM   4491 C  "C3'" . DT  E 2 17  ? -6.684  -13.521 -20.632 1.00 54.31  ? 17   DT  E "C3'" 1 
ATOM   4492 O  "O3'" . DT  E 2 17  ? -5.940  -14.160 -19.619 1.00 72.77  ? 17   DT  E "O3'" 1 
ATOM   4493 C  "C2'" . DT  E 2 17  ? -6.510  -12.019 -20.492 1.00 51.33  ? 17   DT  E "C2'" 1 
ATOM   4494 C  "C1'" . DT  E 2 17  ? -5.124  -11.873 -21.090 1.00 50.69  ? 17   DT  E "C1'" 1 
ATOM   4495 N  N1    . DT  E 2 17  ? -4.764  -10.499 -21.440 1.00 52.64  ? 17   DT  E N1    1 
ATOM   4496 C  C2    . DT  E 2 17  ? -3.463  -10.082 -21.272 1.00 53.72  ? 17   DT  E C2    1 
ATOM   4497 O  O2    . DT  E 2 17  ? -2.579  -10.796 -20.847 1.00 57.50  ? 17   DT  E O2    1 
ATOM   4498 N  N3    . DT  E 2 17  ? -3.232  -8.788  -21.621 1.00 51.90  ? 17   DT  E N3    1 
ATOM   4499 C  C4    . DT  E 2 17  ? -4.148  -7.879  -22.104 1.00 47.70  ? 17   DT  E C4    1 
ATOM   4500 O  O4    . DT  E 2 17  ? -3.835  -6.726  -22.381 1.00 47.99  ? 17   DT  E O4    1 
ATOM   4501 C  C5    . DT  E 2 17  ? -5.501  -8.376  -22.250 1.00 46.16  ? 17   DT  E C5    1 
ATOM   4502 C  C7    . DT  E 2 17  ? -6.587  -7.483  -22.777 1.00 43.21  ? 17   DT  E C7    1 
ATOM   4503 C  C6    . DT  E 2 17  ? -5.739  -9.646  -21.913 1.00 45.98  ? 17   DT  E C6    1 
ATOM   4504 P  P     . DC  E 2 18  ? -6.341  -15.604 -19.054 1.00 74.79  ? 18   DC  E P     1 
ATOM   4505 O  OP1   . DC  E 2 18  ? -6.346  -16.577 -20.180 1.00 70.17  ? 18   DC  E OP1   1 
ATOM   4506 O  OP2   . DC  E 2 18  ? -7.526  -15.413 -18.185 1.00 64.65  ? 18   DC  E OP2   1 
ATOM   4507 O  "O5'" . DC  E 2 18  ? -5.085  -15.988 -18.149 1.00 63.88  ? 18   DC  E "O5'" 1 
ATOM   4508 C  "C5'" . DC  E 2 18  ? -4.719  -15.163 -17.085 1.00 63.30  ? 18   DC  E "C5'" 1 
ATOM   4509 C  "C4'" . DC  E 2 18  ? -3.274  -14.757 -17.206 1.00 59.92  ? 18   DC  E "C4'" 1 
ATOM   4510 O  "O4'" . DC  E 2 18  ? -3.154  -13.699 -18.173 1.00 60.15  ? 18   DC  E "O4'" 1 
ATOM   4511 C  "C3'" . DC  E 2 18  ? -2.685  -14.203 -15.930 1.00 69.04  ? 18   DC  E "C3'" 1 
ATOM   4512 O  "O3'" . DC  E 2 18  ? -2.125  -15.257 -15.214 1.00 74.65  ? 18   DC  E "O3'" 1 
ATOM   4513 C  "C2'" . DC  E 2 18  ? -1.600  -13.263 -16.434 1.00 65.30  ? 18   DC  E "C2'" 1 
ATOM   4514 C  "C1'" . DC  E 2 18  ? -2.149  -12.788 -17.772 1.00 55.58  ? 18   DC  E "C1'" 1 
ATOM   4515 N  N1    . DC  E 2 18  ? -2.729  -11.428 -17.722 1.00 55.60  ? 18   DC  E N1    1 
ATOM   4516 C  C2    . DC  E 2 18  ? -1.879  -10.330 -17.604 1.00 59.44  ? 18   DC  E C2    1 
ATOM   4517 O  O2    . DC  E 2 18  ? -0.672  -10.521 -17.532 1.00 60.71  ? 18   DC  E O2    1 
ATOM   4518 N  N3    . DC  E 2 18  ? -2.407  -9.081  -17.569 1.00 58.78  ? 18   DC  E N3    1 
ATOM   4519 C  C4    . DC  E 2 18  ? -3.719  -8.918  -17.643 1.00 57.22  ? 18   DC  E C4    1 
ATOM   4520 N  N4    . DC  E 2 18  ? -4.185  -7.673  -17.606 1.00 63.63  ? 18   DC  E N4    1 
ATOM   4521 C  C5    . DC  E 2 18  ? -4.611  -10.025 -17.762 1.00 50.81  ? 18   DC  E C5    1 
ATOM   4522 C  C6    . DC  E 2 18  ? -4.079  -11.252 -17.794 1.00 50.35  ? 18   DC  E C6    1 
ATOM   4523 P  P     . DC  E 2 19  ? -2.041  -15.219 -13.616 1.00 83.09  ? 19   DC  E P     1 
ATOM   4524 O  OP1   . DC  E 2 19  ? -1.270  -16.432 -13.310 1.00 82.94  ? 19   DC  E OP1   1 
ATOM   4525 O  OP2   . DC  E 2 19  ? -3.380  -14.987 -13.021 1.00 61.31  ? 19   DC  E OP2   1 
ATOM   4526 O  "O5'" . DC  E 2 19  ? -1.108  -13.971 -13.297 1.00 73.33  ? 19   DC  E "O5'" 1 
ATOM   4527 C  "C5'" . DC  E 2 19  ? 0.271   -14.103 -13.425 1.00 72.49  ? 19   DC  E "C5'" 1 
ATOM   4528 C  "C4'" . DC  E 2 19  ? 0.946   -12.795 -13.092 1.00 77.14  ? 19   DC  E "C4'" 1 
ATOM   4529 O  "O4'" . DC  E 2 19  ? 0.481   -11.779 -13.999 1.00 76.41  ? 19   DC  E "O4'" 1 
ATOM   4530 C  "C3'" . DC  E 2 19  ? 0.620   -12.231 -11.723 1.00 75.77  ? 19   DC  E "C3'" 1 
ATOM   4531 O  "O3'" . DC  E 2 19  ? 1.467   -12.811 -10.727 1.00 80.75  ? 19   DC  E "O3'" 1 
ATOM   4532 C  "C2'" . DC  E 2 19  ? 0.932   -10.744 -11.911 1.00 80.91  ? 19   DC  E "C2'" 1 
ATOM   4533 C  "C1'" . DC  E 2 19  ? 0.731   -10.522 -13.416 1.00 74.22  ? 19   DC  E "C1'" 1 
ATOM   4534 N  N1    . DC  E 2 19  ? -0.394  -9.600  -13.726 1.00 71.81  ? 19   DC  E N1    1 
ATOM   4535 C  C2    . DC  E 2 19  ? -0.143  -8.230  -13.765 1.00 70.01  ? 19   DC  E C2    1 
ATOM   4536 O  O2    . DC  E 2 19  ? 1.002   -7.835  -13.552 1.00 68.36  ? 19   DC  E O2    1 
ATOM   4537 N  N3    . DC  E 2 19  ? -1.158  -7.374  -14.046 1.00 66.38  ? 19   DC  E N3    1 
ATOM   4538 C  C4    . DC  E 2 19  ? -2.381  -7.849  -14.271 1.00 59.08  ? 19   DC  E C4    1 
ATOM   4539 N  N4    . DC  E 2 19  ? -3.346  -6.969  -14.544 1.00 56.08  ? 19   DC  E N4    1 
ATOM   4540 C  C5    . DC  E 2 19  ? -2.663  -9.249  -14.225 1.00 59.58  ? 19   DC  E C5    1 
ATOM   4541 C  C6    . DC  E 2 19  ? -1.649  -10.085 -13.950 1.00 59.22  ? 19   DC  E C6    1 
ATOM   4542 P  P     . DG  E 2 20  ? 1.086   -12.699 -9.165  1.00 90.25  ? 20   DG  E P     1 
ATOM   4543 O  OP1   . DG  E 2 20  ? 1.973   -13.622 -8.431  1.00 103.68 ? 20   DG  E OP1   1 
ATOM   4544 O  OP2   . DG  E 2 20  ? -0.377  -12.871 -9.025  1.00 83.39  ? 20   DG  E OP2   1 
ATOM   4545 O  "O5'" . DG  E 2 20  ? 1.474   -11.200 -8.771  1.00 79.02  ? 20   DG  E "O5'" 1 
ATOM   4546 C  "C5'" . DG  E 2 20  ? 2.801   -10.729 -8.986  1.00 80.60  ? 20   DG  E "C5'" 1 
ATOM   4547 C  "C4'" . DG  E 2 20  ? 2.863   -9.230  -8.791  1.00 77.99  ? 20   DG  E "C4'" 1 
ATOM   4548 O  "O4'" . DG  E 2 20  ? 2.157   -8.589  -9.874  1.00 81.83  ? 20   DG  E "O4'" 1 
ATOM   4549 C  "C3'" . DG  E 2 20  ? 2.210   -8.751  -7.499  1.00 83.54  ? 20   DG  E "C3'" 1 
ATOM   4550 O  "O3'" . DG  E 2 20  ? 3.197   -8.356  -6.557  1.00 93.24  ? 20   DG  E "O3'" 1 
ATOM   4551 C  "C2'" . DG  E 2 20  ? 1.356   -7.554  -7.896  1.00 81.89  ? 20   DG  E "C2'" 1 
ATOM   4552 C  "C1'" . DG  E 2 20  ? 1.464   -7.450  -9.405  1.00 82.33  ? 20   DG  E "C1'" 1 
ATOM   4553 N  N9    . DG  E 2 20  ? 0.123   -7.377  -9.996  1.00 77.50  ? 20   DG  E N9    1 
ATOM   4554 C  C8    . DG  E 2 20  ? -0.797  -8.395  -10.113 1.00 69.02  ? 20   DG  E C8    1 
ATOM   4555 N  N7    . DG  E 2 20  ? -1.928  -8.006  -10.623 1.00 74.13  ? 20   DG  E N7    1 
ATOM   4556 C  C5    . DG  E 2 20  ? -1.756  -6.638  -10.827 1.00 65.68  ? 20   DG  E C5    1 
ATOM   4557 C  C6    . DG  E 2 20  ? -2.652  -5.674  -11.354 1.00 65.36  ? 20   DG  E C6    1 
ATOM   4558 O  O6    . DG  E 2 20  ? -3.810  -5.852  -11.760 1.00 69.26  ? 20   DG  E O6    1 
ATOM   4559 N  N1    . DG  E 2 20  ? -2.082  -4.393  -11.387 1.00 60.87  ? 20   DG  E N1    1 
ATOM   4560 C  C2    . DG  E 2 20  ? -0.801  -4.092  -10.959 1.00 62.63  ? 20   DG  E C2    1 
ATOM   4561 N  N2    . DG  E 2 20  ? -0.414  -2.810  -11.062 1.00 56.23  ? 20   DG  E N2    1 
ATOM   4562 N  N3    . DG  E 2 20  ? 0.039   -4.990  -10.465 1.00 63.23  ? 20   DG  E N3    1 
ATOM   4563 C  C4    . DG  E 2 20  ? -0.510  -6.237  -10.427 1.00 64.71  ? 20   DG  E C4    1 
ATOM   4564 P  P     . DG  E 2 21  ? 2.764   -7.900  -5.076  1.00 89.65  ? 21   DG  E P     1 
ATOM   4565 O  OP1   . DG  E 2 21  ? 4.047   -7.646  -4.377  1.00 81.34  ? 21   DG  E OP1   1 
ATOM   4566 O  OP2   . DG  E 2 21  ? 1.814   -8.917  -4.559  1.00 82.59  ? 21   DG  E OP2   1 
ATOM   4567 O  "O5'" . DG  E 2 21  ? 1.980   -6.497  -5.275  1.00 68.76  ? 21   DG  E "O5'" 1 
ATOM   4568 C  "C5'" . DG  E 2 21  ? 2.723   -5.332  -5.645  1.00 77.61  ? 21   DG  E "C5'" 1 
ATOM   4569 C  "C4'" . DG  E 2 21  ? 1.838   -4.137  -6.013  1.00 66.35  ? 21   DG  E "C4'" 1 
ATOM   4570 O  "O4'" . DG  E 2 21  ? 0.958   -4.456  -7.098  1.00 66.12  ? 21   DG  E "O4'" 1 
ATOM   4571 C  "C3'" . DG  E 2 21  ? 0.897   -3.614  -4.946  1.00 71.65  ? 21   DG  E "C3'" 1 
ATOM   4572 O  "O3'" . DG  E 2 21  ? 1.612   -2.817  -4.002  1.00 76.05  ? 21   DG  E "O3'" 1 
ATOM   4573 C  "C2'" . DG  E 2 21  ? -0.040  -2.740  -5.792  1.00 71.35  ? 21   DG  E "C2'" 1 
ATOM   4574 C  "C1'" . DG  E 2 21  ? -0.057  -3.454  -7.143  1.00 67.49  ? 21   DG  E "C1'" 1 
ATOM   4575 N  N9    . DG  E 2 21  ? -1.350  -4.075  -7.429  1.00 69.16  ? 21   DG  E N9    1 
ATOM   4576 C  C8    . DG  E 2 21  ? -1.716  -5.384  -7.206  1.00 61.86  ? 21   DG  E C8    1 
ATOM   4577 N  N7    . DG  E 2 21  ? -2.944  -5.641  -7.549  1.00 60.40  ? 21   DG  E N7    1 
ATOM   4578 C  C5    . DG  E 2 21  ? -3.424  -4.427  -8.026  1.00 53.26  ? 21   DG  E C5    1 
ATOM   4579 C  C6    . DG  E 2 21  ? -4.693  -4.096  -8.541  1.00 52.65  ? 21   DG  E C6    1 
ATOM   4580 O  O6    . DG  E 2 21  ? -5.670  -4.835  -8.684  1.00 57.74  ? 21   DG  E O6    1 
ATOM   4581 N  N1    . DG  E 2 21  ? -4.780  -2.756  -8.902  1.00 53.00  ? 21   DG  E N1    1 
ATOM   4582 C  C2    . DG  E 2 21  ? -3.759  -1.846  -8.787  1.00 56.92  ? 21   DG  E C2    1 
ATOM   4583 N  N2    . DG  E 2 21  ? -4.029  -0.591  -9.203  1.00 47.22  ? 21   DG  E N2    1 
ATOM   4584 N  N3    . DG  E 2 21  ? -2.547  -2.149  -8.310  1.00 57.32  ? 21   DG  E N3    1 
ATOM   4585 C  C4    . DG  E 2 21  ? -2.460  -3.454  -7.949  1.00 57.66  ? 21   DG  E C4    1 
ATOM   4586 P  P     . DC  E 2 22  ? 0.899   -2.288  -2.658  1.00 79.14  ? 22   DC  E P     1 
ATOM   4587 O  OP1   . DC  E 2 22  ? 1.891   -1.432  -1.972  1.00 82.06  ? 22   DC  E OP1   1 
ATOM   4588 O  OP2   . DC  E 2 22  ? 0.302   -3.462  -1.974  1.00 69.61  ? 22   DC  E OP2   1 
ATOM   4589 O  "O5'" . DC  E 2 22  ? -0.265  -1.309  -3.168  1.00 63.66  ? 22   DC  E "O5'" 1 
ATOM   4590 C  "C5'" . DC  E 2 22  ? 0.051   0.005   -3.648  1.00 64.97  ? 22   DC  E "C5'" 1 
ATOM   4591 C  "C4'" . DC  E 2 22  ? -1.215  0.722   -4.097  1.00 66.86  ? 22   DC  E "C4'" 1 
ATOM   4592 O  "O4'" . DC  E 2 22  ? -1.970  -0.159  -4.970  1.00 70.98  ? 22   DC  E "O4'" 1 
ATOM   4593 C  "C3'" . DC  E 2 22  ? -2.154  1.119   -2.957  1.00 61.78  ? 22   DC  E "C3'" 1 
ATOM   4594 O  "O3'" . DC  E 2 22  ? -2.356  2.518   -2.918  1.00 63.51  ? 22   DC  E "O3'" 1 
ATOM   4595 C  "C2'" . DC  E 2 22  ? -3.468  0.383   -3.237  1.00 70.38  ? 22   DC  E "C2'" 1 
ATOM   4596 C  "C1'" . DC  E 2 22  ? -3.349  -0.061  -4.689  1.00 68.23  ? 22   DC  E "C1'" 1 
ATOM   4597 N  N1    . DC  E 2 22  ? -4.006  -1.401  -4.917  1.00 59.55  ? 22   DC  E N1    1 
ATOM   4598 C  C2    . DC  E 2 22  ? -5.265  -1.455  -5.533  1.00 58.42  ? 22   DC  E C2    1 
ATOM   4599 O  O2    . DC  E 2 22  ? -5.786  -0.398  -5.915  1.00 61.49  ? 22   DC  E O2    1 
ATOM   4600 N  N3    . DC  E 2 22  ? -5.872  -2.667  -5.704  1.00 53.87  ? 22   DC  E N3    1 
ATOM   4601 C  C4    . DC  E 2 22  ? -5.258  -3.781  -5.280  1.00 59.66  ? 22   DC  E C4    1 
ATOM   4602 N  N4    . DC  E 2 22  ? -5.876  -4.951  -5.473  1.00 60.71  ? 22   DC  E N4    1 
ATOM   4603 C  C5    . DC  E 2 22  ? -3.978  -3.740  -4.642  1.00 58.97  ? 22   DC  E C5    1 
ATOM   4604 C  C6    . DC  E 2 22  ? -3.401  -2.542  -4.471  1.00 57.63  ? 22   DC  E C6    1 
ATOM   4605 P  P     . DG  E 2 23  ? -3.259  3.139   -1.737  1.00 74.79  ? 23   DG  E P     1 
ATOM   4606 O  OP1   . DG  E 2 23  ? -2.843  4.544   -1.529  1.00 69.89  ? 23   DG  E OP1   1 
ATOM   4607 O  OP2   . DG  E 2 23  ? -3.325  2.128   -0.652  1.00 58.84  ? 23   DG  E OP2   1 
ATOM   4608 O  "O5'" . DG  E 2 23  ? -4.735  3.161   -2.320  1.00 67.42  ? 23   DG  E "O5'" 1 
ATOM   4609 C  "C5'" . DG  E 2 23  ? -5.038  4.022   -3.371  1.00 74.79  ? 23   DG  E "C5'" 1 
ATOM   4610 C  "C4'" . DG  E 2 23  ? -6.527  4.034   -3.621  1.00 73.75  ? 23   DG  E "C4'" 1 
ATOM   4611 O  "O4'" . DG  E 2 23  ? -6.963  2.725   -4.089  1.00 69.85  ? 23   DG  E "O4'" 1 
ATOM   4612 C  "C3'" . DG  E 2 23  ? -7.361  4.371   -2.399  1.00 65.69  ? 23   DG  E "C3'" 1 
ATOM   4613 O  "O3'" . DG  E 2 23  ? -8.379  5.302   -2.789  1.00 72.26  ? 23   DG  E "O3'" 1 
ATOM   4614 C  "C2'" . DG  E 2 23  ? -7.921  3.007   -1.960  1.00 63.58  ? 23   DG  E "C2'" 1 
ATOM   4615 C  "C1'" . DG  E 2 23  ? -8.010  2.237   -3.282  1.00 63.32  ? 23   DG  E "C1'" 1 
ATOM   4616 N  N9    . DG  E 2 23  ? -7.852  0.774   -3.143  1.00 61.49  ? 23   DG  E N9    1 
ATOM   4617 C  C8    . DG  E 2 23  ? -6.776  0.104   -2.602  1.00 56.79  ? 23   DG  E C8    1 
ATOM   4618 N  N7    . DG  E 2 23  ? -6.905  -1.201  -2.619  1.00 55.55  ? 23   DG  E N7    1 
ATOM   4619 C  C5    . DG  E 2 23  ? -8.140  -1.418  -3.219  1.00 53.85  ? 23   DG  E C5    1 
ATOM   4620 C  C6    . DG  E 2 23  ? -8.820  -2.636  -3.499  1.00 55.86  ? 23   DG  E C6    1 
ATOM   4621 O  O6    . DG  E 2 23  ? -8.454  -3.808  -3.268  1.00 54.15  ? 23   DG  E O6    1 
ATOM   4622 N  N1    . DG  E 2 23  ? -10.047 -2.406  -4.110  1.00 51.88  ? 23   DG  E N1    1 
ATOM   4623 C  C2    . DG  E 2 23  ? -10.556 -1.168  -4.408  1.00 50.98  ? 23   DG  E C2    1 
ATOM   4624 N  N2    . DG  E 2 23  ? -11.762 -1.158  -4.998  1.00 56.67  ? 23   DG  E N2    1 
ATOM   4625 N  N3    . DG  E 2 23  ? -9.936  -0.018  -4.149  1.00 46.68  ? 23   DG  E N3    1 
ATOM   4626 C  C4    . DG  E 2 23  ? -8.737  -0.217  -3.555  1.00 53.83  ? 23   DG  E C4    1 
ATOM   4627 P  P     . DC  E 2 24  ? -9.195  6.161   -1.699  1.00 88.14  ? 24   DC  E P     1 
ATOM   4628 O  OP1   . DC  E 2 24  ? -9.385  7.506   -2.288  1.00 81.35  ? 24   DC  E OP1   1 
ATOM   4629 O  OP2   . DC  E 2 24  ? -8.587  6.035   -0.353  1.00 68.83  ? 24   DC  E OP2   1 
ATOM   4630 O  "O5'" . DC  E 2 24  ? -10.596 5.397   -1.617  1.00 74.24  ? 24   DC  E "O5'" 1 
ATOM   4631 C  "C5'" . DC  E 2 24  ? -11.434 5.345   -2.737  1.00 64.16  ? 24   DC  E "C5'" 1 
ATOM   4632 C  "C4'" . DC  E 2 24  ? -12.455 4.268   -2.541  1.00 68.98  ? 24   DC  E "C4'" 1 
ATOM   4633 O  "O4'" . DC  E 2 24  ? -11.793 3.008   -2.527  1.00 73.43  ? 24   DC  E "O4'" 1 
ATOM   4634 C  "C3'" . DC  E 2 24  ? -13.158 4.300   -1.196  1.00 75.25  ? 24   DC  E "C3'" 1 
ATOM   4635 O  "O3'" . DC  E 2 24  ? -14.327 5.085   -1.270  1.00 75.16  ? 24   DC  E "O3'" 1 
ATOM   4636 C  "C2'" . DC  E 2 24  ? -13.491 2.821   -0.921  1.00 68.67  ? 24   DC  E "C2'" 1 
ATOM   4637 C  "C1'" . DC  E 2 24  ? -12.696 2.076   -1.992  1.00 67.58  ? 24   DC  E "C1'" 1 
ATOM   4638 N  N1    . DC  E 2 24  ? -11.920 0.911   -1.503  1.00 56.14  ? 24   DC  E N1    1 
ATOM   4639 C  C2    . DC  E 2 24  ? -12.411 -0.374  -1.736  1.00 55.49  ? 24   DC  E C2    1 
ATOM   4640 O  O2    . DC  E 2 24  ? -13.506 -0.501  -2.296  1.00 56.24  ? 24   DC  E O2    1 
ATOM   4641 N  N3    . DC  E 2 24  ? -11.678 -1.443  -1.333  1.00 52.73  ? 24   DC  E N3    1 
ATOM   4642 C  C4    . DC  E 2 24  ? -10.500 -1.248  -0.731  1.00 55.54  ? 24   DC  E C4    1 
ATOM   4643 N  N4    . DC  E 2 24  ? -9.812  -2.326  -0.346  1.00 60.87  ? 24   DC  E N4    1 
ATOM   4644 C  C5    . DC  E 2 24  ? -9.975  0.059   -0.503  1.00 53.41  ? 24   DC  E C5    1 
ATOM   4645 C  C6    . DC  E 2 24  ? -10.712 1.100   -0.910  1.00 56.00  ? 24   DC  E C6    1 
ATOM   4646 P  P     . DG  E 2 25  ? -15.150 5.392   0.069   1.00 73.02  ? 25   DG  E P     1 
ATOM   4647 O  OP1   . DG  E 2 25  ? -15.977 6.603   -0.178  1.00 76.10  ? 25   DG  E OP1   1 
ATOM   4648 O  OP2   . DG  E 2 25  ? -14.187 5.373   1.202   1.00 62.83  ? 25   DG  E OP2   1 
ATOM   4649 O  "O5'" . DG  E 2 25  ? -16.129 4.131   0.179   1.00 68.16  ? 25   DG  E "O5'" 1 
ATOM   4650 C  "C5'" . DG  E 2 25  ? -17.289 4.074   -0.639  1.00 61.21  ? 25   DG  E "C5'" 1 
ATOM   4651 C  "C4'" . DG  E 2 25  ? -18.114 2.832   -0.342  1.00 58.56  ? 25   DG  E "C4'" 1 
ATOM   4652 O  "O4'" . DG  E 2 25  ? -17.259 1.661   -0.369  1.00 59.85  ? 25   DG  E "O4'" 1 
ATOM   4653 C  "C3'" . DG  E 2 25  ? -18.799 2.818   1.015   1.00 60.33  ? 25   DG  E "C3'" 1 
ATOM   4654 O  "O3'" . DG  E 2 25  ? -20.081 2.189   0.904   1.00 68.12  ? 25   DG  E "O3'" 1 
ATOM   4655 C  "C2'" . DG  E 2 25  ? -17.833 1.994   1.872   1.00 60.20  ? 25   DG  E "C2'" 1 
ATOM   4656 C  "C1'" . DG  E 2 25  ? -17.311 0.978   0.868   1.00 57.36  ? 25   DG  E "C1'" 1 
ATOM   4657 N  N9    . DG  E 2 25  ? -15.960 0.493   1.173   1.00 54.73  ? 25   DG  E N9    1 
ATOM   4658 C  C8    . DG  E 2 25  ? -14.884 1.261   1.534   1.00 55.21  ? 25   DG  E C8    1 
ATOM   4659 N  N7    . DG  E 2 25  ? -13.791 0.575   1.730   1.00 54.26  ? 25   DG  E N7    1 
ATOM   4660 C  C5    . DG  E 2 25  ? -14.155 -0.735  1.478   1.00 48.68  ? 25   DG  E C5    1 
ATOM   4661 C  C6    . DG  E 2 25  ? -13.377 -1.913  1.547   1.00 51.31  ? 25   DG  E C6    1 
ATOM   4662 O  O6    . DG  E 2 25  ? -12.174 -2.018  1.851   1.00 53.49  ? 25   DG  E O6    1 
ATOM   4663 N  N1    . DG  E 2 25  ? -14.119 -3.048  1.219   1.00 43.30  ? 25   DG  E N1    1 
ATOM   4664 C  C2    . DG  E 2 25  ? -15.451 -3.045  0.888   1.00 53.41  ? 25   DG  E C2    1 
ATOM   4665 N  N2    . DG  E 2 25  ? -15.989 -4.245  0.618   1.00 50.00  ? 25   DG  E N2    1 
ATOM   4666 N  N3    . DG  E 2 25  ? -16.210 -1.936  0.828   1.00 55.27  ? 25   DG  E N3    1 
ATOM   4667 C  C4    . DG  E 2 25  ? -15.489 -0.817  1.134   1.00 51.78  ? 25   DG  E C4    1 
ATOM   4668 O  "O5'" . DC  F 3 1   ? -12.474 -11.112 3.637   1.00 77.90  ? 1    DC  F "O5'" 1 
ATOM   4669 C  "C5'" . DC  F 3 1   ? -13.776 -11.612 3.941   1.00 76.76  ? 1    DC  F "C5'" 1 
ATOM   4670 C  "C4'" . DC  F 3 1   ? -14.824 -11.032 3.003   1.00 71.19  ? 1    DC  F "C4'" 1 
ATOM   4671 O  "O4'" . DC  F 3 1   ? -14.755 -9.577  3.021   1.00 69.90  ? 1    DC  F "O4'" 1 
ATOM   4672 C  "C3'" . DC  F 3 1   ? -14.684 -11.429 1.535   1.00 69.47  ? 1    DC  F "C3'" 1 
ATOM   4673 O  "O3'" . DC  F 3 1   ? -15.972 -11.482 0.949   1.00 79.94  ? 1    DC  F "O3'" 1 
ATOM   4674 C  "C2'" . DC  F 3 1   ? -13.865 -10.275 0.964   1.00 67.66  ? 1    DC  F "C2'" 1 
ATOM   4675 C  "C1'" . DC  F 3 1   ? -14.484 -9.103  1.715   1.00 66.18  ? 1    DC  F "C1'" 1 
ATOM   4676 N  N1    . DC  F 3 1   ? -13.597 -7.918  1.826   1.00 65.11  ? 1    DC  F N1    1 
ATOM   4677 C  C2    . DC  F 3 1   ? -14.113 -6.656  1.514   1.00 58.87  ? 1    DC  F C2    1 
ATOM   4678 O  O2    . DC  F 3 1   ? -15.291 -6.569  1.133   1.00 54.65  ? 1    DC  F O2    1 
ATOM   4679 N  N3    . DC  F 3 1   ? -13.305 -5.569  1.629   1.00 52.10  ? 1    DC  F N3    1 
ATOM   4680 C  C4    . DC  F 3 1   ? -12.039 -5.716  2.039   1.00 52.13  ? 1    DC  F C4    1 
ATOM   4681 N  N4    . DC  F 3 1   ? -11.277 -4.606  2.132   1.00 49.91  ? 1    DC  F N4    1 
ATOM   4682 C  C5    . DC  F 3 1   ? -11.495 -7.001  2.369   1.00 44.38  ? 1    DC  F C5    1 
ATOM   4683 C  C6    . DC  F 3 1   ? -12.298 -8.063  2.248   1.00 55.83  ? 1    DC  F C6    1 
ATOM   4684 P  P     . DG  F 3 2   ? -16.189 -12.144 -0.497  1.00 85.92  ? 2    DG  F P     1 
ATOM   4685 O  OP1   . DG  F 3 2   ? -17.472 -12.884 -0.437  1.00 70.48  ? 2    DG  F OP1   1 
ATOM   4686 O  OP2   . DG  F 3 2   ? -14.945 -12.835 -0.894  1.00 66.70  ? 2    DG  F OP2   1 
ATOM   4687 O  "O5'" . DG  F 3 2   ? -16.381 -10.886 -1.462  1.00 76.33  ? 2    DG  F "O5'" 1 
ATOM   4688 C  "C5'" . DG  F 3 2   ? -17.609 -10.174 -1.444  1.00 74.40  ? 2    DG  F "C5'" 1 
ATOM   4689 C  "C4'" . DG  F 3 2   ? -17.560 -8.989  -2.388  1.00 72.04  ? 2    DG  F "C4'" 1 
ATOM   4690 O  "O4'" . DG  F 3 2   ? -16.588 -8.035  -1.903  1.00 69.97  ? 2    DG  F "O4'" 1 
ATOM   4691 C  "C3'" . DG  F 3 2   ? -17.154 -9.321  -3.827  1.00 69.79  ? 2    DG  F "C3'" 1 
ATOM   4692 O  "O3'" . DG  F 3 2   ? -18.069 -8.728  -4.730  1.00 72.11  ? 2    DG  F "O3'" 1 
ATOM   4693 C  "C2'" . DG  F 3 2   ? -15.757 -8.706  -3.960  1.00 69.87  ? 2    DG  F "C2'" 1 
ATOM   4694 C  "C1'" . DG  F 3 2   ? -15.842 -7.551  -2.981  1.00 61.52  ? 2    DG  F "C1'" 1 
ATOM   4695 N  N9    . DG  F 3 2   ? -14.547 -7.124  -2.480  1.00 58.68  ? 2    DG  F N9    1 
ATOM   4696 C  C8    . DG  F 3 2   ? -13.500 -7.924  -2.091  1.00 51.49  ? 2    DG  F C8    1 
ATOM   4697 N  N7    . DG  F 3 2   ? -12.454 -7.250  -1.696  1.00 51.30  ? 2    DG  F N7    1 
ATOM   4698 C  C5    . DG  F 3 2   ? -12.832 -5.924  -1.824  1.00 48.16  ? 2    DG  F C5    1 
ATOM   4699 C  C6    . DG  F 3 2   ? -12.112 -4.738  -1.533  1.00 55.32  ? 2    DG  F C6    1 
ATOM   4700 O  O6    . DG  F 3 2   ? -10.947 -4.627  -1.092  1.00 53.64  ? 2    DG  F O6    1 
ATOM   4701 N  N1    . DG  F 3 2   ? -12.874 -3.595  -1.815  1.00 52.51  ? 2    DG  F N1    1 
ATOM   4702 C  C2    . DG  F 3 2   ? -14.161 -3.612  -2.304  1.00 50.63  ? 2    DG  F C2    1 
ATOM   4703 N  N2    . DG  F 3 2   ? -14.731 -2.421  -2.507  1.00 49.65  ? 2    DG  F N2    1 
ATOM   4704 N  N3    . DG  F 3 2   ? -14.843 -4.716  -2.570  1.00 44.60  ? 2    DG  F N3    1 
ATOM   4705 C  C4    . DG  F 3 2   ? -14.120 -5.827  -2.306  1.00 52.72  ? 2    DG  F C4    1 
ATOM   4706 P  P     . DC  F 3 3   ? -18.402 -9.434  -6.134  1.00 78.91  ? 3    DC  F P     1 
ATOM   4707 O  OP1   . DC  F 3 3   ? -19.845 -9.778  -6.187  1.00 82.96  ? 3    DC  F OP1   1 
ATOM   4708 O  OP2   . DC  F 3 3   ? -17.361 -10.442 -6.396  1.00 77.30  ? 3    DC  F OP2   1 
ATOM   4709 O  "O5'" . DC  F 3 3   ? -18.150 -8.288  -7.188  1.00 77.19  ? 3    DC  F "O5'" 1 
ATOM   4710 C  "C5'" . DC  F 3 3   ? -16.860 -7.900  -7.464  1.00 67.28  ? 3    DC  F "C5'" 1 
ATOM   4711 C  "C4'" . DC  F 3 3   ? -16.724 -6.421  -7.263  1.00 63.79  ? 3    DC  F "C4'" 1 
ATOM   4712 O  "O4'" . DC  F 3 3   ? -15.777 -6.198  -6.204  1.00 71.27  ? 3    DC  F "O4'" 1 
ATOM   4713 C  "C3'" . DC  F 3 3   ? -16.205 -5.686  -8.488  1.00 62.84  ? 3    DC  F "C3'" 1 
ATOM   4714 O  "O3'" . DC  F 3 3   ? -17.211 -4.801  -8.995  1.00 61.13  ? 3    DC  F "O3'" 1 
ATOM   4715 C  "C2'" . DC  F 3 3   ? -14.940 -4.945  -8.016  1.00 59.55  ? 3    DC  F "C2'" 1 
ATOM   4716 C  "C1'" . DC  F 3 3   ? -14.962 -5.096  -6.499  1.00 60.84  ? 3    DC  F "C1'" 1 
ATOM   4717 N  N1    . DC  F 3 3   ? -13.604 -5.335  -5.865  1.00 50.97  ? 3    DC  F N1    1 
ATOM   4718 C  C2    . DC  F 3 3   ? -12.827 -4.245  -5.492  1.00 50.53  ? 3    DC  F C2    1 
ATOM   4719 O  O2    . DC  F 3 3   ? -13.243 -3.114  -5.720  1.00 53.65  ? 3    DC  F O2    1 
ATOM   4720 N  N3    . DC  F 3 3   ? -11.624 -4.456  -4.916  1.00 53.02  ? 3    DC  F N3    1 
ATOM   4721 C  C4    . DC  F 3 3   ? -11.196 -5.705  -4.688  1.00 56.52  ? 3    DC  F C4    1 
ATOM   4722 N  N4    . DC  F 3 3   ? -9.988  -5.856  -4.106  1.00 54.44  ? 3    DC  F N4    1 
ATOM   4723 C  C5    . DC  F 3 3   ? -11.979 -6.845  -5.051  1.00 48.93  ? 3    DC  F C5    1 
ATOM   4724 C  C6    . DC  F 3 3   ? -13.169 -6.613  -5.629  1.00 52.22  ? 3    DC  F C6    1 
ATOM   4725 P  P     . DG  F 3 4   ? -17.108 -4.244  -10.503 1.00 54.61  ? 4    DG  F P     1 
ATOM   4726 O  OP1   . DG  F 3 4   ? -18.299 -3.419  -10.809 1.00 56.36  ? 4    DG  F OP1   1 
ATOM   4727 O  OP2   . DG  F 3 4   ? -16.707 -5.364  -11.392 1.00 53.02  ? 4    DG  F OP2   1 
ATOM   4728 O  "O5'" . DG  F 3 4   ? -15.927 -3.203  -10.431 1.00 46.95  ? 4    DG  F "O5'" 1 
ATOM   4729 C  "C5'" . DG  F 3 4   ? -16.226 -1.857  -10.198 1.00 47.89  ? 4    DG  F "C5'" 1 
ATOM   4730 C  "C4'" . DG  F 3 4   ? -14.954 -1.081  -9.998  1.00 48.16  ? 4    DG  F "C4'" 1 
ATOM   4731 O  "O4'" . DG  F 3 4   ? -14.042 -1.875  -9.233  1.00 58.24  ? 4    DG  F "O4'" 1 
ATOM   4732 C  "C3'" . DG  F 3 4   ? -14.206 -0.719  -11.284 1.00 47.74  ? 4    DG  F "C3'" 1 
ATOM   4733 O  "O3'" . DG  F 3 4   ? -14.195 0.681   -11.398 1.00 48.42  ? 4    DG  F "O3'" 1 
ATOM   4734 C  "C2'" . DG  F 3 4   ? -12.797 -1.310  -11.087 1.00 50.00  ? 4    DG  F "C2'" 1 
ATOM   4735 C  "C1'" . DG  F 3 4   ? -12.751 -1.509  -9.581  1.00 52.63  ? 4    DG  F "C1'" 1 
ATOM   4736 N  N9    . DG  F 3 4   ? -11.856 -2.560  -9.115  1.00 49.06  ? 4    DG  F N9    1 
ATOM   4737 C  C8    . DG  F 3 4   ? -12.037 -3.923  -9.204  1.00 50.52  ? 4    DG  F C8    1 
ATOM   4738 N  N7    . DG  F 3 4   ? -11.066 -4.614  -8.659  1.00 49.57  ? 4    DG  F N7    1 
ATOM   4739 C  C5    . DG  F 3 4   ? -10.193 -3.641  -8.170  1.00 46.79  ? 4    DG  F C5    1 
ATOM   4740 C  C6    . DG  F 3 4   ? -8.963  -3.771  -7.490  1.00 50.22  ? 4    DG  F C6    1 
ATOM   4741 O  O6    . DG  F 3 4   ? -8.367  -4.810  -7.153  1.00 57.94  ? 4    DG  F O6    1 
ATOM   4742 N  N1    . DG  F 3 4   ? -8.404  -2.533  -7.194  1.00 49.30  ? 4    DG  F N1    1 
ATOM   4743 C  C2    . DG  F 3 4   ? -8.962  -1.320  -7.492  1.00 49.76  ? 4    DG  F C2    1 
ATOM   4744 N  N2    . DG  F 3 4   ? -8.268  -0.233  -7.113  1.00 48.01  ? 4    DG  F N2    1 
ATOM   4745 N  N3    . DG  F 3 4   ? -10.113 -1.177  -8.125  1.00 53.24  ? 4    DG  F N3    1 
ATOM   4746 C  C4    . DG  F 3 4   ? -10.673 -2.378  -8.433  1.00 51.92  ? 4    DG  F C4    1 
ATOM   4747 P  P     . DC  F 3 5   ? -13.512 1.401   -12.644 1.00 50.64  ? 5    DC  F P     1 
ATOM   4748 O  OP1   . DC  F 3 5   ? -14.236 2.646   -12.989 1.00 52.60  ? 5    DC  F OP1   1 
ATOM   4749 O  OP2   . DC  F 3 5   ? -13.314 0.359   -13.658 1.00 53.50  ? 5    DC  F OP2   1 
ATOM   4750 O  "O5'" . DC  F 3 5   ? -12.098 1.794   -12.063 1.00 51.24  ? 5    DC  F "O5'" 1 
ATOM   4751 C  "C5'" . DC  F 3 5   ? -11.331 2.782   -12.696 1.00 57.39  ? 5    DC  F "C5'" 1 
ATOM   4752 C  "C4'" . DC  F 3 5   ? -10.074 3.079   -11.899 1.00 47.99  ? 5    DC  F "C4'" 1 
ATOM   4753 O  "O4'" . DC  F 3 5   ? -9.750  1.965   -11.042 1.00 48.18  ? 5    DC  F "O4'" 1 
ATOM   4754 C  "C3'" . DC  F 3 5   ? -8.847  3.360   -12.743 1.00 51.21  ? 5    DC  F "C3'" 1 
ATOM   4755 O  "O3'" . DC  F 3 5   ? -8.235  4.526   -12.245 1.00 59.35  ? 5    DC  F "O3'" 1 
ATOM   4756 C  "C2'" . DC  F 3 5   ? -7.978  2.103   -12.582 1.00 48.67  ? 5    DC  F "C2'" 1 
ATOM   4757 C  "C1'" . DC  F 3 5   ? -8.410  1.575   -11.223 1.00 51.22  ? 5    DC  F "C1'" 1 
ATOM   4758 N  N1    . DC  F 3 5   ? -8.340  0.076   -11.081 1.00 47.06  ? 5    DC  F N1    1 
ATOM   4759 C  C2    . DC  F 3 5   ? -7.221  -0.510  -10.477 1.00 46.01  ? 5    DC  F C2    1 
ATOM   4760 O  O2    . DC  F 3 5   ? -6.315  0.214   -10.089 1.00 52.76  ? 5    DC  F O2    1 
ATOM   4761 N  N3    . DC  F 3 5   ? -7.165  -1.859  -10.335 1.00 45.23  ? 5    DC  F N3    1 
ATOM   4762 C  C4    . DC  F 3 5   ? -8.172  -2.613  -10.774 1.00 47.57  ? 5    DC  F C4    1 
ATOM   4763 N  N4    . DC  F 3 5   ? -8.079  -3.933  -10.609 1.00 44.36  ? 5    DC  F N4    1 
ATOM   4764 C  C5    . DC  F 3 5   ? -9.331  -2.037  -11.396 1.00 48.58  ? 5    DC  F C5    1 
ATOM   4765 C  C6    . DC  F 3 5   ? -9.379  -0.699  -11.514 1.00 46.44  ? 5    DC  F C6    1 
ATOM   4766 P  P     . DC  F 3 6   ? -7.036  5.223   -13.038 1.00 62.89  ? 6    DC  F P     1 
ATOM   4767 O  OP1   . DC  F 3 6   ? -6.761  6.507   -12.362 1.00 67.94  ? 6    DC  F OP1   1 
ATOM   4768 O  OP2   . DC  F 3 6   ? -7.338  5.275   -14.496 1.00 62.63  ? 6    DC  F OP2   1 
ATOM   4769 O  "O5'" . DC  F 3 6   ? -5.852  4.234   -12.698 1.00 53.21  ? 6    DC  F "O5'" 1 
ATOM   4770 C  "C5'" . DC  F 3 6   ? -4.682  4.267   -13.400 1.00 61.22  ? 6    DC  F "C5'" 1 
ATOM   4771 C  "C4'" . DC  F 3 6   ? -3.623  3.528   -12.622 1.00 62.21  ? 6    DC  F "C4'" 1 
ATOM   4772 O  "O4'" . DC  F 3 6   ? -4.104  2.221   -12.219 1.00 58.08  ? 6    DC  F "O4'" 1 
ATOM   4773 C  "C3'" . DC  F 3 6   ? -2.341  3.303   -13.387 1.00 62.81  ? 6    DC  F "C3'" 1 
ATOM   4774 O  "O3'" . DC  F 3 6   ? -1.300  3.927   -12.688 1.00 65.08  ? 6    DC  F "O3'" 1 
ATOM   4775 C  "C2'" . DC  F 3 6   ? -2.185  1.773   -13.443 1.00 58.10  ? 6    DC  F "C2'" 1 
ATOM   4776 C  "C1'" . DC  F 3 6   ? -3.047  1.308   -12.286 1.00 49.33  ? 6    DC  F "C1'" 1 
ATOM   4777 N  N1    . DC  F 3 6   ? -3.610  -0.055  -12.463 1.00 52.07  ? 6    DC  F N1    1 
ATOM   4778 C  C2    . DC  F 3 6   ? -2.867  -1.165  -12.053 1.00 56.38  ? 6    DC  F C2    1 
ATOM   4779 O  O2    . DC  F 3 6   ? -1.738  -0.983  -11.557 1.00 58.83  ? 6    DC  F O2    1 
ATOM   4780 N  N3    . DC  F 3 6   ? -3.401  -2.417  -12.207 1.00 53.08  ? 6    DC  F N3    1 
ATOM   4781 C  C4    . DC  F 3 6   ? -4.619  -2.565  -12.745 1.00 51.87  ? 6    DC  F C4    1 
ATOM   4782 N  N4    . DC  F 3 6   ? -5.103  -3.807  -12.872 1.00 51.73  ? 6    DC  F N4    1 
ATOM   4783 C  C5    . DC  F 3 6   ? -5.392  -1.441  -13.176 1.00 49.24  ? 6    DC  F C5    1 
ATOM   4784 C  C6    . DC  F 3 6   ? -4.856  -0.218  -13.020 1.00 53.29  ? 6    DC  F C6    1 
ATOM   4785 P  P     . DG  F 3 7   ? -0.164  4.723   -13.484 1.00 72.27  ? 7    DG  F P     1 
ATOM   4786 O  OP1   . DG  F 3 7   ? 0.554   5.458   -12.419 1.00 81.75  ? 7    DG  F OP1   1 
ATOM   4787 O  OP2   . DG  F 3 7   ? -0.720  5.474   -14.634 1.00 61.62  ? 7    DG  F OP2   1 
ATOM   4788 O  "O5'" . DG  F 3 7   ? 0.781   3.547   -14.019 1.00 61.32  ? 7    DG  F "O5'" 1 
ATOM   4789 C  "C5'" . DG  F 3 7   ? 1.505   2.800   -13.086 1.00 62.41  ? 7    DG  F "C5'" 1 
ATOM   4790 C  "C4'" . DG  F 3 7   ? 2.137   1.591   -13.726 1.00 71.03  ? 7    DG  F "C4'" 1 
ATOM   4791 O  "O4'" . DG  F 3 7   ? 1.252   0.468   -13.604 1.00 71.15  ? 7    DG  F "O4'" 1 
ATOM   4792 C  "C3'" . DG  F 3 7   ? 2.469   1.731   -15.216 1.00 73.26  ? 7    DG  F "C3'" 1 
ATOM   4793 O  "O3'" . DG  F 3 7   ? 3.903   1.706   -15.382 1.00 71.29  ? 7    DG  F "O3'" 1 
ATOM   4794 C  "C2'" . DG  F 3 7   ? 1.773   0.526   -15.882 1.00 63.47  ? 7    DG  F "C2'" 1 
ATOM   4795 C  "C1'" . DG  F 3 7   ? 1.452   -0.383  -14.698 1.00 66.47  ? 7    DG  F "C1'" 1 
ATOM   4796 N  N9    . DG  F 3 7   ? 0.239   -1.158  -14.880 1.00 59.50  ? 7    DG  F N9    1 
ATOM   4797 C  C8    . DG  F 3 7   ? -0.992  -0.681  -15.293 1.00 60.03  ? 7    DG  F C8    1 
ATOM   4798 N  N7    . DG  F 3 7   ? -1.913  -1.609  -15.360 1.00 60.96  ? 7    DG  F N7    1 
ATOM   4799 C  C5    . DG  F 3 7   ? -1.247  -2.774  -14.961 1.00 58.22  ? 7    DG  F C5    1 
ATOM   4800 C  C6    . DG  F 3 7   ? -1.721  -4.103  -14.837 1.00 54.39  ? 7    DG  F C6    1 
ATOM   4801 O  O6    . DG  F 3 7   ? -2.842  -4.537  -15.056 1.00 57.91  ? 7    DG  F O6    1 
ATOM   4802 N  N1    . DG  F 3 7   ? -0.735  -4.966  -14.400 1.00 58.41  ? 7    DG  F N1    1 
ATOM   4803 C  C2    . DG  F 3 7   ? 0.547   -4.602  -14.116 1.00 56.52  ? 7    DG  F C2    1 
ATOM   4804 N  N2    . DG  F 3 7   ? 1.339   -5.580  -13.703 1.00 55.35  ? 7    DG  F N2    1 
ATOM   4805 N  N3    . DG  F 3 7   ? 1.021   -3.362  -14.233 1.00 54.71  ? 7    DG  F N3    1 
ATOM   4806 C  C4    . DG  F 3 7   ? 0.073   -2.504  -14.657 1.00 54.20  ? 7    DG  F C4    1 
ATOM   4807 P  P     . DG  F 3 8   ? 4.588   1.570   -16.830 1.00 81.82  ? 8    DG  F P     1 
ATOM   4808 O  OP1   . DG  F 3 8   ? 5.940   2.126   -16.631 1.00 80.51  ? 8    DG  F OP1   1 
ATOM   4809 O  OP2   . DG  F 3 8   ? 3.732   2.147   -17.895 1.00 66.18  ? 8    DG  F OP2   1 
ATOM   4810 O  "O5'" . DG  F 3 8   ? 4.710   -0.017  -17.037 1.00 65.21  ? 8    DG  F "O5'" 1 
ATOM   4811 C  "C5'" . DG  F 3 8   ? 5.054   -0.815  -15.932 1.00 60.33  ? 8    DG  F "C5'" 1 
ATOM   4812 C  "C4'" . DG  F 3 8   ? 5.012   -2.291  -16.265 1.00 63.86  ? 8    DG  F "C4'" 1 
ATOM   4813 O  "O4'" . DG  F 3 8   ? 3.656   -2.766  -16.257 1.00 70.38  ? 8    DG  F "O4'" 1 
ATOM   4814 C  "C3'" . DG  F 3 8   ? 5.596   -2.681  -17.617 1.00 63.13  ? 8    DG  F "C3'" 1 
ATOM   4815 O  "O3'" . DG  F 3 8   ? 6.863   -3.346  -17.385 1.00 62.22  ? 8    DG  F "O3'" 1 
ATOM   4816 C  "C2'" . DG  F 3 8   ? 4.526   -3.617  -18.236 1.00 54.08  ? 8    DG  F "C2'" 1 
ATOM   4817 C  "C1'" . DG  F 3 8   ? 3.576   -3.901  -17.069 1.00 56.60  ? 8    DG  F "C1'" 1 
ATOM   4818 N  N9    . DG  F 3 8   ? 2.169   -4.064  -17.460 1.00 61.77  ? 8    DG  F N9    1 
ATOM   4819 C  C8    . DG  F 3 8   ? 1.329   -3.077  -17.918 1.00 59.05  ? 8    DG  F C8    1 
ATOM   4820 N  N7    . DG  F 3 8   ? 0.133   -3.500  -18.191 1.00 55.17  ? 8    DG  F N7    1 
ATOM   4821 C  C5    . DG  F 3 8   ? 0.168   -4.852  -17.893 1.00 54.60  ? 8    DG  F C5    1 
ATOM   4822 C  C6    . DG  F 3 8   ? -0.853  -5.833  -17.987 1.00 59.06  ? 8    DG  F C6    1 
ATOM   4823 O  O6    . DG  F 3 8   ? -2.030  -5.694  -18.366 1.00 54.35  ? 8    DG  F O6    1 
ATOM   4824 N  N1    . DG  F 3 8   ? -0.401  -7.080  -17.581 1.00 59.91  ? 8    DG  F N1    1 
ATOM   4825 C  C2    . DG  F 3 8   ? 0.869   -7.345  -17.142 1.00 55.73  ? 8    DG  F C2    1 
ATOM   4826 N  N2    . DG  F 3 8   ? 1.118   -8.608  -16.793 1.00 53.13  ? 8    DG  F N2    1 
ATOM   4827 N  N3    . DG  F 3 8   ? 1.829   -6.437  -17.048 1.00 60.47  ? 8    DG  F N3    1 
ATOM   4828 C  C4    . DG  F 3 8   ? 1.410   -5.217  -17.434 1.00 55.63  ? 8    DG  F C4    1 
ATOM   4829 P  P     . DA  F 3 9   ? 7.938   -3.585  -18.561 1.00 62.93  ? 9    DA  F P     1 
ATOM   4830 O  OP1   . DA  F 3 9   ? 9.239   -3.910  -17.927 1.00 69.33  ? 9    DA  F OP1   1 
ATOM   4831 O  OP2   . DA  F 3 9   ? 7.902   -2.462  -19.524 1.00 66.23  ? 9    DA  F OP2   1 
ATOM   4832 O  "O5'" . DA  F 3 9   ? 7.400   -4.916  -19.232 1.00 49.67  ? 9    DA  F "O5'" 1 
ATOM   4833 C  "C5'" . DA  F 3 9   ? 7.135   -5.995  -18.407 1.00 52.78  ? 9    DA  F "C5'" 1 
ATOM   4834 C  "C4'" . DA  F 3 9   ? 6.340   -7.035  -19.129 1.00 62.52  ? 9    DA  F "C4'" 1 
ATOM   4835 O  "O4'" . DA  F 3 9   ? 4.948   -6.606  -19.267 1.00 67.75  ? 9    DA  F "O4'" 1 
ATOM   4836 C  "C3'" . DA  F 3 9   ? 6.838   -7.382  -20.537 1.00 59.28  ? 9    DA  F "C3'" 1 
ATOM   4837 O  "O3'" . DA  F 3 9   ? 7.054   -8.786  -20.588 1.00 73.24  ? 9    DA  F "O3'" 1 
ATOM   4838 C  "C2'" . DA  F 3 9   ? 5.652   -6.968  -21.436 1.00 63.02  ? 9    DA  F "C2'" 1 
ATOM   4839 C  "C1'" . DA  F 3 9   ? 4.479   -7.145  -20.471 1.00 66.45  ? 9    DA  F "C1'" 1 
ATOM   4840 N  N9    . DA  F 3 9   ? 3.233   -6.476  -20.877 1.00 66.38  ? 9    DA  F N9    1 
ATOM   4841 C  C8    . DA  F 3 9   ? 3.080   -5.174  -21.285 1.00 59.43  ? 9    DA  F C8    1 
ATOM   4842 N  N7    . DA  F 3 9   ? 1.846   -4.860  -21.598 1.00 54.52  ? 9    DA  F N7    1 
ATOM   4843 C  C5    . DA  F 3 9   ? 1.135   -6.039  -21.387 1.00 59.44  ? 9    DA  F C5    1 
ATOM   4844 C  C6    . DA  F 3 9   ? -0.233  -6.374  -21.543 1.00 55.39  ? 9    DA  F C6    1 
ATOM   4845 N  N6    . DA  F 3 9   ? -1.169  -5.506  -21.971 1.00 47.71  ? 9    DA  F N6    1 
ATOM   4846 N  N1    . DA  F 3 9   ? -0.601  -7.640  -21.242 1.00 54.62  ? 9    DA  F N1    1 
ATOM   4847 C  C2    . DA  F 3 9   ? 0.332   -8.501  -20.821 1.00 55.27  ? 9    DA  F C2    1 
ATOM   4848 N  N3    . DA  F 3 9   ? 1.630   -8.303  -20.641 1.00 53.01  ? 9    DA  F N3    1 
ATOM   4849 C  C4    . DA  F 3 9   ? 1.973   -7.043  -20.946 1.00 57.08  ? 9    DA  F C4    1 
ATOM   4850 P  P     . DA  F 3 10  ? 8.198   -9.452  -21.502 1.00 81.39  ? 10   DA  F P     1 
ATOM   4851 O  OP1   . DA  F 3 10  ? 9.418   -9.506  -20.661 1.00 86.78  ? 10   DA  F OP1   1 
ATOM   4852 O  OP2   . DA  F 3 10  ? 8.209   -8.825  -22.851 1.00 71.95  ? 10   DA  F OP2   1 
ATOM   4853 O  "O5'" . DA  F 3 10  ? 7.692   -10.962 -21.672 1.00 70.05  ? 10   DA  F "O5'" 1 
ATOM   4854 C  "C5'" . DA  F 3 10  ? 7.250   -11.697 -20.519 1.00 75.48  ? 10   DA  F "C5'" 1 
ATOM   4855 C  "C4'" . DA  F 3 10  ? 6.131   -12.665 -20.873 1.00 74.89  ? 10   DA  F "C4'" 1 
ATOM   4856 O  "O4'" . DA  F 3 10  ? 4.898   -11.932 -21.143 1.00 78.00  ? 10   DA  F "O4'" 1 
ATOM   4857 C  "C3'" . DA  F 3 10  ? 6.375   -13.519 -22.112 1.00 80.37  ? 10   DA  F "C3'" 1 
ATOM   4858 O  "O3'" . DA  F 3 10  ? 5.734   -14.783 -21.934 1.00 86.26  ? 10   DA  F "O3'" 1 
ATOM   4859 C  "C2'" . DA  F 3 10  ? 5.709   -12.693 -23.224 1.00 77.17  ? 10   DA  F "C2'" 1 
ATOM   4860 C  "C1'" . DA  F 3 10  ? 4.477   -12.167 -22.490 1.00 81.72  ? 10   DA  F "C1'" 1 
ATOM   4861 N  N9    . DA  F 3 10  ? 3.905   -10.916 -23.038 1.00 77.93  ? 10   DA  F N9    1 
ATOM   4862 C  C8    . DA  F 3 10  ? 4.566   -9.733  -23.273 1.00 72.31  ? 10   DA  F C8    1 
ATOM   4863 N  N7    . DA  F 3 10  ? 3.795   -8.774  -23.735 1.00 69.87  ? 10   DA  F N7    1 
ATOM   4864 C  C5    . DA  F 3 10  ? 2.535   -9.359  -23.800 1.00 71.24  ? 10   DA  F C5    1 
ATOM   4865 C  C6    . DA  F 3 10  ? 1.278   -8.864  -24.210 1.00 63.75  ? 10   DA  F C6    1 
ATOM   4866 N  N6    . DA  F 3 10  ? 1.091   -7.615  -24.644 1.00 58.81  ? 10   DA  F N6    1 
ATOM   4867 N  N1    . DA  F 3 10  ? 0.223   -9.702  -24.153 1.00 60.19  ? 10   DA  F N1    1 
ATOM   4868 C  C2    . DA  F 3 10  ? 0.418   -10.954 -23.719 1.00 66.35  ? 10   DA  F C2    1 
ATOM   4869 N  N3    . DA  F 3 10  ? 1.549   -11.534 -23.311 1.00 69.11  ? 10   DA  F N3    1 
ATOM   4870 C  C4    . DA  F 3 10  ? 2.581   -10.675 -23.374 1.00 68.65  ? 10   DA  F C4    1 
ATOM   4871 P  P     . DC  F 3 11  ? 6.116   -16.048 -22.849 1.00 90.13  ? 11   DC  F P     1 
ATOM   4872 O  OP1   . DC  F 3 11  ? 6.275   -17.181 -21.904 1.00 79.58  ? 11   DC  F OP1   1 
ATOM   4873 O  OP2   . DC  F 3 11  ? 7.135   -15.661 -23.861 1.00 72.79  ? 11   DC  F OP2   1 
ATOM   4874 O  "O5'" . DC  F 3 11  ? 4.792   -16.328 -23.682 1.00 87.51  ? 11   DC  F "O5'" 1 
ATOM   4875 C  "C5'" . DC  F 3 11  ? 3.541   -16.250 -23.051 1.00 84.77  ? 11   DC  F "C5'" 1 
ATOM   4876 C  "C4'" . DC  F 3 11  ? 2.461   -16.138 -24.092 1.00 87.55  ? 11   DC  F "C4'" 1 
ATOM   4877 O  "O4'" . DC  F 3 11  ? 2.270   -14.752 -24.443 1.00 80.89  ? 11   DC  F "O4'" 1 
ATOM   4878 C  "C3'" . DC  F 3 11  ? 2.768   -16.883 -25.394 1.00 84.18  ? 11   DC  F "C3'" 1 
ATOM   4879 O  "O3'" . DC  F 3 11  ? 1.775   -17.877 -25.593 1.00 92.90  ? 11   DC  F "O3'" 1 
ATOM   4880 C  "C2'" . DC  F 3 11  ? 2.751   -15.793 -26.486 1.00 76.07  ? 11   DC  F "C2'" 1 
ATOM   4881 C  "C1'" . DC  F 3 11  ? 1.990   -14.657 -25.819 1.00 80.14  ? 11   DC  F "C1'" 1 
ATOM   4882 N  N1    . DC  F 3 11  ? 2.389   -13.278 -26.285 1.00 80.60  ? 11   DC  F N1    1 
ATOM   4883 C  C2    . DC  F 3 11  ? 1.401   -12.375 -26.693 1.00 72.60  ? 11   DC  F C2    1 
ATOM   4884 O  O2    . DC  F 3 11  ? 0.212   -12.736 -26.692 1.00 73.85  ? 11   DC  F O2    1 
ATOM   4885 N  N3    . DC  F 3 11  ? 1.774   -11.130 -27.089 1.00 64.53  ? 11   DC  F N3    1 
ATOM   4886 C  C4    . DC  F 3 11  ? 3.059   -10.777 -27.085 1.00 69.03  ? 11   DC  F C4    1 
ATOM   4887 N  N4    . DC  F 3 11  ? 3.368   -9.539  -27.486 1.00 65.55  ? 11   DC  F N4    1 
ATOM   4888 C  C5    . DC  F 3 11  ? 4.081   -11.675 -26.663 1.00 73.85  ? 11   DC  F C5    1 
ATOM   4889 C  C6    . DC  F 3 11  ? 3.706   -12.903 -26.272 1.00 77.02  ? 11   DC  F C6    1 
ATOM   4890 P  P     . DT  F 3 12  ? 1.822   -18.860 -26.857 1.00 97.65  ? 12   DT  F P     1 
ATOM   4891 O  OP1   . DT  F 3 12  ? 1.385   -20.194 -26.383 1.00 93.53  ? 12   DT  F OP1   1 
ATOM   4892 O  OP2   . DT  F 3 12  ? 3.096   -18.677 -27.595 1.00 96.75  ? 12   DT  F OP2   1 
ATOM   4893 O  "O5'" . DT  F 3 12  ? 0.669   -18.300 -27.779 1.00 95.77  ? 12   DT  F "O5'" 1 
ATOM   4894 C  "C5'" . DT  F 3 12  ? 0.628   -18.647 -29.109 1.00 92.13  ? 12   DT  F "C5'" 1 
ATOM   4895 C  "C4'" . DT  F 3 12  ? -0.459  -17.866 -29.788 1.00 89.45  ? 12   DT  F "C4'" 1 
ATOM   4896 O  "O4'" . DT  F 3 12  ? -0.232  -16.447 -29.591 1.00 89.68  ? 12   DT  F "O4'" 1 
ATOM   4897 C  "C3'" . DT  F 3 12  ? -0.542  -18.085 -31.282 1.00 87.53  ? 12   DT  F "C3'" 1 
ATOM   4898 O  "O3'" . DT  F 3 12  ? -1.885  -18.225 -31.640 1.00 81.32  ? 12   DT  F "O3'" 1 
ATOM   4899 C  "C2'" . DT  F 3 12  ? 0.111   -16.825 -31.880 1.00 81.46  ? 12   DT  F "C2'" 1 
ATOM   4900 C  "C1'" . DT  F 3 12  ? -0.232  -15.778 -30.839 1.00 89.28  ? 12   DT  F "C1'" 1 
ATOM   4901 N  N1    . DT  F 3 12  ? 0.740   -14.630 -30.755 1.00 87.55  ? 12   DT  F N1    1 
ATOM   4902 C  C2    . DT  F 3 12  ? 0.283   -13.339 -30.950 1.00 81.70  ? 12   DT  F C2    1 
ATOM   4903 O  O2    . DT  F 3 12  ? -0.880  -13.069 -31.229 1.00 82.11  ? 12   DT  F O2    1 
ATOM   4904 N  N3    . DT  F 3 12  ? 1.239   -12.368 -30.820 1.00 75.58  ? 12   DT  F N3    1 
ATOM   4905 C  C4    . DT  F 3 12  ? 2.576   -12.543 -30.523 1.00 79.58  ? 12   DT  F C4    1 
ATOM   4906 O  O4    . DT  F 3 12  ? 3.359   -11.603 -30.434 1.00 79.09  ? 12   DT  F O4    1 
ATOM   4907 C  C5    . DT  F 3 12  ? 2.992   -13.912 -30.321 1.00 87.10  ? 12   DT  F C5    1 
ATOM   4908 C  C7    . DT  F 3 12  ? 4.426   -14.219 -29.984 1.00 78.93  ? 12   DT  F C7    1 
ATOM   4909 C  C6    . DT  F 3 12  ? 2.061   -14.880 -30.440 1.00 85.61  ? 12   DT  F C6    1 
ATOM   4910 P  P     . DT  F 3 13  ? -2.253  -18.739 -33.105 1.00 89.84  ? 13   DT  F P     1 
ATOM   4911 O  OP1   . DT  F 3 13  ? -3.412  -19.659 -33.009 1.00 94.75  ? 13   DT  F OP1   1 
ATOM   4912 O  OP2   . DT  F 3 13  ? -0.989  -19.149 -33.757 1.00 75.58  ? 13   DT  F OP2   1 
ATOM   4913 O  "O5'" . DT  F 3 13  ? -2.722  -17.411 -33.849 1.00 85.70  ? 13   DT  F "O5'" 1 
ATOM   4914 C  "C5'" . DT  F 3 13  ? -3.753  -16.621 -33.307 1.00 77.14  ? 13   DT  F "C5'" 1 
ATOM   4915 C  "C4'" . DT  F 3 13  ? -3.939  -15.394 -34.157 1.00 78.10  ? 13   DT  F "C4'" 1 
ATOM   4916 O  "O4'" . DT  F 3 13  ? -2.828  -14.496 -33.954 1.00 80.65  ? 13   DT  F "O4'" 1 
ATOM   4917 C  "C3'" . DT  F 3 13  ? -3.985  -15.668 -35.662 1.00 82.81  ? 13   DT  F "C3'" 1 
ATOM   4918 O  "O3'" . DT  F 3 13  ? -4.939  -14.816 -36.266 1.00 78.01  ? 13   DT  F "O3'" 1 
ATOM   4919 C  "C2'" . DT  F 3 13  ? -2.562  -15.316 -36.113 1.00 70.08  ? 13   DT  F "C2'" 1 
ATOM   4920 C  "C1'" . DT  F 3 13  ? -2.289  -14.134 -35.208 1.00 80.13  ? 13   DT  F "C1'" 1 
ATOM   4921 N  N1    . DT  F 3 13  ? -0.845  -13.800 -35.016 1.00 83.53  ? 13   DT  F N1    1 
ATOM   4922 C  C2    . DT  F 3 13  ? -0.462  -12.479 -35.028 1.00 74.64  ? 13   DT  F C2    1 
ATOM   4923 O  O2    . DT  F 3 13  ? -1.239  -11.558 -35.215 1.00 77.01  ? 13   DT  F O2    1 
ATOM   4924 N  N3    . DT  F 3 13  ? 0.867   -12.271 -34.819 1.00 76.50  ? 13   DT  F N3    1 
ATOM   4925 C  C4    . DT  F 3 13  ? 1.837   -13.228 -34.601 1.00 76.23  ? 13   DT  F C4    1 
ATOM   4926 O  O4    . DT  F 3 13  ? 3.013   -12.940 -34.419 1.00 78.85  ? 13   DT  F O4    1 
ATOM   4927 C  C5    . DT  F 3 13  ? 1.373   -14.585 -34.594 1.00 78.66  ? 13   DT  F C5    1 
ATOM   4928 C  C7    . DT  F 3 13  ? 2.344   -15.703 -34.366 1.00 84.98  ? 13   DT  F C7    1 
ATOM   4929 C  C6    . DT  F 3 13  ? 0.065   -14.807 -34.791 1.00 82.64  ? 13   DT  F C6    1 
ATOM   4930 P  P     . DA  F 3 14  ? -6.517  -15.081 -36.110 1.00 66.09  ? 14   DA  F P     1 
ATOM   4931 O  OP1   . DA  F 3 14  ? -6.863  -15.323 -34.691 1.00 67.82  ? 14   DA  F OP1   1 
ATOM   4932 O  OP2   . DA  F 3 14  ? -6.911  -16.059 -37.146 1.00 68.60  ? 14   DA  F OP2   1 
ATOM   4933 O  "O5'" . DA  F 3 14  ? -7.153  -13.654 -36.473 1.00 67.24  ? 14   DA  F "O5'" 1 
ATOM   4934 C  "C5'" . DA  F 3 14  ? -7.175  -12.635 -35.478 1.00 62.57  ? 14   DA  F "C5'" 1 
ATOM   4935 C  "C4'" . DA  F 3 14  ? -6.722  -11.292 -36.020 1.00 59.40  ? 14   DA  F "C4'" 1 
ATOM   4936 O  "O4'" . DA  F 3 14  ? -5.319  -11.331 -36.359 1.00 65.16  ? 14   DA  F "O4'" 1 
ATOM   4937 C  "C3'" . DA  F 3 14  ? -7.428  -10.813 -37.276 1.00 65.10  ? 14   DA  F "C3'" 1 
ATOM   4938 O  "O3'" . DA  F 3 14  ? -7.508  -9.395  -37.233 1.00 57.09  ? 14   DA  F "O3'" 1 
ATOM   4939 C  "C2'" . DA  F 3 14  ? -6.489  -11.282 -38.385 1.00 61.73  ? 14   DA  F "C2'" 1 
ATOM   4940 C  "C1'" . DA  F 3 14  ? -5.151  -10.992 -37.731 1.00 69.04  ? 14   DA  F "C1'" 1 
ATOM   4941 N  N9    . DA  F 3 14  ? -4.052  -11.790 -38.234 1.00 71.64  ? 14   DA  F N9    1 
ATOM   4942 C  C8    . DA  F 3 14  ? -4.105  -13.093 -38.637 1.00 70.85  ? 14   DA  F C8    1 
ATOM   4943 N  N7    . DA  F 3 14  ? -2.942  -13.581 -38.995 1.00 73.52  ? 14   DA  F N7    1 
ATOM   4944 C  C5    . DA  F 3 14  ? -2.064  -12.529 -38.802 1.00 73.07  ? 14   DA  F C5    1 
ATOM   4945 C  C6    . DA  F 3 14  ? -0.675  -12.409 -38.992 1.00 72.66  ? 14   DA  F C6    1 
ATOM   4946 N  N6    . DA  F 3 14  ? 0.089   -13.411 -39.447 1.00 69.72  ? 14   DA  F N6    1 
ATOM   4947 N  N1    . DA  F 3 14  ? -0.100  -11.219 -38.696 1.00 69.14  ? 14   DA  F N1    1 
ATOM   4948 C  C2    . DA  F 3 14  ? -0.874  -10.225 -38.242 1.00 69.96  ? 14   DA  F C2    1 
ATOM   4949 N  N3    . DA  F 3 14  ? -2.194  -10.220 -38.021 1.00 73.59  ? 14   DA  F N3    1 
ATOM   4950 C  C4    . DA  F 3 14  ? -2.731  -11.416 -38.322 1.00 72.38  ? 14   DA  F C4    1 
ATOM   4951 P  P     . DC  F 3 15  ? -8.691  -8.647  -38.012 1.00 56.49  ? 15   DC  F P     1 
ATOM   4952 O  OP1   . DC  F 3 15  ? -8.744  -7.267  -37.476 1.00 54.58  ? 15   DC  F OP1   1 
ATOM   4953 O  OP2   . DC  F 3 15  ? -9.905  -9.484  -37.906 1.00 54.29  ? 15   DC  F OP2   1 
ATOM   4954 O  "O5'" . DC  F 3 15  ? -8.242  -8.768  -39.558 1.00 60.19  ? 15   DC  F "O5'" 1 
ATOM   4955 C  "C5'" . DC  F 3 15  ? -7.591  -7.697  -40.235 1.00 55.87  ? 15   DC  F "C5'" 1 
ATOM   4956 C  "C4'" . DC  F 3 15  ? -6.285  -7.338  -39.568 1.00 55.56  ? 15   DC  F "C4'" 1 
ATOM   4957 O  "O4'" . DC  F 3 15  ? -5.396  -8.481  -39.598 1.00 64.86  ? 15   DC  F "O4'" 1 
ATOM   4958 C  "C3'" . DC  F 3 15  ? -5.517  -6.223  -40.252 1.00 56.65  ? 15   DC  F "C3'" 1 
ATOM   4959 O  "O3'" . DC  F 3 15  ? -4.707  -5.543  -39.300 1.00 55.75  ? 15   DC  F "O3'" 1 
ATOM   4960 C  "C2'" . DC  F 3 15  ? -4.664  -7.002  -41.243 1.00 58.98  ? 15   DC  F "C2'" 1 
ATOM   4961 C  "C1'" . DC  F 3 15  ? -4.252  -8.166  -40.371 1.00 62.40  ? 15   DC  F "C1'" 1 
ATOM   4962 N  N1    . DC  F 3 15  ? -3.864  -9.365  -41.128 1.00 70.00  ? 15   DC  F N1    1 
ATOM   4963 C  C2    . DC  F 3 15  ? -2.519  -9.656  -41.291 1.00 67.05  ? 15   DC  F C2    1 
ATOM   4964 O  O2    . DC  F 3 15  ? -1.681  -8.889  -40.813 1.00 69.54  ? 15   DC  F O2    1 
ATOM   4965 N  N3    . DC  F 3 15  ? -2.168  -10.766 -41.975 1.00 67.54  ? 15   DC  F N3    1 
ATOM   4966 C  C4    . DC  F 3 15  ? -3.101  -11.561 -42.476 1.00 67.96  ? 15   DC  F C4    1 
ATOM   4967 N  N4    . DC  F 3 15  ? -2.699  -12.646 -43.134 1.00 72.89  ? 15   DC  F N4    1 
ATOM   4968 C  C5    . DC  F 3 15  ? -4.488  -11.286 -42.319 1.00 64.15  ? 15   DC  F C5    1 
ATOM   4969 C  C6    . DC  F 3 15  ? -4.825  -10.186 -41.645 1.00 65.39  ? 15   DC  F C6    1 
ATOM   4970 P  P     . DC  F 3 16  ? -3.792  -4.306  -39.761 1.00 49.05  ? 16   DC  F P     1 
ATOM   4971 O  OP1   . DC  F 3 16  ? -2.400  -4.790  -39.924 1.00 54.39  ? 16   DC  F OP1   1 
ATOM   4972 O  OP2   . DC  F 3 16  ? -4.076  -3.259  -38.754 1.00 50.85  ? 16   DC  F OP2   1 
ATOM   4973 O  "O5'" . DC  F 3 16  ? -4.433  -3.900  -41.185 1.00 57.98  ? 16   DC  F "O5'" 1 
ATOM   4974 C  "C5'" . DC  F 3 16  ? -3.846  -2.924  -42.033 1.00 54.35  ? 16   DC  F "C5'" 1 
ATOM   4975 C  "C4'" . DC  F 3 16  ? -2.615  -3.462  -42.741 1.00 57.43  ? 16   DC  F "C4'" 1 
ATOM   4976 O  "O4'" . DC  F 3 16  ? -2.690  -4.883  -42.942 1.00 56.05  ? 16   DC  F "O4'" 1 
ATOM   4977 C  "C3'" . DC  F 3 16  ? -2.311  -2.860  -44.124 1.00 60.43  ? 16   DC  F "C3'" 1 
ATOM   4978 O  "O3'" . DC  F 3 16  ? -1.069  -2.254  -44.048 1.00 59.20  ? 16   DC  F "O3'" 1 
ATOM   4979 C  "C2'" . DC  F 3 16  ? -2.264  -4.077  -45.067 1.00 58.34  ? 16   DC  F "C2'" 1 
ATOM   4980 C  "C1'" . DC  F 3 16  ? -1.927  -5.184  -44.097 1.00 58.05  ? 16   DC  F "C1'" 1 
ATOM   4981 N  N1    . DC  F 3 16  ? -2.283  -6.553  -44.550 1.00 57.61  ? 16   DC  F N1    1 
ATOM   4982 C  C2    . DC  F 3 16  ? -1.283  -7.542  -44.642 1.00 64.17  ? 16   DC  F C2    1 
ATOM   4983 O  O2    . DC  F 3 16  ? -0.102  -7.244  -44.394 1.00 64.32  ? 16   DC  F O2    1 
ATOM   4984 N  N3    . DC  F 3 16  ? -1.639  -8.797  -45.011 1.00 64.13  ? 16   DC  F N3    1 
ATOM   4985 C  C4    . DC  F 3 16  ? -2.918  -9.078  -45.271 1.00 62.90  ? 16   DC  F C4    1 
ATOM   4986 N  N4    . DC  F 3 16  ? -3.221  -10.326 -45.636 1.00 64.64  ? 16   DC  F N4    1 
ATOM   4987 C  C5    . DC  F 3 16  ? -3.944  -8.091  -45.171 1.00 57.51  ? 16   DC  F C5    1 
ATOM   4988 C  C6    . DC  F 3 16  ? -3.585  -6.859  -44.803 1.00 54.09  ? 16   DC  F C6    1 
ATOM   4989 P  P     . DC  F 3 17  ? -0.612  -1.170  -45.118 1.00 61.04  ? 17   DC  F P     1 
ATOM   4990 O  OP1   . DC  F 3 17  ? 0.200   -0.196  -44.345 1.00 62.67  ? 17   DC  F OP1   1 
ATOM   4991 O  OP2   . DC  F 3 17  ? -1.777  -0.704  -45.914 1.00 64.62  ? 17   DC  F OP2   1 
ATOM   4992 O  "O5'" . DC  F 3 17  ? 0.345   -2.019  -46.052 1.00 60.80  ? 17   DC  F "O5'" 1 
ATOM   4993 C  "C5'" . DC  F 3 17  ? 1.338   -2.811  -45.471 1.00 58.48  ? 17   DC  F "C5'" 1 
ATOM   4994 C  "C4'" . DC  F 3 17  ? 2.016   -3.663  -46.513 1.00 62.63  ? 17   DC  F "C4'" 1 
ATOM   4995 O  "O4'" . DC  F 3 17  ? 1.334   -4.929  -46.632 1.00 64.21  ? 17   DC  F "O4'" 1 
ATOM   4996 C  "C3'" . DC  F 3 17  ? 2.061   -3.062  -47.914 1.00 64.71  ? 17   DC  F "C3'" 1 
ATOM   4997 O  "O3'" . DC  F 3 17  ? 3.403   -3.077  -48.357 1.00 71.71  ? 17   DC  F "O3'" 1 
ATOM   4998 C  "C2'" . DC  F 3 17  ? 1.154   -3.997  -48.744 1.00 66.93  ? 17   DC  F "C2'" 1 
ATOM   4999 C  "C1'" . DC  F 3 17  ? 1.288   -5.302  -47.977 1.00 62.15  ? 17   DC  F "C1'" 1 
ATOM   5000 N  N1    . DC  F 3 17  ? 0.153   -6.265  -48.134 1.00 63.30  ? 17   DC  F N1    1 
ATOM   5001 C  C2    . DC  F 3 17  ? 0.435   -7.623  -48.295 1.00 67.40  ? 17   DC  F C2    1 
ATOM   5002 O  O2    . DC  F 3 17  ? 1.613   -7.990  -48.342 1.00 70.28  ? 17   DC  F O2    1 
ATOM   5003 N  N3    . DC  F 3 17  ? -0.586  -8.501  -48.405 1.00 64.58  ? 17   DC  F N3    1 
ATOM   5004 C  C4    . DC  F 3 17  ? -1.840  -8.075  -48.351 1.00 62.74  ? 17   DC  F C4    1 
ATOM   5005 N  N4    . DC  F 3 17  ? -2.816  -8.990  -48.475 1.00 61.28  ? 17   DC  F N4    1 
ATOM   5006 C  C5    . DC  F 3 17  ? -2.154  -6.690  -48.180 1.00 60.61  ? 17   DC  F C5    1 
ATOM   5007 C  C6    . DC  F 3 17  ? -1.133  -5.831  -48.066 1.00 59.44  ? 17   DC  F C6    1 
ATOM   5008 P  P     . DG  F 3 18  ? 3.945   -2.025  -49.443 1.00 85.20  ? 18   DG  F P     1 
ATOM   5009 O  OP1   . DG  F 3 18  ? 5.276   -1.588  -48.971 1.00 77.06  ? 18   DG  F OP1   1 
ATOM   5010 O  OP2   . DG  F 3 18  ? 2.905   -1.023  -49.763 1.00 88.18  ? 18   DG  F OP2   1 
ATOM   5011 O  "O5'" . DG  F 3 18  ? 4.156   -2.955  -50.720 1.00 79.60  ? 18   DG  F "O5'" 1 
ATOM   5012 C  "C5'" . DG  F 3 18  ? 4.863   -4.164  -50.556 1.00 73.98  ? 18   DG  F "C5'" 1 
ATOM   5013 C  "C4'" . DG  F 3 18  ? 4.474   -5.158  -51.612 1.00 78.77  ? 18   DG  F "C4'" 1 
ATOM   5014 O  "O4'" . DG  F 3 18  ? 3.230   -5.799  -51.255 1.00 85.76  ? 18   DG  F "O4'" 1 
ATOM   5015 C  "C3'" . DG  F 3 18  ? 4.272   -4.566  -53.016 1.00 84.84  ? 18   DG  F "C3'" 1 
ATOM   5016 O  "O3'" . DG  F 3 18  ? 5.100   -5.260  -53.924 1.00 97.75  ? 18   DG  F "O3'" 1 
ATOM   5017 C  "C2'" . DG  F 3 18  ? 2.795   -4.825  -53.308 1.00 84.79  ? 18   DG  F "C2'" 1 
ATOM   5018 C  "C1'" . DG  F 3 18  ? 2.525   -6.040  -52.441 1.00 82.94  ? 18   DG  F "C1'" 1 
ATOM   5019 N  N9    . DG  F 3 18  ? 1.106   -6.238  -52.160 1.00 73.88  ? 18   DG  F N9    1 
ATOM   5020 C  C8    . DG  F 3 18  ? 0.143   -5.267  -51.991 1.00 72.28  ? 18   DG  F C8    1 
ATOM   5021 N  N7    . DG  F 3 18  ? -1.055  -5.752  -51.798 1.00 68.92  ? 18   DG  F N7    1 
ATOM   5022 C  C5    . DG  F 3 18  ? -0.873  -7.123  -51.860 1.00 66.10  ? 18   DG  F C5    1 
ATOM   5023 C  C6    . DG  F 3 18  ? -1.809  -8.163  -51.728 1.00 70.18  ? 18   DG  F C6    1 
ATOM   5024 O  O6    . DG  F 3 18  ? -3.026  -8.074  -51.515 1.00 73.52  ? 18   DG  F O6    1 
ATOM   5025 N  N1    . DG  F 3 18  ? -1.212  -9.413  -51.860 1.00 73.85  ? 18   DG  F N1    1 
ATOM   5026 C  C2    . DG  F 3 18  ? 0.130   -9.627  -52.089 1.00 76.74  ? 18   DG  F C2    1 
ATOM   5027 N  N2    . DG  F 3 18  ? 0.519   -10.905 -52.184 1.00 73.40  ? 18   DG  F N2    1 
ATOM   5028 N  N3    . DG  F 3 18  ? 1.024   -8.656  -52.215 1.00 75.03  ? 18   DG  F N3    1 
ATOM   5029 C  C4    . DG  F 3 18  ? 0.451   -7.436  -52.089 1.00 72.88  ? 18   DG  F C4    1 
ATOM   5030 P  P     . DG  F 3 19  ? 5.275   -4.783  -55.446 1.00 100.84 ? 19   DG  F P     1 
ATOM   5031 O  OP1   . DG  F 3 19  ? 6.699   -4.370  -55.528 1.00 91.71  ? 19   DG  F OP1   1 
ATOM   5032 O  OP2   . DG  F 3 19  ? 4.201   -3.845  -55.854 1.00 84.61  ? 19   DG  F OP2   1 
ATOM   5033 O  "O5'" . DG  F 3 19  ? 5.070   -6.150  -56.257 1.00 96.87  ? 19   DG  F "O5'" 1 
ATOM   5034 C  "C5'" . DG  F 3 19  ? 5.822   -7.302  -55.873 1.00 94.25  ? 19   DG  F "C5'" 1 
ATOM   5035 C  "C4'" . DG  F 3 19  ? 5.123   -8.581  -56.296 1.00 99.24  ? 19   DG  F "C4'" 1 
ATOM   5036 O  "O4'" . DG  F 3 19  ? 3.859   -8.704  -55.596 1.00 98.23  ? 19   DG  F "O4'" 1 
ATOM   5037 C  "C3'" . DG  F 3 19  ? 4.813   -8.681  -57.792 1.00 108.42 ? 19   DG  F "C3'" 1 
ATOM   5038 O  "O3'" . DG  F 3 19  ? 5.373   -9.895  -58.331 1.00 113.46 ? 19   DG  F "O3'" 1 
ATOM   5039 C  "C2'" . DG  F 3 19  ? 3.278   -8.660  -57.869 1.00 95.02  ? 19   DG  F "C2'" 1 
ATOM   5040 C  "C1'" . DG  F 3 19  ? 2.856   -9.144  -56.486 1.00 96.34  ? 19   DG  F "C1'" 1 
ATOM   5041 N  N9    . DG  F 3 19  ? 1.573   -8.582  -56.047 1.00 89.79  ? 19   DG  F N9    1 
ATOM   5042 C  C8    . DG  F 3 19  ? 1.321   -7.266  -55.731 1.00 84.07  ? 19   DG  F C8    1 
ATOM   5043 N  N7    . DG  F 3 19  ? 0.086   -7.040  -55.378 1.00 78.21  ? 19   DG  F N7    1 
ATOM   5044 C  C5    . DG  F 3 19  ? -0.523  -8.284  -55.455 1.00 78.84  ? 19   DG  F C5    1 
ATOM   5045 C  C6    . DG  F 3 19  ? -1.863  -8.654  -55.185 1.00 83.49  ? 19   DG  F C6    1 
ATOM   5046 O  O6    . DG  F 3 19  ? -2.801  -7.931  -54.808 1.00 82.29  ? 19   DG  F O6    1 
ATOM   5047 N  N1    . DG  F 3 19  ? -2.076  -10.013 -55.396 1.00 82.72  ? 19   DG  F N1    1 
ATOM   5048 C  C2    . DG  F 3 19  ? -1.120  -10.904 -55.812 1.00 83.96  ? 19   DG  F C2    1 
ATOM   5049 N  N2    . DG  F 3 19  ? -1.532  -12.175 -55.954 1.00 79.63  ? 19   DG  F N2    1 
ATOM   5050 N  N3    . DG  F 3 19  ? 0.151   -10.574 -56.069 1.00 80.84  ? 19   DG  F N3    1 
ATOM   5051 C  C4    . DG  F 3 19  ? 0.374   -9.249  -55.870 1.00 79.31  ? 19   DG  F C4    1 
ATOM   5052 P  P     . DC  F 3 20  ? 5.573   -10.082 -59.918 1.00 97.92  ? 20   DC  F P     1 
ATOM   5053 O  OP1   . DC  F 3 20  ? 6.888   -10.732 -60.111 1.00 101.88 ? 20   DC  F OP1   1 
ATOM   5054 O  OP2   . DC  F 3 20  ? 5.289   -8.791  -60.591 1.00 92.60  ? 20   DC  F OP2   1 
ATOM   5055 O  "O5'" . DC  F 3 20  ? 4.402   -11.098 -60.319 1.00 94.32  ? 20   DC  F "O5'" 1 
ATOM   5056 C  "C5'" . DC  F 3 20  ? 4.117   -12.221 -59.488 1.00 91.26  ? 20   DC  F "C5'" 1 
ATOM   5057 C  "C4'" . DC  F 3 20  ? 2.757   -12.798 -59.822 1.00 92.06  ? 20   DC  F "C4'" 1 
ATOM   5058 O  "O4'" . DC  F 3 20  ? 1.720   -12.048 -59.142 1.00 94.03  ? 20   DC  F "O4'" 1 
ATOM   5059 C  "C3'" . DC  F 3 20  ? 2.410   -12.770 -61.307 1.00 93.38  ? 20   DC  F "C3'" 1 
ATOM   5060 O  "O3'" . DC  F 3 20  ? 2.248   -14.099 -61.787 1.00 104.59 ? 20   DC  F "O3'" 1 
ATOM   5061 C  "C2'" . DC  F 3 20  ? 1.102   -11.963 -61.391 1.00 97.34  ? 20   DC  F "C2'" 1 
ATOM   5062 C  "C1'" . DC  F 3 20  ? 0.579   -11.987 -59.959 1.00 91.63  ? 20   DC  F "C1'" 1 
ATOM   5063 N  N1    . DC  F 3 20  ? -0.205  -10.751 -59.594 1.00 86.00  ? 20   DC  F N1    1 
ATOM   5064 C  C2    . DC  F 3 20  ? -1.572  -10.843 -59.292 1.00 84.74  ? 20   DC  F C2    1 
ATOM   5065 O  O2    . DC  F 3 20  ? -2.124  -11.950 -59.323 1.00 90.78  ? 20   DC  F O2    1 
ATOM   5066 N  N3    . DC  F 3 20  ? -2.253  -9.708  -58.969 1.00 81.86  ? 20   DC  F N3    1 
ATOM   5067 C  C4    . DC  F 3 20  ? -1.620  -8.530  -58.942 1.00 80.34  ? 20   DC  F C4    1 
ATOM   5068 N  N4    . DC  F 3 20  ? -2.324  -7.440  -58.613 1.00 72.50  ? 20   DC  F N4    1 
ATOM   5069 C  C5    . DC  F 3 20  ? -0.234  -8.419  -59.253 1.00 82.13  ? 20   DC  F C5    1 
ATOM   5070 C  C6    . DC  F 3 20  ? 0.425   -9.540  -59.572 1.00 86.37  ? 20   DC  F C6    1 
ATOM   5071 P  P     . DA  F 3 21  ? 2.044   -14.382 -63.358 1.00 118.31 ? 21   DA  F P     1 
ATOM   5072 O  OP1   . DA  F 3 21  ? 2.494   -15.774 -63.590 1.00 114.28 ? 21   DA  F OP1   1 
ATOM   5073 O  OP2   . DA  F 3 21  ? 2.641   -13.254 -64.115 1.00 101.50 ? 21   DA  F OP2   1 
ATOM   5074 O  "O5'" . DA  F 3 21  ? 0.453   -14.310 -63.567 1.00 111.40 ? 21   DA  F "O5'" 1 
ATOM   5075 C  "C5'" . DA  F 3 21  ? -0.406  -15.196 -62.853 1.00 106.88 ? 21   DA  F "C5'" 1 
ATOM   5076 C  "C4'" . DA  F 3 21  ? -1.866  -14.848 -63.094 1.00 109.99 ? 21   DA  F "C4'" 1 
ATOM   5077 O  "O4'" . DA  F 3 21  ? -2.193  -13.579 -62.460 1.00 109.80 ? 21   DA  F "O4'" 1 
ATOM   5078 C  "C3'" . DA  F 3 21  ? -2.266  -14.692 -64.561 1.00 113.64 ? 21   DA  F "C3'" 1 
ATOM   5079 O  "O3'" . DA  F 3 21  ? -3.553  -15.238 -64.749 1.00 119.68 ? 21   DA  F "O3'" 1 
ATOM   5080 C  "C2'" . DA  F 3 21  ? -2.292  -13.177 -64.742 1.00 108.97 ? 21   DA  F "C2'" 1 
ATOM   5081 C  "C1'" . DA  F 3 21  ? -2.850  -12.757 -63.397 1.00 105.96 ? 21   DA  F "C1'" 1 
ATOM   5082 N  N9    . DA  F 3 21  ? -2.596  -11.363 -63.069 1.00 102.70 ? 21   DA  F N9    1 
ATOM   5083 C  C8    . DA  F 3 21  ? -1.487  -10.630 -63.384 1.00 100.33 ? 21   DA  F C8    1 
ATOM   5084 N  N7    . DA  F 3 21  ? -1.536  -9.388  -62.962 1.00 97.05  ? 21   DA  F N7    1 
ATOM   5085 C  C5    . DA  F 3 21  ? -2.765  -9.301  -62.327 1.00 95.15  ? 21   DA  F C5    1 
ATOM   5086 C  C6    . DA  F 3 21  ? -3.420  -8.242  -61.665 1.00 92.53  ? 21   DA  F C6    1 
ATOM   5087 N  N6    . DA  F 3 21  ? -2.893  -7.020  -61.537 1.00 88.98  ? 21   DA  F N6    1 
ATOM   5088 N  N1    . DA  F 3 21  ? -4.641  -8.490  -61.141 1.00 88.58  ? 21   DA  F N1    1 
ATOM   5089 C  C2    . DA  F 3 21  ? -5.162  -9.721  -61.269 1.00 91.38  ? 21   DA  F C2    1 
ATOM   5090 N  N3    . DA  F 3 21  ? -4.641  -10.794 -61.866 1.00 97.36  ? 21   DA  F N3    1 
ATOM   5091 C  C4    . DA  F 3 21  ? -3.431  -10.512 -62.383 1.00 99.16  ? 21   DA  F C4    1 
ATOM   5092 P  P     . DA  F 3 22  ? -3.889  -16.099 -66.059 1.00 115.35 ? 22   DA  F P     1 
ATOM   5093 O  OP1   . DA  F 3 22  ? -3.584  -17.510 -65.725 1.00 110.15 ? 22   DA  F OP1   1 
ATOM   5094 O  OP2   . DA  F 3 22  ? -3.249  -15.427 -67.215 1.00 109.56 ? 22   DA  F OP2   1 
ATOM   5095 O  "O5'" . DA  F 3 22  ? -5.473  -15.950 -66.212 1.00 105.83 ? 22   DA  F "O5'" 1 
ATOM   5096 C  "C5'" . DA  F 3 22  ? -6.314  -16.423 -65.189 1.00 104.66 ? 22   DA  F "C5'" 1 
ATOM   5097 C  "C4'" . DA  F 3 22  ? -7.428  -15.442 -64.924 1.00 107.94 ? 22   DA  F "C4'" 1 
ATOM   5098 O  "O4'" . DA  F 3 22  ? -6.872  -14.164 -64.514 1.00 105.11 ? 22   DA  F "O4'" 1 
ATOM   5099 C  "C3'" . DA  F 3 22  ? -8.316  -15.140 -66.128 1.00 109.70 ? 22   DA  F "C3'" 1 
ATOM   5100 O  "O3'" . DA  F 3 22  ? -9.656  -15.115 -65.705 1.00 114.42 ? 22   DA  F "O3'" 1 
ATOM   5101 C  "C2'" . DA  F 3 22  ? -7.846  -13.751 -66.563 1.00 104.17 ? 22   DA  F "C2'" 1 
ATOM   5102 C  "C1'" . DA  F 3 22  ? -7.535  -13.142 -65.215 1.00 101.77 ? 22   DA  F "C1'" 1 
ATOM   5103 N  N9    . DA  F 3 22  ? -6.674  -11.964 -65.256 1.00 96.58  ? 22   DA  F N9    1 
ATOM   5104 C  C8    . DA  F 3 22  ? -5.390  -11.885 -65.727 1.00 96.30  ? 22   DA  F C8    1 
ATOM   5105 N  N7    . DA  F 3 22  ? -4.854  -10.688 -65.609 1.00 88.32  ? 22   DA  F N7    1 
ATOM   5106 C  C5    . DA  F 3 22  ? -5.854  -9.934  -65.015 1.00 90.72  ? 22   DA  F C5    1 
ATOM   5107 C  C6    . DA  F 3 22  ? -5.923  -8.579  -64.617 1.00 85.73  ? 22   DA  F C6    1 
ATOM   5108 N  N6    . DA  F 3 22  ? -4.916  -7.710  -64.774 1.00 80.96  ? 22   DA  F N6    1 
ATOM   5109 N  N1    . DA  F 3 22  ? -7.075  -8.151  -64.048 1.00 81.18  ? 22   DA  F N1    1 
ATOM   5110 C  C2    . DA  F 3 22  ? -8.079  -9.020  -63.888 1.00 81.79  ? 22   DA  F C2    1 
ATOM   5111 N  N3    . DA  F 3 22  ? -8.131  -10.311 -64.216 1.00 87.20  ? 22   DA  F N3    1 
ATOM   5112 C  C4    . DA  F 3 22  ? -6.979  -10.709 -64.783 1.00 93.81  ? 22   DA  F C4    1 
ATOM   5113 P  P     . DG  F 3 23  ? -10.800 -15.768 -66.617 1.00 138.09 ? 23   DG  F P     1 
ATOM   5114 O  OP1   . DG  F 3 23  ? -11.553 -16.728 -65.772 1.00 128.24 ? 23   DG  F OP1   1 
ATOM   5115 O  OP2   . DG  F 3 23  ? -10.158 -16.230 -67.869 1.00 138.17 ? 23   DG  F OP2   1 
ATOM   5116 O  "O5'" . DG  F 3 23  ? -11.742 -14.529 -66.950 1.00 125.34 ? 23   DG  F "O5'" 1 
ATOM   5117 C  "C5'" . DG  F 3 23  ? -12.354 -13.845 -65.884 1.00 126.64 ? 23   DG  F "C5'" 1 
ATOM   5118 C  "C4'" . DG  F 3 23  ? -12.334 -12.347 -66.103 1.00 126.22 ? 23   DG  F "C4'" 1 
ATOM   5119 O  "O4'" . DG  F 3 23  ? -10.993 -11.868 -66.254 1.00 117.82 ? 23   DG  F "O4'" 1 
ATOM   5120 C  "C3'" . DG  F 3 23  ? -13.048 -11.864 -67.351 1.00 126.88 ? 23   DG  F "C3'" 1 
ATOM   5121 O  "O3'" . DG  F 3 23  ? -14.377 -11.533 -67.013 1.00 127.47 ? 23   DG  F "O3'" 1 
ATOM   5122 C  "C2'" . DG  F 3 23  ? -12.229 -10.622 -67.794 1.00 120.44 ? 23   DG  F "C2'" 1 
ATOM   5123 C  "C1'" . DG  F 3 23  ? -11.100 -10.565 -66.760 1.00 112.15 ? 23   DG  F "C1'" 1 
ATOM   5124 N  N9    . DG  F 3 23  ? -9.795  -10.150 -67.271 1.00 109.41 ? 23   DG  F N9    1 
ATOM   5125 C  C8    . DG  F 3 23  ? -8.866  -10.940 -67.907 1.00 114.12 ? 23   DG  F C8    1 
ATOM   5126 N  N7    . DG  F 3 23  ? -7.762  -10.310 -68.214 1.00 105.99 ? 23   DG  F N7    1 
ATOM   5127 C  C5    . DG  F 3 23  ? -7.965  -9.018  -67.744 1.00 99.95  ? 23   DG  F C5    1 
ATOM   5128 C  C6    . DG  F 3 23  ? -7.116  -7.886  -67.798 1.00 96.18  ? 23   DG  F C6    1 
ATOM   5129 O  O6    . DG  F 3 23  ? -5.978  -7.803  -68.291 1.00 95.66  ? 23   DG  F O6    1 
ATOM   5130 N  N1    . DG  F 3 23  ? -7.705  -6.765  -67.203 1.00 95.26  ? 23   DG  F N1    1 
ATOM   5131 C  C2    . DG  F 3 23  ? -8.959  -6.745  -66.628 1.00 95.79  ? 23   DG  F C2    1 
ATOM   5132 N  N2    . DG  F 3 23  ? -9.354  -5.571  -66.105 1.00 86.24  ? 23   DG  F N2    1 
ATOM   5133 N  N3    . DG  F 3 23  ? -9.771  -7.802  -66.574 1.00 98.70  ? 23   DG  F N3    1 
ATOM   5134 C  C4    . DG  F 3 23  ? -9.210  -8.901  -67.151 1.00 105.85 ? 23   DG  F C4    1 
ATOM   5135 P  P     . DG  F 3 24  ? -15.468 -11.294 -68.160 1.00 144.00 ? 24   DG  F P     1 
ATOM   5136 O  OP1   . DG  F 3 24  ? -16.797 -11.602 -67.578 1.00 140.95 ? 24   DG  F OP1   1 
ATOM   5137 O  OP2   . DG  F 3 24  ? -15.009 -12.013 -69.373 1.00 145.27 ? 24   DG  F OP2   1 
ATOM   5138 O  "O5'" . DG  F 3 24  ? -15.361 -9.724  -68.422 1.00 130.41 ? 24   DG  F "O5'" 1 
ATOM   5139 C  "C5'" . DG  F 3 24  ? -15.376 -8.850  -67.316 1.00 128.49 ? 24   DG  F "C5'" 1 
ATOM   5140 C  "C4'" . DG  F 3 24  ? -14.923 -7.461  -67.708 1.00 126.87 ? 24   DG  F "C4'" 1 
ATOM   5141 O  "O4'" . DG  F 3 24  ? -13.483 -7.438  -67.871 1.00 124.03 ? 24   DG  F "O4'" 1 
ATOM   5142 C  "C3'" . DG  F 3 24  ? -15.515 -6.924  -69.020 1.00 126.59 ? 24   DG  F "C3'" 1 
ATOM   5143 O  "O3'" . DG  F 3 24  ? -16.055 -5.613  -68.798 1.00 130.44 ? 24   DG  F "O3'" 1 
ATOM   5144 C  "C2'" . DG  F 3 24  ? -14.305 -6.884  -69.961 1.00 122.53 ? 24   DG  F "C2'" 1 
ATOM   5145 C  "C1'" . DG  F 3 24  ? -13.183 -6.617  -68.969 1.00 118.80 ? 24   DG  F "C1'" 1 
ATOM   5146 N  N9    . DG  F 3 24  ? -11.847 -6.949  -69.462 1.00 108.38 ? 24   DG  F N9    1 
ATOM   5147 C  C8    . DG  F 3 24  ? -11.396 -8.185  -69.867 1.00 108.61 ? 24   DG  F C8    1 
ATOM   5148 N  N7    . DG  F 3 24  ? -10.150 -8.186  -70.249 1.00 105.97 ? 24   DG  F N7    1 
ATOM   5149 C  C5    . DG  F 3 24  ? -9.743  -6.862  -70.088 1.00 101.86 ? 24   DG  F C5    1 
ATOM   5150 C  C6    . DG  F 3 24  ? -8.490  -6.258  -70.349 1.00 96.07  ? 24   DG  F C6    1 
ATOM   5151 O  O6    . DG  F 3 24  ? -7.459  -6.794  -70.786 1.00 96.49  ? 24   DG  F O6    1 
ATOM   5152 N  N1    . DG  F 3 24  ? -8.498  -4.891  -70.048 1.00 93.76  ? 24   DG  F N1    1 
ATOM   5153 C  C2    . DG  F 3 24  ? -9.585  -4.195  -69.560 1.00 94.48  ? 24   DG  F C2    1 
ATOM   5154 N  N2    . DG  F 3 24  ? -9.401  -2.879  -69.333 1.00 85.13  ? 24   DG  F N2    1 
ATOM   5155 N  N3    . DG  F 3 24  ? -10.773 -4.753  -69.314 1.00 99.10  ? 24   DG  F N3    1 
ATOM   5156 C  C4    . DG  F 3 24  ? -10.777 -6.087  -69.602 1.00 102.59 ? 24   DG  F C4    1 
ATOM   5157 P  P     . DC  F 3 25  ? -17.305 -5.088  -69.662 1.00 121.76 ? 25   DC  F P     1 
ATOM   5158 O  OP1   . DC  F 3 25  ? -18.301 -4.508  -68.731 1.00 113.54 ? 25   DC  F OP1   1 
ATOM   5159 O  OP2   . DC  F 3 25  ? -17.665 -6.206  -70.568 1.00 115.80 ? 25   DC  F OP2   1 
ATOM   5160 O  "O5'" . DC  F 3 25  ? -16.705 -3.866  -70.514 1.00 116.79 ? 25   DC  F "O5'" 1 
ATOM   5161 C  "C5'" . DC  F 3 25  ? -16.600 -2.559  -69.926 1.00 112.40 ? 25   DC  F "C5'" 1 
ATOM   5162 C  "C4'" . DC  F 3 25  ? -15.431 -1.772  -70.513 1.00 109.22 ? 25   DC  F "C4'" 1 
ATOM   5163 O  "O4'" . DC  F 3 25  ? -14.289 -2.637  -70.656 1.00 107.82 ? 25   DC  F "O4'" 1 
ATOM   5164 C  "C3'" . DC  F 3 25  ? -15.682 -1.172  -71.898 1.00 106.11 ? 25   DC  F "C3'" 1 
ATOM   5165 O  "O3'" . DC  F 3 25  ? -15.847 0.247   -71.789 1.00 103.17 ? 25   DC  F "O3'" 1 
ATOM   5166 C  "C2'" . DC  F 3 25  ? -14.437 -1.551  -72.738 1.00 98.88  ? 25   DC  F "C2'" 1 
ATOM   5167 C  "C1'" . DC  F 3 25  ? -13.490 -2.188  -71.724 1.00 96.78  ? 25   DC  F "C1'" 1 
ATOM   5168 N  N1    . DC  F 3 25  ? -12.723 -3.374  -72.247 1.00 93.29  ? 25   DC  F N1    1 
ATOM   5169 C  C2    . DC  F 3 25  ? -11.338 -3.273  -72.464 1.00 87.31  ? 25   DC  F C2    1 
ATOM   5170 O  O2    . DC  F 3 25  ? -10.769 -2.191  -72.250 1.00 85.49  ? 25   DC  F O2    1 
ATOM   5171 N  N3    . DC  F 3 25  ? -10.661 -4.367  -72.910 1.00 77.67  ? 25   DC  F N3    1 
ATOM   5172 C  C4    . DC  F 3 25  ? -11.311 -5.516  -73.121 1.00 87.07  ? 25   DC  F C4    1 
ATOM   5173 N  N4    . DC  F 3 25  ? -10.607 -6.568  -73.558 1.00 89.06  ? 25   DC  F N4    1 
ATOM   5174 C  C5    . DC  F 3 25  ? -12.713 -5.637  -72.892 1.00 94.38  ? 25   DC  F C5    1 
ATOM   5175 C  C6    . DC  F 3 25  ? -13.372 -4.555  -72.455 1.00 91.33  ? 25   DC  F C6    1 
ATOM   5176 N  N     . GLU G 4 5   ? -45.054 14.487  8.906   1.00 68.90  ? 5    GLU G N     1 
ATOM   5177 C  CA    . GLU G 4 5   ? -46.379 14.318  9.501   1.00 73.10  ? 5    GLU G CA    1 
ATOM   5178 C  C     . GLU G 4 5   ? -47.501 14.725  8.531   1.00 80.72  ? 5    GLU G C     1 
ATOM   5179 O  O     . GLU G 4 5   ? -48.564 14.087  8.486   1.00 72.94  ? 5    GLU G O     1 
ATOM   5180 C  CB    . GLU G 4 5   ? -46.489 15.108  10.800  1.00 63.30  ? 5    GLU G CB    1 
ATOM   5181 N  N     . GLU G 4 6   ? -47.286 15.788  7.758   1.00 88.71  ? 6    GLU G N     1 
ATOM   5182 C  CA    . GLU G 4 6   ? -48.199 16.060  6.647   1.00 87.18  ? 6    GLU G CA    1 
ATOM   5183 C  C     . GLU G 4 6   ? -47.841 15.086  5.523   1.00 83.51  ? 6    GLU G C     1 
ATOM   5184 O  O     . GLU G 4 6   ? -48.703 14.640  4.759   1.00 72.24  ? 6    GLU G O     1 
ATOM   5185 C  CB    . GLU G 4 6   ? -48.112 17.517  6.170   1.00 81.83  ? 6    GLU G CB    1 
ATOM   5186 C  CG    . GLU G 4 6   ? -49.142 17.879  5.089   1.00 88.09  ? 6    GLU G CG    1 
ATOM   5187 C  CD    . GLU G 4 6   ? -48.612 18.904  4.098   1.00 102.51 ? 6    GLU G CD    1 
ATOM   5188 O  OE1   . GLU G 4 6   ? -47.705 19.679  4.488   1.00 107.06 ? 6    GLU G OE1   1 
ATOM   5189 O  OE2   . GLU G 4 6   ? -49.073 18.916  2.927   1.00 93.58  ? 6    GLU G OE2   1 
ATOM   5190 N  N     . VAL G 4 7   ? -46.553 14.746  5.456   1.00 72.24  ? 7    VAL G N     1 
ATOM   5191 C  CA    . VAL G 4 7   ? -46.056 13.759  4.510   1.00 64.35  ? 7    VAL G CA    1 
ATOM   5192 C  C     . VAL G 4 7   ? -46.575 12.342  4.796   1.00 61.25  ? 7    VAL G C     1 
ATOM   5193 O  O     . VAL G 4 7   ? -47.040 11.664  3.887   1.00 58.09  ? 7    VAL G O     1 
ATOM   5194 C  CB    . VAL G 4 7   ? -44.517 13.781  4.484   1.00 59.13  ? 7    VAL G CB    1 
ATOM   5195 C  CG1   . VAL G 4 7   ? -43.938 12.538  3.797   1.00 54.36  ? 7    VAL G CG1   1 
ATOM   5196 C  CG2   . VAL G 4 7   ? -44.068 15.030  3.762   1.00 64.89  ? 7    VAL G CG2   1 
ATOM   5197 N  N     . SER G 4 8   ? -46.531 11.896  6.045   1.00 60.32  ? 8    SER G N     1 
ATOM   5198 C  CA    . SER G 4 8   ? -47.047 10.561  6.352   1.00 62.90  ? 8    SER G CA    1 
ATOM   5199 C  C     . SER G 4 8   ? -48.577 10.439  6.156   1.00 63.69  ? 8    SER G C     1 
ATOM   5200 O  O     . SER G 4 8   ? -49.081 9.382   5.772   1.00 62.84  ? 8    SER G O     1 
ATOM   5201 C  CB    . SER G 4 8   ? -46.669 10.165  7.781   1.00 64.63  ? 8    SER G CB    1 
ATOM   5202 O  OG    . SER G 4 8   ? -47.063 11.168  8.688   1.00 64.25  ? 8    SER G OG    1 
ATOM   5203 N  N     . GLY G 4 9   ? -49.311 11.519  6.415   1.00 67.60  ? 9    GLY G N     1 
ATOM   5204 C  CA    . GLY G 4 9   ? -50.754 11.510  6.265   1.00 58.28  ? 9    GLY G CA    1 
ATOM   5205 C  C     . GLY G 4 9   ? -51.147 11.457  4.804   1.00 60.45  ? 9    GLY G C     1 
ATOM   5206 O  O     . GLY G 4 9   ? -52.045 10.719  4.415   1.00 62.85  ? 9    GLY G O     1 
ATOM   5207 N  N     . ILE G 4 10  ? -50.478 12.257  3.989   1.00 58.66  ? 10   ILE G N     1 
ATOM   5208 C  CA    . ILE G 4 10  ? -50.697 12.218  2.557   1.00 57.13  ? 10   ILE G CA    1 
ATOM   5209 C  C     . ILE G 4 10  ? -50.249 10.858  2.024   1.00 55.48  ? 10   ILE G C     1 
ATOM   5210 O  O     . ILE G 4 10  ? -50.909 10.261  1.173   1.00 53.46  ? 10   ILE G O     1 
ATOM   5211 C  CB    . ILE G 4 10  ? -49.949 13.365  1.863   1.00 60.86  ? 10   ILE G CB    1 
ATOM   5212 C  CG1   . ILE G 4 10  ? -50.646 14.689  2.185   1.00 60.97  ? 10   ILE G CG1   1 
ATOM   5213 C  CG2   . ILE G 4 10  ? -49.866 13.150  0.361   1.00 55.80  ? 10   ILE G CG2   1 
ATOM   5214 C  CD1   . ILE G 4 10  ? -49.906 15.925  1.702   1.00 63.35  ? 10   ILE G CD1   1 
ATOM   5215 N  N     . SER G 4 11  ? -49.140 10.357  2.554   1.00 46.20  ? 11   SER G N     1 
ATOM   5216 C  CA    . SER G 4 11  ? -48.662 9.020   2.200   1.00 50.74  ? 11   SER G CA    1 
ATOM   5217 C  C     . SER G 4 11  ? -49.722 7.926   2.439   1.00 50.32  ? 11   SER G C     1 
ATOM   5218 O  O     . SER G 4 11  ? -49.957 7.071   1.581   1.00 44.51  ? 11   SER G O     1 
ATOM   5219 C  CB    . SER G 4 11  ? -47.387 8.677   2.993   1.00 52.89  ? 11   SER G CB    1 
ATOM   5220 O  OG    . SER G 4 11  ? -46.253 9.373   2.502   1.00 55.37  ? 11   SER G OG    1 
ATOM   5221 N  N     . ALA G 4 12  ? -50.330 7.953   3.622   1.00 49.08  ? 12   ALA G N     1 
ATOM   5222 C  CA    . ALA G 4 12  ? -51.306 6.961   4.016   1.00 48.22  ? 12   ALA G CA    1 
ATOM   5223 C  C     . ALA G 4 12  ? -52.550 7.031   3.129   1.00 51.53  ? 12   ALA G C     1 
ATOM   5224 O  O     . ALA G 4 12  ? -53.124 6.002   2.745   1.00 50.73  ? 12   ALA G O     1 
ATOM   5225 C  CB    . ALA G 4 12  ? -51.674 7.155   5.457   1.00 47.95  ? 12   ALA G CB    1 
ATOM   5226 N  N     . TYR G 4 13  ? -52.961 8.252   2.809   1.00 42.24  ? 13   TYR G N     1 
ATOM   5227 C  CA    . TYR G 4 13  ? -54.075 8.460   1.926   1.00 41.58  ? 13   TYR G CA    1 
ATOM   5228 C  C     . TYR G 4 13  ? -53.781 7.879   0.544   1.00 43.02  ? 13   TYR G C     1 
ATOM   5229 O  O     . TYR G 4 13  ? -54.632 7.231   -0.065  1.00 45.32  ? 13   TYR G O     1 
ATOM   5230 C  CB    . TYR G 4 13  ? -54.403 9.953   1.836   1.00 47.43  ? 13   TYR G CB    1 
ATOM   5231 C  CG    . TYR G 4 13  ? -55.510 10.265  0.861   1.00 44.90  ? 13   TYR G CG    1 
ATOM   5232 C  CD1   . TYR G 4 13  ? -56.844 10.023  1.185   1.00 44.42  ? 13   TYR G CD1   1 
ATOM   5233 C  CD2   . TYR G 4 13  ? -55.218 10.778  -0.392  1.00 45.87  ? 13   TYR G CD2   1 
ATOM   5234 C  CE1   . TYR G 4 13  ? -57.849 10.304  0.287   1.00 45.41  ? 13   TYR G CE1   1 
ATOM   5235 C  CE2   . TYR G 4 13  ? -56.214 11.059  -1.297  1.00 50.64  ? 13   TYR G CE2   1 
ATOM   5236 C  CZ    . TYR G 4 13  ? -57.524 10.821  -0.956  1.00 50.34  ? 13   TYR G CZ    1 
ATOM   5237 O  OH    . TYR G 4 13  ? -58.495 11.105  -1.880  1.00 57.96  ? 13   TYR G OH    1 
ATOM   5238 N  N     . LEU G 4 14  ? -52.576 8.106   0.045   1.00 45.14  ? 14   LEU G N     1 
ATOM   5239 C  CA    . LEU G 4 14  ? -52.192 7.553   -1.244  1.00 41.95  ? 14   LEU G CA    1 
ATOM   5240 C  C     . LEU G 4 14  ? -52.111 6.027   -1.188  1.00 46.49  ? 14   LEU G C     1 
ATOM   5241 O  O     . LEU G 4 14  ? -52.426 5.331   -2.164  1.00 49.19  ? 14   LEU G O     1 
ATOM   5242 C  CB    . LEU G 4 14  ? -50.861 8.134   -1.695  1.00 46.05  ? 14   LEU G CB    1 
ATOM   5243 C  CG    . LEU G 4 14  ? -50.907 9.608   -2.077  1.00 46.80  ? 14   LEU G CG    1 
ATOM   5244 C  CD1   . LEU G 4 14  ? -49.503 10.159  -2.310  1.00 45.31  ? 14   LEU G CD1   1 
ATOM   5245 C  CD2   . LEU G 4 14  ? -51.770 9.773   -3.304  1.00 43.58  ? 14   LEU G CD2   1 
ATOM   5246 N  N     . LEU G 4 15  ? -51.704 5.498   -0.041  1.00 40.87  ? 15   LEU G N     1 
ATOM   5247 C  CA    . LEU G 4 15  ? -51.540 4.064   0.069   1.00 42.81  ? 15   LEU G CA    1 
ATOM   5248 C  C     . LEU G 4 15  ? -52.906 3.419   0.003   1.00 42.73  ? 15   LEU G C     1 
ATOM   5249 O  O     . LEU G 4 15  ? -53.072 2.333   -0.552  1.00 43.78  ? 15   LEU G O     1 
ATOM   5250 C  CB    . LEU G 4 15  ? -50.814 3.683   1.362   1.00 40.10  ? 15   LEU G CB    1 
ATOM   5251 C  CG    . LEU G 4 15  ? -50.581 2.178   1.470   1.00 33.11  ? 15   LEU G CG    1 
ATOM   5252 C  CD1   . LEU G 4 15  ? -49.721 1.718   0.323   1.00 32.96  ? 15   LEU G CD1   1 
ATOM   5253 C  CD2   . LEU G 4 15  ? -50.002 1.801   2.812   1.00 35.55  ? 15   LEU G CD2   1 
ATOM   5254 N  N     . GLY G 4 16  ? -53.880 4.113   0.586   1.00 48.05  ? 16   GLY G N     1 
ATOM   5255 C  CA    . GLY G 4 16  ? -55.278 3.753   0.466   1.00 42.45  ? 16   GLY G CA    1 
ATOM   5256 C  C     . GLY G 4 16  ? -55.717 3.683   -0.982  1.00 41.25  ? 16   GLY G C     1 
ATOM   5257 O  O     . GLY G 4 16  ? -56.257 2.665   -1.400  1.00 40.56  ? 16   GLY G O     1 
ATOM   5258 N  N     . LEU G 4 17  ? -55.483 4.738   -1.761  1.00 43.32  ? 17   LEU G N     1 
ATOM   5259 C  CA    . LEU G 4 17  ? -55.891 4.679   -3.163  1.00 47.13  ? 17   LEU G CA    1 
ATOM   5260 C  C     . LEU G 4 17  ? -55.198 3.518   -3.879  1.00 49.99  ? 17   LEU G C     1 
ATOM   5261 O  O     . LEU G 4 17  ? -55.838 2.794   -4.642  1.00 47.52  ? 17   LEU G O     1 
ATOM   5262 C  CB    . LEU G 4 17  ? -55.597 5.984   -3.893  1.00 45.96  ? 17   LEU G CB    1 
ATOM   5263 C  CG    . LEU G 4 17  ? -56.206 7.291   -3.391  1.00 49.93  ? 17   LEU G CG    1 
ATOM   5264 C  CD1   . LEU G 4 17  ? -55.863 8.392   -4.395  1.00 52.08  ? 17   LEU G CD1   1 
ATOM   5265 C  CD2   . LEU G 4 17  ? -57.716 7.215   -3.121  1.00 42.76  ? 17   LEU G CD2   1 
ATOM   5266 N  N     . ILE G 4 18  ? -53.899 3.332   -3.612  1.00 49.12  ? 18   ILE G N     1 
ATOM   5267 C  CA    . ILE G 4 18  ? -53.103 2.275   -4.247  1.00 45.96  ? 18   ILE G CA    1 
ATOM   5268 C  C     . ILE G 4 18  ? -53.643 0.865   -3.985  1.00 44.11  ? 18   ILE G C     1 
ATOM   5269 O  O     . ILE G 4 18  ? -53.803 0.063   -4.907  1.00 45.70  ? 18   ILE G O     1 
ATOM   5270 C  CB    . ILE G 4 18  ? -51.627 2.332   -3.786  1.00 46.03  ? 18   ILE G CB    1 
ATOM   5271 C  CG1   . ILE G 4 18  ? -50.936 3.581   -4.345  1.00 49.26  ? 18   ILE G CG1   1 
ATOM   5272 C  CG2   . ILE G 4 18  ? -50.875 1.079   -4.227  1.00 39.34  ? 18   ILE G CG2   1 
ATOM   5273 C  CD1   . ILE G 4 18  ? -49.623 3.954   -3.633  1.00 40.58  ? 18   ILE G CD1   1 
ATOM   5274 N  N     . ILE G 4 19  ? -53.932 0.560   -2.728  1.00 42.06  ? 19   ILE G N     1 
ATOM   5275 C  CA    . ILE G 4 19  ? -54.392 -0.779  -2.378  1.00 47.72  ? 19   ILE G CA    1 
ATOM   5276 C  C     . ILE G 4 19  ? -55.805 -0.988  -2.873  1.00 48.79  ? 19   ILE G C     1 
ATOM   5277 O  O     . ILE G 4 19  ? -56.187 -2.088  -3.284  1.00 50.67  ? 19   ILE G O     1 
ATOM   5278 C  CB    . ILE G 4 19  ? -54.317 -1.005  -0.866  1.00 44.60  ? 19   ILE G CB    1 
ATOM   5279 C  CG1   . ILE G 4 19  ? -52.919 -1.472  -0.503  1.00 44.91  ? 19   ILE G CG1   1 
ATOM   5280 C  CG2   . ILE G 4 19  ? -55.293 -2.066  -0.418  1.00 50.78  ? 19   ILE G CG2   1 
ATOM   5281 C  CD1   . ILE G 4 19  ? -52.654 -1.387  0.956   1.00 55.19  ? 19   ILE G CD1   1 
ATOM   5282 N  N     . GLY G 4 20  ? -56.563 0.104   -2.836  1.00 45.10  ? 20   GLY G N     1 
ATOM   5283 C  CA    . GLY G 4 20  ? -57.940 0.129   -3.271  1.00 46.54  ? 20   GLY G CA    1 
ATOM   5284 C  C     . GLY G 4 20  ? -58.074 0.065   -4.779  1.00 53.86  ? 20   GLY G C     1 
ATOM   5285 O  O     . GLY G 4 20  ? -58.840 -0.753  -5.297  1.00 52.15  ? 20   GLY G O     1 
ATOM   5286 N  N     . ASP G 4 21  ? -57.321 0.900   -5.494  1.00 53.77  ? 21   ASP G N     1 
ATOM   5287 C  CA    . ASP G 4 21  ? -57.570 1.059   -6.921  1.00 54.74  ? 21   ASP G CA    1 
ATOM   5288 C  C     . ASP G 4 21  ? -56.367 0.908   -7.827  1.00 59.16  ? 21   ASP G C     1 
ATOM   5289 O  O     . ASP G 4 21  ? -56.423 1.293   -8.999  1.00 61.25  ? 21   ASP G O     1 
ATOM   5290 C  CB    . ASP G 4 21  ? -58.197 2.418   -7.190  1.00 54.04  ? 21   ASP G CB    1 
ATOM   5291 C  CG    . ASP G 4 21  ? -59.703 2.390   -7.100  1.00 59.99  ? 21   ASP G CG    1 
ATOM   5292 O  OD1   . ASP G 4 21  ? -60.289 1.279   -7.103  1.00 59.89  ? 21   ASP G OD1   1 
ATOM   5293 O  OD2   . ASP G 4 21  ? -60.299 3.488   -7.056  1.00 60.84  ? 21   ASP G OD2   1 
ATOM   5294 N  N     . GLY G 4 22  ? -55.283 0.354   -7.307  1.00 49.91  ? 22   GLY G N     1 
ATOM   5295 C  CA    . GLY G 4 22  ? -54.135 0.119   -8.147  1.00 47.57  ? 22   GLY G CA    1 
ATOM   5296 C  C     . GLY G 4 22  ? -53.258 -0.983  -7.609  1.00 47.56  ? 22   GLY G C     1 
ATOM   5297 O  O     . GLY G 4 22  ? -53.735 -2.069  -7.262  1.00 50.11  ? 22   GLY G O     1 
ATOM   5298 N  N     . GLY G 4 23  ? -51.963 -0.706  -7.528  1.00 41.37  ? 23   GLY G N     1 
ATOM   5299 C  CA    . GLY G 4 23  ? -51.063 -1.694  -6.980  1.00 43.21  ? 23   GLY G CA    1 
ATOM   5300 C  C     . GLY G 4 23  ? -49.611 -1.290  -6.894  1.00 44.43  ? 23   GLY G C     1 
ATOM   5301 O  O     . GLY G 4 23  ? -49.205 -0.154  -7.176  1.00 38.92  ? 23   GLY G O     1 
ATOM   5302 N  N     . LEU G 4 24  ? -48.824 -2.267  -6.483  1.00 44.92  ? 24   LEU G N     1 
ATOM   5303 C  CA    . LEU G 4 24  ? -47.405 -2.115  -6.321  1.00 38.42  ? 24   LEU G CA    1 
ATOM   5304 C  C     . LEU G 4 24  ? -46.790 -3.286  -7.058  1.00 40.66  ? 24   LEU G C     1 
ATOM   5305 O  O     . LEU G 4 24  ? -46.937 -4.415  -6.630  1.00 41.65  ? 24   LEU G O     1 
ATOM   5306 C  CB    . LEU G 4 24  ? -47.044 -2.117  -4.847  1.00 34.78  ? 24   LEU G CB    1 
ATOM   5307 C  CG    . LEU G 4 24  ? -47.475 -0.922  -4.000  1.00 37.46  ? 24   LEU G CG    1 
ATOM   5308 C  CD1   . LEU G 4 24  ? -47.092 -1.149  -2.540  1.00 37.60  ? 24   LEU G CD1   1 
ATOM   5309 C  CD2   . LEU G 4 24  ? -46.851 0.378   -4.485  1.00 41.82  ? 24   LEU G CD2   1 
ATOM   5310 N  N     . TYR G 4 25  ? -46.131 -3.030  -8.176  1.00 44.41  ? 25   TYR G N     1 
ATOM   5311 C  CA    . TYR G 4 25  ? -45.658 -4.114  -9.025  1.00 42.46  ? 25   TYR G CA    1 
ATOM   5312 C  C     . TYR G 4 25  ? -44.137 -4.090  -9.144  1.00 48.29  ? 25   TYR G C     1 
ATOM   5313 O  O     . TYR G 4 25  ? -43.560 -3.068  -9.504  1.00 49.93  ? 25   TYR G O     1 
ATOM   5314 C  CB    . TYR G 4 25  ? -46.315 -4.020  -10.407 1.00 44.98  ? 25   TYR G CB    1 
ATOM   5315 C  CG    . TYR G 4 25  ? -47.819 -3.912  -10.300 1.00 47.98  ? 25   TYR G CG    1 
ATOM   5316 C  CD1   . TYR G 4 25  ? -48.585 -5.005  -9.917  1.00 43.14  ? 25   TYR G CD1   1 
ATOM   5317 C  CD2   . TYR G 4 25  ? -48.470 -2.709  -10.541 1.00 46.81  ? 25   TYR G CD2   1 
ATOM   5318 C  CE1   . TYR G 4 25  ? -49.946 -4.915  -9.801  1.00 41.94  ? 25   TYR G CE1   1 
ATOM   5319 C  CE2   . TYR G 4 25  ? -49.844 -2.607  -10.421 1.00 45.69  ? 25   TYR G CE2   1 
ATOM   5320 C  CZ    . TYR G 4 25  ? -50.567 -3.719  -10.046 1.00 47.22  ? 25   TYR G CZ    1 
ATOM   5321 O  OH    . TYR G 4 25  ? -51.922 -3.631  -9.921  1.00 48.69  ? 25   TYR G OH    1 
ATOM   5322 N  N     . LYS G 4 26  ? -43.492 -5.214  -8.837  1.00 45.36  ? 26   LYS G N     1 
ATOM   5323 C  CA    A LYS G 4 26  ? -42.112 -5.578  -9.133  0.50 47.88  ? 26   LYS G CA    1 
ATOM   5324 C  CA    B LYS G 4 26  ? -42.120 -5.608  -9.117  0.50 48.05  ? 26   LYS G CA    1 
ATOM   5325 C  C     . LYS G 4 26  ? -42.051 -6.437  -10.403 1.00 49.61  ? 26   LYS G C     1 
ATOM   5326 O  O     . LYS G 4 26  ? -42.205 -7.649  -10.359 1.00 52.96  ? 26   LYS G O     1 
ATOM   5327 C  CB    A LYS G 4 26  ? -41.480 -6.309  -7.939  0.50 49.72  ? 26   LYS G CB    1 
ATOM   5328 C  CB    B LYS G 4 26  ? -41.559 -6.394  -7.929  0.50 49.87  ? 26   LYS G CB    1 
ATOM   5329 C  CG    A LYS G 4 26  ? -39.944 -6.341  -7.959  0.50 52.38  ? 26   LYS G CG    1 
ATOM   5330 C  CG    B LYS G 4 26  ? -40.036 -6.428  -7.809  0.50 52.49  ? 26   LYS G CG    1 
ATOM   5331 C  CD    A LYS G 4 26  ? -39.341 -7.199  -6.833  0.50 55.75  ? 26   LYS G CD    1 
ATOM   5332 C  CD    B LYS G 4 26  ? -39.627 -7.323  -6.639  0.50 55.68  ? 26   LYS G CD    1 
ATOM   5333 C  CE    A LYS G 4 26  ? -39.573 -6.602  -5.436  0.50 57.52  ? 26   LYS G CE    1 
ATOM   5334 C  CE    B LYS G 4 26  ? -38.126 -7.296  -6.378  0.50 57.11  ? 26   LYS G CE    1 
ATOM   5335 N  NZ    A LYS G 4 26  ? -38.645 -7.166  -4.378  0.50 55.09  ? 26   LYS G NZ    1 
ATOM   5336 N  NZ    B LYS G 4 26  ? -37.360 -7.867  -7.514  0.50 56.95  ? 26   LYS G NZ    1 
ATOM   5337 N  N     . LEU G 4 27  ? -41.821 -5.778  -11.538 1.00 46.63  ? 27   LEU G N     1 
ATOM   5338 C  CA    . LEU G 4 27  ? -41.799 -6.415  -12.858 1.00 46.63  ? 27   LEU G CA    1 
ATOM   5339 C  C     . LEU G 4 27  ? -40.460 -7.044  -13.238 1.00 50.44  ? 27   LEU G C     1 
ATOM   5340 O  O     . LEU G 4 27  ? -39.415 -6.449  -13.005 1.00 54.30  ? 27   LEU G O     1 
ATOM   5341 C  CB    . LEU G 4 27  ? -42.147 -5.390  -13.940 1.00 48.57  ? 27   LEU G CB    1 
ATOM   5342 C  CG    . LEU G 4 27  ? -43.540 -4.800  -14.141 1.00 49.90  ? 27   LEU G CG    1 
ATOM   5343 C  CD1   . LEU G 4 27  ? -44.578 -5.895  -14.216 1.00 51.48  ? 27   LEU G CD1   1 
ATOM   5344 C  CD2   . LEU G 4 27  ? -43.874 -3.800  -13.069 1.00 49.36  ? 27   LEU G CD2   1 
ATOM   5345 N  N     . LYS G 4 28  ? -40.482 -8.224  -13.857 1.00 68.22  ? 28   LYS G N     1 
ATOM   5346 C  CA    . LYS G 4 28  ? -39.260 -8.788  -14.461 1.00 71.29  ? 28   LYS G CA    1 
ATOM   5347 C  C     . LYS G 4 28  ? -39.420 -9.113  -15.945 1.00 68.52  ? 28   LYS G C     1 
ATOM   5348 O  O     . LYS G 4 28  ? -39.961 -10.148 -16.320 1.00 73.78  ? 28   LYS G O     1 
ATOM   5349 C  CB    . LYS G 4 28  ? -38.782 -10.044 -13.714 1.00 70.32  ? 28   LYS G CB    1 
ATOM   5350 C  CG    . LYS G 4 28  ? -38.987 -10.007 -12.192 1.00 90.23  ? 28   LYS G CG    1 
ATOM   5351 C  CD    . LYS G 4 28  ? -39.716 -11.243 -11.677 1.00 102.48 ? 28   LYS G CD    1 
ATOM   5352 C  CE    . LYS G 4 28  ? -40.197 -11.072 -10.239 1.00 100.41 ? 28   LYS G CE    1 
ATOM   5353 N  NZ    . LYS G 4 28  ? -41.056 -12.231 -9.851  1.00 102.61 ? 28   LYS G NZ    1 
ATOM   5354 N  N     . TYR G 4 29  ? -38.909 -8.216  -16.778 0.98 55.82  ? 29   TYR G N     1 
ATOM   5355 C  CA    . TYR G 4 29  ? -38.885 -8.394  -18.218 0.98 54.88  ? 29   TYR G CA    1 
ATOM   5356 C  C     . TYR G 4 29  ? -37.686 -9.221  -18.687 0.98 58.35  ? 29   TYR G C     1 
ATOM   5357 O  O     . TYR G 4 29  ? -36.950 -9.803  -17.889 0.98 60.92  ? 29   TYR G O     1 
ATOM   5358 C  CB    . TYR G 4 29  ? -38.843 -7.037  -18.901 0.98 45.28  ? 29   TYR G CB    1 
ATOM   5359 C  CG    . TYR G 4 29  ? -39.822 -6.055  -18.351 0.98 48.92  ? 29   TYR G CG    1 
ATOM   5360 C  CD1   . TYR G 4 29  ? -41.152 -6.425  -18.101 1.00 56.25  ? 29   TYR G CD1   1 
ATOM   5361 C  CD2   . TYR G 4 29  ? -39.432 -4.758  -18.070 1.00 45.86  ? 29   TYR G CD2   1 
ATOM   5362 C  CE1   . TYR G 4 29  ? -42.069 -5.511  -17.610 1.00 46.10  ? 29   TYR G CE1   1 
ATOM   5363 C  CE2   . TYR G 4 29  ? -40.335 -3.832  -17.571 1.00 48.62  ? 29   TYR G CE2   1 
ATOM   5364 C  CZ    . TYR G 4 29  ? -41.650 -4.218  -17.340 0.98 50.79  ? 29   TYR G CZ    1 
ATOM   5365 O  OH    . TYR G 4 29  ? -42.529 -3.294  -16.839 0.98 52.88  ? 29   TYR G OH    1 
ATOM   5366 N  N     . LYS G 4 30  ? -37.488 -9.249  -19.997 1.00 68.24  ? 30   LYS G N     1 
ATOM   5367 C  CA    . LYS G 4 30  ? -36.307 -9.867  -20.577 1.00 67.84  ? 30   LYS G CA    1 
ATOM   5368 C  C     . LYS G 4 30  ? -35.440 -8.772  -21.148 1.00 68.39  ? 30   LYS G C     1 
ATOM   5369 O  O     . LYS G 4 30  ? -35.961 -7.841  -21.759 1.00 76.16  ? 30   LYS G O     1 
ATOM   5370 C  CB    . LYS G 4 30  ? -36.699 -10.871 -21.661 1.00 76.39  ? 30   LYS G CB    1 
ATOM   5371 C  CG    . LYS G 4 30  ? -37.762 -10.366 -22.632 1.00 63.94  ? 30   LYS G CG    1 
ATOM   5372 C  CD    . LYS G 4 30  ? -38.183 -11.485 -23.572 1.00 79.02  ? 30   LYS G CD    1 
ATOM   5373 C  CE    . LYS G 4 30  ? -39.422 -11.128 -24.398 1.00 92.97  ? 30   LYS G CE    1 
ATOM   5374 N  NZ    . LYS G 4 30  ? -39.148 -10.161 -25.495 1.00 88.29  ? 30   LYS G NZ    1 
ATOM   5375 N  N     . GLY G 4 31  ? -34.142 -8.813  -20.882 1.00 62.26  ? 31   GLY G N     1 
ATOM   5376 C  CA    . GLY G 4 31  ? -33.556 -9.632  -19.840 1.00 64.07  ? 31   GLY G CA    1 
ATOM   5377 C  C     . GLY G 4 31  ? -32.233 -8.994  -19.423 1.00 70.83  ? 31   GLY G C     1 
ATOM   5378 O  O     . GLY G 4 31  ? -31.577 -8.308  -20.220 1.00 72.98  ? 31   GLY G O     1 
ATOM   5379 N  N     . ASN G 4 32  ? -31.876 -9.104  -18.150 1.00 75.43  ? 32   ASN G N     1 
ATOM   5380 C  CA    . ASN G 4 32  ? -32.820 -9.318  -17.078 1.00 67.74  ? 32   ASN G CA    1 
ATOM   5381 C  C     . ASN G 4 32  ? -33.338 -7.958  -16.682 1.00 61.21  ? 32   ASN G C     1 
ATOM   5382 O  O     . ASN G 4 32  ? -32.954 -7.455  -15.626 1.00 59.59  ? 32   ASN G O     1 
ATOM   5383 C  CB    . ASN G 4 32  ? -32.154 -9.968  -15.869 1.00 69.63  ? 32   ASN G CB    1 
ATOM   5384 C  CG    . ASN G 4 32  ? -31.719 -11.369 -16.132 1.00 72.83  ? 32   ASN G CG    1 
ATOM   5385 O  OD1   . ASN G 4 32  ? -31.445 -11.737 -17.269 1.00 81.24  ? 32   ASN G OD1   1 
ATOM   5386 N  ND2   . ASN G 4 32  ? -31.637 -12.169 -15.074 1.00 77.02  ? 32   ASN G ND2   1 
ATOM   5387 N  N     . ARG G 4 33  ? -34.158 -7.329  -17.517 1.00 52.54  ? 33   ARG G N     1 
ATOM   5388 C  CA    . ARG G 4 33  ? -34.583 -5.980  -17.179 1.00 54.56  ? 33   ARG G CA    1 
ATOM   5389 C  C     . ARG G 4 33  ? -35.614 -5.988  -16.054 1.00 54.42  ? 33   ARG G C     1 
ATOM   5390 O  O     . ARG G 4 33  ? -36.255 -7.006  -15.780 1.00 53.05  ? 33   ARG G O     1 
ATOM   5391 C  CB    . ARG G 4 33  ? -35.124 -5.263  -18.401 1.00 55.71  ? 33   ARG G CB    1 
ATOM   5392 C  CG    . ARG G 4 33  ? -34.129 -5.175  -19.550 1.00 52.42  ? 33   ARG G CG    1 
ATOM   5393 C  CD    . ARG G 4 33  ? -34.768 -4.531  -20.755 1.00 46.15  ? 33   ARG G CD    1 
ATOM   5394 N  NE    . ARG G 4 33  ? -36.001 -5.231  -21.148 1.00 50.22  ? 33   ARG G NE    1 
ATOM   5395 C  CZ    . ARG G 4 33  ? -37.151 -4.616  -21.407 1.00 55.89  ? 33   ARG G CZ    1 
ATOM   5396 N  NH1   . ARG G 4 33  ? -37.221 -3.290  -21.322 1.00 53.68  ? 33   ARG G NH1   1 
ATOM   5397 N  NH2   . ARG G 4 33  ? -38.231 -5.314  -21.749 1.00 69.47  ? 33   ARG G NH2   1 
ATOM   5398 N  N     . SER G 4 34  ? -35.740 -4.856  -15.373 1.00 52.23  ? 34   SER G N     1 
ATOM   5399 C  CA    . SER G 4 34  ? -36.661 -4.774  -14.253 1.00 48.84  ? 34   SER G CA    1 
ATOM   5400 C  C     . SER G 4 34  ? -37.427 -3.467  -14.275 1.00 48.35  ? 34   SER G C     1 
ATOM   5401 O  O     . SER G 4 34  ? -37.090 -2.545  -15.027 1.00 47.58  ? 34   SER G O     1 
ATOM   5402 C  CB    . SER G 4 34  ? -35.914 -4.913  -12.923 1.00 44.99  ? 34   SER G CB    1 
ATOM   5403 O  OG    . SER G 4 34  ? -35.376 -3.674  -12.494 1.00 45.38  ? 34   SER G OG    1 
ATOM   5404 N  N     . GLU G 4 35  ? -38.460 -3.396  -13.445 1.00 44.42  ? 35   GLU G N     1 
ATOM   5405 C  CA    . GLU G 4 35  ? -39.173 -2.146  -13.222 1.00 47.22  ? 35   GLU G CA    1 
ATOM   5406 C  C     . GLU G 4 35  ? -40.014 -2.259  -11.953 1.00 48.50  ? 35   GLU G C     1 
ATOM   5407 O  O     . GLU G 4 35  ? -40.408 -3.359  -11.545 1.00 47.45  ? 35   GLU G O     1 
ATOM   5408 C  CB    . GLU G 4 35  ? -40.047 -1.787  -14.427 1.00 49.20  ? 35   GLU G CB    1 
ATOM   5409 C  CG    . GLU G 4 35  ? -40.659 -0.402  -14.360 1.00 48.13  ? 35   GLU G CG    1 
ATOM   5410 C  CD    . GLU G 4 35  ? -41.562 -0.081  -15.542 1.00 46.73  ? 35   GLU G CD    1 
ATOM   5411 O  OE1   . GLU G 4 35  ? -41.723 -0.942  -16.426 1.00 49.77  ? 35   GLU G OE1   1 
ATOM   5412 O  OE2   . GLU G 4 35  ? -42.122 1.028   -15.574 1.00 45.05  ? 35   GLU G OE2   1 
ATOM   5413 N  N     . TYR G 4 36  ? -40.259 -1.117  -11.321 1.00 43.84  ? 36   TYR G N     1 
ATOM   5414 C  CA    . TYR G 4 36  ? -41.016 -1.061  -10.087 1.00 43.63  ? 36   TYR G CA    1 
ATOM   5415 C  C     . TYR G 4 36  ? -42.080 -0.001  -10.259 1.00 40.43  ? 36   TYR G C     1 
ATOM   5416 O  O     . TYR G 4 36  ? -41.773 1.161   -10.512 1.00 39.62  ? 36   TYR G O     1 
ATOM   5417 C  CB    . TYR G 4 36  ? -40.116 -0.735  -8.887  1.00 45.93  ? 36   TYR G CB    1 
ATOM   5418 C  CG    . TYR G 4 36  ? -38.908 -1.639  -8.744  1.00 45.80  ? 36   TYR G CG    1 
ATOM   5419 C  CD1   . TYR G 4 36  ? -37.820 -1.519  -9.608  1.00 47.22  ? 36   TYR G CD1   1 
ATOM   5420 C  CD2   . TYR G 4 36  ? -38.848 -2.608  -7.751  1.00 42.74  ? 36   TYR G CD2   1 
ATOM   5421 C  CE1   . TYR G 4 36  ? -36.714 -2.348  -9.497  1.00 45.65  ? 36   TYR G CE1   1 
ATOM   5422 C  CE2   . TYR G 4 36  ? -37.741 -3.438  -7.629  1.00 44.13  ? 36   TYR G CE2   1 
ATOM   5423 C  CZ    . TYR G 4 36  ? -36.680 -3.304  -8.509  1.00 42.63  ? 36   TYR G CZ    1 
ATOM   5424 O  OH    . TYR G 4 36  ? -35.578 -4.116  -8.421  1.00 40.56  ? 36   TYR G OH    1 
ATOM   5425 N  N     . ARG G 4 37  ? -43.339 -0.400  -10.128 1.00 49.75  ? 37   ARG G N     1 
ATOM   5426 C  CA    . ARG G 4 37  ? -44.453 0.523   -10.356 1.00 47.64  ? 37   ARG G CA    1 
ATOM   5427 C  C     . ARG G 4 37  ? -45.307 0.779   -9.113  1.00 46.55  ? 37   ARG G C     1 
ATOM   5428 O  O     . ARG G 4 37  ? -45.595 -0.117  -8.314  1.00 45.73  ? 37   ARG G O     1 
ATOM   5429 C  CB    . ARG G 4 37  ? -45.320 0.009   -11.493 1.00 44.57  ? 37   ARG G CB    1 
ATOM   5430 C  CG    . ARG G 4 37  ? -44.693 0.250   -12.861 1.00 47.07  ? 37   ARG G CG    1 
ATOM   5431 C  CD    . ARG G 4 37  ? -45.506 -0.333  -14.006 1.00 51.97  ? 37   ARG G CD    1 
ATOM   5432 N  NE    . ARG G 4 37  ? -44.769 -0.251  -15.266 1.00 62.39  ? 37   ARG G NE    1 
ATOM   5433 C  CZ    . ARG G 4 37  ? -45.248 -0.590  -16.462 1.00 55.74  ? 37   ARG G CZ    1 
ATOM   5434 N  NH1   . ARG G 4 37  ? -46.494 -1.030  -16.602 1.00 53.21  ? 37   ARG G NH1   1 
ATOM   5435 N  NH2   . ARG G 4 37  ? -44.473 -0.468  -17.528 1.00 52.31  ? 37   ARG G NH2   1 
ATOM   5436 N  N     . VAL G 4 38  ? -45.636 2.047   -8.945  1.00 42.74  ? 38   VAL G N     1 
ATOM   5437 C  CA    . VAL G 4 38  ? -46.628 2.510   -8.001  1.00 44.70  ? 38   VAL G CA    1 
ATOM   5438 C  C     . VAL G 4 38  ? -47.757 2.994   -8.885  1.00 41.20  ? 38   VAL G C     1 
ATOM   5439 O  O     . VAL G 4 38  ? -47.586 3.945   -9.641  1.00 41.19  ? 38   VAL G O     1 
ATOM   5440 C  CB    . VAL G 4 38  ? -46.111 3.645   -7.094  1.00 42.99  ? 38   VAL G CB    1 
ATOM   5441 C  CG1   . VAL G 4 38  ? -47.224 4.175   -6.192  1.00 37.92  ? 38   VAL G CG1   1 
ATOM   5442 C  CG2   . VAL G 4 38  ? -44.952 3.175   -6.271  1.00 40.18  ? 38   VAL G CG2   1 
ATOM   5443 N  N     . VAL G 4 39  ? -48.891 2.312   -8.805  1.00 42.40  ? 39   VAL G N     1 
ATOM   5444 C  CA    . VAL G 4 39  ? -50.007 2.518   -9.719  1.00 45.72  ? 39   VAL G CA    1 
ATOM   5445 C  C     . VAL G 4 39  ? -51.282 2.895   -8.980  1.00 45.37  ? 39   VAL G C     1 
ATOM   5446 O  O     . VAL G 4 39  ? -51.572 2.336   -7.922  1.00 45.99  ? 39   VAL G O     1 
ATOM   5447 C  CB    . VAL G 4 39  ? -50.270 1.226   -10.564 1.00 51.17  ? 39   VAL G CB    1 
ATOM   5448 C  CG1   . VAL G 4 39  ? -51.535 1.367   -11.429 1.00 45.09  ? 39   VAL G CG1   1 
ATOM   5449 C  CG2   . VAL G 4 39  ? -49.042 0.861   -11.419 1.00 40.29  ? 39   VAL G CG2   1 
ATOM   5450 N  N     . ILE G 4 40  ? -52.031 3.844   -9.538  1.00 50.37  ? 40   ILE G N     1 
ATOM   5451 C  CA    . ILE G 4 40  ? -53.383 4.139   -9.087  1.00 48.14  ? 40   ILE G CA    1 
ATOM   5452 C  C     . ILE G 4 40  ? -54.283 4.305   -10.317 1.00 50.59  ? 40   ILE G C     1 
ATOM   5453 O  O     . ILE G 4 40  ? -53.991 5.110   -11.192 1.00 52.08  ? 40   ILE G O     1 
ATOM   5454 C  CB    . ILE G 4 40  ? -53.413 5.403   -8.250  1.00 48.34  ? 40   ILE G CB    1 
ATOM   5455 C  CG1   . ILE G 4 40  ? -52.676 5.172   -6.938  1.00 49.23  ? 40   ILE G CG1   1 
ATOM   5456 C  CG2   . ILE G 4 40  ? -54.845 5.798   -7.975  1.00 52.18  ? 40   ILE G CG2   1 
ATOM   5457 C  CD1   . ILE G 4 40  ? -52.685 6.365   -6.024  1.00 48.76  ? 40   ILE G CD1   1 
ATOM   5458 N  N     . THR G 4 41  ? -55.373 3.553   -10.400 0.96 52.86  ? 41   THR G N     1 
ATOM   5459 C  CA    . THR G 4 41  ? -56.297 3.690   -11.533 0.96 56.48  ? 41   THR G CA    1 
ATOM   5460 C  C     . THR G 4 41  ? -57.665 4.251   -11.158 0.96 57.70  ? 41   THR G C     1 
ATOM   5461 O  O     . THR G 4 41  ? -58.157 4.006   -10.056 0.96 56.93  ? 41   THR G O     1 
ATOM   5462 C  CB    . THR G 4 41  ? -56.551 2.360   -12.188 0.96 53.10  ? 41   THR G CB    1 
ATOM   5463 O  OG1   . THR G 4 41  ? -57.304 1.553   -11.268 1.00 54.85  ? 41   THR G OG1   1 
ATOM   5464 C  CG2   . THR G 4 41  ? -55.257 1.687   -12.552 1.00 46.97  ? 41   THR G CG2   1 
ATOM   5465 N  N     . GLN G 4 42  ? -58.265 4.979   -12.100 1.00 59.74  ? 42   GLN G N     1 
ATOM   5466 C  CA    . GLN G 4 42  ? -59.586 5.590   -11.952 1.00 59.40  ? 42   GLN G CA    1 
ATOM   5467 C  C     . GLN G 4 42  ? -60.160 5.924   -13.351 1.00 68.76  ? 42   GLN G C     1 
ATOM   5468 O  O     . GLN G 4 42  ? -59.417 6.336   -14.255 1.00 69.75  ? 42   GLN G O     1 
ATOM   5469 C  CB    . GLN G 4 42  ? -59.473 6.835   -11.071 1.00 55.25  ? 42   GLN G CB    1 
ATOM   5470 C  CG    . GLN G 4 42  ? -60.612 7.153   -10.121 1.00 66.34  ? 42   GLN G CG    1 
ATOM   5471 C  CD    . GLN G 4 42  ? -60.787 6.147   -9.010  1.00 67.33  ? 42   GLN G CD    1 
ATOM   5472 O  OE1   . GLN G 4 42  ? -61.835 5.544   -8.888  1.00 69.66  ? 42   GLN G OE1   1 
ATOM   5473 N  NE2   . GLN G 4 42  ? -59.728 5.885   -8.261  1.00 71.48  ? 42   GLN G NE2   1 
ATOM   5474 N  N     . LYS G 4 43  ? -61.471 5.746   -13.538 1.00 69.04  ? 43   LYS G N     1 
ATOM   5475 C  CA    . LYS G 4 43  ? -62.096 6.031   -14.832 1.00 63.75  ? 43   LYS G CA    1 
ATOM   5476 C  C     . LYS G 4 43  ? -62.131 7.520   -15.091 1.00 61.19  ? 43   LYS G C     1 
ATOM   5477 O  O     . LYS G 4 43  ? -61.955 7.965   -16.221 1.00 66.00  ? 43   LYS G O     1 
ATOM   5478 C  CB    . LYS G 4 43  ? -63.523 5.474   -14.910 1.00 71.46  ? 43   LYS G CB    1 
ATOM   5479 C  CG    . LYS G 4 43  ? -64.084 5.498   -16.339 1.00 74.17  ? 43   LYS G CG    1 
ATOM   5480 C  CD    . LYS G 4 43  ? -65.563 5.199   -16.428 1.00 76.40  ? 43   LYS G CD    1 
ATOM   5481 C  CE    . LYS G 4 43  ? -65.975 4.997   -17.889 1.00 87.52  ? 43   LYS G CE    1 
ATOM   5482 N  NZ    . LYS G 4 43  ? -65.101 3.977   -18.570 1.00 74.23  ? 43   LYS G NZ    1 
ATOM   5483 N  N     . SER G 4 44  ? -62.380 8.275   -14.030 1.00 53.86  ? 44   SER G N     1 
ATOM   5484 C  CA    . SER G 4 44  ? -62.418 9.733   -14.055 1.00 50.33  ? 44   SER G CA    1 
ATOM   5485 C  C     . SER G 4 44  ? -61.061 10.397  -14.287 1.00 64.99  ? 44   SER G C     1 
ATOM   5486 O  O     . SER G 4 44  ? -60.196 10.371  -13.403 1.00 65.97  ? 44   SER G O     1 
ATOM   5487 C  CB    . SER G 4 44  ? -62.989 10.225  -12.727 1.00 54.10  ? 44   SER G CB    1 
ATOM   5488 O  OG    . SER G 4 44  ? -62.507 11.513  -12.401 1.00 62.26  ? 44   SER G OG    1 
ATOM   5489 N  N     . GLU G 4 45  ? -60.878 11.017  -15.452 1.00 79.25  ? 45   GLU G N     1 
ATOM   5490 C  CA    . GLU G 4 45  ? -59.624 11.721  -15.757 1.00 76.66  ? 45   GLU G CA    1 
ATOM   5491 C  C     . GLU G 4 45  ? -59.400 12.885  -14.807 1.00 74.04  ? 45   GLU G C     1 
ATOM   5492 O  O     . GLU G 4 45  ? -58.271 13.265  -14.492 1.00 78.78  ? 45   GLU G O     1 
ATOM   5493 C  CB    . GLU G 4 45  ? -59.630 12.239  -17.191 1.00 83.94  ? 45   GLU G CB    1 
ATOM   5494 C  CG    . GLU G 4 45  ? -58.338 12.904  -17.598 1.00 87.70  ? 45   GLU G CG    1 
ATOM   5495 C  CD    . GLU G 4 45  ? -58.169 12.964  -19.095 1.00 96.60  ? 45   GLU G CD    1 
ATOM   5496 O  OE1   . GLU G 4 45  ? -59.193 12.894  -19.819 1.00 98.21  ? 45   GLU G OE1   1 
ATOM   5497 O  OE2   . GLU G 4 45  ? -57.004 13.056  -19.546 1.00 95.15  ? 45   GLU G OE2   1 
ATOM   5498 N  N     . ASN G 4 46  ? -60.506 13.448  -14.357 1.00 76.12  ? 46   ASN G N     1 
ATOM   5499 C  CA    . ASN G 4 46  ? -60.483 14.616  -13.508 1.00 78.14  ? 46   ASN G CA    1 
ATOM   5500 C  C     . ASN G 4 46  ? -59.952 14.290  -12.122 1.00 71.97  ? 46   ASN G C     1 
ATOM   5501 O  O     . ASN G 4 46  ? -59.194 15.065  -11.547 1.00 71.37  ? 46   ASN G O     1 
ATOM   5502 C  CB    . ASN G 4 46  ? -61.892 15.220  -13.412 1.00 77.98  ? 46   ASN G CB    1 
ATOM   5503 C  CG    . ASN G 4 46  ? -61.900 16.560  -12.723 1.00 76.71  ? 46   ASN G CG    1 
ATOM   5504 O  OD1   . ASN G 4 46  ? -61.759 17.595  -13.370 1.00 81.98  ? 46   ASN G OD1   1 
ATOM   5505 N  ND2   . ASN G 4 46  ? -62.043 16.552  -11.396 1.00 75.54  ? 46   ASN G ND2   1 
ATOM   5506 N  N     . LEU G 4 47  ? -60.356 13.150  -11.575 1.00 61.86  ? 47   LEU G N     1 
ATOM   5507 C  CA    . LEU G 4 47  ? -59.977 12.837  -10.205 1.00 63.08  ? 47   LEU G CA    1 
ATOM   5508 C  C     . LEU G 4 47  ? -58.465 12.582  -10.156 1.00 61.77  ? 47   LEU G C     1 
ATOM   5509 O  O     . LEU G 4 47  ? -57.780 13.021  -9.232  1.00 62.55  ? 47   LEU G O     1 
ATOM   5510 C  CB    . LEU G 4 47  ? -60.782 11.639  -9.668  1.00 52.01  ? 47   LEU G CB    1 
ATOM   5511 C  CG    . LEU G 4 47  ? -60.464 11.173  -8.239  1.00 49.03  ? 47   LEU G CG    1 
ATOM   5512 C  CD1   . LEU G 4 47  ? -60.834 12.218  -7.198  1.00 52.70  ? 47   LEU G CD1   1 
ATOM   5513 C  CD2   . LEU G 4 47  ? -61.142 9.862   -7.925  1.00 52.57  ? 47   LEU G CD2   1 
ATOM   5514 N  N     . ILE G 4 48  ? -57.947 11.915  -11.183 1.00 56.63  ? 48   ILE G N     1 
ATOM   5515 C  CA    . ILE G 4 48  ? -56.537 11.575  -11.232 1.00 62.05  ? 48   ILE G CA    1 
ATOM   5516 C  C     . ILE G 4 48  ? -55.624 12.796  -11.428 1.00 61.62  ? 48   ILE G C     1 
ATOM   5517 O  O     . ILE G 4 48  ? -54.598 12.907  -10.768 1.00 57.46  ? 48   ILE G O     1 
ATOM   5518 C  CB    . ILE G 4 48  ? -56.261 10.530  -12.340 1.00 58.17  ? 48   ILE G CB    1 
ATOM   5519 C  CG1   . ILE G 4 48  ? -56.365 9.122   -11.759 1.00 50.69  ? 48   ILE G CG1   1 
ATOM   5520 C  CG2   . ILE G 4 48  ? -54.875 10.703  -12.921 1.00 56.08  ? 48   ILE G CG2   1 
ATOM   5521 C  CD1   . ILE G 4 48  ? -56.272 8.037   -12.797 1.00 51.85  ? 48   ILE G CD1   1 
ATOM   5522 N  N     . LYS G 4 49  ? -55.995 13.711  -12.321 1.00 68.96  ? 49   LYS G N     1 
ATOM   5523 C  CA    . LYS G 4 49  ? -55.136 14.853  -12.654 1.00 60.42  ? 49   LYS G CA    1 
ATOM   5524 C  C     . LYS G 4 49  ? -55.275 16.034  -11.702 1.00 59.75  ? 49   LYS G C     1 
ATOM   5525 O  O     . LYS G 4 49  ? -54.308 16.740  -11.453 1.00 67.22  ? 49   LYS G O     1 
ATOM   5526 C  CB    . LYS G 4 49  ? -55.431 15.334  -14.073 1.00 62.93  ? 49   LYS G CB    1 
ATOM   5527 C  CG    . LYS G 4 49  ? -55.066 14.335  -15.149 1.00 66.96  ? 49   LYS G CG    1 
ATOM   5528 C  CD    . LYS G 4 49  ? -55.483 14.817  -16.533 1.00 70.23  ? 49   LYS G CD    1 
ATOM   5529 C  CE    . LYS G 4 49  ? -54.800 13.996  -17.617 1.00 79.89  ? 49   LYS G CE    1 
ATOM   5530 N  NZ    . LYS G 4 49  ? -55.307 14.274  -18.987 1.00 74.03  ? 49   LYS G NZ    1 
ATOM   5531 N  N     . GLN G 4 50  ? -56.470 16.253  -11.170 1.00 62.28  ? 50   GLN G N     1 
ATOM   5532 C  CA    A GLN G 4 50  ? -56.698 17.437  -10.357 0.48 65.29  ? 50   GLN G CA    1 
ATOM   5533 C  CA    B GLN G 4 50  ? -56.761 17.431  -10.348 0.52 65.38  ? 50   GLN G CA    1 
ATOM   5534 C  C     . GLN G 4 50  ? -56.624 17.149  -8.854  1.00 64.64  ? 50   GLN G C     1 
ATOM   5535 O  O     . GLN G 4 50  ? -56.242 18.027  -8.076  1.00 62.53  ? 50   GLN G O     1 
ATOM   5536 C  CB    A GLN G 4 50  ? -58.049 18.069  -10.718 0.48 65.71  ? 50   GLN G CB    1 
ATOM   5537 C  CB    B GLN G 4 50  ? -58.182 17.964  -10.633 0.52 65.66  ? 50   GLN G CB    1 
ATOM   5538 C  CG    A GLN G 4 50  ? -58.237 18.339  -12.221 0.48 68.37  ? 50   GLN G CG    1 
ATOM   5539 C  CG    B GLN G 4 50  ? -58.303 18.931  -11.821 0.52 68.15  ? 50   GLN G CG    1 
ATOM   5540 C  CD    A GLN G 4 50  ? -57.239 19.349  -12.793 0.48 67.48  ? 50   GLN G CD    1 
ATOM   5541 C  CD    B GLN G 4 50  ? -59.713 19.502  -11.997 0.52 69.82  ? 50   GLN G CD    1 
ATOM   5542 O  OE1   A GLN G 4 50  ? -56.825 20.288  -12.112 0.48 67.44  ? 50   GLN G OE1   1 
ATOM   5543 O  OE1   B GLN G 4 50  ? -60.663 19.053  -11.360 0.52 67.10  ? 50   GLN G OE1   1 
ATOM   5544 N  NE2   A GLN G 4 50  ? -56.858 19.157  -14.053 0.48 62.93  ? 50   GLN G NE2   1 
ATOM   5545 N  NE2   B GLN G 4 50  ? -59.845 20.499  -12.866 0.52 70.78  ? 50   GLN G NE2   1 
ATOM   5546 N  N     . HIS G 4 51  ? -56.965 15.929  -8.447  1.00 62.86  ? 51   HIS G N     1 
ATOM   5547 C  CA    . HIS G 4 51  ? -56.910 15.574  -7.032  1.00 59.08  ? 51   HIS G CA    1 
ATOM   5548 C  C     . HIS G 4 51  ? -55.695 14.696  -6.685  1.00 65.85  ? 51   HIS G C     1 
ATOM   5549 O  O     . HIS G 4 51  ? -54.984 14.976  -5.717  1.00 64.59  ? 51   HIS G O     1 
ATOM   5550 C  CB    . HIS G 4 51  ? -58.190 14.864  -6.601  1.00 62.54  ? 51   HIS G CB    1 
ATOM   5551 C  CG    . HIS G 4 51  ? -58.167 14.402  -5.172  1.00 76.16  ? 51   HIS G CG    1 
ATOM   5552 N  ND1   . HIS G 4 51  ? -58.022 15.272  -4.110  1.00 77.30  ? 51   HIS G ND1   1 
ATOM   5553 C  CD2   . HIS G 4 51  ? -58.278 13.164  -4.630  1.00 73.69  ? 51   HIS G CD2   1 
ATOM   5554 C  CE1   . HIS G 4 51  ? -58.037 14.589  -2.979  1.00 74.14  ? 51   HIS G CE1   1 
ATOM   5555 N  NE2   . HIS G 4 51  ? -58.189 13.308  -3.265  1.00 68.68  ? 51   HIS G NE2   1 
ATOM   5556 N  N     . ILE G 4 52  ? -55.440 13.653  -7.474  1.00 57.58  ? 52   ILE G N     1 
ATOM   5557 C  CA    . ILE G 4 52  ? -54.441 12.660  -7.080  1.00 56.31  ? 52   ILE G CA    1 
ATOM   5558 C  C     . ILE G 4 52  ? -53.006 13.012  -7.506  1.00 52.35  ? 52   ILE G C     1 
ATOM   5559 O  O     . ILE G 4 52  ? -52.108 13.036  -6.667  1.00 50.91  ? 52   ILE G O     1 
ATOM   5560 C  CB    . ILE G 4 52  ? -54.827 11.265  -7.609  1.00 53.07  ? 52   ILE G CB    1 
ATOM   5561 C  CG1   . ILE G 4 52  ? -56.187 10.863  -7.037  1.00 51.42  ? 52   ILE G CG1   1 
ATOM   5562 C  CG2   . ILE G 4 52  ? -53.782 10.212  -7.218  1.00 46.91  ? 52   ILE G CG2   1 
ATOM   5563 C  CD1   . ILE G 4 52  ? -56.803 9.673   -7.725  1.00 55.81  ? 52   ILE G CD1   1 
ATOM   5564 N  N     . ALA G 4 53  ? -52.794 13.295  -8.784  1.00 47.78  ? 53   ALA G N     1 
ATOM   5565 C  CA    . ALA G 4 53  ? -51.473 13.676  -9.268  1.00 51.02  ? 53   ALA G CA    1 
ATOM   5566 C  C     . ALA G 4 53  ? -50.835 14.815  -8.459  1.00 52.40  ? 53   ALA G C     1 
ATOM   5567 O  O     . ALA G 4 53  ? -49.665 14.728  -8.128  1.00 49.81  ? 53   ALA G O     1 
ATOM   5568 C  CB    . ALA G 4 53  ? -51.527 14.049  -10.744 1.00 45.75  ? 53   ALA G CB    1 
ATOM   5569 N  N     . PRO G 4 54  ? -51.592 15.880  -8.128  1.00 62.98  ? 54   PRO G N     1 
ATOM   5570 C  CA    . PRO G 4 54  ? -50.899 16.922  -7.348  1.00 56.37  ? 54   PRO G CA    1 
ATOM   5571 C  C     . PRO G 4 54  ? -50.336 16.419  -6.029  1.00 53.84  ? 54   PRO G C     1 
ATOM   5572 O  O     . PRO G 4 54  ? -49.290 16.900  -5.606  1.00 59.24  ? 54   PRO G O     1 
ATOM   5573 C  CB    . PRO G 4 54  ? -52.002 17.967  -7.093  1.00 51.34  ? 54   PRO G CB    1 
ATOM   5574 C  CG    . PRO G 4 54  ? -52.947 17.780  -8.212  1.00 54.32  ? 54   PRO G CG    1 
ATOM   5575 C  CD    . PRO G 4 54  ? -52.954 16.304  -8.513  1.00 52.76  ? 54   PRO G CD    1 
ATOM   5576 N  N     . LEU G 4 55  ? -51.025 15.473  -5.396  1.00 49.85  ? 55   LEU G N     1 
ATOM   5577 C  CA    . LEU G 4 55  ? -50.619 14.950  -4.099  1.00 51.95  ? 55   LEU G CA    1 
ATOM   5578 C  C     . LEU G 4 55  ? -49.424 14.015  -4.242  1.00 53.76  ? 55   LEU G C     1 
ATOM   5579 O  O     . LEU G 4 55  ? -48.535 13.986  -3.387  1.00 47.80  ? 55   LEU G O     1 
ATOM   5580 C  CB    . LEU G 4 55  ? -51.782 14.220  -3.426  1.00 53.49  ? 55   LEU G CB    1 
ATOM   5581 C  CG    . LEU G 4 55  ? -52.893 15.048  -2.775  1.00 49.98  ? 55   LEU G CG    1 
ATOM   5582 C  CD1   . LEU G 4 55  ? -54.049 14.163  -2.419  1.00 47.47  ? 55   LEU G CD1   1 
ATOM   5583 C  CD2   . LEU G 4 55  ? -52.387 15.736  -1.532  1.00 45.47  ? 55   LEU G CD2   1 
ATOM   5584 N  N     . MET G 4 56  ? -49.424 13.249  -5.330  1.00 54.17  ? 56   MET G N     1 
ATOM   5585 C  CA    . MET G 4 56  ? -48.359 12.314  -5.623  1.00 49.52  ? 56   MET G CA    1 
ATOM   5586 C  C     . MET G 4 56  ? -47.105 13.094  -6.025  1.00 59.22  ? 56   MET G C     1 
ATOM   5587 O  O     . MET G 4 56  ? -45.968 12.654  -5.778  1.00 55.82  ? 56   MET G O     1 
ATOM   5588 C  CB    . MET G 4 56  ? -48.770 11.344  -6.735  1.00 52.48  ? 56   MET G CB    1 
ATOM   5589 C  CG    . MET G 4 56  ? -47.676 10.322  -7.097  1.00 55.13  ? 56   MET G CG    1 
ATOM   5590 S  SD    . MET G 4 56  ? -47.334 9.187   -5.733  1.00 52.68  ? 56   MET G SD    1 
ATOM   5591 C  CE    . MET G 4 56  ? -48.528 7.899   -6.077  1.00 44.85  ? 56   MET G CE    1 
ATOM   5592 N  N     . GLN G 4 57  ? -47.329 14.253  -6.645  1.00 51.82  ? 57   GLN G N     1 
ATOM   5593 C  CA    . GLN G 4 57  ? -46.252 15.158  -7.020  1.00 51.45  ? 57   GLN G CA    1 
ATOM   5594 C  C     . GLN G 4 57  ? -45.561 15.689  -5.774  1.00 53.68  ? 57   GLN G C     1 
ATOM   5595 O  O     . GLN G 4 57  ? -44.334 15.770  -5.723  1.00 52.43  ? 57   GLN G O     1 
ATOM   5596 C  CB    . GLN G 4 57  ? -46.774 16.324  -7.857  1.00 49.44  ? 57   GLN G CB    1 
ATOM   5597 C  CG    . GLN G 4 57  ? -45.675 17.191  -8.465  1.00 51.13  ? 57   GLN G CG    1 
ATOM   5598 C  CD    . GLN G 4 57  ? -44.674 16.366  -9.247  1.00 56.91  ? 57   GLN G CD    1 
ATOM   5599 O  OE1   . GLN G 4 57  ? -44.956 15.893  -10.354 1.00 60.08  ? 57   GLN G OE1   1 
ATOM   5600 N  NE2   . GLN G 4 57  ? -43.513 16.135  -8.645  1.00 52.48  ? 57   GLN G NE2   1 
ATOM   5601 N  N     . PHE G 4 58  ? -46.362 16.055  -4.779  1.00 52.70  ? 58   PHE G N     1 
ATOM   5602 C  CA    . PHE G 4 58  ? -45.835 16.548  -3.527  1.00 48.93  ? 58   PHE G CA    1 
ATOM   5603 C  C     . PHE G 4 58  ? -44.917 15.508  -2.905  1.00 52.90  ? 58   PHE G C     1 
ATOM   5604 O  O     . PHE G 4 58  ? -43.779 15.802  -2.541  1.00 55.94  ? 58   PHE G O     1 
ATOM   5605 C  CB    . PHE G 4 58  ? -46.963 16.894  -2.563  1.00 50.64  ? 58   PHE G CB    1 
ATOM   5606 C  CG    . PHE G 4 58  ? -46.489 17.163  -1.163  1.00 49.27  ? 58   PHE G CG    1 
ATOM   5607 C  CD1   . PHE G 4 58  ? -45.742 18.286  -0.877  1.00 54.06  ? 58   PHE G CD1   1 
ATOM   5608 C  CD2   . PHE G 4 58  ? -46.769 16.281  -0.140  1.00 54.40  ? 58   PHE G CD2   1 
ATOM   5609 C  CE1   . PHE G 4 58  ? -45.291 18.527  0.413   1.00 57.71  ? 58   PHE G CE1   1 
ATOM   5610 C  CE2   . PHE G 4 58  ? -46.324 16.522  1.154   1.00 59.66  ? 58   PHE G CE2   1 
ATOM   5611 C  CZ    . PHE G 4 58  ? -45.585 17.641  1.428   1.00 57.08  ? 58   PHE G CZ    1 
ATOM   5612 N  N     . LEU G 4 59  ? -45.418 14.286  -2.801  1.00 54.41  ? 59   LEU G N     1 
ATOM   5613 C  CA    . LEU G 4 59  ? -44.663 13.213  -2.196  1.00 54.62  ? 59   LEU G CA    1 
ATOM   5614 C  C     . LEU G 4 59  ? -43.353 12.958  -2.939  1.00 56.13  ? 59   LEU G C     1 
ATOM   5615 O  O     . LEU G 4 59  ? -42.321 12.699  -2.318  1.00 58.95  ? 59   LEU G O     1 
ATOM   5616 C  CB    . LEU G 4 59  ? -45.504 11.945  -2.156  1.00 52.48  ? 59   LEU G CB    1 
ATOM   5617 C  CG    . LEU G 4 59  ? -44.849 10.742  -1.491  1.00 51.34  ? 59   LEU G CG    1 
ATOM   5618 C  CD1   . LEU G 4 59  ? -44.417 11.090  -0.078  1.00 55.01  ? 59   LEU G CD1   1 
ATOM   5619 C  CD2   . LEU G 4 59  ? -45.824 9.583   -1.464  1.00 48.11  ? 59   LEU G CD2   1 
ATOM   5620 N  N     . ILE G 4 60  ? -43.401 13.045  -4.264  1.00 51.09  ? 60   ILE G N     1 
ATOM   5621 C  CA    . ILE G 4 60  ? -42.235 12.786  -5.114  1.00 49.86  ? 60   ILE G CA    1 
ATOM   5622 C  C     . ILE G 4 60  ? -41.171 13.876  -4.921  1.00 55.01  ? 60   ILE G C     1 
ATOM   5623 O  O     . ILE G 4 60  ? -39.968 13.589  -4.850  1.00 55.90  ? 60   ILE G O     1 
ATOM   5624 C  CB    . ILE G 4 60  ? -42.670 12.679  -6.615  1.00 56.43  ? 60   ILE G CB    1 
ATOM   5625 C  CG1   . ILE G 4 60  ? -43.319 11.322  -6.880  1.00 60.76  ? 60   ILE G CG1   1 
ATOM   5626 C  CG2   . ILE G 4 60  ? -41.529 12.837  -7.576  1.00 45.90  ? 60   ILE G CG2   1 
ATOM   5627 C  CD1   . ILE G 4 60  ? -43.796 11.163  -8.298  1.00 55.22  ? 60   ILE G CD1   1 
ATOM   5628 N  N     . ASP G 4 61  ? -41.625 15.125  -4.829  1.00 52.31  ? 61   ASP G N     1 
ATOM   5629 C  CA    . ASP G 4 61  ? -40.751 16.259  -4.554  1.00 50.96  ? 61   ASP G CA    1 
ATOM   5630 C  C     . ASP G 4 61  ? -40.108 16.098  -3.201  1.00 53.31  ? 61   ASP G C     1 
ATOM   5631 O  O     . ASP G 4 61  ? -38.945 16.406  -2.994  1.00 54.40  ? 61   ASP G O     1 
ATOM   5632 C  CB    . ASP G 4 61  ? -41.525 17.575  -4.584  1.00 43.21  ? 61   ASP G CB    1 
ATOM   5633 C  CG    . ASP G 4 61  ? -41.982 17.946  -5.974  1.00 46.48  ? 61   ASP G CG    1 
ATOM   5634 O  OD1   . ASP G 4 61  ? -41.457 17.362  -6.946  1.00 45.28  ? 61   ASP G OD1   1 
ATOM   5635 O  OD2   . ASP G 4 61  ? -42.856 18.834  -6.093  1.00 49.33  ? 61   ASP G OD2   1 
ATOM   5636 N  N     . GLU G 4 62  ? -40.897 15.612  -2.271  1.00 59.17  ? 62   GLU G N     1 
ATOM   5637 C  CA    . GLU G 4 62  ? -40.487 15.597  -0.896  1.00 57.12  ? 62   GLU G CA    1 
ATOM   5638 C  C     . GLU G 4 62  ? -39.494 14.468  -0.655  1.00 55.50  ? 62   GLU G C     1 
ATOM   5639 O  O     . GLU G 4 62  ? -38.621 14.586  0.182   1.00 56.29  ? 62   GLU G O     1 
ATOM   5640 C  CB    . GLU G 4 62  ? -41.731 15.491  -0.027  1.00 54.66  ? 62   GLU G CB    1 
ATOM   5641 C  CG    . GLU G 4 62  ? -41.500 15.402  1.439   1.00 65.71  ? 62   GLU G CG    1 
ATOM   5642 C  CD    . GLU G 4 62  ? -41.036 16.691  2.079   1.00 66.99  ? 62   GLU G CD    1 
ATOM   5643 O  OE1   . GLU G 4 62  ? -41.639 17.777  1.874   1.00 56.58  ? 62   GLU G OE1   1 
ATOM   5644 O  OE2   . GLU G 4 62  ? -40.060 16.581  2.834   1.00 66.82  ? 62   GLU G OE2   1 
ATOM   5645 N  N     . LEU G 4 63  ? -39.593 13.384  -1.413  1.00 53.57  ? 63   LEU G N     1 
ATOM   5646 C  CA    . LEU G 4 63  ? -38.658 12.265  -1.244  1.00 50.96  ? 63   LEU G CA    1 
ATOM   5647 C  C     . LEU G 4 63  ? -37.514 12.272  -2.263  1.00 50.06  ? 63   LEU G C     1 
ATOM   5648 O  O     . LEU G 4 63  ? -36.676 11.378  -2.258  1.00 49.97  ? 63   LEU G O     1 
ATOM   5649 C  CB    . LEU G 4 63  ? -39.393 10.920  -1.347  1.00 50.38  ? 63   LEU G CB    1 
ATOM   5650 C  CG    . LEU G 4 63  ? -40.594 10.531  -0.478  1.00 51.39  ? 63   LEU G CG    1 
ATOM   5651 C  CD1   . LEU G 4 63  ? -41.250 9.287   -1.065  1.00 50.57  ? 63   LEU G CD1   1 
ATOM   5652 C  CD2   . LEU G 4 63  ? -40.193 10.269  0.960   1.00 40.62  ? 63   LEU G CD2   1 
ATOM   5653 N  N     . ASN G 4 64  ? -37.499 13.268  -3.143  1.00 56.14  ? 64   ASN G N     1 
ATOM   5654 C  CA    . ASN G 4 64  ? -36.530 13.350  -4.233  1.00 53.93  ? 64   ASN G CA    1 
ATOM   5655 C  C     . ASN G 4 64  ? -36.543 12.151  -5.171  1.00 58.61  ? 64   ASN G C     1 
ATOM   5656 O  O     . ASN G 4 64  ? -35.485 11.634  -5.527  1.00 61.68  ? 64   ASN G O     1 
ATOM   5657 C  CB    . ASN G 4 64  ? -35.111 13.534  -3.694  1.00 61.72  ? 64   ASN G CB    1 
ATOM   5658 C  CG    . ASN G 4 64  ? -34.845 14.940  -3.242  1.00 64.18  ? 64   ASN G CG    1 
ATOM   5659 O  OD1   . ASN G 4 64  ? -34.746 15.855  -4.060  1.00 72.71  ? 64   ASN G OD1   1 
ATOM   5660 N  ND2   . ASN G 4 64  ? -34.722 15.128  -1.935  1.00 56.55  ? 64   ASN G ND2   1 
ATOM   5661 N  N     . VAL G 4 65  ? -37.735 11.722  -5.576  1.00 55.15  ? 65   VAL G N     1 
ATOM   5662 C  CA    . VAL G 4 65  ? -37.884 10.710  -6.614  1.00 52.91  ? 65   VAL G CA    1 
ATOM   5663 C  C     . VAL G 4 65  ? -37.729 11.409  -7.955  1.00 54.58  ? 65   VAL G C     1 
ATOM   5664 O  O     . VAL G 4 65  ? -38.470 12.344  -8.242  1.00 56.30  ? 65   VAL G O     1 
ATOM   5665 C  CB    . VAL G 4 65  ? -39.273 10.013  -6.519  1.00 53.22  ? 65   VAL G CB    1 
ATOM   5666 C  CG1   . VAL G 4 65  ? -39.608 9.249   -7.800  1.00 57.11  ? 65   VAL G CG1   1 
ATOM   5667 C  CG2   . VAL G 4 65  ? -39.354 9.121   -5.291  1.00 47.31  ? 65   VAL G CG2   1 
ATOM   5668 N  N     . LYS G 4 66  ? -36.787 10.993  -8.791  1.00 58.98  ? 66   LYS G N     1 
ATOM   5669 C  CA    A LYS G 4 66  ? -36.555 11.690  -10.062 0.54 63.64  ? 66   LYS G CA    1 
ATOM   5670 C  CA    B LYS G 4 66  ? -36.579 11.715  -10.044 0.46 63.63  ? 66   LYS G CA    1 
ATOM   5671 C  C     . LYS G 4 66  ? -37.501 11.204  -11.152 1.00 64.13  ? 66   LYS G C     1 
ATOM   5672 O  O     . LYS G 4 66  ? -37.532 11.762  -12.250 1.00 67.39  ? 66   LYS G O     1 
ATOM   5673 C  CB    A LYS G 4 66  ? -35.097 11.528  -10.530 0.54 67.18  ? 66   LYS G CB    1 
ATOM   5674 C  CB    B LYS G 4 66  ? -35.114 11.629  -10.481 0.46 67.12  ? 66   LYS G CB    1 
ATOM   5675 C  CG    A LYS G 4 66  ? -34.877 10.446  -11.607 0.54 69.61  ? 66   LYS G CG    1 
ATOM   5676 C  CG    B LYS G 4 66  ? -34.120 12.004  -9.388  0.46 64.44  ? 66   LYS G CG    1 
ATOM   5677 C  CD    A LYS G 4 66  ? -34.458 11.038  -12.960 0.54 68.40  ? 66   LYS G CD    1 
ATOM   5678 C  CD    B LYS G 4 66  ? -34.411 13.381  -8.830  0.46 61.68  ? 66   LYS G CD    1 
ATOM   5679 C  CE    A LYS G 4 66  ? -34.805 10.097  -14.114 0.54 64.94  ? 66   LYS G CE    1 
ATOM   5680 C  CE    B LYS G 4 66  ? -33.506 13.686  -7.656  0.46 63.77  ? 66   LYS G CE    1 
ATOM   5681 N  NZ    A LYS G 4 66  ? -34.363 8.694   -13.847 0.54 56.57  ? 66   LYS G NZ    1 
ATOM   5682 N  NZ    B LYS G 4 66  ? -33.814 15.006  -7.030  0.46 63.40  ? 66   LYS G NZ    1 
ATOM   5683 N  N     . SER G 4 67  ? -38.278 10.168  -10.857 1.00 67.73  ? 67   SER G N     1 
ATOM   5684 C  CA    . SER G 4 67  ? -39.175 9.595   -11.868 1.00 61.77  ? 67   SER G CA    1 
ATOM   5685 C  C     . SER G 4 67  ? -40.355 10.479  -12.234 1.00 60.67  ? 67   SER G C     1 
ATOM   5686 O  O     . SER G 4 67  ? -40.772 11.364  -11.483 1.00 59.38  ? 67   SER G O     1 
ATOM   5687 C  CB    . SER G 4 67  ? -39.706 8.245   -11.408 1.00 59.13  ? 67   SER G CB    1 
ATOM   5688 O  OG    . SER G 4 67  ? -38.637 7.395   -11.034 1.00 66.49  ? 67   SER G OG    1 
ATOM   5689 N  N     . LYS G 4 68  ? -40.886 10.211  -13.417 1.00 68.03  ? 68   LYS G N     1 
ATOM   5690 C  CA    . LYS G 4 68  ? -42.056 10.895  -13.931 1.00 63.37  ? 68   LYS G CA    1 
ATOM   5691 C  C     . LYS G 4 68  ? -43.351 10.399  -13.294 1.00 62.07  ? 68   LYS G C     1 
ATOM   5692 O  O     . LYS G 4 68  ? -43.476 9.219   -12.950 1.00 56.75  ? 68   LYS G O     1 
ATOM   5693 C  CB    . LYS G 4 68  ? -42.149 10.691  -15.436 1.00 62.04  ? 68   LYS G CB    1 
ATOM   5694 C  CG    . LYS G 4 68  ? -41.818 11.897  -16.262 1.00 74.16  ? 68   LYS G CG    1 
ATOM   5695 C  CD    . LYS G 4 68  ? -42.330 11.707  -17.695 1.00 80.02  ? 68   LYS G CD    1 
ATOM   5696 C  CE    . LYS G 4 68  ? -43.848 11.533  -17.719 1.00 73.61  ? 68   LYS G CE    1 
ATOM   5697 N  NZ    . LYS G 4 68  ? -44.441 11.697  -19.084 1.00 78.68  ? 68   LYS G NZ    1 
ATOM   5698 N  N     . ILE G 4 69  ? -44.317 11.302  -13.159 1.00 56.49  ? 69   ILE G N     1 
ATOM   5699 C  CA    . ILE G 4 69  ? -45.696 10.893  -12.954 1.00 48.62  ? 69   ILE G CA    1 
ATOM   5700 C  C     . ILE G 4 69  ? -46.304 10.640  -14.313 1.00 52.53  ? 69   ILE G C     1 
ATOM   5701 O  O     . ILE G 4 69  ? -46.577 11.584  -15.039 1.00 63.51  ? 69   ILE G O     1 
ATOM   5702 C  CB    . ILE G 4 69  ? -46.525 11.951  -12.214 1.00 46.44  ? 69   ILE G CB    1 
ATOM   5703 C  CG1   . ILE G 4 69  ? -45.915 12.233  -10.839 1.00 58.68  ? 69   ILE G CG1   1 
ATOM   5704 C  CG2   . ILE G 4 69  ? -47.943 11.475  -12.077 1.00 53.29  ? 69   ILE G CG2   1 
ATOM   5705 C  CD1   . ILE G 4 69  ? -46.787 13.033  -9.905  1.00 54.13  ? 69   ILE G CD1   1 
ATOM   5706 N  N     . GLN G 4 70  ? -46.484 9.374   -14.673 1.00 50.69  ? 70   GLN G N     1 
ATOM   5707 C  CA    . GLN G 4 70  ? -47.080 9.009   -15.961 1.00 50.52  ? 70   GLN G CA    1 
ATOM   5708 C  C     . GLN G 4 70  ? -48.599 8.894   -15.856 1.00 52.51  ? 70   GLN G C     1 
ATOM   5709 O  O     . GLN G 4 70  ? -49.108 8.345   -14.882 1.00 57.29  ? 70   GLN G O     1 
ATOM   5710 C  CB    . GLN G 4 70  ? -46.518 7.679   -16.474 1.00 46.45  ? 70   GLN G CB    1 
ATOM   5711 C  CG    . GLN G 4 70  ? -45.058 7.701   -16.883 1.00 50.26  ? 70   GLN G CG    1 
ATOM   5712 C  CD    . GLN G 4 70  ? -44.569 6.337   -17.350 1.00 55.93  ? 70   GLN G CD    1 
ATOM   5713 O  OE1   . GLN G 4 70  ? -44.916 5.882   -18.442 1.00 58.81  ? 70   GLN G OE1   1 
ATOM   5714 N  NE2   . GLN G 4 70  ? -43.777 5.666   -16.510 1.00 48.73  ? 70   GLN G NE2   1 
ATOM   5715 N  N     . ILE G 4 71  ? -49.328 9.394   -16.849 1.00 55.24  ? 71   ILE G N     1 
ATOM   5716 C  CA    . ILE G 4 71  ? -50.775 9.172   -16.870 1.00 54.22  ? 71   ILE G CA    1 
ATOM   5717 C  C     . ILE G 4 71  ? -51.218 8.487   -18.170 1.00 52.15  ? 71   ILE G C     1 
ATOM   5718 O  O     . ILE G 4 71  ? -51.387 9.136   -19.181 1.00 55.48  ? 71   ILE G O     1 
ATOM   5719 C  CB    . ILE G 4 71  ? -51.546 10.498  -16.671 1.00 53.95  ? 71   ILE G CB    1 
ATOM   5720 C  CG1   . ILE G 4 71  ? -51.137 11.156  -15.349 1.00 52.91  ? 71   ILE G CG1   1 
ATOM   5721 C  CG2   . ILE G 4 71  ? -53.057 10.265  -16.700 1.00 62.45  ? 71   ILE G CG2   1 
ATOM   5722 C  CD1   . ILE G 4 71  ? -51.971 12.351  -14.978 1.00 57.15  ? 71   ILE G CD1   1 
ATOM   5723 N  N     . VAL G 4 72  ? -51.387 7.170   -18.148 1.00 54.98  ? 72   VAL G N     1 
ATOM   5724 C  CA    . VAL G 4 72  ? -51.750 6.437   -19.362 1.00 56.31  ? 72   VAL G CA    1 
ATOM   5725 C  C     . VAL G 4 72  ? -53.266 6.294   -19.534 1.00 66.93  ? 72   VAL G C     1 
ATOM   5726 O  O     . VAL G 4 72  ? -53.938 5.795   -18.627 1.00 63.01  ? 72   VAL G O     1 
ATOM   5727 C  CB    . VAL G 4 72  ? -51.146 5.034   -19.359 1.00 57.68  ? 72   VAL G CB    1 
ATOM   5728 C  CG1   . VAL G 4 72  ? -51.678 4.229   -20.530 1.00 46.67  ? 72   VAL G CG1   1 
ATOM   5729 C  CG2   . VAL G 4 72  ? -49.623 5.115   -19.364 1.00 58.62  ? 72   VAL G CG2   1 
ATOM   5730 N  N     . LYS G 4 73  ? -53.815 6.732   -20.672 1.00 78.29  ? 73   LYS G N     1 
ATOM   5731 C  CA    . LYS G 4 73  ? -55.219 6.428   -20.958 1.00 76.48  ? 73   LYS G CA    1 
ATOM   5732 C  C     . LYS G 4 73  ? -55.278 5.003   -21.498 1.00 74.58  ? 73   LYS G C     1 
ATOM   5733 O  O     . LYS G 4 73  ? -54.648 4.657   -22.501 1.00 79.37  ? 73   LYS G O     1 
ATOM   5734 C  CB    . LYS G 4 73  ? -55.864 7.457   -21.915 1.00 81.13  ? 73   LYS G CB    1 
ATOM   5735 C  CG    . LYS G 4 73  ? -56.002 7.030   -23.380 1.00 90.45  ? 73   LYS G CG    1 
ATOM   5736 C  CD    . LYS G 4 73  ? -57.047 7.845   -24.158 1.00 98.24  ? 73   LYS G CD    1 
ATOM   5737 C  CE    . LYS G 4 73  ? -57.226 7.305   -25.583 1.00 98.32  ? 73   LYS G CE    1 
ATOM   5738 N  NZ    . LYS G 4 73  ? -57.600 5.866   -25.594 1.00 99.38  ? 73   LYS G NZ    1 
ATOM   5739 N  N     . GLY G 4 74  ? -55.977 4.152   -20.766 1.00 54.55  ? 74   GLY G N     1 
ATOM   5740 C  CA    . GLY G 4 74  ? -56.212 2.805   -21.227 1.00 54.35  ? 74   GLY G CA    1 
ATOM   5741 C  C     . GLY G 4 74  ? -57.634 2.768   -21.749 1.00 62.33  ? 74   GLY G C     1 
ATOM   5742 O  O     . GLY G 4 74  ? -58.341 3.783   -21.734 1.00 61.14  ? 74   GLY G O     1 
ATOM   5743 N  N     . ASP G 4 75  ? -58.072 1.602   -22.195 1.00 67.94  ? 75   ASP G N     1 
ATOM   5744 C  CA    . ASP G 4 75  ? -59.411 1.479   -22.759 1.00 79.60  ? 75   ASP G CA    1 
ATOM   5745 C  C     . ASP G 4 75  ? -60.527 1.821   -21.763 1.00 76.97  ? 75   ASP G C     1 
ATOM   5746 O  O     . ASP G 4 75  ? -61.444 2.580   -22.082 1.00 73.16  ? 75   ASP G O     1 
ATOM   5747 C  CB    . ASP G 4 75  ? -59.603 0.062   -23.312 1.00 84.32  ? 75   ASP G CB    1 
ATOM   5748 C  CG    . ASP G 4 75  ? -59.102 -1.012  -22.357 1.00 83.07  ? 75   ASP G CG    1 
ATOM   5749 O  OD1   . ASP G 4 75  ? -59.086 -0.761  -21.124 1.00 80.10  ? 75   ASP G OD1   1 
ATOM   5750 O  OD2   . ASP G 4 75  ? -58.696 -2.095  -22.844 1.00 78.24  ? 75   ASP G OD2   1 
ATOM   5751 N  N     . THR G 4 76  ? -60.441 1.281   -20.552 0.90 71.38  ? 76   THR G N     1 
ATOM   5752 C  CA    . THR G 4 76  ? -61.572 1.367   -19.641 0.90 62.43  ? 76   THR G CA    1 
ATOM   5753 C  C     . THR G 4 76  ? -61.291 2.240   -18.429 0.90 61.37  ? 76   THR G C     1 
ATOM   5754 O  O     . THR G 4 76  ? -62.113 2.336   -17.519 0.90 62.15  ? 76   THR G O     1 
ATOM   5755 C  CB    . THR G 4 76  ? -61.997 -0.034  -19.160 0.90 59.24  ? 76   THR G CB    1 
ATOM   5756 O  OG1   . THR G 4 76  ? -60.959 -0.602  -18.362 1.00 63.32  ? 76   THR G OG1   1 
ATOM   5757 C  CG2   . THR G 4 76  ? -62.256 -0.955  -20.343 1.00 64.53  ? 76   THR G CG2   1 
ATOM   5758 N  N     . ARG G 4 77  ? -60.145 2.905   -18.435 1.00 62.59  ? 77   ARG G N     1 
ATOM   5759 C  CA    . ARG G 4 77  ? -59.660 3.563   -17.232 1.00 61.19  ? 77   ARG G CA    1 
ATOM   5760 C  C     . ARG G 4 77  ? -58.415 4.406   -17.497 1.00 63.24  ? 77   ARG G C     1 
ATOM   5761 O  O     . ARG G 4 77  ? -57.634 4.137   -18.423 1.00 59.89  ? 77   ARG G O     1 
ATOM   5762 C  CB    . ARG G 4 77  ? -59.313 2.515   -16.182 1.00 61.89  ? 77   ARG G CB    1 
ATOM   5763 C  CG    . ARG G 4 77  ? -58.192 1.648   -16.721 1.00 64.36  ? 77   ARG G CG    1 
ATOM   5764 C  CD    . ARG G 4 77  ? -57.790 0.513   -15.847 1.00 58.67  ? 77   ARG G CD    1 
ATOM   5765 N  NE    . ARG G 4 77  ? -56.506 -0.105  -16.220 1.00 68.79  ? 77   ARG G NE    1 
ATOM   5766 C  CZ    . ARG G 4 77  ? -55.410 0.521   -16.675 1.00 66.16  ? 77   ARG G CZ    1 
ATOM   5767 N  NH1   . ARG G 4 77  ? -55.360 1.839   -16.858 1.00 61.83  ? 77   ARG G NH1   1 
ATOM   5768 N  NH2   . ARG G 4 77  ? -54.332 -0.202  -16.951 1.00 57.78  ? 77   ARG G NH2   1 
ATOM   5769 N  N     . TYR G 4 78  ? -58.217 5.405   -16.649 0.96 56.07  ? 78   TYR G N     1 
ATOM   5770 C  CA    . TYR G 4 78  ? -56.930 6.081   -16.571 0.96 60.74  ? 78   TYR G CA    1 
ATOM   5771 C  C     . TYR G 4 78  ? -55.974 5.427   -15.557 0.96 53.20  ? 78   TYR G C     1 
ATOM   5772 O  O     . TYR G 4 78  ? -56.393 4.914   -14.530 0.96 54.47  ? 78   TYR G O     1 
ATOM   5773 C  CB    . TYR G 4 78  ? -57.149 7.549   -16.222 0.96 61.85  ? 78   TYR G CB    1 
ATOM   5774 C  CG    . TYR G 4 78  ? -57.661 8.340   -17.388 0.96 69.21  ? 78   TYR G CG    1 
ATOM   5775 C  CD1   . TYR G 4 78  ? -56.779 8.859   -18.333 1.00 68.81  ? 78   TYR G CD1   1 
ATOM   5776 C  CD2   . TYR G 4 78  ? -59.022 8.555   -17.565 1.00 68.60  ? 78   TYR G CD2   1 
ATOM   5777 C  CE1   . TYR G 4 78  ? -57.236 9.577   -19.421 1.00 78.31  ? 78   TYR G CE1   1 
ATOM   5778 C  CE2   . TYR G 4 78  ? -59.492 9.274   -18.654 1.00 74.80  ? 78   TYR G CE2   1 
ATOM   5779 C  CZ    . TYR G 4 78  ? -58.589 9.789   -19.577 0.96 82.78  ? 78   TYR G CZ    1 
ATOM   5780 O  OH    . TYR G 4 78  ? -59.027 10.513  -20.662 0.96 81.60  ? 78   TYR G OH    1 
ATOM   5781 N  N     . GLU G 4 79  ? -54.681 5.453   -15.848 1.00 58.57  ? 79   GLU G N     1 
ATOM   5782 C  CA    . GLU G 4 79  ? -53.689 4.910   -14.923 1.00 52.66  ? 79   GLU G CA    1 
ATOM   5783 C  C     . GLU G 4 79  ? -52.656 5.973   -14.573 1.00 55.41  ? 79   GLU G C     1 
ATOM   5784 O  O     . GLU G 4 79  ? -51.899 6.412   -15.439 1.00 53.36  ? 79   GLU G O     1 
ATOM   5785 C  CB    . GLU G 4 79  ? -52.997 3.678   -15.518 1.00 49.77  ? 79   GLU G CB    1 
ATOM   5786 C  CG    . GLU G 4 79  ? -51.748 3.241   -14.734 1.00 58.02  ? 79   GLU G CG    1 
ATOM   5787 C  CD    . GLU G 4 79  ? -51.126 1.915   -15.206 1.00 59.33  ? 79   GLU G CD    1 
ATOM   5788 O  OE1   . GLU G 4 79  ? -51.470 1.416   -16.303 1.00 61.48  ? 79   GLU G OE1   1 
ATOM   5789 O  OE2   . GLU G 4 79  ? -50.305 1.353   -14.448 1.00 59.15  ? 79   GLU G OE2   1 
ATOM   5790 N  N     . LEU G 4 80  ? -52.648 6.415   -13.319 1.00 51.30  ? 80   LEU G N     1 
ATOM   5791 C  CA    . LEU G 4 80  ? -51.506 7.163   -12.810 1.00 51.86  ? 80   LEU G CA    1 
ATOM   5792 C  C     . LEU G 4 80  ? -50.380 6.165   -12.417 1.00 51.17  ? 80   LEU G C     1 
ATOM   5793 O  O     . LEU G 4 80  ? -50.575 5.239   -11.621 1.00 48.15  ? 80   LEU G O     1 
ATOM   5794 C  CB    . LEU G 4 80  ? -51.910 8.057   -11.629 1.00 49.59  ? 80   LEU G CB    1 
ATOM   5795 C  CG    . LEU G 4 80  ? -50.784 8.944   -11.062 1.00 56.06  ? 80   LEU G CG    1 
ATOM   5796 C  CD1   . LEU G 4 80  ? -51.302 10.278  -10.559 1.00 57.12  ? 80   LEU G CD1   1 
ATOM   5797 C  CD2   . LEU G 4 80  ? -50.024 8.241   -9.955  1.00 44.07  ? 80   LEU G CD2   1 
ATOM   5798 N  N     . ARG G 4 81  ? -49.204 6.373   -12.989 1.00 45.72  ? 81   ARG G N     1 
ATOM   5799 C  CA    . ARG G 4 81  ? -48.079 5.461   -12.829 1.00 49.49  ? 81   ARG G CA    1 
ATOM   5800 C  C     . ARG G 4 81  ? -46.784 6.195   -12.472 1.00 51.01  ? 81   ARG G C     1 
ATOM   5801 O  O     . ARG G 4 81  ? -46.378 7.136   -13.159 1.00 46.17  ? 81   ARG G O     1 
ATOM   5802 C  CB    . ARG G 4 81  ? -47.868 4.665   -14.117 1.00 47.39  ? 81   ARG G CB    1 
ATOM   5803 C  CG    . ARG G 4 81  ? -46.692 3.743   -14.066 1.00 43.07  ? 81   ARG G CG    1 
ATOM   5804 C  CD    . ARG G 4 81  ? -46.405 3.197   -15.426 1.00 48.14  ? 81   ARG G CD    1 
ATOM   5805 N  NE    . ARG G 4 81  ? -47.566 2.515   -15.973 1.00 56.31  ? 81   ARG G NE    1 
ATOM   5806 C  CZ    . ARG G 4 81  ? -47.605 1.915   -17.160 1.00 55.53  ? 81   ARG G CZ    1 
ATOM   5807 N  NH1   . ARG G 4 81  ? -46.547 1.929   -17.959 1.00 51.48  ? 81   ARG G NH1   1 
ATOM   5808 N  NH2   . ARG G 4 81  ? -48.714 1.307   -17.550 1.00 58.98  ? 81   ARG G NH2   1 
ATOM   5809 N  N     . VAL G 4 82  ? -46.127 5.779   -11.396 1.00 50.32  ? 82   VAL G N     1 
ATOM   5810 C  CA    . VAL G 4 82  ? -44.763 6.241   -11.177 1.00 48.70  ? 82   VAL G CA    1 
ATOM   5811 C  C     . VAL G 4 82  ? -43.831 5.070   -11.286 1.00 43.44  ? 82   VAL G C     1 
ATOM   5812 O  O     . VAL G 4 82  ? -43.968 4.099   -10.559 1.00 46.97  ? 82   VAL G O     1 
ATOM   5813 C  CB    . VAL G 4 82  ? -44.564 6.897   -9.832  1.00 46.28  ? 82   VAL G CB    1 
ATOM   5814 C  CG1   . VAL G 4 82  ? -43.170 7.456   -9.769  1.00 46.41  ? 82   VAL G CG1   1 
ATOM   5815 C  CG2   . VAL G 4 82  ? -45.604 7.989   -9.626  1.00 45.56  ? 82   VAL G CG2   1 
ATOM   5816 N  N     . SER G 4 83  ? -42.893 5.145   -12.216 1.00 47.10  ? 83   SER G N     1 
ATOM   5817 C  CA    . SER G 4 83  ? -41.948 4.055   -12.386 1.00 46.51  ? 83   SER G CA    1 
ATOM   5818 C  C     . SER G 4 83  ? -40.701 4.371   -11.576 1.00 48.68  ? 83   SER G C     1 
ATOM   5819 O  O     . SER G 4 83  ? -39.841 5.114   -12.036 1.00 52.96  ? 83   SER G O     1 
ATOM   5820 C  CB    . SER G 4 83  ? -41.617 3.864   -13.854 1.00 45.36  ? 83   SER G CB    1 
ATOM   5821 O  OG    . SER G 4 83  ? -41.007 2.615   -14.062 1.00 44.49  ? 83   SER G OG    1 
ATOM   5822 N  N     . SER G 4 84  ? -40.622 3.828   -10.362 1.00 44.19  ? 84   SER G N     1 
ATOM   5823 C  CA    . SER G 4 84  ? -39.578 4.203   -9.412  1.00 46.43  ? 84   SER G CA    1 
ATOM   5824 C  C     . SER G 4 84  ? -39.317 3.186   -8.322  1.00 49.80  ? 84   SER G C     1 
ATOM   5825 O  O     . SER G 4 84  ? -40.123 3.051   -7.401  1.00 50.25  ? 84   SER G O     1 
ATOM   5826 C  CB    . SER G 4 84  ? -39.923 5.511   -8.721  1.00 45.38  ? 84   SER G CB    1 
ATOM   5827 O  OG    . SER G 4 84  ? -39.096 5.669   -7.579  1.00 47.73  ? 84   SER G OG    1 
ATOM   5828 N  N     . LYS G 4 85  ? -38.169 2.522   -8.387  1.00 43.83  ? 85   LYS G N     1 
ATOM   5829 C  CA    . LYS G 4 85  ? -37.795 1.562   -7.356  1.00 45.11  ? 85   LYS G CA    1 
ATOM   5830 C  C     . LYS G 4 85  ? -37.881 2.175   -5.964  1.00 46.17  ? 85   LYS G C     1 
ATOM   5831 O  O     . LYS G 4 85  ? -38.257 1.504   -5.005  1.00 48.85  ? 85   LYS G O     1 
ATOM   5832 C  CB    . LYS G 4 85  ? -36.382 1.036   -7.604  1.00 51.09  ? 85   LYS G CB    1 
ATOM   5833 C  CG    . LYS G 4 85  ? -35.945 -0.047  -6.655  1.00 47.15  ? 85   LYS G CG    1 
ATOM   5834 C  CD    . LYS G 4 85  ? -34.470 -0.378  -6.833  1.00 47.04  ? 85   LYS G CD    1 
ATOM   5835 C  CE    . LYS G 4 85  ? -34.068 -1.634  -6.055  1.00 42.81  ? 85   LYS G CE    1 
ATOM   5836 N  NZ    . LYS G 4 85  ? -32.646 -2.001  -6.312  1.00 51.44  ? 85   LYS G NZ    1 
ATOM   5837 N  N     . LYS G 4 86  ? -37.541 3.451   -5.847  1.00 40.27  ? 86   LYS G N     1 
ATOM   5838 C  CA    . LYS G 4 86  ? -37.512 4.075   -4.537  1.00 43.90  ? 86   LYS G CA    1 
ATOM   5839 C  C     . LYS G 4 86  ? -38.923 4.344   -3.991  1.00 47.97  ? 86   LYS G C     1 
ATOM   5840 O  O     . LYS G 4 86  ? -39.171 4.194   -2.784  1.00 48.04  ? 86   LYS G O     1 
ATOM   5841 C  CB    . LYS G 4 86  ? -36.707 5.375   -4.584  1.00 46.10  ? 86   LYS G CB    1 
ATOM   5842 C  CG    . LYS G 4 86  ? -36.578 6.080   -3.241  1.00 45.17  ? 86   LYS G CG    1 
ATOM   5843 C  CD    . LYS G 4 86  ? -35.922 7.441   -3.408  1.00 52.11  ? 86   LYS G CD    1 
ATOM   5844 C  CE    . LYS G 4 86  ? -35.850 8.204   -2.080  1.00 57.56  ? 86   LYS G CE    1 
ATOM   5845 N  NZ    . LYS G 4 86  ? -35.107 9.488   -2.196  1.00 56.06  ? 86   LYS G NZ    1 
ATOM   5846 N  N     . LEU G 4 87  ? -39.841 4.758   -4.863  1.00 44.37  ? 87   LEU G N     1 
ATOM   5847 C  CA    . LEU G 4 87  ? -41.187 5.050   -4.407  1.00 42.90  ? 87   LEU G CA    1 
ATOM   5848 C  C     . LEU G 4 87  ? -41.874 3.712   -4.131  1.00 49.52  ? 87   LEU G C     1 
ATOM   5849 O  O     . LEU G 4 87  ? -42.633 3.575   -3.170  1.00 52.54  ? 87   LEU G O     1 
ATOM   5850 C  CB    . LEU G 4 87  ? -41.960 5.897   -5.428  1.00 41.59  ? 87   LEU G CB    1 
ATOM   5851 C  CG    . LEU G 4 87  ? -43.271 6.527   -4.917  1.00 51.76  ? 87   LEU G CG    1 
ATOM   5852 C  CD1   . LEU G 4 87  ? -43.029 7.593   -3.839  1.00 45.70  ? 87   LEU G CD1   1 
ATOM   5853 C  CD2   . LEU G 4 87  ? -44.129 7.098   -6.067  1.00 48.27  ? 87   LEU G CD2   1 
ATOM   5854 N  N     . TYR G 4 88  ? -41.575 2.710   -4.948  1.00 41.37  ? 88   TYR G N     1 
ATOM   5855 C  CA    . TYR G 4 88  ? -42.102 1.376   -4.719  1.00 34.74  ? 88   TYR G CA    1 
ATOM   5856 C  C     . TYR G 4 88  ? -41.746 0.852   -3.322  1.00 42.23  ? 88   TYR G C     1 
ATOM   5857 O  O     . TYR G 4 88  ? -42.618 0.416   -2.582  1.00 38.92  ? 88   TYR G O     1 
ATOM   5858 C  CB    . TYR G 4 88  ? -41.584 0.427   -5.785  1.00 41.48  ? 88   TYR G CB    1 
ATOM   5859 C  CG    . TYR G 4 88  ? -41.877 -1.021  -5.502  1.00 44.41  ? 88   TYR G CG    1 
ATOM   5860 C  CD1   . TYR G 4 88  ? -43.069 -1.602  -5.921  1.00 40.42  ? 88   TYR G CD1   1 
ATOM   5861 C  CD2   . TYR G 4 88  ? -40.953 -1.818  -4.820  1.00 42.37  ? 88   TYR G CD2   1 
ATOM   5862 C  CE1   . TYR G 4 88  ? -43.344 -2.928  -5.665  1.00 42.76  ? 88   TYR G CE1   1 
ATOM   5863 C  CE2   . TYR G 4 88  ? -41.220 -3.152  -4.553  1.00 42.23  ? 88   TYR G CE2   1 
ATOM   5864 C  CZ    . TYR G 4 88  ? -42.418 -3.698  -4.981  1.00 44.64  ? 88   TYR G CZ    1 
ATOM   5865 O  OH    . TYR G 4 88  ? -42.676 -5.016  -4.733  1.00 46.18  ? 88   TYR G OH    1 
ATOM   5866 N  N     . TYR G 4 89  ? -40.476 0.891   -2.937  0.96 42.69  ? 89   TYR G N     1 
ATOM   5867 C  CA    . TYR G 4 89  ? -40.138 0.365   -1.610  0.96 43.06  ? 89   TYR G CA    1 
ATOM   5868 C  C     . TYR G 4 89  ? -40.651 1.276   -0.497  0.96 42.88  ? 89   TYR G C     1 
ATOM   5869 O  O     . TYR G 4 89  ? -40.952 0.809   0.598   0.96 41.88  ? 89   TYR G O     1 
ATOM   5870 C  CB    . TYR G 4 89  ? -38.634 0.114   -1.468  0.96 41.17  ? 89   TYR G CB    1 
ATOM   5871 C  CG    . TYR G 4 89  ? -38.276 -1.235  -2.037  0.96 44.83  ? 89   TYR G CG    1 
ATOM   5872 C  CD1   . TYR G 4 89  ? -38.707 -2.396  -1.398  1.00 39.41  ? 89   TYR G CD1   1 
ATOM   5873 C  CD2   . TYR G 4 89  ? -37.578 -1.356  -3.249  1.00 39.76  ? 89   TYR G CD2   1 
ATOM   5874 C  CE1   . TYR G 4 89  ? -38.440 -3.628  -1.908  1.00 37.55  ? 89   TYR G CE1   1 
ATOM   5875 C  CE2   . TYR G 4 89  ? -37.304 -2.610  -3.774  1.00 39.42  ? 89   TYR G CE2   1 
ATOM   5876 C  CZ    . TYR G 4 89  ? -37.743 -3.742  -3.092  0.96 44.12  ? 89   TYR G CZ    1 
ATOM   5877 O  OH    . TYR G 4 89  ? -37.486 -5.008  -3.575  0.96 52.06  ? 89   TYR G OH    1 
ATOM   5878 N  N     . TYR G 4 90  ? -40.813 2.555   -0.787  1.00 35.21  ? 90   TYR G N     1 
ATOM   5879 C  CA    . TYR G 4 90  ? -41.424 3.443   0.185   1.00 36.02  ? 90   TYR G CA    1 
ATOM   5880 C  C     . TYR G 4 90  ? -42.824 2.954   0.577   1.00 42.39  ? 90   TYR G C     1 
ATOM   5881 O  O     . TYR G 4 90  ? -43.084 2.709   1.749   1.00 47.46  ? 90   TYR G O     1 
ATOM   5882 C  CB    . TYR G 4 90  ? -41.471 4.859   -0.368  1.00 43.12  ? 90   TYR G CB    1 
ATOM   5883 C  CG    . TYR G 4 90  ? -42.113 5.850   0.556   1.00 50.93  ? 90   TYR G CG    1 
ATOM   5884 C  CD1   . TYR G 4 90  ? -41.381 6.437   1.585   1.00 49.11  ? 90   TYR G CD1   1 
ATOM   5885 C  CD2   . TYR G 4 90  ? -43.446 6.223   0.396   1.00 38.45  ? 90   TYR G CD2   1 
ATOM   5886 C  CE1   . TYR G 4 90  ? -41.955 7.364   2.440   1.00 40.63  ? 90   TYR G CE1   1 
ATOM   5887 C  CE2   . TYR G 4 90  ? -44.026 7.148   1.245   1.00 43.80  ? 90   TYR G CE2   1 
ATOM   5888 C  CZ    . TYR G 4 90  ? -43.276 7.710   2.276   1.00 47.23  ? 90   TYR G CZ    1 
ATOM   5889 O  OH    . TYR G 4 90  ? -43.851 8.624   3.142   1.00 50.88  ? 90   TYR G OH    1 
ATOM   5890 N  N     . PHE G 4 91  ? -43.711 2.766   -0.396  1.00 44.63  ? 91   PHE G N     1 
ATOM   5891 C  CA    . PHE G 4 91  ? -45.079 2.324   -0.091  1.00 45.00  ? 91   PHE G CA    1 
ATOM   5892 C  C     . PHE G 4 91  ? -45.140 0.884   0.402   1.00 45.40  ? 91   PHE G C     1 
ATOM   5893 O  O     . PHE G 4 91  ? -45.869 0.586   1.362   1.00 46.94  ? 91   PHE G O     1 
ATOM   5894 C  CB    . PHE G 4 91  ? -45.998 2.486   -1.308  1.00 47.59  ? 91   PHE G CB    1 
ATOM   5895 C  CG    . PHE G 4 91  ? -46.364 3.918   -1.606  1.00 41.62  ? 91   PHE G CG    1 
ATOM   5896 C  CD1   . PHE G 4 91  ? -47.177 4.631   -0.742  1.00 40.52  ? 91   PHE G CD1   1 
ATOM   5897 C  CD2   . PHE G 4 91  ? -45.890 4.545   -2.746  1.00 40.32  ? 91   PHE G CD2   1 
ATOM   5898 C  CE1   . PHE G 4 91  ? -47.514 5.938   -1.005  1.00 43.03  ? 91   PHE G CE1   1 
ATOM   5899 C  CE2   . PHE G 4 91  ? -46.221 5.843   -3.021  1.00 41.96  ? 91   PHE G CE2   1 
ATOM   5900 C  CZ    . PHE G 4 91  ? -47.043 6.544   -2.146  1.00 46.47  ? 91   PHE G CZ    1 
ATOM   5901 N  N     . ALA G 4 92  ? -44.371 0.007   -0.242  1.00 36.53  ? 92   ALA G N     1 
ATOM   5902 C  CA    . ALA G 4 92  ? -44.300 -1.399  0.154   1.00 38.74  ? 92   ALA G CA    1 
ATOM   5903 C  C     . ALA G 4 92  ? -43.864 -1.539  1.609   1.00 44.09  ? 92   ALA G C     1 
ATOM   5904 O  O     . ALA G 4 92  ? -44.471 -2.287  2.368   1.00 48.13  ? 92   ALA G O     1 
ATOM   5905 C  CB    . ALA G 4 92  ? -43.354 -2.172  -0.759  1.00 35.91  ? 92   ALA G CB    1 
ATOM   5906 N  N     . ASN G 4 93  ? -42.819 -0.813  1.997   1.00 39.69  ? 93   ASN G N     1 
ATOM   5907 C  CA    . ASN G 4 93  ? -42.351 -0.833  3.380   1.00 45.46  ? 93   ASN G CA    1 
ATOM   5908 C  C     . ASN G 4 93  ? -43.380 -0.266  4.335   1.00 49.89  ? 93   ASN G C     1 
ATOM   5909 O  O     . ASN G 4 93  ? -43.540 -0.742  5.463   1.00 46.77  ? 93   ASN G O     1 
ATOM   5910 C  CB    . ASN G 4 93  ? -41.039 -0.057  3.521   1.00 38.60  ? 93   ASN G CB    1 
ATOM   5911 C  CG    . ASN G 4 93  ? -39.878 -0.785  2.895   1.00 39.79  ? 93   ASN G CG    1 
ATOM   5912 O  OD1   . ASN G 4 93  ? -39.949 -1.991  2.701   1.00 44.85  ? 93   ASN G OD1   1 
ATOM   5913 N  ND2   . ASN G 4 93  ? -38.800 -0.068  2.581   1.00 40.29  ? 93   ASN G ND2   1 
ATOM   5914 N  N     . MET G 4 94  ? -44.083 0.762   3.876   1.00 48.82  ? 94   MET G N     1 
ATOM   5915 C  CA    . MET G 4 94  ? -45.089 1.388   4.699   1.00 45.91  ? 94   MET G CA    1 
ATOM   5916 C  C     . MET G 4 94  ? -46.228 0.395   4.897   1.00 49.76  ? 94   MET G C     1 
ATOM   5917 O  O     . MET G 4 94  ? -46.788 0.286   5.981   1.00 50.77  ? 94   MET G O     1 
ATOM   5918 C  CB    . MET G 4 94  ? -45.561 2.682   4.055   1.00 45.04  ? 94   MET G CB    1 
ATOM   5919 C  CG    . MET G 4 94  ? -46.471 3.519   4.930   1.00 52.81  ? 94   MET G CG    1 
ATOM   5920 S  SD    . MET G 4 94  ? -47.064 4.999   4.108   1.00 50.30  ? 94   MET G SD    1 
ATOM   5921 C  CE    . MET G 4 94  ? -47.961 5.775   5.450   1.00 56.62  ? 94   MET G CE    1 
ATOM   5922 N  N     . LEU G 4 95  ? -46.538 -0.366  3.853   1.00 47.43  ? 95   LEU G N     1 
ATOM   5923 C  CA    . LEU G 4 95  ? -47.605 -1.355  3.937   1.00 51.33  ? 95   LEU G CA    1 
ATOM   5924 C  C     . LEU G 4 95  ? -47.252 -2.455  4.922   1.00 53.17  ? 95   LEU G C     1 
ATOM   5925 O  O     . LEU G 4 95  ? -48.117 -3.003  5.617   1.00 55.26  ? 95   LEU G O     1 
ATOM   5926 C  CB    . LEU G 4 95  ? -47.884 -1.956  2.560   1.00 50.71  ? 95   LEU G CB    1 
ATOM   5927 C  CG    . LEU G 4 95  ? -48.885 -3.107  2.418   1.00 49.00  ? 95   LEU G CG    1 
ATOM   5928 C  CD1   . LEU G 4 95  ? -50.222 -2.772  3.046   1.00 42.13  ? 95   LEU G CD1   1 
ATOM   5929 C  CD2   . LEU G 4 95  ? -49.057 -3.412  0.934   1.00 47.85  ? 95   LEU G CD2   1 
ATOM   5930 N  N     . GLU G 4 96  ? -45.967 -2.784  4.964   1.00 57.50  ? 96   GLU G N     1 
ATOM   5931 C  CA    . GLU G 4 96  ? -45.477 -3.879  5.785   1.00 57.77  ? 96   GLU G CA    1 
ATOM   5932 C  C     . GLU G 4 96  ? -45.583 -3.486  7.259   1.00 57.30  ? 96   GLU G C     1 
ATOM   5933 O  O     . GLU G 4 96  ? -45.735 -4.329  8.134   1.00 56.54  ? 96   GLU G O     1 
ATOM   5934 C  CB    . GLU G 4 96  ? -44.037 -4.216  5.384   1.00 57.12  ? 96   GLU G CB    1 
ATOM   5935 C  CG    . GLU G 4 96  ? -43.451 -5.450  6.024   1.00 63.05  ? 96   GLU G CG    1 
ATOM   5936 C  CD    . GLU G 4 96  ? -42.056 -5.744  5.504   1.00 96.43  ? 96   GLU G CD    1 
ATOM   5937 O  OE1   . GLU G 4 96  ? -41.485 -4.865  4.808   1.00 93.65  ? 96   GLU G OE1   1 
ATOM   5938 O  OE2   . GLU G 4 96  ? -41.533 -6.850  5.786   1.00 106.19 ? 96   GLU G OE2   1 
ATOM   5939 N  N     . ARG G 4 97  ? -45.529 -2.189  7.521   1.00 58.08  ? 97   ARG G N     1 
ATOM   5940 C  CA    . ARG G 4 97  ? -45.622 -1.680  8.877   1.00 57.85  ? 97   ARG G CA    1 
ATOM   5941 C  C     . ARG G 4 97  ? -47.010 -1.111  9.185   1.00 55.22  ? 97   ARG G C     1 
ATOM   5942 O  O     . ARG G 4 97  ? -47.153 -0.274  10.072  1.00 59.99  ? 97   ARG G O     1 
ATOM   5943 C  CB    . ARG G 4 97  ? -44.581 -0.581  9.101   1.00 58.44  ? 97   ARG G CB    1 
ATOM   5944 C  CG    . ARG G 4 97  ? -43.183 -0.896  8.618   1.00 63.37  ? 97   ARG G CG    1 
ATOM   5945 C  CD    . ARG G 4 97  ? -42.185 0.112   9.196   1.00 63.79  ? 97   ARG G CD    1 
ATOM   5946 N  NE    . ARG G 4 97  ? -42.041 -0.051  10.641  1.00 73.34  ? 97   ARG G NE    1 
ATOM   5947 C  CZ    . ARG G 4 97  ? -41.836 0.958   11.482  1.00 83.84  ? 97   ARG G CZ    1 
ATOM   5948 N  NH1   . ARG G 4 97  ? -41.760 2.202   11.020  1.00 96.15  ? 97   ARG G NH1   1 
ATOM   5949 N  NH2   . ARG G 4 97  ? -41.729 0.734   12.786  1.00 78.13  ? 97   ARG G NH2   1 
ATOM   5950 N  N     . ILE G 4 98  ? -48.028 -1.530  8.452   1.00 47.85  ? 98   ILE G N     1 
ATOM   5951 C  CA    . ILE G 4 98  ? -49.310 -0.844  8.536   1.00 47.83  ? 98   ILE G CA    1 
ATOM   5952 C  C     . ILE G 4 98  ? -49.961 -0.958  9.910   1.00 51.45  ? 98   ILE G C     1 
ATOM   5953 O  O     . ILE G 4 98  ? -50.651 -0.043  10.337  1.00 54.82  ? 98   ILE G O     1 
ATOM   5954 C  CB    . ILE G 4 98  ? -50.281 -1.363  7.473   1.00 49.93  ? 98   ILE G CB    1 
ATOM   5955 C  CG1   . ILE G 4 98  ? -51.466 -0.404  7.315   1.00 50.79  ? 98   ILE G CG1   1 
ATOM   5956 C  CG2   . ILE G 4 98  ? -50.723 -2.796  7.777   1.00 40.50  ? 98   ILE G CG2   1 
ATOM   5957 C  CD1   . ILE G 4 98  ? -52.524 -0.915  6.344   1.00 44.31  ? 98   ILE G CD1   1 
ATOM   5958 N  N     . ARG G 4 99  ? -49.719 -2.055  10.623  1.00 60.45  ? 99   ARG G N     1 
ATOM   5959 C  CA    . ARG G 4 99  ? -50.334 -2.263  11.940  1.00 58.15  ? 99   ARG G CA    1 
ATOM   5960 C  C     . ARG G 4 99  ? -49.857 -1.211  12.935  1.00 57.16  ? 99   ARG G C     1 
ATOM   5961 O  O     . ARG G 4 99  ? -50.458 -1.033  13.995  1.00 62.83  ? 99   ARG G O     1 
ATOM   5962 C  CB    . ARG G 4 99  ? -50.026 -3.668  12.484  1.00 55.35  ? 99   ARG G CB    1 
ATOM   5963 C  CG    . ARG G 4 99  ? -50.678 -4.796  11.692  1.00 63.57  ? 99   ARG G CG    1 
ATOM   5964 C  CD    . ARG G 4 99  ? -50.110 -6.192  12.028  1.00 63.61  ? 99   ARG G CD    1 
ATOM   5965 N  NE    . ARG G 4 99  ? -50.866 -7.240  11.333  1.00 71.20  ? 99   ARG G NE    1 
ATOM   5966 C  CZ    . ARG G 4 99  ? -50.593 -7.686  10.110  1.00 75.40  ? 99   ARG G CZ    1 
ATOM   5967 N  NH1   . ARG G 4 99  ? -49.555 -7.204  9.441   1.00 72.13  ? 99   ARG G NH1   1 
ATOM   5968 N  NH2   . ARG G 4 99  ? -51.349 -8.627  9.560   1.00 79.42  ? 99   ARG G NH2   1 
ATOM   5969 N  N     . LEU G 4 100 ? -48.785 -0.513  12.570  1.00 50.90  ? 100  LEU G N     1 
ATOM   5970 C  CA    . LEU G 4 100 ? -48.155 0.481   13.427  1.00 47.25  ? 100  LEU G CA    1 
ATOM   5971 C  C     . LEU G 4 100 ? -48.607 1.910   13.109  1.00 51.65  ? 100  LEU G C     1 
ATOM   5972 O  O     . LEU G 4 100 ? -48.175 2.852   13.761  1.00 46.64  ? 100  LEU G O     1 
ATOM   5973 C  CB    . LEU G 4 100 ? -46.640 0.384   13.298  1.00 49.56  ? 100  LEU G CB    1 
ATOM   5974 C  CG    . LEU G 4 100 ? -45.826 -0.732  13.968  1.00 54.10  ? 100  LEU G CG    1 
ATOM   5975 C  CD1   . LEU G 4 100 ? -46.430 -2.104  13.825  1.00 54.82  ? 100  LEU G CD1   1 
ATOM   5976 C  CD2   . LEU G 4 100 ? -44.474 -0.742  13.300  1.00 55.41  ? 100  LEU G CD2   1 
ATOM   5977 N  N     . PHE G 4 101 ? -49.469 2.075   12.108  1.00 54.53  ? 101  PHE G N     1 
ATOM   5978 C  CA    . PHE G 4 101 ? -49.995 3.403   11.787  1.00 56.84  ? 101  PHE G CA    1 
ATOM   5979 C  C     . PHE G 4 101 ? -50.478 4.156   13.028  1.00 60.72  ? 101  PHE G C     1 
ATOM   5980 O  O     . PHE G 4 101 ? -51.072 3.573   13.933  1.00 62.28  ? 101  PHE G O     1 
ATOM   5981 C  CB    . PHE G 4 101 ? -51.153 3.321   10.791  1.00 54.99  ? 101  PHE G CB    1 
ATOM   5982 C  CG    . PHE G 4 101 ? -50.728 3.225   9.365   1.00 55.82  ? 101  PHE G CG    1 
ATOM   5983 C  CD1   . PHE G 4 101 ? -49.451 2.800   9.034   1.00 59.58  ? 101  PHE G CD1   1 
ATOM   5984 C  CD2   . PHE G 4 101 ? -51.610 3.559   8.347   1.00 54.36  ? 101  PHE G CD2   1 
ATOM   5985 C  CE1   . PHE G 4 101 ? -49.054 2.706   7.715   1.00 51.95  ? 101  PHE G CE1   1 
ATOM   5986 C  CE2   . PHE G 4 101 ? -51.228 3.471   7.022   1.00 55.30  ? 101  PHE G CE2   1 
ATOM   5987 C  CZ    . PHE G 4 101 ? -49.943 3.043   6.706   1.00 63.07  ? 101  PHE G CZ    1 
ATOM   5988 N  N     . ASN G 4 102 ? -50.212 5.454   13.071  1.00 64.22  ? 102  ASN G N     1 
ATOM   5989 C  CA    . ASN G 4 102 ? -50.760 6.283   14.128  1.00 61.10  ? 102  ASN G CA    1 
ATOM   5990 C  C     . ASN G 4 102 ? -52.154 6.754   13.733  1.00 59.33  ? 102  ASN G C     1 
ATOM   5991 O  O     . ASN G 4 102 ? -52.636 6.462   12.636  1.00 59.53  ? 102  ASN G O     1 
ATOM   5992 C  CB    . ASN G 4 102 ? -49.828 7.468   14.446  1.00 54.40  ? 102  ASN G CB    1 
ATOM   5993 C  CG    . ASN G 4 102 ? -49.659 8.442   13.277  1.00 59.85  ? 102  ASN G CG    1 
ATOM   5994 O  OD1   . ASN G 4 102 ? -50.437 8.444   12.318  1.00 63.44  ? 102  ASN G OD1   1 
ATOM   5995 N  ND2   . ASN G 4 102 ? -48.643 9.296   13.372  1.00 51.45  ? 102  ASN G ND2   1 
ATOM   5996 N  N     . MET G 4 103 ? -52.785 7.505   14.621  1.00 57.80  ? 103  MET G N     1 
ATOM   5997 C  CA    . MET G 4 103 ? -54.159 7.887   14.424  1.00 52.91  ? 103  MET G CA    1 
ATOM   5998 C  C     . MET G 4 103 ? -54.329 8.755   13.179  1.00 59.20  ? 103  MET G C     1 
ATOM   5999 O  O     . MET G 4 103 ? -55.316 8.607   12.459  1.00 62.30  ? 103  MET G O     1 
ATOM   6000 C  CB    . MET G 4 103 ? -54.683 8.595   15.665  1.00 54.17  ? 103  MET G CB    1 
ATOM   6001 C  CG    . MET G 4 103 ? -56.150 8.953   15.597  1.00 66.86  ? 103  MET G CG    1 
ATOM   6002 S  SD    . MET G 4 103 ? -56.790 9.617   17.150  1.00 84.35  ? 103  MET G SD    1 
ATOM   6003 C  CE    . MET G 4 103 ? -58.365 10.269  16.601  1.00 67.80  ? 103  MET G CE    1 
ATOM   6004 N  N     . ARG G 4 104 ? -53.378 9.640   12.894  1.00 69.80  ? 104  ARG G N     1 
ATOM   6005 C  CA    . ARG G 4 104 ? -53.505 10.476  11.696  1.00 71.15  ? 104  ARG G CA    1 
ATOM   6006 C  C     . ARG G 4 104 ? -53.493 9.600   10.444  1.00 73.93  ? 104  ARG G C     1 
ATOM   6007 O  O     . ARG G 4 104 ? -54.290 9.789   9.512   1.00 72.43  ? 104  ARG G O     1 
ATOM   6008 C  CB    . ARG G 4 104 ? -52.385 11.513  11.609  1.00 75.06  ? 104  ARG G CB    1 
ATOM   6009 C  CG    . ARG G 4 104 ? -52.316 12.227  10.247  1.00 74.72  ? 104  ARG G CG    1 
ATOM   6010 C  CD    . ARG G 4 104 ? -51.364 13.425  10.267  1.00 84.35  ? 104  ARG G CD    1 
ATOM   6011 N  NE    . ARG G 4 104 ? -51.910 14.562  11.007  1.00 90.36  ? 104  ARG G NE    1 
ATOM   6012 C  CZ    . ARG G 4 104 ? -51.476 14.967  12.201  1.00 93.70  ? 104  ARG G CZ    1 
ATOM   6013 N  NH1   . ARG G 4 104 ? -50.475 14.335  12.809  1.00 82.88  ? 104  ARG G NH1   1 
ATOM   6014 N  NH2   . ARG G 4 104 ? -52.049 16.011  12.791  1.00 94.24  ? 104  ARG G NH2   1 
ATOM   6015 N  N     . GLU G 4 105 ? -52.589 8.625   10.450  1.00 68.31  ? 105  GLU G N     1 
ATOM   6016 C  CA    . GLU G 4 105 ? -52.394 7.741   9.312   1.00 62.89  ? 105  GLU G CA    1 
ATOM   6017 C  C     . GLU G 4 105 ? -53.556 6.784   9.127   1.00 62.39  ? 105  GLU G C     1 
ATOM   6018 O  O     . GLU G 4 105 ? -53.917 6.454   7.999   1.00 59.75  ? 105  GLU G O     1 
ATOM   6019 C  CB    . GLU G 4 105 ? -51.103 6.944   9.479   1.00 66.05  ? 105  GLU G CB    1 
ATOM   6020 C  CG    . GLU G 4 105 ? -49.841 7.746   9.321   1.00 56.63  ? 105  GLU G CG    1 
ATOM   6021 C  CD    . GLU G 4 105 ? -48.667 7.003   9.891   1.00 67.86  ? 105  GLU G CD    1 
ATOM   6022 O  OE1   . GLU G 4 105 ? -48.890 6.205   10.824  1.00 66.02  ? 105  GLU G OE1   1 
ATOM   6023 O  OE2   . GLU G 4 105 ? -47.530 7.194   9.406   1.00 81.75  ? 105  GLU G OE2   1 
ATOM   6024 N  N     . GLN G 4 106 ? -54.125 6.320   10.236  1.00 56.61  ? 106  GLN G N     1 
ATOM   6025 C  CA    . GLN G 4 106 ? -55.268 5.431   10.160  1.00 52.48  ? 106  GLN G CA    1 
ATOM   6026 C  C     . GLN G 4 106 ? -56.400 6.128   9.452   1.00 52.55  ? 106  GLN G C     1 
ATOM   6027 O  O     . GLN G 4 106 ? -57.025 5.580   8.541   1.00 46.05  ? 106  GLN G O     1 
ATOM   6028 C  CB    . GLN G 4 106 ? -55.700 4.993   11.544  1.00 51.44  ? 106  GLN G CB    1 
ATOM   6029 C  CG    . GLN G 4 106 ? -54.706 4.080   12.206  1.00 58.65  ? 106  GLN G CG    1 
ATOM   6030 C  CD    . GLN G 4 106 ? -54.980 3.937   13.677  1.00 58.67  ? 106  GLN G CD    1 
ATOM   6031 O  OE1   . GLN G 4 106 ? -56.033 4.351   14.154  1.00 58.34  ? 106  GLN G OE1   1 
ATOM   6032 N  NE2   . GLN G 4 106 ? -54.029 3.373   14.412  1.00 58.63  ? 106  GLN G NE2   1 
ATOM   6033 N  N     . ILE G 4 107 ? -56.651 7.360   9.862   1.00 56.00  ? 107  ILE G N     1 
ATOM   6034 C  CA    . ILE G 4 107 ? -57.763 8.090   9.293   1.00 56.82  ? 107  ILE G CA    1 
ATOM   6035 C  C     . ILE G 4 107 ? -57.527 8.308   7.812   1.00 55.79  ? 107  ILE G C     1 
ATOM   6036 O  O     . ILE G 4 107 ? -58.409 8.028   6.988   1.00 51.45  ? 107  ILE G O     1 
ATOM   6037 C  CB    . ILE G 4 107 ? -57.992 9.420   10.033  1.00 58.19  ? 107  ILE G CB    1 
ATOM   6038 C  CG1   . ILE G 4 107 ? -58.396 9.122   11.486  1.00 57.25  ? 107  ILE G CG1   1 
ATOM   6039 C  CG2   . ILE G 4 107 ? -59.038 10.265  9.316   1.00 68.05  ? 107  ILE G CG2   1 
ATOM   6040 C  CD1   . ILE G 4 107 ? -58.427 10.313  12.398  1.00 53.77  ? 107  ILE G CD1   1 
ATOM   6041 N  N     . ALA G 4 108 ? -56.327 8.758   7.462   1.00 54.77  ? 108  ALA G N     1 
ATOM   6042 C  CA    . ALA G 4 108 ? -56.056 9.066   6.066   1.00 51.46  ? 108  ALA G CA    1 
ATOM   6043 C  C     . ALA G 4 108 ? -56.158 7.798   5.224   1.00 50.00  ? 108  ALA G C     1 
ATOM   6044 O  O     . ALA G 4 108 ? -56.800 7.809   4.183   1.00 49.42  ? 108  ALA G O     1 
ATOM   6045 C  CB    . ALA G 4 108 ? -54.715 9.713   5.915   1.00 47.59  ? 108  ALA G CB    1 
ATOM   6046 N  N     . PHE G 4 109 ? -55.565 6.704   5.697   1.00 50.40  ? 109  PHE G N     1 
ATOM   6047 C  CA    . PHE G 4 109 ? -55.619 5.425   4.992   1.00 45.63  ? 109  PHE G CA    1 
ATOM   6048 C  C     . PHE G 4 109 ? -57.052 5.006   4.719   1.00 48.11  ? 109  PHE G C     1 
ATOM   6049 O  O     . PHE G 4 109 ? -57.409 4.713   3.578   1.00 54.32  ? 109  PHE G O     1 
ATOM   6050 C  CB    . PHE G 4 109 ? -54.899 4.318   5.785   1.00 49.56  ? 109  PHE G CB    1 
ATOM   6051 C  CG    . PHE G 4 109 ? -54.851 3.001   5.071   1.00 45.37  ? 109  PHE G CG    1 
ATOM   6052 C  CD1   . PHE G 4 109 ? -53.991 2.806   4.000   1.00 43.13  ? 109  PHE G CD1   1 
ATOM   6053 C  CD2   . PHE G 4 109 ? -55.694 1.969   5.442   1.00 46.15  ? 109  PHE G CD2   1 
ATOM   6054 C  CE1   . PHE G 4 109 ? -53.955 1.592   3.319   1.00 42.91  ? 109  PHE G CE1   1 
ATOM   6055 C  CE2   . PHE G 4 109 ? -55.679 0.746   4.755   1.00 46.24  ? 109  PHE G CE2   1 
ATOM   6056 C  CZ    . PHE G 4 109 ? -54.802 0.558   3.699   1.00 43.49  ? 109  PHE G CZ    1 
ATOM   6057 N  N     . ILE G 4 110 ? -57.872 4.974   5.765   1.00 51.61  ? 110  ILE G N     1 
ATOM   6058 C  CA    . ILE G 4 110 ? -59.278 4.603   5.642   1.00 46.85  ? 110  ILE G CA    1 
ATOM   6059 C  C     . ILE G 4 110 ? -60.044 5.540   4.702   1.00 44.93  ? 110  ILE G C     1 
ATOM   6060 O  O     . ILE G 4 110 ? -60.897 5.113   3.934   1.00 48.32  ? 110  ILE G O     1 
ATOM   6061 C  CB    . ILE G 4 110 ? -59.943 4.590   7.019   1.00 48.08  ? 110  ILE G CB    1 
ATOM   6062 C  CG1   . ILE G 4 110 ? -59.325 3.491   7.872   1.00 44.75  ? 110  ILE G CG1   1 
ATOM   6063 C  CG2   . ILE G 4 110 ? -61.432 4.332   6.899   1.00 50.34  ? 110  ILE G CG2   1 
ATOM   6064 C  CD1   . ILE G 4 110 ? -59.774 3.534   9.309   1.00 49.16  ? 110  ILE G CD1   1 
ATOM   6065 N  N     . LYS G 4 111 ? -59.736 6.821   4.753   1.00 44.45  ? 111  LYS G N     1 
ATOM   6066 C  CA    . LYS G 4 111 ? -60.336 7.746   3.814   1.00 44.04  ? 111  LYS G CA    1 
ATOM   6067 C  C     . LYS G 4 111 ? -59.952 7.380   2.375   1.00 48.25  ? 111  LYS G C     1 
ATOM   6068 O  O     . LYS G 4 111 ? -60.807 7.337   1.480   1.00 46.19  ? 111  LYS G O     1 
ATOM   6069 C  CB    . LYS G 4 111 ? -59.910 9.167   4.146   1.00 49.28  ? 111  LYS G CB    1 
ATOM   6070 C  CG    . LYS G 4 111 ? -60.517 10.230  3.270   1.00 58.48  ? 111  LYS G CG    1 
ATOM   6071 C  CD    . LYS G 4 111 ? -60.133 11.603  3.819   1.00 75.73  ? 111  LYS G CD    1 
ATOM   6072 C  CE    . LYS G 4 111 ? -60.815 12.739  3.079   1.00 89.04  ? 111  LYS G CE    1 
ATOM   6073 N  NZ    . LYS G 4 111 ? -60.405 14.065  3.628   1.00 99.29  ? 111  LYS G NZ    1 
ATOM   6074 N  N     . GLY G 4 112 ? -58.663 7.103   2.160   1.00 51.09  ? 112  GLY G N     1 
ATOM   6075 C  CA    . GLY G 4 112 ? -58.155 6.740   0.846   1.00 43.36  ? 112  GLY G CA    1 
ATOM   6076 C  C     . GLY G 4 112 ? -58.780 5.446   0.364   1.00 49.28  ? 112  GLY G C     1 
ATOM   6077 O  O     . GLY G 4 112 ? -59.229 5.335   -0.791  1.00 51.53  ? 112  GLY G O     1 
ATOM   6078 N  N     . LEU G 4 113 ? -58.810 4.461   1.259   1.00 43.12  ? 113  LEU G N     1 
ATOM   6079 C  CA    . LEU G 4 113 ? -59.421 3.177   0.953   1.00 41.35  ? 113  LEU G CA    1 
ATOM   6080 C  C     . LEU G 4 113 ? -60.921 3.352   0.669   1.00 44.66  ? 113  LEU G C     1 
ATOM   6081 O  O     . LEU G 4 113 ? -61.463 2.674   -0.208  1.00 47.14  ? 113  LEU G O     1 
ATOM   6082 C  CB    . LEU G 4 113 ? -59.185 2.184   2.096   1.00 36.53  ? 113  LEU G CB    1 
ATOM   6083 C  CG    . LEU G 4 113 ? -59.633 0.746   1.810   1.00 36.66  ? 113  LEU G CG    1 
ATOM   6084 C  CD1   . LEU G 4 113 ? -58.840 0.160   0.690   1.00 42.86  ? 113  LEU G CD1   1 
ATOM   6085 C  CD2   . LEU G 4 113 ? -59.569 -0.162  3.031   1.00 30.77  ? 113  LEU G CD2   1 
ATOM   6086 N  N     . TYR G 4 114 ? -61.593 4.263   1.376   1.00 41.22  ? 114  TYR G N     1 
ATOM   6087 C  CA    . TYR G 4 114 ? -63.024 4.446   1.123   1.00 46.52  ? 114  TYR G CA    1 
ATOM   6088 C  C     . TYR G 4 114 ? -63.251 5.155   -0.194  1.00 43.22  ? 114  TYR G C     1 
ATOM   6089 O  O     . TYR G 4 114 ? -64.110 4.762   -0.947  1.00 46.98  ? 114  TYR G O     1 
ATOM   6090 C  CB    . TYR G 4 114 ? -63.738 5.210   2.244   1.00 49.69  ? 114  TYR G CB    1 
ATOM   6091 C  CG    . TYR G 4 114 ? -65.228 4.911   2.251   1.00 52.34  ? 114  TYR G CG    1 
ATOM   6092 C  CD1   . TYR G 4 114 ? -66.085 5.531   1.349   1.00 54.53  ? 114  TYR G CD1   1 
ATOM   6093 C  CD2   . TYR G 4 114 ? -65.769 3.974   3.120   1.00 52.07  ? 114  TYR G CD2   1 
ATOM   6094 C  CE1   . TYR G 4 114 ? -67.427 5.244   1.319   1.00 49.95  ? 114  TYR G CE1   1 
ATOM   6095 C  CE2   . TYR G 4 114 ? -67.132 3.680   3.097   1.00 53.15  ? 114  TYR G CE2   1 
ATOM   6096 C  CZ    . TYR G 4 114 ? -67.946 4.323   2.194   1.00 50.61  ? 114  TYR G CZ    1 
ATOM   6097 O  OH    . TYR G 4 114 ? -69.289 4.045   2.145   1.00 55.14  ? 114  TYR G OH    1 
ATOM   6098 N  N     . VAL G 4 115 ? -62.473 6.189   -0.484  1.00 47.39  ? 115  VAL G N     1 
ATOM   6099 C  CA    . VAL G 4 115 ? -62.570 6.861   -1.784  1.00 48.70  ? 115  VAL G CA    1 
ATOM   6100 C  C     . VAL G 4 115 ? -62.413 5.876   -2.953  1.00 48.28  ? 115  VAL G C     1 
ATOM   6101 O  O     . VAL G 4 115 ? -63.035 6.029   -4.000  1.00 48.99  ? 115  VAL G O     1 
ATOM   6102 C  CB    . VAL G 4 115 ? -61.521 7.984   -1.901  1.00 51.44  ? 115  VAL G CB    1 
ATOM   6103 C  CG1   . VAL G 4 115 ? -61.386 8.469   -3.336  1.00 42.61  ? 115  VAL G CG1   1 
ATOM   6104 C  CG2   . VAL G 4 115 ? -61.883 9.133   -0.965  1.00 46.56  ? 115  VAL G CG2   1 
ATOM   6105 N  N     . ALA G 4 116 ? -61.601 4.844   -2.761  1.00 51.32  ? 116  ALA G N     1 
ATOM   6106 C  CA    . ALA G 4 116 ? -61.413 3.848   -3.798  1.00 52.19  ? 116  ALA G CA    1 
ATOM   6107 C  C     . ALA G 4 116 ? -62.430 2.700   -3.715  1.00 57.45  ? 116  ALA G C     1 
ATOM   6108 O  O     . ALA G 4 116 ? -63.073 2.371   -4.712  1.00 55.61  ? 116  ALA G O     1 
ATOM   6109 C  CB    . ALA G 4 116 ? -60.001 3.305   -3.741  1.00 48.63  ? 116  ALA G CB    1 
ATOM   6110 N  N     . GLU G 4 117 ? -62.581 2.094   -2.539  1.00 54.70  ? 117  GLU G N     1 
ATOM   6111 C  CA    . GLU G 4 117 ? -63.334 0.842   -2.419  1.00 59.49  ? 117  GLU G CA    1 
ATOM   6112 C  C     . GLU G 4 117 ? -64.673 0.973   -1.689  1.00 52.89  ? 117  GLU G C     1 
ATOM   6113 O  O     . GLU G 4 117 ? -65.317 -0.027  -1.373  1.00 51.13  ? 117  GLU G O     1 
ATOM   6114 C  CB    . GLU G 4 117 ? -62.499 -0.209  -1.681  1.00 56.90  ? 117  GLU G CB    1 
ATOM   6115 C  CG    . GLU G 4 117 ? -61.129 -0.428  -2.198  1.00 57.94  ? 117  GLU G CG    1 
ATOM   6116 C  CD    . GLU G 4 117 ? -61.015 -1.676  -3.050  1.00 60.66  ? 117  GLU G CD    1 
ATOM   6117 O  OE1   . GLU G 4 117 ? -61.573 -1.692  -4.167  1.00 57.11  ? 117  GLU G OE1   1 
ATOM   6118 O  OE2   . GLU G 4 117 ? -60.332 -2.628  -2.608  1.00 56.90  ? 117  GLU G OE2   1 
ATOM   6119 N  N     . GLY G 4 118 ? -65.071 2.198   -1.393  1.00 50.26  ? 118  GLY G N     1 
ATOM   6120 C  CA    . GLY G 4 118 ? -66.261 2.424   -0.595  1.00 52.49  ? 118  GLY G CA    1 
ATOM   6121 C  C     . GLY G 4 118 ? -67.542 2.498   -1.393  1.00 53.69  ? 118  GLY G C     1 
ATOM   6122 O  O     . GLY G 4 118 ? -67.513 2.689   -2.606  1.00 59.07  ? 118  GLY G O     1 
ATOM   6123 N  N     . ASP G 4 119 ? -68.667 2.314   -0.701  1.00 63.50  ? 119  ASP G N     1 
ATOM   6124 C  CA    . ASP G 4 119 ? -69.997 2.595   -1.240  1.00 58.87  ? 119  ASP G CA    1 
ATOM   6125 C  C     . ASP G 4 119 ? -70.172 4.101   -1.363  1.00 61.73  ? 119  ASP G C     1 
ATOM   6126 O  O     . ASP G 4 119 ? -70.204 4.811   -0.350  1.00 61.59  ? 119  ASP G O     1 
ATOM   6127 C  CB    . ASP G 4 119 ? -71.084 2.011   -0.336  1.00 62.14  ? 119  ASP G CB    1 
ATOM   6128 C  CG    . ASP G 4 119 ? -72.404 1.744   -1.073  1.00 65.52  ? 119  ASP G CG    1 
ATOM   6129 O  OD1   . ASP G 4 119 ? -72.673 2.384   -2.114  1.00 62.40  ? 119  ASP G OD1   1 
ATOM   6130 O  OD2   . ASP G 4 119 ? -73.169 0.880   -0.588  1.00 62.89  ? 119  ASP G OD2   1 
ATOM   6131 N  N     . LYS G 4 120 ? -70.275 4.587   -2.596  1.00 66.45  ? 120  LYS G N     1 
ATOM   6132 C  CA    . LYS G 4 120 ? -70.321 6.026   -2.836  1.00 73.74  ? 120  LYS G CA    1 
ATOM   6133 C  C     . LYS G 4 120 ? -71.712 6.659   -2.674  1.00 81.63  ? 120  LYS G C     1 
ATOM   6134 O  O     . LYS G 4 120 ? -71.815 7.855   -2.402  1.00 86.86  ? 120  LYS G O     1 
ATOM   6135 C  CB    . LYS G 4 120 ? -69.805 6.335   -4.231  1.00 76.55  ? 120  LYS G CB    1 
ATOM   6136 C  CG    . LYS G 4 120 ? -68.419 5.854   -4.473  1.00 72.20  ? 120  LYS G CG    1 
ATOM   6137 C  CD    . LYS G 4 120 ? -67.474 6.324   -3.400  1.00 70.07  ? 120  LYS G CD    1 
ATOM   6138 C  CE    . LYS G 4 120 ? -66.071 5.953   -3.804  1.00 75.62  ? 120  LYS G CE    1 
ATOM   6139 N  NZ    . LYS G 4 120 ? -66.005 4.596   -4.482  1.00 73.62  ? 120  LYS G NZ    1 
ATOM   6140 N  N     . THR G 4 121 ? -72.771 5.873   -2.849  1.00 66.21  ? 121  THR G N     1 
ATOM   6141 C  CA    . THR G 4 121 ? -74.120 6.363   -2.610  1.00 67.81  ? 121  THR G CA    1 
ATOM   6142 C  C     . THR G 4 121 ? -74.257 6.890   -1.186  1.00 72.16  ? 121  THR G C     1 
ATOM   6143 O  O     . THR G 4 121 ? -75.127 7.710   -0.910  1.00 71.99  ? 121  THR G O     1 
ATOM   6144 C  CB    . THR G 4 121 ? -75.176 5.269   -2.813  1.00 67.92  ? 121  THR G CB    1 
ATOM   6145 O  OG1   . THR G 4 121 ? -75.251 4.459   -1.637  1.00 69.41  ? 121  THR G OG1   1 
ATOM   6146 C  CG2   . THR G 4 121 ? -74.832 4.397   -3.996  1.00 59.59  ? 121  THR G CG2   1 
ATOM   6147 N  N     . LEU G 4 122 ? -73.404 6.391   -0.289  1.00 67.65  ? 122  LEU G N     1 
ATOM   6148 C  CA    . LEU G 4 122 ? -73.471 6.688   1.143   1.00 68.37  ? 122  LEU G CA    1 
ATOM   6149 C  C     . LEU G 4 122 ? -74.804 6.314   1.821   1.00 74.08  ? 122  LEU G C     1 
ATOM   6150 O  O     . LEU G 4 122 ? -74.996 6.609   3.016   1.00 74.42  ? 122  LEU G O     1 
ATOM   6151 C  CB    . LEU G 4 122 ? -73.162 8.165   1.389   1.00 69.12  ? 122  LEU G CB    1 
ATOM   6152 C  CG    . LEU G 4 122 ? -71.733 8.465   1.856   1.00 71.28  ? 122  LEU G CG    1 
ATOM   6153 C  CD1   . LEU G 4 122 ? -70.692 7.968   0.858   1.00 71.71  ? 122  LEU G CD1   1 
ATOM   6154 C  CD2   . LEU G 4 122 ? -71.564 9.948   2.102   1.00 58.57  ? 122  LEU G CD2   1 
ATOM   6155 N  N     . LYS G 4 123 ? -75.710 5.657   1.084   1.00 74.12  ? 123  LYS G N     1 
ATOM   6156 C  CA    . LYS G 4 123 ? -76.898 5.059   1.700   1.00 69.86  ? 123  LYS G CA    1 
ATOM   6157 C  C     . LYS G 4 123 ? -76.452 3.992   2.705   1.00 72.58  ? 123  LYS G C     1 
ATOM   6158 O  O     . LYS G 4 123 ? -76.795 4.074   3.881   1.00 75.42  ? 123  LYS G O     1 
ATOM   6159 C  CB    . LYS G 4 123 ? -77.849 4.487   0.649   1.00 70.05  ? 123  LYS G CB    1 
ATOM   6160 C  CG    . LYS G 4 123 ? -78.667 5.570   -0.051  1.00 82.60  ? 123  LYS G CG    1 
ATOM   6161 C  CD    . LYS G 4 123 ? -79.575 5.033   -1.166  1.00 87.07  ? 123  LYS G CD    1 
ATOM   6162 C  CE    . LYS G 4 123 ? -80.929 5.783   -1.227  1.00 97.06  ? 123  LYS G CE    1 
ATOM   6163 N  NZ    . LYS G 4 123 ? -82.002 5.215   -0.354  1.00 88.76  ? 123  LYS G NZ    1 
ATOM   6164 N  N     . ARG G 4 124 ? -75.659 3.016   2.270   1.00 69.28  ? 124  ARG G N     1 
ATOM   6165 C  CA    . ARG G 4 124 ? -74.891 2.221   3.237   1.00 65.64  ? 124  ARG G CA    1 
ATOM   6166 C  C     . ARG G 4 124 ? -73.426 2.651   3.253   1.00 61.67  ? 124  ARG G C     1 
ATOM   6167 O  O     . ARG G 4 124 ? -72.968 3.387   2.378   1.00 57.48  ? 124  ARG G O     1 
ATOM   6168 C  CB    . ARG G 4 124 ? -74.982 0.737   2.936   1.00 55.49  ? 124  ARG G CB    1 
ATOM   6169 C  CG    . ARG G 4 124 ? -76.316 0.352   2.417   1.00 55.46  ? 124  ARG G CG    1 
ATOM   6170 C  CD    . ARG G 4 124 ? -76.495 -1.140  2.336   1.00 56.46  ? 124  ARG G CD    1 
ATOM   6171 N  NE    . ARG G 4 124 ? -77.106 -1.434  1.042   1.00 62.98  ? 124  ARG G NE    1 
ATOM   6172 C  CZ    . ARG G 4 124 ? -77.483 -2.636  0.632   1.00 64.38  ? 124  ARG G CZ    1 
ATOM   6173 N  NH1   . ARG G 4 124 ? -77.360 -3.695  1.440   1.00 61.06  ? 124  ARG G NH1   1 
ATOM   6174 N  NH2   . ARG G 4 124 ? -78.009 -2.764  -0.581  1.00 60.23  ? 124  ARG G NH2   1 
ATOM   6175 N  N     . LEU G 4 125 ? -72.707 2.196   4.271   1.00 56.93  ? 125  LEU G N     1 
ATOM   6176 C  CA    . LEU G 4 125 ? -71.287 2.478   4.402   1.00 51.04  ? 125  LEU G CA    1 
ATOM   6177 C  C     . LEU G 4 125 ? -70.508 1.159   4.314   1.00 54.42  ? 125  LEU G C     1 
ATOM   6178 O  O     . LEU G 4 125 ? -70.347 0.429   5.300   1.00 50.27  ? 125  LEU G O     1 
ATOM   6179 C  CB    . LEU G 4 125 ? -71.011 3.211   5.712   1.00 53.07  ? 125  LEU G CB    1 
ATOM   6180 C  CG    . LEU G 4 125 ? -71.846 4.488   5.849   1.00 53.64  ? 125  LEU G CG    1 
ATOM   6181 C  CD1   . LEU G 4 125 ? -71.655 5.139   7.207   1.00 54.55  ? 125  LEU G CD1   1 
ATOM   6182 C  CD2   . LEU G 4 125 ? -71.506 5.470   4.733   1.00 55.43  ? 125  LEU G CD2   1 
ATOM   6183 N  N     . ARG G 4 126 ? -70.048 0.846   3.111   1.00 53.39  ? 126  ARG G N     1 
ATOM   6184 C  CA    . ARG G 4 126 ? -69.405 -0.429  2.865   1.00 55.59  ? 126  ARG G CA    1 
ATOM   6185 C  C     . ARG G 4 126 ? -68.095 -0.298  2.096   1.00 54.74  ? 126  ARG G C     1 
ATOM   6186 O  O     . ARG G 4 126 ? -68.017 0.454   1.137   1.00 49.11  ? 126  ARG G O     1 
ATOM   6187 C  CB    . ARG G 4 126 ? -70.352 -1.336  2.099   1.00 55.86  ? 126  ARG G CB    1 
ATOM   6188 C  CG    . ARG G 4 126 ? -71.669 -1.533  2.780   1.00 50.64  ? 126  ARG G CG    1 
ATOM   6189 C  CD    . ARG G 4 126 ? -72.538 -2.404  1.933   1.00 57.80  ? 126  ARG G CD    1 
ATOM   6190 N  NE    . ARG G 4 126 ? -72.893 -1.770  0.666   1.00 52.94  ? 126  ARG G NE    1 
ATOM   6191 C  CZ    . ARG G 4 126 ? -73.637 -2.365  -0.257  1.00 55.28  ? 126  ARG G CZ    1 
ATOM   6192 N  NH1   . ARG G 4 126 ? -74.087 -3.605  -0.050  1.00 47.02  ? 126  ARG G NH1   1 
ATOM   6193 N  NH2   . ARG G 4 126 ? -73.926 -1.724  -1.382  1.00 55.59  ? 126  ARG G NH2   1 
ATOM   6194 N  N     . ILE G 4 127 ? -67.089 -1.059  2.529   1.00 51.16  ? 127  ILE G N     1 
ATOM   6195 C  CA    . ILE G 4 127 ? -65.790 -1.149  1.864   1.00 49.34  ? 127  ILE G CA    1 
ATOM   6196 C  C     . ILE G 4 127 ? -65.564 -2.589  1.402   1.00 46.73  ? 127  ILE G C     1 
ATOM   6197 O  O     . ILE G 4 127 ? -65.706 -3.528  2.182   1.00 43.98  ? 127  ILE G O     1 
ATOM   6198 C  CB    . ILE G 4 127 ? -64.649 -0.721  2.815   1.00 50.03  ? 127  ILE G CB    1 
ATOM   6199 C  CG1   . ILE G 4 127 ? -64.943 0.656   3.413   1.00 45.46  ? 127  ILE G CG1   1 
ATOM   6200 C  CG2   . ILE G 4 127 ? -63.292 -0.738  2.105   1.00 41.13  ? 127  ILE G CG2   1 
ATOM   6201 C  CD1   . ILE G 4 127 ? -64.047 1.017   4.578   1.00 40.61  ? 127  ILE G CD1   1 
ATOM   6202 N  N     . TRP G 4 128 ? -65.223 -2.785  0.140   1.00 47.21  ? 128  TRP G N     1 
ATOM   6203 C  CA    . TRP G 4 128 ? -64.962 -4.144  -0.327  1.00 48.24  ? 128  TRP G CA    1 
ATOM   6204 C  C     . TRP G 4 128 ? -63.465 -4.421  -0.493  1.00 54.05  ? 128  TRP G C     1 
ATOM   6205 O  O     . TRP G 4 128 ? -62.706 -3.534  -0.882  1.00 50.31  ? 128  TRP G O     1 
ATOM   6206 C  CB    . TRP G 4 128 ? -65.673 -4.395  -1.652  1.00 49.76  ? 128  TRP G CB    1 
ATOM   6207 C  CG    . TRP G 4 128 ? -67.156 -4.414  -1.528  1.00 56.52  ? 128  TRP G CG    1 
ATOM   6208 C  CD1   . TRP G 4 128 ? -67.935 -5.495  -1.237  1.00 54.91  ? 128  TRP G CD1   1 
ATOM   6209 C  CD2   . TRP G 4 128 ? -68.048 -3.302  -1.672  1.00 52.77  ? 128  TRP G CD2   1 
ATOM   6210 N  NE1   . TRP G 4 128 ? -69.255 -5.129  -1.203  1.00 52.98  ? 128  TRP G NE1   1 
ATOM   6211 C  CE2   . TRP G 4 128 ? -69.354 -3.788  -1.467  1.00 55.35  ? 128  TRP G CE2   1 
ATOM   6212 C  CE3   . TRP G 4 128 ? -67.871 -1.947  -1.961  1.00 52.65  ? 128  TRP G CE3   1 
ATOM   6213 C  CZ2   . TRP G 4 128 ? -70.485 -2.964  -1.542  1.00 51.07  ? 128  TRP G CZ2   1 
ATOM   6214 C  CZ3   . TRP G 4 128 ? -68.994 -1.131  -2.036  1.00 58.40  ? 128  TRP G CZ3   1 
ATOM   6215 C  CH2   . TRP G 4 128 ? -70.284 -1.647  -1.827  1.00 54.15  ? 128  TRP G CH2   1 
ATOM   6216 N  N     . ASN G 4 129 ? -63.051 -5.650  -0.199  1.00 49.31  ? 129  ASN G N     1 
ATOM   6217 C  CA    . ASN G 4 129 ? -61.703 -6.090  -0.510  1.00 49.01  ? 129  ASN G CA    1 
ATOM   6218 C  C     . ASN G 4 129 ? -61.521 -7.595  -0.414  1.00 50.05  ? 129  ASN G C     1 
ATOM   6219 O  O     . ASN G 4 129 ? -62.165 -8.243  0.416   1.00 46.94  ? 129  ASN G O     1 
ATOM   6220 C  CB    . ASN G 4 129 ? -60.697 -5.416  0.411   1.00 49.84  ? 129  ASN G CB    1 
ATOM   6221 C  CG    . ASN G 4 129 ? -59.319 -5.422  -0.165  1.00 48.20  ? 129  ASN G CG    1 
ATOM   6222 O  OD1   . ASN G 4 129 ? -58.560 -6.365  0.026   1.00 51.12  ? 129  ASN G OD1   1 
ATOM   6223 N  ND2   . ASN G 4 129 ? -59.004 -4.395  -0.930  1.00 47.81  ? 129  ASN G ND2   1 
ATOM   6224 N  N     . LYS G 4 130 ? -60.629 -8.147  -1.244  1.00 49.52  ? 130  LYS G N     1 
ATOM   6225 C  CA    . LYS G 4 130 ? -60.268 -9.566  -1.134  1.00 46.22  ? 130  LYS G CA    1 
ATOM   6226 C  C     . LYS G 4 130 ? -59.382 -9.877  0.078   1.00 45.45  ? 130  LYS G C     1 
ATOM   6227 O  O     . LYS G 4 130 ? -59.380 -10.995 0.564   1.00 48.46  ? 130  LYS G O     1 
ATOM   6228 C  CB    . LYS G 4 130 ? -59.565 -10.041 -2.387  1.00 46.21  ? 130  LYS G CB    1 
ATOM   6229 C  CG    . LYS G 4 130 ? -60.464 -10.134 -3.569  1.00 60.24  ? 130  LYS G CG    1 
ATOM   6230 C  CD    . LYS G 4 130 ? -59.793 -10.875 -4.699  1.00 61.38  ? 130  LYS G CD    1 
ATOM   6231 C  CE    . LYS G 4 130 ? -59.549 -12.322 -4.357  1.00 59.45  ? 130  LYS G CE    1 
ATOM   6232 N  NZ    . LYS G 4 130 ? -58.947 -12.996 -5.538  1.00 73.93  ? 130  LYS G NZ    1 
ATOM   6233 N  N     . ASN G 4 131 ? -58.635 -8.895  0.567   1.00 39.59  ? 131  ASN G N     1 
ATOM   6234 C  CA    . ASN G 4 131 ? -57.804 -9.117  1.737   1.00 35.38  ? 131  ASN G CA    1 
ATOM   6235 C  C     . ASN G 4 131 ? -58.557 -9.006  3.058   1.00 43.80  ? 131  ASN G C     1 
ATOM   6236 O  O     . ASN G 4 131 ? -58.740 -7.911  3.608   1.00 46.87  ? 131  ASN G O     1 
ATOM   6237 C  CB    . ASN G 4 131 ? -56.630 -8.138  1.760   1.00 44.50  ? 131  ASN G CB    1 
ATOM   6238 C  CG    . ASN G 4 131 ? -55.545 -8.555  2.741   1.00 44.27  ? 131  ASN G CG    1 
ATOM   6239 O  OD1   . ASN G 4 131 ? -55.781 -9.369  3.637   1.00 43.38  ? 131  ASN G OD1   1 
ATOM   6240 N  ND2   . ASN G 4 131 ? -54.351 -7.984  2.590   1.00 42.12  ? 131  ASN G ND2   1 
ATOM   6241 N  N     . LYS G 4 132 ? -58.951 -10.146 3.602   1.00 45.54  ? 132  LYS G N     1 
ATOM   6242 C  CA    . LYS G 4 132 ? -59.645 -10.137 4.878   1.00 46.12  ? 132  LYS G CA    1 
ATOM   6243 C  C     . LYS G 4 132 ? -58.800 -9.572  6.031   1.00 48.74  ? 132  LYS G C     1 
ATOM   6244 O  O     . LYS G 4 132 ? -59.335 -8.946  6.951   1.00 58.89  ? 132  LYS G O     1 
ATOM   6245 C  CB    . LYS G 4 132 ? -60.124 -11.547 5.218   1.00 46.92  ? 132  LYS G CB    1 
ATOM   6246 C  CG    . LYS G 4 132 ? -60.865 -11.645 6.527   1.00 51.05  ? 132  LYS G CG    1 
ATOM   6247 C  CD    . LYS G 4 132 ? -61.334 -13.056 6.739   1.00 58.61  ? 132  LYS G CD    1 
ATOM   6248 C  CE    . LYS G 4 132 ? -62.217 -13.160 7.958   1.00 61.86  ? 132  LYS G CE    1 
ATOM   6249 N  NZ    . LYS G 4 132 ? -62.954 -14.465 7.951   1.00 68.87  ? 132  LYS G NZ    1 
ATOM   6250 N  N     . ALA G 4 133 ? -57.492 -9.774  6.007   1.00 37.70  ? 133  ALA G N     1 
ATOM   6251 C  CA    . ALA G 4 133 ? -56.698 -9.330  7.143   1.00 41.54  ? 133  ALA G CA    1 
ATOM   6252 C  C     . ALA G 4 133 ? -56.565 -7.811  7.130   1.00 44.40  ? 133  ALA G C     1 
ATOM   6253 O  O     . ALA G 4 133 ? -56.498 -7.160  8.179   1.00 47.39  ? 133  ALA G O     1 
ATOM   6254 C  CB    . ALA G 4 133 ? -55.342 -9.997  7.141   1.00 32.41  ? 133  ALA G CB    1 
ATOM   6255 N  N     . LEU G 4 134 ? -56.543 -7.245  5.932   1.00 41.40  ? 134  LEU G N     1 
ATOM   6256 C  CA    . LEU G 4 134 ? -56.528 -5.799  5.782   1.00 43.23  ? 134  LEU G CA    1 
ATOM   6257 C  C     . LEU G 4 134 ? -57.798 -5.198  6.364   1.00 48.40  ? 134  LEU G C     1 
ATOM   6258 O  O     . LEU G 4 134 ? -57.749 -4.223  7.117   1.00 46.40  ? 134  LEU G O     1 
ATOM   6259 C  CB    . LEU G 4 134 ? -56.394 -5.423  4.309   1.00 43.53  ? 134  LEU G CB    1 
ATOM   6260 C  CG    . LEU G 4 134 ? -56.440 -3.925  4.060   1.00 46.67  ? 134  LEU G CG    1 
ATOM   6261 C  CD1   . LEU G 4 134 ? -55.237 -3.263  4.662   1.00 42.56  ? 134  LEU G CD1   1 
ATOM   6262 C  CD2   . LEU G 4 134 ? -56.512 -3.657  2.585   1.00 49.58  ? 134  LEU G CD2   1 
ATOM   6263 N  N     . LEU G 4 135 ? -58.939 -5.799  6.017   1.00 49.72  ? 135  LEU G N     1 
ATOM   6264 C  CA    . LEU G 4 135 ? -60.230 -5.324  6.515   1.00 51.93  ? 135  LEU G CA    1 
ATOM   6265 C  C     . LEU G 4 135 ? -60.342 -5.489  8.034   1.00 51.92  ? 135  LEU G C     1 
ATOM   6266 O  O     . LEU G 4 135 ? -61.023 -4.701  8.693   1.00 53.61  ? 135  LEU G O     1 
ATOM   6267 C  CB    . LEU G 4 135 ? -61.385 -6.043  5.810   1.00 47.23  ? 135  LEU G CB    1 
ATOM   6268 C  CG    . LEU G 4 135 ? -61.575 -5.665  4.333   1.00 48.11  ? 135  LEU G CG    1 
ATOM   6269 C  CD1   . LEU G 4 135 ? -62.789 -6.357  3.710   1.00 44.27  ? 135  LEU G CD1   1 
ATOM   6270 C  CD2   . LEU G 4 135 ? -61.664 -4.155  4.147   1.00 40.35  ? 135  LEU G CD2   1 
ATOM   6271 N  N     . GLU G 4 136 ? -59.675 -6.496  8.591   1.00 50.71  ? 136  GLU G N     1 
ATOM   6272 C  CA    . GLU G 4 136 ? -59.699 -6.687  10.039  1.00 56.31  ? 136  GLU G CA    1 
ATOM   6273 C  C     . GLU G 4 136 ? -58.913 -5.619  10.792  1.00 57.63  ? 136  GLU G C     1 
ATOM   6274 O  O     . GLU G 4 136 ? -59.340 -5.139  11.850  1.00 57.54  ? 136  GLU G O     1 
ATOM   6275 C  CB    . GLU G 4 136 ? -59.185 -8.073  10.392  1.00 52.98  ? 136  GLU G CB    1 
ATOM   6276 C  CG    . GLU G 4 136 ? -60.211 -9.115  10.022  1.00 59.96  ? 136  GLU G CG    1 
ATOM   6277 C  CD    . GLU G 4 136 ? -59.786 -10.520 10.342  1.00 66.59  ? 136  GLU G CD    1 
ATOM   6278 O  OE1   . GLU G 4 136 ? -58.573 -10.756 10.531  1.00 67.41  ? 136  GLU G OE1   1 
ATOM   6279 O  OE2   . GLU G 4 136 ? -60.682 -11.392 10.400  1.00 76.71  ? 136  GLU G OE2   1 
ATOM   6280 N  N     . ILE G 4 137 ? -57.771 -5.248  10.231  1.00 54.43  ? 137  ILE G N     1 
ATOM   6281 C  CA    . ILE G 4 137 ? -56.963 -4.153  10.742  1.00 52.75  ? 137  ILE G CA    1 
ATOM   6282 C  C     . ILE G 4 137 ? -57.775 -2.872  10.677  1.00 50.15  ? 137  ILE G C     1 
ATOM   6283 O  O     . ILE G 4 137 ? -57.884 -2.144  11.654  1.00 52.91  ? 137  ILE G O     1 
ATOM   6284 C  CB    . ILE G 4 137 ? -55.659 -4.003  9.924   1.00 56.04  ? 137  ILE G CB    1 
ATOM   6285 C  CG1   . ILE G 4 137 ? -54.760 -5.218  10.155  1.00 58.33  ? 137  ILE G CG1   1 
ATOM   6286 C  CG2   . ILE G 4 137 ? -54.955 -2.708  10.269  1.00 51.50  ? 137  ILE G CG2   1 
ATOM   6287 C  CD1   . ILE G 4 137 ? -53.538 -5.277  9.279   1.00 55.38  ? 137  ILE G CD1   1 
ATOM   6288 N  N     . VAL G 4 138 ? -58.350 -2.601  9.513   1.00 47.79  ? 138  VAL G N     1 
ATOM   6289 C  CA    . VAL G 4 138 ? -59.241 -1.461  9.378   1.00 51.44  ? 138  VAL G CA    1 
ATOM   6290 C  C     . VAL G 4 138 ? -60.395 -1.510  10.386  1.00 52.97  ? 138  VAL G C     1 
ATOM   6291 O  O     . VAL G 4 138 ? -60.724 -0.498  11.011  1.00 51.18  ? 138  VAL G O     1 
ATOM   6292 C  CB    . VAL G 4 138 ? -59.809 -1.373  7.971   1.00 50.60  ? 138  VAL G CB    1 
ATOM   6293 C  CG1   . VAL G 4 138 ? -60.962 -0.357  7.923   1.00 41.68  ? 138  VAL G CG1   1 
ATOM   6294 C  CG2   . VAL G 4 138 ? -58.695 -1.002  7.014   1.00 42.90  ? 138  VAL G CG2   1 
ATOM   6295 N  N     . SER G 4 139 ? -60.986 -2.693  10.557  1.00 56.41  ? 139  SER G N     1 
ATOM   6296 C  CA    . SER G 4 139 ? -62.051 -2.897  11.537  1.00 51.67  ? 139  SER G CA    1 
ATOM   6297 C  C     . SER G 4 139 ? -61.661 -2.486  12.956  1.00 54.36  ? 139  SER G C     1 
ATOM   6298 O  O     . SER G 4 139 ? -62.395 -1.744  13.604  1.00 55.32  ? 139  SER G O     1 
ATOM   6299 C  CB    . SER G 4 139 ? -62.493 -4.344  11.547  1.00 47.53  ? 139  SER G CB    1 
ATOM   6300 O  OG    . SER G 4 139 ? -63.580 -4.498  12.434  1.00 54.05  ? 139  SER G OG    1 
ATOM   6301 N  N     . ARG G 4 140 ? -60.516 -2.961  13.437  1.00 45.89  ? 140  ARG G N     1 
ATOM   6302 C  CA    . ARG G 4 140 ? -60.010 -2.546  14.744  1.00 50.44  ? 140  ARG G CA    1 
ATOM   6303 C  C     . ARG G 4 140 ? -59.803 -1.019  14.867  1.00 56.06  ? 140  ARG G C     1 
ATOM   6304 O  O     . ARG G 4 140 ? -60.091 -0.426  15.910  1.00 55.97  ? 140  ARG G O     1 
ATOM   6305 C  CB    . ARG G 4 140 ? -58.697 -3.270  15.053  1.00 55.38  ? 140  ARG G CB    1 
ATOM   6306 C  CG    . ARG G 4 140 ? -58.793 -4.782  15.043  1.00 54.85  ? 140  ARG G CG    1 
ATOM   6307 C  CD    . ARG G 4 140 ? -57.478 -5.384  15.454  1.00 66.27  ? 140  ARG G CD    1 
ATOM   6308 N  NE    . ARG G 4 140 ? -56.850 -6.204  14.428  1.00 72.56  ? 140  ARG G NE    1 
ATOM   6309 C  CZ    . ARG G 4 140 ? -57.077 -7.503  14.273  1.00 75.00  ? 140  ARG G CZ    1 
ATOM   6310 N  NH1   . ARG G 4 140 ? -57.925 -8.128  15.084  1.00 78.51  ? 140  ARG G NH1   1 
ATOM   6311 N  NH2   . ARG G 4 140 ? -56.456 -8.173  13.306  1.00 73.34  ? 140  ARG G NH2   1 
ATOM   6312 N  N     . TRP G 4 141 ? -59.297 -0.380  13.817  0.95 53.91  ? 141  TRP G N     1 
ATOM   6313 C  CA    . TRP G 4 141 ? -59.123 1.069   13.848  0.95 51.13  ? 141  TRP G CA    1 
ATOM   6314 C  C     . TRP G 4 141 ? -60.467 1.745   14.024  0.95 57.73  ? 141  TRP G C     1 
ATOM   6315 O  O     . TRP G 4 141 ? -60.641 2.570   14.921  0.95 63.12  ? 141  TRP G O     1 
ATOM   6316 C  CB    . TRP G 4 141 ? -58.446 1.583   12.574  0.95 56.57  ? 141  TRP G CB    1 
ATOM   6317 C  CG    . TRP G 4 141 ? -57.024 1.132   12.427  0.95 56.65  ? 141  TRP G CG    1 
ATOM   6318 C  CD1   . TRP G 4 141 ? -56.253 0.539   13.375  1.00 56.35  ? 141  TRP G CD1   1 
ATOM   6319 C  CD2   . TRP G 4 141 ? -56.225 1.224   11.248  1.00 56.93  ? 141  TRP G CD2   1 
ATOM   6320 N  NE1   . TRP G 4 141 ? -55.010 0.262   12.868  1.00 58.95  ? 141  TRP G NE1   1 
ATOM   6321 C  CE2   . TRP G 4 141 ? -54.961 0.669   11.562  1.00 58.29  ? 141  TRP G CE2   1 
ATOM   6322 C  CE3   . TRP G 4 141 ? -56.440 1.724   9.960   1.00 53.65  ? 141  TRP G CE3   1 
ATOM   6323 C  CZ2   . TRP G 4 141 ? -53.918 0.602   10.633  1.00 55.44  ? 141  TRP G CZ2   1 
ATOM   6324 C  CZ3   . TRP G 4 141 ? -55.413 1.656   9.037   1.00 52.67  ? 141  TRP G CZ3   1 
ATOM   6325 C  CH2   . TRP G 4 141 ? -54.159 1.098   9.380   1.00 58.52  ? 141  TRP G CH2   1 
ATOM   6326 N  N     . LEU G 4 142 ? -61.417 1.382   13.165  1.00 58.14  ? 142  LEU G N     1 
ATOM   6327 C  CA    . LEU G 4 142 ? -62.776 1.908   13.248  1.00 57.20  ? 142  LEU G CA    1 
ATOM   6328 C  C     . LEU G 4 142 ? -63.381 1.745   14.646  1.00 58.48  ? 142  LEU G C     1 
ATOM   6329 O  O     . LEU G 4 142 ? -64.047 2.647   15.151  1.00 57.05  ? 142  LEU G O     1 
ATOM   6330 C  CB    . LEU G 4 142 ? -63.665 1.232   12.210  1.00 48.00  ? 142  LEU G CB    1 
ATOM   6331 C  CG    . LEU G 4 142 ? -63.449 1.704   10.773  1.00 46.47  ? 142  LEU G CG    1 
ATOM   6332 C  CD1   . LEU G 4 142 ? -64.372 0.945   9.827   1.00 43.63  ? 142  LEU G CD1   1 
ATOM   6333 C  CD2   . LEU G 4 142 ? -63.654 3.206   10.662  1.00 42.01  ? 142  LEU G CD2   1 
ATOM   6334 N  N     . ASN G 4 143 ? -63.131 0.602   15.276  1.00 57.91  ? 143  ASN G N     1 
ATOM   6335 C  CA    . ASN G 4 143 ? -63.678 0.348   16.603  1.00 58.82  ? 143  ASN G CA    1 
ATOM   6336 C  C     . ASN G 4 143 ? -63.105 1.333   17.606  1.00 61.26  ? 143  ASN G C     1 
ATOM   6337 O  O     . ASN G 4 143 ? -63.838 2.010   18.312  1.00 61.54  ? 143  ASN G O     1 
ATOM   6338 C  CB    . ASN G 4 143 ? -63.422 -1.104  17.032  1.00 54.62  ? 143  ASN G CB    1 
ATOM   6339 C  CG    . ASN G 4 143 ? -64.572 -2.052  16.623  1.00 63.12  ? 143  ASN G CG    1 
ATOM   6340 O  OD1   . ASN G 4 143 ? -65.746 -1.662  16.618  1.00 61.00  ? 143  ASN G OD1   1 
ATOM   6341 N  ND2   . ASN G 4 143 ? -64.229 -3.286  16.257  1.00 59.80  ? 143  ASN G ND2   1 
ATOM   6342 N  N     . ASN G 4 144 ? -61.789 1.458   17.630  1.00 63.57  ? 144  ASN G N     1 
ATOM   6343 C  CA    . ASN G 4 144 ? -61.161 2.340   18.589  1.00 59.95  ? 144  ASN G CA    1 
ATOM   6344 C  C     . ASN G 4 144 ? -61.488 3.818   18.318  1.00 64.28  ? 144  ASN G C     1 
ATOM   6345 O  O     . ASN G 4 144 ? -61.241 4.677   19.163  1.00 67.06  ? 144  ASN G O     1 
ATOM   6346 C  CB    . ASN G 4 144 ? -59.654 2.080   18.603  1.00 65.80  ? 144  ASN G CB    1 
ATOM   6347 C  CG    . ASN G 4 144 ? -59.318 0.608   18.901  1.00 78.57  ? 144  ASN G CG    1 
ATOM   6348 O  OD1   . ASN G 4 144 ? -60.140 -0.132  19.460  1.00 72.19  ? 144  ASN G OD1   1 
ATOM   6349 N  ND2   . ASN G 4 144 ? -58.106 0.184   18.537  1.00 83.86  ? 144  ASN G ND2   1 
ATOM   6350 N  N     . LEU G 4 145 ? -62.081 4.101   17.160  1.00 63.84  ? 145  LEU G N     1 
ATOM   6351 C  CA    . LEU G 4 145 ? -62.542 5.448   16.830  1.00 59.48  ? 145  LEU G CA    1 
ATOM   6352 C  C     . LEU G 4 145 ? -64.031 5.618   17.087  1.00 66.60  ? 145  LEU G C     1 
ATOM   6353 O  O     . LEU G 4 145 ? -64.630 6.615   16.674  1.00 69.46  ? 145  LEU G O     1 
ATOM   6354 C  CB    . LEU G 4 145 ? -62.243 5.772   15.371  1.00 58.55  ? 145  LEU G CB    1 
ATOM   6355 C  CG    . LEU G 4 145 ? -60.752 5.915   15.064  1.00 62.21  ? 145  LEU G CG    1 
ATOM   6356 C  CD1   . LEU G 4 145 ? -60.520 5.865   13.569  1.00 52.19  ? 145  LEU G CD1   1 
ATOM   6357 C  CD2   . LEU G 4 145 ? -60.183 7.214   15.650  1.00 55.31  ? 145  LEU G CD2   1 
ATOM   6358 N  N     . GLY G 4 146 ? -64.631 4.638   17.757  1.00 78.43  ? 146  GLY G N     1 
ATOM   6359 C  CA    . GLY G 4 146 ? -66.055 4.673   18.064  1.00 71.27  ? 146  GLY G CA    1 
ATOM   6360 C  C     . GLY G 4 146 ? -66.979 4.404   16.885  1.00 77.00  ? 146  GLY G C     1 
ATOM   6361 O  O     . GLY G 4 146 ? -68.079 4.949   16.824  1.00 89.64  ? 146  GLY G O     1 
ATOM   6362 N  N     . VAL G 4 147 ? -66.549 3.559   15.952  1.00 58.54  ? 147  VAL G N     1 
ATOM   6363 C  CA    . VAL G 4 147 ? -67.359 3.232   14.790  1.00 53.33  ? 147  VAL G CA    1 
ATOM   6364 C  C     . VAL G 4 147 ? -67.553 1.712   14.703  1.00 59.56  ? 147  VAL G C     1 
ATOM   6365 O  O     . VAL G 4 147 ? -66.594 0.958   14.518  1.00 62.77  ? 147  VAL G O     1 
ATOM   6366 C  CB    . VAL G 4 147 ? -66.716 3.779   13.502  1.00 55.45  ? 147  VAL G CB    1 
ATOM   6367 C  CG1   . VAL G 4 147 ? -67.623 3.572   12.305  1.00 51.83  ? 147  VAL G CG1   1 
ATOM   6368 C  CG2   . VAL G 4 147 ? -66.390 5.257   13.666  1.00 53.82  ? 147  VAL G CG2   1 
ATOM   6369 N  N     . ARG G 4 148 ? -68.795 1.267   14.863  1.00 60.08  ? 148  ARG G N     1 
ATOM   6370 C  CA    . ARG G 4 148 ? -69.104 -0.156  14.964  1.00 61.27  ? 148  ARG G CA    1 
ATOM   6371 C  C     . ARG G 4 148 ? -69.275 -0.762  13.590  1.00 61.58  ? 148  ARG G C     1 
ATOM   6372 O  O     . ARG G 4 148 ? -69.923 -0.164  12.720  1.00 60.12  ? 148  ARG G O     1 
ATOM   6373 C  CB    . ARG G 4 148 ? -70.368 -0.385  15.804  1.00 65.58  ? 148  ARG G CB    1 
ATOM   6374 C  CG    . ARG G 4 148 ? -70.146 -0.232  17.297  1.00 72.79  ? 148  ARG G CG    1 
ATOM   6375 C  CD    . ARG G 4 148 ? -71.450 -0.082  18.055  1.00 82.30  ? 148  ARG G CD    1 
ATOM   6376 N  NE    . ARG G 4 148 ? -71.940 1.293   18.087  1.00 81.21  ? 148  ARG G NE    1 
ATOM   6377 C  CZ    . ARG G 4 148 ? -73.230 1.606   18.149  1.00 78.51  ? 148  ARG G CZ    1 
ATOM   6378 N  NH1   . ARG G 4 148 ? -74.134 0.640   18.156  1.00 78.78  ? 148  ARG G NH1   1 
ATOM   6379 N  NH2   . ARG G 4 148 ? -73.619 2.874   18.166  1.00 74.00  ? 148  ARG G NH2   1 
ATOM   6380 N  N     . ASN G 4 149 ? -68.712 -1.954  13.395  1.00 47.69  ? 149  ASN G N     1 
ATOM   6381 C  CA    . ASN G 4 149 ? -68.684 -2.540  12.063  1.00 46.71  ? 149  ASN G CA    1 
ATOM   6382 C  C     . ASN G 4 149 ? -68.626 -4.046  12.084  1.00 52.41  ? 149  ASN G C     1 
ATOM   6383 O  O     . ASN G 4 149 ? -68.274 -4.641  13.098  1.00 50.45  ? 149  ASN G O     1 
ATOM   6384 C  CB    . ASN G 4 149 ? -67.492 -1.999  11.282  1.00 45.59  ? 149  ASN G CB    1 
ATOM   6385 C  CG    . ASN G 4 149 ? -66.171 -2.274  11.978  1.00 50.84  ? 149  ASN G CG    1 
ATOM   6386 O  OD1   . ASN G 4 149 ? -65.533 -3.301  11.741  1.00 51.52  ? 149  ASN G OD1   1 
ATOM   6387 N  ND2   . ASN G 4 149 ? -65.759 -1.359  12.849  1.00 47.30  ? 149  ASN G ND2   1 
ATOM   6388 N  N     . THR G 4 150 ? -68.970 -4.661  10.957  0.97 53.82  ? 150  THR G N     1 
ATOM   6389 C  CA    . THR G 4 150 ? -68.830 -6.107  10.815  0.97 53.01  ? 150  THR G CA    1 
ATOM   6390 C  C     . THR G 4 150 ? -68.116 -6.462  9.517   0.97 54.54  ? 150  THR G C     1 
ATOM   6391 O  O     . THR G 4 150 ? -68.086 -5.663  8.572   0.97 55.25  ? 150  THR G O     1 
ATOM   6392 C  CB    . THR G 4 150 ? -70.193 -6.824  10.830  0.97 54.66  ? 150  THR G CB    1 
ATOM   6393 O  OG1   . THR G 4 150 ? -71.089 -6.167  9.925   1.00 60.13  ? 150  THR G OG1   1 
ATOM   6394 C  CG2   . THR G 4 150 ? -70.786 -6.792  12.211  1.00 50.57  ? 150  THR G CG2   1 
ATOM   6395 N  N     . ILE G 4 151 ? -67.555 -7.668  9.477   1.00 45.51  ? 151  ILE G N     1 
ATOM   6396 C  CA    . ILE G 4 151 ? -66.918 -8.193  8.274   1.00 42.29  ? 151  ILE G CA    1 
ATOM   6397 C  C     . ILE G 4 151 ? -67.537 -9.531  7.897   1.00 38.59  ? 151  ILE G C     1 
ATOM   6398 O  O     . ILE G 4 151 ? -67.742 -10.368 8.751   1.00 39.73  ? 151  ILE G O     1 
ATOM   6399 C  CB    . ILE G 4 151 ? -65.383 -8.375  8.473   1.00 46.29  ? 151  ILE G CB    1 
ATOM   6400 C  CG1   . ILE G 4 151 ? -64.714 -7.048  8.864   1.00 40.66  ? 151  ILE G CG1   1 
ATOM   6401 C  CG2   . ILE G 4 151 ? -64.746 -8.957  7.222   1.00 43.37  ? 151  ILE G CG2   1 
ATOM   6402 C  CD1   . ILE G 4 151 ? -63.221 -7.142  9.068   1.00 33.72  ? 151  ILE G CD1   1 
ATOM   6403 N  N     . HIS G 4 152 ? -67.853 -9.726  6.622   1.00 46.20  ? 152  HIS G N     1 
ATOM   6404 C  CA    A HIS G 4 152 ? -68.268 -11.045 6.175   0.55 46.39  ? 152  HIS G CA    1 
ATOM   6405 C  CA    B HIS G 4 152 ? -68.464 -10.958 6.115   0.45 46.65  ? 152  HIS G CA    1 
ATOM   6406 C  C     . HIS G 4 152 ? -67.930 -11.211 4.712   1.00 50.96  ? 152  HIS G C     1 
ATOM   6407 O  O     . HIS G 4 152 ? -67.582 -10.256 4.022   1.00 51.59  ? 152  HIS G O     1 
ATOM   6408 C  CB    A HIS G 4 152 ? -69.766 -11.292 6.427   0.55 50.34  ? 152  HIS G CB    1 
ATOM   6409 C  CB    B HIS G 4 152 ? -70.005 -10.860 6.054   0.45 49.77  ? 152  HIS G CB    1 
ATOM   6410 C  CG    A HIS G 4 152 ? -70.685 -10.495 5.553   0.55 49.34  ? 152  HIS G CG    1 
ATOM   6411 C  CG    B HIS G 4 152 ? -70.658 -10.466 7.346   0.45 50.76  ? 152  HIS G CG    1 
ATOM   6412 N  ND1   A HIS G 4 152 ? -71.238 -11.003 4.395   0.55 53.81  ? 152  HIS G ND1   1 
ATOM   6413 N  ND1   B HIS G 4 152 ? -71.089 -11.387 8.277   0.45 51.74  ? 152  HIS G ND1   1 
ATOM   6414 C  CD2   A HIS G 4 152 ? -71.161 -9.234  5.674   0.55 47.65  ? 152  HIS G CD2   1 
ATOM   6415 C  CD2   B HIS G 4 152 ? -70.966 -9.248  7.854   0.45 50.89  ? 152  HIS G CD2   1 
ATOM   6416 C  CE1   A HIS G 4 152 ? -72.009 -10.087 3.836   0.55 51.05  ? 152  HIS G CE1   1 
ATOM   6417 C  CE1   B HIS G 4 152 ? -71.617 -10.755 9.309   0.45 49.24  ? 152  HIS G CE1   1 
ATOM   6418 N  NE2   A HIS G 4 152 ? -71.981 -9.004  4.593   0.55 53.06  ? 152  HIS G NE2   1 
ATOM   6419 N  NE2   B HIS G 4 152 ? -71.554 -9.457  9.079   0.45 48.32  ? 152  HIS G NE2   1 
ATOM   6420 N  N     . LEU G 4 153 ? -67.944 -12.461 4.262   1.00 57.64  ? 153  LEU G N     1 
ATOM   6421 C  CA    . LEU G 4 153 ? -67.609 -12.753 2.874   1.00 52.32  ? 153  LEU G CA    1 
ATOM   6422 C  C     . LEU G 4 153 ? -68.823 -12.441 2.015   1.00 50.48  ? 153  LEU G C     1 
ATOM   6423 O  O     . LEU G 4 153 ? -69.763 -13.198 1.987   1.00 52.36  ? 153  LEU G O     1 
ATOM   6424 C  CB    . LEU G 4 153 ? -67.170 -14.213 2.688   1.00 49.10  ? 153  LEU G CB    1 
ATOM   6425 C  CG    . LEU G 4 153 ? -66.961 -14.664 1.233   1.00 52.05  ? 153  LEU G CG    1 
ATOM   6426 C  CD1   . LEU G 4 153 ? -65.893 -13.853 0.496   1.00 48.96  ? 153  LEU G CD1   1 
ATOM   6427 C  CD2   . LEU G 4 153 ? -66.645 -16.133 1.176   1.00 51.61  ? 153  LEU G CD2   1 
ATOM   6428 N  N     . ASP G 4 154 ? -68.779 -11.312 1.325   1.00 50.94  ? 154  ASP G N     1 
ATOM   6429 C  CA    . ASP G 4 154 ? -69.845 -10.879 0.458   1.00 44.38  ? 154  ASP G CA    1 
ATOM   6430 C  C     . ASP G 4 154 ? -69.909 -11.751 -0.799  1.00 51.72  ? 154  ASP G C     1 
ATOM   6431 O  O     . ASP G 4 154 ? -70.888 -12.458 -1.028  1.00 57.40  ? 154  ASP G O     1 
ATOM   6432 C  CB    . ASP G 4 154 ? -69.642 -9.407  0.100   1.00 49.39  ? 154  ASP G CB    1 
ATOM   6433 C  CG    . ASP G 4 154 ? -70.941 -8.688  -0.227  1.00 62.92  ? 154  ASP G CG    1 
ATOM   6434 O  OD1   . ASP G 4 154 ? -71.971 -9.018  0.401   1.00 68.97  ? 154  ASP G OD1   1 
ATOM   6435 O  OD2   . ASP G 4 154 ? -70.922 -7.764  -1.084  1.00 60.53  ? 154  ASP G OD2   1 
ATOM   6436 N  N     . ASP G 4 155 ? -68.860 -11.724 -1.604  1.00 50.33  ? 155  ASP G N     1 
ATOM   6437 C  CA    . ASP G 4 155 ? -68.912 -12.348 -2.927  1.00 49.89  ? 155  ASP G CA    1 
ATOM   6438 C  C     . ASP G 4 155 ? -68.178 -13.691 -3.015  1.00 55.03  ? 155  ASP G C     1 
ATOM   6439 O  O     . ASP G 4 155 ? -66.952 -13.713 -3.134  1.00 55.02  ? 155  ASP G O     1 
ATOM   6440 C  CB    . ASP G 4 155 ? -68.325 -11.381 -3.960  1.00 51.75  ? 155  ASP G CB    1 
ATOM   6441 C  CG    . ASP G 4 155 ? -68.468 -11.873 -5.389  1.00 57.02  ? 155  ASP G CG    1 
ATOM   6442 O  OD1   . ASP G 4 155 ? -68.859 -13.044 -5.591  1.00 55.98  ? 155  ASP G OD1   1 
ATOM   6443 O  OD2   . ASP G 4 155 ? -68.160 -11.085 -6.318  1.00 56.85  ? 155  ASP G OD2   1 
ATOM   6444 N  N     . HIS G 4 156 ? -68.929 -14.793 -3.008  1.00 52.20  ? 156  HIS G N     1 
ATOM   6445 C  CA    . HIS G 4 156 ? -68.360 -16.128 -3.173  1.00 44.92  ? 156  HIS G CA    1 
ATOM   6446 C  C     . HIS G 4 156 ? -67.889 -16.355 -4.599  1.00 46.28  ? 156  HIS G C     1 
ATOM   6447 O  O     . HIS G 4 156 ? -67.054 -17.207 -4.847  1.00 46.79  ? 156  HIS G O     1 
ATOM   6448 C  CB    . HIS G 4 156 ? -69.362 -17.231 -2.781  1.00 42.25  ? 156  HIS G CB    1 
ATOM   6449 C  CG    . HIS G 4 156 ? -69.682 -17.270 -1.318  1.00 47.31  ? 156  HIS G CG    1 
ATOM   6450 N  ND1   . HIS G 4 156 ? -70.403 -16.281 -0.683  1.00 54.99  ? 156  HIS G ND1   1 
ATOM   6451 C  CD2   . HIS G 4 156 ? -69.354 -18.166 -0.356  1.00 53.25  ? 156  HIS G CD2   1 
ATOM   6452 C  CE1   . HIS G 4 156 ? -70.516 -16.570 0.602   1.00 54.15  ? 156  HIS G CE1   1 
ATOM   6453 N  NE2   . HIS G 4 156 ? -69.891 -17.713 0.827   1.00 51.03  ? 156  HIS G NE2   1 
ATOM   6454 N  N     . ARG G 4 157 ? -68.394 -15.601 -5.558  1.00 50.84  ? 157  ARG G N     1 
ATOM   6455 C  CA    . ARG G 4 157 ? -67.899 -15.808 -6.918  1.00 53.78  ? 157  ARG G CA    1 
ATOM   6456 C  C     . ARG G 4 157 ? -66.403 -15.463 -7.019  1.00 53.59  ? 157  ARG G C     1 
ATOM   6457 O  O     . ARG G 4 157 ? -65.693 -16.034 -7.835  1.00 55.87  ? 157  ARG G O     1 
ATOM   6458 C  CB    . ARG G 4 157 ? -68.711 -14.990 -7.941  1.00 58.54  ? 157  ARG G CB    1 
ATOM   6459 C  CG    . ARG G 4 157 ? -70.218 -15.326 -8.015  1.00 50.98  ? 157  ARG G CG    1 
ATOM   6460 C  CD    . ARG G 4 157 ? -70.974 -14.252 -8.788  1.00 49.74  ? 157  ARG G CD    1 
ATOM   6461 N  NE    . ARG G 4 157 ? -70.942 -12.986 -8.072  1.00 57.16  ? 157  ARG G NE    1 
ATOM   6462 C  CZ    . ARG G 4 157 ? -70.996 -11.784 -8.636  1.00 63.54  ? 157  ARG G CZ    1 
ATOM   6463 N  NH1   . ARG G 4 157 ? -71.094 -11.659 -9.954  1.00 64.30  ? 157  ARG G NH1   1 
ATOM   6464 N  NH2   . ARG G 4 157 ? -70.939 -10.699 -7.870  1.00 62.74  ? 157  ARG G NH2   1 
ATOM   6465 N  N     . HIS G 4 158 ? -65.929 -14.543 -6.180  1.00 53.82  ? 158  HIS G N     1 
ATOM   6466 C  CA    . HIS G 4 158 ? -64.571 -14.032 -6.304  1.00 49.35  ? 158  HIS G CA    1 
ATOM   6467 C  C     . HIS G 4 158 ? -63.865 -13.870 -4.974  1.00 52.74  ? 158  HIS G C     1 
ATOM   6468 O  O     . HIS G 4 158 ? -62.791 -13.263 -4.910  1.00 59.12  ? 158  HIS G O     1 
ATOM   6469 C  CB    . HIS G 4 158 ? -64.557 -12.674 -7.001  1.00 56.70  ? 158  HIS G CB    1 
ATOM   6470 C  CG    . HIS G 4 158 ? -65.221 -12.667 -8.335  1.00 56.93  ? 158  HIS G CG    1 
ATOM   6471 N  ND1   . HIS G 4 158 ? -66.572 -12.447 -8.488  1.00 60.77  ? 158  HIS G ND1   1 
ATOM   6472 C  CD2   . HIS G 4 158 ? -64.721 -12.851 -9.578  1.00 56.47  ? 158  HIS G CD2   1 
ATOM   6473 C  CE1   . HIS G 4 158 ? -66.877 -12.494 -9.772  1.00 67.82  ? 158  HIS G CE1   1 
ATOM   6474 N  NE2   . HIS G 4 158 ? -65.771 -12.737 -10.455 1.00 70.09  ? 158  HIS G NE2   1 
ATOM   6475 N  N     . GLY G 4 159 ? -64.456 -14.386 -3.906  1.00 51.25  ? 159  GLY G N     1 
ATOM   6476 C  CA    . GLY G 4 159 ? -63.822 -14.271 -2.604  1.00 49.83  ? 159  GLY G CA    1 
ATOM   6477 C  C     . GLY G 4 159 ? -63.577 -12.824 -2.212  1.00 52.83  ? 159  GLY G C     1 
ATOM   6478 O  O     . GLY G 4 159 ? -62.516 -12.485 -1.718  1.00 49.28  ? 159  GLY G O     1 
ATOM   6479 N  N     . VAL G 4 160 ? -64.568 -11.963 -2.448  1.00 64.12  ? 160  VAL G N     1 
ATOM   6480 C  CA    . VAL G 4 160 ? -64.469 -10.572 -2.015  1.00 55.73  ? 160  VAL G CA    1 
ATOM   6481 C  C     . VAL G 4 160 ? -65.193 -10.361 -0.682  1.00 56.33  ? 160  VAL G C     1 
ATOM   6482 O  O     . VAL G 4 160 ? -66.385 -10.627 -0.558  1.00 56.99  ? 160  VAL G O     1 
ATOM   6483 C  CB    . VAL G 4 160 ? -65.031 -9.624  -3.062  1.00 52.62  ? 160  VAL G CB    1 
ATOM   6484 C  CG1   . VAL G 4 160 ? -64.991 -8.181  -2.547  1.00 49.67  ? 160  VAL G CG1   1 
ATOM   6485 C  CG2   . VAL G 4 160 ? -64.254 -9.769  -4.359  1.00 50.45  ? 160  VAL G CG2   1 
ATOM   6486 N  N     . TYR G 4 161 ? -64.448 -9.902  0.315   1.00 48.22  ? 161  TYR G N     1 
ATOM   6487 C  CA    . TYR G 4 161 ? -64.999 -9.633  1.633   1.00 49.04  ? 161  TYR G CA    1 
ATOM   6488 C  C     . TYR G 4 161 ? -65.620 -8.248  1.693   1.00 44.65  ? 161  TYR G C     1 
ATOM   6489 O  O     . TYR G 4 161 ? -65.322 -7.380  0.872   1.00 43.28  ? 161  TYR G O     1 
ATOM   6490 C  CB    . TYR G 4 161 ? -63.905 -9.754  2.708   1.00 43.75  ? 161  TYR G CB    1 
ATOM   6491 C  CG    . TYR G 4 161 ? -63.594 -11.175 3.096   1.00 48.01  ? 161  TYR G CG    1 
ATOM   6492 C  CD1   . TYR G 4 161 ? -62.685 -11.944 2.358   1.00 47.29  ? 161  TYR G CD1   1 
ATOM   6493 C  CD2   . TYR G 4 161 ? -64.213 -11.759 4.186   1.00 44.58  ? 161  TYR G CD2   1 
ATOM   6494 C  CE1   . TYR G 4 161 ? -62.403 -13.255 2.701   1.00 33.92  ? 161  TYR G CE1   1 
ATOM   6495 C  CE2   . TYR G 4 161 ? -63.935 -13.065 4.542   1.00 51.54  ? 161  TYR G CE2   1 
ATOM   6496 C  CZ    . TYR G 4 161 ? -63.029 -13.812 3.803   1.00 47.72  ? 161  TYR G CZ    1 
ATOM   6497 O  OH    . TYR G 4 161 ? -62.766 -15.114 4.192   1.00 50.64  ? 161  TYR G OH    1 
ATOM   6498 N  N     . VAL G 4 162 ? -66.471 -8.030  2.687   1.00 50.15  ? 162  VAL G N     1 
ATOM   6499 C  CA    . VAL G 4 162 ? -67.054 -6.708  2.867   1.00 47.07  ? 162  VAL G CA    1 
ATOM   6500 C  C     . VAL G 4 162 ? -66.952 -6.309  4.321   1.00 41.24  ? 162  VAL G C     1 
ATOM   6501 O  O     . VAL G 4 162 ? -67.057 -7.128  5.222   1.00 48.24  ? 162  VAL G O     1 
ATOM   6502 C  CB    . VAL G 4 162 ? -68.519 -6.648  2.355   1.00 46.60  ? 162  VAL G CB    1 
ATOM   6503 C  CG1   . VAL G 4 162 ? -69.440 -7.412  3.256   1.00 47.41  ? 162  VAL G CG1   1 
ATOM   6504 C  CG2   . VAL G 4 162 ? -68.971 -5.206  2.157   1.00 47.22  ? 162  VAL G CG2   1 
ATOM   6505 N  N     . LEU G 4 163 ? -66.600 -5.053  4.520   1.00 46.35  ? 163  LEU G N     1 
ATOM   6506 C  CA    . LEU G 4 163 ? -66.589 -4.427  5.820   1.00 44.81  ? 163  LEU G CA    1 
ATOM   6507 C  C     . LEU G 4 163 ? -67.766 -3.455  5.809   1.00 51.69  ? 163  LEU G C     1 
ATOM   6508 O  O     . LEU G 4 163 ? -67.870 -2.546  4.958   1.00 48.76  ? 163  LEU G O     1 
ATOM   6509 C  CB    . LEU G 4 163 ? -65.262 -3.715  6.078   1.00 43.88  ? 163  LEU G CB    1 
ATOM   6510 C  CG    . LEU G 4 163 ? -64.962 -3.237  7.504   1.00 49.38  ? 163  LEU G CG    1 
ATOM   6511 C  CD1   . LEU G 4 163 ? -63.515 -2.896  7.625   1.00 51.45  ? 163  LEU G CD1   1 
ATOM   6512 C  CD2   . LEU G 4 163 ? -65.812 -2.036  7.900   1.00 50.75  ? 163  LEU G CD2   1 
ATOM   6513 N  N     . ASN G 4 164 ? -68.675 -3.667  6.741   1.00 55.03  ? 164  ASN G N     1 
ATOM   6514 C  CA    . ASN G 4 164 ? -69.901 -2.895  6.772   1.00 48.20  ? 164  ASN G CA    1 
ATOM   6515 C  C     . ASN G 4 164 ? -69.889 -2.020  7.996   1.00 47.63  ? 164  ASN G C     1 
ATOM   6516 O  O     . ASN G 4 164 ? -69.706 -2.500  9.111   1.00 52.28  ? 164  ASN G O     1 
ATOM   6517 C  CB    . ASN G 4 164 ? -71.101 -3.823  6.760   1.00 52.73  ? 164  ASN G CB    1 
ATOM   6518 C  CG    . ASN G 4 164 ? -72.400 -3.088  6.773   1.00 55.36  ? 164  ASN G CG    1 
ATOM   6519 O  OD1   . ASN G 4 164 ? -72.846 -2.568  5.745   1.00 53.47  ? 164  ASN G OD1   1 
ATOM   6520 N  ND2   . ASN G 4 164 ? -73.042 -3.055  7.940   1.00 57.10  ? 164  ASN G ND2   1 
ATOM   6521 N  N     . ILE G 4 165 ? -70.027 -0.723  7.776   1.00 38.18  ? 165  ILE G N     1 
ATOM   6522 C  CA    . ILE G 4 165 ? -70.082 0.215   8.869   1.00 46.44  ? 165  ILE G CA    1 
ATOM   6523 C  C     . ILE G 4 165 ? -71.546 0.413   9.268   1.00 53.66  ? 165  ILE G C     1 
ATOM   6524 O  O     . ILE G 4 165 ? -72.423 0.645   8.420   1.00 50.34  ? 165  ILE G O     1 
ATOM   6525 C  CB    . ILE G 4 165 ? -69.417 1.545   8.484   1.00 51.70  ? 165  ILE G CB    1 
ATOM   6526 C  CG1   . ILE G 4 165 ? -67.931 1.311   8.209   1.00 51.56  ? 165  ILE G CG1   1 
ATOM   6527 C  CG2   . ILE G 4 165 ? -69.567 2.565   9.594   1.00 51.22  ? 165  ILE G CG2   1 
ATOM   6528 C  CD1   . ILE G 4 165 ? -67.385 2.152   7.083   1.00 55.13  ? 165  ILE G CD1   1 
ATOM   6529 N  N     . SER G 4 166 ? -71.807 0.271   10.562  1.00 60.90  ? 166  SER G N     1 
ATOM   6530 C  CA    . SER G 4 166 ? -73.161 0.399   11.078  1.00 66.35  ? 166  SER G CA    1 
ATOM   6531 C  C     . SER G 4 166 ? -73.705 1.773   10.761  1.00 63.36  ? 166  SER G C     1 
ATOM   6532 O  O     . SER G 4 166 ? -72.980 2.763   10.836  1.00 64.98  ? 166  SER G O     1 
ATOM   6533 C  CB    . SER G 4 166 ? -73.205 0.160   12.587  1.00 61.62  ? 166  SER G CB    1 
ATOM   6534 O  OG    . SER G 4 166 ? -74.552 0.108   13.017  1.00 67.31  ? 166  SER G OG    1 
ATOM   6535 N  N     . LEU G 4 167 ? -74.979 1.840   10.400  1.00 60.53  ? 167  LEU G N     1 
ATOM   6536 C  CA    . LEU G 4 167 ? -75.573 3.124   10.067  1.00 58.04  ? 167  LEU G CA    1 
ATOM   6537 C  C     . LEU G 4 167 ? -75.863 3.912   11.331  1.00 61.48  ? 167  LEU G C     1 
ATOM   6538 O  O     . LEU G 4 167 ? -76.099 5.111   11.274  1.00 70.45  ? 167  LEU G O     1 
ATOM   6539 C  CB    . LEU G 4 167 ? -76.827 2.931   9.240   1.00 61.95  ? 167  LEU G CB    1 
ATOM   6540 C  CG    . LEU G 4 167 ? -76.453 2.431   7.852   1.00 54.63  ? 167  LEU G CG    1 
ATOM   6541 C  CD1   . LEU G 4 167 ? -77.662 2.183   7.021   1.00 54.36  ? 167  LEU G CD1   1 
ATOM   6542 C  CD2   . LEU G 4 167 ? -75.568 3.462   7.198   1.00 63.95  ? 167  LEU G CD2   1 
ATOM   6543 N  N     . ARG G 4 168 ? -75.807 3.236   12.474  1.00 59.73  ? 168  ARG G N     1 
ATOM   6544 C  CA    . ARG G 4 168 ? -75.944 3.886   13.771  1.00 57.54  ? 168  ARG G CA    1 
ATOM   6545 C  C     . ARG G 4 168 ? -74.863 4.920   14.007  1.00 65.97  ? 168  ARG G C     1 
ATOM   6546 O  O     . ARG G 4 168 ? -75.042 5.862   14.775  1.00 72.22  ? 168  ARG G O     1 
ATOM   6547 C  CB    . ARG G 4 168 ? -75.927 2.843   14.898  1.00 65.85  ? 168  ARG G CB    1 
ATOM   6548 C  CG    . ARG G 4 168 ? -77.168 1.956   14.888  1.00 75.84  ? 168  ARG G CG    1 
ATOM   6549 C  CD    . ARG G 4 168 ? -76.994 0.630   15.609  1.00 81.76  ? 168  ARG G CD    1 
ATOM   6550 N  NE    . ARG G 4 168 ? -78.255 -0.119  15.580  1.00 96.06  ? 168  ARG G NE    1 
ATOM   6551 C  CZ    . ARG G 4 168 ? -78.391 -1.348  15.080  1.00 94.94  ? 168  ARG G CZ    1 
ATOM   6552 N  NH1   . ARG G 4 168 ? -77.338 -1.986  14.565  1.00 83.82  ? 168  ARG G NH1   1 
ATOM   6553 N  NH2   . ARG G 4 168 ? -79.583 -1.944  15.097  1.00 90.17  ? 168  ARG G NH2   1 
ATOM   6554 N  N     . ASP G 4 169 ? -73.730 4.741   13.349  1.00 70.74  ? 169  ASP G N     1 
ATOM   6555 C  CA    . ASP G 4 169 ? -72.605 5.621   13.580  1.00 61.22  ? 169  ASP G CA    1 
ATOM   6556 C  C     . ASP G 4 169 ? -72.260 6.361   12.301  1.00 66.40  ? 169  ASP G C     1 
ATOM   6557 O  O     . ASP G 4 169 ? -71.165 6.902   12.164  1.00 68.02  ? 169  ASP G O     1 
ATOM   6558 C  CB    . ASP G 4 169 ? -71.433 4.818   14.104  1.00 54.01  ? 169  ASP G CB    1 
ATOM   6559 C  CG    . ASP G 4 169 ? -71.722 4.234   15.463  1.00 70.58  ? 169  ASP G CG    1 
ATOM   6560 O  OD1   . ASP G 4 169 ? -72.535 4.843   16.195  1.00 78.64  ? 169  ASP G OD1   1 
ATOM   6561 O  OD2   . ASP G 4 169 ? -71.147 3.181   15.809  1.00 70.97  ? 169  ASP G OD2   1 
ATOM   6562 N  N     . ARG G 4 170 ? -73.224 6.390   11.381  1.00 62.73  ? 170  ARG G N     1 
ATOM   6563 C  CA    . ARG G 4 170 ? -73.059 7.063   10.108  1.00 64.95  ? 170  ARG G CA    1 
ATOM   6564 C  C     . ARG G 4 170 ? -72.453 8.447   10.256  1.00 69.42  ? 170  ARG G C     1 
ATOM   6565 O  O     . ARG G 4 170 ? -71.469 8.781   9.591   1.00 78.39  ? 170  ARG G O     1 
ATOM   6566 C  CB    . ARG G 4 170 ? -74.395 7.181   9.379   1.00 70.72  ? 170  ARG G CB    1 
ATOM   6567 C  CG    . ARG G 4 170 ? -74.323 8.151   8.220   1.00 74.66  ? 170  ARG G CG    1 
ATOM   6568 C  CD    . ARG G 4 170 ? -75.686 8.592   7.742   1.00 74.79  ? 170  ARG G CD    1 
ATOM   6569 N  NE    . ARG G 4 170 ? -76.085 7.878   6.535   1.00 78.05  ? 170  ARG G NE    1 
ATOM   6570 C  CZ    . ARG G 4 170 ? -76.886 6.819   6.535   1.00 80.29  ? 170  ARG G CZ    1 
ATOM   6571 N  NH1   . ARG G 4 170 ? -77.360 6.353   7.689   1.00 74.14  ? 170  ARG G NH1   1 
ATOM   6572 N  NH2   . ARG G 4 170 ? -77.209 6.225   5.388   1.00 74.52  ? 170  ARG G NH2   1 
ATOM   6573 N  N     . ILE G 4 171 ? -73.024 9.258   11.132  1.00 67.41  ? 171  ILE G N     1 
ATOM   6574 C  CA    . ILE G 4 171 ? -72.564 10.632  11.218  1.00 71.70  ? 171  ILE G CA    1 
ATOM   6575 C  C     . ILE G 4 171 ? -71.137 10.685  11.749  1.00 67.29  ? 171  ILE G C     1 
ATOM   6576 O  O     . ILE G 4 171 ? -70.305 11.409  11.207  1.00 70.52  ? 171  ILE G O     1 
ATOM   6577 C  CB    . ILE G 4 171 ? -73.500 11.489  12.078  1.00 71.80  ? 171  ILE G CB    1 
ATOM   6578 C  CG1   . ILE G 4 171 ? -74.784 11.774  11.290  1.00 72.39  ? 171  ILE G CG1   1 
ATOM   6579 C  CG2   . ILE G 4 171 ? -72.823 12.790  12.461  1.00 66.48  ? 171  ILE G CG2   1 
ATOM   6580 C  CD1   . ILE G 4 171 ? -75.859 12.457  12.083  1.00 76.51  ? 171  ILE G CD1   1 
ATOM   6581 N  N     . LYS G 4 172 ? -70.843 9.891   12.772  1.00 62.59  ? 172  LYS G N     1 
ATOM   6582 C  CA    . LYS G 4 172 ? -69.503 9.880   13.346  1.00 67.72  ? 172  LYS G CA    1 
ATOM   6583 C  C     . LYS G 4 172 ? -68.488 9.423   12.319  1.00 70.25  ? 172  LYS G C     1 
ATOM   6584 O  O     . LYS G 4 172 ? -67.371 9.940   12.257  1.00 69.23  ? 172  LYS G O     1 
ATOM   6585 C  CB    . LYS G 4 172 ? -69.421 8.968   14.566  1.00 69.21  ? 172  LYS G CB    1 
ATOM   6586 C  CG    . LYS G 4 172 ? -68.079 9.040   15.268  1.00 68.12  ? 172  LYS G CG    1 
ATOM   6587 C  CD    . LYS G 4 172 ? -67.983 8.001   16.352  1.00 65.10  ? 172  LYS G CD    1 
ATOM   6588 C  CE    . LYS G 4 172 ? -68.937 8.302   17.487  1.00 72.70  ? 172  LYS G CE    1 
ATOM   6589 N  NZ    . LYS G 4 172 ? -68.850 7.267   18.562  1.00 83.85  ? 172  LYS G NZ    1 
ATOM   6590 N  N     . PHE G 4 173 ? -68.882 8.443   11.517  1.00 65.68  ? 173  PHE G N     1 
ATOM   6591 C  CA    . PHE G 4 173 ? -68.002 7.960   10.482  1.00 66.66  ? 173  PHE G CA    1 
ATOM   6592 C  C     . PHE G 4 173 ? -67.721 9.076   9.474   1.00 73.06  ? 173  PHE G C     1 
ATOM   6593 O  O     . PHE G 4 173 ? -66.570 9.496   9.313   1.00 71.69  ? 173  PHE G O     1 
ATOM   6594 C  CB    . PHE G 4 173 ? -68.582 6.725   9.778   1.00 62.18  ? 173  PHE G CB    1 
ATOM   6595 C  CG    . PHE G 4 173 ? -67.716 6.234   8.644   1.00 66.40  ? 173  PHE G CG    1 
ATOM   6596 C  CD1   . PHE G 4 173 ? -66.464 5.694   8.900   1.00 63.35  ? 173  PHE G CD1   1 
ATOM   6597 C  CD2   . PHE G 4 173 ? -68.127 6.366   7.325   1.00 61.32  ? 173  PHE G CD2   1 
ATOM   6598 C  CE1   . PHE G 4 173 ? -65.656 5.278   7.864   1.00 58.37  ? 173  PHE G CE1   1 
ATOM   6599 C  CE2   . PHE G 4 173 ? -67.330 5.946   6.291   1.00 59.66  ? 173  PHE G CE2   1 
ATOM   6600 C  CZ    . PHE G 4 173 ? -66.095 5.399   6.558   1.00 58.81  ? 173  PHE G CZ    1 
ATOM   6601 N  N     . VAL G 4 174 ? -68.771 9.563   8.816   1.00 67.79  ? 174  VAL G N     1 
ATOM   6602 C  CA    . VAL G 4 174 ? -68.623 10.566  7.764   1.00 68.87  ? 174  VAL G CA    1 
ATOM   6603 C  C     . VAL G 4 174 ? -67.875 11.826  8.230   1.00 74.47  ? 174  VAL G C     1 
ATOM   6604 O  O     . VAL G 4 174 ? -67.124 12.432  7.466   1.00 79.67  ? 174  VAL G O     1 
ATOM   6605 C  CB    . VAL G 4 174 ? -70.001 10.968  7.193   1.00 62.31  ? 174  VAL G CB    1 
ATOM   6606 C  CG1   . VAL G 4 174 ? -69.838 11.971  6.098   1.00 56.73  ? 174  VAL G CG1   1 
ATOM   6607 C  CG2   . VAL G 4 174 ? -70.712 9.752   6.635   1.00 56.81  ? 174  VAL G CG2   1 
ATOM   6608 N  N     . HIS G 4 175 ? -68.052 12.203  9.490   1.00 84.06  ? 175  HIS G N     1 
ATOM   6609 C  CA    . HIS G 4 175 ? -67.462 13.438  9.985   1.00 87.21  ? 175  HIS G CA    1 
ATOM   6610 C  C     . HIS G 4 175 ? -65.989 13.231  10.292  1.00 95.92  ? 175  HIS G C     1 
ATOM   6611 O  O     . HIS G 4 175 ? -65.150 14.067  9.953   1.00 105.27 ? 175  HIS G O     1 
ATOM   6612 C  CB    . HIS G 4 175 ? -68.206 13.936  11.232  1.00 98.55  ? 175  HIS G CB    1 
ATOM   6613 C  CG    . HIS G 4 175 ? -67.780 15.299  11.694  1.00 121.08 ? 175  HIS G CG    1 
ATOM   6614 N  ND1   . HIS G 4 175 ? -66.648 15.512  12.456  1.00 127.02 ? 175  HIS G ND1   1 
ATOM   6615 C  CD2   . HIS G 4 175 ? -68.338 16.520  11.506  1.00 127.61 ? 175  HIS G CD2   1 
ATOM   6616 C  CE1   . HIS G 4 175 ? -66.527 16.803  12.713  1.00 124.39 ? 175  HIS G CE1   1 
ATOM   6617 N  NE2   . HIS G 4 175 ? -67.539 17.436  12.147  1.00 126.91 ? 175  HIS G NE2   1 
ATOM   6618 N  N     . THR G 4 176 ? -65.669 12.109  10.924  1.00 79.66  ? 176  THR G N     1 
ATOM   6619 C  CA    . THR G 4 176 ? -64.305 11.856  11.374  1.00 73.29  ? 176  THR G CA    1 
ATOM   6620 C  C     . THR G 4 176 ? -63.376 11.344  10.268  1.00 78.91  ? 176  THR G C     1 
ATOM   6621 O  O     . THR G 4 176 ? -62.208 11.735  10.195  1.00 82.36  ? 176  THR G O     1 
ATOM   6622 C  CB    . THR G 4 176 ? -64.297 10.841  12.526  1.00 74.51  ? 176  THR G CB    1 
ATOM   6623 O  OG1   . THR G 4 176 ? -65.148 11.313  13.577  1.00 83.92  ? 176  THR G OG1   1 
ATOM   6624 C  CG2   . THR G 4 176 ? -62.886 10.630  13.064  1.00 76.23  ? 176  THR G CG2   1 
ATOM   6625 N  N     . ILE G 4 177 ? -63.888 10.472  9.404   1.00 79.46  ? 177  ILE G N     1 
ATOM   6626 C  CA    . ILE G 4 177 ? -63.035 9.830   8.411   1.00 76.58  ? 177  ILE G CA    1 
ATOM   6627 C  C     . ILE G 4 177 ? -63.046 10.519  7.053   1.00 83.30  ? 177  ILE G C     1 
ATOM   6628 O  O     . ILE G 4 177 ? -61.987 10.808  6.499   1.00 84.40  ? 177  ILE G O     1 
ATOM   6629 C  CB    . ILE G 4 177 ? -63.427 8.362   8.182   1.00 72.27  ? 177  ILE G CB    1 
ATOM   6630 C  CG1   . ILE G 4 177 ? -63.467 7.587   9.502   1.00 69.40  ? 177  ILE G CG1   1 
ATOM   6631 C  CG2   . ILE G 4 177 ? -62.454 7.718   7.201   1.00 63.15  ? 177  ILE G CG2   1 
ATOM   6632 C  CD1   . ILE G 4 177 ? -62.117 7.382   10.142  1.00 62.11  ? 177  ILE G CD1   1 
ATOM   6633 N  N     . LEU G 4 178 ? -64.232 10.765  6.504   1.00 75.02  ? 178  LEU G N     1 
ATOM   6634 C  CA    . LEU G 4 178 ? -64.313 11.266  5.139   1.00 72.12  ? 178  LEU G CA    1 
ATOM   6635 C  C     . LEU G 4 178 ? -64.211 12.774  5.031   1.00 75.24  ? 178  LEU G C     1 
ATOM   6636 O  O     . LEU G 4 178 ? -63.862 13.286  3.976   1.00 78.17  ? 178  LEU G O     1 
ATOM   6637 C  CB    . LEU G 4 178 ? -65.604 10.797  4.468   1.00 69.29  ? 178  LEU G CB    1 
ATOM   6638 C  CG    . LEU G 4 178 ? -65.867 9.298   4.553   1.00 71.14  ? 178  LEU G CG    1 
ATOM   6639 C  CD1   . LEU G 4 178 ? -67.279 8.974   4.108   1.00 65.85  ? 178  LEU G CD1   1 
ATOM   6640 C  CD2   . LEU G 4 178 ? -64.847 8.554   3.709   1.00 61.29  ? 178  LEU G CD2   1 
ATOM   6641 N  N     . SER G 4 179 ? -64.506 13.488  6.111   1.00 97.53  ? 179  SER G N     1 
ATOM   6642 C  CA    . SER G 4 179 ? -64.457 14.947  6.070   1.00 100.28 ? 179  SER G CA    1 
ATOM   6643 C  C     . SER G 4 179 ? -63.299 15.508  6.888   1.00 111.37 ? 179  SER G C     1 
ATOM   6644 O  O     . SER G 4 179 ? -63.437 16.543  7.547   1.00 115.83 ? 179  SER G O     1 
ATOM   6645 C  CB    . SER G 4 179 ? -65.772 15.541  6.565   1.00 101.10 ? 179  SER G CB    1 
ATOM   6646 O  OG    . SER G 4 179 ? -65.870 15.424  7.970   1.00 109.15 ? 179  SER G OG    1 
ATOM   6647 N  N     . SER G 4 180 ? -62.161 14.817  6.846   1.00 117.55 ? 180  SER G N     1 
ATOM   6648 C  CA    . SER G 4 180 ? -60.921 15.322  7.436   1.00 125.37 ? 180  SER G CA    1 
ATOM   6649 C  C     . SER G 4 180 ? -60.094 16.066  6.371   1.00 136.92 ? 180  SER G C     1 
ATOM   6650 O  O     . SER G 4 180 ? -60.647 16.514  5.360   1.00 128.39 ? 180  SER G O     1 
ATOM   6651 C  CB    . SER G 4 180 ? -60.116 14.178  8.071   1.00 115.96 ? 180  SER G CB    1 
ATOM   6652 O  OG    . SER G 4 180 ? -59.559 13.315  7.093   1.00 111.93 ? 180  SER G OG    1 
ATOM   6653 N  N     . HIS G 4 181 ? -58.785 16.194  6.600   1.00 137.18 ? 181  HIS G N     1 
ATOM   6654 C  CA    . HIS G 4 181 ? -57.908 16.995  5.732   1.00 140.09 ? 181  HIS G CA    1 
ATOM   6655 C  C     . HIS G 4 181 ? -58.447 18.415  5.527   1.00 147.90 ? 181  HIS G C     1 
ATOM   6656 O  O     . HIS G 4 181 ? -59.132 18.699  4.543   1.00 140.87 ? 181  HIS G O     1 
ATOM   6657 C  CB    . HIS G 4 181 ? -57.700 16.311  4.371   1.00 135.98 ? 181  HIS G CB    1 
ATOM   6658 C  CG    . HIS G 4 181 ? -57.014 14.980  4.455   1.00 134.77 ? 181  HIS G CG    1 
ATOM   6659 N  ND1   . HIS G 4 181 ? -55.814 14.721  3.826   1.00 124.74 ? 181  HIS G ND1   1 
ATOM   6660 C  CD2   . HIS G 4 181 ? -57.351 13.842  5.106   1.00 121.63 ? 181  HIS G CD2   1 
ATOM   6661 C  CE1   . HIS G 4 181 ? -55.446 13.478  4.079   1.00 107.45 ? 181  HIS G CE1   1 
ATOM   6662 N  NE2   . HIS G 4 181 ? -56.360 12.924  4.856   1.00 100.82 ? 181  HIS G NE2   1 
ATOM   6663 O  "O5'" . DG  H 2 1   ? -98.032 -0.947  9.260   1.00 90.72  ? 1    DG  H "O5'" 1 
ATOM   6664 C  "C5'" . DG  H 2 1   ? -97.512 -0.100  8.229   1.00 92.54  ? 1    DG  H "C5'" 1 
ATOM   6665 C  "C4'" . DG  H 2 1   ? -96.405 0.777   8.774   1.00 97.07  ? 1    DG  H "C4'" 1 
ATOM   6666 O  "O4'" . DG  H 2 1   ? -95.701 0.041   9.807   1.00 103.28 ? 1    DG  H "O4'" 1 
ATOM   6667 C  "C3'" . DG  H 2 1   ? -95.321 1.170   7.769   1.00 107.69 ? 1    DG  H "C3'" 1 
ATOM   6668 O  "O3'" . DG  H 2 1   ? -94.655 2.366   8.220   1.00 106.02 ? 1    DG  H "O3'" 1 
ATOM   6669 C  "C2'" . DG  H 2 1   ? -94.393 -0.039  7.844   1.00 100.26 ? 1    DG  H "C2'" 1 
ATOM   6670 C  "C1'" . DG  H 2 1   ? -94.387 -0.268  9.356   1.00 98.33  ? 1    DG  H "C1'" 1 
ATOM   6671 N  N9    . DG  H 2 1   ? -94.054 -1.632  9.785   1.00 89.55  ? 1    DG  H N9    1 
ATOM   6672 C  C8    . DG  H 2 1   ? -94.415 -2.828  9.180   1.00 88.92  ? 1    DG  H C8    1 
ATOM   6673 N  N7    . DG  H 2 1   ? -93.977 -3.887  9.820   1.00 83.36  ? 1    DG  H N7    1 
ATOM   6674 C  C5    . DG  H 2 1   ? -93.291 -3.355  10.920  1.00 83.06  ? 1    DG  H C5    1 
ATOM   6675 C  C6    . DG  H 2 1   ? -92.596 -4.008  11.974  1.00 85.63  ? 1    DG  H C6    1 
ATOM   6676 O  O6    . DG  H 2 1   ? -92.451 -5.231  12.158  1.00 89.11  ? 1    DG  H O6    1 
ATOM   6677 N  N1    . DG  H 2 1   ? -92.052 -3.090  12.883  1.00 76.73  ? 1    DG  H N1    1 
ATOM   6678 C  C2    . DG  H 2 1   ? -92.157 -1.721  12.778  1.00 77.59  ? 1    DG  H C2    1 
ATOM   6679 N  N2    . DG  H 2 1   ? -91.562 -1.002  13.740  1.00 79.34  ? 1    DG  H N2    1 
ATOM   6680 N  N3    . DG  H 2 1   ? -92.800 -1.099  11.797  1.00 75.93  ? 1    DG  H N3    1 
ATOM   6681 C  C4    . DG  H 2 1   ? -93.339 -1.973  10.909  1.00 78.10  ? 1    DG  H C4    1 
ATOM   6682 P  P     . DC  H 2 2   ? -94.102 3.437   7.159   1.00 110.59 ? 2    DC  H P     1 
ATOM   6683 O  OP1   . DC  H 2 2   ? -94.656 4.751   7.548   1.00 114.95 ? 2    DC  H OP1   1 
ATOM   6684 O  OP2   . DC  H 2 2   ? -94.333 2.883   5.800   1.00 89.65  ? 2    DC  H OP2   1 
ATOM   6685 O  "O5'" . DC  H 2 2   ? -92.519 3.473   7.423   1.00 110.26 ? 2    DC  H "O5'" 1 
ATOM   6686 C  "C5'" . DC  H 2 2   ? -91.949 4.441   8.322   1.00 98.82  ? 2    DC  H "C5'" 1 
ATOM   6687 C  "C4'" . DC  H 2 2   ? -90.758 3.849   9.076   1.00 92.17  ? 2    DC  H "C4'" 1 
ATOM   6688 O  "O4'" . DC  H 2 2   ? -91.030 2.463   9.392   1.00 89.73  ? 2    DC  H "O4'" 1 
ATOM   6689 C  "C3'" . DC  H 2 2   ? -89.421 3.841   8.311   1.00 86.95  ? 2    DC  H "C3'" 1 
ATOM   6690 O  "O3'" . DC  H 2 2   ? -88.508 4.761   8.896   1.00 78.62  ? 2    DC  H "O3'" 1 
ATOM   6691 C  "C2'" . DC  H 2 2   ? -88.909 2.388   8.419   1.00 82.34  ? 2    DC  H "C2'" 1 
ATOM   6692 C  "C1'" . DC  H 2 2   ? -89.802 1.789   9.501   1.00 80.06  ? 2    DC  H "C1'" 1 
ATOM   6693 N  N1    . DC  H 2 2   ? -90.043 0.308   9.364   1.00 65.52  ? 2    DC  H N1    1 
ATOM   6694 C  C2    . DC  H 2 2   ? -89.619 -0.547  10.378  1.00 66.93  ? 2    DC  H C2    1 
ATOM   6695 O  O2    . DC  H 2 2   ? -89.049 -0.063  11.362  1.00 75.50  ? 2    DC  H O2    1 
ATOM   6696 N  N3    . DC  H 2 2   ? -89.841 -1.883  10.256  1.00 62.67  ? 2    DC  H N3    1 
ATOM   6697 C  C4    . DC  H 2 2   ? -90.459 -2.361  9.179   1.00 66.90  ? 2    DC  H C4    1 
ATOM   6698 N  N4    . DC  H 2 2   ? -90.651 -3.686  9.099   1.00 63.73  ? 2    DC  H N4    1 
ATOM   6699 C  C5    . DC  H 2 2   ? -90.906 -1.503  8.134   1.00 70.04  ? 2    DC  H C5    1 
ATOM   6700 C  C6    . DC  H 2 2   ? -90.676 -0.187  8.267   1.00 72.98  ? 2    DC  H C6    1 
ATOM   6701 P  P     . DC  H 2 3   ? -87.185 5.196   8.090   1.00 99.85  ? 3    DC  H P     1 
ATOM   6702 O  OP1   . DC  H 2 3   ? -86.848 6.597   8.445   1.00 95.32  ? 3    DC  H OP1   1 
ATOM   6703 O  OP2   . DC  H 2 3   ? -87.355 4.812   6.670   1.00 87.51  ? 3    DC  H OP2   1 
ATOM   6704 O  "O5'" . DC  H 2 3   ? -86.054 4.257   8.706   1.00 97.89  ? 3    DC  H "O5'" 1 
ATOM   6705 C  "C5'" . DC  H 2 3   ? -85.746 4.337   10.094  1.00 91.14  ? 3    DC  H "C5'" 1 
ATOM   6706 C  "C4'" . DC  H 2 3   ? -84.859 3.177   10.523  1.00 88.40  ? 3    DC  H "C4'" 1 
ATOM   6707 O  "O4'" . DC  H 2 3   ? -85.575 1.928   10.383  1.00 92.82  ? 3    DC  H "O4'" 1 
ATOM   6708 C  "C3'" . DC  H 2 3   ? -83.560 3.024   9.731   1.00 81.55  ? 3    DC  H "C3'" 1 
ATOM   6709 O  "O3'" . DC  H 2 3   ? -82.480 3.213   10.602  1.00 84.41  ? 3    DC  H "O3'" 1 
ATOM   6710 C  "C2'" . DC  H 2 3   ? -83.602 1.589   9.173   1.00 78.79  ? 3    DC  H "C2'" 1 
ATOM   6711 C  "C1'" . DC  H 2 3   ? -84.673 0.915   10.028  1.00 78.73  ? 3    DC  H "C1'" 1 
ATOM   6712 N  N1    . DC  H 2 3   ? -85.440 -0.141  9.305   1.00 71.17  ? 3    DC  H N1    1 
ATOM   6713 C  C2    . DC  H 2 3   ? -85.419 -1.470  9.770   1.00 75.29  ? 3    DC  H C2    1 
ATOM   6714 O  O2    . DC  H 2 3   ? -84.749 -1.755  10.781  1.00 74.74  ? 3    DC  H O2    1 
ATOM   6715 N  N3    . DC  H 2 3   ? -86.130 -2.415  9.089   1.00 73.74  ? 3    DC  H N3    1 
ATOM   6716 C  C4    . DC  H 2 3   ? -86.834 -2.072  8.004   1.00 70.90  ? 3    DC  H C4    1 
ATOM   6717 N  N4    . DC  H 2 3   ? -87.511 -3.031  7.370   1.00 67.42  ? 3    DC  H N4    1 
ATOM   6718 C  C5    . DC  H 2 3   ? -86.871 -0.728  7.525   1.00 71.13  ? 3    DC  H C5    1 
ATOM   6719 C  C6    . DC  H 2 3   ? -86.167 0.196   8.202   1.00 70.69  ? 3    DC  H C6    1 
ATOM   6720 P  P     . DT  H 2 4   ? -80.984 3.276   10.039  1.00 89.47  ? 4    DT  H P     1 
ATOM   6721 O  OP1   . DT  H 2 4   ? -80.195 4.102   10.993  1.00 81.96  ? 4    DT  H OP1   1 
ATOM   6722 O  OP2   . DT  H 2 4   ? -81.030 3.627   8.601   1.00 78.53  ? 4    DT  H OP2   1 
ATOM   6723 O  "O5'" . DT  H 2 4   ? -80.497 1.758   10.153  1.00 84.25  ? 4    DT  H "O5'" 1 
ATOM   6724 C  "C5'" . DT  H 2 4   ? -80.477 1.124   11.417  1.00 75.67  ? 4    DT  H "C5'" 1 
ATOM   6725 C  "C4'" . DT  H 2 4   ? -80.152 -0.347  11.274  1.00 73.28  ? 4    DT  H "C4'" 1 
ATOM   6726 O  "O4'" . DT  H 2 4   ? -81.212 -0.998  10.555  1.00 70.49  ? 4    DT  H "O4'" 1 
ATOM   6727 C  "C3'" . DT  H 2 4   ? -78.860 -0.670  10.503  1.00 72.76  ? 4    DT  H "C3'" 1 
ATOM   6728 O  "O3'" . DT  H 2 4   ? -77.972 -1.407  11.355  1.00 80.88  ? 4    DT  H "O3'" 1 
ATOM   6729 C  "C2'" . DT  H 2 4   ? -79.335 -1.519  9.315   1.00 68.69  ? 4    DT  H "C2'" 1 
ATOM   6730 C  "C1'" . DT  H 2 4   ? -80.660 -2.056  9.830   1.00 66.69  ? 4    DT  H "C1'" 1 
ATOM   6731 N  N1    . DT  H 2 4   ? -81.617 -2.416  8.774   1.00 59.66  ? 4    DT  H N1    1 
ATOM   6732 C  C2    . DT  H 2 4   ? -81.985 -3.727  8.624   1.00 64.49  ? 4    DT  H C2    1 
ATOM   6733 O  O2    . DT  H 2 4   ? -81.546 -4.631  9.323   1.00 68.98  ? 4    DT  H O2    1 
ATOM   6734 N  N3    . DT  H 2 4   ? -82.891 -3.951  7.616   1.00 68.89  ? 4    DT  H N3    1 
ATOM   6735 C  C4    . DT  H 2 4   ? -83.456 -3.001  6.772   1.00 66.84  ? 4    DT  H C4    1 
ATOM   6736 O  O4    . DT  H 2 4   ? -84.269 -3.291  5.898   1.00 65.29  ? 4    DT  H O4    1 
ATOM   6737 C  C5    . DT  H 2 4   ? -83.021 -1.649  6.993   1.00 61.22  ? 4    DT  H C5    1 
ATOM   6738 C  C7    . DT  H 2 4   ? -83.548 -0.546  6.145   1.00 62.52  ? 4    DT  H C7    1 
ATOM   6739 C  C6    . DT  H 2 4   ? -82.140 -1.423  7.975   1.00 64.16  ? 4    DT  H C6    1 
ATOM   6740 P  P     . DT  H 2 5   ? -76.439 -1.644  10.945  1.00 60.39  ? 5    DT  H P     1 
ATOM   6741 O  OP1   . DT  H 2 5   ? -75.694 -1.860  12.201  1.00 50.34  ? 5    DT  H OP1   1 
ATOM   6742 O  OP2   . DT  H 2 5   ? -76.004 -0.592  10.001  1.00 60.84  ? 5    DT  H OP2   1 
ATOM   6743 O  "O5'" . DT  H 2 5   ? -76.508 -2.983  10.107  1.00 53.86  ? 5    DT  H "O5'" 1 
ATOM   6744 C  "C5'" . DT  H 2 5   ? -76.666 -4.203  10.769  1.00 56.35  ? 5    DT  H "C5'" 1 
ATOM   6745 C  "C4'" . DT  H 2 5   ? -76.959 -5.293  9.767   1.00 60.81  ? 5    DT  H "C4'" 1 
ATOM   6746 O  "O4'" . DT  H 2 5   ? -78.125 -4.917  8.976   1.00 62.77  ? 5    DT  H "O4'" 1 
ATOM   6747 C  "C3'" . DT  H 2 5   ? -75.829 -5.558  8.749   1.00 56.79  ? 5    DT  H "C3'" 1 
ATOM   6748 O  "O3'" . DT  H 2 5   ? -75.537 -6.948  8.701   1.00 65.51  ? 5    DT  H "O3'" 1 
ATOM   6749 C  "C2'" . DT  H 2 5   ? -76.434 -5.088  7.429   1.00 58.65  ? 5    DT  H "C2'" 1 
ATOM   6750 C  "C1'" . DT  H 2 5   ? -77.899 -5.390  7.682   1.00 57.34  ? 5    DT  H "C1'" 1 
ATOM   6751 N  N1    . DT  H 2 5   ? -78.816 -4.749  6.734   1.00 52.87  ? 5    DT  H N1    1 
ATOM   6752 C  C2    . DT  H 2 5   ? -79.720 -5.543  6.070   1.00 62.55  ? 5    DT  H C2    1 
ATOM   6753 O  O2    . DT  H 2 5   ? -79.822 -6.745  6.274   1.00 60.76  ? 5    DT  H O2    1 
ATOM   6754 N  N3    . DT  H 2 5   ? -80.518 -4.881  5.170   1.00 58.72  ? 5    DT  H N3    1 
ATOM   6755 C  C4    . DT  H 2 5   ? -80.499 -3.526  4.882   1.00 57.74  ? 5    DT  H C4    1 
ATOM   6756 O  O4    . DT  H 2 5   ? -81.264 -3.018  4.066   1.00 59.91  ? 5    DT  H O4    1 
ATOM   6757 C  C5    . DT  H 2 5   ? -79.512 -2.752  5.605   1.00 52.54  ? 5    DT  H C5    1 
ATOM   6758 C  C7    . DT  H 2 5   ? -79.393 -1.274  5.366   1.00 44.19  ? 5    DT  H C7    1 
ATOM   6759 C  C6    . DT  H 2 5   ? -78.723 -3.398  6.485   1.00 48.54  ? 5    DT  H C6    1 
ATOM   6760 P  P     . DG  H 2 6   ? -74.074 -7.480  8.285   1.00 62.51  ? 6    DG  H P     1 
ATOM   6761 O  OP1   . DG  H 2 6   ? -73.344 -7.595  9.556   1.00 57.26  ? 6    DG  H OP1   1 
ATOM   6762 O  OP2   . DG  H 2 6   ? -73.527 -6.682  7.153   1.00 59.09  ? 6    DG  H OP2   1 
ATOM   6763 O  "O5'" . DG  H 2 6   ? -74.351 -8.960  7.745   1.00 58.58  ? 6    DG  H "O5'" 1 
ATOM   6764 C  "C5'" . DG  H 2 6   ? -75.100 -9.881  8.540   1.00 57.46  ? 6    DG  H "C5'" 1 
ATOM   6765 C  "C4'" . DG  H 2 6   ? -75.921 -10.798 7.658   1.00 59.42  ? 6    DG  H "C4'" 1 
ATOM   6766 O  "O4'" . DG  H 2 6   ? -76.978 -10.037 7.026   1.00 59.51  ? 6    DG  H "O4'" 1 
ATOM   6767 C  "C3'" . DG  H 2 6   ? -75.148 -11.466 6.524   1.00 58.63  ? 6    DG  H "C3'" 1 
ATOM   6768 O  "O3'" . DG  H 2 6   ? -75.584 -12.778 6.363   1.00 66.34  ? 6    DG  H "O3'" 1 
ATOM   6769 C  "C2'" . DG  H 2 6   ? -75.499 -10.629 5.302   1.00 55.68  ? 6    DG  H "C2'" 1 
ATOM   6770 C  "C1'" . DG  H 2 6   ? -76.911 -10.189 5.619   1.00 64.33  ? 6    DG  H "C1'" 1 
ATOM   6771 N  N9    . DG  H 2 6   ? -77.247 -8.908  5.007   1.00 67.71  ? 6    DG  H N9    1 
ATOM   6772 C  C8    . DG  H 2 6   ? -76.686 -7.684  5.289   1.00 63.06  ? 6    DG  H C8    1 
ATOM   6773 N  N7    . DG  H 2 6   ? -77.177 -6.712  4.576   1.00 60.44  ? 6    DG  H N7    1 
ATOM   6774 C  C5    . DG  H 2 6   ? -78.123 -7.328  3.771   1.00 63.23  ? 6    DG  H C5    1 
ATOM   6775 C  C6    . DG  H 2 6   ? -78.988 -6.775  2.802   1.00 70.43  ? 6    DG  H C6    1 
ATOM   6776 O  O6    . DG  H 2 6   ? -79.083 -5.594  2.442   1.00 72.32  ? 6    DG  H O6    1 
ATOM   6777 N  N1    . DG  H 2 6   ? -79.797 -7.747  2.220   1.00 73.41  ? 6    DG  H N1    1 
ATOM   6778 C  C2    . DG  H 2 6   ? -79.778 -9.082  2.539   1.00 71.97  ? 6    DG  H C2    1 
ATOM   6779 N  N2    . DG  H 2 6   ? -80.633 -9.866  1.864   1.00 78.20  ? 6    DG  H N2    1 
ATOM   6780 N  N3    . DG  H 2 6   ? -78.977 -9.614  3.453   1.00 67.68  ? 6    DG  H N3    1 
ATOM   6781 C  C4    . DG  H 2 6   ? -78.181 -8.679  4.026   1.00 65.60  ? 6    DG  H C4    1 
ATOM   6782 P  P     . DC  H 2 7   ? -74.841 -13.737 5.317   1.00 69.54  ? 7    DC  H P     1 
ATOM   6783 O  OP1   . DC  H 2 7   ? -75.021 -15.117 5.810   1.00 68.72  ? 7    DC  H OP1   1 
ATOM   6784 O  OP2   . DC  H 2 7   ? -73.484 -13.171 5.131   1.00 76.88  ? 7    DC  H OP2   1 
ATOM   6785 O  "O5'" . DC  H 2 7   ? -75.614 -13.529 3.938   1.00 47.99  ? 7    DC  H "O5'" 1 
ATOM   6786 C  "C5'" . DC  H 2 7   ? -76.892 -14.060 3.778   1.00 63.24  ? 7    DC  H "C5'" 1 
ATOM   6787 C  "C4'" . DC  H 2 7   ? -77.446 -13.733 2.408   1.00 63.63  ? 7    DC  H "C4'" 1 
ATOM   6788 O  "O4'" . DC  H 2 7   ? -77.567 -12.311 2.238   1.00 69.90  ? 7    DC  H "O4'" 1 
ATOM   6789 C  "C3'" . DC  H 2 7   ? -76.614 -14.220 1.224   1.00 54.21  ? 7    DC  H "C3'" 1 
ATOM   6790 O  "O3'" . DC  H 2 7   ? -77.311 -15.257 0.586   1.00 63.80  ? 7    DC  H "O3'" 1 
ATOM   6791 C  "C2'" . DC  H 2 7   ? -76.490 -12.981 0.305   1.00 62.35  ? 7    DC  H "C2'" 1 
ATOM   6792 C  "C1'" . DC  H 2 7   ? -77.560 -12.053 0.861   1.00 68.85  ? 7    DC  H "C1'" 1 
ATOM   6793 N  N1    . DC  H 2 7   ? -77.286 -10.609 0.667   1.00 67.15  ? 7    DC  H N1    1 
ATOM   6794 C  C2    . DC  H 2 7   ? -77.903 -9.903  -0.379  1.00 67.23  ? 7    DC  H C2    1 
ATOM   6795 O  O2    . DC  H 2 7   ? -78.659 -10.494 -1.156  1.00 66.25  ? 7    DC  H O2    1 
ATOM   6796 N  N3    . DC  H 2 7   ? -77.637 -8.586  -0.514  1.00 67.84  ? 7    DC  H N3    1 
ATOM   6797 C  C4    . DC  H 2 7   ? -76.813 -7.977  0.346   1.00 68.12  ? 7    DC  H C4    1 
ATOM   6798 N  N4    . DC  H 2 7   ? -76.584 -6.671  0.180   1.00 67.57  ? 7    DC  H N4    1 
ATOM   6799 C  C5    . DC  H 2 7   ? -76.189 -8.675  1.410   1.00 64.53  ? 7    DC  H C5    1 
ATOM   6800 C  C6    . DC  H 2 7   ? -76.453 -9.974  1.534   1.00 65.53  ? 7    DC  H C6    1 
ATOM   6801 P  P     . DC  H 2 8   ? -76.556 -16.227 -0.441  1.00 75.28  ? 8    DC  H P     1 
ATOM   6802 O  OP1   . DC  H 2 8   ? -77.298 -17.501 -0.485  1.00 74.32  ? 8    DC  H OP1   1 
ATOM   6803 O  OP2   . DC  H 2 8   ? -75.126 -16.187 -0.066  1.00 70.15  ? 8    DC  H OP2   1 
ATOM   6804 O  "O5'" . DC  H 2 8   ? -76.674 -15.488 -1.857  1.00 67.17  ? 8    DC  H "O5'" 1 
ATOM   6805 C  "C5'" . DC  H 2 8   ? -77.927 -15.236 -2.433  1.00 57.31  ? 8    DC  H "C5'" 1 
ATOM   6806 C  "C4'" . DC  H 2 8   ? -77.775 -14.368 -3.667  1.00 64.13  ? 8    DC  H "C4'" 1 
ATOM   6807 O  "O4'" . DC  H 2 8   ? -77.473 -13.015 -3.255  1.00 70.29  ? 8    DC  H "O4'" 1 
ATOM   6808 C  "C3'" . DC  H 2 8   ? -76.655 -14.779 -4.647  1.00 62.18  ? 8    DC  H "C3'" 1 
ATOM   6809 O  "O3'" . DC  H 2 8   ? -77.153 -14.798 -5.993  1.00 71.57  ? 8    DC  H "O3'" 1 
ATOM   6810 C  "C2'" . DC  H 2 8   ? -75.600 -13.685 -4.458  1.00 63.00  ? 8    DC  H "C2'" 1 
ATOM   6811 C  "C1'" . DC  H 2 8   ? -76.471 -12.495 -4.105  1.00 71.12  ? 8    DC  H "C1'" 1 
ATOM   6812 N  N1    . DC  H 2 8   ? -75.762 -11.365 -3.385  1.00 71.83  ? 8    DC  H N1    1 
ATOM   6813 C  C2    . DC  H 2 8   ? -76.233 -10.056 -3.544  1.00 69.03  ? 8    DC  H C2    1 
ATOM   6814 O  O2    . DC  H 2 8   ? -77.195 -9.854  -4.289  1.00 69.86  ? 8    DC  H O2    1 
ATOM   6815 N  N3    . DC  H 2 8   ? -75.617 -9.044  -2.885  1.00 68.66  ? 8    DC  H N3    1 
ATOM   6816 C  C4    . DC  H 2 8   ? -74.580 -9.298  -2.097  1.00 64.73  ? 8    DC  H C4    1 
ATOM   6817 N  N4    . DC  H 2 8   ? -74.007 -8.264  -1.477  1.00 60.38  ? 8    DC  H N4    1 
ATOM   6818 C  C5    . DC  H 2 8   ? -74.088 -10.626 -1.906  1.00 64.05  ? 8    DC  H C5    1 
ATOM   6819 C  C6    . DC  H 2 8   ? -74.706 -11.622 -2.561  1.00 63.66  ? 8    DC  H C6    1 
ATOM   6820 P  P     . DG  H 2 9   ? -76.559 -15.832 -7.080  1.00 91.77  ? 9    DG  H P     1 
ATOM   6821 O  OP1   . DG  H 2 9   ? -77.238 -17.137 -6.911  1.00 88.73  ? 9    DG  H OP1   1 
ATOM   6822 O  OP2   . DG  H 2 9   ? -75.084 -15.777 -7.016  1.00 72.30  ? 9    DG  H OP2   1 
ATOM   6823 O  "O5'" . DG  H 2 9   ? -76.932 -15.183 -8.504  1.00 81.08  ? 9    DG  H "O5'" 1 
ATOM   6824 C  "C5'" . DG  H 2 9   ? -78.200 -14.598 -8.732  1.00 74.08  ? 9    DG  H "C5'" 1 
ATOM   6825 C  "C4'" . DG  H 2 9   ? -78.072 -13.268 -9.477  1.00 80.20  ? 9    DG  H "C4'" 1 
ATOM   6826 O  "O4'" . DG  H 2 9   ? -77.616 -12.237 -8.559  1.00 75.76  ? 9    DG  H "O4'" 1 
ATOM   6827 C  "C3'" . DG  H 2 9   ? -77.102 -13.239 -10.674 1.00 76.45  ? 9    DG  H "C3'" 1 
ATOM   6828 O  "O3'" . DG  H 2 9   ? -77.688 -12.466 -11.757 1.00 85.93  ? 9    DG  H "O3'" 1 
ATOM   6829 C  "C2'" . DG  H 2 9   ? -75.873 -12.540 -10.090 1.00 74.34  ? 9    DG  H "C2'" 1 
ATOM   6830 C  "C1'" . DG  H 2 9   ? -76.522 -11.552 -9.132  1.00 73.17  ? 9    DG  H "C1'" 1 
ATOM   6831 N  N9    . DG  H 2 9   ? -75.643 -11.083 -8.055  1.00 74.92  ? 9    DG  H N9    1 
ATOM   6832 C  C8    . DG  H 2 9   ? -74.938 -11.851 -7.157  1.00 71.17  ? 9    DG  H C8    1 
ATOM   6833 N  N7    . DG  H 2 9   ? -74.251 -11.148 -6.297  1.00 70.00  ? 9    DG  H N7    1 
ATOM   6834 C  C5    . DG  H 2 9   ? -74.511 -9.831  -6.649  1.00 69.03  ? 9    DG  H C5    1 
ATOM   6835 C  C6    . DG  H 2 9   ? -74.038 -8.624  -6.081  1.00 69.90  ? 9    DG  H C6    1 
ATOM   6836 O  O6    . DG  H 2 9   ? -73.270 -8.478  -5.117  1.00 66.59  ? 9    DG  H O6    1 
ATOM   6837 N  N1    . DG  H 2 9   ? -74.558 -7.501  -6.736  1.00 72.52  ? 9    DG  H N1    1 
ATOM   6838 C  C2    . DG  H 2 9   ? -75.418 -7.541  -7.811  1.00 71.51  ? 9    DG  H C2    1 
ATOM   6839 N  N2    . DG  H 2 9   ? -75.802 -6.354  -8.321  1.00 62.78  ? 9    DG  H N2    1 
ATOM   6840 N  N3    . DG  H 2 9   ? -75.858 -8.669  -8.359  1.00 75.34  ? 9    DG  H N3    1 
ATOM   6841 C  C4    . DG  H 2 9   ? -75.369 -9.771  -7.725  1.00 75.17  ? 9    DG  H C4    1 
ATOM   6842 P  P     . DG  H 2 10  ? -77.028 -12.416 -13.235 1.00 82.55  ? 10   DG  H P     1 
ATOM   6843 O  OP1   . DG  H 2 10  ? -78.065 -12.828 -14.213 1.00 84.56  ? 10   DG  H OP1   1 
ATOM   6844 O  OP2   . DG  H 2 10  ? -75.725 -13.107 -13.235 1.00 73.63  ? 10   DG  H OP2   1 
ATOM   6845 O  "O5'" . DG  H 2 10  ? -76.760 -10.867 -13.468 1.00 76.02  ? 10   DG  H "O5'" 1 
ATOM   6846 C  "C5'" . DG  H 2 10  ? -77.679 -9.914  -12.970 1.00 74.65  ? 10   DG  H "C5'" 1 
ATOM   6847 C  "C4'" . DG  H 2 10  ? -77.287 -8.525  -13.417 1.00 78.47  ? 10   DG  H "C4'" 1 
ATOM   6848 O  "O4'" . DG  H 2 10  ? -76.467 -7.887  -12.398 1.00 82.70  ? 10   DG  H "O4'" 1 
ATOM   6849 C  "C3'" . DG  H 2 10  ? -76.482 -8.476  -14.705 1.00 78.01  ? 10   DG  H "C3'" 1 
ATOM   6850 O  "O3'" . DG  H 2 10  ? -76.859 -7.313  -15.459 1.00 80.43  ? 10   DG  H "O3'" 1 
ATOM   6851 C  "C2'" . DG  H 2 10  ? -75.023 -8.420  -14.209 1.00 82.14  ? 10   DG  H "C2'" 1 
ATOM   6852 C  "C1'" . DG  H 2 10  ? -75.145 -7.676  -12.874 1.00 77.68  ? 10   DG  H "C1'" 1 
ATOM   6853 N  N9    . DG  H 2 10  ? -74.216 -8.142  -11.833 1.00 79.73  ? 10   DG  H N9    1 
ATOM   6854 C  C8    . DG  H 2 10  ? -73.906 -9.447  -11.518 1.00 76.04  ? 10   DG  H C8    1 
ATOM   6855 N  N7    . DG  H 2 10  ? -73.060 -9.557  -10.525 1.00 71.48  ? 10   DG  H N7    1 
ATOM   6856 C  C5    . DG  H 2 10  ? -72.797 -8.245  -10.151 1.00 70.35  ? 10   DG  H C5    1 
ATOM   6857 C  C6    . DG  H 2 10  ? -71.959 -7.733  -9.124  1.00 69.48  ? 10   DG  H C6    1 
ATOM   6858 O  O6    . DG  H 2 10  ? -71.251 -8.357  -8.310  1.00 69.26  ? 10   DG  H O6    1 
ATOM   6859 N  N1    . DG  H 2 10  ? -71.988 -6.346  -9.086  1.00 65.46  ? 10   DG  H N1    1 
ATOM   6860 C  C2    . DG  H 2 10  ? -72.722 -5.551  -9.922  1.00 64.96  ? 10   DG  H C2    1 
ATOM   6861 N  N2    . DG  H 2 10  ? -72.618 -4.233  -9.721  1.00 60.99  ? 10   DG  H N2    1 
ATOM   6862 N  N3    . DG  H 2 10  ? -73.511 -6.010  -10.881 1.00 75.24  ? 10   DG  H N3    1 
ATOM   6863 C  C4    . DG  H 2 10  ? -73.502 -7.362  -10.940 1.00 75.49  ? 10   DG  H C4    1 
ATOM   6864 P  P     . DG  H 2 11  ? -76.268 -7.045  -16.932 1.00 94.62  ? 11   DG  H P     1 
ATOM   6865 O  OP1   . DG  H 2 11  ? -77.261 -6.162  -17.587 1.00 90.51  ? 11   DG  H OP1   1 
ATOM   6866 O  OP2   . DG  H 2 11  ? -75.808 -8.308  -17.556 1.00 93.45  ? 11   DG  H OP2   1 
ATOM   6867 O  "O5'" . DG  H 2 11  ? -74.903 -6.252  -16.679 1.00 91.69  ? 11   DG  H "O5'" 1 
ATOM   6868 C  "C5'" . DG  H 2 11  ? -74.880 -5.105  -15.835 1.00 88.61  ? 11   DG  H "C5'" 1 
ATOM   6869 C  "C4'" . DG  H 2 11  ? -73.472 -4.550  -15.737 1.00 89.48  ? 11   DG  H "C4'" 1 
ATOM   6870 O  "O4'" . DG  H 2 11  ? -72.744 -5.206  -14.659 1.00 87.55  ? 11   DG  H "O4'" 1 
ATOM   6871 C  "C3'" . DG  H 2 11  ? -72.605 -4.734  -16.987 1.00 90.26  ? 11   DG  H "C3'" 1 
ATOM   6872 O  "O3'" . DG  H 2 11  ? -71.774 -3.606  -17.111 1.00 93.68  ? 11   DG  H "O3'" 1 
ATOM   6873 C  "C2'" . DG  H 2 11  ? -71.777 -5.971  -16.626 1.00 86.88  ? 11   DG  H "C2'" 1 
ATOM   6874 C  "C1'" . DG  H 2 11  ? -71.508 -5.662  -15.168 1.00 85.22  ? 11   DG  H "C1'" 1 
ATOM   6875 N  N9    . DG  H 2 11  ? -71.050 -6.787  -14.359 1.00 85.55  ? 11   DG  H N9    1 
ATOM   6876 C  C8    . DG  H 2 11  ? -71.155 -8.132  -14.636 1.00 85.21  ? 11   DG  H C8    1 
ATOM   6877 N  N7    . DG  H 2 11  ? -70.650 -8.896  -13.700 1.00 78.01  ? 11   DG  H N7    1 
ATOM   6878 C  C5    . DG  H 2 11  ? -70.181 -7.990  -12.745 1.00 78.25  ? 11   DG  H C5    1 
ATOM   6879 C  C6    . DG  H 2 11  ? -69.528 -8.218  -11.506 1.00 74.18  ? 11   DG  H C6    1 
ATOM   6880 O  O6    . DG  H 2 11  ? -69.227 -9.314  -10.980 1.00 74.81  ? 11   DG  H O6    1 
ATOM   6881 N  N1    . DG  H 2 11  ? -69.223 -7.010  -10.857 1.00 66.63  ? 11   DG  H N1    1 
ATOM   6882 C  C2    . DG  H 2 11  ? -69.513 -5.747  -11.352 1.00 68.88  ? 11   DG  H C2    1 
ATOM   6883 N  N2    . DG  H 2 11  ? -69.156 -4.694  -10.592 1.00 60.15  ? 11   DG  H N2    1 
ATOM   6884 N  N3    . DG  H 2 11  ? -70.115 -5.535  -12.505 1.00 75.68  ? 11   DG  H N3    1 
ATOM   6885 C  C4    . DG  H 2 11  ? -70.423 -6.694  -13.142 1.00 80.04  ? 11   DG  H C4    1 
ATOM   6886 P  P     . DT  H 2 12  ? -71.405 -2.991  -18.542 1.00 89.88  ? 12   DT  H P     1 
ATOM   6887 O  OP1   . DT  H 2 12  ? -72.658 -2.395  -19.069 1.00 84.82  ? 12   DT  H OP1   1 
ATOM   6888 O  OP2   . DT  H 2 12  ? -70.619 -4.005  -19.290 1.00 77.65  ? 12   DT  H OP2   1 
ATOM   6889 O  "O5'" . DT  H 2 12  ? -70.413 -1.794  -18.168 1.00 85.76  ? 12   DT  H "O5'" 1 
ATOM   6890 C  "C5'" . DT  H 2 12  ? -70.718 -0.974  -17.042 1.00 82.63  ? 12   DT  H "C5'" 1 
ATOM   6891 C  "C4'" . DT  H 2 12  ? -69.552 -0.899  -16.078 1.00 80.71  ? 12   DT  H "C4'" 1 
ATOM   6892 O  "O4'" . DT  H 2 12  ? -69.316 -2.195  -15.451 1.00 84.67  ? 12   DT  H "O4'" 1 
ATOM   6893 C  "C3'" . DT  H 2 12  ? -68.213 -0.490  -16.702 1.00 75.57  ? 12   DT  H "C3'" 1 
ATOM   6894 O  "O3'" . DT  H 2 12  ? -67.605 0.406   -15.844 1.00 80.69  ? 12   DT  H "O3'" 1 
ATOM   6895 C  "C2'" . DT  H 2 12  ? -67.437 -1.808  -16.726 1.00 65.99  ? 12   DT  H "C2'" 1 
ATOM   6896 C  "C1'" . DT  H 2 12  ? -67.925 -2.398  -15.421 1.00 72.03  ? 12   DT  H "C1'" 1 
ATOM   6897 N  N1    . DT  H 2 12  ? -67.634 -3.841  -15.231 1.00 71.97  ? 12   DT  H N1    1 
ATOM   6898 C  C2    . DT  H 2 12  ? -67.136 -4.247  -14.022 1.00 67.24  ? 12   DT  H C2    1 
ATOM   6899 O  O2    . DT  H 2 12  ? -66.926 -3.474  -13.098 1.00 66.82  ? 12   DT  H O2    1 
ATOM   6900 N  N3    . DT  H 2 12  ? -66.898 -5.591  -13.923 1.00 67.37  ? 12   DT  H N3    1 
ATOM   6901 C  C4    . DT  H 2 12  ? -67.093 -6.552  -14.902 1.00 74.79  ? 12   DT  H C4    1 
ATOM   6902 O  O4    . DT  H 2 12  ? -66.838 -7.743  -14.724 1.00 75.15  ? 12   DT  H O4    1 
ATOM   6903 C  C5    . DT  H 2 12  ? -67.615 -6.061  -16.148 1.00 78.44  ? 12   DT  H C5    1 
ATOM   6904 C  C7    . DT  H 2 12  ? -67.867 -7.013  -17.275 1.00 83.98  ? 12   DT  H C7    1 
ATOM   6905 C  C6    . DT  H 2 12  ? -67.864 -4.740  -16.255 1.00 76.14  ? 12   DT  H C6    1 
ATOM   6906 P  P     . DA  H 2 13  ? -67.380 1.936   -16.256 1.00 77.33  ? 13   DA  H P     1 
ATOM   6907 O  OP1   . DA  H 2 13  ? -68.668 2.668   -16.237 1.00 69.42  ? 13   DA  H OP1   1 
ATOM   6908 O  OP2   . DA  H 2 13  ? -66.493 1.892   -17.451 1.00 63.20  ? 13   DA  H OP2   1 
ATOM   6909 O  "O5'" . DA  H 2 13  ? -66.601 2.497   -14.986 1.00 75.47  ? 13   DA  H "O5'" 1 
ATOM   6910 C  "C5'" . DA  H 2 13  ? -67.078 2.149   -13.671 1.00 66.54  ? 13   DA  H "C5'" 1 
ATOM   6911 C  "C4'" . DA  H 2 13  ? -65.982 1.510   -12.813 1.00 63.34  ? 13   DA  H "C4'" 1 
ATOM   6912 O  "O4'" . DA  H 2 13  ? -65.703 0.153   -13.271 1.00 62.51  ? 13   DA  H "O4'" 1 
ATOM   6913 C  "C3'" . DA  H 2 13  ? -64.631 2.233   -12.796 1.00 64.39  ? 13   DA  H "C3'" 1 
ATOM   6914 O  "O3'" . DA  H 2 13  ? -64.070 2.142   -11.473 1.00 64.68  ? 13   DA  H "O3'" 1 
ATOM   6915 C  "C2'" . DA  H 2 13  ? -63.825 1.424   -13.817 1.00 59.79  ? 13   DA  H "C2'" 1 
ATOM   6916 C  "C1'" . DA  H 2 13  ? -64.321 0.019   -13.516 1.00 56.87  ? 13   DA  H "C1'" 1 
ATOM   6917 N  N9    . DA  H 2 13  ? -64.135 -0.937  -14.600 1.00 52.16  ? 13   DA  H N9    1 
ATOM   6918 C  C8    . DA  H 2 13  ? -64.250 -0.702  -15.940 1.00 57.26  ? 13   DA  H C8    1 
ATOM   6919 N  N7    . DA  H 2 13  ? -64.027 -1.767  -16.686 1.00 49.76  ? 13   DA  H N7    1 
ATOM   6920 C  C5    . DA  H 2 13  ? -63.766 -2.763  -15.768 1.00 47.92  ? 13   DA  H C5    1 
ATOM   6921 C  C6    . DA  H 2 13  ? -63.465 -4.124  -15.918 1.00 55.27  ? 13   DA  H C6    1 
ATOM   6922 N  N6    . DA  H 2 13  ? -63.377 -4.726  -17.101 1.00 54.39  ? 13   DA  H N6    1 
ATOM   6923 N  N1    . DA  H 2 13  ? -63.251 -4.848  -14.799 1.00 57.64  ? 13   DA  H N1    1 
ATOM   6924 C  C2    . DA  H 2 13  ? -63.337 -4.232  -13.614 1.00 53.90  ? 13   DA  H C2    1 
ATOM   6925 N  N3    . DA  H 2 13  ? -63.611 -2.951  -13.354 1.00 52.11  ? 13   DA  H N3    1 
ATOM   6926 C  C4    . DA  H 2 13  ? -63.821 -2.269  -14.480 1.00 46.54  ? 13   DA  H C4    1 
ATOM   6927 P  P     . DA  H 2 14  ? -62.945 3.173   -10.953 1.00 56.22  ? 14   DA  H P     1 
ATOM   6928 O  OP1   . DA  H 2 14  ? -62.760 2.921   -9.509  1.00 58.79  ? 14   DA  H OP1   1 
ATOM   6929 O  OP2   . DA  H 2 14  ? -63.251 4.551   -11.380 1.00 52.75  ? 14   DA  H OP2   1 
ATOM   6930 O  "O5'" . DA  H 2 14  ? -61.626 2.661   -11.683 1.00 56.55  ? 14   DA  H "O5'" 1 
ATOM   6931 C  "C5'" . DA  H 2 14  ? -60.628 1.944   -10.953 1.00 51.72  ? 14   DA  H "C5'" 1 
ATOM   6932 C  "C4'" . DA  H 2 14  ? -61.007 0.495   -10.781 1.00 49.22  ? 14   DA  H "C4'" 1 
ATOM   6933 O  "O4'" . DA  H 2 14  ? -61.349 -0.058  -12.066 1.00 55.87  ? 14   DA  H "O4'" 1 
ATOM   6934 C  "C3'" . DA  H 2 14  ? -59.902 -0.409  -10.223 1.00 52.91  ? 14   DA  H "C3'" 1 
ATOM   6935 O  "O3'" . DA  H 2 14  ? -60.458 -1.264  -9.231  1.00 53.63  ? 14   DA  H "O3'" 1 
ATOM   6936 C  "C2'" . DA  H 2 14  ? -59.442 -1.197  -11.454 1.00 50.79  ? 14   DA  H "C2'" 1 
ATOM   6937 C  "C1'" . DA  H 2 14  ? -60.752 -1.323  -12.189 1.00 48.28  ? 14   DA  H "C1'" 1 
ATOM   6938 N  N9    . DA  H 2 14  ? -60.639 -1.630  -13.609 1.00 50.72  ? 14   DA  H N9    1 
ATOM   6939 C  C8    . DA  H 2 14  ? -60.830 -0.765  -14.659 1.00 46.24  ? 14   DA  H C8    1 
ATOM   6940 N  N7    . DA  H 2 14  ? -60.669 -1.326  -15.834 1.00 46.01  ? 14   DA  H N7    1 
ATOM   6941 C  C5    . DA  H 2 14  ? -60.375 -2.647  -15.538 1.00 46.57  ? 14   DA  H C5    1 
ATOM   6942 C  C6    . DA  H 2 14  ? -60.114 -3.765  -16.353 1.00 51.91  ? 14   DA  H C6    1 
ATOM   6943 N  N6    . DA  H 2 14  ? -60.112 -3.712  -17.699 1.00 45.15  ? 14   DA  H N6    1 
ATOM   6944 N  N1    . DA  H 2 14  ? -59.837 -4.945  -15.731 1.00 50.76  ? 14   DA  H N1    1 
ATOM   6945 C  C2    . DA  H 2 14  ? -59.838 -4.988  -14.396 1.00 48.12  ? 14   DA  H C2    1 
ATOM   6946 N  N3    . DA  H 2 14  ? -60.084 -4.003  -13.526 1.00 51.93  ? 14   DA  H N3    1 
ATOM   6947 C  C4    . DA  H 2 14  ? -60.348 -2.850  -14.171 1.00 49.18  ? 14   DA  H C4    1 
ATOM   6948 P  P     . DG  H 2 15  ? -59.637 -2.517  -8.668  1.00 48.65  ? 15   DG  H P     1 
ATOM   6949 O  OP1   . DG  H 2 15  ? -59.805 -3.674  -9.584  1.00 60.33  ? 15   DG  H OP1   1 
ATOM   6950 O  OP2   . DG  H 2 15  ? -60.121 -2.659  -7.281  1.00 52.12  ? 15   DG  H OP2   1 
ATOM   6951 O  "O5'" . DG  H 2 15  ? -58.105 -1.998  -8.742  1.00 61.44  ? 15   DG  H "O5'" 1 
ATOM   6952 C  "C5'" . DG  H 2 15  ? -57.007 -2.817  -8.315  1.00 51.27  ? 15   DG  H "C5'" 1 
ATOM   6953 C  "C4'" . DG  H 2 15  ? -56.723 -3.946  -9.301  1.00 54.80  ? 15   DG  H "C4'" 1 
ATOM   6954 O  "O4'" . DG  H 2 15  ? -57.096 -3.580  -10.658 1.00 50.52  ? 15   DG  H "O4'" 1 
ATOM   6955 C  "C3'" . DG  H 2 15  ? -55.257 -4.396  -9.377  1.00 50.94  ? 15   DG  H "C3'" 1 
ATOM   6956 O  "O3'" . DG  H 2 15  ? -55.190 -5.780  -9.093  1.00 47.50  ? 15   DG  H "O3'" 1 
ATOM   6957 C  "C2'" . DG  H 2 15  ? -54.842 -4.077  -10.830 1.00 50.29  ? 15   DG  H "C2'" 1 
ATOM   6958 C  "C1'" . DG  H 2 15  ? -56.171 -4.210  -11.529 1.00 51.60  ? 15   DG  H "C1'" 1 
ATOM   6959 N  N9    . DG  H 2 15  ? -56.278 -3.610  -12.857 1.00 48.36  ? 15   DG  H N9    1 
ATOM   6960 C  C8    . DG  H 2 15  ? -56.583 -2.304  -13.154 1.00 51.41  ? 15   DG  H C8    1 
ATOM   6961 N  N7    . DG  H 2 15  ? -56.687 -2.077  -14.433 1.00 46.91  ? 15   DG  H N7    1 
ATOM   6962 C  C5    . DG  H 2 15  ? -56.471 -3.307  -15.016 1.00 45.09  ? 15   DG  H C5    1 
ATOM   6963 C  C6    . DG  H 2 15  ? -56.464 -3.671  -16.382 1.00 51.69  ? 15   DG  H C6    1 
ATOM   6964 O  O6    . DG  H 2 15  ? -56.660 -2.944  -17.368 1.00 55.96  ? 15   DG  H O6    1 
ATOM   6965 N  N1    . DG  H 2 15  ? -56.203 -5.031  -16.556 1.00 47.36  ? 15   DG  H N1    1 
ATOM   6966 C  C2    . DG  H 2 15  ? -55.958 -5.911  -15.526 1.00 54.63  ? 15   DG  H C2    1 
ATOM   6967 N  N2    . DG  H 2 15  ? -55.707 -7.183  -15.876 1.00 57.68  ? 15   DG  H N2    1 
ATOM   6968 N  N3    . DG  H 2 15  ? -55.964 -5.572  -14.233 1.00 49.13  ? 15   DG  H N3    1 
ATOM   6969 C  C4    . DG  H 2 15  ? -56.227 -4.264  -14.059 1.00 44.68  ? 15   DG  H C4    1 
ATOM   6970 P  P     . DT  H 2 16  ? -53.796 -6.463  -8.713  1.00 50.69  ? 16   DT  H P     1 
ATOM   6971 O  OP1   . DT  H 2 16  ? -54.085 -7.697  -7.965  1.00 57.56  ? 16   DT  H OP1   1 
ATOM   6972 O  OP2   . DT  H 2 16  ? -52.904 -5.450  -8.099  1.00 51.13  ? 16   DT  H OP2   1 
ATOM   6973 O  "O5'" . DT  H 2 16  ? -53.226 -6.870  -10.131 1.00 57.46  ? 16   DT  H "O5'" 1 
ATOM   6974 C  "C5'" . DT  H 2 16  ? -53.706 -8.026  -10.760 1.00 51.52  ? 16   DT  H "C5'" 1 
ATOM   6975 C  "C4'" . DT  H 2 16  ? -52.838 -8.387  -11.943 1.00 56.14  ? 16   DT  H "C4'" 1 
ATOM   6976 O  "O4'" . DT  H 2 16  ? -53.094 -7.483  -13.039 1.00 57.42  ? 16   DT  H "O4'" 1 
ATOM   6977 C  "C3'" . DT  H 2 16  ? -51.330 -8.344  -11.707 1.00 52.63  ? 16   DT  H "C3'" 1 
ATOM   6978 O  "O3'" . DT  H 2 16  ? -50.829 -9.562  -12.164 1.00 61.13  ? 16   DT  H "O3'" 1 
ATOM   6979 C  "C2'" . DT  H 2 16  ? -50.863 -7.147  -12.580 1.00 50.26  ? 16   DT  H "C2'" 1 
ATOM   6980 C  "C1'" . DT  H 2 16  ? -51.887 -7.200  -13.697 1.00 53.14  ? 16   DT  H "C1'" 1 
ATOM   6981 N  N1    . DT  H 2 16  ? -52.139 -5.949  -14.452 1.00 54.01  ? 16   DT  H N1    1 
ATOM   6982 C  C2    . DT  H 2 16  ? -52.334 -6.036  -15.822 1.00 52.47  ? 16   DT  H C2    1 
ATOM   6983 O  O2    . DT  H 2 16  ? -52.204 -7.066  -16.442 1.00 56.63  ? 16   DT  H O2    1 
ATOM   6984 N  N3    . DT  H 2 16  ? -52.662 -4.866  -16.444 1.00 49.53  ? 16   DT  H N3    1 
ATOM   6985 C  C4    . DT  H 2 16  ? -52.837 -3.630  -15.850 1.00 53.52  ? 16   DT  H C4    1 
ATOM   6986 O  O4    . DT  H 2 16  ? -53.134 -2.626  -16.511 1.00 51.55  ? 16   DT  H O4    1 
ATOM   6987 C  C5    . DT  H 2 16  ? -52.640 -3.606  -14.390 1.00 48.64  ? 16   DT  H C5    1 
ATOM   6988 C  C7    . DT  H 2 16  ? -52.786 -2.332  -13.623 1.00 43.73  ? 16   DT  H C7    1 
ATOM   6989 C  C6    . DT  H 2 16  ? -52.329 -4.765  -13.772 1.00 48.06  ? 16   DT  H C6    1 
ATOM   6990 P  P     . DT  H 2 17  ? -49.303 -9.987  -11.975 1.00 61.43  ? 17   DT  H P     1 
ATOM   6991 O  OP1   . DT  H 2 17  ? -49.289 -11.397 -11.552 1.00 61.26  ? 17   DT  H OP1   1 
ATOM   6992 O  OP2   . DT  H 2 17  ? -48.589 -8.973  -11.172 1.00 63.13  ? 17   DT  H OP2   1 
ATOM   6993 O  "O5'" . DT  H 2 17  ? -48.758 -9.957  -13.461 1.00 66.00  ? 17   DT  H "O5'" 1 
ATOM   6994 C  "C5'" . DT  H 2 17  ? -49.427 -10.681 -14.461 1.00 57.91  ? 17   DT  H "C5'" 1 
ATOM   6995 C  "C4'" . DT  H 2 17  ? -48.889 -10.309 -15.824 1.00 59.42  ? 17   DT  H "C4'" 1 
ATOM   6996 O  "O4'" . DT  H 2 17  ? -49.390 -8.997  -16.216 1.00 59.09  ? 17   DT  H "O4'" 1 
ATOM   6997 C  "C3'" . DT  H 2 17  ? -47.365 -10.204 -15.902 1.00 63.04  ? 17   DT  H "C3'" 1 
ATOM   6998 O  "O3'" . DT  H 2 17  ? -46.943 -10.685 -17.152 1.00 67.76  ? 17   DT  H "O3'" 1 
ATOM   6999 C  "C2'" . DT  H 2 17  ? -47.152 -8.695  -15.817 1.00 60.96  ? 17   DT  H "C2'" 1 
ATOM   7000 C  "C1'" . DT  H 2 17  ? -48.304 -8.242  -16.679 1.00 50.78  ? 17   DT  H "C1'" 1 
ATOM   7001 N  N1    . DT  H 2 17  ? -48.626 -6.802  -16.578 1.00 52.05  ? 17   DT  H N1    1 
ATOM   7002 C  C2    . DT  H 2 17  ? -48.996 -6.136  -17.714 1.00 54.79  ? 17   DT  H C2    1 
ATOM   7003 O  O2    . DT  H 2 17  ? -49.079 -6.676  -18.798 1.00 59.93  ? 17   DT  H O2    1 
ATOM   7004 N  N3    . DT  H 2 17  ? -49.276 -4.809  -17.543 1.00 52.59  ? 17   DT  H N3    1 
ATOM   7005 C  C4    . DT  H 2 17  ? -49.228 -4.093  -16.370 1.00 51.15  ? 17   DT  H C4    1 
ATOM   7006 O  O4    . DT  H 2 17  ? -49.501 -2.897  -16.324 1.00 52.92  ? 17   DT  H O4    1 
ATOM   7007 C  C5    . DT  H 2 17  ? -48.830 -4.848  -15.199 1.00 52.38  ? 17   DT  H C5    1 
ATOM   7008 C  C7    . DT  H 2 17  ? -48.735 -4.171  -13.856 1.00 45.66  ? 17   DT  H C7    1 
ATOM   7009 C  C6    . DT  H 2 17  ? -48.543 -6.157  -15.362 1.00 53.03  ? 17   DT  H C6    1 
ATOM   7010 P  P     . DC  H 2 18  ? -46.160 -12.078 -17.291 1.00 74.22  ? 18   DC  H P     1 
ATOM   7011 O  OP1   . DC  H 2 18  ? -46.998 -13.200 -16.801 1.00 71.98  ? 18   DC  H OP1   1 
ATOM   7012 O  OP2   . DC  H 2 18  ? -44.801 -11.903 -16.738 1.00 63.20  ? 18   DC  H OP2   1 
ATOM   7013 O  "O5'" . DC  H 2 18  ? -46.006 -12.198 -18.870 1.00 64.83  ? 18   DC  H "O5'" 1 
ATOM   7014 C  "C5'" . DC  H 2 18  ? -45.252 -11.247 -19.552 1.00 58.39  ? 18   DC  H "C5'" 1 
ATOM   7015 C  "C4'" . DC  H 2 18  ? -46.003 -10.726 -20.740 1.00 56.03  ? 18   DC  H "C4'" 1 
ATOM   7016 O  "O4'" . DC  H 2 18  ? -46.990 -9.761  -20.306 1.00 64.09  ? 18   DC  H "O4'" 1 
ATOM   7017 C  "C3'" . DC  H 2 18  ? -45.124 -10.010 -21.737 1.00 65.50  ? 18   DC  H "C3'" 1 
ATOM   7018 O  "O3'" . DC  H 2 18  ? -44.712 -10.939 -22.712 1.00 69.01  ? 18   DC  H "O3'" 1 
ATOM   7019 C  "C2'" . DC  H 2 18  ? -46.046 -8.939  -22.325 1.00 65.41  ? 18   DC  H "C2'" 1 
ATOM   7020 C  "C1'" . DC  H 2 18  ? -46.979 -8.622  -21.159 1.00 59.37  ? 18   DC  H "C1'" 1 
ATOM   7021 N  N1    . DC  H 2 18  ? -46.569 -7.427  -20.342 1.00 64.22  ? 18   DC  H N1    1 
ATOM   7022 C  C2    . DC  H 2 18  ? -46.821 -6.132  -20.822 1.00 62.27  ? 18   DC  H C2    1 
ATOM   7023 O  O2    . DC  H 2 18  ? -47.364 -5.996  -21.918 1.00 59.63  ? 18   DC  H O2    1 
ATOM   7024 N  N3    . DC  H 2 18  ? -46.456 -5.063  -20.059 1.00 56.97  ? 18   DC  H N3    1 
ATOM   7025 C  C4    . DC  H 2 18  ? -45.889 -5.263  -18.866 1.00 49.47  ? 18   DC  H C4    1 
ATOM   7026 N  N4    . DC  H 2 18  ? -45.560 -4.198  -18.154 1.00 50.55  ? 18   DC  H N4    1 
ATOM   7027 C  C5    . DC  H 2 18  ? -45.620 -6.569  -18.362 1.00 48.89  ? 18   DC  H C5    1 
ATOM   7028 C  C6    . DC  H 2 18  ? -45.971 -7.612  -19.121 1.00 54.24  ? 18   DC  H C6    1 
ATOM   7029 P  P     . DC  H 2 19  ? -43.199 -10.945 -23.235 1.00 82.00  ? 19   DC  H P     1 
ATOM   7030 O  OP1   . DC  H 2 19  ? -43.025 -12.119 -24.115 1.00 86.99  ? 19   DC  H OP1   1 
ATOM   7031 O  OP2   . DC  H 2 19  ? -42.302 -10.857 -22.062 1.00 76.57  ? 19   DC  H OP2   1 
ATOM   7032 O  "O5'" . DC  H 2 19  ? -43.155 -9.616  -24.123 1.00 75.00  ? 19   DC  H "O5'" 1 
ATOM   7033 C  "C5'" . DC  H 2 19  ? -44.180 -9.406  -25.087 1.00 63.85  ? 19   DC  H "C5'" 1 
ATOM   7034 C  "C4'" . DC  H 2 19  ? -44.095 -8.023  -25.686 1.00 70.78  ? 19   DC  H "C4'" 1 
ATOM   7035 O  "O4'" . DC  H 2 19  ? -44.623 -7.063  -24.764 1.00 73.44  ? 19   DC  H "O4'" 1 
ATOM   7036 C  "C3'" . DC  H 2 19  ? -42.688 -7.546  -25.996 1.00 78.07  ? 19   DC  H "C3'" 1 
ATOM   7037 O  "O3'" . DC  H 2 19  ? -42.337 -7.971  -27.318 1.00 86.70  ? 19   DC  H "O3'" 1 
ATOM   7038 C  "C2'" . DC  H 2 19  ? -42.811 -6.018  -25.908 1.00 75.62  ? 19   DC  H "C2'" 1 
ATOM   7039 C  "C1'" . DC  H 2 19  ? -44.048 -5.795  -25.028 1.00 71.46  ? 19   DC  H "C1'" 1 
ATOM   7040 N  N1    . DC  H 2 19  ? -43.745 -5.126  -23.721 1.00 67.93  ? 19   DC  H N1    1 
ATOM   7041 C  C2    . DC  H 2 19  ? -43.944 -3.753  -23.593 1.00 64.75  ? 19   DC  H C2    1 
ATOM   7042 O  O2    . DC  H 2 19  ? -44.366 -3.114  -24.570 1.00 65.10  ? 19   DC  H O2    1 
ATOM   7043 N  N3    . DC  H 2 19  ? -43.673 -3.160  -22.400 1.00 57.22  ? 19   DC  H N3    1 
ATOM   7044 C  C4    . DC  H 2 19  ? -43.237 -3.890  -21.374 1.00 54.49  ? 19   DC  H C4    1 
ATOM   7045 N  N4    . DC  H 2 19  ? -43.002 -3.262  -20.220 1.00 52.61  ? 19   DC  H N4    1 
ATOM   7046 C  C5    . DC  H 2 19  ? -43.030 -5.293  -21.483 1.00 54.62  ? 19   DC  H C5    1 
ATOM   7047 C  C6    . DC  H 2 19  ? -43.291 -5.865  -22.662 1.00 60.79  ? 19   DC  H C6    1 
ATOM   7048 P  P     . DG  H 2 20  ? -40.828 -7.897  -27.862 1.00 93.16  ? 20   DG  H P     1 
ATOM   7049 O  OP1   . DG  H 2 20  ? -40.909 -8.520  -29.202 1.00 91.91  ? 20   DG  H OP1   1 
ATOM   7050 O  OP2   . DG  H 2 20  ? -39.867 -8.424  -26.869 1.00 79.99  ? 20   DG  H OP2   1 
ATOM   7051 O  "O5'" . DG  H 2 20  ? -40.564 -6.333  -28.033 1.00 79.36  ? 20   DG  H "O5'" 1 
ATOM   7052 C  "C5'" . DG  H 2 20  ? -41.235 -5.622  -29.053 1.00 73.50  ? 20   DG  H "C5'" 1 
ATOM   7053 C  "C4'" . DG  H 2 20  ? -40.903 -4.151  -28.970 1.00 81.08  ? 20   DG  H "C4'" 1 
ATOM   7054 O  "O4'" . DG  H 2 20  ? -41.315 -3.649  -27.669 1.00 85.18  ? 20   DG  H "O4'" 1 
ATOM   7055 C  "C3'" . DG  H 2 20  ? -39.408 -3.826  -29.119 1.00 85.21  ? 20   DG  H "C3'" 1 
ATOM   7056 O  "O3'" . DG  H 2 20  ? -39.201 -2.804  -30.101 1.00 89.62  ? 20   DG  H "O3'" 1 
ATOM   7057 C  "C2'" . DG  H 2 20  ? -38.987 -3.363  -27.728 1.00 78.65  ? 20   DG  H "C2'" 1 
ATOM   7058 C  "C1'" . DG  H 2 20  ? -40.294 -2.840  -27.136 1.00 83.38  ? 20   DG  H "C1'" 1 
ATOM   7059 N  N9    . DG  H 2 20  ? -40.304 -2.924  -25.674 1.00 70.86  ? 20   DG  H N9    1 
ATOM   7060 C  C8    . DG  H 2 20  ? -40.042 -4.037  -24.907 1.00 69.68  ? 20   DG  H C8    1 
ATOM   7061 N  N7    . DG  H 2 20  ? -40.075 -3.802  -23.623 1.00 67.61  ? 20   DG  H N7    1 
ATOM   7062 C  C5    . DG  H 2 20  ? -40.359 -2.439  -23.538 1.00 63.17  ? 20   DG  H C5    1 
ATOM   7063 C  C6    . DG  H 2 20  ? -40.511 -1.611  -22.403 1.00 59.94  ? 20   DG  H C6    1 
ATOM   7064 O  O6    . DG  H 2 20  ? -40.416 -1.924  -21.209 1.00 61.82  ? 20   DG  H O6    1 
ATOM   7065 N  N1    . DG  H 2 20  ? -40.792 -0.295  -22.757 1.00 55.44  ? 20   DG  H N1    1 
ATOM   7066 C  C2    . DG  H 2 20  ? -40.912 0.162   -24.045 1.00 60.12  ? 20   DG  H C2    1 
ATOM   7067 N  N2    . DG  H 2 20  ? -41.187 1.469   -24.187 1.00 57.14  ? 20   DG  H N2    1 
ATOM   7068 N  N3    . DG  H 2 20  ? -40.769 -0.601  -25.118 1.00 65.04  ? 20   DG  H N3    1 
ATOM   7069 C  C4    . DG  H 2 20  ? -40.492 -1.886  -24.789 1.00 61.77  ? 20   DG  H C4    1 
ATOM   7070 P  P     . DG  H 2 21  ? -37.705 -2.395  -30.532 1.00 94.18  ? 21   DG  H P     1 
ATOM   7071 O  OP1   . DG  H 2 21  ? -37.774 -1.777  -31.872 1.00 78.24  ? 21   DG  H OP1   1 
ATOM   7072 O  OP2   . DG  H 2 21  ? -36.849 -3.579  -30.317 1.00 85.13  ? 21   DG  H OP2   1 
ATOM   7073 O  "O5'" . DG  H 2 21  ? -37.290 -1.267  -29.462 1.00 86.31  ? 21   DG  H "O5'" 1 
ATOM   7074 C  "C5'" . DG  H 2 21  ? -37.741 0.066   -29.658 1.00 82.75  ? 21   DG  H "C5'" 1 
ATOM   7075 C  "C4'" . DG  H 2 21  ? -37.678 0.915   -28.387 1.00 79.17  ? 21   DG  H "C4'" 1 
ATOM   7076 O  "O4'" . DG  H 2 21  ? -38.126 0.195   -27.219 1.00 80.70  ? 21   DG  H "O4'" 1 
ATOM   7077 C  "C3'" . DG  H 2 21  ? -36.319 1.403   -27.950 1.00 75.49  ? 21   DG  H "C3'" 1 
ATOM   7078 O  "O3'" . DG  H 2 21  ? -35.883 2.441   -28.770 1.00 76.48  ? 21   DG  H "O3'" 1 
ATOM   7079 C  "C2'" . DG  H 2 21  ? -36.639 1.922   -26.542 1.00 77.61  ? 21   DG  H "C2'" 1 
ATOM   7080 C  "C1'" . DG  H 2 21  ? -37.802 1.022   -26.103 1.00 73.72  ? 21   DG  H "C1'" 1 
ATOM   7081 N  N9    . DG  H 2 21  ? -37.480 0.208   -24.931 1.00 68.10  ? 21   DG  H N9    1 
ATOM   7082 C  C8    . DG  H 2 21  ? -37.170 -1.134  -24.895 1.00 59.65  ? 21   DG  H C8    1 
ATOM   7083 N  N7    . DG  H 2 21  ? -36.919 -1.573  -23.690 1.00 58.04  ? 21   DG  H N7    1 
ATOM   7084 C  C5    . DG  H 2 21  ? -37.068 -0.445  -22.878 1.00 53.04  ? 21   DG  H C5    1 
ATOM   7085 C  C6    . DG  H 2 21  ? -36.936 -0.304  -21.478 1.00 49.12  ? 21   DG  H C6    1 
ATOM   7086 O  O6    . DG  H 2 21  ? -36.646 -1.170  -20.645 1.00 50.16  ? 21   DG  H O6    1 
ATOM   7087 N  N1    . DG  H 2 21  ? -37.168 1.001   -21.068 1.00 50.66  ? 21   DG  H N1    1 
ATOM   7088 C  C2    . DG  H 2 21  ? -37.502 2.040   -21.899 1.00 53.09  ? 21   DG  H C2    1 
ATOM   7089 N  N2    . DG  H 2 21  ? -37.688 3.232   -21.308 1.00 50.32  ? 21   DG  H N2    1 
ATOM   7090 N  N3    . DG  H 2 21  ? -37.643 1.925   -23.214 1.00 52.05  ? 21   DG  H N3    1 
ATOM   7091 C  C4    . DG  H 2 21  ? -37.407 0.657   -23.630 1.00 58.10  ? 21   DG  H C4    1 
ATOM   7092 P  P     . DC  H 2 22  ? -34.312 2.659   -28.995 1.00 86.08  ? 22   DC  H P     1 
ATOM   7093 O  OP1   . DC  H 2 22  ? -34.204 3.535   -30.181 1.00 83.03  ? 22   DC  H OP1   1 
ATOM   7094 O  OP2   . DC  H 2 22  ? -33.629 1.340   -28.929 1.00 79.03  ? 22   DC  H OP2   1 
ATOM   7095 O  "O5'" . DC  H 2 22  ? -33.826 3.447   -27.698 1.00 78.46  ? 22   DC  H "O5'" 1 
ATOM   7096 C  "C5'" . DC  H 2 22  ? -34.572 4.534   -27.202 1.00 80.16  ? 22   DC  H "C5'" 1 
ATOM   7097 C  "C4'" . DC  H 2 22  ? -34.194 4.793   -25.755 1.00 81.79  ? 22   DC  H "C4'" 1 
ATOM   7098 O  "O4'" . DC  H 2 22  ? -34.574 3.653   -24.926 1.00 79.62  ? 22   DC  H "O4'" 1 
ATOM   7099 C  "C3'" . DC  H 2 22  ? -32.693 5.002   -25.523 1.00 79.65  ? 22   DC  H "C3'" 1 
ATOM   7100 O  "O3'" . DC  H 2 22  ? -32.467 6.284   -24.932 1.00 84.11  ? 22   DC  H "O3'" 1 
ATOM   7101 C  "C2'" . DC  H 2 22  ? -32.290 3.851   -24.584 1.00 76.04  ? 22   DC  H "C2'" 1 
ATOM   7102 C  "C1'" . DC  H 2 22  ? -33.616 3.514   -23.910 1.00 72.92  ? 22   DC  H "C1'" 1 
ATOM   7103 N  N1    . DC  H 2 22  ? -33.678 2.117   -23.355 1.00 59.32  ? 22   DC  H N1    1 
ATOM   7104 C  C2    . DC  H 2 22  ? -33.775 1.919   -21.972 1.00 54.46  ? 22   DC  H C2    1 
ATOM   7105 O  O2    . DC  H 2 22  ? -33.824 2.897   -21.223 1.00 57.58  ? 22   DC  H O2    1 
ATOM   7106 N  N3    . DC  H 2 22  ? -33.824 0.655   -21.492 1.00 53.01  ? 22   DC  H N3    1 
ATOM   7107 C  C4    . DC  H 2 22  ? -33.772 -0.379  -22.331 1.00 54.61  ? 22   DC  H C4    1 
ATOM   7108 N  N4    . DC  H 2 22  ? -33.831 -1.609  -21.814 1.00 55.85  ? 22   DC  H N4    1 
ATOM   7109 C  C5    . DC  H 2 22  ? -33.676 -0.199  -23.735 1.00 56.40  ? 22   DC  H C5    1 
ATOM   7110 C  C6    . DC  H 2 22  ? -33.636 1.056   -24.199 1.00 61.42  ? 22   DC  H C6    1 
ATOM   7111 P  P     . DG  H 2 23  ? -30.999 6.937   -24.958 1.00 84.95  ? 23   DG  H P     1 
ATOM   7112 O  OP1   . DG  H 2 23  ? -31.164 8.387   -25.188 1.00 80.98  ? 23   DG  H OP1   1 
ATOM   7113 O  OP2   . DG  H 2 23  ? -30.167 6.115   -25.866 1.00 77.73  ? 23   DG  H OP2   1 
ATOM   7114 O  "O5'" . DG  H 2 23  ? -30.450 6.712   -23.473 1.00 76.63  ? 23   DG  H "O5'" 1 
ATOM   7115 C  "C5'" . DG  H 2 23  ? -31.158 7.264   -22.373 1.00 73.79  ? 23   DG  H "C5'" 1 
ATOM   7116 C  "C4'" . DG  H 2 23  ? -30.755 6.575   -21.091 1.00 68.30  ? 23   DG  H "C4'" 1 
ATOM   7117 O  "O4'" . DG  H 2 23  ? -31.147 5.198   -21.162 1.00 67.79  ? 23   DG  H "O4'" 1 
ATOM   7118 C  "C3'" . DG  H 2 23  ? -29.255 6.557   -20.827 1.00 64.92  ? 23   DG  H "C3'" 1 
ATOM   7119 O  "O3'" . DG  H 2 23  ? -28.932 7.532   -19.837 1.00 64.19  ? 23   DG  H "O3'" 1 
ATOM   7120 C  "C2'" . DG  H 2 23  ? -28.956 5.120   -20.341 1.00 61.45  ? 23   DG  H "C2'" 1 
ATOM   7121 C  "C1'" . DG  H 2 23  ? -30.330 4.456   -20.300 1.00 62.07  ? 23   DG  H "C1'" 1 
ATOM   7122 N  N9    . DG  H 2 23  ? -30.343 3.055   -20.744 1.00 56.06  ? 23   DG  H N9    1 
ATOM   7123 C  C8    . DG  H 2 23  ? -30.339 2.586   -22.040 1.00 53.66  ? 23   DG  H C8    1 
ATOM   7124 N  N7    . DG  H 2 23  ? -30.357 1.280   -22.121 1.00 50.60  ? 23   DG  H N7    1 
ATOM   7125 C  C5    . DG  H 2 23  ? -30.400 0.862   -20.787 1.00 47.76  ? 23   DG  H C5    1 
ATOM   7126 C  C6    . DG  H 2 23  ? -30.445 -0.444  -20.236 1.00 47.94  ? 23   DG  H C6    1 
ATOM   7127 O  O6    . DG  H 2 23  ? -30.468 -1.533  -20.833 1.00 53.48  ? 23   DG  H O6    1 
ATOM   7128 N  N1    . DG  H 2 23  ? -30.472 -0.415  -18.852 1.00 43.15  ? 23   DG  H N1    1 
ATOM   7129 C  C2    . DG  H 2 23  ? -30.457 0.724   -18.093 1.00 46.48  ? 23   DG  H C2    1 
ATOM   7130 N  N2    . DG  H 2 23  ? -30.481 0.554   -16.762 1.00 45.84  ? 23   DG  H N2    1 
ATOM   7131 N  N3    . DG  H 2 23  ? -30.411 1.945   -18.590 1.00 46.50  ? 23   DG  H N3    1 
ATOM   7132 C  C4    . DG  H 2 23  ? -30.397 1.939   -19.938 1.00 47.16  ? 23   DG  H C4    1 
ATOM   7133 P  P     . DC  H 2 24  ? -27.397 7.915   -19.537 1.00 78.22  ? 24   DC  H P     1 
ATOM   7134 O  OP1   . DC  H 2 24  ? -27.416 9.202   -18.817 1.00 77.30  ? 24   DC  H OP1   1 
ATOM   7135 O  OP2   . DC  H 2 24  ? -26.582 7.749   -20.765 1.00 66.79  ? 24   DC  H OP2   1 
ATOM   7136 O  "O5'" . DC  H 2 24  ? -26.922 6.786   -18.522 1.00 63.72  ? 24   DC  H "O5'" 1 
ATOM   7137 C  "C5'" . DC  H 2 24  ? -27.181 6.927   -17.159 1.00 54.56  ? 24   DC  H "C5'" 1 
ATOM   7138 C  "C4'" . DC  H 2 24  ? -26.812 5.659   -16.424 1.00 57.79  ? 24   DC  H "C4'" 1 
ATOM   7139 O  "O4'" . DC  H 2 24  ? -27.353 4.528   -17.105 1.00 58.93  ? 24   DC  H "O4'" 1 
ATOM   7140 C  "C3'" . DC  H 2 24  ? -25.335 5.368   -16.381 1.00 60.37  ? 24   DC  H "C3'" 1 
ATOM   7141 O  "O3'" . DC  H 2 24  ? -24.807 5.974   -15.271 1.00 61.42  ? 24   DC  H "O3'" 1 
ATOM   7142 C  "C2'" . DC  H 2 24  ? -25.259 3.829   -16.269 1.00 57.03  ? 24   DC  H "C2'" 1 
ATOM   7143 C  "C1'" . DC  H 2 24  ? -26.668 3.382   -16.654 1.00 51.05  ? 24   DC  H "C1'" 1 
ATOM   7144 N  N1    . DC  H 2 24  ? -26.750 2.360   -17.726 1.00 47.66  ? 24   DC  H N1    1 
ATOM   7145 C  C2    . DC  H 2 24  ? -26.865 1.015   -17.385 1.00 45.66  ? 24   DC  H C2    1 
ATOM   7146 O  O2    . DC  H 2 24  ? -26.824 0.695   -16.191 1.00 47.63  ? 24   DC  H O2    1 
ATOM   7147 N  N3    . DC  H 2 24  ? -26.994 0.094   -18.371 1.00 41.61  ? 24   DC  H N3    1 
ATOM   7148 C  C4    . DC  H 2 24  ? -27.025 0.483   -19.639 1.00 43.14  ? 24   DC  H C4    1 
ATOM   7149 N  N4    . DC  H 2 24  ? -27.155 -0.464  -20.578 1.00 47.03  ? 24   DC  H N4    1 
ATOM   7150 C  C5    . DC  H 2 24  ? -26.919 1.853   -20.006 1.00 42.92  ? 24   DC  H C5    1 
ATOM   7151 C  C6    . DC  H 2 24  ? -26.791 2.749   -19.028 1.00 46.82  ? 24   DC  H C6    1 
ATOM   7152 P  P     . DG  H 2 25  ? -23.283 6.422   -15.284 1.00 65.78  ? 25   DG  H P     1 
ATOM   7153 O  OP1   . DG  H 2 25  ? -23.237 7.555   -14.332 1.00 66.05  ? 25   DG  H OP1   1 
ATOM   7154 O  OP2   . DG  H 2 25  ? -22.873 6.579   -16.707 1.00 55.21  ? 25   DG  H OP2   1 
ATOM   7155 O  "O5'" . DG  H 2 25  ? -22.510 5.135   -14.713 1.00 62.81  ? 25   DG  H "O5'" 1 
ATOM   7156 C  "C5'" . DG  H 2 25  ? -22.838 4.593   -13.443 1.00 56.43  ? 25   DG  H "C5'" 1 
ATOM   7157 C  "C4'" . DG  H 2 25  ? -22.172 3.238   -13.254 1.00 57.75  ? 25   DG  H "C4'" 1 
ATOM   7158 O  "O4'" . DG  H 2 25  ? -22.839 2.247   -14.090 1.00 59.14  ? 25   DG  H "O4'" 1 
ATOM   7159 C  "C3'" . DG  H 2 25  ? -20.682 3.191   -13.622 1.00 56.98  ? 25   DG  H "C3'" 1 
ATOM   7160 O  "O3'" . DG  H 2 25  ? -19.925 2.542   -12.581 1.00 66.35  ? 25   DG  H "O3'" 1 
ATOM   7161 C  "C2'" . DG  H 2 25  ? -20.646 2.391   -14.928 1.00 48.48  ? 25   DG  H "C2'" 1 
ATOM   7162 C  "C1'" . DG  H 2 25  ? -21.888 1.516   -14.832 1.00 46.75  ? 25   DG  H "C1'" 1 
ATOM   7163 N  N9    . DG  H 2 25  ? -22.448 1.225   -16.143 1.00 51.65  ? 25   DG  H N9    1 
ATOM   7164 C  C8    . DG  H 2 25  ? -22.623 2.113   -17.182 1.00 50.07  ? 25   DG  H C8    1 
ATOM   7165 N  N7    . DG  H 2 25  ? -23.130 1.561   -18.257 1.00 47.29  ? 25   DG  H N7    1 
ATOM   7166 C  C5    . DG  H 2 25  ? -23.290 0.223   -17.907 1.00 43.03  ? 25   DG  H C5    1 
ATOM   7167 C  C6    . DG  H 2 25  ? -23.773 -0.856  -18.667 1.00 44.65  ? 25   DG  H C6    1 
ATOM   7168 O  O6    . DG  H 2 25  ? -24.178 -0.846  -19.834 1.00 47.65  ? 25   DG  H O6    1 
ATOM   7169 N  N1    . DG  H 2 25  ? -23.765 -2.039  -17.944 1.00 45.23  ? 25   DG  H N1    1 
ATOM   7170 C  C2    . DG  H 2 25  ? -23.325 -2.167  -16.650 1.00 45.35  ? 25   DG  H C2    1 
ATOM   7171 N  N2    . DG  H 2 25  ? -23.385 -3.397  -16.119 1.00 41.59  ? 25   DG  H N2    1 
ATOM   7172 N  N3    . DG  H 2 25  ? -22.852 -1.165  -15.927 1.00 47.09  ? 25   DG  H N3    1 
ATOM   7173 C  C4    . DG  H 2 25  ? -22.870 -0.001  -16.615 1.00 46.50  ? 25   DG  H C4    1 
ATOM   7174 O  "O5'" . DC  I 3 1   ? -23.046 -9.434  -21.242 1.00 77.58  ? 1    DC  I "O5'" 1 
ATOM   7175 C  "C5'" . DC  I 3 1   ? -22.387 -10.281 -20.299 1.00 73.56  ? 1    DC  I "C5'" 1 
ATOM   7176 C  "C4'" . DC  I 3 1   ? -22.898 -10.002 -18.904 1.00 70.55  ? 1    DC  I "C4'" 1 
ATOM   7177 O  "O4'" . DC  I 3 1   ? -22.851 -8.573  -18.667 1.00 71.61  ? 1    DC  I "O4'" 1 
ATOM   7178 C  "C3'" . DC  I 3 1   ? -24.347 -10.413 -18.648 1.00 65.93  ? 1    DC  I "C3'" 1 
ATOM   7179 O  "O3'" . DC  I 3 1   ? -24.499 -10.781 -17.280 1.00 73.27  ? 1    DC  I "O3'" 1 
ATOM   7180 C  "C2'" . DC  I 3 1   ? -25.119 -9.139  -18.971 1.00 56.95  ? 1    DC  I "C2'" 1 
ATOM   7181 C  "C1'" . DC  I 3 1   ? -24.160 -8.071  -18.462 1.00 57.43  ? 1    DC  I "C1'" 1 
ATOM   7182 N  N1    . DC  I 3 1   ? -24.272 -6.776  -19.184 1.00 56.03  ? 1    DC  I N1    1 
ATOM   7183 C  C2    . DC  I 3 1   ? -24.143 -5.570  -18.473 1.00 49.38  ? 1    DC  I C2    1 
ATOM   7184 O  O2    . DC  I 3 1   ? -23.942 -5.602  -17.252 1.00 46.03  ? 1    DC  I O2    1 
ATOM   7185 N  N3    . DC  I 3 1   ? -24.257 -4.401  -19.149 1.00 47.35  ? 1    DC  I N3    1 
ATOM   7186 C  C4    . DC  I 3 1   ? -24.475 -4.408  -20.469 1.00 46.49  ? 1    DC  I C4    1 
ATOM   7187 N  N4    . DC  I 3 1   ? -24.565 -3.230  -21.093 1.00 45.53  ? 1    DC  I N4    1 
ATOM   7188 C  C5    . DC  I 3 1   ? -24.600 -5.618  -21.205 1.00 42.41  ? 1    DC  I C5    1 
ATOM   7189 C  C6    . DC  I 3 1   ? -24.492 -6.769  -20.533 1.00 47.30  ? 1    DC  I C6    1 
ATOM   7190 P  P     . DG  I 3 2   ? -25.752 -11.675 -16.801 1.00 77.47  ? 2    DG  I P     1 
ATOM   7191 O  OP1   . DG  I 3 2   ? -25.176 -12.757 -15.968 1.00 61.99  ? 2    DG  I OP1   1 
ATOM   7192 O  OP2   . DG  I 3 2   ? -26.630 -11.949 -17.965 1.00 58.77  ? 2    DG  I OP2   1 
ATOM   7193 O  "O5'" . DG  I 3 2   ? -26.560 -10.695 -15.826 1.00 68.97  ? 2    DG  I "O5'" 1 
ATOM   7194 C  "C5'" . DG  I 3 2   ? -25.892 -10.108 -14.725 1.00 56.47  ? 2    DG  I "C5'" 1 
ATOM   7195 C  "C4'" . DG  I 3 2   ? -26.535 -8.796  -14.352 1.00 52.84  ? 2    DG  I "C4'" 1 
ATOM   7196 O  "O4'" . DG  I 3 2   ? -26.354 -7.851  -15.416 1.00 60.22  ? 2    DG  I "O4'" 1 
ATOM   7197 C  "C3'" . DG  I 3 2   ? -28.034 -8.862  -14.108 1.00 54.16  ? 2    DG  I "C3'" 1 
ATOM   7198 O  "O3'" . DG  I 3 2   ? -28.273 -8.705  -12.710 1.00 65.27  ? 2    DG  I "O3'" 1 
ATOM   7199 C  "C2'" . DG  I 3 2   ? -28.604 -7.686  -14.929 1.00 54.67  ? 2    DG  I "C2'" 1 
ATOM   7200 C  "C1'" . DG  I 3 2   ? -27.354 -6.894  -15.304 1.00 53.98  ? 2    DG  I "C1'" 1 
ATOM   7201 N  N9    . DG  I 3 2   ? -27.468 -6.176  -16.576 1.00 47.93  ? 2    DG  I N9    1 
ATOM   7202 C  C8    . DG  I 3 2   ? -27.751 -6.717  -17.803 1.00 47.19  ? 2    DG  I C8    1 
ATOM   7203 N  N7    . DG  I 3 2   ? -27.793 -5.829  -18.766 1.00 47.48  ? 2    DG  I N7    1 
ATOM   7204 C  C5    . DG  I 3 2   ? -27.530 -4.621  -18.132 1.00 44.95  ? 2    DG  I C5    1 
ATOM   7205 C  C6    . DG  I 3 2   ? -27.449 -3.312  -18.666 1.00 47.22  ? 2    DG  I C6    1 
ATOM   7206 O  O6    . DG  I 3 2   ? -27.612 -2.947  -19.839 1.00 46.89  ? 2    DG  I O6    1 
ATOM   7207 N  N1    . DG  I 3 2   ? -27.158 -2.374  -17.685 1.00 43.73  ? 2    DG  I N1    1 
ATOM   7208 C  C2    . DG  I 3 2   ? -26.962 -2.665  -16.365 1.00 44.58  ? 2    DG  I C2    1 
ATOM   7209 N  N2    . DG  I 3 2   ? -26.679 -1.627  -15.570 1.00 38.49  ? 2    DG  I N2    1 
ATOM   7210 N  N3    . DG  I 3 2   ? -27.036 -3.888  -15.852 1.00 44.62  ? 2    DG  I N3    1 
ATOM   7211 C  C4    . DG  I 3 2   ? -27.325 -4.812  -16.788 1.00 42.96  ? 2    DG  I C4    1 
ATOM   7212 P  P     . DC  I 3 3   ? -29.749 -8.850  -12.081 1.00 69.32  ? 3    DC  I P     1 
ATOM   7213 O  OP1   . DC  I 3 3   ? -29.553 -9.119  -10.635 1.00 64.57  ? 3    DC  I OP1   1 
ATOM   7214 O  OP2   . DC  I 3 3   ? -30.601 -9.716  -12.934 1.00 75.02  ? 3    DC  I OP2   1 
ATOM   7215 O  "O5'" . DC  I 3 3   ? -30.320 -7.379  -12.184 1.00 65.72  ? 3    DC  I "O5'" 1 
ATOM   7216 C  "C5'" . DC  I 3 3   ? -29.567 -6.362  -11.627 1.00 60.37  ? 3    DC  I "C5'" 1 
ATOM   7217 C  "C4'" . DC  I 3 3   ? -29.954 -5.028  -12.206 1.00 61.21  ? 3    DC  I "C4'" 1 
ATOM   7218 O  "O4'" . DC  I 3 3   ? -29.794 -4.999  -13.628 1.00 56.74  ? 3    DC  I "O4'" 1 
ATOM   7219 C  "C3'" . DC  I 3 3   ? -31.395 -4.590  -11.980 1.00 54.95  ? 3    DC  I "C3'" 1 
ATOM   7220 O  "O3'" . DC  I 3 3   ? -31.422 -3.806  -10.806 1.00 60.53  ? 3    DC  I "O3'" 1 
ATOM   7221 C  "C2'" . DC  I 3 3   ? -31.700 -3.742  -13.235 1.00 53.36  ? 3    DC  I "C2'" 1 
ATOM   7222 C  "C1'" . DC  I 3 3   ? -30.372 -3.788  -14.006 1.00 53.25  ? 3    DC  I "C1'" 1 
ATOM   7223 N  N1    . DC  I 3 3   ? -30.518 -3.747  -15.462 1.00 53.48  ? 3    DC  I N1    1 
ATOM   7224 C  C2    . DC  I 3 3   ? -30.448 -2.518  -16.106 1.00 50.42  ? 3    DC  I C2    1 
ATOM   7225 O  O2    . DC  I 3 3   ? -30.254 -1.508  -15.427 1.00 50.75  ? 3    DC  I O2    1 
ATOM   7226 N  N3    . DC  I 3 3   ? -30.598 -2.467  -17.455 1.00 50.06  ? 3    DC  I N3    1 
ATOM   7227 C  C4    . DC  I 3 3   ? -30.801 -3.601  -18.144 1.00 55.34  ? 3    DC  I C4    1 
ATOM   7228 N  N4    . DC  I 3 3   ? -30.932 -3.512  -19.477 1.00 54.50  ? 3    DC  I N4    1 
ATOM   7229 C  C5    . DC  I 3 3   ? -30.875 -4.875  -17.498 1.00 51.46  ? 3    DC  I C5    1 
ATOM   7230 C  C6    . DC  I 3 3   ? -30.735 -4.900  -16.167 1.00 54.91  ? 3    DC  I C6    1 
ATOM   7231 P  P     . DG  I 3 4   ? -32.789 -3.204  -10.237 1.00 46.38  ? 4    DG  I P     1 
ATOM   7232 O  OP1   . DG  I 3 4   ? -32.567 -2.721  -8.859  1.00 47.11  ? 4    DG  I OP1   1 
ATOM   7233 O  OP2   . DG  I 3 4   ? -33.829 -4.229  -10.489 1.00 48.39  ? 4    DG  I OP2   1 
ATOM   7234 O  "O5'" . DG  I 3 4   ? -33.006 -1.900  -11.116 1.00 44.35  ? 4    DG  I "O5'" 1 
ATOM   7235 C  "C5'" . DG  I 3 4   ? -32.613 -0.644  -10.611 1.00 43.45  ? 4    DG  I "C5'" 1 
ATOM   7236 C  "C4'" . DG  I 3 4   ? -32.985 0.455   -11.586 1.00 44.70  ? 4    DG  I "C4'" 1 
ATOM   7237 O  "O4'" . DG  I 3 4   ? -32.736 0.002   -12.946 1.00 46.53  ? 4    DG  I "O4'" 1 
ATOM   7238 C  "C3'" . DG  I 3 4   ? -34.456 0.892   -11.561 1.00 41.89  ? 4    DG  I "C3'" 1 
ATOM   7239 O  "O3'" . DG  I 3 4   ? -34.490 2.267   -11.718 1.00 44.13  ? 4    DG  I "O3'" 1 
ATOM   7240 C  "C2'" . DG  I 3 4   ? -35.025 0.202   -12.796 1.00 44.99  ? 4    DG  I "C2'" 1 
ATOM   7241 C  "C1'" . DG  I 3 4   ? -33.841 0.339   -13.733 1.00 44.04  ? 4    DG  I "C1'" 1 
ATOM   7242 N  N9    . DG  I 3 4   ? -33.883 -0.515  -14.927 1.00 46.25  ? 4    DG  I N9    1 
ATOM   7243 C  C8    . DG  I 3 4   ? -33.982 -1.895  -14.987 1.00 48.44  ? 4    DG  I C8    1 
ATOM   7244 N  N7    . DG  I 3 4   ? -33.994 -2.363  -16.218 1.00 48.40  ? 4    DG  I N7    1 
ATOM   7245 C  C5    . DG  I 3 4   ? -33.899 -1.215  -17.016 1.00 44.79  ? 4    DG  I C5    1 
ATOM   7246 C  C6    . DG  I 3 4   ? -33.875 -1.077  -18.419 1.00 47.24  ? 4    DG  I C6    1 
ATOM   7247 O  O6    . DG  I 3 4   ? -33.926 -1.969  -19.278 1.00 54.90  ? 4    DG  I O6    1 
ATOM   7248 N  N1    . DG  I 3 4   ? -33.790 0.256   -18.810 1.00 44.25  ? 4    DG  I N1    1 
ATOM   7249 C  C2    . DG  I 3 4   ? -33.721 1.320   -17.957 1.00 45.62  ? 4    DG  I C2    1 
ATOM   7250 N  N2    . DG  I 3 4   ? -33.631 2.534   -18.520 1.00 47.28  ? 4    DG  I N2    1 
ATOM   7251 N  N3    . DG  I 3 4   ? -33.739 1.211   -16.642 1.00 47.61  ? 4    DG  I N3    1 
ATOM   7252 C  C4    . DG  I 3 4   ? -33.835 -0.081  -16.240 1.00 46.05  ? 4    DG  I C4    1 
ATOM   7253 P  P     . DC  I 3 5   ? -35.676 3.154   -11.118 1.00 49.83  ? 5    DC  I P     1 
ATOM   7254 O  OP1   . DC  I 3 5   ? -35.109 4.238   -10.302 1.00 45.38  ? 5    DC  I OP1   1 
ATOM   7255 O  OP2   . DC  I 3 5   ? -36.705 2.255   -10.539 1.00 54.15  ? 5    DC  I OP2   1 
ATOM   7256 O  "O5'" . DC  I 3 5   ? -36.302 3.810   -12.422 1.00 52.50  ? 5    DC  I "O5'" 1 
ATOM   7257 C  "C5'" . DC  I 3 5   ? -36.175 5.188   -12.675 1.00 51.35  ? 5    DC  I "C5'" 1 
ATOM   7258 C  "C4'" . DC  I 3 5   ? -36.380 5.453   -14.154 1.00 51.25  ? 5    DC  I "C4'" 1 
ATOM   7259 O  "O4'" . DC  I 3 5   ? -36.150 4.236   -14.887 1.00 50.36  ? 5    DC  I "O4'" 1 
ATOM   7260 C  "C3'" . DC  I 3 5   ? -37.774 5.924   -14.551 1.00 47.71  ? 5    DC  I "C3'" 1 
ATOM   7261 O  "O3'" . DC  I 3 5   ? -37.657 7.207   -15.140 1.00 50.54  ? 5    DC  I "O3'" 1 
ATOM   7262 C  "C2'" . DC  I 3 5   ? -38.270 4.857   -15.547 1.00 47.39  ? 5    DC  I "C2'" 1 
ATOM   7263 C  "C1'" . DC  I 3 5   ? -36.980 4.213   -16.008 1.00 42.23  ? 5    DC  I "C1'" 1 
ATOM   7264 N  N1    . DC  I 3 5   ? -37.098 2.765   -16.471 1.00 43.88  ? 5    DC  I N1    1 
ATOM   7265 C  C2    . DC  I 3 5   ? -37.098 2.471   -17.842 1.00 43.57  ? 5    DC  I C2    1 
ATOM   7266 O  O2    . DC  I 3 5   ? -37.059 3.394   -18.643 1.00 44.10  ? 5    DC  I O2    1 
ATOM   7267 N  N3    . DC  I 3 5   ? -37.180 1.178   -18.249 1.00 41.33  ? 5    DC  I N3    1 
ATOM   7268 C  C4    . DC  I 3 5   ? -37.229 0.197   -17.343 1.00 47.00  ? 5    DC  I C4    1 
ATOM   7269 N  N4    . DC  I 3 5   ? -37.305 -1.071  -17.788 1.00 42.49  ? 5    DC  I N4    1 
ATOM   7270 C  C5    . DC  I 3 5   ? -37.199 0.472   -15.936 1.00 41.36  ? 5    DC  I C5    1 
ATOM   7271 C  C6    . DC  I 3 5   ? -37.135 1.756   -15.551 1.00 40.39  ? 5    DC  I C6    1 
ATOM   7272 P  P     . DC  I 3 6   ? -38.939 8.059   -15.601 1.00 49.51  ? 6    DC  I P     1 
ATOM   7273 O  OP1   . DC  I 3 6   ? -38.446 9.437   -15.804 1.00 57.88  ? 6    DC  I OP1   1 
ATOM   7274 O  OP2   . DC  I 3 6   ? -40.062 7.861   -14.677 1.00 57.55  ? 6    DC  I OP2   1 
ATOM   7275 O  "O5'" . DC  I 3 6   ? -39.257 7.429   -17.016 1.00 45.70  ? 6    DC  I "O5'" 1 
ATOM   7276 C  "C5'" . DC  I 3 6   ? -40.428 7.742   -17.698 1.00 57.71  ? 6    DC  I "C5'" 1 
ATOM   7277 C  "C4'" . DC  I 3 6   ? -40.336 7.211   -19.106 1.00 55.27  ? 6    DC  I "C4'" 1 
ATOM   7278 O  "O4'" . DC  I 3 6   ? -39.925 5.824   -19.088 1.00 54.11  ? 6    DC  I "O4'" 1 
ATOM   7279 C  "C3'" . DC  I 3 6   ? -41.628 7.263   -19.898 1.00 56.80  ? 6    DC  I "C3'" 1 
ATOM   7280 O  "O3'" . DC  I 3 6   ? -41.435 8.105   -21.018 1.00 56.77  ? 6    DC  I "O3'" 1 
ATOM   7281 C  "C2'" . DC  I 3 6   ? -41.887 5.794   -20.307 1.00 55.25  ? 6    DC  I "C2'" 1 
ATOM   7282 C  "C1'" . DC  I 3 6   ? -40.511 5.168   -20.177 1.00 46.37  ? 6    DC  I "C1'" 1 
ATOM   7283 N  N1    . DC  I 3 6   ? -40.524 3.721   -19.872 1.00 46.16  ? 6    DC  I N1    1 
ATOM   7284 C  C2    . DC  I 3 6   ? -40.692 2.777   -20.904 1.00 47.22  ? 6    DC  I C2    1 
ATOM   7285 O  O2    . DC  I 3 6   ? -40.856 3.169   -22.074 1.00 46.86  ? 6    DC  I O2    1 
ATOM   7286 N  N3    . DC  I 3 6   ? -40.690 1.449   -20.581 1.00 48.37  ? 6    DC  I N3    1 
ATOM   7287 C  C4    . DC  I 3 6   ? -40.531 1.065   -19.300 1.00 47.62  ? 6    DC  I C4    1 
ATOM   7288 N  N4    . DC  I 3 6   ? -40.535 -0.246  -19.029 1.00 42.20  ? 6    DC  I N4    1 
ATOM   7289 C  C5    . DC  I 3 6   ? -40.360 2.012   -18.247 1.00 46.15  ? 6    DC  I C5    1 
ATOM   7290 C  C6    . DC  I 3 6   ? -40.358 3.313   -18.573 1.00 47.44  ? 6    DC  I C6    1 
ATOM   7291 P  P     . DG  I 3 7   ? -42.621 9.052   -21.521 1.00 72.12  ? 7    DG  I P     1 
ATOM   7292 O  OP1   . DG  I 3 7   ? -42.021 9.921   -22.556 1.00 74.34  ? 7    DG  I OP1   1 
ATOM   7293 O  OP2   . DG  I 3 7   ? -43.282 9.687   -20.359 1.00 65.00  ? 7    DG  I OP2   1 
ATOM   7294 O  "O5'" . DG  I 3 7   ? -43.606 8.015   -22.224 1.00 60.73  ? 7    DG  I "O5'" 1 
ATOM   7295 C  "C5'" . DG  I 3 7   ? -43.089 7.145   -23.217 1.00 61.99  ? 7    DG  I "C5'" 1 
ATOM   7296 C  "C4'" . DG  I 3 7   ? -44.196 6.366   -23.900 1.00 64.25  ? 7    DG  I "C4'" 1 
ATOM   7297 O  "O4'" . DG  I 3 7   ? -44.001 4.940   -23.654 1.00 67.89  ? 7    DG  I "O4'" 1 
ATOM   7298 C  "C3'" . DG  I 3 7   ? -45.610 6.672   -23.415 1.00 65.37  ? 7    DG  I "C3'" 1 
ATOM   7299 O  "O3'" . DG  I 3 7   ? -46.549 6.408   -24.492 1.00 80.62  ? 7    DG  I "O3'" 1 
ATOM   7300 C  "C2'" . DG  I 3 7   ? -45.753 5.654   -22.292 1.00 64.27  ? 7    DG  I "C2'" 1 
ATOM   7301 C  "C1'" . DG  I 3 7   ? -45.116 4.440   -22.956 1.00 60.34  ? 7    DG  I "C1'" 1 
ATOM   7302 N  N9    . DG  I 3 7   ? -44.693 3.388   -22.026 1.00 55.61  ? 7    DG  I N9    1 
ATOM   7303 C  C8    . DG  I 3 7   ? -44.495 3.507   -20.664 1.00 53.91  ? 7    DG  I C8    1 
ATOM   7304 N  N7    . DG  I 3 7   ? -44.141 2.378   -20.086 1.00 52.01  ? 7    DG  I N7    1 
ATOM   7305 C  C5    . DG  I 3 7   ? -44.110 1.456   -21.125 1.00 48.70  ? 7    DG  I C5    1 
ATOM   7306 C  C6    . DG  I 3 7   ? -43.799 0.075   -21.110 1.00 52.04  ? 7    DG  I C6    1 
ATOM   7307 O  O6    . DG  I 3 7   ? -43.474 -0.639  -20.150 1.00 51.81  ? 7    DG  I O6    1 
ATOM   7308 N  N1    . DG  I 3 7   ? -43.897 -0.486  -22.378 1.00 56.00  ? 7    DG  I N1    1 
ATOM   7309 C  C2    . DG  I 3 7   ? -44.239 0.189   -23.514 1.00 51.47  ? 7    DG  I C2    1 
ATOM   7310 N  N2    . DG  I 3 7   ? -44.265 -0.539  -24.623 1.00 53.69  ? 7    DG  I N2    1 
ATOM   7311 N  N3    . DG  I 3 7   ? -44.533 1.485   -23.558 1.00 48.56  ? 7    DG  I N3    1 
ATOM   7312 C  C4    . DG  I 3 7   ? -44.449 2.056   -22.328 1.00 53.32  ? 7    DG  I C4    1 
ATOM   7313 P  P     . DG  I 3 8   ? -48.015 7.084   -24.541 1.00 74.40  ? 8    DG  I P     1 
ATOM   7314 O  OP1   . DG  I 3 8   ? -48.069 7.906   -25.765 1.00 84.78  ? 8    DG  I OP1   1 
ATOM   7315 O  OP2   . DG  I 3 8   ? -48.395 7.653   -23.232 1.00 66.10  ? 8    DG  I OP2   1 
ATOM   7316 O  "O5'" . DG  I 3 8   ? -48.977 5.856   -24.741 1.00 60.59  ? 8    DG  I "O5'" 1 
ATOM   7317 C  "C5'" . DG  I 3 8   ? -48.784 4.733   -23.975 1.00 64.14  ? 8    DG  I "C5'" 1 
ATOM   7318 C  "C4'" . DG  I 3 8   ? -48.553 3.553   -24.869 1.00 64.79  ? 8    DG  I "C4'" 1 
ATOM   7319 O  "O4'" . DG  I 3 8   ? -47.592 2.665   -24.250 1.00 67.91  ? 8    DG  I "O4'" 1 
ATOM   7320 C  "C3'" . DG  I 3 8   ? -49.805 2.758   -25.156 1.00 61.90  ? 8    DG  I "C3'" 1 
ATOM   7321 O  "O3'" . DG  I 3 8   ? -49.971 2.600   -26.565 1.00 70.05  ? 8    DG  I "O3'" 1 
ATOM   7322 C  "C2'" . DG  I 3 8   ? -49.604 1.424   -24.419 1.00 69.11  ? 8    DG  I "C2'" 1 
ATOM   7323 C  "C1'" . DG  I 3 8   ? -48.107 1.364   -24.115 1.00 63.81  ? 8    DG  I "C1'" 1 
ATOM   7324 N  N9    . DG  I 3 8   ? -47.812 0.906   -22.751 1.00 59.76  ? 8    DG  I N9    1 
ATOM   7325 C  C8    . DG  I 3 8   ? -47.764 1.675   -21.613 1.00 52.89  ? 8    DG  I C8    1 
ATOM   7326 N  N7    . DG  I 3 8   ? -47.485 0.987   -20.538 1.00 53.30  ? 8    DG  I N7    1 
ATOM   7327 C  C5    . DG  I 3 8   ? -47.341 -0.310  -20.987 1.00 49.60  ? 8    DG  I C5    1 
ATOM   7328 C  C6    . DG  I 3 8   ? -47.037 -1.482  -20.272 1.00 53.84  ? 8    DG  I C6    1 
ATOM   7329 O  O6    . DG  I 3 8   ? -46.828 -1.602  -19.061 1.00 57.77  ? 8    DG  I O6    1 
ATOM   7330 N  N1    . DG  I 3 8   ? -46.987 -2.604  -21.102 1.00 56.52  ? 8    DG  I N1    1 
ATOM   7331 C  C2    . DG  I 3 8   ? -47.209 -2.585  -22.457 1.00 56.34  ? 8    DG  I C2    1 
ATOM   7332 N  N2    . DG  I 3 8   ? -47.117 -3.759  -23.088 1.00 51.76  ? 8    DG  I N2    1 
ATOM   7333 N  N3    . DG  I 3 8   ? -47.494 -1.484  -23.145 1.00 58.55  ? 8    DG  I N3    1 
ATOM   7334 C  C4    . DG  I 3 8   ? -47.539 -0.386  -22.345 1.00 57.89  ? 8    DG  I C4    1 
ATOM   7335 P  P     . DA  I 3 9   ? -51.444 2.455   -27.216 1.00 95.12  ? 9    DA  I P     1 
ATOM   7336 O  OP1   . DA  I 3 9   ? -51.243 2.496   -28.681 1.00 98.66  ? 9    DA  I OP1   1 
ATOM   7337 O  OP2   . DA  I 3 9   ? -52.390 3.433   -26.632 1.00 83.01  ? 9    DA  I OP2   1 
ATOM   7338 O  "O5'" . DA  I 3 9   ? -51.867 0.963   -26.816 1.00 73.88  ? 9    DA  I "O5'" 1 
ATOM   7339 C  "C5'" . DA  I 3 9   ? -50.970 -0.123  -27.141 1.00 78.79  ? 9    DA  I "C5'" 1 
ATOM   7340 C  "C4'" . DA  I 3 9   ? -51.411 -1.402  -26.461 1.00 87.45  ? 9    DA  I "C4'" 1 
ATOM   7341 O  "O4'" . DA  I 3 9   ? -50.822 -1.509  -25.114 1.00 92.67  ? 9    DA  I "O4'" 1 
ATOM   7342 C  "C3'" . DA  I 3 9   ? -52.928 -1.509  -26.260 1.00 89.47  ? 9    DA  I "C3'" 1 
ATOM   7343 O  "O3'" . DA  I 3 9   ? -53.325 -2.854  -26.444 1.00 98.54  ? 9    DA  I "O3'" 1 
ATOM   7344 C  "C2'" . DA  I 3 9   ? -53.079 -1.101  -24.803 1.00 80.79  ? 9    DA  I "C2'" 1 
ATOM   7345 C  "C1'" . DA  I 3 9   ? -51.869 -1.820  -24.226 1.00 83.81  ? 9    DA  I "C1'" 1 
ATOM   7346 N  N9    . DA  I 3 9   ? -51.563 -1.441  -22.842 1.00 74.57  ? 9    DA  I N9    1 
ATOM   7347 C  C8    . DA  I 3 9   ? -51.891 -0.262  -22.213 1.00 72.58  ? 9    DA  I C8    1 
ATOM   7348 N  N7    . DA  I 3 9   ? -51.567 -0.229  -20.938 1.00 70.45  ? 9    DA  I N7    1 
ATOM   7349 C  C5    . DA  I 3 9   ? -51.010 -1.480  -20.709 1.00 67.85  ? 9    DA  I C5    1 
ATOM   7350 C  C6    . DA  I 3 9   ? -50.461 -2.074  -19.557 1.00 65.49  ? 9    DA  I C6    1 
ATOM   7351 N  N6    . DA  I 3 9   ? -50.399 -1.448  -18.375 1.00 63.06  ? 9    DA  I N6    1 
ATOM   7352 N  N1    . DA  I 3 9   ? -49.989 -3.348  -19.661 1.00 63.05  ? 9    DA  I N1    1 
ATOM   7353 C  C2    . DA  I 3 9   ? -50.069 -3.970  -20.847 1.00 66.87  ? 9    DA  I C2    1 
ATOM   7354 N  N3    . DA  I 3 9   ? -50.570 -3.510  -22.003 1.00 73.14  ? 9    DA  I N3    1 
ATOM   7355 C  C4    . DA  I 3 9   ? -51.022 -2.248  -21.865 1.00 69.45  ? 9    DA  I C4    1 
ATOM   7356 P  P     . DA  I 3 10  ? -54.688 -3.238  -27.209 1.00 89.03  ? 10   DA  I P     1 
ATOM   7357 O  OP1   . DA  I 3 10  ? -54.634 -2.693  -28.592 1.00 78.85  ? 10   DA  I OP1   1 
ATOM   7358 O  OP2   . DA  I 3 10  ? -55.825 -2.837  -26.349 1.00 78.10  ? 10   DA  I OP2   1 
ATOM   7359 O  "O5'" . DA  I 3 10  ? -54.588 -4.838  -27.237 1.00 78.86  ? 10   DA  I "O5'" 1 
ATOM   7360 C  "C5'" . DA  I 3 10  ? -53.280 -5.471  -27.296 1.00 75.65  ? 10   DA  I "C5'" 1 
ATOM   7361 C  "C4'" . DA  I 3 10  ? -53.214 -6.677  -26.366 1.00 79.99  ? 10   DA  I "C4'" 1 
ATOM   7362 O  "O4'" . DA  I 3 10  ? -52.842 -6.247  -25.023 1.00 77.49  ? 10   DA  I "O4'" 1 
ATOM   7363 C  "C3'" . DA  I 3 10  ? -54.526 -7.447  -26.213 1.00 78.16  ? 10   DA  I "C3'" 1 
ATOM   7364 O  "O3'" . DA  I 3 10  ? -54.271 -8.848  -26.095 1.00 78.83  ? 10   DA  I "O3'" 1 
ATOM   7365 C  "C2'" . DA  I 3 10  ? -55.120 -6.870  -24.928 1.00 78.75  ? 10   DA  I "C2'" 1 
ATOM   7366 C  "C1'" . DA  I 3 10  ? -53.876 -6.560  -24.100 1.00 73.32  ? 10   DA  I "C1'" 1 
ATOM   7367 N  N9    . DA  I 3 10  ? -54.052 -5.425  -23.172 1.00 70.91  ? 10   DA  I N9    1 
ATOM   7368 C  C8    . DA  I 3 10  ? -54.615 -4.195  -23.444 1.00 70.43  ? 10   DA  I C8    1 
ATOM   7369 N  N7    . DA  I 3 10  ? -54.633 -3.373  -22.415 1.00 61.36  ? 10   DA  I N7    1 
ATOM   7370 C  C5    . DA  I 3 10  ? -54.040 -4.112  -21.398 1.00 60.90  ? 10   DA  I C5    1 
ATOM   7371 C  C6    . DA  I 3 10  ? -53.760 -3.820  -20.052 1.00 53.30  ? 10   DA  I C6    1 
ATOM   7372 N  N6    . DA  I 3 10  ? -54.047 -2.654  -19.477 1.00 49.22  ? 10   DA  I N6    1 
ATOM   7373 N  N1    . DA  I 3 10  ? -53.168 -4.781  -19.312 1.00 58.55  ? 10   DA  I N1    1 
ATOM   7374 C  C2    . DA  I 3 10  ? -52.870 -5.953  -19.886 1.00 57.16  ? 10   DA  I C2    1 
ATOM   7375 N  N3    . DA  I 3 10  ? -53.082 -6.349  -21.136 1.00 58.63  ? 10   DA  I N3    1 
ATOM   7376 C  C4    . DA  I 3 10  ? -53.680 -5.377  -21.848 1.00 63.73  ? 10   DA  I C4    1 
ATOM   7377 P  P     . DC  I 3 11  ? -55.474 -9.914  -26.218 1.00 95.23  ? 11   DC  I P     1 
ATOM   7378 O  OP1   . DC  I 3 11  ? -54.898 -11.152 -26.789 1.00 94.62  ? 11   DC  I OP1   1 
ATOM   7379 O  OP2   . DC  I 3 11  ? -56.643 -9.250  -26.839 1.00 80.39  ? 11   DC  I OP2   1 
ATOM   7380 O  "O5'" . DC  I 3 11  ? -55.866 -10.237 -24.705 1.00 89.79  ? 11   DC  I "O5'" 1 
ATOM   7381 C  "C5'" . DC  I 3 11  ? -54.909 -10.846 -23.848 1.00 88.74  ? 11   DC  I "C5'" 1 
ATOM   7382 C  "C4'" . DC  I 3 11  ? -55.241 -10.583 -22.395 1.00 76.54  ? 11   DC  I "C4'" 1 
ATOM   7383 O  "O4'" . DC  I 3 11  ? -55.262 -9.171  -22.145 1.00 73.10  ? 11   DC  I "O4'" 1 
ATOM   7384 C  "C3'" . DC  I 3 11  ? -56.624 -11.036 -21.963 1.00 79.13  ? 11   DC  I "C3'" 1 
ATOM   7385 O  "O3'" . DC  I 3 11  ? -56.585 -12.368 -21.492 1.00 81.43  ? 11   DC  I "O3'" 1 
ATOM   7386 C  "C2'" . DC  I 3 11  ? -56.991 -10.058 -20.834 1.00 75.76  ? 11   DC  I "C2'" 1 
ATOM   7387 C  "C1'" . DC  I 3 11  ? -55.878 -9.010  -20.897 1.00 73.81  ? 11   DC  I "C1'" 1 
ATOM   7388 N  N1    . DC  I 3 11  ? -56.366 -7.622  -20.744 1.00 68.33  ? 11   DC  I N1    1 
ATOM   7389 C  C2    . DC  I 3 11  ? -56.160 -6.972  -19.529 1.00 67.88  ? 11   DC  I C2    1 
ATOM   7390 O  O2    . DC  I 3 11  ? -55.555 -7.572  -18.633 1.00 68.19  ? 11   DC  I O2    1 
ATOM   7391 N  N3    . DC  I 3 11  ? -56.615 -5.699  -19.375 1.00 64.29  ? 11   DC  I N3    1 
ATOM   7392 C  C4    . DC  I 3 11  ? -57.259 -5.101  -20.382 1.00 63.67  ? 11   DC  I C4    1 
ATOM   7393 N  N4    . DC  I 3 11  ? -57.693 -3.850  -20.196 1.00 58.89  ? 11   DC  I N4    1 
ATOM   7394 C  C5    . DC  I 3 11  ? -57.480 -5.759  -21.627 1.00 62.84  ? 11   DC  I C5    1 
ATOM   7395 C  C6    . DC  I 3 11  ? -57.026 -7.008  -21.761 1.00 63.24  ? 11   DC  I C6    1 
ATOM   7396 P  P     . DT  I 3 12  ? -57.965 -13.108 -21.125 1.00 88.90  ? 12   DT  I P     1 
ATOM   7397 O  OP1   . DT  I 3 12  ? -57.725 -14.561 -21.277 1.00 84.05  ? 12   DT  I OP1   1 
ATOM   7398 O  OP2   . DT  I 3 12  ? -59.064 -12.399 -21.832 1.00 69.99  ? 12   DT  I OP2   1 
ATOM   7399 O  "O5'" . DT  I 3 12  ? -58.162 -12.812 -19.572 1.00 81.28  ? 12   DT  I "O5'" 1 
ATOM   7400 C  "C5'" . DT  I 3 12  ? -57.118 -13.121 -18.671 1.00 78.83  ? 12   DT  I "C5'" 1 
ATOM   7401 C  "C4'" . DT  I 3 12  ? -57.354 -12.447 -17.342 1.00 74.31  ? 12   DT  I "C4'" 1 
ATOM   7402 O  "O4'" . DT  I 3 12  ? -57.480 -11.019 -17.532 1.00 72.02  ? 12   DT  I "O4'" 1 
ATOM   7403 C  "C3'" . DT  I 3 12  ? -58.614 -12.904 -16.620 1.00 72.60  ? 12   DT  I "C3'" 1 
ATOM   7404 O  "O3'" . DT  I 3 12  ? -58.248 -13.403 -15.360 1.00 79.21  ? 12   DT  I "O3'" 1 
ATOM   7405 C  "C2'" . DT  I 3 12  ? -59.479 -11.639 -16.516 1.00 67.91  ? 12   DT  I "C2'" 1 
ATOM   7406 C  "C1'" . DT  I 3 12  ? -58.459 -10.517 -16.664 1.00 68.25  ? 12   DT  I "C1'" 1 
ATOM   7407 N  N1    . DT  I 3 12  ? -59.010 -9.270  -17.285 1.00 67.14  ? 12   DT  I N1    1 
ATOM   7408 C  C2    . DT  I 3 12  ? -59.095 -8.107  -16.546 1.00 64.36  ? 12   DT  I C2    1 
ATOM   7409 O  O2    . DT  I 3 12  ? -58.764 -8.022  -15.376 1.00 62.71  ? 12   DT  I O2    1 
ATOM   7410 N  N3    . DT  I 3 12  ? -59.601 -7.035  -17.228 1.00 65.00  ? 12   DT  I N3    1 
ATOM   7411 C  C4    . DT  I 3 12  ? -60.014 -6.999  -18.545 1.00 62.69  ? 12   DT  I C4    1 
ATOM   7412 O  O4    . DT  I 3 12  ? -60.454 -5.975  -19.064 1.00 57.56  ? 12   DT  I O4    1 
ATOM   7413 C  C5    . DT  I 3 12  ? -59.888 -8.250  -19.264 1.00 62.39  ? 12   DT  I C5    1 
ATOM   7414 C  C7    . DT  I 3 12  ? -60.299 -8.350  -20.699 1.00 56.72  ? 12   DT  I C7    1 
ATOM   7415 C  C6    . DT  I 3 12  ? -59.399 -9.305  -18.604 1.00 69.07  ? 12   DT  I C6    1 
ATOM   7416 P  P     . DT  I 3 13  ? -59.311 -14.172 -14.444 1.00 83.27  ? 13   DT  I P     1 
ATOM   7417 O  OP1   . DT  I 3 13  ? -58.530 -15.201 -13.720 1.00 91.56  ? 13   DT  I OP1   1 
ATOM   7418 O  OP2   . DT  I 3 13  ? -60.462 -14.568 -15.266 1.00 79.95  ? 13   DT  I OP2   1 
ATOM   7419 O  "O5'" . DT  I 3 13  ? -59.787 -13.031 -13.422 1.00 87.40  ? 13   DT  I "O5'" 1 
ATOM   7420 C  "C5'" . DT  I 3 13  ? -58.791 -12.197 -12.795 1.00 79.13  ? 13   DT  I "C5'" 1 
ATOM   7421 C  "C4'" . DT  I 3 13  ? -59.422 -11.069 -11.994 1.00 79.01  ? 13   DT  I "C4'" 1 
ATOM   7422 O  "O4'" . DT  I 3 13  ? -59.879 -10.013 -12.879 1.00 76.26  ? 13   DT  I "O4'" 1 
ATOM   7423 C  "C3'" . DT  I 3 13  ? -60.650 -11.450 -11.149 1.00 80.39  ? 13   DT  I "C3'" 1 
ATOM   7424 O  "O3'" . DT  I 3 13  ? -60.618 -10.712 -9.950  1.00 77.13  ? 13   DT  I "O3'" 1 
ATOM   7425 C  "C2'" . DT  I 3 13  ? -61.800 -10.965 -12.028 1.00 74.81  ? 13   DT  I "C2'" 1 
ATOM   7426 C  "C1'" . DT  I 3 13  ? -61.193 -9.663  -12.497 1.00 69.72  ? 13   DT  I "C1'" 1 
ATOM   7427 N  N1    . DT  I 3 13  ? -61.843 -9.061  -13.646 1.00 67.87  ? 13   DT  I N1    1 
ATOM   7428 C  C2    . DT  I 3 13  ? -62.192 -7.730  -13.587 1.00 67.27  ? 13   DT  I C2    1 
ATOM   7429 O  O2    . DT  I 3 13  ? -62.003 -7.033  -12.603 1.00 69.29  ? 13   DT  I O2    1 
ATOM   7430 N  N3    . DT  I 3 13  ? -62.769 -7.241  -14.721 1.00 60.55  ? 13   DT  I N3    1 
ATOM   7431 C  C4    . DT  I 3 13  ? -63.005 -7.931  -15.891 1.00 67.99  ? 13   DT  I C4    1 
ATOM   7432 O  O4    . DT  I 3 13  ? -63.516 -7.394  -16.866 1.00 75.55  ? 13   DT  I O4    1 
ATOM   7433 C  C5    . DT  I 3 13  ? -62.611 -9.328  -15.883 1.00 67.67  ? 13   DT  I C5    1 
ATOM   7434 C  C7    . DT  I 3 13  ? -62.827 -10.187 -17.094 1.00 58.39  ? 13   DT  I C7    1 
ATOM   7435 C  C6    . DT  I 3 13  ? -62.051 -9.814  -14.774 1.00 68.09  ? 13   DT  I C6    1 
ATOM   7436 P  P     . DA  I 3 14  ? -59.825 -11.247 -8.660  1.00 78.66  ? 14   DA  I P     1 
ATOM   7437 O  OP1   . DA  I 3 14  ? -58.419 -11.541 -8.992  1.00 66.40  ? 14   DA  I OP1   1 
ATOM   7438 O  OP2   . DA  I 3 14  ? -60.736 -12.266 -8.062  1.00 71.11  ? 14   DA  I OP2   1 
ATOM   7439 O  "O5'" . DA  I 3 14  ? -59.714 -9.947  -7.745  1.00 60.80  ? 14   DA  I "O5'" 1 
ATOM   7440 C  "C5'" . DA  I 3 14  ? -59.109 -8.785  -8.279  1.00 59.40  ? 14   DA  I "C5'" 1 
ATOM   7441 C  "C4'" . DA  I 3 14  ? -59.898 -7.540  -7.912  1.00 60.05  ? 14   DA  I "C4'" 1 
ATOM   7442 O  "O4'" . DA  I 3 14  ? -61.027 -7.371  -8.810  1.00 66.93  ? 14   DA  I "O4'" 1 
ATOM   7443 C  "C3'" . DA  I 3 14  ? -60.488 -7.532  -6.512  1.00 63.19  ? 14   DA  I "C3'" 1 
ATOM   7444 O  "O3'" . DA  I 3 14  ? -60.486 -6.187  -6.034  1.00 54.32  ? 14   DA  I "O3'" 1 
ATOM   7445 C  "C2'" . DA  I 3 14  ? -61.909 -8.071  -6.741  1.00 63.57  ? 14   DA  I "C2'" 1 
ATOM   7446 C  "C1'" . DA  I 3 14  ? -62.247 -7.413  -8.074  1.00 63.64  ? 14   DA  I "C1'" 1 
ATOM   7447 N  N9    . DA  I 3 14  ? -63.226 -8.108  -8.909  1.00 55.78  ? 14   DA  I N9    1 
ATOM   7448 C  C8    . DA  I 3 14  ? -63.469 -9.452  -8.988  1.00 58.53  ? 14   DA  I C8    1 
ATOM   7449 N  N7    . DA  I 3 14  ? -64.385 -9.772  -9.888  1.00 63.14  ? 14   DA  I N7    1 
ATOM   7450 C  C5    . DA  I 3 14  ? -64.736 -8.555  -10.452 1.00 57.63  ? 14   DA  I C5    1 
ATOM   7451 C  C6    . DA  I 3 14  ? -65.641 -8.194  -11.468 1.00 55.33  ? 14   DA  I C6    1 
ATOM   7452 N  N6    . DA  I 3 14  ? -66.400 -9.062  -12.126 1.00 58.30  ? 14   DA  I N6    1 
ATOM   7453 N  N1    . DA  I 3 14  ? -65.753 -6.889  -11.769 1.00 60.83  ? 14   DA  I N1    1 
ATOM   7454 C  C2    . DA  I 3 14  ? -65.006 -6.003  -11.111 1.00 52.74  ? 14   DA  I C2    1 
ATOM   7455 N  N3    . DA  I 3 14  ? -64.122 -6.216  -10.149 1.00 52.75  ? 14   DA  I N3    1 
ATOM   7456 C  C4    . DA  I 3 14  ? -64.031 -7.524  -9.860  1.00 57.79  ? 14   DA  I C4    1 
ATOM   7457 P  P     . DC  I 3 15  ? -60.602 -5.884  -4.466  1.00 57.38  ? 15   DC  I P     1 
ATOM   7458 O  OP1   . DC  I 3 15  ? -60.186 -4.468  -4.349  1.00 49.94  ? 15   DC  I OP1   1 
ATOM   7459 O  OP2   . DC  I 3 15  ? -59.939 -6.944  -3.659  1.00 50.03  ? 15   DC  I OP2   1 
ATOM   7460 O  "O5'" . DC  I 3 15  ? -62.180 -6.035  -4.187  1.00 61.92  ? 15   DC  I "O5'" 1 
ATOM   7461 C  "C5'" . DC  I 3 15  ? -63.035 -4.888  -4.134  1.00 51.09  ? 15   DC  I "C5'" 1 
ATOM   7462 C  "C4'" . DC  I 3 15  ? -63.146 -4.239  -5.493  1.00 49.46  ? 15   DC  I "C4'" 1 
ATOM   7463 O  "O4'" . DC  I 3 15  ? -63.706 -5.181  -6.422  1.00 49.04  ? 15   DC  I "O4'" 1 
ATOM   7464 C  "C3'" . DC  I 3 15  ? -64.073 -3.031  -5.554  1.00 54.57  ? 15   DC  I "C3'" 1 
ATOM   7465 O  "O3'" . DC  I 3 15  ? -63.642 -2.169  -6.596  1.00 51.95  ? 15   DC  I "O3'" 1 
ATOM   7466 C  "C2'" . DC  I 3 15  ? -65.414 -3.675  -5.884  1.00 50.34  ? 15   DC  I "C2'" 1 
ATOM   7467 C  "C1'" . DC  I 3 15  ? -64.931 -4.652  -6.923  1.00 55.99  ? 15   DC  I "C1'" 1 
ATOM   7468 N  N1    . DC  I 3 15  ? -65.854 -5.771  -7.255  1.00 54.27  ? 15   DC  I N1    1 
ATOM   7469 C  C2    . DC  I 3 15  ? -66.681 -5.646  -8.366  1.00 53.93  ? 15   DC  I C2    1 
ATOM   7470 O  O2    . DC  I 3 15  ? -66.672 -4.578  -9.000  1.00 55.02  ? 15   DC  I O2    1 
ATOM   7471 N  N3    . DC  I 3 15  ? -67.474 -6.686  -8.711  1.00 51.94  ? 15   DC  I N3    1 
ATOM   7472 C  C4    . DC  I 3 15  ? -67.438 -7.808  -7.998  1.00 52.42  ? 15   DC  I C4    1 
ATOM   7473 N  N4    . DC  I 3 15  ? -68.240 -8.803  -8.365  1.00 59.44  ? 15   DC  I N4    1 
ATOM   7474 C  C5    . DC  I 3 15  ? -66.590 -7.956  -6.865  1.00 52.16  ? 15   DC  I C5    1 
ATOM   7475 C  C6    . DC  I 3 15  ? -65.813 -6.928  -6.540  1.00 52.69  ? 15   DC  I C6    1 
ATOM   7476 P  P     . DC  I 3 16  ? -64.439 -0.810  -6.880  1.00 47.96  ? 16   DC  I P     1 
ATOM   7477 O  OP1   . DC  I 3 16  ? -65.290 -1.066  -8.065  1.00 65.50  ? 16   DC  I OP1   1 
ATOM   7478 O  OP2   . DC  I 3 16  ? -63.458 0.288   -6.958  1.00 52.25  ? 16   DC  I OP2   1 
ATOM   7479 O  "O5'" . DC  I 3 16  ? -65.336 -0.655  -5.553  1.00 44.82  ? 16   DC  I "O5'" 1 
ATOM   7480 C  "C5'" . DC  I 3 16  ? -66.261 0.427   -5.416  1.00 54.44  ? 16   DC  I "C5'" 1 
ATOM   7481 C  "C4'" . DC  I 3 16  ? -67.549 0.195   -6.214  1.00 57.94  ? 16   DC  I "C4'" 1 
ATOM   7482 O  "O4'" . DC  I 3 16  ? -67.811 -1.219  -6.412  1.00 52.95  ? 16   DC  I "O4'" 1 
ATOM   7483 C  "C3'" . DC  I 3 16  ? -68.829 0.775   -5.588  1.00 58.25  ? 16   DC  I "C3'" 1 
ATOM   7484 O  "O3'" . DC  I 3 16  ? -69.420 1.696   -6.521  1.00 57.84  ? 16   DC  I "O3'" 1 
ATOM   7485 C  "C2'" . DC  I 3 16  ? -69.714 -0.468  -5.338  1.00 55.44  ? 16   DC  I "C2'" 1 
ATOM   7486 C  "C1'" . DC  I 3 16  ? -69.207 -1.409  -6.411  1.00 54.45  ? 16   DC  I "C1'" 1 
ATOM   7487 N  N1    . DC  I 3 16  ? -69.473 -2.868  -6.188  1.00 54.23  ? 16   DC  I N1    1 
ATOM   7488 C  C2    . DC  I 3 16  ? -70.073 -3.612  -7.199  1.00 50.00  ? 16   DC  I C2    1 
ATOM   7489 O  O2    . DC  I 3 16  ? -70.422 -3.044  -8.226  1.00 53.45  ? 16   DC  I O2    1 
ATOM   7490 N  N3    . DC  I 3 16  ? -70.255 -4.935  -7.029  1.00 54.30  ? 16   DC  I N3    1 
ATOM   7491 C  C4    . DC  I 3 16  ? -69.860 -5.525  -5.912  1.00 50.75  ? 16   DC  I C4    1 
ATOM   7492 N  N4    . DC  I 3 16  ? -70.075 -6.840  -5.794  1.00 47.92  ? 16   DC  I N4    1 
ATOM   7493 C  C5    . DC  I 3 16  ? -69.230 -4.795  -4.862  1.00 51.09  ? 16   DC  I C5    1 
ATOM   7494 C  C6    . DC  I 3 16  ? -69.048 -3.479  -5.045  1.00 53.63  ? 16   DC  I C6    1 
ATOM   7495 P  P     . DC  I 3 17  ? -70.675 2.608   -6.120  1.00 63.10  ? 17   DC  I P     1 
ATOM   7496 O  OP1   . DC  I 3 17  ? -70.575 3.796   -6.983  1.00 74.65  ? 17   DC  I OP1   1 
ATOM   7497 O  OP2   . DC  I 3 17  ? -70.757 2.836   -4.653  1.00 58.98  ? 17   DC  I OP2   1 
ATOM   7498 O  "O5'" . DC  I 3 17  ? -71.908 1.722   -6.599  1.00 61.12  ? 17   DC  I "O5'" 1 
ATOM   7499 C  "C5'" . DC  I 3 17  ? -72.003 1.334   -7.948  1.00 57.88  ? 17   DC  I "C5'" 1 
ATOM   7500 C  "C4'" . DC  I 3 17  ? -73.244 0.495   -8.180  1.00 67.63  ? 17   DC  I "C4'" 1 
ATOM   7501 O  "O4'" . DC  I 3 17  ? -72.985 -0.872  -7.780  1.00 72.78  ? 17   DC  I "O4'" 1 
ATOM   7502 C  "C3'" . DC  I 3 17  ? -74.500 0.946   -7.409  1.00 69.93  ? 17   DC  I "C3'" 1 
ATOM   7503 O  "O3'" . DC  I 3 17  ? -75.544 1.251   -8.349  1.00 78.26  ? 17   DC  I "O3'" 1 
ATOM   7504 C  "C2'" . DC  I 3 17  ? -74.850 -0.264  -6.510  1.00 67.23  ? 17   DC  I "C2'" 1 
ATOM   7505 C  "C1'" . DC  I 3 17  ? -74.159 -1.419  -7.230  1.00 67.24  ? 17   DC  I "C1'" 1 
ATOM   7506 N  N1    . DC  I 3 17  ? -73.767 -2.581  -6.348  1.00 64.46  ? 17   DC  I N1    1 
ATOM   7507 C  C2    . DC  I 3 17  ? -74.113 -3.886  -6.735  1.00 63.81  ? 17   DC  I C2    1 
ATOM   7508 O  O2    . DC  I 3 17  ? -74.752 -4.053  -7.782  1.00 68.30  ? 17   DC  I O2    1 
ATOM   7509 N  N3    . DC  I 3 17  ? -73.748 -4.936  -5.940  1.00 61.25  ? 17   DC  I N3    1 
ATOM   7510 C  C4    . DC  I 3 17  ? -73.058 -4.720  -4.816  1.00 58.30  ? 17   DC  I C4    1 
ATOM   7511 N  N4    . DC  I 3 17  ? -72.718 -5.784  -4.083  1.00 53.04  ? 17   DC  I N4    1 
ATOM   7512 C  C5    . DC  I 3 17  ? -72.690 -3.398  -4.397  1.00 56.61  ? 17   DC  I C5    1 
ATOM   7513 C  C6    . DC  I 3 17  ? -73.057 -2.366  -5.191  1.00 63.86  ? 17   DC  I C6    1 
ATOM   7514 P  P     . DG  I 3 18  ? -76.821 2.164   -7.967  1.00 77.48  ? 18   DG  I P     1 
ATOM   7515 O  OP1   . DG  I 3 18  ? -77.167 2.839   -9.235  1.00 73.57  ? 18   DG  I OP1   1 
ATOM   7516 O  OP2   . DG  I 3 18  ? -76.652 2.924   -6.710  1.00 68.78  ? 18   DG  I OP2   1 
ATOM   7517 O  "O5'" . DG  I 3 18  ? -77.966 1.108   -7.658  1.00 66.24  ? 18   DG  I "O5'" 1 
ATOM   7518 C  "C5'" . DG  I 3 18  ? -78.279 0.124   -8.613  1.00 65.01  ? 18   DG  I "C5'" 1 
ATOM   7519 C  "C4'" . DG  I 3 18  ? -79.108 -0.951  -7.975  1.00 66.19  ? 18   DG  I "C4'" 1 
ATOM   7520 O  "O4'" . DG  I 3 18  ? -78.239 -1.879  -7.277  1.00 67.20  ? 18   DG  I "O4'" 1 
ATOM   7521 C  "C3'" . DG  I 3 18  ? -80.107 -0.431  -6.927  1.00 73.43  ? 18   DG  I "C3'" 1 
ATOM   7522 O  "O3'" . DG  I 3 18  ? -81.359 -1.097  -7.088  1.00 86.71  ? 18   DG  I "O3'" 1 
ATOM   7523 C  "C2'" . DG  I 3 18  ? -79.451 -0.821  -5.618  1.00 65.51  ? 18   DG  I "C2'" 1 
ATOM   7524 C  "C1'" . DG  I 3 18  ? -78.809 -2.133  -6.024  1.00 69.79  ? 18   DG  I "C1'" 1 
ATOM   7525 N  N9    . DG  I 3 18  ? -77.810 -2.600  -5.060  1.00 68.23  ? 18   DG  I N9    1 
ATOM   7526 C  C8    . DG  I 3 18  ? -77.118 -1.826  -4.160  1.00 63.02  ? 18   DG  I C8    1 
ATOM   7527 N  N7    . DG  I 3 18  ? -76.354 -2.511  -3.366  1.00 63.10  ? 18   DG  I N7    1 
ATOM   7528 C  C5    . DG  I 3 18  ? -76.558 -3.832  -3.750  1.00 63.91  ? 18   DG  I C5    1 
ATOM   7529 C  C6    . DG  I 3 18  ? -75.989 -5.021  -3.243  1.00 56.98  ? 18   DG  I C6    1 
ATOM   7530 O  O6    . DG  I 3 18  ? -75.179 -5.143  -2.324  1.00 53.41  ? 18   DG  I O6    1 
ATOM   7531 N  N1    . DG  I 3 18  ? -76.461 -6.144  -3.906  1.00 62.90  ? 18   DG  I N1    1 
ATOM   7532 C  C2    . DG  I 3 18  ? -77.378 -6.123  -4.936  1.00 68.17  ? 18   DG  I C2    1 
ATOM   7533 N  N2    . DG  I 3 18  ? -77.713 -7.316  -5.458  1.00 61.27  ? 18   DG  I N2    1 
ATOM   7534 N  N3    . DG  I 3 18  ? -77.926 -5.012  -5.420  1.00 62.85  ? 18   DG  I N3    1 
ATOM   7535 C  C4    . DG  I 3 18  ? -77.465 -3.907  -4.782  1.00 62.38  ? 18   DG  I C4    1 
ATOM   7536 P  P     . DG  I 3 19  ? -82.736 -0.466  -6.539  1.00 81.12  ? 19   DG  I P     1 
ATOM   7537 O  OP1   . DG  I 3 19  ? -83.153 0.517   -7.563  1.00 85.65  ? 19   DG  I OP1   1 
ATOM   7538 O  OP2   . DG  I 3 19  ? -82.628 -0.081  -5.104  1.00 64.71  ? 19   DG  I OP2   1 
ATOM   7539 O  "O5'" . DG  I 3 19  ? -83.726 -1.712  -6.611  1.00 73.68  ? 19   DG  I "O5'" 1 
ATOM   7540 C  "C5'" . DG  I 3 19  ? -83.539 -2.709  -7.615  1.00 74.49  ? 19   DG  I "C5'" 1 
ATOM   7541 C  "C4'" . DG  I 3 19  ? -83.823 -4.082  -7.042  1.00 79.74  ? 19   DG  I "C4'" 1 
ATOM   7542 O  "O4'" . DG  I 3 19  ? -82.648 -4.560  -6.327  1.00 91.17  ? 19   DG  I "O4'" 1 
ATOM   7543 C  "C3'" . DG  I 3 19  ? -84.975 -4.119  -6.035  1.00 85.29  ? 19   DG  I "C3'" 1 
ATOM   7544 O  "O3'" . DG  I 3 19  ? -85.775 -5.285  -6.228  1.00 91.49  ? 19   DG  I "O3'" 1 
ATOM   7545 C  "C2'" . DG  I 3 19  ? -84.265 -4.146  -4.687  1.00 78.46  ? 19   DG  I "C2'" 1 
ATOM   7546 C  "C1'" . DG  I 3 19  ? -83.012 -4.937  -5.017  1.00 81.30  ? 19   DG  I "C1'" 1 
ATOM   7547 N  N9    . DG  I 3 19  ? -81.918 -4.645  -4.098  1.00 78.44  ? 19   DG  I N9    1 
ATOM   7548 C  C8    . DG  I 3 19  ? -81.468 -3.403  -3.709  1.00 74.74  ? 19   DG  I C8    1 
ATOM   7549 N  N7    . DG  I 3 19  ? -80.503 -3.451  -2.833  1.00 69.92  ? 19   DG  I N7    1 
ATOM   7550 C  C5    . DG  I 3 19  ? -80.302 -4.813  -2.629  1.00 72.16  ? 19   DG  I C5    1 
ATOM   7551 C  C6    . DG  I 3 19  ? -79.381 -5.485  -1.795  1.00 69.13  ? 19   DG  I C6    1 
ATOM   7552 O  O6    . DG  I 3 19  ? -78.528 -4.996  -1.039  1.00 69.16  ? 19   DG  I O6    1 
ATOM   7553 N  N1    . DG  I 3 19  ? -79.520 -6.866  -1.884  1.00 70.10  ? 19   DG  I N1    1 
ATOM   7554 C  C2    . DG  I 3 19  ? -80.422 -7.517  -2.680  1.00 71.83  ? 19   DG  I C2    1 
ATOM   7555 N  N2    . DG  I 3 19  ? -80.399 -8.855  -2.630  1.00 67.72  ? 19   DG  I N2    1 
ATOM   7556 N  N3    . DG  I 3 19  ? -81.290 -6.904  -3.469  1.00 81.27  ? 19   DG  I N3    1 
ATOM   7557 C  C4    . DG  I 3 19  ? -81.174 -5.556  -3.392  1.00 77.73  ? 19   DG  I C4    1 
ATOM   7558 P  P     . DC  I 3 20  ? -87.129 -5.482  -5.384  1.00 95.60  ? 20   DC  I P     1 
ATOM   7559 O  OP1   . DC  I 3 20  ? -88.077 -6.079  -6.351  1.00 90.89  ? 20   DC  I OP1   1 
ATOM   7560 O  OP2   . DC  I 3 20  ? -87.415 -4.242  -4.609  1.00 81.53  ? 20   DC  I OP2   1 
ATOM   7561 O  "O5'" . DC  I 3 20  ? -86.763 -6.578  -4.280  1.00 86.84  ? 20   DC  I "O5'" 1 
ATOM   7562 C  "C5'" . DC  I 3 20  ? -86.258 -7.834  -4.680  1.00 90.08  ? 20   DC  I "C5'" 1 
ATOM   7563 C  "C4'" . DC  I 3 20  ? -85.825 -8.640  -3.474  1.00 93.11  ? 20   DC  I "C4'" 1 
ATOM   7564 O  "O4'" . DC  I 3 20  ? -84.635 -8.043  -2.881  1.00 89.74  ? 20   DC  I "O4'" 1 
ATOM   7565 C  "C3'" . DC  I 3 20  ? -86.866 -8.732  -2.348  1.00 94.87  ? 20   DC  I "C3'" 1 
ATOM   7566 O  "O3'" . DC  I 3 20  ? -87.055 -10.104 -1.976  1.00 98.93  ? 20   DC  I "O3'" 1 
ATOM   7567 C  "C2'" . DC  I 3 20  ? -86.234 -7.917  -1.208  1.00 93.76  ? 20   DC  I "C2'" 1 
ATOM   7568 C  "C1'" . DC  I 3 20  ? -84.752 -8.123  -1.486  1.00 91.03  ? 20   DC  I "C1'" 1 
ATOM   7569 N  N1    . DC  I 3 20  ? -83.871 -7.098  -0.859  1.00 88.70  ? 20   DC  I N1    1 
ATOM   7570 C  C2    . DC  I 3 20  ? -82.897 -7.501  0.063   1.00 88.27  ? 20   DC  I C2    1 
ATOM   7571 O  O2    . DC  I 3 20  ? -82.775 -8.705  0.329   1.00 90.77  ? 20   DC  I O2    1 
ATOM   7572 N  N3    . DC  I 3 20  ? -82.109 -6.560  0.637   1.00 82.42  ? 20   DC  I N3    1 
ATOM   7573 C  C4    . DC  I 3 20  ? -82.263 -5.276  0.321   1.00 81.15  ? 20   DC  I C4    1 
ATOM   7574 N  N4    . DC  I 3 20  ? -81.458 -4.388  0.912   1.00 78.26  ? 20   DC  I N4    1 
ATOM   7575 C  C5    . DC  I 3 20  ? -83.252 -4.843  -0.612  1.00 80.08  ? 20   DC  I C5    1 
ATOM   7576 C  C6    . DC  I 3 20  ? -84.027 -5.780  -1.170  1.00 85.15  ? 20   DC  I C6    1 
ATOM   7577 P  P     . DA  I 3 21  ? -88.427 -10.590 -1.294  1.00 96.96  ? 21   DA  I P     1 
ATOM   7578 O  OP1   . DA  I 3 21  ? -89.108 -11.467 -2.278  1.00 95.57  ? 21   DA  I OP1   1 
ATOM   7579 O  OP2   . DA  I 3 21  ? -89.084 -9.395  -0.706  1.00 92.30  ? 21   DA  I OP2   1 
ATOM   7580 O  "O5'" . DA  I 3 21  ? -87.961 -11.482 -0.052  1.00 96.44  ? 21   DA  I "O5'" 1 
ATOM   7581 C  "C5'" . DA  I 3 21  ? -86.614 -11.916 0.060   1.00 96.56  ? 21   DA  I "C5'" 1 
ATOM   7582 C  "C4'" . DA  I 3 21  ? -86.140 -11.829 1.502   1.00 92.43  ? 21   DA  I "C4'" 1 
ATOM   7583 O  "O4'" . DA  I 3 21  ? -85.392 -10.596 1.715   1.00 86.97  ? 21   DA  I "O4'" 1 
ATOM   7584 C  "C3'" . DA  I 3 21  ? -87.247 -11.816 2.561   1.00 96.14  ? 21   DA  I "C3'" 1 
ATOM   7585 O  "O3'" . DA  I 3 21  ? -86.797 -12.529 3.687   1.00 103.81 ? 21   DA  I "O3'" 1 
ATOM   7586 C  "C2'" . DA  I 3 21  ? -87.356 -10.330 2.892   1.00 96.35  ? 21   DA  I "C2'" 1 
ATOM   7587 C  "C1'" . DA  I 3 21  ? -85.883 -9.987  2.888   1.00 91.57  ? 21   DA  I "C1'" 1 
ATOM   7588 N  N9    . DA  I 3 21  ? -85.575 -8.562  2.858   1.00 88.76  ? 21   DA  I N9    1 
ATOM   7589 C  C8    . DA  I 3 21  ? -86.324 -7.556  2.316   1.00 87.21  ? 21   DA  I C8    1 
ATOM   7590 N  N7    . DA  I 3 21  ? -85.777 -6.365  2.442   1.00 88.53  ? 21   DA  I N7    1 
ATOM   7591 C  C5    . DA  I 3 21  ? -84.581 -6.615  3.107   1.00 83.84  ? 21   DA  I C5    1 
ATOM   7592 C  C6    . DA  I 3 21  ? -83.534 -5.776  3.541   1.00 71.82  ? 21   DA  I C6    1 
ATOM   7593 N  N6    . DA  I 3 21  ? -83.522 -4.459  3.362   1.00 63.99  ? 21   DA  I N6    1 
ATOM   7594 N  N1    . DA  I 3 21  ? -82.494 -6.350  4.176   1.00 77.79  ? 21   DA  I N1    1 
ATOM   7595 C  C2    . DA  I 3 21  ? -82.498 -7.673  4.361   1.00 77.41  ? 21   DA  I C2    1 
ATOM   7596 N  N3    . DA  I 3 21  ? -83.419 -8.561  4.001   1.00 88.27  ? 21   DA  I N3    1 
ATOM   7597 C  C4    . DA  I 3 21  ? -84.446 -7.961  3.371   1.00 89.29  ? 21   DA  I C4    1 
ATOM   7598 P  P     . DA  I 3 22  ? -87.674 -13.713 4.312   1.00 109.70 ? 22   DA  I P     1 
ATOM   7599 O  OP1   . DA  I 3 22  ? -87.491 -14.879 3.409   1.00 101.59 ? 22   DA  I OP1   1 
ATOM   7600 O  OP2   . DA  I 3 22  ? -89.009 -13.150 4.624   1.00 103.65 ? 22   DA  I OP2   1 
ATOM   7601 O  "O5'" . DA  I 3 22  ? -86.966 -14.006 5.721   1.00 110.52 ? 22   DA  I "O5'" 1 
ATOM   7602 C  "C5'" . DA  I 3 22  ? -85.540 -14.159 5.797   1.00 110.04 ? 22   DA  I "C5'" 1 
ATOM   7603 C  "C4'" . DA  I 3 22  ? -84.972 -13.466 7.034   1.00 108.35 ? 22   DA  I "C4'" 1 
ATOM   7604 O  "O4'" . DA  I 3 22  ? -84.725 -12.064 6.747   1.00 107.88 ? 22   DA  I "O4'" 1 
ATOM   7605 C  "C3'" . DA  I 3 22  ? -85.875 -13.467 8.275   1.00 112.11 ? 22   DA  I "C3'" 1 
ATOM   7606 O  "O3'" . DA  I 3 22  ? -85.076 -13.545 9.435   1.00 113.87 ? 22   DA  I "O3'" 1 
ATOM   7607 C  "C2'" . DA  I 3 22  ? -86.540 -12.099 8.191   1.00 109.19 ? 22   DA  I "C2'" 1 
ATOM   7608 C  "C1'" . DA  I 3 22  ? -85.350 -11.283 7.747   1.00 103.82 ? 22   DA  I "C1'" 1 
ATOM   7609 N  N9    . DA  I 3 22  ? -85.684 -9.984  7.189   1.00 99.89  ? 22   DA  I N9    1 
ATOM   7610 C  C8    . DA  I 3 22  ? -86.743 -9.666  6.387   1.00 95.01  ? 22   DA  I C8    1 
ATOM   7611 N  N7    . DA  I 3 22  ? -86.769 -8.402  6.029   1.00 95.91  ? 22   DA  I N7    1 
ATOM   7612 C  C5    . DA  I 3 22  ? -85.642 -7.861  6.636   1.00 95.56  ? 22   DA  I C5    1 
ATOM   7613 C  C6    . DA  I 3 22  ? -85.088 -6.556  6.652   1.00 89.13  ? 22   DA  I C6    1 
ATOM   7614 N  N6    . DA  I 3 22  ? -85.625 -5.515  6.011   1.00 81.41  ? 22   DA  I N6    1 
ATOM   7615 N  N1    . DA  I 3 22  ? -83.953 -6.367  7.364   1.00 84.83  ? 22   DA  I N1    1 
ATOM   7616 C  C2    . DA  I 3 22  ? -83.416 -7.410  8.010   1.00 86.09  ? 22   DA  I C2    1 
ATOM   7617 N  N3    . DA  I 3 22  ? -83.841 -8.672  8.064   1.00 86.58  ? 22   DA  I N3    1 
ATOM   7618 C  C4    . DA  I 3 22  ? -84.964 -8.830  7.349   1.00 97.01  ? 22   DA  I C4    1 
ATOM   7619 P  P     . DG  I 3 23  ? -85.422 -14.604 10.590  1.00 120.89 ? 23   DG  I P     1 
ATOM   7620 O  OP1   . DG  I 3 23  ? -84.759 -15.881 10.221  1.00 117.37 ? 23   DG  I OP1   1 
ATOM   7621 O  OP2   . DG  I 3 23  ? -86.882 -14.548 10.852  1.00 111.07 ? 23   DG  I OP2   1 
ATOM   7622 O  "O5'" . DG  I 3 23  ? -84.706 -13.991 11.875  1.00 104.08 ? 23   DG  I "O5'" 1 
ATOM   7623 C  "C5'" . DG  I 3 23  ? -85.351 -12.979 12.610  1.00 105.11 ? 23   DG  I "C5'" 1 
ATOM   7624 C  "C4'" . DG  I 3 23  ? -84.430 -11.799 12.828  1.00 99.35  ? 23   DG  I "C4'" 1 
ATOM   7625 O  "O4'" . DG  I 3 23  ? -84.515 -10.910 11.686  1.00 96.16  ? 23   DG  I "O4'" 1 
ATOM   7626 C  "C3'" . DG  I 3 23  ? -84.770 -10.964 14.060  1.00 101.55 ? 23   DG  I "C3'" 1 
ATOM   7627 O  "O3'" . DG  I 3 23  ? -83.603 -10.694 14.821  1.00 106.03 ? 23   DG  I "O3'" 1 
ATOM   7628 C  "C2'" . DG  I 3 23  ? -85.382 -9.692  13.487  1.00 96.36  ? 23   DG  I "C2'" 1 
ATOM   7629 C  "C1'" . DG  I 3 23  ? -84.719 -9.588  12.126  1.00 93.56  ? 23   DG  I "C1'" 1 
ATOM   7630 N  N9    . DG  I 3 23  ? -85.540 -8.879  11.139  1.00 94.41  ? 23   DG  I N9    1 
ATOM   7631 C  C8    . DG  I 3 23  ? -86.486 -9.422  10.298  1.00 91.62  ? 23   DG  I C8    1 
ATOM   7632 N  N7    . DG  I 3 23  ? -87.064 -8.540  9.526   1.00 88.70  ? 23   DG  I N7    1 
ATOM   7633 C  C5    . DG  I 3 23  ? -86.474 -7.328  9.884   1.00 88.35  ? 23   DG  I C5    1 
ATOM   7634 C  C6    . DG  I 3 23  ? -86.695 -6.010  9.390   1.00 84.14  ? 23   DG  I C6    1 
ATOM   7635 O  O6    . DG  I 3 23  ? -87.481 -5.638  8.506   1.00 81.28  ? 23   DG  I O6    1 
ATOM   7636 N  N1    . DG  I 3 23  ? -85.874 -5.075  10.022  1.00 86.56  ? 23   DG  I N1    1 
ATOM   7637 C  C2    . DG  I 3 23  ? -84.958 -5.366  11.007  1.00 83.11  ? 23   DG  I C2    1 
ATOM   7638 N  N2    . DG  I 3 23  ? -84.260 -4.322  11.499  1.00 76.35  ? 23   DG  I N2    1 
ATOM   7639 N  N3    . DG  I 3 23  ? -84.742 -6.591  11.480  1.00 84.79  ? 23   DG  I N3    1 
ATOM   7640 C  C4    . DG  I 3 23  ? -85.532 -7.520  10.875  1.00 90.82  ? 23   DG  I C4    1 
ATOM   7641 P  P     . DG  I 3 24  ? -83.707 -10.577 16.421  1.00 114.20 ? 24   DG  I P     1 
ATOM   7642 O  OP1   . DG  I 3 24  ? -82.358 -10.793 16.986  1.00 119.61 ? 24   DG  I OP1   1 
ATOM   7643 O  OP2   . DG  I 3 24  ? -84.849 -11.403 16.870  1.00 111.59 ? 24   DG  I OP2   1 
ATOM   7644 O  "O5'" . DG  I 3 24  ? -84.063 -9.052  16.670  1.00 103.30 ? 24   DG  I "O5'" 1 
ATOM   7645 C  "C5'" . DG  I 3 24  ? -83.040 -8.098  16.594  1.00 107.55 ? 24   DG  I "C5'" 1 
ATOM   7646 C  "C4'" . DG  I 3 24  ? -83.617 -6.709  16.670  1.00 111.90 ? 24   DG  I "C4'" 1 
ATOM   7647 O  "O4'" . DG  I 3 24  ? -84.369 -6.435  15.458  1.00 106.59 ? 24   DG  I "O4'" 1 
ATOM   7648 C  "C3'" . DG  I 3 24  ? -84.593 -6.477  17.836  1.00 114.85 ? 24   DG  I "C3'" 1 
ATOM   7649 O  "O3'" . DG  I 3 24  ? -84.328 -5.201  18.419  1.00 124.13 ? 24   DG  I "O3'" 1 
ATOM   7650 C  "C2'" . DG  I 3 24  ? -85.961 -6.503  17.143  1.00 105.20 ? 24   DG  I "C2'" 1 
ATOM   7651 C  "C1'" . DG  I 3 24  ? -85.594 -5.846  15.825  1.00 105.00 ? 24   DG  I "C1'" 1 
ATOM   7652 N  N9    . DG  I 3 24  ? -86.569 -6.012  14.736  1.00 94.85  ? 24   DG  I N9    1 
ATOM   7653 C  C8    . DG  I 3 24  ? -87.125 -7.177  14.267  1.00 94.70  ? 24   DG  I C8    1 
ATOM   7654 N  N7    . DG  I 3 24  ? -87.953 -6.996  13.271  1.00 91.46  ? 24   DG  I N7    1 
ATOM   7655 C  C5    . DG  I 3 24  ? -87.943 -5.622  13.072  1.00 87.71  ? 24   DG  I C5    1 
ATOM   7656 C  C6    . DG  I 3 24  ? -88.643 -4.826  12.133  1.00 84.48  ? 24   DG  I C6    1 
ATOM   7657 O  O6    . DG  I 3 24  ? -89.446 -5.193  11.259  1.00 86.81  ? 24   DG  I O6    1 
ATOM   7658 N  N1    . DG  I 3 24  ? -88.338 -3.470  12.280  1.00 81.90  ? 24   DG  I N1    1 
ATOM   7659 C  C2    . DG  I 3 24  ? -87.464 -2.953  13.214  1.00 81.41  ? 24   DG  I C2    1 
ATOM   7660 N  N2    . DG  I 3 24  ? -87.293 -1.620  13.211  1.00 77.96  ? 24   DG  I N2    1 
ATOM   7661 N  N3    . DG  I 3 24  ? -86.806 -3.689  14.089  1.00 84.93  ? 24   DG  I N3    1 
ATOM   7662 C  C4    . DG  I 3 24  ? -87.093 -5.007  13.964  1.00 86.99  ? 24   DG  I C4    1 
ATOM   7663 P  P     . DC  I 3 25  ? -84.423 -4.972  20.009  1.00 134.81 ? 25   DC  I P     1 
ATOM   7664 O  OP1   . DC  I 3 25  ? -83.030 -4.846  20.504  1.00 123.29 ? 25   DC  I OP1   1 
ATOM   7665 O  OP2   . DC  I 3 25  ? -85.316 -6.019  20.568  1.00 113.85 ? 25   DC  I OP2   1 
ATOM   7666 O  "O5'" . DC  I 3 25  ? -85.125 -3.521  20.144  1.00 125.50 ? 25   DC  I "O5'" 1 
ATOM   7667 C  "C5'" . DC  I 3 25  ? -84.400 -2.315  19.792  1.00 112.70 ? 25   DC  I "C5'" 1 
ATOM   7668 C  "C4'" . DC  I 3 25  ? -85.338 -1.206  19.303  1.00 104.72 ? 25   DC  I "C4'" 1 
ATOM   7669 O  "O4'" . DC  I 3 25  ? -86.034 -1.635  18.110  1.00 103.34 ? 25   DC  I "O4'" 1 
ATOM   7670 C  "C3'" . DC  I 3 25  ? -86.412 -0.756  20.298  1.00 105.79 ? 25   DC  I "C3'" 1 
ATOM   7671 O  "O3'" . DC  I 3 25  ? -86.251 0.627   20.591  1.00 110.22 ? 25   DC  I "O3'" 1 
ATOM   7672 C  "C2'" . DC  I 3 25  ? -87.753 -1.035  19.595  1.00 94.86  ? 25   DC  I "C2'" 1 
ATOM   7673 C  "C1'" . DC  I 3 25  ? -87.366 -1.178  18.131  1.00 95.15  ? 25   DC  I "C1'" 1 
ATOM   7674 N  N1    . DC  I 3 25  ? -88.194 -2.183  17.390  1.00 95.71  ? 25   DC  I N1    1 
ATOM   7675 C  C2    . DC  I 3 25  ? -88.951 -1.783  16.269  1.00 90.09  ? 25   DC  I C2    1 
ATOM   7676 O  O2    . DC  I 3 25  ? -88.933 -0.586  15.915  1.00 84.52  ? 25   DC  I O2    1 
ATOM   7677 N  N3    . DC  I 3 25  ? -89.686 -2.724  15.603  1.00 85.12  ? 25   DC  I N3    1 
ATOM   7678 C  C4    . DC  I 3 25  ? -89.669 -4.003  16.010  1.00 89.28  ? 25   DC  I C4    1 
ATOM   7679 N  N4    . DC  I 3 25  ? -90.399 -4.894  15.320  1.00 85.36  ? 25   DC  I N4    1 
ATOM   7680 C  C5    . DC  I 3 25  ? -88.896 -4.423  17.143  1.00 92.26  ? 25   DC  I C5    1 
ATOM   7681 C  C6    . DC  I 3 25  ? -88.184 -3.493  17.794  1.00 93.08  ? 25   DC  I C6    1 
HETATM 7682 ZN ZN    . ZN  J 5 .   ? -7.230  0.450   28.774  1.00 87.34  ? 1188 ZN  A ZN    1 
HETATM 7683 ZN ZN    . ZN  K 5 .   ? -3.518  -1.026  -38.232 1.00 80.44  ? 1197 ZN  D ZN    1 
HETATM 7684 ZN ZN    . ZN  L 5 .   ? -62.753 2.486   -7.099  1.00 88.23  ? 1182 ZN  G ZN    1 
HETATM 7685 O  O     . HOH M 6 .   ? -5.904  12.301  3.393   1.00 70.56  ? 2001 HOH A O     1 
HETATM 7686 O  O     . HOH M 6 .   ? -5.668  -6.388  20.978  1.00 46.05  ? 2002 HOH A O     1 
HETATM 7687 O  O     . HOH M 6 .   ? -7.205  -5.256  23.087  1.00 52.52  ? 2003 HOH A O     1 
HETATM 7688 O  O     . HOH M 6 .   ? -6.891  -2.461  26.991  1.00 36.85  ? 2004 HOH A O     1 
HETATM 7689 O  O     . HOH M 6 .   ? -6.630  2.997   28.775  1.00 42.89  ? 2005 HOH A O     1 
HETATM 7690 O  O     . HOH M 6 .   ? -15.394 -9.426  12.984  1.00 48.74  ? 2006 HOH A O     1 
HETATM 7691 O  O     . HOH M 6 .   ? -25.085 0.160   16.893  1.00 57.40  ? 2007 HOH A O     1 
HETATM 7692 O  O     . HOH M 6 .   ? -23.209 -0.833  10.201  1.00 46.36  ? 2008 HOH A O     1 
HETATM 7693 O  O     . HOH M 6 .   ? -20.035 -3.527  19.833  1.00 51.98  ? 2009 HOH A O     1 
HETATM 7694 O  O     . HOH M 6 .   ? -11.435 4.507   31.692  1.00 53.81  ? 2010 HOH A O     1 
HETATM 7695 O  O     . HOH M 6 .   ? -21.970 12.237  16.249  1.00 58.73  ? 2011 HOH A O     1 
HETATM 7696 O  O     . HOH M 6 .   ? -21.982 12.246  12.778  1.00 59.61  ? 2012 HOH A O     1 
HETATM 7697 O  O     . HOH M 6 .   ? -19.146 16.526  6.162   1.00 65.53  ? 2013 HOH A O     1 
HETATM 7698 O  O     . HOH M 6 .   ? 1.381   16.086  21.447  1.00 56.25  ? 2014 HOH A O     1 
HETATM 7699 O  O     . HOH M 6 .   ? -23.485 4.586   14.983  1.00 53.58  ? 2015 HOH A O     1 
HETATM 7700 O  O     . HOH M 6 .   ? 10.008  0.599   31.820  1.00 48.02  ? 2016 HOH A O     1 
HETATM 7701 O  O     . HOH M 6 .   ? 6.962   -6.272  33.503  1.00 53.21  ? 2017 HOH A O     1 
HETATM 7702 O  O     . HOH M 6 .   ? -4.677  -7.233  19.239  1.00 53.88  ? 2018 HOH A O     1 
HETATM 7703 O  O     . HOH M 6 .   ? -0.662  -14.655 22.479  1.00 52.80  ? 2019 HOH A O     1 
HETATM 7704 O  O     . HOH M 6 .   ? 9.154   -6.351  31.580  1.00 46.02  ? 2020 HOH A O     1 
HETATM 7705 O  O     . HOH M 6 .   ? 16.146  9.585   30.472  1.00 60.32  ? 2021 HOH A O     1 
HETATM 7706 O  O     . HOH M 6 .   ? 3.336   14.773  21.769  1.00 72.97  ? 2022 HOH A O     1 
HETATM 7707 O  O     . HOH N 6 .   ? 11.017  -15.082 29.693  1.00 76.03  ? 2001 HOH B O     1 
HETATM 7708 O  O     . HOH N 6 .   ? -7.552  -4.335  33.099  1.00 66.38  ? 2002 HOH B O     1 
HETATM 7709 O  O     . HOH N 6 .   ? -11.831 -8.515  26.557  1.00 62.77  ? 2003 HOH B O     1 
HETATM 7710 O  O     . HOH N 6 .   ? -13.158 -10.691 25.812  1.00 62.47  ? 2004 HOH B O     1 
HETATM 7711 O  O     . HOH N 6 .   ? -36.897 -5.677  5.663   1.00 51.83  ? 2005 HOH B O     1 
HETATM 7712 O  O     . HOH N 6 .   ? -36.649 5.557   0.023   1.00 76.73  ? 2006 HOH B O     1 
HETATM 7713 O  O     . HOH O 6 .   ? -29.867 2.509   7.670   1.00 62.14  ? 2001 HOH C O     1 
HETATM 7714 O  O     . HOH O 6 .   ? -28.545 2.233   5.865   1.00 68.49  ? 2002 HOH C O     1 
HETATM 7715 O  O     . HOH P 6 .   ? -8.588  -6.643  -35.193 1.00 62.25  ? 2001 HOH D O     1 
HETATM 7716 O  O     . HOH P 6 .   ? -5.724  -4.022  -37.152 1.00 40.49  ? 2002 HOH D O     1 
HETATM 7717 O  O     . HOH P 6 .   ? -3.164  1.339   -38.152 1.00 49.99  ? 2003 HOH D O     1 
HETATM 7718 O  O     . HOH P 6 .   ? -13.466 -9.742  -22.613 1.00 58.74  ? 2004 HOH D O     1 
HETATM 7719 O  O     . HOH P 6 .   ? -13.398 -11.831 -2.236  1.00 63.41  ? 2005 HOH D O     1 
HETATM 7720 O  O     . HOH P 6 .   ? -4.422  -0.331  -16.587 1.00 49.43  ? 2006 HOH D O     1 
HETATM 7721 O  O     . HOH P 6 .   ? -11.240 -1.067  -14.770 1.00 42.61  ? 2007 HOH D O     1 
HETATM 7722 O  O     . HOH P 6 .   ? -4.807  -4.276  -22.346 1.00 42.75  ? 2008 HOH D O     1 
HETATM 7723 O  O     . HOH P 6 .   ? 5.407   6.497   -23.093 1.00 62.80  ? 2009 HOH D O     1 
HETATM 7724 O  O     . HOH P 6 .   ? -14.027 5.625   -14.408 1.00 65.32  ? 2010 HOH D O     1 
HETATM 7725 O  O     . HOH P 6 .   ? -6.744  4.216   -17.363 1.00 46.58  ? 2011 HOH D O     1 
HETATM 7726 O  O     . HOH P 6 .   ? 1.174   -3.037  -23.557 1.00 43.07  ? 2012 HOH D O     1 
HETATM 7727 O  O     . HOH P 6 .   ? -15.844 4.011   -14.562 1.00 53.74  ? 2013 HOH D O     1 
HETATM 7728 O  O     . HOH P 6 .   ? -20.888 -4.429  -27.680 1.00 53.25  ? 2014 HOH D O     1 
HETATM 7729 O  O     . HOH P 6 .   ? -27.280 0.560   -23.424 1.00 60.64  ? 2015 HOH D O     1 
HETATM 7730 O  O     . HOH P 6 .   ? -23.149 3.192   -20.516 1.00 49.61  ? 2016 HOH D O     1 
HETATM 7731 O  O     . HOH P 6 .   ? -21.633 -6.894  -35.421 1.00 60.83  ? 2017 HOH D O     1 
HETATM 7732 O  O     . HOH P 6 .   ? -1.796  -0.972  -40.462 1.00 61.02  ? 2018 HOH D O     1 
HETATM 7733 O  O     . HOH P 6 .   ? -7.696  -4.469  -55.167 1.00 69.62  ? 2019 HOH D O     1 
HETATM 7734 O  O     . HOH P 6 .   ? -16.228 -7.627  -34.229 1.00 63.75  ? 2020 HOH D O     1 
HETATM 7735 O  O     . HOH P 6 .   ? -22.040 -4.557  -52.210 1.00 59.04  ? 2021 HOH D O     1 
HETATM 7736 O  O     . HOH P 6 .   ? -4.701  -21.303 -51.481 1.00 91.69  ? 2022 HOH D O     1 
HETATM 7737 O  O     . HOH Q 6 .   ? 0.159   3.705   -71.281 1.00 71.61  ? 2001 HOH E O     1 
HETATM 7738 O  O     . HOH Q 6 .   ? -1.736  -4.646  -67.445 1.00 77.22  ? 2002 HOH E O     1 
HETATM 7739 O  O     . HOH Q 6 .   ? -5.137  -11.025 -32.033 1.00 62.13  ? 2003 HOH E O     1 
HETATM 7740 O  O     . HOH Q 6 .   ? -4.056  -12.375 -30.353 1.00 54.54  ? 2004 HOH E O     1 
HETATM 7741 O  O     . HOH Q 6 .   ? -4.924  -3.324  -1.160  1.00 70.79  ? 2005 HOH E O     1 
HETATM 7742 O  O     . HOH Q 6 .   ? -6.700  -5.066  -1.578  1.00 59.52  ? 2006 HOH E O     1 
HETATM 7743 O  O     . HOH R 6 .   ? -17.540 2.030   -10.956 1.00 72.25  ? 2001 HOH F O     1 
HETATM 7744 O  O     . HOH R 6 .   ? 3.417   -10.328 -19.464 1.00 80.67  ? 2002 HOH F O     1 
HETATM 7745 O  O     . HOH R 6 .   ? 1.753   -5.454  -42.190 1.00 66.11  ? 2003 HOH F O     1 
HETATM 7746 O  O     . HOH R 6 .   ? 0.389   0.036   -41.229 1.00 71.27  ? 2004 HOH F O     1 
HETATM 7747 O  O     . HOH R 6 .   ? -17.517 -3.041  -67.061 1.00 67.88  ? 2005 HOH F O     1 
HETATM 7748 O  O     . HOH S 6 .   ? -48.968 19.729  0.779   1.00 79.54  ? 2001 HOH G O     1 
HETATM 7749 O  O     . HOH S 6 .   ? -58.566 -2.888  -5.388  1.00 52.01  ? 2002 HOH G O     1 
HETATM 7750 O  O     . HOH S 6 .   ? -56.123 -5.339  -1.851  1.00 50.15  ? 2003 HOH G O     1 
HETATM 7751 O  O     . HOH S 6 .   ? -60.997 -0.680  -6.731  1.00 38.39  ? 2004 HOH G O     1 
HETATM 7752 O  O     . HOH S 6 .   ? -63.240 5.196   -6.779  1.00 59.52  ? 2005 HOH G O     1 
HETATM 7753 O  O     . HOH S 6 .   ? -41.467 -11.707 -19.048 1.00 70.62  ? 2006 HOH G O     1 
HETATM 7754 O  O     . HOH S 6 .   ? -28.731 -10.331 -19.346 1.00 45.44  ? 2007 HOH G O     1 
HETATM 7755 O  O     . HOH S 6 .   ? -43.672 2.964   -17.179 1.00 54.39  ? 2008 HOH G O     1 
HETATM 7756 O  O     . HOH S 6 .   ? -38.880 1.071   -12.333 1.00 55.32  ? 2009 HOH G O     1 
HETATM 7757 O  O     . HOH S 6 .   ? -48.856 -0.898  -14.611 1.00 44.60  ? 2010 HOH G O     1 
HETATM 7758 O  O     . HOH S 6 .   ? -47.843 19.087  -5.730  1.00 55.06  ? 2011 HOH G O     1 
HETATM 7759 O  O     . HOH S 6 .   ? -38.940 16.591  -8.437  1.00 65.08  ? 2012 HOH G O     1 
HETATM 7760 O  O     . HOH S 6 .   ? -35.359 8.780   -8.021  1.00 55.47  ? 2013 HOH G O     1 
HETATM 7761 O  O     . HOH S 6 .   ? -38.043 12.031  -14.281 1.00 76.90  ? 2014 HOH G O     1 
HETATM 7762 O  O     . HOH S 6 .   ? -36.386 6.886   -8.752  1.00 59.68  ? 2015 HOH G O     1 
HETATM 7763 O  O     . HOH S 6 .   ? -42.774 7.245   -14.290 1.00 48.26  ? 2016 HOH G O     1 
HETATM 7764 O  O     . HOH S 6 .   ? -48.091 11.705  -18.697 1.00 61.92  ? 2017 HOH G O     1 
HETATM 7765 O  O     . HOH S 6 .   ? -35.745 4.687   -7.811  1.00 50.25  ? 2018 HOH G O     1 
HETATM 7766 O  O     . HOH S 6 .   ? -73.296 -6.061  1.427   1.00 43.42  ? 2019 HOH G O     1 
HETATM 7767 O  O     . HOH S 6 .   ? -51.966 -7.278  5.235   1.00 58.40  ? 2020 HOH G O     1 
HETATM 7768 O  O     . HOH S 6 .   ? -68.012 -2.898  16.223  1.00 53.69  ? 2021 HOH G O     1 
HETATM 7769 O  O     . HOH S 6 .   ? -72.866 -4.137  10.201  1.00 54.23  ? 2022 HOH G O     1 
HETATM 7770 O  O     . HOH S 6 .   ? -73.237 -6.184  4.220   1.00 48.30  ? 2023 HOH G O     1 
HETATM 7771 O  O     . HOH S 6 .   ? -73.289 -14.248 -1.221  1.00 60.46  ? 2024 HOH G O     1 
HETATM 7772 O  O     . HOH S 6 .   ? -79.393 5.382   8.031   1.00 62.47  ? 2025 HOH G O     1 
HETATM 7773 O  O     . HOH T 6 .   ? -73.715 -1.688  -17.089 1.00 78.65  ? 2001 HOH H O     1 
HETATM 7774 O  O     . HOH T 6 .   ? -59.187 -5.308  -11.219 1.00 60.70  ? 2002 HOH H O     1 
HETATM 7775 O  O     . HOH U 6 .   ? -28.168 -6.235  -21.266 1.00 67.73  ? 2001 HOH I O     1 
HETATM 7776 O  O     . HOH U 6 .   ? -56.983 -4.955  -5.993  1.00 55.95  ? 2002 HOH I O     1 
HETATM 7777 O  O     . HOH U 6 .   ? -56.782 -6.609  -3.655  1.00 52.70  ? 2003 HOH I O     1 
HETATM 7778 O  O     . HOH U 6 .   ? -72.145 6.275   -7.480  1.00 65.13  ? 2004 HOH I O     1 
HETATM 7779 O  O     . HOH U 6 .   ? -89.664 -11.747 7.014   1.00 74.28  ? 2005 HOH I O     1 
HETATM 7780 O  O     . HOH U 6 .   ? -81.843 -3.898  18.287  1.00 77.11  ? 2006 HOH I O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   HIS 2   2   ?   ?   ?   A . n 
A 1 3   ASN 3   3   ?   ?   ?   A . n 
A 1 4   ASN 4   4   4   ASN ASN A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   ASN 6   6   6   ASN ASN A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  TYR 13  13  13  TYR TYR A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  TYR 36  36  36  TYR TYR A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  HIS 51  51  51  HIS HIS A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  MET 56  56  56  MET MET A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  PHE 58  58  58  PHE PHE A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  TYR 78  78  78  TYR TYR A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  MET 94  94  94  MET MET A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 MET 103 103 103 MET MET A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 PHE 109 109 109 PHE PHE A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 THR 121 121 121 THR THR A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 ARG 124 124 124 ARG ARG A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 TRP 128 128 128 TRP TRP A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 ILE 137 137 137 ILE ILE A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 ARG 140 140 140 ARG ARG A . n 
A 1 141 TRP 141 141 141 TRP TRP A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 ASN 143 143 143 ASN ASN A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 THR 150 150 150 THR THR A . n 
A 1 151 ILE 151 151 151 ILE ILE A . n 
A 1 152 HIS 152 152 152 HIS HIS A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 ASP 154 154 154 ASP ASP A . n 
A 1 155 ASP 155 155 155 ASP ASP A . n 
A 1 156 HIS 156 156 156 HIS HIS A . n 
A 1 157 ARG 157 157 157 ARG ARG A . n 
A 1 158 HIS 158 158 158 HIS HIS A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 ASN 164 164 164 ASN ASN A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 PHE 173 173 173 PHE PHE A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 HIS 175 175 175 HIS HIS A . n 
A 1 176 THR 176 176 176 THR THR A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 PRO 186 186 186 PRO PRO A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 GLU 188 188 ?   ?   ?   A . n 
A 1 189 ALA 189 189 ?   ?   ?   A . n 
A 1 190 ALA 190 190 ?   ?   ?   A . n 
A 1 191 ALA 191 191 ?   ?   ?   A . n 
A 1 192 LEU 192 192 ?   ?   ?   A . n 
A 1 193 GLU 193 193 ?   ?   ?   A . n 
A 1 194 HIS 194 194 ?   ?   ?   A . n 
A 1 195 HIS 195 195 ?   ?   ?   A . n 
A 1 196 HIS 196 196 ?   ?   ?   A . n 
A 1 197 HIS 197 197 ?   ?   ?   A . n 
A 1 198 HIS 198 198 ?   ?   ?   A . n 
A 1 199 HIS 199 199 ?   ?   ?   A . n 
B 2 1   DG  1   1   1   DG  DG  B . n 
B 2 2   DC  2   2   2   DC  DC  B . n 
B 2 3   DC  3   3   3   DC  DC  B . n 
B 2 4   DT  4   4   4   DT  DT  B . n 
B 2 5   DT  5   5   5   DT  DT  B . n 
B 2 6   DG  6   6   6   DG  DG  B . n 
B 2 7   DC  7   7   7   DC  DC  B . n 
B 2 8   DC  8   8   8   DC  DC  B . n 
B 2 9   DG  9   9   9   DG  DG  B . n 
B 2 10  DG  10  10  10  DG  DG  B . n 
B 2 11  DG  11  11  11  DG  DG  B . n 
B 2 12  DT  12  12  12  DT  DT  B . n 
B 2 13  DA  13  13  13  DA  DA  B . n 
B 2 14  DA  14  14  14  DA  DA  B . n 
B 2 15  DG  15  15  15  DG  DG  B . n 
B 2 16  DT  16  16  16  DT  DT  B . n 
B 2 17  DT  17  17  17  DT  DT  B . n 
B 2 18  DC  18  18  18  DC  DC  B . n 
B 2 19  DC  19  19  19  DC  DC  B . n 
B 2 20  DG  20  20  20  DG  DG  B . n 
B 2 21  DG  21  21  21  DG  DG  B . n 
B 2 22  DC  22  22  22  DC  DC  B . n 
B 2 23  DG  23  23  23  DG  DG  B . n 
B 2 24  DC  24  24  24  DC  DC  B . n 
B 2 25  DG  25  25  25  DG  DG  B . n 
C 3 1   DC  1   1   1   DC  DC  C . n 
C 3 2   DG  2   2   2   DG  DG  C . n 
C 3 3   DC  3   3   3   DC  DC  C . n 
C 3 4   DG  4   4   4   DG  DG  C . n 
C 3 5   DC  5   5   5   DC  DC  C . n 
C 3 6   DC  6   6   6   DC  DC  C . n 
C 3 7   DG  7   7   7   DG  DG  C . n 
C 3 8   DG  8   8   8   DG  DG  C . n 
C 3 9   DA  9   9   9   DA  DA  C . n 
C 3 10  DA  10  10  10  DA  DA  C . n 
C 3 11  DC  11  11  11  DC  DC  C . n 
C 3 12  DT  12  12  12  DT  DT  C . n 
C 3 13  DT  13  13  13  DT  DT  C . n 
C 3 14  DA  14  14  14  DA  DA  C . n 
C 3 15  DC  15  15  15  DC  DC  C . n 
C 3 16  DC  16  16  16  DC  DC  C . n 
C 3 17  DC  17  17  17  DC  DC  C . n 
C 3 18  DG  18  18  18  DG  DG  C . n 
C 3 19  DG  19  19  19  DG  DG  C . n 
C 3 20  DC  20  20  20  DC  DC  C . n 
C 3 21  DA  21  21  21  DA  DA  C . n 
C 3 22  DA  22  22  22  DA  DA  C . n 
C 3 23  DG  23  23  23  DG  DG  C . n 
C 3 24  DG  24  24  24  DG  DG  C . n 
C 3 25  DC  25  25  25  DC  DC  C . n 
D 1 1   ALA 1   1   ?   ?   ?   D . n 
D 1 2   HIS 2   2   ?   ?   ?   D . n 
D 1 3   ASN 3   3   ?   ?   ?   D . n 
D 1 4   ASN 4   4   ?   ?   ?   D . n 
D 1 5   GLU 5   5   5   GLU GLU D . n 
D 1 6   ASN 6   6   6   ASN ASN D . n 
D 1 7   VAL 7   7   7   VAL VAL D . n 
D 1 8   SER 8   8   8   SER SER D . n 
D 1 9   GLY 9   9   9   GLY GLY D . n 
D 1 10  ILE 10  10  10  ILE ILE D . n 
D 1 11  SER 11  11  11  SER SER D . n 
D 1 12  ALA 12  12  12  ALA ALA D . n 
D 1 13  TYR 13  13  13  TYR TYR D . n 
D 1 14  LEU 14  14  14  LEU LEU D . n 
D 1 15  LEU 15  15  15  LEU LEU D . n 
D 1 16  GLY 16  16  16  GLY GLY D . n 
D 1 17  LEU 17  17  17  LEU LEU D . n 
D 1 18  ILE 18  18  18  ILE ILE D . n 
D 1 19  ILE 19  19  19  ILE ILE D . n 
D 1 20  GLY 20  20  20  GLY GLY D . n 
D 1 21  ASP 21  21  21  ASP ASP D . n 
D 1 22  GLY 22  22  22  GLY GLY D . n 
D 1 23  GLY 23  23  23  GLY GLY D . n 
D 1 24  LEU 24  24  24  LEU LEU D . n 
D 1 25  TYR 25  25  25  TYR TYR D . n 
D 1 26  LYS 26  26  26  LYS LYS D . n 
D 1 27  LEU 27  27  27  LEU LEU D . n 
D 1 28  LYS 28  28  28  LYS LYS D . n 
D 1 29  TYR 29  29  29  TYR TYR D . n 
D 1 30  LYS 30  30  30  LYS LYS D . n 
D 1 31  GLY 31  31  31  GLY GLY D . n 
D 1 32  ASN 32  32  32  ASN ASN D . n 
D 1 33  ARG 33  33  33  ARG ARG D . n 
D 1 34  SER 34  34  34  SER SER D . n 
D 1 35  GLU 35  35  35  GLU GLU D . n 
D 1 36  TYR 36  36  36  TYR TYR D . n 
D 1 37  ARG 37  37  37  ARG ARG D . n 
D 1 38  VAL 38  38  38  VAL VAL D . n 
D 1 39  VAL 39  39  39  VAL VAL D . n 
D 1 40  ILE 40  40  40  ILE ILE D . n 
D 1 41  THR 41  41  41  THR THR D . n 
D 1 42  GLN 42  42  42  GLN GLN D . n 
D 1 43  LYS 43  43  43  LYS LYS D . n 
D 1 44  SER 44  44  44  SER SER D . n 
D 1 45  GLU 45  45  45  GLU GLU D . n 
D 1 46  ASN 46  46  46  ASN ASN D . n 
D 1 47  LEU 47  47  47  LEU LEU D . n 
D 1 48  ILE 48  48  48  ILE ILE D . n 
D 1 49  LYS 49  49  49  LYS LYS D . n 
D 1 50  GLN 50  50  50  GLN GLN D . n 
D 1 51  HIS 51  51  51  HIS HIS D . n 
D 1 52  ILE 52  52  52  ILE ILE D . n 
D 1 53  ALA 53  53  53  ALA ALA D . n 
D 1 54  PRO 54  54  54  PRO PRO D . n 
D 1 55  LEU 55  55  55  LEU LEU D . n 
D 1 56  MET 56  56  56  MET MET D . n 
D 1 57  GLN 57  57  57  GLN GLN D . n 
D 1 58  PHE 58  58  58  PHE PHE D . n 
D 1 59  LEU 59  59  59  LEU LEU D . n 
D 1 60  ILE 60  60  60  ILE ILE D . n 
D 1 61  ASP 61  61  61  ASP ASP D . n 
D 1 62  GLU 62  62  62  GLU GLU D . n 
D 1 63  LEU 63  63  63  LEU LEU D . n 
D 1 64  ASN 64  64  64  ASN ASN D . n 
D 1 65  VAL 65  65  65  VAL VAL D . n 
D 1 66  LYS 66  66  66  LYS LYS D . n 
D 1 67  SER 67  67  67  SER SER D . n 
D 1 68  LYS 68  68  68  LYS LYS D . n 
D 1 69  ILE 69  69  69  ILE ILE D . n 
D 1 70  GLN 70  70  70  GLN GLN D . n 
D 1 71  ILE 71  71  71  ILE ILE D . n 
D 1 72  VAL 72  72  72  VAL VAL D . n 
D 1 73  LYS 73  73  73  LYS LYS D . n 
D 1 74  GLY 74  74  74  GLY GLY D . n 
D 1 75  ASP 75  75  75  ASP ASP D . n 
D 1 76  THR 76  76  76  THR THR D . n 
D 1 77  ARG 77  77  77  ARG ARG D . n 
D 1 78  TYR 78  78  78  TYR TYR D . n 
D 1 79  GLU 79  79  79  GLU GLU D . n 
D 1 80  LEU 80  80  80  LEU LEU D . n 
D 1 81  ARG 81  81  81  ARG ARG D . n 
D 1 82  VAL 82  82  82  VAL VAL D . n 
D 1 83  SER 83  83  83  SER SER D . n 
D 1 84  SER 84  84  84  SER SER D . n 
D 1 85  LYS 85  85  85  LYS LYS D . n 
D 1 86  LYS 86  86  86  LYS LYS D . n 
D 1 87  LEU 87  87  87  LEU LEU D . n 
D 1 88  TYR 88  88  88  TYR TYR D . n 
D 1 89  TYR 89  89  89  TYR TYR D . n 
D 1 90  TYR 90  90  90  TYR TYR D . n 
D 1 91  PHE 91  91  91  PHE PHE D . n 
D 1 92  ALA 92  92  92  ALA ALA D . n 
D 1 93  ASN 93  93  93  ASN ASN D . n 
D 1 94  MET 94  94  94  MET MET D . n 
D 1 95  LEU 95  95  95  LEU LEU D . n 
D 1 96  GLU 96  96  96  GLU GLU D . n 
D 1 97  ARG 97  97  97  ARG ARG D . n 
D 1 98  ILE 98  98  98  ILE ILE D . n 
D 1 99  ARG 99  99  99  ARG ARG D . n 
D 1 100 LEU 100 100 100 LEU LEU D . n 
D 1 101 PHE 101 101 101 PHE PHE D . n 
D 1 102 ASN 102 102 102 ASN ASN D . n 
D 1 103 MET 103 103 103 MET MET D . n 
D 1 104 ARG 104 104 104 ARG ARG D . n 
D 1 105 GLU 105 105 105 GLU GLU D . n 
D 1 106 GLN 106 106 106 GLN GLN D . n 
D 1 107 ILE 107 107 107 ILE ILE D . n 
D 1 108 ALA 108 108 108 ALA ALA D . n 
D 1 109 PHE 109 109 109 PHE PHE D . n 
D 1 110 ILE 110 110 110 ILE ILE D . n 
D 1 111 LYS 111 111 111 LYS LYS D . n 
D 1 112 GLY 112 112 112 GLY GLY D . n 
D 1 113 LEU 113 113 113 LEU LEU D . n 
D 1 114 TYR 114 114 114 TYR TYR D . n 
D 1 115 VAL 115 115 115 VAL VAL D . n 
D 1 116 ALA 116 116 116 ALA ALA D . n 
D 1 117 GLU 117 117 117 GLU GLU D . n 
D 1 118 GLY 118 118 118 GLY GLY D . n 
D 1 119 ASP 119 119 119 ASP ASP D . n 
D 1 120 LYS 120 120 120 LYS LYS D . n 
D 1 121 THR 121 121 121 THR THR D . n 
D 1 122 LEU 122 122 122 LEU LEU D . n 
D 1 123 LYS 123 123 123 LYS LYS D . n 
D 1 124 ARG 124 124 124 ARG ARG D . n 
D 1 125 LEU 125 125 125 LEU LEU D . n 
D 1 126 ARG 126 126 126 ARG ARG D . n 
D 1 127 ILE 127 127 127 ILE ILE D . n 
D 1 128 TRP 128 128 128 TRP TRP D . n 
D 1 129 ASN 129 129 129 ASN ASN D . n 
D 1 130 LYS 130 130 130 LYS LYS D . n 
D 1 131 ASN 131 131 131 ASN ASN D . n 
D 1 132 LYS 132 132 132 LYS LYS D . n 
D 1 133 ALA 133 133 133 ALA ALA D . n 
D 1 134 LEU 134 134 134 LEU LEU D . n 
D 1 135 LEU 135 135 135 LEU LEU D . n 
D 1 136 GLU 136 136 136 GLU GLU D . n 
D 1 137 ILE 137 137 137 ILE ILE D . n 
D 1 138 VAL 138 138 138 VAL VAL D . n 
D 1 139 SER 139 139 139 SER SER D . n 
D 1 140 ARG 140 140 140 ARG ARG D . n 
D 1 141 TRP 141 141 141 TRP TRP D . n 
D 1 142 LEU 142 142 142 LEU LEU D . n 
D 1 143 ASN 143 143 143 ASN ASN D . n 
D 1 144 ASN 144 144 144 ASN ASN D . n 
D 1 145 LEU 145 145 145 LEU LEU D . n 
D 1 146 GLY 146 146 146 GLY GLY D . n 
D 1 147 VAL 147 147 147 VAL VAL D . n 
D 1 148 ARG 148 148 148 ARG ARG D . n 
D 1 149 ASN 149 149 149 ASN ASN D . n 
D 1 150 THR 150 150 150 THR THR D . n 
D 1 151 ILE 151 151 151 ILE ILE D . n 
D 1 152 HIS 152 152 152 HIS HIS D . n 
D 1 153 LEU 153 153 153 LEU LEU D . n 
D 1 154 ASP 154 154 154 ASP ASP D . n 
D 1 155 ASP 155 155 155 ASP ASP D . n 
D 1 156 HIS 156 156 156 HIS HIS D . n 
D 1 157 ARG 157 157 157 ARG ARG D . n 
D 1 158 HIS 158 158 158 HIS HIS D . n 
D 1 159 GLY 159 159 159 GLY GLY D . n 
D 1 160 VAL 160 160 160 VAL VAL D . n 
D 1 161 TYR 161 161 161 TYR TYR D . n 
D 1 162 VAL 162 162 162 VAL VAL D . n 
D 1 163 LEU 163 163 163 LEU LEU D . n 
D 1 164 ASN 164 164 164 ASN ASN D . n 
D 1 165 ILE 165 165 165 ILE ILE D . n 
D 1 166 SER 166 166 166 SER SER D . n 
D 1 167 LEU 167 167 167 LEU LEU D . n 
D 1 168 ARG 168 168 168 ARG ARG D . n 
D 1 169 ASP 169 169 169 ASP ASP D . n 
D 1 170 ARG 170 170 170 ARG ARG D . n 
D 1 171 ILE 171 171 171 ILE ILE D . n 
D 1 172 LYS 172 172 172 LYS LYS D . n 
D 1 173 PHE 173 173 173 PHE PHE D . n 
D 1 174 VAL 174 174 174 VAL VAL D . n 
D 1 175 HIS 175 175 175 HIS HIS D . n 
D 1 176 THR 176 176 176 THR THR D . n 
D 1 177 ILE 177 177 177 ILE ILE D . n 
D 1 178 LEU 178 178 178 LEU LEU D . n 
D 1 179 SER 179 179 179 SER SER D . n 
D 1 180 SER 180 180 180 SER SER D . n 
D 1 181 HIS 181 181 181 HIS HIS D . n 
D 1 182 LEU 182 182 182 LEU LEU D . n 
D 1 183 ASN 183 183 183 ASN ASN D . n 
D 1 184 PRO 184 184 184 PRO PRO D . n 
D 1 185 LEU 185 185 185 LEU LEU D . n 
D 1 186 PRO 186 186 186 PRO PRO D . n 
D 1 187 PRO 187 187 187 PRO PRO D . n 
D 1 188 GLU 188 188 188 GLU GLU D . n 
D 1 189 ALA 189 189 189 ALA ALA D . n 
D 1 190 ALA 190 190 190 ALA ALA D . n 
D 1 191 ALA 191 191 191 ALA ALA D . n 
D 1 192 LEU 192 192 192 LEU LEU D . n 
D 1 193 GLU 193 193 193 GLU GLU D . n 
D 1 194 HIS 194 194 194 HIS HIS D . n 
D 1 195 HIS 195 195 195 HIS HIS D . n 
D 1 196 HIS 196 196 ?   ?   ?   D . n 
D 1 197 HIS 197 197 ?   ?   ?   D . n 
D 1 198 HIS 198 198 ?   ?   ?   D . n 
D 1 199 HIS 199 199 ?   ?   ?   D . n 
E 2 1   DG  1   1   1   DG  DG  E . n 
E 2 2   DC  2   2   2   DC  DC  E . n 
E 2 3   DC  3   3   3   DC  DC  E . n 
E 2 4   DT  4   4   4   DT  DT  E . n 
E 2 5   DT  5   5   5   DT  DT  E . n 
E 2 6   DG  6   6   6   DG  DG  E . n 
E 2 7   DC  7   7   7   DC  DC  E . n 
E 2 8   DC  8   8   8   DC  DC  E . n 
E 2 9   DG  9   9   9   DG  DG  E . n 
E 2 10  DG  10  10  10  DG  DG  E . n 
E 2 11  DG  11  11  11  DG  DG  E . n 
E 2 12  DT  12  12  12  DT  DT  E . n 
E 2 13  DA  13  13  13  DA  DA  E . n 
E 2 14  DA  14  14  14  DA  DA  E . n 
E 2 15  DG  15  15  15  DG  DG  E . n 
E 2 16  DT  16  16  16  DT  DT  E . n 
E 2 17  DT  17  17  17  DT  DT  E . n 
E 2 18  DC  18  18  18  DC  DC  E . n 
E 2 19  DC  19  19  19  DC  DC  E . n 
E 2 20  DG  20  20  20  DG  DG  E . n 
E 2 21  DG  21  21  21  DG  DG  E . n 
E 2 22  DC  22  22  22  DC  DC  E . n 
E 2 23  DG  23  23  23  DG  DG  E . n 
E 2 24  DC  24  24  24  DC  DC  E . n 
E 2 25  DG  25  25  25  DG  DG  E . n 
F 3 1   DC  1   1   1   DC  DC  F . n 
F 3 2   DG  2   2   2   DG  DG  F . n 
F 3 3   DC  3   3   3   DC  DC  F . n 
F 3 4   DG  4   4   4   DG  DG  F . n 
F 3 5   DC  5   5   5   DC  DC  F . n 
F 3 6   DC  6   6   6   DC  DC  F . n 
F 3 7   DG  7   7   7   DG  DG  F . n 
F 3 8   DG  8   8   8   DG  DG  F . n 
F 3 9   DA  9   9   9   DA  DA  F . n 
F 3 10  DA  10  10  10  DA  DA  F . n 
F 3 11  DC  11  11  11  DC  DC  F . n 
F 3 12  DT  12  12  12  DT  DT  F . n 
F 3 13  DT  13  13  13  DT  DT  F . n 
F 3 14  DA  14  14  14  DA  DA  F . n 
F 3 15  DC  15  15  15  DC  DC  F . n 
F 3 16  DC  16  16  16  DC  DC  F . n 
F 3 17  DC  17  17  17  DC  DC  F . n 
F 3 18  DG  18  18  18  DG  DG  F . n 
F 3 19  DG  19  19  19  DG  DG  F . n 
F 3 20  DC  20  20  20  DC  DC  F . n 
F 3 21  DA  21  21  21  DA  DA  F . n 
F 3 22  DA  22  22  22  DA  DA  F . n 
F 3 23  DG  23  23  23  DG  DG  F . n 
F 3 24  DG  24  24  24  DG  DG  F . n 
F 3 25  DC  25  25  25  DC  DC  F . n 
G 4 1   ALA 1   1   ?   ?   ?   G . n 
G 4 2   HIS 2   2   ?   ?   ?   G . n 
G 4 3   ASN 3   3   ?   ?   ?   G . n 
G 4 4   ASN 4   4   ?   ?   ?   G . n 
G 4 5   GLU 5   5   5   GLU GLU G . n 
G 4 6   GLU 6   6   6   GLU GLU G . n 
G 4 7   VAL 7   7   7   VAL VAL G . n 
G 4 8   SER 8   8   8   SER SER G . n 
G 4 9   GLY 9   9   9   GLY GLY G . n 
G 4 10  ILE 10  10  10  ILE ILE G . n 
G 4 11  SER 11  11  11  SER SER G . n 
G 4 12  ALA 12  12  12  ALA ALA G . n 
G 4 13  TYR 13  13  13  TYR TYR G . n 
G 4 14  LEU 14  14  14  LEU LEU G . n 
G 4 15  LEU 15  15  15  LEU LEU G . n 
G 4 16  GLY 16  16  16  GLY GLY G . n 
G 4 17  LEU 17  17  17  LEU LEU G . n 
G 4 18  ILE 18  18  18  ILE ILE G . n 
G 4 19  ILE 19  19  19  ILE ILE G . n 
G 4 20  GLY 20  20  20  GLY GLY G . n 
G 4 21  ASP 21  21  21  ASP ASP G . n 
G 4 22  GLY 22  22  22  GLY GLY G . n 
G 4 23  GLY 23  23  23  GLY GLY G . n 
G 4 24  LEU 24  24  24  LEU LEU G . n 
G 4 25  TYR 25  25  25  TYR TYR G . n 
G 4 26  LYS 26  26  26  LYS LYS G . n 
G 4 27  LEU 27  27  27  LEU LEU G . n 
G 4 28  LYS 28  28  28  LYS LYS G . n 
G 4 29  TYR 29  29  29  TYR TYR G . n 
G 4 30  LYS 30  30  30  LYS LYS G . n 
G 4 31  GLY 31  31  31  GLY GLY G . n 
G 4 32  ASN 32  32  32  ASN ASN G . n 
G 4 33  ARG 33  33  33  ARG ARG G . n 
G 4 34  SER 34  34  34  SER SER G . n 
G 4 35  GLU 35  35  35  GLU GLU G . n 
G 4 36  TYR 36  36  36  TYR TYR G . n 
G 4 37  ARG 37  37  37  ARG ARG G . n 
G 4 38  VAL 38  38  38  VAL VAL G . n 
G 4 39  VAL 39  39  39  VAL VAL G . n 
G 4 40  ILE 40  40  40  ILE ILE G . n 
G 4 41  THR 41  41  41  THR THR G . n 
G 4 42  GLN 42  42  42  GLN GLN G . n 
G 4 43  LYS 43  43  43  LYS LYS G . n 
G 4 44  SER 44  44  44  SER SER G . n 
G 4 45  GLU 45  45  45  GLU GLU G . n 
G 4 46  ASN 46  46  46  ASN ASN G . n 
G 4 47  LEU 47  47  47  LEU LEU G . n 
G 4 48  ILE 48  48  48  ILE ILE G . n 
G 4 49  LYS 49  49  49  LYS LYS G . n 
G 4 50  GLN 50  50  50  GLN GLN G . n 
G 4 51  HIS 51  51  51  HIS HIS G . n 
G 4 52  ILE 52  52  52  ILE ILE G . n 
G 4 53  ALA 53  53  53  ALA ALA G . n 
G 4 54  PRO 54  54  54  PRO PRO G . n 
G 4 55  LEU 55  55  55  LEU LEU G . n 
G 4 56  MET 56  56  56  MET MET G . n 
G 4 57  GLN 57  57  57  GLN GLN G . n 
G 4 58  PHE 58  58  58  PHE PHE G . n 
G 4 59  LEU 59  59  59  LEU LEU G . n 
G 4 60  ILE 60  60  60  ILE ILE G . n 
G 4 61  ASP 61  61  61  ASP ASP G . n 
G 4 62  GLU 62  62  62  GLU GLU G . n 
G 4 63  LEU 63  63  63  LEU LEU G . n 
G 4 64  ASN 64  64  64  ASN ASN G . n 
G 4 65  VAL 65  65  65  VAL VAL G . n 
G 4 66  LYS 66  66  66  LYS LYS G . n 
G 4 67  SER 67  67  67  SER SER G . n 
G 4 68  LYS 68  68  68  LYS LYS G . n 
G 4 69  ILE 69  69  69  ILE ILE G . n 
G 4 70  GLN 70  70  70  GLN GLN G . n 
G 4 71  ILE 71  71  71  ILE ILE G . n 
G 4 72  VAL 72  72  72  VAL VAL G . n 
G 4 73  LYS 73  73  73  LYS LYS G . n 
G 4 74  GLY 74  74  74  GLY GLY G . n 
G 4 75  ASP 75  75  75  ASP ASP G . n 
G 4 76  THR 76  76  76  THR THR G . n 
G 4 77  ARG 77  77  77  ARG ARG G . n 
G 4 78  TYR 78  78  78  TYR TYR G . n 
G 4 79  GLU 79  79  79  GLU GLU G . n 
G 4 80  LEU 80  80  80  LEU LEU G . n 
G 4 81  ARG 81  81  81  ARG ARG G . n 
G 4 82  VAL 82  82  82  VAL VAL G . n 
G 4 83  SER 83  83  83  SER SER G . n 
G 4 84  SER 84  84  84  SER SER G . n 
G 4 85  LYS 85  85  85  LYS LYS G . n 
G 4 86  LYS 86  86  86  LYS LYS G . n 
G 4 87  LEU 87  87  87  LEU LEU G . n 
G 4 88  TYR 88  88  88  TYR TYR G . n 
G 4 89  TYR 89  89  89  TYR TYR G . n 
G 4 90  TYR 90  90  90  TYR TYR G . n 
G 4 91  PHE 91  91  91  PHE PHE G . n 
G 4 92  ALA 92  92  92  ALA ALA G . n 
G 4 93  ASN 93  93  93  ASN ASN G . n 
G 4 94  MET 94  94  94  MET MET G . n 
G 4 95  LEU 95  95  95  LEU LEU G . n 
G 4 96  GLU 96  96  96  GLU GLU G . n 
G 4 97  ARG 97  97  97  ARG ARG G . n 
G 4 98  ILE 98  98  98  ILE ILE G . n 
G 4 99  ARG 99  99  99  ARG ARG G . n 
G 4 100 LEU 100 100 100 LEU LEU G . n 
G 4 101 PHE 101 101 101 PHE PHE G . n 
G 4 102 ASN 102 102 102 ASN ASN G . n 
G 4 103 MET 103 103 103 MET MET G . n 
G 4 104 ARG 104 104 104 ARG ARG G . n 
G 4 105 GLU 105 105 105 GLU GLU G . n 
G 4 106 GLN 106 106 106 GLN GLN G . n 
G 4 107 ILE 107 107 107 ILE ILE G . n 
G 4 108 ALA 108 108 108 ALA ALA G . n 
G 4 109 PHE 109 109 109 PHE PHE G . n 
G 4 110 ILE 110 110 110 ILE ILE G . n 
G 4 111 LYS 111 111 111 LYS LYS G . n 
G 4 112 GLY 112 112 112 GLY GLY G . n 
G 4 113 LEU 113 113 113 LEU LEU G . n 
G 4 114 TYR 114 114 114 TYR TYR G . n 
G 4 115 VAL 115 115 115 VAL VAL G . n 
G 4 116 ALA 116 116 116 ALA ALA G . n 
G 4 117 GLU 117 117 117 GLU GLU G . n 
G 4 118 GLY 118 118 118 GLY GLY G . n 
G 4 119 ASP 119 119 119 ASP ASP G . n 
G 4 120 LYS 120 120 120 LYS LYS G . n 
G 4 121 THR 121 121 121 THR THR G . n 
G 4 122 LEU 122 122 122 LEU LEU G . n 
G 4 123 LYS 123 123 123 LYS LYS G . n 
G 4 124 ARG 124 124 124 ARG ARG G . n 
G 4 125 LEU 125 125 125 LEU LEU G . n 
G 4 126 ARG 126 126 126 ARG ARG G . n 
G 4 127 ILE 127 127 127 ILE ILE G . n 
G 4 128 TRP 128 128 128 TRP TRP G . n 
G 4 129 ASN 129 129 129 ASN ASN G . n 
G 4 130 LYS 130 130 130 LYS LYS G . n 
G 4 131 ASN 131 131 131 ASN ASN G . n 
G 4 132 LYS 132 132 132 LYS LYS G . n 
G 4 133 ALA 133 133 133 ALA ALA G . n 
G 4 134 LEU 134 134 134 LEU LEU G . n 
G 4 135 LEU 135 135 135 LEU LEU G . n 
G 4 136 GLU 136 136 136 GLU GLU G . n 
G 4 137 ILE 137 137 137 ILE ILE G . n 
G 4 138 VAL 138 138 138 VAL VAL G . n 
G 4 139 SER 139 139 139 SER SER G . n 
G 4 140 ARG 140 140 140 ARG ARG G . n 
G 4 141 TRP 141 141 141 TRP TRP G . n 
G 4 142 LEU 142 142 142 LEU LEU G . n 
G 4 143 ASN 143 143 143 ASN ASN G . n 
G 4 144 ASN 144 144 144 ASN ASN G . n 
G 4 145 LEU 145 145 145 LEU LEU G . n 
G 4 146 GLY 146 146 146 GLY GLY G . n 
G 4 147 VAL 147 147 147 VAL VAL G . n 
G 4 148 ARG 148 148 148 ARG ARG G . n 
G 4 149 ASN 149 149 149 ASN ASN G . n 
G 4 150 THR 150 150 150 THR THR G . n 
G 4 151 ILE 151 151 151 ILE ILE G . n 
G 4 152 HIS 152 152 152 HIS HIS G . n 
G 4 153 LEU 153 153 153 LEU LEU G . n 
G 4 154 ASP 154 154 154 ASP ASP G . n 
G 4 155 ASP 155 155 155 ASP ASP G . n 
G 4 156 HIS 156 156 156 HIS HIS G . n 
G 4 157 ARG 157 157 157 ARG ARG G . n 
G 4 158 HIS 158 158 158 HIS HIS G . n 
G 4 159 GLY 159 159 159 GLY GLY G . n 
G 4 160 VAL 160 160 160 VAL VAL G . n 
G 4 161 TYR 161 161 161 TYR TYR G . n 
G 4 162 VAL 162 162 162 VAL VAL G . n 
G 4 163 LEU 163 163 163 LEU LEU G . n 
G 4 164 ASN 164 164 164 ASN ASN G . n 
G 4 165 ILE 165 165 165 ILE ILE G . n 
G 4 166 SER 166 166 166 SER SER G . n 
G 4 167 LEU 167 167 167 LEU LEU G . n 
G 4 168 ARG 168 168 168 ARG ARG G . n 
G 4 169 ASP 169 169 169 ASP ASP G . n 
G 4 170 ARG 170 170 170 ARG ARG G . n 
G 4 171 ILE 171 171 171 ILE ILE G . n 
G 4 172 LYS 172 172 172 LYS LYS G . n 
G 4 173 PHE 173 173 173 PHE PHE G . n 
G 4 174 VAL 174 174 174 VAL VAL G . n 
G 4 175 HIS 175 175 175 HIS HIS G . n 
G 4 176 THR 176 176 176 THR THR G . n 
G 4 177 ILE 177 177 177 ILE ILE G . n 
G 4 178 LEU 178 178 178 LEU LEU G . n 
G 4 179 SER 179 179 179 SER SER G . n 
G 4 180 SER 180 180 180 SER SER G . n 
G 4 181 HIS 181 181 181 HIS HIS G . n 
G 4 182 LEU 182 182 ?   ?   ?   G . n 
G 4 183 ASN 183 183 ?   ?   ?   G . n 
G 4 184 PRO 184 184 ?   ?   ?   G . n 
G 4 185 LEU 185 185 ?   ?   ?   G . n 
G 4 186 PRO 186 186 ?   ?   ?   G . n 
G 4 187 PRO 187 187 ?   ?   ?   G . n 
G 4 188 GLU 188 188 ?   ?   ?   G . n 
G 4 189 ALA 189 189 ?   ?   ?   G . n 
G 4 190 ALA 190 190 ?   ?   ?   G . n 
G 4 191 ALA 191 191 ?   ?   ?   G . n 
G 4 192 LEU 192 192 ?   ?   ?   G . n 
G 4 193 GLU 193 193 ?   ?   ?   G . n 
G 4 194 HIS 194 194 ?   ?   ?   G . n 
G 4 195 HIS 195 195 ?   ?   ?   G . n 
G 4 196 HIS 196 196 ?   ?   ?   G . n 
G 4 197 HIS 197 197 ?   ?   ?   G . n 
G 4 198 HIS 198 198 ?   ?   ?   G . n 
G 4 199 HIS 199 199 ?   ?   ?   G . n 
H 2 1   DG  1   1   1   DG  DG  H . n 
H 2 2   DC  2   2   2   DC  DC  H . n 
H 2 3   DC  3   3   3   DC  DC  H . n 
H 2 4   DT  4   4   4   DT  DT  H . n 
H 2 5   DT  5   5   5   DT  DT  H . n 
H 2 6   DG  6   6   6   DG  DG  H . n 
H 2 7   DC  7   7   7   DC  DC  H . n 
H 2 8   DC  8   8   8   DC  DC  H . n 
H 2 9   DG  9   9   9   DG  DG  H . n 
H 2 10  DG  10  10  10  DG  DG  H . n 
H 2 11  DG  11  11  11  DG  DG  H . n 
H 2 12  DT  12  12  12  DT  DT  H . n 
H 2 13  DA  13  13  13  DA  DA  H . n 
H 2 14  DA  14  14  14  DA  DA  H . n 
H 2 15  DG  15  15  15  DG  DG  H . n 
H 2 16  DT  16  16  16  DT  DT  H . n 
H 2 17  DT  17  17  17  DT  DT  H . n 
H 2 18  DC  18  18  18  DC  DC  H . n 
H 2 19  DC  19  19  19  DC  DC  H . n 
H 2 20  DG  20  20  20  DG  DG  H . n 
H 2 21  DG  21  21  21  DG  DG  H . n 
H 2 22  DC  22  22  22  DC  DC  H . n 
H 2 23  DG  23  23  23  DG  DG  H . n 
H 2 24  DC  24  24  24  DC  DC  H . n 
H 2 25  DG  25  25  25  DG  DG  H . n 
I 3 1   DC  1   1   1   DC  DC  I . n 
I 3 2   DG  2   2   2   DG  DG  I . n 
I 3 3   DC  3   3   3   DC  DC  I . n 
I 3 4   DG  4   4   4   DG  DG  I . n 
I 3 5   DC  5   5   5   DC  DC  I . n 
I 3 6   DC  6   6   6   DC  DC  I . n 
I 3 7   DG  7   7   7   DG  DG  I . n 
I 3 8   DG  8   8   8   DG  DG  I . n 
I 3 9   DA  9   9   9   DA  DA  I . n 
I 3 10  DA  10  10  10  DA  DA  I . n 
I 3 11  DC  11  11  11  DC  DC  I . n 
I 3 12  DT  12  12  12  DT  DT  I . n 
I 3 13  DT  13  13  13  DT  DT  I . n 
I 3 14  DA  14  14  14  DA  DA  I . n 
I 3 15  DC  15  15  15  DC  DC  I . n 
I 3 16  DC  16  16  16  DC  DC  I . n 
I 3 17  DC  17  17  17  DC  DC  I . n 
I 3 18  DG  18  18  18  DG  DG  I . n 
I 3 19  DG  19  19  19  DG  DG  I . n 
I 3 20  DC  20  20  20  DC  DC  I . n 
I 3 21  DA  21  21  21  DA  DA  I . n 
I 3 22  DA  22  22  22  DA  DA  I . n 
I 3 23  DG  23  23  23  DG  DG  I . n 
I 3 24  DG  24  24  24  DG  DG  I . n 
I 3 25  DC  25  25  25  DC  DC  I . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
J 5 ZN  1  1188 1188 ZN  ZN  A . 
K 5 ZN  1  1197 1197 ZN  ZN  D . 
L 5 ZN  1  1182 1182 ZN  ZN  G . 
M 6 HOH 1  2001 2001 HOH HOH A . 
M 6 HOH 2  2002 2002 HOH HOH A . 
M 6 HOH 3  2003 2003 HOH HOH A . 
M 6 HOH 4  2004 2004 HOH HOH A . 
M 6 HOH 5  2005 2005 HOH HOH A . 
M 6 HOH 6  2006 2006 HOH HOH A . 
M 6 HOH 7  2007 2007 HOH HOH A . 
M 6 HOH 8  2008 2008 HOH HOH A . 
M 6 HOH 9  2009 2009 HOH HOH A . 
M 6 HOH 10 2010 2010 HOH HOH A . 
M 6 HOH 11 2011 2011 HOH HOH A . 
M 6 HOH 12 2012 2012 HOH HOH A . 
M 6 HOH 13 2013 2013 HOH HOH A . 
M 6 HOH 14 2014 2014 HOH HOH A . 
M 6 HOH 15 2015 2015 HOH HOH A . 
M 6 HOH 16 2016 2016 HOH HOH A . 
M 6 HOH 17 2017 2017 HOH HOH A . 
M 6 HOH 18 2018 2018 HOH HOH A . 
M 6 HOH 19 2019 2019 HOH HOH A . 
M 6 HOH 20 2020 2020 HOH HOH A . 
M 6 HOH 21 2021 2021 HOH HOH A . 
M 6 HOH 22 2022 2022 HOH HOH A . 
N 6 HOH 1  2001 2001 HOH HOH B . 
N 6 HOH 2  2002 2002 HOH HOH B . 
N 6 HOH 3  2003 2003 HOH HOH B . 
N 6 HOH 4  2004 2004 HOH HOH B . 
N 6 HOH 5  2005 2005 HOH HOH B . 
N 6 HOH 6  2006 2006 HOH HOH B . 
O 6 HOH 1  2001 2001 HOH HOH C . 
O 6 HOH 2  2002 2002 HOH HOH C . 
P 6 HOH 1  2001 2001 HOH HOH D . 
P 6 HOH 2  2002 2002 HOH HOH D . 
P 6 HOH 3  2003 2003 HOH HOH D . 
P 6 HOH 4  2004 2004 HOH HOH D . 
P 6 HOH 5  2005 2005 HOH HOH D . 
P 6 HOH 6  2006 2006 HOH HOH D . 
P 6 HOH 7  2007 2007 HOH HOH D . 
P 6 HOH 8  2008 2008 HOH HOH D . 
P 6 HOH 9  2009 2009 HOH HOH D . 
P 6 HOH 10 2010 2010 HOH HOH D . 
P 6 HOH 11 2011 2011 HOH HOH D . 
P 6 HOH 12 2012 2012 HOH HOH D . 
P 6 HOH 13 2013 2013 HOH HOH D . 
P 6 HOH 14 2014 2014 HOH HOH D . 
P 6 HOH 15 2015 2015 HOH HOH D . 
P 6 HOH 16 2016 2016 HOH HOH D . 
P 6 HOH 17 2017 2017 HOH HOH D . 
P 6 HOH 18 2018 2018 HOH HOH D . 
P 6 HOH 19 2019 2019 HOH HOH D . 
P 6 HOH 20 2020 2020 HOH HOH D . 
P 6 HOH 21 2021 2021 HOH HOH D . 
P 6 HOH 22 2022 2022 HOH HOH D . 
Q 6 HOH 1  2001 2001 HOH HOH E . 
Q 6 HOH 2  2002 2002 HOH HOH E . 
Q 6 HOH 3  2003 2003 HOH HOH E . 
Q 6 HOH 4  2004 2004 HOH HOH E . 
Q 6 HOH 5  2005 2005 HOH HOH E . 
Q 6 HOH 6  2006 2006 HOH HOH E . 
R 6 HOH 1  2001 2001 HOH HOH F . 
R 6 HOH 2  2002 2002 HOH HOH F . 
R 6 HOH 3  2003 2003 HOH HOH F . 
R 6 HOH 4  2004 2004 HOH HOH F . 
R 6 HOH 5  2005 2005 HOH HOH F . 
S 6 HOH 1  2001 2001 HOH HOH G . 
S 6 HOH 2  2002 2002 HOH HOH G . 
S 6 HOH 3  2003 2003 HOH HOH G . 
S 6 HOH 4  2004 2004 HOH HOH G . 
S 6 HOH 5  2005 2005 HOH HOH G . 
S 6 HOH 6  2006 2006 HOH HOH G . 
S 6 HOH 7  2007 2007 HOH HOH G . 
S 6 HOH 8  2008 2008 HOH HOH G . 
S 6 HOH 9  2009 2009 HOH HOH G . 
S 6 HOH 10 2010 2010 HOH HOH G . 
S 6 HOH 11 2011 2011 HOH HOH G . 
S 6 HOH 12 2012 2012 HOH HOH G . 
S 6 HOH 13 2013 2013 HOH HOH G . 
S 6 HOH 14 2014 2014 HOH HOH G . 
S 6 HOH 15 2015 2015 HOH HOH G . 
S 6 HOH 16 2016 2016 HOH HOH G . 
S 6 HOH 17 2017 2017 HOH HOH G . 
S 6 HOH 18 2018 2018 HOH HOH G . 
S 6 HOH 19 2019 2019 HOH HOH G . 
S 6 HOH 20 2020 2020 HOH HOH G . 
S 6 HOH 21 2021 2021 HOH HOH G . 
S 6 HOH 22 2022 2022 HOH HOH G . 
S 6 HOH 23 2023 2023 HOH HOH G . 
S 6 HOH 24 2024 2024 HOH HOH G . 
S 6 HOH 25 2025 2025 HOH HOH G . 
T 6 HOH 1  2001 2001 HOH HOH H . 
T 6 HOH 2  2002 2002 HOH HOH H . 
U 6 HOH 1  2001 2001 HOH HOH I . 
U 6 HOH 2  2002 2002 HOH HOH I . 
U 6 HOH 3  2003 2003 HOH HOH I . 
U 6 HOH 4  2004 2004 HOH HOH I . 
U 6 HOH 5  2005 2005 HOH HOH I . 
U 6 HOH 6  2006 2006 HOH HOH I . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA trimeric 3 
2 author_and_software_defined_assembly PISA trimeric 3 
3 author_and_software_defined_assembly PISA trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,J,M,N,O 
2 1 D,E,F,K,P,Q,R 
3 1 G,H,I,L,S,T,U 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 7440  ? 
1 MORE         -80.2 ? 
1 'SSA (A^2)'  14530 ? 
2 'ABSA (A^2)' 7830  ? 
2 MORE         -82.9 ? 
2 'SSA (A^2)'  14320 ? 
3 'ABSA (A^2)' 7640  ? 
3 MORE         -76.9 ? 
3 'SSA (A^2)'  13960 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OP2 ? C DC  16  ? C DC  16   ? 1_555 ZN ? J ZN . ? A ZN 1188 ? 1_555 OD2 ? A ASP 21  ? A ASP 21   ? 1_555 129.9 ? 
2  OP2 ? C DC  16  ? C DC  16   ? 1_555 ZN ? J ZN . ? A ZN 1188 ? 1_555 OP1 ? B DA  14  ? B DA  14   ? 1_555 107.6 ? 
3  OD2 ? A ASP 21  ? A ASP 21   ? 1_555 ZN ? J ZN . ? A ZN 1188 ? 1_555 OP1 ? B DA  14  ? B DA  14   ? 1_555 94.5  ? 
4  OP2 ? C DC  16  ? C DC  16   ? 1_555 ZN ? J ZN . ? A ZN 1188 ? 1_555 O   ? M HOH .   ? A HOH 2005 ? 1_555 144.7 ? 
5  OD2 ? A ASP 21  ? A ASP 21   ? 1_555 ZN ? J ZN . ? A ZN 1188 ? 1_555 O   ? M HOH .   ? A HOH 2005 ? 1_555 72.2  ? 
6  OP1 ? B DA  14  ? B DA  14   ? 1_555 ZN ? J ZN . ? A ZN 1188 ? 1_555 O   ? M HOH .   ? A HOH 2005 ? 1_555 95.6  ? 
7  OP2 ? C DC  16  ? C DC  16   ? 1_555 ZN ? J ZN . ? A ZN 1188 ? 1_555 O   ? A ALA 116 ? A ALA 116  ? 1_555 79.1  ? 
8  OD2 ? A ASP 21  ? A ASP 21   ? 1_555 ZN ? J ZN . ? A ZN 1188 ? 1_555 O   ? A ALA 116 ? A ALA 116  ? 1_555 87.2  ? 
9  OP1 ? B DA  14  ? B DA  14   ? 1_555 ZN ? J ZN . ? A ZN 1188 ? 1_555 O   ? A ALA 116 ? A ALA 116  ? 1_555 169.2 ? 
10 O   ? M HOH .   ? A HOH 2005 ? 1_555 ZN ? J ZN . ? A ZN 1188 ? 1_555 O   ? A ALA 116 ? A ALA 116  ? 1_555 74.7  ? 
11 OD2 ? D ASP 21  ? D ASP 21   ? 1_555 ZN ? K ZN . ? D ZN 1197 ? 1_555 OP2 ? F DC  16  ? F DC  16   ? 1_555 114.4 ? 
12 OD2 ? D ASP 21  ? D ASP 21   ? 1_555 ZN ? K ZN . ? D ZN 1197 ? 1_555 OP1 ? E DA  14  ? E DA  14   ? 1_555 83.0  ? 
13 OP2 ? F DC  16  ? F DC  16   ? 1_555 ZN ? K ZN . ? D ZN 1197 ? 1_555 OP1 ? E DA  14  ? E DA  14   ? 1_555 113.3 ? 
14 OD2 ? D ASP 21  ? D ASP 21   ? 1_555 ZN ? K ZN . ? D ZN 1197 ? 1_555 O   ? P HOH .   ? D HOH 2003 ? 1_555 71.6  ? 
15 OP2 ? F DC  16  ? F DC  16   ? 1_555 ZN ? K ZN . ? D ZN 1197 ? 1_555 O   ? P HOH .   ? D HOH 2003 ? 1_555 167.8 ? 
16 OP1 ? E DA  14  ? E DA  14   ? 1_555 ZN ? K ZN . ? D ZN 1197 ? 1_555 O   ? P HOH .   ? D HOH 2003 ? 1_555 77.3  ? 
17 OD2 ? D ASP 21  ? D ASP 21   ? 1_555 ZN ? K ZN . ? D ZN 1197 ? 1_555 O   ? D ALA 116 ? D ALA 116  ? 1_555 85.8  ? 
18 OP2 ? F DC  16  ? F DC  16   ? 1_555 ZN ? K ZN . ? D ZN 1197 ? 1_555 O   ? D ALA 116 ? D ALA 116  ? 1_555 74.5  ? 
19 OP1 ? E DA  14  ? E DA  14   ? 1_555 ZN ? K ZN . ? D ZN 1197 ? 1_555 O   ? D ALA 116 ? D ALA 116  ? 1_555 168.3 ? 
20 O   ? P HOH .   ? D HOH 2003 ? 1_555 ZN ? K ZN . ? D ZN 1197 ? 1_555 O   ? D ALA 116 ? D ALA 116  ? 1_555 96.0  ? 
21 OD2 ? G ASP 21  ? G ASP 21   ? 1_555 ZN ? L ZN . ? G ZN 1182 ? 1_555 O   ? G ALA 116 ? G ALA 116  ? 1_555 97.2  ? 
22 OD2 ? G ASP 21  ? G ASP 21   ? 1_555 ZN ? L ZN . ? G ZN 1182 ? 1_555 OP2 ? I DC  16  ? I DC  16   ? 1_555 129.8 ? 
23 O   ? G ALA 116 ? G ALA 116  ? 1_555 ZN ? L ZN . ? G ZN 1182 ? 1_555 OP2 ? I DC  16  ? I DC  16   ? 1_555 81.6  ? 
24 OD2 ? G ASP 21  ? G ASP 21   ? 1_555 ZN ? L ZN . ? G ZN 1182 ? 1_555 OP1 ? H DA  14  ? H DA  14   ? 1_555 87.2  ? 
25 O   ? G ALA 116 ? G ALA 116  ? 1_555 ZN ? L ZN . ? G ZN 1182 ? 1_555 OP1 ? H DA  14  ? H DA  14   ? 1_555 169.2 ? 
26 OP2 ? I DC  16  ? I DC  16   ? 1_555 ZN ? L ZN . ? G ZN 1182 ? 1_555 OP1 ? H DA  14  ? H DA  14   ? 1_555 103.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-12-03 
2 'Structure model' 1 1 2014-12-17 
3 'Structure model' 1 2 2015-01-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
XDS    'data reduction' .                 ? 2 
SCALA  'data scaling'   .                 ? 3 
PHASER phasing          .                 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NZ  A LYS 120  ? ? O  A HOH 2005 ? ? 2.04 
2 1 NH1 D ARG 33   ? ? O6 E DG  21   ? ? 2.10 
3 1 O   G LYS 66   ? ? O  G HOH 2014 ? ? 2.11 
4 1 OD1 G ASP 21   ? ? O  G HOH 2004 ? ? 2.12 
5 1 O   G GLY 20   ? ? O  G HOH 2002 ? ? 2.15 
6 1 OE2 G GLU 45   ? ? NZ G LYS 49   ? ? 2.16 
7 1 O   A HOH 2002 ? ? O  A HOH 2018 ? ? 2.17 
8 1 OD1 D ASP 21   ? ? O  D HOH 2002 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NH2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ARG 
_pdbx_validate_symm_contact.auth_seq_id_1     104 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OP1 
_pdbx_validate_symm_contact.auth_asym_id_2    E 
_pdbx_validate_symm_contact.auth_comp_id_2    DC 
_pdbx_validate_symm_contact.auth_seq_id_2     19 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_555 
_pdbx_validate_symm_contact.dist              2.06 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" B DT 12 ? ? "C3'" B DT 12 ? ? 1.377 1.419 -0.042 0.006 N 
2 1 "O3'" C DG 4  ? ? "C3'" C DG 4  ? ? 1.374 1.419 -0.045 0.006 N 
3 1 "O3'" C DC 5  ? ? "C3'" C DC 5  ? ? 1.380 1.419 -0.039 0.006 N 
4 1 "O3'" E DT 12 ? ? "C3'" E DT 12 ? ? 1.373 1.419 -0.046 0.006 N 
5 1 "O3'" H DT 12 ? ? "C3'" H DT 12 ? ? 1.382 1.419 -0.037 0.006 N 
6 1 "O3'" H DC 24 ? ? "C3'" H DC 24 ? ? 1.370 1.419 -0.049 0.006 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "O4'" B DC 2  ? ? "C1'" B DC 2  ? ? N1    B DC 2  ? ? 111.00 108.30 2.70  0.30 N 
2  1 "O4'" B DG 15 ? ? "C1'" B DG 15 ? ? N9    B DG 15 ? ? 110.99 108.30 2.69  0.30 N 
3  1 "O4'" B DG 20 ? ? "C1'" B DG 20 ? ? N9    B DG 20 ? ? 110.24 108.30 1.94  0.30 N 
4  1 "O4'" B DG 21 ? ? "C1'" B DG 21 ? ? N9    B DG 21 ? ? 111.28 108.30 2.98  0.30 N 
5  1 "O4'" C DG 8  ? ? "C1'" C DG 8  ? ? N9    C DG 8  ? ? 110.60 108.30 2.30  0.30 N 
6  1 "O4'" C DA 9  ? ? "C1'" C DA 9  ? ? N9    C DA 9  ? ? 110.91 108.30 2.61  0.30 N 
7  1 "C3'" C DC 15 ? ? "C2'" C DC 15 ? ? "C1'" C DC 15 ? ? 97.51  102.40 -4.89 0.80 N 
8  1 "O4'" C DG 18 ? ? "C1'" C DG 18 ? ? N9    C DG 18 ? ? 112.00 108.30 3.70  0.30 N 
9  1 "C3'" C DG 23 ? ? "C2'" C DG 23 ? ? "C1'" C DG 23 ? ? 97.29  102.40 -5.11 0.80 N 
10 1 "O4'" C DG 23 ? ? "C1'" C DG 23 ? ? N9    C DG 23 ? ? 110.61 108.30 2.31  0.30 N 
11 1 "O4'" E DG 15 ? ? "C1'" E DG 15 ? ? N9    E DG 15 ? ? 110.26 108.30 1.96  0.30 N 
12 1 "O4'" E DG 20 ? ? "C1'" E DG 20 ? ? N9    E DG 20 ? ? 110.77 108.30 2.47  0.30 N 
13 1 "O4'" F DA 9  ? ? "C1'" F DA 9  ? ? N9    F DA 9  ? ? 110.24 108.30 1.94  0.30 N 
14 1 "O4'" F DG 18 ? ? "C1'" F DG 18 ? ? N9    F DG 18 ? ? 110.46 108.30 2.16  0.30 N 
15 1 "O4'" H DT 5  ? ? "C1'" H DT 5  ? ? N1    H DT 5  ? ? 110.48 108.30 2.18  0.30 N 
16 1 "O4'" H DG 21 ? ? "C4'" H DG 21 ? ? "C3'" H DG 21 ? ? 101.92 104.50 -2.58 0.40 N 
17 1 "O4'" H DG 21 ? ? "C1'" H DG 21 ? ? N9    H DG 21 ? ? 110.75 108.30 2.45  0.30 N 
18 1 "C1'" I DC 3  ? ? "O4'" I DC 3  ? ? "C4'" I DC 3  ? ? 103.92 110.10 -6.18 1.00 N 
19 1 "O4'" I DA 9  ? ? "C1'" I DA 9  ? ? N9    I DA 9  ? ? 112.51 108.30 4.21  0.30 N 
20 1 "O4'" I DC 11 ? ? "C1'" I DC 11 ? ? N1    I DC 11 ? ? 110.18 108.30 1.88  0.30 N 
21 1 "O4'" I DG 18 ? ? "C1'" I DG 18 ? ? N9    I DG 18 ? ? 111.67 108.30 3.37  0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 6   ? ? 3.86    -78.06  
2  1 ASN A 32  ? ? -63.02  80.15   
3  1 SER A 84  ? ? -171.04 113.97  
4  1 LEU A 178 ? ? -58.17  -75.75  
5  1 ASN D 6   ? ? 74.05   -51.53  
6  1 SER D 84  ? ? -160.96 115.49  
7  1 ARG D 97  ? ? -103.98 43.41   
8  1 ILE D 177 ? ? -102.95 -64.54  
9  1 LEU G 122 ? ? 58.19   5.81    
10 1 SER G 180 ? ? -93.42  -158.28 
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   GLU 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    5 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASN 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    6 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            144.58 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 G GLU 5 ? CG  ? G GLU 5 CG  
2 1 Y 1 G GLU 5 ? CD  ? G GLU 5 CD  
3 1 Y 1 G GLU 5 ? OE1 ? G GLU 5 OE1 
4 1 Y 1 G GLU 5 ? OE2 ? G GLU 5 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 1   ? A ALA 1   
2  1 Y 1 A HIS 2   ? A HIS 2   
3  1 Y 1 A ASN 3   ? A ASN 3   
4  1 Y 1 A GLU 188 ? A GLU 188 
5  1 Y 1 A ALA 189 ? A ALA 189 
6  1 Y 1 A ALA 190 ? A ALA 190 
7  1 Y 1 A ALA 191 ? A ALA 191 
8  1 Y 1 A LEU 192 ? A LEU 192 
9  1 Y 1 A GLU 193 ? A GLU 193 
10 1 Y 1 A HIS 194 ? A HIS 194 
11 1 Y 1 A HIS 195 ? A HIS 195 
12 1 Y 1 A HIS 196 ? A HIS 196 
13 1 Y 1 A HIS 197 ? A HIS 197 
14 1 Y 1 A HIS 198 ? A HIS 198 
15 1 Y 1 A HIS 199 ? A HIS 199 
16 1 Y 1 D ALA 1   ? D ALA 1   
17 1 Y 1 D HIS 2   ? D HIS 2   
18 1 Y 1 D ASN 3   ? D ASN 3   
19 1 Y 1 D ASN 4   ? D ASN 4   
20 1 Y 1 D HIS 196 ? D HIS 196 
21 1 Y 1 D HIS 197 ? D HIS 197 
22 1 Y 1 D HIS 198 ? D HIS 198 
23 1 Y 1 D HIS 199 ? D HIS 199 
24 1 Y 1 G ALA 1   ? G ALA 1   
25 1 Y 1 G HIS 2   ? G HIS 2   
26 1 Y 1 G ASN 3   ? G ASN 3   
27 1 Y 1 G ASN 4   ? G ASN 4   
28 1 Y 1 G LEU 182 ? G LEU 182 
29 1 Y 1 G ASN 183 ? G ASN 183 
30 1 Y 1 G PRO 184 ? G PRO 184 
31 1 Y 1 G LEU 185 ? G LEU 185 
32 1 Y 1 G PRO 186 ? G PRO 186 
33 1 Y 1 G PRO 187 ? G PRO 187 
34 1 Y 1 G GLU 188 ? G GLU 188 
35 1 Y 1 G ALA 189 ? G ALA 189 
36 1 Y 1 G ALA 190 ? G ALA 190 
37 1 Y 1 G ALA 191 ? G ALA 191 
38 1 Y 1 G LEU 192 ? G LEU 192 
39 1 Y 1 G GLU 193 ? G GLU 193 
40 1 Y 1 G HIS 194 ? G HIS 194 
41 1 Y 1 G HIS 195 ? G HIS 195 
42 1 Y 1 G HIS 196 ? G HIS 196 
43 1 Y 1 G HIS 197 ? G HIS 197 
44 1 Y 1 G HIS 198 ? G HIS 198 
45 1 Y 1 G HIS 199 ? G HIS 199 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4UN7 'double helix'        
4UN7 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 25 1_555 -0.036 -0.034 -0.495 -7.614  -6.011  5.454  1  B_DG1:DC25_C  B 1  ? C 25 ? 19 1 
1 B DC 2  1_555 C DG 24 1_555 0.335  -0.409 0.136  5.006   -6.609  -1.255 2  B_DC2:DG24_C  B 2  ? C 24 ? 19 1 
1 B DC 3  1_555 C DG 23 1_555 0.315  -0.416 -0.064 -1.951  -6.142  -2.757 3  B_DC3:DG23_C  B 3  ? C 23 ? 19 1 
1 B DT 4  1_555 C DA 22 1_555 -0.052 -0.295 0.214  -9.793  -18.265 -8.256 4  B_DT4:DA22_C  B 4  ? C 22 ? 20 1 
1 B DT 5  1_555 C DA 21 1_555 0.055  -0.087 0.293  -13.183 -8.486  2.584  5  B_DT5:DA21_C  B 5  ? C 21 ? 20 1 
1 B DG 6  1_555 C DC 20 1_555 -0.665 -0.263 0.640  3.786   -2.475  -5.266 6  B_DG6:DC20_C  B 6  ? C 20 ? 19 1 
1 B DC 7  1_555 C DG 19 1_555 0.149  -0.522 0.150  -2.943  -4.966  -4.164 7  B_DC7:DG19_C  B 7  ? C 19 ? 19 1 
1 B DC 8  1_555 C DG 18 1_555 0.070  -0.150 -0.150 -0.871  0.134   1.965  8  B_DC8:DG18_C  B 8  ? C 18 ? 19 1 
1 B DG 9  1_555 C DC 17 1_555 -0.052 -0.233 0.305  6.146   -6.130  0.846  9  B_DG9:DC17_C  B 9  ? C 17 ? 19 1 
1 B DG 10 1_555 C DC 16 1_555 -0.496 -0.428 0.291  0.746   -11.230 -3.863 10 B_DG10:DC16_C B 10 ? C 16 ? 19 1 
1 B DG 11 1_555 C DC 15 1_555 0.354  -0.315 0.310  12.508  -20.461 -3.338 11 B_DG11:DC15_C B 11 ? C 15 ? 19 1 
1 B DT 12 1_555 C DA 14 1_555 -0.710 -0.234 0.555  7.523   -28.047 0.004  12 B_DT12:DA14_C B 12 ? C 14 ? 20 1 
1 B DA 13 1_555 C DT 13 1_555 0.111  -0.327 0.697  5.716   -8.220  1.780  13 B_DA13:DT13_C B 13 ? C 13 ? 20 1 
1 B DA 14 1_555 C DT 12 1_555 0.294  -0.322 0.030  -9.804  -17.996 -1.752 14 B_DA14:DT12_C B 14 ? C 12 ? 20 1 
1 B DG 15 1_555 C DC 11 1_555 -0.557 -0.177 -0.059 -9.248  -18.303 0.161  15 B_DG15:DC11_C B 15 ? C 11 ? 19 1 
1 B DT 16 1_555 C DA 10 1_555 -0.340 0.054  0.248  -9.859  -8.275  7.172  16 B_DT16:DA10_C B 16 ? C 10 ? 20 1 
1 B DT 17 1_555 C DA 9  1_555 -0.150 -0.354 -0.050 -4.493  -1.337  0.972  17 B_DT17:DA9_C  B 17 ? C 9  ? 20 1 
1 B DC 18 1_555 C DG 8  1_555 0.291  -0.424 0.359  -3.699  -14.650 2.859  18 B_DC18:DG8_C  B 18 ? C 8  ? 19 1 
1 B DC 19 1_555 C DG 7  1_555 0.411  -0.435 0.276  -6.175  -5.485  2.072  19 B_DC19:DG7_C  B 19 ? C 7  ? 19 1 
1 B DG 20 1_555 C DC 6  1_555 -0.001 -0.297 0.312  12.242  -2.629  -3.011 20 B_DG20:DC6_C  B 20 ? C 6  ? 19 1 
1 B DG 21 1_555 C DC 5  1_555 -0.430 -0.243 0.300  -0.126  -12.558 0.831  21 B_DG21:DC5_C  B 21 ? C 5  ? 19 1 
1 B DC 22 1_555 C DG 4  1_555 0.327  -0.285 0.077  -1.421  -3.918  -1.829 22 B_DC22:DG4_C  B 22 ? C 4  ? 19 1 
1 B DG 23 1_555 C DC 3  1_555 0.017  -0.296 0.064  0.349   -6.434  0.781  23 B_DG23:DC3_C  B 23 ? C 3  ? 19 1 
1 B DC 24 1_555 C DG 2  1_555 -0.023 -0.138 0.156  -2.952  -6.702  2.028  24 B_DC24:DG2_C  B 24 ? C 2  ? 19 1 
1 B DG 25 1_555 C DC 1  1_555 0.196  -0.410 0.190  13.429  5.482   -2.314 25 B_DG25:DC1_C  B 25 ? C 1  ? 19 1 
1 E DG 1  1_555 F DC 25 1_555 0.671  0.506  0.132  4.986   -12.584 10.207 26 E_DG1:DC25_F  E 1  ? F 25 ? ?  1 
1 E DC 2  1_555 F DG 24 1_555 0.468  -0.497 0.209  8.692   -16.311 -1.838 27 E_DC2:DG24_F  E 2  ? F 24 ? 19 1 
1 E DC 3  1_555 F DG 23 1_555 -0.232 -0.036 0.446  4.532   -17.006 3.916  28 E_DC3:DG23_F  E 3  ? F 23 ? 19 1 
1 E DT 4  1_555 F DA 22 1_555 -0.272 -0.177 0.435  -4.391  -15.248 -8.878 29 E_DT4:DA22_F  E 4  ? F 22 ? 20 1 
1 E DT 5  1_555 F DA 21 1_555 0.136  0.053  0.066  -5.950  -8.244  6.733  30 E_DT5:DA21_F  E 5  ? F 21 ? 20 1 
1 E DG 6  1_555 F DC 20 1_555 -0.302 -0.045 0.567  1.277   -8.467  -2.235 31 E_DG6:DC20_F  E 6  ? F 20 ? 19 1 
1 E DC 7  1_555 F DG 19 1_555 -0.613 -0.397 0.473  -2.979  -6.110  -7.023 32 E_DC7:DG19_F  E 7  ? F 19 ? 19 1 
1 E DC 8  1_555 F DG 18 1_555 -0.349 -0.296 0.010  -2.985  -7.435  -1.390 33 E_DC8:DG18_F  E 8  ? F 18 ? 19 1 
1 E DG 9  1_555 F DC 17 1_555 0.175  -0.251 0.011  4.876   -12.860 1.497  34 E_DG9:DC17_F  E 9  ? F 17 ? 19 1 
1 E DG 10 1_555 F DC 16 1_555 -0.659 -0.208 -0.066 -2.285  -17.217 -0.580 35 E_DG10:DC16_F E 10 ? F 16 ? 19 1 
1 E DG 11 1_555 F DC 15 1_555 -0.192 -0.013 0.123  15.266  -20.694 0.924  36 E_DG11:DC15_F E 11 ? F 15 ? 19 1 
1 E DT 12 1_555 F DA 14 1_555 -0.113 -0.407 0.271  9.783   -26.033 -0.806 37 E_DT12:DA14_F E 12 ? F 14 ? 20 1 
1 E DA 13 1_555 F DT 13 1_555 0.126  -0.324 0.273  -4.444  -18.648 4.470  38 E_DA13:DT13_F E 13 ? F 13 ? 20 1 
1 E DA 14 1_555 F DT 12 1_555 -0.011 -0.250 -0.089 -14.023 -12.694 -4.038 39 E_DA14:DT12_F E 14 ? F 12 ? 20 1 
1 E DG 15 1_555 F DC 11 1_555 -0.554 -0.167 0.356  -8.185  -16.554 2.630  40 E_DG15:DC11_F E 15 ? F 11 ? 19 1 
1 E DT 16 1_555 F DA 10 1_555 0.064  -0.051 0.445  -9.544  -6.198  0.311  41 E_DT16:DA10_F E 16 ? F 10 ? 20 1 
1 E DT 17 1_555 F DA 9  1_555 -0.255 -0.060 -0.165 -1.538  1.582   -1.226 42 E_DT17:DA9_F  E 17 ? F 9  ? 20 1 
1 E DC 18 1_555 F DG 8  1_555 0.360  -0.224 0.489  -6.103  -18.808 1.173  43 E_DC18:DG8_F  E 18 ? F 8  ? 19 1 
1 E DC 19 1_555 F DG 7  1_555 -0.076 -0.504 0.259  -6.347  -3.474  1.559  44 E_DC19:DG7_F  E 19 ? F 7  ? 19 1 
1 E DG 20 1_555 F DC 6  1_555 -0.031 -0.448 0.137  3.840   -6.599  2.666  45 E_DG20:DC6_F  E 20 ? F 6  ? 19 1 
1 E DG 21 1_555 F DC 5  1_555 -0.341 -0.072 0.374  -1.821  -11.942 5.026  46 E_DG21:DC5_F  E 21 ? F 5  ? 19 1 
1 E DC 22 1_555 F DG 4  1_555 0.331  -0.095 0.211  -3.305  -5.106  1.353  47 E_DC22:DG4_F  E 22 ? F 4  ? 19 1 
1 E DG 23 1_555 F DC 3  1_555 0.060  -0.280 0.075  -0.615  -1.028  0.379  48 E_DG23:DC3_F  E 23 ? F 3  ? 19 1 
1 E DC 24 1_555 F DG 2  1_555 0.362  -0.509 0.040  0.073   -6.521  3.565  49 E_DC24:DG2_F  E 24 ? F 2  ? 19 1 
1 E DG 25 1_555 F DC 1  1_555 0.178  -0.264 0.044  13.484  -1.000  1.480  50 E_DG25:DC1_F  E 25 ? F 1  ? 19 1 
1 H DG 1  1_555 I DC 25 1_555 1.303  0.529  -0.181 2.673   -12.540 4.615  51 H_DG1:DC25_I  H 1  ? I 25 ? 19 1 
1 H DC 2  1_555 I DG 24 1_555 0.465  -0.132 -0.323 9.014   -9.420  -1.612 52 H_DC2:DG24_I  H 2  ? I 24 ? 19 1 
1 H DC 3  1_555 I DG 23 1_555 0.223  -0.189 -0.006 3.543   -8.287  -0.106 53 H_DC3:DG23_I  H 3  ? I 23 ? 19 1 
1 H DT 4  1_555 I DA 22 1_555 -0.226 -0.330 0.339  -11.357 -11.135 -5.911 54 H_DT4:DA22_I  H 4  ? I 22 ? 20 1 
1 H DT 5  1_555 I DA 21 1_555 -0.037 -0.304 0.375  -12.038 -8.991  -1.260 55 H_DT5:DA21_I  H 5  ? I 21 ? 20 1 
1 H DG 6  1_555 I DC 20 1_555 -0.378 -0.077 0.550  -3.595  -2.862  0.167  56 H_DG6:DC20_I  H 6  ? I 20 ? 19 1 
1 H DC 7  1_555 I DG 19 1_555 -0.093 -0.179 0.886  -15.384 -1.710  -2.609 57 H_DC7:DG19_I  H 7  ? I 19 ? 19 1 
1 H DC 8  1_555 I DG 18 1_555 0.347  0.200  -0.417 5.284   -8.587  6.820  58 H_DC8:DG18_I  H 8  ? I 18 ? 19 1 
1 H DG 9  1_555 I DC 17 1_555 -0.125 -0.168 0.017  1.914   -8.779  2.991  59 H_DG9:DC17_I  H 9  ? I 17 ? 19 1 
1 H DG 10 1_555 I DC 16 1_555 -0.241 0.035  -0.129 -4.756  -18.726 3.607  60 H_DG10:DC16_I H 10 ? I 16 ? 19 1 
1 H DG 11 1_555 I DC 15 1_555 0.507  -0.200 0.154  13.052  -21.059 -0.960 61 H_DG11:DC15_I H 11 ? I 15 ? 19 1 
1 H DT 12 1_555 I DA 14 1_555 -0.511 -0.185 0.115  15.333  -22.860 -2.466 62 H_DT12:DA14_I H 12 ? I 14 ? 20 1 
1 H DA 13 1_555 I DT 13 1_555 0.193  -0.510 0.352  4.618   -17.109 -0.678 63 H_DA13:DT13_I H 13 ? I 13 ? 20 1 
1 H DA 14 1_555 I DT 12 1_555 -0.094 -0.429 0.117  -5.245  -16.429 -3.265 64 H_DA14:DT12_I H 14 ? I 12 ? 20 1 
1 H DG 15 1_555 I DC 11 1_555 -0.761 -0.185 0.048  -9.524  -17.519 2.859  65 H_DG15:DC11_I H 15 ? I 11 ? 19 1 
1 H DT 16 1_555 I DA 10 1_555 -0.316 0.005  0.089  -8.480  -8.594  2.050  66 H_DT16:DA10_I H 16 ? I 10 ? 20 1 
1 H DT 17 1_555 I DA 9  1_555 -0.205 -0.301 -0.047 -7.872  -3.487  -3.321 67 H_DT17:DA9_I  H 17 ? I 9  ? 20 1 
1 H DC 18 1_555 I DG 8  1_555 0.157  -0.240 0.217  -3.255  -18.499 4.402  68 H_DC18:DG8_I  H 18 ? I 8  ? 19 1 
1 H DC 19 1_555 I DG 7  1_555 0.233  -0.371 -0.163 -4.409  -6.564  0.260  69 H_DC19:DG7_I  H 19 ? I 7  ? 19 1 
1 H DG 20 1_555 I DC 6  1_555 -0.255 -0.244 0.163  14.739  -3.513  -1.637 70 H_DG20:DC6_I  H 20 ? I 6  ? 19 1 
1 H DG 21 1_555 I DC 5  1_555 -0.468 -0.270 0.312  -1.188  -16.846 -0.145 71 H_DG21:DC5_I  H 21 ? I 5  ? 19 1 
1 H DC 22 1_555 I DG 4  1_555 0.077  -0.351 -0.154 2.003   -4.201  -3.705 72 H_DC22:DG4_I  H 22 ? I 4  ? 19 1 
1 H DG 23 1_555 I DC 3  1_555 0.233  -0.514 0.132  0.303   -9.048  -1.648 73 H_DG23:DC3_I  H 23 ? I 3  ? 19 1 
1 H DC 24 1_555 I DG 2  1_555 0.092  -0.433 0.051  -1.457  -7.011  1.355  74 H_DC24:DG2_I  H 24 ? I 2  ? 19 1 
1 H DG 25 1_555 I DC 1  1_555 0.044  -0.280 0.100  13.996  5.087   0.164  75 H_DG25:DC1_I  H 25 ? I 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 C DC 25 1_555 B DC 2  1_555 C DG 24 1_555 0.145  0.075  2.947 -5.564 2.269   30.864 -0.244 -1.204 2.875 4.214   
10.332  31.429 1  BB_DG1DC2:DG24DC25_CC   B 1  ? C 25 ? B 2  ? C 24 ? 
1 B DC 2  1_555 C DG 24 1_555 B DC 3  1_555 C DG 23 1_555 0.576  -0.530 3.466 4.496  1.388   35.610 -1.072 -0.248 3.488 2.257   
-7.312  35.909 2  BB_DC2DC3:DG23DG24_CC   B 2  ? C 24 ? B 3  ? C 23 ? 
1 B DC 3  1_555 C DG 23 1_555 B DT 4  1_555 C DA 22 1_555 -0.515 -0.799 3.519 1.657  6.723   28.724 -3.060 1.378  3.219 13.309  
-3.281  29.530 3  BB_DC3DT4:DA22DG23_CC   B 3  ? C 23 ? B 4  ? C 22 ? 
1 B DT 4  1_555 C DA 22 1_555 B DT 5  1_555 C DA 21 1_555 1.142  -0.121 3.532 0.988  0.470   36.576 -0.264 -1.672 3.558 0.749   
-1.574  36.592 4  BB_DT4DT5:DA21DA22_CC   B 4  ? C 22 ? B 5  ? C 21 ? 
1 B DT 5  1_555 C DA 21 1_555 B DG 6  1_555 C DC 20 1_555 -0.957 -0.029 2.828 -8.330 0.825   34.313 -0.159 0.469  2.971 1.373   
13.865  35.290 5  BB_DT5DG6:DC20DA21_CC   B 5  ? C 21 ? B 6  ? C 20 ? 
1 B DG 6  1_555 C DC 20 1_555 B DC 7  1_555 C DG 19 1_555 0.162  -1.099 3.529 4.215  0.289   37.150 -1.756 0.348  3.518 0.452   
-6.590  37.381 6  BB_DG6DC7:DG19DC20_CC   B 6  ? C 20 ? B 7  ? C 19 ? 
1 B DC 7  1_555 C DG 19 1_555 B DC 8  1_555 C DG 18 1_555 0.861  0.181  3.272 4.622  8.194   31.723 -1.105 -0.710 3.305 14.593  
-8.232  33.054 7  BB_DC7DC8:DG18DG19_CC   B 7  ? C 19 ? B 8  ? C 18 ? 
1 B DC 8  1_555 C DG 18 1_555 B DG 9  1_555 C DC 17 1_555 -1.173 0.616  3.202 -6.464 8.613   29.924 -0.524 0.905  3.418 16.041  
12.038  31.761 8  BB_DC8DG9:DC17DG18_CC   B 8  ? C 18 ? B 9  ? C 17 ? 
1 B DG 9  1_555 C DC 17 1_555 B DG 10 1_555 C DC 16 1_555 -0.695 -0.582 3.313 -2.517 0.868   36.302 -1.055 0.756  3.338 1.391   
4.033   36.397 9  BB_DG9DG10:DC16DC17_CC  B 9  ? C 17 ? B 10 ? C 16 ? 
1 B DG 10 1_555 C DC 16 1_555 B DG 11 1_555 C DC 15 1_555 0.263  0.325  3.312 1.820  6.274   31.662 -0.555 -0.142 3.323 11.348  
-3.291  32.312 10 BB_DG10DG11:DC15DC16_CC B 10 ? C 16 ? B 11 ? C 15 ? 
1 B DG 11 1_555 C DC 15 1_555 B DT 12 1_555 C DA 14 1_555 -0.467 0.265  3.598 -1.961 -13.799 32.435 2.678  0.453  3.245 -23.402 
3.325   35.228 11 BB_DG11DT12:DA14DC15_CC B 11 ? C 15 ? B 12 ? C 14 ? 
1 B DT 12 1_555 C DA 14 1_555 B DA 13 1_555 C DT 13 1_555 0.851  2.223  3.787 2.983  -24.592 54.580 3.531  -0.701 2.689 -25.407 
-3.082  59.543 12 BB_DT12DA13:DT13DA14_CC B 12 ? C 14 ? B 13 ? C 13 ? 
1 B DA 13 1_555 C DT 13 1_555 B DA 14 1_555 C DT 12 1_555 0.213  -0.539 3.917 1.329  -0.410  32.641 -0.874 -0.103 3.929 -0.730  
-2.364  32.670 13 BB_DA13DA14:DT12DT13_CC B 13 ? C 13 ? B 14 ? C 12 ? 
1 B DA 14 1_555 C DT 12 1_555 B DG 15 1_555 C DC 11 1_555 -0.046 -0.481 3.501 1.642  2.157   32.257 -1.268 0.391  3.456 3.873   
-2.949  32.368 14 BB_DA14DG15:DC11DT12_CC B 14 ? C 12 ? B 15 ? C 11 ? 
1 B DG 15 1_555 C DC 11 1_555 B DT 16 1_555 C DA 10 1_555 -0.220 -0.553 3.470 0.071  2.837   34.479 -1.392 0.382  3.414 4.777   
-0.119  34.592 15 BB_DG15DT16:DA10DC11_CC B 15 ? C 11 ? B 16 ? C 10 ? 
1 B DT 16 1_555 C DA 10 1_555 B DT 17 1_555 C DA 9  1_555 0.334  0.477  3.377 1.839  -0.752  36.355 0.871  -0.270 3.379 -1.205  
-2.945  36.407 16 BB_DT16DT17:DA9DA10_CC  B 16 ? C 10 ? B 17 ? C 9  ? 
1 B DT 17 1_555 C DA 9  1_555 B DC 18 1_555 C DG 8  1_555 -0.285 -0.156 3.647 -7.282 -8.822  38.472 0.913  -0.525 3.590 -13.041 
10.764  40.075 17 BB_DT17DC18:DG8DA9_CC   B 17 ? C 9  ? B 18 ? C 8  ? 
1 B DC 18 1_555 C DG 8  1_555 B DC 19 1_555 C DG 7  1_555 -0.405 -1.290 3.389 4.218  3.030   25.912 -3.632 2.015  3.116 6.671   
-9.289  26.419 18 BB_DC18DC19:DG7DG8_CC   B 18 ? C 8  ? B 19 ? C 7  ? 
1 B DC 19 1_555 C DG 7  1_555 B DG 20 1_555 C DC 6  1_555 0.046  -0.544 2.816 1.131  10.657  29.295 -2.710 0.094  2.472 20.237  
-2.149  31.153 19 BB_DC19DG20:DC6DG7_CC   B 19 ? C 7  ? B 20 ? C 6  ? 
1 B DG 20 1_555 C DC 6  1_555 B DG 21 1_555 C DC 5  1_555 0.636  -1.757 3.519 1.372  0.890   28.238 -3.817 -0.960 3.490 1.822   
-2.810  28.284 20 BB_DG20DG21:DC5DC6_CC   B 20 ? C 6  ? B 21 ? C 5  ? 
1 B DG 21 1_555 C DC 5  1_555 B DC 22 1_555 C DG 4  1_555 0.294  -1.000 3.324 3.045  5.329   39.707 -2.062 -0.082 3.182 7.789   
-4.451  40.160 21 BB_DG21DC22:DG4DC5_CC   B 21 ? C 5  ? B 22 ? C 4  ? 
1 B DC 22 1_555 C DG 4  1_555 B DG 23 1_555 C DC 3  1_555 -0.026 -0.840 3.358 -3.322 -0.037  35.876 -1.353 -0.443 3.347 -0.059  
5.379   36.024 22 BB_DC22DG23:DC3DG4_CC   B 22 ? C 4  ? B 23 ? C 3  ? 
1 B DG 23 1_555 C DC 3  1_555 B DC 24 1_555 C DG 2  1_555 -0.652 -0.787 3.333 -1.855 2.962   28.613 -2.251 0.891  3.272 5.965   
3.735   28.821 23 BB_DG23DC24:DG2DC3_CC   B 23 ? C 3  ? B 24 ? C 2  ? 
1 B DC 24 1_555 C DG 2  1_555 B DG 25 1_555 C DC 1  1_555 -0.390 0.421  3.075 -0.415 9.556   32.191 -0.779 0.611  3.076 16.777  
0.729   33.546 24 BB_DC24DG25:DC1DG2_CC   B 24 ? C 2  ? B 25 ? C 1  ? 
1 E DG 1  1_555 F DC 25 1_555 E DC 2  1_555 F DG 24 1_555 -0.326 0.157  3.238 -1.140 -1.159  36.997 0.401  0.362  3.241 -1.825  
1.796   37.032 25 EE_DG1DC2:DG24DC25_FF   E 1  ? F 25 ? E 2  ? F 24 ? 
1 E DC 2  1_555 F DG 24 1_555 E DC 3  1_555 F DG 23 1_555 0.341  -0.317 3.295 1.406  8.943   30.688 -2.192 -0.365 3.095 16.453  
-2.587  31.964 26 EE_DC2DC3:DG23DG24_FF   E 2  ? F 24 ? E 3  ? F 23 ? 
1 E DC 3  1_555 F DG 23 1_555 E DT 4  1_555 F DA 22 1_555 -0.555 -0.326 3.532 -0.207 -1.766  34.512 -0.254 0.900  3.547 -2.974  
0.349   34.557 27 EE_DC3DT4:DA22DG23_FF   E 3  ? F 23 ? E 4  ? F 22 ? 
1 E DT 4  1_555 F DA 22 1_555 E DT 5  1_555 F DA 21 1_555 1.518  0.126  3.327 7.005  4.693   36.479 -0.459 -1.388 3.537 7.377   
-11.009 37.408 28 EE_DT4DT5:DA21DA22_FF   E 4  ? F 22 ? E 5  ? F 21 ? 
1 E DT 5  1_555 F DA 21 1_555 E DG 6  1_555 F DC 20 1_555 -1.218 0.336  3.020 -8.994 2.004   34.113 0.265  0.710  3.241 3.341   
14.996  35.300 29 EE_DT5DG6:DC20DA21_FF   E 5  ? F 21 ? E 6  ? F 20 ? 
1 E DG 6  1_555 F DC 20 1_555 E DC 7  1_555 F DG 19 1_555 0.001  -1.053 3.504 0.533  -1.768  31.538 -1.580 0.105  3.556 -3.250  
-0.979  31.591 30 EE_DG6DC7:DG19DC20_FF   E 6  ? F 20 ? E 7  ? F 19 ? 
1 E DC 7  1_555 F DG 19 1_555 E DC 8  1_555 F DG 18 1_555 0.684  -0.565 3.239 4.990  8.411   35.612 -2.017 -0.415 3.096 13.443  
-7.975  36.888 31 EE_DC7DC8:DG18DG19_FF   E 7  ? F 19 ? E 8  ? F 18 ? 
1 E DC 8  1_555 F DG 18 1_555 E DG 9  1_555 F DC 17 1_555 -0.649 0.762  3.273 -0.804 5.609   33.905 0.394  0.970  3.366 9.535   
1.367   34.361 32 EE_DC8DG9:DC17DG18_FF   E 8  ? F 18 ? E 9  ? F 17 ? 
1 E DG 9  1_555 F DC 17 1_555 E DG 10 1_555 F DC 16 1_555 -0.590 -0.373 3.305 -2.810 8.340   32.635 -2.000 0.558  3.155 14.515  
4.890   33.770 33 EE_DG9DG10:DC16DC17_FF  E 9  ? F 17 ? E 10 ? F 16 ? 
1 E DG 10 1_555 F DC 16 1_555 E DG 11 1_555 F DC 15 1_555 0.144  0.530  3.029 -3.102 9.587   30.637 -0.668 -0.784 3.025 17.558  
5.681   32.213 34 EE_DG10DG11:DC15DC16_FF E 10 ? F 16 ? E 11 ? F 15 ? 
1 E DG 11 1_555 F DC 15 1_555 E DT 12 1_555 F DA 14 1_555 -0.932 0.501  3.574 -4.004 -12.827 37.226 2.383  0.867  3.311 -19.338 
6.037   39.496 35 EE_DG11DT12:DA14DC15_FF E 11 ? F 15 ? E 12 ? F 14 ? 
1 E DT 12 1_555 F DA 14 1_555 E DA 13 1_555 F DT 13 1_555 0.567  2.554  3.968 3.147  -23.854 54.355 3.909  -0.401 2.752 -24.798 
-3.271  59.070 36 EE_DT12DA13:DT13DA14_FF E 12 ? F 14 ? E 13 ? F 13 ? 
1 E DA 13 1_555 F DT 13 1_555 E DA 14 1_555 F DT 12 1_555 0.195  -0.359 3.641 -0.980 -2.477  32.068 -0.153 -0.547 3.650 -4.474  
1.770   32.176 37 EE_DA13DA14:DT12DT13_FF E 13 ? F 13 ? E 14 ? F 12 ? 
1 E DA 14 1_555 F DT 12 1_555 E DG 15 1_555 F DC 11 1_555 0.376  -0.293 3.482 -3.653 7.121   32.141 -1.776 -1.307 3.283 12.619  
6.474   33.097 38 EE_DA14DG15:DC11DT12_FF E 14 ? F 12 ? E 15 ? F 11 ? 
1 E DG 15 1_555 F DC 11 1_555 E DT 16 1_555 F DA 10 1_555 -0.285 -0.530 3.480 -0.484 -2.195  38.351 -0.514 0.369  3.507 -3.337  
0.736   38.414 39 EE_DG15DT16:DA10DC11_FF E 15 ? F 11 ? E 16 ? F 10 ? 
1 E DT 16 1_555 F DA 10 1_555 E DT 17 1_555 F DA 9  1_555 0.718  0.277  3.207 5.213  0.614   35.209 0.364  -0.418 3.281 1.008   
-8.559  35.586 40 EE_DT16DT17:DA9DA10_FF  E 16 ? F 10 ? E 17 ? F 9  ? 
1 E DT 17 1_555 F DA 9  1_555 E DC 18 1_555 F DG 8  1_555 -0.640 -0.161 3.875 -7.203 -9.721  33.487 1.460  -0.228 3.826 -16.228 
12.024  35.547 41 EE_DT17DC18:DG8DA9_FF   E 17 ? F 9  ? E 18 ? F 8  ? 
1 E DC 18 1_555 F DG 8  1_555 E DC 19 1_555 F DG 7  1_555 -0.203 -1.577 3.321 1.979  4.095   27.697 -4.197 0.875  3.040 8.482   
-4.099  28.061 42 EE_DC18DC19:DG7DG8_FF   E 18 ? F 8  ? E 19 ? F 7  ? 
1 E DC 19 1_555 F DG 7  1_555 E DG 20 1_555 F DC 6  1_555 0.370  -0.592 3.019 1.802  8.729   32.141 -2.346 -0.375 2.784 15.400  
-3.179  33.322 43 EE_DC19DG20:DC6DG7_FF   E 19 ? F 7  ? E 20 ? F 6  ? 
1 E DG 20 1_555 F DC 6  1_555 E DG 21 1_555 F DC 5  1_555 0.666  -1.681 3.473 1.288  -1.422  29.092 -3.005 -1.020 3.575 -2.826  
-2.560  29.154 44 EE_DG20DG21:DC5DC6_FF   E 20 ? F 6  ? E 21 ? F 5  ? 
1 E DG 21 1_555 F DC 5  1_555 E DC 22 1_555 F DG 4  1_555 0.533  -0.808 3.222 4.269  6.978   39.395 -1.948 -0.303 3.080 10.218  
-6.251  40.202 45 EE_DG21DC22:DG4DC5_FF   E 21 ? F 5  ? E 22 ? F 4  ? 
1 E DC 22 1_555 F DG 4  1_555 E DG 23 1_555 F DC 3  1_555 -0.260 -0.632 3.327 -1.012 2.195   34.636 -1.399 0.278  3.288 3.681   
1.697   34.718 46 EE_DC22DG23:DC3DG4_FF   E 22 ? F 4  ? E 23 ? F 3  ? 
1 E DG 23 1_555 F DC 3  1_555 E DC 24 1_555 F DG 2  1_555 -0.468 -0.667 3.238 -0.338 2.314   29.188 -1.811 0.854  3.181 4.582   
0.669   29.279 47 EE_DG23DC24:DG2DC3_FF   E 23 ? F 3  ? E 24 ? F 2  ? 
1 E DC 24 1_555 F DG 2  1_555 E DG 25 1_555 F DC 1  1_555 -0.388 0.167  3.093 0.320  8.127   34.098 -0.886 0.691  3.048 13.620  
-0.537  35.027 48 EE_DC24DG25:DC1DG2_FF   E 24 ? F 2  ? E 25 ? F 1  ? 
1 H DG 1  1_555 I DC 25 1_555 H DC 2  1_555 I DG 24 1_555 0.171  0.250  2.993 1.394  0.897   36.745 0.284  -0.097 3.003 1.422   
-2.210  36.781 49 HH_DG1DC2:DG24DC25_II   H 1  ? I 25 ? H 2  ? I 24 ? 
1 H DC 2  1_555 I DG 24 1_555 H DC 3  1_555 I DG 23 1_555 0.303  -0.433 3.608 0.573  7.044   34.575 -1.855 -0.407 3.460 11.701  
-0.952  35.268 50 HH_DC2DC3:DG23DG24_II   H 2  ? I 24 ? H 3  ? I 23 ? 
1 H DC 3  1_555 I DG 23 1_555 H DT 4  1_555 I DA 22 1_555 -0.093 -0.562 3.569 2.141  7.715   32.599 -2.332 0.538  3.340 13.492  
-3.744  33.542 51 HH_DC3DT4:DA22DG23_II   H 3  ? I 23 ? H 4  ? I 22 ? 
1 H DT 4  1_555 I DA 22 1_555 H DT 5  1_555 I DA 21 1_555 0.888  0.153  3.351 3.151  5.529   35.626 -0.564 -0.968 3.400 8.949   
-5.100  36.172 52 HH_DT4DT5:DA21DA22_II   H 4  ? I 22 ? H 5  ? I 21 ? 
1 H DT 5  1_555 I DA 21 1_555 H DG 6  1_555 I DC 20 1_555 -0.758 0.233  2.968 -7.781 -0.113  36.487 0.378  0.226  3.060 -0.178  
12.256  37.280 53 HH_DT5DG6:DC20DA21_II   H 5  ? I 21 ? H 6  ? I 20 ? 
1 H DG 6  1_555 I DC 20 1_555 H DC 7  1_555 I DG 19 1_555 -0.231 -1.428 3.693 -3.278 2.454   32.838 -2.970 -0.213 3.586 4.320   
5.770   33.086 54 HH_DG6DC7:DG19DC20_II   H 6  ? I 20 ? H 7  ? I 19 ? 
1 H DC 7  1_555 I DG 19 1_555 H DC 8  1_555 I DG 18 1_555 0.877  0.276  2.873 12.259 3.577   34.085 -0.022 0.186  3.015 5.854   
-20.061 36.332 55 HH_DC7DC8:DG18DG19_II   H 7  ? I 19 ? H 8  ? I 18 ? 
1 H DC 8  1_555 I DG 18 1_555 H DG 9  1_555 I DC 17 1_555 -1.090 0.680  3.370 -8.150 11.694  29.738 -1.027 0.371  3.553 21.312  
14.853  32.908 56 HH_DC8DG9:DC17DG18_II   H 8  ? I 18 ? H 9  ? I 17 ? 
1 H DG 9  1_555 I DC 17 1_555 H DG 10 1_555 I DC 16 1_555 -0.776 -0.403 3.504 -0.139 2.610   37.275 -0.997 1.192  3.472 4.077   
0.217   37.364 57 HH_DG9DG10:DC16DC17_II  H 9  ? I 17 ? H 10 ? I 16 ? 
1 H DG 10 1_555 I DC 16 1_555 H DG 11 1_555 I DC 15 1_555 0.218  0.535  3.085 -2.567 4.958   32.974 0.149  -0.783 3.105 8.658   
4.482   33.431 58 HH_DG10DG11:DC15DC16_II H 10 ? I 16 ? H 11 ? I 15 ? 
1 H DG 11 1_555 I DC 15 1_555 H DT 12 1_555 I DA 14 1_555 -0.568 0.166  3.334 -0.433 -11.096 29.558 2.400  0.963  3.080 -20.845 
0.814   31.532 59 HH_DG11DT12:DA14DC15_II H 11 ? I 15 ? H 12 ? I 14 ? 
1 H DT 12 1_555 I DA 14 1_555 H DA 13 1_555 I DT 13 1_555 0.688  2.163  3.979 1.771  -23.445 53.858 3.576  -0.603 2.910 -24.610 
-1.859  58.413 60 HH_DT12DA13:DT13DA14_II H 12 ? I 14 ? H 13 ? I 13 ? 
1 H DA 13 1_555 I DT 13 1_555 H DA 14 1_555 I DT 12 1_555 0.507  -0.700 3.588 -0.440 -3.329  30.398 -0.597 -1.058 3.635 -6.325  
0.835   30.579 61 HH_DA13DA14:DT12DT13_II H 13 ? I 13 ? H 14 ? I 12 ? 
1 H DA 14 1_555 I DT 12 1_555 H DG 15 1_555 I DC 11 1_555 0.081  -0.583 3.575 0.637  4.479   34.540 -1.712 -0.030 3.475 7.503   
-1.067  34.826 62 HH_DA14DG15:DC11DT12_II H 14 ? I 12 ? H 15 ? I 11 ? 
1 H DG 15 1_555 I DC 11 1_555 H DT 16 1_555 I DA 10 1_555 -0.691 -0.711 3.370 -0.033 -0.101  35.224 -1.159 1.137  3.372 -0.166  
0.055   35.224 63 HH_DG15DT16:DA10DC11_II H 15 ? I 11 ? H 16 ? I 10 ? 
1 H DT 16 1_555 I DA 10 1_555 H DT 17 1_555 I DA 9  1_555 0.290  0.375  3.411 0.834  0.360   36.870 0.542  -0.341 3.420 0.568   
-1.318  36.880 64 HH_DT16DT17:DA9DA10_II  H 16 ? I 10 ? H 17 ? I 9  ? 
1 H DT 17 1_555 I DA 9  1_555 H DC 18 1_555 I DG 8  1_555 -0.486 0.081  3.433 -7.318 -10.559 36.107 1.536  -0.237 3.316 -16.409 
11.373  38.253 65 HH_DT17DC18:DG8DA9_II   H 17 ? I 9  ? H 18 ? I 8  ? 
1 H DC 18 1_555 I DG 8  1_555 H DC 19 1_555 I DG 7  1_555 -0.527 -1.317 3.463 5.708  4.285   27.113 -3.746 2.455  3.051 8.945   
-11.915 28.019 66 HH_DC18DC19:DG7DG8_II   H 18 ? I 8  ? H 19 ? I 7  ? 
1 H DC 19 1_555 I DG 7  1_555 H DG 20 1_555 I DC 6  1_555 0.194  -0.402 2.907 -1.520 10.543  26.707 -2.865 -0.688 2.552 21.757  
3.136   28.717 67 HH_DC19DG20:DC6DG7_II   H 19 ? I 7  ? H 20 ? I 6  ? 
1 H DG 20 1_555 I DC 6  1_555 H DG 21 1_555 I DC 5  1_555 0.690  -1.671 3.677 0.493  0.642   31.074 -3.256 -1.181 3.653 1.197   
-0.920  31.084 68 HH_DG20DG21:DC5DC6_II   H 20 ? I 6  ? H 21 ? I 5  ? 
1 H DG 21 1_555 I DC 5  1_555 H DC 22 1_555 I DG 4  1_555 0.663  -0.806 3.195 5.800  7.117   37.572 -2.069 -0.309 3.063 10.853  
-8.843  38.638 69 HH_DG21DC22:DG4DC5_II   H 21 ? I 5  ? H 22 ? I 4  ? 
1 H DC 22 1_555 I DG 4  1_555 H DG 23 1_555 I DC 3  1_555 0.241  -0.707 3.387 -2.951 4.277   35.608 -1.766 -0.819 3.253 6.948   
4.794   35.973 70 HH_DC22DG23:DC3DG4_II   H 22 ? I 4  ? H 23 ? I 3  ? 
1 H DG 23 1_555 I DC 3  1_555 H DC 24 1_555 I DG 2  1_555 -0.554 -0.946 3.341 0.808  4.338   29.545 -2.736 1.243  3.157 8.446   
-1.574  29.866 71 HH_DG23DC24:DG2DC3_II   H 23 ? I 3  ? H 24 ? I 2  ? 
1 H DC 24 1_555 I DG 2  1_555 H DG 25 1_555 I DC 1  1_555 -0.323 0.203  3.065 0.501  8.124   28.771 -1.201 0.725  3.003 15.951  
-0.983  29.877 72 HH_DC24DG25:DC1DG2_II   H 24 ? I 2  ? H 25 ? I 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'ZINC ION' ZN  
6 water      HOH 
#