data_4UNA
# 
_entry.id   4UNA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4UNA         
PDBE  EBI-60746    
WWPDB D_1290060746 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 4UN6 unspecified 'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 10 DAYS INCUBATION IN 5MM MN (STATE 7)' 
PDB 4UN7 unspecified 'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA BEFORE INCUBATION IN 5MM MN (STATE 1)'     
PDB 4UN8 unspecified 'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 1H INCUBATION IN 5MM MN (STATE 2)'      
PDB 4UN9 unspecified 'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 8H INCUBATION IN 5MM MN (STATE 3)'      
PDB 4UNB unspecified 'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 6 DAYS INCUBATION IN 5MM MN (STATE 5)'  
PDB 4UNC unspecified 'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 8 DAYS INCUBATION IN 5MM MN (STATE 6)'  
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4UNA 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-05-26 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Molina, R.'     1 
'Stella, S.'     2 
'Redondo, P.'    3 
'Gomez, H.'      4 
'Marcaida, M.J.' 5 
'Orozco, M.'     6 
'Prieto, J.'     7 
'Montoya, G.'    8 
# 
_citation.id                        primary 
_citation.title                     'Visualizing Phosphodiester-Bond Hydrolysis by an Endonuclease.' 
_citation.journal_abbrev            Nat.Struct.Mol.Biol. 
_citation.journal_volume            22 
_citation.page_first                65 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           ? 
_citation.country                   US 
_citation.journal_id_ISSN           1545-9993 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25486305 
_citation.pdbx_database_id_DOI      10.1038/NSMB.2932 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Molina, R.'     1 
primary 'Stella, S.'     2 
primary 'Redondo, P.'    3 
primary 'Gomez, H.'      4 
primary 'Marcaida, M.J.' 5 
primary 'Orozco, M.'     6 
primary 'Prieto, J.'     7 
primary 'Montoya, G.'    8 
# 
_cell.entry_id           4UNA 
_cell.length_a           106.517 
_cell.length_b           70.153 
_cell.length_c           106.704 
_cell.angle_alpha        90.00 
_cell.angle_beta         119.83 
_cell.angle_gamma        90.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4UNA 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'HOMING ENDONUCLEASE I-DMOI'                            23265.057 3   3.1.-.- ? ? ? 
2 polymer     syn 25MER                                                   7707.932  3   ?       ? ? ? 
3 polymer     syn "5'-D(*CP*GP*CP*GP*CP*CP*GP*GP*AP*AP*CP*TP*TP*AP*C)-3'" 4554.962  3   ?       ? ? ? 
4 polymer     syn "5'-D(*CP*CP*GP*GP*CP*AP*AP*GP*GP*C)-3'"                3055.007  3   ?       ? ? ? 
5 non-polymer syn 'MANGANESE (II) ION'                                    54.938    9   ?       ? ? ? 
6 water       nat water                                                   18.015    119 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        I-DMOI 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;AHNNENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYEL
RVSSKKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGV
YVLNISLRDRIKFVHTILSSHLNPLPPEAAALEHHHHHH
;
;AHNNENVSGISAYLLGLIIGDGGLYKLKYKGNRSEYRVVITQKSENLIKQHIAPLMQFLIDELNVKSKIQIVKGDTRYEL
RVSSKKLYYYFANMLERIRLFNMREQIAFIKGLYVAEGDKTLKRLRIWNKNKALLEIVSRWLNNLGVRNTIHLDDHRHGV
YVLNISLRDRIKFVHTILSSHLNPLPPEAAALEHHHHHH
;
A,D,G ? 
2 polydeoxyribonucleotide no no 
;(DG)(DC)(DC)(DT)(DT)(DG)(DC)(DC)(DG)(DG)(DG)(DT)(DA)(DA)(DG)(DT)(DT)(DC)(DC)(DG)
(DG)(DC)(DG)(DC)(DG)
;
GCCTTGCCGGGTAAGTTCCGGCGCG B,E,H ? 
3 polydeoxyribonucleotide no no '(DC)(DG)(DC)(DG)(DC)(DC)(DG)(DG)(DA)(DA)(DC)(DT)(DT)(DA)(DC)' CGCGCCGGAACTTAC C,F,I ? 
4 polydeoxyribonucleotide no no '(DC)(DC)(DG)(DG)(DC)(DA)(DA)(DG)(DG)(DC)' CCGGCAAGGC K,M,O ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   HIS n 
1 3   ASN n 
1 4   ASN n 
1 5   GLU n 
1 6   ASN n 
1 7   VAL n 
1 8   SER n 
1 9   GLY n 
1 10  ILE n 
1 11  SER n 
1 12  ALA n 
1 13  TYR n 
1 14  LEU n 
1 15  LEU n 
1 16  GLY n 
1 17  LEU n 
1 18  ILE n 
1 19  ILE n 
1 20  GLY n 
1 21  ASP n 
1 22  GLY n 
1 23  GLY n 
1 24  LEU n 
1 25  TYR n 
1 26  LYS n 
1 27  LEU n 
1 28  LYS n 
1 29  TYR n 
1 30  LYS n 
1 31  GLY n 
1 32  ASN n 
1 33  ARG n 
1 34  SER n 
1 35  GLU n 
1 36  TYR n 
1 37  ARG n 
1 38  VAL n 
1 39  VAL n 
1 40  ILE n 
1 41  THR n 
1 42  GLN n 
1 43  LYS n 
1 44  SER n 
1 45  GLU n 
1 46  ASN n 
1 47  LEU n 
1 48  ILE n 
1 49  LYS n 
1 50  GLN n 
1 51  HIS n 
1 52  ILE n 
1 53  ALA n 
1 54  PRO n 
1 55  LEU n 
1 56  MET n 
1 57  GLN n 
1 58  PHE n 
1 59  LEU n 
1 60  ILE n 
1 61  ASP n 
1 62  GLU n 
1 63  LEU n 
1 64  ASN n 
1 65  VAL n 
1 66  LYS n 
1 67  SER n 
1 68  LYS n 
1 69  ILE n 
1 70  GLN n 
1 71  ILE n 
1 72  VAL n 
1 73  LYS n 
1 74  GLY n 
1 75  ASP n 
1 76  THR n 
1 77  ARG n 
1 78  TYR n 
1 79  GLU n 
1 80  LEU n 
1 81  ARG n 
1 82  VAL n 
1 83  SER n 
1 84  SER n 
1 85  LYS n 
1 86  LYS n 
1 87  LEU n 
1 88  TYR n 
1 89  TYR n 
1 90  TYR n 
1 91  PHE n 
1 92  ALA n 
1 93  ASN n 
1 94  MET n 
1 95  LEU n 
1 96  GLU n 
1 97  ARG n 
1 98  ILE n 
1 99  ARG n 
1 100 LEU n 
1 101 PHE n 
1 102 ASN n 
1 103 MET n 
1 104 ARG n 
1 105 GLU n 
1 106 GLN n 
1 107 ILE n 
1 108 ALA n 
1 109 PHE n 
1 110 ILE n 
1 111 LYS n 
1 112 GLY n 
1 113 LEU n 
1 114 TYR n 
1 115 VAL n 
1 116 ALA n 
1 117 GLU n 
1 118 GLY n 
1 119 ASP n 
1 120 LYS n 
1 121 THR n 
1 122 LEU n 
1 123 LYS n 
1 124 ARG n 
1 125 LEU n 
1 126 ARG n 
1 127 ILE n 
1 128 TRP n 
1 129 ASN n 
1 130 LYS n 
1 131 ASN n 
1 132 LYS n 
1 133 ALA n 
1 134 LEU n 
1 135 LEU n 
1 136 GLU n 
1 137 ILE n 
1 138 VAL n 
1 139 SER n 
1 140 ARG n 
1 141 TRP n 
1 142 LEU n 
1 143 ASN n 
1 144 ASN n 
1 145 LEU n 
1 146 GLY n 
1 147 VAL n 
1 148 ARG n 
1 149 ASN n 
1 150 THR n 
1 151 ILE n 
1 152 HIS n 
1 153 LEU n 
1 154 ASP n 
1 155 ASP n 
1 156 HIS n 
1 157 ARG n 
1 158 HIS n 
1 159 GLY n 
1 160 VAL n 
1 161 TYR n 
1 162 VAL n 
1 163 LEU n 
1 164 ASN n 
1 165 ILE n 
1 166 SER n 
1 167 LEU n 
1 168 ARG n 
1 169 ASP n 
1 170 ARG n 
1 171 ILE n 
1 172 LYS n 
1 173 PHE n 
1 174 VAL n 
1 175 HIS n 
1 176 THR n 
1 177 ILE n 
1 178 LEU n 
1 179 SER n 
1 180 SER n 
1 181 HIS n 
1 182 LEU n 
1 183 ASN n 
1 184 PRO n 
1 185 LEU n 
1 186 PRO n 
1 187 PRO n 
1 188 GLU n 
1 189 ALA n 
1 190 ALA n 
1 191 ALA n 
1 192 LEU n 
1 193 GLU n 
1 194 HIS n 
1 195 HIS n 
1 196 HIS n 
1 197 HIS n 
1 198 HIS n 
1 199 HIS n 
2 1   DG  n 
2 2   DC  n 
2 3   DC  n 
2 4   DT  n 
2 5   DT  n 
2 6   DG  n 
2 7   DC  n 
2 8   DC  n 
2 9   DG  n 
2 10  DG  n 
2 11  DG  n 
2 12  DT  n 
2 13  DA  n 
2 14  DA  n 
2 15  DG  n 
2 16  DT  n 
2 17  DT  n 
2 18  DC  n 
2 19  DC  n 
2 20  DG  n 
2 21  DG  n 
2 22  DC  n 
2 23  DG  n 
2 24  DC  n 
2 25  DG  n 
3 1   DC  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DC  n 
3 6   DC  n 
3 7   DG  n 
3 8   DG  n 
3 9   DA  n 
3 10  DA  n 
3 11  DC  n 
3 12  DT  n 
3 13  DT  n 
3 14  DA  n 
3 15  DC  n 
4 1   DC  n 
4 2   DC  n 
4 3   DG  n 
4 4   DG  n 
4 5   DC  n 
4 6   DA  n 
4 7   DA  n 
4 8   DG  n 
4 9   DG  n 
4 10  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'DESULFUROCOCCUS MOBILIS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     2274 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              'ROSETTA PLYSS' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PET24D 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
3 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
4 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP DMO1_DESMO 1 ? ? P21505 ? 
2 PDB 4UNA       2 ? ? 4UNA   ? 
3 PDB 4UNA       3 ? ? 4UNA   ? 
4 PDB 4UNA       4 ? ? 4UNA   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 4UNA A 2 ? 188 ? P21505 2  ? 188 ? 2  188 
2  1 4UNA D 2 ? 188 ? P21505 2  ? 188 ? 2  188 
3  1 4UNA G 2 ? 188 ? P21505 2  ? 188 ? 2  188 
4  2 4UNA B 1 ? 25  ? 4UNA   1  ? 25  ? 1  25  
5  2 4UNA E 1 ? 25  ? 4UNA   1  ? 25  ? 1  25  
6  2 4UNA H 1 ? 25  ? 4UNA   1  ? 25  ? 1  25  
7  3 4UNA C 1 ? 15  ? 4UNA   1  ? 15  ? 1  15  
8  3 4UNA F 1 ? 15  ? 4UNA   1  ? 15  ? 1  15  
9  3 4UNA I 1 ? 15  ? 4UNA   1  ? 15  ? 1  15  
10 4 4UNA K 1 ? 10  ? 4UNA   16 ? 25  ? 16 25  
11 4 4UNA M 1 ? 10  ? 4UNA   16 ? 25  ? 16 25  
12 4 4UNA O 1 ? 10  ? 4UNA   16 ? 25  ? 16 25  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4UNA ALA A 1   ? UNP P21505 ? ? 'expression tag' 1   1  
1 4UNA ALA A 189 ? UNP P21505 ? ? 'expression tag' 189 2  
1 4UNA ALA A 190 ? UNP P21505 ? ? 'expression tag' 190 3  
1 4UNA ALA A 191 ? UNP P21505 ? ? 'expression tag' 191 4  
1 4UNA LEU A 192 ? UNP P21505 ? ? 'expression tag' 192 5  
1 4UNA GLU A 193 ? UNP P21505 ? ? 'expression tag' 193 6  
1 4UNA HIS A 194 ? UNP P21505 ? ? 'expression tag' 194 7  
1 4UNA HIS A 195 ? UNP P21505 ? ? 'expression tag' 195 8  
1 4UNA HIS A 196 ? UNP P21505 ? ? 'expression tag' 196 9  
1 4UNA HIS A 197 ? UNP P21505 ? ? 'expression tag' 197 10 
1 4UNA HIS A 198 ? UNP P21505 ? ? 'expression tag' 198 11 
1 4UNA HIS A 199 ? UNP P21505 ? ? 'expression tag' 199 12 
2 4UNA ALA D 1   ? UNP P21505 ? ? 'expression tag' 1   13 
2 4UNA ALA D 189 ? UNP P21505 ? ? 'expression tag' 189 14 
2 4UNA ALA D 190 ? UNP P21505 ? ? 'expression tag' 190 15 
2 4UNA ALA D 191 ? UNP P21505 ? ? 'expression tag' 191 16 
2 4UNA LEU D 192 ? UNP P21505 ? ? 'expression tag' 192 17 
2 4UNA GLU D 193 ? UNP P21505 ? ? 'expression tag' 193 18 
2 4UNA HIS D 194 ? UNP P21505 ? ? 'expression tag' 194 19 
2 4UNA HIS D 195 ? UNP P21505 ? ? 'expression tag' 195 20 
2 4UNA HIS D 196 ? UNP P21505 ? ? 'expression tag' 196 21 
2 4UNA HIS D 197 ? UNP P21505 ? ? 'expression tag' 197 22 
2 4UNA HIS D 198 ? UNP P21505 ? ? 'expression tag' 198 23 
2 4UNA HIS D 199 ? UNP P21505 ? ? 'expression tag' 199 24 
3 4UNA ALA G 1   ? UNP P21505 ? ? 'expression tag' 1   25 
3 4UNA ALA G 189 ? UNP P21505 ? ? 'expression tag' 189 26 
3 4UNA ALA G 190 ? UNP P21505 ? ? 'expression tag' 190 27 
3 4UNA ALA G 191 ? UNP P21505 ? ? 'expression tag' 191 28 
3 4UNA LEU G 192 ? UNP P21505 ? ? 'expression tag' 192 29 
3 4UNA GLU G 193 ? UNP P21505 ? ? 'expression tag' 193 30 
3 4UNA HIS G 194 ? UNP P21505 ? ? 'expression tag' 194 31 
3 4UNA HIS G 195 ? UNP P21505 ? ? 'expression tag' 195 32 
3 4UNA HIS G 196 ? UNP P21505 ? ? 'expression tag' 196 33 
3 4UNA HIS G 197 ? UNP P21505 ? ? 'expression tag' 197 34 
3 4UNA HIS G 198 ? UNP P21505 ? ? 'expression tag' 198 35 
3 4UNA HIS G 199 ? UNP P21505 ? ? 'expression tag' 199 36 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          4UNA 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.density_percent_sol   52 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'PH 6' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.65 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             1.65 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4UNA 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             46.28 
_reflns.d_resolution_high            2.30 
_reflns.number_obs                   261170 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.7 
_reflns.pdbx_Rmerge_I_obs            0.05 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        16.00 
_reflns.B_iso_Wilson_estimate        54.33 
_reflns.pdbx_redundancy              4.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.30 
_reflns_shell.d_res_low              2.42 
_reflns_shell.percent_possible_all   79.9 
_reflns_shell.Rmerge_I_obs           0.48 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.00 
_reflns_shell.pdbx_redundancy        3.0 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4UNA 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     113470 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.18 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.285 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    95.26 
_refine.ls_R_factor_obs                          0.1908 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1898 
_refine.ls_R_factor_R_free                       0.2191 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 3.4 
_refine.ls_number_reflns_R_free                  3841 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2VS7' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.31 
_refine.pdbx_overall_phase_error                 27.27 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4491 
_refine_hist.pdbx_number_atoms_nucleic_acid   3060 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             119 
_refine_hist.number_atoms_total               7679 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        46.285 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 8034  'X-RAY DIFFRACTION' ? 
f_angle_d          1.194  ? ? 11476 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 24.221 ? ? 3241  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.056  ? ? 1293  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 945   'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 2.3000 2.3291  2851 0.3325 66.00  0.3712 . . 89  . . 
'X-RAY DIFFRACTION' . 2.3291 2.3598  3114 0.3209 73.00  0.3563 . . 118 . . 
'X-RAY DIFFRACTION' . 2.3598 2.3921  3251 0.3068 77.00  0.3245 . . 108 . . 
'X-RAY DIFFRACTION' . 2.3921 2.4263  3622 0.3006 84.00  0.3356 . . 143 . . 
'X-RAY DIFFRACTION' . 2.4263 2.4625  3885 0.2911 91.00  0.3240 . . 140 . . 
'X-RAY DIFFRACTION' . 2.4625 2.5009  4201 0.2809 98.00  0.2908 . . 151 . . 
'X-RAY DIFFRACTION' . 2.5009 2.5419  4151 0.2696 99.00  0.3008 . . 152 . . 
'X-RAY DIFFRACTION' . 2.5419 2.5858  4230 0.2694 99.00  0.3419 . . 151 . . 
'X-RAY DIFFRACTION' . 2.5858 2.6328  4214 0.2510 99.00  0.2938 . . 138 . . 
'X-RAY DIFFRACTION' . 2.6328 2.6834  4210 0.2633 99.00  0.2945 . . 166 . . 
'X-RAY DIFFRACTION' . 2.6834 2.7382  4244 0.2485 99.00  0.3297 . . 134 . . 
'X-RAY DIFFRACTION' . 2.7382 2.7977  4269 0.2412 99.00  0.2894 . . 150 . . 
'X-RAY DIFFRACTION' . 2.7977 2.8628  4119 0.2339 99.00  0.2969 . . 148 . . 
'X-RAY DIFFRACTION' . 2.8628 2.9344  4245 0.2266 99.00  0.3022 . . 149 . . 
'X-RAY DIFFRACTION' . 2.9344 3.0137  4213 0.2263 99.00  0.2963 . . 132 . . 
'X-RAY DIFFRACTION' . 3.0137 3.1024  4269 0.2108 99.00  0.2767 . . 152 . . 
'X-RAY DIFFRACTION' . 3.1024 3.2025  4293 0.2018 99.00  0.2159 . . 151 . . 
'X-RAY DIFFRACTION' . 3.2025 3.3169  4144 0.1829 99.00  0.2524 . . 154 . . 
'X-RAY DIFFRACTION' . 3.3169 3.4497  4272 0.1804 99.00  0.2090 . . 164 . . 
'X-RAY DIFFRACTION' . 3.4497 3.6066  4132 0.1783 100.00 0.2137 . . 145 . . 
'X-RAY DIFFRACTION' . 3.6066 3.7967  4337 0.1840 100.00 0.2241 . . 122 . . 
'X-RAY DIFFRACTION' . 3.7967 4.0344  4167 0.1851 99.00  0.2163 . . 160 . . 
'X-RAY DIFFRACTION' . 4.0344 4.3457  4220 0.1622 99.00  0.2106 . . 136 . . 
'X-RAY DIFFRACTION' . 4.3457 4.7826  4271 0.1547 100.00 0.1880 . . 145 . . 
'X-RAY DIFFRACTION' . 4.7826 5.4737  4263 0.1580 99.00  0.1797 . . 152 . . 
'X-RAY DIFFRACTION' . 5.4737 6.8927  4162 0.1710 99.00  0.1276 . . 147 . . 
'X-RAY DIFFRACTION' . 6.8927 46.2943 4280 0.1549 99.00  0.1708 . . 144 . . 
# 
_struct.entry_id                  4UNA 
_struct.title                     
'THE CRYSTAL STRUCTURE OF I-DMOI IN COMPLEX WITH ITS TARGET DNA AT 2 DAYS INCUBATION IN 5MM MN (STATE 4)' 
_struct.pdbx_descriptor           'HOMING ENDONUCLEASE I-DMOI (E.C.3.1.-.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4UNA 
_struct_keywords.pdbx_keywords   HYDROLASE/DNA 
_struct_keywords.text            'HYDROLASE-DNA COMPLEX, CATALYSIS, PROTEIN-DNA INTERACTION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 1 ? 
E  N N 2 ? 
F  N N 3 ? 
G  N N 1 ? 
H  N N 2 ? 
I  N N 3 ? 
J  N N 4 ? 
K  N N 4 ? 
L  N N 4 ? 
M  N N 5 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 5 ? 
S  N N 5 ? 
T  N N 5 ? 
U  N N 5 ? 
V  N N 6 ? 
W  N N 6 ? 
X  N N 6 ? 
Y  N N 6 ? 
Z  N N 6 ? 
AA N N 6 ? 
BA N N 6 ? 
CA N N 6 ? 
DA N N 6 ? 
EA N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 4   ? ASP A 21  ? ASN A 4   ASP A 21  1 ? 18 
HELX_P HELX_P2  2  SER A 44  ? HIS A 51  ? SER A 44  HIS A 51  1 ? 8  
HELX_P HELX_P3  3  HIS A 51  ? LEU A 63  ? HIS A 51  LEU A 63  1 ? 13 
HELX_P HELX_P4  4  SER A 84  ? ARG A 97  ? SER A 84  ARG A 97  1 ? 14 
HELX_P HELX_P5  5  ILE A 98  ? PHE A 101 ? ILE A 98  PHE A 101 5 ? 4  
HELX_P HELX_P6  6  ASN A 102 ? GLY A 118 ? ASN A 102 GLY A 118 1 ? 17 
HELX_P HELX_P7  7  ASN A 131 ? ASN A 144 ? ASN A 131 ASN A 144 1 ? 14 
HELX_P HELX_P8  8  ASP A 169 ? ILE A 177 ? ASP A 169 ILE A 177 1 ? 9  
HELX_P HELX_P9  9  GLU D 5   ? ASP D 21  ? GLU D 5   ASP D 21  1 ? 17 
HELX_P HELX_P10 10 SER D 44  ? HIS D 51  ? SER D 44  HIS D 51  1 ? 8  
HELX_P HELX_P11 11 HIS D 51  ? LEU D 63  ? HIS D 51  LEU D 63  1 ? 13 
HELX_P HELX_P12 12 SER D 84  ? ARG D 97  ? SER D 84  ARG D 97  1 ? 14 
HELX_P HELX_P13 13 ILE D 98  ? PHE D 101 ? ILE D 98  PHE D 101 5 ? 4  
HELX_P HELX_P14 14 ASN D 102 ? GLY D 118 ? ASN D 102 GLY D 118 1 ? 17 
HELX_P HELX_P15 15 ASN D 131 ? LEU D 145 ? ASN D 131 LEU D 145 1 ? 15 
HELX_P HELX_P16 16 ASP D 169 ? ILE D 177 ? ASP D 169 ILE D 177 1 ? 9  
HELX_P HELX_P17 17 ASN G 4   ? ASP G 21  ? ASN G 4   ASP G 21  1 ? 18 
HELX_P HELX_P18 18 SER G 44  ? HIS G 51  ? SER G 44  HIS G 51  1 ? 8  
HELX_P HELX_P19 19 HIS G 51  ? LEU G 63  ? HIS G 51  LEU G 63  1 ? 13 
HELX_P HELX_P20 20 SER G 84  ? ARG G 97  ? SER G 84  ARG G 97  1 ? 14 
HELX_P HELX_P21 21 ILE G 98  ? PHE G 101 ? ILE G 98  PHE G 101 5 ? 4  
HELX_P HELX_P22 22 ASN G 102 ? GLY G 118 ? ASN G 102 GLY G 118 1 ? 17 
HELX_P HELX_P23 23 ASN G 131 ? LEU G 145 ? ASN G 131 LEU G 145 1 ? 15 
HELX_P HELX_P24 24 ASP G 169 ? ILE G 177 ? ASP G 169 ILE G 177 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? M MN .  MN ? ? ? 1_555 A  ASP 21  OD2   ? ? A MN 1188 A ASP 21   1_555 ? ? ? ? ? ? ?            2.229 ? 
metalc2   metalc ? ? M MN .  MN ? ? ? 1_555 A  ALA 116 O     ? ? A MN 1188 A ALA 116  1_555 ? ? ? ? ? ? ?            2.303 ? 
metalc3   metalc ? ? M MN .  MN ? ? ? 1_555 V  HOH .   O     ? ? A MN 1188 A HOH 2003 1_555 ? ? ? ? ? ? ?            2.124 ? 
metalc4   metalc ? ? M MN .  MN ? ? ? 1_555 J  DC  1   OP2   ? ? A MN 1188 K DC  16   1_555 ? ? ? ? ? ? ?            2.679 ? 
metalc5   metalc ? ? M MN .  MN ? ? ? 1_555 J  DC  1   OP3   ? ? A MN 1188 K DC  16   1_555 ? ? ? ? ? ? ?            2.124 ? 
metalc6   metalc ? ? M MN .  MN ? ? ? 1_555 B  DA  14  OP1   ? ? A MN 1188 B DA  14   1_555 ? ? ? ? ? ? ?            2.030 ? 
metalc7   metalc ? ? N MN .  MN ? ? ? 1_555 A  GLU 117 OE2   ? ? A MN 1189 A GLU 117  1_555 ? ? ? ? ? ? ?            2.166 ? 
metalc8   metalc ? ? N MN .  MN ? ? ? 1_555 C  DC  15  OP1   ? ? A MN 1189 C DC  15   1_555 ? ? ? ? ? ? ?            2.073 ? 
metalc9   metalc ? ? N MN .  MN ? ? ? 1_555 V  HOH .   O     ? ? A MN 1189 A HOH 2002 1_555 ? ? ? ? ? ? ?            2.352 ? 
metalc10  metalc ? ? N MN .  MN ? ? ? 1_555 A  GLY 20  O     ? ? A MN 1189 A GLY 20   1_555 ? ? ? ? ? ? ?            2.337 ? 
metalc11  metalc ? ? N MN .  MN ? ? ? 1_555 B  DG  15  OP2   ? ? A MN 1189 B DG  15   1_555 ? ? ? ? ? ? ?            2.414 ? 
metalc12  metalc ? ? O MN .  MN ? ? ? 1_555 A  ASP 21  OD1   ? ? A MN 1190 A ASP 21   1_555 ? ? ? ? ? ? ?            2.295 ? 
metalc13  metalc ? ? O MN .  MN ? ? ? 1_555 A  GLU 117 OE1   ? ? A MN 1190 A GLU 117  1_555 ? ? ? ? ? ? ?            2.388 ? 
metalc14  metalc ? ? O MN .  MN ? ? ? 1_555 B  DA  14  "O3'" ? ? A MN 1190 B DA  14   1_555 ? ? ? ? ? ? ?            2.784 ? 
metalc15  metalc ? ? O MN .  MN ? ? ? 1_555 B  DG  15  OP2   ? ? A MN 1190 B DG  15   1_555 ? ? ? ? ? ? ?            2.099 ? 
metalc16  metalc ? ? O MN .  MN ? ? ? 1_555 C  DC  15  "O3'" ? ? A MN 1190 C DC  15   1_555 ? ? ? ? ? ? ?            2.601 ? 
metalc17  metalc ? ? O MN .  MN ? ? ? 1_555 J  DC  1   OP3   ? ? A MN 1190 K DC  16   1_555 ? ? ? ? ? ? ?            2.406 ? 
metalc18  metalc ? ? P MN .  MN ? ? ? 1_555 D  GLU 117 OE2   ? ? D MN 1189 D GLU 117  1_555 ? ? ? ? ? ? ?            1.946 ? 
metalc19  metalc ? ? P MN .  MN ? ? ? 1_555 Y  HOH .   O     ? ? D MN 1189 D HOH 2002 1_555 ? ? ? ? ? ? ?            2.352 ? 
metalc20  metalc ? ? P MN .  MN ? ? ? 1_555 D  GLY 20  O     ? ? D MN 1189 D GLY 20   1_555 ? ? ? ? ? ? ?            2.300 ? 
metalc21  metalc ? ? P MN .  MN ? ? ? 1_555 E  DG  15  OP2   ? ? D MN 1189 E DG  15   1_555 ? ? ? ? ? ? ?            2.225 ? 
metalc22  metalc ? ? P MN .  MN ? ? ? 1_555 F  DC  15  OP1   ? ? D MN 1189 F DC  15   1_555 ? ? ? ? ? ? ?            2.128 ? 
metalc23  metalc ? ? P MN .  MN ? ? ? 1_555 Y  HOH .   O     ? ? D MN 1189 D HOH 2003 1_555 ? ? ? ? ? ? ?            2.143 ? 
metalc24  metalc ? ? Q MN .  MN ? ? ? 1_555 D  ASP 21  OD2   ? ? D MN 1190 D ASP 21   1_555 ? ? ? ? ? ? ?            2.242 ? 
metalc25  metalc ? ? Q MN .  MN ? ? ? 1_555 D  ALA 116 O     ? ? D MN 1190 D ALA 116  1_555 ? ? ? ? ? ? ?            2.360 ? 
metalc26  metalc ? ? Q MN .  MN ? ? ? 1_555 E  DA  14  OP1   ? ? D MN 1190 E DA  14   1_555 ? ? ? ? ? ? ?            2.092 ? 
metalc27  metalc ? ? Q MN .  MN ? ? ? 1_555 K  DC  1   OP3   ? ? D MN 1190 M DC  16   1_555 ? ? ? ? ? ? ?            2.296 ? 
metalc28  metalc ? ? Q MN .  MN ? ? ? 1_555 K  DC  1   OP2   ? ? D MN 1190 M DC  16   1_555 ? ? ? ? ? ? ?            2.297 ? 
metalc29  metalc ? ? Q MN .  MN ? ? ? 1_555 Y  HOH .   O     ? ? D MN 1190 D HOH 2004 1_555 ? ? ? ? ? ? ?            1.873 ? 
metalc30  metalc ? ? R MN .  MN ? ? ? 1_555 K  DC  1   OP2   ? ? D MN 1191 M DC  16   1_555 ? ? ? ? ? ? ?            2.110 ? 
metalc31  metalc ? ? R MN .  MN ? ? ? 1_555 D  ASP 21  OD1   ? ? D MN 1191 D ASP 21   1_555 ? ? ? ? ? ? ?            2.236 ? 
metalc32  metalc ? ? R MN .  MN ? ? ? 1_555 D  GLU 117 OE1   ? ? D MN 1191 D GLU 117  1_555 ? ? ? ? ? ? ?            2.195 ? 
metalc33  metalc ? ? R MN .  MN ? ? ? 1_555 E  DA  14  "O3'" ? ? D MN 1191 E DA  14   1_555 ? ? ? ? ? ? ?            2.702 ? 
metalc34  metalc ? ? R MN .  MN ? ? ? 1_555 E  DG  15  OP2   ? ? D MN 1191 E DG  15   1_555 ? ? ? ? ? ? ?            2.310 ? 
metalc35  metalc ? ? R MN .  MN ? ? ? 1_555 F  DC  15  "O3'" ? ? D MN 1191 F DC  15   1_555 ? ? ? ? ? ? ?            2.430 ? 
metalc36  metalc ? ? S MN .  MN ? ? ? 1_555 H  DA  14  OP1   ? ? G MN 1180 H DA  14   1_555 ? ? ? ? ? ? ?            2.035 ? 
metalc37  metalc ? ? S MN .  MN ? ? ? 1_555 G  ALA 116 O     ? ? G MN 1180 G ALA 116  1_555 ? ? ? ? ? ? ?            2.203 ? 
metalc38  metalc ? ? S MN .  MN ? ? ? 1_555 L  DC  1   OP3   ? ? G MN 1180 O DC  16   1_555 ? ? ? ? ? ? ?            2.089 ? 
metalc39  metalc ? ? S MN .  MN ? ? ? 1_555 L  DC  1   OP2   ? ? G MN 1180 O DC  16   1_555 ? ? ? ? ? ? ?            2.557 ? 
metalc40  metalc ? ? S MN .  MN ? ? ? 1_555 BA HOH .   O     ? ? G MN 1180 G HOH 2002 1_555 ? ? ? ? ? ? ?            2.220 ? 
metalc41  metalc ? ? S MN .  MN ? ? ? 1_555 G  ASP 21  OD2   ? ? G MN 1180 G ASP 21   1_555 ? ? ? ? ? ? ?            2.430 ? 
metalc42  metalc ? ? T MN .  MN ? ? ? 1_555 BA HOH .   O     ? ? G MN 1181 G HOH 2030 1_555 ? ? ? ? ? ? ?            2.778 ? 
metalc43  metalc ? ? T MN .  MN ? ? ? 1_555 G  GLY 20  O     ? ? G MN 1181 G GLY 20   1_555 ? ? ? ? ? ? ?            2.361 ? 
metalc44  metalc ? ? T MN .  MN ? ? ? 1_555 G  GLU 117 OE2   ? ? G MN 1181 G GLU 117  1_555 ? ? ? ? ? ? ?            1.796 ? 
metalc45  metalc ? ? T MN .  MN ? ? ? 1_555 I  DC  15  OP1   ? ? G MN 1181 I DC  15   1_555 ? ? ? ? ? ? ?            2.030 ? 
metalc46  metalc ? ? T MN .  MN ? ? ? 1_555 BA HOH .   O     ? ? G MN 1181 G HOH 2001 1_555 ? ? ? ? ? ? ?            2.397 ? 
metalc47  metalc ? ? T MN .  MN ? ? ? 1_555 H  DG  15  OP2   ? ? G MN 1181 H DG  15   1_555 ? ? ? ? ? ? ?            2.083 ? 
metalc48  metalc ? ? U MN .  MN ? ? ? 1_555 L  DC  1   OP3   ? ? G MN 1182 O DC  16   1_555 ? ? ? ? ? ? ?            2.568 ? 
metalc49  metalc ? ? U MN .  MN ? ? ? 1_555 G  ASP 21  OD1   ? ? G MN 1182 G ASP 21   1_555 ? ? ? ? ? ? ?            2.583 ? 
metalc50  metalc ? ? U MN .  MN ? ? ? 1_555 I  DC  15  "O3'" ? ? G MN 1182 I DC  15   1_555 ? ? ? ? ? ? ?            2.731 ? 
metalc51  metalc ? ? U MN .  MN ? ? ? 1_555 H  DA  14  "O3'" ? ? G MN 1182 H DA  14   1_555 ? ? ? ? ? ? ?            2.573 ? 
hydrog1   hydrog ? ? B DG 1  N1 ? ? ? 1_555 J  DC  10  N3    ? ? B DG 1    K DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2   hydrog ? ? B DG 1  N2 ? ? ? 1_555 J  DC  10  O2    ? ? B DG 1    K DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3   hydrog ? ? B DG 1  O6 ? ? ? 1_555 J  DC  10  N4    ? ? B DG 1    K DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4   hydrog ? ? B DC 2  N3 ? ? ? 1_555 J  DG  9   N1    ? ? B DC 2    K DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5   hydrog ? ? B DC 2  N4 ? ? ? 1_555 J  DG  9   O6    ? ? B DC 2    K DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6   hydrog ? ? B DC 2  O2 ? ? ? 1_555 J  DG  9   N2    ? ? B DC 2    K DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7   hydrog ? ? B DC 3  N3 ? ? ? 1_555 J  DG  8   N1    ? ? B DC 3    K DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8   hydrog ? ? B DC 3  N4 ? ? ? 1_555 J  DG  8   O6    ? ? B DC 3    K DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9   hydrog ? ? B DC 3  O2 ? ? ? 1_555 J  DG  8   N2    ? ? B DC 3    K DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10  hydrog ? ? B DT 4  N3 ? ? ? 1_555 J  DA  7   N1    ? ? B DT 4    K DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11  hydrog ? ? B DT 4  O4 ? ? ? 1_555 J  DA  7   N6    ? ? B DT 4    K DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12  hydrog ? ? B DT 5  N3 ? ? ? 1_555 J  DA  6   N1    ? ? B DT 5    K DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13  hydrog ? ? B DT 5  O4 ? ? ? 1_555 J  DA  6   N6    ? ? B DT 5    K DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14  hydrog ? ? B DG 6  N1 ? ? ? 1_555 J  DC  5   N3    ? ? B DG 6    K DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15  hydrog ? ? B DG 6  N2 ? ? ? 1_555 J  DC  5   O2    ? ? B DG 6    K DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16  hydrog ? ? B DG 6  O6 ? ? ? 1_555 J  DC  5   N4    ? ? B DG 6    K DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17  hydrog ? ? B DC 7  N3 ? ? ? 1_555 J  DG  4   N1    ? ? B DC 7    K DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18  hydrog ? ? B DC 7  N4 ? ? ? 1_555 J  DG  4   O6    ? ? B DC 7    K DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19  hydrog ? ? B DC 7  O2 ? ? ? 1_555 J  DG  4   N2    ? ? B DC 7    K DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20  hydrog ? ? B DC 8  N3 ? ? ? 1_555 J  DG  3   N1    ? ? B DC 8    K DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21  hydrog ? ? B DC 8  N4 ? ? ? 1_555 J  DG  3   O6    ? ? B DC 8    K DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22  hydrog ? ? B DC 8  O2 ? ? ? 1_555 J  DG  3   N2    ? ? B DC 8    K DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23  hydrog ? ? B DG 9  N1 ? ? ? 1_555 J  DC  2   N3    ? ? B DG 9    K DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24  hydrog ? ? B DG 9  N2 ? ? ? 1_555 J  DC  2   O2    ? ? B DG 9    K DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25  hydrog ? ? B DG 9  O6 ? ? ? 1_555 J  DC  2   N4    ? ? B DG 9    K DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26  hydrog ? ? B DG 10 N1 ? ? ? 1_555 J  DC  1   N3    ? ? B DG 10   K DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27  hydrog ? ? B DG 10 N2 ? ? ? 1_555 J  DC  1   O2    ? ? B DG 10   K DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28  hydrog ? ? B DG 10 O6 ? ? ? 1_555 J  DC  1   N4    ? ? B DG 10   K DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29  hydrog ? ? B DG 11 N1 ? ? ? 1_555 C  DC  15  N3    ? ? B DG 11   C DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30  hydrog ? ? B DG 11 N2 ? ? ? 1_555 C  DC  15  O2    ? ? B DG 11   C DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31  hydrog ? ? B DG 11 O6 ? ? ? 1_555 C  DC  15  N4    ? ? B DG 11   C DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32  hydrog ? ? B DT 12 N3 ? ? ? 1_555 C  DA  14  N1    ? ? B DT 12   C DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33  hydrog ? ? B DT 12 O4 ? ? ? 1_555 C  DA  14  N6    ? ? B DT 12   C DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34  hydrog ? ? B DA 13 N1 ? ? ? 1_555 C  DT  13  N3    ? ? B DA 13   C DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35  hydrog ? ? B DA 13 N6 ? ? ? 1_555 C  DT  13  O4    ? ? B DA 13   C DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36  hydrog ? ? B DA 14 N1 ? ? ? 1_555 C  DT  12  N3    ? ? B DA 14   C DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37  hydrog ? ? B DA 14 N6 ? ? ? 1_555 C  DT  12  O4    ? ? B DA 14   C DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38  hydrog ? ? B DG 15 N1 ? ? ? 1_555 C  DC  11  N3    ? ? B DG 15   C DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39  hydrog ? ? B DG 15 N2 ? ? ? 1_555 C  DC  11  O2    ? ? B DG 15   C DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40  hydrog ? ? B DG 15 O6 ? ? ? 1_555 C  DC  11  N4    ? ? B DG 15   C DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41  hydrog ? ? B DT 16 N3 ? ? ? 1_555 C  DA  10  N1    ? ? B DT 16   C DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42  hydrog ? ? B DT 16 O4 ? ? ? 1_555 C  DA  10  N6    ? ? B DT 16   C DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43  hydrog ? ? B DT 17 N3 ? ? ? 1_555 C  DA  9   N1    ? ? B DT 17   C DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44  hydrog ? ? B DT 17 O4 ? ? ? 1_555 C  DA  9   N6    ? ? B DT 17   C DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45  hydrog ? ? B DC 18 N3 ? ? ? 1_555 C  DG  8   N1    ? ? B DC 18   C DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46  hydrog ? ? B DC 18 N4 ? ? ? 1_555 C  DG  8   O6    ? ? B DC 18   C DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47  hydrog ? ? B DC 18 O2 ? ? ? 1_555 C  DG  8   N2    ? ? B DC 18   C DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48  hydrog ? ? B DC 19 N3 ? ? ? 1_555 C  DG  7   N1    ? ? B DC 19   C DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49  hydrog ? ? B DC 19 N4 ? ? ? 1_555 C  DG  7   O6    ? ? B DC 19   C DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50  hydrog ? ? B DC 19 O2 ? ? ? 1_555 C  DG  7   N2    ? ? B DC 19   C DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51  hydrog ? ? B DG 20 N1 ? ? ? 1_555 C  DC  6   N3    ? ? B DG 20   C DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog52  hydrog ? ? B DG 20 N2 ? ? ? 1_555 C  DC  6   O2    ? ? B DG 20   C DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog53  hydrog ? ? B DG 20 O6 ? ? ? 1_555 C  DC  6   N4    ? ? B DG 20   C DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog54  hydrog ? ? B DG 21 N1 ? ? ? 1_555 C  DC  5   N3    ? ? B DG 21   C DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog55  hydrog ? ? B DG 21 N2 ? ? ? 1_555 C  DC  5   O2    ? ? B DG 21   C DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog56  hydrog ? ? B DG 21 O6 ? ? ? 1_555 C  DC  5   N4    ? ? B DG 21   C DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog57  hydrog ? ? B DC 22 N3 ? ? ? 1_555 C  DG  4   N1    ? ? B DC 22   C DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog58  hydrog ? ? B DC 22 N4 ? ? ? 1_555 C  DG  4   O6    ? ? B DC 22   C DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog59  hydrog ? ? B DC 22 O2 ? ? ? 1_555 C  DG  4   N2    ? ? B DC 22   C DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog60  hydrog ? ? B DG 23 N1 ? ? ? 1_555 C  DC  3   N3    ? ? B DG 23   C DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog61  hydrog ? ? B DG 23 N2 ? ? ? 1_555 C  DC  3   O2    ? ? B DG 23   C DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog62  hydrog ? ? B DG 23 O6 ? ? ? 1_555 C  DC  3   N4    ? ? B DG 23   C DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog63  hydrog ? ? B DC 24 N3 ? ? ? 1_555 C  DG  2   N1    ? ? B DC 24   C DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog64  hydrog ? ? B DC 24 N4 ? ? ? 1_555 C  DG  2   O6    ? ? B DC 24   C DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog65  hydrog ? ? B DC 24 O2 ? ? ? 1_555 C  DG  2   N2    ? ? B DC 24   C DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog66  hydrog ? ? B DG 25 N1 ? ? ? 1_555 C  DC  1   N3    ? ? B DG 25   C DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog67  hydrog ? ? B DG 25 N2 ? ? ? 1_555 C  DC  1   O2    ? ? B DG 25   C DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog68  hydrog ? ? B DG 25 O6 ? ? ? 1_555 C  DC  1   N4    ? ? B DG 25   C DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog69  hydrog ? ? E DG 1  N1 ? ? ? 1_555 K  DC  10  N3    ? ? E DG 1    M DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog70  hydrog ? ? E DG 1  N2 ? ? ? 1_555 K  DC  10  O2    ? ? E DG 1    M DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog71  hydrog ? ? E DG 1  O6 ? ? ? 1_555 K  DC  10  N4    ? ? E DG 1    M DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog72  hydrog ? ? E DC 2  N3 ? ? ? 1_555 K  DG  9   N1    ? ? E DC 2    M DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog73  hydrog ? ? E DC 2  N4 ? ? ? 1_555 K  DG  9   O6    ? ? E DC 2    M DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog74  hydrog ? ? E DC 2  O2 ? ? ? 1_555 K  DG  9   N2    ? ? E DC 2    M DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog75  hydrog ? ? E DC 3  N3 ? ? ? 1_555 K  DG  8   N1    ? ? E DC 3    M DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog76  hydrog ? ? E DC 3  N4 ? ? ? 1_555 K  DG  8   O6    ? ? E DC 3    M DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog77  hydrog ? ? E DC 3  O2 ? ? ? 1_555 K  DG  8   N2    ? ? E DC 3    M DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog78  hydrog ? ? E DT 4  N3 ? ? ? 1_555 K  DA  7   N1    ? ? E DT 4    M DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog79  hydrog ? ? E DT 4  O4 ? ? ? 1_555 K  DA  7   N6    ? ? E DT 4    M DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog80  hydrog ? ? E DT 5  N3 ? ? ? 1_555 K  DA  6   N1    ? ? E DT 5    M DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog81  hydrog ? ? E DT 5  O4 ? ? ? 1_555 K  DA  6   N6    ? ? E DT 5    M DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog82  hydrog ? ? E DG 6  N1 ? ? ? 1_555 K  DC  5   N3    ? ? E DG 6    M DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog83  hydrog ? ? E DG 6  N2 ? ? ? 1_555 K  DC  5   O2    ? ? E DG 6    M DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog84  hydrog ? ? E DG 6  O6 ? ? ? 1_555 K  DC  5   N4    ? ? E DG 6    M DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog85  hydrog ? ? E DC 7  N3 ? ? ? 1_555 K  DG  4   N1    ? ? E DC 7    M DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog86  hydrog ? ? E DC 7  N4 ? ? ? 1_555 K  DG  4   O6    ? ? E DC 7    M DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog87  hydrog ? ? E DC 7  O2 ? ? ? 1_555 K  DG  4   N2    ? ? E DC 7    M DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog88  hydrog ? ? E DC 8  N3 ? ? ? 1_555 K  DG  3   N1    ? ? E DC 8    M DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog89  hydrog ? ? E DC 8  N4 ? ? ? 1_555 K  DG  3   O6    ? ? E DC 8    M DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog90  hydrog ? ? E DC 8  O2 ? ? ? 1_555 K  DG  3   N2    ? ? E DC 8    M DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog91  hydrog ? ? E DG 9  N1 ? ? ? 1_555 K  DC  2   N3    ? ? E DG 9    M DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog92  hydrog ? ? E DG 9  N2 ? ? ? 1_555 K  DC  2   O2    ? ? E DG 9    M DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog93  hydrog ? ? E DG 9  O6 ? ? ? 1_555 K  DC  2   N4    ? ? E DG 9    M DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog94  hydrog ? ? E DG 10 N1 ? ? ? 1_555 K  DC  1   N3    ? ? E DG 10   M DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog95  hydrog ? ? E DG 10 N2 ? ? ? 1_555 K  DC  1   O2    ? ? E DG 10   M DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog96  hydrog ? ? E DG 10 O6 ? ? ? 1_555 K  DC  1   N4    ? ? E DG 10   M DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog97  hydrog ? ? E DG 11 N1 ? ? ? 1_555 F  DC  15  N3    ? ? E DG 11   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog98  hydrog ? ? E DG 11 N2 ? ? ? 1_555 F  DC  15  O2    ? ? E DG 11   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog99  hydrog ? ? E DG 11 O6 ? ? ? 1_555 F  DC  15  N4    ? ? E DG 11   F DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog100 hydrog ? ? E DT 12 N3 ? ? ? 1_555 F  DA  14  N1    ? ? E DT 12   F DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog101 hydrog ? ? E DT 12 O4 ? ? ? 1_555 F  DA  14  N6    ? ? E DT 12   F DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog102 hydrog ? ? E DA 13 N1 ? ? ? 1_555 F  DT  13  N3    ? ? E DA 13   F DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog103 hydrog ? ? E DA 13 N6 ? ? ? 1_555 F  DT  13  O4    ? ? E DA 13   F DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog104 hydrog ? ? E DA 14 N1 ? ? ? 1_555 F  DT  12  N3    ? ? E DA 14   F DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog105 hydrog ? ? E DA 14 N6 ? ? ? 1_555 F  DT  12  O4    ? ? E DA 14   F DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog106 hydrog ? ? E DG 15 N1 ? ? ? 1_555 F  DC  11  N3    ? ? E DG 15   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog107 hydrog ? ? E DG 15 N2 ? ? ? 1_555 F  DC  11  O2    ? ? E DG 15   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog108 hydrog ? ? E DG 15 O6 ? ? ? 1_555 F  DC  11  N4    ? ? E DG 15   F DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog109 hydrog ? ? E DT 16 N3 ? ? ? 1_555 F  DA  10  N1    ? ? E DT 16   F DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog110 hydrog ? ? E DT 16 O4 ? ? ? 1_555 F  DA  10  N6    ? ? E DT 16   F DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog111 hydrog ? ? E DT 17 N3 ? ? ? 1_555 F  DA  9   N1    ? ? E DT 17   F DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog112 hydrog ? ? E DT 17 O4 ? ? ? 1_555 F  DA  9   N6    ? ? E DT 17   F DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog113 hydrog ? ? E DC 18 N3 ? ? ? 1_555 F  DG  8   N1    ? ? E DC 18   F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog114 hydrog ? ? E DC 18 N4 ? ? ? 1_555 F  DG  8   O6    ? ? E DC 18   F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog115 hydrog ? ? E DC 18 O2 ? ? ? 1_555 F  DG  8   N2    ? ? E DC 18   F DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog116 hydrog ? ? E DC 19 N3 ? ? ? 1_555 F  DG  7   N1    ? ? E DC 19   F DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog117 hydrog ? ? E DC 19 N4 ? ? ? 1_555 F  DG  7   O6    ? ? E DC 19   F DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog118 hydrog ? ? E DC 19 O2 ? ? ? 1_555 F  DG  7   N2    ? ? E DC 19   F DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog119 hydrog ? ? E DG 20 N1 ? ? ? 1_555 F  DC  6   N3    ? ? E DG 20   F DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog120 hydrog ? ? E DG 20 N2 ? ? ? 1_555 F  DC  6   O2    ? ? E DG 20   F DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog121 hydrog ? ? E DG 20 O6 ? ? ? 1_555 F  DC  6   N4    ? ? E DG 20   F DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog122 hydrog ? ? E DG 21 N1 ? ? ? 1_555 F  DC  5   N3    ? ? E DG 21   F DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog123 hydrog ? ? E DG 21 N2 ? ? ? 1_555 F  DC  5   O2    ? ? E DG 21   F DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog124 hydrog ? ? E DG 21 O6 ? ? ? 1_555 F  DC  5   N4    ? ? E DG 21   F DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog125 hydrog ? ? E DC 22 N3 ? ? ? 1_555 F  DG  4   N1    ? ? E DC 22   F DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog126 hydrog ? ? E DC 22 N4 ? ? ? 1_555 F  DG  4   O6    ? ? E DC 22   F DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog127 hydrog ? ? E DC 22 O2 ? ? ? 1_555 F  DG  4   N2    ? ? E DC 22   F DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog128 hydrog ? ? E DG 23 N1 ? ? ? 1_555 F  DC  3   N3    ? ? E DG 23   F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog129 hydrog ? ? E DG 23 N2 ? ? ? 1_555 F  DC  3   O2    ? ? E DG 23   F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog130 hydrog ? ? E DG 23 O6 ? ? ? 1_555 F  DC  3   N4    ? ? E DG 23   F DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog131 hydrog ? ? E DC 24 N3 ? ? ? 1_555 F  DG  2   N1    ? ? E DC 24   F DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog132 hydrog ? ? E DC 24 N4 ? ? ? 1_555 F  DG  2   O6    ? ? E DC 24   F DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog133 hydrog ? ? E DC 24 O2 ? ? ? 1_555 F  DG  2   N2    ? ? E DC 24   F DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog134 hydrog ? ? E DG 25 N1 ? ? ? 1_555 F  DC  1   N3    ? ? E DG 25   F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog135 hydrog ? ? E DG 25 N2 ? ? ? 1_555 F  DC  1   O2    ? ? E DG 25   F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog136 hydrog ? ? E DG 25 O6 ? ? ? 1_555 F  DC  1   N4    ? ? E DG 25   F DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog137 hydrog ? ? H DG 1  N1 ? ? ? 1_555 L  DC  10  N3    ? ? H DG 1    O DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog138 hydrog ? ? H DG 1  N2 ? ? ? 1_555 L  DC  10  O2    ? ? H DG 1    O DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog139 hydrog ? ? H DG 1  O6 ? ? ? 1_555 L  DC  10  N4    ? ? H DG 1    O DC  25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog140 hydrog ? ? H DC 2  N3 ? ? ? 1_555 L  DG  9   N1    ? ? H DC 2    O DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog141 hydrog ? ? H DC 2  N4 ? ? ? 1_555 L  DG  9   O6    ? ? H DC 2    O DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog142 hydrog ? ? H DC 2  O2 ? ? ? 1_555 L  DG  9   N2    ? ? H DC 2    O DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog143 hydrog ? ? H DC 3  N3 ? ? ? 1_555 L  DG  8   N1    ? ? H DC 3    O DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog144 hydrog ? ? H DC 3  N4 ? ? ? 1_555 L  DG  8   O6    ? ? H DC 3    O DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog145 hydrog ? ? H DC 3  O2 ? ? ? 1_555 L  DG  8   N2    ? ? H DC 3    O DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog146 hydrog ? ? H DT 4  N3 ? ? ? 1_555 L  DA  7   N1    ? ? H DT 4    O DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog147 hydrog ? ? H DT 4  O4 ? ? ? 1_555 L  DA  7   N6    ? ? H DT 4    O DA  22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog148 hydrog ? ? H DT 5  N3 ? ? ? 1_555 L  DA  6   N1    ? ? H DT 5    O DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog149 hydrog ? ? H DT 5  O4 ? ? ? 1_555 L  DA  6   N6    ? ? H DT 5    O DA  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog150 hydrog ? ? H DG 6  N1 ? ? ? 1_555 L  DC  5   N3    ? ? H DG 6    O DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog151 hydrog ? ? H DG 6  N2 ? ? ? 1_555 L  DC  5   O2    ? ? H DG 6    O DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog152 hydrog ? ? H DG 6  O6 ? ? ? 1_555 L  DC  5   N4    ? ? H DG 6    O DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog153 hydrog ? ? H DC 7  N3 ? ? ? 1_555 L  DG  4   N1    ? ? H DC 7    O DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog154 hydrog ? ? H DC 7  N4 ? ? ? 1_555 L  DG  4   O6    ? ? H DC 7    O DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog155 hydrog ? ? H DC 7  O2 ? ? ? 1_555 L  DG  4   N2    ? ? H DC 7    O DG  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog156 hydrog ? ? H DC 8  N3 ? ? ? 1_555 L  DG  3   N1    ? ? H DC 8    O DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog157 hydrog ? ? H DC 8  N4 ? ? ? 1_555 L  DG  3   O6    ? ? H DC 8    O DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog158 hydrog ? ? H DC 8  O2 ? ? ? 1_555 L  DG  3   N2    ? ? H DC 8    O DG  18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog159 hydrog ? ? H DG 9  N1 ? ? ? 1_555 L  DC  2   N3    ? ? H DG 9    O DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog160 hydrog ? ? H DG 9  N2 ? ? ? 1_555 L  DC  2   O2    ? ? H DG 9    O DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog161 hydrog ? ? H DG 9  O6 ? ? ? 1_555 L  DC  2   N4    ? ? H DG 9    O DC  17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog162 hydrog ? ? H DG 10 N1 ? ? ? 1_555 L  DC  1   N3    ? ? H DG 10   O DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog163 hydrog ? ? H DG 10 N2 ? ? ? 1_555 L  DC  1   O2    ? ? H DG 10   O DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog164 hydrog ? ? H DG 10 O6 ? ? ? 1_555 L  DC  1   N4    ? ? H DG 10   O DC  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog165 hydrog ? ? H DG 11 N1 ? ? ? 1_555 I  DC  15  N3    ? ? H DG 11   I DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog166 hydrog ? ? H DG 11 N2 ? ? ? 1_555 I  DC  15  O2    ? ? H DG 11   I DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog167 hydrog ? ? H DG 11 O6 ? ? ? 1_555 I  DC  15  N4    ? ? H DG 11   I DC  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog168 hydrog ? ? H DT 12 N3 ? ? ? 1_555 I  DA  14  N1    ? ? H DT 12   I DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog169 hydrog ? ? H DT 12 O4 ? ? ? 1_555 I  DA  14  N6    ? ? H DT 12   I DA  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog170 hydrog ? ? H DA 13 N1 ? ? ? 1_555 I  DT  13  N3    ? ? H DA 13   I DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog171 hydrog ? ? H DA 13 N6 ? ? ? 1_555 I  DT  13  O4    ? ? H DA 13   I DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog172 hydrog ? ? H DA 14 N1 ? ? ? 1_555 I  DT  12  N3    ? ? H DA 14   I DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog173 hydrog ? ? H DA 14 N6 ? ? ? 1_555 I  DT  12  O4    ? ? H DA 14   I DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog174 hydrog ? ? H DG 15 N1 ? ? ? 1_555 I  DC  11  N3    ? ? H DG 15   I DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog175 hydrog ? ? H DG 15 N2 ? ? ? 1_555 I  DC  11  O2    ? ? H DG 15   I DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog176 hydrog ? ? H DG 15 O6 ? ? ? 1_555 I  DC  11  N4    ? ? H DG 15   I DC  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog177 hydrog ? ? H DT 16 N3 ? ? ? 1_555 I  DA  10  N1    ? ? H DT 16   I DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog178 hydrog ? ? H DT 16 O4 ? ? ? 1_555 I  DA  10  N6    ? ? H DT 16   I DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog179 hydrog ? ? H DT 17 N3 ? ? ? 1_555 I  DA  9   N1    ? ? H DT 17   I DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog180 hydrog ? ? H DT 17 O4 ? ? ? 1_555 I  DA  9   N6    ? ? H DT 17   I DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog181 hydrog ? ? H DC 18 N3 ? ? ? 1_555 I  DG  8   N1    ? ? H DC 18   I DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog182 hydrog ? ? H DC 18 N4 ? ? ? 1_555 I  DG  8   O6    ? ? H DC 18   I DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog183 hydrog ? ? H DC 18 O2 ? ? ? 1_555 I  DG  8   N2    ? ? H DC 18   I DG  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog184 hydrog ? ? H DC 19 N3 ? ? ? 1_555 I  DG  7   N1    ? ? H DC 19   I DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog185 hydrog ? ? H DC 19 N4 ? ? ? 1_555 I  DG  7   O6    ? ? H DC 19   I DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog186 hydrog ? ? H DC 19 O2 ? ? ? 1_555 I  DG  7   N2    ? ? H DC 19   I DG  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog187 hydrog ? ? H DG 20 N1 ? ? ? 1_555 I  DC  6   N3    ? ? H DG 20   I DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog188 hydrog ? ? H DG 20 N2 ? ? ? 1_555 I  DC  6   O2    ? ? H DG 20   I DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog189 hydrog ? ? H DG 20 O6 ? ? ? 1_555 I  DC  6   N4    ? ? H DG 20   I DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog190 hydrog ? ? H DG 21 N1 ? ? ? 1_555 I  DC  5   N3    ? ? H DG 21   I DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog191 hydrog ? ? H DG 21 N2 ? ? ? 1_555 I  DC  5   O2    ? ? H DG 21   I DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog192 hydrog ? ? H DG 21 O6 ? ? ? 1_555 I  DC  5   N4    ? ? H DG 21   I DC  5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog193 hydrog ? ? H DC 22 N3 ? ? ? 1_555 I  DG  4   N1    ? ? H DC 22   I DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog194 hydrog ? ? H DC 22 N4 ? ? ? 1_555 I  DG  4   O6    ? ? H DC 22   I DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog195 hydrog ? ? H DC 22 O2 ? ? ? 1_555 I  DG  4   N2    ? ? H DC 22   I DG  4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog196 hydrog ? ? H DG 23 N1 ? ? ? 1_555 I  DC  3   N3    ? ? H DG 23   I DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog197 hydrog ? ? H DG 23 N2 ? ? ? 1_555 I  DC  3   O2    ? ? H DG 23   I DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog198 hydrog ? ? H DG 23 O6 ? ? ? 1_555 I  DC  3   N4    ? ? H DG 23   I DC  3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog199 hydrog ? ? H DC 24 N3 ? ? ? 1_555 I  DG  2   N1    ? ? H DC 24   I DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog200 hydrog ? ? H DC 24 N4 ? ? ? 1_555 I  DG  2   O6    ? ? H DC 24   I DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog201 hydrog ? ? H DC 24 O2 ? ? ? 1_555 I  DG  2   N2    ? ? H DC 24   I DG  2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog202 hydrog ? ? H DG 25 N1 ? ? ? 1_555 I  DC  1   N3    ? ? H DG 25   I DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog203 hydrog ? ? H DG 25 N2 ? ? ? 1_555 I  DC  1   O2    ? ? H DG 25   I DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog204 hydrog ? ? H DG 25 O6 ? ? ? 1_555 I  DC  1   N4    ? ? H DG 25   I DC  1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LYS 30 D . ? LYS 30 D GLY 31 D ? GLY 31 D 1 -4.59  
2 GLY 31 D . ? GLY 31 D ASN 32 D ? ASN 32 D 1 -19.49 
3 LYS 30 G . ? LYS 30 G GLY 31 G ? GLY 31 G 1 -13.25 
4 GLY 31 G . ? GLY 31 G ASN 32 G ? ASN 32 G 1 -17.69 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 3 ? 
DA ? 4 ? 
DB ? 3 ? 
GA ? 4 ? 
GB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
DA 1 2 ? anti-parallel 
DA 2 3 ? anti-parallel 
DA 3 4 ? anti-parallel 
DB 1 2 ? anti-parallel 
DB 2 3 ? anti-parallel 
GA 1 2 ? anti-parallel 
GA 2 3 ? anti-parallel 
GA 3 4 ? anti-parallel 
GB 1 2 ? anti-parallel 
GB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 GLY A 22  ? LYS A 28  ? GLY A 22  LYS A 28  
AA 2 SER A 34  ? GLN A 42  ? SER A 34  GLN A 42  
AA 3 TYR A 78  ? SER A 83  ? TYR A 78  SER A 83  
AA 4 ILE A 69  ? LYS A 73  ? ILE A 69  LYS A 73  
AB 1 LEU A 125 ? ASN A 129 ? LEU A 125 ASN A 129 
AB 2 VAL A 160 ? ILE A 165 ? VAL A 160 ILE A 165 
AB 3 ASN A 149 ? ASP A 155 ? ASN A 149 ASP A 155 
DA 1 GLY D 22  ? LYS D 28  ? GLY D 22  LYS D 28  
DA 2 SER D 34  ? GLN D 42  ? SER D 34  GLN D 42  
DA 3 TYR D 78  ? SER D 83  ? TYR D 78  SER D 83  
DA 4 ILE D 69  ? LYS D 73  ? ILE D 69  LYS D 73  
DB 1 LEU D 125 ? ASN D 129 ? LEU D 125 ASN D 129 
DB 2 VAL D 160 ? ILE D 165 ? VAL D 160 ILE D 165 
DB 3 ASN D 149 ? ASP D 155 ? ASN D 149 ASP D 155 
GA 1 GLY G 22  ? LYS G 28  ? GLY G 22  LYS G 28  
GA 2 SER G 34  ? GLN G 42  ? SER G 34  GLN G 42  
GA 3 TYR G 78  ? SER G 83  ? TYR G 78  SER G 83  
GA 4 ILE G 69  ? LYS G 73  ? ILE G 69  LYS G 73  
GB 1 LEU G 125 ? ASN G 129 ? LEU G 125 ASN G 129 
GB 2 VAL G 160 ? ILE G 165 ? VAL G 160 ILE G 165 
GB 3 ASN G 149 ? ASP G 155 ? ASN G 149 ASP G 155 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 27  ? N LEU A 27  O GLU A 35  ? O GLU A 35  
AA 2 3 N GLN A 42  ? N GLN A 42  O TYR A 78  ? O TYR A 78  
AA 3 4 N ARG A 81  ? N ARG A 81  O GLN A 70  ? O GLN A 70  
AB 1 2 N ASN A 129 ? N ASN A 129 O TYR A 161 ? O TYR A 161 
AB 2 3 N ASN A 164 ? N ASN A 164 O THR A 150 ? O THR A 150 
DA 1 2 N LEU D 27  ? N LEU D 27  O GLU D 35  ? O GLU D 35  
DA 2 3 N GLN D 42  ? N GLN D 42  O TYR D 78  ? O TYR D 78  
DA 3 4 N ARG D 81  ? N ARG D 81  O GLN D 70  ? O GLN D 70  
DB 1 2 N ASN D 129 ? N ASN D 129 O TYR D 161 ? O TYR D 161 
DB 2 3 N ASN D 164 ? N ASN D 164 O THR D 150 ? O THR D 150 
GA 1 2 N LEU G 27  ? N LEU G 27  O GLU G 35  ? O GLU G 35  
GA 2 3 N GLN G 42  ? N GLN G 42  O TYR G 78  ? O TYR G 78  
GA 3 4 N ARG G 81  ? N ARG G 81  O GLN G 70  ? O GLN G 70  
GB 1 2 N ASN G 129 ? N ASN G 129 O TYR G 161 ? O TYR G 161 
GB 2 3 N ASN G 164 ? N ASN G 164 O THR G 150 ? O THR G 150 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN A 1188' 
AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN A 1189' 
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MN D 1189' 
AC4 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE MN D 1190' 
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN G 1180' 
AC6 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MN G 1181' 
AC7 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN D 1191' 
AC8 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MN A 1190' 
AC9 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE MN G 1182' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A  21  ? ASP A 21   . ? 1_555 ? 
2  AC1 6 ALA A  116 ? ALA A 116  . ? 1_555 ? 
3  AC1 6 LYS A  120 ? LYS A 120  . ? 1_555 ? 
4  AC1 6 HOH V  .   ? HOH A 2003 . ? 1_555 ? 
5  AC1 6 DA  B  14  ? DA  B 14   . ? 1_555 ? 
6  AC1 6 DC  J  1   ? DC  K 16   . ? 1_555 ? 
7  AC2 6 GLY A  20  ? GLY A 20   . ? 1_555 ? 
8  AC2 6 GLU A  117 ? GLU A 117  . ? 1_555 ? 
9  AC2 6 HOH V  .   ? HOH A 2002 . ? 1_555 ? 
10 AC2 6 HOH V  .   ? HOH A 2035 . ? 1_555 ? 
11 AC2 6 DG  B  15  ? DG  B 15   . ? 1_555 ? 
12 AC2 6 DC  C  15  ? DC  C 15   . ? 1_555 ? 
13 AC3 7 GLY D  20  ? GLY D 20   . ? 1_555 ? 
14 AC3 7 GLU D  117 ? GLU D 117  . ? 1_555 ? 
15 AC3 7 ASN D  129 ? ASN D 129  . ? 1_555 ? 
16 AC3 7 HOH Y  .   ? HOH D 2002 . ? 1_555 ? 
17 AC3 7 HOH Y  .   ? HOH D 2003 . ? 1_555 ? 
18 AC3 7 DG  E  15  ? DG  E 15   . ? 1_555 ? 
19 AC3 7 DC  F  15  ? DC  F 15   . ? 1_555 ? 
20 AC4 5 ASP D  21  ? ASP D 21   . ? 1_555 ? 
21 AC4 5 ALA D  116 ? ALA D 116  . ? 1_555 ? 
22 AC4 5 HOH Y  .   ? HOH D 2004 . ? 1_555 ? 
23 AC4 5 DA  E  14  ? DA  E 14   . ? 1_555 ? 
24 AC4 5 DC  K  1   ? DC  M 16   . ? 1_555 ? 
25 AC5 6 ASP G  21  ? ASP G 21   . ? 1_555 ? 
26 AC5 6 GLN G  42  ? GLN G 42   . ? 1_555 ? 
27 AC5 6 ALA G  116 ? ALA G 116  . ? 1_555 ? 
28 AC5 6 HOH BA .   ? HOH G 2002 . ? 1_555 ? 
29 AC5 6 DA  H  14  ? DA  H 14   . ? 1_555 ? 
30 AC5 6 DC  L  1   ? DC  O 16   . ? 1_555 ? 
31 AC6 7 GLY G  20  ? GLY G 20   . ? 1_555 ? 
32 AC6 7 GLU G  117 ? GLU G 117  . ? 1_555 ? 
33 AC6 7 MN  U  .   ? MN  G 1182 . ? 1_555 ? 
34 AC6 7 HOH BA .   ? HOH G 2001 . ? 1_555 ? 
35 AC6 7 HOH BA .   ? HOH G 2030 . ? 1_555 ? 
36 AC6 7 DG  H  15  ? DG  H 15   . ? 1_555 ? 
37 AC6 7 DC  I  15  ? DC  I 15   . ? 1_555 ? 
38 AC7 6 ASP D  21  ? ASP D 21   . ? 1_555 ? 
39 AC7 6 GLU D  117 ? GLU D 117  . ? 1_555 ? 
40 AC7 6 DA  E  14  ? DA  E 14   . ? 1_555 ? 
41 AC7 6 DG  E  15  ? DG  E 15   . ? 1_555 ? 
42 AC7 6 DC  F  15  ? DC  F 15   . ? 1_555 ? 
43 AC7 6 DC  K  1   ? DC  M 16   . ? 1_555 ? 
44 AC8 6 ASP A  21  ? ASP A 21   . ? 1_555 ? 
45 AC8 6 GLU A  117 ? GLU A 117  . ? 1_555 ? 
46 AC8 6 DA  B  14  ? DA  B 14   . ? 1_555 ? 
47 AC8 6 DG  B  15  ? DG  B 15   . ? 1_555 ? 
48 AC8 6 DC  C  15  ? DC  C 15   . ? 1_555 ? 
49 AC8 6 DC  J  1   ? DC  K 16   . ? 1_555 ? 
50 AC9 7 ASP G  21  ? ASP G 21   . ? 1_555 ? 
51 AC9 7 GLU G  117 ? GLU G 117  . ? 1_555 ? 
52 AC9 7 MN  T  .   ? MN  G 1181 . ? 1_555 ? 
53 AC9 7 DA  H  14  ? DA  H 14   . ? 1_555 ? 
54 AC9 7 DG  H  15  ? DG  H 15   . ? 1_555 ? 
55 AC9 7 DC  I  15  ? DC  I 15   . ? 1_555 ? 
56 AC9 7 DC  L  1   ? DC  O 16   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4UNA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4UNA 
_atom_sites.fract_transf_matrix[1][1]   0.009388 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.005383 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014255 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010803 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASN A  1 4   ? 138.386 -13.661 229.923 1.00 89.88  ? 4    ASN A N     1 
ATOM   2    C  CA    . ASN A  1 4   ? 139.503 -14.495 230.356 1.00 92.86  ? 4    ASN A CA    1 
ATOM   3    C  C     . ASN A  1 4   ? 140.227 -13.891 231.559 1.00 88.43  ? 4    ASN A C     1 
ATOM   4    O  O     . ASN A  1 4   ? 140.754 -12.782 231.478 1.00 88.46  ? 4    ASN A O     1 
ATOM   5    C  CB    . ASN A  1 4   ? 140.486 -14.708 229.195 1.00 97.75  ? 4    ASN A CB    1 
ATOM   6    C  CG    . ASN A  1 4   ? 141.601 -15.700 229.533 1.00 92.99  ? 4    ASN A CG    1 
ATOM   7    O  OD1   . ASN A  1 4   ? 141.810 -16.055 230.696 1.00 86.25  ? 4    ASN A OD1   1 
ATOM   8    N  ND2   . ASN A  1 4   ? 142.318 -16.156 228.506 1.00 91.81  ? 4    ASN A ND2   1 
ATOM   9    N  N     . GLU A  1 5   ? 140.279 -14.633 232.662 1.00 90.09  ? 5    GLU A N     1 
ATOM   10   C  CA    . GLU A  1 5   ? 140.822 -14.092 233.909 1.00 91.50  ? 5    GLU A CA    1 
ATOM   11   C  C     . GLU A  1 5   ? 142.338 -14.255 234.077 1.00 88.65  ? 5    GLU A C     1 
ATOM   12   O  O     . GLU A  1 5   ? 142.953 -13.536 234.864 1.00 85.03  ? 5    GLU A O     1 
ATOM   13   C  CB    . GLU A  1 5   ? 140.112 -14.721 235.114 1.00 93.00  ? 5    GLU A CB    1 
ATOM   14   C  CG    . GLU A  1 5   ? 138.598 -14.663 235.064 1.00 98.04  ? 5    GLU A CG    1 
ATOM   15   C  CD    . GLU A  1 5   ? 137.959 -15.421 236.220 1.00 106.49 ? 5    GLU A CD    1 
ATOM   16   O  OE1   . GLU A  1 5   ? 138.646 -16.276 236.824 1.00 98.33  ? 5    GLU A OE1   1 
ATOM   17   O  OE2   . GLU A  1 5   ? 136.777 -15.155 236.535 1.00 112.93 ? 5    GLU A OE2   1 
ATOM   18   N  N     . ASN A  1 6   ? 142.947 -15.193 233.357 1.00 89.95  ? 6    ASN A N     1 
ATOM   19   C  CA    . ASN A  1 6   ? 144.407 -15.328 233.433 1.00 88.20  ? 6    ASN A CA    1 
ATOM   20   C  C     . ASN A  1 6   ? 145.068 -14.234 232.580 1.00 87.08  ? 6    ASN A C     1 
ATOM   21   O  O     . ASN A  1 6   ? 146.101 -13.681 232.986 1.00 81.30  ? 6    ASN A O     1 
ATOM   22   C  CB    . ASN A  1 6   ? 144.864 -16.759 233.046 1.00 88.65  ? 6    ASN A CB    1 
ATOM   23   C  CG    . ASN A  1 6   ? 145.238 -16.910 231.572 1.00 93.66  ? 6    ASN A CG    1 
ATOM   24   O  OD1   . ASN A  1 6   ? 144.545 -16.418 230.668 1.00 92.15  ? 6    ASN A OD1   1 
ATOM   25   N  ND2   . ASN A  1 6   ? 146.360 -17.592 231.327 1.00 91.68  ? 6    ASN A ND2   1 
ATOM   26   N  N     . VAL A  1 7   ? 144.443 -13.893 231.445 1.00 85.63  ? 7    VAL A N     1 
ATOM   27   C  CA    . VAL A  1 7   ? 144.874 -12.752 230.642 1.00 73.55  ? 7    VAL A CA    1 
ATOM   28   C  C     . VAL A  1 7   ? 144.586 -11.412 231.337 1.00 69.97  ? 7    VAL A C     1 
ATOM   29   O  O     . VAL A  1 7   ? 145.438 -10.523 231.345 1.00 65.07  ? 7    VAL A O     1 
ATOM   30   C  CB    . VAL A  1 7   ? 144.211 -12.775 229.265 1.00 78.67  ? 7    VAL A CB    1 
ATOM   31   C  CG1   . VAL A  1 7   ? 144.068 -11.383 228.689 1.00 74.01  ? 7    VAL A CG1   1 
ATOM   32   C  CG2   . VAL A  1 7   ? 145.009 -13.659 228.301 1.00 77.26  ? 7    VAL A CG2   1 
ATOM   33   N  N     . SER A  1 8   ? 143.410 -11.276 231.945 1.00 72.26  ? 8    SER A N     1 
ATOM   34   C  CA    . SER A  1 8   ? 143.075 -10.050 232.674 1.00 71.65  ? 8    SER A CA    1 
ATOM   35   C  C     . SER A  1 8   ? 144.070 -9.776  233.816 1.00 65.67  ? 8    SER A C     1 
ATOM   36   O  O     . SER A  1 8   ? 144.506 -8.641  234.004 1.00 60.76  ? 8    SER A O     1 
ATOM   37   C  CB    . SER A  1 8   ? 141.651 -10.111 233.229 1.00 66.99  ? 8    SER A CB    1 
ATOM   38   O  OG    . SER A  1 8   ? 141.591 -10.938 234.373 1.00 69.89  ? 8    SER A OG    1 
ATOM   39   N  N     . GLY A  1 9   ? 144.448 -10.816 234.553 1.00 65.00  ? 9    GLY A N     1 
ATOM   40   C  CA    . GLY A  1 9   ? 145.414 -10.674 235.629 1.00 64.71  ? 9    GLY A CA    1 
ATOM   41   C  C     . GLY A  1 9   ? 146.834 -10.353 235.174 1.00 63.10  ? 9    GLY A C     1 
ATOM   42   O  O     . GLY A  1 9   ? 147.490 -9.450  235.708 1.00 52.78  ? 9    GLY A O     1 
ATOM   43   N  N     . ILE A  1 10  ? 147.329 -11.105 234.198 1.00 63.04  ? 10   ILE A N     1 
ATOM   44   C  CA    . ILE A  1 10  ? 148.660 -10.840 233.669 1.00 58.73  ? 10   ILE A CA    1 
ATOM   45   C  C     . ILE A  1 10  ? 148.704 -9.416  233.097 1.00 50.19  ? 10   ILE A C     1 
ATOM   46   O  O     . ILE A  1 10  ? 149.668 -8.702  233.306 1.00 47.41  ? 10   ILE A O     1 
ATOM   47   C  CB    . ILE A  1 10  ? 149.067 -11.887 232.602 1.00 67.05  ? 10   ILE A CB    1 
ATOM   48   C  CG1   . ILE A  1 10  ? 149.518 -13.178 233.289 1.00 68.35  ? 10   ILE A CG1   1 
ATOM   49   C  CG2   . ILE A  1 10  ? 150.207 -11.377 231.718 1.00 59.64  ? 10   ILE A CG2   1 
ATOM   50   C  CD1   . ILE A  1 10  ? 150.103 -14.201 232.329 1.00 68.67  ? 10   ILE A CD1   1 
ATOM   51   N  N     . SER A  1 11  ? 147.638 -9.000  232.421 1.00 54.72  ? 11   SER A N     1 
ATOM   52   C  CA    . SER A  1 11  ? 147.511 -7.621  231.946 1.00 55.09  ? 11   SER A CA    1 
ATOM   53   C  C     . SER A  1 11  ? 147.717 -6.606  233.069 1.00 52.13  ? 11   SER A C     1 
ATOM   54   O  O     . SER A  1 11  ? 148.546 -5.688  232.970 1.00 45.47  ? 11   SER A O     1 
ATOM   55   C  CB    . SER A  1 11  ? 146.128 -7.389  231.327 1.00 57.46  ? 11   SER A CB    1 
ATOM   56   O  OG    . SER A  1 11  ? 145.985 -8.057  230.102 1.00 59.70  ? 11   SER A OG    1 
ATOM   57   N  N     . ALA A  1 12  ? 146.931 -6.778  234.124 1.00 50.27  ? 12   ALA A N     1 
ATOM   58   C  CA    . ALA A  1 12  ? 146.960 -5.877  235.260 1.00 48.56  ? 12   ALA A CA    1 
ATOM   59   C  C     . ALA A  1 12  ? 148.363 -5.827  235.832 1.00 44.43  ? 12   ALA A C     1 
ATOM   60   O  O     . ALA A  1 12  ? 148.861 -4.763  236.180 1.00 43.50  ? 12   ALA A O     1 
ATOM   61   C  CB    . ALA A  1 12  ? 145.944 -6.320  236.335 1.00 50.09  ? 12   ALA A CB    1 
ATOM   62   N  N     . TYR A  1 13  ? 149.006 -6.984  235.921 1.00 42.12  ? 13   TYR A N     1 
ATOM   63   C  CA    . TYR A  1 13  ? 150.357 -7.032  236.459 1.00 43.58  ? 13   TYR A CA    1 
ATOM   64   C  C     . TYR A  1 13  ? 151.351 -6.259  235.572 1.00 46.70  ? 13   TYR A C     1 
ATOM   65   O  O     . TYR A  1 13  ? 152.111 -5.419  236.047 1.00 43.34  ? 13   TYR A O     1 
ATOM   66   C  CB    . TYR A  1 13  ? 150.801 -8.482  236.628 1.00 42.17  ? 13   TYR A CB    1 
ATOM   67   C  CG    . TYR A  1 13  ? 152.245 -8.622  237.054 1.00 47.65  ? 13   TYR A CG    1 
ATOM   68   C  CD1   . TYR A  1 13  ? 152.640 -8.348  238.355 1.00 44.73  ? 13   TYR A CD1   1 
ATOM   69   C  CD2   . TYR A  1 13  ? 153.214 -9.033  236.152 1.00 45.26  ? 13   TYR A CD2   1 
ATOM   70   C  CE1   . TYR A  1 13  ? 153.957 -8.473  238.734 1.00 43.55  ? 13   TYR A CE1   1 
ATOM   71   C  CE2   . TYR A  1 13  ? 154.540 -9.168  236.533 1.00 43.29  ? 13   TYR A CE2   1 
ATOM   72   C  CZ    . TYR A  1 13  ? 154.899 -8.889  237.814 1.00 43.73  ? 13   TYR A CZ    1 
ATOM   73   O  OH    . TYR A  1 13  ? 156.215 -9.020  238.170 1.00 54.15  ? 13   TYR A OH    1 
ATOM   74   N  N     . LEU A  1 14  ? 151.333 -6.551  234.280 1.00 41.46  ? 14   LEU A N     1 
ATOM   75   C  CA    . LEU A  1 14  ? 152.155 -5.832  233.307 1.00 48.70  ? 14   LEU A CA    1 
ATOM   76   C  C     . LEU A  1 14  ? 151.884 -4.324  233.380 1.00 44.34  ? 14   LEU A C     1 
ATOM   77   O  O     . LEU A  1 14  ? 152.806 -3.507  233.353 1.00 39.66  ? 14   LEU A O     1 
ATOM   78   C  CB    . LEU A  1 14  ? 151.886 -6.365  231.888 1.00 38.29  ? 14   LEU A CB    1 
ATOM   79   C  CG    . LEU A  1 14  ? 152.406 -7.781  231.638 1.00 47.01  ? 14   LEU A CG    1 
ATOM   80   C  CD1   . LEU A  1 14  ? 151.893 -8.334  230.306 1.00 47.30  ? 14   LEU A CD1   1 
ATOM   81   C  CD2   . LEU A  1 14  ? 153.942 -7.770  231.673 1.00 44.12  ? 14   LEU A CD2   1 
ATOM   82   N  N     . LEU A  1 15  ? 150.609 -3.972  233.495 1.00 40.18  ? 15   LEU A N     1 
ATOM   83   C  CA    . LEU A  1 15  ? 150.211 -2.578  233.583 1.00 43.25  ? 15   LEU A CA    1 
ATOM   84   C  C     . LEU A  1 15  ? 150.796 -1.909  234.845 1.00 45.48  ? 15   LEU A C     1 
ATOM   85   O  O     . LEU A  1 15  ? 151.117 -0.719  234.833 1.00 44.34  ? 15   LEU A O     1 
ATOM   86   C  CB    . LEU A  1 15  ? 148.687 -2.480  233.550 1.00 41.94  ? 15   LEU A CB    1 
ATOM   87   C  CG    . LEU A  1 15  ? 148.115 -1.073  233.515 1.00 46.42  ? 15   LEU A CG    1 
ATOM   88   C  CD1   . LEU A  1 15  ? 148.520 -0.344  232.238 1.00 37.57  ? 15   LEU A CD1   1 
ATOM   89   C  CD2   . LEU A  1 15  ? 146.590 -1.108  233.689 1.00 43.72  ? 15   LEU A CD2   1 
ATOM   90   N  N     . GLY A  1 16  ? 150.965 -2.683  235.914 1.00 42.12  ? 16   GLY A N     1 
ATOM   91   C  CA    . GLY A  1 16  ? 151.660 -2.193  237.097 1.00 41.86  ? 16   GLY A CA    1 
ATOM   92   C  C     . GLY A  1 16  ? 153.113 -1.842  236.797 1.00 41.98  ? 16   GLY A C     1 
ATOM   93   O  O     . GLY A  1 16  ? 153.615 -0.796  237.202 1.00 42.28  ? 16   GLY A O     1 
ATOM   94   N  N     . LEU A  1 17  ? 153.793 -2.716  236.068 1.00 42.25  ? 17   LEU A N     1 
ATOM   95   C  CA    . LEU A  1 17  ? 155.185 -2.480  235.690 1.00 41.82  ? 17   LEU A CA    1 
ATOM   96   C  C     . LEU A  1 17  ? 155.333 -1.294  234.725 1.00 41.95  ? 17   LEU A C     1 
ATOM   97   O  O     . LEU A  1 17  ? 156.283 -0.496  234.832 1.00 40.53  ? 17   LEU A O     1 
ATOM   98   C  CB    . LEU A  1 17  ? 155.776 -3.745  235.064 1.00 44.86  ? 17   LEU A CB    1 
ATOM   99   C  CG    . LEU A  1 17  ? 155.903 -4.938  236.008 1.00 41.01  ? 17   LEU A CG    1 
ATOM   100  C  CD1   . LEU A  1 17  ? 156.437 -6.139  235.254 1.00 40.50  ? 17   LEU A CD1   1 
ATOM   101  C  CD2   . LEU A  1 17  ? 156.803 -4.552  237.170 1.00 36.10  ? 17   LEU A CD2   1 
ATOM   102  N  N     . ILE A  1 18  ? 154.385 -1.182  233.801 1.00 39.21  ? 18   ILE A N     1 
ATOM   103  C  CA    . ILE A  1 18  ? 154.401 -0.132  232.790 1.00 41.45  ? 18   ILE A CA    1 
ATOM   104  C  C     . ILE A  1 18  ? 154.226 1.249   233.425 1.00 43.26  ? 18   ILE A C     1 
ATOM   105  O  O     . ILE A  1 18  ? 155.071 2.139   233.269 1.00 38.95  ? 18   ILE A O     1 
ATOM   106  C  CB    . ILE A  1 18  ? 153.284 -0.357  231.734 1.00 40.04  ? 18   ILE A CB    1 
ATOM   107  C  CG1   . ILE A  1 18  ? 153.590 -1.602  230.888 1.00 39.45  ? 18   ILE A CG1   1 
ATOM   108  C  CG2   . ILE A  1 18  ? 153.130 0.859   230.846 1.00 36.52  ? 18   ILE A CG2   1 
ATOM   109  C  CD1   . ILE A  1 18  ? 152.381 -2.131  230.142 1.00 37.01  ? 18   ILE A CD1   1 
ATOM   110  N  N     . ILE A  1 19  ? 153.122 1.411   234.144 1.00 36.46  ? 19   ILE A N     1 
ATOM   111  C  CA    . ILE A  1 19  ? 152.836 2.664   234.820 1.00 41.94  ? 19   ILE A CA    1 
ATOM   112  C  C     . ILE A  1 19  ? 153.961 3.011   235.767 1.00 40.25  ? 19   ILE A C     1 
ATOM   113  O  O     . ILE A  1 19  ? 154.374 4.164   235.840 1.00 39.93  ? 19   ILE A O     1 
ATOM   114  C  CB    . ILE A  1 19  ? 151.512 2.590   235.582 1.00 45.49  ? 19   ILE A CB    1 
ATOM   115  C  CG1   . ILE A  1 19  ? 150.376 2.933   234.637 1.00 47.21  ? 19   ILE A CG1   1 
ATOM   116  C  CG2   . ILE A  1 19  ? 151.500 3.525   236.750 1.00 41.25  ? 19   ILE A CG2   1 
ATOM   117  C  CD1   . ILE A  1 19  ? 149.185 2.103   234.926 1.00 55.50  ? 19   ILE A CD1   1 
ATOM   118  N  N     . GLY A  1 20  ? 154.478 2.009   236.465 1.00 37.53  ? 20   GLY A N     1 
ATOM   119  C  CA    . GLY A  1 20  ? 155.582 2.242   237.372 1.00 41.83  ? 20   GLY A CA    1 
ATOM   120  C  C     . GLY A  1 20  ? 156.912 2.521   236.677 1.00 47.52  ? 20   GLY A C     1 
ATOM   121  O  O     . GLY A  1 20  ? 157.471 3.601   236.817 1.00 46.53  ? 20   GLY A O     1 
ATOM   122  N  N     . ASP A  1 21  ? 157.422 1.553   235.921 1.00 45.32  ? 21   ASP A N     1 
ATOM   123  C  CA    . ASP A  1 21  ? 158.792 1.645   235.429 1.00 45.87  ? 21   ASP A CA    1 
ATOM   124  C  C     . ASP A  1 21  ? 158.940 1.821   233.920 1.00 46.69  ? 21   ASP A C     1 
ATOM   125  O  O     . ASP A  1 21  ? 160.028 1.678   233.397 1.00 45.35  ? 21   ASP A O     1 
ATOM   126  C  CB    . ASP A  1 21  ? 159.567 0.413   235.870 1.00 46.24  ? 21   ASP A CB    1 
ATOM   127  C  CG    . ASP A  1 21  ? 160.166 0.580   237.241 1.00 45.32  ? 21   ASP A CG    1 
ATOM   128  O  OD1   . ASP A  1 21  ? 160.158 1.726   237.752 1.00 47.16  ? 21   ASP A OD1   1 
ATOM   129  O  OD2   . ASP A  1 21  ? 160.630 -0.427  237.807 1.00 47.45  ? 21   ASP A OD2   1 
ATOM   130  N  N     . GLY A  1 22  ? 157.853 2.151   233.229 1.00 43.16  ? 22   GLY A N     1 
ATOM   131  C  CA    . GLY A  1 22  ? 157.919 2.385   231.804 1.00 44.74  ? 22   GLY A CA    1 
ATOM   132  C  C     . GLY A  1 22  ? 156.948 3.457   231.371 1.00 44.21  ? 22   GLY A C     1 
ATOM   133  O  O     . GLY A  1 22  ? 156.870 4.526   231.982 1.00 43.63  ? 22   GLY A O     1 
ATOM   134  N  N     . GLY A  1 23  ? 156.188 3.162   230.322 1.00 40.20  ? 23   GLY A N     1 
ATOM   135  C  CA    . GLY A  1 23  ? 155.154 4.067   229.871 1.00 37.63  ? 23   GLY A CA    1 
ATOM   136  C  C     . GLY A  1 23  ? 154.450 3.650   228.595 1.00 44.48  ? 23   GLY A C     1 
ATOM   137  O  O     . GLY A  1 23  ? 154.736 2.612   227.976 1.00 37.54  ? 23   GLY A O     1 
ATOM   138  N  N     . LEU A  1 24  ? 153.496 4.487   228.217 1.00 42.16  ? 24   LEU A N     1 
ATOM   139  C  CA    . LEU A  1 24  ? 152.703 4.274   227.040 1.00 38.25  ? 24   LEU A CA    1 
ATOM   140  C  C     . LEU A  1 24  ? 152.915 5.488   226.162 1.00 42.86  ? 24   LEU A C     1 
ATOM   141  O  O     . LEU A  1 24  ? 152.534 6.592   226.544 1.00 40.84  ? 24   LEU A O     1 
ATOM   142  C  CB    . LEU A  1 24  ? 151.239 4.094   227.394 1.00 37.25  ? 24   LEU A CB    1 
ATOM   143  C  CG    . LEU A  1 24  ? 150.992 2.883   228.279 1.00 41.89  ? 24   LEU A CG    1 
ATOM   144  C  CD1   . LEU A  1 24  ? 149.589 2.922   228.867 1.00 36.26  ? 24   LEU A CD1   1 
ATOM   145  C  CD2   . LEU A  1 24  ? 151.220 1.615   227.487 1.00 38.95  ? 24   LEU A CD2   1 
ATOM   146  N  N     . TYR A  1 25  ? 153.537 5.296   224.998 1.00 40.19  ? 25   TYR A N     1 
ATOM   147  C  CA    . TYR A  1 25  ? 153.919 6.448   224.210 1.00 42.05  ? 25   TYR A CA    1 
ATOM   148  C  C     . TYR A  1 25  ? 153.251 6.463   222.838 1.00 41.76  ? 25   TYR A C     1 
ATOM   149  O  O     . TYR A  1 25  ? 153.353 5.500   222.068 1.00 40.80  ? 25   TYR A O     1 
ATOM   150  C  CB    . TYR A  1 25  ? 155.446 6.499   224.085 1.00 39.22  ? 25   TYR A CB    1 
ATOM   151  C  CG    . TYR A  1 25  ? 156.163 6.435   225.417 1.00 43.58  ? 25   TYR A CG    1 
ATOM   152  C  CD1   . TYR A  1 25  ? 156.033 7.458   226.353 1.00 43.04  ? 25   TYR A CD1   1 
ATOM   153  C  CD2   . TYR A  1 25  ? 156.973 5.354   225.742 1.00 49.24  ? 25   TYR A CD2   1 
ATOM   154  C  CE1   . TYR A  1 25  ? 156.685 7.407   227.566 1.00 44.43  ? 25   TYR A CE1   1 
ATOM   155  C  CE2   . TYR A  1 25  ? 157.645 5.295   226.955 1.00 42.76  ? 25   TYR A CE2   1 
ATOM   156  C  CZ    . TYR A  1 25  ? 157.495 6.320   227.863 1.00 48.43  ? 25   TYR A CZ    1 
ATOM   157  O  OH    . TYR A  1 25  ? 158.145 6.256   229.070 1.00 44.35  ? 25   TYR A OH    1 
ATOM   158  N  N     . LYS A  1 26  ? 152.548 7.555   222.552 1.00 41.21  ? 26   LYS A N     1 
ATOM   159  C  CA    . LYS A  1 26  ? 152.082 7.825   221.190 1.00 51.56  ? 26   LYS A CA    1 
ATOM   160  C  C     . LYS A  1 26  ? 152.994 8.874   220.558 1.00 49.40  ? 26   LYS A C     1 
ATOM   161  O  O     . LYS A  1 26  ? 152.911 10.055  220.895 1.00 52.89  ? 26   LYS A O     1 
ATOM   162  C  CB    . LYS A  1 26  ? 150.621 8.300   221.151 1.00 48.09  ? 26   LYS A CB    1 
ATOM   163  C  CG    . LYS A  1 26  ? 150.127 8.543   219.713 1.00 52.25  ? 26   LYS A CG    1 
ATOM   164  C  CD    . LYS A  1 26  ? 148.694 9.122   219.602 1.00 63.87  ? 26   LYS A CD    1 
ATOM   165  C  CE    . LYS A  1 26  ? 147.764 8.629   220.717 1.00 64.34  ? 26   LYS A CE    1 
ATOM   166  N  NZ    . LYS A  1 26  ? 146.307 9.038   220.554 1.00 67.44  ? 26   LYS A NZ    1 
ATOM   167  N  N     . LEU A  1 27  ? 153.859 8.424   219.649 1.00 46.81  ? 27   LEU A N     1 
ATOM   168  C  CA    . LEU A  1 27  ? 154.870 9.264   218.999 1.00 55.42  ? 27   LEU A CA    1 
ATOM   169  C  C     . LEU A  1 27  ? 154.426 9.779   217.621 1.00 57.63  ? 27   LEU A C     1 
ATOM   170  O  O     . LEU A  1 27  ? 153.802 9.048   216.848 1.00 53.36  ? 27   LEU A O     1 
ATOM   171  C  CB    . LEU A  1 27  ? 156.182 8.487   218.802 1.00 55.49  ? 27   LEU A CB    1 
ATOM   172  C  CG    . LEU A  1 27  ? 157.096 7.871   219.870 1.00 49.99  ? 27   LEU A CG    1 
ATOM   173  C  CD1   . LEU A  1 27  ? 157.643 8.936   220.801 1.00 54.39  ? 27   LEU A CD1   1 
ATOM   174  C  CD2   . LEU A  1 27  ? 156.436 6.731   220.623 1.00 46.13  ? 27   LEU A CD2   1 
ATOM   175  N  N     . LYS A  1 28  ? 154.790 11.021  217.301 1.00 60.68  ? 28   LYS A N     1 
ATOM   176  C  CA    . LYS A  1 28  ? 154.601 11.556  215.949 1.00 58.23  ? 28   LYS A CA    1 
ATOM   177  C  C     . LYS A  1 28  ? 155.953 11.856  215.290 1.00 62.39  ? 28   LYS A C     1 
ATOM   178  O  O     . LYS A  1 28  ? 156.784 12.586  215.834 1.00 61.61  ? 28   LYS A O     1 
ATOM   179  C  CB    . LYS A  1 28  ? 153.738 12.819  215.968 1.00 60.34  ? 28   LYS A CB    1 
ATOM   180  C  CG    . LYS A  1 28  ? 152.349 12.627  216.578 1.00 65.47  ? 28   LYS A CG    1 
ATOM   181  C  CD    . LYS A  1 28  ? 151.581 11.471  215.930 1.00 63.37  ? 28   LYS A CD    1 
ATOM   182  C  CE    . LYS A  1 28  ? 150.355 11.098  216.768 1.00 67.90  ? 28   LYS A CE    1 
ATOM   183  N  NZ    . LYS A  1 28  ? 149.546 9.981   216.194 1.00 63.36  ? 28   LYS A NZ    1 
ATOM   184  N  N     . TYR A  1 29  ? 156.173 11.274  214.121 1.00 58.07  ? 29   TYR A N     1 
ATOM   185  C  CA    . TYR A  1 29  ? 157.417 11.470  213.390 1.00 57.56  ? 29   TYR A CA    1 
ATOM   186  C  C     . TYR A  1 29  ? 157.195 12.308  212.124 1.00 62.23  ? 29   TYR A C     1 
ATOM   187  O  O     . TYR A  1 29  ? 156.050 12.615  211.760 1.00 58.31  ? 29   TYR A O     1 
ATOM   188  C  CB    . TYR A  1 29  ? 158.026 10.121  213.029 1.00 53.56  ? 29   TYR A CB    1 
ATOM   189  C  CG    . TYR A  1 29  ? 158.373 9.257   214.216 1.00 57.20  ? 29   TYR A CG    1 
ATOM   190  C  CD1   . TYR A  1 29  ? 158.819 9.816   215.407 1.00 55.97  ? 29   TYR A CD1   1 
ATOM   191  C  CD2   . TYR A  1 29  ? 158.248 7.872   214.149 1.00 55.62  ? 29   TYR A CD2   1 
ATOM   192  C  CE1   . TYR A  1 29  ? 159.144 9.015   216.495 1.00 50.89  ? 29   TYR A CE1   1 
ATOM   193  C  CE2   . TYR A  1 29  ? 158.570 7.068   215.229 1.00 50.98  ? 29   TYR A CE2   1 
ATOM   194  C  CZ    . TYR A  1 29  ? 159.015 7.647   216.397 1.00 51.82  ? 29   TYR A CZ    1 
ATOM   195  O  OH    . TYR A  1 29  ? 159.326 6.837   217.467 1.00 56.72  ? 29   TYR A OH    1 
ATOM   196  N  N     . LYS A  1 30  ? 158.289 12.674  211.454 1.00 66.83  ? 30   LYS A N     1 
ATOM   197  C  CA    . LYS A  1 30  ? 158.181 13.450  210.218 1.00 68.41  ? 30   LYS A CA    1 
ATOM   198  C  C     . LYS A  1 30  ? 157.583 12.606  209.107 1.00 62.97  ? 30   LYS A C     1 
ATOM   199  O  O     . LYS A  1 30  ? 157.904 11.423  208.974 1.00 60.34  ? 30   LYS A O     1 
ATOM   200  C  CB    . LYS A  1 30  ? 159.543 13.988  209.765 1.00 67.14  ? 30   LYS A CB    1 
ATOM   201  C  CG    . LYS A  1 30  ? 160.433 14.527  210.864 1.00 72.35  ? 30   LYS A CG    1 
ATOM   202  C  CD    . LYS A  1 30  ? 161.706 15.122  210.281 1.00 77.07  ? 30   LYS A CD    1 
ATOM   203  C  CE    . LYS A  1 30  ? 162.939 14.667  211.043 1.00 87.18  ? 30   LYS A CE    1 
ATOM   204  N  NZ    . LYS A  1 30  ? 163.736 13.675  210.255 1.00 85.27  ? 30   LYS A NZ    1 
ATOM   205  N  N     . GLY A  1 31  ? 156.719 13.226  208.308 1.00 65.41  ? 31   GLY A N     1 
ATOM   206  C  CA    . GLY A  1 31  ? 156.188 12.592  207.116 1.00 57.34  ? 31   GLY A CA    1 
ATOM   207  C  C     . GLY A  1 31  ? 154.915 11.843  207.422 1.00 60.59  ? 31   GLY A C     1 
ATOM   208  O  O     . GLY A  1 31  ? 154.639 10.808  206.812 1.00 58.35  ? 31   GLY A O     1 
ATOM   209  N  N     . ASN A  1 32  ? 154.153 12.373  208.381 1.00 58.23  ? 32   ASN A N     1 
ATOM   210  C  CA    . ASN A  1 32  ? 152.940 11.739  208.894 1.00 56.16  ? 32   ASN A CA    1 
ATOM   211  C  C     . ASN A  1 32  ? 153.186 10.346  209.461 1.00 50.60  ? 32   ASN A C     1 
ATOM   212  O  O     . ASN A  1 32  ? 152.249 9.584   209.655 1.00 47.32  ? 32   ASN A O     1 
ATOM   213  C  CB    . ASN A  1 32  ? 151.863 11.655  207.807 1.00 59.29  ? 32   ASN A CB    1 
ATOM   214  C  CG    . ASN A  1 32  ? 151.296 13.004  207.448 1.00 64.01  ? 32   ASN A CG    1 
ATOM   215  O  OD1   . ASN A  1 32  ? 151.793 13.678  206.541 1.00 68.10  ? 32   ASN A OD1   1 
ATOM   216  N  ND2   . ASN A  1 32  ? 150.243 13.408  208.149 1.00 65.17  ? 32   ASN A ND2   1 
ATOM   217  N  N     . ARG A  1 33  ? 154.444 10.005  209.709 1.00 50.40  ? 33   ARG A N     1 
ATOM   218  C  CA    . ARG A  1 33  ? 154.756 8.741   210.359 1.00 52.88  ? 33   ARG A CA    1 
ATOM   219  C  C     . ARG A  1 33  ? 154.453 8.807   211.859 1.00 52.60  ? 33   ARG A C     1 
ATOM   220  O  O     . ARG A  1 33  ? 154.475 9.879   212.474 1.00 52.89  ? 33   ARG A O     1 
ATOM   221  C  CB    . ARG A  1 33  ? 156.218 8.372   210.138 1.00 52.41  ? 33   ARG A CB    1 
ATOM   222  C  CG    . ARG A  1 33  ? 156.557 8.022   208.703 1.00 52.71  ? 33   ARG A CG    1 
ATOM   223  C  CD    . ARG A  1 33  ? 158.052 7.919   208.546 1.00 48.13  ? 33   ARG A CD    1 
ATOM   224  N  NE    . ARG A  1 33  ? 158.685 9.046   209.210 1.00 55.43  ? 33   ARG A NE    1 
ATOM   225  C  CZ    . ARG A  1 33  ? 159.574 8.940   210.189 1.00 53.07  ? 33   ARG A CZ    1 
ATOM   226  N  NH1   . ARG A  1 33  ? 159.962 7.739   210.619 1.00 50.26  ? 33   ARG A NH1   1 
ATOM   227  N  NH2   . ARG A  1 33  ? 160.081 10.041  210.727 1.00 54.59  ? 33   ARG A NH2   1 
ATOM   228  N  N     . SER A  1 34  ? 154.161 7.652   212.439 1.00 54.41  ? 34   SER A N     1 
ATOM   229  C  CA    . SER A  1 34  ? 153.750 7.581   213.833 1.00 48.77  ? 34   SER A CA    1 
ATOM   230  C  C     . SER A  1 34  ? 154.316 6.324   214.478 1.00 50.29  ? 34   SER A C     1 
ATOM   231  O  O     . SER A  1 34  ? 154.912 5.472   213.794 1.00 46.07  ? 34   SER A O     1 
ATOM   232  C  CB    . SER A  1 34  ? 152.228 7.601   213.939 1.00 42.52  ? 34   SER A CB    1 
ATOM   233  O  OG    . SER A  1 34  ? 151.667 6.356   213.576 1.00 45.55  ? 34   SER A OG    1 
ATOM   234  N  N     . GLU A  1 35  ? 154.141 6.220   215.794 1.00 44.81  ? 35   GLU A N     1 
ATOM   235  C  CA    . GLU A  1 35  ? 154.492 5.008   216.521 1.00 44.71  ? 35   GLU A CA    1 
ATOM   236  C  C     . GLU A  1 35  ? 153.812 4.947   217.909 1.00 47.01  ? 35   GLU A C     1 
ATOM   237  O  O     . GLU A  1 35  ? 153.536 5.968   218.544 1.00 43.22  ? 35   GLU A O     1 
ATOM   238  C  CB    . GLU A  1 35  ? 156.020 4.885   216.673 1.00 45.02  ? 35   GLU A CB    1 
ATOM   239  C  CG    . GLU A  1 35  ? 156.481 3.439   216.790 1.00 44.57  ? 35   GLU A CG    1 
ATOM   240  C  CD    . GLU A  1 35  ? 157.931 3.287   217.215 1.00 44.89  ? 35   GLU A CD    1 
ATOM   241  O  OE1   . GLU A  1 35  ? 158.709 4.253   217.062 1.00 45.83  ? 35   GLU A OE1   1 
ATOM   242  O  OE2   . GLU A  1 35  ? 158.284 2.191   217.702 1.00 42.03  ? 35   GLU A OE2   1 
ATOM   243  N  N     . TYR A  1 36  ? 153.560 3.726   218.360 1.00 40.92  ? 36   TYR A N     1 
ATOM   244  C  CA    . TYR A  1 36  ? 152.799 3.472   219.577 1.00 45.20  ? 36   TYR A CA    1 
ATOM   245  C  C     . TYR A  1 36  ? 153.576 2.483   220.399 1.00 43.60  ? 36   TYR A C     1 
ATOM   246  O  O     . TYR A  1 36  ? 153.817 1.364   219.951 1.00 45.59  ? 36   TYR A O     1 
ATOM   247  C  CB    . TYR A  1 36  ? 151.404 2.923   219.261 1.00 40.67  ? 36   TYR A CB    1 
ATOM   248  C  CG    . TYR A  1 36  ? 150.581 3.822   218.371 1.00 44.48  ? 36   TYR A CG    1 
ATOM   249  C  CD1   . TYR A  1 36  ? 150.764 3.826   216.988 1.00 44.27  ? 36   TYR A CD1   1 
ATOM   250  C  CD2   . TYR A  1 36  ? 149.594 4.650   218.907 1.00 47.73  ? 36   TYR A CD2   1 
ATOM   251  C  CE1   . TYR A  1 36  ? 150.003 4.640   216.166 1.00 44.25  ? 36   TYR A CE1   1 
ATOM   252  C  CE2   . TYR A  1 36  ? 148.818 5.462   218.090 1.00 45.29  ? 36   TYR A CE2   1 
ATOM   253  C  CZ    . TYR A  1 36  ? 149.040 5.456   216.721 1.00 48.35  ? 36   TYR A CZ    1 
ATOM   254  O  OH    . TYR A  1 36  ? 148.294 6.260   215.911 1.00 46.02  ? 36   TYR A OH    1 
ATOM   255  N  N     . ARG A  1 37  ? 153.988 2.892   221.592 1.00 39.51  ? 37   ARG A N     1 
ATOM   256  C  CA    . ARG A  1 37  ? 154.918 2.074   222.365 1.00 38.61  ? 37   ARG A CA    1 
ATOM   257  C  C     . ARG A  1 37  ? 154.422 1.701   223.761 1.00 41.46  ? 37   ARG A C     1 
ATOM   258  O  O     . ARG A  1 37  ? 153.951 2.545   224.530 1.00 40.53  ? 37   ARG A O     1 
ATOM   259  C  CB    . ARG A  1 37  ? 156.265 2.783   222.483 1.00 40.74  ? 37   ARG A CB    1 
ATOM   260  C  CG    . ARG A  1 37  ? 157.065 2.814   221.218 1.00 43.96  ? 37   ARG A CG    1 
ATOM   261  C  CD    . ARG A  1 37  ? 158.435 3.376   221.512 1.00 49.48  ? 37   ARG A CD    1 
ATOM   262  N  NE    . ARG A  1 37  ? 159.271 3.472   220.323 1.00 45.65  ? 37   ARG A NE    1 
ATOM   263  C  CZ    . ARG A  1 37  ? 160.465 4.059   220.299 1.00 50.15  ? 37   ARG A CZ    1 
ATOM   264  N  NH1   . ARG A  1 37  ? 160.972 4.588   221.407 1.00 53.18  ? 37   ARG A NH1   1 
ATOM   265  N  NH2   . ARG A  1 37  ? 161.153 4.117   219.167 1.00 51.03  ? 37   ARG A NH2   1 
ATOM   266  N  N     . VAL A  1 38  ? 154.515 0.408   224.041 1.00 39.00  ? 38   VAL A N     1 
ATOM   267  C  CA    . VAL A  1 38  ? 154.369 -0.141  225.366 1.00 42.41  ? 38   VAL A CA    1 
ATOM   268  C  C     . VAL A  1 38  ? 155.769 -0.461  225.897 1.00 46.13  ? 38   VAL A C     1 
ATOM   269  O  O     . VAL A  1 38  ? 156.463 -1.321  225.338 1.00 39.75  ? 38   VAL A O     1 
ATOM   270  C  CB    . VAL A  1 38  ? 153.524 -1.419  225.384 1.00 40.15  ? 38   VAL A CB    1 
ATOM   271  C  CG1   . VAL A  1 38  ? 153.399 -1.924  226.831 1.00 38.52  ? 38   VAL A CG1   1 
ATOM   272  C  CG2   . VAL A  1 38  ? 152.151 -1.186  224.754 1.00 36.89  ? 38   VAL A CG2   1 
ATOM   273  N  N     . VAL A  1 39  ? 156.165 0.222   226.975 1.00 38.72  ? 39   VAL A N     1 
ATOM   274  C  CA    . VAL A  1 39  ? 157.532 0.156   227.487 1.00 38.94  ? 39   VAL A CA    1 
ATOM   275  C  C     . VAL A  1 39  ? 157.578 -0.214  228.973 1.00 42.01  ? 39   VAL A C     1 
ATOM   276  O  O     . VAL A  1 39  ? 156.821 0.319   229.767 1.00 44.59  ? 39   VAL A O     1 
ATOM   277  C  CB    . VAL A  1 39  ? 158.270 1.496   227.296 1.00 42.13  ? 39   VAL A CB    1 
ATOM   278  C  CG1   . VAL A  1 39  ? 159.627 1.473   227.993 1.00 38.07  ? 39   VAL A CG1   1 
ATOM   279  C  CG2   . VAL A  1 39  ? 158.435 1.804   225.802 1.00 41.12  ? 39   VAL A CG2   1 
ATOM   280  N  N     . ILE A  1 40  ? 158.437 -1.171  229.309 1.00 39.25  ? 40   ILE A N     1 
ATOM   281  C  CA    . ILE A  1 40  ? 158.834 -1.458  230.666 1.00 41.86  ? 40   ILE A CA    1 
ATOM   282  C  C     . ILE A  1 40  ? 160.336 -1.415  230.738 1.00 44.72  ? 40   ILE A C     1 
ATOM   283  O  O     . ILE A  1 40  ? 161.003 -2.206  230.080 1.00 45.45  ? 40   ILE A O     1 
ATOM   284  C  CB    . ILE A  1 40  ? 158.379 -2.848  231.153 1.00 44.13  ? 40   ILE A CB    1 
ATOM   285  C  CG1   . ILE A  1 40  ? 156.857 -3.022  231.075 1.00 40.86  ? 40   ILE A CG1   1 
ATOM   286  C  CG2   . ILE A  1 40  ? 158.889 -3.082  232.571 1.00 35.70  ? 40   ILE A CG2   1 
ATOM   287  C  CD1   . ILE A  1 40  ? 156.391 -4.422  231.420 1.00 39.31  ? 40   ILE A CD1   1 
ATOM   288  N  N     . THR A  1 41  ? 160.891 -0.501  231.520 1.00 46.24  ? 41   THR A N     1 
ATOM   289  C  CA    . THR A  1 41  ? 162.326 -0.536  231.732 1.00 47.18  ? 41   THR A CA    1 
ATOM   290  C  C     . THR A  1 41  ? 162.720 -1.131  233.087 1.00 54.24  ? 41   THR A C     1 
ATOM   291  O  O     . THR A  1 41  ? 161.941 -1.104  234.057 1.00 49.66  ? 41   THR A O     1 
ATOM   292  C  CB    . THR A  1 41  ? 162.955 0.849   231.622 1.00 50.09  ? 41   THR A CB    1 
ATOM   293  O  OG1   . THR A  1 41  ? 162.665 1.652   232.785 1.00 46.48  ? 41   THR A OG1   1 
ATOM   294  C  CG2   . THR A  1 41  ? 162.549 1.558   230.330 1.00 45.17  ? 41   THR A CG2   1 
ATOM   295  N  N     . GLN A  1 42  ? 163.951 -1.642  233.141 1.00 53.31  ? 42   GLN A N     1 
ATOM   296  C  CA    . GLN A  1 42  ? 164.427 -2.394  234.286 1.00 53.51  ? 42   GLN A CA    1 
ATOM   297  C  C     . GLN A  1 42  ? 165.922 -2.659  234.194 1.00 59.79  ? 42   GLN A C     1 
ATOM   298  O  O     . GLN A  1 42  ? 166.446 -2.885  233.099 1.00 55.22  ? 42   GLN A O     1 
ATOM   299  C  CB    . GLN A  1 42  ? 163.658 -3.709  234.383 1.00 52.53  ? 42   GLN A CB    1 
ATOM   300  C  CG    . GLN A  1 42  ? 163.767 -4.406  235.714 1.00 55.99  ? 42   GLN A CG    1 
ATOM   301  C  CD    . GLN A  1 42  ? 162.859 -3.802  236.775 1.00 59.56  ? 42   GLN A CD    1 
ATOM   302  O  OE1   . GLN A  1 42  ? 162.931 -4.195  237.931 1.00 61.65  ? 42   GLN A OE1   1 
ATOM   303  N  NE2   . GLN A  1 42  ? 162.009 -2.851  236.389 1.00 56.14  ? 42   GLN A NE2   1 
ATOM   304  N  N     . LYS A  1 43  ? 166.611 -2.653  235.335 1.00 59.46  ? 43   LYS A N     1 
ATOM   305  C  CA    . LYS A  1 43  ? 168.052 -2.855  235.316 1.00 61.43  ? 43   LYS A CA    1 
ATOM   306  C  C     . LYS A  1 43  ? 168.430 -4.321  235.180 1.00 64.50  ? 43   LYS A C     1 
ATOM   307  O  O     . LYS A  1 43  ? 169.369 -4.662  234.463 1.00 65.27  ? 43   LYS A O     1 
ATOM   308  C  CB    . LYS A  1 43  ? 168.709 -2.290  236.566 1.00 63.13  ? 43   LYS A CB    1 
ATOM   309  C  CG    . LYS A  1 43  ? 170.200 -2.084  236.363 1.00 70.62  ? 43   LYS A CG    1 
ATOM   310  C  CD    . LYS A  1 43  ? 170.989 -2.172  237.643 1.00 68.28  ? 43   LYS A CD    1 
ATOM   311  C  CE    . LYS A  1 43  ? 172.464 -1.953  237.381 1.00 76.74  ? 43   LYS A CE    1 
ATOM   312  N  NZ    . LYS A  1 43  ? 173.173 -1.617  238.655 1.00 90.47  ? 43   LYS A NZ    1 
ATOM   313  N  N     . SER A  1 44  ? 167.700 -5.188  235.865 1.00 58.01  ? 44   SER A N     1 
ATOM   314  C  CA    . SER A  1 44  ? 168.041 -6.601  235.870 1.00 56.01  ? 44   SER A CA    1 
ATOM   315  C  C     . SER A  1 44  ? 167.699 -7.316  234.543 1.00 65.29  ? 44   SER A C     1 
ATOM   316  O  O     . SER A  1 44  ? 166.528 -7.546  234.214 1.00 62.63  ? 44   SER A O     1 
ATOM   317  C  CB    . SER A  1 44  ? 167.346 -7.284  237.039 1.00 53.04  ? 44   SER A CB    1 
ATOM   318  O  OG    . SER A  1 44  ? 167.069 -8.635  236.742 1.00 67.36  ? 44   SER A OG    1 
ATOM   319  N  N     . GLU A  1 45  ? 168.739 -7.670  233.791 1.00 69.83  ? 45   GLU A N     1 
ATOM   320  C  CA    . GLU A  1 45  ? 168.585 -8.407  232.533 1.00 70.93  ? 45   GLU A CA    1 
ATOM   321  C  C     . GLU A  1 45  ? 167.714 -9.648  232.685 1.00 67.87  ? 45   GLU A C     1 
ATOM   322  O  O     . GLU A  1 45  ? 166.858 -9.931  231.840 1.00 66.42  ? 45   GLU A O     1 
ATOM   323  C  CB    . GLU A  1 45  ? 169.954 -8.824  231.990 1.00 76.24  ? 45   GLU A CB    1 
ATOM   324  C  CG    . GLU A  1 45  ? 169.906 -9.651  230.711 1.00 74.82  ? 45   GLU A CG    1 
ATOM   325  C  CD    . GLU A  1 45  ? 171.269 -10.204 230.341 1.00 77.73  ? 45   GLU A CD    1 
ATOM   326  O  OE1   . GLU A  1 45  ? 172.214 -9.399  230.220 1.00 80.39  ? 45   GLU A OE1   1 
ATOM   327  O  OE2   . GLU A  1 45  ? 171.399 -11.440 230.196 1.00 77.81  ? 45   GLU A OE2   1 
ATOM   328  N  N     . ASN A  1 46  ? 167.943 -10.385 233.767 1.00 67.23  ? 46   ASN A N     1 
ATOM   329  C  CA    . ASN A  1 46  ? 167.244 -11.644 233.990 1.00 70.23  ? 46   ASN A CA    1 
ATOM   330  C  C     . ASN A  1 46  ? 165.759 -11.453 234.276 1.00 71.88  ? 46   ASN A C     1 
ATOM   331  O  O     . ASN A  1 46  ? 164.933 -12.238 233.806 1.00 72.28  ? 46   ASN A O     1 
ATOM   332  C  CB    . ASN A  1 46  ? 167.889 -12.426 235.137 1.00 73.82  ? 46   ASN A CB    1 
ATOM   333  C  CG    . ASN A  1 46  ? 167.096 -13.664 235.506 1.00 78.01  ? 46   ASN A CG    1 
ATOM   334  O  OD1   . ASN A  1 46  ? 166.302 -13.651 236.448 1.00 83.25  ? 46   ASN A OD1   1 
ATOM   335  N  ND2   . ASN A  1 46  ? 167.292 -14.738 234.750 1.00 81.07  ? 46   ASN A ND2   1 
ATOM   336  N  N     . LEU A  1 47  ? 165.414 -10.422 235.046 1.00 66.19  ? 47   LEU A N     1 
ATOM   337  C  CA    . LEU A  1 47  ? 164.006 -10.143 235.312 1.00 66.29  ? 47   LEU A CA    1 
ATOM   338  C  C     . LEU A  1 47  ? 163.302 -9.733  234.014 1.00 61.68  ? 47   LEU A C     1 
ATOM   339  O  O     . LEU A  1 47  ? 162.234 -10.254 233.678 1.00 62.19  ? 47   LEU A O     1 
ATOM   340  C  CB    . LEU A  1 47  ? 163.852 -9.050  236.372 1.00 58.69  ? 47   LEU A CB    1 
ATOM   341  C  CG    . LEU A  1 47  ? 162.409 -8.855  236.832 1.00 63.00  ? 47   LEU A CG    1 
ATOM   342  C  CD1   . LEU A  1 47  ? 161.969 -10.045 237.681 1.00 68.83  ? 47   LEU A CD1   1 
ATOM   343  C  CD2   . LEU A  1 47  ? 162.219 -7.534  237.570 1.00 59.00  ? 47   LEU A CD2   1 
ATOM   344  N  N     . ILE A  1 48  ? 163.915 -8.800  233.292 1.00 57.24  ? 48   ILE A N     1 
ATOM   345  C  CA    . ILE A  1 48  ? 163.449 -8.411  231.964 1.00 62.95  ? 48   ILE A CA    1 
ATOM   346  C  C     . ILE A  1 48  ? 163.234 -9.600  231.020 1.00 63.05  ? 48   ILE A C     1 
ATOM   347  O  O     . ILE A  1 48  ? 162.133 -9.793  230.500 1.00 58.73  ? 48   ILE A O     1 
ATOM   348  C  CB    . ILE A  1 48  ? 164.440 -7.439  231.303 1.00 64.15  ? 48   ILE A CB    1 
ATOM   349  C  CG1   . ILE A  1 48  ? 164.257 -6.037  231.871 1.00 58.82  ? 48   ILE A CG1   1 
ATOM   350  C  CG2   . ILE A  1 48  ? 164.218 -7.388  229.810 1.00 68.43  ? 48   ILE A CG2   1 
ATOM   351  C  CD1   . ILE A  1 48  ? 162.987 -5.366  231.390 1.00 53.56  ? 48   ILE A CD1   1 
ATOM   352  N  N     . LYS A  1 49  ? 164.277 -10.402 230.806 1.00 66.83  ? 49   LYS A N     1 
ATOM   353  C  CA    . LYS A  1 49  ? 164.231 -11.423 229.759 1.00 63.97  ? 49   LYS A CA    1 
ATOM   354  C  C     . LYS A  1 49  ? 163.572 -12.723 230.206 1.00 63.90  ? 49   LYS A C     1 
ATOM   355  O  O     . LYS A  1 49  ? 162.909 -13.376 229.405 1.00 66.78  ? 49   LYS A O     1 
ATOM   356  C  CB    . LYS A  1 49  ? 165.639 -11.707 229.232 1.00 63.14  ? 49   LYS A CB    1 
ATOM   357  C  CG    . LYS A  1 49  ? 166.343 -10.477 228.659 1.00 64.97  ? 49   LYS A CG    1 
ATOM   358  C  CD    . LYS A  1 49  ? 167.685 -10.814 227.998 1.00 61.61  ? 49   LYS A CD    1 
ATOM   359  C  CE    . LYS A  1 49  ? 168.254 -9.599  227.258 1.00 69.38  ? 49   LYS A CE    1 
ATOM   360  N  NZ    . LYS A  1 49  ? 169.691 -9.728  226.847 1.00 66.37  ? 49   LYS A NZ    1 
ATOM   361  N  N     . GLN A  1 50  ? 163.721 -13.093 231.477 1.00 65.75  ? 50   GLN A N     1 
ATOM   362  C  CA    . GLN A  1 50  ? 163.244 -14.407 231.922 1.00 69.02  ? 50   GLN A CA    1 
ATOM   363  C  C     . GLN A  1 50  ? 161.890 -14.395 232.635 1.00 70.27  ? 50   GLN A C     1 
ATOM   364  O  O     . GLN A  1 50  ? 161.245 -15.439 232.743 1.00 69.32  ? 50   GLN A O     1 
ATOM   365  C  CB    . GLN A  1 50  ? 164.283 -15.073 232.831 1.00 75.32  ? 50   GLN A CB    1 
ATOM   366  C  CG    . GLN A  1 50  ? 165.188 -16.112 232.136 1.00 80.12  ? 50   GLN A CG    1 
ATOM   367  C  CD    . GLN A  1 50  ? 164.465 -16.960 231.085 1.00 85.81  ? 50   GLN A CD    1 
ATOM   368  O  OE1   . GLN A  1 50  ? 163.587 -17.772 231.409 1.00 85.81  ? 50   GLN A OE1   1 
ATOM   369  N  NE2   . GLN A  1 50  ? 164.850 -16.786 229.819 1.00 79.82  ? 50   GLN A NE2   1 
ATOM   370  N  N     . HIS A  1 51  ? 161.443 -13.235 233.108 1.00 68.43  ? 51   HIS A N     1 
ATOM   371  C  CA    . HIS A  1 51  ? 160.140 -13.166 233.784 1.00 67.05  ? 51   HIS A CA    1 
ATOM   372  C  C     . HIS A  1 51  ? 159.148 -12.221 233.094 1.00 60.17  ? 51   HIS A C     1 
ATOM   373  O  O     . HIS A  1 51  ? 158.016 -12.610 232.763 1.00 56.22  ? 51   HIS A O     1 
ATOM   374  C  CB    . HIS A  1 51  ? 160.346 -12.778 235.247 1.00 62.50  ? 51   HIS A CB    1 
ATOM   375  C  CG    . HIS A  1 51  ? 161.232 -13.735 235.984 1.00 73.08  ? 51   HIS A CG    1 
ATOM   376  N  ND1   . HIS A  1 51  ? 160.764 -14.921 236.514 1.00 71.31  ? 51   HIS A ND1   1 
ATOM   377  C  CD2   . HIS A  1 51  ? 162.562 -13.707 236.239 1.00 75.83  ? 51   HIS A CD2   1 
ATOM   378  C  CE1   . HIS A  1 51  ? 161.765 -15.569 237.083 1.00 78.98  ? 51   HIS A CE1   1 
ATOM   379  N  NE2   . HIS A  1 51  ? 162.868 -14.856 236.931 1.00 76.66  ? 51   HIS A NE2   1 
ATOM   380  N  N     . ILE A  1 52  ? 159.575 -10.993 232.842 1.00 56.73  ? 52   ILE A N     1 
ATOM   381  C  CA    . ILE A  1 52  ? 158.668 -10.020 232.262 1.00 55.85  ? 52   ILE A CA    1 
ATOM   382  C  C     . ILE A  1 52  ? 158.344 -10.346 230.798 1.00 55.01  ? 52   ILE A C     1 
ATOM   383  O  O     . ILE A  1 52  ? 157.162 -10.446 230.442 1.00 55.45  ? 52   ILE A O     1 
ATOM   384  C  CB    . ILE A  1 52  ? 159.239 -8.599  232.384 1.00 55.27  ? 52   ILE A CB    1 
ATOM   385  C  CG1   . ILE A  1 52  ? 159.494 -8.267  233.855 1.00 53.67  ? 52   ILE A CG1   1 
ATOM   386  C  CG2   . ILE A  1 52  ? 158.291 -7.583  231.779 1.00 48.44  ? 52   ILE A CG2   1 
ATOM   387  C  CD1   . ILE A  1 52  ? 160.088 -6.908  234.068 1.00 47.42  ? 52   ILE A CD1   1 
ATOM   388  N  N     . ALA A  1 53  ? 159.372 -10.532 229.964 1.00 54.88  ? 53   ALA A N     1 
ATOM   389  C  CA    . ALA A  1 53  ? 159.168 -10.780 228.524 1.00 52.37  ? 53   ALA A CA    1 
ATOM   390  C  C     . ALA A  1 53  ? 158.293 -12.012 228.242 1.00 51.07  ? 53   ALA A C     1 
ATOM   391  O  O     . ALA A  1 53  ? 157.363 -11.918 227.454 1.00 53.71  ? 53   ALA A O     1 
ATOM   392  C  CB    . ALA A  1 53  ? 160.514 -10.901 227.800 1.00 50.64  ? 53   ALA A CB    1 
ATOM   393  N  N     . PRO A  1 54  ? 158.561 -13.162 228.895 1.00 59.33  ? 54   PRO A N     1 
ATOM   394  C  CA    . PRO A  1 54  ? 157.621 -14.269 228.667 1.00 52.92  ? 54   PRO A CA    1 
ATOM   395  C  C     . PRO A  1 54  ? 156.181 -13.946 229.023 1.00 53.37  ? 54   PRO A C     1 
ATOM   396  O  O     . PRO A  1 54  ? 155.284 -14.558 228.445 1.00 56.87  ? 54   PRO A O     1 
ATOM   397  C  CB    . PRO A  1 54  ? 158.156 -15.373 229.580 1.00 54.74  ? 54   PRO A CB    1 
ATOM   398  C  CG    . PRO A  1 54  ? 159.608 -15.104 229.663 1.00 58.53  ? 54   PRO A CG    1 
ATOM   399  C  CD    . PRO A  1 54  ? 159.741 -13.608 229.665 1.00 58.52  ? 54   PRO A CD    1 
ATOM   400  N  N     . LEU A  1 55  ? 155.950 -13.018 229.948 1.00 55.95  ? 55   LEU A N     1 
ATOM   401  C  CA    . LEU A  1 55  ? 154.578 -12.641 230.287 1.00 54.98  ? 55   LEU A CA    1 
ATOM   402  C  C     . LEU A  1 55  ? 153.971 -11.778 229.184 1.00 51.20  ? 55   LEU A C     1 
ATOM   403  O  O     . LEU A  1 55  ? 152.835 -12.000 228.772 1.00 49.91  ? 55   LEU A O     1 
ATOM   404  C  CB    . LEU A  1 55  ? 154.511 -11.901 231.632 1.00 50.15  ? 55   LEU A CB    1 
ATOM   405  C  CG    . LEU A  1 55  ? 154.732 -12.677 232.934 1.00 55.85  ? 55   LEU A CG    1 
ATOM   406  C  CD1   . LEU A  1 55  ? 154.883 -11.726 234.114 1.00 52.24  ? 55   LEU A CD1   1 
ATOM   407  C  CD2   . LEU A  1 55  ? 153.604 -13.661 233.208 1.00 55.89  ? 55   LEU A CD2   1 
ATOM   408  N  N     . MET A  1 56  ? 154.726 -10.786 228.719 1.00 51.50  ? 56   MET A N     1 
ATOM   409  C  CA    . MET A  1 56  ? 154.280 -9.930  227.618 1.00 52.04  ? 56   MET A CA    1 
ATOM   410  C  C     . MET A  1 56  ? 154.089 -10.754 226.352 1.00 54.39  ? 56   MET A C     1 
ATOM   411  O  O     . MET A  1 56  ? 153.159 -10.525 225.567 1.00 53.84  ? 56   MET A O     1 
ATOM   412  C  CB    . MET A  1 56  ? 155.289 -8.800  227.360 1.00 48.03  ? 56   MET A CB    1 
ATOM   413  C  CG    . MET A  1 56  ? 154.861 -7.770  226.308 1.00 45.88  ? 56   MET A CG    1 
ATOM   414  S  SD    . MET A  1 56  ? 153.478 -6.684  226.793 1.00 48.38  ? 56   MET A SD    1 
ATOM   415  C  CE    . MET A  1 56  ? 154.303 -5.595  227.967 1.00 41.44  ? 56   MET A CE    1 
ATOM   416  N  N     . GLN A  1 57  ? 154.985 -11.714 226.159 1.00 54.96  ? 57   GLN A N     1 
ATOM   417  C  CA    . GLN A  1 57  ? 154.934 -12.567 224.983 1.00 59.71  ? 57   GLN A CA    1 
ATOM   418  C  C     . GLN A  1 57  ? 153.639 -13.357 224.989 1.00 58.69  ? 57   GLN A C     1 
ATOM   419  O  O     . GLN A  1 57  ? 152.953 -13.469 223.972 1.00 61.26  ? 57   GLN A O     1 
ATOM   420  C  CB    . GLN A  1 57  ? 156.137 -13.508 224.938 1.00 60.00  ? 57   GLN A CB    1 
ATOM   421  C  CG    . GLN A  1 57  ? 156.171 -14.358 223.683 1.00 59.37  ? 57   GLN A CG    1 
ATOM   422  C  CD    . GLN A  1 57  ? 156.169 -13.519 222.435 1.00 57.47  ? 57   GLN A CD    1 
ATOM   423  O  OE1   . GLN A  1 57  ? 157.155 -12.840 222.126 1.00 59.59  ? 57   GLN A OE1   1 
ATOM   424  N  NE2   . GLN A  1 57  ? 155.044 -13.523 221.726 1.00 57.08  ? 57   GLN A NE2   1 
ATOM   425  N  N     . PHE A  1 58  ? 153.298 -13.884 226.153 1.00 54.36  ? 58   PHE A N     1 
ATOM   426  C  CA    . PHE A  1 58  ? 152.074 -14.651 226.287 1.00 58.31  ? 58   PHE A CA    1 
ATOM   427  C  C     . PHE A  1 58  ? 150.858 -13.784 225.968 1.00 60.34  ? 58   PHE A C     1 
ATOM   428  O  O     . PHE A  1 58  ? 149.991 -14.185 225.191 1.00 63.33  ? 58   PHE A O     1 
ATOM   429  C  CB    . PHE A  1 58  ? 151.976 -15.242 227.698 1.00 60.50  ? 58   PHE A CB    1 
ATOM   430  C  CG    . PHE A  1 58  ? 150.638 -15.832 228.010 1.00 66.12  ? 58   PHE A CG    1 
ATOM   431  C  CD1   . PHE A  1 58  ? 150.291 -17.089 227.530 1.00 69.54  ? 58   PHE A CD1   1 
ATOM   432  C  CD2   . PHE A  1 58  ? 149.716 -15.128 228.778 1.00 66.73  ? 58   PHE A CD2   1 
ATOM   433  C  CE1   . PHE A  1 58  ? 149.048 -17.639 227.819 1.00 74.38  ? 58   PHE A CE1   1 
ATOM   434  C  CE2   . PHE A  1 58  ? 148.473 -15.670 229.063 1.00 74.23  ? 58   PHE A CE2   1 
ATOM   435  C  CZ    . PHE A  1 58  ? 148.139 -16.926 228.584 1.00 74.71  ? 58   PHE A CZ    1 
ATOM   436  N  N     . LEU A  1 59  ? 150.806 -12.593 226.567 1.00 58.85  ? 59   LEU A N     1 
ATOM   437  C  CA    . LEU A  1 59  ? 149.735 -11.636 226.300 1.00 57.84  ? 59   LEU A CA    1 
ATOM   438  C  C     . LEU A  1 59  ? 149.711 -11.233 224.813 1.00 55.02  ? 59   LEU A C     1 
ATOM   439  O  O     . LEU A  1 59  ? 148.650 -11.186 224.199 1.00 57.52  ? 59   LEU A O     1 
ATOM   440  C  CB    . LEU A  1 59  ? 149.887 -10.390 227.189 1.00 52.22  ? 59   LEU A CB    1 
ATOM   441  C  CG    . LEU A  1 59  ? 148.842 -9.292  226.963 1.00 44.02  ? 59   LEU A CG    1 
ATOM   442  C  CD1   . LEU A  1 59  ? 147.463 -9.772  227.375 1.00 49.56  ? 59   LEU A CD1   1 
ATOM   443  C  CD2   . LEU A  1 59  ? 149.191 -8.025  227.695 1.00 49.67  ? 59   LEU A CD2   1 
ATOM   444  N  N     . ILE A  1 60  ? 150.875 -10.939 224.241 1.00 52.16  ? 60   ILE A N     1 
ATOM   445  C  CA    . ILE A  1 60  ? 150.949 -10.649 222.802 1.00 59.63  ? 60   ILE A CA    1 
ATOM   446  C  C     . ILE A  1 60  ? 150.301 -11.750 221.941 1.00 61.80  ? 60   ILE A C     1 
ATOM   447  O  O     . ILE A  1 60  ? 149.430 -11.463 221.115 1.00 60.09  ? 60   ILE A O     1 
ATOM   448  C  CB    . ILE A  1 60  ? 152.400 -10.455 222.343 1.00 56.86  ? 60   ILE A CB    1 
ATOM   449  C  CG1   . ILE A  1 60  ? 152.856 -9.034  222.640 1.00 54.34  ? 60   ILE A CG1   1 
ATOM   450  C  CG2   . ILE A  1 60  ? 152.540 -10.686 220.850 1.00 62.38  ? 60   ILE A CG2   1 
ATOM   451  C  CD1   . ILE A  1 60  ? 154.322 -8.817  222.270 1.00 59.06  ? 60   ILE A CD1   1 
ATOM   452  N  N     . ASP A  1 61  ? 150.712 -13.000 222.155 1.00 61.18  ? 61   ASP A N     1 
ATOM   453  C  CA    . ASP A  1 61  ? 150.147 -14.130 221.422 1.00 60.61  ? 61   ASP A CA    1 
ATOM   454  C  C     . ASP A  1 61  ? 148.641 -14.233 221.596 1.00 62.05  ? 61   ASP A C     1 
ATOM   455  O  O     . ASP A  1 61  ? 147.920 -14.446 220.632 1.00 66.31  ? 61   ASP A O     1 
ATOM   456  C  CB    . ASP A  1 61  ? 150.788 -15.447 221.860 1.00 54.27  ? 61   ASP A CB    1 
ATOM   457  C  CG    . ASP A  1 61  ? 152.270 -15.465 221.647 1.00 58.62  ? 61   ASP A CG    1 
ATOM   458  O  OD1   . ASP A  1 61  ? 152.784 -14.562 220.955 1.00 56.69  ? 61   ASP A OD1   1 
ATOM   459  O  OD2   . ASP A  1 61  ? 152.928 -16.384 222.168 1.00 66.05  ? 61   ASP A OD2   1 
ATOM   460  N  N     . GLU A  1 62  ? 148.168 -14.082 222.826 1.00 59.41  ? 62   GLU A N     1 
ATOM   461  C  CA    . GLU A  1 62  ? 146.749 -14.240 223.103 1.00 60.78  ? 62   GLU A CA    1 
ATOM   462  C  C     . GLU A  1 62  ? 145.914 -13.104 222.519 1.00 63.47  ? 62   GLU A C     1 
ATOM   463  O  O     . GLU A  1 62  ? 144.706 -13.246 222.346 1.00 70.29  ? 62   GLU A O     1 
ATOM   464  C  CB    . GLU A  1 62  ? 146.504 -14.329 224.610 1.00 66.58  ? 62   GLU A CB    1 
ATOM   465  C  CG    . GLU A  1 62  ? 145.334 -15.222 224.997 1.00 73.53  ? 62   GLU A CG    1 
ATOM   466  C  CD    . GLU A  1 62  ? 145.756 -16.668 225.214 1.00 79.92  ? 62   GLU A CD    1 
ATOM   467  O  OE1   . GLU A  1 62  ? 146.940 -16.997 224.957 1.00 81.36  ? 62   GLU A OE1   1 
ATOM   468  O  OE2   . GLU A  1 62  ? 144.910 -17.473 225.659 1.00 80.96  ? 62   GLU A OE2   1 
ATOM   469  N  N     . LEU A  1 63  ? 146.547 -11.971 222.234 1.00 62.70  ? 63   LEU A N     1 
ATOM   470  C  CA    . LEU A  1 63  ? 145.833 -10.832 221.655 1.00 63.00  ? 63   LEU A CA    1 
ATOM   471  C  C     . LEU A  1 63  ? 146.027 -10.794 220.139 1.00 67.52  ? 63   LEU A C     1 
ATOM   472  O  O     . LEU A  1 63  ? 145.471 -9.947  219.436 1.00 65.83  ? 63   LEU A O     1 
ATOM   473  C  CB    . LEU A  1 63  ? 146.319 -9.528  222.277 1.00 60.42  ? 63   LEU A CB    1 
ATOM   474  C  CG    . LEU A  1 63  ? 145.909 -9.260  223.718 1.00 61.97  ? 63   LEU A CG    1 
ATOM   475  C  CD1   . LEU A  1 63  ? 146.397 -7.878  224.142 1.00 58.48  ? 63   LEU A CD1   1 
ATOM   476  C  CD2   . LEU A  1 63  ? 144.404 -9.374  223.860 1.00 56.59  ? 63   LEU A CD2   1 
ATOM   477  N  N     . ASN A  1 64  ? 146.824 -11.736 219.657 1.00 66.02  ? 64   ASN A N     1 
ATOM   478  C  CA    . ASN A  1 64  ? 147.297 -11.753 218.288 1.00 67.69  ? 64   ASN A CA    1 
ATOM   479  C  C     . ASN A  1 64  ? 147.836 -10.405 217.838 1.00 72.14  ? 64   ASN A C     1 
ATOM   480  O  O     . ASN A  1 64  ? 147.552 -9.928  216.734 1.00 69.24  ? 64   ASN A O     1 
ATOM   481  C  CB    . ASN A  1 64  ? 146.210 -12.229 217.342 1.00 71.20  ? 64   ASN A CB    1 
ATOM   482  C  CG    . ASN A  1 64  ? 146.687 -13.374 216.484 1.00 86.24  ? 64   ASN A CG    1 
ATOM   483  O  OD1   . ASN A  1 64  ? 146.938 -14.476 216.991 1.00 87.62  ? 64   ASN A OD1   1 
ATOM   484  N  ND2   . ASN A  1 64  ? 146.865 -13.116 215.188 1.00 84.02  ? 64   ASN A ND2   1 
ATOM   485  N  N     . VAL A  1 65  ? 148.602 -9.789  218.727 1.00 65.31  ? 65   VAL A N     1 
ATOM   486  C  CA    . VAL A  1 65  ? 149.491 -8.720  218.340 1.00 65.73  ? 65   VAL A CA    1 
ATOM   487  C  C     . VAL A  1 65  ? 150.688 -9.421  217.723 1.00 63.47  ? 65   VAL A C     1 
ATOM   488  O  O     . VAL A  1 65  ? 151.095 -10.475 218.202 1.00 67.94  ? 65   VAL A O     1 
ATOM   489  C  CB    . VAL A  1 65  ? 149.895 -7.846  219.543 1.00 59.13  ? 65   VAL A CB    1 
ATOM   490  C  CG1   . VAL A  1 65  ? 151.025 -6.903  219.173 1.00 52.17  ? 65   VAL A CG1   1 
ATOM   491  C  CG2   . VAL A  1 65  ? 148.689 -7.075  220.063 1.00 56.45  ? 65   VAL A CG2   1 
ATOM   492  N  N     . LYS A  1 66  ? 151.240 -8.879  216.651 1.00 57.55  ? 66   LYS A N     1 
ATOM   493  C  CA    . LYS A  1 66  ? 152.311 -9.596  215.980 1.00 69.66  ? 66   LYS A CA    1 
ATOM   494  C  C     . LYS A  1 66  ? 153.530 -8.699  215.881 1.00 69.14  ? 66   LYS A C     1 
ATOM   495  O  O     . LYS A  1 66  ? 154.450 -8.932  215.083 1.00 68.18  ? 66   LYS A O     1 
ATOM   496  C  CB    . LYS A  1 66  ? 151.855 -10.103 214.601 1.00 75.23  ? 66   LYS A CB    1 
ATOM   497  C  CG    . LYS A  1 66  ? 152.048 -11.622 214.417 1.00 83.01  ? 66   LYS A CG    1 
ATOM   498  C  CD    . LYS A  1 66  ? 150.791 -12.328 213.893 1.00 80.99  ? 66   LYS A CD    1 
ATOM   499  C  CE    . LYS A  1 66  ? 150.828 -13.829 214.196 1.00 82.32  ? 66   LYS A CE    1 
ATOM   500  N  NZ    . LYS A  1 66  ? 150.828 -14.107 215.666 1.00 85.49  ? 66   LYS A NZ    1 
ATOM   501  N  N     . SER A  1 67  ? 153.531 -7.673  216.722 1.00 57.29  ? 67   SER A N     1 
ATOM   502  C  CA    . SER A  1 67  ? 154.727 -6.882  216.929 1.00 53.78  ? 67   SER A CA    1 
ATOM   503  C  C     . SER A  1 67  ? 155.728 -7.752  217.671 1.00 53.99  ? 67   SER A C     1 
ATOM   504  O  O     . SER A  1 67  ? 155.354 -8.748  218.305 1.00 54.89  ? 67   SER A O     1 
ATOM   505  C  CB    . SER A  1 67  ? 154.414 -5.603  217.709 1.00 53.82  ? 67   SER A CB    1 
ATOM   506  O  OG    . SER A  1 67  ? 153.588 -4.722  216.955 1.00 49.94  ? 67   SER A OG    1 
ATOM   507  N  N     . LYS A  1 68  ? 157.001 -7.399  217.577 1.00 53.78  ? 68   LYS A N     1 
ATOM   508  C  CA    . LYS A  1 68  ? 158.011 -8.119  218.330 1.00 56.08  ? 68   LYS A CA    1 
ATOM   509  C  C     . LYS A  1 68  ? 158.268 -7.497  219.720 1.00 56.98  ? 68   LYS A C     1 
ATOM   510  O  O     . LYS A  1 68  ? 158.020 -6.303  219.960 1.00 49.69  ? 68   LYS A O     1 
ATOM   511  C  CB    . LYS A  1 68  ? 159.312 -8.172  217.540 1.00 53.09  ? 68   LYS A CB    1 
ATOM   512  C  CG    . LYS A  1 68  ? 160.371 -7.282  218.129 1.00 67.22  ? 68   LYS A CG    1 
ATOM   513  C  CD    . LYS A  1 68  ? 161.782 -7.707  217.752 1.00 70.80  ? 68   LYS A CD    1 
ATOM   514  C  CE    . LYS A  1 68  ? 161.956 -7.665  216.252 1.00 70.20  ? 68   LYS A CE    1 
ATOM   515  N  NZ    . LYS A  1 68  ? 163.370 -7.929  215.868 1.00 77.03  ? 68   LYS A NZ    1 
ATOM   516  N  N     . ILE A  1 69  ? 158.760 -8.319  220.641 1.00 60.67  ? 69   ILE A N     1 
ATOM   517  C  CA    . ILE A  1 69  ? 159.287 -7.807  221.892 1.00 50.97  ? 69   ILE A CA    1 
ATOM   518  C  C     . ILE A  1 69  ? 160.743 -7.379  221.690 1.00 54.39  ? 69   ILE A C     1 
ATOM   519  O  O     . ILE A  1 69  ? 161.660 -8.201  221.683 1.00 59.91  ? 69   ILE A O     1 
ATOM   520  C  CB    . ILE A  1 69  ? 159.174 -8.844  223.022 1.00 56.12  ? 69   ILE A CB    1 
ATOM   521  C  CG1   . ILE A  1 69  ? 157.702 -9.041  223.413 1.00 53.81  ? 69   ILE A CG1   1 
ATOM   522  C  CG2   . ILE A  1 69  ? 159.990 -8.409  224.242 1.00 55.47  ? 69   ILE A CG2   1 
ATOM   523  C  CD1   . ILE A  1 69  ? 157.482 -10.038 224.542 1.00 47.25  ? 69   ILE A CD1   1 
ATOM   524  N  N     . GLN A  1 70  ? 160.946 -6.087  221.479 1.00 46.91  ? 70   GLN A N     1 
ATOM   525  C  CA    . GLN A  1 70  ? 162.284 -5.533  221.477 1.00 47.73  ? 70   GLN A CA    1 
ATOM   526  C  C     . GLN A  1 70  ? 162.839 -5.430  222.896 1.00 55.39  ? 70   GLN A C     1 
ATOM   527  O  O     . GLN A  1 70  ? 162.123 -5.058  223.836 1.00 55.78  ? 70   GLN A O     1 
ATOM   528  C  CB    . GLN A  1 70  ? 162.293 -4.161  220.822 1.00 45.13  ? 70   GLN A CB    1 
ATOM   529  C  CG    . GLN A  1 70  ? 161.814 -4.161  219.376 1.00 45.25  ? 70   GLN A CG    1 
ATOM   530  C  CD    . GLN A  1 70  ? 161.742 -2.763  218.826 1.00 49.52  ? 70   GLN A CD    1 
ATOM   531  O  OE1   . GLN A  1 70  ? 162.738 -2.037  218.814 1.00 53.51  ? 70   GLN A OE1   1 
ATOM   532  N  NE2   . GLN A  1 70  ? 160.555 -2.354  218.407 1.00 47.32  ? 70   GLN A NE2   1 
ATOM   533  N  N     . ILE A  1 71  ? 164.112 -5.782  223.050 1.00 49.17  ? 71   ILE A N     1 
ATOM   534  C  CA    . ILE A  1 71  ? 164.848 -5.503  224.271 1.00 52.45  ? 71   ILE A CA    1 
ATOM   535  C  C     . ILE A  1 71  ? 166.090 -4.702  223.918 1.00 53.40  ? 71   ILE A C     1 
ATOM   536  O  O     . ILE A  1 71  ? 167.050 -5.222  223.363 1.00 58.98  ? 71   ILE A O     1 
ATOM   537  C  CB    . ILE A  1 71  ? 165.213 -6.779  225.029 1.00 51.74  ? 71   ILE A CB    1 
ATOM   538  C  CG1   . ILE A  1 71  ? 163.938 -7.489  225.476 1.00 53.00  ? 71   ILE A CG1   1 
ATOM   539  C  CG2   . ILE A  1 71  ? 165.981 -6.433  226.260 1.00 57.42  ? 71   ILE A CG2   1 
ATOM   540  C  CD1   . ILE A  1 71  ? 164.142 -8.901  225.892 1.00 54.35  ? 71   ILE A CD1   1 
ATOM   541  N  N     . VAL A  1 72  ? 166.032 -3.412  224.214 1.00 52.75  ? 72   VAL A N     1 
ATOM   542  C  CA    . VAL A  1 72  ? 167.111 -2.493  223.931 1.00 52.08  ? 72   VAL A CA    1 
ATOM   543  C  C     . VAL A  1 72  ? 167.971 -2.275  225.169 1.00 61.85  ? 72   VAL A C     1 
ATOM   544  O  O     . VAL A  1 72  ? 167.484 -1.778  226.190 1.00 58.60  ? 72   VAL A O     1 
ATOM   545  C  CB    . VAL A  1 72  ? 166.567 -1.146  223.457 1.00 55.22  ? 72   VAL A CB    1 
ATOM   546  C  CG1   . VAL A  1 72  ? 167.709 -0.178  223.174 1.00 45.91  ? 72   VAL A CG1   1 
ATOM   547  C  CG2   . VAL A  1 72  ? 165.673 -1.341  222.238 1.00 55.04  ? 72   VAL A CG2   1 
ATOM   548  N  N     . LYS A  1 73  ? 169.246 -2.651  225.086 1.00 64.52  ? 73   LYS A N     1 
ATOM   549  C  CA    . LYS A  1 73  ? 170.175 -2.440  226.190 1.00 65.44  ? 73   LYS A CA    1 
ATOM   550  C  C     . LYS A  1 73  ? 170.658 -0.996  226.160 1.00 61.84  ? 73   LYS A C     1 
ATOM   551  O  O     . LYS A  1 73  ? 171.242 -0.538  225.185 1.00 71.81  ? 73   LYS A O     1 
ATOM   552  C  CB    . LYS A  1 73  ? 171.352 -3.423  226.120 1.00 71.13  ? 73   LYS A CB    1 
ATOM   553  C  CG    . LYS A  1 73  ? 172.651 -2.913  226.760 1.00 76.64  ? 73   LYS A CG    1 
ATOM   554  C  CD    . LYS A  1 73  ? 173.335 -3.973  227.637 1.00 74.99  ? 73   LYS A CD    1 
ATOM   555  C  CE    . LYS A  1 73  ? 174.696 -3.486  228.155 1.00 75.84  ? 73   LYS A CE    1 
ATOM   556  N  NZ    . LYS A  1 73  ? 175.305 -2.415  227.306 1.00 77.56  ? 73   LYS A NZ    1 
ATOM   557  N  N     . GLY A  1 74  ? 170.393 -0.266  227.228 1.00 54.64  ? 74   GLY A N     1 
ATOM   558  C  CA    . GLY A  1 74  ? 170.750 1.134   227.269 1.00 60.75  ? 74   GLY A CA    1 
ATOM   559  C  C     . GLY A  1 74  ? 171.789 1.398   228.336 1.00 67.77  ? 74   GLY A C     1 
ATOM   560  O  O     . GLY A  1 74  ? 172.166 0.487   229.079 1.00 70.09  ? 74   GLY A O     1 
ATOM   561  N  N     . ASP A  1 75  ? 172.267 2.642   228.368 1.00 68.99  ? 75   ASP A N     1 
ATOM   562  C  CA    . ASP A  1 75  ? 173.061 3.196   229.469 1.00 78.82  ? 75   ASP A CA    1 
ATOM   563  C  C     . ASP A  1 75  ? 172.911 2.462   230.786 1.00 77.50  ? 75   ASP A C     1 
ATOM   564  O  O     . ASP A  1 75  ? 173.732 1.634   231.189 1.00 75.01  ? 75   ASP A O     1 
ATOM   565  C  CB    . ASP A  1 75  ? 172.648 4.650   229.728 1.00 82.08  ? 75   ASP A CB    1 
ATOM   566  C  CG    . ASP A  1 75  ? 173.521 5.655   229.021 1.00 92.33  ? 75   ASP A CG    1 
ATOM   567  O  OD1   . ASP A  1 75  ? 174.760 5.447   228.946 1.00 91.78  ? 75   ASP A OD1   1 
ATOM   568  O  OD2   . ASP A  1 75  ? 172.948 6.673   228.561 1.00 89.34  ? 75   ASP A OD2   1 
ATOM   569  N  N     . THR A  1 76  ? 171.808 2.785   231.438 1.00 72.27  ? 76   THR A N     1 
ATOM   570  C  CA    . THR A  1 76  ? 171.640 2.505   232.840 1.00 69.92  ? 76   THR A CA    1 
ATOM   571  C  C     . THR A  1 76  ? 170.652 1.375   233.057 1.00 65.49  ? 76   THR A C     1 
ATOM   572  O  O     . THR A  1 76  ? 170.341 1.016   234.196 1.00 64.87  ? 76   THR A O     1 
ATOM   573  C  CB    . THR A  1 76  ? 171.172 3.769   233.557 1.00 62.95  ? 76   THR A CB    1 
ATOM   574  O  OG1   . THR A  1 76  ? 169.869 4.124   233.079 1.00 66.29  ? 76   THR A OG1   1 
ATOM   575  C  CG2   . THR A  1 76  ? 172.131 4.925   233.249 1.00 58.83  ? 76   THR A CG2   1 
ATOM   576  N  N     . ARG A  1 77  ? 170.194 0.778   231.962 1.00 67.12  ? 77   ARG A N     1 
ATOM   577  C  CA    . ARG A  1 77  ? 168.997 -0.040  232.057 1.00 63.37  ? 77   ARG A CA    1 
ATOM   578  C  C     . ARG A  1 77  ? 168.558 -0.698  230.755 1.00 59.72  ? 77   ARG A C     1 
ATOM   579  O  O     . ARG A  1 77  ? 168.721 -0.134  229.679 1.00 57.51  ? 77   ARG A O     1 
ATOM   580  C  CB    . ARG A  1 77  ? 167.867 0.842   232.570 1.00 61.44  ? 77   ARG A CB    1 
ATOM   581  C  CG    . ARG A  1 77  ? 166.701 0.825   231.663 1.00 60.79  ? 77   ARG A CG    1 
ATOM   582  C  CD    . ARG A  1 77  ? 165.991 2.126   231.660 1.00 62.29  ? 77   ARG A CD    1 
ATOM   583  N  NE    . ARG A  1 77  ? 166.609 3.221   230.923 1.00 56.43  ? 77   ARG A NE    1 
ATOM   584  C  CZ    . ARG A  1 77  ? 166.643 3.347   229.595 1.00 65.68  ? 77   ARG A CZ    1 
ATOM   585  N  NH1   . ARG A  1 77  ? 166.185 2.403   228.761 1.00 51.09  ? 77   ARG A NH1   1 
ATOM   586  N  NH2   . ARG A  1 77  ? 167.201 4.439   229.088 1.00 72.56  ? 77   ARG A NH2   1 
ATOM   587  N  N     . TYR A  1 78  ? 167.981 -1.885  230.884 1.00 53.58  ? 78   TYR A N     1 
ATOM   588  C  CA    . TYR A  1 78  ? 167.311 -2.544  229.788 1.00 56.97  ? 78   TYR A CA    1 
ATOM   589  C  C     . TYR A  1 78  ? 165.916 -1.954  229.547 1.00 59.00  ? 78   TYR A C     1 
ATOM   590  O  O     . TYR A  1 78  ? 165.199 -1.612  230.496 1.00 50.81  ? 78   TYR A O     1 
ATOM   591  C  CB    . TYR A  1 78  ? 167.209 -4.037  230.074 1.00 59.68  ? 78   TYR A CB    1 
ATOM   592  C  CG    . TYR A  1 78  ? 168.531 -4.760  229.980 1.00 68.97  ? 78   TYR A CG    1 
ATOM   593  C  CD1   . TYR A  1 78  ? 169.035 -5.168  228.748 1.00 70.09  ? 78   TYR A CD1   1 
ATOM   594  C  CD2   . TYR A  1 78  ? 169.272 -5.053  231.122 1.00 69.83  ? 78   TYR A CD2   1 
ATOM   595  C  CE1   . TYR A  1 78  ? 170.245 -5.839  228.655 1.00 71.87  ? 78   TYR A CE1   1 
ATOM   596  C  CE2   . TYR A  1 78  ? 170.482 -5.714  231.037 1.00 73.66  ? 78   TYR A CE2   1 
ATOM   597  C  CZ    . TYR A  1 78  ? 170.959 -6.110  229.803 1.00 75.57  ? 78   TYR A CZ    1 
ATOM   598  O  OH    . TYR A  1 78  ? 172.157 -6.773  229.715 1.00 82.60  ? 78   TYR A OH    1 
ATOM   599  N  N     . GLU A  1 79  ? 165.538 -1.850  228.271 1.00 55.25  ? 79   GLU A N     1 
ATOM   600  C  CA    . GLU A  1 79  ? 164.204 -1.412  227.888 1.00 49.11  ? 79   GLU A CA    1 
ATOM   601  C  C     . GLU A  1 79  ? 163.479 -2.498  227.087 1.00 51.46  ? 79   GLU A C     1 
ATOM   602  O  O     . GLU A  1 79  ? 163.863 -2.813  225.961 1.00 49.53  ? 79   GLU A O     1 
ATOM   603  C  CB    . GLU A  1 79  ? 164.264 -0.103  227.082 1.00 45.61  ? 79   GLU A CB    1 
ATOM   604  C  CG    . GLU A  1 79  ? 162.915 0.297   226.465 1.00 50.79  ? 79   GLU A CG    1 
ATOM   605  C  CD    . GLU A  1 79  ? 163.012 1.356   225.358 1.00 52.58  ? 79   GLU A CD    1 
ATOM   606  O  OE1   . GLU A  1 79  ? 164.138 1.810   225.037 1.00 58.43  ? 79   GLU A OE1   1 
ATOM   607  O  OE2   . GLU A  1 79  ? 161.952 1.728   224.802 1.00 50.29  ? 79   GLU A OE2   1 
ATOM   608  N  N     . LEU A  1 80  ? 162.443 -3.087  227.684 1.00 48.67  ? 80   LEU A N     1 
ATOM   609  C  CA    . LEU A  1 80  ? 161.542 -3.954  226.930 1.00 47.18  ? 80   LEU A CA    1 
ATOM   610  C  C     . LEU A  1 80  ? 160.524 -3.049  226.257 1.00 47.35  ? 80   LEU A C     1 
ATOM   611  O  O     . LEU A  1 80  ? 159.904 -2.204  226.904 1.00 46.37  ? 80   LEU A O     1 
ATOM   612  C  CB    . LEU A  1 80  ? 160.866 -5.005  227.826 1.00 41.69  ? 80   LEU A CB    1 
ATOM   613  C  CG    . LEU A  1 80  ? 159.760 -5.899  227.250 1.00 50.15  ? 80   LEU A CG    1 
ATOM   614  C  CD1   . LEU A  1 80  ? 159.719 -7.246  227.956 1.00 50.53  ? 80   LEU A CD1   1 
ATOM   615  C  CD2   . LEU A  1 80  ? 158.382 -5.238  227.344 1.00 46.80  ? 80   LEU A CD2   1 
ATOM   616  N  N     . ARG A  1 81  ? 160.380 -3.219  224.948 1.00 50.27  ? 81   ARG A N     1 
ATOM   617  C  CA    . ARG A  1 81  ? 159.532 -2.359  224.147 1.00 43.12  ? 81   ARG A CA    1 
ATOM   618  C  C     . ARG A  1 81  ? 158.700 -3.159  223.154 1.00 49.07  ? 81   ARG A C     1 
ATOM   619  O  O     . ARG A  1 81  ? 159.202 -4.066  222.484 1.00 48.40  ? 81   ARG A O     1 
ATOM   620  C  CB    . ARG A  1 81  ? 160.376 -1.337  223.392 1.00 49.39  ? 81   ARG A CB    1 
ATOM   621  C  CG    . ARG A  1 81  ? 159.561 -0.467  222.465 1.00 43.71  ? 81   ARG A CG    1 
ATOM   622  C  CD    . ARG A  1 81  ? 160.411 0.271   221.480 1.00 46.65  ? 81   ARG A CD    1 
ATOM   623  N  NE    . ARG A  1 81  ? 161.501 0.996   222.108 1.00 45.37  ? 81   ARG A NE    1 
ATOM   624  C  CZ    . ARG A  1 81  ? 162.587 1.408   221.454 1.00 54.28  ? 81   ARG A CZ    1 
ATOM   625  N  NH1   . ARG A  1 81  ? 162.719 1.167   220.147 1.00 50.90  ? 81   ARG A NH1   1 
ATOM   626  N  NH2   . ARG A  1 81  ? 163.546 2.063   222.095 1.00 50.41  ? 81   ARG A NH2   1 
ATOM   627  N  N     . VAL A  1 82  ? 157.420 -2.821  223.068 1.00 47.48  ? 82   VAL A N     1 
ATOM   628  C  CA    . VAL A  1 82  ? 156.553 -3.383  222.047 1.00 44.16  ? 82   VAL A CA    1 
ATOM   629  C  C     . VAL A  1 82  ? 155.966 -2.235  221.271 1.00 47.77  ? 82   VAL A C     1 
ATOM   630  O  O     . VAL A  1 82  ? 155.315 -1.354  221.842 1.00 41.20  ? 82   VAL A O     1 
ATOM   631  C  CB    . VAL A  1 82  ? 155.432 -4.247  222.626 1.00 42.51  ? 82   VAL A CB    1 
ATOM   632  C  CG1   . VAL A  1 82  ? 154.716 -4.987  221.529 1.00 44.14  ? 82   VAL A CG1   1 
ATOM   633  C  CG2   . VAL A  1 82  ? 155.991 -5.230  223.652 1.00 48.04  ? 82   VAL A CG2   1 
ATOM   634  N  N     . SER A  1 83  ? 156.238 -2.241  219.967 1.00 45.54  ? 83   SER A N     1 
ATOM   635  C  CA    . SER A  1 83  ? 155.794 -1.201  219.057 1.00 45.41  ? 83   SER A CA    1 
ATOM   636  C  C     . SER A  1 83  ? 154.511 -1.675  218.382 1.00 45.09  ? 83   SER A C     1 
ATOM   637  O  O     . SER A  1 83  ? 154.537 -2.520  217.487 1.00 44.24  ? 83   SER A O     1 
ATOM   638  C  CB    . SER A  1 83  ? 156.883 -0.884  218.026 1.00 46.26  ? 83   SER A CB    1 
ATOM   639  O  OG    . SER A  1 83  ? 156.576 0.307   217.337 1.00 44.68  ? 83   SER A OG    1 
ATOM   640  N  N     . SER A  1 84  ? 153.390 -1.127  218.828 1.00 43.12  ? 84   SER A N     1 
ATOM   641  C  CA    . SER A  1 84  ? 152.087 -1.695  218.511 1.00 45.13  ? 84   SER A CA    1 
ATOM   642  C  C     . SER A  1 84  ? 150.927 -0.779  218.895 1.00 47.17  ? 84   SER A C     1 
ATOM   643  O  O     . SER A  1 84  ? 150.693 -0.511  220.081 1.00 44.54  ? 84   SER A O     1 
ATOM   644  C  CB    . SER A  1 84  ? 151.911 -3.035  219.221 1.00 40.74  ? 84   SER A CB    1 
ATOM   645  O  OG    . SER A  1 84  ? 150.547 -3.417  219.143 1.00 48.65  ? 84   SER A OG    1 
ATOM   646  N  N     . LYS A  1 85  ? 150.204 -0.313  217.886 1.00 46.49  ? 85   LYS A N     1 
ATOM   647  C  CA    . LYS A  1 85  ? 149.032 0.523   218.100 1.00 43.85  ? 85   LYS A CA    1 
ATOM   648  C  C     . LYS A  1 85  ? 147.976 -0.239  218.897 1.00 44.71  ? 85   LYS A C     1 
ATOM   649  O  O     . LYS A  1 85  ? 147.335 0.317   219.792 1.00 46.66  ? 85   LYS A O     1 
ATOM   650  C  CB    . LYS A  1 85  ? 148.469 0.996   216.757 1.00 42.75  ? 85   LYS A CB    1 
ATOM   651  C  CG    . LYS A  1 85  ? 147.231 1.845   216.856 1.00 43.81  ? 85   LYS A CG    1 
ATOM   652  C  CD    . LYS A  1 85  ? 146.831 2.396   215.489 1.00 45.43  ? 85   LYS A CD    1 
ATOM   653  C  CE    . LYS A  1 85  ? 145.523 3.160   215.579 1.00 47.31  ? 85   LYS A CE    1 
ATOM   654  N  NZ    . LYS A  1 85  ? 145.180 3.810   214.300 1.00 42.20  ? 85   LYS A NZ    1 
ATOM   655  N  N     . LYS A  1 86  ? 147.819 -1.521  218.585 1.00 43.37  ? 86   LYS A N     1 
ATOM   656  C  CA    . LYS A  1 86  ? 146.803 -2.341  219.234 1.00 47.46  ? 86   LYS A CA    1 
ATOM   657  C  C     . LYS A  1 86  ? 147.085 -2.527  220.728 1.00 43.36  ? 86   LYS A C     1 
ATOM   658  O  O     . LYS A  1 86  ? 146.200 -2.383  221.557 1.00 42.52  ? 86   LYS A O     1 
ATOM   659  C  CB    . LYS A  1 86  ? 146.716 -3.696  218.543 1.00 48.98  ? 86   LYS A CB    1 
ATOM   660  C  CG    . LYS A  1 86  ? 145.666 -4.626  219.111 1.00 49.90  ? 86   LYS A CG    1 
ATOM   661  C  CD    . LYS A  1 86  ? 145.595 -5.897  218.283 1.00 57.16  ? 86   LYS A CD    1 
ATOM   662  C  CE    . LYS A  1 86  ? 144.536 -6.845  218.801 1.00 58.86  ? 86   LYS A CE    1 
ATOM   663  N  NZ    . LYS A  1 86  ? 144.684 -8.174  218.145 1.00 64.65  ? 86   LYS A NZ    1 
ATOM   664  N  N     . LEU A  1 87  ? 148.332 -2.851  221.043 1.00 41.62  ? 87   LEU A N     1 
ATOM   665  C  CA    . LEU A  1 87  ? 148.758 -3.114  222.409 1.00 43.85  ? 87   LEU A CA    1 
ATOM   666  C  C     . LEU A  1 87  ? 148.787 -1.833  223.241 1.00 41.43  ? 87   LEU A C     1 
ATOM   667  O  O     . LEU A  1 87  ? 148.423 -1.850  224.418 1.00 42.94  ? 87   LEU A O     1 
ATOM   668  C  CB    . LEU A  1 87  ? 150.138 -3.778  222.429 1.00 42.16  ? 87   LEU A CB    1 
ATOM   669  C  CG    . LEU A  1 87  ? 150.442 -4.368  223.810 1.00 45.61  ? 87   LEU A CG    1 
ATOM   670  C  CD1   . LEU A  1 87  ? 149.481 -5.517  224.076 1.00 45.00  ? 87   LEU A CD1   1 
ATOM   671  C  CD2   . LEU A  1 87  ? 151.895 -4.804  223.990 1.00 43.41  ? 87   LEU A CD2   1 
ATOM   672  N  N     . TYR A  1 88  ? 149.222 -0.739  222.614 1.00 39.16  ? 88   TYR A N     1 
ATOM   673  C  CA    . TYR A  1 88  ? 149.191 0.577   223.226 1.00 38.73  ? 88   TYR A CA    1 
ATOM   674  C  C     . TYR A  1 88  ? 147.763 0.903   223.694 1.00 42.29  ? 88   TYR A C     1 
ATOM   675  O  O     . TYR A  1 88  ? 147.551 1.195   224.872 1.00 42.36  ? 88   TYR A O     1 
ATOM   676  C  CB    . TYR A  1 88  ? 149.711 1.659   222.257 1.00 41.58  ? 88   TYR A CB    1 
ATOM   677  C  CG    . TYR A  1 88  ? 149.425 3.078   222.720 1.00 41.11  ? 88   TYR A CG    1 
ATOM   678  C  CD1   . TYR A  1 88  ? 150.326 3.760   223.543 1.00 41.49  ? 88   TYR A CD1   1 
ATOM   679  C  CD2   . TYR A  1 88  ? 148.241 3.731   222.363 1.00 42.63  ? 88   TYR A CD2   1 
ATOM   680  C  CE1   . TYR A  1 88  ? 150.061 5.051   223.997 1.00 39.03  ? 88   TYR A CE1   1 
ATOM   681  C  CE2   . TYR A  1 88  ? 147.968 5.023   222.816 1.00 44.48  ? 88   TYR A CE2   1 
ATOM   682  C  CZ    . TYR A  1 88  ? 148.881 5.673   223.637 1.00 43.53  ? 88   TYR A CZ    1 
ATOM   683  O  OH    . TYR A  1 88  ? 148.626 6.952   224.079 1.00 46.73  ? 88   TYR A OH    1 
ATOM   684  N  N     . TYR A  1 89  ? 146.790 0.851   222.782 1.00 38.29  ? 89   TYR A N     1 
ATOM   685  C  CA    . TYR A  1 89  ? 145.409 1.144   223.167 1.00 43.96  ? 89   TYR A CA    1 
ATOM   686  C  C     . TYR A  1 89  ? 144.829 0.103   224.130 1.00 44.55  ? 89   TYR A C     1 
ATOM   687  O  O     . TYR A  1 89  ? 144.007 0.440   224.984 1.00 44.36  ? 89   TYR A O     1 
ATOM   688  C  CB    . TYR A  1 89  ? 144.509 1.303   221.931 1.00 38.06  ? 89   TYR A CB    1 
ATOM   689  C  CG    . TYR A  1 89  ? 144.661 2.690   221.331 1.00 43.73  ? 89   TYR A CG    1 
ATOM   690  C  CD1   . TYR A  1 89  ? 144.276 3.813   222.053 1.00 40.33  ? 89   TYR A CD1   1 
ATOM   691  C  CD2   . TYR A  1 89  ? 145.226 2.886   220.075 1.00 40.76  ? 89   TYR A CD2   1 
ATOM   692  C  CE1   . TYR A  1 89  ? 144.426 5.079   221.548 1.00 40.16  ? 89   TYR A CE1   1 
ATOM   693  C  CE2   . TYR A  1 89  ? 145.383 4.163   219.567 1.00 40.15  ? 89   TYR A CE2   1 
ATOM   694  C  CZ    . TYR A  1 89  ? 144.976 5.253   220.307 1.00 43.35  ? 89   TYR A CZ    1 
ATOM   695  O  OH    . TYR A  1 89  ? 145.115 6.536   219.829 1.00 47.34  ? 89   TYR A OH    1 
ATOM   696  N  N     . TYR A  1 90  ? 145.263 -1.146  224.015 1.00 40.65  ? 90   TYR A N     1 
ATOM   697  C  CA    . TYR A  1 90  ? 144.823 -2.158  224.956 1.00 42.34  ? 90   TYR A CA    1 
ATOM   698  C  C     . TYR A  1 90  ? 145.148 -1.731  226.393 1.00 46.00  ? 90   TYR A C     1 
ATOM   699  O  O     . TYR A  1 90  ? 144.285 -1.784  227.280 1.00 48.08  ? 90   TYR A O     1 
ATOM   700  C  CB    . TYR A  1 90  ? 145.468 -3.505  224.635 1.00 44.46  ? 90   TYR A CB    1 
ATOM   701  C  CG    . TYR A  1 90  ? 145.148 -4.609  225.616 1.00 43.43  ? 90   TYR A CG    1 
ATOM   702  C  CD1   . TYR A  1 90  ? 143.953 -5.312  225.534 1.00 45.85  ? 90   TYR A CD1   1 
ATOM   703  C  CD2   . TYR A  1 90  ? 146.051 -4.958  226.620 1.00 46.86  ? 90   TYR A CD2   1 
ATOM   704  C  CE1   . TYR A  1 90  ? 143.650 -6.333  226.435 1.00 43.63  ? 90   TYR A CE1   1 
ATOM   705  C  CE2   . TYR A  1 90  ? 145.767 -5.981  227.526 1.00 44.05  ? 90   TYR A CE2   1 
ATOM   706  C  CZ    . TYR A  1 90  ? 144.563 -6.658  227.426 1.00 48.61  ? 90   TYR A CZ    1 
ATOM   707  O  OH    . TYR A  1 90  ? 144.280 -7.665  228.302 1.00 50.19  ? 90   TYR A OH    1 
ATOM   708  N  N     . PHE A  1 91  ? 146.377 -1.281  226.622 1.00 41.39  ? 91   PHE A N     1 
ATOM   709  C  CA    . PHE A  1 91  ? 146.761 -0.885  227.970 1.00 46.36  ? 91   PHE A CA    1 
ATOM   710  C  C     . PHE A  1 91  ? 146.220 0.486   228.340 1.00 43.75  ? 91   PHE A C     1 
ATOM   711  O  O     . PHE A  1 91  ? 145.898 0.722   229.484 1.00 41.06  ? 91   PHE A O     1 
ATOM   712  C  CB    . PHE A  1 91  ? 148.285 -0.911  228.151 1.00 39.11  ? 91   PHE A CB    1 
ATOM   713  C  CG    . PHE A  1 91  ? 148.823 -2.275  228.429 1.00 40.51  ? 91   PHE A CG    1 
ATOM   714  C  CD1   . PHE A  1 91  ? 148.406 -2.977  229.555 1.00 36.72  ? 91   PHE A CD1   1 
ATOM   715  C  CD2   . PHE A  1 91  ? 149.743 -2.863  227.571 1.00 38.27  ? 91   PHE A CD2   1 
ATOM   716  C  CE1   . PHE A  1 91  ? 148.899 -4.249  229.825 1.00 41.04  ? 91   PHE A CE1   1 
ATOM   717  C  CE2   . PHE A  1 91  ? 150.244 -4.131  227.830 1.00 38.44  ? 91   PHE A CE2   1 
ATOM   718  C  CZ    . PHE A  1 91  ? 149.823 -4.831  228.953 1.00 43.87  ? 91   PHE A CZ    1 
ATOM   719  N  N     . ALA A  1 92  ? 146.139 1.388   227.374 1.00 44.52  ? 92   ALA A N     1 
ATOM   720  C  CA    . ALA A  1 92  ? 145.704 2.731   227.689 1.00 46.01  ? 92   ALA A CA    1 
ATOM   721  C  C     . ALA A  1 92  ? 144.222 2.730   228.062 1.00 50.39  ? 92   ALA A C     1 
ATOM   722  O  O     . ALA A  1 92  ? 143.794 3.472   228.952 1.00 47.79  ? 92   ALA A O     1 
ATOM   723  C  CB    . ALA A  1 92  ? 145.971 3.663   226.534 1.00 37.42  ? 92   ALA A CB    1 
ATOM   724  N  N     . ASN A  1 93  ? 143.439 1.884   227.405 1.00 44.78  ? 93   ASN A N     1 
ATOM   725  C  CA    . ASN A  1 93  ? 142.016 1.832   227.710 1.00 49.31  ? 93   ASN A CA    1 
ATOM   726  C  C     . ASN A  1 93  ? 141.820 1.114   229.035 1.00 52.69  ? 93   ASN A C     1 
ATOM   727  O  O     . ASN A  1 93  ? 140.890 1.413   229.800 1.00 50.26  ? 93   ASN A O     1 
ATOM   728  C  CB    . ASN A  1 93  ? 141.231 1.146   226.587 1.00 44.17  ? 93   ASN A CB    1 
ATOM   729  C  CG    . ASN A  1 93  ? 141.062 2.046   225.373 1.00 50.24  ? 93   ASN A CG    1 
ATOM   730  O  OD1   . ASN A  1 93  ? 140.926 3.265   225.523 1.00 51.67  ? 93   ASN A OD1   1 
ATOM   731  N  ND2   . ASN A  1 93  ? 141.089 1.460   224.163 1.00 42.36  ? 93   ASN A ND2   1 
ATOM   732  N  N     . MET A  1 94  ? 142.706 0.160   229.292 1.00 45.55  ? 94   MET A N     1 
ATOM   733  C  CA    . MET A  1 94  ? 142.651 -0.574  230.530 1.00 50.30  ? 94   MET A CA    1 
ATOM   734  C  C     . MET A  1 94  ? 143.039 0.355   231.688 1.00 55.23  ? 94   MET A C     1 
ATOM   735  O  O     . MET A  1 94  ? 142.496 0.259   232.793 1.00 45.43  ? 94   MET A O     1 
ATOM   736  C  CB    . MET A  1 94  ? 143.559 -1.793  230.483 1.00 50.30  ? 94   MET A CB    1 
ATOM   737  C  CG    . MET A  1 94  ? 143.477 -2.615  231.743 1.00 52.32  ? 94   MET A CG    1 
ATOM   738  S  SD    . MET A  1 94  ? 144.546 -4.045  231.672 1.00 59.78  ? 94   MET A SD    1 
ATOM   739  C  CE    . MET A  1 94  ? 143.993 -4.954  233.113 1.00 62.53  ? 94   MET A CE    1 
ATOM   740  N  N     . LEU A  1 95  ? 143.963 1.273   231.417 1.00 49.34  ? 95   LEU A N     1 
ATOM   741  C  CA    . LEU A  1 95  ? 144.352 2.245   232.422 1.00 50.93  ? 95   LEU A CA    1 
ATOM   742  C  C     . LEU A  1 95  ? 143.164 3.151   232.766 1.00 50.87  ? 95   LEU A C     1 
ATOM   743  O  O     . LEU A  1 95  ? 142.901 3.424   233.932 1.00 49.38  ? 95   LEU A O     1 
ATOM   744  C  CB    . LEU A  1 95  ? 145.553 3.068   231.944 1.00 46.41  ? 95   LEU A CB    1 
ATOM   745  C  CG    . LEU A  1 95  ? 146.079 4.153   232.893 1.00 47.66  ? 95   LEU A CG    1 
ATOM   746  C  CD1   . LEU A  1 95  ? 146.222 3.618   234.305 1.00 41.13  ? 95   LEU A CD1   1 
ATOM   747  C  CD2   . LEU A  1 95  ? 147.422 4.694   232.394 1.00 45.82  ? 95   LEU A CD2   1 
ATOM   748  N  N     . GLU A  1 96  ? 142.442 3.599   231.743 1.00 52.33  ? 96   GLU A N     1 
ATOM   749  C  CA    . GLU A  1 96  ? 141.317 4.507   231.940 1.00 54.35  ? 96   GLU A CA    1 
ATOM   750  C  C     . GLU A  1 96  ? 140.205 3.948   232.829 1.00 54.57  ? 96   GLU A C     1 
ATOM   751  O  O     . GLU A  1 96  ? 139.465 4.700   233.443 1.00 50.17  ? 96   GLU A O     1 
ATOM   752  C  CB    . GLU A  1 96  ? 140.724 4.897   230.601 1.00 53.32  ? 96   GLU A CB    1 
ATOM   753  C  CG    . GLU A  1 96  ? 141.560 5.890   229.835 1.00 62.08  ? 96   GLU A CG    1 
ATOM   754  C  CD    . GLU A  1 96  ? 140.927 6.256   228.508 1.00 72.42  ? 96   GLU A CD    1 
ATOM   755  O  OE1   . GLU A  1 96  ? 140.075 5.471   228.018 1.00 73.98  ? 96   GLU A OE1   1 
ATOM   756  O  OE2   . GLU A  1 96  ? 141.271 7.328   227.960 1.00 79.88  ? 96   GLU A OE2   1 
ATOM   757  N  N     . ARG A  1 97  ? 140.086 2.629   232.876 1.00 54.51  ? 97   ARG A N     1 
ATOM   758  C  CA    . ARG A  1 97  ? 139.030 1.993   233.640 1.00 51.94  ? 97   ARG A CA    1 
ATOM   759  C  C     . ARG A  1 97  ? 139.625 1.259   234.839 1.00 50.78  ? 97   ARG A C     1 
ATOM   760  O  O     . ARG A  1 97  ? 139.077 0.259   235.313 1.00 50.96  ? 97   ARG A O     1 
ATOM   761  C  CB    . ARG A  1 97  ? 138.230 1.038   232.752 1.00 50.85  ? 97   ARG A CB    1 
ATOM   762  C  CG    . ARG A  1 97  ? 138.967 -0.224  232.344 1.00 59.24  ? 97   ARG A CG    1 
ATOM   763  C  CD    . ARG A  1 97  ? 138.115 -1.109  231.413 1.00 69.82  ? 97   ARG A CD    1 
ATOM   764  N  NE    . ARG A  1 97  ? 138.851 -2.292  230.961 1.00 75.62  ? 97   ARG A NE    1 
ATOM   765  C  CZ    . ARG A  1 97  ? 139.324 -3.250  231.763 1.00 78.29  ? 97   ARG A CZ    1 
ATOM   766  N  NH1   . ARG A  1 97  ? 139.142 -3.197  233.081 1.00 69.53  ? 97   ARG A NH1   1 
ATOM   767  N  NH2   . ARG A  1 97  ? 139.982 -4.281  231.240 1.00 80.17  ? 97   ARG A NH2   1 
ATOM   768  N  N     . ILE A  1 98  ? 140.758 1.767   235.321 1.00 50.22  ? 98   ILE A N     1 
ATOM   769  C  CA    . ILE A  1 98  ? 141.439 1.171   236.462 1.00 55.44  ? 98   ILE A CA    1 
ATOM   770  C  C     . ILE A  1 98  ? 140.511 1.049   237.690 1.00 52.85  ? 98   ILE A C     1 
ATOM   771  O  O     . ILE A  1 98  ? 140.521 0.037   238.379 1.00 50.71  ? 98   ILE A O     1 
ATOM   772  C  CB    . ILE A  1 98  ? 142.716 1.972   236.817 1.00 50.01  ? 98   ILE A CB    1 
ATOM   773  C  CG1   . ILE A  1 98  ? 143.401 1.382   238.048 1.00 54.24  ? 98   ILE A CG1   1 
ATOM   774  C  CG2   . ILE A  1 98  ? 142.426 3.465   236.986 1.00 47.50  ? 98   ILE A CG2   1 
ATOM   775  C  CD1   . ILE A  1 98  ? 144.891 1.159   237.855 1.00 50.83  ? 98   ILE A CD1   1 
ATOM   776  N  N     . ARG A  1 99  ? 139.680 2.054   237.927 1.00 49.30  ? 99   ARG A N     1 
ATOM   777  C  CA    . ARG A  1 99  ? 138.772 2.021   239.080 1.00 55.23  ? 99   ARG A CA    1 
ATOM   778  C  C     . ARG A  1 99  ? 137.834 0.816   239.069 1.00 56.95  ? 99   ARG A C     1 
ATOM   779  O  O     . ARG A  1 99  ? 137.470 0.300   240.133 1.00 58.52  ? 99   ARG A O     1 
ATOM   780  C  CB    . ARG A  1 99  ? 137.971 3.326   239.166 1.00 48.52  ? 99   ARG A CB    1 
ATOM   781  C  CG    . ARG A  1 99  ? 138.855 4.481   239.600 1.00 56.01  ? 99   ARG A CG    1 
ATOM   782  C  CD    . ARG A  1 99  ? 138.359 5.829   239.169 1.00 59.86  ? 99   ARG A CD    1 
ATOM   783  N  NE    . ARG A  1 99  ? 139.404 6.824   239.404 1.00 77.36  ? 99   ARG A NE    1 
ATOM   784  C  CZ    . ARG A  1 99  ? 140.303 7.198   238.490 1.00 82.54  ? 99   ARG A CZ    1 
ATOM   785  N  NH1   . ARG A  1 99  ? 140.283 6.675   237.260 1.00 65.07  ? 99   ARG A NH1   1 
ATOM   786  N  NH2   . ARG A  1 99  ? 141.220 8.109   238.804 1.00 83.52  ? 99   ARG A NH2   1 
ATOM   787  N  N     . LEU A  1 100 ? 137.482 0.331   237.882 1.00 53.35  ? 100  LEU A N     1 
ATOM   788  C  CA    . LEU A  1 100 ? 136.577 -0.807  237.792 1.00 53.23  ? 100  LEU A CA    1 
ATOM   789  C  C     . LEU A  1 100 ? 137.282 -2.156  237.946 1.00 53.06  ? 100  LEU A C     1 
ATOM   790  O  O     . LEU A  1 100 ? 136.650 -3.199  237.820 1.00 56.41  ? 100  LEU A O     1 
ATOM   791  C  CB    . LEU A  1 100 ? 135.819 -0.764  236.475 1.00 51.28  ? 100  LEU A CB    1 
ATOM   792  C  CG    . LEU A  1 100 ? 135.135 0.567   236.176 1.00 55.93  ? 100  LEU A CG    1 
ATOM   793  C  CD1   . LEU A  1 100 ? 134.686 0.597   234.733 1.00 53.38  ? 100  LEU A CD1   1 
ATOM   794  C  CD2   . LEU A  1 100 ? 133.947 0.774   237.107 1.00 58.95  ? 100  LEU A CD2   1 
ATOM   795  N  N     . PHE A  1 101 ? 138.578 -2.143  238.235 1.00 50.96  ? 101  PHE A N     1 
ATOM   796  C  CA    . PHE A  1 101 ? 139.320 -3.395  238.413 1.00 56.13  ? 101  PHE A CA    1 
ATOM   797  C  C     . PHE A  1 101 ? 138.681 -4.315  239.464 1.00 64.27  ? 101  PHE A C     1 
ATOM   798  O  O     . PHE A  1 101 ? 138.341 -3.878  240.581 1.00 65.30  ? 101  PHE A O     1 
ATOM   799  C  CB    . PHE A  1 101 ? 140.777 -3.119  238.820 1.00 58.48  ? 101  PHE A CB    1 
ATOM   800  C  CG    . PHE A  1 101 ? 141.703 -2.813  237.672 1.00 57.82  ? 101  PHE A CG    1 
ATOM   801  C  CD1   . PHE A  1 101 ? 141.211 -2.606  236.384 1.00 55.43  ? 101  PHE A CD1   1 
ATOM   802  C  CD2   . PHE A  1 101 ? 143.083 -2.739  237.888 1.00 55.88  ? 101  PHE A CD2   1 
ATOM   803  C  CE1   . PHE A  1 101 ? 142.078 -2.325  235.342 1.00 56.80  ? 101  PHE A CE1   1 
ATOM   804  C  CE2   . PHE A  1 101 ? 143.959 -2.465  236.849 1.00 52.58  ? 101  PHE A CE2   1 
ATOM   805  C  CZ    . PHE A  1 101 ? 143.459 -2.260  235.573 1.00 52.54  ? 101  PHE A CZ    1 
ATOM   806  N  N     . ASN A  1 102 ? 138.529 -5.591  239.124 1.00 59.58  ? 102  ASN A N     1 
ATOM   807  C  CA    . ASN A  1 102 ? 138.062 -6.546  240.120 1.00 63.90  ? 102  ASN A CA    1 
ATOM   808  C  C     . ASN A  1 102 ? 139.215 -6.952  241.034 1.00 64.18  ? 102  ASN A C     1 
ATOM   809  O  O     . ASN A  1 102 ? 140.350 -6.527  240.832 1.00 65.74  ? 102  ASN A O     1 
ATOM   810  C  CB    . ASN A  1 102 ? 137.416 -7.768  239.457 1.00 60.14  ? 102  ASN A CB    1 
ATOM   811  C  CG    . ASN A  1 102 ? 138.265 -8.366  238.359 1.00 68.00  ? 102  ASN A CG    1 
ATOM   812  O  OD1   . ASN A  1 102 ? 139.478 -8.546  238.513 1.00 68.45  ? 102  ASN A OD1   1 
ATOM   813  N  ND2   . ASN A  1 102 ? 137.626 -8.690  237.233 1.00 66.64  ? 102  ASN A ND2   1 
ATOM   814  N  N     . MET A  1 103 ? 138.925 -7.767  242.039 1.00 62.73  ? 103  MET A N     1 
ATOM   815  C  CA    . MET A  1 103 ? 139.921 -8.133  243.037 1.00 62.53  ? 103  MET A CA    1 
ATOM   816  C  C     . MET A  1 103 ? 141.125 -8.863  242.422 1.00 58.65  ? 103  MET A C     1 
ATOM   817  O  O     . MET A  1 103 ? 142.246 -8.776  242.926 1.00 60.03  ? 103  MET A O     1 
ATOM   818  C  CB    . MET A  1 103 ? 139.260 -8.986  244.134 1.00 60.39  ? 103  MET A CB    1 
ATOM   819  C  CG    . MET A  1 103 ? 140.210 -9.819  244.960 1.00 60.89  ? 103  MET A CG    1 
ATOM   820  S  SD    . MET A  1 103 ? 139.381 -10.624 246.345 1.00 78.71  ? 103  MET A SD    1 
ATOM   821  C  CE    . MET A  1 103 ? 138.670 -9.207  247.189 1.00 66.29  ? 103  MET A CE    1 
ATOM   822  N  N     . ARG A  1 104 ? 140.896 -9.580  241.332 1.00 60.72  ? 104  ARG A N     1 
ATOM   823  C  CA    . ARG A  1 104 ? 141.980 -10.291 240.667 1.00 61.27  ? 104  ARG A CA    1 
ATOM   824  C  C     . ARG A  1 104 ? 142.975 -9.309  240.051 1.00 60.39  ? 104  ARG A C     1 
ATOM   825  O  O     . ARG A  1 104 ? 144.204 -9.484  240.141 1.00 53.46  ? 104  ARG A O     1 
ATOM   826  C  CB    . ARG A  1 104 ? 141.422 -11.219 239.594 1.00 62.98  ? 104  ARG A CB    1 
ATOM   827  C  CG    . ARG A  1 104 ? 142.491 -11.984 238.861 1.00 70.54  ? 104  ARG A CG    1 
ATOM   828  C  CD    . ARG A  1 104 ? 141.907 -13.113 238.048 1.00 80.70  ? 104  ARG A CD    1 
ATOM   829  N  NE    . ARG A  1 104 ? 142.897 -14.164 237.851 1.00 89.97  ? 104  ARG A NE    1 
ATOM   830  C  CZ    . ARG A  1 104 ? 142.867 -15.352 238.453 1.00 92.55  ? 104  ARG A CZ    1 
ATOM   831  N  NH1   . ARG A  1 104 ? 141.883 -15.666 239.296 1.00 84.38  ? 104  ARG A NH1   1 
ATOM   832  N  NH2   . ARG A  1 104 ? 143.829 -16.229 238.198 1.00 86.54  ? 104  ARG A NH2   1 
ATOM   833  N  N     . GLU A  1 105 ? 142.413 -8.272  239.438 1.00 56.03  ? 105  GLU A N     1 
ATOM   834  C  CA    . GLU A  1 105 ? 143.174 -7.246  238.753 1.00 56.37  ? 105  GLU A CA    1 
ATOM   835  C  C     . GLU A  1 105 ? 143.841 -6.303  239.754 1.00 57.50  ? 105  GLU A C     1 
ATOM   836  O  O     . GLU A  1 105 ? 144.976 -5.863  239.539 1.00 53.78  ? 105  GLU A O     1 
ATOM   837  C  CB    . GLU A  1 105 ? 142.265 -6.475  237.792 1.00 53.61  ? 105  GLU A CB    1 
ATOM   838  C  CG    . GLU A  1 105 ? 141.796 -7.321  236.591 1.00 61.68  ? 105  GLU A CG    1 
ATOM   839  C  CD    . GLU A  1 105 ? 140.703 -6.650  235.767 1.00 66.79  ? 105  GLU A CD    1 
ATOM   840  O  OE1   . GLU A  1 105 ? 139.826 -5.993  236.364 1.00 66.26  ? 105  GLU A OE1   1 
ATOM   841  O  OE2   . GLU A  1 105 ? 140.710 -6.782  234.522 1.00 72.45  ? 105  GLU A OE2   1 
ATOM   842  N  N     . GLN A  1 106 ? 143.152 -6.008  240.857 1.00 57.44  ? 106  GLN A N     1 
ATOM   843  C  CA    . GLN A  1 106 ? 143.712 -5.091  241.843 1.00 53.17  ? 106  GLN A CA    1 
ATOM   844  C  C     . GLN A  1 106 ? 144.999 -5.668  242.408 1.00 50.42  ? 106  GLN A C     1 
ATOM   845  O  O     . GLN A  1 106 ? 146.047 -5.010  242.420 1.00 49.18  ? 106  GLN A O     1 
ATOM   846  C  CB    . GLN A  1 106 ? 142.712 -4.801  242.963 1.00 56.46  ? 106  GLN A CB    1 
ATOM   847  C  CG    . GLN A  1 106 ? 141.440 -4.103  242.496 1.00 57.88  ? 106  GLN A CG    1 
ATOM   848  C  CD    . GLN A  1 106 ? 140.342 -4.184  243.539 1.00 62.60  ? 106  GLN A CD    1 
ATOM   849  O  OE1   . GLN A  1 106 ? 140.597 -4.597  244.661 1.00 56.57  ? 106  GLN A OE1   1 
ATOM   850  N  NE2   . GLN A  1 106 ? 139.115 -3.821  243.166 1.00 61.59  ? 106  GLN A NE2   1 
ATOM   851  N  N     . ILE A  1 107 ? 144.929 -6.916  242.839 1.00 47.19  ? 107  ILE A N     1 
ATOM   852  C  CA    . ILE A  1 107 ? 146.092 -7.558  243.428 1.00 50.35  ? 107  ILE A CA    1 
ATOM   853  C  C     . ILE A  1 107 ? 147.254 -7.640  242.428 1.00 51.47  ? 107  ILE A C     1 
ATOM   854  O  O     . ILE A  1 107 ? 148.405 -7.377  242.780 1.00 51.75  ? 107  ILE A O     1 
ATOM   855  C  CB    . ILE A  1 107 ? 145.728 -8.964  243.950 1.00 51.99  ? 107  ILE A CB    1 
ATOM   856  C  CG1   . ILE A  1 107 ? 144.640 -8.853  245.027 1.00 57.91  ? 107  ILE A CG1   1 
ATOM   857  C  CG2   . ILE A  1 107 ? 146.959 -9.683  244.486 1.00 51.76  ? 107  ILE A CG2   1 
ATOM   858  C  CD1   . ILE A  1 107 ? 144.154 -10.197 245.553 1.00 57.54  ? 107  ILE A CD1   1 
ATOM   859  N  N     . ALA A  1 108 ? 146.957 -8.003  241.184 1.00 49.46  ? 108  ALA A N     1 
ATOM   860  C  CA    . ALA A  1 108 ? 148.003 -8.081  240.157 1.00 55.12  ? 108  ALA A CA    1 
ATOM   861  C  C     . ALA A  1 108 ? 148.615 -6.698  239.881 1.00 49.44  ? 108  ALA A C     1 
ATOM   862  O  O     . ALA A  1 108 ? 149.842 -6.571  239.759 1.00 46.57  ? 108  ALA A O     1 
ATOM   863  C  CB    . ALA A  1 108 ? 147.450 -8.689  238.870 1.00 48.98  ? 108  ALA A CB    1 
ATOM   864  N  N     . PHE A  1 109 ? 147.769 -5.668  239.802 1.00 46.20  ? 109  PHE A N     1 
ATOM   865  C  CA    . PHE A  1 109 ? 148.264 -4.312  239.591 1.00 44.53  ? 109  PHE A CA    1 
ATOM   866  C  C     . PHE A  1 109 ? 149.186 -3.861  240.726 1.00 48.00  ? 109  PHE A C     1 
ATOM   867  O  O     . PHE A  1 109 ? 150.269 -3.318  240.468 1.00 46.54  ? 109  PHE A O     1 
ATOM   868  C  CB    . PHE A  1 109 ? 147.120 -3.327  239.429 1.00 41.07  ? 109  PHE A CB    1 
ATOM   869  C  CG    . PHE A  1 109 ? 147.574 -1.935  239.082 1.00 48.28  ? 109  PHE A CG    1 
ATOM   870  C  CD1   . PHE A  1 109 ? 147.844 -1.582  237.757 1.00 47.46  ? 109  PHE A CD1   1 
ATOM   871  C  CD2   . PHE A  1 109 ? 147.742 -0.977  240.071 1.00 44.36  ? 109  PHE A CD2   1 
ATOM   872  C  CE1   . PHE A  1 109 ? 148.265 -0.294  237.440 1.00 45.70  ? 109  PHE A CE1   1 
ATOM   873  C  CE2   . PHE A  1 109 ? 148.147 0.305   239.768 1.00 41.92  ? 109  PHE A CE2   1 
ATOM   874  C  CZ    . PHE A  1 109 ? 148.413 0.654   238.447 1.00 46.43  ? 109  PHE A CZ    1 
ATOM   875  N  N     . ILE A  1 110 ? 148.775 -4.111  241.970 1.00 45.14  ? 110  ILE A N     1 
ATOM   876  C  CA    . ILE A  1 110 ? 149.555 -3.688  243.128 1.00 41.93  ? 110  ILE A CA    1 
ATOM   877  C  C     . ILE A  1 110 ? 150.880 -4.442  243.168 1.00 40.38  ? 110  ILE A C     1 
ATOM   878  O  O     . ILE A  1 110 ? 151.930 -3.863  243.435 1.00 45.69  ? 110  ILE A O     1 
ATOM   879  C  CB    . ILE A  1 110 ? 148.776 -3.897  244.443 1.00 42.41  ? 110  ILE A CB    1 
ATOM   880  C  CG1   . ILE A  1 110 ? 147.485 -3.094  244.413 1.00 42.99  ? 110  ILE A CG1   1 
ATOM   881  C  CG2   . ILE A  1 110 ? 149.600 -3.437  245.648 1.00 42.32  ? 110  ILE A CG2   1 
ATOM   882  C  CD1   . ILE A  1 110 ? 146.461 -3.547  245.417 1.00 50.09  ? 110  ILE A CD1   1 
ATOM   883  N  N     . LYS A  1 111 ? 150.839 -5.735  242.878 1.00 40.41  ? 111  LYS A N     1 
ATOM   884  C  CA    . LYS A  1 111 ? 152.070 -6.520  242.751 1.00 44.42  ? 111  LYS A CA    1 
ATOM   885  C  C     . LYS A  1 111 ? 153.038 -5.948  241.692 1.00 47.53  ? 111  LYS A C     1 
ATOM   886  O  O     . LYS A  1 111 ? 154.244 -5.791  241.942 1.00 47.21  ? 111  LYS A O     1 
ATOM   887  C  CB    . LYS A  1 111 ? 151.721 -7.971  242.411 1.00 52.08  ? 111  LYS A CB    1 
ATOM   888  C  CG    . LYS A  1 111 ? 152.921 -8.875  242.283 1.00 53.89  ? 111  LYS A CG    1 
ATOM   889  C  CD    . LYS A  1 111 ? 152.510 -10.339 242.424 1.00 68.88  ? 111  LYS A CD    1 
ATOM   890  C  CE    . LYS A  1 111 ? 153.711 -11.271 242.255 1.00 77.89  ? 111  LYS A CE    1 
ATOM   891  N  NZ    . LYS A  1 111 ? 153.451 -12.644 242.803 1.00 82.58  ? 111  LYS A NZ    1 
ATOM   892  N  N     . GLY A  1 112 ? 152.511 -5.619  240.517 1.00 40.57  ? 112  GLY A N     1 
ATOM   893  C  CA    . GLY A  1 112 ? 153.351 -5.055  239.475 1.00 46.23  ? 112  GLY A CA    1 
ATOM   894  C  C     . GLY A  1 112 ? 153.927 -3.713  239.879 1.00 43.73  ? 112  GLY A C     1 
ATOM   895  O  O     . GLY A  1 112 ? 155.135 -3.470  239.757 1.00 41.28  ? 112  GLY A O     1 
ATOM   896  N  N     . LEU A  1 113 ? 153.052 -2.845  240.384 1.00 47.56  ? 113  LEU A N     1 
ATOM   897  C  CA    . LEU A  1 113 ? 153.463 -1.533  240.855 1.00 42.82  ? 113  LEU A CA    1 
ATOM   898  C  C     . LEU A  1 113 ? 154.545 -1.666  241.910 1.00 43.80  ? 113  LEU A C     1 
ATOM   899  O  O     . LEU A  1 113 ? 155.514 -0.894  241.901 1.00 42.32  ? 113  LEU A O     1 
ATOM   900  C  CB    . LEU A  1 113 ? 152.278 -0.755  241.419 1.00 43.49  ? 113  LEU A CB    1 
ATOM   901  C  CG    . LEU A  1 113 ? 152.490 0.755   241.461 1.00 41.68  ? 113  LEU A CG    1 
ATOM   902  C  CD1   . LEU A  1 113 ? 152.639 1.263   240.030 1.00 43.32  ? 113  LEU A CD1   1 
ATOM   903  C  CD2   . LEU A  1 113 ? 151.356 1.465   242.165 1.00 37.47  ? 113  LEU A CD2   1 
ATOM   904  N  N     . TYR A  1 114 ? 154.401 -2.655  242.800 1.00 42.94  ? 114  TYR A N     1 
ATOM   905  C  CA    . TYR A  1 114 ? 155.389 -2.835  243.860 1.00 43.07  ? 114  TYR A CA    1 
ATOM   906  C  C     . TYR A  1 114 ? 156.714 -3.355  243.332 1.00 39.81  ? 114  TYR A C     1 
ATOM   907  O  O     . TYR A  1 114 ? 157.770 -2.878  243.748 1.00 42.45  ? 114  TYR A O     1 
ATOM   908  C  CB    . TYR A  1 114 ? 154.891 -3.772  244.968 1.00 40.72  ? 114  TYR A CB    1 
ATOM   909  C  CG    . TYR A  1 114 ? 155.626 -3.533  246.268 1.00 43.80  ? 114  TYR A CG    1 
ATOM   910  C  CD1   . TYR A  1 114 ? 156.896 -4.054  246.492 1.00 37.53  ? 114  TYR A CD1   1 
ATOM   911  C  CD2   . TYR A  1 114 ? 155.051 -2.753  247.278 1.00 46.88  ? 114  TYR A CD2   1 
ATOM   912  C  CE1   . TYR A  1 114 ? 157.570 -3.814  247.676 1.00 42.64  ? 114  TYR A CE1   1 
ATOM   913  C  CE2   . TYR A  1 114 ? 155.719 -2.509  248.470 1.00 39.58  ? 114  TYR A CE2   1 
ATOM   914  C  CZ    . TYR A  1 114 ? 156.975 -3.037  248.673 1.00 43.82  ? 114  TYR A CZ    1 
ATOM   915  O  OH    . TYR A  1 114 ? 157.619 -2.772  249.879 1.00 45.89  ? 114  TYR A OH    1 
ATOM   916  N  N     . VAL A  1 115 ? 156.677 -4.347  242.451 1.00 40.93  ? 115  VAL A N     1 
ATOM   917  C  CA    . VAL A  1 115 ? 157.922 -4.771  241.804 1.00 39.42  ? 115  VAL A CA    1 
ATOM   918  C  C     . VAL A  1 115 ? 158.620 -3.557  241.183 1.00 44.49  ? 115  VAL A C     1 
ATOM   919  O  O     . VAL A  1 115 ? 159.839 -3.425  241.301 1.00 47.03  ? 115  VAL A O     1 
ATOM   920  C  CB    . VAL A  1 115 ? 157.687 -5.843  240.718 1.00 45.90  ? 115  VAL A CB    1 
ATOM   921  C  CG1   . VAL A  1 115 ? 159.002 -6.213  240.027 1.00 37.22  ? 115  VAL A CG1   1 
ATOM   922  C  CG2   . VAL A  1 115 ? 157.025 -7.076  241.309 1.00 43.66  ? 115  VAL A CG2   1 
ATOM   923  N  N     . ALA A  1 116 ? 157.858 -2.649  240.556 1.00 40.77  ? 116  ALA A N     1 
ATOM   924  C  CA    . ALA A  1 116 ? 158.476 -1.431  239.994 1.00 49.25  ? 116  ALA A CA    1 
ATOM   925  C  C     . ALA A  1 116 ? 158.901 -0.379  241.042 1.00 46.36  ? 116  ALA A C     1 
ATOM   926  O  O     . ALA A  1 116 ? 160.038 0.063   241.049 1.00 45.44  ? 116  ALA A O     1 
ATOM   927  C  CB    . ALA A  1 116 ? 157.535 -0.764  238.953 1.00 39.13  ? 116  ALA A CB    1 
ATOM   928  N  N     . GLU A  1 117 ? 157.976 0.043   241.897 1.00 41.35  ? 117  GLU A N     1 
ATOM   929  C  CA    . GLU A  1 117 ? 158.174 1.260   242.679 1.00 42.32  ? 117  GLU A CA    1 
ATOM   930  C  C     . GLU A  1 117 ? 158.323 1.020   244.186 1.00 45.36  ? 117  GLU A C     1 
ATOM   931  O  O     . GLU A  1 117 ? 158.398 1.976   244.962 1.00 41.33  ? 117  GLU A O     1 
ATOM   932  C  CB    . GLU A  1 117 ? 156.986 2.213   242.472 1.00 47.40  ? 117  GLU A CB    1 
ATOM   933  C  CG    . GLU A  1 117 ? 156.547 2.429   241.035 1.00 48.41  ? 117  GLU A CG    1 
ATOM   934  C  CD    . GLU A  1 117 ? 157.382 3.474   240.352 1.00 43.26  ? 117  GLU A CD    1 
ATOM   935  O  OE1   . GLU A  1 117 ? 158.617 3.347   240.394 1.00 47.21  ? 117  GLU A OE1   1 
ATOM   936  O  OE2   . GLU A  1 117 ? 156.805 4.422   239.805 1.00 42.34  ? 117  GLU A OE2   1 
ATOM   937  N  N     . GLY A  1 118 ? 158.314 -0.248  244.594 1.00 43.04  ? 118  GLY A N     1 
ATOM   938  C  CA    . GLY A  1 118 ? 158.207 -0.593  246.001 1.00 43.90  ? 118  GLY A CA    1 
ATOM   939  C  C     . GLY A  1 118 ? 159.536 -0.686  246.730 1.00 48.95  ? 118  GLY A C     1 
ATOM   940  O  O     . GLY A  1 118 ? 160.610 -0.833  246.121 1.00 45.28  ? 118  GLY A O     1 
ATOM   941  N  N     . ASP A  1 119 ? 159.453 -0.566  248.050 1.00 46.09  ? 119  ASP A N     1 
ATOM   942  C  CA    . ASP A  1 119 ? 160.576 -0.834  248.937 1.00 46.11  ? 119  ASP A CA    1 
ATOM   943  C  C     . ASP A  1 119 ? 160.873 -2.328  248.849 1.00 50.36  ? 119  ASP A C     1 
ATOM   944  O  O     . ASP A  1 119 ? 160.076 -3.160  249.292 1.00 50.60  ? 119  ASP A O     1 
ATOM   945  C  CB    . ASP A  1 119 ? 160.222 -0.403  250.364 1.00 47.84  ? 119  ASP A CB    1 
ATOM   946  C  CG    . ASP A  1 119 ? 161.412 -0.446  251.317 1.00 49.82  ? 119  ASP A CG    1 
ATOM   947  O  OD1   . ASP A  1 119 ? 162.248 -1.374  251.219 1.00 50.98  ? 119  ASP A OD1   1 
ATOM   948  O  OD2   . ASP A  1 119 ? 161.501 0.469   252.173 1.00 52.56  ? 119  ASP A OD2   1 
ATOM   949  N  N     . LYS A  1 120 ? 162.003 -2.687  248.262 1.00 46.10  ? 120  LYS A N     1 
ATOM   950  C  CA    . LYS A  1 120 ? 162.200 -4.090  247.940 1.00 50.57  ? 120  LYS A CA    1 
ATOM   951  C  C     . LYS A  1 120 ? 162.919 -4.844  249.055 1.00 54.23  ? 120  LYS A C     1 
ATOM   952  O  O     . LYS A  1 120 ? 162.907 -6.075  249.071 1.00 58.53  ? 120  LYS A O     1 
ATOM   953  C  CB    . LYS A  1 120 ? 162.930 -4.237  246.594 1.00 53.01  ? 120  LYS A CB    1 
ATOM   954  C  CG    . LYS A  1 120 ? 161.943 -4.504  245.451 1.00 58.98  ? 120  LYS A CG    1 
ATOM   955  C  CD    . LYS A  1 120 ? 162.290 -3.711  244.193 1.00 68.31  ? 120  LYS A CD    1 
ATOM   956  C  CE    . LYS A  1 120 ? 161.196 -2.701  243.859 1.00 57.39  ? 120  LYS A CE    1 
ATOM   957  N  NZ    . LYS A  1 120 ? 161.739 -1.579  243.023 1.00 58.24  ? 120  LYS A NZ    1 
ATOM   958  N  N     . THR A  1 121 ? 163.493 -4.119  250.011 1.00 47.80  ? 121  THR A N     1 
ATOM   959  C  CA    . THR A  1 121 ? 164.073 -4.769  251.174 1.00 55.55  ? 121  THR A CA    1 
ATOM   960  C  C     . THR A  1 121 ? 163.000 -5.400  252.063 1.00 55.03  ? 121  THR A C     1 
ATOM   961  O  O     . THR A  1 121 ? 163.310 -6.233  252.900 1.00 53.28  ? 121  THR A O     1 
ATOM   962  C  CB    . THR A  1 121 ? 164.883 -3.794  252.034 1.00 56.66  ? 121  THR A CB    1 
ATOM   963  O  OG1   . THR A  1 121 ? 163.983 -3.028  252.845 1.00 59.82  ? 121  THR A OG1   1 
ATOM   964  C  CG2   . THR A  1 121 ? 165.724 -2.872  251.163 1.00 53.59  ? 121  THR A CG2   1 
ATOM   965  N  N     . LEU A  1 122 ? 161.746 -4.989  251.878 1.00 57.51  ? 122  LEU A N     1 
ATOM   966  C  CA    . LEU A  1 122 ? 160.616 -5.411  252.734 1.00 60.29  ? 122  LEU A CA    1 
ATOM   967  C  C     . LEU A  1 122 ? 160.777 -5.096  254.237 1.00 56.88  ? 122  LEU A C     1 
ATOM   968  O  O     . LEU A  1 122 ? 159.884 -5.413  255.012 1.00 56.59  ? 122  LEU A O     1 
ATOM   969  C  CB    . LEU A  1 122 ? 160.336 -6.910  252.570 1.00 54.74  ? 122  LEU A CB    1 
ATOM   970  C  CG    . LEU A  1 122 ? 160.026 -7.377  251.150 1.00 57.08  ? 122  LEU A CG    1 
ATOM   971  C  CD1   . LEU A  1 122 ? 159.666 -8.857  251.117 1.00 58.60  ? 122  LEU A CD1   1 
ATOM   972  C  CD2   . LEU A  1 122 ? 158.900 -6.555  250.589 1.00 54.71  ? 122  LEU A CD2   1 
ATOM   973  N  N     . LYS A  1 123 ? 161.897 -4.485  254.636 1.00 57.28  ? 123  LYS A N     1 
ATOM   974  C  CA    . LYS A  1 123 ? 162.058 -3.936  255.991 1.00 61.55  ? 123  LYS A CA    1 
ATOM   975  C  C     . LYS A  1 123 ? 160.918 -2.955  256.281 1.00 64.21  ? 123  LYS A C     1 
ATOM   976  O  O     . LYS A  1 123 ? 160.298 -2.968  257.354 1.00 58.43  ? 123  LYS A O     1 
ATOM   977  C  CB    . LYS A  1 123 ? 163.409 -3.235  256.147 1.00 55.09  ? 123  LYS A CB    1 
ATOM   978  C  CG    . LYS A  1 123 ? 164.621 -4.119  255.864 1.00 58.61  ? 123  LYS A CG    1 
ATOM   979  C  CD    . LYS A  1 123 ? 165.925 -3.410  256.222 1.00 61.06  ? 123  LYS A CD    1 
ATOM   980  C  CE    . LYS A  1 123 ? 167.137 -4.249  255.836 1.00 69.71  ? 123  LYS A CE    1 
ATOM   981  N  NZ    . LYS A  1 123 ? 168.404 -3.708  256.404 1.00 80.73  ? 123  LYS A NZ    1 
ATOM   982  N  N     . ARG A  1 124 ? 160.641 -2.109  255.297 1.00 63.05  ? 124  ARG A N     1 
ATOM   983  C  CA    . ARG A  1 124 ? 159.433 -1.310  255.311 1.00 58.46  ? 124  ARG A CA    1 
ATOM   984  C  C     . ARG A  1 124 ? 158.688 -1.592  254.020 1.00 55.06  ? 124  ARG A C     1 
ATOM   985  O  O     . ARG A  1 124 ? 159.272 -2.077  253.056 1.00 49.51  ? 124  ARG A O     1 
ATOM   986  C  CB    . ARG A  1 124 ? 159.757 0.168   255.446 1.00 54.91  ? 124  ARG A CB    1 
ATOM   987  C  CG    . ARG A  1 124 ? 160.533 0.500   256.688 1.00 58.43  ? 124  ARG A CG    1 
ATOM   988  C  CD    . ARG A  1 124 ? 161.552 1.563   256.363 1.00 58.37  ? 124  ARG A CD    1 
ATOM   989  N  NE    . ARG A  1 124 ? 161.060 2.881   256.733 1.00 61.79  ? 124  ARG A NE    1 
ATOM   990  C  CZ    . ARG A  1 124 ? 161.837 3.949   256.846 1.00 62.27  ? 124  ARG A CZ    1 
ATOM   991  N  NH1   . ARG A  1 124 ? 163.145 3.856   256.601 1.00 59.78  ? 124  ARG A NH1   1 
ATOM   992  N  NH2   . ARG A  1 124 ? 161.298 5.109   257.193 1.00 62.60  ? 124  ARG A NH2   1 
ATOM   993  N  N     . LEU A  1 125 ? 157.394 -1.306  254.031 1.00 48.86  ? 125  LEU A N     1 
ATOM   994  C  CA    . LEU A  1 125 ? 156.536 -1.545  252.902 1.00 49.29  ? 125  LEU A CA    1 
ATOM   995  C  C     . LEU A  1 125 ? 156.030 -0.203  252.370 1.00 50.77  ? 125  LEU A C     1 
ATOM   996  O  O     . LEU A  1 125 ? 155.183 0.458   252.988 1.00 51.66  ? 125  LEU A O     1 
ATOM   997  C  CB    . LEU A  1 125 ? 155.403 -2.476  253.319 1.00 47.68  ? 125  LEU A CB    1 
ATOM   998  C  CG    . LEU A  1 125 ? 155.896 -3.847  253.812 1.00 48.85  ? 125  LEU A CG    1 
ATOM   999  C  CD1   . LEU A  1 125 ? 154.773 -4.612  254.490 1.00 48.89  ? 125  LEU A CD1   1 
ATOM   1000 C  CD2   . LEU A  1 125 ? 156.463 -4.680  252.659 1.00 47.33  ? 125  LEU A CD2   1 
ATOM   1001 N  N     . ARG A  1 126 ? 156.581 0.192   251.227 1.00 45.42  ? 126  ARG A N     1 
ATOM   1002 C  CA    . ARG A  1 126 ? 156.462 1.550   250.704 1.00 46.39  ? 126  ARG A CA    1 
ATOM   1003 C  C     . ARG A  1 126 ? 156.379 1.585   249.175 1.00 46.68  ? 126  ARG A C     1 
ATOM   1004 O  O     . ARG A  1 126 ? 157.189 0.963   248.476 1.00 45.98  ? 126  ARG A O     1 
ATOM   1005 C  CB    . ARG A  1 126 ? 157.662 2.402   251.152 1.00 48.39  ? 126  ARG A CB    1 
ATOM   1006 C  CG    . ARG A  1 126 ? 157.719 2.716   252.646 1.00 46.99  ? 126  ARG A CG    1 
ATOM   1007 C  CD    . ARG A  1 126 ? 158.874 3.646   252.993 1.00 40.96  ? 126  ARG A CD    1 
ATOM   1008 N  NE    . ARG A  1 126 ? 160.160 2.998   252.801 1.00 41.64  ? 126  ARG A NE    1 
ATOM   1009 C  CZ    . ARG A  1 126 ? 161.329 3.604   252.944 1.00 45.57  ? 126  ARG A CZ    1 
ATOM   1010 N  NH1   . ARG A  1 126 ? 161.380 4.879   253.293 1.00 44.96  ? 126  ARG A NH1   1 
ATOM   1011 N  NH2   . ARG A  1 126 ? 162.453 2.936   252.726 1.00 44.70  ? 126  ARG A NH2   1 
ATOM   1012 N  N     . ILE A  1 127 ? 155.412 2.327   248.652 1.00 47.35  ? 127  ILE A N     1 
ATOM   1013 C  CA    . ILE A  1 127 ? 155.339 2.561   247.216 1.00 42.01  ? 127  ILE A CA    1 
ATOM   1014 C  C     . ILE A  1 127 ? 155.489 4.044   246.931 1.00 43.08  ? 127  ILE A C     1 
ATOM   1015 O  O     . ILE A  1 127 ? 154.759 4.855   247.505 1.00 45.18  ? 127  ILE A O     1 
ATOM   1016 C  CB    . ILE A  1 127 ? 154.025 2.064   246.626 1.00 37.00  ? 127  ILE A CB    1 
ATOM   1017 C  CG1   . ILE A  1 127 ? 153.856 0.578   246.935 1.00 41.60  ? 127  ILE A CG1   1 
ATOM   1018 C  CG2   . ILE A  1 127 ? 153.992 2.351   245.127 1.00 32.74  ? 127  ILE A CG2   1 
ATOM   1019 C  CD1   . ILE A  1 127 ? 152.441 0.080   246.809 1.00 41.68  ? 127  ILE A CD1   1 
ATOM   1020 N  N     . TRP A  1 128 ? 156.432 4.391   246.058 1.00 39.66  ? 128  TRP A N     1 
ATOM   1021 C  CA    . TRP A  1 128 ? 156.680 5.785   245.688 1.00 45.33  ? 128  TRP A CA    1 
ATOM   1022 C  C     . TRP A  1 128 ? 156.036 6.178   244.355 1.00 44.96  ? 128  TRP A C     1 
ATOM   1023 O  O     . TRP A  1 128 ? 156.092 5.408   243.401 1.00 48.33  ? 128  TRP A O     1 
ATOM   1024 C  CB    . TRP A  1 128 ? 158.185 6.048   245.625 1.00 41.91  ? 128  TRP A CB    1 
ATOM   1025 C  CG    . TRP A  1 128 ? 158.839 6.062   246.992 1.00 49.94  ? 128  TRP A CG    1 
ATOM   1026 C  CD1   . TRP A  1 128 ? 158.900 7.119   247.859 1.00 46.96  ? 128  TRP A CD1   1 
ATOM   1027 C  CD2   . TRP A  1 128 ? 159.507 4.968   247.646 1.00 49.82  ? 128  TRP A CD2   1 
ATOM   1028 N  NE1   . TRP A  1 128 ? 159.576 6.758   249.003 1.00 50.76  ? 128  TRP A NE1   1 
ATOM   1029 C  CE2   . TRP A  1 128 ? 159.955 5.444   248.902 1.00 52.03  ? 128  TRP A CE2   1 
ATOM   1030 C  CE3   . TRP A  1 128 ? 159.771 3.638   247.294 1.00 43.52  ? 128  TRP A CE3   1 
ATOM   1031 C  CZ2   . TRP A  1 128 ? 160.646 4.637   249.806 1.00 46.28  ? 128  TRP A CZ2   1 
ATOM   1032 C  CZ3   . TRP A  1 128 ? 160.476 2.846   248.181 1.00 47.75  ? 128  TRP A CZ3   1 
ATOM   1033 C  CH2   . TRP A  1 128 ? 160.892 3.344   249.434 1.00 46.11  ? 128  TRP A CH2   1 
ATOM   1034 N  N     . ASN A  1 129 ? 155.431 7.368   244.299 1.00 44.70  ? 129  ASN A N     1 
ATOM   1035 C  CA    . ASN A  1 129 ? 154.943 7.940   243.032 1.00 44.64  ? 129  ASN A CA    1 
ATOM   1036 C  C     . ASN A  1 129 ? 154.471 9.395   243.098 1.00 45.98  ? 129  ASN A C     1 
ATOM   1037 O  O     . ASN A  1 129 ? 153.824 9.813   244.061 1.00 46.64  ? 129  ASN A O     1 
ATOM   1038 C  CB    . ASN A  1 129 ? 153.791 7.102   242.482 1.00 40.27  ? 129  ASN A CB    1 
ATOM   1039 C  CG    . ASN A  1 129 ? 153.835 7.004   240.984 1.00 44.64  ? 129  ASN A CG    1 
ATOM   1040 O  OD1   . ASN A  1 129 ? 153.136 7.734   240.275 1.00 42.96  ? 129  ASN A OD1   1 
ATOM   1041 N  ND2   . ASN A  1 129 ? 154.714 6.132   240.485 1.00 35.84  ? 129  ASN A ND2   1 
ATOM   1042 N  N     . LYS A  1 130 ? 154.758 10.152  242.052 1.00 45.93  ? 130  LYS A N     1 
ATOM   1043 C  CA    . LYS A  1 130 ? 154.258 11.516  241.949 1.00 46.40  ? 130  LYS A CA    1 
ATOM   1044 C  C     . LYS A  1 130 ? 152.749 11.558  241.735 1.00 48.06  ? 130  LYS A C     1 
ATOM   1045 O  O     . LYS A  1 130 ? 152.120 12.576  241.955 1.00 50.65  ? 130  LYS A O     1 
ATOM   1046 C  CB    . LYS A  1 130 ? 154.962 12.249  240.812 1.00 46.06  ? 130  LYS A CB    1 
ATOM   1047 C  CG    . LYS A  1 130 ? 156.445 12.417  241.044 1.00 48.45  ? 130  LYS A CG    1 
ATOM   1048 C  CD    . LYS A  1 130 ? 157.091 13.330  240.017 1.00 50.59  ? 130  LYS A CD    1 
ATOM   1049 C  CE    . LYS A  1 130 ? 156.439 14.703  240.016 1.00 54.87  ? 130  LYS A CE    1 
ATOM   1050 N  NZ    . LYS A  1 130 ? 157.433 15.750  239.635 1.00 58.46  ? 130  LYS A NZ    1 
ATOM   1051 N  N     . ASN A  1 131 ? 152.172 10.446  241.307 1.00 47.24  ? 131  ASN A N     1 
ATOM   1052 C  CA    . ASN A  1 131 ? 150.752 10.391  240.990 1.00 43.27  ? 131  ASN A CA    1 
ATOM   1053 C  C     . ASN A  1 131 ? 149.878 10.052  242.198 1.00 48.72  ? 131  ASN A C     1 
ATOM   1054 O  O     . ASN A  1 131 ? 149.561 8.883   242.438 1.00 44.55  ? 131  ASN A O     1 
ATOM   1055 C  CB    . ASN A  1 131 ? 150.531 9.361   239.882 1.00 44.51  ? 131  ASN A CB    1 
ATOM   1056 C  CG    . ASN A  1 131 ? 149.173 9.470   239.229 1.00 49.36  ? 131  ASN A CG    1 
ATOM   1057 O  OD1   . ASN A  1 131 ? 148.226 10.033  239.792 1.00 49.73  ? 131  ASN A OD1   1 
ATOM   1058 N  ND2   . ASN A  1 131 ? 149.060 8.898   238.035 1.00 46.13  ? 131  ASN A ND2   1 
ATOM   1059 N  N     . LYS A  1 132 ? 149.463 11.079  242.936 1.00 51.67  ? 132  LYS A N     1 
ATOM   1060 C  CA    . LYS A  1 132 ? 148.722 10.872  244.178 1.00 45.95  ? 132  LYS A CA    1 
ATOM   1061 C  C     . LYS A  1 132 ? 147.407 10.132  243.936 1.00 49.89  ? 132  LYS A C     1 
ATOM   1062 O  O     . LYS A  1 132 ? 147.051 9.222   244.693 1.00 50.44  ? 132  LYS A O     1 
ATOM   1063 C  CB    . LYS A  1 132 ? 148.462 12.213  244.864 1.00 56.52  ? 132  LYS A CB    1 
ATOM   1064 C  CG    . LYS A  1 132 ? 147.976 12.097  246.295 1.00 56.35  ? 132  LYS A CG    1 
ATOM   1065 C  CD    . LYS A  1 132 ? 147.734 13.467  246.882 1.00 59.38  ? 132  LYS A CD    1 
ATOM   1066 C  CE    . LYS A  1 132 ? 147.080 13.366  248.250 1.00 64.75  ? 132  LYS A CE    1 
ATOM   1067 N  NZ    . LYS A  1 132 ? 146.403 14.647  248.583 1.00 73.59  ? 132  LYS A NZ    1 
ATOM   1068 N  N     . ALA A  1 133 ? 146.703 10.497  242.864 1.00 49.72  ? 133  ALA A N     1 
ATOM   1069 C  CA    . ALA A  1 133 ? 145.401 9.895   242.575 1.00 48.68  ? 133  ALA A CA    1 
ATOM   1070 C  C     . ALA A  1 133 ? 145.519 8.395   242.356 1.00 52.13  ? 133  ALA A C     1 
ATOM   1071 O  O     . ALA A  1 133 ? 144.665 7.619   242.801 1.00 51.16  ? 133  ALA A O     1 
ATOM   1072 C  CB    . ALA A  1 133 ? 144.765 10.549  241.371 1.00 46.02  ? 133  ALA A CB    1 
ATOM   1073 N  N     . LEU A  1 134 ? 146.589 7.989   241.680 1.00 49.72  ? 134  LEU A N     1 
ATOM   1074 C  CA    . LEU A  1 134 ? 146.849 6.575   241.483 1.00 47.77  ? 134  LEU A CA    1 
ATOM   1075 C  C     . LEU A  1 134 ? 147.081 5.917   242.839 1.00 45.76  ? 134  LEU A C     1 
ATOM   1076 O  O     . LEU A  1 134 ? 146.513 4.860   243.129 1.00 47.59  ? 134  LEU A O     1 
ATOM   1077 C  CB    . LEU A  1 134 ? 148.052 6.357   240.553 1.00 43.05  ? 134  LEU A CB    1 
ATOM   1078 C  CG    . LEU A  1 134 ? 148.613 4.929   240.521 1.00 43.87  ? 134  LEU A CG    1 
ATOM   1079 C  CD1   . LEU A  1 134 ? 147.574 3.943   240.020 1.00 40.75  ? 134  LEU A CD1   1 
ATOM   1080 C  CD2   . LEU A  1 134 ? 149.898 4.821   239.693 1.00 44.69  ? 134  LEU A CD2   1 
ATOM   1081 N  N     . LEU A  1 135 ? 147.915 6.533   243.674 1.00 43.88  ? 135  LEU A N     1 
ATOM   1082 C  CA    . LEU A  1 135 ? 148.163 5.957   244.993 1.00 47.85  ? 135  LEU A CA    1 
ATOM   1083 C  C     . LEU A  1 135 ? 146.867 5.896   245.814 1.00 46.27  ? 135  LEU A C     1 
ATOM   1084 O  O     . LEU A  1 135 ? 146.638 4.924   246.527 1.00 46.05  ? 135  LEU A O     1 
ATOM   1085 C  CB    . LEU A  1 135 ? 149.246 6.735   245.743 1.00 40.93  ? 135  LEU A CB    1 
ATOM   1086 C  CG    . LEU A  1 135 ? 150.676 6.579   245.198 1.00 44.26  ? 135  LEU A CG    1 
ATOM   1087 C  CD1   . LEU A  1 135 ? 151.640 7.418   245.984 1.00 37.91  ? 135  LEU A CD1   1 
ATOM   1088 C  CD2   . LEU A  1 135 ? 151.137 5.116   245.167 1.00 36.67  ? 135  LEU A CD2   1 
ATOM   1089 N  N     . GLU A  1 136 ? 146.001 6.895   245.685 1.00 45.18  ? 136  GLU A N     1 
ATOM   1090 C  CA    . GLU A  1 136 ? 144.760 6.906   246.481 1.00 52.63  ? 136  GLU A CA    1 
ATOM   1091 C  C     . GLU A  1 136 ? 143.859 5.741   246.108 1.00 51.35  ? 136  GLU A C     1 
ATOM   1092 O  O     . GLU A  1 136 ? 143.213 5.145   246.968 1.00 51.25  ? 136  GLU A O     1 
ATOM   1093 C  CB    . GLU A  1 136 ? 144.016 8.242   246.327 1.00 53.96  ? 136  GLU A CB    1 
ATOM   1094 C  CG    . GLU A  1 136 ? 144.677 9.355   247.149 1.00 62.61  ? 136  GLU A CG    1 
ATOM   1095 C  CD    . GLU A  1 136 ? 144.154 10.750  246.838 1.00 70.91  ? 136  GLU A CD    1 
ATOM   1096 O  OE1   . GLU A  1 136 ? 143.744 10.986  245.670 1.00 65.56  ? 136  GLU A OE1   1 
ATOM   1097 O  OE2   . GLU A  1 136 ? 144.176 11.605  247.766 1.00 69.51  ? 136  GLU A OE2   1 
ATOM   1098 N  N     . ILE A  1 137 ? 143.842 5.402   244.821 1.00 54.47  ? 137  ILE A N     1 
ATOM   1099 C  CA    . ILE A  1 137 ? 143.106 4.236   244.345 1.00 48.39  ? 137  ILE A CA    1 
ATOM   1100 C  C     . ILE A  1 137 ? 143.682 2.961   244.962 1.00 51.08  ? 137  ILE A C     1 
ATOM   1101 O  O     . ILE A  1 137 ? 142.952 2.141   245.525 1.00 48.62  ? 137  ILE A O     1 
ATOM   1102 C  CB    . ILE A  1 137 ? 143.145 4.145   242.808 1.00 53.14  ? 137  ILE A CB    1 
ATOM   1103 C  CG1   . ILE A  1 137 ? 142.426 5.344   242.190 1.00 52.66  ? 137  ILE A CG1   1 
ATOM   1104 C  CG2   . ILE A  1 137 ? 142.531 2.837   242.342 1.00 51.28  ? 137  ILE A CG2   1 
ATOM   1105 C  CD1   . ILE A  1 137 ? 142.791 5.603   240.757 1.00 54.67  ? 137  ILE A CD1   1 
ATOM   1106 N  N     . VAL A  1 138 ? 145.001 2.801   244.864 1.00 49.91  ? 138  VAL A N     1 
ATOM   1107 C  CA    . VAL A  1 138 ? 145.688 1.678   245.508 1.00 50.13  ? 138  VAL A CA    1 
ATOM   1108 C  C     . VAL A  1 138 ? 145.383 1.618   247.020 1.00 45.65  ? 138  VAL A C     1 
ATOM   1109 O  O     . VAL A  1 138 ? 145.211 0.538   247.583 1.00 43.57  ? 138  VAL A O     1 
ATOM   1110 C  CB    . VAL A  1 138 ? 147.220 1.764   245.273 1.00 41.59  ? 138  VAL A CB    1 
ATOM   1111 C  CG1   . VAL A  1 138 ? 147.970 0.683   246.036 1.00 38.28  ? 138  VAL A CG1   1 
ATOM   1112 C  CG2   . VAL A  1 138 ? 147.511 1.661   243.794 1.00 47.21  ? 138  VAL A CG2   1 
ATOM   1113 N  N     . SER A  1 139 ? 145.331 2.779   247.664 1.00 45.22  ? 139  SER A N     1 
ATOM   1114 C  CA    . SER A  1 139 ? 145.028 2.859   249.100 1.00 53.17  ? 139  SER A CA    1 
ATOM   1115 C  C     . SER A  1 139 ? 143.643 2.292   249.432 1.00 49.90  ? 139  SER A C     1 
ATOM   1116 O  O     . SER A  1 139 ? 143.496 1.541   250.398 1.00 49.36  ? 139  SER A O     1 
ATOM   1117 C  CB    . SER A  1 139 ? 145.116 4.306   249.595 1.00 49.18  ? 139  SER A CB    1 
ATOM   1118 O  OG    . SER A  1 139 ? 144.667 4.405   250.940 1.00 54.12  ? 139  SER A OG    1 
ATOM   1119 N  N     . ARG A  1 140 ? 142.642 2.645   248.624 1.00 46.96  ? 140  ARG A N     1 
ATOM   1120 C  CA    . ARG A  1 140 ? 141.281 2.181   248.855 1.00 50.98  ? 140  ARG A CA    1 
ATOM   1121 C  C     . ARG A  1 140 ? 141.185 0.673   248.666 1.00 57.14  ? 140  ARG A C     1 
ATOM   1122 O  O     . ARG A  1 140 ? 140.620 -0.025  249.525 1.00 55.97  ? 140  ARG A O     1 
ATOM   1123 C  CB    . ARG A  1 140 ? 140.308 2.923   247.952 1.00 53.26  ? 140  ARG A CB    1 
ATOM   1124 C  CG    . ARG A  1 140 ? 140.121 4.378   248.367 1.00 56.54  ? 140  ARG A CG    1 
ATOM   1125 C  CD    . ARG A  1 140 ? 139.391 5.204   247.324 1.00 62.80  ? 140  ARG A CD    1 
ATOM   1126 N  NE    . ARG A  1 140 ? 139.745 6.622   247.413 1.00 70.84  ? 140  ARG A NE    1 
ATOM   1127 C  CZ    . ARG A  1 140 ? 140.107 7.379   246.376 1.00 73.21  ? 140  ARG A CZ    1 
ATOM   1128 N  NH1   . ARG A  1 140 ? 140.174 6.863   245.145 1.00 65.45  ? 140  ARG A NH1   1 
ATOM   1129 N  NH2   . ARG A  1 140 ? 140.415 8.659   246.572 1.00 72.30  ? 140  ARG A NH2   1 
ATOM   1130 N  N     . TRP A  1 141 ? 141.762 0.173   247.571 1.00 49.89  ? 141  TRP A N     1 
ATOM   1131 C  CA    . TRP A  1 141 ? 141.875 -1.267  247.336 1.00 49.31  ? 141  TRP A CA    1 
ATOM   1132 C  C     . TRP A  1 141 ? 142.549 -1.995  248.497 1.00 53.14  ? 141  TRP A C     1 
ATOM   1133 O  O     . TRP A  1 141 ? 142.114 -3.084  248.910 1.00 53.14  ? 141  TRP A O     1 
ATOM   1134 C  CB    . TRP A  1 141 ? 142.673 -1.551  246.061 1.00 47.56  ? 141  TRP A CB    1 
ATOM   1135 C  CG    . TRP A  1 141 ? 142.015 -1.108  244.785 1.00 56.94  ? 141  TRP A CG    1 
ATOM   1136 C  CD1   . TRP A  1 141 ? 140.725 -0.672  244.623 1.00 58.08  ? 141  TRP A CD1   1 
ATOM   1137 C  CD2   . TRP A  1 141 ? 142.623 -1.040  243.491 1.00 56.95  ? 141  TRP A CD2   1 
ATOM   1138 N  NE1   . TRP A  1 141 ? 140.498 -0.332  243.314 1.00 59.30  ? 141  TRP A NE1   1 
ATOM   1139 C  CE2   . TRP A  1 141 ? 141.648 -0.555  242.590 1.00 60.23  ? 141  TRP A CE2   1 
ATOM   1140 C  CE3   . TRP A  1 141 ? 143.899 -1.349  243.000 1.00 56.63  ? 141  TRP A CE3   1 
ATOM   1141 C  CZ2   . TRP A  1 141 ? 141.898 -0.374  241.229 1.00 56.44  ? 141  TRP A CZ2   1 
ATOM   1142 C  CZ3   . TRP A  1 141 ? 144.157 -1.165  241.641 1.00 52.42  ? 141  TRP A CZ3   1 
ATOM   1143 C  CH2   . TRP A  1 141 ? 143.158 -0.680  240.775 1.00 53.44  ? 141  TRP A CH2   1 
ATOM   1144 N  N     . LEU A  1 142 ? 143.648 -1.419  248.979 1.00 48.08  ? 142  LEU A N     1 
ATOM   1145 C  CA    . LEU A  1 142 ? 144.380 -2.001  250.087 1.00 52.45  ? 142  LEU A CA    1 
ATOM   1146 C  C     . LEU A  1 142 ? 143.511 -1.982  251.356 1.00 53.93  ? 142  LEU A C     1 
ATOM   1147 O  O     . LEU A  1 142 ? 143.459 -2.968  252.081 1.00 51.95  ? 142  LEU A O     1 
ATOM   1148 C  CB    . LEU A  1 142 ? 145.697 -1.265  250.313 1.00 48.84  ? 142  LEU A CB    1 
ATOM   1149 C  CG    . LEU A  1 142 ? 146.812 -1.691  249.349 1.00 51.77  ? 142  LEU A CG    1 
ATOM   1150 C  CD1   . LEU A  1 142 ? 148.043 -0.836  249.545 1.00 48.40  ? 142  LEU A CD1   1 
ATOM   1151 C  CD2   . LEU A  1 142 ? 147.162 -3.162  249.518 1.00 46.65  ? 142  LEU A CD2   1 
ATOM   1152 N  N     . ASN A  1 143 ? 142.809 -0.878  251.598 1.00 50.01  ? 143  ASN A N     1 
ATOM   1153 C  CA    . ASN A  1 143 ? 141.901 -0.799  252.747 1.00 59.17  ? 143  ASN A CA    1 
ATOM   1154 C  C     . ASN A  1 143 ? 140.816 -1.892  252.691 1.00 60.71  ? 143  ASN A C     1 
ATOM   1155 O  O     . ASN A  1 143 ? 140.595 -2.605  253.673 1.00 58.65  ? 143  ASN A O     1 
ATOM   1156 C  CB    . ASN A  1 143 ? 141.273 0.598   252.846 1.00 55.42  ? 143  ASN A CB    1 
ATOM   1157 C  CG    . ASN A  1 143 ? 142.180 1.599   253.583 1.00 58.41  ? 143  ASN A CG    1 
ATOM   1158 O  OD1   . ASN A  1 143 ? 142.743 1.281   254.635 1.00 59.21  ? 143  ASN A OD1   1 
ATOM   1159 N  ND2   . ASN A  1 143 ? 142.329 2.806   253.026 1.00 58.22  ? 143  ASN A ND2   1 
ATOM   1160 N  N     . ASN A  1 144 ? 140.185 -2.053  251.528 1.00 62.33  ? 144  ASN A N     1 
ATOM   1161 C  CA    . ASN A  1 144 ? 139.311 -3.200  251.269 1.00 58.96  ? 144  ASN A CA    1 
ATOM   1162 C  C     . ASN A  1 144 ? 139.903 -4.592  251.353 1.00 60.61  ? 144  ASN A C     1 
ATOM   1163 O  O     . ASN A  1 144 ? 139.158 -5.560  251.363 1.00 66.40  ? 144  ASN A O     1 
ATOM   1164 C  CB    . ASN A  1 144 ? 138.670 -3.074  249.887 1.00 66.54  ? 144  ASN A CB    1 
ATOM   1165 C  CG    . ASN A  1 144 ? 137.404 -2.218  249.882 1.00 81.39  ? 144  ASN A CG    1 
ATOM   1166 O  OD1   . ASN A  1 144 ? 136.648 -2.163  250.876 1.00 87.63  ? 144  ASN A OD1   1 
ATOM   1167 N  ND2   . ASN A  1 144 ? 137.172 -1.530  248.761 1.00 80.64  ? 144  ASN A ND2   1 
ATOM   1168 N  N     . LEU A  1 145 ? 141.216 -4.710  251.381 1.00 58.16  ? 145  LEU A N     1 
ATOM   1169 C  CA    . LEU A  1 145 ? 141.834 -6.010  251.522 1.00 57.34  ? 145  LEU A CA    1 
ATOM   1170 C  C     . LEU A  1 145 ? 142.343 -6.164  252.951 1.00 61.30  ? 145  LEU A C     1 
ATOM   1171 O  O     . LEU A  1 145 ? 143.018 -7.147  253.299 1.00 61.48  ? 145  LEU A O     1 
ATOM   1172 C  CB    . LEU A  1 145 ? 142.948 -6.145  250.491 1.00 61.42  ? 145  LEU A CB    1 
ATOM   1173 C  CG    . LEU A  1 145 ? 142.464 -6.470  249.069 1.00 65.66  ? 145  LEU A CG    1 
ATOM   1174 C  CD1   . LEU A  1 145 ? 143.445 -5.975  248.025 1.00 63.92  ? 145  LEU A CD1   1 
ATOM   1175 C  CD2   . LEU A  1 145 ? 142.256 -7.965  248.881 1.00 63.58  ? 145  LEU A CD2   1 
ATOM   1176 N  N     . GLY A  1 146 ? 141.973 -5.185  253.777 1.00 56.64  ? 146  GLY A N     1 
ATOM   1177 C  CA    . GLY A  1 146 ? 142.294 -5.198  255.188 1.00 56.47  ? 146  GLY A CA    1 
ATOM   1178 C  C     . GLY A  1 146 ? 143.757 -4.891  255.387 1.00 62.03  ? 146  GLY A C     1 
ATOM   1179 O  O     . GLY A  1 146 ? 144.396 -5.421  256.289 1.00 63.07  ? 146  GLY A O     1 
ATOM   1180 N  N     . VAL A  1 147 ? 144.301 -4.041  254.526 1.00 58.38  ? 147  VAL A N     1 
ATOM   1181 C  CA    . VAL A  1 147 ? 145.685 -3.639  254.675 1.00 56.94  ? 147  VAL A CA    1 
ATOM   1182 C  C     . VAL A  1 147 ? 145.713 -2.131  254.875 1.00 55.69  ? 147  VAL A C     1 
ATOM   1183 O  O     . VAL A  1 147 ? 145.302 -1.355  253.999 1.00 55.88  ? 147  VAL A O     1 
ATOM   1184 C  CB    . VAL A  1 147 ? 146.535 -4.068  253.469 1.00 58.64  ? 147  VAL A CB    1 
ATOM   1185 C  CG1   . VAL A  1 147 ? 147.994 -3.706  253.700 1.00 56.93  ? 147  VAL A CG1   1 
ATOM   1186 C  CG2   . VAL A  1 147 ? 146.394 -5.566  253.258 1.00 55.27  ? 147  VAL A CG2   1 
ATOM   1187 N  N     . ARG A  1 148 ? 146.153 -1.732  256.062 1.00 54.61  ? 148  ARG A N     1 
ATOM   1188 C  CA    . ARG A  1 148 ? 146.152 -0.335  256.450 1.00 51.56  ? 148  ARG A CA    1 
ATOM   1189 C  C     . ARG A  1 148 ? 147.368 0.384   255.896 1.00 48.76  ? 148  ARG A C     1 
ATOM   1190 O  O     . ARG A  1 148 ? 148.455 -0.181  255.764 1.00 42.40  ? 148  ARG A O     1 
ATOM   1191 C  CB    . ARG A  1 148 ? 146.107 -0.198  257.973 1.00 55.77  ? 148  ARG A CB    1 
ATOM   1192 C  CG    . ARG A  1 148 ? 144.783 -0.646  258.614 1.00 63.21  ? 148  ARG A CG    1 
ATOM   1193 C  CD    . ARG A  1 148 ? 144.962 -0.905  260.101 1.00 60.27  ? 148  ARG A CD    1 
ATOM   1194 N  NE    . ARG A  1 148 ? 145.072 -2.329  260.410 1.00 66.15  ? 148  ARG A NE    1 
ATOM   1195 C  CZ    . ARG A  1 148 ? 145.728 -2.828  261.461 1.00 71.04  ? 148  ARG A CZ    1 
ATOM   1196 N  NH1   . ARG A  1 148 ? 146.370 -2.026  262.307 1.00 71.78  ? 148  ARG A NH1   1 
ATOM   1197 N  NH2   . ARG A  1 148 ? 145.758 -4.140  261.658 1.00 62.22  ? 148  ARG A NH2   1 
ATOM   1198 N  N     . ASN A  1 149 ? 147.175 1.654   255.598 1.00 40.23  ? 149  ASN A N     1 
ATOM   1199 C  CA    . ASN A  1 149 ? 148.170 2.392   254.870 1.00 51.50  ? 149  ASN A CA    1 
ATOM   1200 C  C     . ASN A  1 149 ? 147.880 3.867   254.944 1.00 46.96  ? 149  ASN A C     1 
ATOM   1201 O  O     . ASN A  1 149 ? 146.738 4.283   255.111 1.00 48.81  ? 149  ASN A O     1 
ATOM   1202 C  CB    . ASN A  1 149 ? 148.207 1.947   253.392 1.00 42.59  ? 149  ASN A CB    1 
ATOM   1203 C  CG    . ASN A  1 149 ? 146.915 2.267   252.672 1.00 46.19  ? 149  ASN A CG    1 
ATOM   1204 O  OD1   . ASN A  1 149 ? 146.770 3.349   252.101 1.00 44.06  ? 149  ASN A OD1   1 
ATOM   1205 N  ND2   . ASN A  1 149 ? 145.952 1.345   252.725 1.00 46.62  ? 149  ASN A ND2   1 
ATOM   1206 N  N     . THR A  1 150 ? 148.927 4.650   254.768 1.00 48.84  ? 150  THR A N     1 
ATOM   1207 C  CA    . THR A  1 150 ? 148.823 6.096   254.721 1.00 50.16  ? 150  THR A CA    1 
ATOM   1208 C  C     . THR A  1 150 ? 149.575 6.646   253.509 1.00 52.04  ? 150  THR A C     1 
ATOM   1209 O  O     . THR A  1 150 ? 150.566 6.074   253.051 1.00 49.92  ? 150  THR A O     1 
ATOM   1210 C  CB    . THR A  1 150 ? 149.403 6.738   256.003 1.00 58.31  ? 150  THR A CB    1 
ATOM   1211 O  OG1   . THR A  1 150 ? 150.794 6.373   256.138 1.00 53.24  ? 150  THR A OG1   1 
ATOM   1212 C  CG2   . THR A  1 150 ? 148.608 6.272   257.247 1.00 39.54  ? 150  THR A CG2   1 
ATOM   1213 N  N     . ILE A  1 151 ? 149.108 7.778   253.013 1.00 50.31  ? 151  ILE A N     1 
ATOM   1214 C  CA    . ILE A  1 151 ? 149.773 8.465   251.924 1.00 51.32  ? 151  ILE A CA    1 
ATOM   1215 C  C     . ILE A  1 151 ? 150.260 9.809   252.421 1.00 49.90  ? 151  ILE A C     1 
ATOM   1216 O  O     . ILE A  1 151 ? 149.522 10.512  253.107 1.00 50.74  ? 151  ILE A O     1 
ATOM   1217 C  CB    . ILE A  1 151 ? 148.824 8.676   250.741 1.00 41.74  ? 151  ILE A CB    1 
ATOM   1218 C  CG1   . ILE A  1 151 ? 148.266 7.326   250.284 1.00 44.91  ? 151  ILE A CG1   1 
ATOM   1219 C  CG2   . ILE A  1 151 ? 149.528 9.454   249.644 1.00 48.81  ? 151  ILE A CG2   1 
ATOM   1220 C  CD1   . ILE A  1 151 ? 147.252 7.403   249.178 1.00 45.12  ? 151  ILE A CD1   1 
ATOM   1221 N  N     . HIS A  1 152 ? 151.494 10.167  252.095 1.00 47.66  ? 152  HIS A N     1 
ATOM   1222 C  CA    . HIS A  1 152 ? 151.936 11.528  252.320 1.00 52.03  ? 152  HIS A CA    1 
ATOM   1223 C  C     . HIS A  1 152 ? 153.063 11.861  251.351 1.00 51.70  ? 152  HIS A C     1 
ATOM   1224 O  O     . HIS A  1 152 ? 153.559 10.989  250.649 1.00 53.99  ? 152  HIS A O     1 
ATOM   1225 C  CB    . HIS A  1 152 ? 152.369 11.729  253.777 1.00 54.19  ? 152  HIS A CB    1 
ATOM   1226 C  CG    . HIS A  1 152 ? 153.772 11.293  254.060 1.00 55.89  ? 152  HIS A CG    1 
ATOM   1227 N  ND1   . HIS A  1 152 ? 154.086 10.005  254.453 1.00 56.07  ? 152  HIS A ND1   1 
ATOM   1228 C  CD2   . HIS A  1 152 ? 154.946 11.968  254.011 1.00 55.38  ? 152  HIS A CD2   1 
ATOM   1229 C  CE1   . HIS A  1 152 ? 155.393 9.910   254.626 1.00 61.19  ? 152  HIS A CE1   1 
ATOM   1230 N  NE2   . HIS A  1 152 ? 155.941 11.088  254.371 1.00 60.99  ? 152  HIS A NE2   1 
ATOM   1231 N  N     . LEU A  1 153 ? 153.433 13.136  251.303 1.00 52.75  ? 153  LEU A N     1 
ATOM   1232 C  CA    . LEU A  1 153 ? 154.498 13.626  250.447 1.00 50.54  ? 153  LEU A CA    1 
ATOM   1233 C  C     . LEU A  1 153 ? 155.874 13.298  251.032 1.00 56.44  ? 153  LEU A C     1 
ATOM   1234 O  O     . LEU A  1 153 ? 156.284 13.875  252.030 1.00 57.63  ? 153  LEU A O     1 
ATOM   1235 C  CB    . LEU A  1 153 ? 154.351 15.133  250.251 1.00 51.09  ? 153  LEU A CB    1 
ATOM   1236 C  CG    . LEU A  1 153 ? 155.281 15.764  249.219 1.00 56.22  ? 153  LEU A CG    1 
ATOM   1237 C  CD1   . LEU A  1 153 ? 154.956 15.211  247.831 1.00 55.68  ? 153  LEU A CD1   1 
ATOM   1238 C  CD2   . LEU A  1 153 ? 155.132 17.271  249.244 1.00 53.83  ? 153  LEU A CD2   1 
ATOM   1239 N  N     . ASP A  1 154 ? 156.576 12.369  250.398 1.00 55.30  ? 154  ASP A N     1 
ATOM   1240 C  CA    . ASP A  1 154 ? 157.860 11.899  250.879 1.00 49.71  ? 154  ASP A CA    1 
ATOM   1241 C  C     . ASP A  1 154 ? 158.987 12.809  250.422 1.00 56.29  ? 154  ASP A C     1 
ATOM   1242 O  O     . ASP A  1 154 ? 159.809 13.233  251.216 1.00 57.67  ? 154  ASP A O     1 
ATOM   1243 C  CB    . ASP A  1 154 ? 158.121 10.474  250.385 1.00 49.43  ? 154  ASP A CB    1 
ATOM   1244 C  CG    . ASP A  1 154 ? 159.158 9.756   251.222 1.00 52.29  ? 154  ASP A CG    1 
ATOM   1245 O  OD1   . ASP A  1 154 ? 159.120 9.949   252.455 1.00 56.96  ? 154  ASP A OD1   1 
ATOM   1246 O  OD2   . ASP A  1 154 ? 160.012 9.019   250.666 1.00 50.90  ? 154  ASP A OD2   1 
ATOM   1247 N  N     . ASP A  1 155 ? 159.028 13.088  249.128 1.00 49.70  ? 155  ASP A N     1 
ATOM   1248 C  CA    . ASP A  1 155 ? 160.095 13.883  248.540 1.00 50.17  ? 155  ASP A CA    1 
ATOM   1249 C  C     . ASP A  1 155 ? 159.611 15.268  248.180 1.00 58.32  ? 155  ASP A C     1 
ATOM   1250 O  O     . ASP A  1 155 ? 159.055 15.472  247.094 1.00 58.85  ? 155  ASP A O     1 
ATOM   1251 C  CB    . ASP A  1 155 ? 160.644 13.193  247.286 1.00 55.68  ? 155  ASP A CB    1 
ATOM   1252 C  CG    . ASP A  1 155 ? 161.922 13.821  246.784 1.00 55.69  ? 155  ASP A CG    1 
ATOM   1253 O  OD1   . ASP A  1 155 ? 162.197 14.986  247.116 1.00 56.75  ? 155  ASP A OD1   1 
ATOM   1254 O  OD2   . ASP A  1 155 ? 162.662 13.142  246.047 1.00 61.42  ? 155  ASP A OD2   1 
ATOM   1255 N  N     . HIS A  1 156 ? 159.843 16.222  249.078 1.00 62.32  ? 156  HIS A N     1 
ATOM   1256 C  CA    . HIS A  1 156 ? 159.447 17.606  248.839 1.00 59.02  ? 156  HIS A CA    1 
ATOM   1257 C  C     . HIS A  1 156 ? 160.200 18.208  247.639 1.00 55.78  ? 156  HIS A C     1 
ATOM   1258 O  O     . HIS A  1 156 ? 159.684 19.097  246.974 1.00 57.24  ? 156  HIS A O     1 
ATOM   1259 C  CB    . HIS A  1 156 ? 159.669 18.452  250.099 1.00 60.71  ? 156  HIS A CB    1 
ATOM   1260 C  CG    . HIS A  1 156 ? 158.716 18.136  251.211 1.00 67.16  ? 156  HIS A CG    1 
ATOM   1261 N  ND1   . HIS A  1 156 ? 158.405 19.043  252.210 1.00 68.11  ? 156  HIS A ND1   1 
ATOM   1262 C  CD2   . HIS A  1 156 ? 158.005 17.018  251.491 1.00 65.85  ? 156  HIS A CD2   1 
ATOM   1263 C  CE1   . HIS A  1 156 ? 157.545 18.495  253.046 1.00 60.64  ? 156  HIS A CE1   1 
ATOM   1264 N  NE2   . HIS A  1 156 ? 157.285 17.263  252.637 1.00 58.12  ? 156  HIS A NE2   1 
ATOM   1265 N  N     . ARG A  1 157 ? 161.399 17.713  247.344 1.00 54.36  ? 157  ARG A N     1 
ATOM   1266 C  CA    . ARG A  1 157 ? 162.164 18.240  246.207 1.00 59.13  ? 157  ARG A CA    1 
ATOM   1267 C  C     . ARG A  1 157 ? 161.494 17.937  244.852 1.00 67.84  ? 157  ARG A C     1 
ATOM   1268 O  O     . ARG A  1 157 ? 161.421 18.807  243.980 1.00 67.93  ? 157  ARG A O     1 
ATOM   1269 C  CB    . ARG A  1 157 ? 163.594 17.676  246.189 1.00 56.79  ? 157  ARG A CB    1 
ATOM   1270 C  CG    . ARG A  1 157 ? 164.298 17.674  247.528 1.00 53.06  ? 157  ARG A CG    1 
ATOM   1271 C  CD    . ARG A  1 157 ? 165.478 16.705  247.530 1.00 57.34  ? 157  ARG A CD    1 
ATOM   1272 N  NE    . ARG A  1 157 ? 165.073 15.300  247.609 1.00 57.57  ? 157  ARG A NE    1 
ATOM   1273 C  CZ    . ARG A  1 157 ? 165.923 14.275  247.576 1.00 61.89  ? 157  ARG A CZ    1 
ATOM   1274 N  NH1   . ARG A  1 157 ? 167.231 14.495  247.472 1.00 54.41  ? 157  ARG A NH1   1 
ATOM   1275 N  NH2   . ARG A  1 157 ? 165.469 13.028  247.653 1.00 58.12  ? 157  ARG A NH2   1 
ATOM   1276 N  N     . HIS A  1 158 ? 161.011 16.708  244.676 1.00 64.04  ? 158  HIS A N     1 
ATOM   1277 C  CA    . HIS A  1 158 ? 160.515 16.269  243.376 1.00 53.54  ? 158  HIS A CA    1 
ATOM   1278 C  C     . HIS A  1 158 ? 159.024 16.025  243.339 1.00 55.36  ? 158  HIS A C     1 
ATOM   1279 O  O     . HIS A  1 158 ? 158.504 15.579  242.321 1.00 54.66  ? 158  HIS A O     1 
ATOM   1280 C  CB    . HIS A  1 158 ? 161.211 14.990  242.944 1.00 56.41  ? 158  HIS A CB    1 
ATOM   1281 C  CG    . HIS A  1 158 ? 162.672 15.148  242.680 1.00 63.03  ? 158  HIS A CG    1 
ATOM   1282 N  ND1   . HIS A  1 158 ? 163.632 14.891  243.637 1.00 61.47  ? 158  HIS A ND1   1 
ATOM   1283 C  CD2   . HIS A  1 158 ? 163.343 15.492  241.554 1.00 63.08  ? 158  HIS A CD2   1 
ATOM   1284 C  CE1   . HIS A  1 158 ? 164.830 15.090  243.116 1.00 64.55  ? 158  HIS A CE1   1 
ATOM   1285 N  NE2   . HIS A  1 158 ? 164.682 15.454  241.852 1.00 59.09  ? 158  HIS A NE2   1 
ATOM   1286 N  N     . GLY A  1 159 ? 158.337 16.293  244.441 1.00 57.92  ? 159  GLY A N     1 
ATOM   1287 C  CA    . GLY A  1 159 ? 156.896 16.109  244.486 1.00 50.45  ? 159  GLY A CA    1 
ATOM   1288 C  C     . GLY A  1 159 ? 156.468 14.654  244.553 1.00 52.61  ? 159  GLY A C     1 
ATOM   1289 O  O     . GLY A  1 159 ? 155.370 14.307  244.134 1.00 54.17  ? 159  GLY A O     1 
ATOM   1290 N  N     . VAL A  1 160 ? 157.320 13.796  245.099 1.00 49.29  ? 160  VAL A N     1 
ATOM   1291 C  CA    . VAL A  1 160 ? 157.012 12.377  245.137 1.00 47.34  ? 160  VAL A CA    1 
ATOM   1292 C  C     . VAL A  1 160 ? 156.322 11.931  246.425 1.00 48.95  ? 160  VAL A C     1 
ATOM   1293 O  O     . VAL A  1 160 ? 156.858 12.058  247.513 1.00 50.31  ? 160  VAL A O     1 
ATOM   1294 C  CB    . VAL A  1 160 ? 158.281 11.552  244.939 1.00 52.66  ? 160  VAL A CB    1 
ATOM   1295 C  CG1   . VAL A  1 160 ? 157.958 10.057  244.996 1.00 42.91  ? 160  VAL A CG1   1 
ATOM   1296 C  CG2   . VAL A  1 160 ? 158.932 11.934  243.606 1.00 44.65  ? 160  VAL A CG2   1 
ATOM   1297 N  N     . TYR A  1 161 ? 155.120 11.399  246.275 1.00 46.60  ? 161  TYR A N     1 
ATOM   1298 C  CA    . TYR A  1 161 ? 154.387 10.796  247.372 1.00 47.30  ? 161  TYR A CA    1 
ATOM   1299 C  C     . TYR A  1 161 ? 154.900 9.393   247.686 1.00 47.74  ? 161  TYR A C     1 
ATOM   1300 O  O     . TYR A  1 161 ? 155.497 8.725   246.834 1.00 46.24  ? 161  TYR A O     1 
ATOM   1301 C  CB    . TYR A  1 161 ? 152.886 10.736  247.035 1.00 49.47  ? 161  TYR A CB    1 
ATOM   1302 C  CG    . TYR A  1 161 ? 152.228 12.094  246.939 1.00 55.74  ? 161  TYR A CG    1 
ATOM   1303 C  CD1   . TYR A  1 161 ? 152.256 12.832  245.752 1.00 53.93  ? 161  TYR A CD1   1 
ATOM   1304 C  CD2   . TYR A  1 161 ? 151.592 12.655  248.050 1.00 54.07  ? 161  TYR A CD2   1 
ATOM   1305 C  CE1   . TYR A  1 161 ? 151.660 14.088  245.681 1.00 54.23  ? 161  TYR A CE1   1 
ATOM   1306 C  CE2   . TYR A  1 161 ? 150.998 13.898  247.986 1.00 55.35  ? 161  TYR A CE2   1 
ATOM   1307 C  CZ    . TYR A  1 161 ? 151.030 14.612  246.809 1.00 60.86  ? 161  TYR A CZ    1 
ATOM   1308 O  OH    . TYR A  1 161 ? 150.425 15.848  246.782 1.00 64.29  ? 161  TYR A OH    1 
ATOM   1309 N  N     . VAL A  1 162 ? 154.659 8.953   248.913 1.00 45.39  ? 162  VAL A N     1 
ATOM   1310 C  CA    . VAL A  1 162 ? 154.849 7.563   249.295 1.00 38.76  ? 162  VAL A CA    1 
ATOM   1311 C  C     . VAL A  1 162 ? 153.527 7.028   249.821 1.00 43.60  ? 162  VAL A C     1 
ATOM   1312 O  O     . VAL A  1 162 ? 152.769 7.761   250.459 1.00 49.07  ? 162  VAL A O     1 
ATOM   1313 C  CB    . VAL A  1 162 ? 155.972 7.400   250.357 1.00 49.31  ? 162  VAL A CB    1 
ATOM   1314 C  CG1   . VAL A  1 162 ? 155.610 8.101   251.687 1.00 39.59  ? 162  VAL A CG1   1 
ATOM   1315 C  CG2   . VAL A  1 162 ? 156.299 5.926   250.589 1.00 45.54  ? 162  VAL A CG2   1 
ATOM   1316 N  N     . LEU A  1 163 ? 153.216 5.772   249.504 1.00 47.76  ? 163  LEU A N     1 
ATOM   1317 C  CA    . LEU A  1 163 ? 152.134 5.047   250.187 1.00 44.61  ? 163  LEU A CA    1 
ATOM   1318 C  C     . LEU A  1 163 ? 152.819 4.079   251.145 1.00 45.06  ? 163  LEU A C     1 
ATOM   1319 O  O     . LEU A  1 163 ? 153.538 3.174   250.719 1.00 42.65  ? 163  LEU A O     1 
ATOM   1320 C  CB    . LEU A  1 163 ? 151.208 4.314   249.197 1.00 39.85  ? 163  LEU A CB    1 
ATOM   1321 C  CG    . LEU A  1 163 ? 149.912 3.644   249.698 1.00 46.87  ? 163  LEU A CG    1 
ATOM   1322 C  CD1   . LEU A  1 163 ? 148.962 3.341   248.552 1.00 47.42  ? 163  LEU A CD1   1 
ATOM   1323 C  CD2   . LEU A  1 163 ? 150.176 2.363   250.468 1.00 44.33  ? 163  LEU A CD2   1 
ATOM   1324 N  N     . ASN A  1 164 ? 152.637 4.297   252.443 1.00 46.43  ? 164  ASN A N     1 
ATOM   1325 C  CA    . ASN A  1 164 ? 153.255 3.427   253.437 1.00 47.65  ? 164  ASN A CA    1 
ATOM   1326 C  C     . ASN A  1 164 ? 152.283 2.354   253.901 1.00 47.24  ? 164  ASN A C     1 
ATOM   1327 O  O     . ASN A  1 164 ? 151.240 2.664   254.474 1.00 49.45  ? 164  ASN A O     1 
ATOM   1328 C  CB    . ASN A  1 164 ? 153.756 4.241   254.634 1.00 48.69  ? 164  ASN A CB    1 
ATOM   1329 C  CG    . ASN A  1 164 ? 154.586 3.414   255.594 1.00 49.34  ? 164  ASN A CG    1 
ATOM   1330 O  OD1   . ASN A  1 164 ? 155.742 3.098   255.315 1.00 51.32  ? 164  ASN A OD1   1 
ATOM   1331 N  ND2   . ASN A  1 164 ? 153.990 3.046   256.737 1.00 50.72  ? 164  ASN A ND2   1 
ATOM   1332 N  N     . ILE A  1 165 ? 152.620 1.092   253.649 1.00 47.07  ? 165  ILE A N     1 
ATOM   1333 C  CA    . ILE A  1 165 ? 151.808 -0.013  254.153 1.00 45.67  ? 165  ILE A CA    1 
ATOM   1334 C  C     . ILE A  1 165 ? 152.173 -0.254  255.627 1.00 49.65  ? 165  ILE A C     1 
ATOM   1335 O  O     . ILE A  1 165 ? 153.360 -0.420  255.984 1.00 42.88  ? 165  ILE A O     1 
ATOM   1336 C  CB    . ILE A  1 165 ? 152.007 -1.314  253.326 1.00 47.68  ? 165  ILE A CB    1 
ATOM   1337 C  CG1   . ILE A  1 165 ? 151.413 -1.175  251.920 1.00 47.19  ? 165  ILE A CG1   1 
ATOM   1338 C  CG2   . ILE A  1 165 ? 151.387 -2.507  254.035 1.00 49.73  ? 165  ILE A CG2   1 
ATOM   1339 C  CD1   . ILE A  1 165 ? 152.408 -0.769  250.860 1.00 46.75  ? 165  ILE A CD1   1 
ATOM   1340 N  N     . SER A  1 166 ? 151.159 -0.250  256.482 1.00 43.21  ? 166  SER A N     1 
ATOM   1341 C  CA    . SER A  1 166 ? 151.385 -0.479  257.907 1.00 48.62  ? 166  SER A CA    1 
ATOM   1342 C  C     . SER A  1 166 ? 152.013 -1.847  258.168 1.00 46.99  ? 166  SER A C     1 
ATOM   1343 O  O     . SER A  1 166 ? 151.458 -2.866  257.767 1.00 48.77  ? 166  SER A O     1 
ATOM   1344 C  CB    . SER A  1 166 ? 150.062 -0.348  258.693 1.00 54.37  ? 166  SER A CB    1 
ATOM   1345 O  OG    . SER A  1 166 ? 150.240 -0.624  260.073 1.00 52.24  ? 166  SER A OG    1 
ATOM   1346 N  N     . LEU A  1 167 ? 153.164 -1.871  258.841 1.00 48.13  ? 167  LEU A N     1 
ATOM   1347 C  CA    . LEU A  1 167 ? 153.774 -3.140  259.241 1.00 54.72  ? 167  LEU A CA    1 
ATOM   1348 C  C     . LEU A  1 167 ? 152.841 -4.019  260.119 1.00 57.78  ? 167  LEU A C     1 
ATOM   1349 O  O     . LEU A  1 167 ? 153.028 -5.235  260.216 1.00 57.47  ? 167  LEU A O     1 
ATOM   1350 C  CB    . LEU A  1 167 ? 155.079 -2.881  259.973 1.00 51.48  ? 167  LEU A CB    1 
ATOM   1351 C  CG    . LEU A  1 167 ? 156.080 -2.119  259.127 1.00 56.87  ? 167  LEU A CG    1 
ATOM   1352 C  CD1   . LEU A  1 167 ? 157.429 -2.068  259.830 1.00 56.89  ? 167  LEU A CD1   1 
ATOM   1353 C  CD2   . LEU A  1 167 ? 156.213 -2.775  257.757 1.00 56.29  ? 167  LEU A CD2   1 
ATOM   1354 N  N     . ARG A  1 168 ? 151.833 -3.414  260.742 1.00 53.19  ? 168  ARG A N     1 
ATOM   1355 C  CA    . ARG A  1 168 ? 150.807 -4.197  261.437 1.00 57.82  ? 168  ARG A CA    1 
ATOM   1356 C  C     . ARG A  1 168 ? 150.071 -5.162  260.497 1.00 61.71  ? 168  ARG A C     1 
ATOM   1357 O  O     . ARG A  1 168 ? 149.631 -6.235  260.924 1.00 55.14  ? 168  ARG A O     1 
ATOM   1358 C  CB    . ARG A  1 168 ? 149.816 -3.263  262.158 1.00 61.78  ? 168  ARG A CB    1 
ATOM   1359 C  CG    . ARG A  1 168 ? 150.513 -2.442  263.250 1.00 63.13  ? 168  ARG A CG    1 
ATOM   1360 C  CD    . ARG A  1 168 ? 149.775 -1.178  263.699 1.00 69.09  ? 168  ARG A CD    1 
ATOM   1361 N  NE    . ARG A  1 168 ? 150.538 -0.483  264.753 1.00 78.13  ? 168  ARG A NE    1 
ATOM   1362 C  CZ    . ARG A  1 168 ? 150.974 0.779   264.674 1.00 77.01  ? 168  ARG A CZ    1 
ATOM   1363 N  NH1   . ARG A  1 168 ? 150.720 1.518   263.590 1.00 63.92  ? 168  ARG A NH1   1 
ATOM   1364 N  NH2   . ARG A  1 168 ? 151.663 1.308   265.682 1.00 70.44  ? 168  ARG A NH2   1 
ATOM   1365 N  N     . ASP A  1 169 ? 149.977 -4.818  259.214 1.00 58.29  ? 169  ASP A N     1 
ATOM   1366 C  CA    . ASP A  1 169 ? 149.313 -5.705  258.274 1.00 54.22  ? 169  ASP A CA    1 
ATOM   1367 C  C     . ASP A  1 169 ? 150.321 -6.323  257.316 1.00 57.49  ? 169  ASP A C     1 
ATOM   1368 O  O     . ASP A  1 169 ? 149.998 -6.632  256.171 1.00 58.95  ? 169  ASP A O     1 
ATOM   1369 C  CB    . ASP A  1 169 ? 148.221 -4.949  257.527 1.00 57.18  ? 169  ASP A CB    1 
ATOM   1370 C  CG    . ASP A  1 169 ? 147.141 -4.426  258.465 1.00 61.57  ? 169  ASP A CG    1 
ATOM   1371 O  OD1   . ASP A  1 169 ? 146.754 -5.162  259.409 1.00 65.31  ? 169  ASP A OD1   1 
ATOM   1372 O  OD2   . ASP A  1 169 ? 146.693 -3.274  258.274 1.00 60.38  ? 169  ASP A OD2   1 
ATOM   1373 N  N     . ARG A  1 170 ? 151.539 -6.513  257.820 1.00 56.46  ? 170  ARG A N     1 
ATOM   1374 C  CA    . ARG A  1 170 ? 152.694 -7.014  257.056 1.00 54.14  ? 170  ARG A CA    1 
ATOM   1375 C  C     . ARG A  1 170 ? 152.440 -8.299  256.290 1.00 61.24  ? 170  ARG A C     1 
ATOM   1376 O  O     . ARG A  1 170 ? 152.564 -8.359  255.050 1.00 60.98  ? 170  ARG A O     1 
ATOM   1377 C  CB    . ARG A  1 170 ? 153.859 -7.262  258.006 1.00 53.03  ? 170  ARG A CB    1 
ATOM   1378 C  CG    . ARG A  1 170 ? 155.155 -6.789  257.497 1.00 56.76  ? 170  ARG A CG    1 
ATOM   1379 C  CD    . ARG A  1 170 ? 156.272 -7.234  258.369 1.00 48.97  ? 170  ARG A CD    1 
ATOM   1380 N  NE    . ARG A  1 170 ? 157.520 -6.695  257.873 1.00 57.71  ? 170  ARG A NE    1 
ATOM   1381 C  CZ    . ARG A  1 170 ? 158.463 -6.180  258.649 1.00 73.09  ? 170  ARG A CZ    1 
ATOM   1382 N  NH1   . ARG A  1 170 ? 158.294 -6.132  259.978 1.00 76.36  ? 170  ARG A NH1   1 
ATOM   1383 N  NH2   . ARG A  1 170 ? 159.575 -5.708  258.101 1.00 69.10  ? 170  ARG A NH2   1 
ATOM   1384 N  N     . ILE A  1 171 ? 152.108 -9.328  257.065 1.00 60.02  ? 171  ILE A N     1 
ATOM   1385 C  CA    . ILE A  1 171 ? 151.850 -10.661 256.550 1.00 63.01  ? 171  ILE A CA    1 
ATOM   1386 C  C     . ILE A  1 171 ? 150.732 -10.662 255.511 1.00 61.53  ? 171  ILE A C     1 
ATOM   1387 O  O     . ILE A  1 171 ? 150.928 -11.166 254.404 1.00 66.00  ? 171  ILE A O     1 
ATOM   1388 C  CB    . ILE A  1 171 ? 151.511 -11.623 257.703 1.00 63.15  ? 171  ILE A CB    1 
ATOM   1389 C  CG1   . ILE A  1 171 ? 152.773 -11.888 258.532 1.00 58.46  ? 171  ILE A CG1   1 
ATOM   1390 C  CG2   . ILE A  1 171 ? 150.930 -12.930 257.171 1.00 57.12  ? 171  ILE A CG2   1 
ATOM   1391 C  CD1   . ILE A  1 171 ? 152.497 -12.193 259.990 1.00 66.23  ? 171  ILE A CD1   1 
ATOM   1392 N  N     . LYS A  1 172 ? 149.575 -10.086 255.837 1.00 55.23  ? 172  LYS A N     1 
ATOM   1393 C  CA    . LYS A  1 172 ? 148.497 -10.068 254.856 1.00 58.59  ? 172  LYS A CA    1 
ATOM   1394 C  C     . LYS A  1 172 ? 148.978 -9.383  253.566 1.00 65.77  ? 172  LYS A C     1 
ATOM   1395 O  O     . LYS A  1 172 ? 148.751 -9.913  252.476 1.00 66.52  ? 172  LYS A O     1 
ATOM   1396 C  CB    . LYS A  1 172 ? 147.243 -9.385  255.398 1.00 57.32  ? 172  LYS A CB    1 
ATOM   1397 C  CG    . LYS A  1 172 ? 146.109 -9.309  254.367 1.00 65.44  ? 172  LYS A CG    1 
ATOM   1398 C  CD    . LYS A  1 172 ? 145.003 -10.334 254.674 1.00 78.35  ? 172  LYS A CD    1 
ATOM   1399 C  CE    . LYS A  1 172 ? 143.977 -10.476 253.541 1.00 78.83  ? 172  LYS A CE    1 
ATOM   1400 N  NZ    . LYS A  1 172 ? 142.712 -11.145 253.994 1.00 80.19  ? 172  LYS A NZ    1 
ATOM   1401 N  N     . PHE A  1 173 ? 149.679 -8.251  253.674 1.00 62.34  ? 173  PHE A N     1 
ATOM   1402 C  CA    . PHE A  1 173 ? 150.139 -7.569  252.463 1.00 62.60  ? 173  PHE A CA    1 
ATOM   1403 C  C     . PHE A  1 173 ? 151.097 -8.433  251.650 1.00 61.65  ? 173  PHE A C     1 
ATOM   1404 O  O     . PHE A  1 173 ? 150.839 -8.697  250.485 1.00 59.42  ? 173  PHE A O     1 
ATOM   1405 C  CB    . PHE A  1 173 ? 150.818 -6.227  252.760 1.00 59.40  ? 173  PHE A CB    1 
ATOM   1406 C  CG    . PHE A  1 173 ? 151.334 -5.542  251.518 1.00 53.57  ? 173  PHE A CG    1 
ATOM   1407 C  CD1   . PHE A  1 173 ? 150.455 -4.992  250.598 1.00 56.28  ? 173  PHE A CD1   1 
ATOM   1408 C  CD2   . PHE A  1 173 ? 152.691 -5.499  251.243 1.00 55.30  ? 173  PHE A CD2   1 
ATOM   1409 C  CE1   . PHE A  1 173 ? 150.932 -4.392  249.430 1.00 56.06  ? 173  PHE A CE1   1 
ATOM   1410 C  CE2   . PHE A  1 173 ? 153.175 -4.905  250.081 1.00 50.95  ? 173  PHE A CE2   1 
ATOM   1411 C  CZ    . PHE A  1 173 ? 152.301 -4.346  249.182 1.00 49.35  ? 173  PHE A CZ    1 
ATOM   1412 N  N     . VAL A  1 174 ? 152.197 -8.873  252.249 1.00 59.91  ? 174  VAL A N     1 
ATOM   1413 C  CA    . VAL A  1 174 ? 153.151 -9.661  251.485 1.00 61.35  ? 174  VAL A CA    1 
ATOM   1414 C  C     . VAL A  1 174 ? 152.502 -10.952 250.986 1.00 68.40  ? 174  VAL A C     1 
ATOM   1415 O  O     . VAL A  1 174 ? 152.550 -11.261 249.792 1.00 71.29  ? 174  VAL A O     1 
ATOM   1416 C  CB    . VAL A  1 174 ? 154.402 -9.988  252.296 1.00 58.60  ? 174  VAL A CB    1 
ATOM   1417 C  CG1   . VAL A  1 174 ? 155.264 -10.977 251.547 1.00 61.22  ? 174  VAL A CG1   1 
ATOM   1418 C  CG2   . VAL A  1 174 ? 155.184 -8.720  252.577 1.00 52.77  ? 174  VAL A CG2   1 
ATOM   1419 N  N     . HIS A  1 175 ? 151.848 -11.678 251.882 1.00 63.70  ? 175  HIS A N     1 
ATOM   1420 C  CA    . HIS A  1 175 ? 151.288 -12.965 251.507 1.00 66.78  ? 175  HIS A CA    1 
ATOM   1421 C  C     . HIS A  1 175 ? 150.166 -12.893 250.468 1.00 69.04  ? 175  HIS A C     1 
ATOM   1422 O  O     . HIS A  1 175 ? 150.060 -13.778 249.626 1.00 66.71  ? 175  HIS A O     1 
ATOM   1423 C  CB    . HIS A  1 175 ? 150.767 -13.699 252.740 1.00 69.01  ? 175  HIS A CB    1 
ATOM   1424 C  CG    . HIS A  1 175 ? 150.763 -15.181 252.579 1.00 73.22  ? 175  HIS A CG    1 
ATOM   1425 N  ND1   . HIS A  1 175 ? 149.606 -15.916 252.469 1.00 74.07  ? 175  HIS A ND1   1 
ATOM   1426 C  CD2   . HIS A  1 175 ? 151.788 -16.066 252.468 1.00 77.34  ? 175  HIS A CD2   1 
ATOM   1427 C  CE1   . HIS A  1 175 ? 149.911 -17.197 252.315 1.00 76.00  ? 175  HIS A CE1   1 
ATOM   1428 N  NE2   . HIS A  1 175 ? 151.228 -17.309 252.313 1.00 77.84  ? 175  HIS A NE2   1 
ATOM   1429 N  N     . THR A  1 176 ? 149.328 -11.858 250.537 1.00 68.29  ? 176  THR A N     1 
ATOM   1430 C  CA    . THR A  1 176 ? 148.169 -11.739 249.647 1.00 65.71  ? 176  THR A CA    1 
ATOM   1431 C  C     . THR A  1 176 ? 148.468 -10.941 248.370 1.00 70.63  ? 176  THR A C     1 
ATOM   1432 O  O     . THR A  1 176 ? 147.743 -11.047 247.378 1.00 76.14  ? 176  THR A O     1 
ATOM   1433 C  CB    . THR A  1 176 ? 146.972 -11.070 250.368 1.00 68.31  ? 176  THR A CB    1 
ATOM   1434 O  OG1   . THR A  1 176 ? 146.744 -11.720 251.617 1.00 72.83  ? 176  THR A OG1   1 
ATOM   1435 C  CG2   . THR A  1 176 ? 145.705 -11.152 249.545 1.00 66.17  ? 176  THR A CG2   1 
ATOM   1436 N  N     . ILE A  1 177 ? 149.534 -10.149 248.382 1.00 68.57  ? 177  ILE A N     1 
ATOM   1437 C  CA    . ILE A  1 177 ? 149.814 -9.279  247.250 1.00 65.15  ? 177  ILE A CA    1 
ATOM   1438 C  C     . ILE A  1 177 ? 151.154 -9.595  246.592 1.00 70.70  ? 177  ILE A C     1 
ATOM   1439 O  O     . ILE A  1 177 ? 151.207 -9.909  245.400 1.00 68.84  ? 177  ILE A O     1 
ATOM   1440 C  CB    . ILE A  1 177 ? 149.804 -7.789  247.660 1.00 66.61  ? 177  ILE A CB    1 
ATOM   1441 C  CG1   . ILE A  1 177 ? 148.464 -7.404  248.294 1.00 62.04  ? 177  ILE A CG1   1 
ATOM   1442 C  CG2   . ILE A  1 177 ? 150.118 -6.892  246.450 1.00 63.04  ? 177  ILE A CG2   1 
ATOM   1443 C  CD1   . ILE A  1 177 ? 147.335 -7.399  247.334 1.00 62.27  ? 177  ILE A CD1   1 
ATOM   1444 N  N     . LEU A  1 178 ? 152.238 -9.506  247.353 1.00 62.10  ? 178  LEU A N     1 
ATOM   1445 C  CA    . LEU A  1 178 ? 153.554 -9.669  246.758 1.00 65.05  ? 178  LEU A CA    1 
ATOM   1446 C  C     . LEU A  1 178 ? 153.828 -11.101 246.322 1.00 74.06  ? 178  LEU A C     1 
ATOM   1447 O  O     . LEU A  1 178 ? 154.224 -11.355 245.188 1.00 71.85  ? 178  LEU A O     1 
ATOM   1448 C  CB    . LEU A  1 178 ? 154.637 -9.216  247.732 1.00 63.12  ? 178  LEU A CB    1 
ATOM   1449 C  CG    . LEU A  1 178 ? 154.747 -7.709  247.934 1.00 57.53  ? 178  LEU A CG    1 
ATOM   1450 C  CD1   . LEU A  1 178 ? 156.159 -7.332  248.271 1.00 52.51  ? 178  LEU A CD1   1 
ATOM   1451 C  CD2   . LEU A  1 178 ? 154.284 -6.976  246.696 1.00 54.24  ? 178  LEU A CD2   1 
ATOM   1452 N  N     . SER A  1 179 ? 153.630 -12.038 247.238 1.00 77.71  ? 179  SER A N     1 
ATOM   1453 C  CA    . SER A  1 179 ? 153.950 -13.434 246.979 1.00 78.95  ? 179  SER A CA    1 
ATOM   1454 C  C     . SER A  1 179 ? 152.659 -14.189 246.715 1.00 78.03  ? 179  SER A C     1 
ATOM   1455 O  O     . SER A  1 179 ? 152.346 -15.181 247.392 1.00 80.69  ? 179  SER A O     1 
ATOM   1456 C  CB    . SER A  1 179 ? 154.698 -14.044 248.165 1.00 80.03  ? 179  SER A CB    1 
ATOM   1457 O  OG    . SER A  1 179 ? 153.865 -14.024 249.311 1.00 73.96  ? 179  SER A OG    1 
ATOM   1458 N  N     . SER A  1 180 ? 151.893 -13.694 245.748 1.00 79.66  ? 180  SER A N     1 
ATOM   1459 C  CA    . SER A  1 180 ? 150.628 -14.324 245.392 1.00 80.01  ? 180  SER A CA    1 
ATOM   1460 C  C     . SER A  1 180 ? 150.888 -15.206 244.173 1.00 80.39  ? 180  SER A C     1 
ATOM   1461 O  O     . SER A  1 180 ? 151.577 -14.801 243.235 1.00 82.32  ? 180  SER A O     1 
ATOM   1462 C  CB    . SER A  1 180 ? 149.529 -13.282 245.125 1.00 75.79  ? 180  SER A CB    1 
ATOM   1463 O  OG    . SER A  1 180 ? 149.658 -12.661 243.858 1.00 79.09  ? 180  SER A OG    1 
ATOM   1464 N  N     . HIS A  1 181 ? 150.372 -16.427 244.205 1.00 77.71  ? 181  HIS A N     1 
ATOM   1465 C  CA    . HIS A  1 181 ? 150.649 -17.384 243.140 1.00 77.18  ? 181  HIS A CA    1 
ATOM   1466 C  C     . HIS A  1 181 ? 149.585 -17.257 242.030 1.00 81.29  ? 181  HIS A C     1 
ATOM   1467 O  O     . HIS A  1 181 ? 149.607 -18.000 241.050 1.00 79.74  ? 181  HIS A O     1 
ATOM   1468 C  CB    . HIS A  1 181 ? 150.705 -18.824 243.709 1.00 72.20  ? 181  HIS A CB    1 
ATOM   1469 C  CG    . HIS A  1 181 ? 151.846 -19.085 244.666 1.00 78.93  ? 181  HIS A CG    1 
ATOM   1470 N  ND1   . HIS A  1 181 ? 153.116 -19.437 244.255 1.00 86.18  ? 181  HIS A ND1   1 
ATOM   1471 C  CD2   . HIS A  1 181 ? 151.904 -19.017 246.021 1.00 80.70  ? 181  HIS A CD2   1 
ATOM   1472 C  CE1   . HIS A  1 181 ? 153.896 -19.607 245.314 1.00 80.21  ? 181  HIS A CE1   1 
ATOM   1473 N  NE2   . HIS A  1 181 ? 153.185 -19.360 246.397 1.00 77.07  ? 181  HIS A NE2   1 
ATOM   1474 N  N     . LEU A  1 182 ? 148.653 -16.312 242.186 1.00 78.00  ? 182  LEU A N     1 
ATOM   1475 C  CA    . LEU A  1 182 ? 147.531 -16.145 241.240 1.00 75.91  ? 182  LEU A CA    1 
ATOM   1476 C  C     . LEU A  1 182 ? 148.036 -15.791 239.852 1.00 77.12  ? 182  LEU A C     1 
ATOM   1477 O  O     . LEU A  1 182 ? 149.121 -15.218 239.724 1.00 76.74  ? 182  LEU A O     1 
ATOM   1478 C  CB    . LEU A  1 182 ? 146.525 -15.067 241.715 1.00 72.11  ? 182  LEU A CB    1 
ATOM   1479 C  CG    . LEU A  1 182 ? 145.820 -15.132 243.092 1.00 79.86  ? 182  LEU A CG    1 
ATOM   1480 C  CD1   . LEU A  1 182 ? 146.725 -14.971 244.315 1.00 78.72  ? 182  LEU A CD1   1 
ATOM   1481 C  CD2   . LEU A  1 182 ? 144.684 -14.132 243.162 1.00 72.78  ? 182  LEU A CD2   1 
ATOM   1482 N  N     . ASN A  1 183 ? 147.217 -16.093 238.837 1.00 84.50  ? 183  ASN A N     1 
ATOM   1483 C  CA    . ASN A  1 183 ? 147.552 -15.931 237.406 1.00 83.52  ? 183  ASN A CA    1 
ATOM   1484 C  C     . ASN A  1 183 ? 149.064 -15.953 237.134 1.00 83.17  ? 183  ASN A C     1 
ATOM   1485 O  O     . ASN A  1 183 ? 149.708 -14.897 237.033 1.00 87.01  ? 183  ASN A O     1 
ATOM   1486 C  CB    . ASN A  1 183 ? 146.926 -14.639 236.839 1.00 83.85  ? 183  ASN A CB    1 
ATOM   1487 C  CG    . ASN A  1 183 ? 147.371 -13.379 237.589 1.00 81.59  ? 183  ASN A CG    1 
ATOM   1488 O  OD1   . ASN A  1 183 ? 147.165 -13.249 238.791 1.00 83.89  ? 183  ASN A OD1   1 
ATOM   1489 N  ND2   . ASN A  1 183 ? 148.059 -12.485 236.882 1.00 83.39  ? 183  ASN A ND2   1 
ATOM   1490 N  N     . PRO A  1 184 ? 149.648 -17.161 237.056 1.00 84.35  ? 184  PRO A N     1 
ATOM   1491 C  CA    . PRO A  1 184 ? 151.127 -17.285 236.995 1.00 89.46  ? 184  PRO A CA    1 
ATOM   1492 C  C     . PRO A  1 184 ? 151.476 -17.707 235.599 1.00 85.49  ? 184  PRO A C     1 
ATOM   1493 O  O     . PRO A  1 184 ? 150.511 -18.243 235.038 1.00 84.92  ? 184  PRO A O     1 
ATOM   1494 C  CB    . PRO A  1 184 ? 151.426 -18.409 237.996 1.00 83.91  ? 184  PRO A CB    1 
ATOM   1495 C  CG    . PRO A  1 184 ? 150.162 -19.453 237.606 1.00 83.41  ? 184  PRO A CG    1 
ATOM   1496 C  CD    . PRO A  1 184 ? 148.970 -18.440 237.423 1.00 76.11  ? 184  PRO A CD    1 
ATOM   1497 N  N     . LEU A  1 185 ? 152.669 -17.454 235.031 1.00 80.94  ? 185  LEU A N     1 
ATOM   1498 C  CA    . LEU A  1 185 ? 152.919 -17.845 233.639 1.00 81.39  ? 185  LEU A CA    1 
ATOM   1499 C  C     . LEU A  1 185 ? 152.346 -19.244 233.629 1.00 86.63  ? 185  LEU A C     1 
ATOM   1500 O  O     . LEU A  1 185 ? 152.833 -20.097 234.412 1.00 87.44  ? 185  LEU A O     1 
ATOM   1501 C  CB    . LEU A  1 185 ? 154.441 -17.821 233.304 1.00 76.69  ? 185  LEU A CB    1 
ATOM   1502 C  CG    . LEU A  1 185 ? 154.980 -18.043 231.897 1.00 77.91  ? 185  LEU A CG    1 
ATOM   1503 C  CD1   . LEU A  1 185 ? 154.721 -16.795 230.966 1.00 65.69  ? 185  LEU A CD1   1 
ATOM   1504 C  CD2   . LEU A  1 185 ? 156.527 -18.258 231.963 1.00 75.91  ? 185  LEU A CD2   1 
ATOM   1505 N  N     . PRO A  1 186 ? 151.241 -19.476 232.889 1.00 86.21  ? 186  PRO A N     1 
ATOM   1506 C  CA    . PRO A  1 186 ? 150.764 -20.870 232.880 1.00 87.73  ? 186  PRO A CA    1 
ATOM   1507 C  C     . PRO A  1 186 ? 151.883 -21.640 232.200 1.00 89.30  ? 186  PRO A C     1 
ATOM   1508 O  O     . PRO A  1 186 ? 152.725 -20.963 231.520 1.00 84.55  ? 186  PRO A O     1 
ATOM   1509 C  CB    . PRO A  1 186 ? 149.582 -20.860 231.887 1.00 83.98  ? 186  PRO A CB    1 
ATOM   1510 C  CG    . PRO A  1 186 ? 150.256 -19.911 230.717 1.00 82.06  ? 186  PRO A CG    1 
ATOM   1511 C  CD    . PRO A  1 186 ? 150.896 -18.768 231.626 1.00 80.18  ? 186  PRO A CD    1 
ATOM   1512 N  N     . PRO A  1 187 ? 151.873 -22.982 232.231 1.00 85.69  ? 187  PRO A N     1 
ATOM   1513 C  CA    . PRO A  1 187 ? 152.778 -23.680 231.293 1.00 87.88  ? 187  PRO A CA    1 
ATOM   1514 C  C     . PRO A  1 187 ? 152.604 -25.192 231.433 1.00 83.11  ? 187  PRO A C     1 
ATOM   1515 O  O     . PRO A  1 187 ? 152.106 -25.654 232.503 1.00 82.61  ? 187  PRO A O     1 
ATOM   1516 C  CB    . PRO A  1 187 ? 154.256 -23.257 231.580 1.00 77.99  ? 187  PRO A CB    1 
ATOM   1517 O  "O5'" . DG  B  2 1   ? 164.933 -2.760  278.641 1.00 73.32  ? 1    DG  B "O5'" 1 
ATOM   1518 C  "C5'" . DG  B  2 1   ? 163.882 -2.023  278.055 1.00 62.78  ? 1    DG  B "C5'" 1 
ATOM   1519 C  "C4'" . DG  B  2 1   ? 163.234 -2.830  276.957 1.00 72.67  ? 1    DG  B "C4'" 1 
ATOM   1520 O  "O4'" . DG  B  2 1   ? 161.989 -2.198  276.550 1.00 73.88  ? 1    DG  B "O4'" 1 
ATOM   1521 C  "C3'" . DG  B  2 1   ? 164.058 -2.953  275.685 1.00 68.26  ? 1    DG  B "C3'" 1 
ATOM   1522 O  "O3'" . DG  B  2 1   ? 163.669 -4.149  275.015 1.00 75.95  ? 1    DG  B "O3'" 1 
ATOM   1523 C  "C2'" . DG  B  2 1   ? 163.642 -1.696  274.921 1.00 62.51  ? 1    DG  B "C2'" 1 
ATOM   1524 C  "C1'" . DG  B  2 1   ? 162.150 -1.604  275.272 1.00 67.13  ? 1    DG  B "C1'" 1 
ATOM   1525 N  N9    . DG  B  2 1   ? 161.613 -0.233  275.313 1.00 62.62  ? 1    DG  B N9    1 
ATOM   1526 C  C8    . DG  B  2 1   ? 162.312 0.946   275.519 1.00 59.27  ? 1    DG  B C8    1 
ATOM   1527 N  N7    . DG  B  2 1   ? 161.550 2.015   275.498 1.00 59.45  ? 1    DG  B N7    1 
ATOM   1528 C  C5    . DG  B  2 1   ? 160.266 1.512   275.262 1.00 56.59  ? 1    DG  B C5    1 
ATOM   1529 C  C6    . DG  B  2 1   ? 159.024 2.188   275.128 1.00 56.50  ? 1    DG  B C6    1 
ATOM   1530 O  O6    . DG  B  2 1   ? 158.798 3.413   275.198 1.00 60.13  ? 1    DG  B O6    1 
ATOM   1531 N  N1    . DG  B  2 1   ? 157.974 1.293   274.894 1.00 56.21  ? 1    DG  B N1    1 
ATOM   1532 C  C2    . DG  B  2 1   ? 158.107 -0.076  274.800 1.00 59.26  ? 1    DG  B C2    1 
ATOM   1533 N  N2    . DG  B  2 1   ? 156.985 -0.771  274.565 1.00 59.36  ? 1    DG  B N2    1 
ATOM   1534 N  N3    . DG  B  2 1   ? 159.259 -0.719  274.923 1.00 58.32  ? 1    DG  B N3    1 
ATOM   1535 C  C4    . DG  B  2 1   ? 160.293 0.133   275.146 1.00 60.06  ? 1    DG  B C4    1 
ATOM   1536 P  P     . DC  B  2 2   ? 164.467 -4.705  273.731 1.00 81.68  ? 2    DC  B P     1 
ATOM   1537 O  OP1   . DC  B  2 2   ? 164.715 -6.151  273.930 1.00 70.42  ? 2    DC  B OP1   1 
ATOM   1538 O  OP2   . DC  B  2 2   ? 165.580 -3.779  273.400 1.00 74.85  ? 2    DC  B OP2   1 
ATOM   1539 O  "O5'" . DC  B  2 2   ? 163.369 -4.606  272.588 1.00 75.95  ? 2    DC  B "O5'" 1 
ATOM   1540 C  "C5'" . DC  B  2 2   ? 162.031 -4.959  272.870 1.00 66.48  ? 2    DC  B "C5'" 1 
ATOM   1541 C  "C4'" . DC  B  2 2   ? 161.103 -4.246  271.916 1.00 69.62  ? 2    DC  B "C4'" 1 
ATOM   1542 O  "O4'" . DC  B  2 2   ? 160.874 -2.897  272.368 1.00 68.33  ? 2    DC  B "O4'" 1 
ATOM   1543 C  "C3'" . DC  B  2 2   ? 161.653 -4.115  270.496 1.00 71.03  ? 2    DC  B "C3'" 1 
ATOM   1544 O  "O3'" . DC  B  2 2   ? 160.957 -4.996  269.663 1.00 76.63  ? 2    DC  B "O3'" 1 
ATOM   1545 C  "C2'" . DC  B  2 2   ? 161.426 -2.634  270.113 1.00 61.47  ? 2    DC  B "C2'" 1 
ATOM   1546 C  "C1'" . DC  B  2 2   ? 160.546 -2.120  271.249 1.00 66.08  ? 2    DC  B "C1'" 1 
ATOM   1547 N  N1    . DC  B  2 2   ? 160.732 -0.671  271.580 1.00 57.19  ? 2    DC  B N1    1 
ATOM   1548 C  C2    . DC  B  2 2   ? 159.615 0.165   271.577 1.00 58.97  ? 2    DC  B C2    1 
ATOM   1549 O  O2    . DC  B  2 2   ? 158.514 -0.320  271.296 1.00 61.37  ? 2    DC  B O2    1 
ATOM   1550 N  N3    . DC  B  2 2   ? 159.770 1.484   271.879 1.00 57.69  ? 2    DC  B N3    1 
ATOM   1551 C  C4    . DC  B  2 2   ? 160.987 1.963   272.172 1.00 58.53  ? 2    DC  B C4    1 
ATOM   1552 N  N4    . DC  B  2 2   ? 161.091 3.268   272.457 1.00 57.09  ? 2    DC  B N4    1 
ATOM   1553 C  C5    . DC  B  2 2   ? 162.148 1.122   272.182 1.00 53.63  ? 2    DC  B C5    1 
ATOM   1554 C  C6    . DC  B  2 2   ? 161.975 -0.178  271.883 1.00 57.92  ? 2    DC  B C6    1 
ATOM   1555 P  P     . DC  B  2 3   ? 161.398 -5.214  268.134 1.00 79.45  ? 3    DC  B P     1 
ATOM   1556 O  OP1   . DC  B  2 3   ? 161.417 -6.673  267.882 1.00 84.91  ? 3    DC  B OP1   1 
ATOM   1557 O  OP2   . DC  B  2 3   ? 162.604 -4.403  267.828 1.00 71.10  ? 3    DC  B OP2   1 
ATOM   1558 O  "O5'" . DC  B  2 3   ? 160.159 -4.604  267.346 1.00 73.61  ? 3    DC  B "O5'" 1 
ATOM   1559 C  "C5'" . DC  B  2 3   ? 158.855 -4.731  267.884 1.00 60.32  ? 3    DC  B "C5'" 1 
ATOM   1560 C  "C4'" . DC  B  2 3   ? 157.945 -3.665  267.309 1.00 65.82  ? 3    DC  B "C4'" 1 
ATOM   1561 O  "O4'" . DC  B  2 3   ? 158.183 -2.383  267.959 1.00 61.24  ? 3    DC  B "O4'" 1 
ATOM   1562 C  "C3'" . DC  B  2 3   ? 158.103 -3.420  265.803 1.00 58.54  ? 3    DC  B "C3'" 1 
ATOM   1563 O  "O3'" . DC  B  2 3   ? 156.825 -3.341  265.255 1.00 64.56  ? 3    DC  B "O3'" 1 
ATOM   1564 C  "C2'" . DC  B  2 3   ? 158.819 -2.068  265.742 1.00 57.24  ? 3    DC  B "C2'" 1 
ATOM   1565 C  "C1'" . DC  B  2 3   ? 158.246 -1.377  266.978 1.00 58.47  ? 3    DC  B "C1'" 1 
ATOM   1566 N  N1    . DC  B  2 3   ? 159.092 -0.224  267.489 1.00 58.74  ? 3    DC  B N1    1 
ATOM   1567 C  C2    . DC  B  2 3   ? 158.497 1.024   267.751 1.00 55.31  ? 3    DC  B C2    1 
ATOM   1568 O  O2    . DC  B  2 3   ? 157.286 1.158   267.599 1.00 57.68  ? 3    DC  B O2    1 
ATOM   1569 N  N3    . DC  B  2 3   ? 159.272 2.047   268.185 1.00 58.78  ? 3    DC  B N3    1 
ATOM   1570 C  C4    . DC  B  2 3   ? 160.583 1.869   268.367 1.00 59.18  ? 3    DC  B C4    1 
ATOM   1571 N  N4    . DC  B  2 3   ? 161.302 2.913   268.816 1.00 54.88  ? 3    DC  B N4    1 
ATOM   1572 C  C5    . DC  B  2 3   ? 161.216 0.615   268.093 1.00 55.05  ? 3    DC  B C5    1 
ATOM   1573 C  C6    . DC  B  2 3   ? 160.443 -0.393  267.663 1.00 56.41  ? 3    DC  B C6    1 
ATOM   1574 P  P     . DT  B  2 4   ? 156.579 -3.412  263.675 1.00 71.60  ? 4    DT  B P     1 
ATOM   1575 O  OP1   . DT  B  2 4   ? 155.592 -4.495  263.435 1.00 62.60  ? 4    DT  B OP1   1 
ATOM   1576 O  OP2   . DT  B  2 4   ? 157.891 -3.386  262.977 1.00 63.03  ? 4    DT  B OP2   1 
ATOM   1577 O  "O5'" . DT  B  2 4   ? 155.875 -2.021  263.371 1.00 68.94  ? 4    DT  B "O5'" 1 
ATOM   1578 C  "C5'" . DT  B  2 4   ? 155.037 -1.418  264.334 1.00 59.45  ? 4    DT  B "C5'" 1 
ATOM   1579 C  "C4'" . DT  B  2 4   ? 154.986 0.078   264.100 1.00 58.73  ? 4    DT  B "C4'" 1 
ATOM   1580 O  "O4'" . DT  B  2 4   ? 156.156 0.705   264.659 1.00 53.11  ? 4    DT  B "O4'" 1 
ATOM   1581 C  "C3'" . DT  B  2 4   ? 154.962 0.501   262.619 1.00 61.64  ? 4    DT  B "C3'" 1 
ATOM   1582 O  "O3'" . DT  B  2 4   ? 153.739 1.155   262.348 1.00 62.56  ? 4    DT  B "O3'" 1 
ATOM   1583 C  "C2'" . DT  B  2 4   ? 156.174 1.444   262.468 1.00 54.50  ? 4    DT  B "C2'" 1 
ATOM   1584 C  "C1'" . DT  B  2 4   ? 156.405 1.858   263.915 1.00 57.19  ? 4    DT  B "C1'" 1 
ATOM   1585 N  N1    . DT  B  2 4   ? 157.775 2.348   264.234 1.00 56.12  ? 4    DT  B N1    1 
ATOM   1586 C  C2    . DT  B  2 4   ? 157.937 3.671   264.574 1.00 56.71  ? 4    DT  B C2    1 
ATOM   1587 O  O2    . DT  B  2 4   ? 157.016 4.462   264.606 1.00 58.65  ? 4    DT  B O2    1 
ATOM   1588 N  N3    . DT  B  2 4   ? 159.224 4.043   264.874 1.00 54.87  ? 4    DT  B N3    1 
ATOM   1589 C  C4    . DT  B  2 4   ? 160.339 3.237   264.884 1.00 55.41  ? 4    DT  B C4    1 
ATOM   1590 O  O4    . DT  B  2 4   ? 161.451 3.666   265.166 1.00 60.03  ? 4    DT  B O4    1 
ATOM   1591 C  C5    . DT  B  2 4   ? 160.108 1.854   264.521 1.00 58.63  ? 4    DT  B C5    1 
ATOM   1592 C  C7    . DT  B  2 4   ? 161.255 0.888   264.493 1.00 55.13  ? 4    DT  B C7    1 
ATOM   1593 C  C6    . DT  B  2 4   ? 158.844 1.476   264.217 1.00 54.58  ? 4    DT  B C6    1 
ATOM   1594 P  P     . DT  B  2 5   ? 153.303 1.442   260.837 1.00 54.12  ? 5    DT  B P     1 
ATOM   1595 O  OP1   . DT  B  2 5   ? 151.827 1.436   260.763 1.00 53.50  ? 5    DT  B OP1   1 
ATOM   1596 O  OP2   . DT  B  2 5   ? 154.060 0.489   259.968 1.00 59.23  ? 5    DT  B OP2   1 
ATOM   1597 O  "O5'" . DT  B  2 5   ? 153.911 2.889   260.558 1.00 52.47  ? 5    DT  B "O5'" 1 
ATOM   1598 C  "C5'" . DT  B  2 5   ? 153.417 4.019   261.210 1.00 50.06  ? 5    DT  B "C5'" 1 
ATOM   1599 C  "C4'" . DT  B  2 5   ? 154.322 5.220   260.946 1.00 58.46  ? 5    DT  B "C4'" 1 
ATOM   1600 O  "O4'" . DT  B  2 5   ? 155.645 4.977   261.492 1.00 52.29  ? 5    DT  B "O4'" 1 
ATOM   1601 C  "C3'" . DT  B  2 5   ? 154.547 5.608   259.460 1.00 57.55  ? 5    DT  B "C3'" 1 
ATOM   1602 O  "O3'" . DT  B  2 5   ? 154.254 6.989   259.292 1.00 56.46  ? 5    DT  B "O3'" 1 
ATOM   1603 C  "C2'" . DT  B  2 5   ? 156.047 5.347   259.251 1.00 57.40  ? 5    DT  B "C2'" 1 
ATOM   1604 C  "C1'" . DT  B  2 5   ? 156.571 5.608   260.652 1.00 57.09  ? 5    DT  B "C1'" 1 
ATOM   1605 N  N1    . DT  B  2 5   ? 157.888 5.036   260.925 1.00 56.64  ? 5    DT  B N1    1 
ATOM   1606 C  C2    . DT  B  2 5   ? 158.844 5.825   261.511 1.00 58.09  ? 5    DT  B C2    1 
ATOM   1607 O  O2    . DT  B  2 5   ? 158.653 6.995   261.804 1.00 59.25  ? 5    DT  B O2    1 
ATOM   1608 N  N3    . DT  B  2 5   ? 160.043 5.197   261.735 1.00 55.05  ? 5    DT  B N3    1 
ATOM   1609 C  C4    . DT  B  2 5   ? 160.358 3.879   261.449 1.00 56.64  ? 5    DT  B C4    1 
ATOM   1610 O  O4    . DT  B  2 5   ? 161.463 3.400   261.691 1.00 59.15  ? 5    DT  B O4    1 
ATOM   1611 C  C5    . DT  B  2 5   ? 159.298 3.111   260.830 1.00 56.45  ? 5    DT  B C5    1 
ATOM   1612 C  C7    . DT  B  2 5   ? 159.516 1.672   260.456 1.00 54.82  ? 5    DT  B C7    1 
ATOM   1613 C  C6    . DT  B  2 5   ? 158.131 3.720   260.608 1.00 54.18  ? 5    DT  B C6    1 
ATOM   1614 P  P     . DG  B  2 6   ? 153.833 7.599   257.868 1.00 57.56  ? 6    DG  B P     1 
ATOM   1615 O  OP1   . DG  B  2 6   ? 152.359 7.633   257.825 1.00 56.34  ? 6    DG  B OP1   1 
ATOM   1616 O  OP2   . DG  B  2 6   ? 154.579 6.956   256.761 1.00 61.13  ? 6    DG  B OP2   1 
ATOM   1617 O  "O5'" . DG  B  2 6   ? 154.333 9.106   257.975 1.00 62.20  ? 6    DG  B "O5'" 1 
ATOM   1618 C  "C5'" . DG  B  2 6   ? 153.913 9.909   259.072 1.00 55.47  ? 6    DG  B "C5'" 1 
ATOM   1619 C  "C4'" . DG  B  2 6   ? 154.996 10.897  259.444 1.00 59.54  ? 6    DG  B "C4'" 1 
ATOM   1620 O  "O4'" . DG  B  2 6   ? 156.163 10.175  259.913 1.00 58.85  ? 6    DG  B "O4'" 1 
ATOM   1621 C  "C3'" . DG  B  2 6   ? 155.483 11.791  258.300 1.00 60.23  ? 6    DG  B "C3'" 1 
ATOM   1622 O  "O3'" . DG  B  2 6   ? 155.683 13.115  258.782 1.00 60.08  ? 6    DG  B "O3'" 1 
ATOM   1623 C  "C2'" . DG  B  2 6   ? 156.797 11.140  257.883 1.00 58.89  ? 6    DG  B "C2'" 1 
ATOM   1624 C  "C1'" . DG  B  2 6   ? 157.305 10.615  259.210 1.00 57.71  ? 6    DG  B "C1'" 1 
ATOM   1625 N  N9    . DG  B  2 6   ? 158.201 9.481   259.085 1.00 59.63  ? 6    DG  B N9    1 
ATOM   1626 C  C8    . DG  B  2 6   ? 157.888 8.225   258.617 1.00 56.89  ? 6    DG  B C8    1 
ATOM   1627 N  N7    . DG  B  2 6   ? 158.893 7.400   258.643 1.00 56.72  ? 6    DG  B N7    1 
ATOM   1628 C  C5    . DG  B  2 6   ? 159.938 8.156   259.167 1.00 58.08  ? 6    DG  B C5    1 
ATOM   1629 C  C6    . DG  B  2 6   ? 161.284 7.799   259.434 1.00 57.66  ? 6    DG  B C6    1 
ATOM   1630 O  O6    . DG  B  2 6   ? 161.841 6.706   259.260 1.00 57.55  ? 6    DG  B O6    1 
ATOM   1631 N  N1    . DG  B  2 6   ? 162.000 8.865   259.964 1.00 59.13  ? 6    DG  B N1    1 
ATOM   1632 C  C2    . DG  B  2 6   ? 161.485 10.113  260.210 1.00 60.30  ? 6    DG  B C2    1 
ATOM   1633 N  N2    . DG  B  2 6   ? 162.333 11.008  260.726 1.00 63.94  ? 6    DG  B N2    1 
ATOM   1634 N  N3    . DG  B  2 6   ? 160.230 10.462  259.966 1.00 58.24  ? 6    DG  B N3    1 
ATOM   1635 C  C4    . DG  B  2 6   ? 159.518 9.437   259.450 1.00 58.77  ? 6    DG  B C4    1 
ATOM   1636 P  P     . DC  B  2 7   ? 155.985 14.324  257.770 1.00 68.63  ? 7    DC  B P     1 
ATOM   1637 O  OP1   . DC  B  2 7   ? 155.620 15.582  258.454 1.00 65.52  ? 7    DC  B OP1   1 
ATOM   1638 O  OP2   . DC  B  2 7   ? 155.333 14.001  256.476 1.00 67.40  ? 7    DC  B OP2   1 
ATOM   1639 O  "O5'" . DC  B  2 7   ? 157.577 14.286  257.615 1.00 61.98  ? 7    DC  B "O5'" 1 
ATOM   1640 C  "C5'" . DC  B  2 7   ? 158.357 14.580  258.730 1.00 61.23  ? 7    DC  B "C5'" 1 
ATOM   1641 C  "C4'" . DC  B  2 7   ? 159.832 14.395  258.458 1.00 64.04  ? 7    DC  B "C4'" 1 
ATOM   1642 O  "O4'" . DC  B  2 7   ? 160.149 12.999  258.327 1.00 68.54  ? 7    DC  B "O4'" 1 
ATOM   1643 C  "C3'" . DC  B  2 7   ? 160.393 15.080  257.206 1.00 65.50  ? 7    DC  B "C3'" 1 
ATOM   1644 O  "O3'" . DC  B  2 7   ? 161.358 16.048  257.625 1.00 76.93  ? 7    DC  B "O3'" 1 
ATOM   1645 C  "C2'" . DC  B  2 7   ? 161.058 13.927  256.420 1.00 64.86  ? 7    DC  B "C2'" 1 
ATOM   1646 C  "C1'" . DC  B  2 7   ? 161.303 12.912  257.528 1.00 69.69  ? 7    DC  B "C1'" 1 
ATOM   1647 N  N1    . DC  B  2 7   ? 161.467 11.480  257.080 1.00 66.86  ? 7    DC  B N1    1 
ATOM   1648 C  C2    . DC  B  2 7   ? 162.711 10.846  257.206 1.00 65.07  ? 7    DC  B C2    1 
ATOM   1649 O  O2    . DC  B  2 7   ? 163.678 11.485  257.649 1.00 62.39  ? 7    DC  B O2    1 
ATOM   1650 N  N3    . DC  B  2 7   ? 162.825 9.549   256.816 1.00 66.04  ? 7    DC  B N3    1 
ATOM   1651 C  C4    . DC  B  2 7   ? 161.760 8.895   256.345 1.00 58.30  ? 7    DC  B C4    1 
ATOM   1652 N  N4    . DC  B  2 7   ? 161.918 7.621   255.987 1.00 54.01  ? 7    DC  B N4    1 
ATOM   1653 C  C5    . DC  B  2 7   ? 160.490 9.516   256.229 1.00 58.45  ? 7    DC  B C5    1 
ATOM   1654 C  C6    . DC  B  2 7   ? 160.385 10.792  256.607 1.00 64.63  ? 7    DC  B C6    1 
ATOM   1655 P  P     . DC  B  2 8   ? 161.727 17.313  256.706 1.00 75.76  ? 8    DC  B P     1 
ATOM   1656 O  OP1   . DC  B  2 8   ? 162.045 18.445  257.610 1.00 76.63  ? 8    DC  B OP1   1 
ATOM   1657 O  OP2   . DC  B  2 8   ? 160.636 17.450  255.703 1.00 70.95  ? 8    DC  B OP2   1 
ATOM   1658 O  "O5'" . DC  B  2 8   ? 163.051 16.847  255.936 1.00 68.91  ? 8    DC  B "O5'" 1 
ATOM   1659 C  "C5'" . DC  B  2 8   ? 164.202 16.482  256.649 1.00 65.16  ? 8    DC  B "C5'" 1 
ATOM   1660 C  "C4'" . DC  B  2 8   ? 165.197 15.807  255.729 1.00 66.68  ? 8    DC  B "C4'" 1 
ATOM   1661 O  "O4'" . DC  B  2 8   ? 164.834 14.407  255.570 1.00 70.97  ? 8    DC  B "O4'" 1 
ATOM   1662 C  "C3'" . DC  B  2 8   ? 165.269 16.392  254.304 1.00 68.44  ? 8    DC  B "C3'" 1 
ATOM   1663 O  "O3'" . DC  B  2 8   ? 166.630 16.624  253.927 1.00 69.80  ? 8    DC  B "O3'" 1 
ATOM   1664 C  "C2'" . DC  B  2 8   ? 164.634 15.299  253.439 1.00 67.20  ? 8    DC  B "C2'" 1 
ATOM   1665 C  "C1'" . DC  B  2 8   ? 165.016 14.050  254.213 1.00 69.81  ? 8    DC  B "C1'" 1 
ATOM   1666 N  N1    . DC  B  2 8   ? 164.161 12.854  253.907 1.00 63.99  ? 8    DC  B N1    1 
ATOM   1667 C  C2    . DC  B  2 8   ? 164.724 11.575  253.941 1.00 64.79  ? 8    DC  B C2    1 
ATOM   1668 O  O2    . DC  B  2 8   ? 165.922 11.453  254.216 1.00 61.16  ? 8    DC  B O2    1 
ATOM   1669 N  N3    . DC  B  2 8   ? 163.937 10.500  253.666 1.00 62.04  ? 8    DC  B N3    1 
ATOM   1670 C  C4    . DC  B  2 8   ? 162.649 10.674  253.366 1.00 58.41  ? 8    DC  B C4    1 
ATOM   1671 N  N4    . DC  B  2 8   ? 161.917 9.586   253.097 1.00 53.66  ? 8    DC  B N4    1 
ATOM   1672 C  C5    . DC  B  2 8   ? 162.058 11.972  253.323 1.00 58.80  ? 8    DC  B C5    1 
ATOM   1673 C  C6    . DC  B  2 8   ? 162.843 13.022  253.592 1.00 62.02  ? 8    DC  B C6    1 
ATOM   1674 P  P     . DG  B  2 9   ? 166.976 17.605  252.693 1.00 75.33  ? 9    DG  B P     1 
ATOM   1675 O  OP1   . DG  B  2 9   ? 166.796 19.002  253.145 1.00 74.31  ? 9    DG  B OP1   1 
ATOM   1676 O  OP2   . DG  B  2 9   ? 166.208 17.190  251.502 1.00 80.61  ? 9    DG  B OP2   1 
ATOM   1677 O  "O5'" . DG  B  2 9   ? 168.491 17.236  252.326 1.00 72.02  ? 9    DG  B "O5'" 1 
ATOM   1678 C  "C5'" . DG  B  2 9   ? 169.373 16.769  253.321 1.00 70.02  ? 9    DG  B "C5'" 1 
ATOM   1679 C  "C4'" . DG  B  2 9   ? 170.236 15.626  252.806 1.00 71.44  ? 9    DG  B "C4'" 1 
ATOM   1680 O  "O4'" . DG  B  2 9   ? 169.463 14.400  252.765 1.00 76.01  ? 9    DG  B "O4'" 1 
ATOM   1681 C  "C3'" . DG  B  2 9   ? 170.807 15.790  251.403 1.00 78.58  ? 9    DG  B "C3'" 1 
ATOM   1682 O  "O3'" . DG  B  2 9   ? 172.059 15.116  251.344 1.00 81.20  ? 9    DG  B "O3'" 1 
ATOM   1683 C  "C2'" . DG  B  2 9   ? 169.762 15.078  250.544 1.00 74.33  ? 9    DG  B "C2'" 1 
ATOM   1684 C  "C1'" . DG  B  2 9   ? 169.434 13.896  251.441 1.00 75.29  ? 9    DG  B "C1'" 1 
ATOM   1685 N  N9    . DG  B  2 9   ? 168.117 13.303  251.217 1.00 69.07  ? 9    DG  B N9    1 
ATOM   1686 C  C8    . DG  B  2 9   ? 166.906 13.956  251.158 1.00 65.01  ? 9    DG  B C8    1 
ATOM   1687 N  N7    . DG  B  2 9   ? 165.894 13.154  250.976 1.00 65.86  ? 9    DG  B N7    1 
ATOM   1688 C  C5    . DG  B  2 9   ? 166.472 11.886  250.922 1.00 67.21  ? 9    DG  B C5    1 
ATOM   1689 C  C6    . DG  B  2 9   ? 165.875 10.613  250.736 1.00 59.56  ? 9    DG  B C6    1 
ATOM   1690 O  O6    . DG  B  2 9   ? 164.673 10.345  250.586 1.00 58.34  ? 9    DG  B O6    1 
ATOM   1691 N  N1    . DG  B  2 9   ? 166.829 9.590   250.738 1.00 60.99  ? 9    DG  B N1    1 
ATOM   1692 C  C2    . DG  B  2 9   ? 168.189 9.781   250.900 1.00 64.86  ? 9    DG  B C2    1 
ATOM   1693 N  N2    . DG  B  2 9   ? 168.960 8.684   250.871 1.00 57.82  ? 9    DG  B N2    1 
ATOM   1694 N  N3    . DG  B  2 9   ? 168.752 10.965  251.068 1.00 66.88  ? 9    DG  B N3    1 
ATOM   1695 C  C4    . DG  B  2 9   ? 167.839 11.967  251.072 1.00 66.56  ? 9    DG  B C4    1 
ATOM   1696 P  P     . DG  B  2 10  ? 173.029 15.303  250.082 1.00 83.58  ? 10   DG  B P     1 
ATOM   1697 O  OP1   . DG  B  2 10  ? 174.366 15.649  250.628 1.00 93.83  ? 10   DG  B OP1   1 
ATOM   1698 O  OP2   . DG  B  2 10  ? 172.345 16.208  249.127 1.00 72.58  ? 10   DG  B OP2   1 
ATOM   1699 O  "O5'" . DG  B  2 10  ? 173.129 13.834  249.453 1.00 79.85  ? 10   DG  B "O5'" 1 
ATOM   1700 C  "C5'" . DG  B  2 10  ? 173.532 12.740  250.275 1.00 81.41  ? 10   DG  B "C5'" 1 
ATOM   1701 C  "C4'" . DG  B  2 10  ? 173.739 11.467  249.456 1.00 85.93  ? 10   DG  B "C4'" 1 
ATOM   1702 O  "O4'" . DG  B  2 10  ? 172.481 10.756  249.296 1.00 84.69  ? 10   DG  B "O4'" 1 
ATOM   1703 C  "C3'" . DG  B  2 10  ? 174.293 11.658  248.047 1.00 85.62  ? 10   DG  B "C3'" 1 
ATOM   1704 O  "O3'" . DG  B  2 10  ? 175.174 10.577  247.739 1.00 83.93  ? 10   DG  B "O3'" 1 
ATOM   1705 C  "C2'" . DG  B  2 10  ? 173.031 11.636  247.170 1.00 81.49  ? 10   DG  B "C2'" 1 
ATOM   1706 C  "C1'" . DG  B  2 10  ? 172.148 10.639  247.916 1.00 79.96  ? 10   DG  B "C1'" 1 
ATOM   1707 N  N9    . DG  B  2 10  ? 170.718 10.902  247.810 1.00 74.17  ? 10   DG  B N9    1 
ATOM   1708 C  C8    . DG  B  2 10  ? 170.084 12.116  247.965 1.00 74.87  ? 10   DG  B C8    1 
ATOM   1709 N  N7    . DG  B  2 10  ? 168.784 12.043  247.865 1.00 70.03  ? 10   DG  B N7    1 
ATOM   1710 C  C5    . DG  B  2 10  ? 168.536 10.688  247.657 1.00 69.53  ? 10   DG  B C5    1 
ATOM   1711 C  C6    . DG  B  2 10  ? 167.308 10.003  247.480 1.00 64.16  ? 10   DG  B C6    1 
ATOM   1712 O  O6    . DG  B  2 10  ? 166.161 10.478  247.479 1.00 62.18  ? 10   DG  B O6    1 
ATOM   1713 N  N1    . DG  B  2 10  ? 167.503 8.630   247.288 1.00 59.11  ? 10   DG  B N1    1 
ATOM   1714 C  C2    . DG  B  2 10  ? 168.731 8.004   247.277 1.00 63.58  ? 10   DG  B C2    1 
ATOM   1715 N  N2    . DG  B  2 10  ? 168.722 6.675   247.092 1.00 59.58  ? 10   DG  B N2    1 
ATOM   1716 N  N3    . DG  B  2 10  ? 169.890 8.638   247.440 1.00 71.58  ? 10   DG  B N3    1 
ATOM   1717 C  C4    . DG  B  2 10  ? 169.717 9.972   247.625 1.00 70.78  ? 10   DG  B C4    1 
ATOM   1718 P  P     . DG  B  2 11  ? 176.173 10.674  246.485 1.00 94.76  ? 11   DG  B P     1 
ATOM   1719 O  OP1   . DG  B  2 11  ? 177.393 9.906   246.821 1.00 89.65  ? 11   DG  B OP1   1 
ATOM   1720 O  OP2   . DG  B  2 11  ? 176.243 12.096  246.066 1.00 87.31  ? 11   DG  B OP2   1 
ATOM   1721 O  "O5'" . DG  B  2 11  ? 175.404 9.898   245.326 1.00 85.01  ? 11   DG  B "O5'" 1 
ATOM   1722 C  "C5'" . DG  B  2 11  ? 175.117 8.518   245.470 1.00 83.27  ? 11   DG  B "C5'" 1 
ATOM   1723 C  "C4'" . DG  B  2 11  ? 174.125 8.076   244.415 1.00 83.30  ? 11   DG  B "C4'" 1 
ATOM   1724 O  "O4'" . DG  B  2 11  ? 172.813 8.633   244.706 1.00 83.05  ? 11   DG  B "O4'" 1 
ATOM   1725 C  "C3'" . DG  B  2 11  ? 174.453 8.523   242.983 1.00 81.09  ? 11   DG  B "C3'" 1 
ATOM   1726 O  "O3'" . DG  B  2 11  ? 174.189 7.459   242.104 1.00 82.43  ? 11   DG  B "O3'" 1 
ATOM   1727 C  "C2'" . DG  B  2 11  ? 173.469 9.674   242.754 1.00 77.84  ? 11   DG  B "C2'" 1 
ATOM   1728 C  "C1'" . DG  B  2 11  ? 172.275 9.122   243.498 1.00 76.85  ? 11   DG  B "C1'" 1 
ATOM   1729 N  N9    . DG  B  2 11  ? 171.224 10.087  243.788 1.00 71.88  ? 11   DG  B N9    1 
ATOM   1730 C  C8    . DG  B  2 11  ? 171.356 11.433  244.033 1.00 68.16  ? 11   DG  B C8    1 
ATOM   1731 N  N7    . DG  B  2 11  ? 170.214 12.030  244.263 1.00 69.21  ? 11   DG  B N7    1 
ATOM   1732 C  C5    . DG  B  2 11  ? 169.267 11.004  244.169 1.00 67.91  ? 11   DG  B C5    1 
ATOM   1733 C  C6    . DG  B  2 11  ? 167.850 11.030  244.321 1.00 61.83  ? 11   DG  B C6    1 
ATOM   1734 O  O6    . DG  B  2 11  ? 167.114 11.997  244.581 1.00 61.73  ? 11   DG  B O6    1 
ATOM   1735 N  N1    . DG  B  2 11  ? 167.293 9.765   244.138 1.00 58.45  ? 11   DG  B N1    1 
ATOM   1736 C  C2    . DG  B  2 11  ? 168.008 8.625   243.852 1.00 58.78  ? 11   DG  B C2    1 
ATOM   1737 N  N2    . DG  B  2 11  ? 167.302 7.501   243.717 1.00 53.74  ? 11   DG  B N2    1 
ATOM   1738 N  N3    . DG  B  2 11  ? 169.322 8.587   243.712 1.00 65.30  ? 11   DG  B N3    1 
ATOM   1739 C  C4    . DG  B  2 11  ? 169.883 9.807   243.880 1.00 69.44  ? 11   DG  B C4    1 
ATOM   1740 P  P     . DT  B  2 12  ? 175.352 6.432   241.705 1.00 86.16  ? 12   DT  B P     1 
ATOM   1741 O  OP1   . DT  B  2 12  ? 176.192 6.150   242.901 1.00 80.85  ? 12   DT  B OP1   1 
ATOM   1742 O  OP2   . DT  B  2 12  ? 175.926 7.037   240.479 1.00 79.60  ? 12   DT  B OP2   1 
ATOM   1743 O  "O5'" . DT  B  2 12  ? 174.572 5.085   241.292 1.00 81.17  ? 12   DT  B "O5'" 1 
ATOM   1744 C  "C5'" . DT  B  2 12  ? 173.739 4.381   242.241 1.00 73.55  ? 12   DT  B "C5'" 1 
ATOM   1745 C  "C4'" . DT  B  2 12  ? 172.418 3.911   241.606 1.00 72.03  ? 12   DT  B "C4'" 1 
ATOM   1746 O  "O4'" . DT  B  2 12  ? 171.455 5.001   241.603 1.00 75.34  ? 12   DT  B "O4'" 1 
ATOM   1747 C  "C3'" . DT  B  2 12  ? 172.479 3.457   240.139 1.00 71.69  ? 12   DT  B "C3'" 1 
ATOM   1748 O  "O3'" . DT  B  2 12  ? 171.394 2.601   239.886 1.00 71.14  ? 12   DT  B "O3'" 1 
ATOM   1749 C  "C2'" . DT  B  2 12  ? 172.225 4.769   239.418 1.00 64.54  ? 12   DT  B "C2'" 1 
ATOM   1750 C  "C1'" . DT  B  2 12  ? 171.058 5.235   240.257 1.00 68.42  ? 12   DT  B "C1'" 1 
ATOM   1751 N  N1    . DT  B  2 12  ? 170.673 6.663   240.087 1.00 71.10  ? 12   DT  B N1    1 
ATOM   1752 C  C2    . DT  B  2 12  ? 169.394 7.032   240.433 1.00 63.02  ? 12   DT  B C2    1 
ATOM   1753 O  O2    . DT  B  2 12  ? 168.585 6.247   240.873 1.00 60.13  ? 12   DT  B O2    1 
ATOM   1754 N  N3    . DT  B  2 12  ? 169.100 8.355   240.255 1.00 58.05  ? 12   DT  B N3    1 
ATOM   1755 C  C4    . DT  B  2 12  ? 169.940 9.331   239.754 1.00 67.88  ? 12   DT  B C4    1 
ATOM   1756 O  O4    . DT  B  2 12  ? 169.576 10.501  239.621 1.00 71.58  ? 12   DT  B O4    1 
ATOM   1757 C  C5    . DT  B  2 12  ? 171.282 8.879   239.402 1.00 69.20  ? 12   DT  B C5    1 
ATOM   1758 C  C7    . DT  B  2 12  ? 172.285 9.849   238.856 1.00 64.90  ? 12   DT  B C7    1 
ATOM   1759 C  C6    . DT  B  2 12  ? 171.580 7.577   239.583 1.00 68.04  ? 12   DT  B C6    1 
ATOM   1760 P  P     . DA  B  2 13  ? 171.460 1.028   240.194 1.00 80.39  ? 13   DA  B P     1 
ATOM   1761 O  OP1   . DA  B  2 13  ? 171.651 0.827   241.647 1.00 73.61  ? 13   DA  B OP1   1 
ATOM   1762 O  OP2   . DA  B  2 13  ? 172.467 0.484   239.255 1.00 74.32  ? 13   DA  B OP2   1 
ATOM   1763 O  "O5'" . DA  B  2 13  ? 169.983 0.516   239.764 1.00 71.61  ? 13   DA  B "O5'" 1 
ATOM   1764 C  "C5'" . DA  B  2 13  ? 168.834 0.784   240.604 1.00 59.78  ? 13   DA  B "C5'" 1 
ATOM   1765 C  "C4'" . DA  B  2 13  ? 167.699 1.494   239.856 1.00 57.05  ? 13   DA  B "C4'" 1 
ATOM   1766 O  "O4'" . DA  B  2 13  ? 168.106 2.836   239.471 1.00 62.52  ? 13   DA  B "O4'" 1 
ATOM   1767 C  "C3'" . DA  B  2 13  ? 167.184 0.826   238.563 1.00 59.07  ? 13   DA  B "C3'" 1 
ATOM   1768 O  "O3'" . DA  B  2 13  ? 165.747 0.915   238.511 1.00 53.37  ? 13   DA  B "O3'" 1 
ATOM   1769 C  "C2'" . DA  B  2 13  ? 167.809 1.708   237.482 1.00 59.60  ? 13   DA  B "C2'" 1 
ATOM   1770 C  "C1'" . DA  B  2 13  ? 167.670 3.064   238.148 1.00 54.08  ? 13   DA  B "C1'" 1 
ATOM   1771 N  N9    . DA  B  2 13  ? 168.472 4.139   237.538 1.00 56.94  ? 13   DA  B N9    1 
ATOM   1772 C  C8    . DA  B  2 13  ? 169.739 4.043   237.011 1.00 59.77  ? 13   DA  B C8    1 
ATOM   1773 N  N7    . DA  B  2 13  ? 170.206 5.177   236.535 1.00 55.16  ? 13   DA  B N7    1 
ATOM   1774 C  C5    . DA  B  2 13  ? 169.184 6.081   236.759 1.00 54.07  ? 13   DA  B C5    1 
ATOM   1775 C  C6    . DA  B  2 13  ? 169.049 7.457   236.478 1.00 55.99  ? 13   DA  B C6    1 
ATOM   1776 N  N6    . DA  B  2 13  ? 170.001 8.194   235.887 1.00 54.60  ? 13   DA  B N6    1 
ATOM   1777 N  N1    . DA  B  2 13  ? 167.885 8.053   236.837 1.00 56.70  ? 13   DA  B N1    1 
ATOM   1778 C  C2    . DA  B  2 13  ? 166.932 7.320   237.430 1.00 51.66  ? 13   DA  B C2    1 
ATOM   1779 N  N3    . DA  B  2 13  ? 166.940 6.026   237.731 1.00 47.70  ? 13   DA  B N3    1 
ATOM   1780 C  C4    . DA  B  2 13  ? 168.101 5.458   237.374 1.00 53.35  ? 13   DA  B C4    1 
ATOM   1781 P  P     . DA  B  2 14  ? 164.840 -0.310  237.996 1.00 53.32  ? 14   DA  B P     1 
ATOM   1782 O  OP1   . DA  B  2 14  ? 163.747 -0.424  238.966 1.00 57.19  ? 14   DA  B OP1   1 
ATOM   1783 O  OP2   . DA  B  2 14  ? 165.683 -1.487  237.725 1.00 55.20  ? 14   DA  B OP2   1 
ATOM   1784 O  "O5'" . DA  B  2 14  ? 164.066 0.210   236.649 1.00 61.07  ? 14   DA  B "O5'" 1 
ATOM   1785 C  "C5'" . DA  B  2 14  ? 164.338 1.478   235.974 1.00 46.80  ? 14   DA  B "C5'" 1 
ATOM   1786 C  "C4'" . DA  B  2 14  ? 163.730 2.702   236.677 1.00 53.94  ? 14   DA  B "C4'" 1 
ATOM   1787 O  "O4'" . DA  B  2 14  ? 164.763 3.706   236.668 1.00 54.91  ? 14   DA  B "O4'" 1 
ATOM   1788 C  "C3'" . DA  B  2 14  ? 162.527 3.426   236.000 1.00 52.22  ? 14   DA  B "C3'" 1 
ATOM   1789 O  "O3'" . DA  B  2 14  ? 161.936 4.443   236.946 1.00 52.53  ? 14   DA  B "O3'" 1 
ATOM   1790 C  "C2'" . DA  B  2 14  ? 163.276 4.136   234.895 1.00 54.21  ? 14   DA  B "C2'" 1 
ATOM   1791 C  "C1'" . DA  B  2 14  ? 164.452 4.687   235.697 1.00 47.15  ? 14   DA  B "C1'" 1 
ATOM   1792 N  N9    . DA  B  2 14  ? 165.655 4.946   234.916 1.00 56.95  ? 14   DA  B N9    1 
ATOM   1793 C  C8    . DA  B  2 14  ? 166.621 4.040   234.551 1.00 53.00  ? 14   DA  B C8    1 
ATOM   1794 N  N7    . DA  B  2 14  ? 167.593 4.565   233.858 1.00 49.36  ? 14   DA  B N7    1 
ATOM   1795 C  C5    . DA  B  2 14  ? 167.252 5.904   233.764 1.00 51.66  ? 14   DA  B C5    1 
ATOM   1796 C  C6    . DA  B  2 14  ? 167.884 7.001   233.153 1.00 56.24  ? 14   DA  B C6    1 
ATOM   1797 N  N6    . DA  B  2 14  ? 169.047 6.907   232.487 1.00 57.23  ? 14   DA  B N6    1 
ATOM   1798 N  N1    . DA  B  2 14  ? 167.274 8.204   233.248 1.00 55.05  ? 14   DA  B N1    1 
ATOM   1799 C  C2    . DA  B  2 14  ? 166.111 8.294   233.916 1.00 55.17  ? 14   DA  B C2    1 
ATOM   1800 N  N3    . DA  B  2 14  ? 165.428 7.337   234.530 1.00 51.94  ? 14   DA  B N3    1 
ATOM   1801 C  C4    . DA  B  2 14  ? 166.062 6.156   234.418 1.00 53.62  ? 14   DA  B C4    1 
ATOM   1802 P  P     . DG  B  2 15  ? 160.527 5.268   236.761 1.00 59.88  ? 15   DG  B P     1 
ATOM   1803 O  OP1   . DG  B  2 15  ? 160.587 6.742   236.733 1.00 44.01  ? 15   DG  B OP1   1 
ATOM   1804 O  OP2   . DG  B  2 15  ? 159.806 4.885   238.006 1.00 55.50  ? 15   DG  B OP2   1 
ATOM   1805 O  "O5'" . DG  B  2 15  ? 159.721 4.606   235.514 1.00 55.33  ? 15   DG  B "O5'" 1 
ATOM   1806 C  "C5'" . DG  B  2 15  ? 159.913 4.954   234.138 1.00 46.63  ? 15   DG  B "C5'" 1 
ATOM   1807 C  "C4'" . DG  B  2 15  ? 159.864 6.443   233.857 1.00 49.33  ? 15   DG  B "C4'" 1 
ATOM   1808 O  "O4'" . DG  B  2 15  ? 161.234 6.864   233.591 1.00 51.99  ? 15   DG  B "O4'" 1 
ATOM   1809 C  "C3'" . DG  B  2 15  ? 159.079 6.832   232.580 1.00 49.01  ? 15   DG  B "C3'" 1 
ATOM   1810 O  "O3'" . DG  B  2 15  ? 158.702 8.208   232.603 1.00 46.39  ? 15   DG  B "O3'" 1 
ATOM   1811 C  "C2'" . DG  B  2 15  ? 160.129 6.603   231.520 1.00 50.44  ? 15   DG  B "C2'" 1 
ATOM   1812 C  "C1'" . DG  B  2 15  ? 161.343 7.198   232.219 1.00 49.13  ? 15   DG  B "C1'" 1 
ATOM   1813 N  N9    . DG  B  2 15  ? 162.609 6.728   231.690 1.00 53.71  ? 15   DG  B N9    1 
ATOM   1814 C  C8    . DG  B  2 15  ? 163.090 5.442   231.642 1.00 52.29  ? 15   DG  B C8    1 
ATOM   1815 N  N7    . DG  B  2 15  ? 164.266 5.363   231.084 1.00 49.90  ? 15   DG  B N7    1 
ATOM   1816 C  C5    . DG  B  2 15  ? 164.564 6.681   230.738 1.00 51.45  ? 15   DG  B C5    1 
ATOM   1817 C  C6    . DG  B  2 15  ? 165.701 7.234   230.100 1.00 54.76  ? 15   DG  B C6    1 
ATOM   1818 O  O6    . DG  B  2 15  ? 166.711 6.648   229.699 1.00 52.52  ? 15   DG  B O6    1 
ATOM   1819 N  N1    . DG  B  2 15  ? 165.586 8.613   229.948 1.00 50.71  ? 15   DG  B N1    1 
ATOM   1820 C  C2    . DG  B  2 15  ? 164.506 9.358   230.364 1.00 53.97  ? 15   DG  B C2    1 
ATOM   1821 N  N2    . DG  B  2 15  ? 164.555 10.674  230.147 1.00 59.06  ? 15   DG  B N2    1 
ATOM   1822 N  N3    . DG  B  2 15  ? 163.453 8.850   230.955 1.00 54.05  ? 15   DG  B N3    1 
ATOM   1823 C  C4    . DG  B  2 15  ? 163.549 7.514   231.102 1.00 48.96  ? 15   DG  B C4    1 
ATOM   1824 P  P     . DT  B  2 16  ? 157.538 8.760   231.639 1.00 49.54  ? 16   DT  B P     1 
ATOM   1825 O  OP1   . DT  B  2 16  ? 156.775 9.798   232.354 1.00 53.63  ? 16   DT  B OP1   1 
ATOM   1826 O  OP2   . DT  B  2 16  ? 156.885 7.580   231.053 1.00 48.38  ? 16   DT  B OP2   1 
ATOM   1827 O  "O5'" . DT  B  2 16  ? 158.303 9.497   230.443 1.00 55.37  ? 16   DT  B "O5'" 1 
ATOM   1828 C  "C5'" . DT  B  2 16  ? 158.908 10.755  230.659 1.00 53.34  ? 16   DT  B "C5'" 1 
ATOM   1829 C  "C4'" . DT  B  2 16  ? 159.544 11.277  229.385 1.00 52.54  ? 16   DT  B "C4'" 1 
ATOM   1830 O  "O4'" . DT  B  2 16  ? 160.711 10.510  229.061 1.00 52.34  ? 16   DT  B "O4'" 1 
ATOM   1831 C  "C3'" . DT  B  2 16  ? 158.659 11.233  228.134 1.00 57.85  ? 16   DT  B "C3'" 1 
ATOM   1832 O  "O3'" . DT  B  2 16  ? 158.625 12.518  227.572 1.00 59.59  ? 16   DT  B "O3'" 1 
ATOM   1833 C  "C2'" . DT  B  2 16  ? 159.359 10.220  227.208 1.00 51.25  ? 16   DT  B "C2'" 1 
ATOM   1834 C  "C1'" . DT  B  2 16  ? 160.789 10.378  227.658 1.00 52.15  ? 16   DT  B "C1'" 1 
ATOM   1835 N  N1    . DT  B  2 16  ? 161.653 9.246   227.400 1.00 49.15  ? 16   DT  B N1    1 
ATOM   1836 C  C2    . DT  B  2 16  ? 162.844 9.465   226.760 1.00 56.87  ? 16   DT  B C2    1 
ATOM   1837 O  O2    . DT  B  2 16  ? 163.167 10.558  226.319 1.00 58.75  ? 16   DT  B O2    1 
ATOM   1838 N  N3    . DT  B  2 16  ? 163.638 8.348   226.623 1.00 50.22  ? 16   DT  B N3    1 
ATOM   1839 C  C4    . DT  B  2 16  ? 163.360 7.072   227.079 1.00 50.97  ? 16   DT  B C4    1 
ATOM   1840 O  O4    . DT  B  2 16  ? 164.134 6.134   226.921 1.00 54.38  ? 16   DT  B O4    1 
ATOM   1841 C  C5    . DT  B  2 16  ? 162.090 6.922   227.769 1.00 49.78  ? 16   DT  B C5    1 
ATOM   1842 C  C7    . DT  B  2 16  ? 161.673 5.585   228.308 1.00 46.16  ? 16   DT  B C7    1 
ATOM   1843 C  C6    . DT  B  2 16  ? 161.318 8.008   227.906 1.00 49.77  ? 16   DT  B C6    1 
ATOM   1844 P  P     . DT  B  2 17  ? 157.667 12.834  226.331 1.00 59.75  ? 17   DT  B P     1 
ATOM   1845 O  OP1   . DT  B  2 17  ? 157.120 14.183  226.555 1.00 55.47  ? 17   DT  B OP1   1 
ATOM   1846 O  OP2   . DT  B  2 17  ? 156.712 11.718  226.129 1.00 56.01  ? 17   DT  B OP2   1 
ATOM   1847 O  "O5'" . DT  B  2 17  ? 158.709 12.890  225.133 1.00 59.63  ? 17   DT  B "O5'" 1 
ATOM   1848 C  "C5'" . DT  B  2 17  ? 159.848 13.708  225.268 1.00 56.03  ? 17   DT  B "C5'" 1 
ATOM   1849 C  "C4'" . DT  B  2 17  ? 160.776 13.553  224.090 1.00 57.96  ? 17   DT  B "C4'" 1 
ATOM   1850 O  "O4'" . DT  B  2 17  ? 161.518 12.316  224.203 1.00 62.27  ? 17   DT  B "O4'" 1 
ATOM   1851 C  "C3'" . DT  B  2 17  ? 160.107 13.502  222.714 1.00 63.04  ? 17   DT  B "C3'" 1 
ATOM   1852 O  "O3'" . DT  B  2 17  ? 160.949 14.160  221.784 1.00 67.51  ? 17   DT  B "O3'" 1 
ATOM   1853 C  "C2'" . DT  B  2 17  ? 160.071 12.005  222.427 1.00 60.24  ? 17   DT  B "C2'" 1 
ATOM   1854 C  "C1'" . DT  B  2 17  ? 161.435 11.629  222.967 1.00 58.78  ? 17   DT  B "C1'" 1 
ATOM   1855 N  N1    . DT  B  2 17  ? 161.601 10.203  223.240 1.00 56.21  ? 17   DT  B N1    1 
ATOM   1856 C  C2    . DT  B  2 17  ? 162.821 9.616   223.021 1.00 54.63  ? 17   DT  B C2    1 
ATOM   1857 O  O2    . DT  B  2 17  ? 163.783 10.221  222.588 1.00 59.09  ? 17   DT  B O2    1 
ATOM   1858 N  N3    . DT  B  2 17  ? 162.878 8.286   223.329 1.00 56.42  ? 17   DT  B N3    1 
ATOM   1859 C  C4    . DT  B  2 17  ? 161.859 7.507   223.850 1.00 56.68  ? 17   DT  B C4    1 
ATOM   1860 O  O4    . DT  B  2 17  ? 162.006 6.314   224.111 1.00 53.20  ? 17   DT  B O4    1 
ATOM   1861 C  C5    . DT  B  2 17  ? 160.604 8.196   224.058 1.00 51.67  ? 17   DT  B C5    1 
ATOM   1862 C  C7    . DT  B  2 17  ? 159.428 7.460   224.596 1.00 48.14  ? 17   DT  B C7    1 
ATOM   1863 C  C6    . DT  B  2 17  ? 160.537 9.494   223.751 1.00 53.08  ? 17   DT  B C6    1 
ATOM   1864 P  P     . DC  B  2 18  ? 160.342 15.011  220.565 1.00 82.76  ? 18   DC  B P     1 
ATOM   1865 O  OP1   . DC  B  2 18  ? 160.230 16.398  221.081 1.00 65.49  ? 18   DC  B OP1   1 
ATOM   1866 O  OP2   . DC  B  2 18  ? 159.128 14.346  220.006 1.00 68.83  ? 18   DC  B OP2   1 
ATOM   1867 O  "O5'" . DC  B  2 18  ? 161.499 14.906  219.467 1.00 67.10  ? 18   DC  B "O5'" 1 
ATOM   1868 C  "C5'" . DC  B  2 18  ? 162.775 15.394  219.764 1.00 63.19  ? 18   DC  B "C5'" 1 
ATOM   1869 C  "C4'" . DC  B  2 18  ? 163.851 14.395  219.380 1.00 66.32  ? 18   DC  B "C4'" 1 
ATOM   1870 O  "O4'" . DC  B  2 18  ? 163.717 13.186  220.156 1.00 62.77  ? 18   DC  B "O4'" 1 
ATOM   1871 C  "C3'" . DC  B  2 18  ? 163.835 13.907  217.948 1.00 66.65  ? 18   DC  B "C3'" 1 
ATOM   1872 O  "O3'" . DC  B  2 18  ? 164.435 14.893  217.087 1.00 84.30  ? 18   DC  B "O3'" 1 
ATOM   1873 C  "C2'" . DC  B  2 18  ? 164.711 12.654  218.060 1.00 66.35  ? 18   DC  B "C2'" 1 
ATOM   1874 C  "C1'" . DC  B  2 18  ? 164.418 12.151  219.485 1.00 65.17  ? 18   DC  B "C1'" 1 
ATOM   1875 N  N1    . DC  B  2 18  ? 163.605 10.886  219.517 1.00 58.32  ? 18   DC  B N1    1 
ATOM   1876 C  C2    . DC  B  2 18  ? 164.257 9.636   219.461 1.00 60.97  ? 18   DC  B C2    1 
ATOM   1877 O  O2    . DC  B  2 18  ? 165.497 9.595   219.407 1.00 64.09  ? 18   DC  B O2    1 
ATOM   1878 N  N3    . DC  B  2 18  ? 163.507 8.503   219.472 1.00 57.45  ? 18   DC  B N3    1 
ATOM   1879 C  C4    . DC  B  2 18  ? 162.177 8.588   219.529 1.00 55.14  ? 18   DC  B C4    1 
ATOM   1880 N  N4    . DC  B  2 18  ? 161.486 7.448   219.545 1.00 56.01  ? 18   DC  B N4    1 
ATOM   1881 C  C5    . DC  B  2 18  ? 161.497 9.847   219.569 1.00 53.70  ? 18   DC  B C5    1 
ATOM   1882 C  C6    . DC  B  2 18  ? 162.240 10.957  219.558 1.00 56.99  ? 18   DC  B C6    1 
ATOM   1883 P  P     . DC  B  2 19  ? 164.296 14.826  215.476 1.00 86.76  ? 19   DC  B P     1 
ATOM   1884 O  OP1   . DC  B  2 19  ? 164.984 16.039  214.982 1.00 86.51  ? 19   DC  B OP1   1 
ATOM   1885 O  OP2   . DC  B  2 19  ? 162.875 14.614  215.097 1.00 73.68  ? 19   DC  B OP2   1 
ATOM   1886 O  "O5'" . DC  B  2 19  ? 165.174 13.549  215.050 1.00 75.66  ? 19   DC  B "O5'" 1 
ATOM   1887 C  "C5'" . DC  B  2 19  ? 166.584 13.545  215.281 1.00 72.72  ? 19   DC  B "C5'" 1 
ATOM   1888 C  "C4'" . DC  B  2 19  ? 167.202 12.184  214.968 1.00 77.33  ? 19   DC  B "C4'" 1 
ATOM   1889 O  "O4'" . DC  B  2 19  ? 166.708 11.186  215.884 1.00 74.47  ? 19   DC  B "O4'" 1 
ATOM   1890 C  "C3'" . DC  B  2 19  ? 166.887 11.623  213.591 1.00 81.33  ? 19   DC  B "C3'" 1 
ATOM   1891 O  "O3'" . DC  B  2 19  ? 167.810 12.155  212.637 1.00 92.68  ? 19   DC  B "O3'" 1 
ATOM   1892 C  "C2'" . DC  B  2 19  ? 167.093 10.115  213.786 1.00 74.53  ? 19   DC  B "C2'" 1 
ATOM   1893 C  "C1'" . DC  B  2 19  ? 166.823 9.903   215.282 1.00 70.54  ? 19   DC  B "C1'" 1 
ATOM   1894 N  N1    . DC  B  2 19  ? 165.580 9.104   215.571 1.00 60.26  ? 19   DC  B N1    1 
ATOM   1895 C  C2    . DC  B  2 19  ? 165.648 7.704   215.593 1.00 63.15  ? 19   DC  B C2    1 
ATOM   1896 O  O2    . DC  B  2 19  ? 166.733 7.150   215.378 1.00 63.10  ? 19   DC  B O2    1 
ATOM   1897 N  N3    . DC  B  2 19  ? 164.518 6.992   215.856 1.00 62.02  ? 19   DC  B N3    1 
ATOM   1898 C  C4    . DC  B  2 19  ? 163.369 7.629   216.097 1.00 60.23  ? 19   DC  B C4    1 
ATOM   1899 N  N4    . DC  B  2 19  ? 162.290 6.888   216.370 1.00 54.69  ? 19   DC  B N4    1 
ATOM   1900 C  C5    . DC  B  2 19  ? 163.279 9.056   216.078 1.00 58.68  ? 19   DC  B C5    1 
ATOM   1901 C  C6    . DC  B  2 19  ? 164.398 9.745   215.814 1.00 61.45  ? 19   DC  B C6    1 
ATOM   1902 P  P     . DG  B  2 20  ? 167.415 12.311  211.083 1.00 89.88  ? 20   DG  B P     1 
ATOM   1903 O  OP1   . DG  B  2 20  ? 168.397 13.281  210.547 1.00 86.70  ? 20   DG  B OP1   1 
ATOM   1904 O  OP2   . DG  B  2 20  ? 165.952 12.539  210.918 1.00 75.81  ? 20   DG  B OP2   1 
ATOM   1905 O  "O5'" . DG  B  2 20  ? 167.728 10.880  210.484 1.00 78.29  ? 20   DG  B "O5'" 1 
ATOM   1906 C  "C5'" . DG  B  2 20  ? 168.921 10.225  210.832 1.00 77.72  ? 20   DG  B "C5'" 1 
ATOM   1907 C  "C4'" . DG  B  2 20  ? 168.801 8.774   210.463 1.00 77.62  ? 20   DG  B "C4'" 1 
ATOM   1908 O  "O4'" . DG  B  2 20  ? 167.942 8.133   211.428 1.00 83.32  ? 20   DG  B "O4'" 1 
ATOM   1909 C  "C3'" . DG  B  2 20  ? 168.164 8.554   209.092 1.00 79.20  ? 20   DG  B "C3'" 1 
ATOM   1910 O  "O3'" . DG  B  2 20  ? 169.140 8.049   208.163 1.00 83.33  ? 20   DG  B "O3'" 1 
ATOM   1911 C  "C2'" . DG  B  2 20  ? 167.009 7.566   209.328 1.00 77.11  ? 20   DG  B "C2'" 1 
ATOM   1912 C  "C1'" . DG  B  2 20  ? 167.135 7.169   210.795 1.00 78.17  ? 20   DG  B "C1'" 1 
ATOM   1913 N  N9    . DG  B  2 20  ? 165.834 7.108   211.478 1.00 73.60  ? 20   DG  B N9    1 
ATOM   1914 C  C8    . DG  B  2 20  ? 164.962 8.149   211.727 1.00 70.58  ? 20   DG  B C8    1 
ATOM   1915 N  N7    . DG  B  2 20  ? 163.871 7.773   212.338 1.00 67.08  ? 20   DG  B N7    1 
ATOM   1916 C  C5    . DG  B  2 20  ? 164.033 6.404   212.502 1.00 59.98  ? 20   DG  B C5    1 
ATOM   1917 C  C6    . DG  B  2 20  ? 163.181 5.454   213.092 1.00 56.48  ? 20   DG  B C6    1 
ATOM   1918 O  O6    . DG  B  2 20  ? 162.077 5.640   213.607 1.00 57.94  ? 20   DG  B O6    1 
ATOM   1919 N  N1    . DG  B  2 20  ? 163.724 4.170   213.042 1.00 57.59  ? 20   DG  B N1    1 
ATOM   1920 C  C2    . DG  B  2 20  ? 164.944 3.855   212.489 1.00 55.67  ? 20   DG  B C2    1 
ATOM   1921 N  N2    . DG  B  2 20  ? 165.313 2.567   212.526 1.00 53.15  ? 20   DG  B N2    1 
ATOM   1922 N  N3    . DG  B  2 20  ? 165.746 4.736   211.937 1.00 59.82  ? 20   DG  B N3    1 
ATOM   1923 C  C4    . DG  B  2 20  ? 165.230 5.984   211.977 1.00 63.08  ? 20   DG  B C4    1 
ATOM   1924 P  P     . DG  B  2 21  ? 168.693 7.498   206.721 1.00 88.38  ? 21   DG  B P     1 
ATOM   1925 O  OP1   . DG  B  2 21  ? 169.859 7.575   205.812 1.00 83.13  ? 21   DG  B OP1   1 
ATOM   1926 O  OP2   . DG  B  2 21  ? 167.417 8.156   206.332 1.00 72.38  ? 21   DG  B OP2   1 
ATOM   1927 O  "O5'" . DG  B  2 21  ? 168.435 5.955   206.997 1.00 71.81  ? 21   DG  B "O5'" 1 
ATOM   1928 C  "C5'" . DG  B  2 21  ? 167.301 5.354   206.481 1.00 70.41  ? 21   DG  B "C5'" 1 
ATOM   1929 C  "C4'" . DG  B  2 21  ? 166.943 4.146   207.295 1.00 71.03  ? 21   DG  B "C4'" 1 
ATOM   1930 O  "O4'" . DG  B  2 21  ? 166.224 4.574   208.461 1.00 73.93  ? 21   DG  B "O4'" 1 
ATOM   1931 C  "C3'" . DG  B  2 21  ? 166.017 3.182   206.588 1.00 70.50  ? 21   DG  B "C3'" 1 
ATOM   1932 O  "O3'" . DG  B  2 21  ? 166.774 2.196   205.946 1.00 77.78  ? 21   DG  B "O3'" 1 
ATOM   1933 C  "C2'" . DG  B  2 21  ? 165.186 2.566   207.712 1.00 68.44  ? 21   DG  B "C2'" 1 
ATOM   1934 C  "C1'" . DG  B  2 21  ? 165.328 3.560   208.860 1.00 66.13  ? 21   DG  B "C1'" 1 
ATOM   1935 N  N9    . DG  B  2 21  ? 164.067 4.172   209.245 1.00 60.59  ? 21   DG  B N9    1 
ATOM   1936 C  C8    . DG  B  2 21  ? 163.723 5.503   209.165 1.00 61.27  ? 21   DG  B C8    1 
ATOM   1937 N  N7    . DG  B  2 21  ? 162.519 5.750   209.600 1.00 58.97  ? 21   DG  B N7    1 
ATOM   1938 C  C5    . DG  B  2 21  ? 162.044 4.507   209.993 1.00 55.83  ? 21   DG  B C5    1 
ATOM   1939 C  C6    . DG  B  2 21  ? 160.803 4.151   210.555 1.00 50.66  ? 21   DG  B C6    1 
ATOM   1940 O  O6    . DG  B  2 21  ? 159.851 4.894   210.809 1.00 48.98  ? 21   DG  B O6    1 
ATOM   1941 N  N1    . DG  B  2 21  ? 160.721 2.774   210.811 1.00 44.64  ? 21   DG  B N1    1 
ATOM   1942 C  C2    . DG  B  2 21  ? 161.731 1.866   210.560 1.00 50.83  ? 21   DG  B C2    1 
ATOM   1943 N  N2    . DG  B  2 21  ? 161.481 0.584   210.868 1.00 50.72  ? 21   DG  B N2    1 
ATOM   1944 N  N3    . DG  B  2 21  ? 162.904 2.194   210.031 1.00 56.66  ? 21   DG  B N3    1 
ATOM   1945 C  C4    . DG  B  2 21  ? 162.986 3.528   209.776 1.00 56.39  ? 21   DG  B C4    1 
ATOM   1946 P  P     . DC  B  2 22  ? 166.207 1.543   204.599 1.00 79.47  ? 22   DC  B P     1 
ATOM   1947 O  OP1   . DC  B  2 22  ? 167.198 0.555   204.102 1.00 75.41  ? 22   DC  B OP1   1 
ATOM   1948 O  OP2   . DC  B  2 22  ? 165.693 2.688   203.807 1.00 68.94  ? 22   DC  B OP2   1 
ATOM   1949 O  "O5'" . DC  B  2 22  ? 164.912 0.715   205.048 1.00 68.73  ? 22   DC  B "O5'" 1 
ATOM   1950 C  "C5'" . DC  B  2 22  ? 165.071 -0.449  205.829 1.00 69.24  ? 22   DC  B "C5'" 1 
ATOM   1951 C  "C4'" . DC  B  2 22  ? 163.729 -0.970  206.283 1.00 69.04  ? 22   DC  B "C4'" 1 
ATOM   1952 O  "O4'" . DC  B  2 22  ? 163.015 0.066   207.016 1.00 67.67  ? 22   DC  B "O4'" 1 
ATOM   1953 C  "C3'" . DC  B  2 22  ? 162.803 -1.401  205.153 1.00 68.52  ? 22   DC  B "C3'" 1 
ATOM   1954 O  "O3'" . DC  B  2 22  ? 162.282 -2.668  205.437 1.00 66.96  ? 22   DC  B "O3'" 1 
ATOM   1955 C  "C2'" . DC  B  2 22  ? 161.706 -0.339  205.152 1.00 67.79  ? 22   DC  B "C2'" 1 
ATOM   1956 C  "C1'" . DC  B  2 22  ? 161.672 0.061   206.611 1.00 59.03  ? 22   DC  B "C1'" 1 
ATOM   1957 N  N1    . DC  B  2 22  ? 161.115 1.410   206.829 1.00 58.45  ? 22   DC  B N1    1 
ATOM   1958 C  C2    . DC  B  2 22  ? 159.858 1.544   207.432 1.00 53.14  ? 22   DC  B C2    1 
ATOM   1959 O  O2    . DC  B  2 22  ? 159.242 0.521   207.775 1.00 52.88  ? 22   DC  B O2    1 
ATOM   1960 N  N3    . DC  B  2 22  ? 159.351 2.794   207.626 1.00 47.88  ? 22   DC  B N3    1 
ATOM   1961 C  C4    . DC  B  2 22  ? 160.053 3.867   207.249 1.00 49.77  ? 22   DC  B C4    1 
ATOM   1962 N  N4    . DC  B  2 22  ? 159.508 5.074   207.453 1.00 46.58  ? 22   DC  B N4    1 
ATOM   1963 C  C5    . DC  B  2 22  ? 161.336 3.747   206.625 1.00 56.05  ? 22   DC  B C5    1 
ATOM   1964 C  C6    . DC  B  2 22  ? 161.822 2.511   206.438 1.00 56.24  ? 22   DC  B C6    1 
ATOM   1965 P  P     . DG  B  2 23  ? 161.405 -3.430  204.334 1.00 78.77  ? 23   DG  B P     1 
ATOM   1966 O  OP1   . DG  B  2 23  ? 161.787 -4.859  204.418 1.00 74.56  ? 23   DG  B OP1   1 
ATOM   1967 O  OP2   . DG  B  2 23  ? 161.502 -2.677  203.064 1.00 72.57  ? 23   DG  B OP2   1 
ATOM   1968 O  "O5'" . DG  B  2 23  ? 159.916 -3.262  204.871 1.00 70.21  ? 23   DG  B "O5'" 1 
ATOM   1969 C  "C5'" . DG  B  2 23  ? 159.656 -3.498  206.231 1.00 67.38  ? 23   DG  B "C5'" 1 
ATOM   1970 C  "C4'" . DG  B  2 23  ? 158.173 -3.591  206.474 1.00 67.01  ? 23   DG  B "C4'" 1 
ATOM   1971 O  "O4'" . DG  B  2 23  ? 157.639 -2.279  206.781 1.00 61.91  ? 23   DG  B "O4'" 1 
ATOM   1972 C  "C3'" . DG  B  2 23  ? 157.364 -4.113  205.298 1.00 64.80  ? 23   DG  B "C3'" 1 
ATOM   1973 O  "O3'" . DG  B  2 23  ? 156.308 -4.878  205.805 1.00 61.97  ? 23   DG  B "O3'" 1 
ATOM   1974 C  "C2'" . DG  B  2 23  ? 156.867 -2.832  204.612 1.00 56.08  ? 23   DG  B "C2'" 1 
ATOM   1975 C  "C1'" . DG  B  2 23  ? 156.695 -1.888  205.796 1.00 56.74  ? 23   DG  B "C1'" 1 
ATOM   1976 N  N9    . DG  B  2 23  ? 156.953 -0.489  205.500 1.00 54.66  ? 23   DG  B N9    1 
ATOM   1977 C  C8    . DG  B  2 23  ? 158.080 0.053   204.918 1.00 48.61  ? 23   DG  B C8    1 
ATOM   1978 N  N7    . DG  B  2 23  ? 158.037 1.357   204.830 1.00 45.83  ? 23   DG  B N7    1 
ATOM   1979 C  C5    . DG  B  2 23  ? 156.813 1.694   205.401 1.00 45.83  ? 23   DG  B C5    1 
ATOM   1980 C  C6    . DG  B  2 23  ? 156.205 2.958   205.594 1.00 45.83  ? 23   DG  B C6    1 
ATOM   1981 O  O6    . DG  B  2 23  ? 156.636 4.083   205.289 1.00 49.10  ? 23   DG  B O6    1 
ATOM   1982 N  N1    . DG  B  2 23  ? 154.968 2.840   206.218 1.00 46.94  ? 23   DG  B N1    1 
ATOM   1983 C  C2    . DG  B  2 23  ? 154.391 1.656   206.619 1.00 49.04  ? 23   DG  B C2    1 
ATOM   1984 N  N2    . DG  B  2 23  ? 153.182 1.745   207.205 1.00 45.46  ? 23   DG  B N2    1 
ATOM   1985 N  N3    . DG  B  2 23  ? 154.945 0.472   206.440 1.00 47.55  ? 23   DG  B N3    1 
ATOM   1986 C  C4    . DG  B  2 23  ? 156.148 0.566   205.833 1.00 48.76  ? 23   DG  B C4    1 
ATOM   1987 P  P     . DC  B  2 24  ? 155.570 -5.946  204.878 1.00 75.10  ? 24   DC  B P     1 
ATOM   1988 O  OP1   . DC  B  2 24  ? 155.194 -7.100  205.732 1.00 63.36  ? 24   DC  B OP1   1 
ATOM   1989 O  OP2   . DC  B  2 24  ? 156.347 -6.072  203.611 1.00 74.45  ? 24   DC  B OP2   1 
ATOM   1990 O  "O5'" . DC  B  2 24  ? 154.226 -5.205  204.494 1.00 68.63  ? 24   DC  B "O5'" 1 
ATOM   1991 C  "C5'" . DC  B  2 24  ? 153.397 -4.718  205.504 1.00 63.11  ? 24   DC  B "C5'" 1 
ATOM   1992 C  "C4'" . DC  B  2 24  ? 152.403 -3.786  204.901 1.00 56.23  ? 24   DC  B "C4'" 1 
ATOM   1993 O  "O4'" . DC  B  2 24  ? 152.967 -2.451  204.859 1.00 53.72  ? 24   DC  B "O4'" 1 
ATOM   1994 C  "C3'" . DC  B  2 24  ? 152.047 -4.138  203.450 1.00 63.06  ? 24   DC  B "C3'" 1 
ATOM   1995 O  "O3'" . DC  B  2 24  ? 150.639 -4.212  203.314 1.00 60.69  ? 24   DC  B "O3'" 1 
ATOM   1996 C  "C2'" . DC  B  2 24  ? 152.647 -2.972  202.641 1.00 59.13  ? 24   DC  B "C2'" 1 
ATOM   1997 C  "C1'" . DC  B  2 24  ? 152.532 -1.859  203.669 1.00 54.54  ? 24   DC  B "C1'" 1 
ATOM   1998 N  N1    . DC  B  2 24  ? 153.346 -0.666  203.371 1.00 44.96  ? 24   DC  B N1    1 
ATOM   1999 C  C2    . DC  B  2 24  ? 152.803 0.589   203.628 1.00 43.68  ? 24   DC  B C2    1 
ATOM   2000 O  O2    . DC  B  2 24  ? 151.658 0.660   204.107 1.00 45.22  ? 24   DC  B O2    1 
ATOM   2001 N  N3    . DC  B  2 24  ? 153.527 1.692   203.330 1.00 42.44  ? 24   DC  B N3    1 
ATOM   2002 C  C4    . DC  B  2 24  ? 154.738 1.564   202.791 1.00 43.57  ? 24   DC  B C4    1 
ATOM   2003 N  N4    . DC  B  2 24  ? 155.414 2.685   202.523 1.00 45.32  ? 24   DC  B N4    1 
ATOM   2004 C  C5    . DC  B  2 24  ? 155.314 0.281   202.513 1.00 39.17  ? 24   DC  B C5    1 
ATOM   2005 C  C6    . DC  B  2 24  ? 154.580 -0.798  202.803 1.00 41.67  ? 24   DC  B C6    1 
ATOM   2006 P  P     . DG  B  2 25  ? 149.983 -5.015  202.088 1.00 59.44  ? 25   DG  B P     1 
ATOM   2007 O  OP1   . DG  B  2 25  ? 149.502 -6.321  202.593 1.00 54.75  ? 25   DG  B OP1   1 
ATOM   2008 O  OP2   . DG  B  2 25  ? 150.892 -4.920  200.906 1.00 57.34  ? 25   DG  B OP2   1 
ATOM   2009 O  "O5'" . DG  B  2 25  ? 148.712 -4.135  201.739 1.00 59.91  ? 25   DG  B "O5'" 1 
ATOM   2010 C  "C5'" . DG  B  2 25  ? 147.754 -3.836  202.735 1.00 52.48  ? 25   DG  B "C5'" 1 
ATOM   2011 C  "C4'" . DG  B  2 25  ? 146.884 -2.680  202.276 1.00 47.24  ? 25   DG  B "C4'" 1 
ATOM   2012 O  "O4'" . DG  B  2 25  ? 147.668 -1.466  202.303 1.00 46.23  ? 25   DG  B "O4'" 1 
ATOM   2013 C  "C3'" . DG  B  2 25  ? 146.354 -2.808  200.854 1.00 51.02  ? 25   DG  B "C3'" 1 
ATOM   2014 O  "O3'" . DG  B  2 25  ? 145.050 -2.265  200.777 1.00 55.49  ? 25   DG  B "O3'" 1 
ATOM   2015 C  "C2'" . DG  B  2 25  ? 147.358 -1.994  200.034 1.00 46.55  ? 25   DG  B "C2'" 1 
ATOM   2016 C  "C1'" . DG  B  2 25  ? 147.742 -0.893  201.012 1.00 46.68  ? 25   DG  B "C1'" 1 
ATOM   2017 N  N9    . DG  B  2 25  ? 149.102 -0.390  200.826 1.00 43.40  ? 25   DG  B N9    1 
ATOM   2018 C  C8    . DG  B  2 25  ? 150.244 -1.139  200.697 1.00 38.88  ? 25   DG  B C8    1 
ATOM   2019 N  N7    . DG  B  2 25  ? 151.326 -0.414  200.609 1.00 37.96  ? 25   DG  B N7    1 
ATOM   2020 C  C5    . DG  B  2 25  ? 150.878 0.890   200.647 1.00 32.03  ? 25   DG  B C5    1 
ATOM   2021 C  C6    . DG  B  2 25  ? 151.601 2.091   200.564 1.00 37.64  ? 25   DG  B C6    1 
ATOM   2022 O  O6    . DG  B  2 25  ? 152.827 2.239   200.425 1.00 41.29  ? 25   DG  B O6    1 
ATOM   2023 N  N1    . DG  B  2 25  ? 150.775 3.206   200.686 1.00 41.47  ? 25   DG  B N1    1 
ATOM   2024 C  C2    . DG  B  2 25  ? 149.410 3.156   200.856 1.00 44.11  ? 25   DG  B C2    1 
ATOM   2025 N  N2    . DG  B  2 25  ? 148.778 4.338   200.939 1.00 41.57  ? 25   DG  B N2    1 
ATOM   2026 N  N3    . DG  B  2 25  ? 148.711 2.025   200.928 1.00 41.30  ? 25   DG  B N3    1 
ATOM   2027 C  C4    . DG  B  2 25  ? 149.513 0.932   200.807 1.00 40.99  ? 25   DG  B C4    1 
ATOM   2028 O  "O5'" . DC  C  3 1   ? 152.859 10.976  197.794 1.00 70.76  ? 1    DC  C "O5'" 1 
ATOM   2029 C  "C5'" . DC  C  3 1   ? 151.569 11.553  197.606 1.00 61.73  ? 1    DC  C "C5'" 1 
ATOM   2030 C  "C4'" . DC  C  3 1   ? 150.576 11.032  198.637 1.00 60.53  ? 1    DC  C "C4'" 1 
ATOM   2031 O  "O4'" . DC  C  3 1   ? 150.657 9.583   198.722 1.00 59.65  ? 1    DC  C "O4'" 1 
ATOM   2032 C  "C3'" . DC  C  3 1   ? 150.744 11.554  200.072 1.00 62.99  ? 1    DC  C "C3'" 1 
ATOM   2033 O  "O3'" . DC  C  3 1   ? 149.433 11.777  200.612 1.00 70.12  ? 1    DC  C "O3'" 1 
ATOM   2034 C  "C2'" . DC  C  3 1   ? 151.466 10.392  200.776 1.00 58.46  ? 1    DC  C "C2'" 1 
ATOM   2035 C  "C1'" . DC  C  3 1   ? 150.844 9.185   200.072 1.00 56.33  ? 1    DC  C "C1'" 1 
ATOM   2036 N  N1    . DC  C  3 1   ? 151.688 7.944   200.060 1.00 47.89  ? 1    DC  C N1    1 
ATOM   2037 C  C2    . DC  C  3 1   ? 151.123 6.714   200.435 1.00 50.73  ? 1    DC  C C2    1 
ATOM   2038 O  O2    . DC  C  3 1   ? 149.942 6.674   200.798 1.00 47.64  ? 1    DC  C O2    1 
ATOM   2039 N  N3    . DC  C  3 1   ? 151.892 5.593   200.373 1.00 48.42  ? 1    DC  C N3    1 
ATOM   2040 C  C4    . DC  C  3 1   ? 153.155 5.673   199.938 1.00 43.86  ? 1    DC  C C4    1 
ATOM   2041 N  N4    . DC  C  3 1   ? 153.874 4.550   199.898 1.00 39.84  ? 1    DC  C N4    1 
ATOM   2042 C  C5    . DC  C  3 1   ? 153.737 6.910   199.550 1.00 41.95  ? 1    DC  C C5    1 
ATOM   2043 C  C6    . DC  C  3 1   ? 152.972 8.006   199.615 1.00 48.87  ? 1    DC  C C6    1 
ATOM   2044 P  P     . DG  C  3 2   ? 149.169 12.664  201.933 1.00 72.86  ? 2    DG  C P     1 
ATOM   2045 O  OP1   . DG  C  3 2   ? 147.866 13.333  201.717 1.00 61.43  ? 2    DG  C OP1   1 
ATOM   2046 O  OP2   . DG  C  3 2   ? 150.398 13.440  202.254 1.00 59.94  ? 2    DG  C OP2   1 
ATOM   2047 O  "O5'" . DG  C  3 2   ? 148.887 11.565  203.055 1.00 58.74  ? 2    DG  C "O5'" 1 
ATOM   2048 C  "C5'" . DG  C  3 2   ? 147.811 10.650  202.885 1.00 51.73  ? 2    DG  C "C5'" 1 
ATOM   2049 C  "C4'" . DG  C  3 2   ? 147.864 9.576   203.951 1.00 59.58  ? 2    DG  C "C4'" 1 
ATOM   2050 O  "O4'" . DG  C  3 2   ? 148.831 8.560   203.572 1.00 62.04  ? 2    DG  C "O4'" 1 
ATOM   2051 C  "C3'" . DG  C  3 2   ? 148.301 10.074  205.330 1.00 54.59  ? 2    DG  C "C3'" 1 
ATOM   2052 O  "O3'" . DG  C  3 2   ? 147.487 9.493   206.324 1.00 65.97  ? 2    DG  C "O3'" 1 
ATOM   2053 C  "C2'" . DG  C  3 2   ? 149.738 9.577   205.436 1.00 51.41  ? 2    DG  C "C2'" 1 
ATOM   2054 C  "C1'" . DG  C  3 2   ? 149.638 8.264   204.682 1.00 53.77  ? 2    DG  C "C1'" 1 
ATOM   2055 N  N9    . DG  C  3 2   ? 150.920 7.763   204.202 1.00 49.40  ? 2    DG  C N9    1 
ATOM   2056 C  C8    . DG  C  3 2   ? 151.984 8.514   203.781 1.00 48.71  ? 2    DG  C C8    1 
ATOM   2057 N  N7    . DG  C  3 2   ? 153.011 7.799   203.404 1.00 50.23  ? 2    DG  C N7    1 
ATOM   2058 C  C5    . DG  C  3 2   ? 152.604 6.490   203.587 1.00 43.56  ? 2    DG  C C5    1 
ATOM   2059 C  C6    . DG  C  3 2   ? 153.295 5.289   203.344 1.00 44.22  ? 2    DG  C C6    1 
ATOM   2060 O  O6    . DG  C  3 2   ? 154.449 5.141   202.906 1.00 43.58  ? 2    DG  C O6    1 
ATOM   2061 N  N1    . DG  C  3 2   ? 152.525 4.175   203.675 1.00 43.06  ? 2    DG  C N1    1 
ATOM   2062 C  C2    . DG  C  3 2   ? 151.250 4.223   204.159 1.00 44.43  ? 2    DG  C C2    1 
ATOM   2063 N  N2    . DG  C  3 2   ? 150.673 3.042   204.401 1.00 48.48  ? 2    DG  C N2    1 
ATOM   2064 N  N3    . DG  C  3 2   ? 150.580 5.349   204.391 1.00 47.47  ? 2    DG  C N3    1 
ATOM   2065 C  C4    . DG  C  3 2   ? 151.320 6.442   204.086 1.00 48.71  ? 2    DG  C C4    1 
ATOM   2066 P  P     . DC  C  3 3   ? 147.174 10.292  207.682 1.00 64.28  ? 3    DC  C P     1 
ATOM   2067 O  OP1   . DC  C  3 3   ? 145.817 10.853  207.568 1.00 70.08  ? 3    DC  C OP1   1 
ATOM   2068 O  OP2   . DC  C  3 3   ? 148.342 11.132  208.051 1.00 62.64  ? 3    DC  C OP2   1 
ATOM   2069 O  "O5'" . DC  C  3 3   ? 147.194 9.175   208.774 1.00 63.91  ? 3    DC  C "O5'" 1 
ATOM   2070 C  "C5'" . DC  C  3 3   ? 148.419 8.861   209.365 1.00 61.58  ? 3    DC  C "C5'" 1 
ATOM   2071 C  "C4'" . DC  C  3 3   ? 148.699 7.394   209.202 1.00 58.92  ? 3    DC  C "C4'" 1 
ATOM   2072 O  "O4'" . DC  C  3 3   ? 149.668 7.213   208.145 1.00 52.81  ? 3    DC  C "O4'" 1 
ATOM   2073 C  "C3'" . DC  C  3 3   ? 149.276 6.728   210.452 1.00 49.30  ? 3    DC  C "C3'" 1 
ATOM   2074 O  "O3'" . DC  C  3 3   ? 148.339 5.790   210.968 1.00 53.38  ? 3    DC  C "O3'" 1 
ATOM   2075 C  "C2'" . DC  C  3 3   ? 150.568 6.048   209.964 1.00 49.40  ? 3    DC  C "C2'" 1 
ATOM   2076 C  "C1'" . DC  C  3 3   ? 150.426 6.077   208.434 1.00 47.84  ? 3    DC  C "C1'" 1 
ATOM   2077 N  N1    . DC  C  3 3   ? 151.715 6.191   207.749 1.00 45.43  ? 3    DC  C N1    1 
ATOM   2078 C  C2    . DC  C  3 3   ? 152.420 5.039   207.471 1.00 45.64  ? 3    DC  C C2    1 
ATOM   2079 O  O2    . DC  C  3 3   ? 151.925 3.953   207.787 1.00 46.68  ? 3    DC  C O2    1 
ATOM   2080 N  N3    . DC  C  3 3   ? 153.624 5.133   206.855 1.00 46.28  ? 3    DC  C N3    1 
ATOM   2081 C  C4    . DC  C  3 3   ? 154.124 6.321   206.536 1.00 46.06  ? 3    DC  C C4    1 
ATOM   2082 N  N4    . DC  C  3 3   ? 155.324 6.348   205.924 1.00 45.44  ? 3    DC  C N4    1 
ATOM   2083 C  C5    . DC  C  3 3   ? 153.418 7.531   206.822 1.00 45.32  ? 3    DC  C C5    1 
ATOM   2084 C  C6    . DC  C  3 3   ? 152.225 7.419   207.425 1.00 48.72  ? 3    DC  C C6    1 
ATOM   2085 P  P     . DG  C  3 4   ? 148.442 5.292   212.498 1.00 48.12  ? 4    DG  C P     1 
ATOM   2086 O  OP1   . DG  C  3 4   ? 147.125 4.735   212.896 1.00 42.04  ? 4    DG  C OP1   1 
ATOM   2087 O  OP2   . DG  C  3 4   ? 149.093 6.387   213.242 1.00 44.15  ? 4    DG  C OP2   1 
ATOM   2088 O  "O5'" . DG  C  3 4   ? 149.450 4.053   212.433 1.00 46.00  ? 4    DG  C "O5'" 1 
ATOM   2089 C  "C5'" . DG  C  3 4   ? 149.060 2.885   211.748 1.00 38.63  ? 4    DG  C "C5'" 1 
ATOM   2090 C  "C4'" . DG  C  3 4   ? 150.202 1.903   211.689 1.00 40.43  ? 4    DG  C "C4'" 1 
ATOM   2091 O  "O4'" . DG  C  3 4   ? 151.279 2.450   210.883 1.00 40.09  ? 4    DG  C "O4'" 1 
ATOM   2092 C  "C3'" . DG  C  3 4   ? 150.833 1.542   213.047 1.00 46.51  ? 4    DG  C "C3'" 1 
ATOM   2093 O  "O3'" . DG  C  3 4   ? 150.946 0.128   213.107 1.00 46.69  ? 4    DG  C "O3'" 1 
ATOM   2094 C  "C2'" . DG  C  3 4   ? 152.208 2.227   212.989 1.00 46.15  ? 4    DG  C "C2'" 1 
ATOM   2095 C  "C1'" . DG  C  3 4   ? 152.499 2.147   211.498 1.00 43.30  ? 4    DG  C "C1'" 1 
ATOM   2096 N  N9    . DG  C  3 4   ? 153.475 3.095   211.004 1.00 45.10  ? 4    DG  C N9    1 
ATOM   2097 C  C8    . DG  C  3 4   ? 153.395 4.473   211.036 1.00 47.28  ? 4    DG  C C8    1 
ATOM   2098 N  N7    . DG  C  3 4   ? 154.417 5.068   210.470 1.00 42.78  ? 4    DG  C N7    1 
ATOM   2099 C  C5    . DG  C  3 4   ? 155.216 4.008   210.021 1.00 46.10  ? 4    DG  C C5    1 
ATOM   2100 C  C6    . DG  C  3 4   ? 156.443 4.027   209.316 1.00 47.25  ? 4    DG  C C6    1 
ATOM   2101 O  O6    . DG  C  3 4   ? 157.098 5.014   208.967 1.00 46.73  ? 4    DG  C O6    1 
ATOM   2102 N  N1    . DG  C  3 4   ? 156.912 2.733   209.045 1.00 46.79  ? 4    DG  C N1    1 
ATOM   2103 C  C2    . DG  C  3 4   ? 156.260 1.571   209.413 1.00 47.99  ? 4    DG  C C2    1 
ATOM   2104 N  N2    . DG  C  3 4   ? 156.850 0.411   209.078 1.00 45.37  ? 4    DG  C N2    1 
ATOM   2105 N  N3    . DG  C  3 4   ? 155.102 1.549   210.061 1.00 45.35  ? 4    DG  C N3    1 
ATOM   2106 C  C4    . DG  C  3 4   ? 154.643 2.795   210.332 1.00 43.16  ? 4    DG  C C4    1 
ATOM   2107 P  P     . DC  C  3 5   ? 151.566 -0.641  214.370 1.00 49.47  ? 5    DC  C P     1 
ATOM   2108 O  OP1   . DC  C  3 5   ? 150.731 -1.839  214.553 1.00 44.63  ? 5    DC  C OP1   1 
ATOM   2109 O  OP2   . DC  C  3 5   ? 151.730 0.281   215.525 1.00 48.56  ? 5    DC  C OP2   1 
ATOM   2110 O  "O5'" . DC  C  3 5   ? 152.996 -1.098  213.817 1.00 44.42  ? 5    DC  C "O5'" 1 
ATOM   2111 C  "C5'" . DC  C  3 5   ? 153.749 -2.061  214.487 1.00 47.74  ? 5    DC  C "C5'" 1 
ATOM   2112 C  "C4'" . DC  C  3 5   ? 154.933 -2.495  213.642 1.00 45.82  ? 5    DC  C "C4'" 1 
ATOM   2113 O  "O4'" . DC  C  3 5   ? 155.347 -1.398  212.779 1.00 40.19  ? 5    DC  C "O4'" 1 
ATOM   2114 C  "C3'" . DC  C  3 5   ? 156.166 -2.889  214.437 1.00 45.90  ? 5    DC  C "C3'" 1 
ATOM   2115 O  "O3'" . DC  C  3 5   ? 156.839 -3.938  213.781 1.00 51.15  ? 5    DC  C "O3'" 1 
ATOM   2116 C  "C2'" . DC  C  3 5   ? 156.982 -1.607  214.415 1.00 46.82  ? 5    DC  C "C2'" 1 
ATOM   2117 C  "C1'" . DC  C  3 5   ? 156.694 -1.099  213.018 1.00 42.30  ? 5    DC  C "C1'" 1 
ATOM   2118 N  N1    . DC  C  3 5   ? 156.894 0.362   212.872 1.00 44.82  ? 5    DC  C N1    1 
ATOM   2119 C  C2    . DC  C  3 5   ? 158.071 0.834   212.279 1.00 43.82  ? 5    DC  C C2    1 
ATOM   2120 O  O2    . DC  C  3 5   ? 158.906 0.012   211.889 1.00 44.50  ? 5    DC  C O2    1 
ATOM   2121 N  N3    . DC  C  3 5   ? 158.266 2.174   212.163 1.00 40.59  ? 5    DC  C N3    1 
ATOM   2122 C  C4    . DC  C  3 5   ? 157.333 3.022   212.599 1.00 44.75  ? 5    DC  C C4    1 
ATOM   2123 N  N4    . DC  C  3 5   ? 157.562 4.331   212.461 1.00 41.26  ? 5    DC  C N4    1 
ATOM   2124 C  C5    . DC  C  3 5   ? 156.125 2.561   213.221 1.00 45.31  ? 5    DC  C C5    1 
ATOM   2125 C  C6    . DC  C  3 5   ? 155.951 1.232   213.332 1.00 45.37  ? 5    DC  C C6    1 
ATOM   2126 P  P     . DC  C  3 6   ? 157.545 -5.114  214.613 1.00 55.30  ? 6    DC  C P     1 
ATOM   2127 O  OP1   . DC  C  3 6   ? 157.265 -6.412  213.955 1.00 54.01  ? 6    DC  C OP1   1 
ATOM   2128 O  OP2   . DC  C  3 6   ? 157.182 -4.938  216.044 1.00 63.30  ? 6    DC  C OP2   1 
ATOM   2129 O  "O5'" . DC  C  3 6   ? 159.097 -4.850  214.430 1.00 56.45  ? 6    DC  C "O5'" 1 
ATOM   2130 C  "C5'" . DC  C  3 6   ? 159.660 -3.606  214.740 1.00 55.95  ? 6    DC  C "C5'" 1 
ATOM   2131 C  "C4'" . DC  C  3 6   ? 160.957 -3.395  213.969 1.00 52.03  ? 6    DC  C "C4'" 1 
ATOM   2132 O  "O4'" . DC  C  3 6   ? 160.936 -2.066  213.395 1.00 49.36  ? 6    DC  C "O4'" 1 
ATOM   2133 C  "C3'" . DC  C  3 6   ? 162.224 -3.475  214.833 1.00 61.96  ? 6    DC  C "C3'" 1 
ATOM   2134 O  "O3'" . DC  C  3 6   ? 163.289 -4.202  214.168 1.00 66.86  ? 6    DC  C "O3'" 1 
ATOM   2135 C  "C2'" . DC  C  3 6   ? 162.588 -2.010  215.079 1.00 58.43  ? 6    DC  C "C2'" 1 
ATOM   2136 C  "C1'" . DC  C  3 6   ? 162.063 -1.325  213.823 1.00 52.56  ? 6    DC  C "C1'" 1 
ATOM   2137 N  N1    . DC  C  3 6   ? 161.647 0.099   214.041 1.00 50.88  ? 6    DC  C N1    1 
ATOM   2138 C  C2    . DC  C  3 6   ? 162.522 1.137   213.703 1.00 53.15  ? 6    DC  C C2    1 
ATOM   2139 O  O2    . DC  C  3 6   ? 163.625 0.859   213.228 1.00 56.05  ? 6    DC  C O2    1 
ATOM   2140 N  N3    . DC  C  3 6   ? 162.133 2.424   213.901 1.00 51.72  ? 6    DC  C N3    1 
ATOM   2141 C  C4    . DC  C  3 6   ? 160.935 2.685   214.419 1.00 47.54  ? 6    DC  C C4    1 
ATOM   2142 N  N4    . DC  C  3 6   ? 160.598 3.969   214.602 1.00 46.38  ? 6    DC  C N4    1 
ATOM   2143 C  C5    . DC  C  3 6   ? 160.035 1.639   214.788 1.00 47.68  ? 6    DC  C C5    1 
ATOM   2144 C  C6    . DC  C  3 6   ? 160.427 0.374   214.583 1.00 47.74  ? 6    DC  C C6    1 
ATOM   2145 P  P     . DG  C  3 7   ? 164.363 -5.028  215.041 1.00 71.06  ? 7    DG  C P     1 
ATOM   2146 O  OP1   . DG  C  3 7   ? 164.940 -6.093  214.201 1.00 67.51  ? 7    DG  C OP1   1 
ATOM   2147 O  OP2   . DG  C  3 7   ? 163.724 -5.399  216.308 1.00 65.70  ? 7    DG  C OP2   1 
ATOM   2148 O  "O5'" . DG  C  3 7   ? 165.449 -3.933  215.457 1.00 59.77  ? 7    DG  C "O5'" 1 
ATOM   2149 C  "C5'" . DG  C  3 7   ? 166.179 -3.241  214.479 1.00 64.68  ? 7    DG  C "C5'" 1 
ATOM   2150 C  "C4'" . DG  C  3 7   ? 167.053 -2.215  215.148 1.00 66.63  ? 7    DG  C "C4'" 1 
ATOM   2151 O  "O4'" . DG  C  3 7   ? 166.360 -0.948  215.145 1.00 62.67  ? 7    DG  C "O4'" 1 
ATOM   2152 C  "C3'" . DG  C  3 7   ? 167.392 -2.526  216.622 1.00 68.39  ? 7    DG  C "C3'" 1 
ATOM   2153 O  "O3'" . DG  C  3 7   ? 168.818 -2.371  216.839 1.00 76.51  ? 7    DG  C "O3'" 1 
ATOM   2154 C  "C2'" . DG  C  3 7   ? 166.565 -1.493  217.399 1.00 65.36  ? 7    DG  C "C2'" 1 
ATOM   2155 C  "C1'" . DG  C  3 7   ? 166.505 -0.343  216.398 1.00 62.04  ? 7    DG  C "C1'" 1 
ATOM   2156 N  N9    . DG  C  3 7   ? 165.389 0.574   216.594 1.00 54.79  ? 7    DG  C N9    1 
ATOM   2157 C  C8    . DG  C  3 7   ? 164.112 0.264   217.008 1.00 48.91  ? 7    DG  C C8    1 
ATOM   2158 N  N7    . DG  C  3 7   ? 163.324 1.305   217.067 1.00 47.80  ? 7    DG  C N7    1 
ATOM   2159 C  C5    . DG  C  3 7   ? 164.127 2.367   216.689 1.00 49.64  ? 7    DG  C C5    1 
ATOM   2160 C  C6    . DG  C  3 7   ? 163.826 3.735   216.570 1.00 50.97  ? 7    DG  C C6    1 
ATOM   2161 O  O6    . DG  C  3 7   ? 162.764 4.303   216.797 1.00 51.80  ? 7    DG  C O6    1 
ATOM   2162 N  N1    . DG  C  3 7   ? 164.919 4.472   216.142 1.00 53.19  ? 7    DG  C N1    1 
ATOM   2163 C  C2    . DG  C  3 7   ? 166.151 3.947   215.856 1.00 56.86  ? 7    DG  C C2    1 
ATOM   2164 N  N2    . DG  C  3 7   ? 167.081 4.817   215.449 1.00 58.04  ? 7    DG  C N2    1 
ATOM   2165 N  N3    . DG  C  3 7   ? 166.453 2.659   215.959 1.00 53.21  ? 7    DG  C N3    1 
ATOM   2166 C  C4    . DG  C  3 7   ? 165.398 1.932   216.380 1.00 54.25  ? 7    DG  C C4    1 
ATOM   2167 P  P     . DG  C  3 8   ? 169.505 -2.570  218.287 1.00 83.54  ? 8    DG  C P     1 
ATOM   2168 O  OP1   . DG  C  3 8   ? 170.757 -3.301  218.015 1.00 86.05  ? 8    DG  C OP1   1 
ATOM   2169 O  OP2   . DG  C  3 8   ? 168.568 -3.124  219.295 1.00 81.77  ? 8    DG  C OP2   1 
ATOM   2170 O  "O5'" . DG  C  3 8   ? 169.879 -1.077  218.713 1.00 66.03  ? 8    DG  C "O5'" 1 
ATOM   2171 C  "C5'" . DG  C  3 8   ? 170.444 -0.245  217.745 1.00 65.96  ? 8    DG  C "C5'" 1 
ATOM   2172 C  "C4'" . DG  C  3 8   ? 170.236 1.225   218.059 1.00 62.82  ? 8    DG  C "C4'" 1 
ATOM   2173 O  "O4'" . DG  C  3 8   ? 168.847 1.566   218.096 1.00 63.55  ? 8    DG  C "O4'" 1 
ATOM   2174 C  "C3'" . DG  C  3 8   ? 170.795 1.720   219.387 1.00 66.94  ? 8    DG  C "C3'" 1 
ATOM   2175 O  "O3'" . DG  C  3 8   ? 172.078 2.254   219.155 1.00 72.15  ? 8    DG  C "O3'" 1 
ATOM   2176 C  "C2'" . DG  C  3 8   ? 169.795 2.826   219.815 1.00 67.62  ? 8    DG  C "C2'" 1 
ATOM   2177 C  "C1'" . DG  C  3 8   ? 168.789 2.852   218.657 1.00 63.26  ? 8    DG  C "C1'" 1 
ATOM   2178 N  N9    . DG  C  3 8   ? 167.416 3.151   219.061 1.00 58.26  ? 8    DG  C N9    1 
ATOM   2179 C  C8    . DG  C  3 8   ? 166.458 2.257   219.495 1.00 51.96  ? 8    DG  C C8    1 
ATOM   2180 N  N7    . DG  C  3 8   ? 165.316 2.825   219.782 1.00 56.51  ? 8    DG  C N7    1 
ATOM   2181 C  C5    . DG  C  3 8   ? 165.532 4.182   219.537 1.00 56.23  ? 8    DG  C C5    1 
ATOM   2182 C  C6    . DG  C  3 8   ? 164.654 5.298   219.670 1.00 54.62  ? 8    DG  C C6    1 
ATOM   2183 O  O6    . DG  C  3 8   ? 163.481 5.312   220.041 1.00 53.35  ? 8    DG  C O6    1 
ATOM   2184 N  N1    . DG  C  3 8   ? 165.270 6.493   219.306 1.00 60.23  ? 8    DG  C N1    1 
ATOM   2185 C  C2    . DG  C  3 8   ? 166.572 6.604   218.873 1.00 60.34  ? 8    DG  C C2    1 
ATOM   2186 N  N2    . DG  C  3 8   ? 166.990 7.846   218.576 1.00 55.69  ? 8    DG  C N2    1 
ATOM   2187 N  N3    . DG  C  3 8   ? 167.404 5.568   218.739 1.00 58.09  ? 8    DG  C N3    1 
ATOM   2188 C  C4    . DG  C  3 8   ? 166.819 4.395   219.089 1.00 57.80  ? 8    DG  C C4    1 
ATOM   2189 P  P     . DA  C  3 9   ? 173.161 2.385   220.333 1.00 80.92  ? 9    DA  C P     1 
ATOM   2190 O  OP1   . DA  C  3 9   ? 174.473 2.574   219.647 1.00 85.67  ? 9    DA  C OP1   1 
ATOM   2191 O  OP2   . DA  C  3 9   ? 173.022 1.240   221.273 1.00 57.61  ? 9    DA  C OP2   1 
ATOM   2192 O  "O5'" . DA  C  3 9   ? 172.778 3.778   221.011 1.00 67.19  ? 9    DA  C "O5'" 1 
ATOM   2193 C  "C5'" . DA  C  3 9   ? 172.682 4.926   220.189 1.00 69.69  ? 9    DA  C "C5'" 1 
ATOM   2194 C  "C4'" . DA  C  3 9   ? 172.064 6.073   220.947 1.00 78.49  ? 9    DA  C "C4'" 1 
ATOM   2195 O  "O4'" . DA  C  3 9   ? 170.617 5.880   221.078 1.00 77.05  ? 9    DA  C "O4'" 1 
ATOM   2196 C  "C3'" . DA  C  3 9   ? 172.593 6.249   222.373 1.00 80.94  ? 9    DA  C "C3'" 1 
ATOM   2197 O  "O3'" . DA  C  3 9   ? 172.763 7.619   222.627 1.00 89.87  ? 9    DA  C "O3'" 1 
ATOM   2198 C  "C2'" . DA  C  3 9   ? 171.456 5.688   223.222 1.00 77.26  ? 9    DA  C "C2'" 1 
ATOM   2199 C  "C1'" . DA  C  3 9   ? 170.268 6.173   222.411 1.00 79.72  ? 9    DA  C "C1'" 1 
ATOM   2200 N  N9    . DA  C  3 9   ? 169.007 5.525   222.751 1.00 71.86  ? 9    DA  C N9    1 
ATOM   2201 C  C8    . DA  C  3 9   ? 168.816 4.216   223.106 1.00 65.81  ? 9    DA  C C8    1 
ATOM   2202 N  N7    . DA  C  3 9   ? 167.564 3.915   223.362 1.00 66.90  ? 9    DA  C N7    1 
ATOM   2203 C  C5    . DA  C  3 9   ? 166.888 5.115   223.168 1.00 66.99  ? 9    DA  C C5    1 
ATOM   2204 C  C6    . DA  C  3 9   ? 165.528 5.472   223.286 1.00 62.21  ? 9    DA  C C6    1 
ATOM   2205 N  N6    . DA  C  3 9   ? 164.568 4.602   223.645 1.00 60.59  ? 9    DA  C N6    1 
ATOM   2206 N  N1    . DA  C  3 9   ? 165.191 6.763   223.017 1.00 60.68  ? 9    DA  C N1    1 
ATOM   2207 C  C2    . DA  C  3 9   ? 166.157 7.625   222.660 1.00 64.14  ? 9    DA  C C2    1 
ATOM   2208 N  N3    . DA  C  3 9   ? 167.467 7.403   222.519 1.00 64.67  ? 9    DA  C N3    1 
ATOM   2209 C  C4    . DA  C  3 9   ? 167.767 6.118   222.791 1.00 66.85  ? 9    DA  C C4    1 
ATOM   2210 P  P     . DA  C  3 10  ? 174.185 8.209   223.075 1.00 91.20  ? 10   DA  C P     1 
ATOM   2211 O  OP1   . DA  C  3 10  ? 175.143 7.853   221.999 1.00 85.56  ? 10   DA  C OP1   1 
ATOM   2212 O  OP2   . DA  C  3 10  ? 174.460 7.785   224.474 1.00 82.84  ? 10   DA  C OP2   1 
ATOM   2213 O  "O5'" . DA  C  3 10  ? 173.912 9.787   223.070 1.00 78.41  ? 10   DA  C "O5'" 1 
ATOM   2214 C  "C5'" . DA  C  3 10  ? 173.271 10.374  221.946 1.00 77.49  ? 10   DA  C "C5'" 1 
ATOM   2215 C  "C4'" . DA  C  3 10  ? 172.246 11.407  222.371 1.00 78.50  ? 10   DA  C "C4'" 1 
ATOM   2216 O  "O4'" . DA  C  3 10  ? 170.999 10.751  222.724 1.00 81.61  ? 10   DA  C "O4'" 1 
ATOM   2217 C  "C3'" . DA  C  3 10  ? 172.631 12.258  223.573 1.00 77.37  ? 10   DA  C "C3'" 1 
ATOM   2218 O  "O3'" . DA  C  3 10  ? 172.139 13.590  223.375 1.00 77.12  ? 10   DA  C "O3'" 1 
ATOM   2219 C  "C2'" . DA  C  3 10  ? 171.926 11.542  224.737 1.00 82.14  ? 10   DA  C "C2'" 1 
ATOM   2220 C  "C1'" . DA  C  3 10  ? 170.646 11.050  224.064 1.00 80.06  ? 10   DA  C "C1'" 1 
ATOM   2221 N  N9    . DA  C  3 10  ? 170.055 9.839   224.659 1.00 78.03  ? 10   DA  C N9    1 
ATOM   2222 C  C8    . DA  C  3 10  ? 170.687 8.653   224.934 1.00 78.21  ? 10   DA  C C8    1 
ATOM   2223 N  N7    . DA  C  3 10  ? 169.896 7.728   225.437 1.00 71.22  ? 10   DA  C N7    1 
ATOM   2224 C  C5    . DA  C  3 10  ? 168.654 8.341   225.474 1.00 73.03  ? 10   DA  C C5    1 
ATOM   2225 C  C6    . DA  C  3 10  ? 167.381 7.896   225.908 1.00 68.30  ? 10   DA  C C6    1 
ATOM   2226 N  N6    . DA  C  3 10  ? 167.154 6.671   226.392 1.00 61.93  ? 10   DA  C N6    1 
ATOM   2227 N  N1    . DA  C  3 10  ? 166.354 8.763   225.823 1.00 64.09  ? 10   DA  C N1    1 
ATOM   2228 C  C2    . DA  C  3 10  ? 166.580 9.988   225.333 1.00 67.96  ? 10   DA  C C2    1 
ATOM   2229 N  N3    . DA  C  3 10  ? 167.723 10.520  224.895 1.00 74.66  ? 10   DA  C N3    1 
ATOM   2230 C  C4    . DA  C  3 10  ? 168.732 9.639   224.994 1.00 72.67  ? 10   DA  C C4    1 
ATOM   2231 P  P     . DC  C  3 11  ? 172.649 14.803  224.298 1.00 91.79  ? 11   DC  C P     1 
ATOM   2232 O  OP1   . DC  C  3 11  ? 172.542 16.083  223.562 1.00 87.05  ? 11   DC  C OP1   1 
ATOM   2233 O  OP2   . DC  C  3 11  ? 173.933 14.367  224.907 1.00 85.32  ? 11   DC  C OP2   1 
ATOM   2234 O  "O5'" . DC  C  3 11  ? 171.538 14.889  225.436 1.00 91.50  ? 11   DC  C "O5'" 1 
ATOM   2235 C  "C5'" . DC  C  3 11  ? 170.184 15.073  225.072 1.00 85.09  ? 11   DC  C "C5'" 1 
ATOM   2236 C  "C4'" . DC  C  3 11  ? 169.288 14.773  226.246 1.00 82.95  ? 11   DC  C "C4'" 1 
ATOM   2237 O  "O4'" . DC  C  3 11  ? 169.153 13.351  226.404 1.00 84.42  ? 11   DC  C "O4'" 1 
ATOM   2238 C  "C3'" . DC  C  3 11  ? 169.824 15.269  227.585 1.00 85.28  ? 11   DC  C "C3'" 1 
ATOM   2239 O  "O3'" . DC  C  3 11  ? 169.148 16.465  227.952 1.00 88.40  ? 11   DC  C "O3'" 1 
ATOM   2240 C  "C2'" . DC  C  3 11  ? 169.540 14.110  228.569 1.00 80.80  ? 11   DC  C "C2'" 1 
ATOM   2241 C  "C1'" . DC  C  3 11  ? 168.743 13.123  227.721 1.00 80.64  ? 11   DC  C "C1'" 1 
ATOM   2242 N  N1    . DC  C  3 11  ? 168.978 11.688  228.067 1.00 75.65  ? 11   DC  C N1    1 
ATOM   2243 C  C2    . DC  C  3 11  ? 167.901 10.891  228.497 1.00 69.87  ? 11   DC  C C2    1 
ATOM   2244 O  O2    . DC  C  3 11  ? 166.770 11.393  228.575 1.00 67.54  ? 11   DC  C O2    1 
ATOM   2245 N  N3    . DC  C  3 11  ? 168.130 9.589   228.802 1.00 66.43  ? 11   DC  C N3    1 
ATOM   2246 C  C4    . DC  C  3 11  ? 169.361 9.087   228.709 1.00 69.73  ? 11   DC  C C4    1 
ATOM   2247 N  N4    . DC  C  3 11  ? 169.542 7.798   229.032 1.00 67.47  ? 11   DC  C N4    1 
ATOM   2248 C  C5    . DC  C  3 11  ? 170.464 9.884   228.277 1.00 76.02  ? 11   DC  C C5    1 
ATOM   2249 C  C6    . DC  C  3 11  ? 170.227 11.166  227.967 1.00 73.70  ? 11   DC  C C6    1 
ATOM   2250 P  P     . DT  C  3 12  ? 169.518 17.222  229.319 1.00 91.98  ? 12   DT  C P     1 
ATOM   2251 O  OP1   . DT  C  3 12  ? 169.266 18.667  229.111 1.00 92.68  ? 12   DT  C OP1   1 
ATOM   2252 O  OP2   . DT  C  3 12  ? 170.839 16.734  229.790 1.00 76.92  ? 12   DT  C OP2   1 
ATOM   2253 O  "O5'" . DT  C  3 12  ? 168.397 16.710  230.329 1.00 89.01  ? 12   DT  C "O5'" 1 
ATOM   2254 C  "C5'" . DT  C  3 12  ? 167.049 16.645  229.897 1.00 86.39  ? 12   DT  C "C5'" 1 
ATOM   2255 C  "C4'" . DT  C  3 12  ? 166.205 15.957  230.941 1.00 81.84  ? 12   DT  C "C4'" 1 
ATOM   2256 O  "O4'" . DT  C  3 12  ? 166.489 14.536  230.921 1.00 81.71  ? 12   DT  C "O4'" 1 
ATOM   2257 C  "C3'" . DT  C  3 12  ? 166.468 16.429  232.376 1.00 76.86  ? 12   DT  C "C3'" 1 
ATOM   2258 O  "O3'" . DT  C  3 12  ? 165.238 16.734  233.004 1.00 83.25  ? 12   DT  C "O3'" 1 
ATOM   2259 C  "C2'" . DT  C  3 12  ? 167.177 15.238  233.033 1.00 75.56  ? 12   DT  C "C2'" 1 
ATOM   2260 C  "C1'" . DT  C  3 12  ? 166.600 14.078  232.247 1.00 79.81  ? 12   DT  C "C1'" 1 
ATOM   2261 N  N1    . DT  C  3 12  ? 167.438 12.848  232.256 1.00 77.60  ? 12   DT  C N1    1 
ATOM   2262 C  C2    . DT  C  3 12  ? 166.864 11.663  232.643 1.00 73.79  ? 12   DT  C C2    1 
ATOM   2263 O  O2    . DT  C  3 12  ? 165.701 11.574  233.000 1.00 72.16  ? 12   DT  C O2    1 
ATOM   2264 N  N3    . DT  C  3 12  ? 167.700 10.580  232.598 1.00 67.42  ? 12   DT  C N3    1 
ATOM   2265 C  C4    . DT  C  3 12  ? 169.027 10.561  232.217 1.00 68.19  ? 12   DT  C C4    1 
ATOM   2266 O  O4    . DT  C  3 12  ? 169.695 9.528   232.219 1.00 61.47  ? 12   DT  C O4    1 
ATOM   2267 C  C5    . DT  C  3 12  ? 169.569 11.840  231.817 1.00 74.34  ? 12   DT  C C5    1 
ATOM   2268 C  C7    . DT  C  3 12  ? 171.000 11.950  231.376 1.00 73.19  ? 12   DT  C C7    1 
ATOM   2269 C  C6    . DT  C  3 12  ? 168.754 12.909  231.849 1.00 75.73  ? 12   DT  C C6    1 
ATOM   2270 P  P     . DT  C  3 13  ? 165.197 17.386  234.472 1.00 80.98  ? 13   DT  C P     1 
ATOM   2271 O  OP1   . DT  C  3 13  ? 164.168 18.454  234.398 1.00 73.95  ? 13   DT  C OP1   1 
ATOM   2272 O  OP2   . DT  C  3 13  ? 166.562 17.660  234.965 1.00 74.95  ? 13   DT  C OP2   1 
ATOM   2273 O  "O5'" . DT  C  3 13  ? 164.677 16.185  235.388 1.00 82.26  ? 13   DT  C "O5'" 1 
ATOM   2274 C  "C5'" . DT  C  3 13  ? 163.452 15.537  235.073 1.00 77.54  ? 13   DT  C "C5'" 1 
ATOM   2275 C  "C4'" . DT  C  3 13  ? 163.229 14.339  235.975 1.00 68.80  ? 13   DT  C "C4'" 1 
ATOM   2276 O  "O4'" . DT  C  3 13  ? 164.248 13.345  235.716 1.00 66.03  ? 13   DT  C "O4'" 1 
ATOM   2277 C  "C3'" . DT  C  3 13  ? 163.295 14.636  237.475 1.00 62.54  ? 13   DT  C "C3'" 1 
ATOM   2278 O  "O3'" . DT  C  3 13  ? 162.242 13.943  238.154 1.00 58.66  ? 13   DT  C "O3'" 1 
ATOM   2279 C  "C2'" . DT  C  3 13  ? 164.669 14.073  237.863 1.00 57.63  ? 13   DT  C "C2'" 1 
ATOM   2280 C  "C1'" . DT  C  3 13  ? 164.733 12.872  236.943 1.00 66.87  ? 13   DT  C "C1'" 1 
ATOM   2281 N  N1    . DT  C  3 13  ? 166.107 12.292  236.707 1.00 71.54  ? 13   DT  C N1    1 
ATOM   2282 C  C2    . DT  C  3 13  ? 166.307 10.938  236.912 1.00 65.60  ? 13   DT  C C2    1 
ATOM   2283 O  O2    . DT  C  3 13  ? 165.435 10.179  237.315 1.00 65.63  ? 13   DT  C O2    1 
ATOM   2284 N  N3    . DT  C  3 13  ? 167.575 10.500  236.646 1.00 65.49  ? 13   DT  C N3    1 
ATOM   2285 C  C4    . DT  C  3 13  ? 168.643 11.250  236.187 1.00 66.97  ? 13   DT  C C4    1 
ATOM   2286 O  O4    . DT  C  3 13  ? 169.746 10.747  235.960 1.00 66.62  ? 13   DT  C O4    1 
ATOM   2287 C  C5    . DT  C  3 13  ? 168.364 12.657  235.975 1.00 68.58  ? 13   DT  C C5    1 
ATOM   2288 C  C7    . DT  C  3 13  ? 169.441 13.574  235.471 1.00 69.41  ? 13   DT  C C7    1 
ATOM   2289 C  C6    . DT  C  3 13  ? 167.121 13.104  236.235 1.00 69.32  ? 13   DT  C C6    1 
ATOM   2290 P  P     . DA  C  3 14  ? 160.716 14.461  238.140 1.00 64.27  ? 14   DA  C P     1 
ATOM   2291 O  OP1   . DA  C  3 14  ? 160.363 14.923  236.780 1.00 64.66  ? 14   DA  C OP1   1 
ATOM   2292 O  OP2   . DA  C  3 14  ? 160.463 15.361  239.291 1.00 61.20  ? 14   DA  C OP2   1 
ATOM   2293 O  "O5'" . DA  C  3 14  ? 159.901 13.114  238.418 1.00 60.13  ? 14   DA  C "O5'" 1 
ATOM   2294 C  "C5'" . DA  C  3 14  ? 159.883 12.093  237.436 1.00 47.82  ? 14   DA  C "C5'" 1 
ATOM   2295 C  "C4'" . DA  C  3 14  ? 160.079 10.710  238.030 1.00 45.53  ? 14   DA  C "C4'" 1 
ATOM   2296 O  "O4'" . DA  C  3 14  ? 161.463 10.505  238.390 1.00 48.33  ? 14   DA  C "O4'" 1 
ATOM   2297 C  "C3'" . DA  C  3 14  ? 159.279 10.383  239.284 1.00 49.27  ? 14   DA  C "C3'" 1 
ATOM   2298 O  "O3'" . DA  C  3 14  ? 158.978 8.994   239.257 1.00 45.32  ? 14   DA  C "O3'" 1 
ATOM   2299 C  "C2'" . DA  C  3 14  ? 160.275 10.715  240.400 1.00 44.66  ? 14   DA  C "C2'" 1 
ATOM   2300 C  "C1'" . DA  C  3 14  ? 161.554 10.184  239.776 1.00 50.89  ? 14   DA  C "C1'" 1 
ATOM   2301 N  N9    . DA  C  3 14  ? 162.782 10.802  240.249 1.00 53.51  ? 14   DA  C N9    1 
ATOM   2302 C  C8    . DA  C  3 14  ? 162.984 12.120  240.553 1.00 56.43  ? 14   DA  C C8    1 
ATOM   2303 N  N7    . DA  C  3 14  ? 164.226 12.402  240.857 1.00 58.68  ? 14   DA  C N7    1 
ATOM   2304 C  C5    . DA  C  3 14  ? 164.883 11.187  240.718 1.00 52.70  ? 14   DA  C C5    1 
ATOM   2305 C  C6    . DA  C  3 14  ? 166.218 10.810  240.901 1.00 54.78  ? 14   DA  C C6    1 
ATOM   2306 N  N6    . DA  C  3 14  ? 167.180 11.659  241.283 1.00 61.67  ? 14   DA  C N6    1 
ATOM   2307 N  N1    . DA  C  3 14  ? 166.537 9.517   240.677 1.00 60.02  ? 14   DA  C N1    1 
ATOM   2308 C  C2    . DA  C  3 14  ? 165.575 8.668   240.306 1.00 53.22  ? 14   DA  C C2    1 
ATOM   2309 N  N3    . DA  C  3 14  ? 164.292 8.910   240.104 1.00 55.16  ? 14   DA  C N3    1 
ATOM   2310 C  C4    . DA  C  3 14  ? 164.009 10.200  240.333 1.00 51.99  ? 14   DA  C C4    1 
ATOM   2311 P  P     . DC  C  3 15  ? 157.702 8.426   240.046 1.00 47.65  ? 15   DC  C P     1 
ATOM   2312 O  OP1   . DC  C  3 15  ? 157.334 7.141   239.423 1.00 43.46  ? 15   DC  C OP1   1 
ATOM   2313 O  OP2   . DC  C  3 15  ? 156.690 9.495   240.085 1.00 44.51  ? 15   DC  C OP2   1 
ATOM   2314 O  "O5'" . DC  C  3 15  ? 158.279 8.196   241.555 1.00 47.32  ? 15   DC  C "O5'" 1 
ATOM   2315 C  "C5'" . DC  C  3 15  ? 158.707 6.892   241.998 1.00 44.67  ? 15   DC  C "C5'" 1 
ATOM   2316 C  "C4'" . DC  C  3 15  ? 160.093 6.495   241.474 1.00 47.90  ? 15   DC  C "C4'" 1 
ATOM   2317 O  "O4'" . DC  C  3 15  ? 161.034 7.583   241.665 1.00 48.37  ? 15   DC  C "O4'" 1 
ATOM   2318 C  "C3'" . DC  C  3 15  ? 160.724 5.307   242.221 1.00 50.32  ? 15   DC  C "C3'" 1 
ATOM   2319 O  "O3'" . DC  C  3 15  ? 161.577 4.572   241.367 1.00 46.69  ? 15   DC  C "O3'" 1 
ATOM   2320 C  "C2'" . DC  C  3 15  ? 161.529 6.007   243.296 1.00 50.56  ? 15   DC  C "C2'" 1 
ATOM   2321 C  "C1'" . DC  C  3 15  ? 162.116 7.109   242.454 1.00 47.50  ? 15   DC  C "C1'" 1 
ATOM   2322 N  N1    . DC  C  3 15  ? 162.700 8.237   243.213 1.00 48.44  ? 15   DC  C N1    1 
ATOM   2323 C  C2    . DC  C  3 15  ? 164.066 8.253   243.450 1.00 48.92  ? 15   DC  C C2    1 
ATOM   2324 O  O2    . DC  C  3 15  ? 164.743 7.301   243.052 1.00 49.77  ? 15   DC  C O2    1 
ATOM   2325 N  N3    . DC  C  3 15  ? 164.612 9.309   244.112 1.00 53.98  ? 15   DC  C N3    1 
ATOM   2326 C  C4    . DC  C  3 15  ? 163.830 10.308  244.537 1.00 54.99  ? 15   DC  C C4    1 
ATOM   2327 N  N4    . DC  C  3 15  ? 164.406 11.325  245.181 1.00 55.55  ? 15   DC  C N4    1 
ATOM   2328 C  C5    . DC  C  3 15  ? 162.417 10.308  244.312 1.00 53.63  ? 15   DC  C C5    1 
ATOM   2329 C  C6    . DC  C  3 15  ? 161.900 9.261   243.648 1.00 55.07  ? 15   DC  C C6    1 
ATOM   2330 N  N     . ASN D  1 4   ? 119.779 -17.274 197.883 1.00 89.24  ? 4    ASN D N     1 
ATOM   2331 C  CA    . ASN D  1 4   ? 120.076 -15.849 197.792 1.00 91.88  ? 4    ASN D CA    1 
ATOM   2332 C  C     . ASN D  1 4   ? 119.255 -15.117 196.725 1.00 91.88  ? 4    ASN D C     1 
ATOM   2333 O  O     . ASN D  1 4   ? 119.562 -13.981 196.355 1.00 87.66  ? 4    ASN D O     1 
ATOM   2334 C  CB    . ASN D  1 4   ? 121.571 -15.634 197.543 1.00 98.96  ? 4    ASN D CB    1 
ATOM   2335 C  CG    . ASN D  1 4   ? 122.399 -15.772 198.816 1.00 103.65 ? 4    ASN D CG    1 
ATOM   2336 O  OD1   . ASN D  1 4   ? 122.731 -16.882 199.234 1.00 107.54 ? 4    ASN D OD1   1 
ATOM   2337 N  ND2   . ASN D  1 4   ? 122.737 -14.640 199.434 1.00 97.84  ? 4    ASN D ND2   1 
ATOM   2338 N  N     . GLU D  1 5   ? 118.218 -15.785 196.228 1.00 93.43  ? 5    GLU D N     1 
ATOM   2339 C  CA    . GLU D  1 5   ? 117.095 -15.095 195.610 1.00 88.99  ? 5    GLU D CA    1 
ATOM   2340 C  C     . GLU D  1 5   ? 116.014 -15.099 196.685 1.00 88.53  ? 5    GLU D C     1 
ATOM   2341 O  O     . GLU D  1 5   ? 114.936 -14.513 196.530 1.00 86.70  ? 5    GLU D O     1 
ATOM   2342 C  CB    . GLU D  1 5   ? 116.635 -15.773 194.316 1.00 89.12  ? 5    GLU D CB    1 
ATOM   2343 C  CG    . GLU D  1 5   ? 117.088 -15.036 193.042 1.00 93.97  ? 5    GLU D CG    1 
ATOM   2344 C  CD    . GLU D  1 5   ? 116.374 -13.699 192.824 1.00 94.68  ? 5    GLU D CD    1 
ATOM   2345 O  OE1   . GLU D  1 5   ? 115.122 -13.672 192.866 1.00 96.30  ? 5    GLU D OE1   1 
ATOM   2346 O  OE2   . GLU D  1 5   ? 117.066 -12.672 192.635 1.00 87.81  ? 5    GLU D OE2   1 
ATOM   2347 N  N     . ASN D  1 6   ? 116.339 -15.778 197.786 1.00 88.03  ? 6    ASN D N     1 
ATOM   2348 C  CA    . ASN D  1 6   ? 115.534 -15.743 198.996 1.00 83.44  ? 6    ASN D CA    1 
ATOM   2349 C  C     . ASN D  1 6   ? 115.885 -14.514 199.825 1.00 78.06  ? 6    ASN D C     1 
ATOM   2350 O  O     . ASN D  1 6   ? 115.001 -13.788 200.276 1.00 74.96  ? 6    ASN D O     1 
ATOM   2351 C  CB    . ASN D  1 6   ? 115.737 -17.011 199.833 1.00 82.08  ? 6    ASN D CB    1 
ATOM   2352 C  CG    . ASN D  1 6   ? 114.600 -17.250 200.825 1.00 86.68  ? 6    ASN D CG    1 
ATOM   2353 O  OD1   . ASN D  1 6   ? 113.472 -16.797 200.620 1.00 89.69  ? 6    ASN D OD1   1 
ATOM   2354 N  ND2   . ASN D  1 6   ? 114.895 -17.967 201.901 1.00 87.92  ? 6    ASN D ND2   1 
ATOM   2355 N  N     . VAL D  1 7   ? 117.177 -14.263 200.014 1.00 75.76  ? 7    VAL D N     1 
ATOM   2356 C  CA    . VAL D  1 7   ? 117.572 -13.094 200.789 1.00 77.07  ? 7    VAL D CA    1 
ATOM   2357 C  C     . VAL D  1 7   ? 117.303 -11.803 200.005 1.00 68.10  ? 7    VAL D C     1 
ATOM   2358 O  O     . VAL D  1 7   ? 117.030 -10.762 200.598 1.00 68.04  ? 7    VAL D O     1 
ATOM   2359 C  CB    . VAL D  1 7   ? 119.069 -13.165 201.242 1.00 78.69  ? 7    VAL D CB    1 
ATOM   2360 C  CG1   . VAL D  1 7   ? 119.632 -14.540 200.988 1.00 85.13  ? 7    VAL D CG1   1 
ATOM   2361 C  CG2   . VAL D  1 7   ? 119.925 -12.076 200.598 1.00 68.20  ? 7    VAL D CG2   1 
ATOM   2362 N  N     . SER D  1 8   ? 117.340 -11.865 198.682 1.00 65.79  ? 8    SER D N     1 
ATOM   2363 C  CA    . SER D  1 8   ? 117.073 -10.668 197.905 1.00 67.53  ? 8    SER D CA    1 
ATOM   2364 C  C     . SER D  1 8   ? 115.600 -10.293 198.061 1.00 59.28  ? 8    SER D C     1 
ATOM   2365 O  O     . SER D  1 8   ? 115.256 -9.114  198.132 1.00 58.92  ? 8    SER D O     1 
ATOM   2366 C  CB    . SER D  1 8   ? 117.444 -10.867 196.428 1.00 62.29  ? 8    SER D CB    1 
ATOM   2367 O  OG    . SER D  1 8   ? 116.473 -11.653 195.763 1.00 73.36  ? 8    SER D OG    1 
ATOM   2368 N  N     . GLY D  1 9   ? 114.731 -11.296 198.126 1.00 57.80  ? 9    GLY D N     1 
ATOM   2369 C  CA    . GLY D  1 9   ? 113.315 -11.040 198.330 1.00 56.15  ? 9    GLY D CA    1 
ATOM   2370 C  C     . GLY D  1 9   ? 113.036 -10.523 199.741 1.00 59.58  ? 9    GLY D C     1 
ATOM   2371 O  O     . GLY D  1 9   ? 112.245 -9.599  199.957 1.00 52.95  ? 9    GLY D O     1 
ATOM   2372 N  N     . ILE D  1 10  ? 113.692 -11.125 200.717 1.00 54.01  ? 10   ILE D N     1 
ATOM   2373 C  CA    . ILE D  1 10  ? 113.458 -10.747 202.096 1.00 60.16  ? 10   ILE D CA    1 
ATOM   2374 C  C     . ILE D  1 10  ? 113.960 -9.321  202.294 1.00 54.94  ? 10   ILE D C     1 
ATOM   2375 O  O     . ILE D  1 10  ? 113.316 -8.506  202.965 1.00 48.87  ? 10   ILE D O     1 
ATOM   2376 C  CB    . ILE D  1 10  ? 114.142 -11.729 203.056 1.00 57.65  ? 10   ILE D CB    1 
ATOM   2377 C  CG1   . ILE D  1 10  ? 113.317 -13.010 203.122 1.00 59.33  ? 10   ILE D CG1   1 
ATOM   2378 C  CG2   . ILE D  1 10  ? 114.298 -11.122 204.431 1.00 56.97  ? 10   ILE D CG2   1 
ATOM   2379 C  CD1   . ILE D  1 10  ? 114.131 -14.221 203.433 1.00 66.77  ? 10   ILE D CD1   1 
ATOM   2380 N  N     . SER D  1 11  ? 115.088 -9.020  201.660 1.00 50.50  ? 11   SER D N     1 
ATOM   2381 C  CA    . SER D  1 11  ? 115.704 -7.710  201.750 1.00 46.54  ? 11   SER D CA    1 
ATOM   2382 C  C     . SER D  1 11  ? 114.774 -6.653  201.211 1.00 50.49  ? 11   SER D C     1 
ATOM   2383 O  O     . SER D  1 11  ? 114.572 -5.619  201.853 1.00 48.05  ? 11   SER D O     1 
ATOM   2384 C  CB    . SER D  1 11  ? 117.016 -7.676  200.979 1.00 52.10  ? 11   SER D CB    1 
ATOM   2385 O  OG    . SER D  1 11  ? 117.973 -8.495  201.611 1.00 59.23  ? 11   SER D OG    1 
ATOM   2386 N  N     . ALA D  1 12  ? 114.200 -6.926  200.038 1.00 46.52  ? 12   ALA D N     1 
ATOM   2387 C  CA    . ALA D  1 12  ? 113.322 -5.974  199.390 1.00 44.86  ? 12   ALA D CA    1 
ATOM   2388 C  C     . ALA D  1 12  ? 112.045 -5.760  200.203 1.00 43.47  ? 12   ALA D C     1 
ATOM   2389 O  O     . ALA D  1 12  ? 111.549 -4.640  200.293 1.00 44.29  ? 12   ALA D O     1 
ATOM   2390 C  CB    . ALA D  1 12  ? 112.996 -6.425  197.994 1.00 46.39  ? 12   ALA D CB    1 
ATOM   2391 N  N     . TYR D  1 13  ? 111.517 -6.828  200.785 1.00 42.42  ? 13   TYR D N     1 
ATOM   2392 C  CA    . TYR D  1 13  ? 110.427 -6.709  201.755 1.00 48.31  ? 13   TYR D CA    1 
ATOM   2393 C  C     . TYR D  1 13  ? 110.815 -5.776  202.923 1.00 41.66  ? 13   TYR D C     1 
ATOM   2394 O  O     . TYR D  1 13  ? 110.122 -4.810  203.208 1.00 41.01  ? 13   TYR D O     1 
ATOM   2395 C  CB    . TYR D  1 13  ? 110.036 -8.086  202.294 1.00 47.76  ? 13   TYR D CB    1 
ATOM   2396 C  CG    . TYR D  1 13  ? 108.833 -8.074  203.210 1.00 50.14  ? 13   TYR D CG    1 
ATOM   2397 C  CD1   . TYR D  1 13  ? 107.551 -7.856  202.704 1.00 48.21  ? 13   TYR D CD1   1 
ATOM   2398 C  CD2   . TYR D  1 13  ? 108.969 -8.297  204.582 1.00 50.61  ? 13   TYR D CD2   1 
ATOM   2399 C  CE1   . TYR D  1 13  ? 106.446 -7.861  203.529 1.00 51.74  ? 13   TYR D CE1   1 
ATOM   2400 C  CE2   . TYR D  1 13  ? 107.859 -8.306  205.422 1.00 47.74  ? 13   TYR D CE2   1 
ATOM   2401 C  CZ    . TYR D  1 13  ? 106.608 -8.087  204.887 1.00 51.62  ? 13   TYR D CZ    1 
ATOM   2402 O  OH    . TYR D  1 13  ? 105.508 -8.083  205.701 1.00 56.66  ? 13   TYR D OH    1 
ATOM   2403 N  N     . LEU D  1 14  ? 111.943 -6.042  203.563 1.00 41.22  ? 14   LEU D N     1 
ATOM   2404 C  CA    . LEU D  1 14  ? 112.368 -5.210  204.679 1.00 41.34  ? 14   LEU D CA    1 
ATOM   2405 C  C     . LEU D  1 14  ? 112.593 -3.764  204.250 1.00 46.00  ? 14   LEU D C     1 
ATOM   2406 O  O     . LEU D  1 14  ? 112.310 -2.831  205.017 1.00 39.49  ? 14   LEU D O     1 
ATOM   2407 C  CB    . LEU D  1 14  ? 113.638 -5.767  205.316 1.00 40.03  ? 14   LEU D CB    1 
ATOM   2408 C  CG    . LEU D  1 14  ? 113.474 -7.122  206.007 1.00 46.85  ? 14   LEU D CG    1 
ATOM   2409 C  CD1   . LEU D  1 14  ? 114.837 -7.655  206.505 1.00 44.51  ? 14   LEU D CD1   1 
ATOM   2410 C  CD2   . LEU D  1 14  ? 112.455 -7.035  207.153 1.00 43.45  ? 14   LEU D CD2   1 
ATOM   2411 N  N     . LEU D  1 15  ? 113.095 -3.577  203.026 1.00 41.78  ? 15   LEU D N     1 
ATOM   2412 C  CA    . LEU D  1 15  ? 113.340 -2.230  202.526 1.00 41.13  ? 15   LEU D CA    1 
ATOM   2413 C  C     . LEU D  1 15  ? 112.009 -1.481  202.431 1.00 40.27  ? 15   LEU D C     1 
ATOM   2414 O  O     . LEU D  1 15  ? 111.944 -0.306  202.776 1.00 39.88  ? 15   LEU D O     1 
ATOM   2415 C  CB    . LEU D  1 15  ? 114.057 -2.257  201.166 1.00 40.24  ? 15   LEU D CB    1 
ATOM   2416 C  CG    . LEU D  1 15  ? 114.666 -0.942  200.681 1.00 36.53  ? 15   LEU D CG    1 
ATOM   2417 C  CD1   . LEU D  1 15  ? 115.658 -0.423  201.686 1.00 34.00  ? 15   LEU D CD1   1 
ATOM   2418 C  CD2   . LEU D  1 15  ? 115.333 -1.089  199.272 1.00 34.99  ? 15   LEU D CD2   1 
ATOM   2419 N  N     . GLY D  1 16  ? 110.958 -2.172  201.988 1.00 34.02  ? 16   GLY D N     1 
ATOM   2420 C  CA    . GLY D  1 16  ? 109.632 -1.594  201.930 1.00 38.11  ? 16   GLY D CA    1 
ATOM   2421 C  C     . GLY D  1 16  ? 109.154 -1.130  203.308 1.00 43.02  ? 16   GLY D C     1 
ATOM   2422 O  O     . GLY D  1 16  ? 108.626 -0.026  203.449 1.00 40.82  ? 16   GLY D O     1 
ATOM   2423 N  N     . LEU D  1 17  ? 109.362 -1.958  204.330 1.00 38.43  ? 17   LEU D N     1 
ATOM   2424 C  CA    . LEU D  1 17  ? 108.993 -1.589  205.701 1.00 40.01  ? 17   LEU D CA    1 
ATOM   2425 C  C     . LEU D  1 17  ? 109.864 -0.442  206.220 1.00 39.64  ? 17   LEU D C     1 
ATOM   2426 O  O     . LEU D  1 17  ? 109.364 0.471   206.876 1.00 39.18  ? 17   LEU D O     1 
ATOM   2427 C  CB    . LEU D  1 17  ? 109.108 -2.793  206.640 1.00 33.88  ? 17   LEU D CB    1 
ATOM   2428 C  CG    . LEU D  1 17  ? 108.200 -3.988  206.352 1.00 39.29  ? 17   LEU D CG    1 
ATOM   2429 C  CD1   . LEU D  1 17  ? 108.594 -5.143  207.231 1.00 45.08  ? 17   LEU D CD1   1 
ATOM   2430 C  CD2   . LEU D  1 17  ? 106.719 -3.655  206.531 1.00 37.27  ? 17   LEU D CD2   1 
ATOM   2431 N  N     . ILE D  1 18  ? 111.162 -0.495  205.916 1.00 37.08  ? 18   ILE D N     1 
ATOM   2432 C  CA    . ILE D  1 18  ? 112.103 0.508   206.384 1.00 36.03  ? 18   ILE D CA    1 
ATOM   2433 C  C     . ILE D  1 18  ? 111.768 1.858   205.798 1.00 37.44  ? 18   ILE D C     1 
ATOM   2434 O  O     . ILE D  1 18  ? 111.649 2.853   206.509 1.00 36.75  ? 18   ILE D O     1 
ATOM   2435 C  CB    . ILE D  1 18  ? 113.562 0.135   206.020 1.00 39.91  ? 18   ILE D CB    1 
ATOM   2436 C  CG1   . ILE D  1 18  ? 114.016 -1.060  206.857 1.00 38.12  ? 18   ILE D CG1   1 
ATOM   2437 C  CG2   . ILE D  1 18  ? 114.508 1.339   206.211 1.00 32.64  ? 18   ILE D CG2   1 
ATOM   2438 C  CD1   . ILE D  1 18  ? 115.236 -1.762  206.335 1.00 39.34  ? 18   ILE D CD1   1 
ATOM   2439 N  N     . ILE D  1 19  ? 111.607 1.884   204.480 1.00 38.85  ? 19   ILE D N     1 
ATOM   2440 C  CA    . ILE D  1 19  ? 111.306 3.115   203.788 1.00 36.23  ? 19   ILE D CA    1 
ATOM   2441 C  C     . ILE D  1 19  ? 109.931 3.639   204.199 1.00 40.13  ? 19   ILE D C     1 
ATOM   2442 O  O     . ILE D  1 19  ? 109.738 4.836   204.385 1.00 40.40  ? 19   ILE D O     1 
ATOM   2443 C  CB    . ILE D  1 19  ? 111.361 2.914   202.271 1.00 42.95  ? 19   ILE D CB    1 
ATOM   2444 C  CG1   . ILE D  1 19  ? 112.811 2.715   201.855 1.00 41.57  ? 19   ILE D CG1   1 
ATOM   2445 C  CG2   . ILE D  1 19  ? 110.749 4.097   201.562 1.00 39.65  ? 19   ILE D CG2   1 
ATOM   2446 C  CD1   . ILE D  1 19  ? 113.652 3.917   202.089 1.00 46.81  ? 19   ILE D CD1   1 
ATOM   2447 N  N     . GLY D  1 20  ? 108.975 2.736   204.349 1.00 39.65  ? 20   GLY D N     1 
ATOM   2448 C  CA    . GLY D  1 20  ? 107.662 3.127   204.823 1.00 41.59  ? 20   GLY D CA    1 
ATOM   2449 C  C     . GLY D  1 20  ? 107.642 3.606   206.268 1.00 46.13  ? 20   GLY D C     1 
ATOM   2450 O  O     . GLY D  1 20  ? 107.396 4.777   206.531 1.00 47.92  ? 20   GLY D O     1 
ATOM   2451 N  N     . ASP D  1 21  ? 107.917 2.705   207.205 1.00 42.01  ? 21   ASP D N     1 
ATOM   2452 C  CA    . ASP D  1 21  ? 107.662 2.986   208.619 1.00 43.84  ? 21   ASP D CA    1 
ATOM   2453 C  C     . ASP D  1 21  ? 108.899 3.086   209.508 1.00 44.31  ? 21   ASP D C     1 
ATOM   2454 O  O     . ASP D  1 21  ? 108.789 2.988   210.737 1.00 42.16  ? 21   ASP D O     1 
ATOM   2455 C  CB    . ASP D  1 21  ? 106.754 1.915   209.209 1.00 42.55  ? 21   ASP D CB    1 
ATOM   2456 C  CG    . ASP D  1 21  ? 105.313 2.147   208.902 1.00 40.23  ? 21   ASP D CG    1 
ATOM   2457 O  OD1   . ASP D  1 21  ? 104.978 3.226   208.379 1.00 46.45  ? 21   ASP D OD1   1 
ATOM   2458 O  OD2   . ASP D  1 21  ? 104.509 1.257   209.221 1.00 40.78  ? 21   ASP D OD2   1 
ATOM   2459 N  N     . GLY D  1 22  ? 110.068 3.252   208.900 1.00 39.48  ? 22   GLY D N     1 
ATOM   2460 C  CA    . GLY D  1 22  ? 111.284 3.339   209.663 1.00 38.11  ? 22   GLY D CA    1 
ATOM   2461 C  C     . GLY D  1 22  ? 112.231 4.252   208.939 1.00 42.22  ? 22   GLY D C     1 
ATOM   2462 O  O     . GLY D  1 22  ? 111.809 5.286   208.437 1.00 45.72  ? 22   GLY D O     1 
ATOM   2463 N  N     . GLY D  1 23  ? 113.499 3.865   208.857 1.00 39.70  ? 23   GLY D N     1 
ATOM   2464 C  CA    . GLY D  1 23  ? 114.459 4.654   208.114 1.00 41.15  ? 23   GLY D CA    1 
ATOM   2465 C  C     . GLY D  1 23  ? 115.885 4.160   208.255 1.00 44.06  ? 23   GLY D C     1 
ATOM   2466 O  O     . GLY D  1 23  ? 116.179 3.175   208.952 1.00 40.34  ? 23   GLY D O     1 
ATOM   2467 N  N     . LEU D  1 24  ? 116.783 4.864   207.589 1.00 42.15  ? 24   LEU D N     1 
ATOM   2468 C  CA    . LEU D  1 24  ? 118.187 4.521   207.620 1.00 41.82  ? 24   LEU D CA    1 
ATOM   2469 C  C     . LEU D  1 24  ? 118.941 5.727   208.118 1.00 42.84  ? 24   LEU D C     1 
ATOM   2470 O  O     . LEU D  1 24  ? 118.958 6.763   207.462 1.00 43.48  ? 24   LEU D O     1 
ATOM   2471 C  CB    . LEU D  1 24  ? 118.683 4.105   206.236 1.00 38.69  ? 24   LEU D CB    1 
ATOM   2472 C  CG    . LEU D  1 24  ? 117.909 2.976   205.564 1.00 39.97  ? 24   LEU D CG    1 
ATOM   2473 C  CD1   . LEU D  1 24  ? 118.262 2.901   204.072 1.00 38.23  ? 24   LEU D CD1   1 
ATOM   2474 C  CD2   . LEU D  1 24  ? 118.189 1.641   206.261 1.00 31.01  ? 24   LEU D CD2   1 
ATOM   2475 N  N     . TYR D  1 25  ? 119.578 5.598   209.272 1.00 38.43  ? 25   TYR D N     1 
ATOM   2476 C  CA    . TYR D  1 25  ? 120.140 6.777   209.897 1.00 44.98  ? 25   TYR D CA    1 
ATOM   2477 C  C     . TYR D  1 25  ? 121.634 6.686   210.083 1.00 40.66  ? 25   TYR D C     1 
ATOM   2478 O  O     . TYR D  1 25  ? 122.162 5.703   210.594 1.00 41.13  ? 25   TYR D O     1 
ATOM   2479 C  CB    . TYR D  1 25  ? 119.450 7.033   211.243 1.00 41.66  ? 25   TYR D CB    1 
ATOM   2480 C  CG    . TYR D  1 25  ? 117.947 7.058   211.091 1.00 43.91  ? 25   TYR D CG    1 
ATOM   2481 C  CD1   . TYR D  1 25  ? 117.321 8.091   210.401 1.00 37.06  ? 25   TYR D CD1   1 
ATOM   2482 C  CD2   . TYR D  1 25  ? 117.154 6.037   211.615 1.00 42.02  ? 25   TYR D CD2   1 
ATOM   2483 C  CE1   . TYR D  1 25  ? 115.941 8.122   210.246 1.00 39.40  ? 25   TYR D CE1   1 
ATOM   2484 C  CE2   . TYR D  1 25  ? 115.770 6.059   211.471 1.00 41.79  ? 25   TYR D CE2   1 
ATOM   2485 C  CZ    . TYR D  1 25  ? 115.172 7.103   210.789 1.00 44.19  ? 25   TYR D CZ    1 
ATOM   2486 O  OH    . TYR D  1 25  ? 113.811 7.124   210.633 1.00 44.35  ? 25   TYR D OH    1 
ATOM   2487 N  N     . LYS D  1 26  ? 122.300 7.743   209.653 1.00 40.91  ? 26   LYS D N     1 
ATOM   2488 C  CA    . LYS D  1 26  ? 123.725 7.898   209.856 1.00 45.76  ? 26   LYS D CA    1 
ATOM   2489 C  C     . LYS D  1 26  ? 123.914 8.997   210.889 1.00 45.99  ? 26   LYS D C     1 
ATOM   2490 O  O     . LYS D  1 26  ? 123.629 10.163  210.621 1.00 47.21  ? 26   LYS D O     1 
ATOM   2491 C  CB    . LYS D  1 26  ? 124.431 8.221   208.535 1.00 42.94  ? 26   LYS D CB    1 
ATOM   2492 C  CG    . LYS D  1 26  ? 125.867 8.696   208.680 1.00 48.14  ? 26   LYS D CG    1 
ATOM   2493 C  CD    . LYS D  1 26  ? 126.611 8.553   207.337 1.00 50.38  ? 26   LYS D CD    1 
ATOM   2494 C  CE    . LYS D  1 26  ? 127.890 9.398   207.276 1.00 60.44  ? 26   LYS D CE    1 
ATOM   2495 N  NZ    . LYS D  1 26  ? 128.860 9.133   208.378 1.00 60.30  ? 26   LYS D NZ    1 
ATOM   2496 N  N     . LEU D  1 27  ? 124.383 8.619   212.068 1.00 42.63  ? 27   LEU D N     1 
ATOM   2497 C  CA    . LEU D  1 27  ? 124.414 9.545   213.195 1.00 48.53  ? 27   LEU D CA    1 
ATOM   2498 C  C     . LEU D  1 27  ? 125.814 9.947   213.637 1.00 50.05  ? 27   LEU D C     1 
ATOM   2499 O  O     . LEU D  1 27  ? 126.757 9.152   213.606 1.00 49.95  ? 27   LEU D O     1 
ATOM   2500 C  CB    . LEU D  1 27  ? 123.666 8.944   214.382 1.00 44.82  ? 27   LEU D CB    1 
ATOM   2501 C  CG    . LEU D  1 27  ? 122.188 8.644   214.138 1.00 41.31  ? 27   LEU D CG    1 
ATOM   2502 C  CD1   . LEU D  1 27  ? 122.003 7.165   214.139 1.00 42.76  ? 27   LEU D CD1   1 
ATOM   2503 C  CD2   . LEU D  1 27  ? 121.313 9.298   215.210 1.00 39.01  ? 27   LEU D CD2   1 
ATOM   2504 N  N     . LYS D  1 28  ? 125.919 11.204  214.049 1.00 53.72  ? 28   LYS D N     1 
ATOM   2505 C  CA    . LYS D  1 28  ? 127.147 11.769  214.593 1.00 54.44  ? 28   LYS D CA    1 
ATOM   2506 C  C     . LYS D  1 28  ? 126.928 12.168  216.038 1.00 59.97  ? 28   LYS D C     1 
ATOM   2507 O  O     . LYS D  1 28  ? 125.938 12.815  216.383 1.00 56.62  ? 28   LYS D O     1 
ATOM   2508 C  CB    . LYS D  1 28  ? 127.594 12.974  213.779 1.00 54.91  ? 28   LYS D CB    1 
ATOM   2509 C  CG    . LYS D  1 28  ? 127.847 12.630  212.329 1.00 58.20  ? 28   LYS D CG    1 
ATOM   2510 C  CD    . LYS D  1 28  ? 128.723 11.385  212.232 1.00 64.99  ? 28   LYS D CD    1 
ATOM   2511 C  CE    . LYS D  1 28  ? 129.215 11.132  210.814 1.00 70.76  ? 28   LYS D CE    1 
ATOM   2512 N  NZ    . LYS D  1 28  ? 130.270 10.069  210.781 1.00 73.77  ? 28   LYS D NZ    1 
ATOM   2513 N  N     . TYR D  1 29  ? 127.850 11.754  216.891 0.98 58.36  ? 29   TYR D N     1 
ATOM   2514 C  CA    . TYR D  1 29  ? 127.727 12.035  218.294 0.98 55.32  ? 29   TYR D CA    1 
ATOM   2515 C  C     . TYR D  1 29  ? 128.913 12.855  218.759 0.98 64.09  ? 29   TYR D C     1 
ATOM   2516 O  O     . TYR D  1 29  ? 129.886 13.030  218.018 0.98 66.84  ? 29   TYR D O     1 
ATOM   2517 C  CB    . TYR D  1 29  ? 127.652 10.739  219.099 0.98 56.10  ? 29   TYR D CB    1 
ATOM   2518 C  CG    . TYR D  1 29  ? 126.475 9.842   218.791 0.98 52.85  ? 29   TYR D CG    1 
ATOM   2519 C  CD1   . TYR D  1 29  ? 125.273 10.349  218.330 1.00 53.36  ? 29   TYR D CD1   1 
ATOM   2520 C  CD2   . TYR D  1 29  ? 126.572 8.476   218.976 1.00 53.86  ? 29   TYR D CD2   1 
ATOM   2521 C  CE1   . TYR D  1 29  ? 124.205 9.513   218.064 1.00 48.36  ? 29   TYR D CE1   1 
ATOM   2522 C  CE2   . TYR D  1 29  ? 125.512 7.637   218.712 1.00 50.82  ? 29   TYR D CE2   1 
ATOM   2523 C  CZ    . TYR D  1 29  ? 124.333 8.156   218.256 0.98 48.45  ? 29   TYR D CZ    1 
ATOM   2524 O  OH    . TYR D  1 29  ? 123.291 7.292   217.997 0.98 45.36  ? 29   TYR D OH    1 
ATOM   2525 N  N     . LYS D  1 30  ? 128.809 13.379  219.978 1.00 68.79  ? 30   LYS D N     1 
ATOM   2526 C  CA    . LYS D  1 30  ? 129.991 13.686  220.769 1.00 72.02  ? 30   LYS D CA    1 
ATOM   2527 C  C     . LYS D  1 30  ? 130.655 12.335  220.992 1.00 70.02  ? 30   LYS D C     1 
ATOM   2528 O  O     . LYS D  1 30  ? 130.040 11.458  221.616 1.00 72.06  ? 30   LYS D O     1 
ATOM   2529 C  CB    . LYS D  1 30  ? 129.631 14.340  222.119 1.00 72.35  ? 30   LYS D CB    1 
ATOM   2530 C  CG    . LYS D  1 30  ? 128.561 15.433  222.053 1.00 81.18  ? 30   LYS D CG    1 
ATOM   2531 C  CD    . LYS D  1 30  ? 128.202 16.009  223.437 1.00 80.32  ? 30   LYS D CD    1 
ATOM   2532 C  CE    . LYS D  1 30  ? 127.451 15.005  224.309 1.00 78.59  ? 30   LYS D CE    1 
ATOM   2533 N  NZ    . LYS D  1 30  ? 126.760 15.626  225.484 1.00 75.15  ? 30   LYS D NZ    1 
ATOM   2534 N  N     . GLY D  1 31  ? 131.859 12.112  220.472 1.00 68.98  ? 31   GLY D N     1 
ATOM   2535 C  CA    . GLY D  1 31  ? 132.596 13.017  219.609 1.00 69.29  ? 31   GLY D CA    1 
ATOM   2536 C  C     . GLY D  1 31  ? 133.970 12.373  219.508 1.00 62.33  ? 31   GLY D C     1 
ATOM   2537 O  O     . GLY D  1 31  ? 134.503 11.957  220.526 1.00 69.45  ? 31   GLY D O     1 
ATOM   2538 N  N     . ASN D  1 32  ? 134.500 12.157  218.310 1.00 69.23  ? 32   ASN D N     1 
ATOM   2539 C  CA    . ASN D  1 32  ? 133.733 12.109  217.080 1.00 61.49  ? 32   ASN D CA    1 
ATOM   2540 C  C     . ASN D  1 32  ? 133.099 10.730  216.962 1.00 58.11  ? 32   ASN D C     1 
ATOM   2541 O  O     . ASN D  1 32  ? 133.433 9.978   216.052 1.00 60.98  ? 32   ASN D O     1 
ATOM   2542 C  CB    . ASN D  1 32  ? 134.616 12.344  215.838 1.00 68.03  ? 32   ASN D CB    1 
ATOM   2543 C  CG    . ASN D  1 32  ? 135.487 13.587  215.925 1.00 70.70  ? 32   ASN D CG    1 
ATOM   2544 O  OD1   . ASN D  1 32  ? 136.176 13.819  216.915 1.00 75.29  ? 32   ASN D OD1   1 
ATOM   2545 N  ND2   . ASN D  1 32  ? 135.475 14.386  214.858 1.00 75.00  ? 32   ASN D ND2   1 
ATOM   2546 N  N     . ARG D  1 33  ? 132.221 10.363  217.886 1.00 58.80  ? 33   ARG D N     1 
ATOM   2547 C  CA    . ARG D  1 33  ? 131.608 9.042   217.811 1.00 55.55  ? 33   ARG D CA    1 
ATOM   2548 C  C     . ARG D  1 33  ? 130.538 9.006   216.706 1.00 54.26  ? 33   ARG D C     1 
ATOM   2549 O  O     . ARG D  1 33  ? 130.119 10.046  216.211 1.00 55.81  ? 33   ARG D O     1 
ATOM   2550 C  CB    . ARG D  1 33  ? 131.014 8.654   219.160 1.00 56.14  ? 33   ARG D CB    1 
ATOM   2551 C  CG    . ARG D  1 33  ? 132.019 8.628   220.292 1.00 52.35  ? 33   ARG D CG    1 
ATOM   2552 C  CD    . ARG D  1 33  ? 131.348 8.305   221.641 1.00 56.03  ? 33   ARG D CD    1 
ATOM   2553 N  NE    . ARG D  1 33  ? 130.220 9.183   221.936 1.00 54.15  ? 33   ARG D NE    1 
ATOM   2554 C  CZ    . ARG D  1 33  ? 128.986 8.759   222.170 1.00 56.59  ? 33   ARG D CZ    1 
ATOM   2555 N  NH1   . ARG D  1 33  ? 128.715 7.465   222.159 1.00 53.19  ? 33   ARG D NH1   1 
ATOM   2556 N  NH2   . ARG D  1 33  ? 128.024 9.628   222.429 1.00 62.93  ? 33   ARG D NH2   1 
ATOM   2557 N  N     . SER D  1 34  ? 130.110 7.817   216.299 1.00 46.77  ? 34   SER D N     1 
ATOM   2558 C  CA    . SER D  1 34  ? 129.086 7.735   215.269 1.00 46.46  ? 34   SER D CA    1 
ATOM   2559 C  C     . SER D  1 34  ? 128.206 6.504   215.440 1.00 45.43  ? 34   SER D C     1 
ATOM   2560 O  O     . SER D  1 34  ? 128.427 5.693   216.342 1.00 43.77  ? 34   SER D O     1 
ATOM   2561 C  CB    . SER D  1 34  ? 129.724 7.727   213.878 1.00 48.11  ? 34   SER D CB    1 
ATOM   2562 O  OG    . SER D  1 34  ? 130.463 6.537   213.657 1.00 42.42  ? 34   SER D OG    1 
ATOM   2563 N  N     . GLU D  1 35  ? 127.203 6.375   214.570 1.00 44.06  ? 35   GLU D N     1 
ATOM   2564 C  CA    . GLU D  1 35  ? 126.330 5.205   214.585 1.00 42.59  ? 35   GLU D CA    1 
ATOM   2565 C  C     . GLU D  1 35  ? 125.549 5.121   213.283 1.00 43.29  ? 35   GLU D C     1 
ATOM   2566 O  O     . GLU D  1 35  ? 125.236 6.144   212.676 1.00 40.97  ? 35   GLU D O     1 
ATOM   2567 C  CB    . GLU D  1 35  ? 125.361 5.240   215.792 1.00 44.61  ? 35   GLU D CB    1 
ATOM   2568 C  CG    . GLU D  1 35  ? 124.767 3.873   216.119 1.00 40.91  ? 35   GLU D CG    1 
ATOM   2569 C  CD    . GLU D  1 35  ? 123.737 3.906   217.251 1.00 49.93  ? 35   GLU D CD    1 
ATOM   2570 O  OE1   . GLU D  1 35  ? 123.587 4.961   217.916 1.00 45.68  ? 35   GLU D OE1   1 
ATOM   2571 O  OE2   . GLU D  1 35  ? 123.078 2.862   217.475 1.00 44.49  ? 35   GLU D OE2   1 
ATOM   2572 N  N     . TYR D  1 36  ? 125.246 3.894   212.861 1.00 40.16  ? 36   TYR D N     1 
ATOM   2573 C  CA    . TYR D  1 36  ? 124.485 3.649   211.644 1.00 38.77  ? 36   TYR D CA    1 
ATOM   2574 C  C     . TYR D  1 36  ? 123.333 2.732   212.018 1.00 41.79  ? 36   TYR D C     1 
ATOM   2575 O  O     . TYR D  1 36  ? 123.538 1.623   212.537 1.00 40.34  ? 36   TYR D O     1 
ATOM   2576 C  CB    . TYR D  1 36  ? 125.354 3.015   210.535 1.00 38.96  ? 36   TYR D CB    1 
ATOM   2577 C  CG    . TYR D  1 36  ? 126.642 3.753   210.244 1.00 38.04  ? 36   TYR D CG    1 
ATOM   2578 C  CD1   . TYR D  1 36  ? 127.729 3.645   211.103 1.00 38.52  ? 36   TYR D CD1   1 
ATOM   2579 C  CD2   . TYR D  1 36  ? 126.775 4.561   209.110 1.00 41.97  ? 36   TYR D CD2   1 
ATOM   2580 C  CE1   . TYR D  1 36  ? 128.894 4.313   210.866 1.00 41.62  ? 36   TYR D CE1   1 
ATOM   2581 C  CE2   . TYR D  1 36  ? 127.946 5.232   208.854 1.00 40.52  ? 36   TYR D CE2   1 
ATOM   2582 C  CZ    . TYR D  1 36  ? 129.007 5.099   209.741 1.00 45.40  ? 36   TYR D CZ    1 
ATOM   2583 O  OH    . TYR D  1 36  ? 130.182 5.763   209.521 1.00 42.93  ? 36   TYR D OH    1 
ATOM   2584 N  N     . ARG D  1 37  ? 122.118 3.199   211.757 1.00 36.47  ? 37   ARG D N     1 
ATOM   2585 C  CA    . ARG D  1 37  ? 120.937 2.471   212.179 1.00 38.11  ? 37   ARG D CA    1 
ATOM   2586 C  C     . ARG D  1 37  ? 120.033 2.105   211.031 1.00 39.70  ? 37   ARG D C     1 
ATOM   2587 O  O     . ARG D  1 37  ? 119.804 2.896   210.111 1.00 37.99  ? 37   ARG D O     1 
ATOM   2588 C  CB    . ARG D  1 37  ? 120.146 3.287   213.204 1.00 38.57  ? 37   ARG D CB    1 
ATOM   2589 C  CG    . ARG D  1 37  ? 120.871 3.463   214.525 1.00 41.00  ? 37   ARG D CG    1 
ATOM   2590 C  CD    . ARG D  1 37  ? 119.946 4.025   215.584 1.00 45.44  ? 37   ARG D CD    1 
ATOM   2591 N  NE    . ARG D  1 37  ? 120.591 4.154   216.890 1.00 44.73  ? 37   ARG D NE    1 
ATOM   2592 C  CZ    . ARG D  1 37  ? 120.074 4.828   217.919 1.00 47.28  ? 37   ARG D CZ    1 
ATOM   2593 N  NH1   . ARG D  1 37  ? 118.889 5.430   217.811 1.00 44.52  ? 37   ARG D NH1   1 
ATOM   2594 N  NH2   . ARG D  1 37  ? 120.737 4.886   219.061 1.00 46.43  ? 37   ARG D NH2   1 
ATOM   2595 N  N     . VAL D  1 38  ? 119.533 0.880   211.114 1.00 39.76  ? 38   VAL D N     1 
ATOM   2596 C  CA    . VAL D  1 38  ? 118.481 0.373   210.262 1.00 37.04  ? 38   VAL D CA    1 
ATOM   2597 C  C     . VAL D  1 38  ? 117.240 0.245   211.147 1.00 38.36  ? 38   VAL D C     1 
ATOM   2598 O  O     . VAL D  1 38  ? 117.270 -0.499  212.111 1.00 41.52  ? 38   VAL D O     1 
ATOM   2599 C  CB    . VAL D  1 38  ? 118.871 -0.988  209.637 1.00 40.26  ? 38   VAL D CB    1 
ATOM   2600 C  CG1   . VAL D  1 38  ? 117.730 -1.564  208.848 1.00 36.28  ? 38   VAL D CG1   1 
ATOM   2601 C  CG2   . VAL D  1 38  ? 120.128 -0.837  208.739 1.00 35.80  ? 38   VAL D CG2   1 
ATOM   2602 N  N     . VAL D  1 39  ? 116.169 0.979   210.838 1.00 38.72  ? 39   VAL D N     1 
ATOM   2603 C  CA    . VAL D  1 39  ? 114.999 1.051   211.721 1.00 39.74  ? 39   VAL D CA    1 
ATOM   2604 C  C     . VAL D  1 39  ? 113.665 0.742   211.037 1.00 37.17  ? 39   VAL D C     1 
ATOM   2605 O  O     . VAL D  1 39  ? 113.420 1.167   209.926 1.00 40.58  ? 39   VAL D O     1 
ATOM   2606 C  CB    . VAL D  1 39  ? 114.904 2.455   212.379 1.00 40.29  ? 39   VAL D CB    1 
ATOM   2607 C  CG1   . VAL D  1 39  ? 113.527 2.686   213.016 1.00 41.10  ? 39   VAL D CG1   1 
ATOM   2608 C  CG2   . VAL D  1 39  ? 116.007 2.631   213.393 1.00 34.97  ? 39   VAL D CG2   1 
ATOM   2609 N  N     . ILE D  1 40  ? 112.830 -0.032  211.716 1.00 36.49  ? 40   ILE D N     1 
ATOM   2610 C  CA    . ILE D  1 40  ? 111.413 -0.196  211.384 1.00 39.07  ? 40   ILE D CA    1 
ATOM   2611 C  C     . ILE D  1 40  ? 110.566 0.070   212.656 1.00 44.69  ? 40   ILE D C     1 
ATOM   2612 O  O     . ILE D  1 40  ? 110.767 -0.583  213.669 1.00 39.90  ? 40   ILE D O     1 
ATOM   2613 C  CB    . ILE D  1 40  ? 111.121 -1.616  210.843 1.00 41.02  ? 40   ILE D CB    1 
ATOM   2614 C  CG1   . ILE D  1 40  ? 112.000 -1.906  209.613 1.00 39.82  ? 40   ILE D CG1   1 
ATOM   2615 C  CG2   . ILE D  1 40  ? 109.623 -1.822  210.567 1.00 32.65  ? 40   ILE D CG2   1 
ATOM   2616 C  CD1   . ILE D  1 40  ? 111.900 -3.307  209.082 1.00 33.73  ? 40   ILE D CD1   1 
ATOM   2617 N  N     . THR D  1 41  ? 109.654 1.037   212.633 1.00 40.98  ? 41   THR D N     1 
ATOM   2618 C  CA    . THR D  1 41  ? 108.768 1.210   213.784 1.00 40.15  ? 41   THR D CA    1 
ATOM   2619 C  C     . THR D  1 41  ? 107.389 0.638   213.503 1.00 46.25  ? 41   THR D C     1 
ATOM   2620 O  O     . THR D  1 41  ? 106.988 0.496   212.336 1.00 44.64  ? 41   THR D O     1 
ATOM   2621 C  CB    . THR D  1 41  ? 108.591 2.673   214.199 1.00 40.31  ? 41   THR D CB    1 
ATOM   2622 O  OG1   . THR D  1 41  ? 107.905 3.384   213.172 1.00 41.52  ? 41   THR D OG1   1 
ATOM   2623 C  CG2   . THR D  1 41  ? 109.923 3.342   214.500 1.00 35.49  ? 41   THR D CG2   1 
ATOM   2624 N  N     . GLN D  1 42  ? 106.665 0.321   214.580 1.00 42.55  ? 42   GLN D N     1 
ATOM   2625 C  CA    . GLN D  1 42  ? 105.340 -0.299  214.499 1.00 44.80  ? 42   GLN D CA    1 
ATOM   2626 C  C     . GLN D  1 42  ? 104.684 -0.351  215.896 1.00 46.92  ? 42   GLN D C     1 
ATOM   2627 O  O     . GLN D  1 42  ? 105.366 -0.576  216.908 1.00 41.45  ? 42   GLN D O     1 
ATOM   2628 C  CB    . GLN D  1 42  ? 105.443 -1.708  213.891 1.00 40.08  ? 42   GLN D CB    1 
ATOM   2629 C  CG    . GLN D  1 42  ? 104.164 -2.261  213.265 1.00 46.98  ? 42   GLN D CG    1 
ATOM   2630 C  CD    . GLN D  1 42  ? 103.843 -1.712  211.854 1.00 48.67  ? 42   GLN D CD    1 
ATOM   2631 O  OE1   . GLN D  1 42  ? 102.769 -1.989  211.310 1.00 48.67  ? 42   GLN D OE1   1 
ATOM   2632 N  NE2   . GLN D  1 42  ? 104.752 -0.911  211.285 1.00 45.67  ? 42   GLN D NE2   1 
ATOM   2633 N  N     . LYS D  1 43  ? 103.368 -0.145  215.948 1.00 48.65  ? 43   LYS D N     1 
ATOM   2634 C  CA    . LYS D  1 43  ? 102.669 -0.156  217.221 1.00 48.06  ? 43   LYS D CA    1 
ATOM   2635 C  C     . LYS D  1 43  ? 102.545 -1.585  217.766 1.00 46.87  ? 43   LYS D C     1 
ATOM   2636 O  O     . LYS D  1 43  ? 102.837 -1.828  218.931 1.00 50.25  ? 43   LYS D O     1 
ATOM   2637 C  CB    . LYS D  1 43  ? 101.294 0.491   217.097 1.00 50.59  ? 43   LYS D CB    1 
ATOM   2638 C  CG    . LYS D  1 43  ? 100.617 0.732   218.466 1.00 55.14  ? 43   LYS D CG    1 
ATOM   2639 C  CD    . LYS D  1 43  ? 99.139  1.013   218.299 1.00 62.93  ? 43   LYS D CD    1 
ATOM   2640 C  CE    . LYS D  1 43  ? 98.379  0.884   219.610 1.00 60.41  ? 43   LYS D CE    1 
ATOM   2641 N  NZ    . LYS D  1 43  ? 96.948  0.596   219.306 1.00 60.70  ? 43   LYS D NZ    1 
ATOM   2642 N  N     . SER D  1 44  ? 102.177 -2.532  216.908 1.00 50.22  ? 44   SER D N     1 
ATOM   2643 C  CA    . SER D  1 44  ? 101.989 -3.919  217.332 1.00 44.59  ? 44   SER D CA    1 
ATOM   2644 C  C     . SER D  1 44  ? 103.289 -4.602  217.734 1.00 55.59  ? 44   SER D C     1 
ATOM   2645 O  O     . SER D  1 44  ? 104.224 -4.717  216.923 1.00 55.78  ? 44   SER D O     1 
ATOM   2646 C  CB    . SER D  1 44  ? 101.316 -4.723  216.224 1.00 48.34  ? 44   SER D CB    1 
ATOM   2647 O  OG    . SER D  1 44  ? 101.541 -6.107  216.425 1.00 58.48  ? 44   SER D OG    1 
ATOM   2648 N  N     . GLU D  1 45  ? 103.344 -5.047  218.988 1.00 59.71  ? 45   GLU D N     1 
ATOM   2649 C  CA    . GLU D  1 45  ? 104.466 -5.824  219.507 1.00 58.76  ? 45   GLU D CA    1 
ATOM   2650 C  C     . GLU D  1 45  ? 104.624 -7.148  218.770 1.00 58.71  ? 45   GLU D C     1 
ATOM   2651 O  O     . GLU D  1 45  ? 105.733 -7.582  218.488 1.00 55.33  ? 45   GLU D O     1 
ATOM   2652 C  CB    . GLU D  1 45  ? 104.284 -6.096  221.004 1.00 65.30  ? 45   GLU D CB    1 
ATOM   2653 C  CG    . GLU D  1 45  ? 105.524 -6.672  221.687 1.00 70.01  ? 45   GLU D CG    1 
ATOM   2654 C  CD    . GLU D  1 45  ? 105.307 -6.994  223.160 1.00 74.33  ? 45   GLU D CD    1 
ATOM   2655 O  OE1   . GLU D  1 45  ? 104.147 -7.244  223.546 1.00 74.55  ? 45   GLU D OE1   1 
ATOM   2656 O  OE2   . GLU D  1 45  ? 106.297 -6.984  223.929 1.00 69.83  ? 45   GLU D OE2   1 
ATOM   2657 N  N     . ASN D  1 46  ? 103.502 -7.790  218.476 1.00 60.71  ? 46   ASN D N     1 
ATOM   2658 C  CA    . ASN D  1 46  ? 103.523 -9.059  217.767 1.00 63.24  ? 46   ASN D CA    1 
ATOM   2659 C  C     . ASN D  1 46  ? 104.156 -8.943  216.384 1.00 61.27  ? 46   ASN D C     1 
ATOM   2660 O  O     . ASN D  1 46  ? 105.072 -9.699  216.056 1.00 63.15  ? 46   ASN D O     1 
ATOM   2661 C  CB    . ASN D  1 46  ? 102.106 -9.632  217.638 1.00 64.40  ? 46   ASN D CB    1 
ATOM   2662 C  CG    . ASN D  1 46  ? 101.628 -10.318 218.916 1.00 74.71  ? 46   ASN D CG    1 
ATOM   2663 O  OD1   . ASN D  1 46  ? 102.308 -10.291 219.952 1.00 71.39  ? 46   ASN D OD1   1 
ATOM   2664 N  ND2   . ASN D  1 46  ? 100.446 -10.934 218.849 1.00 77.44  ? 46   ASN D ND2   1 
ATOM   2665 N  N     . LEU D  1 47  ? 103.664 -8.011  215.573 1.00 55.84  ? 47   LEU D N     1 
ATOM   2666 C  CA    . LEU D  1 47  ? 104.161 -7.900  214.213 1.00 58.31  ? 47   LEU D CA    1 
ATOM   2667 C  C     . LEU D  1 47  ? 105.684 -7.693  214.240 1.00 53.35  ? 47   LEU D C     1 
ATOM   2668 O  O     . LEU D  1 47  ? 106.424 -8.386  213.553 1.00 53.41  ? 47   LEU D O     1 
ATOM   2669 C  CB    . LEU D  1 47  ? 103.453 -6.765  213.453 1.00 51.18  ? 47   LEU D CB    1 
ATOM   2670 C  CG    . LEU D  1 47  ? 103.748 -6.747  211.948 1.00 58.35  ? 47   LEU D CG    1 
ATOM   2671 C  CD1   . LEU D  1 47  ? 103.051 -7.906  211.234 1.00 60.22  ? 47   LEU D CD1   1 
ATOM   2672 C  CD2   . LEU D  1 47  ? 103.380 -5.411  211.302 1.00 53.50  ? 47   LEU D CD2   1 
ATOM   2673 N  N     . ILE D  1 48  ? 106.154 -6.776  215.070 1.00 51.93  ? 48   ILE D N     1 
ATOM   2674 C  CA    . ILE D  1 48  ? 107.585 -6.541  215.155 1.00 48.25  ? 48   ILE D CA    1 
ATOM   2675 C  C     . ILE D  1 48  ? 108.364 -7.744  215.700 1.00 53.65  ? 48   ILE D C     1 
ATOM   2676 O  O     . ILE D  1 48  ? 109.421 -8.075  215.160 1.00 52.12  ? 48   ILE D O     1 
ATOM   2677 C  CB    . ILE D  1 48  ? 107.892 -5.282  216.001 1.00 50.46  ? 48   ILE D CB    1 
ATOM   2678 C  CG1   . ILE D  1 48  ? 108.121 -4.088  215.070 1.00 50.90  ? 48   ILE D CG1   1 
ATOM   2679 C  CG2   . ILE D  1 48  ? 109.114 -5.490  216.882 1.00 55.08  ? 48   ILE D CG2   1 
ATOM   2680 C  CD1   . ILE D  1 48  ? 108.302 -2.784  215.792 1.00 51.46  ? 48   ILE D CD1   1 
ATOM   2681 N  N     . LYS D  1 49  ? 107.850 -8.425  216.724 1.00 47.53  ? 49   LYS D N     1 
ATOM   2682 C  CA    . LYS D  1 49  ? 108.622 -9.508  217.323 1.00 50.59  ? 49   LYS D CA    1 
ATOM   2683 C  C     . LYS D  1 49  ? 108.458 -10.831 216.583 1.00 51.12  ? 49   LYS D C     1 
ATOM   2684 O  O     . LYS D  1 49  ? 109.390 -11.632 216.517 1.00 48.10  ? 49   LYS D O     1 
ATOM   2685 C  CB    . LYS D  1 49  ? 108.255 -9.696  218.801 1.00 52.83  ? 49   LYS D CB    1 
ATOM   2686 C  CG    . LYS D  1 49  ? 108.936 -8.716  219.733 1.00 54.90  ? 49   LYS D CG    1 
ATOM   2687 C  CD    . LYS D  1 49  ? 108.595 -8.984  221.205 1.00 63.05  ? 49   LYS D CD    1 
ATOM   2688 C  CE    . LYS D  1 49  ? 109.179 -7.900  222.122 1.00 63.95  ? 49   LYS D CE    1 
ATOM   2689 N  NZ    . LYS D  1 49  ? 108.950 -8.155  223.575 1.00 68.91  ? 49   LYS D NZ    1 
ATOM   2690 N  N     . GLN D  1 50  ? 107.277 -11.061 216.029 1.00 50.59  ? 50   GLN D N     1 
ATOM   2691 C  CA    . GLN D  1 50  ? 106.978 -12.365 215.446 1.00 56.61  ? 50   GLN D CA    1 
ATOM   2692 C  C     . GLN D  1 50  ? 107.087 -12.402 213.925 1.00 56.64  ? 50   GLN D C     1 
ATOM   2693 O  O     . GLN D  1 50  ? 107.445 -13.421 213.343 1.00 58.09  ? 50   GLN D O     1 
ATOM   2694 C  CB    . GLN D  1 50  ? 105.576 -12.823 215.857 1.00 54.63  ? 50   GLN D CB    1 
ATOM   2695 C  CG    . GLN D  1 50  ? 105.326 -12.831 217.355 1.00 54.15  ? 50   GLN D CG    1 
ATOM   2696 C  CD    . GLN D  1 50  ? 103.905 -13.270 217.675 1.00 65.92  ? 50   GLN D CD    1 
ATOM   2697 O  OE1   . GLN D  1 50  ? 103.198 -13.803 216.811 1.00 70.81  ? 50   GLN D OE1   1 
ATOM   2698 N  NE2   . GLN D  1 50  ? 103.473 -13.032 218.903 1.00 63.71  ? 50   GLN D NE2   1 
ATOM   2699 N  N     . HIS D  1 51  ? 106.769 -11.300 213.271 1.00 52.81  ? 51   HIS D N     1 
ATOM   2700 C  CA    . HIS D  1 51  ? 106.822 -11.304 211.824 1.00 54.31  ? 51   HIS D CA    1 
ATOM   2701 C  C     . HIS D  1 51  ? 108.097 -10.638 211.291 1.00 53.97  ? 51   HIS D C     1 
ATOM   2702 O  O     . HIS D  1 51  ? 108.818 -11.218 210.468 1.00 55.66  ? 51   HIS D O     1 
ATOM   2703 C  CB    . HIS D  1 51  ? 105.585 -10.628 211.241 1.00 53.12  ? 51   HIS D CB    1 
ATOM   2704 C  CG    . HIS D  1 51  ? 105.647 -10.465 209.751 1.00 65.51  ? 51   HIS D CG    1 
ATOM   2705 N  ND1   . HIS D  1 51  ? 105.402 -11.505 208.876 1.00 63.54  ? 51   HIS D ND1   1 
ATOM   2706 C  CD2   . HIS D  1 51  ? 105.949 -9.391  208.986 1.00 55.99  ? 51   HIS D CD2   1 
ATOM   2707 C  CE1   . HIS D  1 51  ? 105.542 -11.071 207.637 1.00 65.58  ? 51   HIS D CE1   1 
ATOM   2708 N  NE2   . HIS D  1 51  ? 105.873 -9.794  207.675 1.00 59.18  ? 51   HIS D NE2   1 
ATOM   2709 N  N     . ILE D  1 52  ? 108.395 -9.436  211.770 1.00 47.72  ? 52   ILE D N     1 
ATOM   2710 C  CA    . ILE D  1 52  ? 109.483 -8.672  211.178 1.00 50.49  ? 52   ILE D CA    1 
ATOM   2711 C  C     . ILE D  1 52  ? 110.873 -9.105  211.667 1.00 52.48  ? 52   ILE D C     1 
ATOM   2712 O  O     . ILE D  1 52  ? 111.732 -9.441  210.849 1.00 49.42  ? 52   ILE D O     1 
ATOM   2713 C  CB    . ILE D  1 52  ? 109.289 -7.174  211.426 1.00 51.34  ? 52   ILE D CB    1 
ATOM   2714 C  CG1   . ILE D  1 52  ? 107.998 -6.716  210.748 1.00 50.67  ? 52   ILE D CG1   1 
ATOM   2715 C  CG2   . ILE D  1 52  ? 110.479 -6.379  210.882 1.00 46.13  ? 52   ILE D CG2   1 
ATOM   2716 C  CD1   . ILE D  1 52  ? 107.550 -5.352  211.180 1.00 48.75  ? 52   ILE D CD1   1 
ATOM   2717 N  N     . ALA D  1 53  ? 111.080 -9.110  212.984 1.00 48.58  ? 53   ALA D N     1 
ATOM   2718 C  CA    . ALA D  1 53  ? 112.360 -9.492  213.586 1.00 45.01  ? 53   ALA D CA    1 
ATOM   2719 C  C     . ALA D  1 53  ? 112.915 -10.839 213.097 1.00 49.28  ? 53   ALA D C     1 
ATOM   2720 O  O     . ALA D  1 53  ? 114.125 -10.956 212.877 1.00 45.41  ? 53   ALA D O     1 
ATOM   2721 C  CB    . ALA D  1 53  ? 112.243 -9.506  215.098 1.00 42.44  ? 53   ALA D CB    1 
ATOM   2722 N  N     . PRO D  1 54  ? 112.052 -11.867 212.948 1.00 46.86  ? 54   PRO D N     1 
ATOM   2723 C  CA    . PRO D  1 54  ? 112.633 -13.093 212.388 1.00 46.67  ? 54   PRO D CA    1 
ATOM   2724 C  C     . PRO D  1 54  ? 113.202 -12.917 210.962 1.00 53.53  ? 54   PRO D C     1 
ATOM   2725 O  O     . PRO D  1 54  ? 114.254 -13.484 210.662 1.00 52.77  ? 54   PRO D O     1 
ATOM   2726 C  CB    . PRO D  1 54  ? 111.457 -14.062 212.398 1.00 49.77  ? 54   PRO D CB    1 
ATOM   2727 C  CG    . PRO D  1 54  ? 110.624 -13.609 213.577 1.00 53.98  ? 54   PRO D CG    1 
ATOM   2728 C  CD    . PRO D  1 54  ? 110.720 -12.112 213.539 1.00 50.12  ? 54   PRO D CD    1 
ATOM   2729 N  N     . LEU D  1 55  ? 112.548 -12.127 210.116 1.00 52.25  ? 55   LEU D N     1 
ATOM   2730 C  CA    . LEU D  1 55  ? 113.091 -11.836 208.792 1.00 49.24  ? 55   LEU D CA    1 
ATOM   2731 C  C     . LEU D  1 55  ? 114.410 -11.053 208.871 1.00 49.17  ? 55   LEU D C     1 
ATOM   2732 O  O     . LEU D  1 55  ? 115.371 -11.383 208.173 1.00 49.17  ? 55   LEU D O     1 
ATOM   2733 C  CB    . LEU D  1 55  ? 112.067 -11.074 207.964 1.00 43.59  ? 55   LEU D CB    1 
ATOM   2734 C  CG    . LEU D  1 55  ? 110.771 -11.853 207.745 1.00 49.41  ? 55   LEU D CG    1 
ATOM   2735 C  CD1   . LEU D  1 55  ? 109.747 -11.016 206.992 1.00 48.12  ? 55   LEU D CD1   1 
ATOM   2736 C  CD2   . LEU D  1 55  ? 111.057 -13.144 207.001 1.00 54.02  ? 55   LEU D CD2   1 
ATOM   2737 N  N     . MET D  1 56  ? 114.472 -10.038 209.729 1.00 45.40  ? 56   MET D N     1 
ATOM   2738 C  CA    . MET D  1 56  ? 115.712 -9.278  209.865 1.00 48.14  ? 56   MET D CA    1 
ATOM   2739 C  C     . MET D  1 56  ? 116.848 -10.160 210.394 1.00 53.14  ? 56   MET D C     1 
ATOM   2740 O  O     . MET D  1 56  ? 117.990 -10.060 209.932 1.00 50.18  ? 56   MET D O     1 
ATOM   2741 C  CB    . MET D  1 56  ? 115.534 -8.071  210.782 1.00 41.64  ? 56   MET D CB    1 
ATOM   2742 C  CG    . MET D  1 56  ? 116.748 -7.144  210.818 1.00 43.40  ? 56   MET D CG    1 
ATOM   2743 S  SD    . MET D  1 56  ? 117.018 -6.281  209.228 1.00 46.43  ? 56   MET D SD    1 
ATOM   2744 C  CE    . MET D  1 56  ? 115.683 -5.089  209.274 1.00 39.42  ? 56   MET D CE    1 
ATOM   2745 N  N     . GLN D  1 57  ? 116.529 -11.028 211.354 1.00 52.23  ? 57   GLN D N     1 
ATOM   2746 C  CA    . GLN D  1 57  ? 117.531 -11.926 211.928 1.00 51.47  ? 57   GLN D CA    1 
ATOM   2747 C  C     . GLN D  1 57  ? 118.153 -12.835 210.879 1.00 49.13  ? 57   GLN D C     1 
ATOM   2748 O  O     . GLN D  1 57  ? 119.362 -13.016 210.847 1.00 51.53  ? 57   GLN D O     1 
ATOM   2749 C  CB    . GLN D  1 57  ? 116.925 -12.790 213.039 1.00 49.52  ? 57   GLN D CB    1 
ATOM   2750 C  CG    . GLN D  1 57  ? 117.977 -13.559 213.825 1.00 45.41  ? 57   GLN D CG    1 
ATOM   2751 C  CD    . GLN D  1 57  ? 118.993 -12.645 214.491 1.00 52.54  ? 57   GLN D CD    1 
ATOM   2752 O  OE1   . GLN D  1 57  ? 120.190 -12.686 214.189 1.00 54.79  ? 57   GLN D OE1   1 
ATOM   2753 N  NE2   . GLN D  1 57  ? 118.517 -11.804 215.393 1.00 50.33  ? 57   GLN D NE2   1 
ATOM   2754 N  N     . PHE D  1 58  ? 117.309 -13.428 210.046 1.00 50.55  ? 58   PHE D N     1 
ATOM   2755 C  CA    . PHE D  1 58  ? 117.769 -14.289 208.980 1.00 50.90  ? 58   PHE D CA    1 
ATOM   2756 C  C     . PHE D  1 58  ? 118.755 -13.536 208.091 1.00 55.87  ? 58   PHE D C     1 
ATOM   2757 O  O     . PHE D  1 58  ? 119.856 -14.022 207.821 1.00 57.69  ? 58   PHE D O     1 
ATOM   2758 C  CB    . PHE D  1 58  ? 116.578 -14.788 208.182 1.00 54.26  ? 58   PHE D CB    1 
ATOM   2759 C  CG    . PHE D  1 58  ? 116.947 -15.590 206.968 1.00 65.64  ? 58   PHE D CG    1 
ATOM   2760 C  CD1   . PHE D  1 58  ? 117.584 -16.811 207.094 1.00 66.19  ? 58   PHE D CD1   1 
ATOM   2761 C  CD2   . PHE D  1 58  ? 116.623 -15.136 205.700 1.00 67.70  ? 58   PHE D CD2   1 
ATOM   2762 C  CE1   . PHE D  1 58  ? 117.911 -17.552 205.984 1.00 65.31  ? 58   PHE D CE1   1 
ATOM   2763 C  CE2   . PHE D  1 58  ? 116.946 -15.879 204.580 1.00 71.43  ? 58   PHE D CE2   1 
ATOM   2764 C  CZ    . PHE D  1 58  ? 117.587 -17.088 204.725 1.00 72.09  ? 58   PHE D CZ    1 
ATOM   2765 N  N     . LEU D  1 59  ? 118.365 -12.328 207.685 1.00 53.16  ? 59   LEU D N     1 
ATOM   2766 C  CA    . LEU D  1 59  ? 119.196 -11.475 206.843 1.00 53.92  ? 59   LEU D CA    1 
ATOM   2767 C  C     . LEU D  1 59  ? 120.507 -11.101 207.533 1.00 53.58  ? 59   LEU D C     1 
ATOM   2768 O  O     . LEU D  1 59  ? 121.577 -11.095 206.907 1.00 50.80  ? 59   LEU D O     1 
ATOM   2769 C  CB    . LEU D  1 59  ? 118.433 -10.208 206.438 1.00 50.93  ? 59   LEU D CB    1 
ATOM   2770 C  CG    . LEU D  1 59  ? 119.246 -9.196  205.605 1.00 55.21  ? 59   LEU D CG    1 
ATOM   2771 C  CD1   . LEU D  1 59  ? 119.804 -9.858  204.334 1.00 51.25  ? 59   LEU D CD1   1 
ATOM   2772 C  CD2   . LEU D  1 59  ? 118.415 -7.973  205.250 1.00 49.22  ? 59   LEU D CD2   1 
ATOM   2773 N  N     . ILE D  1 60  ? 120.412 -10.787 208.818 1.00 47.10  ? 60   ILE D N     1 
ATOM   2774 C  CA    A ILE D  1 60  ? 121.580 -10.484 209.633 0.45 52.49  ? 60   ILE D CA    1 
ATOM   2775 C  CA    B ILE D  1 60  ? 121.591 -10.467 209.609 0.55 52.52  ? 60   ILE D CA    1 
ATOM   2776 C  C     . ILE D  1 60  ? 122.587 -11.635 209.625 1.00 56.42  ? 60   ILE D C     1 
ATOM   2777 O  O     . ILE D  1 60  ? 123.806 -11.431 209.552 1.00 52.46  ? 60   ILE D O     1 
ATOM   2778 C  CB    A ILE D  1 60  ? 121.160 -10.179 211.079 0.45 54.44  ? 60   ILE D CB    1 
ATOM   2779 C  CB    B ILE D  1 60  ? 121.200 -10.099 211.048 0.55 54.53  ? 60   ILE D CB    1 
ATOM   2780 C  CG1   A ILE D  1 60  ? 120.623 -8.757  211.165 0.45 53.53  ? 60   ILE D CG1   1 
ATOM   2781 C  CG1   B ILE D  1 60  ? 120.704 -8.656  211.116 0.55 53.54  ? 60   ILE D CG1   1 
ATOM   2782 C  CG2   A ILE D  1 60  ? 122.325 -10.353 212.042 0.45 55.70  ? 60   ILE D CG2   1 
ATOM   2783 C  CG2   B ILE D  1 60  ? 122.369 -10.281 212.003 0.55 55.69  ? 60   ILE D CG2   1 
ATOM   2784 C  CD1   A ILE D  1 60  ? 121.626 -7.741  210.740 0.45 49.33  ? 60   ILE D CD1   1 
ATOM   2785 C  CD1   B ILE D  1 60  ? 120.259 -8.252  212.515 0.55 48.79  ? 60   ILE D CD1   1 
ATOM   2786 N  N     . ASP D  1 61  ? 122.064 -12.852 209.702 1.00 56.04  ? 61   ASP D N     1 
ATOM   2787 C  CA    . ASP D  1 61  ? 122.906 -14.033 209.744 1.00 57.54  ? 61   ASP D CA    1 
ATOM   2788 C  C     . ASP D  1 61  ? 123.490 -14.349 208.361 1.00 59.94  ? 61   ASP D C     1 
ATOM   2789 O  O     . ASP D  1 61  ? 124.673 -14.666 208.259 1.00 61.40  ? 61   ASP D O     1 
ATOM   2790 C  CB    . ASP D  1 61  ? 122.124 -15.228 210.293 1.00 49.19  ? 61   ASP D CB    1 
ATOM   2791 C  CG    . ASP D  1 61  ? 121.699 -15.039 211.748 1.00 56.48  ? 61   ASP D CG    1 
ATOM   2792 O  OD1   . ASP D  1 61  ? 122.322 -14.215 212.461 1.00 57.14  ? 61   ASP D OD1   1 
ATOM   2793 O  OD2   . ASP D  1 61  ? 120.740 -15.720 212.175 1.00 56.57  ? 61   ASP D OD2   1 
ATOM   2794 N  N     . GLU D  1 62  ? 122.678 -14.245 207.309 1.00 55.44  ? 62   GLU D N     1 
ATOM   2795 C  CA    . GLU D  1 62  ? 123.170 -14.456 205.943 1.00 60.95  ? 62   GLU D CA    1 
ATOM   2796 C  C     . GLU D  1 62  ? 124.293 -13.506 205.550 1.00 61.76  ? 62   GLU D C     1 
ATOM   2797 O  O     . GLU D  1 62  ? 125.189 -13.873 204.793 1.00 67.75  ? 62   GLU D O     1 
ATOM   2798 C  CB    . GLU D  1 62  ? 122.036 -14.322 204.926 1.00 61.85  ? 62   GLU D CB    1 
ATOM   2799 C  CG    . GLU D  1 62  ? 120.982 -15.405 205.051 1.00 71.90  ? 62   GLU D CG    1 
ATOM   2800 C  CD    . GLU D  1 62  ? 121.460 -16.749 204.499 1.00 82.28  ? 62   GLU D CD    1 
ATOM   2801 O  OE1   . GLU D  1 62  ? 122.597 -16.824 203.979 1.00 82.97  ? 62   GLU D OE1   1 
ATOM   2802 O  OE2   . GLU D  1 62  ? 120.709 -17.740 204.615 1.00 84.38  ? 62   GLU D OE2   1 
ATOM   2803 N  N     . LEU D  1 63  ? 124.244 -12.281 206.051 1.00 58.46  ? 63   LEU D N     1 
ATOM   2804 C  CA    . LEU D  1 63  ? 125.228 -11.288 205.659 1.00 57.51  ? 63   LEU D CA    1 
ATOM   2805 C  C     . LEU D  1 63  ? 126.395 -11.309 206.622 1.00 60.02  ? 63   LEU D C     1 
ATOM   2806 O  O     . LEU D  1 63  ? 127.314 -10.496 206.511 1.00 59.80  ? 63   LEU D O     1 
ATOM   2807 C  CB    . LEU D  1 63  ? 124.612 -9.888  205.619 1.00 56.13  ? 63   LEU D CB    1 
ATOM   2808 C  CG    . LEU D  1 63  ? 123.570 -9.599  204.540 1.00 57.86  ? 63   LEU D CG    1 
ATOM   2809 C  CD1   . LEU D  1 63  ? 122.958 -8.210  204.739 1.00 47.73  ? 63   LEU D CD1   1 
ATOM   2810 C  CD2   . LEU D  1 63  ? 124.177 -9.731  203.150 1.00 56.45  ? 63   LEU D CD2   1 
ATOM   2811 N  N     . ASN D  1 64  ? 126.338 -12.229 207.580 1.00 60.14  ? 64   ASN D N     1 
ATOM   2812 C  CA    . ASN D  1 64  ? 127.335 -12.297 208.648 1.00 64.94  ? 64   ASN D CA    1 
ATOM   2813 C  C     . ASN D  1 64  ? 127.555 -10.957 209.346 1.00 59.28  ? 64   ASN D C     1 
ATOM   2814 O  O     . ASN D  1 64  ? 128.669 -10.626 209.753 1.00 64.95  ? 64   ASN D O     1 
ATOM   2815 C  CB    . ASN D  1 64  ? 128.666 -12.853 208.112 1.00 68.09  ? 64   ASN D CB    1 
ATOM   2816 C  CG    . ASN D  1 64  ? 128.712 -14.379 208.148 1.00 73.10  ? 64   ASN D CG    1 
ATOM   2817 O  OD1   . ASN D  1 64  ? 129.230 -14.968 209.104 1.00 79.49  ? 64   ASN D OD1   1 
ATOM   2818 N  ND2   . ASN D  1 64  ? 128.149 -15.025 207.122 1.00 71.14  ? 64   ASN D ND2   1 
ATOM   2819 N  N     . VAL D  1 65  ? 126.469 -10.203 209.484 1.00 57.82  ? 65   VAL D N     1 
ATOM   2820 C  CA    . VAL D  1 65  ? 126.429 -9.011  210.324 1.00 59.22  ? 65   VAL D CA    1 
ATOM   2821 C  C     . VAL D  1 65  ? 126.309 -9.472  211.767 1.00 58.30  ? 65   VAL D C     1 
ATOM   2822 O  O     . VAL D  1 65  ? 125.553 -10.390 212.060 1.00 59.98  ? 65   VAL D O     1 
ATOM   2823 C  CB    . VAL D  1 65  ? 125.249 -8.088  209.944 1.00 56.29  ? 65   VAL D CB    1 
ATOM   2824 C  CG1   . VAL D  1 65  ? 125.177 -6.872  210.882 1.00 53.87  ? 65   VAL D CG1   1 
ATOM   2825 C  CG2   . VAL D  1 65  ? 125.380 -7.652  208.491 1.00 49.02  ? 65   VAL D CG2   1 
ATOM   2826 N  N     . LYS D  1 66  ? 127.068 -8.882  212.674 1.00 56.20  ? 66   LYS D N     1 
ATOM   2827 C  CA    . LYS D  1 66  ? 127.052 -9.419  214.030 1.00 67.03  ? 66   LYS D CA    1 
ATOM   2828 C  C     . LYS D  1 66  ? 126.475 -8.424  215.025 1.00 66.06  ? 66   LYS D C     1 
ATOM   2829 O  O     . LYS D  1 66  ? 126.663 -8.549  216.242 1.00 73.98  ? 66   LYS D O     1 
ATOM   2830 C  CB    . LYS D  1 66  ? 128.457 -9.886  214.443 1.00 71.67  ? 66   LYS D CB    1 
ATOM   2831 C  CG    . LYS D  1 66  ? 129.303 -10.353 213.245 1.00 71.84  ? 66   LYS D CG    1 
ATOM   2832 C  CD    . LYS D  1 66  ? 130.074 -11.652 213.519 1.00 75.35  ? 66   LYS D CD    1 
ATOM   2833 C  CE    . LYS D  1 66  ? 130.252 -12.457 212.225 1.00 76.95  ? 66   LYS D CE    1 
ATOM   2834 N  NZ    . LYS D  1 66  ? 130.156 -13.934 212.429 1.00 82.74  ? 66   LYS D NZ    1 
ATOM   2835 N  N     . SER D  1 67  ? 125.735 -7.458  214.491 1.00 62.68  ? 67   SER D N     1 
ATOM   2836 C  CA    . SER D  1 67  ? 124.923 -6.572  215.312 1.00 59.18  ? 67   SER D CA    1 
ATOM   2837 C  C     . SER D  1 67  ? 123.699 -7.336  215.787 1.00 55.04  ? 67   SER D C     1 
ATOM   2838 O  O     . SER D  1 67  ? 123.291 -8.326  215.175 1.00 54.07  ? 67   SER D O     1 
ATOM   2839 C  CB    . SER D  1 67  ? 124.505 -5.328  214.526 1.00 56.22  ? 67   SER D CB    1 
ATOM   2840 O  OG    . SER D  1 67  ? 125.610 -4.472  214.311 1.00 56.25  ? 67   SER D OG    1 
ATOM   2841 N  N     . LYS D  1 68  ? 123.103 -6.888  216.877 1.00 52.35  ? 68   LYS D N     1 
ATOM   2842 C  CA    . LYS D  1 68  ? 121.925 -7.578  217.359 1.00 53.54  ? 68   LYS D CA    1 
ATOM   2843 C  C     . LYS D  1 68  ? 120.683 -6.790  216.996 1.00 53.49  ? 68   LYS D C     1 
ATOM   2844 O  O     . LYS D  1 68  ? 120.753 -5.572  216.747 1.00 43.40  ? 68   LYS D O     1 
ATOM   2845 C  CB    . LYS D  1 68  ? 121.997 -7.799  218.864 1.00 52.66  ? 68   LYS D CB    1 
ATOM   2846 C  CG    . LYS D  1 68  ? 122.203 -6.559  219.685 1.00 56.63  ? 68   LYS D CG    1 
ATOM   2847 C  CD    . LYS D  1 68  ? 122.297 -6.932  221.168 1.00 60.53  ? 68   LYS D CD    1 
ATOM   2848 C  CE    . LYS D  1 68  ? 120.962 -7.462  221.689 1.00 57.02  ? 68   LYS D CE    1 
ATOM   2849 N  NZ    . LYS D  1 68  ? 121.086 -7.930  223.094 1.00 74.67  ? 68   LYS D NZ    1 
ATOM   2850 N  N     . ILE D  1 69  ? 119.553 -7.491  216.943 1.00 47.41  ? 69   ILE D N     1 
ATOM   2851 C  CA    . ILE D  1 69  ? 118.278 -6.827  216.770 1.00 46.32  ? 69   ILE D CA    1 
ATOM   2852 C  C     . ILE D  1 69  ? 117.854 -6.266  218.123 1.00 52.94  ? 69   ILE D C     1 
ATOM   2853 O  O     . ILE D  1 69  ? 117.641 -7.015  219.092 1.00 54.67  ? 69   ILE D O     1 
ATOM   2854 C  CB    . ILE D  1 69  ? 117.205 -7.772  216.198 1.00 47.79  ? 69   ILE D CB    1 
ATOM   2855 C  CG1   . ILE D  1 69  ? 117.559 -8.164  214.760 1.00 47.82  ? 69   ILE D CG1   1 
ATOM   2856 C  CG2   . ILE D  1 69  ? 115.850 -7.101  216.199 1.00 48.51  ? 69   ILE D CG2   1 
ATOM   2857 C  CD1   . ILE D  1 69  ? 116.606 -9.157  214.115 1.00 49.13  ? 69   ILE D CD1   1 
ATOM   2858 N  N     . GLN D  1 70  ? 117.789 -4.939  218.206 1.00 48.23  ? 70   GLN D N     1 
ATOM   2859 C  CA    . GLN D  1 70  ? 117.231 -4.293  219.386 1.00 46.37  ? 70   GLN D CA    1 
ATOM   2860 C  C     . GLN D  1 70  ? 115.761 -3.993  219.165 1.00 52.62  ? 70   GLN D C     1 
ATOM   2861 O  O     . GLN D  1 70  ? 115.373 -3.530  218.081 1.00 48.15  ? 70   GLN D O     1 
ATOM   2862 C  CB    . GLN D  1 70  ? 117.963 -3.005  219.703 1.00 44.86  ? 70   GLN D CB    1 
ATOM   2863 C  CG    . GLN D  1 70  ? 119.456 -3.138  219.758 1.00 46.43  ? 70   GLN D CG    1 
ATOM   2864 C  CD    . GLN D  1 70  ? 120.086 -1.820  220.100 1.00 50.05  ? 70   GLN D CD    1 
ATOM   2865 O  OE1   . GLN D  1 70  ? 119.719 -1.192  221.096 1.00 56.36  ? 70   GLN D OE1   1 
ATOM   2866 N  NE2   . GLN D  1 70  ? 121.001 -1.357  219.249 1.00 49.25  ? 70   GLN D NE2   1 
ATOM   2867 N  N     . ILE D  1 71  ? 114.951 -4.279  220.182 1.00 45.59  ? 71   ILE D N     1 
ATOM   2868 C  CA    . ILE D  1 71  ? 113.569 -3.828  220.229 1.00 43.67  ? 71   ILE D CA    1 
ATOM   2869 C  C     . ILE D  1 71  ? 113.417 -2.845  221.381 1.00 48.36  ? 71   ILE D C     1 
ATOM   2870 O  O     . ILE D  1 71  ? 113.509 -3.222  222.559 1.00 51.85  ? 71   ILE D O     1 
ATOM   2871 C  CB    . ILE D  1 71  ? 112.585 -4.977  220.430 1.00 43.31  ? 71   ILE D CB    1 
ATOM   2872 C  CG1   . ILE D  1 71  ? 112.840 -6.080  219.417 1.00 44.34  ? 71   ILE D CG1   1 
ATOM   2873 C  CG2   . ILE D  1 71  ? 111.152 -4.470  220.340 1.00 45.13  ? 71   ILE D CG2   1 
ATOM   2874 C  CD1   . ILE D  1 71  ? 112.552 -5.671  218.023 1.00 51.95  ? 71   ILE D CD1   1 
ATOM   2875 N  N     . VAL D  1 72  ? 113.203 -1.584  221.044 1.00 47.11  ? 72   VAL D N     1 
ATOM   2876 C  CA    . VAL D  1 72  ? 112.992 -0.545  222.041 1.00 44.19  ? 72   VAL D CA    1 
ATOM   2877 C  C     . VAL D  1 72  ? 111.521 -0.127  222.079 1.00 53.26  ? 72   VAL D C     1 
ATOM   2878 O  O     . VAL D  1 72  ? 110.931 0.221   221.049 1.00 48.07  ? 72   VAL D O     1 
ATOM   2879 C  CB    . VAL D  1 72  ? 113.869 0.688   221.757 1.00 47.40  ? 72   VAL D CB    1 
ATOM   2880 C  CG1   . VAL D  1 72  ? 113.619 1.790   222.781 1.00 46.72  ? 72   VAL D CG1   1 
ATOM   2881 C  CG2   . VAL D  1 72  ? 115.338 0.294   221.725 1.00 49.52  ? 72   VAL D CG2   1 
ATOM   2882 N  N     . LYS D  1 73  ? 110.929 -0.166  223.271 1.00 55.23  ? 73   LYS D N     1 
ATOM   2883 C  CA    . LYS D  1 73  ? 109.552 0.273   223.456 1.00 54.53  ? 73   LYS D CA    1 
ATOM   2884 C  C     . LYS D  1 73  ? 109.461 1.772   223.676 1.00 57.34  ? 73   LYS D C     1 
ATOM   2885 O  O     . LYS D  1 73  ? 110.065 2.302   224.606 1.00 65.70  ? 73   LYS D O     1 
ATOM   2886 C  CB    . LYS D  1 73  ? 108.912 -0.445  224.637 1.00 59.33  ? 73   LYS D CB    1 
ATOM   2887 C  CG    . LYS D  1 73  ? 107.577 0.178   225.040 1.00 63.04  ? 73   LYS D CG    1 
ATOM   2888 C  CD    . LYS D  1 73  ? 106.800 -0.744  225.943 1.00 71.96  ? 73   LYS D CD    1 
ATOM   2889 C  CE    . LYS D  1 73  ? 106.998 -2.180  225.503 1.00 74.58  ? 73   LYS D CE    1 
ATOM   2890 N  NZ    . LYS D  1 73  ? 105.905 -3.089  225.956 1.00 82.03  ? 73   LYS D NZ    1 
ATOM   2891 N  N     . GLY D  1 74  ? 108.698 2.451   222.827 1.00 52.00  ? 74   GLY D N     1 
ATOM   2892 C  CA    . GLY D  1 74  ? 108.471 3.878   222.979 1.00 53.37  ? 74   GLY D CA    1 
ATOM   2893 C  C     . GLY D  1 74  ? 107.059 4.190   223.466 1.00 57.43  ? 74   GLY D C     1 
ATOM   2894 O  O     . GLY D  1 74  ? 106.246 3.289   223.676 1.00 54.79  ? 74   GLY D O     1 
ATOM   2895 N  N     . ASP D  1 75  ? 106.771 5.480   223.634 1.00 58.37  ? 75   ASP D N     1 
ATOM   2896 C  CA    . ASP D  1 75  ? 105.435 5.954   224.010 1.00 65.04  ? 75   ASP D CA    1 
ATOM   2897 C  C     . ASP D  1 75  ? 104.334 5.421   223.078 1.00 65.23  ? 75   ASP D C     1 
ATOM   2898 O  O     . ASP D  1 75  ? 103.300 4.920   223.531 1.00 67.59  ? 75   ASP D O     1 
ATOM   2899 C  CB    . ASP D  1 75  ? 105.403 7.505   224.042 1.00 66.11  ? 75   ASP D CB    1 
ATOM   2900 C  CG    . ASP D  1 75  ? 106.081 8.170   222.800 1.00 72.86  ? 75   ASP D CG    1 
ATOM   2901 O  OD1   . ASP D  1 75  ? 106.217 7.531   221.718 1.00 67.74  ? 75   ASP D OD1   1 
ATOM   2902 O  OD2   . ASP D  1 75  ? 106.462 9.365   222.904 1.00 68.05  ? 75   ASP D OD2   1 
ATOM   2903 N  N     . THR D  1 76  ? 104.582 5.506   221.775 1.00 59.05  ? 76   THR D N     1 
ATOM   2904 C  CA    . THR D  1 76  ? 103.562 5.245   220.774 1.00 57.43  ? 76   THR D CA    1 
ATOM   2905 C  C     . THR D  1 76  ? 103.870 4.086   219.820 1.00 54.69  ? 76   THR D C     1 
ATOM   2906 O  O     . THR D  1 76  ? 103.024 3.748   218.968 1.00 53.04  ? 76   THR D O     1 
ATOM   2907 C  CB    . THR D  1 76  ? 103.326 6.505   219.904 1.00 56.79  ? 76   THR D CB    1 
ATOM   2908 O  OG1   . THR D  1 76  ? 104.478 6.740   219.080 1.00 52.55  ? 76   THR D OG1   1 
ATOM   2909 C  CG2   . THR D  1 76  ? 103.090 7.706   220.779 1.00 53.65  ? 76   THR D CG2   1 
ATOM   2910 N  N     . ARG D  1 77  ? 105.055 3.487   219.926 1.00 43.20  ? 77   ARG D N     1 
ATOM   2911 C  CA    . ARG D  1 77  ? 105.489 2.562   218.874 1.00 49.63  ? 77   ARG D CA    1 
ATOM   2912 C  C     . ARG D  1 77  ? 106.573 1.696   219.488 1.00 45.61  ? 77   ARG D C     1 
ATOM   2913 O  O     . ARG D  1 77  ? 107.324 2.171   220.342 1.00 48.01  ? 77   ARG D O     1 
ATOM   2914 C  CB    . ARG D  1 77  ? 106.053 3.346   217.661 1.00 43.42  ? 77   ARG D CB    1 
ATOM   2915 C  CG    . ARG D  1 77  ? 107.348 3.963   218.102 1.00 45.69  ? 77   ARG D CG    1 
ATOM   2916 C  CD    . ARG D  1 77  ? 108.001 5.052   217.395 1.00 48.47  ? 77   ARG D CD    1 
ATOM   2917 N  NE    . ARG D  1 77  ? 109.446 5.177   217.685 1.00 54.14  ? 77   ARG D NE    1 
ATOM   2918 C  CZ    . ARG D  1 77  ? 110.080 4.867   218.819 1.00 51.75  ? 77   ARG D CZ    1 
ATOM   2919 N  NH1   . ARG D  1 77  ? 109.493 4.255   219.830 1.00 50.21  ? 77   ARG D NH1   1 
ATOM   2920 N  NH2   . ARG D  1 77  ? 111.378 5.083   218.902 1.00 59.58  ? 77   ARG D NH2   1 
ATOM   2921 N  N     . TYR D  1 78  ? 106.664 0.440   219.086 1.00 45.54  ? 78   TYR D N     1 
ATOM   2922 C  CA    . TYR D  1 78  ? 107.920 -0.264  219.232 1.00 46.45  ? 78   TYR D CA    1 
ATOM   2923 C  C     . TYR D  1 78  ? 108.884 0.144   218.117 1.00 48.54  ? 78   TYR D C     1 
ATOM   2924 O  O     . TYR D  1 78  ? 108.452 0.369   216.960 1.00 42.09  ? 78   TYR D O     1 
ATOM   2925 C  CB    . TYR D  1 78  ? 107.700 -1.761  219.185 1.00 47.49  ? 78   TYR D CB    1 
ATOM   2926 C  CG    . TYR D  1 78  ? 107.052 -2.345  220.381 1.00 53.32  ? 78   TYR D CG    1 
ATOM   2927 C  CD1   . TYR D  1 78  ? 105.695 -2.272  220.570 1.00 63.52  ? 78   TYR D CD1   1 
ATOM   2928 C  CD2   . TYR D  1 78  ? 107.817 -3.012  221.333 1.00 58.44  ? 78   TYR D CD2   1 
ATOM   2929 C  CE1   . TYR D  1 78  ? 105.126 -2.841  221.701 1.00 63.63  ? 78   TYR D CE1   1 
ATOM   2930 C  CE2   . TYR D  1 78  ? 107.257 -3.585  222.458 1.00 67.82  ? 78   TYR D CE2   1 
ATOM   2931 C  CZ    . TYR D  1 78  ? 105.915 -3.495  222.633 1.00 68.94  ? 78   TYR D CZ    1 
ATOM   2932 O  OH    . TYR D  1 78  ? 105.352 -4.062  223.757 1.00 71.77  ? 78   TYR D OH    1 
ATOM   2933 N  N     . GLU D  1 79  ? 110.178 0.187   218.448 1.00 43.53  ? 79   GLU D N     1 
ATOM   2934 C  CA    . GLU D  1 79  ? 111.210 0.429   217.441 1.00 46.41  ? 79   GLU D CA    1 
ATOM   2935 C  C     . GLU D  1 79  ? 112.076 -0.799  217.286 1.00 44.82  ? 79   GLU D C     1 
ATOM   2936 O  O     . GLU D  1 79  ? 112.716 -1.219  218.244 1.00 40.17  ? 79   GLU D O     1 
ATOM   2937 C  CB    . GLU D  1 79  ? 112.104 1.624   217.799 1.00 46.02  ? 79   GLU D CB    1 
ATOM   2938 C  CG    . GLU D  1 79  ? 113.319 1.736   216.874 1.00 46.39  ? 79   GLU D CG    1 
ATOM   2939 C  CD    . GLU D  1 79  ? 114.361 2.725   217.350 1.00 45.23  ? 79   GLU D CD    1 
ATOM   2940 O  OE1   . GLU D  1 79  ? 114.121 3.434   218.348 1.00 44.74  ? 79   GLU D OE1   1 
ATOM   2941 O  OE2   . GLU D  1 79  ? 115.425 2.793   216.700 1.00 44.47  ? 79   GLU D OE2   1 
ATOM   2942 N  N     . LEU D  1 80  ? 112.087 -1.383  216.096 1.00 39.35  ? 80   LEU D N     1 
ATOM   2943 C  CA    . LEU D  1 80  ? 113.061 -2.424  215.801 1.00 41.41  ? 80   LEU D CA    1 
ATOM   2944 C  C     . LEU D  1 80  ? 114.294 -1.772  215.213 1.00 42.91  ? 80   LEU D C     1 
ATOM   2945 O  O     . LEU D  1 80  ? 114.213 -1.077  214.198 1.00 46.99  ? 80   LEU D O     1 
ATOM   2946 C  CB    . LEU D  1 80  ? 112.504 -3.474  214.846 1.00 45.23  ? 80   LEU D CB    1 
ATOM   2947 C  CG    . LEU D  1 80  ? 113.451 -4.615  214.462 1.00 44.50  ? 80   LEU D CG    1 
ATOM   2948 C  CD1   . LEU D  1 80  ? 112.634 -5.850  214.176 1.00 43.87  ? 80   LEU D CD1   1 
ATOM   2949 C  CD2   . LEU D  1 80  ? 114.328 -4.250  213.236 1.00 41.18  ? 80   LEU D CD2   1 
ATOM   2950 N  N     . ARG D  1 81  ? 115.439 -2.029  215.832 1.00 41.56  ? 81   ARG D N     1 
ATOM   2951 C  CA    . ARG D  1 81  ? 116.663 -1.351  215.463 1.00 41.39  ? 81   ARG D CA    1 
ATOM   2952 C  C     . ARG D  1 81  ? 117.879 -2.276  215.315 1.00 48.38  ? 81   ARG D C     1 
ATOM   2953 O  O     . ARG D  1 81  ? 118.211 -3.044  216.240 1.00 43.29  ? 81   ARG D O     1 
ATOM   2954 C  CB    . ARG D  1 81  ? 116.975 -0.285  216.500 1.00 43.70  ? 81   ARG D CB    1 
ATOM   2955 C  CG    . ARG D  1 81  ? 118.290 0.404   216.276 1.00 47.73  ? 81   ARG D CG    1 
ATOM   2956 C  CD    . ARG D  1 81  ? 118.706 1.115   217.550 1.00 47.85  ? 81   ARG D CD    1 
ATOM   2957 N  NE    . ARG D  1 81  ? 117.654 1.999   218.024 1.00 47.24  ? 81   ARG D NE    1 
ATOM   2958 C  CZ    . ARG D  1 81  ? 117.690 2.639   219.190 1.00 51.56  ? 81   ARG D CZ    1 
ATOM   2959 N  NH1   . ARG D  1 81  ? 118.733 2.499   220.010 1.00 43.16  ? 81   ARG D NH1   1 
ATOM   2960 N  NH2   . ARG D  1 81  ? 116.677 3.418   219.539 1.00 48.65  ? 81   ARG D NH2   1 
ATOM   2961 N  N     . VAL D  1 82  ? 118.552 -2.180  214.162 1.00 44.83  ? 82   VAL D N     1 
ATOM   2962 C  CA    . VAL D  1 82  ? 119.886 -2.766  214.023 1.00 41.01  ? 82   VAL D CA    1 
ATOM   2963 C  C     . VAL D  1 82  ? 120.941 -1.681  213.852 1.00 42.18  ? 82   VAL D C     1 
ATOM   2964 O  O     . VAL D  1 82  ? 120.872 -0.852  212.943 1.00 44.28  ? 82   VAL D O     1 
ATOM   2965 C  CB    . VAL D  1 82  ? 120.011 -3.729  212.830 1.00 38.93  ? 82   VAL D CB    1 
ATOM   2966 C  CG1   . VAL D  1 82  ? 121.340 -4.457  212.913 1.00 41.61  ? 82   VAL D CG1   1 
ATOM   2967 C  CG2   . VAL D  1 82  ? 118.866 -4.720  212.780 1.00 35.81  ? 82   VAL D CG2   1 
ATOM   2968 N  N     . SER D  1 83  ? 121.932 -1.710  214.726 1.00 41.96  ? 83   SER D N     1 
ATOM   2969 C  CA    . SER D  1 83  ? 123.015 -0.754  214.714 1.00 41.77  ? 83   SER D CA    1 
ATOM   2970 C  C     . SER D  1 83  ? 124.198 -1.394  213.990 1.00 48.71  ? 83   SER D C     1 
ATOM   2971 O  O     . SER D  1 83  ? 124.966 -2.146  214.590 1.00 47.01  ? 83   SER D O     1 
ATOM   2972 C  CB    . SER D  1 83  ? 123.375 -0.356  216.151 1.00 44.20  ? 83   SER D CB    1 
ATOM   2973 O  OG    . SER D  1 83  ? 124.353 0.665   216.189 1.00 48.47  ? 83   SER D OG    1 
ATOM   2974 N  N     . SER D  1 84  ? 124.319 -1.127  212.692 1.00 43.85  ? 84   SER D N     1 
ATOM   2975 C  CA    . SER D  1 84  ? 125.361 -1.752  211.880 1.00 48.35  ? 84   SER D CA    1 
ATOM   2976 C  C     . SER D  1 84  ? 125.692 -0.962  210.627 1.00 40.43  ? 84   SER D C     1 
ATOM   2977 O  O     . SER D  1 84  ? 124.869 -0.859  209.717 1.00 41.55  ? 84   SER D O     1 
ATOM   2978 C  CB    . SER D  1 84  ? 124.953 -3.167  211.467 1.00 44.85  ? 84   SER D CB    1 
ATOM   2979 O  OG    . SER D  1 84  ? 125.787 -3.635  210.408 1.00 45.07  ? 84   SER D OG    1 
ATOM   2980 N  N     . LYS D  1 85  ? 126.898 -0.416  210.581 1.00 42.17  ? 85   LYS D N     1 
ATOM   2981 C  CA    . LYS D  1 85  ? 127.369 0.280   209.387 1.00 44.92  ? 85   LYS D CA    1 
ATOM   2982 C  C     . LYS D  1 85  ? 127.180 -0.573  208.129 1.00 43.91  ? 85   LYS D C     1 
ATOM   2983 O  O     . LYS D  1 85  ? 126.669 -0.106  207.106 1.00 43.64  ? 85   LYS D O     1 
ATOM   2984 C  CB    . LYS D  1 85  ? 128.832 0.654   209.545 1.00 46.31  ? 85   LYS D CB    1 
ATOM   2985 C  CG    . LYS D  1 85  ? 129.388 1.421   208.372 1.00 46.57  ? 85   LYS D CG    1 
ATOM   2986 C  CD    . LYS D  1 85  ? 130.750 2.015   208.711 1.00 46.94  ? 85   LYS D CD    1 
ATOM   2987 C  CE    . LYS D  1 85  ? 131.429 2.567   207.457 1.00 45.93  ? 85   LYS D CE    1 
ATOM   2988 N  NZ    . LYS D  1 85  ? 132.659 3.301   207.797 1.00 38.37  ? 85   LYS D NZ    1 
ATOM   2989 N  N     . LYS D  1 86  ? 127.543 -1.843  208.241 1.00 39.79  ? 86   LYS D N     1 
ATOM   2990 C  CA    . LYS D  1 86  ? 127.375 -2.767  207.151 1.00 43.21  ? 86   LYS D CA    1 
ATOM   2991 C  C     . LYS D  1 86  ? 125.915 -2.937  206.681 1.00 44.36  ? 86   LYS D C     1 
ATOM   2992 O  O     . LYS D  1 86  ? 125.633 -2.884  205.467 1.00 41.12  ? 86   LYS D O     1 
ATOM   2993 C  CB    . LYS D  1 86  ? 127.969 -4.115  207.535 1.00 43.95  ? 86   LYS D CB    1 
ATOM   2994 C  CG    . LYS D  1 86  ? 127.893 -5.116  206.428 1.00 47.13  ? 86   LYS D CG    1 
ATOM   2995 C  CD    . LYS D  1 86  ? 128.616 -6.372  206.794 1.00 52.56  ? 86   LYS D CD    1 
ATOM   2996 C  CE    . LYS D  1 86  ? 128.560 -7.335  205.640 1.00 51.78  ? 86   LYS D CE    1 
ATOM   2997 N  NZ    . LYS D  1 86  ? 129.047 -8.664  206.046 1.00 62.00  ? 86   LYS D NZ    1 
ATOM   2998 N  N     . LEU D  1 87  ? 124.991 -3.158  207.614 1.00 42.08  ? 87   LEU D N     1 
ATOM   2999 C  CA    . LEU D  1 87  ? 123.584 -3.336  207.244 1.00 40.09  ? 87   LEU D CA    1 
ATOM   3000 C  C     . LEU D  1 87  ? 122.997 -2.020  206.685 1.00 39.26  ? 87   LEU D C     1 
ATOM   3001 O  O     . LEU D  1 87  ? 122.212 -2.021  205.728 1.00 35.72  ? 87   LEU D O     1 
ATOM   3002 C  CB    . LEU D  1 87  ? 122.767 -3.824  208.447 1.00 42.92  ? 87   LEU D CB    1 
ATOM   3003 C  CG    . LEU D  1 87  ? 121.406 -4.416  208.074 1.00 42.20  ? 87   LEU D CG    1 
ATOM   3004 C  CD1   . LEU D  1 87  ? 121.597 -5.609  207.152 1.00 42.55  ? 87   LEU D CD1   1 
ATOM   3005 C  CD2   . LEU D  1 87  ? 120.595 -4.808  209.297 1.00 42.92  ? 87   LEU D CD2   1 
ATOM   3006 N  N     . TYR D  1 88  ? 123.399 -0.907  207.294 1.00 35.20  ? 88   TYR D N     1 
ATOM   3007 C  CA    . TYR D  1 88  ? 123.026 0.416   206.812 1.00 38.27  ? 88   TYR D CA    1 
ATOM   3008 C  C     . TYR D  1 88  ? 123.351 0.610   205.337 1.00 38.18  ? 88   TYR D C     1 
ATOM   3009 O  O     . TYR D  1 88  ? 122.456 0.950   204.563 1.00 38.28  ? 88   TYR D O     1 
ATOM   3010 C  CB    . TYR D  1 88  ? 123.711 1.510   207.644 1.00 34.94  ? 88   TYR D CB    1 
ATOM   3011 C  CG    . TYR D  1 88  ? 123.495 2.922   207.120 1.00 41.45  ? 88   TYR D CG    1 
ATOM   3012 C  CD1   . TYR D  1 88  ? 124.372 3.478   206.178 1.00 43.83  ? 88   TYR D CD1   1 
ATOM   3013 C  CD2   . TYR D  1 88  ? 122.420 3.704   207.561 1.00 37.97  ? 88   TYR D CD2   1 
ATOM   3014 C  CE1   . TYR D  1 88  ? 124.190 4.771   205.686 1.00 41.54  ? 88   TYR D CE1   1 
ATOM   3015 C  CE2   . TYR D  1 88  ? 122.232 4.994   207.087 1.00 37.97  ? 88   TYR D CE2   1 
ATOM   3016 C  CZ    . TYR D  1 88  ? 123.125 5.525   206.142 1.00 46.28  ? 88   TYR D CZ    1 
ATOM   3017 O  OH    . TYR D  1 88  ? 122.959 6.801   205.647 1.00 44.89  ? 88   TYR D OH    1 
ATOM   3018 N  N     . TYR D  1 89  ? 124.615 0.424   204.943 1.00 37.70  ? 89   TYR D N     1 
ATOM   3019 C  CA    . TYR D  1 89  ? 124.983 0.608   203.516 1.00 38.23  ? 89   TYR D CA    1 
ATOM   3020 C  C     . TYR D  1 89  ? 124.439 -0.519  202.633 1.00 40.25  ? 89   TYR D C     1 
ATOM   3021 O  O     . TYR D  1 89  ? 124.133 -0.302  201.457 1.00 41.40  ? 89   TYR D O     1 
ATOM   3022 C  CB    . TYR D  1 89  ? 126.503 0.736   203.330 1.00 35.60  ? 89   TYR D CB    1 
ATOM   3023 C  CG    . TYR D  1 89  ? 127.034 2.080   203.757 1.00 36.59  ? 89   TYR D CG    1 
ATOM   3024 C  CD1   . TYR D  1 89  ? 126.721 3.227   203.050 1.00 36.23  ? 89   TYR D CD1   1 
ATOM   3025 C  CD2   . TYR D  1 89  ? 127.832 2.208   204.884 1.00 41.20  ? 89   TYR D CD2   1 
ATOM   3026 C  CE1   . TYR D  1 89  ? 127.180 4.474   203.463 1.00 40.64  ? 89   TYR D CE1   1 
ATOM   3027 C  CE2   . TYR D  1 89  ? 128.299 3.460   205.309 1.00 37.75  ? 89   TYR D CE2   1 
ATOM   3028 C  CZ    . TYR D  1 89  ? 127.970 4.581   204.590 1.00 38.60  ? 89   TYR D CZ    1 
ATOM   3029 O  OH    . TYR D  1 89  ? 128.443 5.810   204.987 1.00 45.01  ? 89   TYR D OH    1 
ATOM   3030 N  N     . TYR D  1 90  ? 124.294 -1.715  203.202 1.00 37.87  ? 90   TYR D N     1 
ATOM   3031 C  CA    . TYR D  1 90  ? 123.608 -2.774  202.488 1.00 37.92  ? 90   TYR D CA    1 
ATOM   3032 C  C     . TYR D  1 90  ? 122.251 -2.272  201.950 1.00 40.47  ? 90   TYR D C     1 
ATOM   3033 O  O     . TYR D  1 90  ? 122.000 -2.349  200.747 1.00 43.24  ? 90   TYR D O     1 
ATOM   3034 C  CB    . TYR D  1 90  ? 123.402 -4.005  203.379 1.00 39.54  ? 90   TYR D CB    1 
ATOM   3035 C  CG    . TYR D  1 90  ? 122.593 -5.077  202.675 1.00 44.56  ? 90   TYR D CG    1 
ATOM   3036 C  CD1   . TYR D  1 90  ? 123.198 -5.919  201.739 1.00 44.26  ? 90   TYR D CD1   1 
ATOM   3037 C  CD2   . TYR D  1 90  ? 121.223 -5.237  202.912 1.00 40.33  ? 90   TYR D CD2   1 
ATOM   3038 C  CE1   . TYR D  1 90  ? 122.473 -6.902  201.069 1.00 40.86  ? 90   TYR D CE1   1 
ATOM   3039 C  CE2   . TYR D  1 90  ? 120.485 -6.233  202.239 1.00 48.39  ? 90   TYR D CE2   1 
ATOM   3040 C  CZ    . TYR D  1 90  ? 121.123 -7.059  201.308 1.00 49.88  ? 90   TYR D CZ    1 
ATOM   3041 O  OH    . TYR D  1 90  ? 120.432 -8.046  200.609 1.00 48.62  ? 90   TYR D OH    1 
ATOM   3042 N  N     . PHE D  1 91  ? 121.394 -1.745  202.833 1.00 40.41  ? 91   PHE D N     1 
ATOM   3043 C  CA    . PHE D  1 91  ? 120.077 -1.229  202.426 1.00 41.23  ? 91   PHE D CA    1 
ATOM   3044 C  C     . PHE D  1 91  ? 120.109 0.096   201.660 1.00 37.30  ? 91   PHE D C     1 
ATOM   3045 O  O     . PHE D  1 91  ? 119.269 0.316   200.807 1.00 36.71  ? 91   PHE D O     1 
ATOM   3046 C  CB    . PHE D  1 91  ? 119.154 -1.038  203.637 1.00 35.21  ? 91   PHE D CB    1 
ATOM   3047 C  CG    . PHE D  1 91  ? 118.575 -2.312  204.165 1.00 34.87  ? 91   PHE D CG    1 
ATOM   3048 C  CD1   . PHE D  1 91  ? 117.637 -3.009  203.435 1.00 34.01  ? 91   PHE D CD1   1 
ATOM   3049 C  CD2   . PHE D  1 91  ? 118.952 -2.794  205.407 1.00 35.74  ? 91   PHE D CD2   1 
ATOM   3050 C  CE1   . PHE D  1 91  ? 117.097 -4.174  203.908 1.00 37.95  ? 91   PHE D CE1   1 
ATOM   3051 C  CE2   . PHE D  1 91  ? 118.411 -3.954  205.903 1.00 38.73  ? 91   PHE D CE2   1 
ATOM   3052 C  CZ    . PHE D  1 91  ? 117.480 -4.650  205.159 1.00 43.16  ? 91   PHE D CZ    1 
ATOM   3053 N  N     . ALA D  1 92  ? 121.034 0.987   202.009 1.00 39.24  ? 92   ALA D N     1 
ATOM   3054 C  CA    . ALA D  1 92  ? 121.125 2.273   201.324 1.00 38.80  ? 92   ALA D CA    1 
ATOM   3055 C  C     . ALA D  1 92  ? 121.544 2.092   199.857 1.00 42.89  ? 92   ALA D C     1 
ATOM   3056 O  O     . ALA D  1 92  ? 121.007 2.751   198.975 1.00 43.74  ? 92   ALA D O     1 
ATOM   3057 C  CB    . ALA D  1 92  ? 122.081 3.182   202.022 1.00 31.31  ? 92   ALA D CB    1 
ATOM   3058 N  N     . ASN D  1 93  ? 122.492 1.197   199.607 1.00 40.32  ? 93   ASN D N     1 
ATOM   3059 C  CA    . ASN D  1 93  ? 122.927 0.933   198.232 1.00 44.43  ? 93   ASN D CA    1 
ATOM   3060 C  C     . ASN D  1 93  ? 121.808 0.254   197.483 1.00 47.13  ? 93   ASN D C     1 
ATOM   3061 O  O     . ASN D  1 93  ? 121.546 0.561   196.314 1.00 44.93  ? 93   ASN D O     1 
ATOM   3062 C  CB    . ASN D  1 93  ? 124.196 0.079   198.192 1.00 36.05  ? 93   ASN D CB    1 
ATOM   3063 C  CG    . ASN D  1 93  ? 125.402 0.817   198.740 1.00 43.02  ? 93   ASN D CG    1 
ATOM   3064 O  OD1   . ASN D  1 93  ? 125.523 2.031   198.573 1.00 53.53  ? 93   ASN D OD1   1 
ATOM   3065 N  ND2   . ASN D  1 93  ? 126.304 0.095   199.379 1.00 42.31  ? 93   ASN D ND2   1 
ATOM   3066 N  N     . MET D  1 94  ? 121.115 -0.646  198.174 1.00 42.62  ? 94   MET D N     1 
ATOM   3067 C  CA    . MET D  1 94  ? 119.971 -1.311  197.567 1.00 41.50  ? 94   MET D CA    1 
ATOM   3068 C  C     . MET D  1 94  ? 118.914 -0.281  197.168 1.00 47.03  ? 94   MET D C     1 
ATOM   3069 O  O     . MET D  1 94  ? 118.303 -0.397  196.108 1.00 47.15  ? 94   MET D O     1 
ATOM   3070 C  CB    . MET D  1 94  ? 119.406 -2.352  198.519 1.00 42.86  ? 94   MET D CB    1 
ATOM   3071 C  CG    . MET D  1 94  ? 118.271 -3.162  197.973 1.00 44.15  ? 94   MET D CG    1 
ATOM   3072 S  SD    . MET D  1 94  ? 117.863 -4.531  199.075 1.00 56.49  ? 94   MET D SD    1 
ATOM   3073 C  CE    . MET D  1 94  ? 116.593 -5.326  198.121 1.00 51.51  ? 94   MET D CE    1 
ATOM   3074 N  N     . LEU D  1 95  ? 118.722 0.747   197.998 1.00 48.24  ? 95   LEU D N     1 
ATOM   3075 C  CA    . LEU D  1 95  ? 117.730 1.788   197.695 1.00 50.51  ? 95   LEU D CA    1 
ATOM   3076 C  C     . LEU D  1 95  ? 118.073 2.630   196.444 1.00 45.78  ? 95   LEU D C     1 
ATOM   3077 O  O     . LEU D  1 95  ? 117.185 3.025   195.699 1.00 49.33  ? 95   LEU D O     1 
ATOM   3078 C  CB    . LEU D  1 95  ? 117.546 2.713   198.902 1.00 41.75  ? 95   LEU D CB    1 
ATOM   3079 C  CG    . LEU D  1 95  ? 116.556 3.853   198.662 1.00 41.67  ? 95   LEU D CG    1 
ATOM   3080 C  CD1   . LEU D  1 95  ? 115.178 3.312   198.281 1.00 38.66  ? 95   LEU D CD1   1 
ATOM   3081 C  CD2   . LEU D  1 95  ? 116.474 4.746   199.887 1.00 41.87  ? 95   LEU D CD2   1 
ATOM   3082 N  N     . GLU D  1 96  ? 119.349 2.922   196.231 1.00 44.35  ? 96   GLU D N     1 
ATOM   3083 C  CA    . GLU D  1 96  ? 119.764 3.683   195.055 1.00 53.38  ? 96   GLU D CA    1 
ATOM   3084 C  C     . GLU D  1 96  ? 119.523 2.889   193.779 1.00 50.66  ? 96   GLU D C     1 
ATOM   3085 O  O     . GLU D  1 96  ? 119.153 3.435   192.745 1.00 55.71  ? 96   GLU D O     1 
ATOM   3086 C  CB    . GLU D  1 96  ? 121.236 4.049   195.147 1.00 56.76  ? 96   GLU D CB    1 
ATOM   3087 C  CG    . GLU D  1 96  ? 121.540 5.158   196.106 1.00 62.45  ? 96   GLU D CG    1 
ATOM   3088 C  CD    . GLU D  1 96  ? 122.991 5.562   196.016 1.00 85.59  ? 96   GLU D CD    1 
ATOM   3089 O  OE1   . GLU D  1 96  ? 123.848 4.871   196.626 1.00 79.67  ? 96   GLU D OE1   1 
ATOM   3090 O  OE2   . GLU D  1 96  ? 123.276 6.553   195.308 1.00 98.44  ? 96   GLU D OE2   1 
ATOM   3091 N  N     . ARG D  1 97  ? 119.731 1.588   193.882 1.00 51.90  ? 97   ARG D N     1 
ATOM   3092 C  CA    . ARG D  1 97  ? 119.568 0.679   192.771 1.00 51.64  ? 97   ARG D CA    1 
ATOM   3093 C  C     . ARG D  1 97  ? 118.137 0.152   192.654 1.00 54.60  ? 97   ARG D C     1 
ATOM   3094 O  O     . ARG D  1 97  ? 117.919 -0.898  192.049 1.00 53.66  ? 97   ARG D O     1 
ATOM   3095 C  CB    . ARG D  1 97  ? 120.547 -0.487  192.930 1.00 55.32  ? 97   ARG D CB    1 
ATOM   3096 C  CG    . ARG D  1 97  ? 121.994 -0.039  192.791 1.00 57.32  ? 97   ARG D CG    1 
ATOM   3097 C  CD    . ARG D  1 97  ? 122.999 -1.162  192.973 1.00 60.71  ? 97   ARG D CD    1 
ATOM   3098 N  NE    . ARG D  1 97  ? 122.829 -2.181  191.943 1.00 78.58  ? 97   ARG D NE    1 
ATOM   3099 C  CZ    . ARG D  1 97  ? 123.304 -2.085  190.702 1.00 72.99  ? 97   ARG D CZ    1 
ATOM   3100 N  NH1   . ARG D  1 97  ? 123.948 -0.990  190.317 1.00 69.21  ? 97   ARG D NH1   1 
ATOM   3101 N  NH2   . ARG D  1 97  ? 123.099 -3.071  189.836 1.00 73.16  ? 97   ARG D NH2   1 
ATOM   3102 N  N     . ILE D  1 98  ? 117.165 0.867   193.227 1.00 50.28  ? 98   ILE D N     1 
ATOM   3103 C  CA    . ILE D  1 98  ? 115.782 0.377   193.249 1.00 50.62  ? 98   ILE D CA    1 
ATOM   3104 C  C     . ILE D  1 98  ? 115.122 0.238   191.868 1.00 52.67  ? 98   ILE D C     1 
ATOM   3105 O  O     . ILE D  1 98  ? 114.346 -0.691  191.649 1.00 55.16  ? 98   ILE D O     1 
ATOM   3106 C  CB    . ILE D  1 98  ? 114.887 1.272   194.145 1.00 50.50  ? 98   ILE D CB    1 
ATOM   3107 C  CG1   . ILE D  1 98  ? 113.502 0.640   194.312 1.00 49.82  ? 98   ILE D CG1   1 
ATOM   3108 C  CG2   . ILE D  1 98  ? 114.837 2.714   193.637 1.00 47.39  ? 98   ILE D CG2   1 
ATOM   3109 C  CD1   . ILE D  1 98  ? 112.663 1.265   195.434 1.00 56.11  ? 98   ILE D CD1   1 
ATOM   3110 N  N     . ARG D  1 99  ? 115.438 1.133   190.934 1.00 56.50  ? 99   ARG D N     1 
ATOM   3111 C  CA    . ARG D  1 99  ? 114.902 1.040   189.569 1.00 56.19  ? 99   ARG D CA    1 
ATOM   3112 C  C     . ARG D  1 99  ? 115.326 -0.252  188.859 1.00 53.37  ? 99   ARG D C     1 
ATOM   3113 O  O     . ARG D  1 99  ? 114.639 -0.721  187.950 1.00 50.20  ? 99   ARG D O     1 
ATOM   3114 C  CB    . ARG D  1 99  ? 115.326 2.260   188.750 1.00 49.32  ? 99   ARG D CB    1 
ATOM   3115 C  CG    . ARG D  1 99  ? 114.674 3.534   189.255 1.00 54.13  ? 99   ARG D CG    1 
ATOM   3116 C  CD    . ARG D  1 99  ? 115.403 4.779   188.803 1.00 57.75  ? 99   ARG D CD    1 
ATOM   3117 N  NE    . ARG D  1 99  ? 114.827 5.987   189.390 1.00 63.43  ? 99   ARG D NE    1 
ATOM   3118 C  CZ    . ARG D  1 99  ? 115.209 6.516   190.553 1.00 67.29  ? 99   ARG D CZ    1 
ATOM   3119 N  NH1   . ARG D  1 99  ? 116.184 5.955   191.263 1.00 60.54  ? 99   ARG D NH1   1 
ATOM   3120 N  NH2   . ARG D  1 99  ? 114.626 7.620   191.001 1.00 63.92  ? 99   ARG D NH2   1 
ATOM   3121 N  N     . LEU D  1 100 ? 116.428 -0.846  189.313 1.00 50.07  ? 100  LEU D N     1 
ATOM   3122 C  CA    . LEU D  1 100 ? 116.925 -2.104  188.752 1.00 48.16  ? 100  LEU D CA    1 
ATOM   3123 C  C     . LEU D  1 100 ? 116.302 -3.359  189.375 1.00 56.48  ? 100  LEU D C     1 
ATOM   3124 O  O     . LEU D  1 100 ? 116.630 -4.475  188.968 1.00 55.22  ? 100  LEU D O     1 
ATOM   3125 C  CB    . LEU D  1 100 ? 118.450 -2.173  188.892 1.00 46.77  ? 100  LEU D CB    1 
ATOM   3126 C  CG    . LEU D  1 100 ? 119.204 -0.962  188.331 1.00 54.71  ? 100  LEU D CG    1 
ATOM   3127 C  CD1   . LEU D  1 100 ? 120.701 -1.145  188.445 1.00 59.69  ? 100  LEU D CD1   1 
ATOM   3128 C  CD2   . LEU D  1 100 ? 118.804 -0.716  186.891 1.00 44.68  ? 100  LEU D CD2   1 
ATOM   3129 N  N     . PHE D  1 101 ? 115.416 -3.186  190.358 1.00 54.54  ? 101  PHE D N     1 
ATOM   3130 C  CA    . PHE D  1 101 ? 114.764 -4.333  190.998 1.00 56.60  ? 101  PHE D CA    1 
ATOM   3131 C  C     . PHE D  1 101 ? 114.128 -5.284  189.970 1.00 60.30  ? 101  PHE D C     1 
ATOM   3132 O  O     . PHE D  1 101 ? 113.443 -4.847  189.034 1.00 55.19  ? 101  PHE D O     1 
ATOM   3133 C  CB    . PHE D  1 101 ? 113.688 -3.869  191.990 1.00 54.54  ? 101  PHE D CB    1 
ATOM   3134 C  CG    . PHE D  1 101 ? 114.209 -3.529  193.362 1.00 53.20  ? 101  PHE D CG    1 
ATOM   3135 C  CD1   . PHE D  1 101 ? 115.558 -3.261  193.576 1.00 51.07  ? 101  PHE D CD1   1 
ATOM   3136 C  CD2   . PHE D  1 101 ? 113.335 -3.497  194.451 1.00 54.80  ? 101  PHE D CD2   1 
ATOM   3137 C  CE1   . PHE D  1 101 ? 116.033 -2.950  194.856 1.00 51.45  ? 101  PHE D CE1   1 
ATOM   3138 C  CE2   . PHE D  1 101 ? 113.789 -3.196  195.736 1.00 50.85  ? 101  PHE D CE2   1 
ATOM   3139 C  CZ    . PHE D  1 101 ? 115.138 -2.917  195.942 1.00 55.53  ? 101  PHE D CZ    1 
ATOM   3140 N  N     . ASN D  1 102 ? 114.360 -6.583  190.147 1.00 60.02  ? 102  ASN D N     1 
ATOM   3141 C  CA    . ASN D  1 102 ? 113.738 -7.584  189.288 1.00 58.68  ? 102  ASN D CA    1 
ATOM   3142 C  C     . ASN D  1 102 ? 112.334 -7.867  189.791 1.00 59.68  ? 102  ASN D C     1 
ATOM   3143 O  O     . ASN D  1 102 ? 111.946 -7.349  190.840 1.00 58.52  ? 102  ASN D O     1 
ATOM   3144 C  CB    . ASN D  1 102 ? 114.585 -8.868  189.226 1.00 55.14  ? 102  ASN D CB    1 
ATOM   3145 C  CG    . ASN D  1 102 ? 114.735 -9.559  190.584 1.00 65.74  ? 102  ASN D CG    1 
ATOM   3146 O  OD1   . ASN D  1 102 ? 113.802 -9.600  191.391 1.00 60.09  ? 102  ASN D OD1   1 
ATOM   3147 N  ND2   . ASN D  1 102 ? 115.920 -10.114 190.834 1.00 62.25  ? 102  ASN D ND2   1 
ATOM   3148 N  N     . MET D  1 103 ? 111.585 -8.697  189.063 1.00 60.03  ? 103  MET D N     1 
ATOM   3149 C  CA    . MET D  1 103 ? 110.162 -8.897  189.336 1.00 60.89  ? 103  MET D CA    1 
ATOM   3150 C  C     . MET D  1 103 ? 109.925 -9.352  190.779 1.00 57.56  ? 103  MET D C     1 
ATOM   3151 O  O     . MET D  1 103 ? 109.025 -8.857  191.455 1.00 56.25  ? 103  MET D O     1 
ATOM   3152 C  CB    . MET D  1 103 ? 109.556 -9.905  188.352 1.00 62.45  ? 103  MET D CB    1 
ATOM   3153 C  CG    . MET D  1 103 ? 108.098 -10.276 188.653 1.00 66.64  ? 103  MET D CG    1 
ATOM   3154 S  SD    . MET D  1 103 ? 107.197 -11.087 187.304 1.00 83.04  ? 103  MET D SD    1 
ATOM   3155 C  CE    . MET D  1 103 ? 105.647 -11.478 188.124 1.00 62.48  ? 103  MET D CE    1 
ATOM   3156 N  N     . ARG D  1 104 ? 110.753 -10.277 191.248 1.00 60.33  ? 104  ARG D N     1 
ATOM   3157 C  CA    . ARG D  1 104 ? 110.596 -10.815 192.591 1.00 61.90  ? 104  ARG D CA    1 
ATOM   3158 C  C     . ARG D  1 104 ? 110.814 -9.733  193.649 1.00 54.55  ? 104  ARG D C     1 
ATOM   3159 O  O     . ARG D  1 104 ? 110.030 -9.630  194.581 1.00 57.63  ? 104  ARG D O     1 
ATOM   3160 C  CB    . ARG D  1 104 ? 111.545 -11.990 192.816 1.00 63.68  ? 104  ARG D CB    1 
ATOM   3161 C  CG    . ARG D  1 104 ? 110.968 -13.320 192.349 1.00 71.48  ? 104  ARG D CG    1 
ATOM   3162 C  CD    . ARG D  1 104 ? 111.949 -14.454 192.571 1.00 85.42  ? 104  ARG D CD    1 
ATOM   3163 N  NE    . ARG D  1 104 ? 112.016 -14.827 193.983 1.00 94.37  ? 104  ARG D NE    1 
ATOM   3164 C  CZ    . ARG D  1 104 ? 111.707 -16.033 194.447 1.00 95.16  ? 104  ARG D CZ    1 
ATOM   3165 N  NH1   . ARG D  1 104 ? 111.319 -16.987 193.606 1.00 94.88  ? 104  ARG D NH1   1 
ATOM   3166 N  NH2   . ARG D  1 104 ? 111.781 -16.287 195.747 1.00 91.01  ? 104  ARG D NH2   1 
ATOM   3167 N  N     . GLU D  1 105 ? 111.850 -8.916  193.475 1.00 51.49  ? 105  GLU D N     1 
ATOM   3168 C  CA    . GLU D  1 105 ? 112.137 -7.822  194.398 1.00 55.13  ? 105  GLU D CA    1 
ATOM   3169 C  C     . GLU D  1 105 ? 111.052 -6.732  194.389 1.00 54.97  ? 105  GLU D C     1 
ATOM   3170 O  O     . GLU D  1 105 ? 110.732 -6.165  195.441 1.00 52.85  ? 105  GLU D O     1 
ATOM   3171 C  CB    . GLU D  1 105 ? 113.496 -7.199  194.077 1.00 50.49  ? 105  GLU D CB    1 
ATOM   3172 C  CG    . GLU D  1 105 ? 114.664 -8.156  194.227 1.00 54.48  ? 105  GLU D CG    1 
ATOM   3173 C  CD    . GLU D  1 105 ? 115.934 -7.623  193.592 1.00 57.52  ? 105  GLU D CD    1 
ATOM   3174 O  OE1   . GLU D  1 105 ? 115.859 -7.089  192.478 1.00 59.25  ? 105  GLU D OE1   1 
ATOM   3175 O  OE2   . GLU D  1 105 ? 117.015 -7.746  194.192 1.00 63.46  ? 105  GLU D OE2   1 
ATOM   3176 N  N     . GLN D  1 106 ? 110.492 -6.446  193.213 1.00 54.07  ? 106  GLN D N     1 
ATOM   3177 C  CA    . GLN D  1 106 ? 109.435 -5.442  193.078 1.00 54.09  ? 106  GLN D CA    1 
ATOM   3178 C  C     . GLN D  1 106 ? 108.209 -5.818  193.896 1.00 55.22  ? 106  GLN D C     1 
ATOM   3179 O  O     . GLN D  1 106 ? 107.620 -4.989  194.589 1.00 54.19  ? 106  GLN D O     1 
ATOM   3180 C  CB    . GLN D  1 106 ? 109.035 -5.261  191.615 1.00 54.61  ? 106  GLN D CB    1 
ATOM   3181 C  CG    . GLN D  1 106 ? 110.177 -4.784  190.714 1.00 59.68  ? 106  GLN D CG    1 
ATOM   3182 C  CD    . GLN D  1 106 ? 109.821 -4.795  189.235 1.00 57.88  ? 106  GLN D CD    1 
ATOM   3183 O  OE1   . GLN D  1 106 ? 108.657 -4.894  188.869 1.00 55.90  ? 106  GLN D OE1   1 
ATOM   3184 N  NE2   . GLN D  1 106 ? 110.833 -4.694  188.383 1.00 56.47  ? 106  GLN D NE2   1 
ATOM   3185 N  N     . ILE D  1 107 ? 107.830 -7.081  193.818 1.00 53.99  ? 107  ILE D N     1 
ATOM   3186 C  CA    . ILE D  1 107 ? 106.652 -7.548  194.530 1.00 56.96  ? 107  ILE D CA    1 
ATOM   3187 C  C     . ILE D  1 107 ? 106.894 -7.539  196.048 1.00 54.22  ? 107  ILE D C     1 
ATOM   3188 O  O     . ILE D  1 107 ? 106.047 -7.068  196.813 1.00 54.36  ? 107  ILE D O     1 
ATOM   3189 C  CB    . ILE D  1 107 ? 106.252 -8.953  194.030 1.00 62.05  ? 107  ILE D CB    1 
ATOM   3190 C  CG1   . ILE D  1 107 ? 105.760 -8.844  192.574 1.00 65.64  ? 107  ILE D CG1   1 
ATOM   3191 C  CG2   . ILE D  1 107 ? 105.203 -9.578  194.942 1.00 66.13  ? 107  ILE D CG2   1 
ATOM   3192 C  CD1   . ILE D  1 107 ? 105.098 -10.076 192.036 1.00 63.24  ? 107  ILE D CD1   1 
ATOM   3193 N  N     . ALA D  1 108 ? 108.059 -8.030  196.466 1.00 46.27  ? 108  ALA D N     1 
ATOM   3194 C  CA    . ALA D  1 108 ? 108.454 -7.987  197.861 1.00 52.50  ? 108  ALA D CA    1 
ATOM   3195 C  C     . ALA D  1 108 ? 108.435 -6.553  198.400 1.00 52.92  ? 108  ALA D C     1 
ATOM   3196 O  O     . ALA D  1 108 ? 107.886 -6.304  199.482 1.00 51.40  ? 108  ALA D O     1 
ATOM   3197 C  CB    . ALA D  1 108 ? 109.830 -8.608  198.042 1.00 48.83  ? 108  ALA D CB    1 
ATOM   3198 N  N     . PHE D  1 109 ? 109.026 -5.617  197.652 1.00 47.82  ? 109  PHE D N     1 
ATOM   3199 C  CA    . PHE D  1 109 ? 109.114 -4.227  198.098 1.00 43.06  ? 109  PHE D CA    1 
ATOM   3200 C  C     . PHE D  1 109 ? 107.735 -3.601  198.188 1.00 45.89  ? 109  PHE D C     1 
ATOM   3201 O  O     . PHE D  1 109 ? 107.400 -2.931  199.167 1.00 45.67  ? 109  PHE D O     1 
ATOM   3202 C  CB    . PHE D  1 109 ? 110.000 -3.401  197.164 1.00 47.80  ? 109  PHE D CB    1 
ATOM   3203 C  CG    . PHE D  1 109 ? 110.110 -1.956  197.560 1.00 47.28  ? 109  PHE D CG    1 
ATOM   3204 C  CD1   . PHE D  1 109 ? 111.046 -1.551  198.513 1.00 46.18  ? 109  PHE D CD1   1 
ATOM   3205 C  CD2   . PHE D  1 109 ? 109.282 -1.000  196.991 1.00 44.66  ? 109  PHE D CD2   1 
ATOM   3206 C  CE1   . PHE D  1 109 ? 111.152 -0.211  198.894 1.00 41.87  ? 109  PHE D CE1   1 
ATOM   3207 C  CE2   . PHE D  1 109 ? 109.371 0.335   197.363 1.00 43.49  ? 109  PHE D CE2   1 
ATOM   3208 C  CZ    . PHE D  1 109 ? 110.309 0.734   198.310 1.00 47.27  ? 109  PHE D CZ    1 
ATOM   3209 N  N     . ILE D  1 110 ? 106.936 -3.815  197.153 1.00 48.28  ? 110  ILE D N     1 
ATOM   3210 C  CA    . ILE D  1 110 ? 105.581 -3.306  197.154 1.00 52.39  ? 110  ILE D CA    1 
ATOM   3211 C  C     . ILE D  1 110 ? 104.802 -3.889  198.331 1.00 48.33  ? 110  ILE D C     1 
ATOM   3212 O  O     . ILE D  1 110 ? 104.076 -3.170  199.010 1.00 43.38  ? 110  ILE D O     1 
ATOM   3213 C  CB    . ILE D  1 110 ? 104.856 -3.621  195.853 1.00 48.55  ? 110  ILE D CB    1 
ATOM   3214 C  CG1   . ILE D  1 110 ? 105.500 -2.861  194.700 1.00 55.40  ? 110  ILE D CG1   1 
ATOM   3215 C  CG2   . ILE D  1 110 ? 103.409 -3.213  195.959 1.00 49.27  ? 110  ILE D CG2   1 
ATOM   3216 C  CD1   . ILE D  1 110 ? 104.934 -3.242  193.339 1.00 57.74  ? 110  ILE D CD1   1 
ATOM   3217 N  N     . LYS D  1 111 ? 104.969 -5.189  198.557 1.00 47.26  ? 111  LYS D N     1 
ATOM   3218 C  CA    . LYS D  1 111 ? 104.319 -5.882  199.668 1.00 50.71  ? 111  LYS D CA    1 
ATOM   3219 C  C     . LYS D  1 111 ? 104.642 -5.195  200.994 1.00 51.51  ? 111  LYS D C     1 
ATOM   3220 O  O     . LYS D  1 111 ? 103.732 -4.820  201.735 1.00 46.48  ? 111  LYS D O     1 
ATOM   3221 C  CB    . LYS D  1 111 ? 104.752 -7.355  199.701 1.00 55.23  ? 111  LYS D CB    1 
ATOM   3222 C  CG    . LYS D  1 111 ? 103.944 -8.251  200.628 1.00 65.67  ? 111  LYS D CG    1 
ATOM   3223 C  CD    . LYS D  1 111 ? 103.725 -9.628  199.999 1.00 74.31  ? 111  LYS D CD    1 
ATOM   3224 C  CE    . LYS D  1 111 ? 105.005 -10.210 199.416 1.00 78.28  ? 111  LYS D CE    1 
ATOM   3225 N  NZ    . LYS D  1 111 ? 104.800 -11.589 198.874 1.00 86.55  ? 111  LYS D NZ    1 
ATOM   3226 N  N     . GLY D  1 112 ? 105.942 -5.005  201.249 1.00 48.96  ? 112  GLY D N     1 
ATOM   3227 C  CA    . GLY D  1 112 ? 106.438 -4.389  202.466 1.00 44.81  ? 112  GLY D CA    1 
ATOM   3228 C  C     . GLY D  1 112 ? 106.012 -2.942  202.643 1.00 46.55  ? 112  GLY D C     1 
ATOM   3229 O  O     . GLY D  1 112 ? 105.623 -2.525  203.743 1.00 45.00  ? 112  GLY D O     1 
ATOM   3230 N  N     . LEU D  1 113 ? 106.087 -2.175  201.561 1.00 44.11  ? 113  LEU D N     1 
ATOM   3231 C  CA    . LEU D  1 113 ? 105.624 -0.791  201.564 1.00 46.27  ? 113  LEU D CA    1 
ATOM   3232 C  C     . LEU D  1 113 ? 104.117 -0.704  201.809 1.00 46.28  ? 113  LEU D C     1 
ATOM   3233 O  O     . LEU D  1 113 ? 103.641 0.269   202.395 1.00 45.04  ? 113  LEU D O     1 
ATOM   3234 C  CB    . LEU D  1 113 ? 105.988 -0.088  200.239 1.00 42.24  ? 113  LEU D CB    1 
ATOM   3235 C  CG    . LEU D  1 113 ? 105.672 1.414   200.210 1.00 43.46  ? 113  LEU D CG    1 
ATOM   3236 C  CD1   . LEU D  1 113 ? 106.580 2.143   201.182 1.00 42.23  ? 113  LEU D CD1   1 
ATOM   3237 C  CD2   . LEU D  1 113 ? 105.775 2.048   198.820 1.00 35.82  ? 113  LEU D CD2   1 
ATOM   3238 N  N     . TYR D  1 114 ? 103.366 -1.714  201.370 1.00 43.91  ? 114  TYR D N     1 
ATOM   3239 C  CA    . TYR D  1 114 ? 101.936 -1.692  201.606 1.00 43.26  ? 114  TYR D CA    1 
ATOM   3240 C  C     . TYR D  1 114 ? 101.642 -1.987  203.077 1.00 48.00  ? 114  TYR D C     1 
ATOM   3241 O  O     . TYR D  1 114 ? 100.782 -1.343  203.677 1.00 44.84  ? 114  TYR D O     1 
ATOM   3242 C  CB    . TYR D  1 114 ? 101.169 -2.675  200.701 1.00 51.27  ? 114  TYR D CB    1 
ATOM   3243 C  CG    . TYR D  1 114 ? 99.687  -2.327  200.660 1.00 52.40  ? 114  TYR D CG    1 
ATOM   3244 C  CD1   . TYR D  1 114 ? 98.816  -2.775  201.655 1.00 45.01  ? 114  TYR D CD1   1 
ATOM   3245 C  CD2   . TYR D  1 114 ? 99.173  -1.500  199.664 1.00 44.68  ? 114  TYR D CD2   1 
ATOM   3246 C  CE1   . TYR D  1 114 ? 97.462  -2.424  201.650 1.00 45.88  ? 114  TYR D CE1   1 
ATOM   3247 C  CE2   . TYR D  1 114 ? 97.834  -1.146  199.644 1.00 49.27  ? 114  TYR D CE2   1 
ATOM   3248 C  CZ    . TYR D  1 114 ? 96.973  -1.611  200.643 1.00 53.37  ? 114  TYR D CZ    1 
ATOM   3249 O  OH    . TYR D  1 114 ? 95.633  -1.260  200.628 1.00 47.07  ? 114  TYR D OH    1 
ATOM   3250 N  N     . VAL D  1 115 ? 102.356 -2.942  203.660 1.00 44.97  ? 115  VAL D N     1 
ATOM   3251 C  CA    . VAL D  1 115 ? 102.183 -3.232  205.077 1.00 42.48  ? 115  VAL D CA    1 
ATOM   3252 C  C     . VAL D  1 115 ? 102.428 -1.980  205.906 1.00 43.14  ? 115  VAL D C     1 
ATOM   3253 O  O     . VAL D  1 115 ? 101.667 -1.671  206.835 1.00 47.62  ? 115  VAL D O     1 
ATOM   3254 C  CB    . VAL D  1 115 ? 103.120 -4.346  205.561 1.00 44.97  ? 115  VAL D CB    1 
ATOM   3255 C  CG1   . VAL D  1 115 ? 103.015 -4.497  207.069 1.00 39.37  ? 115  VAL D CG1   1 
ATOM   3256 C  CG2   . VAL D  1 115 ? 102.799 -5.647  204.861 1.00 42.13  ? 115  VAL D CG2   1 
ATOM   3257 N  N     . ALA D  1 116 ? 103.478 -1.252  205.557 1.00 41.05  ? 116  ALA D N     1 
ATOM   3258 C  CA    . ALA D  1 116 ? 103.789 -0.010  206.231 1.00 40.98  ? 116  ALA D CA    1 
ATOM   3259 C  C     . ALA D  1 116 ? 102.740 1.059   205.950 1.00 44.52  ? 116  ALA D C     1 
ATOM   3260 O  O     . ALA D  1 116 ? 102.138 1.596   206.869 1.00 42.38  ? 116  ALA D O     1 
ATOM   3261 C  CB    . ALA D  1 116 ? 105.184 0.493   205.823 1.00 38.09  ? 116  ALA D CB    1 
ATOM   3262 N  N     . GLU D  1 117 ? 102.499 1.349   204.678 1.00 45.66  ? 117  GLU D N     1 
ATOM   3263 C  CA    . GLU D  1 117 ? 101.813 2.590   204.318 1.00 49.16  ? 117  GLU D CA    1 
ATOM   3264 C  C     . GLU D  1 117 ? 100.445 2.414   203.700 1.00 45.48  ? 117  GLU D C     1 
ATOM   3265 O  O     . GLU D  1 117 ? 99.799  3.394   203.360 1.00 50.46  ? 117  GLU D O     1 
ATOM   3266 C  CB    . GLU D  1 117 ? 102.667 3.404   203.333 1.00 46.72  ? 117  GLU D CB    1 
ATOM   3267 C  CG    . GLU D  1 117 ? 104.128 3.558   203.713 1.00 46.78  ? 117  GLU D CG    1 
ATOM   3268 C  CD    . GLU D  1 117 ? 104.342 4.596   204.800 1.00 49.61  ? 117  GLU D CD    1 
ATOM   3269 O  OE1   . GLU D  1 117 ? 103.745 4.453   205.887 1.00 55.06  ? 117  GLU D OE1   1 
ATOM   3270 O  OE2   . GLU D  1 117 ? 105.090 5.559   204.569 1.00 46.62  ? 117  GLU D OE2   1 
ATOM   3271 N  N     . GLY D  1 118 ? 100.018 1.175   203.526 1.00 42.28  ? 118  GLY D N     1 
ATOM   3272 C  CA    . GLY D  1 118 ? 98.825  0.910   202.747 1.00 50.40  ? 118  GLY D CA    1 
ATOM   3273 C  C     . GLY D  1 118 ? 97.516  0.928   203.508 1.00 53.82  ? 118  GLY D C     1 
ATOM   3274 O  O     . GLY D  1 118 ? 97.493  0.858   204.739 1.00 51.71  ? 118  GLY D O     1 
ATOM   3275 N  N     . ASP D  1 119 ? 96.424  1.020   202.752 1.00 55.01  ? 119  ASP D N     1 
ATOM   3276 C  CA    . ASP D  1 119 ? 95.068  0.941   203.291 1.00 55.49  ? 119  ASP D CA    1 
ATOM   3277 C  C     . ASP D  1 119 ? 94.816  -0.476  203.809 1.00 56.22  ? 119  ASP D C     1 
ATOM   3278 O  O     . ASP D  1 119 ? 94.636  -1.409  203.030 1.00 53.39  ? 119  ASP D O     1 
ATOM   3279 C  CB    . ASP D  1 119 ? 94.056  1.337   202.200 1.00 60.19  ? 119  ASP D CB    1 
ATOM   3280 C  CG    . ASP D  1 119 ? 92.625  1.491   202.723 1.00 58.67  ? 119  ASP D CG    1 
ATOM   3281 O  OD1   . ASP D  1 119 ? 92.158  0.624   203.486 1.00 52.24  ? 119  ASP D OD1   1 
ATOM   3282 O  OD2   . ASP D  1 119 ? 91.968  2.491   202.348 1.00 57.49  ? 119  ASP D OD2   1 
ATOM   3283 N  N     . LYS D  1 120 ? 94.808  -0.648  205.125 1.00 58.78  ? 120  LYS D N     1 
ATOM   3284 C  CA    . LYS D  1 120 ? 94.747  -2.004  205.675 1.00 61.11  ? 120  LYS D CA    1 
ATOM   3285 C  C     . LYS D  1 120 ? 93.334  -2.615  205.735 1.00 63.01  ? 120  LYS D C     1 
ATOM   3286 O  O     . LYS D  1 120 ? 93.195  -3.814  205.957 1.00 65.04  ? 120  LYS D O     1 
ATOM   3287 C  CB    . LYS D  1 120 ? 95.408  -2.034  207.058 1.00 60.28  ? 120  LYS D CB    1 
ATOM   3288 C  CG    . LYS D  1 120 ? 96.885  -2.465  206.981 1.00 62.13  ? 120  LYS D CG    1 
ATOM   3289 C  CD    . LYS D  1 120 ? 97.713  -1.919  208.124 1.00 66.78  ? 120  LYS D CD    1 
ATOM   3290 C  CE    . LYS D  1 120 ? 98.490  -0.682  207.706 1.00 63.11  ? 120  LYS D CE    1 
ATOM   3291 N  NZ    . LYS D  1 120 ? 98.991  0.042   208.923 1.00 64.10  ? 120  LYS D NZ    1 
ATOM   3292 N  N     . THR D  1 121 ? 92.296  -1.819  205.492 1.00 57.33  ? 121  THR D N     1 
ATOM   3293 C  CA    . THR D  1 121 ? 90.944  -2.375  205.408 1.00 63.45  ? 121  THR D CA    1 
ATOM   3294 C  C     . THR D  1 121 ? 90.742  -3.187  204.118 1.00 65.46  ? 121  THR D C     1 
ATOM   3295 O  O     . THR D  1 121 ? 89.833  -4.007  204.030 1.00 65.69  ? 121  THR D O     1 
ATOM   3296 C  CB    . THR D  1 121 ? 89.848  -1.278  205.444 1.00 62.26  ? 121  THR D CB    1 
ATOM   3297 O  OG1   . THR D  1 121 ? 89.698  -0.694  204.140 1.00 64.51  ? 121  THR D OG1   1 
ATOM   3298 C  CG2   . THR D  1 121 ? 90.195  -0.185  206.455 1.00 56.66  ? 121  THR D CG2   1 
ATOM   3299 N  N     . LEU D  1 122 ? 91.570  -2.914  203.108 1.00 68.76  ? 122  LEU D N     1 
ATOM   3300 C  CA    . LEU D  1 122 ? 91.448  -3.490  201.754 1.00 68.51  ? 122  LEU D CA    1 
ATOM   3301 C  C     . LEU D  1 122 ? 90.092  -3.205  201.054 1.00 74.46  ? 122  LEU D C     1 
ATOM   3302 O  O     . LEU D  1 122 ? 89.886  -3.611  199.899 1.00 75.30  ? 122  LEU D O     1 
ATOM   3303 C  CB    . LEU D  1 122 ? 91.706  -5.006  201.786 1.00 70.59  ? 122  LEU D CB    1 
ATOM   3304 C  CG    . LEU D  1 122 ? 93.101  -5.477  202.216 1.00 71.10  ? 122  LEU D CG    1 
ATOM   3305 C  CD1   . LEU D  1 122 ? 93.176  -6.996  202.208 1.00 68.97  ? 122  LEU D CD1   1 
ATOM   3306 C  CD2   . LEU D  1 122 ? 94.186  -4.874  201.337 1.00 65.95  ? 122  LEU D CD2   1 
ATOM   3307 N  N     . LYS D  1 123 ? 89.182  -2.517  201.748 1.00 72.72  ? 123  LYS D N     1 
ATOM   3308 C  CA    . LYS D  1 123 ? 87.982  -1.963  201.130 1.00 69.87  ? 123  LYS D CA    1 
ATOM   3309 C  C     . LYS D  1 123 ? 88.410  -1.044  199.996 1.00 72.40  ? 123  LYS D C     1 
ATOM   3310 O  O     . LYS D  1 123 ? 87.774  -0.987  198.936 1.00 73.78  ? 123  LYS D O     1 
ATOM   3311 C  CB    . LYS D  1 123 ? 87.144  -1.186  202.145 1.00 68.59  ? 123  LYS D CB    1 
ATOM   3312 C  CG    . LYS D  1 123 ? 86.602  -2.028  203.290 1.00 75.02  ? 123  LYS D CG    1 
ATOM   3313 C  CD    . LYS D  1 123 ? 85.520  -1.285  204.086 1.00 81.89  ? 123  LYS D CD    1 
ATOM   3314 C  CE    . LYS D  1 123 ? 84.845  -0.175  203.270 1.00 83.82  ? 123  LYS D CE    1 
ATOM   3315 N  NZ    . LYS D  1 123 ? 84.266  0.903   204.144 1.00 92.00  ? 123  LYS D NZ    1 
ATOM   3316 N  N     . ARG D  1 124 ? 89.495  -0.313  200.241 1.00 67.35  ? 124  ARG D N     1 
ATOM   3317 C  CA    . ARG D  1 124 ? 90.154  0.469   199.203 1.00 68.57  ? 124  ARG D CA    1 
ATOM   3318 C  C     . ARG D  1 124 ? 91.617  0.082   199.162 1.00 60.08  ? 124  ARG D C     1 
ATOM   3319 O  O     . ARG D  1 124 ? 92.129  -0.487  200.116 1.00 62.47  ? 124  ARG D O     1 
ATOM   3320 C  CB    . ARG D  1 124 ? 89.984  1.960   199.456 1.00 64.30  ? 124  ARG D CB    1 
ATOM   3321 C  CG    . ARG D  1 124 ? 88.539  2.360   199.513 1.00 65.39  ? 124  ARG D CG    1 
ATOM   3322 C  CD    . ARG D  1 124 ? 88.371  3.739   200.077 1.00 62.36  ? 124  ARG D CD    1 
ATOM   3323 N  NE    . ARG D  1 124 ? 88.746  4.749   199.101 1.00 64.61  ? 124  ARG D NE    1 
ATOM   3324 C  CZ    . ARG D  1 124 ? 88.421  6.031   199.216 1.00 69.74  ? 124  ARG D CZ    1 
ATOM   3325 N  NH1   . ARG D  1 124 ? 87.716  6.430   200.274 1.00 62.60  ? 124  ARG D NH1   1 
ATOM   3326 N  NH2   . ARG D  1 124 ? 88.797  6.906   198.281 1.00 67.04  ? 124  ARG D NH2   1 
ATOM   3327 N  N     . LEU D  1 125 ? 92.281  0.359   198.049 1.00 58.84  ? 125  LEU D N     1 
ATOM   3328 C  CA    . LEU D  1 125 ? 93.683  -0.021  197.898 1.00 58.84  ? 125  LEU D CA    1 
ATOM   3329 C  C     . LEU D  1 125 ? 94.541  1.219   197.670 1.00 60.79  ? 125  LEU D C     1 
ATOM   3330 O  O     . LEU D  1 125 ? 94.690  1.687   196.531 1.00 59.23  ? 125  LEU D O     1 
ATOM   3331 C  CB    . LEU D  1 125 ? 93.855  -1.026  196.754 1.00 61.71  ? 125  LEU D CB    1 
ATOM   3332 C  CG    . LEU D  1 125 ? 93.135  -2.374  196.911 1.00 63.78  ? 125  LEU D CG    1 
ATOM   3333 C  CD1   . LEU D  1 125 ? 93.339  -3.253  195.696 1.00 57.61  ? 125  LEU D CD1   1 
ATOM   3334 C  CD2   . LEU D  1 125 ? 93.568  -3.117  198.170 1.00 61.00  ? 125  LEU D CD2   1 
ATOM   3335 N  N     . ARG D  1 126 ? 95.099  1.738   198.769 1.00 56.97  ? 126  ARG D N     1 
ATOM   3336 C  CA    . ARG D  1 126 ? 95.816  3.011   198.775 1.00 53.74  ? 126  ARG D CA    1 
ATOM   3337 C  C     . ARG D  1 126 ? 97.179  2.938   199.476 1.00 54.17  ? 126  ARG D C     1 
ATOM   3338 O  O     . ARG D  1 126 ? 97.318  2.337   200.533 1.00 51.54  ? 126  ARG D O     1 
ATOM   3339 C  CB    . ARG D  1 126 ? 94.959  4.090   199.445 1.00 53.16  ? 126  ARG D CB    1 
ATOM   3340 C  CG    . ARG D  1 126 ? 93.586  4.259   198.825 1.00 53.91  ? 126  ARG D CG    1 
ATOM   3341 C  CD    . ARG D  1 126 ? 92.764  5.302   199.554 1.00 52.53  ? 126  ARG D CD    1 
ATOM   3342 N  NE    . ARG D  1 126 ? 92.206  4.789   200.801 1.00 57.04  ? 126  ARG D NE    1 
ATOM   3343 C  CZ    . ARG D  1 126 ? 91.527  5.526   201.675 1.00 57.22  ? 126  ARG D CZ    1 
ATOM   3344 N  NH1   . ARG D  1 126 ? 91.318  6.816   201.440 1.00 54.94  ? 126  ARG D NH1   1 
ATOM   3345 N  NH2   . ARG D  1 126 ? 91.060  4.977   202.783 1.00 55.34  ? 126  ARG D NH2   1 
ATOM   3346 N  N     . ILE D  1 127 ? 98.180  3.559   198.862 1.00 55.84  ? 127  ILE D N     1 
ATOM   3347 C  CA    . ILE D  1 127 ? 99.494  3.727   199.466 1.00 54.08  ? 127  ILE D CA    1 
ATOM   3348 C  C     . ILE D  1 127 ? 99.825  5.212   199.559 1.00 54.20  ? 127  ILE D C     1 
ATOM   3349 O  O     . ILE D  1 127 ? 99.834  5.924   198.546 1.00 51.76  ? 127  ILE D O     1 
ATOM   3350 C  CB    . ILE D  1 127 ? 100.597 3.004   198.657 1.00 54.71  ? 127  ILE D CB    1 
ATOM   3351 C  CG1   . ILE D  1 127 ? 100.200 1.552   198.425 1.00 50.86  ? 127  ILE D CG1   1 
ATOM   3352 C  CG2   . ILE D  1 127 ? 101.949 3.108   199.358 1.00 43.20  ? 127  ILE D CG2   1 
ATOM   3353 C  CD1   . ILE D  1 127 ? 101.205 0.783   197.664 1.00 45.99  ? 127  ILE D CD1   1 
ATOM   3354 N  N     . TRP D  1 128 ? 100.094 5.667   200.778 0.94 46.48  ? 128  TRP D N     1 
ATOM   3355 C  CA    . TRP D  1 128 ? 100.406 7.068   201.043 0.94 47.39  ? 128  TRP D CA    1 
ATOM   3356 C  C     . TRP D  1 128 ? 101.913 7.329   201.209 0.94 50.03  ? 128  TRP D C     1 
ATOM   3357 O  O     . TRP D  1 128 ? 102.619 6.565   201.870 0.94 46.68  ? 128  TRP D O     1 
ATOM   3358 C  CB    . TRP D  1 128 ? 99.684  7.537   202.308 0.94 49.00  ? 128  TRP D CB    1 
ATOM   3359 C  CG    . TRP D  1 128 ? 98.182  7.628   202.210 0.94 56.16  ? 128  TRP D CG    1 
ATOM   3360 C  CD1   . TRP D  1 128 ? 97.454  8.709   201.802 1.00 53.49  ? 128  TRP D CD1   1 
ATOM   3361 C  CD2   . TRP D  1 128 ? 97.225  6.610   202.558 1.00 52.69  ? 128  TRP D CD2   1 
ATOM   3362 N  NE1   . TRP D  1 128 ? 96.111  8.429   201.870 1.00 57.47  ? 128  TRP D NE1   1 
ATOM   3363 C  CE2   . TRP D  1 128 ? 95.942  7.150   202.330 1.00 53.97  ? 128  TRP D CE2   1 
ATOM   3364 C  CE3   . TRP D  1 128 ? 97.332  5.301   203.037 1.00 50.43  ? 128  TRP D CE3   1 
ATOM   3365 C  CZ2   . TRP D  1 128 ? 94.772  6.423   202.560 1.00 50.68  ? 128  TRP D CZ2   1 
ATOM   3366 C  CZ3   . TRP D  1 128 ? 96.165  4.579   203.268 1.00 53.00  ? 128  TRP D CZ3   1 
ATOM   3367 C  CH2   . TRP D  1 128 ? 94.903  5.145   203.026 1.00 53.53  ? 128  TRP D CH2   1 
ATOM   3368 N  N     . ASN D  1 129 ? 102.390 8.429   200.639 1.00 45.03  ? 129  ASN D N     1 
ATOM   3369 C  CA    . ASN D  1 129 ? 103.752 8.875   200.874 1.00 48.97  ? 129  ASN D CA    1 
ATOM   3370 C  C     . ASN D  1 129 ? 103.971 10.297  200.360 1.00 52.21  ? 129  ASN D C     1 
ATOM   3371 O  O     . ASN D  1 129 ? 103.306 10.734  199.416 1.00 51.56  ? 129  ASN D O     1 
ATOM   3372 C  CB    . ASN D  1 129 ? 104.761 7.919   200.215 1.00 44.31  ? 129  ASN D CB    1 
ATOM   3373 C  CG    . ASN D  1 129 ? 106.056 7.814   201.006 1.00 49.39  ? 129  ASN D CG    1 
ATOM   3374 O  OD1   . ASN D  1 129 ? 107.027 8.523   200.726 1.00 43.95  ? 129  ASN D OD1   1 
ATOM   3375 N  ND2   . ASN D  1 129 ? 106.067 6.946   202.015 1.00 44.73  ? 129  ASN D ND2   1 
ATOM   3376 N  N     . LYS D  1 130 ? 104.903 11.022  200.972 1.00 49.09  ? 130  LYS D N     1 
ATOM   3377 C  CA    . LYS D  1 130 ? 105.249 12.344  200.467 1.00 46.73  ? 130  LYS D CA    1 
ATOM   3378 C  C     . LYS D  1 130 ? 106.235 12.245  199.326 1.00 49.85  ? 130  LYS D C     1 
ATOM   3379 O  O     . LYS D  1 130 ? 106.437 13.219  198.607 1.00 47.96  ? 130  LYS D O     1 
ATOM   3380 C  CB    . LYS D  1 130 ? 105.817 13.217  201.574 1.00 45.14  ? 130  LYS D CB    1 
ATOM   3381 C  CG    . LYS D  1 130 ? 104.820 13.490  202.686 1.00 51.02  ? 130  LYS D CG    1 
ATOM   3382 C  CD    . LYS D  1 130 ? 105.382 14.470  203.670 1.00 53.32  ? 130  LYS D CD    1 
ATOM   3383 C  CE    . LYS D  1 130 ? 105.942 15.689  202.965 1.00 55.64  ? 130  LYS D CE    1 
ATOM   3384 N  NZ    . LYS D  1 130 ? 106.242 16.753  203.970 1.00 66.99  ? 130  LYS D NZ    1 
ATOM   3385 N  N     . ASN D  1 131 ? 106.843 11.067  199.166 1.00 48.70  ? 131  ASN D N     1 
ATOM   3386 C  CA    . ASN D  1 131 ? 107.809 10.815  198.085 1.00 49.06  ? 131  ASN D CA    1 
ATOM   3387 C  C     . ASN D  1 131 ? 107.126 10.449  196.766 1.00 49.21  ? 131  ASN D C     1 
ATOM   3388 O  O     . ASN D  1 131 ? 106.885 9.273   196.488 1.00 48.32  ? 131  ASN D O     1 
ATOM   3389 C  CB    . ASN D  1 131 ? 108.768 9.698   198.491 1.00 46.08  ? 131  ASN D CB    1 
ATOM   3390 C  CG    . ASN D  1 131 ? 110.006 9.618   197.607 1.00 49.77  ? 131  ASN D CG    1 
ATOM   3391 O  OD1   . ASN D  1 131 ? 109.956 9.877   196.409 1.00 49.65  ? 131  ASN D OD1   1 
ATOM   3392 N  ND2   . ASN D  1 131 ? 111.129 9.243   198.210 1.00 44.09  ? 131  ASN D ND2   1 
ATOM   3393 N  N     . LYS D  1 132 ? 106.826 11.453  195.950 1.00 53.75  ? 132  LYS D N     1 
ATOM   3394 C  CA    . LYS D  1 132 ? 106.104 11.218  194.700 1.00 54.67  ? 132  LYS D CA    1 
ATOM   3395 C  C     . LYS D  1 132 ? 106.889 10.320  193.744 1.00 51.23  ? 132  LYS D C     1 
ATOM   3396 O  O     . LYS D  1 132 ? 106.315 9.481   193.046 1.00 52.40  ? 132  LYS D O     1 
ATOM   3397 C  CB    . LYS D  1 132 ? 105.771 12.540  194.010 1.00 54.11  ? 132  LYS D CB    1 
ATOM   3398 C  CG    . LYS D  1 132 ? 104.618 12.426  193.027 1.00 61.18  ? 132  LYS D CG    1 
ATOM   3399 C  CD    . LYS D  1 132 ? 104.517 13.653  192.148 1.00 68.32  ? 132  LYS D CD    1 
ATOM   3400 C  CE    . LYS D  1 132 ? 103.614 13.384  190.950 1.00 75.93  ? 132  LYS D CE    1 
ATOM   3401 N  NZ    . LYS D  1 132 ? 103.751 14.411  189.872 1.00 81.51  ? 132  LYS D NZ    1 
ATOM   3402 N  N     . ALA D  1 133 ? 108.203 10.495  193.724 1.00 48.55  ? 133  ALA D N     1 
ATOM   3403 C  CA    . ALA D  1 133 ? 109.046 9.742   192.803 1.00 46.70  ? 133  ALA D CA    1 
ATOM   3404 C  C     . ALA D  1 133 ? 109.005 8.261   193.151 1.00 49.83  ? 133  ALA D C     1 
ATOM   3405 O  O     . ALA D  1 133 ? 108.976 7.403   192.273 1.00 48.69  ? 133  ALA D O     1 
ATOM   3406 C  CB    . ALA D  1 133 ? 110.469 10.272  192.837 1.00 42.17  ? 133  ALA D CB    1 
ATOM   3407 N  N     . LEU D  1 134 ? 108.974 7.963   194.445 1.00 52.23  ? 134  LEU D N     1 
ATOM   3408 C  CA    . LEU D  1 134 ? 108.939 6.578   194.874 1.00 48.91  ? 134  LEU D CA    1 
ATOM   3409 C  C     . LEU D  1 134 ? 107.616 5.937   194.463 1.00 46.02  ? 134  LEU D C     1 
ATOM   3410 O  O     . LEU D  1 134 ? 107.586 4.798   193.994 1.00 48.43  ? 134  LEU D O     1 
ATOM   3411 C  CB    . LEU D  1 134 ? 109.156 6.477   196.390 1.00 52.87  ? 134  LEU D CB    1 
ATOM   3412 C  CG    . LEU D  1 134 ? 108.825 5.115   196.999 1.00 48.31  ? 134  LEU D CG    1 
ATOM   3413 C  CD1   . LEU D  1 134 ? 109.966 4.160   196.763 1.00 48.19  ? 134  LEU D CD1   1 
ATOM   3414 C  CD2   . LEU D  1 134 ? 108.505 5.255   198.477 1.00 49.00  ? 134  LEU D CD2   1 
ATOM   3415 N  N     . LEU D  1 135 ? 106.522 6.671   194.630 1.00 47.33  ? 135  LEU D N     1 
ATOM   3416 C  CA    . LEU D  1 135 ? 105.215 6.158   194.238 1.00 52.95  ? 135  LEU D CA    1 
ATOM   3417 C  C     . LEU D  1 135 ? 105.154 5.905   192.725 1.00 53.80  ? 135  LEU D C     1 
ATOM   3418 O  O     . LEU D  1 135 ? 104.633 4.883   192.287 1.00 53.91  ? 135  LEU D O     1 
ATOM   3419 C  CB    . LEU D  1 135 ? 104.097 7.113   194.680 1.00 52.83  ? 135  LEU D CB    1 
ATOM   3420 C  CG    . LEU D  1 135 ? 103.836 7.103   196.199 1.00 53.65  ? 135  LEU D CG    1 
ATOM   3421 C  CD1   . LEU D  1 135 ? 102.677 8.018   196.587 1.00 48.71  ? 135  LEU D CD1   1 
ATOM   3422 C  CD2   . LEU D  1 135 ? 103.598 5.687   196.721 1.00 45.85  ? 135  LEU D CD2   1 
ATOM   3423 N  N     . GLU D  1 136 ? 105.720 6.817   191.939 1.00 51.89  ? 136  GLU D N     1 
ATOM   3424 C  CA    . GLU D  1 136 ? 105.727 6.675   190.484 1.00 57.15  ? 136  GLU D CA    1 
ATOM   3425 C  C     . GLU D  1 136 ? 106.480 5.424   190.025 1.00 57.72  ? 136  GLU D C     1 
ATOM   3426 O  O     . GLU D  1 136 ? 106.038 4.736   189.108 1.00 57.61  ? 136  GLU D O     1 
ATOM   3427 C  CB    . GLU D  1 136 ? 106.317 7.931   189.843 1.00 54.93  ? 136  GLU D CB    1 
ATOM   3428 C  CG    . GLU D  1 136 ? 105.332 9.089   189.873 1.00 63.58  ? 136  GLU D CG    1 
ATOM   3429 C  CD    . GLU D  1 136 ? 105.965 10.432  189.585 1.00 70.49  ? 136  GLU D CD    1 
ATOM   3430 O  OE1   . GLU D  1 136 ? 107.182 10.594  189.836 1.00 64.33  ? 136  GLU D OE1   1 
ATOM   3431 O  OE2   . GLU D  1 136 ? 105.234 11.327  189.106 1.00 81.10  ? 136  GLU D OE2   1 
ATOM   3432 N  N     . ILE D  1 137 ? 107.601 5.127   190.677 1.00 57.27  ? 137  ILE D N     1 
ATOM   3433 C  CA    . ILE D  1 137 ? 108.328 3.883   190.433 1.00 57.92  ? 137  ILE D CA    1 
ATOM   3434 C  C     . ILE D  1 137 ? 107.404 2.685   190.651 1.00 56.58  ? 137  ILE D C     1 
ATOM   3435 O  O     . ILE D  1 137 ? 107.263 1.821   189.777 1.00 55.76  ? 137  ILE D O     1 
ATOM   3436 C  CB    . ILE D  1 137 ? 109.564 3.751   191.360 1.00 56.29  ? 137  ILE D CB    1 
ATOM   3437 C  CG1   . ILE D  1 137 ? 110.631 4.776   190.987 1.00 54.39  ? 137  ILE D CG1   1 
ATOM   3438 C  CG2   . ILE D  1 137 ? 110.154 2.353   191.287 1.00 52.37  ? 137  ILE D CG2   1 
ATOM   3439 C  CD1   . ILE D  1 137 ? 111.802 4.801   191.943 1.00 51.47  ? 137  ILE D CD1   1 
ATOM   3440 N  N     . VAL D  1 138 ? 106.778 2.647   191.824 1.00 52.03  ? 138  VAL D N     1 
ATOM   3441 C  CA    . VAL D  1 138 ? 105.853 1.578   192.169 1.00 55.52  ? 138  VAL D CA    1 
ATOM   3442 C  C     . VAL D  1 138 ? 104.707 1.519   191.157 1.00 51.55  ? 138  VAL D C     1 
ATOM   3443 O  O     . VAL D  1 138 ? 104.253 0.440   190.758 1.00 53.90  ? 138  VAL D O     1 
ATOM   3444 C  CB    . VAL D  1 138 ? 105.290 1.757   193.622 1.00 46.38  ? 138  VAL D CB    1 
ATOM   3445 C  CG1   . VAL D  1 138 ? 104.307 0.673   193.941 1.00 45.37  ? 138  VAL D CG1   1 
ATOM   3446 C  CG2   . VAL D  1 138 ? 106.420 1.702   194.632 1.00 46.75  ? 138  VAL D CG2   1 
ATOM   3447 N  N     . SER D  1 139 ? 104.250 2.695   190.749 1.00 49.60  ? 139  SER D N     1 
ATOM   3448 C  CA    . SER D  1 139 ? 103.183 2.826   189.768 1.00 55.20  ? 139  SER D CA    1 
ATOM   3449 C  C     . SER D  1 139 ? 103.553 2.162   188.435 1.00 53.35  ? 139  SER D C     1 
ATOM   3450 O  O     . SER D  1 139 ? 102.744 1.461   187.841 1.00 56.12  ? 139  SER D O     1 
ATOM   3451 C  CB    . SER D  1 139 ? 102.866 4.299   189.552 1.00 55.45  ? 139  SER D CB    1 
ATOM   3452 O  OG    . SER D  1 139 ? 101.776 4.444   188.676 1.00 57.62  ? 139  SER D OG    1 
ATOM   3453 N  N     . ARG D  1 140 ? 104.781 2.375   187.977 1.00 50.17  ? 140  ARG D N     1 
ATOM   3454 C  CA    . ARG D  1 140 ? 105.229 1.746   186.741 1.00 56.69  ? 140  ARG D CA    1 
ATOM   3455 C  C     . ARG D  1 140 ? 105.344 0.235   186.920 1.00 58.94  ? 140  ARG D C     1 
ATOM   3456 O  O     . ARG D  1 140 ? 105.024 -0.520  186.005 1.00 64.50  ? 140  ARG D O     1 
ATOM   3457 C  CB    . ARG D  1 140 ? 106.557 2.343   186.270 1.00 52.38  ? 140  ARG D CB    1 
ATOM   3458 C  CG    . ARG D  1 140 ? 106.491 3.837   186.048 1.00 56.61  ? 140  ARG D CG    1 
ATOM   3459 C  CD    . ARG D  1 140 ? 107.728 4.373   185.341 1.00 60.75  ? 140  ARG D CD    1 
ATOM   3460 N  NE    . ARG D  1 140 ? 108.697 4.931   186.273 1.00 69.98  ? 140  ARG D NE    1 
ATOM   3461 C  CZ    . ARG D  1 140 ? 108.734 6.207   186.653 1.00 77.13  ? 140  ARG D CZ    1 
ATOM   3462 N  NH1   . ARG D  1 140 ? 107.847 7.075   186.169 1.00 69.49  ? 140  ARG D NH1   1 
ATOM   3463 N  NH2   . ARG D  1 140 ? 109.661 6.616   187.522 1.00 71.02  ? 140  ARG D NH2   1 
ATOM   3464 N  N     . TRP D  1 141 ? 105.787 -0.209  188.093 1.00 55.31  ? 141  TRP D N     1 
ATOM   3465 C  CA    . TRP D  1 141 ? 105.866 -1.644  188.377 1.00 56.14  ? 141  TRP D CA    1 
ATOM   3466 C  C     . TRP D  1 141 ? 104.476 -2.264  188.361 1.00 58.27  ? 141  TRP D C     1 
ATOM   3467 O  O     . TRP D  1 141 ? 104.274 -3.345  187.817 1.00 60.38  ? 141  TRP D O     1 
ATOM   3468 C  CB    . TRP D  1 141 ? 106.531 -1.911  189.735 1.00 55.84  ? 141  TRP D CB    1 
ATOM   3469 C  CG    . TRP D  1 141 ? 107.973 -1.547  189.800 1.00 56.16  ? 141  TRP D CG    1 
ATOM   3470 C  CD1   . TRP D  1 141 ? 108.764 -1.157  188.767 1.00 60.21  ? 141  TRP D CD1   1 
ATOM   3471 C  CD2   . TRP D  1 141 ? 108.797 -1.518  190.971 1.00 54.72  ? 141  TRP D CD2   1 
ATOM   3472 N  NE1   . TRP D  1 141 ? 110.032 -0.892  189.214 1.00 63.02  ? 141  TRP D NE1   1 
ATOM   3473 C  CE2   . TRP D  1 141 ? 110.079 -1.104  190.562 1.00 54.36  ? 141  TRP D CE2   1 
ATOM   3474 C  CE3   . TRP D  1 141 ? 108.572 -1.804  192.321 1.00 54.53  ? 141  TRP D CE3   1 
ATOM   3475 C  CZ2   . TRP D  1 141 ? 111.143 -0.970  191.458 1.00 53.69  ? 141  TRP D CZ2   1 
ATOM   3476 C  CZ3   . TRP D  1 141 ? 109.627 -1.669  193.211 1.00 54.35  ? 141  TRP D CZ3   1 
ATOM   3477 C  CH2   . TRP D  1 141 ? 110.900 -1.256  192.773 1.00 57.63  ? 141  TRP D CH2   1 
ATOM   3478 N  N     . LEU D  1 142 ? 103.521 -1.578  188.977 1.00 52.14  ? 142  LEU D N     1 
ATOM   3479 C  CA    . LEU D  1 142 ? 102.158 -2.074  189.015 1.00 59.92  ? 142  LEU D CA    1 
ATOM   3480 C  C     . LEU D  1 142 ? 101.526 -2.117  187.596 1.00 62.41  ? 142  LEU D C     1 
ATOM   3481 O  O     . LEU D  1 142 ? 100.826 -3.074  187.245 1.00 62.49  ? 142  LEU D O     1 
ATOM   3482 C  CB    . LEU D  1 142 ? 101.314 -1.220  189.971 1.00 52.05  ? 142  LEU D CB    1 
ATOM   3483 C  CG    . LEU D  1 142 ? 101.626 -1.362  191.466 1.00 52.68  ? 142  LEU D CG    1 
ATOM   3484 C  CD1   . LEU D  1 142 ? 100.716 -0.478  192.311 1.00 48.80  ? 142  LEU D CD1   1 
ATOM   3485 C  CD2   . LEU D  1 142 ? 101.523 -2.809  191.910 1.00 48.33  ? 142  LEU D CD2   1 
ATOM   3486 N  N     . ASN D  1 143 ? 101.772 -1.093  186.783 1.00 57.97  ? 143  ASN D N     1 
ATOM   3487 C  CA    . ASN D  1 143 ? 101.291 -1.120  185.401 1.00 65.23  ? 143  ASN D CA    1 
ATOM   3488 C  C     . ASN D  1 143 ? 101.865 -2.304  184.640 1.00 60.37  ? 143  ASN D C     1 
ATOM   3489 O  O     . ASN D  1 143 ? 101.125 -3.066  184.021 1.00 64.73  ? 143  ASN D O     1 
ATOM   3490 C  CB    . ASN D  1 143 ? 101.603 0.195   184.683 1.00 55.84  ? 143  ASN D CB    1 
ATOM   3491 C  CG    . ASN D  1 143 ? 100.498 1.223   184.885 1.00 61.40  ? 143  ASN D CG    1 
ATOM   3492 O  OD1   . ASN D  1 143 ? 99.315  0.877   184.844 1.00 64.14  ? 143  ASN D OD1   1 
ATOM   3493 N  ND2   . ASN D  1 143 ? 100.870 2.474   185.144 1.00 58.28  ? 143  ASN D ND2   1 
ATOM   3494 N  N     . ASN D  1 144 ? 103.169 -2.498  184.734 1.00 58.02  ? 144  ASN D N     1 
ATOM   3495 C  CA    . ASN D  1 144 ? 103.783 -3.653  184.104 1.00 60.81  ? 144  ASN D CA    1 
ATOM   3496 C  C     . ASN D  1 144 ? 103.312 -4.974  184.728 1.00 63.49  ? 144  ASN D C     1 
ATOM   3497 O  O     . ASN D  1 144 ? 103.524 -6.045  184.158 1.00 62.69  ? 144  ASN D O     1 
ATOM   3498 C  CB    . ASN D  1 144 ? 105.304 -3.536  184.173 1.00 63.77  ? 144  ASN D CB    1 
ATOM   3499 C  CG    . ASN D  1 144 ? 106.011 -4.699  183.501 1.00 71.30  ? 144  ASN D CG    1 
ATOM   3500 O  OD1   . ASN D  1 144 ? 106.492 -5.617  184.167 1.00 69.97  ? 144  ASN D OD1   1 
ATOM   3501 N  ND2   . ASN D  1 144 ? 106.060 -4.677  182.170 1.00 71.49  ? 144  ASN D ND2   1 
ATOM   3502 N  N     . LEU D  1 145 ? 102.661 -4.904  185.890 1.00 64.10  ? 145  LEU D N     1 
ATOM   3503 C  CA    . LEU D  1 145 ? 102.095 -6.109  186.511 1.00 65.67  ? 145  LEU D CA    1 
ATOM   3504 C  C     . LEU D  1 145 ? 100.609 -6.232  186.217 1.00 62.49  ? 145  LEU D C     1 
ATOM   3505 O  O     . LEU D  1 145 ? 99.936  -7.124  186.729 1.00 65.00  ? 145  LEU D O     1 
ATOM   3506 C  CB    . LEU D  1 145 ? 102.340 -6.123  188.027 1.00 62.14  ? 145  LEU D CB    1 
ATOM   3507 C  CG    . LEU D  1 145 ? 103.792 -6.414  188.440 1.00 60.56  ? 145  LEU D CG    1 
ATOM   3508 C  CD1   . LEU D  1 145 ? 104.045 -6.063  189.901 1.00 59.62  ? 145  LEU D CD1   1 
ATOM   3509 C  CD2   . LEU D  1 145 ? 104.176 -7.864  188.164 1.00 60.08  ? 145  LEU D CD2   1 
ATOM   3510 N  N     . GLY D  1 146 ? 100.102 -5.336  185.383 1.00 61.45  ? 146  GLY D N     1 
ATOM   3511 C  CA    . GLY D  1 146 ? 98.707  -5.383  185.002 1.00 65.51  ? 146  GLY D CA    1 
ATOM   3512 C  C     . GLY D  1 146 ? 97.760  -4.851  186.060 1.00 70.09  ? 146  GLY D C     1 
ATOM   3513 O  O     . GLY D  1 146 ? 96.561  -5.137  186.026 1.00 70.29  ? 146  GLY D O     1 
ATOM   3514 N  N     . VAL D  1 147 ? 98.290  -4.078  187.005 1.00 66.88  ? 147  VAL D N     1 
ATOM   3515 C  CA    . VAL D  1 147 ? 97.446  -3.440  188.011 1.00 67.89  ? 147  VAL D CA    1 
ATOM   3516 C  C     . VAL D  1 147 ? 97.320  -1.939  187.729 1.00 67.49  ? 147  VAL D C     1 
ATOM   3517 O  O     . VAL D  1 147 ? 98.277  -1.171  187.890 1.00 68.93  ? 147  VAL D O     1 
ATOM   3518 C  CB    . VAL D  1 147 ? 97.988  -3.666  189.441 1.00 62.16  ? 147  VAL D CB    1 
ATOM   3519 C  CG1   . VAL D  1 147 ? 97.092  -2.977  190.451 1.00 63.12  ? 147  VAL D CG1   1 
ATOM   3520 C  CG2   . VAL D  1 147 ? 98.083  -5.148  189.738 1.00 60.99  ? 147  VAL D CG2   1 
ATOM   3521 N  N     . ARG D  1 148 ? 96.141  -1.527  187.284 1.00 63.89  ? 148  ARG D N     1 
ATOM   3522 C  CA    . ARG D  1 148 ? 95.907  -0.125  186.974 1.00 65.38  ? 148  ARG D CA    1 
ATOM   3523 C  C     . ARG D  1 148 ? 95.853  0.702   188.253 1.00 62.35  ? 148  ARG D C     1 
ATOM   3524 O  O     . ARG D  1 148 ? 95.419  0.214   189.292 1.00 60.57  ? 148  ARG D O     1 
ATOM   3525 C  CB    . ARG D  1 148 ? 94.617  0.032   186.169 1.00 71.22  ? 148  ARG D CB    1 
ATOM   3526 C  CG    . ARG D  1 148 ? 94.766  -0.330  184.690 1.00 76.07  ? 148  ARG D CG    1 
ATOM   3527 C  CD    . ARG D  1 148 ? 93.424  -0.660  184.062 1.00 76.38  ? 148  ARG D CD    1 
ATOM   3528 N  NE    . ARG D  1 148 ? 93.051  -2.049  184.314 1.00 81.35  ? 148  ARG D NE    1 
ATOM   3529 C  CZ    . ARG D  1 148 ? 91.810  -2.516  184.233 1.00 85.23  ? 148  ARG D CZ    1 
ATOM   3530 N  NH1   . ARG D  1 148 ? 90.811  -1.704  183.911 1.00 83.65  ? 148  ARG D NH1   1 
ATOM   3531 N  NH2   . ARG D  1 148 ? 91.564  -3.795  184.483 1.00 83.21  ? 148  ARG D NH2   1 
ATOM   3532 N  N     . ASN D  1 149 ? 96.285  1.955   188.164 1.00 54.26  ? 149  ASN D N     1 
ATOM   3533 C  CA    . ASN D  1 149 ? 96.407  2.808   189.332 1.00 57.71  ? 149  ASN D CA    1 
ATOM   3534 C  C     . ASN D  1 149 ? 96.610  4.287   188.988 1.00 59.54  ? 149  ASN D C     1 
ATOM   3535 O  O     . ASN D  1 149 ? 97.067  4.627   187.888 1.00 57.43  ? 149  ASN D O     1 
ATOM   3536 C  CB    . ASN D  1 149 ? 97.576  2.327   190.207 1.00 61.03  ? 149  ASN D CB    1 
ATOM   3537 C  CG    . ASN D  1 149 ? 98.917  2.443   189.501 1.00 58.47  ? 149  ASN D CG    1 
ATOM   3538 O  OD1   . ASN D  1 149 ? 99.567  3.493   189.565 1.00 56.73  ? 149  ASN D OD1   1 
ATOM   3539 N  ND2   . ASN D  1 149 ? 99.331  1.373   188.806 1.00 59.73  ? 149  ASN D ND2   1 
ATOM   3540 N  N     . THR D  1 150 ? 96.296  5.162   189.941 0.99 56.95  ? 150  THR D N     1 
ATOM   3541 C  CA    . THR D  1 150 ? 96.498  6.598   189.763 0.99 58.87  ? 150  THR D CA    1 
ATOM   3542 C  C     . THR D  1 150 ? 97.354  7.167   190.887 0.99 58.69  ? 150  THR D C     1 
ATOM   3543 O  O     . THR D  1 150 ? 97.451  6.563   191.955 0.99 63.34  ? 150  THR D O     1 
ATOM   3544 C  CB    . THR D  1 150 ? 95.156  7.361   189.724 0.99 65.66  ? 150  THR D CB    1 
ATOM   3545 O  OG1   . THR D  1 150 ? 94.412  7.096   190.926 1.00 67.53  ? 150  THR D OG1   1 
ATOM   3546 C  CG2   . THR D  1 150 ? 94.324  6.939   188.509 1.00 52.98  ? 150  THR D CG2   1 
ATOM   3547 N  N     . ILE D  1 151 ? 97.969  8.322   190.654 1.00 58.60  ? 151  ILE D N     1 
ATOM   3548 C  CA    . ILE D  1 151 ? 98.659  9.047   191.722 1.00 56.87  ? 151  ILE D CA    1 
ATOM   3549 C  C     . ILE D  1 151 ? 98.107  10.457  191.860 1.00 56.86  ? 151  ILE D C     1 
ATOM   3550 O  O     . ILE D  1 151 ? 98.084  11.215  190.908 1.00 62.33  ? 151  ILE D O     1 
ATOM   3551 C  CB    . ILE D  1 151 ? 100.180 9.126   191.479 1.00 53.41  ? 151  ILE D CB    1 
ATOM   3552 C  CG1   . ILE D  1 151 ? 100.808 7.736   191.549 1.00 55.97  ? 151  ILE D CG1   1 
ATOM   3553 C  CG2   . ILE D  1 151 ? 100.840 10.048  192.477 1.00 52.38  ? 151  ILE D CG2   1 
ATOM   3554 C  CD1   . ILE D  1 151 ? 102.289 7.724   191.254 1.00 49.69  ? 151  ILE D CD1   1 
ATOM   3555 N  N     . HIS D  1 152 ? 97.663  10.812  193.052 1.00 56.78  ? 152  HIS D N     1 
ATOM   3556 C  CA    . HIS D  1 152 ? 97.113  12.140  193.288 1.00 59.34  ? 152  HIS D CA    1 
ATOM   3557 C  C     . HIS D  1 152 ? 97.656  12.701  194.582 1.00 62.54  ? 152  HIS D C     1 
ATOM   3558 O  O     . HIS D  1 152 ? 98.157  11.956  195.419 1.00 61.20  ? 152  HIS D O     1 
ATOM   3559 C  CB    . HIS D  1 152 ? 95.584  12.099  193.335 1.00 61.93  ? 152  HIS D CB    1 
ATOM   3560 C  CG    . HIS D  1 152 ? 94.957  11.787  192.012 1.00 70.18  ? 152  HIS D CG    1 
ATOM   3561 N  ND1   . HIS D  1 152 ? 94.742  12.746  191.049 1.00 74.16  ? 152  HIS D ND1   1 
ATOM   3562 C  CD2   . HIS D  1 152 ? 94.531  10.616  191.484 1.00 71.43  ? 152  HIS D CD2   1 
ATOM   3563 C  CE1   . HIS D  1 152 ? 94.194  12.181  189.985 1.00 74.65  ? 152  HIS D CE1   1 
ATOM   3564 N  NE2   . HIS D  1 152 ? 94.056  10.891  190.222 1.00 70.96  ? 152  HIS D NE2   1 
ATOM   3565 N  N     . LEU D  1 153 ? 97.563  14.017  194.735 1.00 62.33  ? 153  LEU D N     1 
ATOM   3566 C  CA    . LEU D  1 153 ? 97.885  14.650  195.995 1.00 62.06  ? 153  LEU D CA    1 
ATOM   3567 C  C     . LEU D  1 153 ? 96.674  14.527  196.898 1.00 64.20  ? 153  LEU D C     1 
ATOM   3568 O  O     . LEU D  1 153 ? 95.657  15.158  196.650 1.00 71.86  ? 153  LEU D O     1 
ATOM   3569 C  CB    . LEU D  1 153 ? 98.275  16.112  195.798 1.00 61.98  ? 153  LEU D CB    1 
ATOM   3570 C  CG    . LEU D  1 153 ? 98.624  16.835  197.098 1.00 63.46  ? 153  LEU D CG    1 
ATOM   3571 C  CD1   . LEU D  1 153 ? 99.727  16.074  197.811 1.00 67.05  ? 153  LEU D CD1   1 
ATOM   3572 C  CD2   . LEU D  1 153 ? 99.035  18.271  196.842 1.00 60.79  ? 153  LEU D CD2   1 
ATOM   3573 N  N     . ASP D  1 154 ? 96.787  13.706  197.935 1.00 58.90  ? 154  ASP D N     1 
ATOM   3574 C  CA    . ASP D  1 154 ? 95.658  13.357  198.787 1.00 61.10  ? 154  ASP D CA    1 
ATOM   3575 C  C     . ASP D  1 154 ? 95.551  14.320  199.977 1.00 67.76  ? 154  ASP D C     1 
ATOM   3576 O  O     . ASP D  1 154 ? 94.476  14.826  200.297 1.00 67.75  ? 154  ASP D O     1 
ATOM   3577 C  CB    . ASP D  1 154 ? 95.814  11.904  199.260 1.00 61.66  ? 154  ASP D CB    1 
ATOM   3578 C  CG    . ASP D  1 154 ? 94.591  11.381  200.000 1.00 68.29  ? 154  ASP D CG    1 
ATOM   3579 O  OD1   . ASP D  1 154 ? 93.562  11.078  199.340 1.00 62.29  ? 154  ASP D OD1   1 
ATOM   3580 O  OD2   . ASP D  1 154 ? 94.675  11.254  201.248 1.00 64.00  ? 154  ASP D OD2   1 
ATOM   3581 N  N     . ASP D  1 155 ? 96.684  14.572  200.619 1.00 68.05  ? 155  ASP D N     1 
ATOM   3582 C  CA    . ASP D  1 155 ? 96.759  15.506  201.728 1.00 63.39  ? 155  ASP D CA    1 
ATOM   3583 C  C     . ASP D  1 155 ? 97.413  16.819  201.311 1.00 71.47  ? 155  ASP D C     1 
ATOM   3584 O  O     . ASP D  1 155 ? 98.641  16.900  201.198 1.00 68.50  ? 155  ASP D O     1 
ATOM   3585 C  CB    . ASP D  1 155 ? 97.536  14.882  202.883 1.00 63.17  ? 155  ASP D CB    1 
ATOM   3586 C  CG    . ASP D  1 155 ? 97.448  15.697  204.153 1.00 67.15  ? 155  ASP D CG    1 
ATOM   3587 O  OD1   . ASP D  1 155 ? 97.272  16.932  204.078 1.00 65.64  ? 155  ASP D OD1   1 
ATOM   3588 O  OD2   . ASP D  1 155 ? 97.539  15.091  205.240 1.00 68.57  ? 155  ASP D OD2   1 
ATOM   3589 N  N     . HIS D  1 156 ? 96.593  17.851  201.112 1.00 76.90  ? 156  HIS D N     1 
ATOM   3590 C  CA    . HIS D  1 156 ? 97.080  19.181  200.727 1.00 76.34  ? 156  HIS D CA    1 
ATOM   3591 C  C     . HIS D  1 156 ? 97.797  19.879  201.897 1.00 72.10  ? 156  HIS D C     1 
ATOM   3592 O  O     . HIS D  1 156 ? 98.600  20.782  201.686 1.00 75.77  ? 156  HIS D O     1 
ATOM   3593 C  CB    . HIS D  1 156 ? 95.920  20.055  200.219 1.00 76.31  ? 156  HIS D CB    1 
ATOM   3594 C  CG    . HIS D  1 156 ? 94.866  20.316  201.255 1.00 84.60  ? 156  HIS D CG    1 
ATOM   3595 N  ND1   . HIS D  1 156 ? 94.932  21.377  202.134 1.00 87.61  ? 156  HIS D ND1   1 
ATOM   3596 C  CD2   . HIS D  1 156 ? 93.731  19.643  201.561 1.00 84.58  ? 156  HIS D CD2   1 
ATOM   3597 C  CE1   . HIS D  1 156 ? 93.881  21.348  202.937 1.00 81.36  ? 156  HIS D CE1   1 
ATOM   3598 N  NE2   . HIS D  1 156 ? 93.137  20.309  202.611 1.00 84.97  ? 156  HIS D NE2   1 
ATOM   3599 N  N     . ARG D  1 157 ? 97.508  19.452  203.123 1.00 69.27  ? 157  ARG D N     1 
ATOM   3600 C  CA    . ARG D  1 157 ? 98.102  20.059  204.315 1.00 68.69  ? 157  ARG D CA    1 
ATOM   3601 C  C     . ARG D  1 157 ? 99.595  19.747  204.493 1.00 73.17  ? 157  ARG D C     1 
ATOM   3602 O  O     . ARG D  1 157 ? 100.369 20.635  204.849 1.00 72.44  ? 157  ARG D O     1 
ATOM   3603 C  CB    . ARG D  1 157 ? 97.353  19.610  205.567 1.00 66.57  ? 157  ARG D CB    1 
ATOM   3604 C  CG    . ARG D  1 157 ? 95.891  19.981  205.619 1.00 67.68  ? 157  ARG D CG    1 
ATOM   3605 C  CD    . ARG D  1 157 ? 95.188  19.150  206.687 1.00 66.87  ? 157  ARG D CD    1 
ATOM   3606 N  NE    . ARG D  1 157 ? 95.185  17.736  206.322 1.00 67.65  ? 157  ARG D NE    1 
ATOM   3607 C  CZ    . ARG D  1 157 ? 94.853  16.742  207.140 1.00 69.02  ? 157  ARG D CZ    1 
ATOM   3608 N  NH1   . ARG D  1 157 ? 94.494  16.990  208.395 1.00 67.31  ? 157  ARG D NH1   1 
ATOM   3609 N  NH2   . ARG D  1 157 ? 94.886  15.491  206.702 1.00 63.56  ? 157  ARG D NH2   1 
ATOM   3610 N  N     . HIS D  1 158 ? 99.998  18.494  204.272 1.00 68.69  ? 158  HIS D N     1 
ATOM   3611 C  CA    . HIS D  1 158 ? 101.392 18.116  204.474 1.00 63.74  ? 158  HIS D CA    1 
ATOM   3612 C  C     . HIS D  1 158 ? 102.116 17.645  203.220 1.00 63.35  ? 158  HIS D C     1 
ATOM   3613 O  O     . HIS D  1 158 ? 103.265 17.221  203.307 1.00 61.56  ? 158  HIS D O     1 
ATOM   3614 C  CB    . HIS D  1 158 ? 101.517 17.011  205.516 1.00 64.62  ? 158  HIS D CB    1 
ATOM   3615 C  CG    . HIS D  1 158 ? 100.609 17.158  206.687 1.00 62.80  ? 158  HIS D CG    1 
ATOM   3616 N  ND1   . HIS D  1 158 ? 101.031 17.678  207.890 1.00 73.87  ? 158  HIS D ND1   1 
ATOM   3617 C  CD2   . HIS D  1 158 ? 99.318  16.789  206.868 1.00 68.48  ? 158  HIS D CD2   1 
ATOM   3618 C  CE1   . HIS D  1 158 ? 100.030 17.656  208.753 1.00 69.30  ? 158  HIS D CE1   1 
ATOM   3619 N  NE2   . HIS D  1 158 ? 98.981  17.119  208.157 1.00 69.20  ? 158  HIS D NE2   1 
ATOM   3620 N  N     . GLY D  1 159 ? 101.459 17.694  202.070 1.00 59.45  ? 159  GLY D N     1 
ATOM   3621 C  CA    . GLY D  1 159 ? 102.106 17.300  200.836 1.00 58.24  ? 159  GLY D CA    1 
ATOM   3622 C  C     . GLY D  1 159 ? 102.194 15.802  200.643 1.00 59.31  ? 159  GLY D C     1 
ATOM   3623 O  O     . GLY D  1 159 ? 103.157 15.290  200.065 1.00 58.62  ? 159  GLY D O     1 
ATOM   3624 N  N     . VAL D  1 160 ? 101.175 15.094  201.112 1.00 61.47  ? 160  VAL D N     1 
ATOM   3625 C  CA    . VAL D  1 160 ? 101.170 13.644  201.019 1.00 59.76  ? 160  VAL D CA    1 
ATOM   3626 C  C     . VAL D  1 160 ? 100.383 13.151  199.824 1.00 59.48  ? 160  VAL D C     1 
ATOM   3627 O  O     . VAL D  1 160 ? 99.169  13.328  199.752 1.00 60.75  ? 160  VAL D O     1 
ATOM   3628 C  CB    . VAL D  1 160 ? 100.583 13.005  202.268 1.00 57.06  ? 160  VAL D CB    1 
ATOM   3629 C  CG1   . VAL D  1 160 ? 100.714 11.492  202.162 1.00 52.86  ? 160  VAL D CG1   1 
ATOM   3630 C  CG2   . VAL D  1 160 ? 101.270 13.553  203.509 1.00 51.84  ? 160  VAL D CG2   1 
ATOM   3631 N  N     . TYR D  1 161 ? 101.085 12.520  198.892 0.99 60.75  ? 161  TYR D N     1 
ATOM   3632 C  CA    . TYR D  1 161 ? 100.453 11.907  197.731 0.99 56.61  ? 161  TYR D CA    1 
ATOM   3633 C  C     . TYR D  1 161 ? 99.895  10.528  198.093 0.99 56.53  ? 161  TYR D C     1 
ATOM   3634 O  O     . TYR D  1 161 ? 100.302 9.925   199.092 0.99 55.75  ? 161  TYR D O     1 
ATOM   3635 C  CB    . TYR D  1 161 ? 101.455 11.783  196.581 0.99 59.02  ? 161  TYR D CB    1 
ATOM   3636 C  CG    . TYR D  1 161 ? 102.008 13.103  196.095 0.99 64.32  ? 161  TYR D CG    1 
ATOM   3637 C  CD1   . TYR D  1 161 ? 103.041 13.735  196.777 1.00 63.48  ? 161  TYR D CD1   1 
ATOM   3638 C  CD2   . TYR D  1 161 ? 101.502 13.721  194.953 1.00 64.92  ? 161  TYR D CD2   1 
ATOM   3639 C  CE1   . TYR D  1 161 ? 103.558 14.946  196.340 1.00 64.84  ? 161  TYR D CE1   1 
ATOM   3640 C  CE2   . TYR D  1 161 ? 102.016 14.937  194.509 1.00 64.01  ? 161  TYR D CE2   1 
ATOM   3641 C  CZ    . TYR D  1 161 ? 103.043 15.540  195.210 0.99 66.81  ? 161  TYR D CZ    1 
ATOM   3642 O  OH    . TYR D  1 161 ? 103.566 16.739  194.797 0.99 67.93  ? 161  TYR D OH    1 
ATOM   3643 N  N     . VAL D  1 162 ? 98.962  10.033  197.284 1.00 52.57  ? 162  VAL D N     1 
ATOM   3644 C  CA    . VAL D  1 162 ? 98.442  8.691   197.463 1.00 48.35  ? 162  VAL D CA    1 
ATOM   3645 C  C     . VAL D  1 162 ? 98.493  7.980   196.126 1.00 56.44  ? 162  VAL D C     1 
ATOM   3646 O  O     . VAL D  1 162 ? 98.329  8.594   195.069 1.00 60.76  ? 162  VAL D O     1 
ATOM   3647 C  CB    . VAL D  1 162 ? 96.997  8.692   198.025 1.00 59.02  ? 162  VAL D CB    1 
ATOM   3648 C  CG1   . VAL D  1 162 ? 95.986  9.087   196.954 1.00 52.91  ? 162  VAL D CG1   1 
ATOM   3649 C  CG2   . VAL D  1 162 ? 96.653  7.338   198.639 1.00 54.97  ? 162  VAL D CG2   1 
ATOM   3650 N  N     . LEU D  1 163 ? 98.792  6.691   196.164 1.00 57.17  ? 163  LEU D N     1 
ATOM   3651 C  CA    . LEU D  1 163 ? 98.711  5.872   194.971 1.00 54.06  ? 163  LEU D CA    1 
ATOM   3652 C  C     . LEU D  1 163 ? 97.449  5.048   195.136 1.00 58.17  ? 163  LEU D C     1 
ATOM   3653 O  O     . LEU D  1 163 ? 97.361  4.204   196.034 1.00 55.73  ? 163  LEU D O     1 
ATOM   3654 C  CB    . LEU D  1 163 ? 99.956  4.990   194.791 1.00 49.40  ? 163  LEU D CB    1 
ATOM   3655 C  CG    . LEU D  1 163 ? 100.004 4.056   193.566 1.00 56.00  ? 163  LEU D CG    1 
ATOM   3656 C  CD1   . LEU D  1 163 ? 101.446 3.740   193.158 1.00 54.87  ? 163  LEU D CD1   1 
ATOM   3657 C  CD2   . LEU D  1 163 ? 99.260  2.751   193.821 1.00 56.46  ? 163  LEU D CD2   1 
ATOM   3658 N  N     . ASN D  1 164 ? 96.462  5.308   194.287 1.00 59.15  ? 164  ASN D N     1 
ATOM   3659 C  CA    . ASN D  1 164 ? 95.242  4.533   194.337 1.00 55.18  ? 164  ASN D CA    1 
ATOM   3660 C  C     . ASN D  1 164 ? 95.293  3.378   193.363 1.00 59.51  ? 164  ASN D C     1 
ATOM   3661 O  O     . ASN D  1 164 ? 95.459  3.568   192.163 1.00 58.12  ? 164  ASN D O     1 
ATOM   3662 C  CB    . ASN D  1 164 ? 94.020  5.395   194.057 1.00 58.95  ? 164  ASN D CB    1 
ATOM   3663 C  CG    . ASN D  1 164 ? 92.723  4.651   194.342 1.00 62.94  ? 164  ASN D CG    1 
ATOM   3664 O  OD1   . ASN D  1 164 ? 92.489  4.206   195.473 1.00 62.24  ? 164  ASN D OD1   1 
ATOM   3665 N  ND2   . ASN D  1 164 ? 91.877  4.502   193.321 1.00 62.02  ? 164  ASN D ND2   1 
ATOM   3666 N  N     . ILE D  1 165 ? 95.178  2.172   193.896 1.00 60.59  ? 165  ILE D N     1 
ATOM   3667 C  CA    . ILE D  1 165 ? 95.077  0.992   193.068 1.00 62.98  ? 165  ILE D CA    1 
ATOM   3668 C  C     . ILE D  1 165 ? 93.610  0.802   192.702 1.00 68.53  ? 165  ILE D C     1 
ATOM   3669 O  O     . ILE D  1 165 ? 92.746  0.765   193.589 1.00 62.17  ? 165  ILE D O     1 
ATOM   3670 C  CB    . ILE D  1 165 ? 95.620  -0.241  193.788 1.00 62.36  ? 165  ILE D CB    1 
ATOM   3671 C  CG1   . ILE D  1 165 ? 97.149  -0.231  193.756 1.00 59.59  ? 165  ILE D CG1   1 
ATOM   3672 C  CG2   . ILE D  1 165 ? 95.081  -1.508  193.153 1.00 60.95  ? 165  ILE D CG2   1 
ATOM   3673 C  CD1   . ILE D  1 165 ? 97.771  -0.347  195.118 1.00 62.10  ? 165  ILE D CD1   1 
ATOM   3674 N  N     . SER D  1 166 ? 93.334  0.703   191.400 1.00 65.09  ? 166  SER D N     1 
ATOM   3675 C  CA    . SER D  1 166 ? 91.965  0.572   190.899 1.00 67.75  ? 166  SER D CA    1 
ATOM   3676 C  C     . SER D  1 166 ? 91.280  -0.703  191.377 1.00 70.06  ? 166  SER D C     1 
ATOM   3677 O  O     . SER D  1 166 ? 91.797  -1.811  191.190 1.00 69.50  ? 166  SER D O     1 
ATOM   3678 C  CB    . SER D  1 166 ? 91.945  0.608   189.367 1.00 72.74  ? 166  SER D CB    1 
ATOM   3679 O  OG    . SER D  1 166 ? 90.614  0.687   188.891 1.00 68.81  ? 166  SER D OG    1 
ATOM   3680 N  N     . LEU D  1 167 ? 90.099  -0.534  191.968 1.00 68.90  ? 167  LEU D N     1 
ATOM   3681 C  CA    . LEU D  1 167 ? 89.316  -1.641  192.501 1.00 70.76  ? 167  LEU D CA    1 
ATOM   3682 C  C     . LEU D  1 167 ? 89.021  -2.696  191.441 1.00 77.09  ? 167  LEU D C     1 
ATOM   3683 O  O     . LEU D  1 167 ? 88.743  -3.851  191.771 1.00 81.28  ? 167  LEU D O     1 
ATOM   3684 C  CB    . LEU D  1 167 ? 88.010  -1.118  193.097 1.00 75.46  ? 167  LEU D CB    1 
ATOM   3685 C  CG    . LEU D  1 167 ? 88.187  -0.112  194.239 1.00 76.74  ? 167  LEU D CG    1 
ATOM   3686 C  CD1   . LEU D  1 167 ? 86.842  0.271   194.846 1.00 75.97  ? 167  LEU D CD1   1 
ATOM   3687 C  CD2   . LEU D  1 167 ? 89.113  -0.669  195.306 1.00 69.24  ? 167  LEU D CD2   1 
ATOM   3688 N  N     . ARG D  1 168 ? 89.085  -2.284  190.174 1.00 75.84  ? 168  ARG D N     1 
ATOM   3689 C  CA    . ARG D  1 168 ? 88.955  -3.179  189.024 1.00 79.03  ? 168  ARG D CA    1 
ATOM   3690 C  C     . ARG D  1 168 ? 89.987  -4.306  189.033 1.00 77.90  ? 168  ARG D C     1 
ATOM   3691 O  O     . ARG D  1 168 ? 89.735  -5.385  188.501 1.00 79.66  ? 168  ARG D O     1 
ATOM   3692 C  CB    . ARG D  1 168 ? 89.084  -2.387  187.716 1.00 75.98  ? 168  ARG D CB    1 
ATOM   3693 C  CG    . ARG D  1 168 ? 87.968  -1.375  187.478 1.00 74.91  ? 168  ARG D CG    1 
ATOM   3694 C  CD    . ARG D  1 168 ? 88.207  -0.580  186.195 1.00 84.84  ? 168  ARG D CD    1 
ATOM   3695 N  NE    . ARG D  1 168 ? 89.449  0.191   186.242 1.00 85.49  ? 168  ARG D NE    1 
ATOM   3696 C  CZ    . ARG D  1 168 ? 89.885  0.989   185.269 1.00 84.96  ? 168  ARG D CZ    1 
ATOM   3697 N  NH1   . ARG D  1 168 ? 89.190  1.126   184.147 1.00 90.13  ? 168  ARG D NH1   1 
ATOM   3698 N  NH2   . ARG D  1 168 ? 91.026  1.645   185.413 1.00 85.76  ? 168  ARG D NH2   1 
ATOM   3699 N  N     . ASP D  1 169 ? 91.151  -4.059  189.625 1.00 75.95  ? 169  ASP D N     1 
ATOM   3700 C  CA    . ASP D  1 169 ? 92.205  -5.066  189.630 1.00 74.55  ? 169  ASP D CA    1 
ATOM   3701 C  C     . ASP D  1 169 ? 92.473  -5.627  191.024 1.00 73.24  ? 169  ASP D C     1 
ATOM   3702 O  O     . ASP D  1 169 ? 93.472  -6.320  191.242 1.00 71.88  ? 169  ASP D O     1 
ATOM   3703 C  CB    . ASP D  1 169 ? 93.481  -4.484  189.029 1.00 75.87  ? 169  ASP D CB    1 
ATOM   3704 C  CG    . ASP D  1 169 ? 93.302  -4.088  187.576 1.00 78.54  ? 169  ASP D CG    1 
ATOM   3705 O  OD1   . ASP D  1 169 ? 92.581  -4.815  186.856 1.00 80.96  ? 169  ASP D OD1   1 
ATOM   3706 O  OD2   . ASP D  1 169 ? 93.869  -3.053  187.160 1.00 74.96  ? 169  ASP D OD2   1 
ATOM   3707 N  N     . ARG D  1 170 ? 91.554  -5.340  191.943 1.00 73.21  ? 170  ARG D N     1 
ATOM   3708 C  CA    . ARG D  1 170 ? 91.602  -5.819  193.321 1.00 67.38  ? 170  ARG D CA    1 
ATOM   3709 C  C     . ARG D  1 170 ? 92.112  -7.248  193.465 1.00 70.85  ? 170  ARG D C     1 
ATOM   3710 O  O     . ARG D  1 170 ? 93.028  -7.497  194.241 1.00 72.60  ? 170  ARG D O     1 
ATOM   3711 C  CB    . ARG D  1 170 ? 90.217  -5.721  193.956 1.00 76.17  ? 170  ARG D CB    1 
ATOM   3712 C  CG    . ARG D  1 170 ? 90.021  -6.694  195.099 1.00 79.11  ? 170  ARG D CG    1 
ATOM   3713 C  CD    . ARG D  1 170 ? 88.603  -6.700  195.603 1.00 80.39  ? 170  ARG D CD    1 
ATOM   3714 N  NE    . ARG D  1 170 ? 88.289  -5.517  196.394 1.00 83.56  ? 170  ARG D NE    1 
ATOM   3715 C  CZ    . ARG D  1 170 ? 87.474  -4.547  195.992 1.00 85.62  ? 170  ARG D CZ    1 
ATOM   3716 N  NH1   . ARG D  1 170 ? 86.895  -4.611  194.795 1.00 84.73  ? 170  ARG D NH1   1 
ATOM   3717 N  NH2   . ARG D  1 170 ? 87.236  -3.514  196.789 1.00 83.70  ? 170  ARG D NH2   1 
ATOM   3718 N  N     . ILE D  1 171 ? 91.533  -8.180  192.713 1.00 76.52  ? 171  ILE D N     1 
ATOM   3719 C  CA    . ILE D  1 171 ? 91.918  -9.589  192.813 1.00 77.14  ? 171  ILE D CA    1 
ATOM   3720 C  C     . ILE D  1 171 ? 93.355  -9.794  192.341 1.00 75.84  ? 171  ILE D C     1 
ATOM   3721 O  O     . ILE D  1 171 ? 94.112  -10.558 192.935 1.00 76.51  ? 171  ILE D O     1 
ATOM   3722 C  CB    . ILE D  1 171 ? 90.977  -10.516 191.989 1.00 76.86  ? 171  ILE D CB    1 
ATOM   3723 C  CG1   . ILE D  1 171 ? 89.521  -10.333 192.412 1.00 76.28  ? 171  ILE D CG1   1 
ATOM   3724 C  CG2   . ILE D  1 171 ? 91.370  -11.974 192.167 1.00 72.49  ? 171  ILE D CG2   1 
ATOM   3725 C  CD1   . ILE D  1 171 ? 89.218  -10.851 193.818 1.00 78.87  ? 171  ILE D CD1   1 
ATOM   3726 N  N     . LYS D  1 172 ? 93.736  -9.109  191.273 1.00 71.70  ? 172  LYS D N     1 
ATOM   3727 C  CA    . LYS D  1 172 ? 95.076  -9.289  190.736 1.00 75.59  ? 172  LYS D CA    1 
ATOM   3728 C  C     . LYS D  1 172 ? 96.111  -8.780  191.736 1.00 74.49  ? 172  LYS D C     1 
ATOM   3729 O  O     . LYS D  1 172 ? 97.049  -9.495  192.103 1.00 71.91  ? 172  LYS D O     1 
ATOM   3730 C  CB    . LYS D  1 172 ? 95.224  -8.578  189.384 1.00 73.68  ? 172  LYS D CB    1 
ATOM   3731 C  CG    . LYS D  1 172 ? 96.571  -8.812  188.723 1.00 72.80  ? 172  LYS D CG    1 
ATOM   3732 C  CD    . LYS D  1 172 ? 96.738  -7.990  187.456 1.00 74.87  ? 172  LYS D CD    1 
ATOM   3733 C  CE    . LYS D  1 172 ? 95.827  -8.487  186.348 1.00 77.92  ? 172  LYS D CE    1 
ATOM   3734 N  NZ    . LYS D  1 172 ? 95.965  -7.671  185.104 1.00 82.39  ? 172  LYS D NZ    1 
ATOM   3735 N  N     . PHE D  1 173 ? 95.917  -7.547  192.187 1.00 74.89  ? 173  PHE D N     1 
ATOM   3736 C  CA    . PHE D  1 173 ? 96.818  -6.931  193.148 1.00 74.45  ? 173  PHE D CA    1 
ATOM   3737 C  C     . PHE D  1 173 ? 96.921  -7.733  194.455 1.00 72.40  ? 173  PHE D C     1 
ATOM   3738 O  O     . PHE D  1 173 ? 98.022  -8.010  194.931 1.00 73.23  ? 173  PHE D O     1 
ATOM   3739 C  CB    . PHE D  1 173 ? 96.366  -5.499  193.440 1.00 69.28  ? 173  PHE D CB    1 
ATOM   3740 C  CG    . PHE D  1 173 ? 97.192  -4.808  194.484 1.00 70.08  ? 173  PHE D CG    1 
ATOM   3741 C  CD1   . PHE D  1 173 ? 98.526  -4.505  194.244 1.00 67.16  ? 173  PHE D CD1   1 
ATOM   3742 C  CD2   . PHE D  1 173 ? 96.638  -4.460  195.708 1.00 65.87  ? 173  PHE D CD2   1 
ATOM   3743 C  CE1   . PHE D  1 173 ? 99.290  -3.873  195.209 1.00 67.72  ? 173  PHE D CE1   1 
ATOM   3744 C  CE2   . PHE D  1 173 ? 97.397  -3.824  196.673 1.00 64.58  ? 173  PHE D CE2   1 
ATOM   3745 C  CZ    . PHE D  1 173 ? 98.722  -3.533  196.429 1.00 61.49  ? 173  PHE D CZ    1 
ATOM   3746 N  N     . VAL D  1 174 ? 95.783  -8.121  195.024 1.00 70.24  ? 174  VAL D N     1 
ATOM   3747 C  CA    . VAL D  1 174 ? 95.797  -8.798  196.321 1.00 74.38  ? 174  VAL D CA    1 
ATOM   3748 C  C     . VAL D  1 174 ? 96.361  -10.218 196.236 1.00 76.13  ? 174  VAL D C     1 
ATOM   3749 O  O     . VAL D  1 174 ? 97.112  -10.649 197.116 1.00 73.99  ? 174  VAL D O     1 
ATOM   3750 C  CB    . VAL D  1 174 ? 94.387  -8.848  196.949 1.00 69.69  ? 174  VAL D CB    1 
ATOM   3751 C  CG1   . VAL D  1 174 ? 94.381  -9.728  198.186 1.00 67.37  ? 174  VAL D CG1   1 
ATOM   3752 C  CG2   . VAL D  1 174 ? 93.917  -7.452  197.304 1.00 67.44  ? 174  VAL D CG2   1 
ATOM   3753 N  N     . HIS D  1 175 ? 96.022  -10.943 195.176 1.00 76.73  ? 175  HIS D N     1 
ATOM   3754 C  CA    . HIS D  1 175 ? 96.417  -12.343 195.105 1.00 78.82  ? 175  HIS D CA    1 
ATOM   3755 C  C     . HIS D  1 175 ? 97.856  -12.512 194.649 1.00 76.85  ? 175  HIS D C     1 
ATOM   3756 O  O     . HIS D  1 175 ? 98.581  -13.338 195.192 1.00 82.63  ? 175  HIS D O     1 
ATOM   3757 C  CB    . HIS D  1 175 ? 95.487  -13.129 194.178 1.00 85.49  ? 175  HIS D CB    1 
ATOM   3758 C  CG    . HIS D  1 175 ? 95.728  -14.610 194.196 1.00 92.79  ? 175  HIS D CG    1 
ATOM   3759 N  ND1   . HIS D  1 175 ? 96.505  -15.250 193.257 1.00 90.41  ? 175  HIS D ND1   1 
ATOM   3760 C  CD2   . HIS D  1 175 ? 95.300  -15.572 195.053 1.00 94.14  ? 175  HIS D CD2   1 
ATOM   3761 C  CE1   . HIS D  1 175 ? 96.541  -16.547 193.526 1.00 92.72  ? 175  HIS D CE1   1 
ATOM   3762 N  NE2   . HIS D  1 175 ? 95.819  -16.764 194.610 1.00 92.69  ? 175  HIS D NE2   1 
ATOM   3763 N  N     . THR D  1 176 ? 98.275  -11.729 193.664 1.00 73.88  ? 176  THR D N     1 
ATOM   3764 C  CA    . THR D  1 176 ? 99.570  -11.970 193.039 1.00 77.06  ? 176  THR D CA    1 
ATOM   3765 C  C     . THR D  1 176 ? 100.683 -11.115 193.632 1.00 77.30  ? 176  THR D C     1 
ATOM   3766 O  O     . THR D  1 176 ? 101.864 -11.399 193.418 1.00 72.23  ? 176  THR D O     1 
ATOM   3767 C  CB    . THR D  1 176 ? 99.524  -11.717 191.509 1.00 83.28  ? 176  THR D CB    1 
ATOM   3768 O  OG1   . THR D  1 176 ? 99.133  -10.361 191.257 1.00 82.70  ? 176  THR D OG1   1 
ATOM   3769 C  CG2   . THR D  1 176 ? 98.549  -12.677 190.820 1.00 78.95  ? 176  THR D CG2   1 
ATOM   3770 N  N     . ILE D  1 177 ? 100.320 -10.070 194.369 1.00 73.99  ? 177  ILE D N     1 
ATOM   3771 C  CA    . ILE D  1 177 ? 101.338 -9.219  194.976 1.00 75.23  ? 177  ILE D CA    1 
ATOM   3772 C  C     . ILE D  1 177 ? 101.322 -9.289  196.504 1.00 78.21  ? 177  ILE D C     1 
ATOM   3773 O  O     . ILE D  1 177 ? 102.360 -9.552  197.123 1.00 75.32  ? 177  ILE D O     1 
ATOM   3774 C  CB    . ILE D  1 177 ? 101.189 -7.756  194.521 1.00 73.32  ? 177  ILE D CB    1 
ATOM   3775 C  CG1   . ILE D  1 177 ? 101.179 -7.693  192.995 1.00 77.31  ? 177  ILE D CG1   1 
ATOM   3776 C  CG2   . ILE D  1 177 ? 102.308 -6.900  195.079 1.00 69.39  ? 177  ILE D CG2   1 
ATOM   3777 C  CD1   . ILE D  1 177 ? 101.436 -6.318  192.448 1.00 77.55  ? 177  ILE D CD1   1 
ATOM   3778 N  N     . LEU D  1 178 ? 100.159 -9.070  197.115 1.00 73.15  ? 178  LEU D N     1 
ATOM   3779 C  CA    . LEU D  1 178 ? 100.060 -9.168  198.571 1.00 73.29  ? 178  LEU D CA    1 
ATOM   3780 C  C     . LEU D  1 178 ? 100.144 -10.615 199.076 1.00 78.61  ? 178  LEU D C     1 
ATOM   3781 O  O     . LEU D  1 178 ? 100.648 -10.856 200.173 1.00 82.97  ? 178  LEU D O     1 
ATOM   3782 C  CB    . LEU D  1 178 ? 98.769  -8.516  199.074 1.00 75.37  ? 178  LEU D CB    1 
ATOM   3783 C  CG    . LEU D  1 178 ? 98.719  -6.984  199.024 1.00 74.35  ? 178  LEU D CG    1 
ATOM   3784 C  CD1   . LEU D  1 178 ? 97.459  -6.443  199.687 1.00 62.54  ? 178  LEU D CD1   1 
ATOM   3785 C  CD2   . LEU D  1 178 ? 99.966  -6.376  199.651 1.00 63.50  ? 178  LEU D CD2   1 
ATOM   3786 N  N     . SER D  1 179 ? 99.674  -11.574 198.276 1.00 79.93  ? 179  SER D N     1 
ATOM   3787 C  CA    . SER D  1 179 ? 99.662  -12.977 198.700 1.00 81.59  ? 179  SER D CA    1 
ATOM   3788 C  C     . SER D  1 179 ? 100.740 -13.828 198.019 1.00 88.01  ? 179  SER D C     1 
ATOM   3789 O  O     . SER D  1 179 ? 100.587 -15.044 197.883 1.00 90.68  ? 179  SER D O     1 
ATOM   3790 C  CB    . SER D  1 179 ? 98.286  -13.590 198.437 1.00 73.52  ? 179  SER D CB    1 
ATOM   3791 O  OG    . SER D  1 179 ? 97.280  -12.884 199.136 1.00 73.03  ? 179  SER D OG    1 
ATOM   3792 N  N     . SER D  1 180 ? 101.834 -13.193 197.609 1.00 85.95  ? 180  SER D N     1 
ATOM   3793 C  CA    . SER D  1 180 ? 102.869 -13.881 196.842 1.00 87.56  ? 180  SER D CA    1 
ATOM   3794 C  C     . SER D  1 180 ? 103.761 -14.765 197.712 1.00 97.78  ? 180  SER D C     1 
ATOM   3795 O  O     . SER D  1 180 ? 104.455 -14.266 198.606 1.00 95.43  ? 180  SER D O     1 
ATOM   3796 C  CB    . SER D  1 180 ? 103.729 -12.865 196.090 1.00 85.00  ? 180  SER D CB    1 
ATOM   3797 O  OG    . SER D  1 180 ? 104.826 -13.504 195.458 1.00 88.24  ? 180  SER D OG    1 
ATOM   3798 N  N     . HIS D  1 181 ? 103.759 -16.069 197.424 1.00 97.95  ? 181  HIS D N     1 
ATOM   3799 C  CA    . HIS D  1 181 ? 104.524 -17.050 198.200 1.00 95.67  ? 181  HIS D CA    1 
ATOM   3800 C  C     . HIS D  1 181 ? 105.992 -17.194 197.769 1.00 98.81  ? 181  HIS D C     1 
ATOM   3801 O  O     . HIS D  1 181 ? 106.579 -18.269 197.903 1.00 100.13 ? 181  HIS D O     1 
ATOM   3802 C  CB    . HIS D  1 181 ? 103.844 -18.423 198.132 1.00 93.57  ? 181  HIS D CB    1 
ATOM   3803 C  CG    . HIS D  1 181 ? 102.492 -18.462 198.777 1.00 100.51 ? 181  HIS D CG    1 
ATOM   3804 N  ND1   . HIS D  1 181 ? 101.326 -18.622 198.056 1.00 103.39 ? 181  HIS D ND1   1 
ATOM   3805 C  CD2   . HIS D  1 181 ? 102.119 -18.354 200.075 1.00 103.91 ? 181  HIS D CD2   1 
ATOM   3806 C  CE1   . HIS D  1 181 ? 100.295 -18.613 198.884 1.00 104.64 ? 181  HIS D CE1   1 
ATOM   3807 N  NE2   . HIS D  1 181 ? 100.747 -18.450 200.115 1.00 102.28 ? 181  HIS D NE2   1 
ATOM   3808 N  N     . LEU D  1 182 ? 106.588 -16.114 197.272 1.00 98.34  ? 182  LEU D N     1 
ATOM   3809 C  CA    . LEU D  1 182 ? 107.983 -16.143 196.828 1.00 95.18  ? 182  LEU D CA    1 
ATOM   3810 C  C     . LEU D  1 182 ? 108.878 -15.324 197.769 1.00 93.30  ? 182  LEU D C     1 
ATOM   3811 O  O     . LEU D  1 182 ? 110.075 -15.588 197.916 1.00 92.77  ? 182  LEU D O     1 
ATOM   3812 C  CB    . LEU D  1 182 ? 108.100 -15.618 195.390 1.00 94.18  ? 182  LEU D CB    1 
ATOM   3813 C  CG    . LEU D  1 182 ? 107.515 -16.442 194.235 1.00 93.78  ? 182  LEU D CG    1 
ATOM   3814 C  CD1   . LEU D  1 182 ? 105.989 -16.387 194.194 1.00 94.29  ? 182  LEU D CD1   1 
ATOM   3815 C  CD2   . LEU D  1 182 ? 108.111 -15.979 192.907 1.00 88.21  ? 182  LEU D CD2   1 
ATOM   3816 N  N     . ASN D  1 183 ? 108.272 -14.316 198.388 1.00 90.41  ? 183  ASN D N     1 
ATOM   3817 C  CA    . ASN D  1 183 ? 108.918 -13.469 199.378 1.00 84.55  ? 183  ASN D CA    1 
ATOM   3818 C  C     . ASN D  1 183 ? 108.080 -13.605 200.646 1.00 89.52  ? 183  ASN D C     1 
ATOM   3819 O  O     . ASN D  1 183 ? 107.040 -14.267 200.607 1.00 91.57  ? 183  ASN D O     1 
ATOM   3820 C  CB    . ASN D  1 183 ? 108.986 -12.018 198.896 1.00 78.20  ? 183  ASN D CB    1 
ATOM   3821 C  CG    . ASN D  1 183 ? 109.168 -11.903 197.393 1.00 84.18  ? 183  ASN D CG    1 
ATOM   3822 O  OD1   . ASN D  1 183 ? 108.345 -11.284 196.710 1.00 79.78  ? 183  ASN D OD1   1 
ATOM   3823 N  ND2   . ASN D  1 183 ? 110.250 -12.494 196.865 1.00 84.58  ? 183  ASN D ND2   1 
ATOM   3824 N  N     . PRO D  1 184 ? 108.508 -12.999 201.771 1.00 84.53  ? 184  PRO D N     1 
ATOM   3825 C  CA    . PRO D  1 184 ? 107.689 -13.211 202.977 1.00 83.37  ? 184  PRO D CA    1 
ATOM   3826 C  C     . PRO D  1 184 ? 106.285 -12.651 202.862 1.00 84.85  ? 184  PRO D C     1 
ATOM   3827 O  O     . PRO D  1 184 ? 106.118 -11.529 202.380 1.00 80.83  ? 184  PRO D O     1 
ATOM   3828 C  CB    . PRO D  1 184 ? 108.455 -12.463 204.065 1.00 71.26  ? 184  PRO D CB    1 
ATOM   3829 C  CG    . PRO D  1 184 ? 109.852 -12.415 203.581 1.00 77.80  ? 184  PRO D CG    1 
ATOM   3830 C  CD    . PRO D  1 184 ? 109.782 -12.324 202.083 1.00 77.35  ? 184  PRO D CD    1 
ATOM   3831 N  N     . LEU D  1 185 ? 105.292 -13.426 203.297 1.00 89.31  ? 185  LEU D N     1 
ATOM   3832 C  CA    . LEU D  1 185 ? 103.912 -12.952 203.284 1.00 88.92  ? 185  LEU D CA    1 
ATOM   3833 C  C     . LEU D  1 185 ? 103.609 -12.210 204.566 1.00 87.09  ? 185  LEU D C     1 
ATOM   3834 O  O     . LEU D  1 185 ? 104.015 -12.636 205.654 1.00 87.34  ? 185  LEU D O     1 
ATOM   3835 C  CB    . LEU D  1 185 ? 102.895 -14.092 203.108 1.00 88.30  ? 185  LEU D CB    1 
ATOM   3836 C  CG    . LEU D  1 185 ? 102.726 -14.608 201.676 1.00 94.80  ? 185  LEU D CG    1 
ATOM   3837 C  CD1   . LEU D  1 185 ? 103.879 -15.547 201.333 1.00 93.76  ? 185  LEU D CD1   1 
ATOM   3838 C  CD2   . LEU D  1 185 ? 101.366 -15.259 201.437 1.00 93.49  ? 185  LEU D CD2   1 
ATOM   3839 N  N     . PRO D  1 186 ? 102.891 -11.087 204.439 1.00 87.56  ? 186  PRO D N     1 
ATOM   3840 C  CA    . PRO D  1 186 ? 102.362 -10.347 205.586 1.00 82.92  ? 186  PRO D CA    1 
ATOM   3841 C  C     . PRO D  1 186 ? 101.040 -10.944 206.044 1.00 88.64  ? 186  PRO D C     1 
ATOM   3842 O  O     . PRO D  1 186 ? 100.483 -11.795 205.336 1.00 88.84  ? 186  PRO D O     1 
ATOM   3843 C  CB    . PRO D  1 186 ? 102.162 -8.946  205.024 1.00 74.25  ? 186  PRO D CB    1 
ATOM   3844 C  CG    . PRO D  1 186 ? 101.820 -9.184  203.576 1.00 79.91  ? 186  PRO D CG    1 
ATOM   3845 C  CD    . PRO D  1 186 ? 102.579 -10.424 203.158 1.00 82.45  ? 186  PRO D CD    1 
ATOM   3846 N  N     . PRO D  1 187 ? 100.552 -10.530 207.220 1.00 88.53  ? 187  PRO D N     1 
ATOM   3847 C  CA    . PRO D  1 187 ? 99.195  -10.903 207.644 1.00 88.40  ? 187  PRO D CA    1 
ATOM   3848 C  C     . PRO D  1 187 ? 98.110  -9.965  207.081 1.00 86.35  ? 187  PRO D C     1 
ATOM   3849 O  O     . PRO D  1 187 ? 97.122  -10.416 206.485 1.00 83.81  ? 187  PRO D O     1 
ATOM   3850 C  CB    . PRO D  1 187 ? 99.272  -10.811 209.172 1.00 92.75  ? 187  PRO D CB    1 
ATOM   3851 C  CG    . PRO D  1 187 ? 100.349 -9.791  209.423 1.00 88.49  ? 187  PRO D CG    1 
ATOM   3852 C  CD    . PRO D  1 187 ? 101.340 -9.920  208.307 1.00 76.19  ? 187  PRO D CD    1 
ATOM   3853 O  "O5'" . DG  E  2 1   ? 67.456  4.455   192.247 1.00 72.73  ? 1    DG  E "O5'" 1 
ATOM   3854 C  "C5'" . DG  E  2 1   ? 67.431  3.031   192.354 1.00 73.17  ? 1    DG  E "C5'" 1 
ATOM   3855 C  "C4'" . DG  E  2 1   ? 68.843  2.450   192.368 1.00 76.67  ? 1    DG  E "C4'" 1 
ATOM   3856 O  "O4'" . DG  E  2 1   ? 69.693  3.166   191.431 1.00 73.53  ? 1    DG  E "O4'" 1 
ATOM   3857 C  "C3'" . DG  E  2 1   ? 69.570  2.485   193.723 1.00 79.50  ? 1    DG  E "C3'" 1 
ATOM   3858 O  "O3'" . DG  E  2 1   ? 70.141  1.189   193.979 1.00 83.21  ? 1    DG  E "O3'" 1 
ATOM   3859 C  "C2'" . DG  E  2 1   ? 70.643  3.579   193.545 1.00 69.19  ? 1    DG  E "C2'" 1 
ATOM   3860 C  "C1'" . DG  E  2 1   ? 70.935  3.485   192.056 1.00 74.82  ? 1    DG  E "C1'" 1 
ATOM   3861 N  N9    . DG  E  2 1   ? 71.430  4.720   191.444 1.00 66.50  ? 1    DG  E N9    1 
ATOM   3862 C  C8    . DG  E  2 1   ? 71.112  6.019   191.787 1.00 60.62  ? 1    DG  E C8    1 
ATOM   3863 N  N7    . DG  E  2 1   ? 71.684  6.913   191.020 1.00 61.75  ? 1    DG  E N7    1 
ATOM   3864 C  C5    . DG  E  2 1   ? 72.419  6.155   190.105 1.00 63.93  ? 1    DG  E C5    1 
ATOM   3865 C  C6    . DG  E  2 1   ? 73.247  6.563   189.020 1.00 66.94  ? 1    DG  E C6    1 
ATOM   3866 O  O6    . DG  E  2 1   ? 73.508  7.716   188.639 1.00 69.08  ? 1    DG  E O6    1 
ATOM   3867 N  N1    . DG  E  2 1   ? 73.804  5.461   188.355 1.00 63.28  ? 1    DG  E N1    1 
ATOM   3868 C  C2    . DG  E  2 1   ? 73.587  4.140   188.698 1.00 60.66  ? 1    DG  E C2    1 
ATOM   3869 N  N2    . DG  E  2 1   ? 74.201  3.220   187.951 1.00 59.88  ? 1    DG  E N2    1 
ATOM   3870 N  N3    . DG  E  2 1   ? 72.813  3.749   189.701 1.00 61.32  ? 1    DG  E N3    1 
ATOM   3871 C  C4    . DG  E  2 1   ? 72.263  4.804   190.355 1.00 63.46  ? 1    DG  E C4    1 
ATOM   3872 P  P     . DC  E  2 2   ? 70.916  0.858   195.354 1.00 91.24  ? 2    DC  E P     1 
ATOM   3873 O  OP1   . DC  E  2 2   ? 70.369  -0.417  195.886 1.00 81.16  ? 2    DC  E OP1   1 
ATOM   3874 O  OP2   . DC  E  2 2   ? 70.956  2.070   196.212 1.00 82.04  ? 2    DC  E OP2   1 
ATOM   3875 O  "O5'" . DC  E  2 2   ? 72.397  0.557   194.855 1.00 82.55  ? 2    DC  E "O5'" 1 
ATOM   3876 C  "C5'" . DC  E  2 2   ? 72.608  -0.404  193.837 1.00 79.72  ? 2    DC  E "C5'" 1 
ATOM   3877 C  "C4'" . DC  E  2 2   ? 73.941  -0.167  193.155 1.00 81.23  ? 2    DC  E "C4'" 1 
ATOM   3878 O  "O4'" . DC  E  2 2   ? 73.945  1.139   192.548 1.00 78.04  ? 2    DC  E "O4'" 1 
ATOM   3879 C  "C3'" . DC  E  2 2   ? 75.158  -0.183  194.089 1.00 79.65  ? 2    DC  E "C3'" 1 
ATOM   3880 O  "O3'" . DC  E  2 2   ? 75.910  -1.373  193.882 1.00 81.84  ? 2    DC  E "O3'" 1 
ATOM   3881 C  "C2'" . DC  E  2 2   ? 75.961  1.081   193.710 1.00 74.08  ? 2    DC  E "C2'" 1 
ATOM   3882 C  "C1'" . DC  E  2 2   ? 75.280  1.543   192.427 1.00 71.96  ? 2    DC  E "C1'" 1 
ATOM   3883 N  N1    . DC  E  2 2   ? 75.308  3.009   192.226 1.00 62.60  ? 2    DC  E N1    1 
ATOM   3884 C  C2    . DC  E  2 2   ? 76.027  3.531   191.156 1.00 67.03  ? 2    DC  E C2    1 
ATOM   3885 O  O2    . DC  E  2 2   ? 76.634  2.752   190.403 1.00 70.13  ? 2    DC  E O2    1 
ATOM   3886 N  N3    . DC  E  2 2   ? 76.045  4.876   190.970 1.00 66.33  ? 2    DC  E N3    1 
ATOM   3887 C  C4    . DC  E  2 2   ? 75.383  5.676   191.807 1.00 64.52  ? 2    DC  E C4    1 
ATOM   3888 N  N4    . DC  E  2 2   ? 75.439  6.997   191.584 1.00 64.77  ? 2    DC  E N4    1 
ATOM   3889 C  C5    . DC  E  2 2   ? 74.638  5.157   192.911 1.00 61.56  ? 2    DC  E C5    1 
ATOM   3890 C  C6    . DC  E  2 2   ? 74.628  3.829   193.079 1.00 64.27  ? 2    DC  E C6    1 
ATOM   3891 P  P     . DC  E  2 3   ? 77.173  -1.703  194.817 1.00 88.82  ? 3    DC  E P     1 
ATOM   3892 O  OP1   . DC  E  2 3   ? 77.400  -3.168  194.765 1.00 90.10  ? 3    DC  E OP1   1 
ATOM   3893 O  OP2   . DC  E  2 3   ? 76.970  -1.018  196.116 1.00 80.76  ? 3    DC  E OP2   1 
ATOM   3894 O  "O5'" . DC  E  2 3   ? 78.381  -0.988  194.060 1.00 82.94  ? 3    DC  E "O5'" 1 
ATOM   3895 C  "C5'" . DC  E  2 3   ? 78.623  -1.301  192.709 1.00 78.45  ? 3    DC  E "C5'" 1 
ATOM   3896 C  "C4'" . DC  E  2 3   ? 79.761  -0.473  192.157 1.00 80.12  ? 3    DC  E "C4'" 1 
ATOM   3897 O  "O4'" . DC  E  2 3   ? 79.324  0.889   191.968 1.00 75.97  ? 3    DC  E "O4'" 1 
ATOM   3898 C  "C3'" . DC  E  2 3   ? 81.016  -0.415  193.031 1.00 74.84  ? 3    DC  E "C3'" 1 
ATOM   3899 O  "O3'" . DC  E  2 3   ? 82.130  -0.816  192.252 1.00 81.41  ? 3    DC  E "O3'" 1 
ATOM   3900 C  "C2'" . DC  E  2 3   ? 81.105  1.058   193.456 1.00 72.13  ? 3    DC  E "C2'" 1 
ATOM   3901 C  "C1'" . DC  E  2 3   ? 80.353  1.765   192.334 1.00 73.02  ? 3    DC  E "C1'" 1 
ATOM   3902 N  N1    . DC  E  2 3   ? 79.711  3.057   192.730 1.00 68.14  ? 3    DC  E N1    1 
ATOM   3903 C  C2    . DC  E  2 3   ? 79.944  4.214   191.968 1.00 67.96  ? 3    DC  E C2    1 
ATOM   3904 O  O2    . DC  E  2 3   ? 80.706  4.156   190.993 1.00 72.30  ? 3    DC  E O2    1 
ATOM   3905 N  N3    . DC  E  2 3   ? 79.335  5.370   192.327 1.00 64.69  ? 3    DC  E N3    1 
ATOM   3906 C  C4    . DC  E  2 3   ? 78.524  5.393   193.387 1.00 66.90  ? 3    DC  E C4    1 
ATOM   3907 N  N4    . DC  E  2 3   ? 77.945  6.558   193.703 1.00 70.94  ? 3    DC  E N4    1 
ATOM   3908 C  C5    . DC  E  2 3   ? 78.266  4.225   194.168 1.00 62.86  ? 3    DC  E C5    1 
ATOM   3909 C  C6    . DC  E  2 3   ? 78.870  3.091   193.806 1.00 66.66  ? 3    DC  E C6    1 
ATOM   3910 P  P     . DT  E  2 4   ? 83.544  -1.163  192.927 1.00 79.82  ? 4    DT  E P     1 
ATOM   3911 O  OP1   . DT  E  2 4   ? 84.071  -2.370  192.254 1.00 81.40  ? 4    DT  E OP1   1 
ATOM   3912 O  OP2   . DT  E  2 4   ? 83.407  -1.126  194.400 1.00 82.65  ? 4    DT  E OP2   1 
ATOM   3913 O  "O5'" . DT  E  2 4   ? 84.451  0.054   192.482 1.00 76.40  ? 4    DT  E "O5'" 1 
ATOM   3914 C  "C5'" . DT  E  2 4   ? 84.657  0.286   191.119 1.00 69.58  ? 4    DT  E "C5'" 1 
ATOM   3915 C  "C4'" . DT  E  2 4   ? 85.031  1.727   190.897 1.00 71.77  ? 4    DT  E "C4'" 1 
ATOM   3916 O  "O4'" . DT  E  2 4   ? 84.017  2.579   191.476 1.00 69.01  ? 4    DT  E "O4'" 1 
ATOM   3917 C  "C3'" . DT  E  2 4   ? 86.358  2.154   191.547 1.00 72.68  ? 4    DT  E "C3'" 1 
ATOM   3918 O  "O3'" . DT  E  2 4   ? 87.256  2.644   190.540 1.00 73.94  ? 4    DT  E "O3'" 1 
ATOM   3919 C  "C2'" . DT  E  2 4   ? 85.950  3.257   192.533 1.00 68.12  ? 4    DT  E "C2'" 1 
ATOM   3920 C  "C1'" . DT  E  2 4   ? 84.650  3.740   191.913 1.00 67.88  ? 4    DT  E "C1'" 1 
ATOM   3921 N  N1    . DT  E  2 4   ? 83.768  4.446   192.848 1.00 64.15  ? 4    DT  E N1    1 
ATOM   3922 C  C2    . DT  E  2 4   ? 83.574  5.788   192.668 1.00 70.70  ? 4    DT  E C2    1 
ATOM   3923 O  O2    . DT  E  2 4   ? 84.095  6.413   191.760 1.00 70.59  ? 4    DT  E O2    1 
ATOM   3924 N  N3    . DT  E  2 4   ? 82.736  6.381   193.589 1.00 68.80  ? 4    DT  E N3    1 
ATOM   3925 C  C4    . DT  E  2 4   ? 82.100  5.767   194.655 1.00 66.47  ? 4    DT  E C4    1 
ATOM   3926 O  O4    . DT  E  2 4   ? 81.371  6.381   195.428 1.00 67.89  ? 4    DT  E O4    1 
ATOM   3927 C  C5    . DT  E  2 4   ? 82.350  4.352   194.789 1.00 65.10  ? 4    DT  E C5    1 
ATOM   3928 C  C7    . DT  E  2 4   ? 81.711  3.584   195.906 1.00 60.10  ? 4    DT  E C7    1 
ATOM   3929 C  C6    . DT  E  2 4   ? 83.168  3.762   193.889 1.00 66.20  ? 4    DT  E C6    1 
ATOM   3930 P  P     . DT  E  2 5   ? 88.814  2.874   190.872 1.00 66.44  ? 5    DT  E P     1 
ATOM   3931 O  OP1   . DT  E  2 5   ? 89.562  2.804   189.596 1.00 66.25  ? 5    DT  E OP1   1 
ATOM   3932 O  OP2   . DT  E  2 5   ? 89.186  1.988   192.005 1.00 69.71  ? 5    DT  E OP2   1 
ATOM   3933 O  "O5'" . DT  E  2 5   ? 88.865  4.363   191.438 1.00 59.79  ? 5    DT  E "O5'" 1 
ATOM   3934 C  "C5'" . DT  E  2 5   ? 88.697  5.462   190.576 1.00 58.54  ? 5    DT  E "C5'" 1 
ATOM   3935 C  "C4'" . DT  E  2 5   ? 88.481  6.715   191.392 1.00 64.84  ? 5    DT  E "C4'" 1 
ATOM   3936 O  "O4'" . DT  E  2 5   ? 87.329  6.530   192.264 1.00 70.09  ? 5    DT  E "O4'" 1 
ATOM   3937 C  "C3'" . DT  E  2 5   ? 89.648  7.082   192.331 1.00 73.17  ? 5    DT  E "C3'" 1 
ATOM   3938 O  "O3'" . DT  E  2 5   ? 89.975  8.438   192.187 1.00 74.03  ? 5    DT  E "O3'" 1 
ATOM   3939 C  "C2'" . DT  E  2 5   ? 89.081  6.813   193.727 1.00 71.08  ? 5    DT  E "C2'" 1 
ATOM   3940 C  "C1'" . DT  E  2 5   ? 87.632  7.166   193.477 1.00 70.50  ? 5    DT  E "C1'" 1 
ATOM   3941 N  N1    . DT  E  2 5   ? 86.699  6.746   194.552 1.00 65.04  ? 5    DT  E N1    1 
ATOM   3942 C  C2    . DT  E  2 5   ? 85.788  7.659   195.005 1.00 67.66  ? 5    DT  E C2    1 
ATOM   3943 O  O2    . DT  E  2 5   ? 85.690  8.779   194.541 1.00 69.68  ? 5    DT  E O2    1 
ATOM   3944 N  N3    . DT  E  2 5   ? 84.980  7.213   196.018 1.00 70.47  ? 5    DT  E N3    1 
ATOM   3945 C  C4    . DT  E  2 5   ? 85.004  5.967   196.619 1.00 66.91  ? 5    DT  E C4    1 
ATOM   3946 O  O4    . DT  E  2 5   ? 84.234  5.661   197.521 1.00 69.29  ? 5    DT  E O4    1 
ATOM   3947 C  C5    . DT  E  2 5   ? 85.995  5.053   196.107 1.00 61.61  ? 5    DT  E C5    1 
ATOM   3948 C  C7    . DT  E  2 5   ? 86.108  3.672   196.679 1.00 59.13  ? 5    DT  E C7    1 
ATOM   3949 C  C6    . DT  E  2 5   ? 86.795  5.483   195.110 1.00 67.94  ? 5    DT  E C6    1 
ATOM   3950 P  P     . DG  E  2 6   ? 91.500  8.868   191.935 1.00 75.17  ? 6    DG  E P     1 
ATOM   3951 O  OP1   . DG  E  2 6   ? 91.800  8.520   190.526 1.00 70.23  ? 6    DG  E OP1   1 
ATOM   3952 O  OP2   . DG  E  2 6   ? 92.327  8.306   193.028 1.00 78.64  ? 6    DG  E OP2   1 
ATOM   3953 O  "O5'" . DG  E  2 6   ? 91.459  10.456  192.068 1.00 70.49  ? 6    DG  E "O5'" 1 
ATOM   3954 C  "C5'" . DG  E  2 6   ? 90.608  11.200  191.217 1.00 71.73  ? 6    DG  E "C5'" 1 
ATOM   3955 C  "C4'" . DG  E  2 6   ? 89.978  12.349  191.969 1.00 73.07  ? 6    DG  E "C4'" 1 
ATOM   3956 O  "O4'" . DG  E  2 6   ? 88.961  11.849  192.876 1.00 74.58  ? 6    DG  E "O4'" 1 
ATOM   3957 C  "C3'" . DG  E  2 6   ? 90.945  13.161  192.812 1.00 77.29  ? 6    DG  E "C3'" 1 
ATOM   3958 O  "O3'" . DG  E  2 6   ? 90.706  14.530  192.589 1.00 81.11  ? 6    DG  E "O3'" 1 
ATOM   3959 C  "C2'" . DG  E  2 6   ? 90.630  12.741  194.260 1.00 74.34  ? 6    DG  E "C2'" 1 
ATOM   3960 C  "C1'" . DG  E  2 6   ? 89.163  12.364  194.178 1.00 74.90  ? 6    DG  E "C1'" 1 
ATOM   3961 N  N9    . DG  E  2 6   ? 88.759  11.323  195.122 1.00 75.54  ? 6    DG  E N9    1 
ATOM   3962 C  C8    . DG  E  2 6   ? 89.260  10.040  195.209 1.00 73.50  ? 6    DG  E C8    1 
ATOM   3963 N  N7    . DG  E  2 6   ? 88.680  9.316   196.133 1.00 69.53  ? 6    DG  E N7    1 
ATOM   3964 C  C5    . DG  E  2 6   ? 87.721  10.164  196.677 1.00 68.54  ? 6    DG  E C5    1 
ATOM   3965 C  C6    . DG  E  2 6   ? 86.784  9.932   197.703 1.00 69.84  ? 6    DG  E C6    1 
ATOM   3966 O  O6    . DG  E  2 6   ? 86.611  8.901   198.364 1.00 73.00  ? 6    DG  E O6    1 
ATOM   3967 N  N1    . DG  E  2 6   ? 85.999  11.051  197.950 1.00 71.20  ? 6    DG  E N1    1 
ATOM   3968 C  C2    . DG  E  2 6   ? 86.100  12.244  197.281 1.00 72.77  ? 6    DG  E C2    1 
ATOM   3969 N  N2    . DG  E  2 6   ? 85.247  13.207  197.658 1.00 73.17  ? 6    DG  E N2    1 
ATOM   3970 N  N3    . DG  E  2 6   ? 86.974  12.479  196.311 1.00 74.25  ? 6    DG  E N3    1 
ATOM   3971 C  C4    . DG  E  2 6   ? 87.749  11.398  196.061 1.00 72.62  ? 6    DG  E C4    1 
ATOM   3972 P  P     . DC  E  2 7   ? 91.717  15.631  193.167 1.00 87.04  ? 7    DC  E P     1 
ATOM   3973 O  OP1   . DC  E  2 7   ? 91.618  16.843  192.320 1.00 82.77  ? 7    DC  E OP1   1 
ATOM   3974 O  OP2   . DC  E  2 7   ? 93.038  14.968  193.314 1.00 81.40  ? 7    DC  E OP2   1 
ATOM   3975 O  "O5'" . DC  E  2 7   ? 91.089  15.968  194.597 1.00 72.51  ? 7    DC  E "O5'" 1 
ATOM   3976 C  "C5'" . DC  E  2 7   ? 89.745  16.342  194.670 1.00 71.00  ? 7    DC  E "C5'" 1 
ATOM   3977 C  "C4'" . DC  E  2 7   ? 89.301  16.470  196.105 1.00 77.42  ? 7    DC  E "C4'" 1 
ATOM   3978 O  "O4'" . DC  E  2 7   ? 88.980  15.168  196.636 1.00 78.50  ? 7    DC  E "O4'" 1 
ATOM   3979 C  "C3'" . DC  E  2 7   ? 90.340  17.068  197.062 1.00 82.41  ? 7    DC  E "C3'" 1 
ATOM   3980 O  "O3'" . DC  E  2 7   ? 89.847  18.306  197.599 1.00 86.90  ? 7    DC  E "O3'" 1 
ATOM   3981 C  "C2'" . DC  E  2 7   ? 90.505  15.990  198.151 1.00 84.44  ? 7    DC  E "C2'" 1 
ATOM   3982 C  "C1'" . DC  E  2 7   ? 89.202  15.223  198.015 1.00 82.92  ? 7    DC  E "C1'" 1 
ATOM   3983 N  N1    . DC  E  2 7   ? 89.235  13.829  198.559 1.00 79.29  ? 7    DC  E N1    1 
ATOM   3984 C  C2    . DC  E  2 7   ? 88.322  13.461  199.551 1.00 73.34  ? 7    DC  E C2    1 
ATOM   3985 O  O2    . DC  E  2 7   ? 87.514  14.301  199.962 1.00 76.42  ? 7    DC  E O2    1 
ATOM   3986 N  N3    . DC  E  2 7   ? 88.353  12.194  200.034 1.00 72.50  ? 7    DC  E N3    1 
ATOM   3987 C  C4    . DC  E  2 7   ? 89.240  11.316  199.558 1.00 70.08  ? 7    DC  E C4    1 
ATOM   3988 N  N4    . DC  E  2 7   ? 89.233  10.075  200.066 1.00 67.82  ? 7    DC  E N4    1 
ATOM   3989 C  C5    . DC  E  2 7   ? 90.181  11.675  198.548 1.00 72.60  ? 7    DC  E C5    1 
ATOM   3990 C  C6    . DC  E  2 7   ? 90.142  12.928  198.078 1.00 76.71  ? 7    DC  E C6    1 
ATOM   3991 P  P     . DC  E  2 8   ? 90.592  19.028  198.831 1.00 95.64  ? 8    DC  E P     1 
ATOM   3992 O  OP1   . DC  E  2 8   ? 90.108  20.421  198.934 1.00 90.16  ? 8    DC  E OP1   1 
ATOM   3993 O  OP2   . DC  E  2 8   ? 92.045  18.734  198.758 1.00 87.38  ? 8    DC  E OP2   1 
ATOM   3994 O  "O5'" . DC  E  2 8   ? 90.008  18.276  200.095 1.00 90.62  ? 8    DC  E "O5'" 1 
ATOM   3995 C  "C5'" . DC  E  2 8   ? 88.661  18.423  200.430 1.00 83.33  ? 8    DC  E "C5'" 1 
ATOM   3996 C  "C4'" . DC  E  2 8   ? 88.476  18.096  201.887 1.00 85.59  ? 8    DC  E "C4'" 1 
ATOM   3997 O  "O4'" . DC  E  2 8   ? 88.494  16.656  202.059 1.00 83.94  ? 8    DC  E "O4'" 1 
ATOM   3998 C  "C3'" . DC  E  2 8   ? 89.572  18.643  202.803 1.00 86.43  ? 8    DC  E "C3'" 1 
ATOM   3999 O  "O3'" . DC  E  2 8   ? 89.001  19.081  204.018 1.00 91.14  ? 8    DC  E "O3'" 1 
ATOM   4000 C  "C2'" . DC  E  2 8   ? 90.475  17.430  203.024 1.00 82.65  ? 8    DC  E "C2'" 1 
ATOM   4001 C  "C1'" . DC  E  2 8   ? 89.454  16.304  203.033 1.00 80.88  ? 8    DC  E "C1'" 1 
ATOM   4002 N  N1    . DC  E  2 8   ? 90.017  14.980  202.658 1.00 77.18  ? 8    DC  E N1    1 
ATOM   4003 C  C2    . DC  E  2 8   ? 89.547  13.826  203.295 1.00 72.92  ? 8    DC  E C2    1 
ATOM   4004 O  O2    . DC  E  2 8   ? 88.686  13.935  204.173 1.00 73.49  ? 8    DC  E O2    1 
ATOM   4005 N  N3    . DC  E  2 8   ? 90.057  12.624  202.935 1.00 69.78  ? 8    DC  E N3    1 
ATOM   4006 C  C4    . DC  E  2 8   ? 90.991  12.556  201.982 1.00 71.39  ? 8    DC  E C4    1 
ATOM   4007 N  N4    . DC  E  2 8   ? 91.467  11.350  201.657 1.00 65.73  ? 8    DC  E N4    1 
ATOM   4008 C  C5    . DC  E  2 8   ? 91.475  13.721  201.315 1.00 72.52  ? 8    DC  E C5    1 
ATOM   4009 C  C6    . DC  E  2 8   ? 90.964  14.899  201.679 1.00 75.25  ? 8    DC  E C6    1 
ATOM   4010 P  P     . DG  E  2 9   ? 89.731  20.209  204.891 1.00 89.96  ? 9    DG  E P     1 
ATOM   4011 O  OP1   . DG  E  2 9   ? 88.931  21.447  204.733 1.00 92.74  ? 9    DG  E OP1   1 
ATOM   4012 O  OP2   . DG  E  2 9   ? 91.171  20.224  204.546 1.00 89.53  ? 9    DG  E OP2   1 
ATOM   4013 O  "O5'" . DG  E  2 9   ? 89.594  19.659  206.383 1.00 84.32  ? 9    DG  E "O5'" 1 
ATOM   4014 C  "C5'" . DG  E  2 9   ? 88.321  19.551  206.965 1.00 81.10  ? 9    DG  E "C5'" 1 
ATOM   4015 C  "C4'" . DG  E  2 9   ? 88.308  18.495  208.051 1.00 78.16  ? 9    DG  E "C4'" 1 
ATOM   4016 O  "O4'" . DG  E  2 9   ? 88.664  17.202  207.491 1.00 83.16  ? 9    DG  E "O4'" 1 
ATOM   4017 C  "C3'" . DG  E  2 9   ? 89.267  18.730  209.212 1.00 75.30  ? 9    DG  E "C3'" 1 
ATOM   4018 O  "O3'" . DG  E  2 9   ? 88.613  18.361  210.412 1.00 76.70  ? 9    DG  E "O3'" 1 
ATOM   4019 C  "C2'" . DG  E  2 9   ? 90.439  17.790  208.886 1.00 76.67  ? 9    DG  E "C2'" 1 
ATOM   4020 C  "C1'" . DG  E  2 9   ? 89.699  16.617  208.263 1.00 77.47  ? 9    DG  E "C1'" 1 
ATOM   4021 N  N9    . DG  E  2 9   ? 90.499  15.780  207.365 1.00 71.77  ? 9    DG  E N9    1 
ATOM   4022 C  C8    . DG  E  2 9   ? 91.252  16.202  206.297 1.00 73.26  ? 9    DG  E C8    1 
ATOM   4023 N  N7    . DG  E  2 9   ? 91.813  15.225  205.634 1.00 72.23  ? 9    DG  E N7    1 
ATOM   4024 C  C5    . DG  E  2 9   ? 91.393  14.077  206.295 1.00 67.91  ? 9    DG  E C5    1 
ATOM   4025 C  C6    . DG  E  2 9   ? 91.685  12.712  206.035 1.00 65.30  ? 9    DG  E C6    1 
ATOM   4026 O  O6    . DG  E  2 9   ? 92.393  12.228  205.138 1.00 65.85  ? 9    DG  E O6    1 
ATOM   4027 N  N1    . DG  E  2 9   ? 91.060  11.870  206.949 1.00 67.82  ? 9    DG  E N1    1 
ATOM   4028 C  C2    . DG  E  2 9   ? 90.249  12.287  207.976 1.00 64.83  ? 9    DG  E C2    1 
ATOM   4029 N  N2    . DG  E  2 9   ? 89.739  11.320  208.746 1.00 64.30  ? 9    DG  E N2    1 
ATOM   4030 N  N3    . DG  E  2 9   ? 89.966  13.562  208.236 1.00 62.97  ? 9    DG  E N3    1 
ATOM   4031 C  C4    . DG  E  2 9   ? 90.574  14.400  207.360 1.00 67.62  ? 9    DG  E C4    1 
ATOM   4032 P  P     . DG  E  2 10  ? 89.221  18.756  211.847 1.00 85.02  ? 10   DG  E P     1 
ATOM   4033 O  OP1   . DG  E  2 10  ? 88.170  19.458  212.618 1.00 83.28  ? 10   DG  E OP1   1 
ATOM   4034 O  OP2   . DG  E  2 10  ? 90.528  19.419  211.638 1.00 77.20  ? 10   DG  E OP2   1 
ATOM   4035 O  "O5'" . DG  E  2 10  ? 89.445  17.338  212.534 1.00 79.49  ? 10   DG  E "O5'" 1 
ATOM   4036 C  "C5'" . DG  E  2 10  ? 88.519  16.289  212.293 1.00 72.40  ? 10   DG  E "C5'" 1 
ATOM   4037 C  "C4'" . DG  E  2 10  ? 88.891  15.041  213.073 1.00 73.16  ? 10   DG  E "C4'" 1 
ATOM   4038 O  "O4'" . DG  E  2 10  ? 89.640  14.137  212.225 1.00 72.76  ? 10   DG  E "O4'" 1 
ATOM   4039 C  "C3'" . DG  E  2 10  ? 89.767  15.268  214.294 1.00 71.34  ? 10   DG  E "C3'" 1 
ATOM   4040 O  "O3'" . DG  E  2 10  ? 89.492  14.273  215.245 1.00 70.76  ? 10   DG  E "O3'" 1 
ATOM   4041 C  "C2'" . DG  E  2 10  ? 91.180  15.117  213.729 1.00 69.19  ? 10   DG  E "C2'" 1 
ATOM   4042 C  "C1'" . DG  E  2 10  ? 90.977  14.016  212.695 1.00 71.32  ? 10   DG  E "C1'" 1 
ATOM   4043 N  N9    . DG  E  2 10  ? 91.858  14.112  211.533 1.00 70.44  ? 10   DG  E N9    1 
ATOM   4044 C  C8    . DG  E  2 10  ? 92.238  15.256  210.872 1.00 67.48  ? 10   DG  E C8    1 
ATOM   4045 N  N7    . DG  E  2 10  ? 93.012  15.031  209.849 1.00 64.28  ? 10   DG  E N7    1 
ATOM   4046 C  C5    . DG  E  2 10  ? 93.140  13.649  209.819 1.00 64.37  ? 10   DG  E C5    1 
ATOM   4047 C  C6    . DG  E  2 10  ? 93.856  12.824  208.921 1.00 63.22  ? 10   DG  E C6    1 
ATOM   4048 O  O6    . DG  E  2 10  ? 94.536  13.170  207.948 1.00 64.16  ? 10   DG  E O6    1 
ATOM   4049 N  N1    . DG  E  2 10  ? 93.725  11.473  209.243 1.00 59.26  ? 10   DG  E N1    1 
ATOM   4050 C  C2    . DG  E  2 10  ? 92.986  10.988  210.299 1.00 62.97  ? 10   DG  E C2    1 
ATOM   4051 N  N2    . DG  E  2 10  ? 92.970  9.657   210.456 1.00 61.71  ? 10   DG  E N2    1 
ATOM   4052 N  N3    . DG  E  2 10  ? 92.313  11.755  211.148 1.00 64.24  ? 10   DG  E N3    1 
ATOM   4053 C  C4    . DG  E  2 10  ? 92.431  13.069  210.844 1.00 63.20  ? 10   DG  E C4    1 
ATOM   4054 P  P     . DG  E  2 11  ? 90.117  14.387  216.718 1.00 77.31  ? 11   DG  E P     1 
ATOM   4055 O  OP1   . DG  E  2 11  ? 89.188  13.700  217.643 1.00 75.35  ? 11   DG  E OP1   1 
ATOM   4056 O  OP2   . DG  E  2 11  ? 90.543  15.791  216.923 1.00 69.78  ? 11   DG  E OP2   1 
ATOM   4057 O  "O5'" . DG  E  2 11  ? 91.461  13.525  216.631 1.00 80.08  ? 11   DG  E "O5'" 1 
ATOM   4058 C  "C5'" . DG  E  2 11  ? 91.408  12.101  216.655 1.00 70.91  ? 11   DG  E "C5'" 1 
ATOM   4059 C  "C4'" . DG  E  2 11  ? 92.796  11.513  216.473 1.00 71.93  ? 11   DG  E "C4'" 1 
ATOM   4060 O  "O4'" . DG  E  2 11  ? 93.312  11.847  215.145 1.00 66.71  ? 11   DG  E "O4'" 1 
ATOM   4061 C  "C3'" . DG  E  2 11  ? 93.856  12.015  217.464 1.00 66.28  ? 11   DG  E "C3'" 1 
ATOM   4062 O  "O3'" . DG  E  2 11  ? 94.683  10.939  217.842 1.00 70.01  ? 11   DG  E "O3'" 1 
ATOM   4063 C  "C2'" . DG  E  2 11  ? 94.648  13.016  216.615 1.00 65.62  ? 11   DG  E "C2'" 1 
ATOM   4064 C  "C1'" . DG  E  2 11  ? 94.640  12.275  215.294 1.00 62.69  ? 11   DG  E "C1'" 1 
ATOM   4065 N  N9    . DG  E  2 11  ? 95.013  13.067  214.138 1.00 63.29  ? 11   DG  E N9    1 
ATOM   4066 C  C8    . DG  E  2 11  ? 94.879  14.419  213.974 1.00 63.45  ? 11   DG  E C8    1 
ATOM   4067 N  N7    . DG  E  2 11  ? 95.311  14.844  212.814 1.00 61.51  ? 11   DG  E N7    1 
ATOM   4068 C  C5    . DG  E  2 11  ? 95.750  13.693  212.168 1.00 59.86  ? 11   DG  E C5    1 
ATOM   4069 C  C6    . DG  E  2 11  ? 96.324  13.520  210.881 1.00 60.24  ? 11   DG  E C6    1 
ATOM   4070 O  O6    . DG  E  2 11  ? 96.561  14.379  210.013 1.00 60.55  ? 11   DG  E O6    1 
ATOM   4071 N  N1    . DG  E  2 11  ? 96.631  12.190  210.635 1.00 57.43  ? 11   DG  E N1    1 
ATOM   4072 C  C2    . DG  E  2 11  ? 96.420  11.160  211.506 1.00 55.82  ? 11   DG  E C2    1 
ATOM   4073 N  N2    . DG  E  2 11  ? 96.786  9.947   211.084 1.00 54.10  ? 11   DG  E N2    1 
ATOM   4074 N  N3    . DG  E  2 11  ? 95.884  11.302  212.709 1.00 59.42  ? 11   DG  E N3    1 
ATOM   4075 C  C4    . DG  E  2 11  ? 95.577  12.594  212.973 1.00 62.85  ? 11   DG  E C4    1 
ATOM   4076 P  P     . DT  E  2 12  ? 94.263  9.931   219.019 1.00 73.88  ? 12   DT  E P     1 
ATOM   4077 O  OP1   . DT  E  2 12  ? 92.798  9.708   218.998 1.00 69.08  ? 12   DT  E OP1   1 
ATOM   4078 O  OP2   . DT  E  2 12  ? 95.010  10.374  220.213 1.00 71.31  ? 12   DT  E OP2   1 
ATOM   4079 O  "O5'" . DT  E  2 12  ? 94.931  8.547   218.607 1.00 67.86  ? 12   DT  E "O5'" 1 
ATOM   4080 C  "C5'" . DT  E  2 12  ? 94.453  7.836   217.485 1.00 61.04  ? 12   DT  E "C5'" 1 
ATOM   4081 C  "C4'" . DT  E  2 12  ? 95.598  7.180   216.736 1.00 63.23  ? 12   DT  E "C4'" 1 
ATOM   4082 O  "O4'" . DT  E  2 12  ? 96.235  8.143   215.842 1.00 59.76  ? 12   DT  E "O4'" 1 
ATOM   4083 C  "C3'" . DT  E  2 12  ? 96.735  6.644   217.599 1.00 60.93  ? 12   DT  E "C3'" 1 
ATOM   4084 O  "O3'" . DT  E  2 12  ? 97.364  5.647   216.875 1.00 69.57  ? 12   DT  E "O3'" 1 
ATOM   4085 C  "C2'" . DT  E  2 12  ? 97.657  7.855   217.642 1.00 56.28  ? 12   DT  E "C2'" 1 
ATOM   4086 C  "C1'" . DT  E  2 12  ? 97.606  8.228   216.173 1.00 57.11  ? 12   DT  E "C1'" 1 
ATOM   4087 N  N1    . DT  E  2 12  ? 98.056  9.578   215.874 1.00 57.97  ? 12   DT  E N1    1 
ATOM   4088 C  C2    . DT  E  2 12  ? 98.534  9.859   214.616 1.00 55.41  ? 12   DT  E C2    1 
ATOM   4089 O  O2    . DT  E  2 12  ? 98.621  9.023   213.734 1.00 58.19  ? 12   DT  E O2    1 
ATOM   4090 N  N3    . DT  E  2 12  ? 98.906  11.159  214.424 1.00 56.64  ? 12   DT  E N3    1 
ATOM   4091 C  C4    . DT  E  2 12  ? 98.851  12.187  215.348 1.00 61.88  ? 12   DT  E C4    1 
ATOM   4092 O  O4    . DT  E  2 12  ? 99.213  13.326  215.080 1.00 67.29  ? 12   DT  E O4    1 
ATOM   4093 C  C5    . DT  E  2 12  ? 98.339  11.823  216.652 1.00 61.83  ? 12   DT  E C5    1 
ATOM   4094 C  C7    . DT  E  2 12  ? 98.227  12.852  217.735 1.00 64.66  ? 12   DT  E C7    1 
ATOM   4095 C  C6    . DT  E  2 12  ? 97.967  10.550  216.849 1.00 61.59  ? 12   DT  E C6    1 
ATOM   4096 P  P     . DA  E  2 13  ? 97.273  4.097   217.254 1.00 71.17  ? 13   DA  E P     1 
ATOM   4097 O  OP1   . DA  E  2 13  ? 95.915  3.584   216.964 1.00 64.22  ? 13   DA  E OP1   1 
ATOM   4098 O  OP2   . DA  E  2 13  ? 97.875  3.940   218.594 1.00 57.07  ? 13   DA  E OP2   1 
ATOM   4099 O  "O5'" . DA  E  2 13  ? 98.257  3.470   216.142 1.00 64.89  ? 13   DA  E "O5'" 1 
ATOM   4100 C  "C5'" . DA  E  2 13  ? 97.987  3.717   214.735 1.00 45.75  ? 13   DA  E "C5'" 1 
ATOM   4101 C  "C4'" . DA  E  2 13  ? 99.254  4.060   213.936 1.00 49.60  ? 13   DA  E "C4'" 1 
ATOM   4102 O  "O4'" . DA  E  2 13  ? 99.657  5.439   214.168 1.00 50.55  ? 13   DA  E "O4'" 1 
ATOM   4103 C  "C3'" . DA  E  2 13  ? 100.500 3.201   214.194 1.00 44.99  ? 13   DA  E "C3'" 1 
ATOM   4104 O  "O3'" . DA  E  2 13  ? 101.147 3.000   212.961 1.00 47.73  ? 13   DA  E "O3'" 1 
ATOM   4105 C  "C2'" . DA  E  2 13  ? 101.339 4.090   215.117 1.00 44.21  ? 13   DA  E "C2'" 1 
ATOM   4106 C  "C1'" . DA  E  2 13  ? 101.019 5.476   214.563 1.00 49.12  ? 13   DA  E "C1'" 1 
ATOM   4107 N  N9    . DA  E  2 13  ? 101.185 6.565   215.526 1.00 52.99  ? 13   DA  E N9    1 
ATOM   4108 C  C8    . DA  E  2 13  ? 100.930 6.533   216.877 1.00 50.05  ? 13   DA  E C8    1 
ATOM   4109 N  N7    . DA  E  2 13  ? 101.158 7.676   217.485 1.00 45.91  ? 13   DA  E N7    1 
ATOM   4110 C  C5    . DA  E  2 13  ? 101.584 8.518   216.462 1.00 50.30  ? 13   DA  E C5    1 
ATOM   4111 C  C6    . DA  E  2 13  ? 101.987 9.873   216.445 1.00 53.98  ? 13   DA  E C6    1 
ATOM   4112 N  N6    . DA  E  2 13  ? 102.015 10.650  217.535 1.00 50.60  ? 13   DA  E N6    1 
ATOM   4113 N  N1    . DA  E  2 13  ? 102.366 10.399  215.257 1.00 50.90  ? 13   DA  E N1    1 
ATOM   4114 C  C2    . DA  E  2 13  ? 102.325 9.626   214.167 1.00 52.03  ? 13   DA  E C2    1 
ATOM   4115 N  N3    . DA  E  2 13  ? 101.972 8.346   214.062 1.00 50.89  ? 13   DA  E N3    1 
ATOM   4116 C  C4    . DA  E  2 13  ? 101.607 7.848   215.253 1.00 48.18  ? 13   DA  E C4    1 
ATOM   4117 P  P     . DA  E  2 14  ? 102.239 1.843   212.748 1.00 44.78  ? 14   DA  E P     1 
ATOM   4118 O  OP1   . DA  E  2 14  ? 102.170 1.590   211.296 1.00 48.32  ? 14   DA  E OP1   1 
ATOM   4119 O  OP2   . DA  E  2 14  ? 102.047 0.685   213.640 1.00 44.99  ? 14   DA  E OP2   1 
ATOM   4120 O  "O5'" . DA  E  2 14  ? 103.621 2.561   213.166 1.00 41.84  ? 14   DA  E "O5'" 1 
ATOM   4121 C  "C5'" . DA  E  2 14  ? 104.518 3.058   212.154 1.00 45.97  ? 14   DA  E "C5'" 1 
ATOM   4122 C  "C4'" . DA  E  2 14  ? 104.235 4.517   211.836 1.00 47.87  ? 14   DA  E "C4'" 1 
ATOM   4123 O  "O4'" . DA  E  2 14  ? 103.974 5.212   213.091 1.00 40.54  ? 14   DA  E "O4'" 1 
ATOM   4124 C  "C3'" . DA  E  2 14  ? 105.397 5.288   211.156 1.00 40.48  ? 14   DA  E "C3'" 1 
ATOM   4125 O  "O3'" . DA  E  2 14  ? 104.916 6.212   210.121 1.00 47.15  ? 14   DA  E "O3'" 1 
ATOM   4126 C  "C2'" . DA  E  2 14  ? 105.981 6.059   212.333 1.00 46.51  ? 14   DA  E "C2'" 1 
ATOM   4127 C  "C1'" . DA  E  2 14  ? 104.691 6.411   213.052 1.00 44.44  ? 14   DA  E "C1'" 1 
ATOM   4128 N  N9    . DA  E  2 14  ? 104.841 6.895   214.398 1.00 46.30  ? 14   DA  E N9    1 
ATOM   4129 C  C8    . DA  E  2 14  ? 104.565 6.202   215.535 1.00 47.62  ? 14   DA  E C8    1 
ATOM   4130 N  N7    . DA  E  2 14  ? 104.749 6.890   216.628 1.00 48.82  ? 14   DA  E N7    1 
ATOM   4131 C  C5    . DA  E  2 14  ? 105.169 8.126   216.184 1.00 46.05  ? 14   DA  E C5    1 
ATOM   4132 C  C6    . DA  E  2 14  ? 105.520 9.297   216.877 1.00 47.65  ? 14   DA  E C6    1 
ATOM   4133 N  N6    . DA  E  2 14  ? 105.498 9.384   218.212 1.00 44.09  ? 14   DA  E N6    1 
ATOM   4134 N  N1    . DA  E  2 14  ? 105.891 10.370  216.144 1.00 45.18  ? 14   DA  E N1    1 
ATOM   4135 C  C2    . DA  E  2 14  ? 105.903 10.258  214.787 1.00 54.05  ? 14   DA  E C2    1 
ATOM   4136 N  N3    . DA  E  2 14  ? 105.586 9.202   214.022 1.00 39.37  ? 14   DA  E N3    1 
ATOM   4137 C  C4    . DA  E  2 14  ? 105.229 8.155   214.799 1.00 46.54  ? 14   DA  E C4    1 
ATOM   4138 P  P     . DG  E  2 15  ? 105.971 6.882   209.069 1.00 55.50  ? 15   DG  E P     1 
ATOM   4139 O  OP1   . DG  E  2 15  ? 106.085 8.353   209.102 1.00 47.57  ? 15   DG  E OP1   1 
ATOM   4140 O  OP2   . DG  E  2 15  ? 105.502 6.480   207.728 1.00 53.33  ? 15   DG  E OP2   1 
ATOM   4141 O  "O5'" . DG  E  2 15  ? 107.331 6.128   209.491 1.00 46.75  ? 15   DG  E "O5'" 1 
ATOM   4142 C  "C5'" . DG  E  2 15  ? 108.634 6.611   209.149 1.00 44.13  ? 15   DG  E "C5'" 1 
ATOM   4143 C  "C4'" . DG  E  2 15  ? 109.019 7.883   209.893 1.00 45.08  ? 15   DG  E "C4'" 1 
ATOM   4144 O  "O4'" . DG  E  2 15  ? 108.539 7.891   211.273 1.00 46.89  ? 15   DG  E "O4'" 1 
ATOM   4145 C  "C3'" . DG  E  2 15  ? 110.525 8.129   209.973 1.00 44.89  ? 15   DG  E "C3'" 1 
ATOM   4146 O  "O3'" . DG  E  2 15  ? 110.803 9.368   209.405 1.00 47.48  ? 15   DG  E "O3'" 1 
ATOM   4147 C  "C2'" . DG  E  2 15  ? 110.841 8.117   211.476 1.00 42.42  ? 15   DG  E "C2'" 1 
ATOM   4148 C  "C1'" . DG  E  2 15  ? 109.513 8.545   212.058 1.00 44.97  ? 15   DG  E "C1'" 1 
ATOM   4149 N  N9    . DG  E  2 15  ? 109.314 8.184   213.460 1.00 44.70  ? 15   DG  E N9    1 
ATOM   4150 C  C8    . DG  E  2 15  ? 108.923 6.964   213.946 1.00 47.66  ? 15   DG  E C8    1 
ATOM   4151 N  N7    . DG  E  2 15  ? 108.798 6.939   215.243 1.00 43.03  ? 15   DG  E N7    1 
ATOM   4152 C  C5    . DG  E  2 15  ? 109.104 8.231   215.645 1.00 46.84  ? 15   DG  E C5    1 
ATOM   4153 C  C6    . DG  E  2 15  ? 109.135 8.809   216.953 1.00 45.35  ? 15   DG  E C6    1 
ATOM   4154 O  O6    . DG  E  2 15  ? 108.883 8.270   218.044 1.00 47.46  ? 15   DG  E O6    1 
ATOM   4155 N  N1    . DG  E  2 15  ? 109.512 10.144  216.914 1.00 42.52  ? 15   DG  E N1    1 
ATOM   4156 C  C2    . DG  E  2 15  ? 109.817 10.840  215.772 1.00 48.32  ? 15   DG  E C2    1 
ATOM   4157 N  N2    . DG  E  2 15  ? 110.153 12.122  215.938 1.00 48.37  ? 15   DG  E N2    1 
ATOM   4158 N  N3    . DG  E  2 15  ? 109.790 10.313  214.540 1.00 47.56  ? 15   DG  E N3    1 
ATOM   4159 C  C4    . DG  E  2 15  ? 109.427 9.011   214.556 1.00 41.80  ? 15   DG  E C4    1 
ATOM   4160 P  P     . DT  E  2 16  ? 112.256 9.681   208.833 1.00 46.91  ? 16   DT  E P     1 
ATOM   4161 O  OP1   . DT  E  2 16  ? 112.035 10.595  207.700 1.00 50.10  ? 16   DT  E OP1   1 
ATOM   4162 O  OP2   . DT  E  2 16  ? 113.019 8.413   208.712 1.00 46.06  ? 16   DT  E OP2   1 
ATOM   4163 O  "O5'" . DT  E  2 16  ? 112.966 10.458  210.018 1.00 49.45  ? 16   DT  E "O5'" 1 
ATOM   4164 C  "C5'" . DT  E  2 16  ? 112.442 11.661  210.471 1.00 45.13  ? 16   DT  E "C5'" 1 
ATOM   4165 C  "C4'" . DT  E  2 16  ? 113.250 12.178  211.642 1.00 46.84  ? 16   DT  E "C4'" 1 
ATOM   4166 O  "O4'" . DT  E  2 16  ? 112.835 11.544  212.872 1.00 45.46  ? 16   DT  E "O4'" 1 
ATOM   4167 C  "C3'" . DT  E  2 16  ? 114.760 11.988  211.548 1.00 42.43  ? 16   DT  E "C3'" 1 
ATOM   4168 O  "O3'" . DT  E  2 16  ? 115.335 13.251  211.656 1.00 49.06  ? 16   DT  E "O3'" 1 
ATOM   4169 C  "C2'" . DT  E  2 16  ? 115.111 11.088  212.756 1.00 46.22  ? 16   DT  E "C2'" 1 
ATOM   4170 C  "C1'" . DT  E  2 16  ? 113.960 11.386  213.706 1.00 44.95  ? 16   DT  E "C1'" 1 
ATOM   4171 N  N1    . DT  E  2 16  ? 113.603 10.307  214.700 1.00 46.65  ? 16   DT  E N1    1 
ATOM   4172 C  C2    . DT  E  2 16  ? 113.438 10.661  216.025 1.00 48.81  ? 16   DT  E C2    1 
ATOM   4173 O  O2    . DT  E  2 16  ? 113.646 11.789  216.441 1.00 52.92  ? 16   DT  E O2    1 
ATOM   4174 N  N3    . DT  E  2 16  ? 113.047 9.642   216.855 1.00 44.99  ? 16   DT  E N3    1 
ATOM   4175 C  C4    . DT  E  2 16  ? 112.777 8.338   216.509 1.00 46.21  ? 16   DT  E C4    1 
ATOM   4176 O  O4    . DT  E  2 16  ? 112.421 7.508   217.336 1.00 42.05  ? 16   DT  E O4    1 
ATOM   4177 C  C5    . DT  E  2 16  ? 112.946 8.017   215.093 1.00 46.16  ? 16   DT  E C5    1 
ATOM   4178 C  C7    . DT  E  2 16  ? 112.688 6.613   214.595 1.00 33.57  ? 16   DT  E C7    1 
ATOM   4179 C  C6    . DT  E  2 16  ? 113.336 9.013   214.262 1.00 43.51  ? 16   DT  E C6    1 
ATOM   4180 P  P     . DT  E  2 17  ? 116.895 13.477  211.410 1.00 51.49  ? 17   DT  E P     1 
ATOM   4181 O  OP1   . DT  E  2 17  ? 117.018 14.777  210.718 1.00 49.91  ? 17   DT  E OP1   1 
ATOM   4182 O  OP2   . DT  E  2 17  ? 117.456 12.246  210.800 1.00 54.99  ? 17   DT  E OP2   1 
ATOM   4183 O  "O5'" . DT  E  2 17  ? 117.463 13.607  212.885 1.00 53.91  ? 17   DT  E "O5'" 1 
ATOM   4184 C  "C5'" . DT  E  2 17  ? 116.936 14.597  213.720 1.00 53.72  ? 17   DT  E "C5'" 1 
ATOM   4185 C  "C4'" . DT  E  2 17  ? 117.476 14.482  215.129 1.00 57.22  ? 17   DT  E "C4'" 1 
ATOM   4186 O  "O4'" . DT  E  2 17  ? 116.851 13.374  215.826 1.00 53.41  ? 17   DT  E "O4'" 1 
ATOM   4187 C  "C3'" . DT  E  2 17  ? 118.977 14.264  215.276 1.00 57.20  ? 17   DT  E "C3'" 1 
ATOM   4188 O  "O3'" . DT  E  2 17  ? 119.358 14.891  216.452 1.00 64.72  ? 17   DT  E "O3'" 1 
ATOM   4189 C  "C2'" . DT  E  2 17  ? 119.049 12.762  215.474 1.00 53.90  ? 17   DT  E "C2'" 1 
ATOM   4190 C  "C1'" . DT  E  2 17  ? 117.862 12.592  216.405 1.00 52.72  ? 17   DT  E "C1'" 1 
ATOM   4191 N  N1    . DT  E  2 17  ? 117.375 11.206  216.524 1.00 51.29  ? 17   DT  E N1    1 
ATOM   4192 C  C2    . DT  E  2 17  ? 116.887 10.786  217.731 1.00 48.92  ? 17   DT  E C2    1 
ATOM   4193 O  O2    . DT  E  2 17  ? 116.834 11.504  218.706 1.00 51.79  ? 17   DT  E O2    1 
ATOM   4194 N  N3    . DT  E  2 17  ? 116.459 9.499   217.758 1.00 44.97  ? 17   DT  E N3    1 
ATOM   4195 C  C4    . DT  E  2 17  ? 116.462 8.596   216.720 1.00 42.92  ? 17   DT  E C4    1 
ATOM   4196 O  O4    . DT  E  2 17  ? 116.049 7.445   216.856 1.00 37.78  ? 17   DT  E O4    1 
ATOM   4197 C  C5    . DT  E  2 17  ? 116.998 9.099   215.461 1.00 46.23  ? 17   DT  E C5    1 
ATOM   4198 C  C7    . DT  E  2 17  ? 117.072 8.211   214.251 1.00 41.73  ? 17   DT  E C7    1 
ATOM   4199 C  C6    . DT  E  2 17  ? 117.420 10.367  215.425 1.00 46.75  ? 17   DT  E C6    1 
ATOM   4200 P  P     . DC  E  2 18  ? 120.560 15.946  216.503 1.00 71.31  ? 18   DC  E P     1 
ATOM   4201 O  OP1   . DC  E  2 18  ? 119.917 17.277  216.481 1.00 69.41  ? 18   DC  E OP1   1 
ATOM   4202 O  OP2   . DC  E  2 18  ? 121.573 15.631  215.479 1.00 69.47  ? 18   DC  E OP2   1 
ATOM   4203 O  "O5'" . DC  E  2 18  ? 121.215 15.638  217.940 1.00 70.63  ? 18   DC  E "O5'" 1 
ATOM   4204 C  "C5'" . DC  E  2 18  ? 120.820 16.377  219.062 1.00 60.44  ? 18   DC  E "C5'" 1 
ATOM   4205 C  "C4'" . DC  E  2 18  ? 120.158 15.508  220.120 1.00 63.34  ? 18   DC  E "C4'" 1 
ATOM   4206 O  "O4'" . DC  E  2 18  ? 119.523 14.352  219.552 1.00 58.91  ? 18   DC  E "O4'" 1 
ATOM   4207 C  "C3'" . DC  E  2 18  ? 121.077 14.908  221.148 1.00 61.33  ? 18   DC  E "C3'" 1 
ATOM   4208 O  "O3'" . DC  E  2 18  ? 121.477 15.896  222.073 1.00 70.21  ? 18   DC  E "O3'" 1 
ATOM   4209 C  "C2'" . DC  E  2 18  ? 120.151 13.875  221.794 1.00 57.72  ? 18   DC  E "C2'" 1 
ATOM   4210 C  "C1'" . DC  E  2 18  ? 119.262 13.445  220.620 1.00 53.51  ? 18   DC  E "C1'" 1 
ATOM   4211 N  N1    . DC  E  2 18  ? 119.536 12.060  220.167 1.00 51.24  ? 18   DC  E N1    1 
ATOM   4212 C  C2    . DC  E  2 18  ? 119.065 10.973  220.927 1.00 53.73  ? 18   DC  E C2    1 
ATOM   4213 O  O2    . DC  E  2 18  ? 118.417 11.187  221.969 1.00 54.45  ? 18   DC  E O2    1 
ATOM   4214 N  N3    . DC  E  2 18  ? 119.330 9.709   220.501 1.00 51.07  ? 18   DC  E N3    1 
ATOM   4215 C  C4    . DC  E  2 18  ? 120.025 9.516   219.379 1.00 54.88  ? 18   DC  E C4    1 
ATOM   4216 N  N4    . DC  E  2 18  ? 120.255 8.250   218.998 1.00 53.88  ? 18   DC  E N4    1 
ATOM   4217 C  C5    . DC  E  2 18  ? 120.516 10.614  218.595 1.00 47.96  ? 18   DC  E C5    1 
ATOM   4218 C  C6    . DC  E  2 18  ? 120.253 11.853  219.028 1.00 49.43  ? 18   DC  E C6    1 
ATOM   4219 P  P     . DC  E  2 19  ? 122.928 15.827  222.762 1.00 73.66  ? 19   DC  E P     1 
ATOM   4220 O  OP1   . DC  E  2 19  ? 123.095 17.122  223.445 1.00 80.93  ? 19   DC  E OP1   1 
ATOM   4221 O  OP2   . DC  E  2 19  ? 123.946 15.379  221.774 1.00 67.93  ? 19   DC  E OP2   1 
ATOM   4222 O  "O5'" . DC  E  2 19  ? 122.747 14.710  223.883 1.00 71.43  ? 19   DC  E "O5'" 1 
ATOM   4223 C  "C5'" . DC  E  2 19  ? 121.643 14.787  224.761 1.00 66.54  ? 19   DC  E "C5'" 1 
ATOM   4224 C  "C4'" . DC  E  2 19  ? 121.519 13.510  225.549 1.00 68.46  ? 19   DC  E "C4'" 1 
ATOM   4225 O  "O4'" . DC  E  2 19  ? 120.928 12.485  224.736 1.00 65.01  ? 19   DC  E "O4'" 1 
ATOM   4226 C  "C3'" . DC  E  2 19  ? 122.838 12.920  225.987 1.00 68.97  ? 19   DC  E "C3'" 1 
ATOM   4227 O  "O3'" . DC  E  2 19  ? 123.240 13.536  227.188 1.00 78.00  ? 19   DC  E "O3'" 1 
ATOM   4228 C  "C2'" . DC  E  2 19  ? 122.475 11.454  226.213 1.00 66.26  ? 19   DC  E "C2'" 1 
ATOM   4229 C  "C1'" . DC  E  2 19  ? 121.316 11.225  225.247 1.00 60.47  ? 19   DC  E "C1'" 1 
ATOM   4230 N  N1    . DC  E  2 19  ? 121.674 10.331  224.130 1.00 59.11  ? 19   DC  E N1    1 
ATOM   4231 C  C2    . DC  E  2 19  ? 121.535 8.955   224.308 1.00 60.00  ? 19   DC  E C2    1 
ATOM   4232 O  O2    . DC  E  2 19  ? 121.101 8.533   225.392 1.00 53.47  ? 19   DC  E O2    1 
ATOM   4233 N  N3    . DC  E  2 19  ? 121.867 8.122   223.285 1.00 53.76  ? 19   DC  E N3    1 
ATOM   4234 C  C4    . DC  E  2 19  ? 122.319 8.627   222.139 1.00 55.26  ? 19   DC  E C4    1 
ATOM   4235 N  N4    . DC  E  2 19  ? 122.621 7.765   221.158 1.00 48.83  ? 19   DC  E N4    1 
ATOM   4236 C  C5    . DC  E  2 19  ? 122.474 10.039  221.944 1.00 55.18  ? 19   DC  E C5    1 
ATOM   4237 C  C6    . DC  E  2 19  ? 122.152 10.844  222.960 1.00 49.96  ? 19   DC  E C6    1 
ATOM   4238 P  P     . DG  E  2 20  ? 124.757 13.443  227.696 1.00 83.49  ? 20   DG  E P     1 
ATOM   4239 O  OP1   . DG  E  2 20  ? 124.844 14.353  228.860 1.00 90.02  ? 20   DG  E OP1   1 
ATOM   4240 O  OP2   . DG  E  2 20  ? 125.677 13.586  226.534 1.00 78.78  ? 20   DG  E OP2   1 
ATOM   4241 O  "O5'" . DG  E  2 20  ? 124.865 11.967  228.259 1.00 73.82  ? 20   DG  E "O5'" 1 
ATOM   4242 C  "C5'" . DG  E  2 20  ? 123.917 11.498  229.216 1.00 78.16  ? 20   DG  E "C5'" 1 
ATOM   4243 C  "C4'" . DG  E  2 20  ? 124.231 10.067  229.532 1.00 76.00  ? 20   DG  E "C4'" 1 
ATOM   4244 O  "O4'" . DG  E  2 20  ? 123.823 9.230   228.403 1.00 74.01  ? 20   DG  E "O4'" 1 
ATOM   4245 C  "C3'" . DG  E  2 20  ? 125.729 9.847   229.718 1.00 76.49  ? 20   DG  E "C3'" 1 
ATOM   4246 O  "O3'" . DG  E  2 20  ? 125.999 9.037   230.833 1.00 85.13  ? 20   DG  E "O3'" 1 
ATOM   4247 C  "C2'" . DG  E  2 20  ? 126.162 9.180   228.426 1.00 77.55  ? 20   DG  E "C2'" 1 
ATOM   4248 C  "C1'" . DG  E  2 20  ? 124.910 8.429   228.008 1.00 74.15  ? 20   DG  E "C1'" 1 
ATOM   4249 N  N9    . DG  E  2 20  ? 124.912 8.209   226.564 1.00 66.47  ? 20   DG  E N9    1 
ATOM   4250 C  C8    . DG  E  2 20  ? 125.241 9.127   225.591 1.00 62.47  ? 20   DG  E C8    1 
ATOM   4251 N  N7    . DG  E  2 20  ? 125.252 8.625   224.387 1.00 59.97  ? 20   DG  E N7    1 
ATOM   4252 C  C5    . DG  E  2 20  ? 124.937 7.281   224.576 1.00 56.29  ? 20   DG  E C5    1 
ATOM   4253 C  C6    . DG  E  2 20  ? 124.803 6.235   223.637 1.00 52.24  ? 20   DG  E C6    1 
ATOM   4254 O  O6    . DG  E  2 20  ? 124.933 6.291   222.410 1.00 58.86  ? 20   DG  E O6    1 
ATOM   4255 N  N1    . DG  E  2 20  ? 124.480 5.022   224.248 1.00 53.56  ? 20   DG  E N1    1 
ATOM   4256 C  C2    . DG  E  2 20  ? 124.308 4.845   225.608 1.00 54.89  ? 20   DG  E C2    1 
ATOM   4257 N  N2    . DG  E  2 20  ? 123.995 3.606   226.019 1.00 49.61  ? 20   DG  E N2    1 
ATOM   4258 N  N3    . DG  E  2 20  ? 124.433 5.819   226.502 1.00 55.57  ? 20   DG  E N3    1 
ATOM   4259 C  C4    . DG  E  2 20  ? 124.746 7.007   225.915 1.00 60.90  ? 20   DG  E C4    1 
ATOM   4260 P  P     . DG  E  2 21  ? 127.521 8.645   231.170 1.00 89.18  ? 21   DG  E P     1 
ATOM   4261 O  OP1   . DG  E  2 21  ? 127.487 8.083   232.535 1.00 77.95  ? 21   DG  E OP1   1 
ATOM   4262 O  OP2   . DG  E  2 21  ? 128.380 9.807   230.827 1.00 80.64  ? 21   DG  E OP2   1 
ATOM   4263 O  "O5'" . DG  E  2 21  ? 127.864 7.461   230.145 1.00 72.47  ? 21   DG  E "O5'" 1 
ATOM   4264 C  "C5'" . DG  E  2 21  ? 128.515 6.308   230.608 1.00 70.87  ? 21   DG  E "C5'" 1 
ATOM   4265 C  "C4'" . DG  E  2 21  ? 127.860 5.045   230.079 1.00 68.93  ? 21   DG  E "C4'" 1 
ATOM   4266 O  "O4'" . DG  E  2 21  ? 127.054 5.347   228.918 1.00 67.95  ? 21   DG  E "O4'" 1 
ATOM   4267 C  "C3'" . DG  E  2 21  ? 128.847 3.993   229.614 1.00 73.42  ? 21   DG  E "C3'" 1 
ATOM   4268 O  "O3'" . DG  E  2 21  ? 129.218 3.169   230.708 1.00 70.70  ? 21   DG  E "O3'" 1 
ATOM   4269 C  "C2'" . DG  E  2 21  ? 128.053 3.214   228.564 1.00 70.35  ? 21   DG  E "C2'" 1 
ATOM   4270 C  "C1'" . DG  E  2 21  ? 127.147 4.285   227.974 1.00 64.76  ? 21   DG  E "C1'" 1 
ATOM   4271 N  N9    . DG  E  2 21  ? 127.595 4.818   226.673 1.00 65.37  ? 21   DG  E N9    1 
ATOM   4272 C  C8    . DG  E  2 21  ? 127.975 6.113   226.385 1.00 60.38  ? 21   DG  E C8    1 
ATOM   4273 N  N7    . DG  E  2 21  ? 128.288 6.295   225.127 1.00 53.41  ? 21   DG  E N7    1 
ATOM   4274 C  C5    . DG  E  2 21  ? 128.095 5.052   224.544 1.00 52.02  ? 21   DG  E C5    1 
ATOM   4275 C  C6    . DG  E  2 21  ? 128.274 4.638   223.199 1.00 50.19  ? 21   DG  E C6    1 
ATOM   4276 O  O6    . DG  E  2 21  ? 128.642 5.317   222.245 1.00 50.21  ? 21   DG  E O6    1 
ATOM   4277 N  N1    . DG  E  2 21  ? 127.975 3.290   223.015 1.00 48.50  ? 21   DG  E N1    1 
ATOM   4278 C  C2    . DG  E  2 21  ? 127.557 2.439   224.010 1.00 54.32  ? 21   DG  E C2    1 
ATOM   4279 N  N2    . DG  E  2 21  ? 127.320 1.167   223.645 1.00 49.09  ? 21   DG  E N2    1 
ATOM   4280 N  N3    . DG  E  2 21  ? 127.373 2.813   225.281 1.00 57.99  ? 21   DG  E N3    1 
ATOM   4281 C  C4    . DG  E  2 21  ? 127.668 4.132   225.473 1.00 56.27  ? 21   DG  E C4    1 
ATOM   4282 P  P     . DC  E  2 22  ? 130.752 2.752   230.911 1.00 72.95  ? 22   DC  E P     1 
ATOM   4283 O  OP1   . DC  E  2 22  ? 130.851 2.036   232.201 1.00 78.26  ? 22   DC  E OP1   1 
ATOM   4284 O  OP2   . DC  E  2 22  ? 131.596 3.936   230.621 1.00 66.15  ? 22   DC  E OP2   1 
ATOM   4285 O  "O5'" . DC  E  2 22  ? 131.000 1.693   229.749 1.00 69.35  ? 22   DC  E "O5'" 1 
ATOM   4286 C  "C5'" . DC  E  2 22  ? 130.121 0.594   229.585 1.00 65.61  ? 22   DC  E "C5'" 1 
ATOM   4287 C  "C4'" . DC  E  2 22  ? 130.444 -0.090  228.283 1.00 69.03  ? 22   DC  E "C4'" 1 
ATOM   4288 O  "O4'" . DC  E  2 22  ? 130.111 0.821   227.201 1.00 65.41  ? 22   DC  E "O4'" 1 
ATOM   4289 C  "C3'" . DC  E  2 22  ? 131.936 -0.413  228.135 1.00 64.06  ? 22   DC  E "C3'" 1 
ATOM   4290 O  "O3'" . DC  E  2 22  ? 132.171 -1.813  228.010 1.00 64.32  ? 22   DC  E "O3'" 1 
ATOM   4291 C  "C2'" . DC  E  2 22  ? 132.387 0.343   226.887 1.00 67.32  ? 22   DC  E "C2'" 1 
ATOM   4292 C  "C1'" . DC  E  2 22  ? 131.091 0.739   226.201 1.00 62.81  ? 22   DC  E "C1'" 1 
ATOM   4293 N  N1    . DC  E  2 22  ? 131.215 2.046   225.529 1.00 58.81  ? 22   DC  E N1    1 
ATOM   4294 C  C2    . DC  E  2 22  ? 131.251 2.091   224.131 1.00 53.61  ? 22   DC  E C2    1 
ATOM   4295 O  O2    . DC  E  2 22  ? 131.122 1.035   223.495 1.00 53.85  ? 22   DC  E O2    1 
ATOM   4296 N  N3    . DC  E  2 22  ? 131.397 3.291   223.516 1.00 50.44  ? 22   DC  E N3    1 
ATOM   4297 C  C4    . DC  E  2 22  ? 131.521 4.399   224.243 1.00 51.75  ? 22   DC  E C4    1 
ATOM   4298 N  N4    . DC  E  2 22  ? 131.661 5.556   223.595 1.00 49.29  ? 22   DC  E N4    1 
ATOM   4299 C  C5    . DC  E  2 22  ? 131.502 4.368   225.671 1.00 54.59  ? 22   DC  E C5    1 
ATOM   4300 C  C6    . DC  E  2 22  ? 131.360 3.179   226.266 1.00 53.97  ? 22   DC  E C6    1 
ATOM   4301 P  P     . DG  E  2 23  ? 133.685 -2.363  228.051 1.00 79.05  ? 23   DG  E P     1 
ATOM   4302 O  OP1   . DG  E  2 23  ? 133.674 -3.576  228.896 1.00 80.36  ? 23   DG  E OP1   1 
ATOM   4303 O  OP2   . DG  E  2 23  ? 134.602 -1.233  228.329 1.00 65.57  ? 23   DG  E OP2   1 
ATOM   4304 O  "O5'" . DG  E  2 23  ? 134.002 -2.772  226.545 1.00 68.06  ? 23   DG  E "O5'" 1 
ATOM   4305 C  "C5'" . DG  E  2 23  ? 132.939 -3.020  225.659 1.00 71.62  ? 23   DG  E "C5'" 1 
ATOM   4306 C  "C4'" . DG  E  2 23  ? 133.450 -3.215  224.249 1.00 68.70  ? 23   DG  E "C4'" 1 
ATOM   4307 O  "O4'" . DG  E  2 23  ? 133.324 -1.980  223.510 1.00 66.71  ? 23   DG  E "O4'" 1 
ATOM   4308 C  "C3'" . DG  E  2 23  ? 134.911 -3.626  224.141 1.00 66.02  ? 23   DG  E "C3'" 1 
ATOM   4309 O  "O3'" . DG  E  2 23  ? 135.061 -4.491  223.024 1.00 68.79  ? 23   DG  E "O3'" 1 
ATOM   4310 C  "C2'" . DG  E  2 23  ? 135.625 -2.292  223.928 1.00 63.68  ? 23   DG  E "C2'" 1 
ATOM   4311 C  "C1'" . DG  E  2 23  ? 134.602 -1.539  223.079 1.00 65.11  ? 23   DG  E "C1'" 1 
ATOM   4312 N  N9    . DG  E  2 23  ? 134.649 -0.087  223.237 1.00 56.88  ? 23   DG  E N9    1 
ATOM   4313 C  C8    . DG  E  2 23  ? 134.597 0.616   224.413 1.00 55.68  ? 23   DG  E C8    1 
ATOM   4314 N  N7    . DG  E  2 23  ? 134.630 1.908   224.247 1.00 57.22  ? 23   DG  E N7    1 
ATOM   4315 C  C5    . DG  E  2 23  ? 134.689 2.074   222.870 1.00 49.10  ? 23   DG  E C5    1 
ATOM   4316 C  C6    . DG  E  2 23  ? 134.744 3.253   222.100 1.00 49.86  ? 23   DG  E C6    1 
ATOM   4317 O  O6    . DG  E  2 23  ? 134.758 4.431   222.495 1.00 53.71  ? 23   DG  E O6    1 
ATOM   4318 N  N1    . DG  E  2 23  ? 134.807 2.972   220.739 1.00 46.35  ? 23   DG  E N1    1 
ATOM   4319 C  C2    . DG  E  2 23  ? 134.800 1.710   220.195 1.00 46.09  ? 23   DG  E C2    1 
ATOM   4320 N  N2    . DG  E  2 23  ? 134.858 1.641   218.862 1.00 48.16  ? 23   DG  E N2    1 
ATOM   4321 N  N3    . DG  E  2 23  ? 134.740 0.597   220.900 1.00 47.01  ? 23   DG  E N3    1 
ATOM   4322 C  C4    . DG  E  2 23  ? 134.692 0.855   222.231 1.00 52.11  ? 23   DG  E C4    1 
ATOM   4323 P  P     . DC  E  2 24  ? 136.397 -5.365  222.837 1.00 81.53  ? 24   DC  E P     1 
ATOM   4324 O  OP1   . DC  E  2 24  ? 135.939 -6.671  222.294 1.00 69.34  ? 24   DC  E OP1   1 
ATOM   4325 O  OP2   . DC  E  2 24  ? 137.261 -5.292  224.044 1.00 58.53  ? 24   DC  E OP2   1 
ATOM   4326 O  "O5'" . DC  E  2 24  ? 137.197 -4.564  221.713 1.00 69.67  ? 24   DC  E "O5'" 1 
ATOM   4327 C  "C5'" . DC  E  2 24  ? 136.662 -4.453  220.425 1.00 55.97  ? 24   DC  E "C5'" 1 
ATOM   4328 C  "C4'" . DC  E  2 24  ? 137.531 -3.557  219.625 1.00 54.06  ? 24   DC  E "C4'" 1 
ATOM   4329 O  "O4'" . DC  E  2 24  ? 137.228 -2.184  219.971 1.00 51.82  ? 24   DC  E "O4'" 1 
ATOM   4330 C  "C3'" . DC  E  2 24  ? 139.021 -3.750  219.909 1.00 58.62  ? 24   DC  E "C3'" 1 
ATOM   4331 O  "O3'" . DC  E  2 24  ? 139.725 -3.974  218.698 1.00 51.04  ? 24   DC  E "O3'" 1 
ATOM   4332 C  "C2'" . DC  E  2 24  ? 139.432 -2.435  220.575 1.00 59.76  ? 24   DC  E "C2'" 1 
ATOM   4333 C  "C1'" . DC  E  2 24  ? 138.423 -1.465  219.991 1.00 53.87  ? 24   DC  E "C1'" 1 
ATOM   4334 N  N1    . DC  E  2 24  ? 138.255 -0.242  220.816 1.00 48.28  ? 24   DC  E N1    1 
ATOM   4335 C  C2    . DC  E  2 24  ? 138.171 0.999   220.194 1.00 48.52  ? 24   DC  E C2    1 
ATOM   4336 O  O2    . DC  E  2 24  ? 138.213 1.054   218.953 1.00 50.04  ? 24   DC  E O2    1 
ATOM   4337 N  N3    . DC  E  2 24  ? 138.045 2.108   220.962 1.00 46.51  ? 24   DC  E N3    1 
ATOM   4338 C  C4    . DC  E  2 24  ? 138.024 1.995   222.298 1.00 48.23  ? 24   DC  E C4    1 
ATOM   4339 N  N4    . DC  E  2 24  ? 137.902 3.112   223.024 1.00 48.96  ? 24   DC  E N4    1 
ATOM   4340 C  C5    . DC  E  2 24  ? 138.119 0.738   222.943 1.00 45.29  ? 24   DC  E C5    1 
ATOM   4341 C  C6    . DC  E  2 24  ? 138.240 -0.343  222.171 1.00 49.28  ? 24   DC  E C6    1 
ATOM   4342 P  P     . DG  E  2 25  ? 141.222 -4.559  218.709 1.00 54.46  ? 25   DG  E P     1 
ATOM   4343 O  OP1   . DG  E  2 25  ? 141.218 -5.910  218.136 1.00 59.23  ? 25   DG  E OP1   1 
ATOM   4344 O  OP2   . DG  E  2 25  ? 141.841 -4.365  220.036 1.00 54.76  ? 25   DG  E OP2   1 
ATOM   4345 O  "O5'" . DG  E  2 25  ? 141.990 -3.591  217.689 1.00 57.05  ? 25   DG  E "O5'" 1 
ATOM   4346 C  "C5'" . DG  E  2 25  ? 141.471 -3.353  216.387 1.00 46.90  ? 25   DG  E "C5'" 1 
ATOM   4347 C  "C4'" . DG  E  2 25  ? 142.172 -2.169  215.733 1.00 46.34  ? 25   DG  E "C4'" 1 
ATOM   4348 O  "O4'" . DG  E  2 25  ? 141.715 -0.926  216.331 1.00 48.37  ? 25   DG  E "O4'" 1 
ATOM   4349 C  "C3'" . DG  E  2 25  ? 143.690 -2.162  215.857 1.00 49.80  ? 25   DG  E "C3'" 1 
ATOM   4350 O  "O3'" . DG  E  2 25  ? 144.280 -1.645  214.646 1.00 52.00  ? 25   DG  E "O3'" 1 
ATOM   4351 C  "C2'" . DG  E  2 25  ? 143.942 -1.244  217.055 1.00 44.75  ? 25   DG  E "C2'" 1 
ATOM   4352 C  "C1'" . DG  E  2 25  ? 142.793 -0.239  216.949 1.00 47.77  ? 25   DG  E "C1'" 1 
ATOM   4353 N  N9    . DG  E  2 25  ? 142.339 0.280   218.259 1.00 45.65  ? 25   DG  E N9    1 
ATOM   4354 C  C8    . DG  E  2 25  ? 142.010 -0.462  219.370 1.00 46.61  ? 25   DG  E C8    1 
ATOM   4355 N  N7    . DG  E  2 25  ? 141.622 0.263   220.393 1.00 47.16  ? 25   DG  E N7    1 
ATOM   4356 C  C5    . DG  E  2 25  ? 141.701 1.570   219.935 1.00 43.03  ? 25   DG  E C5    1 
ATOM   4357 C  C6    . DG  E  2 25  ? 141.418 2.785   220.605 1.00 42.68  ? 25   DG  E C6    1 
ATOM   4358 O  O6    . DG  E  2 25  ? 141.040 2.942   221.774 1.00 49.71  ? 25   DG  E O6    1 
ATOM   4359 N  N1    . DG  E  2 25  ? 141.623 3.892   219.783 1.00 42.49  ? 25   DG  E N1    1 
ATOM   4360 C  C2    . DG  E  2 25  ? 142.057 3.830   218.472 1.00 45.36  ? 25   DG  E C2    1 
ATOM   4361 N  N2    . DG  E  2 25  ? 142.196 4.999   217.833 1.00 41.02  ? 25   DG  E N2    1 
ATOM   4362 N  N3    . DG  E  2 25  ? 142.340 2.697   217.835 1.00 47.99  ? 25   DG  E N3    1 
ATOM   4363 C  C4    . DG  E  2 25  ? 142.141 1.606   218.624 1.00 43.54  ? 25   DG  E C4    1 
ATOM   4364 O  "O5'" . DC  F  3 1   ? 142.564 11.875  222.644 1.00 69.30  ? 1    DC  F "O5'" 1 
ATOM   4365 C  "C5'" . DC  F  3 1   ? 143.632 12.205  221.773 1.00 66.83  ? 1    DC  F "C5'" 1 
ATOM   4366 C  "C4'" . DC  F  3 1   ? 143.307 11.810  220.342 1.00 64.99  ? 1    DC  F "C4'" 1 
ATOM   4367 O  "O4'" . DC  F  3 1   ? 143.318 10.365  220.216 1.00 65.80  ? 1    DC  F "O4'" 1 
ATOM   4368 C  "C3'" . DC  F  3 1   ? 141.938 12.255  219.838 1.00 67.99  ? 1    DC  F "C3'" 1 
ATOM   4369 O  "O3'" . DC  F  3 1   ? 142.024 12.459  218.453 1.00 77.12  ? 1    DC  F "O3'" 1 
ATOM   4370 C  "C2'" . DC  F  3 1   ? 141.053 11.062  220.176 1.00 60.97  ? 1    DC  F "C2'" 1 
ATOM   4371 C  "C1'" . DC  F  3 1   ? 142.009 9.902   219.919 1.00 62.85  ? 1    DC  F "C1'" 1 
ATOM   4372 N  N1    . DC  F  3 1   ? 141.713 8.677   220.740 1.00 53.61  ? 1    DC  F N1    1 
ATOM   4373 C  C2    . DC  F  3 1   ? 141.669 7.432   220.101 1.00 51.99  ? 1    DC  F C2    1 
ATOM   4374 O  O2    . DC  F  3 1   ? 141.886 7.379   218.876 1.00 54.97  ? 1    DC  F O2    1 
ATOM   4375 N  N3    . DC  F  3 1   ? 141.401 6.324   220.837 1.00 46.58  ? 1    DC  F N3    1 
ATOM   4376 C  C4    . DC  F  3 1   ? 141.178 6.432   222.152 1.00 48.21  ? 1    DC  F C4    1 
ATOM   4377 N  N4    . DC  F  3 1   ? 140.914 5.312   222.829 1.00 44.15  ? 1    DC  F N4    1 
ATOM   4378 C  C5    . DC  F  3 1   ? 141.218 7.692   222.824 1.00 45.60  ? 1    DC  F C5    1 
ATOM   4379 C  C6    . DC  F  3 1   ? 141.488 8.780   222.084 1.00 51.82  ? 1    DC  F C6    1 
ATOM   4380 P  P     . DG  F  3 2   ? 140.748 12.878  217.571 1.00 87.68  ? 2    DG  F P     1 
ATOM   4381 O  OP1   . DG  F  3 2   ? 141.355 13.772  216.548 1.00 71.73  ? 2    DG  F OP1   1 
ATOM   4382 O  OP2   . DG  F  3 2   ? 139.557 13.230  218.394 1.00 69.05  ? 2    DG  F OP2   1 
ATOM   4383 O  "O5'" . DG  F  3 2   ? 140.306 11.513  216.872 1.00 78.26  ? 2    DG  F "O5'" 1 
ATOM   4384 C  "C5'" . DG  F  3 2   ? 141.106 10.927  215.860 1.00 71.05  ? 2    DG  F "C5'" 1 
ATOM   4385 C  "C4'" . DG  F  3 2   ? 140.352 9.775   215.230 1.00 72.33  ? 2    DG  F "C4'" 1 
ATOM   4386 O  "O4'" . DG  F  3 2   ? 140.208 8.709   216.210 1.00 65.45  ? 2    DG  F "O4'" 1 
ATOM   4387 C  "C3'" . DG  F  3 2   ? 138.932 10.118  214.779 1.00 67.51  ? 2    DG  F "C3'" 1 
ATOM   4388 O  "O3'" . DG  F  3 2   ? 138.627 9.419   213.584 1.00 75.73  ? 2    DG  F "O3'" 1 
ATOM   4389 C  "C2'" . DG  F  3 2   ? 138.086 9.624   215.948 1.00 62.73  ? 2    DG  F "C2'" 1 
ATOM   4390 C  "C1'" . DG  F  3 2   ? 138.848 8.374   216.346 1.00 56.96  ? 2    DG  F "C1'" 1 
ATOM   4391 N  N9    . DG  F  3 2   ? 138.622 7.964   217.725 1.00 53.37  ? 2    DG  F N9    1 
ATOM   4392 C  C8    . DG  F  3 2   ? 138.466 8.785   218.813 1.00 49.52  ? 2    DG  F C8    1 
ATOM   4393 N  N7    . DG  F  3 2   ? 138.293 8.138   219.934 1.00 54.02  ? 2    DG  F N7    1 
ATOM   4394 C  C5    . DG  F  3 2   ? 138.337 6.800   219.566 1.00 49.31  ? 2    DG  F C5    1 
ATOM   4395 C  C6    . DG  F  3 2   ? 138.203 5.631   220.359 1.00 50.30  ? 2    DG  F C6    1 
ATOM   4396 O  O6    . DG  F  3 2   ? 138.020 5.545   221.581 1.00 49.28  ? 2    DG  F O6    1 
ATOM   4397 N  N1    . DG  F  3 2   ? 138.312 4.471   219.592 1.00 51.04  ? 2    DG  F N1    1 
ATOM   4398 C  C2    . DG  F  3 2   ? 138.521 4.443   218.232 1.00 48.62  ? 2    DG  F C2    1 
ATOM   4399 N  N2    . DG  F  3 2   ? 138.596 3.229   217.681 1.00 48.30  ? 2    DG  F N2    1 
ATOM   4400 N  N3    . DG  F  3 2   ? 138.646 5.531   217.468 1.00 48.06  ? 2    DG  F N3    1 
ATOM   4401 C  C4    . DG  F  3 2   ? 138.542 6.673   218.206 1.00 49.93  ? 2    DG  F C4    1 
ATOM   4402 P  P     . DC  F  3 3   ? 137.517 9.979   212.564 1.00 72.09  ? 3    DC  F P     1 
ATOM   4403 O  OP1   . DC  F  3 3   ? 138.173 10.148  211.248 1.00 76.54  ? 3    DC  F OP1   1 
ATOM   4404 O  OP2   . DC  F  3 3   ? 136.789 11.086  213.217 1.00 71.39  ? 3    DC  F OP2   1 
ATOM   4405 O  "O5'" . DC  F  3 3   ? 136.482 8.784   212.447 1.00 65.68  ? 3    DC  F "O5'" 1 
ATOM   4406 C  "C5'" . DC  F  3 3   ? 135.910 8.259   213.610 1.00 62.10  ? 3    DC  F "C5'" 1 
ATOM   4407 C  "C4'" . DC  F  3 3   ? 135.736 6.767   213.478 1.00 59.22  ? 3    DC  F "C4'" 1 
ATOM   4408 O  "O4'" . DC  F  3 3   ? 136.137 6.135   214.718 1.00 58.89  ? 3    DC  F "O4'" 1 
ATOM   4409 C  "C3'" . DC  F  3 3   ? 134.306 6.329   213.204 1.00 57.29  ? 3    DC  F "C3'" 1 
ATOM   4410 O  "O3'" . DC  F  3 3   ? 134.276 5.254   212.254 1.00 56.95  ? 3    DC  F "O3'" 1 
ATOM   4411 C  "C2'" . DC  F  3 3   ? 133.787 5.913   214.583 1.00 54.74  ? 3    DC  F "C2'" 1 
ATOM   4412 C  "C1'" . DC  F  3 3   ? 135.053 5.483   215.326 1.00 51.71  ? 3    DC  F "C1'" 1 
ATOM   4413 N  N1    . DC  F  3 3   ? 135.052 5.859   216.761 1.00 44.76  ? 3    DC  F N1    1 
ATOM   4414 C  C2    . DC  F  3 3   ? 135.008 4.862   217.731 1.00 48.84  ? 3    DC  F C2    1 
ATOM   4415 O  O2    . DC  F  3 3   ? 134.959 3.682   217.371 1.00 50.75  ? 3    DC  F O2    1 
ATOM   4416 N  N3    . DC  F  3 3   ? 135.010 5.214   219.045 1.00 48.60  ? 3    DC  F N3    1 
ATOM   4417 C  C4    . DC  F  3 3   ? 135.057 6.502   219.390 1.00 50.84  ? 3    DC  F C4    1 
ATOM   4418 N  N4    . DC  F  3 3   ? 135.055 6.805   220.699 1.00 51.47  ? 3    DC  F N4    1 
ATOM   4419 C  C5    . DC  F  3 3   ? 135.109 7.535   218.410 1.00 49.49  ? 3    DC  F C5    1 
ATOM   4420 C  C6    . DC  F  3 3   ? 135.111 7.170   217.117 1.00 51.24  ? 3    DC  F C6    1 
ATOM   4421 P  P     . DG  F  3 4   ? 132.907 4.890   211.495 1.00 51.57  ? 4    DG  F P     1 
ATOM   4422 O  OP1   . DG  F  3 4   ? 133.240 4.163   210.240 1.00 53.85  ? 4    DG  F OP1   1 
ATOM   4423 O  OP2   . DG  F  3 4   ? 132.072 6.104   211.455 1.00 47.73  ? 4    DG  F OP2   1 
ATOM   4424 O  "O5'" . DG  F  3 4   ? 132.251 3.812   212.441 1.00 46.42  ? 4    DG  F "O5'" 1 
ATOM   4425 C  "C5'" . DG  F  3 4   ? 132.755 2.515   212.415 1.00 45.45  ? 4    DG  F "C5'" 1 
ATOM   4426 C  "C4'" . DG  F  3 4   ? 132.272 1.733   213.610 1.00 44.38  ? 4    DG  F "C4'" 1 
ATOM   4427 O  "O4'" . DG  F  3 4   ? 132.487 2.492   214.811 1.00 48.10  ? 4    DG  F "O4'" 1 
ATOM   4428 C  "C3'" . DG  F  3 4   ? 130.786 1.363   213.593 1.00 48.20  ? 4    DG  F "C3'" 1 
ATOM   4429 O  "O3'" . DG  F  3 4   ? 130.718 -0.020  213.649 1.00 49.05  ? 4    DG  F "O3'" 1 
ATOM   4430 C  "C2'" . DG  F  3 4   ? 130.217 2.026   214.858 1.00 46.41  ? 4    DG  F "C2'" 1 
ATOM   4431 C  "C1'" . DG  F  3 4   ? 131.466 2.182   215.709 1.00 47.66  ? 4    DG  F "C1'" 1 
ATOM   4432 N  N9    . DG  F  3 4   ? 131.415 3.236   216.722 1.00 44.97  ? 4    DG  F N9    1 
ATOM   4433 C  C8    . DG  F  3 4   ? 131.420 4.598   216.521 1.00 44.89  ? 4    DG  F C8    1 
ATOM   4434 N  N7    . DG  F  3 4   ? 131.413 5.281   217.633 1.00 44.69  ? 4    DG  F N7    1 
ATOM   4435 C  C5    . DG  F  3 4   ? 131.428 4.306   218.632 1.00 43.31  ? 4    DG  F C5    1 
ATOM   4436 C  C6    . DG  F  3 4   ? 131.420 4.437   220.043 1.00 48.67  ? 4    DG  F C6    1 
ATOM   4437 O  O6    . DG  F  3 4   ? 131.405 5.479   220.718 1.00 50.51  ? 4    DG  F O6    1 
ATOM   4438 N  N1    . DG  F  3 4   ? 131.428 3.193   220.678 1.00 44.49  ? 4    DG  F N1    1 
ATOM   4439 C  C2    . DG  F  3 4   ? 131.447 1.985   220.028 1.00 46.91  ? 4    DG  F C2    1 
ATOM   4440 N  N2    . DG  F  3 4   ? 131.460 0.887   220.797 1.00 43.54  ? 4    DG  F N2    1 
ATOM   4441 N  N3    . DG  F  3 4   ? 131.455 1.856   218.709 1.00 45.55  ? 4    DG  F N3    1 
ATOM   4442 C  C4    . DG  F  3 4   ? 131.440 3.052   218.083 1.00 43.52  ? 4    DG  F C4    1 
ATOM   4443 P  P     . DC  F  3 5   ? 129.344 -0.814  213.512 1.00 48.95  ? 5    DC  F P     1 
ATOM   4444 O  OP1   . DC  F  3 5   ? 129.632 -2.096  212.834 1.00 50.47  ? 5    DC  F OP1   1 
ATOM   4445 O  OP2   . DC  F  3 5   ? 128.281 0.026   212.917 1.00 44.68  ? 5    DC  F OP2   1 
ATOM   4446 O  "O5'" . DC  F  3 5   ? 129.013 -1.103  215.026 1.00 53.03  ? 5    DC  F "O5'" 1 
ATOM   4447 C  "C5'" . DC  F  3 5   ? 128.150 -2.130  215.351 1.00 51.21  ? 5    DC  F "C5'" 1 
ATOM   4448 C  "C4'" . DC  F  3 5   ? 128.200 -2.407  216.834 1.00 55.11  ? 5    DC  F "C4'" 1 
ATOM   4449 O  "O4'" . DC  F  3 5   ? 128.744 -1.268  217.560 1.00 47.04  ? 5    DC  F "O4'" 1 
ATOM   4450 C  "C3'" . DC  F  3 5   ? 126.856 -2.708  217.438 1.00 53.77  ? 5    DC  F "C3'" 1 
ATOM   4451 O  "O3'" . DC  F  3 5   ? 126.996 -3.841  218.217 1.00 59.26  ? 5    DC  F "O3'" 1 
ATOM   4452 C  "C2'" . DC  F  3 5   ? 126.519 -1.447  218.256 1.00 51.02  ? 5    DC  F "C2'" 1 
ATOM   4453 C  "C1'" . DC  F  3 5   ? 127.895 -0.924  218.623 1.00 47.75  ? 5    DC  F "C1'" 1 
ATOM   4454 N  N1    . DC  F  3 5   ? 127.971 0.552   218.803 1.00 45.77  ? 5    DC  F N1    1 
ATOM   4455 C  C2    . DC  F  3 5   ? 128.034 1.094   220.095 1.00 47.73  ? 5    DC  F C2    1 
ATOM   4456 O  O2    . DC  F  3 5   ? 128.000 0.334   221.072 1.00 51.66  ? 5    DC  F O2    1 
ATOM   4457 N  N3    . DC  F  3 5   ? 128.126 2.439   220.242 1.00 44.18  ? 5    DC  F N3    1 
ATOM   4458 C  C4    . DC  F  3 5   ? 128.165 3.225   219.172 1.00 44.85  ? 5    DC  F C4    1 
ATOM   4459 N  N4    . DC  F  3 5   ? 128.257 4.546   219.372 1.00 42.42  ? 5    DC  F N4    1 
ATOM   4460 C  C5    . DC  F  3 5   ? 128.113 2.692   217.848 1.00 42.54  ? 5    DC  F C5    1 
ATOM   4461 C  C6    . DC  F  3 5   ? 128.026 1.363   217.714 1.00 44.13  ? 5    DC  F C6    1 
ATOM   4462 P  P     . DC  F  3 6   ? 125.716 -4.519  218.883 1.00 56.32  ? 6    DC  F P     1 
ATOM   4463 O  OP1   . DC  F  3 6   ? 126.129 -5.880  219.286 1.00 55.63  ? 6    DC  F OP1   1 
ATOM   4464 O  OP2   . DC  F  3 6   ? 124.547 -4.380  217.979 1.00 59.27  ? 6    DC  F OP2   1 
ATOM   4465 O  "O5'" . DC  F  3 6   ? 125.509 -3.605  220.143 1.00 47.90  ? 6    DC  F "O5'" 1 
ATOM   4466 C  "C5'" . DC  F  3 6   ? 124.331 -3.628  220.781 1.00 56.36  ? 6    DC  F "C5'" 1 
ATOM   4467 C  "C4'" . DC  F  3 6   ? 124.439 -2.884  222.073 1.00 56.54  ? 6    DC  F "C4'" 1 
ATOM   4468 O  "O4'" . DC  F  3 6   ? 125.004 -1.564  221.854 1.00 52.11  ? 6    DC  F "O4'" 1 
ATOM   4469 C  "C3'" . DC  F  3 6   ? 123.100 -2.675  222.733 1.00 58.61  ? 6    DC  F "C3'" 1 
ATOM   4470 O  "O3'" . DC  F  3 6   ? 123.115 -3.304  223.980 1.00 63.51  ? 6    DC  F "O3'" 1 
ATOM   4471 C  "C2'" . DC  F  3 6   ? 122.935 -1.149  222.830 1.00 54.71  ? 6    DC  F "C2'" 1 
ATOM   4472 C  "C1'" . DC  F  3 6   ? 124.364 -0.656  222.716 1.00 51.32  ? 6    DC  F "C1'" 1 
ATOM   4473 N  N1    . DC  F  3 6   ? 124.493 0.732   222.167 1.00 48.34  ? 6    DC  F N1    1 
ATOM   4474 C  C2    . DC  F  3 6   ? 124.443 1.823   223.043 1.00 53.08  ? 6    DC  F C2    1 
ATOM   4475 O  O2    . DC  F  3 6   ? 124.292 1.612   224.261 1.00 52.11  ? 6    DC  F O2    1 
ATOM   4476 N  N3    . DC  F  3 6   ? 124.583 3.083   222.535 1.00 49.96  ? 6    DC  F N3    1 
ATOM   4477 C  C4    . DC  F  3 6   ? 124.753 3.261   221.217 1.00 48.15  ? 6    DC  F C4    1 
ATOM   4478 N  N4    . DC  F  3 6   ? 124.877 4.515   220.764 1.00 45.77  ? 6    DC  F N4    1 
ATOM   4479 C  C5    . DC  F  3 6   ? 124.797 2.160   220.307 1.00 45.44  ? 6    DC  F C5    1 
ATOM   4480 C  C6    . DC  F  3 6   ? 124.673 0.928   220.817 1.00 50.49  ? 6    DC  F C6    1 
ATOM   4481 P  P     . DG  F  3 7   ? 121.809 -4.078  224.473 1.00 65.44  ? 7    DG  F P     1 
ATOM   4482 O  OP1   . DG  F  3 7   ? 122.266 -4.918  225.598 1.00 71.02  ? 7    DG  F OP1   1 
ATOM   4483 O  OP2   . DG  F  3 7   ? 121.101 -4.688  223.331 1.00 62.94  ? 7    DG  F OP2   1 
ATOM   4484 O  "O5'" . DG  F  3 7   ? 120.899 -2.889  225.005 1.00 63.63  ? 7    DG  F "O5'" 1 
ATOM   4485 C  "C5'" . DG  F  3 7   ? 121.319 -2.168  226.126 1.00 58.01  ? 7    DG  F "C5'" 1 
ATOM   4486 C  "C4'" . DG  F  3 7   ? 120.467 -0.940  226.317 1.00 63.45  ? 7    DG  F "C4'" 1 
ATOM   4487 O  "O4'" . DG  F  3 7   ? 121.045 0.160   225.593 1.00 56.69  ? 7    DG  F "O4'" 1 
ATOM   4488 C  "C3'" . DG  F  3 7   ? 119.000 -1.057  225.848 1.00 60.89  ? 7    DG  F "C3'" 1 
ATOM   4489 O  "O3'" . DG  F  3 7   ? 118.127 -0.896  226.998 1.00 68.98  ? 7    DG  F "O3'" 1 
ATOM   4490 C  "C2'" . DG  F  3 7   ? 118.841 0.085   224.828 1.00 52.31  ? 7    DG  F "C2'" 1 
ATOM   4491 C  "C1'" . DG  F  3 7   ? 120.004 1.007   225.192 1.00 56.23  ? 7    DG  F "C1'" 1 
ATOM   4492 N  N9    . DG  F  3 7   ? 120.492 1.832   224.095 1.00 53.03  ? 7    DG  F N9    1 
ATOM   4493 C  C8    . DG  F  3 7   ? 120.827 1.419   222.818 1.00 51.05  ? 7    DG  F C8    1 
ATOM   4494 N  N7    . DG  F  3 7   ? 121.255 2.392   222.054 1.00 52.45  ? 7    DG  F N7    1 
ATOM   4495 C  C5    . DG  F  3 7   ? 121.195 3.518   222.874 1.00 52.78  ? 7    DG  F C5    1 
ATOM   4496 C  C6    . DG  F  3 7   ? 121.521 4.874   222.606 1.00 48.96  ? 7    DG  F C6    1 
ATOM   4497 O  O6    . DG  F  3 7   ? 121.947 5.373   221.565 1.00 47.63  ? 7    DG  F O6    1 
ATOM   4498 N  N1    . DG  F  3 7   ? 121.313 5.679   223.715 1.00 48.27  ? 7    DG  F N1    1 
ATOM   4499 C  C2    . DG  F  3 7   ? 120.853 5.232   224.932 1.00 50.69  ? 7    DG  F C2    1 
ATOM   4500 N  N2    . DG  F  3 7   ? 120.713 6.158   225.888 1.00 53.76  ? 7    DG  F N2    1 
ATOM   4501 N  N3    . DG  F  3 7   ? 120.542 3.974   225.194 1.00 46.85  ? 7    DG  F N3    1 
ATOM   4502 C  C4    . DG  F  3 7   ? 120.732 3.179   224.133 1.00 50.29  ? 7    DG  F C4    1 
ATOM   4503 P  P     . DG  F  3 8   ? 116.528 -0.745  226.854 1.00 69.51  ? 8    DG  F P     1 
ATOM   4504 O  OP1   . DG  F  3 8   ? 115.944 -1.367  228.061 1.00 77.54  ? 8    DG  F OP1   1 
ATOM   4505 O  OP2   . DG  F  3 8   ? 116.085 -1.217  225.521 1.00 68.71  ? 8    DG  F OP2   1 
ATOM   4506 O  "O5'" . DG  F  3 8   ? 116.283 0.836   226.968 1.00 62.96  ? 8    DG  F "O5'" 1 
ATOM   4507 C  "C5'" . DG  F  3 8   ? 117.007 1.603   227.928 1.00 55.49  ? 8    DG  F "C5'" 1 
ATOM   4508 C  "C4'" . DG  F  3 8   ? 116.741 3.087   227.746 1.00 55.73  ? 8    DG  F "C4'" 1 
ATOM   4509 O  "O4'" . DG  F  3 8   ? 117.488 3.620   226.612 1.00 55.68  ? 8    DG  F "O4'" 1 
ATOM   4510 C  "C3'" . DG  F  3 8   ? 115.282 3.449   227.493 1.00 60.24  ? 8    DG  F "C3'" 1 
ATOM   4511 O  "O3'" . DG  F  3 8   ? 114.837 4.250   228.553 1.00 62.63  ? 8    DG  F "O3'" 1 
ATOM   4512 C  "C2'" . DG  F  3 8   ? 115.286 4.222   226.150 1.00 50.32  ? 8    DG  F "C2'" 1 
ATOM   4513 C  "C1'" . DG  F  3 8   ? 116.740 4.666   226.031 1.00 53.84  ? 8    DG  F "C1'" 1 
ATOM   4514 N  N9    . DG  F  3 8   ? 117.193 4.821   224.652 1.00 56.58  ? 8    DG  F N9    1 
ATOM   4515 C  C8    . DG  F  3 8   ? 117.328 3.812   223.723 1.00 53.78  ? 8    DG  F C8    1 
ATOM   4516 N  N7    . DG  F  3 8   ? 117.751 4.218   222.579 1.00 46.63  ? 8    DG  F N7    1 
ATOM   4517 C  C5    . DG  F  3 8   ? 117.925 5.583   222.733 1.00 47.47  ? 8    DG  F C5    1 
ATOM   4518 C  C6    . DG  F  3 8   ? 118.379 6.549   221.806 1.00 47.85  ? 8    DG  F C6    1 
ATOM   4519 O  O6    . DG  F  3 8   ? 118.715 6.389   220.633 1.00 49.13  ? 8    DG  F O6    1 
ATOM   4520 N  N1    . DG  F  3 8   ? 118.406 7.820   222.359 1.00 52.72  ? 8    DG  F N1    1 
ATOM   4521 C  C2    . DG  F  3 8   ? 118.041 8.124   223.643 1.00 50.14  ? 8    DG  F C2    1 
ATOM   4522 N  N2    . DG  F  3 8   ? 118.147 9.410   223.987 1.00 50.04  ? 8    DG  F N2    1 
ATOM   4523 N  N3    . DG  F  3 8   ? 117.611 7.229   224.528 1.00 49.71  ? 8    DG  F N3    1 
ATOM   4524 C  C4    . DG  F  3 8   ? 117.580 5.980   224.004 1.00 50.91  ? 8    DG  F C4    1 
ATOM   4525 P  P     . DA  F  3 9   ? 113.277 4.532   228.764 1.00 57.87  ? 9    DA  F P     1 
ATOM   4526 O  OP1   . DA  F  3 9   ? 113.122 4.752   230.223 1.00 72.78  ? 9    DA  F OP1   1 
ATOM   4527 O  OP2   . DA  F  3 9   ? 112.471 3.489   228.079 1.00 64.15  ? 9    DA  F OP2   1 
ATOM   4528 O  "O5'" . DA  F  3 9   ? 113.040 5.894   227.979 1.00 53.19  ? 9    DA  F "O5'" 1 
ATOM   4529 C  "C5'" . DA  F  3 9   ? 113.921 6.958   228.167 1.00 53.02  ? 9    DA  F "C5'" 1 
ATOM   4530 C  "C4'" . DA  F  3 9   ? 113.620 8.047   227.175 1.00 58.81  ? 9    DA  F "C4'" 1 
ATOM   4531 O  "O4'" . DA  F  3 9   ? 114.197 7.711   225.870 1.00 60.58  ? 9    DA  F "O4'" 1 
ATOM   4532 C  "C3'" . DA  F  3 9   ? 112.126 8.296   226.926 1.00 57.06  ? 9    DA  F "C3'" 1 
ATOM   4533 O  "O3'" . DA  F  3 9   ? 111.922 9.693   226.883 1.00 69.15  ? 9    DA  F "O3'" 1 
ATOM   4534 C  "C2'" . DA  F  3 9   ? 111.920 7.683   225.530 1.00 57.71  ? 9    DA  F "C2'" 1 
ATOM   4535 C  "C1'" . DA  F  3 9   ? 113.255 8.049   224.888 1.00 57.11  ? 9    DA  F "C1'" 1 
ATOM   4536 N  N9    . DA  F  3 9   ? 113.565 7.355   223.625 1.00 59.44  ? 9    DA  F N9    1 
ATOM   4537 C  C8    . DA  F  3 9   ? 113.259 6.062   223.289 1.00 53.68  ? 9    DA  F C8    1 
ATOM   4538 N  N7    . DA  F  3 9   ? 113.661 5.718   222.087 1.00 52.48  ? 9    DA  F N7    1 
ATOM   4539 C  C5    . DA  F  3 9   ? 114.276 6.863   221.592 1.00 52.33  ? 9    DA  F C5    1 
ATOM   4540 C  C6    . DA  F  3 9   ? 114.902 7.154   220.351 1.00 51.71  ? 9    DA  F C6    1 
ATOM   4541 N  N6    . DA  F  3 9   ? 115.014 6.265   219.354 1.00 44.47  ? 9    DA  F N6    1 
ATOM   4542 N  N1    . DA  F  3 9   ? 115.406 8.398   220.182 1.00 49.99  ? 9    DA  F N1    1 
ATOM   4543 C  C2    . DA  F  3 9   ? 115.293 9.279   221.186 1.00 49.13  ? 9    DA  F C2    1 
ATOM   4544 N  N3    . DA  F  3 9   ? 114.721 9.122   222.381 1.00 51.95  ? 9    DA  F N3    1 
ATOM   4545 C  C4    . DA  F  3 9   ? 114.228 7.882   222.523 1.00 53.06  ? 9    DA  F C4    1 
ATOM   4546 P  P     . DA  F  3 10  ? 110.843 10.446  227.806 1.00 69.60  ? 10   DA  F P     1 
ATOM   4547 O  OP1   . DA  F  3 10  ? 111.239 10.292  229.226 1.00 72.59  ? 10   DA  F OP1   1 
ATOM   4548 O  OP2   . DA  F  3 10  ? 109.487 10.104  227.327 1.00 54.65  ? 10   DA  F OP2   1 
ATOM   4549 O  "O5'" . DA  F  3 10  ? 111.090 11.978  227.426 1.00 66.28  ? 10   DA  F "O5'" 1 
ATOM   4550 C  "C5'" . DA  F  3 10  ? 112.428 12.488  227.370 1.00 65.45  ? 10   DA  F "C5'" 1 
ATOM   4551 C  "C4'" . DA  F  3 10  ? 112.601 13.408  226.179 1.00 66.20  ? 10   DA  F "C4'" 1 
ATOM   4552 O  "O4'" . DA  F  3 10  ? 112.851 12.625  224.966 1.00 66.97  ? 10   DA  F "O4'" 1 
ATOM   4553 C  "C3'" . DA  F  3 10  ? 111.394 14.292  225.864 1.00 69.10  ? 10   DA  F "C3'" 1 
ATOM   4554 O  "O3'" . DA  F  3 10  ? 111.865 15.549  225.428 1.00 75.86  ? 10   DA  F "O3'" 1 
ATOM   4555 C  "C2'" . DA  F  3 10  ? 110.690 13.523  224.733 1.00 68.08  ? 10   DA  F "C2'" 1 
ATOM   4556 C  "C1'" . DA  F  3 10  ? 111.886 12.955  223.972 1.00 66.64  ? 10   DA  F "C1'" 1 
ATOM   4557 N  N9    . DA  F  3 10  ? 111.595 11.748  223.176 1.00 65.21  ? 10   DA  F N9    1 
ATOM   4558 C  C8    . DA  F  3 10  ? 110.909 10.632  223.575 1.00 62.01  ? 10   DA  F C8    1 
ATOM   4559 N  N7    . DA  F  3 10  ? 110.825 9.699   222.648 1.00 59.50  ? 10   DA  F N7    1 
ATOM   4560 C  C5    . DA  F  3 10  ? 111.516 10.233  221.575 1.00 56.21  ? 10   DA  F C5    1 
ATOM   4561 C  C6    . DA  F  3 10  ? 111.792 9.741   220.276 1.00 56.67  ? 10   DA  F C6    1 
ATOM   4562 N  N6    . DA  F  3 10  ? 111.390 8.547   219.845 1.00 50.01  ? 10   DA  F N6    1 
ATOM   4563 N  N1    . DA  F  3 10  ? 112.498 10.533  219.437 1.00 52.28  ? 10   DA  F N1    1 
ATOM   4564 C  C2    . DA  F  3 10  ? 112.896 11.732  219.872 1.00 59.15  ? 10   DA  F C2    1 
ATOM   4565 N  N3    . DA  F  3 10  ? 112.702 12.300  221.074 1.00 64.53  ? 10   DA  F N3    1 
ATOM   4566 C  C4    . DA  F  3 10  ? 111.996 11.493  221.880 1.00 58.50  ? 10   DA  F C4    1 
ATOM   4567 P  P     . DC  F  3 11  ? 110.880 16.805  225.275 1.00 76.62  ? 11   DC  F P     1 
ATOM   4568 O  OP1   . DC  F  3 11  ? 111.589 17.938  225.919 1.00 82.28  ? 11   DC  F OP1   1 
ATOM   4569 O  OP2   . DC  F  3 11  ? 109.514 16.421  225.700 1.00 72.51  ? 11   DC  F OP2   1 
ATOM   4570 O  "O5'" . DC  F  3 11  ? 110.819 17.045  223.693 1.00 75.59  ? 11   DC  F "O5'" 1 
ATOM   4571 C  "C5'" . DC  F  3 11  ? 111.787 16.440  222.857 1.00 71.20  ? 11   DC  F "C5'" 1 
ATOM   4572 C  "C4'" . DC  F  3 11  ? 111.406 16.580  221.392 1.00 79.16  ? 11   DC  F "C4'" 1 
ATOM   4573 O  "O4'" . DC  F  3 11  ? 111.196 15.276  220.792 1.00 75.88  ? 11   DC  F "O4'" 1 
ATOM   4574 C  "C3'" . DC  F  3 11  ? 110.138 17.385  221.118 1.00 78.08  ? 11   DC  F "C3'" 1 
ATOM   4575 O  "O3'" . DC  F  3 11  ? 110.388 18.247  220.052 1.00 76.81  ? 11   DC  F "O3'" 1 
ATOM   4576 C  "C2'" . DC  F  3 11  ? 109.096 16.321  220.751 1.00 75.81  ? 11   DC  F "C2'" 1 
ATOM   4577 C  "C1'" . DC  F  3 11  ? 109.961 15.258  220.098 1.00 70.76  ? 11   DC  F "C1'" 1 
ATOM   4578 N  N1    . DC  F  3 11  ? 109.411 13.872  220.193 1.00 68.17  ? 11   DC  F N1    1 
ATOM   4579 C  C2    . DC  F  3 11  ? 109.657 12.967  219.151 1.00 60.65  ? 11   DC  F C2    1 
ATOM   4580 O  O2    . DC  F  3 11  ? 110.299 13.352  218.164 1.00 60.18  ? 11   DC  F O2    1 
ATOM   4581 N  N3    . DC  F  3 11  ? 109.176 11.703  219.252 1.00 54.09  ? 11   DC  F N3    1 
ATOM   4582 C  C4    . DC  F  3 11  ? 108.490 11.337  220.334 1.00 58.27  ? 11   DC  F C4    1 
ATOM   4583 N  N4    . DC  F  3 11  ? 108.038 10.085  220.389 1.00 59.77  ? 11   DC  F N4    1 
ATOM   4584 C  C5    . DC  F  3 11  ? 108.229 12.241  221.406 1.00 55.99  ? 11   DC  F C5    1 
ATOM   4585 C  C6    . DC  F  3 11  ? 108.709 13.485  221.298 1.00 60.23  ? 11   DC  F C6    1 
ATOM   4586 P  P     . DT  F  3 12  ? 109.301 19.338  219.630 1.00 92.29  ? 12   DT  F P     1 
ATOM   4587 O  OP1   . DT  F  3 12  ? 110.067 20.483  219.061 1.00 82.17  ? 12   DT  F OP1   1 
ATOM   4588 O  OP2   . DT  F  3 12  ? 108.315 19.457  220.739 1.00 74.10  ? 12   DT  F OP2   1 
ATOM   4589 O  "O5'" . DT  F  3 12  ? 108.509 18.623  218.462 1.00 86.69  ? 12   DT  F "O5'" 1 
ATOM   4590 C  "C5'" . DT  F  3 12  ? 108.056 19.361  217.394 1.00 78.93  ? 12   DT  F "C5'" 1 
ATOM   4591 C  "C4'" . DT  F  3 12  ? 107.991 18.480  216.186 1.00 77.41  ? 12   DT  F "C4'" 1 
ATOM   4592 O  "O4'" . DT  F  3 12  ? 107.994 17.091  216.603 1.00 77.18  ? 12   DT  F "O4'" 1 
ATOM   4593 C  "C3'" . DT  F  3 12  ? 106.751 18.687  215.338 1.00 70.62  ? 12   DT  F "C3'" 1 
ATOM   4594 O  "O3'" . DT  F  3 12  ? 107.144 18.987  214.027 1.00 67.20  ? 12   DT  F "O3'" 1 
ATOM   4595 C  "C2'" . DT  F  3 12  ? 105.982 17.359  215.442 1.00 70.69  ? 12   DT  F "C2'" 1 
ATOM   4596 C  "C1'" . DT  F  3 12  ? 107.072 16.368  215.826 1.00 76.23  ? 12   DT  F "C1'" 1 
ATOM   4597 N  N1    . DT  F  3 12  ? 106.579 15.220  216.641 1.00 71.46  ? 12   DT  F N1    1 
ATOM   4598 C  C2    . DT  F  3 12  ? 106.558 13.955  216.090 1.00 65.48  ? 12   DT  F C2    1 
ATOM   4599 O  O2    . DT  F  3 12  ? 106.914 13.715  214.954 1.00 68.95  ? 12   DT  F O2    1 
ATOM   4600 N  N3    . DT  F  3 12  ? 106.093 12.977  216.920 1.00 63.57  ? 12   DT  F N3    1 
ATOM   4601 C  C4    . DT  F  3 12  ? 105.655 13.130  218.229 1.00 62.56  ? 12   DT  F C4    1 
ATOM   4602 O  O4    . DT  F  3 12  ? 105.250 12.186  218.899 1.00 63.77  ? 12   DT  F O4    1 
ATOM   4603 C  C5    . DT  F  3 12  ? 105.708 14.478  218.749 1.00 67.24  ? 12   DT  F C5    1 
ATOM   4604 C  C7    . DT  F  3 12  ? 105.256 14.763  220.150 1.00 62.15  ? 12   DT  F C7    1 
ATOM   4605 C  C6    . DT  F  3 12  ? 106.165 15.446  217.940 1.00 70.99  ? 12   DT  F C6    1 
ATOM   4606 P  P     . DT  F  3 13  ? 106.037 19.392  212.949 1.00 78.97  ? 13   DT  F P     1 
ATOM   4607 O  OP1   . DT  F  3 13  ? 106.705 20.142  211.847 1.00 73.65  ? 13   DT  F OP1   1 
ATOM   4608 O  OP2   . DT  F  3 13  ? 104.879 19.934  213.704 1.00 69.98  ? 13   DT  F OP2   1 
ATOM   4609 O  "O5'" . DT  F  3 13  ? 105.587 17.986  212.342 1.00 78.56  ? 13   DT  F "O5'" 1 
ATOM   4610 C  "C5'" . DT  F  3 13  ? 106.481 17.262  211.498 1.00 68.64  ? 13   DT  F "C5'" 1 
ATOM   4611 C  "C4'" . DT  F  3 13  ? 105.764 16.086  210.891 1.00 63.92  ? 13   DT  F "C4'" 1 
ATOM   4612 O  "O4'" . DT  F  3 13  ? 105.367 15.175  211.944 1.00 65.51  ? 13   DT  F "O4'" 1 
ATOM   4613 C  "C3'" . DT  F  3 13  ? 104.482 16.451  210.142 1.00 65.76  ? 13   DT  F "C3'" 1 
ATOM   4614 O  "O3'" . DT  F  3 13  ? 104.385 15.677  208.960 1.00 60.64  ? 13   DT  F "O3'" 1 
ATOM   4615 C  "C2'" . DT  F  3 13  ? 103.385 16.083  211.149 1.00 61.79  ? 13   DT  F "C2'" 1 
ATOM   4616 C  "C1'" . DT  F  3 13  ? 104.006 14.858  211.790 1.00 64.55  ? 13   DT  F "C1'" 1 
ATOM   4617 N  N1    . DT  F  3 13  ? 103.487 14.502  213.123 1.00 65.41  ? 13   DT  F N1    1 
ATOM   4618 C  C2    . DT  F  3 13  ? 103.233 13.181  213.398 1.00 61.85  ? 13   DT  F C2    1 
ATOM   4619 O  O2    . DT  F  3 13  ? 103.371 12.291  212.580 1.00 63.32  ? 13   DT  F O2    1 
ATOM   4620 N  N3    . DT  F  3 13  ? 102.797 12.936  214.668 1.00 65.08  ? 13   DT  F N3    1 
ATOM   4621 C  C4    . DT  F  3 13  ? 102.607 13.861  215.681 1.00 65.79  ? 13   DT  F C4    1 
ATOM   4622 O  O4    . DT  F  3 13  ? 102.212 13.543  216.798 1.00 66.42  ? 13   DT  F O4    1 
ATOM   4623 C  C5    . DT  F  3 13  ? 102.906 15.223  215.334 1.00 71.71  ? 13   DT  F C5    1 
ATOM   4624 C  C7    . DT  F  3 13  ? 102.729 16.308  216.358 1.00 72.45  ? 13   DT  F C7    1 
ATOM   4625 C  C6    . DT  F  3 13  ? 103.336 15.477  214.082 1.00 67.57  ? 13   DT  F C6    1 
ATOM   4626 P  P     . DA  F  3 14  ? 105.305 15.986  207.675 1.00 60.64  ? 14   DA  F P     1 
ATOM   4627 O  OP1   . DA  F  3 14  ? 106.653 16.418  208.109 1.00 58.84  ? 14   DA  F OP1   1 
ATOM   4628 O  OP2   . DA  F  3 14  ? 104.517 16.813  206.738 1.00 62.57  ? 14   DA  F OP2   1 
ATOM   4629 O  "O5'" . DA  F  3 14  ? 105.474 14.547  206.991 1.00 61.84  ? 14   DA  F "O5'" 1 
ATOM   4630 C  "C5'" . DA  F  3 14  ? 106.242 13.539  207.656 1.00 52.26  ? 14   DA  F "C5'" 1 
ATOM   4631 C  "C4'" . DA  F  3 14  ? 105.577 12.174  207.574 1.00 51.53  ? 14   DA  F "C4'" 1 
ATOM   4632 O  "O4'" . DA  F  3 14  ? 104.535 12.058  208.570 1.00 54.04  ? 14   DA  F "O4'" 1 
ATOM   4633 C  "C3'" . DA  F  3 14  ? 104.905 11.824  206.252 1.00 55.12  ? 14   DA  F "C3'" 1 
ATOM   4634 O  "O3'" . DA  F  3 14  ? 104.984 10.415  206.091 1.00 50.14  ? 14   DA  F "O3'" 1 
ATOM   4635 C  "C2'" . DA  F  3 14  ? 103.460 12.280  206.496 1.00 52.40  ? 14   DA  F "C2'" 1 
ATOM   4636 C  "C1'" . DA  F  3 14  ? 103.277 11.840  207.938 1.00 53.79  ? 14   DA  F "C1'" 1 
ATOM   4637 N  N9    . DA  F  3 14  ? 102.301 12.595  208.711 1.00 59.38  ? 14   DA  F N9    1 
ATOM   4638 C  C8    . DA  F  3 14  ? 102.031 13.933  208.632 1.00 62.03  ? 14   DA  F C8    1 
ATOM   4639 N  N7    . DA  F  3 14  ? 101.160 14.352  209.526 1.00 64.77  ? 14   DA  F N7    1 
ATOM   4640 C  C5    . DA  F  3 14  ? 100.856 13.212  210.255 1.00 63.44  ? 14   DA  F C5    1 
ATOM   4641 C  C6    . DA  F  3 14  ? 99.993  12.981  211.349 1.00 61.19  ? 14   DA  F C6    1 
ATOM   4642 N  N6    . DA  F  3 14  ? 99.253  13.936  211.912 1.00 62.16  ? 14   DA  F N6    1 
ATOM   4643 N  N1    . DA  F  3 14  ? 99.921  11.723  211.839 1.00 61.53  ? 14   DA  F N1    1 
ATOM   4644 C  C2    . DA  F  3 14  ? 100.671 10.769  211.270 1.00 59.73  ? 14   DA  F C2    1 
ATOM   4645 N  N3    . DA  F  3 14  ? 101.506 10.864  210.232 1.00 56.31  ? 14   DA  F N3    1 
ATOM   4646 C  C4    . DA  F  3 14  ? 101.559 12.123  209.773 1.00 59.11  ? 14   DA  F C4    1 
ATOM   4647 P  P     . DC  F  3 15  ? 104.912 9.725   204.650 1.00 48.77  ? 15   DC  F P     1 
ATOM   4648 O  OP1   . DC  F  3 15  ? 105.490 8.378   204.811 1.00 46.93  ? 15   DC  F OP1   1 
ATOM   4649 O  OP2   . DC  F  3 15  ? 105.541 10.620  203.653 1.00 47.79  ? 15   DC  F OP2   1 
ATOM   4650 O  "O5'" . DC  F  3 15  ? 103.323 9.642   204.344 1.00 50.91  ? 15   DC  F "O5'" 1 
ATOM   4651 C  "C5'" . DC  F  3 15  ? 102.561 8.443   204.603 1.00 46.32  ? 15   DC  F "C5'" 1 
ATOM   4652 C  "C4'" . DC  F  3 15  ? 102.375 8.204   206.103 1.00 53.15  ? 15   DC  F "C4'" 1 
ATOM   4653 O  "O4'" . DC  F  3 15  ? 101.808 9.383   206.736 1.00 53.81  ? 15   DC  F "O4'" 1 
ATOM   4654 C  "C3'" . DC  F  3 15  ? 101.416 7.074   206.463 1.00 53.27  ? 15   DC  F "C3'" 1 
ATOM   4655 O  "O3'" . DC  F  3 15  ? 101.804 6.501   207.710 1.00 51.19  ? 15   DC  F "O3'" 1 
ATOM   4656 C  "C2'" . DC  F  3 15  ? 100.096 7.823   206.599 1.00 51.35  ? 15   DC  F "C2'" 1 
ATOM   4657 C  "C1'" . DC  F  3 15  ? 100.585 9.027   207.360 1.00 53.62  ? 15   DC  F "C1'" 1 
ATOM   4658 N  N1    . DC  F  3 15  ? 99.672  10.213  207.349 1.00 53.62  ? 15   DC  F N1    1 
ATOM   4659 C  C2    . DC  F  3 15  ? 98.806  10.430  208.429 1.00 53.88  ? 15   DC  F C2    1 
ATOM   4660 O  O2    . DC  F  3 15  ? 98.763  9.606   209.341 1.00 49.14  ? 15   DC  F O2    1 
ATOM   4661 N  N3    . DC  F  3 15  ? 98.023  11.528  208.427 1.00 57.48  ? 15   DC  F N3    1 
ATOM   4662 C  C4    . DC  F  3 15  ? 98.089  12.395  207.415 1.00 61.25  ? 15   DC  F C4    1 
ATOM   4663 N  N4    . DC  F  3 15  ? 97.296  13.466  207.459 1.00 64.70  ? 15   DC  F N4    1 
ATOM   4664 C  C5    . DC  F  3 15  ? 98.977  12.203  206.313 1.00 58.22  ? 15   DC  F C5    1 
ATOM   4665 C  C6    . DC  F  3 15  ? 99.747  11.114  206.327 1.00 55.06  ? 15   DC  F C6    1 
ATOM   4666 N  N     . ASN G  1 4   ? 161.673 -15.264 197.693 1.00 74.44  ? 4    ASN G N     1 
ATOM   4667 C  CA    . ASN G  1 4   ? 162.170 -13.952 198.101 1.00 74.54  ? 4    ASN G CA    1 
ATOM   4668 C  C     . ASN G  1 4   ? 163.073 -13.344 197.041 1.00 76.82  ? 4    ASN G C     1 
ATOM   4669 O  O     . ASN G  1 4   ? 163.017 -12.141 196.796 1.00 74.29  ? 4    ASN G O     1 
ATOM   4670 C  CB    . ASN G  1 4   ? 162.939 -14.034 199.421 1.00 70.89  ? 4    ASN G CB    1 
ATOM   4671 C  CG    . ASN G  1 4   ? 163.312 -12.657 199.972 1.00 84.00  ? 4    ASN G CG    1 
ATOM   4672 O  OD1   . ASN G  1 4   ? 164.080 -11.913 199.358 1.00 83.64  ? 4    ASN G OD1   1 
ATOM   4673 N  ND2   . ASN G  1 4   ? 162.793 -12.330 201.153 1.00 86.07  ? 4    ASN G ND2   1 
ATOM   4674 N  N     . GLU G  1 5   ? 163.918 -14.174 196.434 1.00 74.47  ? 5    GLU G N     1 
ATOM   4675 C  CA    . GLU G  1 5   ? 164.910 -13.690 195.477 1.00 75.13  ? 5    GLU G CA    1 
ATOM   4676 C  C     . GLU G  1 5   ? 164.560 -14.146 194.051 1.00 73.18  ? 5    GLU G C     1 
ATOM   4677 O  O     . GLU G  1 5   ? 164.960 -13.518 193.060 1.00 71.43  ? 5    GLU G O     1 
ATOM   4678 C  CB    . GLU G  1 5   ? 166.314 -14.151 195.897 1.00 75.23  ? 5    GLU G CB    1 
ATOM   4679 C  CG    . GLU G  1 5   ? 167.208 -14.630 194.762 1.00 83.17  ? 5    GLU G CG    1 
ATOM   4680 C  CD    . GLU G  1 5   ? 168.557 -15.116 195.247 1.00 94.17  ? 5    GLU G CD    1 
ATOM   4681 O  OE1   . GLU G  1 5   ? 168.666 -15.469 196.448 1.00 94.45  ? 5    GLU G OE1   1 
ATOM   4682 O  OE2   . GLU G  1 5   ? 169.504 -15.143 194.423 1.00 94.28  ? 5    GLU G OE2   1 
ATOM   4683 N  N     . ASN G  1 6   ? 163.800 -15.235 193.958 1.00 73.95  ? 6    ASN G N     1 
ATOM   4684 C  CA    . ASN G  1 6   ? 163.112 -15.580 192.719 1.00 70.36  ? 6    ASN G CA    1 
ATOM   4685 C  C     . ASN G  1 6   ? 161.940 -14.588 192.546 1.00 68.76  ? 6    ASN G C     1 
ATOM   4686 O  O     . ASN G  1 6   ? 161.592 -14.200 191.416 1.00 60.52  ? 6    ASN G O     1 
ATOM   4687 C  CB    . ASN G  1 6   ? 162.638 -17.049 192.746 1.00 62.95  ? 6    ASN G CB    1 
ATOM   4688 C  CG    . ASN G  1 6   ? 161.800 -17.445 191.512 1.00 69.20  ? 6    ASN G CG    1 
ATOM   4689 O  OD1   . ASN G  1 6   ? 162.277 -17.393 190.373 1.00 68.76  ? 6    ASN G OD1   1 
ATOM   4690 N  ND2   . ASN G  1 6   ? 160.563 -17.884 191.750 1.00 62.35  ? 6    ASN G ND2   1 
ATOM   4691 N  N     . VAL G  1 7   ? 161.365 -14.155 193.673 1.00 61.69  ? 7    VAL G N     1 
ATOM   4692 C  CA    . VAL G  1 7   ? 160.275 -13.179 193.654 1.00 59.44  ? 7    VAL G CA    1 
ATOM   4693 C  C     . VAL G  1 7   ? 160.790 -11.762 193.383 1.00 57.60  ? 7    VAL G C     1 
ATOM   4694 O  O     . VAL G  1 7   ? 160.164 -10.995 192.644 1.00 53.08  ? 7    VAL G O     1 
ATOM   4695 C  CB    . VAL G  1 7   ? 159.471 -13.200 194.979 1.00 61.84  ? 7    VAL G CB    1 
ATOM   4696 C  CG1   . VAL G  1 7   ? 158.536 -11.993 195.085 1.00 52.84  ? 7    VAL G CG1   1 
ATOM   4697 C  CG2   . VAL G  1 7   ? 158.671 -14.483 195.080 1.00 59.60  ? 7    VAL G CG2   1 
ATOM   4698 N  N     . SER G  1 8   ? 161.935 -11.415 193.965 1.00 55.81  ? 8    SER G N     1 
ATOM   4699 C  CA    . SER G  1 8   ? 162.476 -10.074 193.780 1.00 56.41  ? 8    SER G CA    1 
ATOM   4700 C  C     . SER G  1 8   ? 163.047 -9.913  192.374 1.00 53.46  ? 8    SER G C     1 
ATOM   4701 O  O     . SER G  1 8   ? 163.035 -8.818  191.829 1.00 52.87  ? 8    SER G O     1 
ATOM   4702 C  CB    . SER G  1 8   ? 163.547 -9.760  194.823 1.00 58.53  ? 8    SER G CB    1 
ATOM   4703 O  OG    . SER G  1 8   ? 164.697 -10.546 194.595 1.00 63.16  ? 8    SER G OG    1 
ATOM   4704 N  N     . GLY G  1 9   ? 163.530 -11.008 191.792 1.00 58.01  ? 9    GLY G N     1 
ATOM   4705 C  CA    . GLY G  1 9   ? 164.040 -11.012 190.430 1.00 51.88  ? 9    GLY G CA    1 
ATOM   4706 C  C     . GLY G  1 9   ? 162.934 -10.837 189.404 1.00 49.20  ? 9    GLY G C     1 
ATOM   4707 O  O     . GLY G  1 9   ? 162.987 -9.941  188.567 1.00 47.33  ? 9    GLY G O     1 
ATOM   4708 N  N     . ILE G  1 10  ? 161.921 -11.692 189.460 1.00 47.69  ? 10   ILE G N     1 
ATOM   4709 C  CA    . ILE G  1 10  ? 160.760 -11.514 188.595 1.00 49.45  ? 10   ILE G CA    1 
ATOM   4710 C  C     . ILE G  1 10  ? 160.121 -10.112 188.778 1.00 49.28  ? 10   ILE G C     1 
ATOM   4711 O  O     . ILE G  1 10  ? 159.702 -9.494  187.794 1.00 44.10  ? 10   ILE G O     1 
ATOM   4712 C  CB    . ILE G  1 10  ? 159.709 -12.616 188.841 1.00 51.31  ? 10   ILE G CB    1 
ATOM   4713 C  CG1   . ILE G  1 10  ? 160.314 -13.989 188.557 1.00 48.45  ? 10   ILE G CG1   1 
ATOM   4714 C  CG2   . ILE G  1 10  ? 158.491 -12.422 187.944 1.00 46.01  ? 10   ILE G CG2   1 
ATOM   4715 C  CD1   . ILE G  1 10  ? 159.345 -15.131 188.801 1.00 51.07  ? 10   ILE G CD1   1 
ATOM   4716 N  N     . SER G  1 11  ? 160.089 -9.606  190.018 1.00 43.79  ? 11   SER G N     1 
ATOM   4717 C  CA    . SER G  1 11  ? 159.551 -8.268  190.306 1.00 39.12  ? 11   SER G CA    1 
ATOM   4718 C  C     . SER G  1 11  ? 160.317 -7.145  189.607 1.00 42.30  ? 11   SER G C     1 
ATOM   4719 O  O     . SER G  1 11  ? 159.720 -6.194  189.113 1.00 39.07  ? 11   SER G O     1 
ATOM   4720 C  CB    . SER G  1 11  ? 159.569 -7.984  191.815 1.00 43.54  ? 11   SER G CB    1 
ATOM   4721 O  OG    . SER G  1 11  ? 158.688 -8.832  192.511 1.00 51.78  ? 11   SER G OG    1 
ATOM   4722 N  N     . ALA G  1 12  ? 161.644 -7.236  189.615 1.00 42.61  ? 12   ALA G N     1 
ATOM   4723 C  CA    . ALA G  1 12  ? 162.473 -6.207  189.011 1.00 43.13  ? 12   ALA G CA    1 
ATOM   4724 C  C     . ALA G  1 12  ? 162.338 -6.245  187.484 1.00 40.10  ? 12   ALA G C     1 
ATOM   4725 O  O     . ALA G  1 12  ? 162.251 -5.207  186.851 1.00 40.67  ? 12   ALA G O     1 
ATOM   4726 C  CB    . ALA G  1 12  ? 163.915 -6.361  189.434 1.00 40.61  ? 12   ALA G CB    1 
ATOM   4727 N  N     . TYR G  1 13  ? 162.290 -7.443  186.912 1.00 39.54  ? 13   TYR G N     1 
ATOM   4728 C  CA    . TYR G  1 13  ? 162.041 -7.615  185.486 1.00 40.72  ? 13   TYR G CA    1 
ATOM   4729 C  C     . TYR G  1 13  ? 160.688 -7.025  185.065 1.00 43.69  ? 13   TYR G C     1 
ATOM   4730 O  O     . TYR G  1 13  ? 160.599 -6.297  184.082 1.00 41.40  ? 13   TYR G O     1 
ATOM   4731 C  CB    . TYR G  1 13  ? 162.110 -9.097  185.106 1.00 41.97  ? 13   TYR G CB    1 
ATOM   4732 C  CG    . TYR G  1 13  ? 161.764 -9.372  183.659 1.00 40.64  ? 13   TYR G CG    1 
ATOM   4733 C  CD1   . TYR G  1 13  ? 162.698 -9.171  182.649 1.00 43.64  ? 13   TYR G CD1   1 
ATOM   4734 C  CD2   . TYR G  1 13  ? 160.502 -9.829  183.305 1.00 46.21  ? 13   TYR G CD2   1 
ATOM   4735 C  CE1   . TYR G  1 13  ? 162.383 -9.418  181.326 1.00 47.23  ? 13   TYR G CE1   1 
ATOM   4736 C  CE2   . TYR G  1 13  ? 160.167 -10.080 181.977 1.00 41.96  ? 13   TYR G CE2   1 
ATOM   4737 C  CZ    . TYR G  1 13  ? 161.111 -9.869  180.999 1.00 47.92  ? 13   TYR G CZ    1 
ATOM   4738 O  OH    . TYR G  1 13  ? 160.785 -10.112 179.692 1.00 48.94  ? 13   TYR G OH    1 
ATOM   4739 N  N     . LEU G  1 14  ? 159.636 -7.314  185.823 1.00 44.12  ? 14   LEU G N     1 
ATOM   4740 C  CA    . LEU G  1 14  ? 158.331 -6.730  185.522 1.00 42.27  ? 14   LEU G CA    1 
ATOM   4741 C  C     . LEU G  1 14  ? 158.341 -5.202  185.675 1.00 40.66  ? 14   LEU G C     1 
ATOM   4742 O  O     . LEU G  1 14  ? 157.708 -4.478  184.899 1.00 38.29  ? 14   LEU G O     1 
ATOM   4743 C  CB    . LEU G  1 14  ? 157.252 -7.344  186.412 1.00 40.91  ? 14   LEU G CB    1 
ATOM   4744 C  CG    . LEU G  1 14  ? 156.985 -8.823  186.121 1.00 44.98  ? 14   LEU G CG    1 
ATOM   4745 C  CD1   . LEU G  1 14  ? 156.121 -9.444  187.219 1.00 40.88  ? 14   LEU G CD1   1 
ATOM   4746 C  CD2   . LEU G  1 14  ? 156.362 -9.015  184.720 1.00 37.48  ? 14   LEU G CD2   1 
ATOM   4747 N  N     . LEU G  1 15  ? 159.074 -4.701  186.658 1.00 37.05  ? 15   LEU G N     1 
ATOM   4748 C  CA    . LEU G  1 15  ? 159.131 -3.259  186.828 1.00 36.63  ? 15   LEU G CA    1 
ATOM   4749 C  C     . LEU G  1 15  ? 159.863 -2.609  185.628 1.00 39.41  ? 15   LEU G C     1 
ATOM   4750 O  O     . LEU G  1 15  ? 159.535 -1.502  185.208 1.00 35.28  ? 15   LEU G O     1 
ATOM   4751 C  CB    . LEU G  1 15  ? 159.787 -2.904  188.164 1.00 33.33  ? 15   LEU G CB    1 
ATOM   4752 C  CG    . LEU G  1 15  ? 159.816 -1.403  188.452 1.00 40.16  ? 15   LEU G CG    1 
ATOM   4753 C  CD1   . LEU G  1 15  ? 158.420 -0.843  188.739 1.00 35.02  ? 15   LEU G CD1   1 
ATOM   4754 C  CD2   . LEU G  1 15  ? 160.794 -1.081  189.591 1.00 39.21  ? 15   LEU G CD2   1 
ATOM   4755 N  N     . GLY G  1 16  ? 160.831 -3.322  185.062 1.00 41.49  ? 16   GLY G N     1 
ATOM   4756 C  CA    . GLY G  1 16  ? 161.468 -2.899  183.822 1.00 39.14  ? 16   GLY G CA    1 
ATOM   4757 C  C     . GLY G  1 16  ? 160.440 -2.723  182.717 1.00 38.53  ? 16   GLY G C     1 
ATOM   4758 O  O     . GLY G  1 16  ? 160.332 -1.641  182.144 1.00 37.71  ? 16   GLY G O     1 
ATOM   4759 N  N     . LEU G  1 17  ? 159.661 -3.768  182.438 1.00 38.57  ? 17   LEU G N     1 
ATOM   4760 C  CA    . LEU G  1 17  ? 158.598 -3.659  181.441 1.00 40.21  ? 17   LEU G CA    1 
ATOM   4761 C  C     . LEU G  1 17  ? 157.621 -2.537  181.804 1.00 43.89  ? 17   LEU G C     1 
ATOM   4762 O  O     . LEU G  1 17  ? 157.203 -1.772  180.916 1.00 36.25  ? 17   LEU G O     1 
ATOM   4763 C  CB    . LEU G  1 17  ? 157.834 -4.982  181.295 1.00 38.09  ? 17   LEU G CB    1 
ATOM   4764 C  CG    . LEU G  1 17  ? 158.642 -6.207  180.873 1.00 42.27  ? 17   LEU G CG    1 
ATOM   4765 C  CD1   . LEU G  1 17  ? 157.752 -7.439  180.803 1.00 38.93  ? 17   LEU G CD1   1 
ATOM   4766 C  CD2   . LEU G  1 17  ? 159.272 -5.939  179.515 1.00 38.07  ? 17   LEU G CD2   1 
ATOM   4767 N  N     . ILE G  1 18  ? 157.272 -2.433  183.102 1.00 36.68  ? 18   ILE G N     1 
ATOM   4768 C  CA    . ILE G  1 18  ? 156.267 -1.460  183.518 1.00 35.72  ? 18   ILE G CA    1 
ATOM   4769 C  C     . ILE G  1 18  ? 156.765 -0.050  183.231 1.00 36.28  ? 18   ILE G C     1 
ATOM   4770 O  O     . ILE G  1 18  ? 156.094 0.725   182.564 1.00 41.02  ? 18   ILE G O     1 
ATOM   4771 C  CB    . ILE G  1 18  ? 155.866 -1.569  185.066 1.00 38.41  ? 18   ILE G CB    1 
ATOM   4772 C  CG1   . ILE G  1 18  ? 154.953 -2.779  185.330 1.00 33.61  ? 18   ILE G CG1   1 
ATOM   4773 C  CG2   . ILE G  1 18  ? 155.107 -0.312  185.516 1.00 29.44  ? 18   ILE G CG2   1 
ATOM   4774 C  CD1   . ILE G  1 18  ? 155.200 -3.478  186.695 1.00 37.36  ? 18   ILE G CD1   1 
ATOM   4775 N  N     . ILE G  1 19  ? 157.940 0.308   183.724 1.00 37.69  ? 19   ILE G N     1 
ATOM   4776 C  CA    A ILE G  1 19  ? 158.494 1.657   183.590 0.96 39.97  ? 19   ILE G CA    1 
ATOM   4777 C  CA    B ILE G  1 19  ? 158.289 1.706   183.551 0.04 39.91  ? 19   ILE G CA    1 
ATOM   4778 C  C     . ILE G  1 19  ? 158.779 1.986   182.129 1.00 41.37  ? 19   ILE G C     1 
ATOM   4779 O  O     . ILE G  1 19  ? 158.635 3.116   181.670 1.00 39.87  ? 19   ILE G O     1 
ATOM   4780 C  CB    A ILE G  1 19  ? 159.809 1.810   184.394 0.96 42.25  ? 19   ILE G CB    1 
ATOM   4781 C  CB    B ILE G  1 19  ? 159.307 2.187   184.590 0.04 40.81  ? 19   ILE G CB    1 
ATOM   4782 C  CG1   A ILE G  1 19  ? 159.538 1.746   185.901 0.96 42.52  ? 19   ILE G CG1   1 
ATOM   4783 C  CG1   B ILE G  1 19  ? 160.715 1.713   184.274 0.04 40.55  ? 19   ILE G CG1   1 
ATOM   4784 C  CG2   A ILE G  1 19  ? 160.525 3.112   184.044 0.96 40.17  ? 19   ILE G CG2   1 
ATOM   4785 C  CG2   B ILE G  1 19  ? 158.882 1.751   185.989 0.04 41.59  ? 19   ILE G CG2   1 
ATOM   4786 C  CD1   A ILE G  1 19  ? 158.552 2.782   186.370 0.96 45.89  ? 19   ILE G CD1   1 
ATOM   4787 C  CD1   B ILE G  1 19  ? 161.693 2.294   185.236 0.04 40.60  ? 19   ILE G CD1   1 
ATOM   4788 N  N     . GLY G  1 20  ? 159.252 0.970   181.409 1.00 39.71  ? 20   GLY G N     1 
ATOM   4789 C  CA    . GLY G  1 20  ? 159.525 1.146   179.995 1.00 38.76  ? 20   GLY G CA    1 
ATOM   4790 C  C     . GLY G  1 20  ? 158.256 1.250   179.145 1.00 42.06  ? 20   GLY G C     1 
ATOM   4791 O  O     . GLY G  1 20  ? 158.022 2.265   178.489 1.00 38.27  ? 20   GLY G O     1 
ATOM   4792 N  N     . ASP G  1 21  ? 157.430 0.207   179.155 1.00 37.08  ? 21   ASP G N     1 
ATOM   4793 C  CA    . ASP G  1 21  ? 156.309 0.146   178.222 1.00 40.51  ? 21   ASP G CA    1 
ATOM   4794 C  C     . ASP G  1 21  ? 154.925 0.323   178.849 1.00 41.60  ? 21   ASP G C     1 
ATOM   4795 O  O     . ASP G  1 21  ? 153.920 0.211   178.167 1.00 42.62  ? 21   ASP G O     1 
ATOM   4796 C  CB    . ASP G  1 21  ? 156.333 -1.180  177.454 1.00 38.12  ? 21   ASP G CB    1 
ATOM   4797 C  CG    . ASP G  1 21  ? 157.213 -1.122  176.195 1.00 39.83  ? 21   ASP G CG    1 
ATOM   4798 O  OD1   . ASP G  1 21  ? 157.706 -0.033  175.863 1.00 35.40  ? 21   ASP G OD1   1 
ATOM   4799 O  OD2   . ASP G  1 21  ? 157.404 -2.175  175.546 1.00 39.65  ? 21   ASP G OD2   1 
ATOM   4800 N  N     . GLY G  1 22  ? 154.848 0.581   180.142 1.00 41.82  ? 22   GLY G N     1 
ATOM   4801 C  CA    . GLY G  1 22  ? 153.533 0.702   180.746 1.00 41.20  ? 22   GLY G CA    1 
ATOM   4802 C  C     . GLY G  1 22  ? 153.488 1.841   181.727 1.00 40.06  ? 22   GLY G C     1 
ATOM   4803 O  O     . GLY G  1 22  ? 153.903 2.952   181.394 1.00 38.32  ? 22   GLY G O     1 
ATOM   4804 N  N     . GLY G  1 23  ? 153.003 1.566   182.937 1.00 34.87  ? 23   GLY G N     1 
ATOM   4805 C  CA    . GLY G  1 23  ? 152.943 2.597   183.953 1.00 37.49  ? 23   GLY G CA    1 
ATOM   4806 C  C     . GLY G  1 23  ? 152.289 2.176   185.261 1.00 41.64  ? 23   GLY G C     1 
ATOM   4807 O  O     . GLY G  1 23  ? 151.720 1.078   185.395 1.00 36.15  ? 23   GLY G O     1 
ATOM   4808 N  N     . LEU G  1 24  ? 152.396 3.064   186.239 1.00 39.89  ? 24   LEU G N     1 
ATOM   4809 C  CA    . LEU G  1 24  ? 151.731 2.899   187.516 1.00 38.82  ? 24   LEU G CA    1 
ATOM   4810 C  C     . LEU G  1 24  ? 150.793 4.090   187.636 1.00 42.02  ? 24   LEU G C     1 
ATOM   4811 O  O     . LEU G  1 24  ? 151.254 5.222   187.708 1.00 40.84  ? 24   LEU G O     1 
ATOM   4812 C  CB    . LEU G  1 24  ? 152.747 2.859   188.648 1.00 39.95  ? 24   LEU G CB    1 
ATOM   4813 C  CG    . LEU G  1 24  ? 153.746 1.712   188.528 1.00 39.20  ? 24   LEU G CG    1 
ATOM   4814 C  CD1   . LEU G  1 24  ? 154.723 1.737   189.685 1.00 42.70  ? 24   LEU G CD1   1 
ATOM   4815 C  CD2   . LEU G  1 24  ? 153.006 0.385   188.451 1.00 34.95  ? 24   LEU G CD2   1 
ATOM   4816 N  N     . TYR G  1 25  ? 149.487 3.846   187.598 0.99 35.59  ? 25   TYR G N     1 
ATOM   4817 C  CA    . TYR G  1 25  ? 148.526 4.941   187.537 0.99 42.09  ? 25   TYR G CA    1 
ATOM   4818 C  C     . TYR G  1 25  ? 147.634 4.937   188.774 0.99 42.79  ? 25   TYR G C     1 
ATOM   4819 O  O     . TYR G  1 25  ? 146.975 3.943   189.069 0.99 44.19  ? 25   TYR G O     1 
ATOM   4820 C  CB    . TYR G  1 25  ? 147.668 4.846   186.267 0.99 38.19  ? 25   TYR G CB    1 
ATOM   4821 C  CG    . TYR G  1 25  ? 148.510 4.822   185.013 0.99 45.45  ? 25   TYR G CG    1 
ATOM   4822 C  CD1   . TYR G  1 25  ? 149.196 5.956   184.594 1.00 41.26  ? 25   TYR G CD1   1 
ATOM   4823 C  CD2   . TYR G  1 25  ? 148.655 3.653   184.279 1.00 42.88  ? 25   TYR G CD2   1 
ATOM   4824 C  CE1   . TYR G  1 25  ? 149.979 5.929   183.471 1.00 44.12  ? 25   TYR G CE1   1 
ATOM   4825 C  CE2   . TYR G  1 25  ? 149.431 3.617   183.150 1.00 42.57  ? 25   TYR G CE2   1 
ATOM   4826 C  CZ    . TYR G  1 25  ? 150.089 4.755   182.754 0.99 44.67  ? 25   TYR G CZ    1 
ATOM   4827 O  OH    . TYR G  1 25  ? 150.877 4.711   181.650 0.99 43.85  ? 25   TYR G OH    1 
ATOM   4828 N  N     . LYS G  1 26  ? 147.615 6.058   189.480 1.00 41.49  ? 26   LYS G N     1 
ATOM   4829 C  CA    A LYS G  1 26  ? 146.717 6.426   190.561 0.40 44.31  ? 26   LYS G CA    1 
ATOM   4830 C  CA    B LYS G  1 26  ? 146.702 6.417   190.556 0.60 44.20  ? 26   LYS G CA    1 
ATOM   4831 C  C     . LYS G  1 26  ? 145.600 7.327   190.026 1.00 43.89  ? 26   LYS G C     1 
ATOM   4832 O  O     . LYS G  1 26  ? 145.805 8.520   189.835 1.00 43.03  ? 26   LYS G O     1 
ATOM   4833 C  CB    A LYS G  1 26  ? 147.507 7.114   191.685 0.40 43.42  ? 26   LYS G CB    1 
ATOM   4834 C  CB    B LYS G  1 26  ? 147.464 7.091   191.704 0.60 42.61  ? 26   LYS G CB    1 
ATOM   4835 C  CG    A LYS G  1 26  ? 146.746 7.269   193.006 0.40 45.73  ? 26   LYS G CG    1 
ATOM   4836 C  CG    B LYS G  1 26  ? 146.622 7.353   192.967 0.60 45.70  ? 26   LYS G CG    1 
ATOM   4837 C  CD    A LYS G  1 26  ? 147.617 7.913   194.095 0.40 46.38  ? 26   LYS G CD    1 
ATOM   4838 C  CD    B LYS G  1 26  ? 147.434 8.142   193.999 0.60 46.50  ? 26   LYS G CD    1 
ATOM   4839 C  CE    A LYS G  1 26  ? 148.605 6.924   194.718 0.40 47.01  ? 26   LYS G CE    1 
ATOM   4840 C  CE    B LYS G  1 26  ? 146.812 8.097   195.394 0.60 46.20  ? 26   LYS G CE    1 
ATOM   4841 N  NZ    A LYS G  1 26  ? 149.218 7.420   196.016 0.40 48.17  ? 26   LYS G NZ    1 
ATOM   4842 N  NZ    B LYS G  1 26  ? 145.484 8.762   195.435 0.60 47.79  ? 26   LYS G NZ    1 
ATOM   4843 N  N     . LEU G  1 27  ? 144.426 6.747   189.793 1.00 40.34  ? 27   LEU G N     1 
ATOM   4844 C  CA    . LEU G  1 27  ? 143.302 7.442   189.168 1.00 46.61  ? 27   LEU G CA    1 
ATOM   4845 C  C     . LEU G  1 27  ? 142.238 7.939   190.148 1.00 53.82  ? 27   LEU G C     1 
ATOM   4846 O  O     . LEU G  1 27  ? 141.792 7.200   191.033 1.00 47.61  ? 27   LEU G O     1 
ATOM   4847 C  CB    . LEU G  1 27  ? 142.595 6.524   188.169 1.00 46.86  ? 27   LEU G CB    1 
ATOM   4848 C  CG    . LEU G  1 27  ? 143.254 6.007   186.893 1.00 49.23  ? 27   LEU G CG    1 
ATOM   4849 C  CD1   . LEU G  1 27  ? 143.968 7.104   186.130 1.00 45.99  ? 27   LEU G CD1   1 
ATOM   4850 C  CD2   . LEU G  1 27  ? 144.173 4.863   187.235 1.00 44.29  ? 27   LEU G CD2   1 
ATOM   4851 N  N     . LYS G  1 28  ? 141.794 9.173   189.945 1.00 55.61  ? 28   LYS G N     1 
ATOM   4852 C  CA    . LYS G  1 28  ? 140.643 9.697   190.663 1.00 53.81  ? 28   LYS G CA    1 
ATOM   4853 C  C     . LYS G  1 28  ? 139.500 9.925   189.662 1.00 58.89  ? 28   LYS G C     1 
ATOM   4854 O  O     . LYS G  1 28  ? 139.707 10.466  188.572 1.00 56.48  ? 28   LYS G O     1 
ATOM   4855 C  CB    . LYS G  1 28  ? 141.005 10.988  191.391 1.00 55.62  ? 28   LYS G CB    1 
ATOM   4856 C  CG    . LYS G  1 28  ? 139.884 11.548  192.273 1.00 74.78  ? 28   LYS G CG    1 
ATOM   4857 C  CD    . LYS G  1 28  ? 139.604 10.655  193.488 1.00 68.98  ? 28   LYS G CD    1 
ATOM   4858 C  CE    . LYS G  1 28  ? 138.513 11.241  194.371 1.00 67.88  ? 28   LYS G CE    1 
ATOM   4859 N  NZ    . LYS G  1 28  ? 138.933 12.549  194.972 1.00 65.85  ? 28   LYS G NZ    1 
ATOM   4860 N  N     . TYR G  1 29  ? 138.300 9.482   190.015 1.00 57.13  ? 29   TYR G N     1 
ATOM   4861 C  CA    . TYR G  1 29  ? 137.173 9.551   189.092 1.00 57.14  ? 29   TYR G CA    1 
ATOM   4862 C  C     . TYR G  1 29  ? 136.020 10.416  189.616 1.00 64.78  ? 29   TYR G C     1 
ATOM   4863 O  O     . TYR G  1 29  ? 136.068 10.952  190.728 1.00 60.06  ? 29   TYR G O     1 
ATOM   4864 C  CB    . TYR G  1 29  ? 136.636 8.146   188.797 1.00 52.71  ? 29   TYR G CB    1 
ATOM   4865 C  CG    . TYR G  1 29  ? 137.585 7.187   188.110 1.00 55.19  ? 29   TYR G CG    1 
ATOM   4866 C  CD1   . TYR G  1 29  ? 138.468 7.633   187.124 1.00 54.66  ? 29   TYR G CD1   1 
ATOM   4867 C  CD2   . TYR G  1 29  ? 137.572 5.827   188.421 1.00 45.61  ? 29   TYR G CD2   1 
ATOM   4868 C  CE1   . TYR G  1 29  ? 139.324 6.749   186.468 1.00 48.97  ? 29   TYR G CE1   1 
ATOM   4869 C  CE2   . TYR G  1 29  ? 138.416 4.937   187.782 1.00 50.33  ? 29   TYR G CE2   1 
ATOM   4870 C  CZ    . TYR G  1 29  ? 139.295 5.406   186.801 1.00 53.45  ? 29   TYR G CZ    1 
ATOM   4871 O  OH    . TYR G  1 29  ? 140.150 4.535   186.166 1.00 49.81  ? 29   TYR G OH    1 
ATOM   4872 N  N     . LYS G  1 30  ? 134.991 10.558  188.788 1.00 68.98  ? 30   LYS G N     1 
ATOM   4873 C  CA    . LYS G  1 30  ? 133.664 10.923  189.265 1.00 66.37  ? 30   LYS G CA    1 
ATOM   4874 C  C     . LYS G  1 30  ? 133.132 9.695   189.980 1.00 69.95  ? 30   LYS G C     1 
ATOM   4875 O  O     . LYS G  1 30  ? 132.984 8.671   189.321 1.00 75.89  ? 30   LYS G O     1 
ATOM   4876 C  CB    . LYS G  1 30  ? 132.734 11.286  188.095 1.00 62.62  ? 30   LYS G CB    1 
ATOM   4877 C  CG    . LYS G  1 30  ? 133.034 12.595  187.381 1.00 68.17  ? 30   LYS G CG    1 
ATOM   4878 C  CD    . LYS G  1 30  ? 132.872 12.451  185.873 1.00 72.75  ? 30   LYS G CD    1 
ATOM   4879 C  CE    . LYS G  1 30  ? 131.522 11.862  185.480 1.00 78.76  ? 30   LYS G CE    1 
ATOM   4880 N  NZ    . LYS G  1 30  ? 131.441 11.603  184.001 1.00 76.20  ? 30   LYS G NZ    1 
ATOM   4881 N  N     . GLY G  1 31  ? 132.891 9.709   191.289 1.00 62.21  ? 31   GLY G N     1 
ATOM   4882 C  CA    . GLY G  1 31  ? 133.311 10.702  192.261 1.00 66.16  ? 31   GLY G CA    1 
ATOM   4883 C  C     . GLY G  1 31  ? 132.753 10.133  193.566 1.00 66.61  ? 31   GLY G C     1 
ATOM   4884 O  O     . GLY G  1 31  ? 131.650 9.596   193.543 1.00 69.16  ? 31   GLY G O     1 
ATOM   4885 N  N     . ASN G  1 32  ? 133.501 10.116  194.668 1.00 65.17  ? 32   ASN G N     1 
ATOM   4886 C  CA    . ASN G  1 32  ? 134.951 10.258  194.707 1.00 65.20  ? 32   ASN G CA    1 
ATOM   4887 C  C     . ASN G  1 32  ? 135.611 8.914   194.418 1.00 58.89  ? 32   ASN G C     1 
ATOM   4888 O  O     . ASN G  1 32  ? 136.368 8.412   195.249 1.00 53.82  ? 32   ASN G O     1 
ATOM   4889 C  CB    . ASN G  1 32  ? 135.409 10.727  196.093 1.00 67.58  ? 32   ASN G CB    1 
ATOM   4890 C  CG    . ASN G  1 32  ? 135.196 12.206  196.322 1.00 74.51  ? 32   ASN G CG    1 
ATOM   4891 O  OD1   . ASN G  1 32  ? 136.154 12.980  196.348 1.00 82.27  ? 32   ASN G OD1   1 
ATOM   4892 N  ND2   . ASN G  1 32  ? 133.940 12.608  196.512 1.00 72.43  ? 32   ASN G ND2   1 
ATOM   4893 N  N     . ARG G  1 33  ? 135.298 8.302   193.281 1.00 57.40  ? 33   ARG G N     1 
ATOM   4894 C  CA    . ARG G  1 33  ? 135.814 6.961   193.002 1.00 57.40  ? 33   ARG G CA    1 
ATOM   4895 C  C     . ARG G  1 33  ? 137.307 6.951   192.614 1.00 51.61  ? 33   ARG G C     1 
ATOM   4896 O  O     . ARG G  1 33  ? 137.920 7.989   192.329 1.00 50.13  ? 33   ARG G O     1 
ATOM   4897 C  CB    . ARG G  1 33  ? 134.980 6.289   191.913 1.00 58.07  ? 33   ARG G CB    1 
ATOM   4898 C  CG    . ARG G  1 33  ? 133.502 6.097   192.269 1.00 52.37  ? 33   ARG G CG    1 
ATOM   4899 C  CD    . ARG G  1 33  ? 132.796 5.482   191.072 1.00 52.12  ? 33   ARG G CD    1 
ATOM   4900 N  NE    . ARG G  1 33  ? 133.022 6.313   189.890 1.00 61.55  ? 33   ARG G NE    1 
ATOM   4901 C  CZ    . ARG G  1 33  ? 133.409 5.880   188.694 1.00 56.87  ? 33   ARG G CZ    1 
ATOM   4902 N  NH1   . ARG G  1 33  ? 133.622 4.591   188.453 1.00 56.60  ? 33   ARG G NH1   1 
ATOM   4903 N  NH2   . ARG G  1 33  ? 133.575 6.761   187.728 1.00 64.39  ? 33   ARG G NH2   1 
ATOM   4904 N  N     . SER G  1 34  ? 137.907 5.772   192.653 1.00 46.17  ? 34   SER G N     1 
ATOM   4905 C  CA    . SER G  1 34  ? 139.348 5.694   192.479 1.00 46.45  ? 34   SER G CA    1 
ATOM   4906 C  C     . SER G  1 34  ? 139.760 4.366   191.871 1.00 43.94  ? 34   SER G C     1 
ATOM   4907 O  O     . SER G  1 34  ? 138.944 3.435   191.757 1.00 40.84  ? 34   SER G O     1 
ATOM   4908 C  CB    . SER G  1 34  ? 140.073 5.913   193.820 1.00 44.94  ? 34   SER G CB    1 
ATOM   4909 O  OG    . SER G  1 34  ? 140.132 4.723   194.602 1.00 45.92  ? 34   SER G OG    1 
ATOM   4910 N  N     . GLU G  1 35  ? 141.027 4.300   191.469 1.00 43.98  ? 35   GLU G N     1 
ATOM   4911 C  CA    . GLU G  1 35  ? 141.599 3.086   190.892 1.00 45.69  ? 35   GLU G CA    1 
ATOM   4912 C  C     . GLU G  1 35  ? 143.130 3.154   190.883 1.00 42.55  ? 35   GLU G C     1 
ATOM   4913 O  O     . GLU G  1 35  ? 143.737 4.224   190.786 1.00 39.46  ? 35   GLU G O     1 
ATOM   4914 C  CB    . GLU G  1 35  ? 141.067 2.843   189.468 1.00 41.76  ? 35   GLU G CB    1 
ATOM   4915 C  CG    . GLU G  1 35  ? 141.318 1.417   188.968 1.00 46.85  ? 35   GLU G CG    1 
ATOM   4916 C  CD    . GLU G  1 35  ? 140.815 1.138   187.543 1.00 47.14  ? 35   GLU G CD    1 
ATOM   4917 O  OE1   . GLU G  1 35  ? 140.232 2.037   186.893 1.00 44.13  ? 35   GLU G OE1   1 
ATOM   4918 O  OE2   . GLU G  1 35  ? 140.986 -0.013  187.086 1.00 43.09  ? 35   GLU G OE2   1 
ATOM   4919 N  N     . TYR G  1 36  ? 143.747 1.993   191.019 1.00 38.68  ? 36   TYR G N     1 
ATOM   4920 C  CA    . TYR G  1 36  ? 145.197 1.894   191.047 1.00 40.15  ? 36   TYR G CA    1 
ATOM   4921 C  C     . TYR G  1 36  ? 145.551 0.839   190.017 1.00 40.69  ? 36   TYR G C     1 
ATOM   4922 O  O     . TYR G  1 36  ? 145.090 -0.304  190.106 1.00 38.07  ? 36   TYR G O     1 
ATOM   4923 C  CB    . TYR G  1 36  ? 145.721 1.507   192.435 1.00 40.48  ? 36   TYR G CB    1 
ATOM   4924 C  CG    . TYR G  1 36  ? 145.264 2.413   193.554 1.00 41.68  ? 36   TYR G CG    1 
ATOM   4925 C  CD1   . TYR G  1 36  ? 143.953 2.352   194.041 1.00 41.85  ? 36   TYR G CD1   1 
ATOM   4926 C  CD2   . TYR G  1 36  ? 146.129 3.327   194.121 1.00 38.14  ? 36   TYR G CD2   1 
ATOM   4927 C  CE1   . TYR G  1 36  ? 143.532 3.177   195.051 1.00 41.64  ? 36   TYR G CE1   1 
ATOM   4928 C  CE2   . TYR G  1 36  ? 145.719 4.156   195.133 1.00 38.75  ? 36   TYR G CE2   1 
ATOM   4929 C  CZ    . TYR G  1 36  ? 144.418 4.075   195.598 1.00 44.73  ? 36   TYR G CZ    1 
ATOM   4930 O  OH    . TYR G  1 36  ? 144.003 4.902   196.604 1.00 40.41  ? 36   TYR G OH    1 
ATOM   4931 N  N     . ARG G  1 37  ? 146.327 1.233   189.014 1.00 41.36  ? 37   ARG G N     1 
ATOM   4932 C  CA    . ARG G  1 37  ? 146.604 0.332   187.901 1.00 39.30  ? 37   ARG G CA    1 
ATOM   4933 C  C     . ARG G  1 37  ? 148.094 0.049   187.717 1.00 38.54  ? 37   ARG G C     1 
ATOM   4934 O  O     . ARG G  1 37  ? 148.939 0.961   187.755 1.00 36.32  ? 37   ARG G O     1 
ATOM   4935 C  CB    . ARG G  1 37  ? 146.024 0.905   186.618 1.00 38.63  ? 37   ARG G CB    1 
ATOM   4936 C  CG    . ARG G  1 37  ? 144.532 0.699   186.440 1.00 40.78  ? 37   ARG G CG    1 
ATOM   4937 C  CD    . ARG G  1 37  ? 144.050 1.364   185.145 1.00 44.10  ? 37   ARG G CD    1 
ATOM   4938 N  NE    . ARG G  1 37  ? 142.595 1.352   185.027 1.00 49.58  ? 37   ARG G NE    1 
ATOM   4939 C  CZ    . ARG G  1 37  ? 141.903 1.782   183.972 1.00 49.46  ? 37   ARG G CZ    1 
ATOM   4940 N  NH1   . ARG G  1 37  ? 142.518 2.262   182.879 1.00 48.01  ? 37   ARG G NH1   1 
ATOM   4941 N  NH2   . ARG G  1 37  ? 140.586 1.719   184.014 1.00 43.97  ? 37   ARG G NH2   1 
ATOM   4942 N  N     . VAL G  1 38  ? 148.391 -1.236  187.558 1.00 36.86  ? 38   VAL G N     1 
ATOM   4943 C  CA    . VAL G  1 38  ? 149.687 -1.694  187.109 1.00 36.69  ? 38   VAL G CA    1 
ATOM   4944 C  C     . VAL G  1 38  ? 149.540 -2.067  185.624 1.00 39.11  ? 38   VAL G C     1 
ATOM   4945 O  O     . VAL G  1 38  ? 148.730 -2.927  185.267 1.00 34.71  ? 38   VAL G O     1 
ATOM   4946 C  CB    . VAL G  1 38  ? 150.202 -2.891  187.915 1.00 34.05  ? 38   VAL G CB    1 
ATOM   4947 C  CG1   . VAL G  1 38  ? 151.588 -3.321  187.393 1.00 33.63  ? 38   VAL G CG1   1 
ATOM   4948 C  CG2   . VAL G  1 38  ? 150.289 -2.545  189.418 1.00 40.96  ? 38   VAL G CG2   1 
ATOM   4949 N  N     . VAL G  1 39  ? 150.300 -1.396  184.765 1.00 37.78  ? 39   VAL G N     1 
ATOM   4950 C  CA    . VAL G  1 39  ? 150.124 -1.553  183.308 1.00 38.64  ? 39   VAL G CA    1 
ATOM   4951 C  C     . VAL G  1 39  ? 151.426 -1.820  182.572 1.00 39.61  ? 39   VAL G C     1 
ATOM   4952 O  O     . VAL G  1 39  ? 152.421 -1.125  182.801 1.00 34.92  ? 39   VAL G O     1 
ATOM   4953 C  CB    . VAL G  1 39  ? 149.499 -0.290  182.652 1.00 43.04  ? 39   VAL G CB    1 
ATOM   4954 C  CG1   . VAL G  1 39  ? 149.576 -0.358  181.074 1.00 39.19  ? 39   VAL G CG1   1 
ATOM   4955 C  CG2   . VAL G  1 39  ? 148.079 -0.055  183.157 1.00 38.05  ? 39   VAL G CG2   1 
ATOM   4956 N  N     . ILE G  1 40  ? 151.390 -2.840  181.708 1.00 39.65  ? 40   ILE G N     1 
ATOM   4957 C  CA    . ILE G  1 40  ? 152.371 -3.065  180.658 1.00 45.50  ? 40   ILE G CA    1 
ATOM   4958 C  C     . ILE G  1 40  ? 151.645 -3.170  179.307 1.00 46.85  ? 40   ILE G C     1 
ATOM   4959 O  O     . ILE G  1 40  ? 150.787 -4.045  179.149 1.00 44.92  ? 40   ILE G O     1 
ATOM   4960 C  CB    . ILE G  1 40  ? 153.192 -4.360  180.877 1.00 40.24  ? 40   ILE G CB    1 
ATOM   4961 C  CG1   . ILE G  1 40  ? 154.013 -4.308  182.166 1.00 34.64  ? 40   ILE G CG1   1 
ATOM   4962 C  CG2   . ILE G  1 40  ? 154.058 -4.629  179.666 1.00 41.14  ? 40   ILE G CG2   1 
ATOM   4963 C  CD1   . ILE G  1 40  ? 154.315 -5.693  182.748 1.00 30.97  ? 40   ILE G CD1   1 
ATOM   4964 N  N     . THR G  1 41  ? 151.955 -2.280  178.356 0.99 46.66  ? 41   THR G N     1 
ATOM   4965 C  CA    . THR G  1 41  ? 151.412 -2.407  176.986 0.99 45.96  ? 41   THR G CA    1 
ATOM   4966 C  C     . THR G  1 41  ? 152.437 -2.983  176.002 0.99 43.97  ? 41   THR G C     1 
ATOM   4967 O  O     . THR G  1 41  ? 153.639 -2.760  176.158 0.99 41.89  ? 41   THR G O     1 
ATOM   4968 C  CB    . THR G  1 41  ? 150.939 -1.070  176.390 0.99 42.30  ? 41   THR G CB    1 
ATOM   4969 O  OG1   . THR G  1 41  ? 152.082 -0.261  176.096 1.00 43.08  ? 41   THR G OG1   1 
ATOM   4970 C  CG2   . THR G  1 41  ? 149.981 -0.322  177.287 1.00 38.58  ? 41   THR G CG2   1 
ATOM   4971 N  N     . GLN G  1 42  ? 151.945 -3.716  175.003 1.00 44.95  ? 42   GLN G N     1 
ATOM   4972 C  CA    . GLN G  1 42  ? 152.770 -4.322  173.950 1.00 42.82  ? 42   GLN G CA    1 
ATOM   4973 C  C     . GLN G  1 42  ? 151.917 -4.658  172.727 1.00 55.49  ? 42   GLN G C     1 
ATOM   4974 O  O     . GLN G  1 42  ? 150.706 -4.939  172.848 1.00 48.36  ? 42   GLN G O     1 
ATOM   4975 C  CB    . GLN G  1 42  ? 153.470 -5.582  174.466 1.00 45.06  ? 42   GLN G CB    1 
ATOM   4976 C  CG    . GLN G  1 42  ? 154.871 -5.931  173.915 1.00 49.80  ? 42   GLN G CG    1 
ATOM   4977 C  CD    . GLN G  1 42  ? 156.014 -5.011  174.342 1.00 52.73  ? 42   GLN G CD    1 
ATOM   4978 O  OE1   . GLN G  1 42  ? 157.034 -4.947  173.671 1.00 55.57  ? 42   GLN G OE1   1 
ATOM   4979 N  NE2   . GLN G  1 42  ? 155.833 -4.274  175.432 1.00 49.80  ? 42   GLN G NE2   1 
ATOM   4980 N  N     . LYS G  1 43  ? 152.552 -4.627  171.550 1.00 52.95  ? 43   LYS G N     1 
ATOM   4981 C  CA    . LYS G  1 43  ? 151.888 -4.995  170.315 1.00 47.88  ? 43   LYS G CA    1 
ATOM   4982 C  C     . LYS G  1 43  ? 151.715 -6.497  170.224 1.00 47.46  ? 43   LYS G C     1 
ATOM   4983 O  O     . LYS G  1 43  ? 150.640 -6.988  169.912 1.00 49.12  ? 43   LYS G O     1 
ATOM   4984 C  CB    . LYS G  1 43  ? 152.677 -4.489  169.115 1.00 54.86  ? 43   LYS G CB    1 
ATOM   4985 C  CG    . LYS G  1 43  ? 152.085 -4.888  167.773 1.00 56.29  ? 43   LYS G CG    1 
ATOM   4986 C  CD    . LYS G  1 43  ? 152.878 -4.323  166.599 1.00 60.17  ? 43   LYS G CD    1 
ATOM   4987 C  CE    . LYS G  1 43  ? 152.181 -4.634  165.271 1.00 69.92  ? 43   LYS G CE    1 
ATOM   4988 N  NZ    . LYS G  1 43  ? 150.717 -4.316  165.329 1.00 73.08  ? 43   LYS G NZ    1 
ATOM   4989 N  N     . SER G  1 44  ? 152.793 -7.217  170.500 1.00 51.92  ? 44   SER G N     1 
ATOM   4990 C  CA    . SER G  1 44  ? 152.830 -8.674  170.369 1.00 54.48  ? 44   SER G CA    1 
ATOM   4991 C  C     . SER G  1 44  ? 151.851 -9.373  171.316 1.00 60.24  ? 44   SER G C     1 
ATOM   4992 O  O     . SER G  1 44  ? 152.045 -9.392  172.538 1.00 63.07  ? 44   SER G O     1 
ATOM   4993 C  CB    . SER G  1 44  ? 154.262 -9.173  170.616 1.00 52.68  ? 44   SER G CB    1 
ATOM   4994 O  OG    . SER G  1 44  ? 154.323 -10.584 170.623 1.00 56.17  ? 44   SER G OG    1 
ATOM   4995 N  N     . GLU G  1 45  ? 150.788 -9.930  170.748 1.00 62.65  ? 45   GLU G N     1 
ATOM   4996 C  CA    . GLU G  1 45  ? 149.770 -10.621 171.528 1.00 63.62  ? 45   GLU G CA    1 
ATOM   4997 C  C     . GLU G  1 45  ? 150.384 -11.786 172.284 1.00 64.63  ? 45   GLU G C     1 
ATOM   4998 O  O     . GLU G  1 45  ? 150.048 -12.049 173.450 1.00 62.68  ? 45   GLU G O     1 
ATOM   4999 C  CB    . GLU G  1 45  ? 148.646 -11.127 170.623 1.00 65.93  ? 45   GLU G CB    1 
ATOM   5000 C  CG    . GLU G  1 45  ? 147.558 -11.884 171.363 1.00 70.39  ? 45   GLU G CG    1 
ATOM   5001 C  CD    . GLU G  1 45  ? 146.372 -12.209 170.483 1.00 80.10  ? 45   GLU G CD    1 
ATOM   5002 O  OE1   . GLU G  1 45  ? 146.567 -12.377 169.256 1.00 81.36  ? 45   GLU G OE1   1 
ATOM   5003 O  OE2   . GLU G  1 45  ? 145.244 -12.285 171.017 1.00 81.23  ? 45   GLU G OE2   1 
ATOM   5004 N  N     . ASN G  1 46  ? 151.297 -12.476 171.609 1.00 60.85  ? 46   ASN G N     1 
ATOM   5005 C  CA    . ASN G  1 46  ? 151.880 -13.679 172.163 1.00 61.33  ? 46   ASN G CA    1 
ATOM   5006 C  C     . ASN G  1 46  ? 152.790 -13.362 173.332 1.00 59.09  ? 46   ASN G C     1 
ATOM   5007 O  O     . ASN G  1 46  ? 152.774 -14.072 174.331 1.00 60.93  ? 46   ASN G O     1 
ATOM   5008 C  CB    . ASN G  1 46  ? 152.659 -14.462 171.096 1.00 55.87  ? 46   ASN G CB    1 
ATOM   5009 C  CG    . ASN G  1 46  ? 153.618 -15.489 171.708 1.00 66.63  ? 46   ASN G CG    1 
ATOM   5010 O  OD1   . ASN G  1 46  ? 154.775 -15.183 172.011 1.00 68.01  ? 46   ASN G OD1   1 
ATOM   5011 N  ND2   . ASN G  1 46  ? 153.127 -16.703 171.913 1.00 70.71  ? 46   ASN G ND2   1 
ATOM   5012 N  N     . LEU G  1 47  ? 153.601 -12.314 173.202 1.00 55.75  ? 47   LEU G N     1 
ATOM   5013 C  CA    . LEU G  1 47  ? 154.569 -11.994 174.242 1.00 56.87  ? 47   LEU G CA    1 
ATOM   5014 C  C     . LEU G  1 47  ? 153.825 -11.669 175.536 1.00 56.58  ? 47   LEU G C     1 
ATOM   5015 O  O     . LEU G  1 47  ? 154.219 -12.064 176.631 1.00 54.71  ? 47   LEU G O     1 
ATOM   5016 C  CB    . LEU G  1 47  ? 155.465 -10.823 173.825 1.00 51.58  ? 47   LEU G CB    1 
ATOM   5017 C  CG    . LEU G  1 47  ? 156.492 -10.412 174.896 1.00 54.48  ? 47   LEU G CG    1 
ATOM   5018 C  CD1   . LEU G  1 47  ? 157.641 -11.410 174.979 1.00 57.96  ? 47   LEU G CD1   1 
ATOM   5019 C  CD2   . LEU G  1 47  ? 157.036 -9.002  174.692 1.00 53.46  ? 47   LEU G CD2   1 
ATOM   5020 N  N     . ILE G  1 48  ? 152.711 -10.972 175.394 1.00 53.14  ? 48   ILE G N     1 
ATOM   5021 C  CA    . ILE G  1 48  ? 152.054 -10.436 176.555 1.00 58.58  ? 48   ILE G CA    1 
ATOM   5022 C  C     . ILE G  1 48  ? 151.195 -11.518 177.218 1.00 57.10  ? 48   ILE G C     1 
ATOM   5023 O  O     . ILE G  1 48  ? 151.107 -11.561 178.442 1.00 54.60  ? 48   ILE G O     1 
ATOM   5024 C  CB    . ILE G  1 48  ? 151.254 -9.174  176.179 1.00 54.86  ? 48   ILE G CB    1 
ATOM   5025 C  CG1   . ILE G  1 48  ? 151.464 -8.111  177.256 1.00 60.64  ? 48   ILE G CG1   1 
ATOM   5026 C  CG2   . ILE G  1 48  ? 149.792 -9.480  175.961 1.00 57.29  ? 48   ILE G CG2   1 
ATOM   5027 C  CD1   . ILE G  1 48  ? 150.912 -6.764  176.864 1.00 63.10  ? 48   ILE G CD1   1 
ATOM   5028 N  N     . LYS G  1 49  ? 150.646 -12.439 176.429 1.00 58.01  ? 49   LYS G N     1 
ATOM   5029 C  CA    . LYS G  1 49  ? 149.818 -13.512 176.977 1.00 55.28  ? 49   LYS G CA    1 
ATOM   5030 C  C     . LYS G  1 49  ? 150.610 -14.749 177.383 1.00 54.24  ? 49   LYS G C     1 
ATOM   5031 O  O     . LYS G  1 49  ? 150.198 -15.484 178.269 1.00 53.35  ? 49   LYS G O     1 
ATOM   5032 C  CB    . LYS G  1 49  ? 148.741 -13.927 175.976 1.00 51.48  ? 49   LYS G CB    1 
ATOM   5033 C  CG    . LYS G  1 49  ? 147.638 -12.920 175.784 1.00 52.86  ? 49   LYS G CG    1 
ATOM   5034 C  CD    . LYS G  1 49  ? 146.525 -13.492 174.906 1.00 58.67  ? 49   LYS G CD    1 
ATOM   5035 C  CE    . LYS G  1 49  ? 145.503 -12.426 174.523 1.00 60.48  ? 49   LYS G CE    1 
ATOM   5036 N  NZ    . LYS G  1 49  ? 144.391 -12.965 173.698 1.00 63.00  ? 49   LYS G NZ    1 
ATOM   5037 N  N     . GLN G  1 50  ? 151.740 -14.997 176.739 1.00 52.18  ? 50   GLN G N     1 
ATOM   5038 C  CA    . GLN G  1 50  ? 152.462 -16.237 176.998 1.00 55.99  ? 50   GLN G CA    1 
ATOM   5039 C  C     . GLN G  1 50  ? 153.728 -16.042 177.813 1.00 53.38  ? 50   GLN G C     1 
ATOM   5040 O  O     . GLN G  1 50  ? 154.218 -16.981 178.442 1.00 53.08  ? 50   GLN G O     1 
ATOM   5041 C  CB    . GLN G  1 50  ? 152.801 -16.942 175.682 1.00 58.39  ? 50   GLN G CB    1 
ATOM   5042 C  CG    . GLN G  1 50  ? 151.586 -17.560 175.001 1.00 66.95  ? 50   GLN G CG    1 
ATOM   5043 C  CD    . GLN G  1 50  ? 151.969 -18.653 174.024 1.00 86.79  ? 50   GLN G CD    1 
ATOM   5044 O  OE1   . GLN G  1 50  ? 153.013 -18.574 173.367 1.00 87.30  ? 50   GLN G OE1   1 
ATOM   5045 N  NE2   . GLN G  1 50  ? 151.132 -19.685 173.925 1.00 91.90  ? 50   GLN G NE2   1 
ATOM   5046 N  N     . HIS G  1 51  ? 154.259 -14.827 177.807 1.00 52.89  ? 51   HIS G N     1 
ATOM   5047 C  CA    . HIS G  1 51  ? 155.492 -14.545 178.531 1.00 53.34  ? 51   HIS G CA    1 
ATOM   5048 C  C     . HIS G  1 51  ? 155.221 -13.674 179.754 1.00 49.20  ? 51   HIS G C     1 
ATOM   5049 O  O     . HIS G  1 51  ? 155.543 -14.039 180.872 1.00 52.79  ? 51   HIS G O     1 
ATOM   5050 C  CB    . HIS G  1 51  ? 156.519 -13.872 177.602 1.00 55.14  ? 51   HIS G CB    1 
ATOM   5051 C  CG    . HIS G  1 51  ? 157.781 -13.450 178.295 1.00 64.11  ? 51   HIS G CG    1 
ATOM   5052 N  ND1   . HIS G  1 51  ? 158.704 -14.352 178.784 1.00 63.79  ? 51   HIS G ND1   1 
ATOM   5053 C  CD2   . HIS G  1 51  ? 158.272 -12.218 178.584 1.00 59.64  ? 51   HIS G CD2   1 
ATOM   5054 C  CE1   . HIS G  1 51  ? 159.712 -13.696 179.336 1.00 61.67  ? 51   HIS G CE1   1 
ATOM   5055 N  NE2   . HIS G  1 51  ? 159.472 -12.399 179.226 1.00 58.93  ? 51   HIS G NE2   1 
ATOM   5056 N  N     . ILE G  1 52  ? 154.608 -12.525 179.539 1.00 46.09  ? 52   ILE G N     1 
ATOM   5057 C  CA    . ILE G  1 52  ? 154.492 -11.556 180.601 1.00 51.11  ? 52   ILE G CA    1 
ATOM   5058 C  C     . ILE G  1 52  ? 153.374 -11.917 181.606 1.00 47.54  ? 52   ILE G C     1 
ATOM   5059 O  O     . ILE G  1 52  ? 153.626 -12.001 182.809 1.00 45.81  ? 52   ILE G O     1 
ATOM   5060 C  CB    . ILE G  1 52  ? 154.275 -10.165 180.020 1.00 45.73  ? 52   ILE G CB    1 
ATOM   5061 C  CG1   . ILE G  1 52  ? 155.448 -9.819  179.092 1.00 46.88  ? 52   ILE G CG1   1 
ATOM   5062 C  CG2   . ILE G  1 52  ? 154.153 -9.133  181.138 1.00 38.53  ? 52   ILE G CG2   1 
ATOM   5063 C  CD1   . ILE G  1 52  ? 155.202 -8.615  178.239 1.00 44.53  ? 52   ILE G CD1   1 
ATOM   5064 N  N     . ALA G  1 53  ? 152.175 -12.175 181.106 1.00 43.78  ? 53   ALA G N     1 
ATOM   5065 C  CA    . ALA G  1 53  ? 151.056 -12.508 181.970 1.00 44.67  ? 53   ALA G CA    1 
ATOM   5066 C  C     . ALA G  1 53  ? 151.338 -13.653 182.972 1.00 47.29  ? 53   ALA G C     1 
ATOM   5067 O  O     . ALA G  1 53  ? 150.977 -13.526 184.147 1.00 48.21  ? 53   ALA G O     1 
ATOM   5068 C  CB    . ALA G  1 53  ? 149.810 -12.822 181.120 1.00 42.67  ? 53   ALA G CB    1 
ATOM   5069 N  N     . PRO G  1 54  ? 151.979 -14.758 182.539 1.00 47.21  ? 54   PRO G N     1 
ATOM   5070 C  CA    . PRO G  1 54  ? 152.190 -15.812 183.551 1.00 41.98  ? 54   PRO G CA    1 
ATOM   5071 C  C     . PRO G  1 54  ? 153.096 -15.397 184.699 1.00 47.64  ? 54   PRO G C     1 
ATOM   5072 O  O     . PRO G  1 54  ? 152.892 -15.849 185.826 1.00 49.05  ? 54   PRO G O     1 
ATOM   5073 C  CB    . PRO G  1 54  ? 152.841 -16.949 182.751 1.00 44.23  ? 54   PRO G CB    1 
ATOM   5074 C  CG    . PRO G  1 54  ? 152.372 -16.725 181.335 1.00 43.10  ? 54   PRO G CG    1 
ATOM   5075 C  CD    . PRO G  1 54  ? 152.283 -15.237 181.173 1.00 48.06  ? 54   PRO G CD    1 
ATOM   5076 N  N     . LEU G  1 55  ? 154.091 -14.564 184.401 1.00 49.85  ? 55   LEU G N     1 
ATOM   5077 C  CA    . LEU G  1 55  ? 154.979 -14.014 185.412 1.00 44.83  ? 55   LEU G CA    1 
ATOM   5078 C  C     . LEU G  1 55  ? 154.227 -13.074 186.356 1.00 45.72  ? 55   LEU G C     1 
ATOM   5079 O  O     . LEU G  1 55  ? 154.471 -13.068 187.556 1.00 46.65  ? 55   LEU G O     1 
ATOM   5080 C  CB    . LEU G  1 55  ? 156.149 -13.271 184.754 1.00 45.60  ? 55   LEU G CB    1 
ATOM   5081 C  CG    . LEU G  1 55  ? 157.239 -14.107 184.073 1.00 51.36  ? 55   LEU G CG    1 
ATOM   5082 C  CD1   . LEU G  1 55  ? 158.078 -13.266 183.117 1.00 44.34  ? 55   LEU G CD1   1 
ATOM   5083 C  CD2   . LEU G  1 55  ? 158.137 -14.741 185.126 1.00 50.17  ? 55   LEU G CD2   1 
ATOM   5084 N  N     . MET G  1 56  ? 153.334 -12.262 185.804 1.00 43.65  ? 56   MET G N     1 
ATOM   5085 C  CA    . MET G  1 56  ? 152.546 -11.335 186.606 1.00 46.20  ? 56   MET G CA    1 
ATOM   5086 C  C     . MET G  1 56  ? 151.585 -12.144 187.483 1.00 51.54  ? 56   MET G C     1 
ATOM   5087 O  O     . MET G  1 56  ? 151.384 -11.820 188.669 1.00 46.06  ? 56   MET G O     1 
ATOM   5088 C  CB    . MET G  1 56  ? 151.775 -10.348 185.719 1.00 46.95  ? 56   MET G CB    1 
ATOM   5089 C  CG    . MET G  1 56  ? 151.012 -9.252  186.482 1.00 38.46  ? 56   MET G CG    1 
ATOM   5090 S  SD    . MET G  1 56  ? 152.037 -8.059  187.385 1.00 44.68  ? 56   MET G SD    1 
ATOM   5091 C  CE    . MET G  1 56  ? 152.442 -6.893  186.091 1.00 42.40  ? 56   MET G CE    1 
ATOM   5092 N  N     . GLN G  1 57  ? 151.021 -13.209 186.906 1.00 44.98  ? 57   GLN G N     1 
ATOM   5093 C  CA    . GLN G  1 57  ? 150.161 -14.110 187.669 1.00 50.60  ? 57   GLN G CA    1 
ATOM   5094 C  C     . GLN G  1 57  ? 150.900 -14.713 188.870 1.00 51.61  ? 57   GLN G C     1 
ATOM   5095 O  O     . GLN G  1 57  ? 150.337 -14.812 189.964 1.00 46.85  ? 57   GLN G O     1 
ATOM   5096 C  CB    . GLN G  1 57  ? 149.616 -15.231 186.791 1.00 45.84  ? 57   GLN G CB    1 
ATOM   5097 C  CG    . GLN G  1 57  ? 148.524 -16.058 187.462 1.00 44.66  ? 57   GLN G CG    1 
ATOM   5098 C  CD    . GLN G  1 57  ? 147.343 -15.207 187.935 1.00 50.78  ? 57   GLN G CD    1 
ATOM   5099 O  OE1   . GLN G  1 57  ? 146.665 -14.549 187.136 1.00 47.42  ? 57   GLN G OE1   1 
ATOM   5100 N  NE2   . GLN G  1 57  ? 147.095 -15.218 189.248 1.00 45.43  ? 57   GLN G NE2   1 
ATOM   5101 N  N     . PHE G  1 58  ? 152.154 -15.108 188.666 1.00 45.99  ? 58   PHE G N     1 
ATOM   5102 C  CA    . PHE G  1 58  ? 152.938 -15.664 189.751 1.00 43.65  ? 58   PHE G CA    1 
ATOM   5103 C  C     . PHE G  1 58  ? 153.058 -14.670 190.874 1.00 46.37  ? 58   PHE G C     1 
ATOM   5104 O  O     . PHE G  1 58  ? 152.939 -15.014 192.051 1.00 43.97  ? 58   PHE G O     1 
ATOM   5105 C  CB    . PHE G  1 58  ? 154.334 -16.055 189.297 1.00 38.65  ? 58   PHE G CB    1 
ATOM   5106 C  CG    . PHE G  1 58  ? 155.271 -16.334 190.431 1.00 37.94  ? 58   PHE G CG    1 
ATOM   5107 C  CD1   . PHE G  1 58  ? 155.109 -17.456 191.223 1.00 42.66  ? 58   PHE G CD1   1 
ATOM   5108 C  CD2   . PHE G  1 58  ? 156.308 -15.474 190.715 1.00 45.60  ? 58   PHE G CD2   1 
ATOM   5109 C  CE1   . PHE G  1 58  ? 155.983 -17.721 192.304 1.00 46.13  ? 58   PHE G CE1   1 
ATOM   5110 C  CE2   . PHE G  1 58  ? 157.188 -15.730 191.778 1.00 53.78  ? 58   PHE G CE2   1 
ATOM   5111 C  CZ    . PHE G  1 58  ? 157.024 -16.855 192.575 1.00 44.89  ? 58   PHE G CZ    1 
ATOM   5112 N  N     . LEU G  1 59  ? 153.317 -13.428 190.499 1.00 46.39  ? 59   LEU G N     1 
ATOM   5113 C  CA    . LEU G  1 59  ? 153.538 -12.401 191.492 1.00 47.31  ? 59   LEU G CA    1 
ATOM   5114 C  C     . LEU G  1 59  ? 152.230 -12.112 192.246 1.00 46.00  ? 59   LEU G C     1 
ATOM   5115 O  O     . LEU G  1 59  ? 152.241 -11.850 193.441 1.00 46.42  ? 59   LEU G O     1 
ATOM   5116 C  CB    . LEU G  1 59  ? 154.093 -11.146 190.835 1.00 44.56  ? 59   LEU G CB    1 
ATOM   5117 C  CG    . LEU G  1 59  ? 154.281 -9.964  191.773 1.00 47.40  ? 59   LEU G CG    1 
ATOM   5118 C  CD1   . LEU G  1 59  ? 155.208 -10.382 192.882 1.00 45.01  ? 59   LEU G CD1   1 
ATOM   5119 C  CD2   . LEU G  1 59  ? 154.842 -8.775  191.019 1.00 46.26  ? 59   LEU G CD2   1 
ATOM   5120 N  N     . ILE G  1 60  ? 151.107 -12.192 191.542 1.00 43.01  ? 60   ILE G N     1 
ATOM   5121 C  CA    . ILE G  1 60  ? 149.805 -11.966 192.144 1.00 45.33  ? 60   ILE G CA    1 
ATOM   5122 C  C     . ILE G  1 60  ? 149.493 -13.056 193.166 1.00 48.32  ? 60   ILE G C     1 
ATOM   5123 O  O     . ILE G  1 60  ? 149.098 -12.758 194.291 1.00 47.30  ? 60   ILE G O     1 
ATOM   5124 C  CB    . ILE G  1 60  ? 148.696 -11.923 191.084 1.00 46.02  ? 60   ILE G CB    1 
ATOM   5125 C  CG1   . ILE G  1 60  ? 148.758 -10.623 190.309 1.00 44.91  ? 60   ILE G CG1   1 
ATOM   5126 C  CG2   . ILE G  1 60  ? 147.332 -11.992 191.733 1.00 45.81  ? 60   ILE G CG2   1 
ATOM   5127 C  CD1   . ILE G  1 60  ? 147.779 -10.584 189.162 1.00 49.92  ? 60   ILE G CD1   1 
ATOM   5128 N  N     . ASP G  1 61  ? 149.675 -14.312 192.762 1.00 49.35  ? 61   ASP G N     1 
ATOM   5129 C  CA    . ASP G  1 61  ? 149.496 -15.446 193.657 1.00 47.19  ? 61   ASP G CA    1 
ATOM   5130 C  C     . ASP G  1 61  ? 150.356 -15.283 194.882 1.00 49.38  ? 61   ASP G C     1 
ATOM   5131 O  O     . ASP G  1 61  ? 149.893 -15.404 196.017 1.00 51.74  ? 61   ASP G O     1 
ATOM   5132 C  CB    . ASP G  1 61  ? 149.839 -16.765 192.965 1.00 44.22  ? 61   ASP G CB    1 
ATOM   5133 C  CG    . ASP G  1 61  ? 149.014 -17.005 191.725 1.00 48.86  ? 61   ASP G CG    1 
ATOM   5134 O  OD1   . ASP G  1 61  ? 148.016 -16.279 191.540 1.00 47.09  ? 61   ASP G OD1   1 
ATOM   5135 O  OD2   . ASP G  1 61  ? 149.348 -17.933 190.949 1.00 45.94  ? 61   ASP G OD2   1 
ATOM   5136 N  N     . GLU G  1 62  ? 151.618 -14.985 194.630 1.00 49.02  ? 62   GLU G N     1 
ATOM   5137 C  CA    . GLU G  1 62  ? 152.620 -14.895 195.668 1.00 46.36  ? 62   GLU G CA    1 
ATOM   5138 C  C     . GLU G  1 62  ? 152.309 -13.796 196.686 1.00 50.13  ? 62   GLU G C     1 
ATOM   5139 O  O     . GLU G  1 62  ? 152.592 -13.932 197.871 1.00 53.45  ? 62   GLU G O     1 
ATOM   5140 C  CB    . GLU G  1 62  ? 153.974 -14.668 195.012 1.00 49.27  ? 62   GLU G CB    1 
ATOM   5141 C  CG    . GLU G  1 62  ? 155.091 -14.425 195.952 1.00 54.12  ? 62   GLU G CG    1 
ATOM   5142 C  CD    . GLU G  1 62  ? 155.350 -15.608 196.840 1.00 59.49  ? 62   GLU G CD    1 
ATOM   5143 O  OE1   . GLU G  1 62  ? 155.277 -16.766 196.356 1.00 61.29  ? 62   GLU G OE1   1 
ATOM   5144 O  OE2   . GLU G  1 62  ? 155.643 -15.364 198.020 1.00 50.46  ? 62   GLU G OE2   1 
ATOM   5145 N  N     . LEU G  1 63  ? 151.703 -12.710 196.228 1.00 51.57  ? 63   LEU G N     1 
ATOM   5146 C  CA    . LEU G  1 63  ? 151.382 -11.593 197.111 1.00 50.77  ? 63   LEU G CA    1 
ATOM   5147 C  C     . LEU G  1 63  ? 149.944 -11.594 197.616 1.00 49.57  ? 63   LEU G C     1 
ATOM   5148 O  O     . LEU G  1 63  ? 149.524 -10.624 198.227 1.00 49.66  ? 63   LEU G O     1 
ATOM   5149 C  CB    . LEU G  1 63  ? 151.639 -10.269 196.392 1.00 45.58  ? 63   LEU G CB    1 
ATOM   5150 C  CG    . LEU G  1 63  ? 153.078 -9.945  196.002 1.00 49.38  ? 63   LEU G CG    1 
ATOM   5151 C  CD1   . LEU G  1 63  ? 153.104 -8.686  195.176 1.00 47.76  ? 63   LEU G CD1   1 
ATOM   5152 C  CD2   . LEU G  1 63  ? 153.901 -9.772  197.248 1.00 50.91  ? 63   LEU G CD2   1 
ATOM   5153 N  N     . ASN G  1 64  ? 149.192 -12.655 197.326 1.00 49.42  ? 64   ASN G N     1 
ATOM   5154 C  CA    . ASN G  1 64  ? 147.754 -12.732 197.630 1.00 52.58  ? 64   ASN G CA    1 
ATOM   5155 C  C     . ASN G  1 64  ? 146.938 -11.541 197.143 1.00 55.10  ? 64   ASN G C     1 
ATOM   5156 O  O     . ASN G  1 64  ? 145.961 -11.153 197.783 1.00 52.28  ? 64   ASN G O     1 
ATOM   5157 C  CB    . ASN G  1 64  ? 147.522 -12.899 199.138 1.00 52.60  ? 64   ASN G CB    1 
ATOM   5158 C  CG    . ASN G  1 64  ? 147.969 -14.237 199.635 1.00 52.37  ? 64   ASN G CG    1 
ATOM   5159 O  OD1   . ASN G  1 64  ? 148.876 -14.329 200.454 1.00 61.40  ? 64   ASN G OD1   1 
ATOM   5160 N  ND2   . ASN G  1 64  ? 147.350 -15.297 199.127 1.00 55.71  ? 64   ASN G ND2   1 
ATOM   5161 N  N     . VAL G  1 65  ? 147.330 -10.973 196.008 1.00 52.64  ? 65   VAL G N     1 
ATOM   5162 C  CA    . VAL G  1 65  ? 146.533 -9.950  195.345 1.00 48.39  ? 65   VAL G CA    1 
ATOM   5163 C  C     . VAL G  1 65  ? 145.312 -10.631 194.737 1.00 50.91  ? 65   VAL G C     1 
ATOM   5164 O  O     . VAL G  1 65  ? 145.442 -11.675 194.115 1.00 51.91  ? 65   VAL G O     1 
ATOM   5165 C  CB    . VAL G  1 65  ? 147.365 -9.220  194.271 1.00 51.14  ? 65   VAL G CB    1 
ATOM   5166 C  CG1   . VAL G  1 65  ? 146.489 -8.389  193.364 1.00 50.40  ? 65   VAL G CG1   1 
ATOM   5167 C  CG2   . VAL G  1 65  ? 148.448 -8.375  194.928 1.00 44.19  ? 65   VAL G CG2   1 
ATOM   5168 N  N     . LYS G  1 66  ? 144.120 -10.080 194.938 1.00 56.11  ? 66   LYS G N     1 
ATOM   5169 C  CA    . LYS G  1 66  ? 142.922 -10.819 194.524 1.00 62.45  ? 66   LYS G CA    1 
ATOM   5170 C  C     . LYS G  1 66  ? 142.476 -10.324 193.146 1.00 63.83  ? 66   LYS G C     1 
ATOM   5171 O  O     . LYS G  1 66  ? 141.649 -10.952 192.477 1.00 68.65  ? 66   LYS G O     1 
ATOM   5172 C  CB    . LYS G  1 66  ? 141.791 -10.689 195.565 1.00 67.83  ? 66   LYS G CB    1 
ATOM   5173 C  CG    . LYS G  1 66  ? 140.409 -11.191 195.080 1.00 80.90  ? 66   LYS G CG    1 
ATOM   5174 C  CD    . LYS G  1 66  ? 139.231 -10.273 195.456 1.00 92.25  ? 66   LYS G CD    1 
ATOM   5175 C  CE    . LYS G  1 66  ? 137.924 -10.728 194.777 1.00 87.19  ? 66   LYS G CE    1 
ATOM   5176 N  NZ    . LYS G  1 66  ? 137.473 -9.770  193.703 1.00 84.20  ? 66   LYS G NZ    1 
ATOM   5177 N  N     . SER G  1 67  ? 143.054 -9.207  192.716 1.00 56.17  ? 67   SER G N     1 
ATOM   5178 C  CA    . SER G  1 67  ? 142.760 -8.653  191.400 1.00 53.48  ? 67   SER G CA    1 
ATOM   5179 C  C     . SER G  1 67  ? 143.074 -9.620  190.263 1.00 51.71  ? 67   SER G C     1 
ATOM   5180 O  O     . SER G  1 67  ? 143.912 -10.499 190.396 1.00 50.53  ? 67   SER G O     1 
ATOM   5181 C  CB    . SER G  1 67  ? 143.530 -7.361  191.198 1.00 51.16  ? 67   SER G CB    1 
ATOM   5182 O  OG    . SER G  1 67  ? 142.908 -6.319  191.919 1.00 54.49  ? 67   SER G OG    1 
ATOM   5183 N  N     . LYS G  1 68  ? 142.380 -9.469  189.148 1.00 48.60  ? 68   LYS G N     1 
ATOM   5184 C  CA    . LYS G  1 68  ? 142.659 -10.321 188.003 1.00 53.42  ? 68   LYS G CA    1 
ATOM   5185 C  C     . LYS G  1 68  ? 143.556 -9.590  187.013 1.00 51.72  ? 68   LYS G C     1 
ATOM   5186 O  O     . LYS G  1 68  ? 143.602 -8.350  186.972 1.00 47.25  ? 68   LYS G O     1 
ATOM   5187 C  CB    . LYS G  1 68  ? 141.373 -10.756 187.298 1.00 56.05  ? 68   LYS G CB    1 
ATOM   5188 C  CG    . LYS G  1 68  ? 140.380 -9.636  187.061 1.00 64.41  ? 68   LYS G CG    1 
ATOM   5189 C  CD    . LYS G  1 68  ? 139.095 -10.166 186.432 1.00 72.82  ? 68   LYS G CD    1 
ATOM   5190 C  CE    . LYS G  1 68  ? 139.361 -10.832 185.085 1.00 74.64  ? 68   LYS G CE    1 
ATOM   5191 N  NZ    . LYS G  1 68  ? 138.116 -11.402 184.453 1.00 86.62  ? 68   LYS G NZ    1 
ATOM   5192 N  N     . ILE G  1 69  ? 144.273 -10.367 186.216 1.00 49.70  ? 69   ILE G N     1 
ATOM   5193 C  CA    . ILE G  1 69  ? 145.010 -9.814  185.097 1.00 41.09  ? 69   ILE G CA    1 
ATOM   5194 C  C     . ILE G  1 69  ? 143.998 -9.471  184.006 1.00 47.14  ? 69   ILE G C     1 
ATOM   5195 O  O     . ILE G  1 69  ? 143.226 -10.323 183.566 1.00 50.84  ? 69   ILE G O     1 
ATOM   5196 C  CB    . ILE G  1 69  ? 146.059 -10.812 184.590 1.00 45.38  ? 69   ILE G CB    1 
ATOM   5197 C  CG1   . ILE G  1 69  ? 147.134 -11.030 185.662 1.00 42.90  ? 69   ILE G CG1   1 
ATOM   5198 C  CG2   . ILE G  1 69  ? 146.667 -10.351 183.246 1.00 42.24  ? 69   ILE G CG2   1 
ATOM   5199 C  CD1   . ILE G  1 69  ? 148.192 -12.063 185.292 1.00 47.10  ? 69   ILE G CD1   1 
ATOM   5200 N  N     . GLN G  1 70  ? 143.958 -8.216  183.593 1.00 44.17  ? 70   GLN G N     1 
ATOM   5201 C  CA    . GLN G  1 70  ? 143.138 -7.865  182.444 1.00 44.17  ? 70   GLN G CA    1 
ATOM   5202 C  C     . GLN G  1 70  ? 144.017 -7.655  181.227 1.00 44.73  ? 70   GLN G C     1 
ATOM   5203 O  O     . GLN G  1 70  ? 145.095 -7.061  181.329 1.00 43.41  ? 70   GLN G O     1 
ATOM   5204 C  CB    . GLN G  1 70  ? 142.327 -6.599  182.700 1.00 45.37  ? 70   GLN G CB    1 
ATOM   5205 C  CG    . GLN G  1 70  ? 141.403 -6.639  183.912 1.00 43.03  ? 70   GLN G CG    1 
ATOM   5206 C  CD    . GLN G  1 70  ? 140.696 -5.326  184.068 1.00 46.31  ? 70   GLN G CD    1 
ATOM   5207 O  OE1   . GLN G  1 70  ? 139.871 -4.964  183.231 1.00 50.87  ? 70   GLN G OE1   1 
ATOM   5208 N  NE2   . GLN G  1 70  ? 141.043 -4.575  185.115 1.00 40.06  ? 70   GLN G NE2   1 
ATOM   5209 N  N     . ILE G  1 71  ? 143.547 -8.137  180.078 1.00 50.22  ? 71   ILE G N     1 
ATOM   5210 C  CA    . ILE G  1 71  ? 144.208 -7.894  178.800 1.00 44.26  ? 71   ILE G CA    1 
ATOM   5211 C  C     . ILE G  1 71  ? 143.210 -7.195  177.889 1.00 49.43  ? 71   ILE G C     1 
ATOM   5212 O  O     . ILE G  1 71  ? 142.231 -7.794  177.429 1.00 53.37  ? 71   ILE G O     1 
ATOM   5213 C  CB    . ILE G  1 71  ? 144.754 -9.204  178.166 1.00 47.09  ? 71   ILE G CB    1 
ATOM   5214 C  CG1   . ILE G  1 71  ? 145.879 -9.769  179.046 1.00 45.35  ? 71   ILE G CG1   1 
ATOM   5215 C  CG2   . ILE G  1 71  ? 145.286 -8.941  176.749 1.00 52.21  ? 71   ILE G CG2   1 
ATOM   5216 C  CD1   . ILE G  1 71  ? 146.104 -11.245 178.926 1.00 51.87  ? 71   ILE G CD1   1 
ATOM   5217 N  N     . VAL G  1 72  ? 143.446 -5.902  177.674 1.00 46.45  ? 72   VAL G N     1 
ATOM   5218 C  CA    . VAL G  1 72  ? 142.561 -5.072  176.877 1.00 46.01  ? 72   VAL G CA    1 
ATOM   5219 C  C     . VAL G  1 72  ? 143.181 -4.861  175.490 1.00 59.05  ? 72   VAL G C     1 
ATOM   5220 O  O     . VAL G  1 72  ? 144.342 -4.446  175.372 1.00 53.94  ? 72   VAL G O     1 
ATOM   5221 C  CB    . VAL G  1 72  ? 142.308 -3.723  177.567 1.00 50.10  ? 72   VAL G CB    1 
ATOM   5222 C  CG1   . VAL G  1 72  ? 141.406 -2.834  176.722 1.00 50.82  ? 72   VAL G CG1   1 
ATOM   5223 C  CG2   . VAL G  1 72  ? 141.699 -3.946  178.964 1.00 51.99  ? 72   VAL G CG2   1 
ATOM   5224 N  N     . LYS G  1 73  ? 142.417 -5.170  174.443 1.00 60.45  ? 73   LYS G N     1 
ATOM   5225 C  CA    . LYS G  1 73  ? 142.921 -5.044  173.082 1.00 59.31  ? 73   LYS G CA    1 
ATOM   5226 C  C     . LYS G  1 73  ? 142.609 -3.671  172.522 1.00 57.44  ? 73   LYS G C     1 
ATOM   5227 O  O     . LYS G  1 73  ? 141.457 -3.374  172.220 1.00 61.19  ? 73   LYS G O     1 
ATOM   5228 C  CB    . LYS G  1 73  ? 142.332 -6.123  172.170 1.00 63.25  ? 73   LYS G CB    1 
ATOM   5229 C  CG    . LYS G  1 73  ? 142.936 -6.127  170.753 1.00 61.19  ? 73   LYS G CG    1 
ATOM   5230 C  CD    . LYS G  1 73  ? 141.848 -6.093  169.691 1.00 71.82  ? 73   LYS G CD    1 
ATOM   5231 C  CE    . LYS G  1 73  ? 142.442 -6.144  168.288 1.00 72.34  ? 73   LYS G CE    1 
ATOM   5232 N  NZ    . LYS G  1 73  ? 143.302 -7.348  168.114 1.00 74.42  ? 73   LYS G NZ    1 
ATOM   5233 N  N     . GLY G  1 74  ? 143.637 -2.835  172.404 1.00 54.57  ? 74   GLY G N     1 
ATOM   5234 C  CA    . GLY G  1 74  ? 143.509 -1.548  171.744 1.00 55.99  ? 74   GLY G CA    1 
ATOM   5235 C  C     . GLY G  1 74  ? 143.901 -1.705  170.286 1.00 61.79  ? 74   GLY G C     1 
ATOM   5236 O  O     . GLY G  1 74  ? 144.362 -2.777  169.870 1.00 62.10  ? 74   GLY G O     1 
ATOM   5237 N  N     . ASP G  1 75  ? 143.735 -0.658  169.491 1.00 61.63  ? 75   ASP G N     1 
ATOM   5238 C  CA    . ASP G  1 75  ? 143.990 -0.821  168.059 1.00 69.16  ? 75   ASP G CA    1 
ATOM   5239 C  C     . ASP G  1 75  ? 145.472 -1.003  167.732 1.00 70.90  ? 75   ASP G C     1 
ATOM   5240 O  O     . ASP G  1 75  ? 145.836 -1.800  166.858 1.00 65.77  ? 75   ASP G O     1 
ATOM   5241 C  CB    . ASP G  1 75  ? 143.421 0.359   167.279 1.00 68.26  ? 75   ASP G CB    1 
ATOM   5242 C  CG    . ASP G  1 75  ? 141.973 0.139   166.883 1.00 78.40  ? 75   ASP G CG    1 
ATOM   5243 O  OD1   . ASP G  1 75  ? 141.564 -1.036  166.733 1.00 77.87  ? 75   ASP G OD1   1 
ATOM   5244 O  OD2   . ASP G  1 75  ? 141.249 1.140   166.715 1.00 83.60  ? 75   ASP G OD2   1 
ATOM   5245 N  N     . THR G  1 76  ? 146.327 -0.287  168.451 0.88 64.85  ? 76   THR G N     1 
ATOM   5246 C  CA    . THR G  1 76  ? 147.737 -0.291  168.124 0.88 59.10  ? 76   THR G CA    1 
ATOM   5247 C  C     . THR G  1 76  ? 148.558 -1.145  169.078 0.88 54.03  ? 76   THR G C     1 
ATOM   5248 O  O     . THR G  1 76  ? 149.765 -1.259  168.907 0.88 54.22  ? 76   THR G O     1 
ATOM   5249 C  CB    . THR G  1 76  ? 148.300 1.140   168.109 0.88 56.74  ? 76   THR G CB    1 
ATOM   5250 O  OG1   . THR G  1 76  ? 148.291 1.678   169.433 1.00 59.71  ? 76   THR G OG1   1 
ATOM   5251 C  CG2   . THR G  1 76  ? 147.455 2.029   167.211 1.00 52.96  ? 76   THR G CG2   1 
ATOM   5252 N  N     . ARG G  1 77  ? 147.901 -1.778  170.049 1.00 56.22  ? 77   ARG G N     1 
ATOM   5253 C  CA    . ARG G  1 77  ? 148.608 -2.440  171.146 1.00 54.98  ? 77   ARG G CA    1 
ATOM   5254 C  C     . ARG G  1 77  ? 147.679 -3.187  172.118 1.00 54.08  ? 77   ARG G C     1 
ATOM   5255 O  O     . ARG G  1 77  ? 146.530 -2.791  172.322 1.00 49.60  ? 77   ARG G O     1 
ATOM   5256 C  CB    . ARG G  1 77  ? 149.406 -1.401  171.929 1.00 53.95  ? 77   ARG G CB    1 
ATOM   5257 C  CG    . ARG G  1 77  ? 148.540 -0.203  172.316 1.00 51.24  ? 77   ARG G CG    1 
ATOM   5258 C  CD    . ARG G  1 77  ? 148.913 0.212   173.681 1.00 49.57  ? 77   ARG G CD    1 
ATOM   5259 N  NE    . ARG G  1 77  ? 147.937 1.020   174.408 1.00 54.75  ? 77   ARG G NE    1 
ATOM   5260 C  CZ    . ARG G  1 77  ? 146.748 0.591   174.829 1.00 51.53  ? 77   ARG G CZ    1 
ATOM   5261 N  NH1   . ARG G  1 77  ? 146.312 -0.626  174.510 1.00 46.86  ? 77   ARG G NH1   1 
ATOM   5262 N  NH2   . ARG G  1 77  ? 145.978 1.409   175.543 1.00 51.10  ? 77   ARG G NH2   1 
ATOM   5263 N  N     . TYR G  1 78  ? 148.196 -4.262  172.710 0.95 49.14  ? 78   TYR G N     1 
ATOM   5264 C  CA    . TYR G  1 78  ? 147.551 -4.921  173.839 0.95 53.10  ? 78   TYR G CA    1 
ATOM   5265 C  C     . TYR G  1 78  ? 147.977 -4.296  175.161 0.95 51.31  ? 78   TYR G C     1 
ATOM   5266 O  O     . TYR G  1 78  ? 149.164 -4.092  175.393 0.95 44.61  ? 78   TYR G O     1 
ATOM   5267 C  CB    . TYR G  1 78  ? 147.885 -6.410  173.862 0.95 52.76  ? 78   TYR G CB    1 
ATOM   5268 C  CG    . TYR G  1 78  ? 147.156 -7.185  172.803 0.95 63.41  ? 78   TYR G CG    1 
ATOM   5269 C  CD1   . TYR G  1 78  ? 145.891 -7.705  173.051 1.00 56.57  ? 78   TYR G CD1   1 
ATOM   5270 C  CD2   . TYR G  1 78  ? 147.722 -7.385  171.543 1.00 63.36  ? 78   TYR G CD2   1 
ATOM   5271 C  CE1   . TYR G  1 78  ? 145.203 -8.407  172.082 1.00 68.22  ? 78   TYR G CE1   1 
ATOM   5272 C  CE2   . TYR G  1 78  ? 147.039 -8.089  170.562 1.00 67.50  ? 78   TYR G CE2   1 
ATOM   5273 C  CZ    . TYR G  1 78  ? 145.776 -8.599  170.837 0.95 73.06  ? 78   TYR G CZ    1 
ATOM   5274 O  OH    . TYR G  1 78  ? 145.078 -9.305  169.875 0.95 77.82  ? 78   TYR G OH    1 
ATOM   5275 N  N     . GLU G  1 79  ? 147.009 -4.009  176.030 1.00 52.14  ? 79   GLU G N     1 
ATOM   5276 C  CA    . GLU G  1 79  ? 147.308 -3.542  177.376 1.00 44.07  ? 79   GLU G CA    1 
ATOM   5277 C  C     . GLU G  1 79  ? 147.062 -4.639  178.422 1.00 49.80  ? 79   GLU G C     1 
ATOM   5278 O  O     . GLU G  1 79  ? 145.915 -5.108  178.616 1.00 45.47  ? 79   GLU G O     1 
ATOM   5279 C  CB    . GLU G  1 79  ? 146.472 -2.303  177.713 1.00 47.25  ? 79   GLU G CB    1 
ATOM   5280 C  CG    . GLU G  1 79  ? 146.744 -1.754  179.134 1.00 48.57  ? 79   GLU G CG    1 
ATOM   5281 C  CD    . GLU G  1 79  ? 145.644 -0.837  179.673 1.00 50.04  ? 79   GLU G CD    1 
ATOM   5282 O  OE1   . GLU G  1 79  ? 144.820 -0.327  178.892 1.00 51.04  ? 79   GLU G OE1   1 
ATOM   5283 O  OE2   . GLU G  1 79  ? 145.604 -0.618  180.903 1.00 51.15  ? 79   GLU G OE2   1 
ATOM   5284 N  N     . LEU G  1 80  ? 148.137 -5.052  179.090 1.00 48.57  ? 80   LEU G N     1 
ATOM   5285 C  CA    . LEU G  1 80  ? 148.007 -5.865  180.300 1.00 45.84  ? 80   LEU G CA    1 
ATOM   5286 C  C     . LEU G  1 80  ? 147.815 -4.946  181.501 1.00 45.70  ? 80   LEU G C     1 
ATOM   5287 O  O     . LEU G  1 80  ? 148.595 -4.027  181.719 1.00 43.10  ? 80   LEU G O     1 
ATOM   5288 C  CB    . LEU G  1 80  ? 149.222 -6.772  180.517 1.00 44.53  ? 80   LEU G CB    1 
ATOM   5289 C  CG    . LEU G  1 80  ? 149.148 -7.722  181.728 1.00 48.72  ? 80   LEU G CG    1 
ATOM   5290 C  CD1   . LEU G  1 80  ? 149.780 -9.065  181.429 1.00 47.52  ? 80   LEU G CD1   1 
ATOM   5291 C  CD2   . LEU G  1 80  ? 149.797 -7.129  182.981 1.00 43.34  ? 80   LEU G CD2   1 
ATOM   5292 N  N     . ARG G  1 81  ? 146.772 -5.199  182.281 1.00 44.95  ? 81   ARG G N     1 
ATOM   5293 C  CA    . ARG G  1 81  ? 146.428 -4.308  183.388 1.00 41.65  ? 81   ARG G CA    1 
ATOM   5294 C  C     . ARG G  1 81  ? 145.951 -5.065  184.628 1.00 45.25  ? 81   ARG G C     1 
ATOM   5295 O  O     . ARG G  1 81  ? 145.088 -5.951  184.557 1.00 40.69  ? 81   ARG G O     1 
ATOM   5296 C  CB    . ARG G  1 81  ? 145.352 -3.313  182.956 1.00 44.95  ? 81   ARG G CB    1 
ATOM   5297 C  CG    . ARG G  1 81  ? 144.737 -2.502  184.100 1.00 45.65  ? 81   ARG G CG    1 
ATOM   5298 C  CD    . ARG G  1 81  ? 143.338 -2.061  183.745 1.00 42.00  ? 81   ARG G CD    1 
ATOM   5299 N  NE    . ARG G  1 81  ? 143.351 -1.321  182.487 1.00 47.95  ? 81   ARG G NE    1 
ATOM   5300 C  CZ    . ARG G  1 81  ? 142.267 -0.915  181.823 1.00 51.54  ? 81   ARG G CZ    1 
ATOM   5301 N  NH1   . ARG G  1 81  ? 141.037 -1.173  182.289 1.00 42.06  ? 81   ARG G NH1   1 
ATOM   5302 N  NH2   . ARG G  1 81  ? 142.421 -0.254  180.678 1.00 48.13  ? 81   ARG G NH2   1 
ATOM   5303 N  N     . VAL G  1 82  ? 146.546 -4.707  185.758 1.00 41.84  ? 82   VAL G N     1 
ATOM   5304 C  CA    . VAL G  1 82  ? 146.103 -5.193  187.055 1.00 44.70  ? 82   VAL G CA    1 
ATOM   5305 C  C     . VAL G  1 82  ? 145.593 -4.012  187.869 1.00 43.91  ? 82   VAL G C     1 
ATOM   5306 O  O     . VAL G  1 82  ? 146.357 -3.084  188.192 1.00 41.15  ? 82   VAL G O     1 
ATOM   5307 C  CB    . VAL G  1 82  ? 147.221 -5.912  187.815 1.00 45.88  ? 82   VAL G CB    1 
ATOM   5308 C  CG1   . VAL G  1 82  ? 146.658 -6.536  189.082 1.00 43.51  ? 82   VAL G CG1   1 
ATOM   5309 C  CG2   . VAL G  1 82  ? 147.861 -6.983  186.918 1.00 39.33  ? 82   VAL G CG2   1 
ATOM   5310 N  N     . SER G  1 83  ? 144.290 -4.022  188.137 1.00 38.41  ? 83   SER G N     1 
ATOM   5311 C  CA    . SER G  1 83  ? 143.661 -2.978  188.927 1.00 41.07  ? 83   SER G CA    1 
ATOM   5312 C  C     . SER G  1 83  ? 143.786 -3.356  190.400 1.00 42.31  ? 83   SER G C     1 
ATOM   5313 O  O     . SER G  1 83  ? 143.027 -4.180  190.883 1.00 41.03  ? 83   SER G O     1 
ATOM   5314 C  CB    . SER G  1 83  ? 142.196 -2.810  188.519 1.00 43.09  ? 83   SER G CB    1 
ATOM   5315 O  OG    . SER G  1 83  ? 141.636 -1.643  189.095 1.00 45.10  ? 83   SER G OG    1 
ATOM   5316 N  N     . SER G  1 84  ? 144.771 -2.794  191.094 1.00 41.12  ? 84   SER G N     1 
ATOM   5317 C  CA    . SER G  1 84  ? 145.060 -3.225  192.460 1.00 41.01  ? 84   SER G CA    1 
ATOM   5318 C  C     . SER G  1 84  ? 145.918 -2.249  193.244 1.00 42.28  ? 84   SER G C     1 
ATOM   5319 O  O     . SER G  1 84  ? 147.118 -2.092  192.963 1.00 38.50  ? 84   SER G O     1 
ATOM   5320 C  CB    . SER G  1 84  ? 145.754 -4.581  192.464 1.00 38.59  ? 84   SER G CB    1 
ATOM   5321 O  OG    . SER G  1 84  ? 146.420 -4.769  193.703 1.00 38.17  ? 84   SER G OG    1 
ATOM   5322 N  N     . LYS G  1 85  ? 145.306 -1.619  194.245 1.00 38.37  ? 85   LYS G N     1 
ATOM   5323 C  CA    . LYS G  1 85  ? 146.025 -0.698  195.125 1.00 39.69  ? 85   LYS G CA    1 
ATOM   5324 C  C     . LYS G  1 85  ? 147.281 -1.358  195.700 1.00 39.48  ? 85   LYS G C     1 
ATOM   5325 O  O     . LYS G  1 85  ? 148.349 -0.751  195.745 1.00 39.61  ? 85   LYS G O     1 
ATOM   5326 C  CB    . LYS G  1 85  ? 145.109 -0.218  196.249 1.00 41.93  ? 85   LYS G CB    1 
ATOM   5327 C  CG    . LYS G  1 85  ? 145.664 0.898   197.109 1.00 42.08  ? 85   LYS G CG    1 
ATOM   5328 C  CD    . LYS G  1 85  ? 144.663 1.285   198.240 1.00 42.27  ? 85   LYS G CD    1 
ATOM   5329 C  CE    . LYS G  1 85  ? 145.190 2.469   199.051 1.00 40.55  ? 85   LYS G CE    1 
ATOM   5330 N  NZ    . LYS G  1 85  ? 144.227 2.996   200.055 1.00 39.21  ? 85   LYS G NZ    1 
ATOM   5331 N  N     . LYS G  1 86  ? 147.145 -2.614  196.104 1.00 36.98  ? 86   LYS G N     1 
ATOM   5332 C  CA    . LYS G  1 86  ? 148.243 -3.348  196.715 1.00 40.75  ? 86   LYS G CA    1 
ATOM   5333 C  C     . LYS G  1 86  ? 149.428 -3.563  195.743 1.00 38.63  ? 86   LYS G C     1 
ATOM   5334 O  O     . LYS G  1 86  ? 150.601 -3.300  196.070 1.00 35.17  ? 86   LYS G O     1 
ATOM   5335 C  CB    . LYS G  1 86  ? 147.731 -4.696  197.222 1.00 34.94  ? 86   LYS G CB    1 
ATOM   5336 C  CG    . LYS G  1 86  ? 148.708 -5.431  198.094 1.00 43.72  ? 86   LYS G CG    1 
ATOM   5337 C  CD    . LYS G  1 86  ? 148.168 -6.796  198.497 1.00 42.21  ? 86   LYS G CD    1 
ATOM   5338 C  CE    . LYS G  1 86  ? 149.208 -7.522  199.324 1.00 49.34  ? 86   LYS G CE    1 
ATOM   5339 N  NZ    . LYS G  1 86  ? 148.755 -8.852  199.769 1.00 56.40  ? 86   LYS G NZ    1 
ATOM   5340 N  N     . LEU G  1 87  ? 149.112 -4.066  194.559 1.00 38.87  ? 87   LEU G N     1 
ATOM   5341 C  CA    . LEU G  1 87  ? 150.139 -4.294  193.539 1.00 40.10  ? 87   LEU G CA    1 
ATOM   5342 C  C     . LEU G  1 87  ? 150.753 -2.964  193.110 1.00 33.75  ? 87   LEU G C     1 
ATOM   5343 O  O     . LEU G  1 87  ? 151.962 -2.856  192.905 1.00 37.27  ? 87   LEU G O     1 
ATOM   5344 C  CB    . LEU G  1 87  ? 149.552 -5.039  192.331 1.00 42.37  ? 87   LEU G CB    1 
ATOM   5345 C  CG    . LEU G  1 87  ? 150.670 -5.625  191.464 1.00 41.87  ? 87   LEU G CG    1 
ATOM   5346 C  CD1   . LEU G  1 87  ? 151.481 -6.599  192.309 1.00 41.05  ? 87   LEU G CD1   1 
ATOM   5347 C  CD2   . LEU G  1 87  ? 150.123 -6.279  190.220 1.00 36.48  ? 87   LEU G CD2   1 
ATOM   5348 N  N     . TYR G  1 88  ? 149.911 -1.945  193.023 1.00 35.18  ? 88   TYR G N     1 
ATOM   5349 C  CA    . TYR G  1 88  ? 150.366 -0.605  192.707 1.00 33.70  ? 88   TYR G CA    1 
ATOM   5350 C  C     . TYR G  1 88  ? 151.461 -0.158  193.683 1.00 39.66  ? 88   TYR G C     1 
ATOM   5351 O  O     . TYR G  1 88  ? 152.581 0.163   193.256 1.00 39.40  ? 88   TYR G O     1 
ATOM   5352 C  CB    . TYR G  1 88  ? 149.176 0.379   192.691 1.00 34.54  ? 88   TYR G CB    1 
ATOM   5353 C  CG    . TYR G  1 88  ? 149.609 1.827   192.569 1.00 41.31  ? 88   TYR G CG    1 
ATOM   5354 C  CD1   . TYR G  1 88  ? 149.931 2.578   193.713 1.00 44.44  ? 88   TYR G CD1   1 
ATOM   5355 C  CD2   . TYR G  1 88  ? 149.718 2.447   191.318 1.00 38.89  ? 88   TYR G CD2   1 
ATOM   5356 C  CE1   . TYR G  1 88  ? 150.352 3.892   193.624 1.00 43.00  ? 88   TYR G CE1   1 
ATOM   5357 C  CE2   . TYR G  1 88  ? 150.142 3.778   191.211 1.00 39.43  ? 88   TYR G CE2   1 
ATOM   5358 C  CZ    . TYR G  1 88  ? 150.462 4.487   192.373 1.00 44.01  ? 88   TYR G CZ    1 
ATOM   5359 O  OH    . TYR G  1 88  ? 150.876 5.794   192.317 1.00 47.27  ? 88   TYR G OH    1 
ATOM   5360 N  N     . TYR G  1 89  ? 151.178 -0.172  194.988 0.99 35.04  ? 89   TYR G N     1 
ATOM   5361 C  CA    . TYR G  1 89  ? 152.163 0.325   195.952 0.99 38.27  ? 89   TYR G CA    1 
ATOM   5362 C  C     . TYR G  1 89  ? 153.380 -0.586  196.034 0.99 37.10  ? 89   TYR G C     1 
ATOM   5363 O  O     . TYR G  1 89  ? 154.505 -0.111  196.175 0.99 39.10  ? 89   TYR G O     1 
ATOM   5364 C  CB    . TYR G  1 89  ? 151.531 0.532   197.350 0.99 38.37  ? 89   TYR G CB    1 
ATOM   5365 C  CG    . TYR G  1 89  ? 150.868 1.884   197.416 0.99 41.44  ? 89   TYR G CG    1 
ATOM   5366 C  CD1   . TYR G  1 89  ? 151.646 3.041   197.367 1.00 36.36  ? 89   TYR G CD1   1 
ATOM   5367 C  CD2   . TYR G  1 89  ? 149.463 2.020   197.466 1.00 38.09  ? 89   TYR G CD2   1 
ATOM   5368 C  CE1   . TYR G  1 89  ? 151.067 4.290   197.392 1.00 38.95  ? 89   TYR G CE1   1 
ATOM   5369 C  CE2   . TYR G  1 89  ? 148.867 3.285   197.484 1.00 35.02  ? 89   TYR G CE2   1 
ATOM   5370 C  CZ    . TYR G  1 89  ? 149.688 4.412   197.450 0.99 43.10  ? 89   TYR G CZ    1 
ATOM   5371 O  OH    . TYR G  1 89  ? 149.175 5.682   197.460 0.99 47.79  ? 89   TYR G OH    1 
ATOM   5372 N  N     . TYR G  1 90  ? 153.151 -1.884  195.929 1.00 34.19  ? 90   TYR G N     1 
ATOM   5373 C  CA    . TYR G  1 90  ? 154.255 -2.816  195.794 1.00 37.13  ? 90   TYR G CA    1 
ATOM   5374 C  C     . TYR G  1 90  ? 155.288 -2.330  194.757 1.00 39.70  ? 90   TYR G C     1 
ATOM   5375 O  O     . TYR G  1 90  ? 156.440 -2.106  195.118 1.00 42.75  ? 90   TYR G O     1 
ATOM   5376 C  CB    . TYR G  1 90  ? 153.731 -4.199  195.415 1.00 36.38  ? 90   TYR G CB    1 
ATOM   5377 C  CG    . TYR G  1 90  ? 154.822 -5.224  195.261 1.00 46.09  ? 90   TYR G CG    1 
ATOM   5378 C  CD1   . TYR G  1 90  ? 155.409 -5.828  196.381 1.00 43.20  ? 90   TYR G CD1   1 
ATOM   5379 C  CD2   . TYR G  1 90  ? 155.284 -5.588  193.988 1.00 45.76  ? 90   TYR G CD2   1 
ATOM   5380 C  CE1   . TYR G  1 90  ? 156.421 -6.776  196.232 1.00 43.66  ? 90   TYR G CE1   1 
ATOM   5381 C  CE2   . TYR G  1 90  ? 156.281 -6.525  193.833 1.00 44.93  ? 90   TYR G CE2   1 
ATOM   5382 C  CZ    . TYR G  1 90  ? 156.852 -7.116  194.947 1.00 46.33  ? 90   TYR G CZ    1 
ATOM   5383 O  OH    . TYR G  1 90  ? 157.854 -8.043  194.762 1.00 45.50  ? 90   TYR G OH    1 
ATOM   5384 N  N     . PHE G  1 91  ? 154.883 -2.110  193.499 1.00 37.24  ? 91   PHE G N     1 
ATOM   5385 C  CA    . PHE G  1 91  ? 155.844 -1.643  192.481 1.00 39.24  ? 91   PHE G CA    1 
ATOM   5386 C  C     . PHE G  1 91  ? 156.301 -0.210  192.734 1.00 40.39  ? 91   PHE G C     1 
ATOM   5387 O  O     . PHE G  1 91  ? 157.488 0.104   192.580 1.00 43.27  ? 91   PHE G O     1 
ATOM   5388 C  CB    . PHE G  1 91  ? 155.265 -1.741  191.057 1.00 38.49  ? 91   PHE G CB    1 
ATOM   5389 C  CG    . PHE G  1 91  ? 155.187 -3.141  190.537 1.00 34.79  ? 91   PHE G CG    1 
ATOM   5390 C  CD1   . PHE G  1 91  ? 156.344 -3.876  190.333 1.00 38.71  ? 91   PHE G CD1   1 
ATOM   5391 C  CD2   . PHE G  1 91  ? 153.969 -3.724  190.265 1.00 35.38  ? 91   PHE G CD2   1 
ATOM   5392 C  CE1   . PHE G  1 91  ? 156.284 -5.173  189.859 1.00 34.94  ? 91   PHE G CE1   1 
ATOM   5393 C  CE2   . PHE G  1 91  ? 153.890 -5.011  189.795 1.00 34.86  ? 91   PHE G CE2   1 
ATOM   5394 C  CZ    . PHE G  1 91  ? 155.050 -5.737  189.583 1.00 36.33  ? 91   PHE G CZ    1 
ATOM   5395 N  N     . ALA G  1 92  ? 155.372 0.663   193.121 1.00 40.28  ? 92   ALA G N     1 
ATOM   5396 C  CA    . ALA G  1 92  ? 155.739 2.061   193.342 1.00 40.84  ? 92   ALA G CA    1 
ATOM   5397 C  C     . ALA G  1 92  ? 156.789 2.191   194.463 1.00 44.24  ? 92   ALA G C     1 
ATOM   5398 O  O     . ALA G  1 92  ? 157.739 2.964   194.338 1.00 45.02  ? 92   ALA G O     1 
ATOM   5399 C  CB    . ALA G  1 92  ? 154.525 2.881   193.654 1.00 39.07  ? 92   ALA G CB    1 
ATOM   5400 N  N     . ASN G  1 93  ? 156.633 1.414   195.538 1.00 41.73  ? 93   ASN G N     1 
ATOM   5401 C  CA    . ASN G  1 93  ? 157.596 1.457   196.637 1.00 43.52  ? 93   ASN G CA    1 
ATOM   5402 C  C     . ASN G  1 93  ? 158.919 0.836   196.195 1.00 43.61  ? 93   ASN G C     1 
ATOM   5403 O  O     . ASN G  1 93  ? 160.003 1.250   196.624 1.00 42.74  ? 93   ASN G O     1 
ATOM   5404 C  CB    . ASN G  1 93  ? 157.047 0.746   197.888 1.00 36.01  ? 93   ASN G CB    1 
ATOM   5405 C  CG    . ASN G  1 93  ? 155.961 1.559   198.595 1.00 38.01  ? 93   ASN G CG    1 
ATOM   5406 O  OD1   . ASN G  1 93  ? 155.945 2.784   198.529 1.00 42.31  ? 93   ASN G OD1   1 
ATOM   5407 N  ND2   . ASN G  1 93  ? 155.044 0.878   199.247 1.00 35.69  ? 93   ASN G ND2   1 
ATOM   5408 N  N     . MET G  1 94  ? 158.827 -0.156  195.323 1.00 42.20  ? 94   MET G N     1 
ATOM   5409 C  CA    . MET G  1 94  ? 160.026 -0.764  194.794 1.00 42.45  ? 94   MET G CA    1 
ATOM   5410 C  C     . MET G  1 94  ? 160.757 0.234   193.871 1.00 41.49  ? 94   MET G C     1 
ATOM   5411 O  O     . MET G  1 94  ? 161.978 0.315   193.890 1.00 40.04  ? 94   MET G O     1 
ATOM   5412 C  CB    . MET G  1 94  ? 159.674 -2.062  194.082 1.00 44.32  ? 94   MET G CB    1 
ATOM   5413 C  CG    . MET G  1 94  ? 160.853 -2.764  193.461 1.00 44.41  ? 94   MET G CG    1 
ATOM   5414 S  SD    . MET G  1 94  ? 160.374 -4.357  192.785 1.00 49.78  ? 94   MET G SD    1 
ATOM   5415 C  CE    . MET G  1 94  ? 161.999 -5.121  192.654 1.00 53.14  ? 94   MET G CE    1 
ATOM   5416 N  N     . LEU G  1 95  ? 160.008 1.028   193.113 1.00 40.56  ? 95   LEU G N     1 
ATOM   5417 C  CA    . LEU G  1 95  ? 160.611 2.032   192.227 1.00 44.09  ? 95   LEU G CA    1 
ATOM   5418 C  C     . LEU G  1 95  ? 161.356 3.107   193.010 1.00 46.98  ? 95   LEU G C     1 
ATOM   5419 O  O     . LEU G  1 95  ? 162.430 3.558   192.592 1.00 47.00  ? 95   LEU G O     1 
ATOM   5420 C  CB    . LEU G  1 95  ? 159.545 2.693   191.342 1.00 40.72  ? 95   LEU G CB    1 
ATOM   5421 C  CG    . LEU G  1 95  ? 160.026 3.815   190.412 1.00 46.93  ? 95   LEU G CG    1 
ATOM   5422 C  CD1   . LEU G  1 95  ? 161.156 3.338   189.509 1.00 45.55  ? 95   LEU G CD1   1 
ATOM   5423 C  CD2   . LEU G  1 95  ? 158.887 4.338   189.573 1.00 44.43  ? 95   LEU G CD2   1 
ATOM   5424 N  N     . GLU G  1 96  ? 160.758 3.533   194.127 1.00 44.75  ? 96   GLU G N     1 
ATOM   5425 C  CA    . GLU G  1 96  ? 161.376 4.472   195.059 1.00 46.05  ? 96   GLU G CA    1 
ATOM   5426 C  C     . GLU G  1 96  ? 162.713 3.981   195.567 1.00 47.28  ? 96   GLU G C     1 
ATOM   5427 O  O     . GLU G  1 96  ? 163.615 4.777   195.814 1.00 48.80  ? 96   GLU G O     1 
ATOM   5428 C  CB    . GLU G  1 96  ? 160.477 4.719   196.273 1.00 54.17  ? 96   GLU G CB    1 
ATOM   5429 C  CG    . GLU G  1 96  ? 159.129 5.319   195.970 1.00 55.91  ? 96   GLU G CG    1 
ATOM   5430 C  CD    . GLU G  1 96  ? 158.616 6.121   197.139 1.00 74.30  ? 96   GLU G CD    1 
ATOM   5431 O  OE1   . GLU G  1 96  ? 159.410 6.935   197.666 1.00 80.78  ? 96   GLU G OE1   1 
ATOM   5432 O  OE2   . GLU G  1 96  ? 157.437 5.933   197.535 1.00 76.31  ? 96   GLU G OE2   1 
ATOM   5433 N  N     . ARG G  1 97  ? 162.828 2.669   195.747 1.00 45.27  ? 97   ARG G N     1 
ATOM   5434 C  CA    . ARG G  1 97  ? 164.045 2.070   196.284 1.00 45.77  ? 97   ARG G CA    1 
ATOM   5435 C  C     . ARG G  1 97  ? 165.022 1.595   195.216 1.00 47.18  ? 97   ARG G C     1 
ATOM   5436 O  O     . ARG G  1 97  ? 165.925 0.810   195.511 1.00 46.50  ? 97   ARG G O     1 
ATOM   5437 C  CB    . ARG G  1 97  ? 163.694 0.881   197.163 1.00 48.10  ? 97   ARG G CB    1 
ATOM   5438 C  CG    . ARG G  1 97  ? 162.823 1.243   198.316 1.00 59.78  ? 97   ARG G CG    1 
ATOM   5439 C  CD    . ARG G  1 97  ? 162.786 0.120   199.323 1.00 65.26  ? 97   ARG G CD    1 
ATOM   5440 N  NE    . ARG G  1 97  ? 163.086 0.704   200.618 1.00 74.95  ? 97   ARG G NE    1 
ATOM   5441 C  CZ    . ARG G  1 97  ? 164.201 0.485   201.305 1.00 77.04  ? 97   ARG G CZ    1 
ATOM   5442 N  NH1   . ARG G  1 97  ? 165.145 -0.340  200.862 1.00 70.62  ? 97   ARG G NH1   1 
ATOM   5443 N  NH2   . ARG G  1 97  ? 164.355 1.096   202.459 1.00 88.94  ? 97   ARG G NH2   1 
ATOM   5444 N  N     . ILE G  1 98  ? 164.834 2.041   193.984 1.00 43.93  ? 98   ILE G N     1 
ATOM   5445 C  CA    . ILE G  1 98  ? 165.562 1.450   192.875 1.00 49.48  ? 98   ILE G CA    1 
ATOM   5446 C  C     . ILE G  1 98  ? 167.075 1.577   193.083 1.00 49.96  ? 98   ILE G C     1 
ATOM   5447 O  O     . ILE G  1 98  ? 167.831 0.666   192.735 1.00 49.30  ? 98   ILE G O     1 
ATOM   5448 C  CB    . ILE G  1 98  ? 165.134 2.081   191.523 1.00 45.22  ? 98   ILE G CB    1 
ATOM   5449 C  CG1   . ILE G  1 98  ? 165.638 1.250   190.349 1.00 48.06  ? 98   ILE G CG1   1 
ATOM   5450 C  CG2   . ILE G  1 98  ? 165.568 3.542   191.416 1.00 42.31  ? 98   ILE G CG2   1 
ATOM   5451 C  CD1   . ILE G  1 98  ? 165.164 1.780   188.993 1.00 42.32  ? 98   ILE G CD1   1 
ATOM   5452 N  N     . ARG G  1 99  ? 167.511 2.664   193.717 1.00 47.54  ? 99   ARG G N     1 
ATOM   5453 C  CA    . ARG G  1 99  ? 168.944 2.878   193.921 1.00 51.31  ? 99   ARG G CA    1 
ATOM   5454 C  C     . ARG G  1 99  ? 169.596 1.847   194.843 1.00 52.50  ? 99   ARG G C     1 
ATOM   5455 O  O     . ARG G  1 99  ? 170.810 1.824   194.982 1.00 54.59  ? 99   ARG G O     1 
ATOM   5456 C  CB    . ARG G  1 99  ? 169.194 4.285   194.462 1.00 51.67  ? 99   ARG G CB    1 
ATOM   5457 C  CG    . ARG G  1 99  ? 168.986 5.354   193.399 1.00 57.00  ? 99   ARG G CG    1 
ATOM   5458 C  CD    . ARG G  1 99  ? 169.056 6.763   193.953 1.00 57.36  ? 99   ARG G CD    1 
ATOM   5459 N  NE    . ARG G  1 99  ? 168.792 7.737   192.896 1.00 68.30  ? 99   ARG G NE    1 
ATOM   5460 C  CZ    . ARG G  1 99  ? 167.596 8.255   192.634 1.00 73.16  ? 99   ARG G CZ    1 
ATOM   5461 N  NH1   . ARG G  1 99  ? 166.546 7.910   193.377 1.00 64.64  ? 99   ARG G NH1   1 
ATOM   5462 N  NH2   . ARG G  1 99  ? 167.455 9.127   191.638 1.00 63.04  ? 99   ARG G NH2   1 
ATOM   5463 N  N     . LEU G  1 100 ? 168.795 0.981   195.454 1.00 48.61  ? 100  LEU G N     1 
ATOM   5464 C  CA    . LEU G  1 100 ? 169.331 -0.013  196.371 1.00 49.27  ? 100  LEU G CA    1 
ATOM   5465 C  C     . LEU G  1 100 ? 169.238 -1.429  195.834 1.00 52.53  ? 100  LEU G C     1 
ATOM   5466 O  O     . LEU G  1 100 ? 169.616 -2.369  196.521 1.00 51.55  ? 100  LEU G O     1 
ATOM   5467 C  CB    . LEU G  1 100 ? 168.613 0.064   197.711 1.00 49.46  ? 100  LEU G CB    1 
ATOM   5468 C  CG    . LEU G  1 100 ? 168.457 1.460   198.311 1.00 56.52  ? 100  LEU G CG    1 
ATOM   5469 C  CD1   . LEU G  1 100 ? 167.255 1.496   199.240 1.00 52.08  ? 100  LEU G CD1   1 
ATOM   5470 C  CD2   . LEU G  1 100 ? 169.719 1.857   199.052 1.00 55.00  ? 100  LEU G CD2   1 
ATOM   5471 N  N     . PHE G  1 101 ? 168.717 -1.584  194.622 1.00 49.76  ? 101  PHE G N     1 
ATOM   5472 C  CA    . PHE G  1 101 ? 168.674 -2.893  193.974 1.00 51.48  ? 101  PHE G CA    1 
ATOM   5473 C  C     . PHE G  1 101 ? 170.014 -3.637  194.091 1.00 53.66  ? 101  PHE G C     1 
ATOM   5474 O  O     . PHE G  1 101 ? 171.099 -3.056  193.919 1.00 49.06  ? 101  PHE G O     1 
ATOM   5475 C  CB    . PHE G  1 101 ? 168.288 -2.758  192.485 1.00 48.15  ? 101  PHE G CB    1 
ATOM   5476 C  CG    . PHE G  1 101 ? 166.812 -2.566  192.248 1.00 52.95  ? 101  PHE G CG    1 
ATOM   5477 C  CD1   . PHE G  1 101 ? 165.949 -2.279  193.310 1.00 48.89  ? 101  PHE G CD1   1 
ATOM   5478 C  CD2   . PHE G  1 101 ? 166.277 -2.697  190.974 1.00 46.70  ? 101  PHE G CD2   1 
ATOM   5479 C  CE1   . PHE G  1 101 ? 164.589 -2.106  193.099 1.00 44.34  ? 101  PHE G CE1   1 
ATOM   5480 C  CE2   . PHE G  1 101 ? 164.915 -2.536  190.751 1.00 49.12  ? 101  PHE G CE2   1 
ATOM   5481 C  CZ    . PHE G  1 101 ? 164.067 -2.241  191.820 1.00 51.23  ? 101  PHE G CZ    1 
ATOM   5482 N  N     . ASN G  1 102 ? 169.929 -4.926  194.392 1.00 56.26  ? 102  ASN G N     1 
ATOM   5483 C  CA    . ASN G  1 102 ? 171.104 -5.789  194.372 1.00 57.37  ? 102  ASN G CA    1 
ATOM   5484 C  C     . ASN G  1 102 ? 171.414 -6.203  192.946 1.00 56.95  ? 102  ASN G C     1 
ATOM   5485 O  O     . ASN G  1 102 ? 170.699 -5.821  192.018 1.00 56.00  ? 102  ASN G O     1 
ATOM   5486 C  CB    . ASN G  1 102 ? 170.905 -7.020  195.281 1.00 57.37  ? 102  ASN G CB    1 
ATOM   5487 C  CG    . ASN G  1 102 ? 169.741 -7.921  194.845 1.00 58.53  ? 102  ASN G CG    1 
ATOM   5488 O  OD1   . ASN G  1 102 ? 169.368 -7.966  193.670 1.00 61.02  ? 102  ASN G OD1   1 
ATOM   5489 N  ND2   . ASN G  1 102 ? 169.173 -8.655  195.803 1.00 45.94  ? 102  ASN G ND2   1 
ATOM   5490 N  N     . MET G  1 103 ? 172.456 -7.005  192.774 1.00 56.01  ? 103  MET G N     1 
ATOM   5491 C  CA    . MET G  1 103 ? 172.947 -7.324  191.442 1.00 54.78  ? 103  MET G CA    1 
ATOM   5492 C  C     . MET G  1 103 ? 171.932 -8.140  190.652 1.00 54.99  ? 103  MET G C     1 
ATOM   5493 O  O     . MET G  1 103 ? 171.784 -7.943  189.448 1.00 62.11  ? 103  MET G O     1 
ATOM   5494 C  CB    . MET G  1 103 ? 174.283 -8.066  191.537 1.00 62.31  ? 103  MET G CB    1 
ATOM   5495 C  CG    . MET G  1 103 ? 174.903 -8.447  190.202 1.00 63.38  ? 103  MET G CG    1 
ATOM   5496 S  SD    . MET G  1 103 ? 176.503 -9.246  190.460 1.00 80.42  ? 103  MET G SD    1 
ATOM   5497 C  CE    . MET G  1 103 ? 176.938 -9.731  188.788 1.00 72.76  ? 103  MET G CE    1 
ATOM   5498 N  N     . ARG G  1 104 ? 171.220 -9.040  191.324 1.00 59.41  ? 104  ARG G N     1 
ATOM   5499 C  CA    . ARG G  1 104 ? 170.204 -9.849  190.653 1.00 60.06  ? 104  ARG G CA    1 
ATOM   5500 C  C     . ARG G  1 104 ? 169.049 -8.959  190.194 1.00 58.89  ? 104  ARG G C     1 
ATOM   5501 O  O     . ARG G  1 104 ? 168.535 -9.109  189.078 1.00 58.95  ? 104  ARG G O     1 
ATOM   5502 C  CB    . ARG G  1 104 ? 169.679 -10.970 191.565 1.00 58.30  ? 104  ARG G CB    1 
ATOM   5503 C  CG    . ARG G  1 104 ? 168.400 -11.656 191.031 1.00 67.14  ? 104  ARG G CG    1 
ATOM   5504 C  CD    . ARG G  1 104 ? 168.614 -13.126 190.641 1.00 77.44  ? 104  ARG G CD    1 
ATOM   5505 N  NE    . ARG G  1 104 ? 167.407 -13.791 190.121 1.00 85.42  ? 104  ARG G NE    1 
ATOM   5506 C  CZ    . ARG G  1 104 ? 166.867 -13.588 188.914 1.00 85.08  ? 104  ARG G CZ    1 
ATOM   5507 N  NH1   . ARG G  1 104 ? 167.418 -12.736 188.056 1.00 82.34  ? 104  ARG G NH1   1 
ATOM   5508 N  NH2   . ARG G  1 104 ? 165.769 -14.251 188.556 1.00 86.26  ? 104  ARG G NH2   1 
ATOM   5509 N  N     . GLU G  1 105 ? 168.655 -8.025  191.055 1.00 54.42  ? 105  GLU G N     1 
ATOM   5510 C  CA    . GLU G  1 105 ? 167.586 -7.102  190.715 1.00 55.70  ? 105  GLU G CA    1 
ATOM   5511 C  C     . GLU G  1 105 ? 167.983 -6.171  189.561 1.00 53.52  ? 105  GLU G C     1 
ATOM   5512 O  O     . GLU G  1 105 ? 167.202 -5.995  188.619 1.00 50.97  ? 105  GLU G O     1 
ATOM   5513 C  CB    . GLU G  1 105 ? 167.169 -6.296  191.947 1.00 53.06  ? 105  GLU G CB    1 
ATOM   5514 C  CG    . GLU G  1 105 ? 166.401 -7.115  192.971 1.00 50.38  ? 105  GLU G CG    1 
ATOM   5515 C  CD    . GLU G  1 105 ? 166.325 -6.429  194.317 1.00 59.15  ? 105  GLU G CD    1 
ATOM   5516 O  OE1   . GLU G  1 105 ? 167.361 -5.903  194.784 1.00 55.22  ? 105  GLU G OE1   1 
ATOM   5517 O  OE2   . GLU G  1 105 ? 165.220 -6.394  194.904 1.00 70.84  ? 105  GLU G OE2   1 
ATOM   5518 N  N     . GLN G  1 106 ? 169.187 -5.597  189.638 1.00 52.09  ? 106  GLN G N     1 
ATOM   5519 C  CA    . GLN G  1 106 ? 169.709 -4.715  188.598 1.00 49.89  ? 106  GLN G CA    1 
ATOM   5520 C  C     . GLN G  1 106 ? 169.590 -5.375  187.242 1.00 47.33  ? 106  GLN G C     1 
ATOM   5521 O  O     . GLN G  1 106 ? 169.074 -4.793  186.284 1.00 43.60  ? 106  GLN G O     1 
ATOM   5522 C  CB    . GLN G  1 106 ? 171.172 -4.354  188.857 1.00 49.04  ? 106  GLN G CB    1 
ATOM   5523 C  CG    . GLN G  1 106 ? 171.414 -3.520  190.107 1.00 52.68  ? 106  GLN G CG    1 
ATOM   5524 C  CD    . GLN G  1 106 ? 172.891 -3.446  190.469 1.00 52.07  ? 106  GLN G CD    1 
ATOM   5525 O  OE1   . GLN G  1 106 ? 173.735 -3.961  189.750 1.00 53.70  ? 106  GLN G OE1   1 
ATOM   5526 N  NE2   . GLN G  1 106 ? 173.202 -2.808  191.585 1.00 54.21  ? 106  GLN G NE2   1 
ATOM   5527 N  N     . ILE G  1 107 ? 170.058 -6.610  187.175 1.00 48.28  ? 107  ILE G N     1 
ATOM   5528 C  CA    . ILE G  1 107 ? 170.150 -7.296  185.899 1.00 51.34  ? 107  ILE G CA    1 
ATOM   5529 C  C     . ILE G  1 107 ? 168.750 -7.557  185.377 1.00 47.98  ? 107  ILE G C     1 
ATOM   5530 O  O     . ILE G  1 107 ? 168.462 -7.363  184.183 1.00 46.58  ? 107  ILE G O     1 
ATOM   5531 C  CB    . ILE G  1 107 ? 170.952 -8.617  186.032 1.00 53.66  ? 107  ILE G CB    1 
ATOM   5532 C  CG1   . ILE G  1 107 ? 172.451 -8.301  186.173 1.00 57.74  ? 107  ILE G CG1   1 
ATOM   5533 C  CG2   . ILE G  1 107 ? 170.714 -9.518  184.828 1.00 51.57  ? 107  ILE G CG2   1 
ATOM   5534 C  CD1   . ILE G  1 107 ? 173.334 -9.494  186.561 1.00 50.12  ? 107  ILE G CD1   1 
ATOM   5535 N  N     . ALA G  1 108 ? 167.877 -7.988  186.280 1.00 46.85  ? 108  ALA G N     1 
ATOM   5536 C  CA    . ALA G  1 108 ? 166.500 -8.268  185.916 1.00 43.63  ? 108  ALA G CA    1 
ATOM   5537 C  C     . ALA G  1 108 ? 165.849 -7.017  185.341 1.00 40.32  ? 108  ALA G C     1 
ATOM   5538 O  O     . ALA G  1 108 ? 165.229 -7.062  184.287 1.00 41.93  ? 108  ALA G O     1 
ATOM   5539 C  CB    . ALA G  1 108 ? 165.716 -8.779  187.129 1.00 41.81  ? 108  ALA G CB    1 
ATOM   5540 N  N     . PHE G  1 109 ? 166.005 -5.905  186.056 1.00 42.84  ? 109  PHE G N     1 
ATOM   5541 C  CA    . PHE G  1 109 ? 165.400 -4.637  185.682 1.00 40.97  ? 109  PHE G CA    1 
ATOM   5542 C  C     . PHE G  1 109 ? 165.929 -4.153  184.319 1.00 42.57  ? 109  PHE G C     1 
ATOM   5543 O  O     . PHE G  1 109 ? 165.159 -3.742  183.441 1.00 39.97  ? 109  PHE G O     1 
ATOM   5544 C  CB    . PHE G  1 109 ? 165.657 -3.588  186.768 1.00 37.74  ? 109  PHE G CB    1 
ATOM   5545 C  CG    . PHE G  1 109 ? 165.173 -2.220  186.408 1.00 39.81  ? 109  PHE G CG    1 
ATOM   5546 C  CD1   . PHE G  1 109 ? 163.863 -1.842  186.662 1.00 40.18  ? 109  PHE G CD1   1 
ATOM   5547 C  CD2   . PHE G  1 109 ? 166.020 -1.309  185.789 1.00 42.72  ? 109  PHE G CD2   1 
ATOM   5548 C  CE1   . PHE G  1 109 ? 163.406 -0.576  186.309 1.00 37.10  ? 109  PHE G CE1   1 
ATOM   5549 C  CE2   . PHE G  1 109 ? 165.570 -0.048  185.435 1.00 41.57  ? 109  PHE G CE2   1 
ATOM   5550 C  CZ    . PHE G  1 109 ? 164.261 0.319   185.697 1.00 39.25  ? 109  PHE G CZ    1 
ATOM   5551 N  N     . ILE G  1 110 ? 167.242 -4.197  184.150 1.00 41.54  ? 110  ILE G N     1 
ATOM   5552 C  CA    . ILE G  1 110 ? 167.837 -3.802  182.872 1.00 45.20  ? 110  ILE G CA    1 
ATOM   5553 C  C     . ILE G  1 110 ? 167.341 -4.707  181.750 1.00 38.50  ? 110  ILE G C     1 
ATOM   5554 O  O     . ILE G  1 110 ? 167.043 -4.233  180.660 1.00 40.02  ? 110  ILE G O     1 
ATOM   5555 C  CB    . ILE G  1 110 ? 169.359 -3.814  182.941 1.00 44.05  ? 110  ILE G CB    1 
ATOM   5556 C  CG1   . ILE G  1 110 ? 169.819 -2.766  183.954 1.00 36.91  ? 110  ILE G CG1   1 
ATOM   5557 C  CG2   . ILE G  1 110 ? 169.947 -3.489  181.583 1.00 40.28  ? 110  ILE G CG2   1 
ATOM   5558 C  CD1   . ILE G  1 110 ? 171.213 -2.978  184.432 1.00 45.33  ? 110  ILE G CD1   1 
ATOM   5559 N  N     . LYS G  1 111 ? 167.171 -5.994  182.027 1.00 39.45  ? 111  LYS G N     1 
ATOM   5560 C  CA    . LYS G  1 111 ? 166.641 -6.863  180.987 1.00 37.83  ? 111  LYS G CA    1 
ATOM   5561 C  C     . LYS G  1 111 ? 165.192 -6.488  180.629 1.00 43.70  ? 111  LYS G C     1 
ATOM   5562 O  O     . LYS G  1 111 ? 164.840 -6.439  179.441 1.00 43.87  ? 111  LYS G O     1 
ATOM   5563 C  CB    . LYS G  1 111 ? 166.737 -8.341  181.385 1.00 41.73  ? 111  LYS G CB    1 
ATOM   5564 C  CG    . LYS G  1 111 ? 165.937 -9.222  180.436 1.00 54.34  ? 111  LYS G CG    1 
ATOM   5565 C  CD    . LYS G  1 111 ? 166.179 -10.719 180.588 1.00 61.77  ? 111  LYS G CD    1 
ATOM   5566 C  CE    . LYS G  1 111 ? 166.458 -11.138 182.018 1.00 69.58  ? 111  LYS G CE    1 
ATOM   5567 N  NZ    . LYS G  1 111 ? 166.078 -12.578 182.214 1.00 74.70  ? 111  LYS G NZ    1 
ATOM   5568 N  N     . GLY G  1 112 ? 164.365 -6.206  181.645 1.00 43.20  ? 112  GLY G N     1 
ATOM   5569 C  CA    . GLY G  1 112 ? 162.994 -5.760  181.432 1.00 36.01  ? 112  GLY G CA    1 
ATOM   5570 C  C     . GLY G  1 112 ? 162.931 -4.448  180.672 1.00 42.22  ? 112  GLY G C     1 
ATOM   5571 O  O     . GLY G  1 112 ? 162.176 -4.301  179.694 1.00 43.18  ? 112  GLY G O     1 
ATOM   5572 N  N     . LEU G  1 113 ? 163.754 -3.493  181.093 1.00 40.28  ? 113  LEU G N     1 
ATOM   5573 C  CA    . LEU G  1 113 ? 163.832 -2.216  180.411 1.00 38.36  ? 113  LEU G CA    1 
ATOM   5574 C  C     . LEU G  1 113 ? 164.329 -2.367  178.945 1.00 40.99  ? 113  LEU G C     1 
ATOM   5575 O  O     . LEU G  1 113 ? 163.830 -1.689  178.039 1.00 41.24  ? 113  LEU G O     1 
ATOM   5576 C  CB    . LEU G  1 113 ? 164.720 -1.267  181.196 1.00 38.32  ? 113  LEU G CB    1 
ATOM   5577 C  CG    . LEU G  1 113 ? 164.725 0.169   180.668 1.00 42.88  ? 113  LEU G CG    1 
ATOM   5578 C  CD1   . LEU G  1 113 ? 163.339 0.749   180.815 1.00 38.50  ? 113  LEU G CD1   1 
ATOM   5579 C  CD2   . LEU G  1 113 ? 165.752 1.010   181.415 1.00 40.66  ? 113  LEU G CD2   1 
ATOM   5580 N  N     . TYR G  1 114 ? 165.263 -3.287  178.700 1.00 42.89  ? 114  TYR G N     1 
ATOM   5581 C  CA    . TYR G  1 114 ? 165.754 -3.478  177.334 1.00 40.41  ? 114  TYR G CA    1 
ATOM   5582 C  C     . TYR G  1 114 ? 164.692 -4.126  176.450 1.00 40.75  ? 114  TYR G C     1 
ATOM   5583 O  O     . TYR G  1 114 ? 164.487 -3.702  175.307 1.00 41.40  ? 114  TYR G O     1 
ATOM   5584 C  CB    . TYR G  1 114 ? 167.046 -4.305  177.288 1.00 41.50  ? 114  TYR G CB    1 
ATOM   5585 C  CG    . TYR G  1 114 ? 167.809 -4.041  176.004 1.00 39.53  ? 114  TYR G CG    1 
ATOM   5586 C  CD1   . TYR G  1 114 ? 167.569 -4.795  174.863 1.00 45.24  ? 114  TYR G CD1   1 
ATOM   5587 C  CD2   . TYR G  1 114 ? 168.747 -3.021  175.924 1.00 41.87  ? 114  TYR G CD2   1 
ATOM   5588 C  CE1   . TYR G  1 114 ? 168.249 -4.544  173.664 1.00 48.24  ? 114  TYR G CE1   1 
ATOM   5589 C  CE2   . TYR G  1 114 ? 169.437 -2.759  174.740 1.00 45.58  ? 114  TYR G CE2   1 
ATOM   5590 C  CZ    . TYR G  1 114 ? 169.185 -3.528  173.614 1.00 48.45  ? 114  TYR G CZ    1 
ATOM   5591 O  OH    . TYR G  1 114 ? 169.857 -3.282  172.436 1.00 52.27  ? 114  TYR G OH    1 
ATOM   5592 N  N     . VAL G  1 115 ? 164.015 -5.140  176.973 1.00 39.02  ? 115  VAL G N     1 
ATOM   5593 C  CA    . VAL G  1 115 ? 162.879 -5.716  176.258 1.00 38.69  ? 115  VAL G CA    1 
ATOM   5594 C  C     . VAL G  1 115 ? 161.900 -4.622  175.826 1.00 39.93  ? 115  VAL G C     1 
ATOM   5595 O  O     . VAL G  1 115 ? 161.445 -4.621  174.690 1.00 40.51  ? 115  VAL G O     1 
ATOM   5596 C  CB    . VAL G  1 115 ? 162.112 -6.759  177.121 1.00 42.33  ? 115  VAL G CB    1 
ATOM   5597 C  CG1   . VAL G  1 115 ? 160.832 -7.182  176.419 1.00 31.90  ? 115  VAL G CG1   1 
ATOM   5598 C  CG2   . VAL G  1 115 ? 162.993 -7.957  177.427 1.00 41.46  ? 115  VAL G CG2   1 
ATOM   5599 N  N     . ALA G  1 116 ? 161.578 -3.691  176.733 1.00 37.29  ? 116  ALA G N     1 
ATOM   5600 C  CA    . ALA G  1 116 ? 160.610 -2.653  176.425 1.00 38.21  ? 116  ALA G CA    1 
ATOM   5601 C  C     . ALA G  1 116 ? 161.173 -1.607  175.464 1.00 41.46  ? 116  ALA G C     1 
ATOM   5602 O  O     . ALA G  1 116 ? 160.539 -1.274  174.458 1.00 33.63  ? 116  ALA G O     1 
ATOM   5603 C  CB    . ALA G  1 116 ? 160.122 -1.973  177.693 1.00 38.74  ? 116  ALA G CB    1 
ATOM   5604 N  N     . GLU G  1 117 ? 162.343 -1.060  175.775 1.00 40.37  ? 117  GLU G N     1 
ATOM   5605 C  CA    . GLU G  1 117 ? 162.813 0.079   174.984 1.00 43.60  ? 117  GLU G CA    1 
ATOM   5606 C  C     . GLU G  1 117 ? 164.216 -0.050  174.362 1.00 42.44  ? 117  GLU G C     1 
ATOM   5607 O  O     . GLU G  1 117 ? 164.827 0.942   173.960 1.00 41.19  ? 117  GLU G O     1 
ATOM   5608 C  CB    . GLU G  1 117 ? 162.728 1.323   175.856 1.00 47.61  ? 117  GLU G CB    1 
ATOM   5609 C  CG    . GLU G  1 117 ? 161.264 1.642   176.131 1.00 45.86  ? 117  GLU G CG    1 
ATOM   5610 C  CD    . GLU G  1 117 ? 161.073 2.779   177.035 1.00 42.88  ? 117  GLU G CD    1 
ATOM   5611 O  OE1   . GLU G  1 117 ? 161.899 3.003   177.937 1.00 50.20  ? 117  GLU G OE1   1 
ATOM   5612 O  OE2   . GLU G  1 117 ? 160.088 3.479   176.821 1.00 53.38  ? 117  GLU G OE2   1 
ATOM   5613 N  N     . GLY G  1 118 ? 164.708 -1.276  174.261 1.00 34.87  ? 118  GLY G N     1 
ATOM   5614 C  CA    . GLY G  1 118 ? 166.041 -1.489  173.746 1.00 43.06  ? 118  GLY G CA    1 
ATOM   5615 C  C     . GLY G  1 118 ? 166.048 -1.567  172.228 1.00 40.53  ? 118  GLY G C     1 
ATOM   5616 O  O     . GLY G  1 118 ? 165.040 -1.895  171.613 1.00 41.47  ? 118  GLY G O     1 
ATOM   5617 N  N     . ASP G  1 119 ? 167.181 -1.225  171.626 1.00 46.84  ? 119  ASP G N     1 
ATOM   5618 C  CA    . ASP G  1 119 ? 167.446 -1.517  170.213 1.00 45.56  ? 119  ASP G CA    1 
ATOM   5619 C  C     . ASP G  1 119 ? 167.397 -3.031  170.015 1.00 43.52  ? 119  ASP G C     1 
ATOM   5620 O  O     . ASP G  1 119 ? 168.282 -3.758  170.455 1.00 46.17  ? 119  ASP G O     1 
ATOM   5621 C  CB    . ASP G  1 119 ? 168.800 -0.940  169.797 1.00 44.87  ? 119  ASP G CB    1 
ATOM   5622 C  CG    . ASP G  1 119 ? 169.059 -1.034  168.282 1.00 51.54  ? 119  ASP G CG    1 
ATOM   5623 O  OD1   . ASP G  1 119 ? 168.789 -2.090  167.660 1.00 48.89  ? 119  ASP G OD1   1 
ATOM   5624 O  OD2   . ASP G  1 119 ? 169.527 -0.023  167.709 1.00 52.53  ? 119  ASP G OD2   1 
ATOM   5625 N  N     . LYS G  1 120 ? 166.345 -3.504  169.363 1.00 43.56  ? 120  LYS G N     1 
ATOM   5626 C  CA    . LYS G  1 120 ? 166.125 -4.938  169.255 1.00 53.35  ? 120  LYS G CA    1 
ATOM   5627 C  C     . LYS G  1 120 ? 166.692 -5.572  167.971 1.00 59.19  ? 120  LYS G C     1 
ATOM   5628 O  O     . LYS G  1 120 ? 166.566 -6.776  167.768 1.00 63.01  ? 120  LYS G O     1 
ATOM   5629 C  CB    . LYS G  1 120 ? 164.629 -5.240  169.386 1.00 47.38  ? 120  LYS G CB    1 
ATOM   5630 C  CG    . LYS G  1 120 ? 164.241 -5.681  170.808 1.00 55.26  ? 120  LYS G CG    1 
ATOM   5631 C  CD    . LYS G  1 120 ? 162.911 -5.096  171.236 1.00 60.53  ? 120  LYS G CD    1 
ATOM   5632 C  CE    . LYS G  1 120 ? 163.131 -4.042  172.282 1.00 48.67  ? 120  LYS G CE    1 
ATOM   5633 N  NZ    . LYS G  1 120 ? 161.988 -3.060  172.357 1.00 51.15  ? 120  LYS G NZ    1 
ATOM   5634 N  N     . THR G  1 121 ? 167.346 -4.786  167.123 1.00 52.28  ? 121  THR G N     1 
ATOM   5635 C  CA    . THR G  1 121 ? 168.075 -5.384  166.003 1.00 60.37  ? 121  THR G CA    1 
ATOM   5636 C  C     . THR G  1 121 ? 169.400 -5.956  166.513 1.00 63.10  ? 121  THR G C     1 
ATOM   5637 O  O     . THR G  1 121 ? 170.040 -6.746  165.827 1.00 62.36  ? 121  THR G O     1 
ATOM   5638 C  CB    . THR G  1 121 ? 168.376 -4.377  164.877 1.00 54.59  ? 121  THR G CB    1 
ATOM   5639 O  OG1   . THR G  1 121 ? 169.530 -3.593  165.217 1.00 55.62  ? 121  THR G OG1   1 
ATOM   5640 C  CG2   . THR G  1 121 ? 167.194 -3.462  164.631 1.00 51.00  ? 121  THR G CG2   1 
ATOM   5641 N  N     . LEU G  1 122 ? 169.797 -5.536  167.719 1.00 63.29  ? 122  LEU G N     1 
ATOM   5642 C  CA    . LEU G  1 122 ? 171.088 -5.882  168.347 1.00 61.02  ? 122  LEU G CA    1 
ATOM   5643 C  C     . LEU G  1 122 ? 172.340 -5.611  167.481 1.00 65.96  ? 122  LEU G C     1 
ATOM   5644 O  O     . LEU G  1 122 ? 173.462 -5.881  167.928 1.00 66.63  ? 122  LEU G O     1 
ATOM   5645 C  CB    . LEU G  1 122 ? 171.095 -7.350  168.795 1.00 62.24  ? 122  LEU G CB    1 
ATOM   5646 C  CG    . LEU G  1 122 ? 170.178 -7.714  169.971 1.00 63.18  ? 122  LEU G CG    1 
ATOM   5647 C  CD1   . LEU G  1 122 ? 170.576 -9.042  170.608 1.00 59.36  ? 122  LEU G CD1   1 
ATOM   5648 C  CD2   . LEU G  1 122 ? 170.169 -6.605  171.003 1.00 60.83  ? 122  LEU G CD2   1 
ATOM   5649 N  N     . LYS G  1 123 ? 172.154 -5.089  166.261 1.00 63.66  ? 123  LYS G N     1 
ATOM   5650 C  CA    . LYS G  1 123 ? 173.259 -4.500  165.503 1.00 61.73  ? 123  LYS G CA    1 
ATOM   5651 C  C     . LYS G  1 123 ? 173.898 -3.411  166.355 1.00 57.62  ? 123  LYS G C     1 
ATOM   5652 O  O     . LYS G  1 123 ? 175.115 -3.348  166.497 1.00 63.24  ? 123  LYS G O     1 
ATOM   5653 C  CB    . LYS G  1 123 ? 172.796 -3.923  164.153 1.00 55.89  ? 123  LYS G CB    1 
ATOM   5654 C  CG    . LYS G  1 123 ? 172.210 -4.943  163.176 1.00 71.93  ? 123  LYS G CG    1 
ATOM   5655 C  CD    . LYS G  1 123 ? 171.569 -4.283  161.932 1.00 73.78  ? 123  LYS G CD    1 
ATOM   5656 C  CE    . LYS G  1 123 ? 170.063 -4.589  161.840 1.00 72.18  ? 123  LYS G CE    1 
ATOM   5657 N  NZ    . LYS G  1 123 ? 169.351 -3.960  160.676 1.00 70.30  ? 123  LYS G NZ    1 
ATOM   5658 N  N     . ARG G  1 124 ? 173.067 -2.552  166.929 1.00 55.25  ? 124  ARG G N     1 
ATOM   5659 C  CA    . ARG G  1 124 ? 173.541 -1.635  167.955 1.00 57.08  ? 124  ARG G CA    1 
ATOM   5660 C  C     . ARG G  1 124 ? 172.810 -1.914  169.274 1.00 54.09  ? 124  ARG G C     1 
ATOM   5661 O  O     . ARG G  1 124 ? 171.720 -2.485  169.268 1.00 49.52  ? 124  ARG G O     1 
ATOM   5662 C  CB    . ARG G  1 124 ? 173.348 -0.193  167.509 1.00 52.21  ? 124  ARG G CB    1 
ATOM   5663 C  CG    . ARG G  1 124 ? 173.765 0.032   166.079 1.00 55.45  ? 124  ARG G CG    1 
ATOM   5664 C  CD    . ARG G  1 124 ? 173.098 1.260   165.516 1.00 54.37  ? 124  ARG G CD    1 
ATOM   5665 N  NE    . ARG G  1 124 ? 173.701 2.452   166.087 1.00 60.21  ? 124  ARG G NE    1 
ATOM   5666 C  CZ    . ARG G  1 124 ? 173.576 3.674   165.577 1.00 65.45  ? 124  ARG G CZ    1 
ATOM   5667 N  NH1   . ARG G  1 124 ? 172.841 3.869   164.468 1.00 56.59  ? 124  ARG G NH1   1 
ATOM   5668 N  NH2   . ARG G  1 124 ? 174.187 4.697   166.184 1.00 58.92  ? 124  ARG G NH2   1 
ATOM   5669 N  N     . LEU G  1 125 ? 173.433 -1.525  170.385 1.00 46.11  ? 125  LEU G N     1 
ATOM   5670 C  CA    . LEU G  1 125 ? 172.902 -1.775  171.716 1.00 50.80  ? 125  LEU G CA    1 
ATOM   5671 C  C     . LEU G  1 125 ? 172.511 -0.473  172.425 1.00 49.70  ? 125  LEU G C     1 
ATOM   5672 O  O     . LEU G  1 125 ? 173.337 0.160   173.095 1.00 47.72  ? 125  LEU G O     1 
ATOM   5673 C  CB    . LEU G  1 125 ? 173.922 -2.544  172.553 1.00 47.02  ? 125  LEU G CB    1 
ATOM   5674 C  CG    . LEU G  1 125 ? 174.350 -3.888  171.961 1.00 53.17  ? 125  LEU G CG    1 
ATOM   5675 C  CD1   . LEU G  1 125 ? 175.504 -4.486  172.749 1.00 52.69  ? 125  LEU G CD1   1 
ATOM   5676 C  CD2   . LEU G  1 125 ? 173.179 -4.849  171.917 1.00 48.98  ? 125  LEU G CD2   1 
ATOM   5677 N  N     . ARG G  1 126 ? 171.244 -0.087  172.279 1.00 45.21  ? 126  ARG G N     1 
ATOM   5678 C  CA    . ARG G  1 126 ? 170.761 1.198   172.790 1.00 46.46  ? 126  ARG G CA    1 
ATOM   5679 C  C     . ARG G  1 126 ? 169.454 1.101   173.619 1.00 46.42  ? 126  ARG G C     1 
ATOM   5680 O  O     . ARG G  1 126 ? 168.624 0.227   173.391 1.00 37.16  ? 126  ARG G O     1 
ATOM   5681 C  CB    . ARG G  1 126 ? 170.556 2.158   171.617 1.00 43.59  ? 126  ARG G CB    1 
ATOM   5682 C  CG    . ARG G  1 126 ? 171.795 2.324   170.729 1.00 48.61  ? 126  ARG G CG    1 
ATOM   5683 C  CD    . ARG G  1 126 ? 171.526 3.176   169.504 1.00 42.76  ? 126  ARG G CD    1 
ATOM   5684 N  NE    . ARG G  1 126 ? 170.595 2.551   168.572 1.00 44.59  ? 126  ARG G NE    1 
ATOM   5685 C  CZ    . ARG G  1 126 ? 170.153 3.139   167.461 1.00 46.10  ? 126  ARG G CZ    1 
ATOM   5686 N  NH1   . ARG G  1 126 ? 170.563 4.365   167.148 1.00 45.77  ? 126  ARG G NH1   1 
ATOM   5687 N  NH2   . ARG G  1 126 ? 169.300 2.508   166.668 1.00 41.08  ? 126  ARG G NH2   1 
ATOM   5688 N  N     . ILE G  1 127 ? 169.286 2.011   174.578 1.00 40.80  ? 127  ILE G N     1 
ATOM   5689 C  CA    . ILE G  1 127 ? 168.053 2.112   175.357 1.00 38.57  ? 127  ILE G CA    1 
ATOM   5690 C  C     . ILE G  1 127 ? 167.556 3.556   175.303 1.00 37.59  ? 127  ILE G C     1 
ATOM   5691 O  O     . ILE G  1 127 ? 168.306 4.478   175.614 1.00 38.11  ? 127  ILE G O     1 
ATOM   5692 C  CB    . ILE G  1 127 ? 168.281 1.687   176.839 1.00 42.37  ? 127  ILE G CB    1 
ATOM   5693 C  CG1   . ILE G  1 127 ? 168.991 0.334   176.906 1.00 38.29  ? 127  ILE G CG1   1 
ATOM   5694 C  CG2   . ILE G  1 127 ? 166.960 1.693   177.640 1.00 36.96  ? 127  ILE G CG2   1 
ATOM   5695 C  CD1   . ILE G  1 127 ? 169.322 -0.098  178.313 1.00 39.19  ? 127  ILE G CD1   1 
ATOM   5696 N  N     . TRP G  1 128 ? 166.313 3.764   174.898 1.00 31.77  ? 128  TRP G N     1 
ATOM   5697 C  CA    . TRP G  1 128 ? 165.772 5.118   174.832 1.00 38.00  ? 128  TRP G CA    1 
ATOM   5698 C  C     . TRP G  1 128 ? 164.857 5.499   176.020 1.00 42.37  ? 128  TRP G C     1 
ATOM   5699 O  O     . TRP G  1 128 ? 164.023 4.695   176.462 1.00 35.16  ? 128  TRP G O     1 
ATOM   5700 C  CB    . TRP G  1 128 ? 164.980 5.295   173.538 1.00 40.50  ? 128  TRP G CB    1 
ATOM   5701 C  CG    . TRP G  1 128 ? 165.837 5.311   172.276 1.00 45.19  ? 128  TRP G CG    1 
ATOM   5702 C  CD1   . TRP G  1 128 ? 166.453 6.401   171.714 1.00 41.15  ? 128  TRP G CD1   1 
ATOM   5703 C  CD2   . TRP G  1 128 ? 166.155 4.193   171.435 1.00 38.02  ? 128  TRP G CD2   1 
ATOM   5704 N  NE1   . TRP G  1 128 ? 167.135 6.028   170.571 1.00 43.03  ? 128  TRP G NE1   1 
ATOM   5705 C  CE2   . TRP G  1 128 ? 166.964 4.679   170.373 1.00 48.23  ? 128  TRP G CE2   1 
ATOM   5706 C  CE3   . TRP G  1 128 ? 165.833 2.832   171.466 1.00 40.28  ? 128  TRP G CE3   1 
ATOM   5707 C  CZ2   . TRP G  1 128 ? 167.461 3.844   169.353 1.00 40.20  ? 128  TRP G CZ2   1 
ATOM   5708 C  CZ3   . TRP G  1 128 ? 166.329 1.999   170.437 1.00 47.08  ? 128  TRP G CZ3   1 
ATOM   5709 C  CH2   . TRP G  1 128 ? 167.131 2.518   169.400 1.00 42.54  ? 128  TRP G CH2   1 
ATOM   5710 N  N     . ASN G  1 129 ? 164.987 6.736   176.499 1.00 40.42  ? 129  ASN G N     1 
ATOM   5711 C  CA    . ASN G  1 129 ? 164.065 7.257   177.511 1.00 40.53  ? 129  ASN G CA    1 
ATOM   5712 C  C     . ASN G  1 129 ? 164.145 8.762   177.738 1.00 39.63  ? 129  ASN G C     1 
ATOM   5713 O  O     . ASN G  1 129 ? 165.232 9.352   177.679 1.00 39.08  ? 129  ASN G O     1 
ATOM   5714 C  CB    . ASN G  1 129 ? 164.285 6.559   178.859 1.00 37.28  ? 129  ASN G CB    1 
ATOM   5715 C  CG    . ASN G  1 129 ? 162.987 6.283   179.558 1.00 40.86  ? 129  ASN G CG    1 
ATOM   5716 O  OD1   . ASN G  1 129 ? 162.553 7.053   180.414 1.00 41.74  ? 129  ASN G OD1   1 
ATOM   5717 N  ND2   . ASN G  1 129 ? 162.326 5.205   179.163 1.00 39.97  ? 129  ASN G ND2   1 
ATOM   5718 N  N     . LYS G  1 130 ? 162.994 9.369   178.041 1.00 41.16  ? 130  LYS G N     1 
ATOM   5719 C  CA    . LYS G  1 130 ? 162.936 10.779  178.475 1.00 43.47  ? 130  LYS G CA    1 
ATOM   5720 C  C     . LYS G  1 130 ? 163.561 10.992  179.855 1.00 39.12  ? 130  LYS G C     1 
ATOM   5721 O  O     . LYS G  1 130 ? 164.025 12.095  180.170 1.00 41.53  ? 130  LYS G O     1 
ATOM   5722 C  CB    . LYS G  1 130 ? 161.492 11.282  178.501 1.00 40.56  ? 130  LYS G CB    1 
ATOM   5723 C  CG    . LYS G  1 130 ? 160.917 11.545  177.107 1.00 52.32  ? 130  LYS G CG    1 
ATOM   5724 C  CD    . LYS G  1 130 ? 159.638 12.376  177.124 1.00 49.40  ? 130  LYS G CD    1 
ATOM   5725 C  CE    . LYS G  1 130 ? 159.941 13.866  177.257 1.00 55.62  ? 130  LYS G CE    1 
ATOM   5726 N  NZ    . LYS G  1 130 ? 158.791 14.702  176.807 1.00 64.76  ? 130  LYS G NZ    1 
ATOM   5727 N  N     . ASN G  1 131 ? 163.551 9.939   180.675 1.00 39.74  ? 131  ASN G N     1 
ATOM   5728 C  CA    . ASN G  1 131 ? 163.981 10.031  182.078 1.00 36.30  ? 131  ASN G CA    1 
ATOM   5729 C  C     . ASN G  1 131 ? 165.477 9.874   182.186 1.00 36.72  ? 131  ASN G C     1 
ATOM   5730 O  O     . ASN G  1 131 ? 165.996 8.761   182.286 1.00 39.46  ? 131  ASN G O     1 
ATOM   5731 C  CB    . ASN G  1 131 ? 163.298 8.961   182.923 1.00 32.62  ? 131  ASN G CB    1 
ATOM   5732 C  CG    . ASN G  1 131 ? 163.465 9.181   184.462 1.00 40.59  ? 131  ASN G CG    1 
ATOM   5733 O  OD1   . ASN G  1 131 ? 164.478 9.704   184.967 1.00 34.71  ? 131  ASN G OD1   1 
ATOM   5734 N  ND2   . ASN G  1 131 ? 162.460 8.746   185.199 1.00 39.11  ? 131  ASN G ND2   1 
ATOM   5735 N  N     . LYS G  1 132 ? 166.178 10.996  182.167 1.00 41.39  ? 132  LYS G N     1 
ATOM   5736 C  CA    . LYS G  1 132 ? 167.636 10.953  182.215 1.00 37.13  ? 132  LYS G CA    1 
ATOM   5737 C  C     . LYS G  1 132 ? 168.127 10.283  183.484 1.00 42.82  ? 132  LYS G C     1 
ATOM   5738 O  O     . LYS G  1 132 ? 169.081 9.500   183.451 1.00 40.87  ? 132  LYS G O     1 
ATOM   5739 C  CB    . LYS G  1 132 ? 168.210 12.358  182.117 1.00 40.08  ? 132  LYS G CB    1 
ATOM   5740 C  CG    . LYS G  1 132 ? 169.712 12.395  182.217 1.00 44.01  ? 132  LYS G CG    1 
ATOM   5741 C  CD    . LYS G  1 132 ? 170.211 13.788  181.976 1.00 47.50  ? 132  LYS G CD    1 
ATOM   5742 C  CE    . LYS G  1 132 ? 171.699 13.789  181.672 1.00 52.94  ? 132  LYS G CE    1 
ATOM   5743 N  NZ    . LYS G  1 132 ? 172.173 15.178  181.418 1.00 52.33  ? 132  LYS G NZ    1 
ATOM   5744 N  N     . ALA G  1 133 ? 167.451 10.580  184.596 1.00 36.77  ? 133  ALA G N     1 
ATOM   5745 C  CA    . ALA G  1 133 ? 167.881 10.072  185.888 1.00 39.64  ? 133  ALA G CA    1 
ATOM   5746 C  C     . ALA G  1 133 ? 167.788 8.561   185.888 1.00 37.12  ? 133  ALA G C     1 
ATOM   5747 O  O     . ALA G  1 133 ? 168.659 7.889   186.412 1.00 42.54  ? 133  ALA G O     1 
ATOM   5748 C  CB    . ALA G  1 133 ? 167.040 10.683  187.050 1.00 32.82  ? 133  ALA G CB    1 
ATOM   5749 N  N     . LEU G  1 134 ? 166.749 8.016   185.280 1.00 34.54  ? 134  LEU G N     1 
ATOM   5750 C  CA    . LEU G  1 134 ? 166.672 6.567   185.177 1.00 39.22  ? 134  LEU G CA    1 
ATOM   5751 C  C     . LEU G  1 134 ? 167.854 5.983   184.366 1.00 43.18  ? 134  LEU G C     1 
ATOM   5752 O  O     . LEU G  1 134 ? 168.463 4.978   184.758 1.00 38.25  ? 134  LEU G O     1 
ATOM   5753 C  CB    . LEU G  1 134 ? 165.351 6.156   184.551 1.00 41.88  ? 134  LEU G CB    1 
ATOM   5754 C  CG    . LEU G  1 134 ? 165.174 4.660   184.320 1.00 42.54  ? 134  LEU G CG    1 
ATOM   5755 C  CD1   . LEU G  1 134 ? 165.249 3.878   185.629 1.00 37.29  ? 134  LEU G CD1   1 
ATOM   5756 C  CD2   . LEU G  1 134 ? 163.858 4.434   183.625 1.00 41.92  ? 134  LEU G CD2   1 
ATOM   5757 N  N     . LEU G  1 135 ? 168.182 6.626   183.243 1.00 41.36  ? 135  LEU G N     1 
ATOM   5758 C  CA    . LEU G  1 135 ? 169.294 6.157   182.410 1.00 42.44  ? 135  LEU G CA    1 
ATOM   5759 C  C     . LEU G  1 135 ? 170.630 6.245   183.185 1.00 44.22  ? 135  LEU G C     1 
ATOM   5760 O  O     . LEU G  1 135 ? 171.429 5.311   183.138 1.00 41.79  ? 135  LEU G O     1 
ATOM   5761 C  CB    . LEU G  1 135 ? 169.344 6.935   181.085 1.00 34.72  ? 135  LEU G CB    1 
ATOM   5762 C  CG    . LEU G  1 135 ? 168.191 6.594   180.112 1.00 39.25  ? 135  LEU G CG    1 
ATOM   5763 C  CD1   . LEU G  1 135 ? 168.375 7.155   178.661 1.00 39.53  ? 135  LEU G CD1   1 
ATOM   5764 C  CD2   . LEU G  1 135 ? 167.994 5.087   180.049 1.00 38.53  ? 135  LEU G CD2   1 
ATOM   5765 N  N     . GLU G  1 136 ? 170.831 7.322   183.949 1.00 39.47  ? 136  GLU G N     1 
ATOM   5766 C  CA    A GLU G  1 136 ? 172.057 7.485   184.718 0.59 42.90  ? 136  GLU G CA    1 
ATOM   5767 C  CA    B GLU G  1 136 ? 172.055 7.492   184.728 0.41 43.16  ? 136  GLU G CA    1 
ATOM   5768 C  C     . GLU G  1 136 ? 172.267 6.346   185.711 1.00 48.26  ? 136  GLU G C     1 
ATOM   5769 O  O     . GLU G  1 136 ? 173.397 5.893   185.918 1.00 52.40  ? 136  GLU G O     1 
ATOM   5770 C  CB    A GLU G  1 136 ? 172.055 8.824   185.458 0.59 44.87  ? 136  GLU G CB    1 
ATOM   5771 C  CB    B GLU G  1 136 ? 172.037 8.817   185.496 0.41 45.43  ? 136  GLU G CB    1 
ATOM   5772 C  CG    A GLU G  1 136 ? 172.270 10.020  184.546 0.59 44.92  ? 136  GLU G CG    1 
ATOM   5773 C  CG    B GLU G  1 136 ? 171.773 10.045  184.641 0.41 45.19  ? 136  GLU G CG    1 
ATOM   5774 C  CD    A GLU G  1 136 ? 171.997 11.343  185.238 0.59 46.82  ? 136  GLU G CD    1 
ATOM   5775 C  CD    B GLU G  1 136 ? 173.018 10.610  183.992 0.41 45.95  ? 136  GLU G CD    1 
ATOM   5776 O  OE1   A GLU G  1 136 ? 171.489 11.327  186.385 0.59 48.55  ? 136  GLU G OE1   1 
ATOM   5777 O  OE1   B GLU G  1 136 ? 173.698 11.432  184.638 0.41 48.22  ? 136  GLU G OE1   1 
ATOM   5778 O  OE2   A GLU G  1 136 ? 172.280 12.400  184.630 0.59 46.67  ? 136  GLU G OE2   1 
ATOM   5779 O  OE2   B GLU G  1 136 ? 173.311 10.250  182.832 0.41 47.42  ? 136  GLU G OE2   1 
ATOM   5780 N  N     . ILE G  1 137 ? 171.179 5.884   186.315 1.00 43.81  ? 137  ILE G N     1 
ATOM   5781 C  CA    . ILE G  1 137 ? 171.238 4.788   187.270 1.00 42.67  ? 137  ILE G CA    1 
ATOM   5782 C  C     . ILE G  1 137 ? 171.612 3.497   186.571 1.00 42.98  ? 137  ILE G C     1 
ATOM   5783 O  O     . ILE G  1 137 ? 172.470 2.748   187.032 1.00 44.33  ? 137  ILE G O     1 
ATOM   5784 C  CB    . ILE G  1 137 ? 169.876 4.599   188.005 1.00 44.97  ? 137  ILE G CB    1 
ATOM   5785 C  CG1   . ILE G  1 137 ? 169.653 5.724   189.019 1.00 46.44  ? 137  ILE G CG1   1 
ATOM   5786 C  CG2   . ILE G  1 137 ? 169.822 3.248   188.669 1.00 43.38  ? 137  ILE G CG2   1 
ATOM   5787 C  CD1   . ILE G  1 137 ? 168.217 5.902   189.466 1.00 45.53  ? 137  ILE G CD1   1 
ATOM   5788 N  N     . VAL G  1 138 ? 170.936 3.230   185.459 1.00 43.43  ? 138  VAL G N     1 
ATOM   5789 C  CA    . VAL G  1 138 ? 171.252 2.077   184.632 1.00 44.52  ? 138  VAL G CA    1 
ATOM   5790 C  C     . VAL G  1 138 ? 172.698 2.151   184.127 1.00 47.62  ? 138  VAL G C     1 
ATOM   5791 O  O     . VAL G  1 138 ? 173.401 1.138   184.034 1.00 44.59  ? 138  VAL G O     1 
ATOM   5792 C  CB    . VAL G  1 138 ? 170.272 1.967   183.442 1.00 47.02  ? 138  VAL G CB    1 
ATOM   5793 C  CG1   . VAL G  1 138 ? 170.746 0.917   182.429 1.00 36.11  ? 138  VAL G CG1   1 
ATOM   5794 C  CG2   . VAL G  1 138 ? 168.837 1.649   183.971 1.00 43.34  ? 138  VAL G CG2   1 
ATOM   5795 N  N     . SER G  1 139 ? 173.155 3.363   183.842 1.00 44.78  ? 139  SER G N     1 
ATOM   5796 C  CA    . SER G  1 139 ? 174.508 3.540   183.350 1.00 47.39  ? 139  SER G CA    1 
ATOM   5797 C  C     . SER G  1 139 ? 175.538 3.109   184.402 1.00 48.69  ? 139  SER G C     1 
ATOM   5798 O  O     . SER G  1 139 ? 176.487 2.377   184.094 1.00 49.08  ? 139  SER G O     1 
ATOM   5799 C  CB    . SER G  1 139 ? 174.732 4.983   182.933 1.00 41.32  ? 139  SER G CB    1 
ATOM   5800 O  OG    . SER G  1 139 ? 176.099 5.181   182.705 1.00 43.10  ? 139  SER G OG    1 
ATOM   5801 N  N     . ARG G  1 140 ? 175.335 3.542   185.639 1.00 41.42  ? 140  ARG G N     1 
ATOM   5802 C  CA    . ARG G  1 140 ? 176.232 3.179   186.733 1.00 49.66  ? 140  ARG G CA    1 
ATOM   5803 C  C     . ARG G  1 140 ? 176.244 1.665   187.022 1.00 51.27  ? 140  ARG G C     1 
ATOM   5804 O  O     . ARG G  1 140 ? 177.318 1.064   187.180 1.00 50.84  ? 140  ARG G O     1 
ATOM   5805 C  CB    . ARG G  1 140 ? 175.857 3.969   187.985 1.00 53.61  ? 140  ARG G CB    1 
ATOM   5806 C  CG    . ARG G  1 140 ? 175.854 5.458   187.719 1.00 50.78  ? 140  ARG G CG    1 
ATOM   5807 C  CD    . ARG G  1 140 ? 175.908 6.269   188.973 1.00 58.69  ? 140  ARG G CD    1 
ATOM   5808 N  NE    . ARG G  1 140 ? 174.600 6.639   189.495 1.00 63.61  ? 140  ARG G NE    1 
ATOM   5809 C  CZ    . ARG G  1 140 ? 174.039 7.832   189.320 1.00 62.79  ? 140  ARG G CZ    1 
ATOM   5810 N  NH1   . ARG G  1 140 ? 174.673 8.782   188.635 1.00 58.23  ? 140  ARG G NH1   1 
ATOM   5811 N  NH2   . ARG G  1 140 ? 172.845 8.078   189.837 1.00 60.39  ? 140  ARG G NH2   1 
ATOM   5812 N  N     . TRP G  1 141 ? 175.065 1.053   187.088 1.00 45.81  ? 141  TRP G N     1 
ATOM   5813 C  CA    . TRP G  1 141 ? 174.977 -0.399  187.171 1.00 44.28  ? 141  TRP G CA    1 
ATOM   5814 C  C     . TRP G  1 141 ? 175.759 -1.088  186.032 1.00 50.53  ? 141  TRP G C     1 
ATOM   5815 O  O     . TRP G  1 141 ? 176.519 -2.022  186.285 1.00 53.96  ? 141  TRP G O     1 
ATOM   5816 C  CB    . TRP G  1 141 ? 173.521 -0.860  187.125 1.00 42.09  ? 141  TRP G CB    1 
ATOM   5817 C  CG    . TRP G  1 141 ? 172.686 -0.482  188.292 1.00 48.99  ? 141  TRP G CG    1 
ATOM   5818 C  CD1   . TRP G  1 141 ? 173.117 -0.041  189.513 1.00 49.03  ? 141  TRP G CD1   1 
ATOM   5819 C  CD2   . TRP G  1 141 ? 171.254 -0.511  188.360 1.00 46.69  ? 141  TRP G CD2   1 
ATOM   5820 N  NE1   . TRP G  1 141 ? 172.048 0.199   190.332 1.00 49.35  ? 141  TRP G NE1   1 
ATOM   5821 C  CE2   . TRP G  1 141 ? 170.891 -0.079  189.654 1.00 50.13  ? 141  TRP G CE2   1 
ATOM   5822 C  CE3   . TRP G  1 141 ? 170.249 -0.862  187.458 1.00 45.51  ? 141  TRP G CE3   1 
ATOM   5823 C  CZ2   . TRP G  1 141 ? 169.556 0.011   190.066 1.00 48.69  ? 141  TRP G CZ2   1 
ATOM   5824 C  CZ3   . TRP G  1 141 ? 168.922 -0.775  187.873 1.00 49.53  ? 141  TRP G CZ3   1 
ATOM   5825 C  CH2   . TRP G  1 141 ? 168.592 -0.344  189.167 1.00 46.32  ? 141  TRP G CH2   1 
ATOM   5826 N  N     . LEU G  1 142 ? 175.557 -0.649  184.786 1.00 43.08  ? 142  LEU G N     1 
ATOM   5827 C  CA    . LEU G  1 142 ? 176.252 -1.255  183.655 1.00 48.26  ? 142  LEU G CA    1 
ATOM   5828 C  C     . LEU G  1 142 ? 177.766 -1.101  183.801 1.00 53.12  ? 142  LEU G C     1 
ATOM   5829 O  O     . LEU G  1 142 ? 178.518 -2.038  183.516 1.00 52.14  ? 142  LEU G O     1 
ATOM   5830 C  CB    . LEU G  1 142 ? 175.801 -0.645  182.321 1.00 45.57  ? 142  LEU G CB    1 
ATOM   5831 C  CG    . LEU G  1 142 ? 174.468 -1.130  181.766 1.00 41.65  ? 142  LEU G CG    1 
ATOM   5832 C  CD1   . LEU G  1 142 ? 174.126 -0.362  180.512 1.00 42.84  ? 142  LEU G CD1   1 
ATOM   5833 C  CD2   . LEU G  1 142 ? 174.514 -2.616  181.500 1.00 46.44  ? 142  LEU G CD2   1 
ATOM   5834 N  N     . ASN G  1 143 ? 178.208 0.073   184.247 1.00 51.67  ? 143  ASN G N     1 
ATOM   5835 C  CA    . ASN G  1 143 ? 179.641 0.326   184.383 1.00 52.36  ? 143  ASN G CA    1 
ATOM   5836 C  C     . ASN G  1 143 ? 180.248 -0.618  185.393 1.00 52.87  ? 143  ASN G C     1 
ATOM   5837 O  O     . ASN G  1 143 ? 181.317 -1.176  185.170 1.00 54.63  ? 143  ASN G O     1 
ATOM   5838 C  CB    . ASN G  1 143 ? 179.923 1.782   184.778 1.00 48.85  ? 143  ASN G CB    1 
ATOM   5839 C  CG    . ASN G  1 143 ? 180.219 2.659   183.568 1.00 53.24  ? 143  ASN G CG    1 
ATOM   5840 O  OD1   . ASN G  1 143 ? 180.815 2.195   182.604 1.00 57.30  ? 143  ASN G OD1   1 
ATOM   5841 N  ND2   . ASN G  1 143 ? 179.820 3.923   183.618 1.00 47.81  ? 143  ASN G ND2   1 
ATOM   5842 N  N     . ASN G  1 144 ? 179.543 -0.835  186.492 1.00 55.58  ? 144  ASN G N     1 
ATOM   5843 C  CA    . ASN G  1 144 ? 180.089 -1.650  187.563 1.00 53.01  ? 144  ASN G CA    1 
ATOM   5844 C  C     . ASN G  1 144 ? 179.956 -3.140  187.234 1.00 53.38  ? 144  ASN G C     1 
ATOM   5845 O  O     . ASN G  1 144 ? 180.597 -3.982  187.851 1.00 57.70  ? 144  ASN G O     1 
ATOM   5846 C  CB    . ASN G  1 144 ? 179.416 -1.280  188.885 1.00 47.49  ? 144  ASN G CB    1 
ATOM   5847 C  CG    . ASN G  1 144 ? 179.673 0.189   189.270 1.00 60.89  ? 144  ASN G CG    1 
ATOM   5848 O  OD1   . ASN G  1 144 ? 180.540 0.846   188.682 1.00 62.01  ? 144  ASN G OD1   1 
ATOM   5849 N  ND2   . ASN G  1 144 ? 178.926 0.702   190.248 1.00 63.06  ? 144  ASN G ND2   1 
ATOM   5850 N  N     . LEU G  1 145 ? 179.145 -3.453  186.229 1.00 54.13  ? 145  LEU G N     1 
ATOM   5851 C  CA    . LEU G  1 145 ? 179.092 -4.803  185.678 1.00 55.10  ? 145  LEU G CA    1 
ATOM   5852 C  C     . LEU G  1 145 ? 180.067 -4.953  184.500 1.00 56.21  ? 145  LEU G C     1 
ATOM   5853 O  O     . LEU G  1 145 ? 180.077 -5.974  183.800 1.00 54.66  ? 145  LEU G O     1 
ATOM   5854 C  CB    . LEU G  1 145 ? 177.669 -5.139  185.230 1.00 56.29  ? 145  LEU G CB    1 
ATOM   5855 C  CG    . LEU G  1 145 ? 176.615 -5.222  186.342 1.00 55.56  ? 145  LEU G CG    1 
ATOM   5856 C  CD1   . LEU G  1 145 ? 175.241 -5.462  185.758 1.00 51.02  ? 145  LEU G CD1   1 
ATOM   5857 C  CD2   . LEU G  1 145 ? 176.973 -6.320  187.318 1.00 51.23  ? 145  LEU G CD2   1 
ATOM   5858 N  N     . GLY G  1 146 ? 180.883 -3.925  184.277 1.00 57.68  ? 146  GLY G N     1 
ATOM   5859 C  CA    . GLY G  1 146 ? 181.897 -3.978  183.238 1.00 54.81  ? 146  GLY G CA    1 
ATOM   5860 C  C     . GLY G  1 146 ? 181.344 -3.774  181.844 1.00 58.78  ? 146  GLY G C     1 
ATOM   5861 O  O     . GLY G  1 146 ? 181.906 -4.263  180.863 1.00 64.94  ? 146  GLY G O     1 
ATOM   5862 N  N     . VAL G  1 147 ? 180.236 -3.047  181.746 1.00 56.07  ? 147  VAL G N     1 
ATOM   5863 C  CA    . VAL G  1 147 ? 179.692 -2.699  180.444 1.00 57.16  ? 147  VAL G CA    1 
ATOM   5864 C  C     . VAL G  1 147 ? 179.745 -1.186  180.287 1.00 57.40  ? 147  VAL G C     1 
ATOM   5865 O  O     . VAL G  1 147 ? 179.100 -0.443  181.037 1.00 53.66  ? 147  VAL G O     1 
ATOM   5866 C  CB    . VAL G  1 147 ? 178.257 -3.235  180.266 1.00 54.91  ? 147  VAL G CB    1 
ATOM   5867 C  CG1   . VAL G  1 147 ? 177.689 -2.836  178.905 1.00 51.63  ? 147  VAL G CG1   1 
ATOM   5868 C  CG2   . VAL G  1 147 ? 178.260 -4.744  180.397 1.00 57.88  ? 147  VAL G CG2   1 
ATOM   5869 N  N     . ARG G  1 148 ? 180.555 -0.743  179.327 1.00 50.91  ? 148  ARG G N     1 
ATOM   5870 C  CA    . ARG G  1 148 ? 180.780 0.679   179.095 1.00 54.23  ? 148  ARG G CA    1 
ATOM   5871 C  C     . ARG G  1 148 ? 179.672 1.235   178.230 1.00 49.00  ? 148  ARG G C     1 
ATOM   5872 O  O     . ARG G  1 148 ? 179.131 0.539   177.376 1.00 48.40  ? 148  ARG G O     1 
ATOM   5873 C  CB    . ARG G  1 148 ? 182.139 0.936   178.426 1.00 53.61  ? 148  ARG G CB    1 
ATOM   5874 C  CG    . ARG G  1 148 ? 183.327 0.900   179.362 1.00 57.78  ? 148  ARG G CG    1 
ATOM   5875 C  CD    . ARG G  1 148 ? 184.628 0.686   178.585 1.00 64.14  ? 148  ARG G CD    1 
ATOM   5876 N  NE    . ARG G  1 148 ? 184.666 -0.610  177.910 1.00 63.11  ? 148  ARG G NE    1 
ATOM   5877 C  CZ    . ARG G  1 148 ? 185.733 -1.099  177.285 1.00 68.70  ? 148  ARG G CZ    1 
ATOM   5878 N  NH1   . ARG G  1 148 ? 186.863 -0.407  177.262 1.00 68.98  ? 148  ARG G NH1   1 
ATOM   5879 N  NH2   . ARG G  1 148 ? 185.673 -2.284  176.688 1.00 62.44  ? 148  ARG G NH2   1 
ATOM   5880 N  N     . ASN G  1 149 ? 179.367 2.507   178.437 1.00 44.50  ? 149  ASN G N     1 
ATOM   5881 C  CA    . ASN G  1 149 ? 178.198 3.109   177.849 1.00 40.43  ? 149  ASN G CA    1 
ATOM   5882 C  C     . ASN G  1 149 ? 178.243 4.614   177.986 1.00 40.51  ? 149  ASN G C     1 
ATOM   5883 O  O     . ASN G  1 149 ? 179.046 5.163   178.739 1.00 41.56  ? 149  ASN G O     1 
ATOM   5884 C  CB    . ASN G  1 149 ? 176.947 2.565   178.524 1.00 40.97  ? 149  ASN G CB    1 
ATOM   5885 C  CG    . ASN G  1 149 ? 176.865 2.975   179.980 1.00 46.56  ? 149  ASN G CG    1 
ATOM   5886 O  OD1   . ASN G  1 149 ? 176.389 4.064   180.300 1.00 46.47  ? 149  ASN G OD1   1 
ATOM   5887 N  ND2   . ASN G  1 149 ? 177.386 2.134   180.864 1.00 48.36  ? 149  ASN G ND2   1 
ATOM   5888 N  N     . THR G  1 150 ? 177.356 5.283   177.273 1.00 38.46  ? 150  THR G N     1 
ATOM   5889 C  CA    . THR G  1 150 ? 177.325 6.736   177.255 1.00 38.54  ? 150  THR G CA    1 
ATOM   5890 C  C     . THR G  1 150 ? 175.896 7.203   177.175 1.00 39.42  ? 150  THR G C     1 
ATOM   5891 O  O     . THR G  1 150 ? 175.053 6.521   176.592 1.00 43.22  ? 150  THR G O     1 
ATOM   5892 C  CB    . THR G  1 150 ? 178.105 7.326   176.047 1.00 47.24  ? 150  THR G CB    1 
ATOM   5893 O  OG1   . THR G  1 150 ? 177.640 6.726   174.822 1.00 48.43  ? 150  THR G OG1   1 
ATOM   5894 C  CG2   . THR G  1 150 ? 179.586 7.082   176.188 1.00 43.59  ? 150  THR G CG2   1 
ATOM   5895 N  N     . ILE G  1 151 ? 175.619 8.378   177.717 1.00 42.77  ? 151  ILE G N     1 
ATOM   5896 C  CA    . ILE G  1 151 ? 174.285 8.929   177.607 1.00 42.80  ? 151  ILE G CA    1 
ATOM   5897 C  C     . ILE G  1 151 ? 174.315 10.294  176.920 1.00 39.05  ? 151  ILE G C     1 
ATOM   5898 O  O     . ILE G  1 151 ? 175.147 11.128  177.244 1.00 42.97  ? 151  ILE G O     1 
ATOM   5899 C  CB    . ILE G  1 151 ? 173.622 9.060   178.992 1.00 40.33  ? 151  ILE G CB    1 
ATOM   5900 C  CG1   . ILE G  1 151 ? 173.371 7.671   179.585 1.00 42.01  ? 151  ILE G CG1   1 
ATOM   5901 C  CG2   . ILE G  1 151 ? 172.301 9.833   178.884 1.00 33.57  ? 151  ILE G CG2   1 
ATOM   5902 C  CD1   . ILE G  1 151 ? 172.987 7.677   181.094 1.00 35.40  ? 151  ILE G CD1   1 
ATOM   5903 N  N     . HIS G  1 152 ? 173.408 10.512  175.969 1.00 38.87  ? 152  HIS G N     1 
ATOM   5904 C  CA    A HIS G  1 152 ? 173.242 11.854  175.424 0.62 44.43  ? 152  HIS G CA    1 
ATOM   5905 C  CA    B HIS G  1 152 ? 173.287 11.779  175.238 0.38 44.43  ? 152  HIS G CA    1 
ATOM   5906 C  C     . HIS G  1 152 ? 171.820 12.066  174.958 1.00 42.59  ? 152  HIS G C     1 
ATOM   5907 O  O     . HIS G  1 152 ? 171.020 11.133  174.894 1.00 44.10  ? 152  HIS G O     1 
ATOM   5908 C  CB    A HIS G  1 152 ? 174.223 12.128  174.265 0.62 43.69  ? 152  HIS G CB    1 
ATOM   5909 C  CB    B HIS G  1 152 ? 174.026 11.751  173.884 0.38 43.14  ? 152  HIS G CB    1 
ATOM   5910 C  CG    A HIS G  1 152 ? 173.852 11.460  172.979 0.62 41.79  ? 152  HIS G CG    1 
ATOM   5911 C  CG    B HIS G  1 152 ? 175.482 11.404  173.962 0.38 43.73  ? 152  HIS G CG    1 
ATOM   5912 N  ND1   A HIS G  1 152 ? 174.181 10.153  172.694 0.62 39.95  ? 152  HIS G ND1   1 
ATOM   5913 N  ND1   B HIS G  1 152 ? 176.474 12.360  174.006 0.38 46.22  ? 152  HIS G ND1   1 
ATOM   5914 C  CD2   A HIS G  1 152 ? 173.184 11.922  171.890 0.62 43.40  ? 152  HIS G CD2   1 
ATOM   5915 C  CD2   B HIS G  1 152 ? 176.114 10.209  173.943 0.38 43.35  ? 152  HIS G CD2   1 
ATOM   5916 C  CE1   A HIS G  1 152 ? 173.730 9.837   171.492 0.62 44.19  ? 152  HIS G CE1   1 
ATOM   5917 C  CE1   B HIS G  1 152 ? 177.653 11.765  174.043 0.38 44.46  ? 152  HIS G CE1   1 
ATOM   5918 N  NE2   A HIS G  1 152 ? 173.121 10.896  170.982 0.62 42.29  ? 152  HIS G NE2   1 
ATOM   5919 N  NE2   B HIS G  1 152 ? 177.464 10.460  174.007 0.38 42.57  ? 152  HIS G NE2   1 
ATOM   5920 N  N     . LEU G  1 153 ? 171.497 13.327  174.697 1.00 41.68  ? 153  LEU G N     1 
ATOM   5921 C  CA    . LEU G  1 153 ? 170.177 13.681  174.214 1.00 42.34  ? 153  LEU G CA    1 
ATOM   5922 C  C     . LEU G  1 153 ? 170.092 13.300  172.738 1.00 47.79  ? 153  LEU G C     1 
ATOM   5923 O  O     . LEU G  1 153 ? 170.748 13.908  171.904 1.00 49.71  ? 153  LEU G O     1 
ATOM   5924 C  CB    . LEU G  1 153 ? 169.879 15.179  174.401 1.00 41.59  ? 153  LEU G CB    1 
ATOM   5925 C  CG    . LEU G  1 153 ? 168.377 15.427  174.177 1.00 50.46  ? 153  LEU G CG    1 
ATOM   5926 C  CD1   . LEU G  1 153 ? 167.611 15.464  175.514 1.00 48.02  ? 153  LEU G CD1   1 
ATOM   5927 C  CD2   . LEU G  1 153 ? 168.070 16.647  173.374 1.00 50.12  ? 153  LEU G CD2   1 
ATOM   5928 N  N     . ASP G  1 154 ? 169.301 12.279  172.435 1.00 47.03  ? 154  ASP G N     1 
ATOM   5929 C  CA    . ASP G  1 154 ? 169.203 11.731  171.093 1.00 41.56  ? 154  ASP G CA    1 
ATOM   5930 C  C     . ASP G  1 154 ? 168.160 12.490  170.263 1.00 49.61  ? 154  ASP G C     1 
ATOM   5931 O  O     . ASP G  1 154 ? 168.468 13.039  169.210 1.00 47.39  ? 154  ASP G O     1 
ATOM   5932 C  CB    . ASP G  1 154 ? 168.853 10.243  171.157 1.00 39.34  ? 154  ASP G CB    1 
ATOM   5933 C  CG    . ASP G  1 154 ? 169.016 9.547   169.816 1.00 47.24  ? 154  ASP G CG    1 
ATOM   5934 O  OD1   . ASP G  1 154 ? 170.066 9.740   169.176 1.00 49.68  ? 154  ASP G OD1   1 
ATOM   5935 O  OD2   . ASP G  1 154 ? 168.107 8.802   169.395 1.00 46.42  ? 154  ASP G OD2   1 
ATOM   5936 N  N     . ASP G  1 155 ? 166.927 12.533  170.755 1.00 46.91  ? 155  ASP G N     1 
ATOM   5937 C  CA    . ASP G  1 155 ? 165.830 13.148  170.027 1.00 38.98  ? 155  ASP G CA    1 
ATOM   5938 C  C     . ASP G  1 155 ? 165.462 14.516  170.604 1.00 48.93  ? 155  ASP G C     1 
ATOM   5939 O  O     . ASP G  1 155 ? 164.752 14.605  171.622 1.00 46.66  ? 155  ASP G O     1 
ATOM   5940 C  CB    . ASP G  1 155 ? 164.624 12.215  170.053 1.00 41.40  ? 155  ASP G CB    1 
ATOM   5941 C  CG    . ASP G  1 155 ? 163.467 12.714  169.208 1.00 47.22  ? 155  ASP G CG    1 
ATOM   5942 O  OD1   . ASP G  1 155 ? 163.501 13.874  168.742 1.00 50.88  ? 155  ASP G OD1   1 
ATOM   5943 O  OD2   . ASP G  1 155 ? 162.498 11.941  169.028 1.00 46.87  ? 155  ASP G OD2   1 
ATOM   5944 N  N     . HIS G  1 156 ? 165.916 15.580  169.937 1.00 49.77  ? 156  HIS G N     1 
ATOM   5945 C  CA    . HIS G  1 156 ? 165.577 16.938  170.349 1.00 47.28  ? 156  HIS G CA    1 
ATOM   5946 C  C     . HIS G  1 156 ? 164.117 17.291  170.050 1.00 51.67  ? 156  HIS G C     1 
ATOM   5947 O  O     . HIS G  1 156 ? 163.625 18.309  170.514 1.00 53.78  ? 156  HIS G O     1 
ATOM   5948 C  CB    . HIS G  1 156 ? 166.496 17.966  169.683 1.00 38.66  ? 156  HIS G CB    1 
ATOM   5949 C  CG    . HIS G  1 156 ? 167.892 17.997  170.239 1.00 48.12  ? 156  HIS G CG    1 
ATOM   5950 N  ND1   . HIS G  1 156 ? 168.834 17.029  169.960 1.00 48.72  ? 156  HIS G ND1   1 
ATOM   5951 C  CD2   . HIS G  1 156 ? 168.513 18.900  171.038 1.00 45.90  ? 156  HIS G CD2   1 
ATOM   5952 C  CE1   . HIS G  1 156 ? 169.970 17.327  170.571 1.00 51.81  ? 156  HIS G CE1   1 
ATOM   5953 N  NE2   . HIS G  1 156 ? 169.803 18.460  171.229 1.00 48.42  ? 156  HIS G NE2   1 
ATOM   5954 N  N     . ARG G  1 157 ? 163.402 16.479  169.283 1.00 48.63  ? 157  ARG G N     1 
ATOM   5955 C  CA    . ARG G  1 157 ? 161.994 16.800  169.076 1.00 49.27  ? 157  ARG G CA    1 
ATOM   5956 C  C     . ARG G  1 157 ? 161.158 16.496  170.328 1.00 54.65  ? 157  ARG G C     1 
ATOM   5957 O  O     . ARG G  1 157 ? 160.141 17.135  170.575 1.00 52.05  ? 157  ARG G O     1 
ATOM   5958 C  CB    . ARG G  1 157 ? 161.417 16.035  167.884 1.00 49.46  ? 157  ARG G CB    1 
ATOM   5959 C  CG    . ARG G  1 157 ? 162.045 16.339  166.512 1.00 48.14  ? 157  ARG G CG    1 
ATOM   5960 C  CD    . ARG G  1 157 ? 161.612 15.257  165.549 1.00 40.44  ? 157  ARG G CD    1 
ATOM   5961 N  NE    . ARG G  1 157 ? 162.088 13.966  166.032 1.00 50.89  ? 157  ARG G NE    1 
ATOM   5962 C  CZ    . ARG G  1 157 ? 161.946 12.805  165.401 1.00 55.76  ? 157  ARG G CZ    1 
ATOM   5963 N  NH1   . ARG G  1 157 ? 161.328 12.747  164.221 1.00 52.85  ? 157  ARG G NH1   1 
ATOM   5964 N  NH2   . ARG G  1 157 ? 162.438 11.696  165.954 1.00 43.20  ? 157  ARG G NH2   1 
ATOM   5965 N  N     . HIS G  1 158 ? 161.588 15.510  171.106 1.00 49.30  ? 158  HIS G N     1 
ATOM   5966 C  CA    . HIS G  1 158 ? 160.779 14.997  172.198 1.00 48.81  ? 158  HIS G CA    1 
ATOM   5967 C  C     . HIS G  1 158 ? 161.553 14.848  173.504 1.00 50.57  ? 158  HIS G C     1 
ATOM   5968 O  O     . HIS G  1 158 ? 161.065 14.226  174.440 1.00 53.70  ? 158  HIS G O     1 
ATOM   5969 C  CB    . HIS G  1 158 ? 160.188 13.638  171.823 1.00 50.99  ? 158  HIS G CB    1 
ATOM   5970 C  CG    . HIS G  1 158 ? 159.178 13.690  170.720 1.00 55.89  ? 158  HIS G CG    1 
ATOM   5971 N  ND1   . HIS G  1 158 ? 159.499 13.427  169.404 1.00 58.30  ? 158  HIS G ND1   1 
ATOM   5972 C  CD2   . HIS G  1 158 ? 157.848 13.943  170.740 1.00 59.47  ? 158  HIS G CD2   1 
ATOM   5973 C  CE1   . HIS G  1 158 ? 158.412 13.533  168.660 1.00 57.40  ? 158  HIS G CE1   1 
ATOM   5974 N  NE2   . HIS G  1 158 ? 157.398 13.845  169.446 1.00 60.23  ? 158  HIS G NE2   1 
ATOM   5975 N  N     . GLY G  1 159 ? 162.762 15.394  173.562 1.00 49.38  ? 159  GLY G N     1 
ATOM   5976 C  CA    . GLY G  1 159 ? 163.574 15.307  174.767 1.00 46.78  ? 159  GLY G CA    1 
ATOM   5977 C  C     . GLY G  1 159 ? 163.917 13.882  175.183 1.00 49.37  ? 159  GLY G C     1 
ATOM   5978 O  O     . GLY G  1 159 ? 164.022 13.584  176.387 1.00 43.21  ? 159  GLY G O     1 
ATOM   5979 N  N     . VAL G  1 160 ? 164.094 13.001  174.193 1.00 49.34  ? 160  VAL G N     1 
ATOM   5980 C  CA    . VAL G  1 160 ? 164.414 11.599  174.467 1.00 46.02  ? 160  VAL G CA    1 
ATOM   5981 C  C     . VAL G  1 160 ? 165.936 11.368  174.497 1.00 47.93  ? 160  VAL G C     1 
ATOM   5982 O  O     . VAL G  1 160 ? 166.658 11.624  173.509 1.00 43.86  ? 160  VAL G O     1 
ATOM   5983 C  CB    . VAL G  1 160 ? 163.738 10.657  173.433 1.00 45.54  ? 160  VAL G CB    1 
ATOM   5984 C  CG1   . VAL G  1 160 ? 164.101 9.204   173.691 1.00 39.97  ? 160  VAL G CG1   1 
ATOM   5985 C  CG2   . VAL G  1 160 ? 162.229 10.816  173.489 1.00 40.23  ? 160  VAL G CG2   1 
ATOM   5986 N  N     . TYR G  1 161 ? 166.425 10.934  175.661 0.98 43.23  ? 161  TYR G N     1 
ATOM   5987 C  CA    . TYR G  1 161 ? 167.826 10.560  175.786 0.98 42.11  ? 161  TYR G CA    1 
ATOM   5988 C  C     . TYR G  1 161 ? 168.012 9.141   175.269 0.98 44.34  ? 161  TYR G C     1 
ATOM   5989 O  O     . TYR G  1 161 ? 167.035 8.374   175.156 0.98 42.30  ? 161  TYR G O     1 
ATOM   5990 C  CB    . TYR G  1 161 ? 168.314 10.655  177.238 0.98 39.08  ? 161  TYR G CB    1 
ATOM   5991 C  CG    . TYR G  1 161 ? 168.387 12.061  177.754 0.98 41.38  ? 161  TYR G CG    1 
ATOM   5992 C  CD1   . TYR G  1 161 ? 167.241 12.699  178.239 1.00 39.52  ? 161  TYR G CD1   1 
ATOM   5993 C  CD2   . TYR G  1 161 ? 169.589 12.762  177.759 1.00 39.70  ? 161  TYR G CD2   1 
ATOM   5994 C  CE1   . TYR G  1 161 ? 167.280 13.994  178.711 1.00 33.70  ? 161  TYR G CE1   1 
ATOM   5995 C  CE2   . TYR G  1 161 ? 169.638 14.071  178.239 1.00 46.48  ? 161  TYR G CE2   1 
ATOM   5996 C  CZ    . TYR G  1 161 ? 168.467 14.675  178.720 0.98 43.53  ? 161  TYR G CZ    1 
ATOM   5997 O  OH    . TYR G  1 161 ? 168.488 15.971  179.175 0.98 44.03  ? 161  TYR G OH    1 
ATOM   5998 N  N     . VAL G  1 162 ? 169.264 8.801   174.955 1.00 40.08  ? 162  VAL G N     1 
ATOM   5999 C  CA    . VAL G  1 162 ? 169.632 7.429   174.643 1.00 33.72  ? 162  VAL G CA    1 
ATOM   6000 C  C     . VAL G  1 162 ? 170.806 7.038   175.509 1.00 36.03  ? 162  VAL G C     1 
ATOM   6001 O  O     . VAL G  1 162 ? 171.682 7.846   175.808 1.00 39.52  ? 162  VAL G O     1 
ATOM   6002 C  CB    . VAL G  1 162 ? 169.991 7.241   173.141 1.00 42.81  ? 162  VAL G CB    1 
ATOM   6003 C  CG1   . VAL G  1 162 ? 171.348 7.875   172.824 1.00 36.27  ? 162  VAL G CG1   1 
ATOM   6004 C  CG2   . VAL G  1 162 ? 169.980 5.767   172.764 1.00 36.86  ? 162  VAL G CG2   1 
ATOM   6005 N  N     . LEU G  1 163 ? 170.788 5.797   175.958 1.00 39.23  ? 163  LEU G N     1 
ATOM   6006 C  CA    . LEU G  1 163 ? 171.950 5.183   176.564 1.00 38.24  ? 163  LEU G CA    1 
ATOM   6007 C  C     . LEU G  1 163 ? 172.553 4.230   175.526 1.00 42.07  ? 163  LEU G C     1 
ATOM   6008 O  O     . LEU G  1 163 ? 171.904 3.272   175.088 1.00 37.73  ? 163  LEU G O     1 
ATOM   6009 C  CB    . LEU G  1 163 ? 171.572 4.444   177.849 1.00 35.61  ? 163  LEU G CB    1 
ATOM   6010 C  CG    . LEU G  1 163 ? 172.697 3.830   178.692 1.00 44.13  ? 163  LEU G CG    1 
ATOM   6011 C  CD1   . LEU G  1 163 ? 172.208 3.559   180.111 1.00 41.07  ? 163  LEU G CD1   1 
ATOM   6012 C  CD2   . LEU G  1 163 ? 173.206 2.533   178.076 1.00 42.76  ? 163  LEU G CD2   1 
ATOM   6013 N  N     . ASN G  1 164 ? 173.791 4.495   175.130 1.00 45.45  ? 164  ASN G N     1 
ATOM   6014 C  CA    . ASN G  1 164 ? 174.460 3.655   174.144 1.00 38.43  ? 164  ASN G CA    1 
ATOM   6015 C  C     . ASN G  1 164 ? 175.392 2.696   174.831 1.00 41.15  ? 164  ASN G C     1 
ATOM   6016 O  O     . ASN G  1 164 ? 176.311 3.116   175.525 1.00 45.03  ? 164  ASN G O     1 
ATOM   6017 C  CB    . ASN G  1 164 ? 175.242 4.501   173.145 1.00 41.73  ? 164  ASN G CB    1 
ATOM   6018 C  CG    . ASN G  1 164 ? 175.747 3.685   171.978 1.00 43.87  ? 164  ASN G CG    1 
ATOM   6019 O  OD1   . ASN G  1 164 ? 174.958 3.201   171.166 1.00 43.16  ? 164  ASN G OD1   1 
ATOM   6020 N  ND2   . ASN G  1 164 ? 177.058 3.486   171.914 1.00 43.52  ? 164  ASN G ND2   1 
ATOM   6021 N  N     . ILE G  1 165 ? 175.143 1.408   174.677 1.00 40.07  ? 165  ILE G N     1 
ATOM   6022 C  CA    . ILE G  1 165 ? 176.051 0.419   175.226 1.00 46.73  ? 165  ILE G CA    1 
ATOM   6023 C  C     . ILE G  1 165 ? 177.183 0.230   174.205 1.00 48.59  ? 165  ILE G C     1 
ATOM   6024 O  O     . ILE G  1 165 ? 176.916 -0.006  173.026 1.00 47.76  ? 165  ILE G O     1 
ATOM   6025 C  CB    . ILE G  1 165 ? 175.326 -0.903  175.517 1.00 42.41  ? 165  ILE G CB    1 
ATOM   6026 C  CG1   . ILE G  1 165 ? 174.422 -0.762  176.745 1.00 50.82  ? 165  ILE G CG1   1 
ATOM   6027 C  CG2   . ILE G  1 165 ? 176.317 -2.027  175.717 1.00 51.17  ? 165  ILE G CG2   1 
ATOM   6028 C  CD1   . ILE G  1 165 ? 172.944 -0.896  176.456 1.00 44.65  ? 165  ILE G CD1   1 
ATOM   6029 N  N     . SER G  1 166 ? 178.434 0.384   174.630 1.00 48.46  ? 166  SER G N     1 
ATOM   6030 C  CA    . SER G  1 166 ? 179.547 0.297   173.677 1.00 55.50  ? 166  SER G CA    1 
ATOM   6031 C  C     . SER G  1 166 ? 179.645 -1.090  173.069 1.00 54.97  ? 166  SER G C     1 
ATOM   6032 O  O     . SER G  1 166 ? 179.612 -2.095  173.788 1.00 51.99  ? 166  SER G O     1 
ATOM   6033 C  CB    . SER G  1 166 ? 180.887 0.646   174.325 1.00 55.41  ? 166  SER G CB    1 
ATOM   6034 O  OG    . SER G  1 166 ? 181.897 0.700   173.320 1.00 60.09  ? 166  SER G OG    1 
ATOM   6035 N  N     . LEU G  1 167 ? 179.782 -1.134  171.745 1.00 53.29  ? 167  LEU G N     1 
ATOM   6036 C  CA    . LEU G  1 167 ? 179.850 -2.403  171.024 1.00 56.25  ? 167  LEU G CA    1 
ATOM   6037 C  C     . LEU G  1 167 ? 181.068 -3.226  171.427 1.00 55.65  ? 167  LEU G C     1 
ATOM   6038 O  O     . LEU G  1 167 ? 181.076 -4.440  171.258 1.00 59.70  ? 167  LEU G O     1 
ATOM   6039 C  CB    . LEU G  1 167 ? 179.836 -2.165  169.515 1.00 55.58  ? 167  LEU G CB    1 
ATOM   6040 C  CG    . LEU G  1 167 ? 178.445 -1.745  169.047 1.00 55.08  ? 167  LEU G CG    1 
ATOM   6041 C  CD1   . LEU G  1 167 ? 178.343 -1.584  167.541 1.00 52.62  ? 167  LEU G CD1   1 
ATOM   6042 C  CD2   . LEU G  1 167 ? 177.417 -2.750  169.559 1.00 57.80  ? 167  LEU G CD2   1 
ATOM   6043 N  N     . ARG G  1 168 ? 182.072 -2.563  171.995 1.00 53.39  ? 168  ARG G N     1 
ATOM   6044 C  CA    . ARG G  1 168 ? 183.245 -3.233  172.549 1.00 52.44  ? 168  ARG G CA    1 
ATOM   6045 C  C     . ARG G  1 168 ? 182.891 -4.262  173.611 1.00 62.47  ? 168  ARG G C     1 
ATOM   6046 O  O     . ARG G  1 168 ? 183.583 -5.264  173.754 1.00 65.12  ? 168  ARG G O     1 
ATOM   6047 C  CB    . ARG G  1 168 ? 184.206 -2.212  173.154 1.00 58.72  ? 168  ARG G CB    1 
ATOM   6048 C  CG    . ARG G  1 168 ? 184.722 -1.170  172.176 1.00 60.77  ? 168  ARG G CG    1 
ATOM   6049 C  CD    . ARG G  1 168 ? 185.593 -0.135  172.887 1.00 65.42  ? 168  ARG G CD    1 
ATOM   6050 N  NE    . ARG G  1 168 ? 184.817 0.655   173.842 1.00 71.51  ? 168  ARG G NE    1 
ATOM   6051 C  CZ    . ARG G  1 168 ? 185.336 1.562   174.664 1.00 71.44  ? 168  ARG G CZ    1 
ATOM   6052 N  NH1   . ARG G  1 168 ? 186.638 1.810   174.647 1.00 73.13  ? 168  ARG G NH1   1 
ATOM   6053 N  NH2   . ARG G  1 168 ? 184.550 2.230   175.497 1.00 71.11  ? 168  ARG G NH2   1 
ATOM   6054 N  N     . ASP G  1 169 ? 181.825 -4.004  174.367 1.00 61.19  ? 169  ASP G N     1 
ATOM   6055 C  CA    . ASP G  1 169 ? 181.440 -4.878  175.466 1.00 54.18  ? 169  ASP G CA    1 
ATOM   6056 C  C     . ASP G  1 169 ? 180.140 -5.618  175.167 1.00 61.61  ? 169  ASP G C     1 
ATOM   6057 O  O     . ASP G  1 169 ? 179.424 -6.061  176.079 1.00 62.44  ? 169  ASP G O     1 
ATOM   6058 C  CB    . ASP G  1 169 ? 181.307 -4.066  176.743 1.00 60.83  ? 169  ASP G CB    1 
ATOM   6059 C  CG    . ASP G  1 169 ? 182.597 -3.390  177.115 1.00 62.63  ? 169  ASP G CG    1 
ATOM   6060 O  OD1   . ASP G  1 169 ? 183.637 -4.077  177.140 1.00 70.61  ? 169  ASP G OD1   1 
ATOM   6061 O  OD2   . ASP G  1 169 ? 182.578 -2.176  177.373 1.00 61.43  ? 169  ASP G OD2   1 
ATOM   6062 N  N     . ARG G  1 170 ? 179.855 -5.732  173.875 1.00 53.87  ? 170  ARG G N     1 
ATOM   6063 C  CA    . ARG G  1 170 ? 178.658 -6.370  173.367 1.00 59.54  ? 170  ARG G CA    1 
ATOM   6064 C  C     . ARG G  1 170 ? 178.413 -7.767  173.916 1.00 67.23  ? 170  ARG G C     1 
ATOM   6065 O  O     . ARG G  1 170 ? 177.295 -8.092  174.338 1.00 68.53  ? 170  ARG G O     1 
ATOM   6066 C  CB    . ARG G  1 170 ? 178.729 -6.451  171.849 1.00 60.10  ? 170  ARG G CB    1 
ATOM   6067 C  CG    . ARG G  1 170 ? 177.813 -7.492  171.268 1.00 60.76  ? 170  ARG G CG    1 
ATOM   6068 C  CD    . ARG G  1 170 ? 178.117 -7.703  169.813 1.00 62.70  ? 170  ARG G CD    1 
ATOM   6069 N  NE    . ARG G  1 170 ? 177.215 -6.963  168.947 1.00 64.61  ? 170  ARG G NE    1 
ATOM   6070 C  CZ    . ARG G  1 170 ? 177.623 -6.101  168.027 1.00 69.81  ? 170  ARG G CZ    1 
ATOM   6071 N  NH1   . ARG G  1 170 ? 178.924 -5.859  167.877 1.00 70.70  ? 170  ARG G NH1   1 
ATOM   6072 N  NH2   . ARG G  1 170 ? 176.731 -5.475  167.265 1.00 62.80  ? 170  ARG G NH2   1 
ATOM   6073 N  N     . ILE G  1 171 ? 179.445 -8.601  173.885 1.00 64.61  ? 171  ILE G N     1 
ATOM   6074 C  CA    . ILE G  1 171 ? 179.300 -9.988  174.311 1.00 64.30  ? 171  ILE G CA    1 
ATOM   6075 C  C     . ILE G  1 171 ? 179.016 -10.059 175.814 1.00 62.49  ? 171  ILE G C     1 
ATOM   6076 O  O     . ILE G  1 171 ? 178.138 -10.804 176.252 1.00 62.54  ? 171  ILE G O     1 
ATOM   6077 C  CB    . ILE G  1 171 ? 180.553 -10.819 173.950 1.00 63.25  ? 171  ILE G CB    1 
ATOM   6078 C  CG1   . ILE G  1 171 ? 180.603 -11.057 172.438 1.00 68.44  ? 171  ILE G CG1   1 
ATOM   6079 C  CG2   . ILE G  1 171 ? 180.555 -12.143 174.689 1.00 63.05  ? 171  ILE G CG2   1 
ATOM   6080 C  CD1   . ILE G  1 171 ? 181.788 -11.890 171.974 1.00 72.28  ? 171  ILE G CD1   1 
ATOM   6081 N  N     . LYS G  1 172 ? 179.737 -9.264  176.598 1.00 59.66  ? 172  LYS G N     1 
ATOM   6082 C  CA    . LYS G  1 172 ? 179.484 -9.221  178.033 1.00 60.41  ? 172  LYS G CA    1 
ATOM   6083 C  C     . LYS G  1 172 ? 178.065 -8.742  178.320 1.00 66.95  ? 172  LYS G C     1 
ATOM   6084 O  O     . LYS G  1 172 ? 177.446 -9.184  179.282 1.00 61.70  ? 172  LYS G O     1 
ATOM   6085 C  CB    . LYS G  1 172 ? 180.485 -8.314  178.750 1.00 63.73  ? 172  LYS G CB    1 
ATOM   6086 C  CG    . LYS G  1 172 ? 180.365 -8.328  180.275 1.00 66.37  ? 172  LYS G CG    1 
ATOM   6087 C  CD    . LYS G  1 172 ? 181.367 -7.364  180.906 1.00 69.95  ? 172  LYS G CD    1 
ATOM   6088 C  CE    . LYS G  1 172 ? 182.789 -7.624  180.386 1.00 74.27  ? 172  LYS G CE    1 
ATOM   6089 N  NZ    . LYS G  1 172 ? 183.750 -6.491  180.615 1.00 71.98  ? 172  LYS G NZ    1 
ATOM   6090 N  N     . PHE G  1 173 ? 177.546 -7.839  177.494 1.00 61.15  ? 173  PHE G N     1 
ATOM   6091 C  CA    . PHE G  1 173 ? 176.218 -7.318  177.763 1.00 63.09  ? 173  PHE G CA    1 
ATOM   6092 C  C     . PHE G  1 173 ? 175.157 -8.370  177.433 1.00 64.50  ? 173  PHE G C     1 
ATOM   6093 O  O     . PHE G  1 173 ? 174.289 -8.682  178.253 1.00 61.03  ? 173  PHE G O     1 
ATOM   6094 C  CB    . PHE G  1 173 ? 175.958 -6.022  176.986 1.00 55.91  ? 173  PHE G CB    1 
ATOM   6095 C  CG    . PHE G  1 173 ? 174.558 -5.478  177.166 1.00 56.27  ? 173  PHE G CG    1 
ATOM   6096 C  CD1   . PHE G  1 173 ? 174.147 -4.959  178.384 1.00 55.75  ? 173  PHE G CD1   1 
ATOM   6097 C  CD2   . PHE G  1 173 ? 173.646 -5.516  176.121 1.00 51.29  ? 173  PHE G CD2   1 
ATOM   6098 C  CE1   . PHE G  1 173 ? 172.856 -4.480  178.553 1.00 58.09  ? 173  PHE G CE1   1 
ATOM   6099 C  CE2   . PHE G  1 173 ? 172.362 -5.032  176.278 1.00 53.74  ? 173  PHE G CE2   1 
ATOM   6100 C  CZ    . PHE G  1 173 ? 171.959 -4.513  177.496 1.00 52.68  ? 173  PHE G CZ    1 
ATOM   6101 N  N     . VAL G  1 174 ? 175.250 -8.932  176.237 1.00 64.20  ? 174  VAL G N     1 
ATOM   6102 C  CA    . VAL G  1 174 ? 174.232 -9.842  175.746 1.00 61.54  ? 174  VAL G CA    1 
ATOM   6103 C  C     . VAL G  1 174 ? 174.148 -11.108 176.615 1.00 69.35  ? 174  VAL G C     1 
ATOM   6104 O  O     . VAL G  1 174 ? 173.114 -11.769 176.656 1.00 67.37  ? 174  VAL G O     1 
ATOM   6105 C  CB    . VAL G  1 174 ? 174.506 -10.190 174.263 1.00 65.06  ? 174  VAL G CB    1 
ATOM   6106 C  CG1   . VAL G  1 174 ? 173.519 -11.204 173.737 1.00 66.89  ? 174  VAL G CG1   1 
ATOM   6107 C  CG2   . VAL G  1 174 ? 174.437 -8.929  173.420 1.00 58.15  ? 174  VAL G CG2   1 
ATOM   6108 N  N     . HIS G  1 175 ? 175.211 -11.422 177.352 1.00 68.85  ? 175  HIS G N     1 
ATOM   6109 C  CA    . HIS G  1 175 ? 175.248 -12.699 178.056 1.00 67.73  ? 175  HIS G CA    1 
ATOM   6110 C  C     . HIS G  1 175 ? 175.036 -12.606 179.573 1.00 73.34  ? 175  HIS G C     1 
ATOM   6111 O  O     . HIS G  1 175 ? 174.552 -13.553 180.203 1.00 75.01  ? 175  HIS G O     1 
ATOM   6112 C  CB    . HIS G  1 175 ? 176.559 -13.418 177.740 1.00 72.92  ? 175  HIS G CB    1 
ATOM   6113 C  CG    . HIS G  1 175 ? 176.531 -14.131 176.410 1.00 86.17  ? 175  HIS G CG    1 
ATOM   6114 N  ND1   . HIS G  1 175 ? 175.359 -14.533 175.819 1.00 83.15  ? 175  HIS G ND1   1 
ATOM   6115 C  CD2   . HIS G  1 175 ? 177.536 -14.500 175.579 1.00 84.88  ? 175  HIS G CD2   1 
ATOM   6116 C  CE1   . HIS G  1 175 ? 175.637 -15.129 174.662 1.00 87.60  ? 175  HIS G CE1   1 
ATOM   6117 N  NE2   . HIS G  1 175 ? 176.940 -15.120 174.496 1.00 92.35  ? 175  HIS G NE2   1 
ATOM   6118 N  N     . THR G  1 176 ? 175.352 -11.463 180.159 0.94 67.12  ? 176  THR G N     1 
ATOM   6119 C  CA    . THR G  1 176 ? 175.126 -11.288 181.586 0.94 70.21  ? 176  THR G CA    1 
ATOM   6120 C  C     . THR G  1 176 ? 173.803 -10.571 181.896 0.94 70.94  ? 176  THR G C     1 
ATOM   6121 O  O     . THR G  1 176 ? 173.240 -10.745 182.981 0.94 70.03  ? 176  THR G O     1 
ATOM   6122 C  CB    . THR G  1 176 ? 176.295 -10.524 182.236 0.94 74.27  ? 176  THR G CB    1 
ATOM   6123 O  OG1   . THR G  1 176 ? 176.899 -9.669  181.259 1.00 72.09  ? 176  THR G OG1   1 
ATOM   6124 C  CG2   . THR G  1 176 ? 177.343 -11.488 182.753 1.00 80.79  ? 176  THR G CG2   1 
ATOM   6125 N  N     . ILE G  1 177 ? 173.311 -9.781  180.944 1.00 63.75  ? 177  ILE G N     1 
ATOM   6126 C  CA    . ILE G  1 177 ? 172.036 -9.094  181.100 1.00 61.38  ? 177  ILE G CA    1 
ATOM   6127 C  C     . ILE G  1 177 ? 170.910 -9.786  180.363 1.00 67.85  ? 177  ILE G C     1 
ATOM   6128 O  O     . ILE G  1 177 ? 169.948 -10.254 180.974 1.00 71.84  ? 177  ILE G O     1 
ATOM   6129 C  CB    . ILE G  1 177 ? 172.082 -7.650  180.579 1.00 63.55  ? 177  ILE G CB    1 
ATOM   6130 C  CG1   . ILE G  1 177 ? 173.170 -6.840  181.282 1.00 64.37  ? 177  ILE G CG1   1 
ATOM   6131 C  CG2   . ILE G  1 177 ? 170.704 -6.993  180.714 1.00 57.98  ? 177  ILE G CG2   1 
ATOM   6132 C  CD1   . ILE G  1 177 ? 172.954 -6.694  182.760 1.00 61.60  ? 177  ILE G CD1   1 
ATOM   6133 N  N     . LEU G  1 178 ? 171.014 -9.818  179.039 1.00 66.00  ? 178  LEU G N     1 
ATOM   6134 C  CA    . LEU G  1 178 ? 169.920 -10.315 178.221 1.00 65.04  ? 178  LEU G CA    1 
ATOM   6135 C  C     . LEU G  1 178 ? 169.808 -11.835 178.318 1.00 69.89  ? 178  LEU G C     1 
ATOM   6136 O  O     . LEU G  1 178 ? 168.728 -12.387 178.157 1.00 77.05  ? 178  LEU G O     1 
ATOM   6137 C  CB    . LEU G  1 178 ? 170.101 -9.862  176.768 1.00 62.69  ? 178  LEU G CB    1 
ATOM   6138 C  CG    . LEU G  1 178 ? 170.056 -8.341  176.567 1.00 59.72  ? 178  LEU G CG    1 
ATOM   6139 C  CD1   . LEU G  1 178 ? 170.089 -7.995  175.097 1.00 63.27  ? 178  LEU G CD1   1 
ATOM   6140 C  CD2   . LEU G  1 178 ? 168.816 -7.730  177.211 1.00 59.01  ? 178  LEU G CD2   1 
ATOM   6141 N  N     . SER G  1 179 ? 170.919 -12.503 178.612 1.00 74.53  ? 179  SER G N     1 
ATOM   6142 C  CA    . SER G  1 179 ? 170.951 -13.967 178.707 1.00 76.75  ? 179  SER G CA    1 
ATOM   6143 C  C     . SER G  1 179 ? 171.204 -14.437 180.140 1.00 75.75  ? 179  SER G C     1 
ATOM   6144 O  O     . SER G  1 179 ? 170.391 -14.209 181.034 1.00 82.92  ? 179  SER G O     1 
ATOM   6145 C  CB    . SER G  1 179 ? 172.030 -14.543 177.778 1.00 75.62  ? 179  SER G CB    1 
ATOM   6146 O  OG    . SER G  1 179 ? 171.848 -14.104 176.436 1.00 77.50  ? 179  SER G OG    1 
ATOM   6147 O  "O5'" . DG  H  2 1   ? 190.389 1.331   151.794 1.00 77.80  ? 1    DG  H "O5'" 1 
ATOM   6148 C  "C5'" . DG  H  2 1   ? 189.063 0.770   151.635 1.00 86.13  ? 1    DG  H "C5'" 1 
ATOM   6149 C  "C4'" . DG  H  2 1   ? 188.900 -0.514  152.457 1.00 91.56  ? 1    DG  H "C4'" 1 
ATOM   6150 O  "O4'" . DG  H  2 1   ? 189.516 -0.339  153.752 1.00 94.29  ? 1    DG  H "O4'" 1 
ATOM   6151 C  "C3'" . DG  H  2 1   ? 187.464 -0.912  152.787 1.00 90.17  ? 1    DG  H "C3'" 1 
ATOM   6152 O  "O3'" . DG  H  2 1   ? 187.414 -2.320  153.155 1.00 86.48  ? 1    DG  H "O3'" 1 
ATOM   6153 C  "C2'" . DG  H  2 1   ? 187.177 -0.017  153.997 1.00 86.98  ? 1    DG  H "C2'" 1 
ATOM   6154 C  "C1'" . DG  H  2 1   ? 188.545 0.073   154.669 1.00 84.99  ? 1    DG  H "C1'" 1 
ATOM   6155 N  N9    . DG  H  2 1   ? 188.932 1.350   155.220 1.00 78.42  ? 1    DG  H N9    1 
ATOM   6156 C  C8    . DG  H  2 1   ? 188.854 2.572   154.609 1.00 72.98  ? 1    DG  H C8    1 
ATOM   6157 N  N7    . DG  H  2 1   ? 189.308 3.585   155.325 1.00 70.25  ? 1    DG  H N7    1 
ATOM   6158 C  C5    . DG  H  2 1   ? 189.740 2.964   156.494 1.00 70.08  ? 1    DG  H C5    1 
ATOM   6159 C  C6    . DG  H  2 1   ? 190.333 3.515   157.653 1.00 68.34  ? 1    DG  H C6    1 
ATOM   6160 O  O6    . DG  H  2 1   ? 190.601 4.705   157.913 1.00 67.64  ? 1    DG  H O6    1 
ATOM   6161 N  N1    . DG  H  2 1   ? 190.621 2.552   158.577 1.00 64.58  ? 1    DG  H N1    1 
ATOM   6162 C  C2    . DG  H  2 1   ? 190.374 1.212   158.455 1.00 68.16  ? 1    DG  H C2    1 
ATOM   6163 N  N2    . DG  H  2 1   ? 190.754 0.449   159.554 1.00 68.96  ? 1    DG  H N2    1 
ATOM   6164 N  N3    . DG  H  2 1   ? 189.819 0.646   157.352 1.00 68.09  ? 1    DG  H N3    1 
ATOM   6165 C  C4    . DG  H  2 1   ? 189.528 1.570   156.429 1.00 73.13  ? 1    DG  H C4    1 
ATOM   6166 P  P     . DC  H  2 2   ? 186.061 -2.998  153.722 1.00 107.33 ? 2    DC  H P     1 
ATOM   6167 O  OP1   . DC  H  2 2   ? 186.133 -4.480  153.585 1.00 86.33  ? 2    DC  H OP1   1 
ATOM   6168 O  OP2   . DC  H  2 2   ? 184.898 -2.252  153.180 1.00 93.05  ? 2    DC  H OP2   1 
ATOM   6169 O  "O5'" . DC  H  2 2   ? 186.132 -2.715  155.287 1.00 93.56  ? 2    DC  H "O5'" 1 
ATOM   6170 C  "C5'" . DC  H  2 2   ? 186.559 -3.739  156.170 1.00 87.63  ? 2    DC  H "C5'" 1 
ATOM   6171 C  "C4'" . DC  H  2 2   ? 186.539 -3.226  157.592 1.00 83.12  ? 2    DC  H "C4'" 1 
ATOM   6172 O  "O4'" . DC  H  2 2   ? 187.027 -1.868  157.602 1.00 86.49  ? 2    DC  H "O4'" 1 
ATOM   6173 C  "C3'" . DC  H  2 2   ? 185.151 -3.174  158.218 1.00 76.93  ? 2    DC  H "C3'" 1 
ATOM   6174 O  "O3'" . DC  H  2 2   ? 185.098 -4.067  159.296 1.00 76.12  ? 2    DC  H "O3'" 1 
ATOM   6175 C  "C2'" . DC  H  2 2   ? 184.963 -1.708  158.660 1.00 73.31  ? 2    DC  H "C2'" 1 
ATOM   6176 C  "C1'" . DC  H  2 2   ? 186.382 -1.152  158.609 1.00 74.85  ? 2    DC  H "C1'" 1 
ATOM   6177 N  N1    . DC  H  2 2   ? 186.469 0.311   158.276 1.00 67.45  ? 2    DC  H N1    1 
ATOM   6178 C  C2    . DC  H  2 2   ? 187.020 1.191   159.205 1.00 66.65  ? 2    DC  H C2    1 
ATOM   6179 O  O2    . DC  H  2 2   ? 187.429 0.741   160.284 1.00 69.70  ? 2    DC  H O2    1 
ATOM   6180 N  N3    . DC  H  2 2   ? 187.094 2.517   158.900 1.00 64.03  ? 2    DC  H N3    1 
ATOM   6181 C  C4    . DC  H  2 2   ? 186.641 2.961   157.723 1.00 66.59  ? 2    DC  H C4    1 
ATOM   6182 N  N4    . DC  H  2 2   ? 186.734 4.277   157.469 1.00 64.14  ? 2    DC  H N4    1 
ATOM   6183 C  C5    . DC  H  2 2   ? 186.072 2.075   156.761 1.00 63.52  ? 2    DC  H C5    1 
ATOM   6184 C  C6    . DC  H  2 2   ? 186.009 0.770   157.080 1.00 68.38  ? 2    DC  H C6    1 
ATOM   6185 P  P     . DC  H  2 3   ? 183.682 -4.454  159.942 1.00 93.74  ? 3    DC  H P     1 
ATOM   6186 O  OP1   . DC  H  2 3   ? 183.703 -5.902  160.281 1.00 85.83  ? 3    DC  H OP1   1 
ATOM   6187 O  OP2   . DC  H  2 3   ? 182.625 -3.884  159.067 1.00 83.86  ? 3    DC  H OP2   1 
ATOM   6188 O  "O5'" . DC  H  2 3   ? 183.674 -3.632  161.304 1.00 85.87  ? 3    DC  H "O5'" 1 
ATOM   6189 C  "C5'" . DC  H  2 3   ? 184.796 -3.695  162.157 1.00 81.40  ? 3    DC  H "C5'" 1 
ATOM   6190 C  "C4'" . DC  H  2 3   ? 184.738 -2.587  163.179 1.00 77.10  ? 3    DC  H "C4'" 1 
ATOM   6191 O  "O4'" . DC  H  2 3   ? 185.032 -1.328  162.534 1.00 75.90  ? 3    DC  H "O4'" 1 
ATOM   6192 C  "C3'" . DC  H  2 3   ? 183.380 -2.431  163.866 1.00 68.20  ? 3    DC  H "C3'" 1 
ATOM   6193 O  "O3'" . DC  H  2 3   ? 183.549 -2.682  165.251 1.00 73.61  ? 3    DC  H "O3'" 1 
ATOM   6194 C  "C2'" . DC  H  2 3   ? 182.953 -0.977  163.554 1.00 69.10  ? 3    DC  H "C2'" 1 
ATOM   6195 C  "C1'" . DC  H  2 3   ? 184.262 -0.313  163.112 1.00 70.11  ? 3    DC  H "C1'" 1 
ATOM   6196 N  N1    . DC  H  2 3   ? 184.096 0.770   162.087 1.00 63.68  ? 3    DC  H N1    1 
ATOM   6197 C  C2    . DC  H  2 3   ? 184.477 2.082   162.393 1.00 66.62  ? 3    DC  H C2    1 
ATOM   6198 O  O2    . DC  H  2 3   ? 184.942 2.329   163.519 1.00 65.47  ? 3    DC  H O2    1 
ATOM   6199 N  N3    . DC  H  2 3   ? 184.325 3.051   161.444 1.00 64.51  ? 3    DC  H N3    1 
ATOM   6200 C  C4    . DC  H  2 3   ? 183.826 2.742   160.240 1.00 63.92  ? 3    DC  H C4    1 
ATOM   6201 N  N4    . DC  H  2 3   ? 183.689 3.730   159.343 1.00 62.31  ? 3    DC  H N4    1 
ATOM   6202 C  C5    . DC  H  2 3   ? 183.436 1.409   159.914 1.00 63.16  ? 3    DC  H C5    1 
ATOM   6203 C  C6    . DC  H  2 3   ? 183.591 0.466   160.858 1.00 66.29  ? 3    DC  H C6    1 
ATOM   6204 P  P     . DT  H  2 4   ? 182.306 -2.719  166.276 1.00 78.14  ? 4    DT  H P     1 
ATOM   6205 O  OP1   . DT  H  2 4   ? 182.729 -3.503  167.462 1.00 66.94  ? 4    DT  H OP1   1 
ATOM   6206 O  OP2   . DT  H  2 4   ? 181.052 -3.095  165.579 1.00 74.55  ? 4    DT  H OP2   1 
ATOM   6207 O  "O5'" . DT  H  2 4   ? 182.195 -1.195  166.727 1.00 69.65  ? 4    DT  H "O5'" 1 
ATOM   6208 C  "C5'" . DT  H  2 4   ? 183.323 -0.550  167.269 1.00 59.85  ? 4    DT  H "C5'" 1 
ATOM   6209 C  "C4'" . DT  H  2 4   ? 183.053 0.924   167.454 1.00 61.30  ? 4    DT  H "C4'" 1 
ATOM   6210 O  "O4'" . DT  H  2 4   ? 182.968 1.557   166.175 1.00 57.72  ? 4    DT  H "O4'" 1 
ATOM   6211 C  "C3'" . DT  H  2 4   ? 181.740 1.266   168.183 1.00 55.47  ? 4    DT  H "C3'" 1 
ATOM   6212 O  "O3'" . DT  H  2 4   ? 182.055 1.907   169.402 1.00 65.09  ? 4    DT  H "O3'" 1 
ATOM   6213 C  "C2'" . DT  H  2 4   ? 180.996 2.208   167.217 1.00 51.48  ? 4    DT  H "C2'" 1 
ATOM   6214 C  "C1'" . DT  H  2 4   ? 182.114 2.658   166.285 1.00 57.48  ? 4    DT  H "C1'" 1 
ATOM   6215 N  N1    . DT  H  2 4   ? 181.688 2.985   164.938 1.00 55.82  ? 4    DT  H N1    1 
ATOM   6216 C  C2    . DT  H  2 4   ? 181.773 4.278   164.515 1.00 59.83  ? 4    DT  H C2    1 
ATOM   6217 O  O2    . DT  H  2 4   ? 182.155 5.184   165.237 1.00 59.21  ? 4    DT  H O2    1 
ATOM   6218 N  N3    . DT  H  2 4   ? 181.386 4.480   163.208 1.00 60.94  ? 4    DT  H N3    1 
ATOM   6219 C  C4    . DT  H  2 4   ? 180.939 3.517   162.316 1.00 59.93  ? 4    DT  H C4    1 
ATOM   6220 O  O4    . DT  H  2 4   ? 180.603 3.781   161.168 1.00 65.23  ? 4    DT  H O4    1 
ATOM   6221 C  C5    . DT  H  2 4   ? 180.881 2.178   162.837 1.00 59.33  ? 4    DT  H C5    1 
ATOM   6222 C  C7    . DT  H  2 4   ? 180.400 1.057   161.971 1.00 61.89  ? 4    DT  H C7    1 
ATOM   6223 C  C6    . DT  H  2 4   ? 181.262 1.978   164.105 1.00 59.49  ? 4    DT  H C6    1 
ATOM   6224 P  P     . DT  H  2 5   ? 180.939 2.185   170.533 1.00 54.07  ? 5    DT  H P     1 
ATOM   6225 O  OP1   . DT  H  2 5   ? 181.715 2.390   171.765 1.00 46.27  ? 5    DT  H OP1   1 
ATOM   6226 O  OP2   . DT  H  2 5   ? 179.861 1.163   170.479 1.00 52.63  ? 5    DT  H OP2   1 
ATOM   6227 O  "O5'" . DT  H  2 5   ? 180.276 3.553   170.063 1.00 47.20  ? 5    DT  H "O5'" 1 
ATOM   6228 C  "C5'" . DT  H  2 5   ? 180.962 4.752   170.234 1.00 46.82  ? 5    DT  H "C5'" 1 
ATOM   6229 C  "C4'" . DT  H  2 5   ? 180.228 5.874   169.543 1.00 50.30  ? 5    DT  H "C4'" 1 
ATOM   6230 O  "O4'" . DT  H  2 5   ? 180.105 5.568   168.128 1.00 55.38  ? 5    DT  H "O4'" 1 
ATOM   6231 C  "C3'" . DT  H  2 5   ? 178.790 6.145   170.044 1.00 51.74  ? 5    DT  H "C3'" 1 
ATOM   6232 O  "O3'" . DT  H  2 5   ? 178.621 7.547   170.203 1.00 54.45  ? 5    DT  H "O3'" 1 
ATOM   6233 C  "C2'" . DT  H  2 5   ? 177.921 5.630   168.890 1.00 52.40  ? 5    DT  H "C2'" 1 
ATOM   6234 C  "C1'" . DT  H  2 5   ? 178.833 5.986   167.718 1.00 53.74  ? 5    DT  H "C1'" 1 
ATOM   6235 N  N1    . DT  H  2 5   ? 178.506 5.348   166.436 1.00 53.23  ? 5    DT  H N1    1 
ATOM   6236 C  C2    . DT  H  2 5   ? 178.540 6.126   165.303 1.00 58.05  ? 5    DT  H C2    1 
ATOM   6237 O  O2    . DT  H  2 5   ? 178.834 7.315   165.327 1.00 55.54  ? 5    DT  H O2    1 
ATOM   6238 N  N3    . DT  H  2 5   ? 178.218 5.468   164.135 1.00 53.36  ? 5    DT  H N3    1 
ATOM   6239 C  C4    . DT  H  2 5   ? 177.885 4.134   163.993 1.00 54.80  ? 5    DT  H C4    1 
ATOM   6240 O  O4    . DT  H  2 5   ? 177.613 3.638   162.893 1.00 54.22  ? 5    DT  H O4    1 
ATOM   6241 C  C5    . DT  H  2 5   ? 177.860 3.367   165.234 1.00 56.54  ? 5    DT  H C5    1 
ATOM   6242 C  C7    . DT  H  2 5   ? 177.500 1.913   165.214 1.00 50.66  ? 5    DT  H C7    1 
ATOM   6243 C  C6    . DT  H  2 5   ? 178.171 4.005   166.384 1.00 51.84  ? 5    DT  H C6    1 
ATOM   6244 P  P     . DG  H  2 6   ? 177.584 8.163   171.268 1.00 56.38  ? 6    DG  H P     1 
ATOM   6245 O  OP1   . DG  H  2 6   ? 178.298 8.263   172.555 1.00 52.21  ? 6    DG  H OP1   1 
ATOM   6246 O  OP2   . DG  H  2 6   ? 176.286 7.459   171.189 1.00 52.78  ? 6    DG  H OP2   1 
ATOM   6247 O  "O5'" . DG  H  2 6   ? 177.318 9.630   170.706 1.00 54.39  ? 6    DG  H "O5'" 1 
ATOM   6248 C  "C5'" . DG  H  2 6   ? 178.401 10.499  170.412 1.00 45.57  ? 6    DG  H "C5'" 1 
ATOM   6249 C  "C4'" . DG  H  2 6   ? 178.030 11.417  169.265 1.00 50.30  ? 6    DG  H "C4'" 1 
ATOM   6250 O  "O4'" . DG  H  2 6   ? 177.952 10.652  168.032 1.00 51.20  ? 6    DG  H "O4'" 1 
ATOM   6251 C  "C3'" . DG  H  2 6   ? 176.689 12.120  169.402 1.00 54.64  ? 6    DG  H "C3'" 1 
ATOM   6252 O  "O3'" . DG  H  2 6   ? 176.810 13.432  168.903 1.00 54.76  ? 6    DG  H "O3'" 1 
ATOM   6253 C  "C2'" . DG  H  2 6   ? 175.756 11.272  168.538 1.00 51.84  ? 6    DG  H "C2'" 1 
ATOM   6254 C  "C1'" . DG  H  2 6   ? 176.690 10.817  167.430 1.00 52.92  ? 6    DG  H "C1'" 1 
ATOM   6255 N  N9    . DG  H  2 6   ? 176.305 9.536   166.840 1.00 55.54  ? 6    DG  H N9    1 
ATOM   6256 C  C8    . DG  H  2 6   ? 176.141 8.340   167.499 1.00 54.54  ? 6    DG  H C8    1 
ATOM   6257 N  N7    . DG  H  2 6   ? 175.779 7.357   166.718 1.00 52.04  ? 6    DG  H N7    1 
ATOM   6258 C  C5    . DG  H  2 6   ? 175.715 7.931   165.460 1.00 55.20  ? 6    DG  H C5    1 
ATOM   6259 C  C6    . DG  H  2 6   ? 175.387 7.348   164.213 1.00 56.92  ? 6    DG  H C6    1 
ATOM   6260 O  O6    . DG  H  2 6   ? 175.076 6.174   163.977 1.00 55.50  ? 6    DG  H O6    1 
ATOM   6261 N  N1    . DG  H  2 6   ? 175.425 8.285   163.180 1.00 60.93  ? 6    DG  H N1    1 
ATOM   6262 C  C2    . DG  H  2 6   ? 175.761 9.618   163.339 1.00 61.41  ? 6    DG  H C2    1 
ATOM   6263 N  N2    . DG  H  2 6   ? 175.755 10.374  162.230 1.00 59.86  ? 6    DG  H N2    1 
ATOM   6264 N  N3    . DG  H  2 6   ? 176.075 10.172  164.510 1.00 58.42  ? 6    DG  H N3    1 
ATOM   6265 C  C4    . DG  H  2 6   ? 176.035 9.275   165.517 1.00 52.80  ? 6    DG  H C4    1 
ATOM   6266 P  P     . DC  H  2 7   ? 175.613 14.482  169.053 1.00 56.13  ? 7    DC  H P     1 
ATOM   6267 O  OP1   . DC  H  2 7   ? 176.247 15.806  169.221 1.00 60.29  ? 7    DC  H OP1   1 
ATOM   6268 O  OP2   . DC  H  2 7   ? 174.657 13.958  170.062 1.00 63.18  ? 7    DC  H OP2   1 
ATOM   6269 O  "O5'" . DC  H  2 7   ? 174.853 14.408  167.667 1.00 51.51  ? 7    DC  H "O5'" 1 
ATOM   6270 C  "C5'" . DC  H  2 7   ? 175.519 14.770  166.492 1.00 58.78  ? 7    DC  H "C5'" 1 
ATOM   6271 C  "C4'" . DC  H  2 7   ? 174.614 14.554  165.311 1.00 57.32  ? 7    DC  H "C4'" 1 
ATOM   6272 O  "O4'" . DC  H  2 7   ? 174.477 13.140  165.080 1.00 59.37  ? 7    DC  H "O4'" 1 
ATOM   6273 C  "C3'" . DC  H  2 7   ? 173.186 15.088  165.491 1.00 58.32  ? 7    DC  H "C3'" 1 
ATOM   6274 O  "O3'" . DC  H  2 7   ? 172.904 15.997  164.457 1.00 58.82  ? 7    DC  H "O3'" 1 
ATOM   6275 C  "C2'" . DC  H  2 7   ? 172.304 13.834  165.392 1.00 58.06  ? 7    DC  H "C2'" 1 
ATOM   6276 C  "C1'" . DC  H  2 7   ? 173.192 12.905  164.588 1.00 56.72  ? 7    DC  H "C1'" 1 
ATOM   6277 N  N1    . DC  H  2 7   ? 172.894 11.462  164.757 1.00 56.87  ? 7    DC  H N1    1 
ATOM   6278 C  C2    . DC  H  2 7   ? 172.468 10.717  163.656 1.00 59.30  ? 7    DC  H C2    1 
ATOM   6279 O  O2    . DC  H  2 7   ? 172.331 11.284  162.563 1.00 61.73  ? 7    DC  H O2    1 
ATOM   6280 N  N3    . DC  H  2 7   ? 172.205 9.398   163.817 1.00 58.11  ? 7    DC  H N3    1 
ATOM   6281 C  C4    . DC  H  2 7   ? 172.373 8.826   165.006 1.00 54.90  ? 7    DC  H C4    1 
ATOM   6282 N  N4    . DC  H  2 7   ? 172.111 7.521   165.110 1.00 52.12  ? 7    DC  H N4    1 
ATOM   6283 C  C5    . DC  H  2 7   ? 172.812 9.567   166.141 1.00 56.12  ? 7    DC  H C5    1 
ATOM   6284 C  C6    . DC  H  2 7   ? 173.062 10.869  165.971 1.00 55.74  ? 7    DC  H C6    1 
ATOM   6285 P  P     . DC  H  2 8   ? 171.695 17.036  164.589 1.00 62.25  ? 8    DC  H P     1 
ATOM   6286 O  OP1   . DC  H  2 8   ? 171.999 18.258  163.813 1.00 64.71  ? 8    DC  H OP1   1 
ATOM   6287 O  OP2   . DC  H  2 8   ? 171.402 17.134  166.032 1.00 65.66  ? 8    DC  H OP2   1 
ATOM   6288 O  "O5'" . DC  H  2 8   ? 170.479 16.303  163.858 1.00 56.88  ? 8    DC  H "O5'" 1 
ATOM   6289 C  "C5'" . DC  H  2 8   ? 170.606 15.904  162.521 1.00 56.53  ? 8    DC  H "C5'" 1 
ATOM   6290 C  "C4'" . DC  H  2 8   ? 169.421 15.066  162.092 1.00 51.92  ? 8    DC  H "C4'" 1 
ATOM   6291 O  "O4'" . DC  H  2 8   ? 169.594 13.710  162.571 1.00 58.08  ? 8    DC  H "O4'" 1 
ATOM   6292 C  "C3'" . DC  H  2 8   ? 168.051 15.531  162.613 1.00 58.80  ? 8    DC  H "C3'" 1 
ATOM   6293 O  "O3'" . DC  H  2 8   ? 167.120 15.548  161.538 1.00 58.44  ? 8    DC  H "O3'" 1 
ATOM   6294 C  "C2'" . DC  H  2 8   ? 167.684 14.455  163.645 1.00 57.57  ? 8    DC  H "C2'" 1 
ATOM   6295 C  "C1'" . DC  H  2 8   ? 168.346 13.234  163.025 1.00 62.40  ? 8    DC  H "C1'" 1 
ATOM   6296 N  N1    . DC  H  2 8   ? 168.588 12.080  163.973 1.00 61.52  ? 8    DC  H N1    1 
ATOM   6297 C  C2    . DC  H  2 8   ? 168.518 10.763  163.492 1.00 58.63  ? 8    DC  H C2    1 
ATOM   6298 O  O2    . DC  H  2 8   ? 168.228 10.567  162.303 1.00 58.32  ? 8    DC  H O2    1 
ATOM   6299 N  N3    . DC  H  2 8   ? 168.766 9.739   164.346 1.00 57.02  ? 8    DC  H N3    1 
ATOM   6300 C  C4    . DC  H  2 8   ? 169.068 9.990   165.626 1.00 55.07  ? 8    DC  H C4    1 
ATOM   6301 N  N4    . DC  H  2 8   ? 169.302 8.945   166.437 1.00 46.37  ? 8    DC  H N4    1 
ATOM   6302 C  C5    . DC  H  2 8   ? 169.156 11.325  166.127 1.00 53.98  ? 8    DC  H C5    1 
ATOM   6303 C  C6    . DC  H  2 8   ? 168.912 12.326  165.279 1.00 52.97  ? 8    DC  H C6    1 
ATOM   6304 P  P     . DG  H  2 9   ? 165.878 16.576  161.527 1.00 65.72  ? 9    DG  H P     1 
ATOM   6305 O  OP1   . DG  H  2 9   ? 166.349 17.831  160.895 1.00 73.80  ? 9    DG  H OP1   1 
ATOM   6306 O  OP2   . DG  H  2 9   ? 165.266 16.593  162.875 1.00 72.95  ? 9    DG  H OP2   1 
ATOM   6307 O  "O5'" . DG  H  2 9   ? 164.809 15.870  160.563 1.00 69.67  ? 9    DG  H "O5'" 1 
ATOM   6308 C  "C5'" . DG  H  2 9   ? 165.223 15.329  159.295 1.00 63.94  ? 9    DG  H "C5'" 1 
ATOM   6309 C  "C4'" . DG  H  2 9   ? 164.434 14.065  158.942 1.00 63.19  ? 9    DG  H "C4'" 1 
ATOM   6310 O  "O4'" . DG  H  2 9   ? 164.913 12.941  159.735 1.00 61.85  ? 9    DG  H "O4'" 1 
ATOM   6311 C  "C3'" . DG  H  2 9   ? 162.928 14.126  159.185 1.00 60.31  ? 9    DG  H "C3'" 1 
ATOM   6312 O  "O3'" . DG  H  2 9   ? 162.271 13.325  158.211 1.00 65.12  ? 9    DG  H "O3'" 1 
ATOM   6313 C  "C2'" . DG  H  2 9   ? 162.809 13.503  160.573 1.00 60.44  ? 9    DG  H "C2'" 1 
ATOM   6314 C  "C1'" . DG  H  2 9   ? 163.841 12.390  160.467 1.00 57.93  ? 9    DG  H "C1'" 1 
ATOM   6315 N  N9    . DG  H  2 9   ? 164.355 11.911  161.752 1.00 58.48  ? 9    DG  H N9    1 
ATOM   6316 C  C8    . DG  H  2 9   ? 164.809 12.666  162.809 1.00 55.45  ? 9    DG  H C8    1 
ATOM   6317 N  N7    . DG  H  2 9   ? 165.227 11.948  163.823 1.00 53.56  ? 9    DG  H N7    1 
ATOM   6318 C  C5    . DG  H  2 9   ? 165.035 10.639  163.415 1.00 53.73  ? 9    DG  H C5    1 
ATOM   6319 C  C6    . DG  H  2 9   ? 165.294 9.424   164.089 1.00 50.30  ? 9    DG  H C6    1 
ATOM   6320 O  O6    . DG  H  2 9   ? 165.761 9.255   165.214 1.00 52.89  ? 9    DG  H O6    1 
ATOM   6321 N  N1    . DG  H  2 9   ? 164.956 8.322   163.310 1.00 57.54  ? 9    DG  H N1    1 
ATOM   6322 C  C2    . DG  H  2 9   ? 164.431 8.393   162.032 1.00 55.82  ? 9    DG  H C2    1 
ATOM   6323 N  N2    . DG  H  2 9   ? 164.164 7.229   161.429 1.00 55.47  ? 9    DG  H N2    1 
ATOM   6324 N  N3    . DG  H  2 9   ? 164.175 9.519   161.402 1.00 52.86  ? 9    DG  H N3    1 
ATOM   6325 C  C4    . DG  H  2 9   ? 164.505 10.599  162.140 1.00 58.39  ? 9    DG  H C4    1 
ATOM   6326 P  P     . DG  H  2 10  ? 160.682 13.443  157.973 1.00 73.60  ? 10   DG  H P     1 
ATOM   6327 O  OP1   . DG  H  2 10  ? 160.477 13.858  156.563 1.00 77.11  ? 10   DG  H OP1   1 
ATOM   6328 O  OP2   . DG  H  2 10  ? 160.089 14.262  159.054 1.00 70.00  ? 10   DG  H OP2   1 
ATOM   6329 O  "O5'" . DG  H  2 10  ? 160.164 11.932  158.116 1.00 70.10  ? 10   DG  H "O5'" 1 
ATOM   6330 C  "C5'" . DG  H  2 10  ? 160.901 10.869  157.508 1.00 66.40  ? 10   DG  H "C5'" 1 
ATOM   6331 C  "C4'" . DG  H  2 10  ? 160.218 9.523   157.726 1.00 69.81  ? 10   DG  H "C4'" 1 
ATOM   6332 O  "O4'" . DG  H  2 10  ? 160.735 8.885   158.927 1.00 65.15  ? 10   DG  H "O4'" 1 
ATOM   6333 C  "C3'" . DG  H  2 10  ? 158.703 9.560   157.892 1.00 68.50  ? 10   DG  H "C3'" 1 
ATOM   6334 O  "O3'" . DG  H  2 10  ? 158.146 8.370   157.314 1.00 63.14  ? 10   DG  H "O3'" 1 
ATOM   6335 C  "C2'" . DG  H  2 10  ? 158.527 9.599   159.424 1.00 69.84  ? 10   DG  H "C2'" 1 
ATOM   6336 C  "C1'" . DG  H  2 10  ? 159.709 8.753   159.907 1.00 69.29  ? 10   DG  H "C1'" 1 
ATOM   6337 N  N9    . DG  H  2 10  ? 160.284 9.165   161.199 1.00 64.39  ? 10   DG  H N9    1 
ATOM   6338 C  C8    . DG  H  2 10  ? 160.546 10.449  161.624 1.00 62.73  ? 10   DG  H C8    1 
ATOM   6339 N  N7    . DG  H  2 10  ? 161.100 10.504  162.813 1.00 61.94  ? 10   DG  H N7    1 
ATOM   6340 C  C5    . DG  H  2 10  ? 161.230 9.172   163.191 1.00 59.25  ? 10   DG  H C5    1 
ATOM   6341 C  C6    . DG  H  2 10  ? 161.771 8.607   164.374 1.00 51.96  ? 10   DG  H C6    1 
ATOM   6342 O  O6    . DG  H  2 10  ? 162.255 9.187   165.349 1.00 52.02  ? 10   DG  H O6    1 
ATOM   6343 N  N1    . DG  H  2 10  ? 161.714 7.220   164.356 1.00 52.51  ? 10   DG  H N1    1 
ATOM   6344 C  C2    . DG  H  2 10  ? 161.191 6.467   163.330 1.00 53.59  ? 10   DG  H C2    1 
ATOM   6345 N  N2    . DG  H  2 10  ? 161.222 5.138   163.494 1.00 45.57  ? 10   DG  H N2    1 
ATOM   6346 N  N3    . DG  H  2 10  ? 160.684 6.981   162.215 1.00 61.21  ? 10   DG  H N3    1 
ATOM   6347 C  C4    . DG  H  2 10  ? 160.739 8.335   162.210 1.00 61.54  ? 10   DG  H C4    1 
ATOM   6348 P  P     . DG  H  2 11  ? 156.558 8.192   157.138 1.00 72.16  ? 11   DG  H P     1 
ATOM   6349 O  OP1   . DG  H  2 11  ? 156.404 7.237   156.012 1.00 73.16  ? 11   DG  H OP1   1 
ATOM   6350 O  OP2   . DG  H  2 11  ? 155.881 9.509   157.139 1.00 63.47  ? 11   DG  H OP2   1 
ATOM   6351 O  "O5'" . DG  H  2 11  ? 156.097 7.452   158.479 1.00 69.30  ? 11   DG  H "O5'" 1 
ATOM   6352 C  "C5'" . DG  H  2 11  ? 156.446 6.101   158.682 1.00 67.25  ? 11   DG  H "C5'" 1 
ATOM   6353 C  "C4'" . DG  H  2 11  ? 156.035 5.648   160.061 1.00 68.49  ? 11   DG  H "C4'" 1 
ATOM   6354 O  "O4'" . DG  H  2 11  ? 156.827 6.344   161.057 1.00 62.72  ? 11   DG  H "O4'" 1 
ATOM   6355 C  "C3'" . DG  H  2 11  ? 154.574 5.931   160.431 1.00 71.27  ? 11   DG  H "C3'" 1 
ATOM   6356 O  "O3'" . DG  H  2 11  ? 154.088 4.847   161.171 1.00 74.70  ? 11   DG  H "O3'" 1 
ATOM   6357 C  "C2'" . DG  H  2 11  ? 154.683 7.170   161.320 1.00 67.66  ? 11   DG  H "C2'" 1 
ATOM   6358 C  "C1'" . DG  H  2 11  ? 155.952 6.808   162.054 1.00 68.72  ? 11   DG  H "C1'" 1 
ATOM   6359 N  N9    . DG  H  2 11  ? 156.595 7.890   162.766 1.00 63.59  ? 11   DG  H N9    1 
ATOM   6360 C  C8    . DG  H  2 11  ? 156.565 9.233   162.482 1.00 61.06  ? 11   DG  H C8    1 
ATOM   6361 N  N7    . DG  H  2 11  ? 157.264 9.950   163.322 1.00 59.82  ? 11   DG  H N7    1 
ATOM   6362 C  C5    . DG  H  2 11  ? 157.789 9.008   164.208 1.00 60.89  ? 11   DG  H C5    1 
ATOM   6363 C  C6    . DG  H  2 11  ? 158.622 9.173   165.343 1.00 56.96  ? 11   DG  H C6    1 
ATOM   6364 O  O6    . DG  H  2 11  ? 159.098 10.230  165.803 1.00 56.69  ? 11   DG  H O6    1 
ATOM   6365 N  N1    . DG  H  2 11  ? 158.904 7.941   165.953 1.00 49.50  ? 11   DG  H N1    1 
ATOM   6366 C  C2    . DG  H  2 11  ? 158.435 6.720   165.512 1.00 51.31  ? 11   DG  H C2    1 
ATOM   6367 N  N2    . DG  H  2 11  ? 158.806 5.640   166.205 1.00 46.30  ? 11   DG  H N2    1 
ATOM   6368 N  N3    . DG  H  2 11  ? 157.658 6.566   164.465 1.00 56.34  ? 11   DG  H N3    1 
ATOM   6369 C  C4    . DG  H  2 11  ? 157.380 7.742   163.865 1.00 60.65  ? 11   DG  H C4    1 
ATOM   6370 P  P     . DT  H  2 12  ? 153.162 3.748   160.472 1.00 73.99  ? 12   DT  H P     1 
ATOM   6371 O  OP1   . DT  H  2 12  ? 153.651 3.588   159.083 1.00 71.37  ? 12   DT  H OP1   1 
ATOM   6372 O  OP2   . DT  H  2 12  ? 151.763 4.147   160.787 1.00 65.57  ? 12   DT  H OP2   1 
ATOM   6373 O  "O5'" . DT  H  2 12  ? 153.483 2.409   161.278 1.00 63.87  ? 12   DT  H "O5'" 1 
ATOM   6374 C  "C5'" . DT  H  2 12  ? 154.828 2.002   161.470 1.00 61.69  ? 12   DT  H "C5'" 1 
ATOM   6375 C  "C4'" . DT  H  2 12  ? 155.087 1.600   162.925 1.00 69.28  ? 12   DT  H "C4'" 1 
ATOM   6376 O  "O4'" . DT  H  2 12  ? 155.364 2.773   163.744 1.00 68.21  ? 12   DT  H "O4'" 1 
ATOM   6377 C  "C3'" . DT  H  2 12  ? 153.943 0.897   163.656 1.00 66.44  ? 12   DT  H "C3'" 1 
ATOM   6378 O  "O3'" . DT  H  2 12  ? 154.514 0.169   164.674 1.00 68.32  ? 12   DT  H "O3'" 1 
ATOM   6379 C  "C2'" . DT  H  2 12  ? 153.201 2.081   164.258 1.00 54.90  ? 12   DT  H "C2'" 1 
ATOM   6380 C  "C1'" . DT  H  2 12  ? 154.403 2.827   164.789 1.00 59.62  ? 12   DT  H "C1'" 1 
ATOM   6381 N  N1    . DT  H  2 12  ? 154.170 4.222   165.123 1.00 62.38  ? 12   DT  H N1    1 
ATOM   6382 C  C2    . DT  H  2 12  ? 154.906 4.771   166.150 1.00 55.82  ? 12   DT  H C2    1 
ATOM   6383 O  O2    . DT  H  2 12  ? 155.724 4.132   166.797 1.00 54.57  ? 12   DT  H O2    1 
ATOM   6384 N  N3    . DT  H  2 12  ? 154.656 6.088   166.394 1.00 50.76  ? 12   DT  H N3    1 
ATOM   6385 C  C4    . DT  H  2 12  ? 153.756 6.899   165.733 1.00 61.49  ? 12   DT  H C4    1 
ATOM   6386 O  O4    . DT  H  2 12  ? 153.605 8.081   166.032 1.00 66.72  ? 12   DT  H O4    1 
ATOM   6387 C  C5    . DT  H  2 12  ? 153.009 6.258   164.655 1.00 65.10  ? 12   DT  H C5    1 
ATOM   6388 C  C7    . DT  H  2 12  ? 152.003 7.040   163.866 1.00 60.94  ? 12   DT  H C7    1 
ATOM   6389 C  C6    . DT  H  2 12  ? 153.256 4.962   164.400 1.00 56.35  ? 12   DT  H C6    1 
ATOM   6390 P  P     . DA  H  2 13  ? 154.277 -1.401  164.820 1.00 73.14  ? 13   DA  H P     1 
ATOM   6391 O  OP1   . DA  H  2 13  ? 155.342 -2.086  164.034 1.00 55.27  ? 13   DA  H OP1   1 
ATOM   6392 O  OP2   . DA  H  2 13  ? 152.819 -1.624  164.631 1.00 61.18  ? 13   DA  H OP2   1 
ATOM   6393 O  "O5'" . DA  H  2 13  ? 154.642 -1.636  166.366 1.00 68.41  ? 13   DA  H "O5'" 1 
ATOM   6394 C  "C5'" . DA  H  2 13  ? 155.932 -1.249  166.829 1.00 51.70  ? 13   DA  H "C5'" 1 
ATOM   6395 C  "C4'" . DA  H  2 13  ? 155.853 -0.522  168.155 1.00 56.92  ? 13   DA  H "C4'" 1 
ATOM   6396 O  "O4'" . DA  H  2 13  ? 155.207 0.777   168.000 1.00 57.67  ? 13   DA  H "O4'" 1 
ATOM   6397 C  "C3'" . DA  H  2 13  ? 155.080 -1.250  169.261 1.00 50.53  ? 13   DA  H "C3'" 1 
ATOM   6398 O  "O3'" . DA  H  2 13  ? 155.781 -1.071  170.461 1.00 49.78  ? 13   DA  H "O3'" 1 
ATOM   6399 C  "C2'" . DA  H  2 13  ? 153.749 -0.495  169.280 1.00 51.53  ? 13   DA  H "C2'" 1 
ATOM   6400 C  "C1'" . DA  H  2 13  ? 154.247 0.918   169.040 1.00 53.42  ? 13   DA  H "C1'" 1 
ATOM   6401 N  N9    . DA  H  2 13  ? 153.218 1.855   168.606 1.00 49.01  ? 13   DA  H N9    1 
ATOM   6402 C  C8    . DA  H  2 13  ? 152.191 1.606   167.738 1.00 53.94  ? 13   DA  H C8    1 
ATOM   6403 N  N7    . DA  H  2 13  ? 151.434 2.653   167.499 1.00 51.43  ? 13   DA  H N7    1 
ATOM   6404 C  C5    . DA  H  2 13  ? 152.012 3.656   168.248 1.00 48.25  ? 13   DA  H C5    1 
ATOM   6405 C  C6    . DA  H  2 13  ? 151.680 5.003   168.423 1.00 51.12  ? 13   DA  H C6    1 
ATOM   6406 N  N6    . DA  H  2 13  ? 150.638 5.574   167.825 1.00 51.73  ? 13   DA  H N6    1 
ATOM   6407 N  N1    . DA  H  2 13  ? 152.455 5.743   169.254 1.00 53.03  ? 13   DA  H N1    1 
ATOM   6408 C  C2    . DA  H  2 13  ? 153.499 5.153   169.853 1.00 48.36  ? 13   DA  H C2    1 
ATOM   6409 N  N3    . DA  H  2 13  ? 153.913 3.885   169.750 1.00 45.34  ? 13   DA  H N3    1 
ATOM   6410 C  C4    . DA  H  2 13  ? 153.116 3.185   168.936 1.00 44.46  ? 13   DA  H C4    1 
ATOM   6411 P  P     . DA  H  2 14  ? 155.607 -2.082  171.690 1.00 49.90  ? 14   DA  H P     1 
ATOM   6412 O  OP1   . DA  H  2 14  ? 156.870 -1.923  172.449 1.00 45.61  ? 14   DA  H OP1   1 
ATOM   6413 O  OP2   . DA  H  2 14  ? 155.268 -3.446  171.222 1.00 39.57  ? 14   DA  H OP2   1 
ATOM   6414 O  "O5'" . DA  H  2 14  ? 154.399 -1.416  172.537 1.00 47.41  ? 14   DA  H "O5'" 1 
ATOM   6415 C  "C5'" . DA  H  2 14  ? 154.671 -0.595  173.704 1.00 42.38  ? 14   DA  H "C5'" 1 
ATOM   6416 C  "C4'" . DA  H  2 14  ? 155.076 0.835   173.333 1.00 47.32  ? 14   DA  H "C4'" 1 
ATOM   6417 O  "O4'" . DA  H  2 14  ? 154.171 1.329   172.304 1.00 46.97  ? 14   DA  H "O4'" 1 
ATOM   6418 C  "C3'" . DA  H  2 14  ? 154.969 1.841   174.501 1.00 48.45  ? 14   DA  H "C3'" 1 
ATOM   6419 O  "O3'" . DA  H  2 14  ? 156.057 2.860   174.519 1.00 48.71  ? 14   DA  H "O3'" 1 
ATOM   6420 C  "C2'" . DA  H  2 14  ? 153.600 2.474   174.266 1.00 50.42  ? 14   DA  H "C2'" 1 
ATOM   6421 C  "C1'" . DA  H  2 14  ? 153.600 2.548   172.750 1.00 48.23  ? 14   DA  H "C1'" 1 
ATOM   6422 N  N9    . DA  H  2 14  ? 152.277 2.723   172.140 1.00 49.54  ? 14   DA  H N9    1 
ATOM   6423 C  C8    . DA  H  2 14  ? 151.553 1.797   171.426 1.00 49.87  ? 14   DA  H C8    1 
ATOM   6424 N  N7    . DA  H  2 14  ? 150.407 2.259   170.979 1.00 45.57  ? 14   DA  H N7    1 
ATOM   6425 C  C5    . DA  H  2 14  ? 150.383 3.573   171.422 1.00 48.86  ? 14   DA  H C5    1 
ATOM   6426 C  C6    . DA  H  2 14  ? 149.443 4.605   171.274 1.00 52.64  ? 14   DA  H C6    1 
ATOM   6427 N  N6    . DA  H  2 14  ? 148.292 4.457   170.610 1.00 55.24  ? 14   DA  H N6    1 
ATOM   6428 N  N1    . DA  H  2 14  ? 149.723 5.798   171.842 1.00 54.73  ? 14   DA  H N1    1 
ATOM   6429 C  C2    . DA  H  2 14  ? 150.868 5.942   172.509 1.00 49.24  ? 14   DA  H C2    1 
ATOM   6430 N  N3    . DA  H  2 14  ? 151.831 5.047   172.712 1.00 47.91  ? 14   DA  H N3    1 
ATOM   6431 C  C4    . DA  H  2 14  ? 151.521 3.872   172.140 1.00 45.96  ? 14   DA  H C4    1 
ATOM   6432 P  P     . DG  H  2 15  ? 156.055 3.963   175.716 1.00 49.97  ? 15   DG  H P     1 
ATOM   6433 O  OP1   . DG  H  2 15  ? 155.351 5.160   175.177 1.00 51.54  ? 15   DG  H OP1   1 
ATOM   6434 O  OP2   . DG  H  2 15  ? 157.359 4.269   176.305 1.00 39.67  ? 15   DG  H OP2   1 
ATOM   6435 O  "O5'" . DG  H  2 15  ? 155.207 3.136   176.839 1.00 50.10  ? 15   DG  H "O5'" 1 
ATOM   6436 C  "C5'" . DG  H  2 15  ? 154.799 3.713   178.069 1.00 42.78  ? 15   DG  H "C5'" 1 
ATOM   6437 C  "C4'" . DG  H  2 15  ? 153.895 4.896   177.839 1.00 43.15  ? 15   DG  H "C4'" 1 
ATOM   6438 O  "O4'" . DG  H  2 15  ? 152.952 4.627   176.760 1.00 45.89  ? 15   DG  H "O4'" 1 
ATOM   6439 C  "C3'" . DG  H  2 15  ? 153.059 5.307   179.044 1.00 44.24  ? 15   DG  H "C3'" 1 
ATOM   6440 O  "O3'" . DG  H  2 15  ? 153.309 6.632   179.320 1.00 43.27  ? 15   DG  H "O3'" 1 
ATOM   6441 C  "C2'" . DG  H  2 15  ? 151.612 5.088   178.586 1.00 46.24  ? 15   DG  H "C2'" 1 
ATOM   6442 C  "C1'" . DG  H  2 15  ? 151.748 5.261   177.086 1.00 46.70  ? 15   DG  H "C1'" 1 
ATOM   6443 N  N9    . DG  H  2 15  ? 150.673 4.671   176.298 1.00 45.88  ? 15   DG  H N9    1 
ATOM   6444 C  C8    . DG  H  2 15  ? 150.553 3.371   175.887 1.00 47.30  ? 15   DG  H C8    1 
ATOM   6445 N  N7    . DG  H  2 15  ? 149.490 3.154   175.162 1.00 44.98  ? 15   DG  H N7    1 
ATOM   6446 C  C5    . DG  H  2 15  ? 148.884 4.389   175.085 1.00 44.25  ? 15   DG  H C5    1 
ATOM   6447 C  C6    . DG  H  2 15  ? 147.700 4.770   174.434 1.00 50.30  ? 15   DG  H C6    1 
ATOM   6448 O  O6    . DG  H  2 15  ? 146.933 4.055   173.777 1.00 48.33  ? 15   DG  H O6    1 
ATOM   6449 N  N1    . DG  H  2 15  ? 147.432 6.131   174.609 1.00 50.86  ? 15   DG  H N1    1 
ATOM   6450 C  C2    . DG  H  2 15  ? 148.223 7.002   175.336 1.00 51.58  ? 15   DG  H C2    1 
ATOM   6451 N  N2    . DG  H  2 15  ? 147.817 8.277   175.409 1.00 52.53  ? 15   DG  H N2    1 
ATOM   6452 N  N3    . DG  H  2 15  ? 149.337 6.644   175.950 1.00 50.31  ? 15   DG  H N3    1 
ATOM   6453 C  C4    . DG  H  2 15  ? 149.599 5.329   175.784 1.00 46.06  ? 15   DG  H C4    1 
ATOM   6454 P  P     . DT  H  2 16  ? 152.916 7.227   180.750 1.00 51.86  ? 16   DT  H P     1 
ATOM   6455 O  OP1   . DT  H  2 16  ? 153.777 8.403   180.996 1.00 47.34  ? 16   DT  H OP1   1 
ATOM   6456 O  OP2   . DT  H  2 16  ? 152.778 6.096   181.716 1.00 46.68  ? 16   DT  H OP2   1 
ATOM   6457 O  "O5'" . DT  H  2 16  ? 151.461 7.774   180.513 1.00 52.43  ? 16   DT  H "O5'" 1 
ATOM   6458 C  "C5'" . DT  H  2 16  ? 151.280 8.996   179.888 1.00 45.97  ? 16   DT  H "C5'" 1 
ATOM   6459 C  "C4'" . DT  H  2 16  ? 149.831 9.360   179.933 1.00 49.76  ? 16   DT  H "C4'" 1 
ATOM   6460 O  "O4'" . DT  H  2 16  ? 149.079 8.418   179.158 1.00 44.01  ? 16   DT  H "O4'" 1 
ATOM   6461 C  "C3'" . DT  H  2 16  ? 149.205 9.344   181.338 1.00 48.24  ? 16   DT  H "C3'" 1 
ATOM   6462 O  "O3'" . DT  H  2 16  ? 148.675 10.605  181.537 1.00 57.27  ? 16   DT  H "O3'" 1 
ATOM   6463 C  "C2'" . DT  H  2 16  ? 148.114 8.247   181.257 1.00 45.68  ? 16   DT  H "C2'" 1 
ATOM   6464 C  "C1'" . DT  H  2 16  ? 147.823 8.255   179.764 1.00 48.02  ? 16   DT  H "C1'" 1 
ATOM   6465 N  N1    . DT  H  2 16  ? 147.237 7.039   179.164 1.00 48.88  ? 16   DT  H N1    1 
ATOM   6466 C  C2    . DT  H  2 16  ? 146.125 7.184   178.361 1.00 51.30  ? 16   DT  H C2    1 
ATOM   6467 O  O2    . DT  H  2 16  ? 145.551 8.244   178.213 1.00 55.31  ? 16   DT  H O2    1 
ATOM   6468 N  N3    . DT  H  2 16  ? 145.691 6.040   177.753 1.00 46.33  ? 16   DT  H N3    1 
ATOM   6469 C  C4    . DT  H  2 16  ? 146.259 4.790   177.829 1.00 47.80  ? 16   DT  H C4    1 
ATOM   6470 O  O4    . DT  H  2 16  ? 145.787 3.822   177.229 1.00 44.49  ? 16   DT  H O4    1 
ATOM   6471 C  C5    . DT  H  2 16  ? 147.446 4.697   178.675 1.00 50.66  ? 16   DT  H C5    1 
ATOM   6472 C  C7    . DT  H  2 16  ? 148.142 3.380   178.854 1.00 43.99  ? 16   DT  H C7    1 
ATOM   6473 C  C6    . DT  H  2 16  ? 147.890 5.825   179.277 1.00 47.99  ? 16   DT  H C6    1 
ATOM   6474 P  P     . DT  H  2 17  ? 148.023 11.048  182.923 1.00 54.19  ? 17   DT  H P     1 
ATOM   6475 O  OP1   . DT  H  2 17  ? 148.418 12.454  183.121 1.00 56.35  ? 17   DT  H OP1   1 
ATOM   6476 O  OP2   . DT  H  2 17  ? 148.318 10.070  183.986 1.00 47.68  ? 17   DT  H OP2   1 
ATOM   6477 O  "O5'" . DT  H  2 17  ? 146.479 10.980  182.573 1.00 56.11  ? 17   DT  H "O5'" 1 
ATOM   6478 C  "C5'" . DT  H  2 17  ? 145.981 11.677  181.468 1.00 47.36  ? 17   DT  H "C5'" 1 
ATOM   6479 C  "C4'" . DT  H  2 17  ? 144.490 11.426  181.313 1.00 55.68  ? 17   DT  H "C4'" 1 
ATOM   6480 O  "O4'" . DT  H  2 17  ? 144.271 10.143  180.666 1.00 51.99  ? 17   DT  H "O4'" 1 
ATOM   6481 C  "C3'" . DT  H  2 17  ? 143.659 11.381  182.615 1.00 53.05  ? 17   DT  H "C3'" 1 
ATOM   6482 O  "O3'" . DT  H  2 17  ? 142.379 11.881  182.323 1.00 62.78  ? 17   DT  H "O3'" 1 
ATOM   6483 C  "C2'" . DT  H  2 17  ? 143.566 9.879   182.877 1.00 49.67  ? 17   DT  H "C2'" 1 
ATOM   6484 C  "C1'" . DT  H  2 17  ? 143.367 9.390   181.443 1.00 54.95  ? 17   DT  H "C1'" 1 
ATOM   6485 N  N1    . DT  H  2 17  ? 143.640 7.952   181.218 1.00 48.64  ? 17   DT  H N1    1 
ATOM   6486 C  C2    . DT  H  2 17  ? 142.829 7.266   180.367 1.00 47.81  ? 17   DT  H C2    1 
ATOM   6487 O  O2    . DT  H  2 17  ? 141.899 7.775   179.798 1.00 53.74  ? 17   DT  H O2    1 
ATOM   6488 N  N3    . DT  H  2 17  ? 143.137 5.957   180.204 1.00 48.37  ? 17   DT  H N3    1 
ATOM   6489 C  C4    . DT  H  2 17  ? 144.176 5.272   180.786 1.00 50.07  ? 17   DT  H C4    1 
ATOM   6490 O  O4    . DT  H  2 17  ? 144.381 4.083   180.564 1.00 51.56  ? 17   DT  H O4    1 
ATOM   6491 C  C5    . DT  H  2 17  ? 145.005 6.049   181.676 1.00 48.40  ? 17   DT  H C5    1 
ATOM   6492 C  C7    . DT  H  2 17  ? 146.161 5.405   182.381 1.00 50.37  ? 17   DT  H C7    1 
ATOM   6493 C  C6    . DT  H  2 17  ? 144.701 7.343   181.847 1.00 47.83  ? 17   DT  H C6    1 
ATOM   6494 P  P     . DC  H  2 18  ? 141.670 13.016  183.208 1.00 66.68  ? 18   DC  H P     1 
ATOM   6495 O  OP1   . DC  H  2 18  ? 142.152 14.321  182.691 1.00 59.59  ? 18   DC  H OP1   1 
ATOM   6496 O  OP2   . DC  H  2 18  ? 141.855 12.753  184.651 1.00 56.25  ? 18   DC  H OP2   1 
ATOM   6497 O  "O5'" . DC  H  2 18  ? 140.133 12.781  182.832 1.00 55.76  ? 18   DC  H "O5'" 1 
ATOM   6498 C  "C5'" . DC  H  2 18  ? 139.693 13.051  181.528 1.00 58.50  ? 18   DC  H "C5'" 1 
ATOM   6499 C  "C4'" . DC  H  2 18  ? 138.850 11.921  180.940 1.00 60.59  ? 18   DC  H "C4'" 1 
ATOM   6500 O  "O4'" . DC  H  2 18  ? 139.643 10.748  180.736 1.00 58.48  ? 18   DC  H "O4'" 1 
ATOM   6501 C  "C3'" . DC  H  2 18  ? 137.687 11.413  181.763 1.00 62.47  ? 18   DC  H "C3'" 1 
ATOM   6502 O  "O3'" . DC  H  2 18  ? 136.577 12.295  181.654 1.00 76.60  ? 18   DC  H "O3'" 1 
ATOM   6503 C  "C2'" . DC  H  2 18  ? 137.390 10.088  181.055 1.00 62.13  ? 18   DC  H "C2'" 1 
ATOM   6504 C  "C1'" . DC  H  2 18  ? 138.760 9.668   180.512 1.00 56.31  ? 18   DC  H "C1'" 1 
ATOM   6505 N  N1    . DC  H  2 18  ? 139.292 8.461   181.178 1.00 55.06  ? 18   DC  H N1    1 
ATOM   6506 C  C2    . DC  H  2 18  ? 138.971 7.205   180.661 1.00 57.13  ? 18   DC  H C2    1 
ATOM   6507 O  O2    . DC  H  2 18  ? 138.259 7.134   179.654 1.00 61.25  ? 18   DC  H O2    1 
ATOM   6508 N  N3    . DC  H  2 18  ? 139.455 6.102   181.270 1.00 57.92  ? 18   DC  H N3    1 
ATOM   6509 C  C4    . DC  H  2 18  ? 140.225 6.228   182.350 1.00 51.63  ? 18   DC  H C4    1 
ATOM   6510 N  N4    . DC  H  2 18  ? 140.681 5.111   182.913 1.00 47.44  ? 18   DC  H N4    1 
ATOM   6511 C  C5    . DC  H  2 18  ? 140.563 7.503   182.896 1.00 46.44  ? 18   DC  H C5    1 
ATOM   6512 C  C6    . DC  H  2 18  ? 140.071 8.583   182.292 1.00 48.98  ? 18   DC  H C6    1 
ATOM   6513 P  P     . DC  H  2 19  ? 135.285 12.106  182.598 1.00 76.32  ? 19   DC  H P     1 
ATOM   6514 O  OP1   . DC  H  2 19  ? 134.428 13.301  182.440 1.00 81.73  ? 19   DC  H OP1   1 
ATOM   6515 O  OP2   . DC  H  2 19  ? 135.766 11.788  183.953 1.00 75.30  ? 19   DC  H OP2   1 
ATOM   6516 O  "O5'" . DC  H  2 19  ? 134.540 10.814  182.008 1.00 63.94  ? 19   DC  H "O5'" 1 
ATOM   6517 C  "C5'" . DC  H  2 19  ? 134.061 10.797  180.679 1.00 60.87  ? 19   DC  H "C5'" 1 
ATOM   6518 C  "C4'" . DC  H  2 19  ? 133.453 9.444   180.359 1.00 63.81  ? 19   DC  H "C4'" 1 
ATOM   6519 O  "O4'" . DC  H  2 19  ? 134.487 8.439   180.325 1.00 63.51  ? 19   DC  H "O4'" 1 
ATOM   6520 C  "C3'" . DC  H  2 19  ? 132.457 8.948   181.392 1.00 72.23  ? 19   DC  H "C3'" 1 
ATOM   6521 O  "O3'" . DC  H  2 19  ? 131.160 9.395   181.033 1.00 77.20  ? 19   DC  H "O3'" 1 
ATOM   6522 C  "C2'" . DC  H  2 19  ? 132.562 7.421   181.296 1.00 71.05  ? 19   DC  H "C2'" 1 
ATOM   6523 C  "C1'" . DC  H  2 19  ? 133.944 7.177   180.691 1.00 66.90  ? 19   DC  H "C1'" 1 
ATOM   6524 N  N1    . DC  H  2 19  ? 134.900 6.446   181.636 1.00 62.27  ? 19   DC  H N1    1 
ATOM   6525 C  C2    . DC  H  2 19  ? 135.023 5.056   181.544 1.00 58.92  ? 19   DC  H C2    1 
ATOM   6526 O  O2    . DC  H  2 19  ? 134.359 4.449   180.697 1.00 57.45  ? 19   DC  H O2    1 
ATOM   6527 N  N3    . DC  H  2 19  ? 135.872 4.411   182.380 1.00 56.53  ? 19   DC  H N3    1 
ATOM   6528 C  C4    . DC  H  2 19  ? 136.572 5.096   183.277 1.00 55.52  ? 19   DC  H C4    1 
ATOM   6529 N  N4    . DC  H  2 19  ? 137.400 4.411   184.070 1.00 52.78  ? 19   DC  H N4    1 
ATOM   6530 C  C5    . DC  H  2 19  ? 136.460 6.517   183.398 1.00 52.88  ? 19   DC  H C5    1 
ATOM   6531 C  C6    . DC  H  2 19  ? 135.617 7.143   182.569 1.00 56.06  ? 19   DC  H C6    1 
ATOM   6532 P  P     . DG  H  2 20  ? 129.916 9.238   182.035 1.00 85.41  ? 20   DG  H P     1 
ATOM   6533 O  OP1   . DG  H  2 20  ? 128.785 9.795   181.256 1.00 89.45  ? 20   DG  H OP1   1 
ATOM   6534 O  OP2   . DG  H  2 20  ? 130.245 9.743   183.399 1.00 71.43  ? 20   DG  H OP2   1 
ATOM   6535 O  "O5'" . DG  H  2 20  ? 129.679 7.669   182.127 1.00 68.97  ? 20   DG  H "O5'" 1 
ATOM   6536 C  "C5'" . DG  H  2 20  ? 129.168 6.984   181.023 1.00 67.63  ? 20   DG  H "C5'" 1 
ATOM   6537 C  "C4'" . DG  H  2 20  ? 128.952 5.546   181.391 1.00 75.72  ? 20   DG  H "C4'" 1 
ATOM   6538 O  "O4'" . DG  H  2 20  ? 130.238 4.949   181.708 1.00 75.10  ? 20   DG  H "O4'" 1 
ATOM   6539 C  "C3'" . DG  H  2 20  ? 128.065 5.359   182.624 1.00 74.99  ? 20   DG  H "C3'" 1 
ATOM   6540 O  "O3'" . DG  H  2 20  ? 127.084 4.369   182.386 1.00 83.63  ? 20   DG  H "O3'" 1 
ATOM   6541 C  "C2'" . DG  H  2 20  ? 129.036 4.932   183.715 1.00 75.71  ? 20   DG  H "C2'" 1 
ATOM   6542 C  "C1'" . DG  H  2 20  ? 130.143 4.252   182.929 1.00 72.40  ? 20   DG  H "C1'" 1 
ATOM   6543 N  N9    . DG  H  2 20  ? 131.421 4.313   183.636 1.00 67.82  ? 20   DG  H N9    1 
ATOM   6544 C  C8    . DG  H  2 20  ? 131.997 5.424   184.214 1.00 67.74  ? 20   DG  H C8    1 
ATOM   6545 N  N7    . DG  H  2 20  ? 133.125 5.170   184.821 1.00 62.54  ? 20   DG  H N7    1 
ATOM   6546 C  C5    . DG  H  2 20  ? 133.301 3.804   184.639 1.00 61.52  ? 20   DG  H C5    1 
ATOM   6547 C  C6    . DG  H  2 20  ? 134.337 2.960   185.080 1.00 54.79  ? 20   DG  H C6    1 
ATOM   6548 O  O6    . DG  H  2 20  ? 135.340 3.264   185.727 1.00 55.53  ? 20   DG  H O6    1 
ATOM   6549 N  N1    . DG  H  2 20  ? 134.127 1.637   184.696 1.00 54.10  ? 20   DG  H N1    1 
ATOM   6550 C  C2    . DG  H  2 20  ? 133.047 1.193   183.963 1.00 55.16  ? 20   DG  H C2    1 
ATOM   6551 N  N2    . DG  H  2 20  ? 133.014 -0.115  183.678 1.00 52.79  ? 20   DG  H N2    1 
ATOM   6552 N  N3    . DG  H  2 20  ? 132.066 1.974   183.550 1.00 60.62  ? 20   DG  H N3    1 
ATOM   6553 C  C4    . DG  H  2 20  ? 132.256 3.262   183.922 1.00 62.79  ? 20   DG  H C4    1 
ATOM   6554 P  P     . DG  H  2 21  ? 126.087 3.921   183.568 1.00 88.60  ? 21   DG  H P     1 
ATOM   6555 O  OP1   . DG  H  2 21  ? 124.890 3.342   182.913 1.00 81.08  ? 21   DG  H OP1   1 
ATOM   6556 O  OP2   . DG  H  2 21  ? 125.956 5.053   184.522 1.00 85.46  ? 21   DG  H OP2   1 
ATOM   6557 O  "O5'" . DG  H  2 21  ? 126.875 2.733   184.310 1.00 79.84  ? 21   DG  H "O5'" 1 
ATOM   6558 C  "C5'" . DG  H  2 21  ? 126.705 1.390   183.858 1.00 75.23  ? 21   DG  H "C5'" 1 
ATOM   6559 C  "C4'" . DG  H  2 21  ? 127.698 0.438   184.514 1.00 71.75  ? 21   DG  H "C4'" 1 
ATOM   6560 O  "O4'" . DG  H  2 21  ? 128.954 1.101   184.748 1.00 67.92  ? 21   DG  H "O4'" 1 
ATOM   6561 C  "C3'" . DG  H  2 21  ? 127.332 -0.067  185.899 1.00 69.42  ? 21   DG  H "C3'" 1 
ATOM   6562 O  "O3'" . DG  H  2 21  ? 126.402 -1.143  185.841 1.00 70.99  ? 21   DG  H "O3'" 1 
ATOM   6563 C  "C2'" . DG  H  2 21  ? 128.687 -0.546  186.432 1.00 70.99  ? 21   DG  H "C2'" 1 
ATOM   6564 C  "C1'" . DG  H  2 21  ? 129.701 0.244   185.596 1.00 65.43  ? 21   DG  H "C1'" 1 
ATOM   6565 N  N9    . DG  H  2 21  ? 130.646 1.004   186.415 1.00 61.04  ? 21   DG  H N9    1 
ATOM   6566 C  C8    . DG  H  2 21  ? 130.672 2.364   186.638 1.00 59.94  ? 21   DG  H C8    1 
ATOM   6567 N  N7    . DG  H  2 21  ? 131.642 2.737   187.435 1.00 58.89  ? 21   DG  H N7    1 
ATOM   6568 C  C5    . DG  H  2 21  ? 132.287 1.546   187.768 1.00 53.90  ? 21   DG  H C5    1 
ATOM   6569 C  C6    . DG  H  2 21  ? 133.410 1.319   188.589 1.00 50.99  ? 21   DG  H C6    1 
ATOM   6570 O  O6    . DG  H  2 21  ? 134.080 2.147   189.210 1.00 52.41  ? 21   DG  H O6    1 
ATOM   6571 N  N1    . DG  H  2 21  ? 133.744 -0.033  188.653 1.00 50.27  ? 21   DG  H N1    1 
ATOM   6572 C  C2    . DG  H  2 21  ? 133.075 -1.036  187.999 1.00 51.53  ? 21   DG  H C2    1 
ATOM   6573 N  N2    . DG  H  2 21  ? 133.542 -2.279  188.182 1.00 50.88  ? 21   DG  H N2    1 
ATOM   6574 N  N3    . DG  H  2 21  ? 132.020 -0.838  187.220 1.00 51.65  ? 21   DG  H N3    1 
ATOM   6575 C  C4    . DG  H  2 21  ? 131.684 0.475   187.153 1.00 55.56  ? 21   DG  H C4    1 
ATOM   6576 P  P     . DC  H  2 22  ? 125.509 -1.474  187.144 1.00 79.28  ? 22   DC  H P     1 
ATOM   6577 O  OP1   . DC  H  2 22  ? 124.467 -2.459  186.785 1.00 78.74  ? 22   DC  H OP1   1 
ATOM   6578 O  OP2   . DC  H  2 22  ? 125.177 -0.169  187.764 1.00 69.11  ? 22   DC  H OP2   1 
ATOM   6579 O  "O5'" . DC  H  2 22  ? 126.512 -2.216  188.132 1.00 70.06  ? 22   DC  H "O5'" 1 
ATOM   6580 C  "C5'" . DC  H  2 22  ? 127.255 -3.342  187.685 1.00 69.22  ? 22   DC  H "C5'" 1 
ATOM   6581 C  "C4'" . DC  H  2 22  ? 128.321 -3.666  188.703 1.00 75.80  ? 22   DC  H "C4'" 1 
ATOM   6582 O  "O4'" . DC  H  2 22  ? 129.261 -2.554  188.792 1.00 71.01  ? 22   DC  H "O4'" 1 
ATOM   6583 C  "C3'" . DC  H  2 22  ? 127.767 -3.863  190.123 1.00 73.88  ? 22   DC  H "C3'" 1 
ATOM   6584 O  "O3'" . DC  H  2 22  ? 128.142 -5.114  190.638 1.00 79.06  ? 22   DC  H "O3'" 1 
ATOM   6585 C  "C2'" . DC  H  2 22  ? 128.374 -2.727  190.934 1.00 66.60  ? 22   DC  H "C2'" 1 
ATOM   6586 C  "C1'" . DC  H  2 22  ? 129.621 -2.393  190.141 1.00 65.04  ? 22   DC  H "C1'" 1 
ATOM   6587 N  N1    . DC  H  2 22  ? 130.066 -1.011  190.376 1.00 58.95  ? 22   DC  H N1    1 
ATOM   6588 C  C2    . DC  H  2 22  ? 131.290 -0.793  190.999 1.00 52.31  ? 22   DC  H C2    1 
ATOM   6589 O  O2    . DC  H  2 22  ? 131.990 -1.766  191.287 1.00 54.43  ? 22   DC  H O2    1 
ATOM   6590 N  N3    . DC  H  2 22  ? 131.684 0.476   191.248 1.00 48.96  ? 22   DC  H N3    1 
ATOM   6591 C  C4    . DC  H  2 22  ? 130.892 1.493   190.920 1.00 50.86  ? 22   DC  H C4    1 
ATOM   6592 N  N4    . DC  H  2 22  ? 131.321 2.725   191.185 1.00 50.02  ? 22   DC  H N4    1 
ATOM   6593 C  C5    . DC  H  2 22  ? 129.625 1.290   190.297 1.00 51.89  ? 22   DC  H C5    1 
ATOM   6594 C  C6    . DC  H  2 22  ? 129.252 0.030   190.052 1.00 57.55  ? 22   DC  H C6    1 
ATOM   6595 P  P     . DG  H  2 23  ? 127.234 -5.801  191.771 1.00 87.45  ? 23   DG  H P     1 
ATOM   6596 O  OP1   . DG  H  2 23  ? 126.884 -7.145  191.242 1.00 81.88  ? 23   DG  H OP1   1 
ATOM   6597 O  OP2   . DG  H  2 23  ? 126.188 -4.820  192.175 1.00 72.78  ? 23   DG  H OP2   1 
ATOM   6598 O  "O5'" . DG  H  2 23  ? 128.238 -5.953  193.011 1.00 77.86  ? 23   DG  H "O5'" 1 
ATOM   6599 C  "C5'" . DG  H  2 23  ? 129.621 -6.219  192.762 1.00 76.80  ? 23   DG  H "C5'" 1 
ATOM   6600 C  "C4'" . DG  H  2 23  ? 130.474 -5.695  193.894 1.00 71.54  ? 23   DG  H "C4'" 1 
ATOM   6601 O  "O4'" . DG  H  2 23  ? 130.775 -4.291  193.677 1.00 70.45  ? 23   DG  H "O4'" 1 
ATOM   6602 C  "C3'" . DG  H  2 23  ? 129.817 -5.794  195.273 1.00 64.90  ? 23   DG  H "C3'" 1 
ATOM   6603 O  "O3'" . DG  H  2 23  ? 130.640 -6.565  196.146 1.00 71.56  ? 23   DG  H "O3'" 1 
ATOM   6604 C  "C2'" . DG  H  2 23  ? 129.679 -4.337  195.738 1.00 63.51  ? 23   DG  H "C2'" 1 
ATOM   6605 C  "C1'" . DG  H  2 23  ? 130.738 -3.619  194.920 1.00 66.14  ? 23   DG  H "C1'" 1 
ATOM   6606 N  N9    . DG  H  2 23  ? 130.451 -2.196  194.676 1.00 55.52  ? 23   DG  H N9    1 
ATOM   6607 C  C8    . DG  H  2 23  ? 129.375 -1.661  194.009 1.00 48.80  ? 23   DG  H C8    1 
ATOM   6608 N  N7    . DG  H  2 23  ? 129.412 -0.358  193.934 1.00 46.28  ? 23   DG  H N7    1 
ATOM   6609 C  C5    . DG  H  2 23  ? 130.594 -0.010  194.581 1.00 40.45  ? 23   DG  H C5    1 
ATOM   6610 C  C6    . DG  H  2 23  ? 131.166 1.257   194.825 1.00 44.27  ? 23   DG  H C6    1 
ATOM   6611 O  O6    . DG  H  2 23  ? 130.745 2.372   194.502 1.00 48.98  ? 23   DG  H O6    1 
ATOM   6612 N  N1    . DG  H  2 23  ? 132.359 1.154   195.519 1.00 46.70  ? 23   DG  H N1    1 
ATOM   6613 C  C2    . DG  H  2 23  ? 132.931 -0.019  195.929 1.00 47.07  ? 23   DG  H C2    1 
ATOM   6614 N  N2    . DG  H  2 23  ? 134.098 0.085   196.583 1.00 46.19  ? 23   DG  H N2    1 
ATOM   6615 N  N3    . DG  H  2 23  ? 132.406 -1.208  195.714 1.00 47.38  ? 23   DG  H N3    1 
ATOM   6616 C  C4    . DG  H  2 23  ? 131.241 -1.127  195.039 1.00 47.18  ? 23   DG  H C4    1 
ATOM   6617 P  P     . DC  H  2 24  ? 130.006 -7.327  197.420 1.00 82.40  ? 24   DC  H P     1 
ATOM   6618 O  OP1   . DC  H  2 24  ? 130.334 -8.765  197.320 1.00 74.43  ? 24   DC  H OP1   1 
ATOM   6619 O  OP2   . DC  H  2 24  ? 128.614 -6.855  197.666 1.00 62.69  ? 24   DC  H OP2   1 
ATOM   6620 O  "O5'" . DC  H  2 24  ? 130.819 -6.705  198.618 1.00 73.55  ? 24   DC  H "O5'" 1 
ATOM   6621 C  "C5'" . DC  H  2 24  ? 130.696 -5.360  198.825 1.00 63.11  ? 24   DC  H "C5'" 1 
ATOM   6622 C  "C4'" . DC  H  2 24  ? 131.817 -4.842  199.653 1.00 56.82  ? 24   DC  H "C4'" 1 
ATOM   6623 O  "O4'" . DC  H  2 24  ? 132.382 -3.705  198.974 1.00 47.88  ? 24   DC  H "O4'" 1 
ATOM   6624 C  "C3'" . DC  H  2 24  ? 131.360 -4.377  201.034 1.00 56.57  ? 24   DC  H "C3'" 1 
ATOM   6625 O  "O3'" . DC  H  2 24  ? 131.870 -5.251  202.016 1.00 58.46  ? 24   DC  H "O3'" 1 
ATOM   6626 C  "C2'" . DC  H  2 24  ? 131.914 -2.958  201.190 1.00 54.26  ? 24   DC  H "C2'" 1 
ATOM   6627 C  "C1'" . DC  H  2 24  ? 132.240 -2.535  199.759 1.00 54.48  ? 24   DC  H "C1'" 1 
ATOM   6628 N  N1    . DC  H  2 24  ? 131.248 -1.595  199.090 1.00 43.58  ? 24   DC  H N1    1 
ATOM   6629 C  C2    . DC  H  2 24  ? 131.492 -0.216  199.125 1.00 48.36  ? 24   DC  H C2    1 
ATOM   6630 O  O2    . DC  H  2 24  ? 132.487 0.208   199.752 1.00 53.36  ? 24   DC  H O2    1 
ATOM   6631 N  N3    . DC  H  2 24  ? 130.638 0.621   198.488 1.00 43.97  ? 24   DC  H N3    1 
ATOM   6632 C  C4    . DC  H  2 24  ? 129.586 0.130   197.842 1.00 48.62  ? 24   DC  H C4    1 
ATOM   6633 N  N4    . DC  H  2 24  ? 128.766 1.003   197.219 1.00 45.50  ? 24   DC  H N4    1 
ATOM   6634 C  C5    . DC  H  2 24  ? 129.322 -1.272  197.803 1.00 46.69  ? 24   DC  H C5    1 
ATOM   6635 C  C6    . DC  H  2 24  ? 130.176 -2.087  198.427 1.00 42.39  ? 24   DC  H C6    1 
ATOM   6636 P  P     . DG  H  2 25  ? 131.035 -5.512  203.359 1.00 57.70  ? 25   DG  H P     1 
ATOM   6637 O  OP1   . DG  H  2 25  ? 131.601 -6.734  203.969 1.00 61.76  ? 25   DG  H OP1   1 
ATOM   6638 O  OP2   . DG  H  2 25  ? 129.588 -5.463  203.014 1.00 55.65  ? 25   DG  H OP2   1 
ATOM   6639 O  "O5'" . DG  H  2 25  ? 131.376 -4.225  204.248 1.00 54.05  ? 25   DG  H "O5'" 1 
ATOM   6640 C  "C5'" . DG  H  2 25  ? 132.672 -4.059  204.798 1.00 50.30  ? 25   DG  H "C5'" 1 
ATOM   6641 C  "C4'" . DG  H  2 25  ? 132.792 -2.706  205.477 1.00 53.51  ? 25   DG  H "C4'" 1 
ATOM   6642 O  "O4'" . DG  H  2 25  ? 132.562 -1.652  204.493 1.00 51.69  ? 25   DG  H "O4'" 1 
ATOM   6643 C  "C3'" . DG  H  2 25  ? 131.789 -2.459  206.609 1.00 51.79  ? 25   DG  H "C3'" 1 
ATOM   6644 O  "O3'" . DG  H  2 25  ? 132.427 -1.768  207.706 1.00 54.39  ? 25   DG  H "O3'" 1 
ATOM   6645 C  "C2'" . DG  H  2 25  ? 130.707 -1.607  205.939 1.00 46.70  ? 25   DG  H "C2'" 1 
ATOM   6646 C  "C1'" . DG  H  2 25  ? 131.506 -0.809  204.917 1.00 45.22  ? 25   DG  H "C1'" 1 
ATOM   6647 N  N9    . DG  H  2 25  ? 130.704 -0.424  203.758 1.00 45.84  ? 25   DG  H N9    1 
ATOM   6648 C  C8    . DG  H  2 25  ? 129.901 -1.244  202.994 1.00 45.80  ? 25   DG  H C8    1 
ATOM   6649 N  N7    . DG  H  2 25  ? 129.282 -0.611  202.022 1.00 42.34  ? 25   DG  H N7    1 
ATOM   6650 C  C5    . DG  H  2 25  ? 129.693 0.713   202.162 1.00 41.11  ? 25   DG  H C5    1 
ATOM   6651 C  C6    . DG  H  2 25  ? 129.333 1.863   201.415 1.00 40.80  ? 25   DG  H C6    1 
ATOM   6652 O  O6    . DG  H  2 25  ? 128.562 1.934   200.451 1.00 43.90  ? 25   DG  H O6    1 
ATOM   6653 N  N1    . DG  H  2 25  ? 129.975 3.009   201.886 1.00 41.86  ? 25   DG  H N1    1 
ATOM   6654 C  C2    . DG  H  2 25  ? 130.842 3.036   202.971 1.00 44.56  ? 25   DG  H C2    1 
ATOM   6655 N  N2    . DG  H  2 25  ? 131.359 4.230   203.303 1.00 43.11  ? 25   DG  H N2    1 
ATOM   6656 N  N3    . DG  H  2 25  ? 131.170 1.967   203.687 1.00 42.77  ? 25   DG  H N3    1 
ATOM   6657 C  C4    . DG  H  2 25  ? 130.565 0.845   203.227 1.00 43.86  ? 25   DG  H C4    1 
ATOM   6658 O  "O5'" . DC  I  3 1   ? 126.685 10.940  200.075 1.00 69.54  ? 1    DC  I "O5'" 1 
ATOM   6659 C  "C5'" . DC  I  3 1   ? 126.837 11.073  201.507 1.00 63.08  ? 1    DC  I "C5'" 1 
ATOM   6660 C  "C4'" . DC  I  3 1   ? 128.283 10.853  201.932 1.00 64.45  ? 1    DC  I "C4'" 1 
ATOM   6661 O  "O4'" . DC  I  3 1   ? 128.511 9.440   202.177 1.00 66.88  ? 1    DC  I "O4'" 1 
ATOM   6662 C  "C3'" . DC  I  3 1   ? 129.353 11.272  200.918 1.00 62.16  ? 1    DC  I "C3'" 1 
ATOM   6663 O  "O3'" . DC  I  3 1   ? 130.520 11.671  201.638 1.00 67.68  ? 1    DC  I "O3'" 1 
ATOM   6664 C  "C2'" . DC  I  3 1   ? 129.581 9.982   200.125 1.00 53.03  ? 1    DC  I "C2'" 1 
ATOM   6665 C  "C1'" . DC  I  3 1   ? 129.404 8.911   201.206 1.00 57.54  ? 1    DC  I "C1'" 1 
ATOM   6666 N  N1    . DC  I  3 1   ? 128.823 7.636   200.704 1.00 50.87  ? 1    DC  I N1    1 
ATOM   6667 C  C2    . DC  I  3 1   ? 129.346 6.407   201.150 1.00 48.08  ? 1    DC  I C2    1 
ATOM   6668 O  O2    . DC  I  3 1   ? 130.302 6.403   201.947 1.00 46.33  ? 1    DC  I O2    1 
ATOM   6669 N  N3    . DC  I  3 1   ? 128.788 5.253   200.694 1.00 47.78  ? 1    DC  I N3    1 
ATOM   6670 C  C4    . DC  I  3 1   ? 127.760 5.298   199.837 1.00 48.46  ? 1    DC  I C4    1 
ATOM   6671 N  N4    . DC  I  3 1   ? 127.253 4.135   199.405 1.00 44.70  ? 1    DC  I N4    1 
ATOM   6672 C  C5    . DC  I  3 1   ? 127.215 6.539   199.378 1.00 49.63  ? 1    DC  I C5    1 
ATOM   6673 C  C6    . DC  I  3 1   ? 127.769 7.671   199.840 1.00 50.32  ? 1    DC  I C6    1 
ATOM   6674 P  P     . DG  I  3 2   ? 131.787 12.376  200.928 1.00 76.81  ? 2    DG  I P     1 
ATOM   6675 O  OP1   . DG  I  3 2   ? 132.333 13.288  201.973 1.00 63.65  ? 2    DG  I OP1   1 
ATOM   6676 O  OP2   . DG  I  3 2   ? 131.479 12.843  199.556 1.00 64.42  ? 2    DG  I OP2   1 
ATOM   6677 O  "O5'" . DG  I  3 2   ? 132.831 11.186  200.792 1.00 65.46  ? 2    DG  I "O5'" 1 
ATOM   6678 C  "C5'" . DG  I  3 2   ? 133.243 10.514  201.961 1.00 62.96  ? 2    DG  I "C5'" 1 
ATOM   6679 C  "C4'" . DG  I  3 2   ? 134.081 9.305   201.612 1.00 61.54  ? 2    DG  I "C4'" 1 
ATOM   6680 O  "O4'" . DG  I  3 2   ? 133.214 8.236   201.175 1.00 58.96  ? 2    DG  I "O4'" 1 
ATOM   6681 C  "C3'" . DG  I  3 2   ? 135.093 9.527   200.490 1.00 54.31  ? 2    DG  I "C3'" 1 
ATOM   6682 O  "O3'" . DG  I  3 2   ? 136.384 9.151   200.948 1.00 61.57  ? 2    DG  I "O3'" 1 
ATOM   6683 C  "C2'" . DG  I  3 2   ? 134.592 8.617   199.370 1.00 50.79  ? 2    DG  I "C2'" 1 
ATOM   6684 C  "C1'" . DG  I  3 2   ? 133.836 7.549   200.146 1.00 52.93  ? 2    DG  I "C1'" 1 
ATOM   6685 N  N9    . DG  I  3 2   ? 132.793 6.883   199.383 1.00 47.65  ? 2    DG  I N9    1 
ATOM   6686 C  C8    . DG  I  3 2   ? 131.884 7.469   198.532 1.00 45.35  ? 2    DG  I C8    1 
ATOM   6687 N  N7    . DG  I  3 2   ? 131.056 6.618   197.995 1.00 44.57  ? 2    DG  I N7    1 
ATOM   6688 C  C5    . DG  I  3 2   ? 131.439 5.393   198.520 1.00 43.87  ? 2    DG  I C5    1 
ATOM   6689 C  C6    . DG  I  3 2   ? 130.909 4.106   198.298 1.00 45.75  ? 2    DG  I C6    1 
ATOM   6690 O  O6    . DG  I  3 2   ? 129.954 3.779   197.568 1.00 48.96  ? 2    DG  I O6    1 
ATOM   6691 N  N1    . DG  I  3 2   ? 131.597 3.139   199.020 1.00 43.89  ? 2    DG  I N1    1 
ATOM   6692 C  C2    . DG  I  3 2   ? 132.654 3.387   199.860 1.00 47.79  ? 2    DG  I C2    1 
ATOM   6693 N  N2    . DG  I  3 2   ? 133.172 2.322   200.485 1.00 46.51  ? 2    DG  I N2    1 
ATOM   6694 N  N3    . DG  I  3 2   ? 133.163 4.592   200.080 1.00 45.56  ? 2    DG  I N3    1 
ATOM   6695 C  C4    . DG  I  3 2   ? 132.508 5.541   199.378 1.00 46.19  ? 2    DG  I C4    1 
ATOM   6696 P  P     . DC  I  3 3   ? 137.680 9.315   200.004 1.00 62.81  ? 3    DC  I P     1 
ATOM   6697 O  OP1   . DC  I  3 3   ? 138.802 9.590   200.914 1.00 56.95  ? 3    DC  I OP1   1 
ATOM   6698 O  OP2   . DC  I  3 3   ? 137.385 10.199  198.856 1.00 58.14  ? 3    DC  I OP2   1 
ATOM   6699 O  "O5'" . DC  I  3 3   ? 137.885 7.861   199.416 1.00 54.94  ? 3    DC  I "O5'" 1 
ATOM   6700 C  "C5'" . DC  I  3 3   ? 137.954 6.794   200.314 1.00 52.74  ? 3    DC  I "C5'" 1 
ATOM   6701 C  "C4'" . DC  I  3 3   ? 137.766 5.484   199.595 1.00 54.54  ? 3    DC  I "C4'" 1 
ATOM   6702 O  "O4'" . DC  I  3 3   ? 136.449 5.410   199.036 1.00 53.13  ? 3    DC  I "O4'" 1 
ATOM   6703 C  "C3'" . DC  I  3 3   ? 138.723 5.228   198.428 1.00 51.25  ? 3    DC  I "C3'" 1 
ATOM   6704 O  "O3'" . DC  I  3 3   ? 139.655 4.255   198.850 1.00 56.67  ? 3    DC  I "O3'" 1 
ATOM   6705 C  "C2'" . DC  I  3 3   ? 137.805 4.695   197.303 1.00 49.78  ? 3    DC  I "C2'" 1 
ATOM   6706 C  "C1'" . DC  I  3 3   ? 136.489 4.429   198.054 1.00 48.28  ? 3    DC  I "C1'" 1 
ATOM   6707 N  N1    . DC  I  3 3   ? 135.260 4.556   197.240 1.00 43.59  ? 3    DC  I N1    1 
ATOM   6708 C  C2    . DC  I  3 3   ? 134.574 3.413   196.880 1.00 46.08  ? 3    DC  I C2    1 
ATOM   6709 O  O2    . DC  I  3 3   ? 135.029 2.323   197.230 1.00 46.91  ? 3    DC  I O2    1 
ATOM   6710 N  N3    . DC  I  3 3   ? 133.429 3.529   196.141 1.00 51.92  ? 3    DC  I N3    1 
ATOM   6711 C  C4    . DC  I  3 3   ? 132.972 4.746   195.791 1.00 49.15  ? 3    DC  I C4    1 
ATOM   6712 N  N4    . DC  I  3 3   ? 131.840 4.812   195.073 1.00 44.51  ? 3    DC  I N4    1 
ATOM   6713 C  C5    . DC  I  3 3   ? 133.662 5.940   196.167 1.00 43.75  ? 3    DC  I C5    1 
ATOM   6714 C  C6    . DC  I  3 3   ? 134.789 5.799   196.886 1.00 50.64  ? 3    DC  I C6    1 
ATOM   6715 P  P     . DG  I  3 4   ? 141.005 3.980   198.032 1.00 49.12  ? 4    DG  I P     1 
ATOM   6716 O  OP1   . DG  I  3 4   ? 142.045 3.586   199.001 1.00 44.83  ? 4    DG  I OP1   1 
ATOM   6717 O  OP2   . DG  I  3 4   ? 141.244 5.117   197.115 1.00 49.53  ? 4    DG  I OP2   1 
ATOM   6718 O  "O5'" . DG  I  3 4   ? 140.652 2.649   197.247 1.00 46.52  ? 4    DG  I "O5'" 1 
ATOM   6719 C  "C5'" . DG  I  3 4   ? 140.374 1.490   197.992 1.00 41.10  ? 4    DG  I "C5'" 1 
ATOM   6720 C  "C4'" . DG  I  3 4   ? 139.785 0.410   197.112 1.00 41.35  ? 4    DG  I "C4'" 1 
ATOM   6721 O  "O4'" . DG  I  3 4   ? 138.530 0.850   196.551 1.00 41.50  ? 4    DG  I "O4'" 1 
ATOM   6722 C  "C3'" . DG  I  3 4   ? 140.653 -0.042  195.920 1.00 46.85  ? 4    DG  I "C3'" 1 
ATOM   6723 O  "O3'" . DG  I  3 4   ? 140.660 -1.417  195.965 1.00 50.85  ? 4    DG  I "O3'" 1 
ATOM   6724 C  "C2'" . DG  I  3 4   ? 139.887 0.483   194.694 1.00 42.64  ? 4    DG  I "C2'" 1 
ATOM   6725 C  "C1'" . DG  I  3 4   ? 138.451 0.433   195.216 1.00 45.41  ? 4    DG  I "C1'" 1 
ATOM   6726 N  N9    . DG  I  3 4   ? 137.492 1.317   194.562 1.00 43.85  ? 4    DG  I N9    1 
ATOM   6727 C  C8    . DG  I  3 4   ? 137.518 2.699   194.507 1.00 43.84  ? 4    DG  I C8    1 
ATOM   6728 N  N7    . DG  I  3 4   ? 136.473 3.214   193.891 1.00 43.74  ? 4    DG  I N7    1 
ATOM   6729 C  C5    . DG  I  3 4   ? 135.700 2.101   193.547 1.00 39.68  ? 4    DG  I C5    1 
ATOM   6730 C  C6    . DG  I  3 4   ? 134.464 2.023   192.871 1.00 42.36  ? 4    DG  I C6    1 
ATOM   6731 O  O6    . DG  I  3 4   ? 133.786 2.948   192.428 1.00 49.19  ? 4    DG  I O6    1 
ATOM   6732 N  N1    . DG  I  3 4   ? 134.031 0.708   192.718 1.00 39.40  ? 4    DG  I N1    1 
ATOM   6733 C  C2    . DG  I  3 4   ? 134.707 -0.393  193.167 1.00 43.32  ? 4    DG  I C2    1 
ATOM   6734 N  N2    . DG  I  3 4   ? 134.136 -1.580  192.932 1.00 44.72  ? 4    DG  I N2    1 
ATOM   6735 N  N3    . DG  I  3 4   ? 135.875 -0.340  193.798 1.00 43.45  ? 4    DG  I N3    1 
ATOM   6736 C  C4    . DG  I  3 4   ? 136.309 0.934   193.954 1.00 40.58  ? 4    DG  I C4    1 
ATOM   6737 P  P     . DC  I  3 5   ? 141.562 -2.309  195.013 1.00 45.54  ? 5    DC  I P     1 
ATOM   6738 O  OP1   . DC  I  3 5   ? 142.139 -3.383  195.854 1.00 47.06  ? 5    DC  I OP1   1 
ATOM   6739 O  OP2   . DC  I  3 5   ? 142.511 -1.447  194.265 1.00 47.87  ? 5    DC  I OP2   1 
ATOM   6740 O  "O5'" . DC  I  3 5   ? 140.456 -2.969  194.079 1.00 47.82  ? 5    DC  I "O5'" 1 
ATOM   6741 C  "C5'" . DC  I  3 5   ? 140.780 -4.019  193.221 1.00 47.93  ? 5    DC  I "C5'" 1 
ATOM   6742 C  "C4'" . DC  I  3 5   ? 139.528 -4.552  192.577 1.00 41.23  ? 5    DC  I "C4'" 1 
ATOM   6743 O  "O4'" . DC  I  3 5   ? 138.510 -3.509  192.535 1.00 44.93  ? 5    DC  I "O4'" 1 
ATOM   6744 C  "C3'" . DC  I  3 5   ? 139.705 -5.012  191.147 1.00 49.32  ? 5    DC  I "C3'" 1 
ATOM   6745 O  "O3'" . DC  I  3 5   ? 138.946 -6.139  190.953 1.00 49.18  ? 5    DC  I "O3'" 1 
ATOM   6746 C  "C2'" . DC  I  3 5   ? 139.177 -3.837  190.324 1.00 41.92  ? 5    DC  I "C2'" 1 
ATOM   6747 C  "C1'" . DC  I  3 5   ? 138.035 -3.360  191.208 1.00 43.58  ? 5    DC  I "C1'" 1 
ATOM   6748 N  N1    . DC  I  3 5   ? 137.668 -1.932  190.991 1.00 41.36  ? 5    DC  I N1    1 
ATOM   6749 C  C2    . DC  I  3 5   ? 136.489 -1.613  190.304 1.00 42.97  ? 5    DC  I C2    1 
ATOM   6750 O  O2    . DC  I  3 5   ? 135.781 -2.531  189.868 1.00 44.61  ? 5    DC  I O2    1 
ATOM   6751 N  N3    . DC  I  3 5   ? 136.166 -0.306  190.114 1.00 41.05  ? 5    DC  I N3    1 
ATOM   6752 C  C4    . DC  I  3 5   ? 136.967 0.651   190.579 1.00 43.66  ? 5    DC  I C4    1 
ATOM   6753 N  N4    . DC  I  3 5   ? 136.609 1.926   190.367 1.00 42.30  ? 5    DC  I N4    1 
ATOM   6754 C  C5    . DC  I  3 5   ? 138.176 0.347   191.294 1.00 43.00  ? 5    DC  I C5    1 
ATOM   6755 C  C6    . DC  I  3 5   ? 138.484 -0.946  191.469 1.00 41.26  ? 5    DC  I C6    1 
ATOM   6756 P  P     . DC  I  3 6   ? 139.246 -7.070  189.700 1.00 52.87  ? 6    DC  I P     1 
ATOM   6757 O  OP1   . DC  I  3 6   ? 138.705 -8.409  190.013 1.00 54.59  ? 6    DC  I OP1   1 
ATOM   6758 O  OP2   . DC  I  3 6   ? 140.703 -6.940  189.411 1.00 53.86  ? 6    DC  I OP2   1 
ATOM   6759 O  "O5'" . DC  I  3 6   ? 138.381 -6.403  188.532 1.00 54.69  ? 6    DC  I "O5'" 1 
ATOM   6760 C  "C5'" . DC  I  3 6   ? 137.130 -6.956  188.195 1.00 52.83  ? 6    DC  I "C5'" 1 
ATOM   6761 C  "C4'" . DC  I  3 6   ? 136.385 -6.112  187.171 1.00 51.49  ? 6    DC  I "C4'" 1 
ATOM   6762 O  "O4'" . DC  I  3 6   ? 136.500 -4.704  187.443 1.00 51.27  ? 6    DC  I "O4'" 1 
ATOM   6763 C  "C3'" . DC  I  3 6   ? 136.806 -6.280  185.701 1.00 53.68  ? 6    DC  I "C3'" 1 
ATOM   6764 O  "O3'" . DC  I  3 6   ? 135.762 -6.971  185.008 1.00 61.54  ? 6    DC  I "O3'" 1 
ATOM   6765 C  "C2'" . DC  I  3 6   ? 136.965 -4.827  185.184 1.00 48.23  ? 6    DC  I "C2'" 1 
ATOM   6766 C  "C1'" . DC  I  3 6   ? 136.189 -4.058  186.237 1.00 49.38  ? 6    DC  I "C1'" 1 
ATOM   6767 N  N1    . DC  I  3 6   ? 136.494 -2.609  186.358 1.00 46.76  ? 6    DC  I N1    1 
ATOM   6768 C  C2    . DC  I  3 6   ? 135.672 -1.682  185.702 1.00 48.87  ? 6    DC  I C2    1 
ATOM   6769 O  O2    . DC  I  3 6   ? 134.747 -2.098  184.996 1.00 49.75  ? 6    DC  I O2    1 
ATOM   6770 N  N3    . DC  I  3 6   ? 135.931 -0.354  185.841 1.00 48.34  ? 6    DC  I N3    1 
ATOM   6771 C  C4    . DC  I  3 6   ? 136.947 0.049   186.612 1.00 45.09  ? 6    DC  I C4    1 
ATOM   6772 N  N4    . DC  I  3 6   ? 137.162 1.360   186.722 1.00 41.70  ? 6    DC  I N4    1 
ATOM   6773 C  C5    . DC  I  3 6   ? 137.789 -0.880  187.291 1.00 41.41  ? 6    DC  I C5    1 
ATOM   6774 C  C6    . DC  I  3 6   ? 137.526 -2.188  187.142 1.00 42.23  ? 6    DC  I C6    1 
ATOM   6775 P  P     . DG  I  3 7   ? 136.082 -7.930  183.759 1.00 67.36  ? 7    DG  I P     1 
ATOM   6776 O  OP1   . DG  I  3 7   ? 134.998 -8.941  183.755 1.00 67.07  ? 7    DG  I OP1   1 
ATOM   6777 O  OP2   . DG  I  3 7   ? 137.499 -8.381  183.820 1.00 70.08  ? 7    DG  I OP2   1 
ATOM   6778 O  "O5'" . DG  I  3 7   ? 135.947 -6.942  182.512 1.00 54.82  ? 7    DG  I "O5'" 1 
ATOM   6779 C  "C5'" . DG  I  3 7   ? 134.734 -6.273  182.277 1.00 55.83  ? 7    DG  I "C5'" 1 
ATOM   6780 C  "C4'" . DG  I  3 7   ? 134.873 -5.251  181.162 1.00 60.51  ? 7    DG  I "C4'" 1 
ATOM   6781 O  "O4'" . DG  I  3 7   ? 135.082 -3.932  181.733 1.00 58.99  ? 7    DG  I "O4'" 1 
ATOM   6782 C  "C3'" . DG  I  3 7   ? 136.021 -5.477  180.162 1.00 57.93  ? 7    DG  I "C3'" 1 
ATOM   6783 O  "O3'" . DG  I  3 7   ? 135.500 -5.331  178.817 1.00 77.09  ? 7    DG  I "O3'" 1 
ATOM   6784 C  "C2'" . DG  I  3 7   ? 137.004 -4.352  180.519 1.00 55.80  ? 7    DG  I "C2'" 1 
ATOM   6785 C  "C1'" . DG  I  3 7   ? 136.043 -3.257  180.970 1.00 54.51  ? 7    DG  I "C1'" 1 
ATOM   6786 N  N9    . DG  I  3 7   ? 136.660 -2.209  181.795 1.00 52.24  ? 7    DG  I N9    1 
ATOM   6787 C  C8    . DG  I  3 7   ? 137.685 -2.359  182.705 1.00 50.82  ? 7    DG  I C8    1 
ATOM   6788 N  N7    . DG  I  3 7   ? 138.032 -1.240  183.294 1.00 47.14  ? 7    DG  I N7    1 
ATOM   6789 C  C5    . DG  I  3 7   ? 137.198 -0.288  182.738 1.00 47.38  ? 7    DG  I C5    1 
ATOM   6790 C  C6    . DG  I  3 7   ? 137.111 1.098   182.982 1.00 47.81  ? 7    DG  I C6    1 
ATOM   6791 O  O6    . DG  I  3 7   ? 137.781 1.787   183.746 1.00 47.50  ? 7    DG  I O6    1 
ATOM   6792 N  N1    . DG  I  3 7   ? 136.123 1.693   182.221 1.00 52.60  ? 7    DG  I N1    1 
ATOM   6793 C  C2    . DG  I  3 7   ? 135.318 1.041   181.332 1.00 52.18  ? 7    DG  I C2    1 
ATOM   6794 N  N2    . DG  I  3 7   ? 134.430 1.796   180.697 1.00 53.93  ? 7    DG  I N2    1 
ATOM   6795 N  N3    . DG  I  3 7   ? 135.381 -0.255  181.082 1.00 51.51  ? 7    DG  I N3    1 
ATOM   6796 C  C4    . DG  I  3 7   ? 136.343 -0.860  181.815 1.00 51.17  ? 7    DG  I C4    1 
ATOM   6797 P  P     . DG  I  3 8   ? 136.284 -5.868  177.508 1.00 72.99  ? 8    DG  I P     1 
ATOM   6798 O  OP1   . DG  I  3 8   ? 135.379 -6.812  176.819 1.00 75.05  ? 8    DG  I OP1   1 
ATOM   6799 O  OP2   . DG  I  3 8   ? 137.693 -6.237  177.788 1.00 63.26  ? 8    DG  I OP2   1 
ATOM   6800 O  "O5'" . DG  I  3 8   ? 136.405 -4.567  176.639 1.00 64.79  ? 8    DG  I "O5'" 1 
ATOM   6801 C  "C5'" . DG  I  3 8   ? 136.891 -3.434  177.235 1.00 64.14  ? 8    DG  I "C5'" 1 
ATOM   6802 C  "C4'" . DG  I  3 8   ? 136.068 -2.256  176.830 1.00 65.00  ? 8    DG  I "C4'" 1 
ATOM   6803 O  "O4'" . DG  I  3 8   ? 136.052 -1.310  177.917 1.00 61.46  ? 8    DG  I "O4'" 1 
ATOM   6804 C  "C3'" . DG  I  3 8   ? 136.618 -1.539  175.612 1.00 61.02  ? 8    DG  I "C3'" 1 
ATOM   6805 O  "O3'" . DG  I  3 8   ? 135.586 -1.240  174.694 1.00 69.58  ? 8    DG  I "O3'" 1 
ATOM   6806 C  "C2'" . DG  I  3 8   ? 137.278 -0.284  176.168 1.00 59.72  ? 8    DG  I "C2'" 1 
ATOM   6807 C  "C1'" . DG  I  3 8   ? 136.610 -0.081  177.520 1.00 60.88  ? 8    DG  I "C1'" 1 
ATOM   6808 N  N9    . DG  I  3 8   ? 137.570 0.330   178.523 1.00 57.70  ? 8    DG  I N9    1 
ATOM   6809 C  C8    . DG  I  3 8   ? 138.478 -0.471  179.184 1.00 51.62  ? 8    DG  I C8    1 
ATOM   6810 N  N7    . DG  I  3 8   ? 139.243 0.195   180.008 1.00 51.27  ? 8    DG  I N7    1 
ATOM   6811 C  C5    . DG  I  3 8   ? 138.814 1.511   179.887 1.00 49.34  ? 8    DG  I C5    1 
ATOM   6812 C  C6    . DG  I  3 8   ? 139.276 2.672   180.523 1.00 48.51  ? 8    DG  I C6    1 
ATOM   6813 O  O6    . DG  I  3 8   ? 140.175 2.770   181.352 1.00 55.32  ? 8    DG  I O6    1 
ATOM   6814 N  N1    . DG  I  3 8   ? 138.576 3.806   180.114 1.00 52.86  ? 8    DG  I N1    1 
ATOM   6815 C  C2    . DG  I  3 8   ? 137.552 3.804   179.184 1.00 55.90  ? 8    DG  I C2    1 
ATOM   6816 N  N2    . DG  I  3 8   ? 136.995 4.991   178.901 1.00 52.90  ? 8    DG  I N2    1 
ATOM   6817 N  N3    . DG  I  3 8   ? 137.114 2.717   178.572 1.00 53.67  ? 8    DG  I N3    1 
ATOM   6818 C  C4    . DG  I  3 8   ? 137.791 1.612   178.968 1.00 56.94  ? 8    DG  I C4    1 
ATOM   6819 P  P     . DA  I  3 9   ? 135.930 -1.102  173.125 1.00 73.53  ? 9    DA  I P     1 
ATOM   6820 O  OP1   . DA  I  3 9   ? 134.615 -1.049  172.449 1.00 82.72  ? 9    DA  I OP1   1 
ATOM   6821 O  OP2   . DA  I  3 9   ? 136.942 -2.118  172.746 1.00 61.88  ? 9    DA  I OP2   1 
ATOM   6822 O  "O5'" . DA  I  3 9   ? 136.590 0.345   173.003 1.00 60.02  ? 9    DA  I "O5'" 1 
ATOM   6823 C  "C5'" . DA  I  3 9   ? 135.860 1.465   173.477 1.00 64.51  ? 9    DA  I "C5'" 1 
ATOM   6824 C  "C4'" . DA  I  3 9   ? 136.758 2.668   173.609 1.00 68.03  ? 9    DA  I "C4'" 1 
ATOM   6825 O  "O4'" . DA  I  3 9   ? 137.585 2.551   174.809 1.00 70.15  ? 9    DA  I "O4'" 1 
ATOM   6826 C  "C3'" . DA  I  3 9   ? 137.739 2.854   172.443 1.00 73.14  ? 9    DA  I "C3'" 1 
ATOM   6827 O  "O3'" . DA  I  3 9   ? 137.782 4.216   172.075 1.00 80.01  ? 9    DA  I "O3'" 1 
ATOM   6828 C  "C2'" . DA  I  3 9   ? 139.062 2.427   173.054 1.00 69.55  ? 9    DA  I "C2'" 1 
ATOM   6829 C  "C1'" . DA  I  3 9   ? 138.869 2.981   174.453 1.00 71.63  ? 9    DA  I "C1'" 1 
ATOM   6830 N  N9    . DA  I  3 9   ? 139.870 2.530   175.413 1.00 63.61  ? 9    DA  I N9    1 
ATOM   6831 C  C8    . DA  I  3 9   ? 140.476 1.303   175.467 1.00 56.66  ? 9    DA  I C8    1 
ATOM   6832 N  N7    . DA  I  3 9   ? 141.368 1.197   176.423 1.00 60.09  ? 9    DA  I N7    1 
ATOM   6833 C  C5    . DA  I  3 9   ? 141.358 2.449   177.025 1.00 60.28  ? 9    DA  I C5    1 
ATOM   6834 C  C6    . DA  I  3 9   ? 142.087 2.988   178.093 1.00 52.89  ? 9    DA  I C6    1 
ATOM   6835 N  N6    . DA  I  3 9   ? 143.004 2.294   178.769 1.00 56.16  ? 9    DA  I N6    1 
ATOM   6836 N  N1    . DA  I  3 9   ? 141.844 4.275   178.440 1.00 55.88  ? 9    DA  I N1    1 
ATOM   6837 C  C2    . DA  I  3 9   ? 140.925 4.966   177.757 1.00 57.84  ? 9    DA  I C2    1 
ATOM   6838 N  N3    . DA  I  3 9   ? 140.173 4.565   176.731 1.00 64.55  ? 9    DA  I N3    1 
ATOM   6839 C  C4    . DA  I  3 9   ? 140.447 3.284   176.408 1.00 64.66  ? 9    DA  I C4    1 
ATOM   6840 P  P     . DA  I  3 10  ? 137.431 4.669   170.572 1.00 78.31  ? 10   DA  I P     1 
ATOM   6841 O  OP1   . DA  I  3 10  ? 136.077 4.151   170.277 1.00 76.00  ? 10   DA  I OP1   1 
ATOM   6842 O  OP2   . DA  I  3 10  ? 138.561 4.302   169.688 1.00 71.33  ? 10   DA  I OP2   1 
ATOM   6843 O  "O5'" . DA  I  3 10  ? 137.378 6.263   170.695 1.00 73.45  ? 10   DA  I "O5'" 1 
ATOM   6844 C  "C5'" . DA  I  3 10  ? 136.669 6.869   171.773 1.00 66.61  ? 10   DA  I "C5'" 1 
ATOM   6845 C  "C4'" . DA  I  3 10  ? 137.466 8.027   172.344 1.00 76.77  ? 10   DA  I "C4'" 1 
ATOM   6846 O  "O4'" . DA  I  3 10  ? 138.443 7.529   173.303 1.00 77.78  ? 10   DA  I "O4'" 1 
ATOM   6847 C  "C3'" . DA  I  3 10  ? 138.261 8.839   171.322 1.00 77.48  ? 10   DA  I "C3'" 1 
ATOM   6848 O  "O3'" . DA  I  3 10  ? 138.268 10.218  171.717 1.00 80.05  ? 10   DA  I "O3'" 1 
ATOM   6849 C  "C2'" . DA  I  3 10  ? 139.657 8.214   171.408 1.00 76.13  ? 10   DA  I "C2'" 1 
ATOM   6850 C  "C1'" . DA  I  3 10  ? 139.753 7.880   172.894 1.00 72.13  ? 10   DA  I "C1'" 1 
ATOM   6851 N  N9    . DA  I  3 10  ? 140.645 6.756   173.208 1.00 72.41  ? 10   DA  I N9    1 
ATOM   6852 C  C8    . DA  I  3 10  ? 140.685 5.532   172.595 1.00 70.46  ? 10   DA  I C8    1 
ATOM   6853 N  N7    . DA  I  3 10  ? 141.571 4.706   173.107 1.00 67.33  ? 10   DA  I N7    1 
ATOM   6854 C  C5    . DA  I  3 10  ? 142.145 5.432   174.141 1.00 69.21  ? 10   DA  I C5    1 
ATOM   6855 C  C6    . DA  I  3 10  ? 143.163 5.127   175.079 1.00 61.15  ? 10   DA  I C6    1 
ATOM   6856 N  N6    . DA  I  3 10  ? 143.797 3.955   175.132 1.00 47.28  ? 10   DA  I N6    1 
ATOM   6857 N  N1    . DA  I  3 10  ? 143.494 6.083   175.973 1.00 63.04  ? 10   DA  I N1    1 
ATOM   6858 C  C2    . DA  I  3 10  ? 142.855 7.259   175.931 1.00 65.74  ? 10   DA  I C2    1 
ATOM   6859 N  N3    . DA  I  3 10  ? 141.893 7.663   175.104 1.00 68.32  ? 10   DA  I N3    1 
ATOM   6860 C  C4    . DA  I  3 10  ? 141.581 6.696   174.222 1.00 71.98  ? 10   DA  I C4    1 
ATOM   6861 P  P     . DC  I  3 11  ? 138.771 11.368  170.711 1.00 86.38  ? 11   DC  I P     1 
ATOM   6862 O  OP1   . DC  I  3 11  ? 138.033 12.595  171.094 1.00 77.36  ? 11   DC  I OP1   1 
ATOM   6863 O  OP2   . DC  I  3 11  ? 138.785 10.839  169.324 1.00 77.30  ? 11   DC  I OP2   1 
ATOM   6864 O  "O5'" . DC  I  3 11  ? 140.285 11.617  171.139 1.00 87.48  ? 11   DC  I "O5'" 1 
ATOM   6865 C  "C5'" . DC  I  3 11  ? 140.575 12.067  172.461 1.00 86.76  ? 11   DC  I "C5'" 1 
ATOM   6866 C  "C4'" . DC  I  3 11  ? 142.041 11.876  172.761 1.00 80.84  ? 11   DC  I "C4'" 1 
ATOM   6867 O  "O4'" . DC  I  3 11  ? 142.316 10.471  172.895 1.00 78.60  ? 11   DC  I "O4'" 1 
ATOM   6868 C  "C3'" . DC  I  3 11  ? 142.967 12.349  171.646 1.00 82.36  ? 11   DC  I "C3'" 1 
ATOM   6869 O  "O3'" . DC  I  3 11  ? 143.499 13.637  171.959 1.00 86.95  ? 11   DC  I "O3'" 1 
ATOM   6870 C  "C2'" . DC  I  3 11  ? 144.065 11.266  171.563 1.00 76.36  ? 11   DC  I "C2'" 1 
ATOM   6871 C  "C1'" . DC  I  3 11  ? 143.683 10.292  172.671 1.00 74.11  ? 11   DC  I "C1'" 1 
ATOM   6872 N  N1    . DC  I  3 11  ? 143.953 8.855   172.348 1.00 72.56  ? 11   DC  I N1    1 
ATOM   6873 C  C2    . DC  I  3 11  ? 144.957 8.189   173.048 1.00 68.29  ? 11   DC  I C2    1 
ATOM   6874 O  O2    . DC  I  3 11  ? 145.588 8.804   173.905 1.00 72.26  ? 11   DC  I O2    1 
ATOM   6875 N  N3    . DC  I  3 11  ? 145.211 6.892   172.767 1.00 65.08  ? 11   DC  I N3    1 
ATOM   6876 C  C4    . DC  I  3 11  ? 144.511 6.265   171.834 1.00 64.07  ? 11   DC  I C4    1 
ATOM   6877 N  N4    . DC  I  3 11  ? 144.811 4.989   171.596 1.00 61.88  ? 11   DC  I N4    1 
ATOM   6878 C  C5    . DC  I  3 11  ? 143.476 6.923   171.099 1.00 68.07  ? 11   DC  I C5    1 
ATOM   6879 C  C6    . DC  I  3 11  ? 143.232 8.210   171.388 1.00 70.74  ? 11   DC  I C6    1 
ATOM   6880 P  P     . DT  I  3 12  ? 144.471 14.381  170.914 1.00 88.34  ? 12   DT  I P     1 
ATOM   6881 O  OP1   . DT  I  3 12  ? 144.260 15.836  171.092 1.00 87.51  ? 12   DT  I OP1   1 
ATOM   6882 O  OP2   . DT  I  3 12  ? 144.314 13.739  169.588 1.00 78.71  ? 12   DT  I OP2   1 
ATOM   6883 O  "O5'" . DT  I  3 12  ? 145.934 14.013  171.435 1.00 85.04  ? 12   DT  I "O5'" 1 
ATOM   6884 C  "C5'" . DT  I  3 12  ? 146.253 14.175  172.820 1.00 82.07  ? 12   DT  I "C5'" 1 
ATOM   6885 C  "C4'" . DT  I  3 12  ? 147.630 13.617  173.124 1.00 77.83  ? 12   DT  I "C4'" 1 
ATOM   6886 O  "O4'" . DT  I  3 12  ? 147.588 12.170  173.083 1.00 74.87  ? 12   DT  I "O4'" 1 
ATOM   6887 C  "C3'" . DT  I  3 12  ? 148.723 14.057  172.154 1.00 75.55  ? 12   DT  I "C3'" 1 
ATOM   6888 O  "O3'" . DT  I  3 12  ? 149.805 14.627  172.875 1.00 81.93  ? 12   DT  I "O3'" 1 
ATOM   6889 C  "C2'" . DT  I  3 12  ? 149.131 12.772  171.422 1.00 71.50  ? 12   DT  I "C2'" 1 
ATOM   6890 C  "C1'" . DT  I  3 12  ? 148.700 11.675  172.382 1.00 73.36  ? 12   DT  I "C1'" 1 
ATOM   6891 N  N1    . DT  I  3 12  ? 148.287 10.410  171.694 1.00 73.78  ? 12   DT  I N1    1 
ATOM   6892 C  C2    . DT  I  3 12  ? 148.841 9.216   172.092 1.00 68.97  ? 12   DT  I C2    1 
ATOM   6893 O  O2    . DT  I  3 12  ? 149.662 9.125   172.987 1.00 71.26  ? 12   DT  I O2    1 
ATOM   6894 N  N3    . DT  I  3 12  ? 148.398 8.122   171.400 1.00 65.49  ? 12   DT  I N3    1 
ATOM   6895 C  C4    . DT  I  3 12  ? 147.473 8.097   170.375 1.00 63.03  ? 12   DT  I C4    1 
ATOM   6896 O  O4    . DT  I  3 12  ? 147.138 7.055   169.825 1.00 58.53  ? 12   DT  I O4    1 
ATOM   6897 C  C5    . DT  I  3 12  ? 146.929 9.381   170.003 1.00 67.92  ? 12   DT  I C5    1 
ATOM   6898 C  C7    . DT  I  3 12  ? 145.921 9.484   168.901 1.00 72.04  ? 12   DT  I C7    1 
ATOM   6899 C  C6    . DT  I  3 12  ? 147.357 10.463  170.671 1.00 74.06  ? 12   DT  I C6    1 
ATOM   6900 P  P     . DT  I  3 13  ? 151.020 15.329  172.095 1.00 83.65  ? 13   DT  I P     1 
ATOM   6901 O  OP1   . DT  I  3 13  ? 151.165 16.694  172.646 1.00 88.51  ? 13   DT  I OP1   1 
ATOM   6902 O  OP2   . DT  I  3 13  ? 150.833 15.149  170.641 1.00 84.20  ? 13   DT  I OP2   1 
ATOM   6903 O  "O5'" . DT  I  3 13  ? 152.285 14.439  172.513 1.00 83.92  ? 13   DT  I "O5'" 1 
ATOM   6904 C  "C5'" . DT  I  3 13  ? 152.173 13.490  173.579 1.00 75.27  ? 13   DT  I "C5'" 1 
ATOM   6905 C  "C4'" . DT  I  3 13  ? 153.246 12.419  173.465 1.00 69.98  ? 13   DT  I "C4'" 1 
ATOM   6906 O  "O4'" . DT  I  3 13  ? 152.703 11.245  172.799 1.00 68.09  ? 13   DT  I "O4'" 1 
ATOM   6907 C  "C3'" . DT  I  3 13  ? 154.488 12.820  172.657 1.00 68.14  ? 13   DT  I "C3'" 1 
ATOM   6908 O  "O3'" . DT  I  3 13  ? 155.666 12.226  173.233 1.00 61.19  ? 13   DT  I "O3'" 1 
ATOM   6909 C  "C2'" . DT  I  3 13  ? 154.181 12.217  171.290 1.00 64.70  ? 13   DT  I "C2'" 1 
ATOM   6910 C  "C1'" . DT  I  3 13  ? 153.548 10.907  171.723 1.00 63.99  ? 13   DT  I "C1'" 1 
ATOM   6911 N  N1    . DT  I  3 13  ? 152.744 10.225  170.677 1.00 64.30  ? 13   DT  I N1    1 
ATOM   6912 C  C2    . DT  I  3 13  ? 152.934 8.884   170.484 1.00 62.08  ? 13   DT  I C2    1 
ATOM   6913 O  O2    . DT  I  3 13  ? 153.733 8.237   171.127 1.00 60.90  ? 13   DT  I O2    1 
ATOM   6914 N  N3    . DT  I  3 13  ? 152.149 8.319   169.505 1.00 62.82  ? 13   DT  I N3    1 
ATOM   6915 C  C4    . DT  I  3 13  ? 151.205 8.961   168.723 1.00 66.02  ? 13   DT  I C4    1 
ATOM   6916 O  O4    . DT  I  3 13  ? 150.546 8.371   167.874 1.00 65.53  ? 13   DT  I O4    1 
ATOM   6917 C  C5    . DT  I  3 13  ? 151.050 10.378  168.978 1.00 68.50  ? 13   DT  I C5    1 
ATOM   6918 C  C7    . DT  I  3 13  ? 150.060 11.181  168.188 1.00 67.53  ? 13   DT  I C7    1 
ATOM   6919 C  C6    . DT  I  3 13  ? 151.822 10.939  169.933 1.00 71.76  ? 13   DT  I C6    1 
ATOM   6920 P  P     . DA  I  3 14  ? 156.428 12.912  174.474 1.00 56.26  ? 14   DA  I P     1 
ATOM   6921 O  OP1   . DA  I  3 14  ? 155.418 13.410  175.430 1.00 67.22  ? 14   DA  I OP1   1 
ATOM   6922 O  OP2   . DA  I  3 14  ? 157.448 13.852  173.951 1.00 54.78  ? 14   DA  I OP2   1 
ATOM   6923 O  "O5'" . DA  I  3 14  ? 157.173 11.677  175.161 1.00 56.91  ? 14   DA  I "O5'" 1 
ATOM   6924 C  "C5'" . DA  I  3 14  ? 156.407 10.620  175.691 1.00 51.62  ? 14   DA  I "C5'" 1 
ATOM   6925 C  "C4'" . DA  I  3 14  ? 156.953 9.257   175.288 1.00 49.57  ? 14   DA  I "C4'" 1 
ATOM   6926 O  "O4'" . DA  I  3 14  ? 156.600 8.931   173.909 1.00 49.07  ? 14   DA  I "O4'" 1 
ATOM   6927 C  "C3'" . DA  I  3 14  ? 158.455 9.079   175.386 1.00 49.69  ? 14   DA  I "C3'" 1 
ATOM   6928 O  "O3'" . DA  I  3 14  ? 158.686 7.751   175.835 1.00 40.94  ? 14   DA  I "O3'" 1 
ATOM   6929 C  "C2'" . DA  I  3 14  ? 158.917 9.294   173.920 1.00 50.88  ? 14   DA  I "C2'" 1 
ATOM   6930 C  "C1'" . DA  I  3 14  ? 157.767 8.650   173.151 1.00 48.96  ? 14   DA  I "C1'" 1 
ATOM   6931 N  N9    . DA  I  3 14  ? 157.509 9.187   171.813 1.00 51.51  ? 14   DA  I N9    1 
ATOM   6932 C  C8    . DA  I  3 14  ? 157.497 10.501  171.441 1.00 54.61  ? 14   DA  I C8    1 
ATOM   6933 N  N7    . DA  I  3 14  ? 157.137 10.697  170.191 1.00 56.65  ? 14   DA  I N7    1 
ATOM   6934 C  C5    . DA  I  3 14  ? 156.852 9.425   169.725 1.00 53.83  ? 14   DA  I C5    1 
ATOM   6935 C  C6    . DA  I  3 14  ? 156.417 8.950   168.474 1.00 50.73  ? 14   DA  I C6    1 
ATOM   6936 N  N6    . DA  I  3 14  ? 156.182 9.742   167.438 1.00 58.03  ? 14   DA  I N6    1 
ATOM   6937 N  N1    . DA  I  3 14  ? 156.225 7.627   168.337 1.00 51.89  ? 14   DA  I N1    1 
ATOM   6938 C  C2    . DA  I  3 14  ? 156.464 6.827   169.385 1.00 48.52  ? 14   DA  I C2    1 
ATOM   6939 N  N3    . DA  I  3 14  ? 156.892 7.153   170.601 1.00 42.82  ? 14   DA  I N3    1 
ATOM   6940 C  C4    . DA  I  3 14  ? 157.060 8.483   170.712 1.00 46.32  ? 14   DA  I C4    1 
ATOM   6941 P  P     . DC  I  3 15  ? 160.063 7.340   176.538 1.00 38.99  ? 15   DC  I P     1 
ATOM   6942 O  OP1   . DC  I  3 15  ? 159.804 6.043   177.171 1.00 35.40  ? 15   DC  I OP1   1 
ATOM   6943 O  OP2   . DC  I  3 15  ? 160.599 8.468   177.322 1.00 41.63  ? 15   DC  I OP2   1 
ATOM   6944 O  "O5'" . DC  I  3 15  ? 161.073 7.134   175.287 1.00 48.86  ? 15   DC  I "O5'" 1 
ATOM   6945 C  "C5'" . DC  I  3 15  ? 161.395 5.820   174.798 1.00 42.15  ? 15   DC  I "C5'" 1 
ATOM   6946 C  "C4'" . DC  I  3 15  ? 160.369 5.303   173.790 1.00 45.07  ? 15   DC  I "C4'" 1 
ATOM   6947 O  "O4'" . DC  I  3 15  ? 160.037 6.339   172.824 1.00 44.25  ? 15   DC  I "O4'" 1 
ATOM   6948 C  "C3'" . DC  I  3 15  ? 160.850 4.117   172.938 1.00 46.61  ? 15   DC  I "C3'" 1 
ATOM   6949 O  "O3'" . DC  I  3 15  ? 159.743 3.273   172.616 1.00 46.03  ? 15   DC  I "O3'" 1 
ATOM   6950 C  "C2'" . DC  I  3 15  ? 161.374 4.817   171.688 1.00 48.46  ? 15   DC  I "C2'" 1 
ATOM   6951 C  "C1'" . DC  I  3 15  ? 160.260 5.818   171.512 1.00 46.94  ? 15   DC  I "C1'" 1 
ATOM   6952 N  N1    . DC  I  3 15  ? 160.533 6.952   170.568 1.00 46.47  ? 15   DC  I N1    1 
ATOM   6953 C  C2    . DC  I  3 15  ? 160.079 6.887   169.237 1.00 45.12  ? 15   DC  I C2    1 
ATOM   6954 O  O2    . DC  I  3 15  ? 159.531 5.862   168.834 1.00 41.51  ? 15   DC  I O2    1 
ATOM   6955 N  N3    . DC  I  3 15  ? 160.274 7.955   168.428 1.00 45.25  ? 15   DC  I N3    1 
ATOM   6956 C  C4    . DC  I  3 15  ? 160.895 9.042   168.901 1.00 47.30  ? 15   DC  I C4    1 
ATOM   6957 N  N4    . DC  I  3 15  ? 161.081 10.069  168.075 1.00 48.00  ? 15   DC  I N4    1 
ATOM   6958 C  C5    . DC  I  3 15  ? 161.345 9.129   170.253 1.00 48.25  ? 15   DC  I C5    1 
ATOM   6959 C  C6    . DC  I  3 15  ? 161.136 8.078   171.038 1.00 45.27  ? 15   DC  I C6    1 
ATOM   6960 O  OP3   . DC  J  4 1   ? 162.104 1.833   240.349 1.00 52.59  ? 16   DC  K OP3   1 
ATOM   6961 P  P     . DC  J  4 1   ? 162.857 1.847   241.628 1.00 59.63  ? 16   DC  K P     1 
ATOM   6962 O  OP1   . DC  J  4 1   ? 163.939 2.856   241.528 1.00 49.00  ? 16   DC  K OP1   1 
ATOM   6963 O  OP2   . DC  J  4 1   ? 163.234 0.422   241.872 1.00 53.31  ? 16   DC  K OP2   1 
ATOM   6964 O  "O5'" . DC  J  4 1   ? 161.825 2.325   242.770 1.00 50.30  ? 16   DC  K "O5'" 1 
ATOM   6965 C  "C5'" . DC  J  4 1   ? 161.931 1.817   244.126 1.00 49.00  ? 16   DC  K "C5'" 1 
ATOM   6966 C  "C4'" . DC  J  4 1   ? 163.314 2.094   244.705 1.00 49.83  ? 16   DC  K "C4'" 1 
ATOM   6967 O  "O4'" . DC  J  4 1   ? 163.499 3.517   244.878 1.00 49.16  ? 16   DC  K "O4'" 1 
ATOM   6968 C  "C3'" . DC  J  4 1   ? 163.616 1.460   246.073 1.00 52.36  ? 16   DC  K "C3'" 1 
ATOM   6969 O  "O3'" . DC  J  4 1   ? 164.708 0.568   245.929 1.00 53.74  ? 16   DC  K "O3'" 1 
ATOM   6970 C  "C2'" . DC  J  4 1   ? 163.961 2.661   246.984 1.00 45.53  ? 16   DC  K "C2'" 1 
ATOM   6971 C  "C1'" . DC  J  4 1   ? 164.360 3.716   245.961 1.00 51.51  ? 16   DC  K "C1'" 1 
ATOM   6972 N  N1    . DC  J  4 1   ? 164.202 5.118   246.398 1.00 48.83  ? 16   DC  K N1    1 
ATOM   6973 C  C2    . DC  J  4 1   ? 165.325 5.953   246.441 1.00 53.17  ? 16   DC  K C2    1 
ATOM   6974 O  O2    . DC  J  4 1   ? 166.433 5.481   246.159 1.00 53.41  ? 16   DC  K O2    1 
ATOM   6975 N  N3    . DC  J  4 1   ? 165.170 7.252   246.809 1.00 52.10  ? 16   DC  K N3    1 
ATOM   6976 C  C4    . DC  J  4 1   ? 163.960 7.713   247.112 1.00 48.45  ? 16   DC  K C4    1 
ATOM   6977 N  N4    . DC  J  4 1   ? 163.849 8.993   247.466 1.00 42.20  ? 16   DC  K N4    1 
ATOM   6978 C  C5    . DC  J  4 1   ? 162.806 6.877   247.059 1.00 49.64  ? 16   DC  K C5    1 
ATOM   6979 C  C6    . DC  J  4 1   ? 162.972 5.601   246.690 1.00 46.34  ? 16   DC  K C6    1 
ATOM   6980 P  P     . DC  J  4 2   ? 165.157 -0.395  247.133 1.00 51.16  ? 17   DC  K P     1 
ATOM   6981 O  OP1   . DC  J  4 2   ? 165.976 -1.463  246.518 1.00 58.57  ? 17   DC  K OP1   1 
ATOM   6982 O  OP2   . DC  J  4 2   ? 163.977 -0.716  247.963 1.00 54.14  ? 17   DC  K OP2   1 
ATOM   6983 O  "O5'" . DC  J  4 2   ? 166.151 0.511   247.974 1.00 58.56  ? 17   DC  K "O5'" 1 
ATOM   6984 C  "C5'" . DC  J  4 2   ? 167.282 1.037   247.344 1.00 51.19  ? 17   DC  K "C5'" 1 
ATOM   6985 C  "C4'" . DC  J  4 2   ? 168.097 1.838   248.317 1.00 58.63  ? 17   DC  K "C4'" 1 
ATOM   6986 O  "O4'" . DC  J  4 2   ? 167.555 3.171   248.422 1.00 59.54  ? 17   DC  K "O4'" 1 
ATOM   6987 C  "C3'" . DC  J  4 2   ? 168.157 1.273   249.743 1.00 57.88  ? 17   DC  K "C3'" 1 
ATOM   6988 O  "O3'" . DC  J  4 2   ? 169.539 1.188   250.158 1.00 66.82  ? 17   DC  K "O3'" 1 
ATOM   6989 C  "C2'" . DC  J  4 2   ? 167.372 2.301   250.572 1.00 57.86  ? 17   DC  K "C2'" 1 
ATOM   6990 C  "C1'" . DC  J  4 2   ? 167.596 3.573   249.771 1.00 57.92  ? 17   DC  K "C1'" 1 
ATOM   6991 N  N1    . DC  J  4 2   ? 166.558 4.619   249.965 1.00 53.35  ? 17   DC  K N1    1 
ATOM   6992 C  C2    . DC  J  4 2   ? 166.959 5.920   250.243 1.00 55.35  ? 17   DC  K C2    1 
ATOM   6993 O  O2    . DC  J  4 2   ? 168.164 6.158   250.352 1.00 60.45  ? 17   DC  K O2    1 
ATOM   6994 N  N3    . DC  J  4 2   ? 166.014 6.887   250.395 1.00 57.10  ? 17   DC  K N3    1 
ATOM   6995 C  C4    . DC  J  4 2   ? 164.714 6.581   250.278 1.00 55.12  ? 17   DC  K C4    1 
ATOM   6996 N  N4    . DC  J  4 2   ? 163.824 7.568   250.447 1.00 49.71  ? 17   DC  K N4    1 
ATOM   6997 C  C5    . DC  J  4 2   ? 164.279 5.248   249.980 1.00 51.19  ? 17   DC  K C5    1 
ATOM   6998 C  C6    . DC  J  4 2   ? 165.228 4.308   249.832 1.00 55.34  ? 17   DC  K C6    1 
ATOM   6999 P  P     . DG  J  4 3   ? 170.000 0.241   251.381 1.00 71.61  ? 18   DG  K P     1 
ATOM   7000 O  OP1   . DG  J  4 3   ? 171.409 -0.125  251.104 1.00 69.02  ? 18   DG  K OP1   1 
ATOM   7001 O  OP2   . DG  J  4 3   ? 168.984 -0.815  251.641 1.00 69.58  ? 18   DG  K OP2   1 
ATOM   7002 O  "O5'" . DG  J  4 3   ? 170.039 1.246   252.615 1.00 64.74  ? 18   DG  K "O5'" 1 
ATOM   7003 C  "C5'" . DG  J  4 3   ? 170.814 2.413   252.513 1.00 59.54  ? 18   DG  K "C5'" 1 
ATOM   7004 C  "C4'" . DG  J  4 3   ? 170.513 3.335   253.656 1.00 62.07  ? 18   DG  K "C4'" 1 
ATOM   7005 O  "O4'" . DG  J  4 3   ? 169.376 4.178   253.324 1.00 63.91  ? 18   DG  K "O4'" 1 
ATOM   7006 C  "C3'" . DG  J  4 3   ? 170.149 2.622   254.969 1.00 67.18  ? 18   DG  K "C3'" 1 
ATOM   7007 O  "O3'" . DG  J  4 3   ? 170.814 3.253   256.046 1.00 78.57  ? 18   DG  K "O3'" 1 
ATOM   7008 C  "C2'" . DG  J  4 3   ? 168.651 2.850   255.069 1.00 63.63  ? 18   DG  K "C2'" 1 
ATOM   7009 C  "C1'" . DG  J  4 3   ? 168.548 4.233   254.455 1.00 65.28  ? 18   DG  K "C1'" 1 
ATOM   7010 N  N9    . DG  J  4 3   ? 167.181 4.595   254.095 1.00 62.61  ? 18   DG  K N9    1 
ATOM   7011 C  C8    . DG  J  4 3   ? 166.144 3.726   253.827 1.00 60.85  ? 18   DG  K C8    1 
ATOM   7012 N  N7    . DG  J  4 3   ? 165.017 4.325   253.584 1.00 60.18  ? 18   DG  K N7    1 
ATOM   7013 C  C5    . DG  J  4 3   ? 165.315 5.679   253.719 1.00 57.51  ? 18   DG  K C5    1 
ATOM   7014 C  C6    . DG  J  4 3   ? 164.480 6.809   253.580 1.00 55.39  ? 18   DG  K C6    1 
ATOM   7015 O  O6    . DG  J  4 3   ? 163.279 6.838   253.304 1.00 53.80  ? 18   DG  K O6    1 
ATOM   7016 N  N1    . DG  J  4 3   ? 165.171 7.996   253.796 1.00 57.33  ? 18   DG  K N1    1 
ATOM   7017 C  C2    . DG  J  4 3   ? 166.504 8.077   254.114 1.00 58.41  ? 18   DG  K C2    1 
ATOM   7018 N  N2    . DG  J  4 3   ? 166.992 9.311   254.284 1.00 57.39  ? 18   DG  K N2    1 
ATOM   7019 N  N3    . DG  J  4 3   ? 167.305 7.023   254.246 1.00 57.24  ? 18   DG  K N3    1 
ATOM   7020 C  C4    . DG  J  4 3   ? 166.642 5.861   254.040 1.00 56.89  ? 18   DG  K C4    1 
ATOM   7021 P  P     . DG  J  4 4   ? 171.476 2.403   257.238 1.00 77.59  ? 19   DG  K P     1 
ATOM   7022 O  OP1   . DG  J  4 4   ? 172.728 1.837   256.669 1.00 72.05  ? 19   DG  K OP1   1 
ATOM   7023 O  OP2   . DG  J  4 4   ? 170.460 1.516   257.870 1.00 66.96  ? 19   DG  K OP2   1 
ATOM   7024 O  "O5'" . DG  J  4 4   ? 171.831 3.547   258.291 1.00 76.41  ? 19   DG  K "O5'" 1 
ATOM   7025 C  "C5'" . DG  J  4 4   ? 172.568 4.682   257.861 1.00 74.25  ? 19   DG  K "C5'" 1 
ATOM   7026 C  "C4'" . DG  J  4 4   ? 171.952 5.956   258.402 1.00 76.03  ? 19   DG  K "C4'" 1 
ATOM   7027 O  "O4'" . DG  J  4 4   ? 170.695 6.209   257.730 1.00 75.46  ? 19   DG  K "O4'" 1 
ATOM   7028 C  "C3'" . DG  J  4 4   ? 171.633 5.945   259.901 1.00 81.67  ? 19   DG  K "C3'" 1 
ATOM   7029 O  "O3'" . DG  J  4 4   ? 172.073 7.163   260.481 1.00 92.41  ? 19   DG  K "O3'" 1 
ATOM   7030 C  "C2'" . DG  J  4 4   ? 170.108 5.841   259.938 1.00 78.13  ? 19   DG  K "C2'" 1 
ATOM   7031 C  "C1'" . DG  J  4 4   ? 169.741 6.607   258.681 1.00 76.49  ? 19   DG  K "C1'" 1 
ATOM   7032 N  N9    . DG  J  4 4   ? 168.411 6.294   258.162 1.00 71.10  ? 19   DG  K N9    1 
ATOM   7033 C  C8    . DG  J  4 4   ? 167.955 5.063   257.760 1.00 67.64  ? 19   DG  K C8    1 
ATOM   7034 N  N7    . DG  J  4 4   ? 166.725 5.080   257.331 1.00 72.09  ? 19   DG  K N7    1 
ATOM   7035 C  C5    . DG  J  4 4   ? 166.335 6.412   257.454 1.00 67.73  ? 19   DG  K C5    1 
ATOM   7036 C  C6    . DG  J  4 4   ? 165.095 7.037   257.146 1.00 65.91  ? 19   DG  K C6    1 
ATOM   7037 O  O6    . DG  J  4 4   ? 164.065 6.519   256.686 1.00 65.20  ? 19   DG  K O6    1 
ATOM   7038 N  N1    . DG  J  4 4   ? 165.122 8.404   257.425 1.00 67.05  ? 19   DG  K N1    1 
ATOM   7039 C  C2    . DG  J  4 4   ? 166.209 9.082   257.936 1.00 66.46  ? 19   DG  K C2    1 
ATOM   7040 N  N2    . DG  J  4 4   ? 166.046 10.396  258.131 1.00 61.45  ? 19   DG  K N2    1 
ATOM   7041 N  N3    . DG  J  4 4   ? 167.374 8.510   258.225 1.00 65.67  ? 19   DG  K N3    1 
ATOM   7042 C  C4    . DG  J  4 4   ? 167.364 7.176   257.961 1.00 67.00  ? 19   DG  K C4    1 
ATOM   7043 P  P     . DC  J  4 5   ? 172.362 7.258   262.058 1.00 92.14  ? 20   DC  K P     1 
ATOM   7044 O  OP1   . DC  J  4 5   ? 173.726 7.826   262.204 1.00 95.39  ? 20   DC  K OP1   1 
ATOM   7045 O  OP2   . DC  J  4 5   ? 172.018 5.944   262.661 1.00 83.80  ? 20   DC  K OP2   1 
ATOM   7046 O  "O5'" . DC  J  4 5   ? 171.316 8.352   262.565 1.00 78.71  ? 20   DC  K "O5'" 1 
ATOM   7047 C  "C5'" . DC  J  4 5   ? 171.265 9.615   261.929 1.00 79.21  ? 20   DC  K "C5'" 1 
ATOM   7048 C  "C4'" . DC  J  4 5   ? 169.903 10.246  262.133 1.00 83.00  ? 20   DC  K "C4'" 1 
ATOM   7049 O  "O4'" . DC  J  4 5   ? 168.917 9.536   261.351 1.00 81.23  ? 20   DC  K "O4'" 1 
ATOM   7050 C  "C3'" . DC  J  4 5   ? 169.401 10.201  263.573 1.00 80.75  ? 20   DC  K "C3'" 1 
ATOM   7051 O  "O3'" . DC  J  4 5   ? 169.469 11.492  264.148 1.00 86.54  ? 20   DC  K "O3'" 1 
ATOM   7052 C  "C2'" . DC  J  4 5   ? 167.945 9.697   263.476 1.00 81.90  ? 20   DC  K "C2'" 1 
ATOM   7053 C  "C1'" . DC  J  4 5   ? 167.668 9.681   261.976 1.00 77.34  ? 20   DC  K "C1'" 1 
ATOM   7054 N  N1    . DC  J  4 5   ? 166.774 8.559   261.542 1.00 73.18  ? 20   DC  K N1    1 
ATOM   7055 C  C2    . DC  J  4 5   ? 165.440 8.831   261.239 1.00 69.07  ? 20   DC  K C2    1 
ATOM   7056 O  O2    . DC  J  4 5   ? 165.032 9.994   261.340 1.00 70.30  ? 20   DC  K O2    1 
ATOM   7057 N  N3    . DC  J  4 5   ? 164.629 7.814   260.847 1.00 67.98  ? 20   DC  K N3    1 
ATOM   7058 C  C4    . DC  J  4 5   ? 165.111 6.571   260.750 1.00 69.63  ? 20   DC  K C4    1 
ATOM   7059 N  N4    . DC  J  4 5   ? 164.270 5.600   260.355 1.00 62.67  ? 20   DC  K N4    1 
ATOM   7060 C  C5    . DC  J  4 5   ? 166.477 6.270   261.054 1.00 70.02  ? 20   DC  K C5    1 
ATOM   7061 C  C6    . DC  J  4 5   ? 167.264 7.284   261.444 1.00 72.18  ? 20   DC  K C6    1 
ATOM   7062 P  P     . DA  J  4 6   ? 169.224 11.689  265.724 1.00 91.89  ? 21   DA  K P     1 
ATOM   7063 O  OP1   . DA  J  4 6   ? 169.811 12.999  266.071 1.00 92.31  ? 21   DA  K OP1   1 
ATOM   7064 O  OP2   . DA  J  4 6   ? 169.562 10.448  266.458 1.00 80.53  ? 21   DA  K OP2   1 
ATOM   7065 O  "O5'" . DA  J  4 6   ? 167.653 11.838  265.848 1.00 88.96  ? 21   DA  K "O5'" 1 
ATOM   7066 C  "C5'" . DA  J  4 6   ? 167.030 12.992  265.369 1.00 89.38  ? 21   DA  K "C5'" 1 
ATOM   7067 C  "C4'" . DA  J  4 6   ? 165.542 12.847  265.499 1.00 90.08  ? 21   DA  K "C4'" 1 
ATOM   7068 O  "O4'" . DA  J  4 6   ? 165.114 11.652  264.785 1.00 86.60  ? 21   DA  K "O4'" 1 
ATOM   7069 C  "C3'" . DA  J  4 6   ? 165.043 12.665  266.931 1.00 86.31  ? 21   DA  K "C3'" 1 
ATOM   7070 O  "O3'" . DA  J  4 6   ? 163.806 13.299  267.048 1.00 87.12  ? 21   DA  K "O3'" 1 
ATOM   7071 C  "C2'" . DA  J  4 6   ? 164.881 11.150  267.034 1.00 81.72  ? 21   DA  K "C2'" 1 
ATOM   7072 C  "C1'" . DA  J  4 6   ? 164.326 10.866  265.653 1.00 81.42  ? 21   DA  K "C1'" 1 
ATOM   7073 N  N9    . DA  J  4 6   ? 164.408 9.472   265.234 1.00 75.40  ? 21   DA  K N9    1 
ATOM   7074 C  C8    . DA  J  4 6   ? 165.424 8.590   265.473 1.00 74.09  ? 21   DA  K C8    1 
ATOM   7075 N  N7    . DA  J  4 6   ? 165.219 7.398   264.966 1.00 71.48  ? 21   DA  K N7    1 
ATOM   7076 C  C5    . DA  J  4 6   ? 163.981 7.507   264.343 1.00 72.49  ? 21   DA  K C5    1 
ATOM   7077 C  C6    . DA  J  4 6   ? 163.191 6.588   263.614 1.00 67.66  ? 21   DA  K C6    1 
ATOM   7078 N  N6    . DA  J  4 6   ? 163.560 5.325   263.382 1.00 62.94  ? 21   DA  K N6    1 
ATOM   7079 N  N1    . DA  J  4 6   ? 161.998 7.019   263.140 1.00 64.00  ? 21   DA  K N1    1 
ATOM   7080 C  C2    . DA  J  4 6   ? 161.631 8.285   263.370 1.00 63.62  ? 21   DA  K C2    1 
ATOM   7081 N  N3    . DA  J  4 6   ? 162.283 9.238   264.035 1.00 70.65  ? 21   DA  K N3    1 
ATOM   7082 C  C4    . DA  J  4 6   ? 163.466 8.778   264.501 1.00 75.31  ? 21   DA  K C4    1 
ATOM   7083 P  P     . DA  J  4 7   ? 163.369 13.994  268.421 1.00 90.40  ? 22   DA  K P     1 
ATOM   7084 O  OP1   . DA  J  4 7   ? 163.845 15.394  268.329 1.00 97.99  ? 22   DA  K OP1   1 
ATOM   7085 O  OP2   . DA  J  4 7   ? 163.705 13.104  269.557 1.00 87.35  ? 22   DA  K OP2   1 
ATOM   7086 O  "O5'" . DA  J  4 7   ? 161.790 14.007  268.326 1.00 89.60  ? 22   DA  K "O5'" 1 
ATOM   7087 C  "C5'" . DA  J  4 7   ? 161.185 14.461  267.142 1.00 90.23  ? 22   DA  K "C5'" 1 
ATOM   7088 C  "C4'" . DA  J  4 7   ? 159.849 13.795  266.955 1.00 81.73  ? 22   DA  K "C4'" 1 
ATOM   7089 O  "O4'" . DA  J  4 7   ? 160.045 12.436  266.497 1.00 84.08  ? 22   DA  K "O4'" 1 
ATOM   7090 C  "C3'" . DA  J  4 7   ? 159.005 13.706  268.213 1.00 78.22  ? 22   DA  K "C3'" 1 
ATOM   7091 O  "O3'" . DA  J  4 7   ? 157.685 14.003  267.870 1.00 87.24  ? 22   DA  K "O3'" 1 
ATOM   7092 C  "C2'" . DA  J  4 7   ? 159.175 12.246  268.660 1.00 77.93  ? 22   DA  K "C2'" 1 
ATOM   7093 C  "C1'" . DA  J  4 7   ? 159.353 11.531  267.331 1.00 77.66  ? 22   DA  K "C1'" 1 
ATOM   7094 N  N9    . DA  J  4 7   ? 160.149 10.297  267.393 1.00 74.74  ? 22   DA  K N9    1 
ATOM   7095 C  C8    . DA  J  4 7   ? 161.379 10.134  267.970 1.00 73.50  ? 22   DA  K C8    1 
ATOM   7096 N  N7    . DA  J  4 7   ? 161.871 8.922   267.836 1.00 71.13  ? 22   DA  K N7    1 
ATOM   7097 C  C5    . DA  J  4 7   ? 160.910 8.249   267.096 1.00 68.53  ? 22   DA  K C5    1 
ATOM   7098 C  C6    . DA  J  4 7   ? 160.829 6.926   266.614 1.00 60.70  ? 22   DA  K C6    1 
ATOM   7099 N  N6    . DA  J  4 7   ? 161.770 6.010   266.817 1.00 61.44  ? 22   DA  K N6    1 
ATOM   7100 N  N1    . DA  J  4 7   ? 159.733 6.577   265.922 1.00 59.71  ? 22   DA  K N1    1 
ATOM   7101 C  C2    . DA  J  4 7   ? 158.785 7.489   265.716 1.00 62.77  ? 22   DA  K C2    1 
ATOM   7102 N  N3    . DA  J  4 7   ? 158.741 8.758   266.113 1.00 70.33  ? 22   DA  K N3    1 
ATOM   7103 C  C4    . DA  J  4 7   ? 159.848 9.081   266.807 1.00 73.02  ? 22   DA  K C4    1 
ATOM   7104 P  P     . DG  J  4 8   ? 156.576 14.254  268.996 1.00 87.19  ? 23   DG  K P     1 
ATOM   7105 O  OP1   . DG  J  4 8   ? 155.675 15.288  268.433 1.00 87.16  ? 23   DG  K OP1   1 
ATOM   7106 O  OP2   . DG  J  4 8   ? 157.240 14.462  270.303 1.00 93.52  ? 23   DG  K OP2   1 
ATOM   7107 O  "O5'" . DG  J  4 8   ? 155.806 12.858  269.061 1.00 84.82  ? 23   DG  K "O5'" 1 
ATOM   7108 C  "C5'" . DG  J  4 8   ? 155.300 12.297  267.864 1.00 82.01  ? 23   DG  K "C5'" 1 
ATOM   7109 C  "C4'" . DG  J  4 8   ? 154.815 10.884  268.093 1.00 82.03  ? 23   DG  K "C4'" 1 
ATOM   7110 O  "O4'" . DG  J  4 8   ? 155.927 9.958   268.035 1.00 76.78  ? 23   DG  K "O4'" 1 
ATOM   7111 C  "C3'" . DG  J  4 8   ? 154.131 10.632  269.438 1.00 78.66  ? 23   DG  K "C3'" 1 
ATOM   7112 O  "O3'" . DG  J  4 8   ? 152.979 9.848   269.204 1.00 86.29  ? 23   DG  K "O3'" 1 
ATOM   7113 C  "C2'" . DG  J  4 8   ? 155.192 9.845   270.215 1.00 76.93  ? 23   DG  K "C2'" 1 
ATOM   7114 C  "C1'" . DG  J  4 8   ? 155.786 9.035   269.083 1.00 74.87  ? 23   DG  K "C1'" 1 
ATOM   7115 N  N9    . DG  J  4 8   ? 157.093 8.450   269.348 1.00 70.21  ? 23   DG  K N9    1 
ATOM   7116 C  C8    . DG  J  4 8   ? 158.210 9.086   269.835 1.00 71.85  ? 23   DG  K C8    1 
ATOM   7117 N  N7    . DG  J  4 8   ? 159.254 8.305   269.926 1.00 71.21  ? 23   DG  K N7    1 
ATOM   7118 C  C5    . DG  J  4 8   ? 158.799 7.074   269.461 1.00 66.86  ? 23   DG  K C5    1 
ATOM   7119 C  C6    . DG  J  4 8   ? 159.482 5.835   269.326 1.00 62.96  ? 23   DG  K C6    1 
ATOM   7120 O  O6    . DG  J  4 8   ? 160.665 5.575   269.594 1.00 59.89  ? 23   DG  K O6    1 
ATOM   7121 N  N1    . DG  J  4 8   ? 158.647 4.837   268.812 1.00 63.50  ? 23   DG  K N1    1 
ATOM   7122 C  C2    . DG  J  4 8   ? 157.321 5.017   268.469 1.00 67.99  ? 23   DG  K C2    1 
ATOM   7123 N  N2    . DG  J  4 8   ? 156.680 3.941   267.986 1.00 63.10  ? 23   DG  K N2    1 
ATOM   7124 N  N3    . DG  J  4 8   ? 156.671 6.173   268.593 1.00 68.12  ? 23   DG  K N3    1 
ATOM   7125 C  C4    . DG  J  4 8   ? 157.472 7.153   269.093 1.00 68.04  ? 23   DG  K C4    1 
ATOM   7126 P  P     . DG  J  4 9   ? 151.764 9.843   270.251 1.00 95.73  ? 24   DG  K P     1 
ATOM   7127 O  OP1   . DG  J  4 9   ? 150.662 10.661  269.689 1.00 87.70  ? 24   DG  K OP1   1 
ATOM   7128 O  OP2   . DG  J  4 9   ? 152.332 10.182  271.581 1.00 90.14  ? 24   DG  K OP2   1 
ATOM   7129 O  "O5'" . DG  J  4 9   ? 151.297 8.310   270.265 1.00 86.90  ? 24   DG  K "O5'" 1 
ATOM   7130 C  "C5'" . DG  J  4 9   ? 151.339 7.544   269.070 1.00 80.43  ? 24   DG  K "C5'" 1 
ATOM   7131 C  "C4'" . DG  J  4 9   ? 151.359 6.063   269.393 1.00 82.81  ? 24   DG  K "C4'" 1 
ATOM   7132 O  "O4'" . DG  J  4 9   ? 152.734 5.607   269.503 1.00 86.35  ? 24   DG  K "O4'" 1 
ATOM   7133 C  "C3'" . DG  J  4 9   ? 150.682 5.686   270.710 1.00 84.77  ? 24   DG  K "C3'" 1 
ATOM   7134 O  "O3'" . DG  J  4 9   ? 149.983 4.470   270.553 1.00 93.56  ? 24   DG  K "O3'" 1 
ATOM   7135 C  "C2'" . DG  J  4 9   ? 151.857 5.530   271.675 1.00 80.62  ? 24   DG  K "C2'" 1 
ATOM   7136 C  "C1'" . DG  J  4 9   ? 152.929 4.970   270.752 1.00 77.30  ? 24   DG  K "C1'" 1 
ATOM   7137 N  N9    . DG  J  4 9   ? 154.302 5.226   271.208 1.00 74.26  ? 24   DG  K N9    1 
ATOM   7138 C  C8    . DG  J  4 9   ? 154.833 6.424   271.635 1.00 69.14  ? 24   DG  K C8    1 
ATOM   7139 N  N7    . DG  J  4 9   ? 156.092 6.342   271.978 1.00 66.68  ? 24   DG  K N7    1 
ATOM   7140 C  C5    . DG  J  4 9   ? 156.419 5.005   271.762 1.00 64.05  ? 24   DG  K C5    1 
ATOM   7141 C  C6    . DG  J  4 9   ? 157.643 4.316   271.959 1.00 64.12  ? 24   DG  K C6    1 
ATOM   7142 O  O6    . DG  J  4 9   ? 158.729 4.770   272.365 1.00 62.89  ? 24   DG  K O6    1 
ATOM   7143 N  N1    . DG  J  4 9   ? 157.536 2.963   271.614 1.00 63.53  ? 24   DG  K N1    1 
ATOM   7144 C  C2    . DG  J  4 9   ? 156.394 2.357   271.138 1.00 61.27  ? 24   DG  K C2    1 
ATOM   7145 N  N2    . DG  J  4 9   ? 156.481 1.047   270.860 1.00 60.65  ? 24   DG  K N2    1 
ATOM   7146 N  N3    . DG  J  4 9   ? 155.244 2.988   270.958 1.00 65.61  ? 24   DG  K N3    1 
ATOM   7147 C  C4    . DG  J  4 9   ? 155.328 4.305   271.288 1.00 70.93  ? 24   DG  K C4    1 
ATOM   7148 P  P     . DC  J  4 10  ? 148.560 4.251   271.272 1.00 108.53 ? 25   DC  K P     1 
ATOM   7149 O  OP1   . DC  J  4 10  ? 147.583 4.031   270.176 1.00 91.74  ? 25   DC  K OP1   1 
ATOM   7150 O  OP2   . DC  J  4 10  ? 148.359 5.315   272.294 1.00 87.57  ? 25   DC  K OP2   1 
ATOM   7151 O  "O5'" . DC  J  4 10  ? 148.733 2.859   272.036 1.00 92.11  ? 25   DC  K "O5'" 1 
ATOM   7152 C  "C5'" . DC  J  4 10  ? 149.138 1.710   271.315 1.00 84.10  ? 25   DC  K "C5'" 1 
ATOM   7153 C  "C4'" . DC  J  4 10  ? 150.063 0.867   272.159 1.00 83.34  ? 25   DC  K "C4'" 1 
ATOM   7154 O  "O4'" . DC  J  4 10  ? 151.348 1.522   272.282 1.00 76.99  ? 25   DC  K "O4'" 1 
ATOM   7155 C  "C3'" . DC  J  4 10  ? 149.581 0.638   273.598 1.00 78.05  ? 25   DC  K "C3'" 1 
ATOM   7156 O  "O3'" . DC  J  4 10  ? 149.154 -0.712  273.761 1.00 74.82  ? 25   DC  K "O3'" 1 
ATOM   7157 C  "C2'" . DC  J  4 10  ? 150.813 0.959   274.471 1.00 72.78  ? 25   DC  K "C2'" 1 
ATOM   7158 C  "C1'" . DC  J  4 10  ? 151.943 1.038   273.448 1.00 72.59  ? 25   DC  K "C1'" 1 
ATOM   7159 N  N1    . DC  J  4 10  ? 153.050 1.940   273.841 1.00 68.83  ? 25   DC  K N1    1 
ATOM   7160 C  C2    . DC  J  4 10  ? 154.345 1.425   273.927 1.00 64.91  ? 25   DC  K C2    1 
ATOM   7161 O  O2    . DC  J  4 10  ? 154.531 0.231   273.659 1.00 63.64  ? 25   DC  K O2    1 
ATOM   7162 N  N3    . DC  J  4 10  ? 155.360 2.246   274.297 1.00 60.48  ? 25   DC  K N3    1 
ATOM   7163 C  C4    . DC  J  4 10  ? 155.117 3.522   274.569 1.00 58.37  ? 25   DC  K C4    1 
ATOM   7164 N  N4    . DC  J  4 10  ? 156.151 4.286   274.922 1.00 60.35  ? 25   DC  K N4    1 
ATOM   7165 C  C5    . DC  J  4 10  ? 153.802 4.072   274.490 1.00 63.10  ? 25   DC  K C5    1 
ATOM   7166 C  C6    . DC  J  4 10  ? 152.803 3.251   274.127 1.00 67.04  ? 25   DC  K C6    1 
ATOM   7167 O  OP3   . DC  K  4 1   ? 100.183 2.587   209.234 1.00 53.49  ? 16   DC  M OP3   1 
ATOM   7168 P  P     . DC  K  4 1   ? 100.565 3.976   208.854 1.00 56.75  ? 16   DC  M P     1 
ATOM   7169 O  OP1   . DC  K  4 1   ? 99.931  4.879   209.850 1.00 55.19  ? 16   DC  M OP1   1 
ATOM   7170 O  OP2   . DC  K  4 1   ? 102.034 3.975   208.699 1.00 47.06  ? 16   DC  M OP2   1 
ATOM   7171 O  "O5'" . DC  K  4 1   ? 99.989  4.287   207.389 1.00 53.64  ? 16   DC  M "O5'" 1 
ATOM   7172 C  "C5'" . DC  K  4 1   ? 98.809  3.637   206.917 1.00 49.73  ? 16   DC  M "C5'" 1 
ATOM   7173 C  "C4'" . DC  K  4 1   ? 97.606  4.056   207.754 1.00 51.91  ? 16   DC  M "C4'" 1 
ATOM   7174 O  "O4'" . DC  K  4 1   ? 97.489  5.498   207.768 1.00 51.61  ? 16   DC  M "O4'" 1 
ATOM   7175 C  "C3'" . DC  K  4 1   ? 96.254  3.522   207.282 1.00 50.65  ? 16   DC  M "C3'" 1 
ATOM   7176 O  "O3'" . DC  K  4 1   ? 95.678  2.804   208.315 1.00 53.58  ? 16   DC  M "O3'" 1 
ATOM   7177 C  "C2'" . DC  K  4 1   ? 95.437  4.777   206.941 1.00 50.67  ? 16   DC  M "C2'" 1 
ATOM   7178 C  "C1'" . DC  K  4 1   ? 96.130  5.840   207.772 1.00 50.97  ? 16   DC  M "C1'" 1 
ATOM   7179 N  N1    . DC  K  4 1   ? 95.991  7.235   207.254 1.00 47.79  ? 16   DC  M N1    1 
ATOM   7180 C  C2    . DC  K  4 1   ? 95.312  8.179   208.031 1.00 54.38  ? 16   DC  M C2    1 
ATOM   7181 O  O2    . DC  K  4 1   ? 94.827  7.829   209.108 1.00 54.90  ? 16   DC  M O2    1 
ATOM   7182 N  N3    . DC  K  4 1   ? 95.199  9.447   207.578 1.00 53.89  ? 16   DC  M N3    1 
ATOM   7183 C  C4    . DC  K  4 1   ? 95.725  9.783   206.409 1.00 52.85  ? 16   DC  M C4    1 
ATOM   7184 N  N4    . DC  K  4 1   ? 95.578  11.050  206.010 1.00 56.82  ? 16   DC  M N4    1 
ATOM   7185 C  C5    . DC  K  4 1   ? 96.426  8.836   205.598 1.00 47.77  ? 16   DC  M C5    1 
ATOM   7186 C  C6    . DC  K  4 1   ? 96.540  7.588   206.059 1.00 46.85  ? 16   DC  M C6    1 
ATOM   7187 P  P     . DC  K  4 2   ? 94.352  1.938   208.069 1.00 55.31  ? 17   DC  M P     1 
ATOM   7188 O  OP1   . DC  K  4 2   ? 94.388  0.843   209.070 1.00 59.01  ? 17   DC  M OP1   1 
ATOM   7189 O  OP2   . DC  K  4 2   ? 94.162  1.614   206.627 1.00 57.63  ? 17   DC  M OP2   1 
ATOM   7190 O  "O5'" . DC  K  4 2   ? 93.211  2.961   208.460 1.00 57.59  ? 17   DC  M "O5'" 1 
ATOM   7191 C  "C5'" . DC  K  4 2   ? 93.171  3.486   209.750 1.00 53.65  ? 17   DC  M "C5'" 1 
ATOM   7192 C  "C4'" . DC  K  4 2   ? 91.985  4.402   209.882 1.00 58.01  ? 17   DC  M "C4'" 1 
ATOM   7193 O  "O4'" . DC  K  4 2   ? 92.265  5.675   209.248 1.00 57.76  ? 17   DC  M "O4'" 1 
ATOM   7194 C  "C3'" . DC  K  4 2   ? 90.697  3.877   209.246 1.00 59.76  ? 17   DC  M "C3'" 1 
ATOM   7195 O  "O3'" . DC  K  4 2   ? 89.665  3.996   210.188 1.00 65.29  ? 17   DC  M "O3'" 1 
ATOM   7196 C  "C2'" . DC  K  4 2   ? 90.480  4.803   208.027 1.00 61.03  ? 17   DC  M "C2'" 1 
ATOM   7197 C  "C1'" . DC  K  4 2   ? 91.127  6.090   208.513 1.00 63.57  ? 17   DC  M "C1'" 1 
ATOM   7198 N  N1    . DC  K  4 2   ? 91.594  7.032   207.433 1.00 59.39  ? 17   DC  M N1    1 
ATOM   7199 C  C2    . DC  K  4 2   ? 91.380  8.412   207.579 1.00 62.56  ? 17   DC  M C2    1 
ATOM   7200 O  O2    . DC  K  4 2   ? 90.766  8.827   208.576 1.00 61.90  ? 17   DC  M O2    1 
ATOM   7201 N  N3    . DC  K  4 2   ? 91.843  9.256   206.624 1.00 57.55  ? 17   DC  M N3    1 
ATOM   7202 C  C4    . DC  K  4 2   ? 92.501  8.772   205.566 1.00 56.66  ? 17   DC  M C4    1 
ATOM   7203 N  N4    . DC  K  4 2   ? 92.941  9.644   204.640 1.00 52.55  ? 17   DC  M N4    1 
ATOM   7204 C  C5    . DC  K  4 2   ? 92.734  7.373   205.408 1.00 57.34  ? 17   DC  M C5    1 
ATOM   7205 C  C6    . DC  K  4 2   ? 92.280  6.551   206.367 1.00 54.43  ? 17   DC  M C6    1 
ATOM   7206 P  P     . DG  K  4 3   ? 88.389  3.025   210.137 1.00 67.77  ? 18   DG  M P     1 
ATOM   7207 O  OP1   . DG  K  4 3   ? 88.070  2.688   211.549 1.00 70.60  ? 18   DG  M OP1   1 
ATOM   7208 O  OP2   . DG  K  4 3   ? 88.654  1.941   209.168 1.00 70.93  ? 18   DG  M OP2   1 
ATOM   7209 O  "O5'" . DG  K  4 3   ? 87.257  3.966   209.515 1.00 62.59  ? 18   DG  M "O5'" 1 
ATOM   7210 C  "C5'" . DG  K  4 3   ? 86.989  5.210   210.131 1.00 67.06  ? 18   DG  M "C5'" 1 
ATOM   7211 C  "C4'" . DG  K  4 3   ? 86.402  6.192   209.145 1.00 68.74  ? 18   DG  M "C4'" 1 
ATOM   7212 O  "O4'" . DG  K  4 3   ? 87.447  6.721   208.287 1.00 71.20  ? 18   DG  M "O4'" 1 
ATOM   7213 C  "C3'" . DG  K  4 3   ? 85.319  5.627   208.198 1.00 73.63  ? 18   DG  M "C3'" 1 
ATOM   7214 O  "O3'" . DG  K  4 3   ? 84.180  6.498   208.213 1.00 84.54  ? 18   DG  M "O3'" 1 
ATOM   7215 C  "C2'" . DG  K  4 3   ? 86.011  5.670   206.837 1.00 69.11  ? 18   DG  M "C2'" 1 
ATOM   7216 C  "C1'" . DG  K  4 3   ? 86.867  6.906   207.034 1.00 69.96  ? 18   DG  M "C1'" 1 
ATOM   7217 N  N9    . DG  K  4 3   ? 87.872  7.125   205.992 1.00 63.42  ? 18   DG  M N9    1 
ATOM   7218 C  C8    . DG  K  4 3   ? 88.532  6.176   205.244 1.00 62.09  ? 18   DG  M C8    1 
ATOM   7219 N  N7    . DG  K  4 3   ? 89.329  6.689   204.339 1.00 58.84  ? 18   DG  M N7    1 
ATOM   7220 C  C5    . DG  K  4 3   ? 89.161  8.062   204.483 1.00 61.00  ? 18   DG  M C5    1 
ATOM   7221 C  C6    . DG  K  4 3   ? 89.754  9.133   203.777 1.00 62.99  ? 18   DG  M C6    1 
ATOM   7222 O  O6    . DG  K  4 3   ? 90.572  9.080   202.851 1.00 67.12  ? 18   DG  M O6    1 
ATOM   7223 N  N1    . DG  K  4 3   ? 89.308  10.373  204.239 1.00 64.52  ? 18   DG  M N1    1 
ATOM   7224 C  C2    . DG  K  4 3   ? 88.400  10.550  205.257 1.00 65.55  ? 18   DG  M C2    1 
ATOM   7225 N  N2    . DG  K  4 3   ? 88.087  11.819  205.566 1.00 66.01  ? 18   DG  M N2    1 
ATOM   7226 N  N3    . DG  K  4 3   ? 87.836  9.553   205.928 1.00 64.45  ? 18   DG  M N3    1 
ATOM   7227 C  C4    . DG  K  4 3   ? 88.260  8.342   205.486 1.00 62.99  ? 18   DG  M C4    1 
ATOM   7228 P  P     . DG  K  4 4   ? 82.707  5.987   207.807 1.00 86.33  ? 19   DG  M P     1 
ATOM   7229 O  OP1   . DG  K  4 4   ? 82.155  5.335   209.017 1.00 82.75  ? 19   DG  M OP1   1 
ATOM   7230 O  OP2   . DG  K  4 4   ? 82.757  5.245   206.521 1.00 76.78  ? 19   DG  M OP2   1 
ATOM   7231 O  "O5'" . DG  K  4 4   ? 81.919  7.351   207.517 1.00 75.31  ? 19   DG  M "O5'" 1 
ATOM   7232 C  "C5'" . DG  K  4 4   ? 82.157  8.501   208.323 1.00 73.59  ? 19   DG  M "C5'" 1 
ATOM   7233 C  "C4'" . DG  K  4 4   ? 82.150  9.765   207.475 1.00 80.16  ? 19   DG  M "C4'" 1 
ATOM   7234 O  "O4'" . DG  K  4 4   ? 83.412  9.879   206.760 1.00 78.72  ? 19   DG  M "O4'" 1 
ATOM   7235 C  "C3'" . DG  K  4 4   ? 81.039  9.832   206.418 1.00 87.50  ? 19   DG  M "C3'" 1 
ATOM   7236 O  "O3'" . DG  K  4 4   ? 80.307  11.072  206.518 1.00 94.58  ? 19   DG  M "O3'" 1 
ATOM   7237 C  "C2'" . DG  K  4 4   ? 81.781  9.717   205.083 1.00 80.79  ? 19   DG  M "C2'" 1 
ATOM   7238 C  "C1'" . DG  K  4 4   ? 83.175  10.232  205.416 1.00 78.84  ? 19   DG  M "C1'" 1 
ATOM   7239 N  N9    . DG  K  4 4   ? 84.206  9.616   204.579 1.00 67.58  ? 19   DG  M N9    1 
ATOM   7240 C  C8    . DG  K  4 4   ? 84.544  8.286   204.543 1.00 67.36  ? 19   DG  M C8    1 
ATOM   7241 N  N7    . DG  K  4 4   ? 85.484  8.011   203.681 1.00 67.77  ? 19   DG  M N7    1 
ATOM   7242 C  C5    . DG  K  4 4   ? 85.785  9.236   203.104 1.00 66.97  ? 19   DG  M C5    1 
ATOM   7243 C  C6    . DG  K  4 4   ? 86.736  9.562   202.105 1.00 68.81  ? 19   DG  M C6    1 
ATOM   7244 O  O6    . DG  K  4 4   ? 87.523  8.806   201.510 1.00 66.77  ? 19   DG  M O6    1 
ATOM   7245 N  N1    . DG  K  4 4   ? 86.717  10.919  201.806 1.00 69.80  ? 19   DG  M N1    1 
ATOM   7246 C  C2    . DG  K  4 4   ? 85.893  11.843  202.401 1.00 69.67  ? 19   DG  M C2    1 
ATOM   7247 N  N2    . DG  K  4 4   ? 86.030  13.103  201.978 1.00 71.54  ? 19   DG  M N2    1 
ATOM   7248 N  N3    . DG  K  4 4   ? 85.004  11.555  203.343 1.00 65.37  ? 19   DG  M N3    1 
ATOM   7249 C  C4    . DG  K  4 4   ? 85.003  10.236  203.642 1.00 64.62  ? 19   DG  M C4    1 
ATOM   7250 P  P     . DC  K  4 5   ? 78.849  11.227  205.842 1.00 89.54  ? 20   DC  M P     1 
ATOM   7251 O  OP1   . DC  K  4 5   ? 77.920  11.538  206.951 1.00 82.95  ? 20   DC  M OP1   1 
ATOM   7252 O  OP2   . DC  K  4 5   ? 78.571  10.078  204.940 1.00 77.54  ? 20   DC  M OP2   1 
ATOM   7253 O  "O5'" . DC  K  4 5   ? 79.004  12.510  204.901 1.00 86.07  ? 20   DC  M "O5'" 1 
ATOM   7254 C  "C5'" . DC  K  4 5   ? 80.190  13.283  204.934 1.00 81.88  ? 20   DC  M "C5'" 1 
ATOM   7255 C  "C4'" . DC  K  4 5   ? 80.461  13.894  203.572 1.00 87.86  ? 20   DC  M "C4'" 1 
ATOM   7256 O  "O4'" . DC  K  4 5   ? 81.592  13.228  202.937 1.00 85.98  ? 20   DC  M "O4'" 1 
ATOM   7257 C  "C3'" . DC  K  4 5   ? 79.299  13.805  202.583 1.00 91.15  ? 20   DC  M "C3'" 1 
ATOM   7258 O  "O3'" . DC  K  4 5   ? 79.104  15.074  201.967 1.00 102.81 ? 20   DC  M "O3'" 1 
ATOM   7259 C  "C2'" . DC  K  4 5   ? 79.760  12.745  201.576 1.00 88.24  ? 20   DC  M "C2'" 1 
ATOM   7260 C  "C1'" . DC  K  4 5   ? 81.272  12.923  201.601 1.00 83.02  ? 20   DC  M "C1'" 1 
ATOM   7261 N  N1    . DC  K  4 5   ? 82.027  11.691  201.204 1.00 75.59  ? 20   DC  M N1    1 
ATOM   7262 C  C2    . DC  K  4 5   ? 83.087  11.782  200.287 1.00 77.35  ? 20   DC  M C2    1 
ATOM   7263 O  O2    . DC  K  4 5   ? 83.390  12.888  199.813 1.00 80.24  ? 20   DC  M O2    1 
ATOM   7264 N  N3    . DC  K  4 5   ? 83.758  10.650  199.944 1.00 76.01  ? 20   DC  M N3    1 
ATOM   7265 C  C4    . DC  K  4 5   ? 83.408  9.475   200.478 1.00 74.60  ? 20   DC  M C4    1 
ATOM   7266 N  N4    . DC  K  4 5   ? 84.101  8.386   200.109 1.00 68.94  ? 20   DC  M N4    1 
ATOM   7267 C  C5    . DC  K  4 5   ? 82.330  9.365   201.410 1.00 74.63  ? 20   DC  M C5    1 
ATOM   7268 C  C6    . DC  K  4 5   ? 81.677  10.485  201.741 1.00 77.78  ? 20   DC  M C6    1 
ATOM   7269 P  P     . DA  K  4 6   ? 77.782  15.376  201.105 1.00 103.29 ? 21   DA  M P     1 
ATOM   7270 O  OP1   . DA  K  4 6   ? 77.356  16.752  201.447 1.00 101.81 ? 21   DA  M OP1   1 
ATOM   7271 O  OP2   . DA  K  4 6   ? 76.844  14.236  201.281 1.00 93.17  ? 21   DA  M OP2   1 
ATOM   7272 O  "O5'" . DA  K  4 6   ? 78.316  15.378  199.600 1.00 89.74  ? 21   DA  M "O5'" 1 
ATOM   7273 C  "C5'" . DA  K  4 6   ? 79.434  16.178  199.247 1.00 89.79  ? 21   DA  M "C5'" 1 
ATOM   7274 C  "C4'" . DA  K  4 6   ? 79.981  15.760  197.895 1.00 94.41  ? 21   DA  M "C4'" 1 
ATOM   7275 O  "O4'" . DA  K  4 6   ? 80.647  14.473  198.008 1.00 93.01  ? 21   DA  M "O4'" 1 
ATOM   7276 C  "C3'" . DA  K  4 6   ? 78.930  15.581  196.795 1.00 94.79  ? 21   DA  M "C3'" 1 
ATOM   7277 O  "O3'" . DA  K  4 6   ? 79.445  16.050  195.589 1.00 96.90  ? 21   DA  M "O3'" 1 
ATOM   7278 C  "C2'" . DA  K  4 6   ? 78.744  14.071  196.740 1.00 91.74  ? 21   DA  M "C2'" 1 
ATOM   7279 C  "C1'" . DA  K  4 6   ? 80.174  13.634  196.976 1.00 91.43  ? 21   DA  M "C1'" 1 
ATOM   7280 N  N9    . DA  K  4 6   ? 80.313  12.244  197.385 1.00 85.88  ? 21   DA  M N9    1 
ATOM   7281 C  C8    . DA  K  4 6   ? 79.454  11.513  198.160 1.00 80.90  ? 21   DA  M C8    1 
ATOM   7282 N  N7    . DA  K  4 6   ? 79.846  10.275  198.355 1.00 80.38  ? 21   DA  M N7    1 
ATOM   7283 C  C5    . DA  K  4 6   ? 81.047  10.193  197.659 1.00 83.01  ? 21   DA  M C5    1 
ATOM   7284 C  C6    . DA  K  4 6   ? 81.971  9.144   197.471 1.00 76.53  ? 21   DA  M C6    1 
ATOM   7285 N  N6    . DA  K  4 6   ? 81.815  7.925   197.995 1.00 75.72  ? 21   DA  M N6    1 
ATOM   7286 N  N1    . DA  K  4 6   ? 83.063  9.398   196.713 1.00 78.58  ? 21   DA  M N1    1 
ATOM   7287 C  C2    . DA  K  4 6   ? 83.221  10.623  196.188 1.00 77.52  ? 21   DA  M C2    1 
ATOM   7288 N  N3    . DA  K  4 6   ? 82.430  11.686  196.301 1.00 80.71  ? 21   DA  M N3    1 
ATOM   7289 C  C4    . DA  K  4 6   ? 81.347  11.399  197.057 1.00 85.40  ? 21   DA  M C4    1 
ATOM   7290 P  P     . DA  K  4 7   ? 78.505  16.894  194.608 1.00 107.00 ? 22   DA  M P     1 
ATOM   7291 O  OP1   . DA  K  4 7   ? 78.308  18.225  195.240 1.00 97.77  ? 22   DA  M OP1   1 
ATOM   7292 O  OP2   . DA  K  4 7   ? 77.354  16.004  194.308 1.00 100.18 ? 22   DA  M OP2   1 
ATOM   7293 O  "O5'" . DA  K  4 7   ? 79.380  17.058  193.276 1.00 91.36  ? 22   DA  M "O5'" 1 
ATOM   7294 C  "C5'" . DA  K  4 7   ? 80.774  17.240  193.374 1.00 91.67  ? 22   DA  M "C5'" 1 
ATOM   7295 C  "C4'" . DA  K  4 7   ? 81.500  16.335  192.400 1.00 95.48  ? 22   DA  M "C4'" 1 
ATOM   7296 O  "O4'" . DA  K  4 7   ? 81.588  14.990  192.939 1.00 96.40  ? 22   DA  M "O4'" 1 
ATOM   7297 C  "C3'" . DA  K  4 7   ? 80.833  16.196  191.039 1.00 98.95  ? 22   DA  M "C3'" 1 
ATOM   7298 O  "O3'" . DA  K  4 7   ? 81.819  16.218  190.035 1.00 102.22 ? 22   DA  M "O3'" 1 
ATOM   7299 C  "C2'" . DA  K  4 7   ? 80.142  14.832  191.117 1.00 95.54  ? 22   DA  M "C2'" 1 
ATOM   7300 C  "C1'" . DA  K  4 7   ? 81.119  14.061  191.981 1.00 93.36  ? 22   DA  M "C1'" 1 
ATOM   7301 N  N9    . DA  K  4 7   ? 80.528  12.930  192.697 1.00 89.57  ? 22   DA  M N9    1 
ATOM   7302 C  C8    . DA  K  4 7   ? 79.381  12.933  193.447 1.00 86.06  ? 22   DA  M C8    1 
ATOM   7303 N  N7    . DA  K  4 7   ? 79.109  11.773  194.002 1.00 83.45  ? 22   DA  M N7    1 
ATOM   7304 C  C5    . DA  K  4 7   ? 80.155  10.953  193.595 1.00 83.71  ? 22   DA  M C5    1 
ATOM   7305 C  C6    . DA  K  4 7   ? 80.458  9.594   193.845 1.00 78.50  ? 22   DA  M C6    1 
ATOM   7306 N  N6    . DA  K  4 7   ? 79.697  8.795   194.595 1.00 75.41  ? 22   DA  M N6    1 
ATOM   7307 N  N1    . DA  K  4 7   ? 81.579  9.089   193.285 1.00 75.49  ? 22   DA  M N1    1 
ATOM   7308 C  C2    . DA  K  4 7   ? 82.343  9.892   192.533 1.00 79.22  ? 22   DA  M C2    1 
ATOM   7309 N  N3    . DA  K  4 7   ? 82.166  11.177  192.229 1.00 82.00  ? 22   DA  M N3    1 
ATOM   7310 C  C4    . DA  K  4 7   ? 81.042  11.653  192.796 1.00 85.97  ? 22   DA  M C4    1 
ATOM   7311 P  P     . DG  K  4 8   ? 81.403  16.582  188.532 1.00 111.00 ? 23   DG  M P     1 
ATOM   7312 O  OP1   . DG  K  4 8   ? 82.409  17.525  187.984 1.00 98.23  ? 23   DG  M OP1   1 
ATOM   7313 O  OP2   . DG  K  4 8   ? 79.966  16.938  188.567 1.00 109.86 ? 23   DG  M OP2   1 
ATOM   7314 O  "O5'" . DG  K  4 8   ? 81.529  15.196  187.767 1.00 101.89 ? 23   DG  M "O5'" 1 
ATOM   7315 C  "C5'" . DG  K  4 8   ? 82.797  14.632  187.584 1.00 99.45  ? 23   DG  M "C5'" 1 
ATOM   7316 C  "C4'" . DG  K  4 8   ? 82.684  13.136  187.450 1.00 98.86  ? 23   DG  M "C4'" 1 
ATOM   7317 O  "O4'" . DG  K  4 8   ? 81.972  12.610  188.573 1.00 99.62  ? 23   DG  M "O4'" 1 
ATOM   7318 C  "C3'" . DG  K  4 8   ? 81.898  12.662  186.237 1.00 98.68  ? 23   DG  M "C3'" 1 
ATOM   7319 O  "O3'" . DG  K  4 8   ? 82.806  12.309  185.211 1.00 103.05 ? 23   DG  M "O3'" 1 
ATOM   7320 C  "C2'" . DG  K  4 8   ? 81.101  11.442  186.750 1.00 92.27  ? 23   DG  M "C2'" 1 
ATOM   7321 C  "C1'" . DG  K  4 8   ? 81.522  11.337  188.215 1.00 92.19  ? 23   DG  M "C1'" 1 
ATOM   7322 N  N9    . DG  K  4 8   ? 80.458  10.962  189.139 1.00 86.14  ? 23   DG  M N9    1 
ATOM   7323 C  C8    . DG  K  4 8   ? 79.507  11.790  189.687 1.00 83.48  ? 23   DG  M C8    1 
ATOM   7324 N  N7    . DG  K  4 8   ? 78.698  11.178  190.507 1.00 82.70  ? 23   DG  M N7    1 
ATOM   7325 C  C5    . DG  K  4 8   ? 79.151  9.861   190.513 1.00 80.26  ? 23   DG  M C5    1 
ATOM   7326 C  C6    . DG  K  4 8   ? 78.668  8.728   191.221 1.00 77.27  ? 23   DG  M C6    1 
ATOM   7327 O  O6    . DG  K  4 8   ? 77.709  8.663   192.010 1.00 80.22  ? 23   DG  M O6    1 
ATOM   7328 N  N1    . DG  K  4 8   ? 79.421  7.583   190.941 1.00 74.86  ? 23   DG  M N1    1 
ATOM   7329 C  C2    . DG  K  4 8   ? 80.503  7.540   190.086 1.00 75.54  ? 23   DG  M C2    1 
ATOM   7330 N  N2    . DG  K  4 8   ? 81.103  6.346   189.941 1.00 68.82  ? 23   DG  M N2    1 
ATOM   7331 N  N3    . DG  K  4 8   ? 80.961  8.593   189.416 1.00 75.21  ? 23   DG  M N3    1 
ATOM   7332 C  C4    . DG  K  4 8   ? 80.239  9.715   189.680 1.00 81.06  ? 23   DG  M C4    1 
ATOM   7333 P  P     . DG  K  4 9   ? 82.290  12.065  183.713 1.00 110.33 ? 24   DG  M P     1 
ATOM   7334 O  OP1   . DG  K  4 9   ? 83.430  12.358  182.812 1.00 102.79 ? 24   DG  M OP1   1 
ATOM   7335 O  OP2   . DG  K  4 9   ? 81.010  12.795  183.546 1.00 107.22 ? 24   DG  M OP2   1 
ATOM   7336 O  "O5'" . DG  K  4 9   ? 82.018  10.493  183.682 1.00 97.92  ? 24   DG  M "O5'" 1 
ATOM   7337 C  "C5'" . DG  K  4 9   ? 83.049  9.624   184.091 1.00 94.00  ? 24   DG  M "C5'" 1 
ATOM   7338 C  "C4'" . DG  K  4 9   ? 82.534  8.220   184.311 1.00 93.75  ? 24   DG  M "C4'" 1 
ATOM   7339 O  "O4'" . DG  K  4 9   ? 81.707  8.170   185.500 1.00 93.49  ? 24   DG  M "O4'" 1 
ATOM   7340 C  "C3'" . DG  K  4 9   ? 81.690  7.644   183.172 1.00 95.61  ? 24   DG  M "C3'" 1 
ATOM   7341 O  "O3'" . DG  K  4 9   ? 82.188  6.348   182.850 1.00 99.70  ? 24   DG  M "O3'" 1 
ATOM   7342 C  "C2'" . DG  K  4 9   ? 80.276  7.582   183.770 1.00 91.15  ? 24   DG  M "C2'" 1 
ATOM   7343 C  "C1'" . DG  K  4 9   ? 80.595  7.351   185.240 1.00 89.97  ? 24   DG  M "C1'" 1 
ATOM   7344 N  N9    . DG  K  4 9   ? 79.528  7.728   186.165 1.00 82.71  ? 24   DG  M N9    1 
ATOM   7345 C  C8    . DG  K  4 9   ? 78.982  8.981   186.336 1.00 79.60  ? 24   DG  M C8    1 
ATOM   7346 N  N7    . DG  K  4 9   ? 78.065  9.028   187.264 1.00 74.34  ? 24   DG  M N7    1 
ATOM   7347 C  C5    . DG  K  4 9   ? 78.003  7.723   187.746 1.00 75.25  ? 24   DG  M C5    1 
ATOM   7348 C  C6    . DG  K  4 9   ? 77.184  7.165   188.752 1.00 71.28  ? 24   DG  M C6    1 
ATOM   7349 O  O6    . DG  K  4 9   ? 76.327  7.736   189.442 1.00 72.86  ? 24   DG  M O6    1 
ATOM   7350 N  N1    . DG  K  4 9   ? 77.436  5.804   188.935 1.00 69.09  ? 24   DG  M N1    1 
ATOM   7351 C  C2    . DG  K  4 9   ? 78.363  5.070   188.226 1.00 73.33  ? 24   DG  M C2    1 
ATOM   7352 N  N2    . DG  K  4 9   ? 78.466  3.762   188.548 1.00 68.94  ? 24   DG  M N2    1 
ATOM   7353 N  N3    . DG  K  4 9   ? 79.137  5.582   187.269 1.00 75.33  ? 24   DG  M N3    1 
ATOM   7354 C  C4    . DG  K  4 9   ? 78.903  6.911   187.086 1.00 77.78  ? 24   DG  M C4    1 
ATOM   7355 P  P     . DC  K  4 10  ? 81.842  5.661   181.441 1.00 104.58 ? 25   DC  M P     1 
ATOM   7356 O  OP1   . DC  K  4 10  ? 83.078  5.020   180.926 1.00 98.88  ? 25   DC  M OP1   1 
ATOM   7357 O  OP2   . DC  K  4 10  ? 81.122  6.667   180.620 1.00 97.17  ? 25   DC  M OP2   1 
ATOM   7358 O  "O5'" . DC  K  4 10  ? 80.835  4.486   181.848 1.00 97.84  ? 25   DC  M "O5'" 1 
ATOM   7359 C  "C5'" . DC  K  4 10  ? 81.232  3.500   182.806 1.00 88.20  ? 25   DC  M "C5'" 1 
ATOM   7360 C  "C4'" . DC  K  4 10  ? 80.041  2.650   183.213 1.00 87.13  ? 25   DC  M "C4'" 1 
ATOM   7361 O  "O4'" . DC  K  4 10  ? 79.229  3.381   184.172 1.00 84.67  ? 25   DC  M "O4'" 1 
ATOM   7362 C  "C3'" . DC  K  4 10  ? 79.102  2.263   182.060 1.00 86.17  ? 25   DC  M "C3'" 1 
ATOM   7363 O  "O3'" . DC  K  4 10  ? 78.799  0.868   182.118 1.00 86.01  ? 25   DC  M "O3'" 1 
ATOM   7364 C  "C2'" . DC  K  4 10  ? 77.859  3.131   182.301 1.00 78.80  ? 25   DC  M "C2'" 1 
ATOM   7365 C  "C1'" . DC  K  4 10  ? 77.869  3.267   183.817 1.00 76.29  ? 25   DC  M "C1'" 1 
ATOM   7366 N  N1    . DC  K  4 10  ? 77.141  4.471   184.330 1.00 70.09  ? 25   DC  M N1    1 
ATOM   7367 C  C2    . DC  K  4 10  ? 76.312  4.354   185.464 1.00 70.49  ? 25   DC  M C2    1 
ATOM   7368 O  O2    . DC  K  4 10  ? 76.194  3.251   186.015 1.00 66.67  ? 25   DC  M O2    1 
ATOM   7369 N  N3    . DC  K  4 10  ? 75.666  5.460   185.926 1.00 64.23  ? 25   DC  M N3    1 
ATOM   7370 C  C4    . DC  K  4 10  ? 75.820  6.636   185.291 1.00 70.41  ? 25   DC  M C4    1 
ATOM   7371 N  N4    . DC  K  4 10  ? 75.169  7.703   185.776 1.00 70.60  ? 25   DC  M N4    1 
ATOM   7372 C  C5    . DC  K  4 10  ? 76.660  6.767   184.142 1.00 70.06  ? 25   DC  M C5    1 
ATOM   7373 C  C6    . DC  K  4 10  ? 77.297  5.671   183.706 1.00 69.79  ? 25   DC  M C6    1 
ATOM   7374 O  OP3   . DC  L  4 1   ? 158.758 0.402   172.955 1.00 41.51  ? 16   DC  O OP3   1 
ATOM   7375 P  P     . DC  L  4 1   ? 159.518 0.319   171.640 1.00 57.96  ? 16   DC  O P     1 
ATOM   7376 O  OP1   . DC  L  4 1   ? 158.768 1.085   170.621 1.00 54.64  ? 16   DC  O OP1   1 
ATOM   7377 O  OP2   . DC  L  4 1   ? 159.788 -1.115  171.297 1.00 43.19  ? 16   DC  O OP2   1 
ATOM   7378 O  "O5'" . DC  L  4 1   ? 160.932 1.043   171.917 1.00 45.24  ? 16   DC  O "O5'" 1 
ATOM   7379 C  "C5'" . DC  L  4 1   ? 162.131 0.622   171.234 1.00 42.76  ? 16   DC  O "C5'" 1 
ATOM   7380 C  "C4'" . DC  L  4 1   ? 161.967 0.715   169.720 1.00 46.26  ? 16   DC  O "C4'" 1 
ATOM   7381 O  "O4'" . DC  L  4 1   ? 161.831 2.103   169.320 1.00 47.71  ? 16   DC  O "O4'" 1 
ATOM   7382 C  "C3'" . DC  L  4 1   ? 163.134 0.143   168.887 1.00 50.30  ? 16   DC  O "C3'" 1 
ATOM   7383 O  "O3'" . DC  L  4 1   ? 162.610 -0.743  167.905 1.00 51.16  ? 16   DC  O "O3'" 1 
ATOM   7384 C  "C2'" . DC  L  4 1   ? 163.772 1.393   168.251 1.00 45.39  ? 16   DC  O "C2'" 1 
ATOM   7385 C  "C1'" . DC  L  4 1   ? 162.561 2.298   168.130 1.00 47.50  ? 16   DC  O "C1'" 1 
ATOM   7386 N  N1    . DC  L  4 1   ? 162.857 3.747   168.000 1.00 47.14  ? 16   DC  O N1    1 
ATOM   7387 C  C2    . DC  L  4 1   ? 162.301 4.449   166.934 1.00 47.07  ? 16   DC  O C2    1 
ATOM   7388 O  O2    . DC  L  4 1   ? 161.608 3.839   166.126 1.00 48.79  ? 16   DC  O O2    1 
ATOM   7389 N  N3    . DC  L  4 1   ? 162.533 5.777   166.819 1.00 47.54  ? 16   DC  O N3    1 
ATOM   7390 C  C4    . DC  L  4 1   ? 163.287 6.403   167.718 1.00 45.29  ? 16   DC  O C4    1 
ATOM   7391 N  N4    . DC  L  4 1   ? 163.491 7.709   167.549 1.00 38.94  ? 16   DC  O N4    1 
ATOM   7392 C  C5    . DC  L  4 1   ? 163.871 5.707   168.826 1.00 42.48  ? 16   DC  O C5    1 
ATOM   7393 C  C6    . DC  L  4 1   ? 163.627 4.387   168.928 1.00 42.66  ? 16   DC  O C6    1 
ATOM   7394 P  P     . DC  L  4 2   ? 163.570 -1.713  167.053 1.00 49.44  ? 17   DC  O P     1 
ATOM   7395 O  OP1   . DC  L  4 2   ? 162.762 -2.913  166.766 1.00 45.41  ? 17   DC  O OP1   1 
ATOM   7396 O  OP2   . DC  L  4 2   ? 164.877 -1.902  167.743 1.00 47.14  ? 17   DC  O OP2   1 
ATOM   7397 O  "O5'" . DC  L  4 2   ? 163.787 -0.887  165.717 1.00 48.94  ? 17   DC  O "O5'" 1 
ATOM   7398 C  "C5'" . DC  L  4 2   ? 162.659 -0.509  164.953 1.00 44.48  ? 17   DC  O "C5'" 1 
ATOM   7399 C  "C4'" . DC  L  4 2   ? 163.084 0.305   163.755 1.00 51.27  ? 17   DC  O "C4'" 1 
ATOM   7400 O  "O4'" . DC  L  4 2   ? 163.337 1.666   164.153 1.00 51.87  ? 17   DC  O "O4'" 1 
ATOM   7401 C  "C3'" . DC  L  4 2   ? 164.355 -0.184  163.055 1.00 54.26  ? 17   DC  O "C3'" 1 
ATOM   7402 O  "O3'" . DC  L  4 2   ? 164.016 -0.520  161.709 1.00 66.24  ? 17   DC  O "O3'" 1 
ATOM   7403 C  "C2'" . DC  L  4 2   ? 165.331 1.015   163.151 1.00 48.08  ? 17   DC  O "C2'" 1 
ATOM   7404 C  "C1'" . DC  L  4 2   ? 164.379 2.185   163.376 1.00 49.68  ? 17   DC  O "C1'" 1 
ATOM   7405 N  N1    . DC  L  4 2   ? 164.941 3.339   164.131 1.00 50.89  ? 17   DC  O N1    1 
ATOM   7406 C  C2    . DC  L  4 2   ? 164.844 4.636   163.595 1.00 51.55  ? 17   DC  O C2    1 
ATOM   7407 O  O2    . DC  L  4 2   ? 164.331 4.788   162.486 1.00 54.74  ? 17   DC  O O2    1 
ATOM   7408 N  N3    . DC  L  4 2   ? 165.330 5.690   164.310 1.00 51.11  ? 17   DC  O N3    1 
ATOM   7409 C  C4    . DC  L  4 2   ? 165.869 5.484   165.526 1.00 50.42  ? 17   DC  O C4    1 
ATOM   7410 N  N4    . DC  L  4 2   ? 166.330 6.549   166.198 1.00 43.26  ? 17   DC  O N4    1 
ATOM   7411 C  C5    . DC  L  4 2   ? 165.973 4.174   166.091 1.00 46.96  ? 17   DC  O C5    1 
ATOM   7412 C  C6    . DC  L  4 2   ? 165.489 3.141   165.372 1.00 51.70  ? 17   DC  O C6    1 
ATOM   7413 P  P     . DG  L  4 3   ? 165.005 -1.360  160.744 1.00 61.13  ? 18   DG  O P     1 
ATOM   7414 O  OP1   . DG  L  4 3   ? 164.079 -1.841  159.682 1.00 65.07  ? 18   DG  O OP1   1 
ATOM   7415 O  OP2   . DG  L  4 3   ? 165.878 -2.291  161.504 1.00 56.12  ? 18   DG  O OP2   1 
ATOM   7416 O  "O5'" . DG  L  4 3   ? 165.931 -0.244  160.098 1.00 48.82  ? 18   DG  O "O5'" 1 
ATOM   7417 C  "C5'" . DG  L  4 3   ? 165.356 0.755   159.283 1.00 49.76  ? 18   DG  O "C5'" 1 
ATOM   7418 C  "C4'" . DG  L  4 3   ? 166.358 1.851   159.020 1.00 52.15  ? 18   DG  O "C4'" 1 
ATOM   7419 O  "O4'" . DG  L  4 3   ? 166.464 2.708   160.194 1.00 54.73  ? 18   DG  O "O4'" 1 
ATOM   7420 C  "C3'" . DG  L  4 3   ? 167.794 1.361   158.730 1.00 55.10  ? 18   DG  O "C3'" 1 
ATOM   7421 O  "O3'" . DG  L  4 3   ? 168.327 2.051   157.610 1.00 69.06  ? 18   DG  O "O3'" 1 
ATOM   7422 C  "C2'" . DG  L  4 3   ? 168.548 1.758   159.991 1.00 55.73  ? 18   DG  O "C2'" 1 
ATOM   7423 C  "C1'" . DG  L  4 3   ? 167.816 3.038   160.331 1.00 57.25  ? 18   DG  O "C1'" 1 
ATOM   7424 N  N9    . DG  L  4 3   ? 168.135 3.550   161.658 1.00 53.88  ? 18   DG  O N9    1 
ATOM   7425 C  C8    . DG  L  4 3   ? 168.564 2.819   162.738 1.00 52.55  ? 18   DG  O C8    1 
ATOM   7426 N  N7    . DG  L  4 3   ? 168.861 3.546   163.773 1.00 48.92  ? 18   DG  O N7    1 
ATOM   7427 C  C5    . DG  L  4 3   ? 168.635 4.846   163.353 1.00 51.78  ? 18   DG  O C5    1 
ATOM   7428 C  C6    . DG  L  4 3   ? 168.782 6.061   164.056 1.00 48.36  ? 18   DG  O C6    1 
ATOM   7429 O  O6    . DG  L  4 3   ? 169.182 6.226   165.207 1.00 46.61  ? 18   DG  O O6    1 
ATOM   7430 N  N1    . DG  L  4 3   ? 168.455 7.160   163.264 1.00 55.87  ? 18   DG  O N1    1 
ATOM   7431 C  C2    . DG  L  4 3   ? 168.038 7.087   161.945 1.00 55.54  ? 18   DG  O C2    1 
ATOM   7432 N  N2    . DG  L  4 3   ? 167.761 8.256   161.343 1.00 49.62  ? 18   DG  O N2    1 
ATOM   7433 N  N3    . DG  L  4 3   ? 167.887 5.948   161.278 1.00 53.18  ? 18   DG  O N3    1 
ATOM   7434 C  C4    . DG  L  4 3   ? 168.213 4.872   162.040 1.00 53.56  ? 18   DG  O C4    1 
ATOM   7435 P  P     . DG  L  4 4   ? 169.227 1.292   156.506 1.00 62.65  ? 19   DG  O P     1 
ATOM   7436 O  OP1   . DG  L  4 4   ? 168.256 0.442   155.776 1.00 57.28  ? 19   DG  O OP1   1 
ATOM   7437 O  OP2   . DG  L  4 4   ? 170.446 0.712   157.139 1.00 56.52  ? 19   DG  O OP2   1 
ATOM   7438 O  "O5'" . DG  L  4 4   ? 169.712 2.492   155.566 1.00 60.48  ? 19   DG  O "O5'" 1 
ATOM   7439 C  "C5'" . DG  L  4 4   ? 168.792 3.517   155.194 1.00 57.95  ? 19   DG  O "C5'" 1 
ATOM   7440 C  "C4'" . DG  L  4 4   ? 169.470 4.883   155.205 1.00 68.03  ? 19   DG  O "C4'" 1 
ATOM   7441 O  "O4'" . DG  L  4 4   ? 169.515 5.427   156.559 1.00 61.36  ? 19   DG  O "O4'" 1 
ATOM   7442 C  "C3'" . DG  L  4 4   ? 170.908 4.898   154.704 1.00 65.30  ? 19   DG  O "C3'" 1 
ATOM   7443 O  "O3'" . DG  L  4 4   ? 171.126 6.068   153.930 1.00 72.63  ? 19   DG  O "O3'" 1 
ATOM   7444 C  "C2'" . DG  L  4 4   ? 171.724 4.922   155.998 1.00 61.77  ? 19   DG  O "C2'" 1 
ATOM   7445 C  "C1'" . DG  L  4 4   ? 170.842 5.775   156.895 1.00 63.73  ? 19   DG  O "C1'" 1 
ATOM   7446 N  N9    . DG  L  4 4   ? 171.049 5.513   158.322 1.00 64.14  ? 19   DG  O N9    1 
ATOM   7447 C  C8    . DG  L  4 4   ? 171.134 4.283   158.925 1.00 61.73  ? 19   DG  O C8    1 
ATOM   7448 N  N7    . DG  L  4 4   ? 171.346 4.347   160.208 1.00 62.30  ? 19   DG  O N7    1 
ATOM   7449 C  C5    . DG  L  4 4   ? 171.394 5.709   160.481 1.00 62.71  ? 19   DG  O C5    1 
ATOM   7450 C  C6    . DG  L  4 4   ? 171.585 6.390   161.716 1.00 57.66  ? 19   DG  O C6    1 
ATOM   7451 O  O6    . DG  L  4 4   ? 171.759 5.901   162.839 1.00 57.01  ? 19   DG  O O6    1 
ATOM   7452 N  N1    . DG  L  4 4   ? 171.578 7.774   161.548 1.00 57.57  ? 19   DG  O N1    1 
ATOM   7453 C  C2    . DG  L  4 4   ? 171.400 8.417   160.339 1.00 60.23  ? 19   DG  O C2    1 
ATOM   7454 N  N2    . DG  L  4 4   ? 171.418 9.755   160.367 1.00 57.29  ? 19   DG  O N2    1 
ATOM   7455 N  N3    . DG  L  4 4   ? 171.214 7.789   159.184 1.00 61.53  ? 19   DG  O N3    1 
ATOM   7456 C  C4    . DG  L  4 4   ? 171.221 6.442   159.329 1.00 61.52  ? 19   DG  O C4    1 
ATOM   7457 P  P     . DC  L  4 5   ? 172.504 6.268   153.128 1.00 73.28  ? 20   DC  O P     1 
ATOM   7458 O  OP1   . DC  L  4 5   ? 172.084 6.920   151.865 1.00 68.33  ? 20   DC  O OP1   1 
ATOM   7459 O  OP2   . DC  L  4 5   ? 173.284 5.007   153.159 1.00 58.41  ? 20   DC  O OP2   1 
ATOM   7460 O  "O5'" . DC  L  4 5   ? 173.327 7.322   154.009 1.00 63.19  ? 20   DC  O "O5'" 1 
ATOM   7461 C  "C5'" . DC  L  4 5   ? 172.756 8.588   154.284 1.00 64.55  ? 20   DC  O "C5'" 1 
ATOM   7462 C  "C4'" . DC  L  4 5   ? 173.620 9.371   155.249 1.00 72.25  ? 20   DC  O "C4'" 1 
ATOM   7463 O  "O4'" . DC  L  4 5   ? 173.493 8.837   156.603 1.00 69.86  ? 20   DC  O "O4'" 1 
ATOM   7464 C  "C3'" . DC  L  4 5   ? 175.113 9.371   154.929 1.00 71.92  ? 20   DC  O "C3'" 1 
ATOM   7465 O  "O3'" . DC  L  4 5   ? 175.589 10.688  155.006 1.00 81.84  ? 20   DC  O "O3'" 1 
ATOM   7466 C  "C2'" . DC  L  4 5   ? 175.718 8.497   156.032 1.00 72.70  ? 20   DC  O "C2'" 1 
ATOM   7467 C  "C1'" . DC  L  4 5   ? 174.775 8.791   157.186 1.00 69.67  ? 20   DC  O "C1'" 1 
ATOM   7468 N  N1    . DC  L  4 5   ? 174.779 7.751   158.256 1.00 69.56  ? 20   DC  O N1    1 
ATOM   7469 C  C2    . DC  L  4 5   ? 174.882 8.143   159.600 1.00 68.91  ? 20   DC  O C2    1 
ATOM   7470 O  O2    . DC  L  4 5   ? 174.973 9.352   159.873 1.00 66.66  ? 20   DC  O O2    1 
ATOM   7471 N  N3    . DC  L  4 5   ? 174.882 7.185   160.566 1.00 65.95  ? 20   DC  O N3    1 
ATOM   7472 C  C4    . DC  L  4 5   ? 174.778 5.894   160.230 1.00 65.51  ? 20   DC  O C4    1 
ATOM   7473 N  N4    . DC  L  4 5   ? 174.784 4.986   161.217 1.00 60.86  ? 20   DC  O N4    1 
ATOM   7474 C  C5    . DC  L  4 5   ? 174.676 5.476   158.865 1.00 62.75  ? 20   DC  O C5    1 
ATOM   7475 C  C6    . DC  L  4 5   ? 174.677 6.428   157.923 1.00 64.23  ? 20   DC  O C6    1 
ATOM   7476 P  P     . DA  L  4 6   ? 176.836 11.154  154.117 1.00 88.08  ? 21   DA  O P     1 
ATOM   7477 O  OP1   . DA  L  4 6   ? 176.310 12.163  153.165 1.00 85.12  ? 21   DA  O OP1   1 
ATOM   7478 O  OP2   . DA  L  4 6   ? 177.544 9.942   153.637 1.00 87.34  ? 21   DA  O OP2   1 
ATOM   7479 O  "O5'" . DA  L  4 6   ? 177.792 11.862  155.173 1.00 79.70  ? 21   DA  O "O5'" 1 
ATOM   7480 C  "C5'" . DA  L  4 6   ? 177.225 12.631  156.204 1.00 83.88  ? 21   DA  O "C5'" 1 
ATOM   7481 C  "C4'" . DA  L  4 6   ? 178.085 12.559  157.438 1.00 85.88  ? 21   DA  O "C4'" 1 
ATOM   7482 O  "O4'" . DA  L  4 6   ? 177.803 11.333  158.160 1.00 80.44  ? 21   DA  O "O4'" 1 
ATOM   7483 C  "C3'" . DA  L  4 6   ? 179.588 12.533  157.157 1.00 92.39  ? 21   DA  O "C3'" 1 
ATOM   7484 O  "O3'" . DA  L  4 6   ? 180.249 13.299  158.131 1.00 93.58  ? 21   DA  O "O3'" 1 
ATOM   7485 C  "C2'" . DA  L  4 6   ? 179.930 11.054  157.302 1.00 86.94  ? 21   DA  O "C2'" 1 
ATOM   7486 C  "C1'" . DA  L  4 6   ? 179.027 10.712  158.465 1.00 84.37  ? 21   DA  O "C1'" 1 
ATOM   7487 N  N9    . DA  L  4 6   ? 178.801 9.292   158.654 1.00 76.65  ? 21   DA  O N9    1 
ATOM   7488 C  C8    . DA  L  4 6   ? 178.661 8.338   157.689 1.00 74.85  ? 21   DA  O C8    1 
ATOM   7489 N  N7    . DA  L  4 6   ? 178.461 7.133   158.166 1.00 75.13  ? 21   DA  O N7    1 
ATOM   7490 C  C5    . DA  L  4 6   ? 178.468 7.317   159.545 1.00 73.54  ? 21   DA  O C5    1 
ATOM   7491 C  C6    . DA  L  4 6   ? 178.306 6.430   160.630 1.00 64.95  ? 21   DA  O C6    1 
ATOM   7492 N  N6    . DA  L  4 6   ? 178.099 5.124   160.489 1.00 60.91  ? 21   DA  O N6    1 
ATOM   7493 N  N1    . DA  L  4 6   ? 178.378 6.944   161.872 1.00 67.24  ? 21   DA  O N1    1 
ATOM   7494 C  C2    . DA  L  4 6   ? 178.587 8.257   162.017 1.00 66.81  ? 21   DA  O C2    1 
ATOM   7495 N  N3    . DA  L  4 6   ? 178.746 9.187   161.079 1.00 72.10  ? 21   DA  O N3    1 
ATOM   7496 C  C4    . DA  L  4 6   ? 178.677 8.644   159.856 1.00 75.44  ? 21   DA  O C4    1 
ATOM   7497 P  P     . DA  L  4 7   ? 181.353 14.371  157.688 1.00 95.06  ? 22   DA  O P     1 
ATOM   7498 O  OP1   . DA  L  4 7   ? 180.627 15.582  157.240 1.00 89.66  ? 22   DA  O OP1   1 
ATOM   7499 O  OP2   . DA  L  4 7   ? 182.303 13.662  156.793 1.00 89.85  ? 22   DA  O OP2   1 
ATOM   7500 O  "O5'" . DA  L  4 7   ? 182.106 14.709  159.055 1.00 95.94  ? 22   DA  O "O5'" 1 
ATOM   7501 C  "C5'" . DA  L  4 7   ? 181.372 14.734  160.276 1.00 95.15  ? 22   DA  O "C5'" 1 
ATOM   7502 C  "C4'" . DA  L  4 7   ? 182.165 14.074  161.391 1.00 93.39  ? 22   DA  O "C4'" 1 
ATOM   7503 O  "O4'" . DA  L  4 7   ? 181.851 12.659  161.455 1.00 89.66  ? 22   DA  O "O4'" 1 
ATOM   7504 C  "C3'" . DA  L  4 7   ? 183.679 14.154  161.243 1.00 94.14  ? 22   DA  O "C3'" 1 
ATOM   7505 O  "O3'" . DA  L  4 7   ? 184.249 14.335  162.514 1.00 100.38 ? 22   DA  O "O3'" 1 
ATOM   7506 C  "C2'" . DA  L  4 7   ? 184.038 12.785  160.659 1.00 92.05  ? 22   DA  O "C2'" 1 
ATOM   7507 C  "C1'" . DA  L  4 7   ? 183.041 11.902  161.380 1.00 86.68  ? 22   DA  O "C1'" 1 
ATOM   7508 N  N9    . DA  L  4 7   ? 182.729 10.660  160.689 1.00 80.59  ? 22   DA  O N9    1 
ATOM   7509 C  C8    . DA  L  4 7   ? 182.541 10.484  159.346 1.00 80.88  ? 22   DA  O C8    1 
ATOM   7510 N  N7    . DA  L  4 7   ? 182.238 9.248   159.013 1.00 81.61  ? 22   DA  O N7    1 
ATOM   7511 C  C5    . DA  L  4 7   ? 182.209 8.571   160.231 1.00 78.92  ? 22   DA  O C5    1 
ATOM   7512 C  C6    . DA  L  4 7   ? 181.946 7.220   160.577 1.00 71.93  ? 22   DA  O C6    1 
ATOM   7513 N  N6    . DA  L  4 7   ? 181.644 6.269   159.684 1.00 68.67  ? 22   DA  O N6    1 
ATOM   7514 N  N1    . DA  L  4 7   ? 182.009 6.885   161.884 1.00 71.40  ? 22   DA  O N1    1 
ATOM   7515 C  C2    . DA  L  4 7   ? 182.310 7.833   162.779 1.00 71.25  ? 22   DA  O C2    1 
ATOM   7516 N  N3    . DA  L  4 7   ? 182.571 9.123   162.579 1.00 74.43  ? 22   DA  O N3    1 
ATOM   7517 C  C4    . DA  L  4 7   ? 182.505 9.431   161.271 1.00 78.72  ? 22   DA  O C4    1 
ATOM   7518 P  P     . DG  L  4 8   ? 185.751 14.877  162.659 1.00 107.89 ? 23   DG  O P     1 
ATOM   7519 O  OP1   . DG  L  4 8   ? 185.646 16.147  163.415 1.00 100.33 ? 23   DG  O OP1   1 
ATOM   7520 O  OP2   . DG  L  4 8   ? 186.417 14.823  161.331 1.00 95.10  ? 23   DG  O OP2   1 
ATOM   7521 O  "O5'" . DG  L  4 8   ? 186.452 13.772  163.572 1.00 95.64  ? 23   DG  O "O5'" 1 
ATOM   7522 C  "C5'" . DG  L  4 8   ? 185.822 13.361  164.764 1.00 92.25  ? 23   DG  O "C5'" 1 
ATOM   7523 C  "C4'" . DG  L  4 8   ? 186.248 11.958  165.132 1.00 90.24  ? 23   DG  O "C4'" 1 
ATOM   7524 O  "O4'" . DG  L  4 8   ? 185.633 11.008  164.232 1.00 87.88  ? 23   DG  O "O4'" 1 
ATOM   7525 C  "C3'" . DG  L  4 8   ? 187.755 11.694  165.055 1.00 90.66  ? 23   DG  O "C3'" 1 
ATOM   7526 O  "O3'" . DG  L  4 8   ? 188.169 11.051  166.237 1.00 92.27  ? 23   DG  O "O3'" 1 
ATOM   7527 C  "C2'" . DG  L  4 8   ? 187.890 10.766  163.850 1.00 86.65  ? 23   DG  O "C2'" 1 
ATOM   7528 C  "C1'" . DG  L  4 8   ? 186.579 10.018  163.944 1.00 84.97  ? 23   DG  O "C1'" 1 
ATOM   7529 N  N9    . DG  L  4 8   ? 186.183 9.327   162.725 1.00 82.23  ? 23   DG  O N9    1 
ATOM   7530 C  C8    . DG  L  4 8   ? 185.989 9.870   161.475 1.00 79.83  ? 23   DG  O C8    1 
ATOM   7531 N  N7    . DG  L  4 8   ? 185.623 8.990   160.584 1.00 76.33  ? 23   DG  O N7    1 
ATOM   7532 C  C5    . DG  L  4 8   ? 185.566 7.793   161.290 1.00 73.67  ? 23   DG  O C5    1 
ATOM   7533 C  C6    . DG  L  4 8   ? 185.224 6.491   160.859 1.00 70.77  ? 23   DG  O C6    1 
ATOM   7534 O  O6    . DG  L  4 8   ? 184.893 6.116   159.723 1.00 73.07  ? 23   DG  O O6    1 
ATOM   7535 N  N1    . DG  L  4 8   ? 185.280 5.571   161.910 1.00 74.12  ? 23   DG  O N1    1 
ATOM   7536 C  C2    . DG  L  4 8   ? 185.635 5.876   163.206 1.00 71.00  ? 23   DG  O C2    1 
ATOM   7537 N  N2    . DG  L  4 8   ? 185.647 4.858   164.080 1.00 68.04  ? 23   DG  O N2    1 
ATOM   7538 N  N3    . DG  L  4 8   ? 185.963 7.086   163.614 1.00 68.57  ? 23   DG  O N3    1 
ATOM   7539 C  C4    . DG  L  4 8   ? 185.903 7.990   162.610 1.00 76.68  ? 23   DG  O C4    1 
ATOM   7540 P  P     . DG  L  4 9   ? 189.685 11.180  166.735 1.00 94.81  ? 24   DG  O P     1 
ATOM   7541 O  OP1   . DG  L  4 9   ? 189.673 11.985  167.974 1.00 105.27 ? 24   DG  O OP1   1 
ATOM   7542 O  OP2   . DG  L  4 9   ? 190.498 11.600  165.572 1.00 95.72  ? 24   DG  O OP2   1 
ATOM   7543 O  "O5'" . DG  L  4 9   ? 190.094 9.683   167.099 1.00 89.48  ? 24   DG  O "O5'" 1 
ATOM   7544 C  "C5'" . DG  L  4 9   ? 189.160 8.832   167.741 1.00 91.38  ? 24   DG  O "C5'" 1 
ATOM   7545 C  "C4'" . DG  L  4 9   ? 189.513 7.381   167.487 1.00 93.01  ? 24   DG  O "C4'" 1 
ATOM   7546 O  "O4'" . DG  L  4 9   ? 188.900 6.946   166.248 1.00 85.77  ? 24   DG  O "O4'" 1 
ATOM   7547 C  "C3'" . DG  L  4 9   ? 191.013 7.108   167.356 1.00 95.57  ? 24   DG  O "C3'" 1 
ATOM   7548 O  "O3'" . DG  L  4 9   ? 191.393 6.031   168.207 1.00 100.44 ? 24   DG  O "O3'" 1 
ATOM   7549 C  "C2'" . DG  L  4 9   ? 191.215 6.774   165.871 1.00 87.53  ? 24   DG  O "C2'" 1 
ATOM   7550 C  "C1'" . DG  L  4 9   ? 189.844 6.255   165.458 1.00 85.56  ? 24   DG  O "C1'" 1 
ATOM   7551 N  N9    . DG  L  4 9   ? 189.525 6.495   164.047 1.00 80.33  ? 24   DG  O N9    1 
ATOM   7552 C  C8    . DG  L  4 9   ? 189.560 7.702   163.377 1.00 81.05  ? 24   DG  O C8    1 
ATOM   7553 N  N7    . DG  L  4 9   ? 189.212 7.610   162.117 1.00 75.96  ? 24   DG  O N7    1 
ATOM   7554 C  C5    . DG  L  4 9   ? 188.930 6.261   161.942 1.00 70.50  ? 24   DG  O C5    1 
ATOM   7555 C  C6    . DG  L  4 9   ? 188.505 5.566   160.791 1.00 66.68  ? 24   DG  O C6    1 
ATOM   7556 O  O6    . DG  L  4 9   ? 188.281 6.025   159.665 1.00 68.69  ? 24   DG  O O6    1 
ATOM   7557 N  N1    . DG  L  4 9   ? 188.330 4.204   161.043 1.00 65.04  ? 24   DG  O N1    1 
ATOM   7558 C  C2    . DG  L  4 9   ? 188.533 3.593   162.263 1.00 69.15  ? 24   DG  O C2    1 
ATOM   7559 N  N2    . DG  L  4 9   ? 188.306 2.266   162.320 1.00 64.50  ? 24   DG  O N2    1 
ATOM   7560 N  N3    . DG  L  4 9   ? 188.941 4.236   163.353 1.00 70.83  ? 24   DG  O N3    1 
ATOM   7561 C  C4    . DG  L  4 9   ? 189.113 5.561   163.122 1.00 70.81  ? 24   DG  O C4    1 
ATOM   7562 P  P     . DC  L  4 10  ? 192.949 5.670   168.406 1.00 113.53 ? 25   DC  O P     1 
ATOM   7563 O  OP1   . DC  L  4 10  ? 193.176 5.469   169.856 1.00 110.03 ? 25   DC  O OP1   1 
ATOM   7564 O  OP2   . DC  L  4 10  ? 193.757 6.670   167.667 1.00 97.14  ? 25   DC  O OP2   1 
ATOM   7565 O  "O5'" . DC  L  4 10  ? 193.096 4.238   167.698 1.00 105.00 ? 25   DC  O "O5'" 1 
ATOM   7566 C  "C5'" . DC  L  4 10  ? 192.327 3.126   168.175 1.00 97.55  ? 25   DC  O "C5'" 1 
ATOM   7567 C  "C4'" . DC  L  4 10  ? 192.402 1.958   167.207 1.00 88.47  ? 25   DC  O "C4'" 1 
ATOM   7568 O  "O4'" . DC  L  4 10  ? 191.828 2.352   165.940 1.00 83.34  ? 25   DC  O "O4'" 1 
ATOM   7569 C  "C3'" . DC  L  4 10  ? 193.816 1.456   166.910 1.00 88.45  ? 25   DC  O "C3'" 1 
ATOM   7570 O  "O3'" . DC  L  4 10  ? 193.873 0.037   167.078 1.00 90.51  ? 25   DC  O "O3'" 1 
ATOM   7571 C  "C2'" . DC  L  4 10  ? 194.072 1.881   165.455 1.00 81.36  ? 25   DC  O "C2'" 1 
ATOM   7572 C  "C1'" . DC  L  4 10  ? 192.662 1.935   164.885 1.00 81.13  ? 25   DC  O "C1'" 1 
ATOM   7573 N  N1    . DC  L  4 10  ? 192.490 2.902   163.732 1.00 74.93  ? 25   DC  O N1    1 
ATOM   7574 C  C2    . DC  L  4 10  ? 192.027 2.422   162.491 1.00 73.14  ? 25   DC  O C2    1 
ATOM   7575 O  O2    . DC  L  4 10  ? 191.778 1.215   162.366 1.00 65.60  ? 25   DC  O O2    1 
ATOM   7576 N  N3    . DC  L  4 10  ? 191.866 3.298   161.459 1.00 67.06  ? 25   DC  O N3    1 
ATOM   7577 C  C4    . DC  L  4 10  ? 192.135 4.597   161.635 1.00 69.67  ? 25   DC  O C4    1 
ATOM   7578 N  N4    . DC  L  4 10  ? 191.951 5.421   160.590 1.00 63.61  ? 25   DC  O N4    1 
ATOM   7579 C  C5    . DC  L  4 10  ? 192.597 5.108   162.898 1.00 69.28  ? 25   DC  O C5    1 
ATOM   7580 C  C6    . DC  L  4 10  ? 192.758 4.233   163.907 1.00 70.60  ? 25   DC  O C6    1 
HETATM 7581 MN MN    . MN  M  5 .   ? 161.854 -0.157  239.650 1.00 53.27  ? 1188 MN  A MN    1 
HETATM 7582 MN MN    . MN  N  5 .   ? 157.490 5.559   238.093 1.00 48.02  ? 1189 MN  A MN    1 
HETATM 7583 MN MN    . MN  O  5 .   ? 160.691 3.414   239.213 0.77 53.47  ? 1190 MN  A MN    1 
HETATM 7584 MN MN    . MN  P  5 .   ? 106.313 6.609   205.660 1.00 48.53  ? 1189 MN  D MN    1 
HETATM 7585 MN MN    . MN  Q  5 .   ? 102.323 1.756   209.216 1.00 48.17  ? 1190 MN  D MN    1 
HETATM 7586 MN MN    . MN  R  5 .   ? 103.720 5.036   208.003 0.75 54.78  ? 1191 MN  D MN    1 
HETATM 7587 MN MN    . MN  S  5 .   ? 158.584 -1.607  173.499 1.00 42.27  ? 1180 MN  G MN    1 
HETATM 7588 MN MN    . MN  T  5 .   ? 158.840 4.359   177.767 1.00 43.98  ? 1181 MN  G MN    1 
HETATM 7589 MN MN    . MN  U  5 .   ? 158.521 2.175   174.798 0.79 54.37  ? 1182 MN  G MN    1 
HETATM 7590 O  O     . HOH V  6 .   ? 147.643 6.864   228.532 1.00 55.15  ? 2001 HOH A O     1 
HETATM 7591 O  O     . HOH V  6 .   ? 155.257 6.124   237.619 1.00 41.61  ? 2002 HOH A O     1 
HETATM 7592 O  O     . HOH V  6 .   ? 161.766 -2.269  239.862 1.00 46.75  ? 2003 HOH A O     1 
HETATM 7593 O  O     . HOH V  6 .   ? 153.131 6.429   230.391 1.00 54.13  ? 2004 HOH A O     1 
HETATM 7594 O  O     . HOH V  6 .   ? 149.757 7.614   226.434 1.00 52.51  ? 2005 HOH A O     1 
HETATM 7595 O  O     . HOH V  6 .   ? 156.672 12.819  219.262 1.00 59.07  ? 2006 HOH A O     1 
HETATM 7596 O  O     . HOH V  6 .   ? 160.833 0.974   218.206 1.00 45.83  ? 2007 HOH A O     1 
HETATM 7597 O  O     . HOH V  6 .   ? 153.991 1.596   216.360 1.00 40.52  ? 2008 HOH A O     1 
HETATM 7598 O  O     . HOH V  6 .   ? 160.604 3.950   224.185 1.00 46.07  ? 2009 HOH A O     1 
HETATM 7599 O  O     . HOH V  6 .   ? 164.577 -4.874  240.763 1.00 60.67  ? 2010 HOH A O     1 
HETATM 7600 O  O     . HOH V  6 .   ? 159.081 -11.160 220.349 1.00 52.76  ? 2011 HOH A O     1 
HETATM 7601 O  O     . HOH V  6 .   ? 155.107 -11.711 218.513 1.00 64.37  ? 2012 HOH A O     1 
HETATM 7602 O  O     . HOH V  6 .   ? 158.127 -3.763  218.627 1.00 46.34  ? 2013 HOH A O     1 
HETATM 7603 O  O     . HOH V  6 .   ? 173.079 -2.182  232.441 1.00 70.89  ? 2014 HOH A O     1 
HETATM 7604 O  O     . HOH V  6 .   ? 148.958 -2.908  216.035 1.00 47.52  ? 2015 HOH A O     1 
HETATM 7605 O  O     . HOH V  6 .   ? 143.741 -2.899  221.641 1.00 51.80  ? 2016 HOH A O     1 
HETATM 7606 O  O     . HOH V  6 .   ? 141.876 -0.925  222.707 1.00 49.66  ? 2017 HOH A O     1 
HETATM 7607 O  O     . HOH V  6 .   ? 141.779 -2.576  226.903 1.00 41.91  ? 2018 HOH A O     1 
HETATM 7608 O  O     . HOH V  6 .   ? 140.561 -8.851  225.948 1.00 66.92  ? 2019 HOH A O     1 
HETATM 7609 O  O     . HOH V  6 .   ? 144.679 5.708   229.423 1.00 53.69  ? 2020 HOH A O     1 
HETATM 7610 O  O     . HOH V  6 .   ? 140.495 -13.117 245.464 1.00 72.60  ? 2021 HOH A O     1 
HETATM 7611 O  O     . HOH V  6 .   ? 158.897 -7.443  244.907 1.00 56.20  ? 2022 HOH A O     1 
HETATM 7612 O  O     . HOH V  6 .   ? 155.936 0.269   256.052 1.00 43.12  ? 2023 HOH A O     1 
HETATM 7613 O  O     . HOH V  6 .   ? 153.639 8.261   237.541 1.00 44.93  ? 2024 HOH A O     1 
HETATM 7614 O  O     . HOH V  6 .   ? 151.247 7.852   236.203 1.00 54.93  ? 2025 HOH A O     1 
HETATM 7615 O  O     . HOH V  6 .   ? 143.888 5.160   254.037 1.00 56.07  ? 2026 HOH A O     1 
HETATM 7616 O  O     . HOH V  6 .   ? 144.294 2.392   256.448 1.00 57.68  ? 2027 HOH A O     1 
HETATM 7617 O  O     . HOH V  6 .   ? 143.496 -7.340  259.929 1.00 67.34  ? 2028 HOH A O     1 
HETATM 7618 O  O     . HOH V  6 .   ? 152.683 7.462   254.449 1.00 54.52  ? 2029 HOH A O     1 
HETATM 7619 O  O     . HOH V  6 .   ? 151.378 3.748   257.461 1.00 52.92  ? 2030 HOH A O     1 
HETATM 7620 O  O     . HOH V  6 .   ? 151.228 10.565  256.278 1.00 57.72  ? 2031 HOH A O     1 
HETATM 7621 O  O     . HOH V  6 .   ? 159.262 21.262  252.920 1.00 53.73  ? 2032 HOH A O     1 
HETATM 7622 O  O     . HOH V  6 .   ? 149.172 -9.119  258.961 1.00 54.93  ? 2033 HOH A O     1 
HETATM 7623 O  O     . HOH V  6 .   ? 151.198 -8.512  259.959 1.00 51.87  ? 2034 HOH A O     1 
HETATM 7624 O  O     . HOH V  6 .   ? 157.803 7.586   236.152 1.00 55.73  ? 2035 HOH A O     1 
HETATM 7625 O  O     . HOH W  6 .   ? 159.558 -2.008  262.607 1.00 54.48  ? 2001 HOH B O     1 
HETATM 7626 O  O     . HOH W  6 .   ? 156.535 8.278   262.983 1.00 60.09  ? 2002 HOH B O     1 
HETATM 7627 O  O     . HOH W  6 .   ? 167.430 4.513   240.902 1.00 59.21  ? 2003 HOH B O     1 
HETATM 7628 O  O     . HOH W  6 .   ? 155.120 10.838  228.134 1.00 52.87  ? 2004 HOH B O     1 
HETATM 7629 O  O     . HOH W  6 .   ? 157.534 10.126  223.761 1.00 55.47  ? 2005 HOH B O     1 
HETATM 7630 O  O     . HOH W  6 .   ? 158.927 12.295  218.805 1.00 63.51  ? 2006 HOH B O     1 
HETATM 7631 O  O     . HOH W  6 .   ? 159.350 -1.909  209.818 1.00 54.62  ? 2007 HOH B O     1 
HETATM 7632 O  O     . HOH W  6 .   ? 151.886 -3.371  198.728 1.00 49.67  ? 2008 HOH B O     1 
HETATM 7633 O  O     . HOH X  6 .   ? 171.336 18.225  224.908 1.00 71.28  ? 2001 HOH C O     1 
HETATM 7634 O  O     . HOH X  6 .   ? 165.545 4.558   242.123 1.00 54.70  ? 2002 HOH C O     1 
HETATM 7635 O  O     . HOH Y  6 .   ? 124.749 -10.776 199.900 1.00 64.75  ? 2001 HOH D O     1 
HETATM 7636 O  O     . HOH Y  6 .   ? 108.171 7.013   204.275 1.00 41.58  ? 2002 HOH D O     1 
HETATM 7637 O  O     . HOH Y  6 .   ? 107.469 8.019   206.786 1.00 52.38  ? 2003 HOH D O     1 
HETATM 7638 O  O     . HOH Y  6 .   ? 102.103 -0.101  209.112 1.00 43.49  ? 2004 HOH D O     1 
HETATM 7639 O  O     . HOH Y  6 .   ? 115.609 6.767   205.358 1.00 52.36  ? 2005 HOH D O     1 
HETATM 7640 O  O     . HOH Y  6 .   ? 120.712 8.183   205.931 1.00 50.01  ? 2006 HOH D O     1 
HETATM 7641 O  O     . HOH Y  6 .   ? 120.693 10.292  208.911 1.00 56.30  ? 2007 HOH D O     1 
HETATM 7642 O  O     . HOH Y  6 .   ? 121.525 1.375   219.466 1.00 39.11  ? 2008 HOH D O     1 
HETATM 7643 O  O     . HOH Y  6 .   ? 126.550 1.713   214.279 1.00 43.57  ? 2009 HOH D O     1 
HETATM 7644 O  O     . HOH Y  6 .   ? 116.532 4.869   216.005 1.00 40.53  ? 2010 HOH D O     1 
HETATM 7645 O  O     . HOH Y  6 .   ? 99.908  -2.651  211.517 1.00 54.51  ? 2011 HOH D O     1 
HETATM 7646 O  O     . HOH Y  6 .   ? 119.594 -10.653 216.877 1.00 55.60  ? 2012 HOH D O     1 
HETATM 7647 O  O     . HOH Y  6 .   ? 121.917 -11.033 215.215 1.00 54.56  ? 2013 HOH D O     1 
HETATM 7648 O  O     . HOH Y  6 .   ? 128.173 -11.742 203.697 1.00 60.34  ? 2014 HOH D O     1 
HETATM 7649 O  O     . HOH Y  6 .   ? 127.665 -5.004  211.786 1.00 56.00  ? 2015 HOH D O     1 
HETATM 7650 O  O     . HOH Y  6 .   ? 121.994 -3.659  217.111 1.00 45.72  ? 2016 HOH D O     1 
HETATM 7651 O  O     . HOH Y  6 .   ? 115.943 -6.658  222.205 1.00 55.02  ? 2017 HOH D O     1 
HETATM 7652 O  O     . HOH Y  6 .   ? 104.370 2.004   222.760 1.00 63.39  ? 2018 HOH D O     1 
HETATM 7653 O  O     . HOH Y  6 .   ? 112.589 3.870   220.483 1.00 43.18  ? 2019 HOH D O     1 
HETATM 7654 O  O     . HOH Y  6 .   ? 128.936 -3.496  210.705 1.00 50.15  ? 2020 HOH D O     1 
HETATM 7655 O  O     . HOH Y  6 .   ? 127.334 -3.332  203.146 1.00 46.88  ? 2021 HOH D O     1 
HETATM 7656 O  O     . HOH Y  6 .   ? 127.286 -2.122  201.121 1.00 42.41  ? 2022 HOH D O     1 
HETATM 7657 O  O     . HOH Y  6 .   ? 123.417 -3.474  198.635 1.00 43.24  ? 2023 HOH D O     1 
HETATM 7658 O  O     . HOH Y  6 .   ? 120.449 -8.459  198.032 1.00 59.38  ? 2024 HOH D O     1 
HETATM 7659 O  O     . HOH Y  6 .   ? 120.340 5.203   199.404 1.00 45.58  ? 2025 HOH D O     1 
HETATM 7660 O  O     . HOH Y  6 .   ? 91.418  1.791   195.436 1.00 59.68  ? 2026 HOH D O     1 
HETATM 7661 O  O     . HOH Y  6 .   ? 108.750 8.981   203.063 1.00 48.39  ? 2027 HOH D O     1 
HETATM 7662 O  O     . HOH Y  6 .   ? 111.706 8.573   201.113 1.00 48.53  ? 2028 HOH D O     1 
HETATM 7663 O  O     . HOH Y  6 .   ? 99.387  4.944   186.037 1.00 57.72  ? 2029 HOH D O     1 
HETATM 7664 O  O     . HOH Y  6 .   ? 97.524  16.889  210.345 1.00 63.44  ? 2030 HOH D O     1 
HETATM 7665 O  O     . HOH Z  6 .   ? 102.856 8.244   210.015 1.00 53.88  ? 2001 HOH E O     1 
HETATM 7666 O  O     . HOH Z  6 .   ? 106.306 9.749   211.326 1.00 48.58  ? 2002 HOH E O     1 
HETATM 7667 O  O     . HOH Z  6 .   ? 123.342 5.014   228.967 1.00 58.29  ? 2003 HOH E O     1 
HETATM 7668 O  O     . HOH Z  6 .   ? 123.149 2.380   229.110 1.00 57.04  ? 2004 HOH E O     1 
HETATM 7669 O  O     . HOH Z  6 .   ? 135.398 5.225   225.395 1.00 59.12  ? 2005 HOH E O     1 
HETATM 7670 O  O     . HOH AA 6 .   ? 131.992 -0.849  217.662 1.00 52.21  ? 2001 HOH F O     1 
HETATM 7671 O  O     . HOH AA 6 .   ? 109.005 22.504  214.901 1.00 69.13  ? 2002 HOH F O     1 
HETATM 7672 O  O     . HOH AA 6 .   ? 107.957 11.252  204.479 1.00 52.66  ? 2003 HOH F O     1 
HETATM 7673 O  O     . HOH BA 6 .   ? 159.188 5.135   180.008 1.00 37.16  ? 2001 HOH G O     1 
HETATM 7674 O  O     . HOH BA 6 .   ? 159.245 -3.726  173.531 1.00 39.37  ? 2002 HOH G O     1 
HETATM 7675 O  O     . HOH BA 6 .   ? 154.296 5.365   185.366 1.00 54.90  ? 2003 HOH G O     1 
HETATM 7676 O  O     . HOH BA 6 .   ? 154.908 6.193   190.669 1.00 56.44  ? 2004 HOH G O     1 
HETATM 7677 O  O     . HOH BA 6 .   ? 140.076 -1.402  185.008 1.00 43.01  ? 2005 HOH G O     1 
HETATM 7678 O  O     . HOH BA 6 .   ? 142.043 -0.158  191.663 1.00 38.51  ? 2006 HOH G O     1 
HETATM 7679 O  O     . HOH BA 6 .   ? 145.432 1.755   182.027 1.00 39.94  ? 2007 HOH G O     1 
HETATM 7680 O  O     . HOH BA 6 .   ? 159.000 -7.042  171.530 1.00 53.72  ? 2008 HOH G O     1 
HETATM 7681 O  O     . HOH BA 6 .   ? 161.557 16.006  180.021 1.00 51.70  ? 2009 HOH G O     1 
HETATM 7682 O  O     . HOH BA 6 .   ? 163.098 16.449  183.725 1.00 56.37  ? 2010 HOH G O     1 
HETATM 7683 O  O     . HOH BA 6 .   ? 161.668 -12.302 174.901 1.00 54.27  ? 2011 HOH G O     1 
HETATM 7684 O  O     . HOH BA 6 .   ? 144.044 -5.929  195.105 1.00 48.16  ? 2012 HOH G O     1 
HETATM 7685 O  O     . HOH BA 6 .   ? 142.328 -6.127  187.405 1.00 47.81  ? 2013 HOH G O     1 
HETATM 7686 O  O     . HOH BA 6 .   ? 153.084 7.129   194.908 1.00 51.38  ? 2014 HOH G O     1 
HETATM 7687 O  O     . HOH BA 6 .   ? 166.257 5.166   194.865 1.00 50.38  ? 2015 HOH G O     1 
HETATM 7688 O  O     . HOH BA 6 .   ? 169.036 -11.187 187.851 1.00 59.53  ? 2016 HOH G O     1 
HETATM 7689 O  O     . HOH BA 6 .   ? 166.549 0.146   166.427 1.00 48.58  ? 2017 HOH G O     1 
HETATM 7690 O  O     . HOH BA 6 .   ? 175.551 0.275   170.714 1.00 42.67  ? 2018 HOH G O     1 
HETATM 7691 O  O     . HOH BA 6 .   ? 171.490 6.905   168.392 1.00 50.94  ? 2019 HOH G O     1 
HETATM 7692 O  O     . HOH BA 6 .   ? 159.495 7.423   180.859 1.00 40.73  ? 2020 HOH G O     1 
HETATM 7693 O  O     . HOH BA 6 .   ? 163.313 14.552  179.068 1.00 46.01  ? 2021 HOH G O     1 
HETATM 7694 O  O     . HOH BA 6 .   ? 165.051 13.866  182.546 1.00 49.04  ? 2022 HOH G O     1 
HETATM 7695 O  O     . HOH BA 6 .   ? 165.443 12.898  184.687 1.00 45.56  ? 2023 HOH G O     1 
HETATM 7696 O  O     . HOH BA 6 .   ? 181.299 3.412   180.711 1.00 50.03  ? 2024 HOH G O     1 
HETATM 7697 O  O     . HOH BA 6 .   ? 179.595 6.128   181.580 1.00 48.60  ? 2025 HOH G O     1 
HETATM 7698 O  O     . HOH BA 6 .   ? 174.684 7.852   173.953 1.00 44.61  ? 2026 HOH G O     1 
HETATM 7699 O  O     . HOH BA 6 .   ? 178.733 4.680   173.428 1.00 53.50  ? 2027 HOH G O     1 
HETATM 7700 O  O     . HOH BA 6 .   ? 177.573 1.513   169.020 1.00 48.84  ? 2028 HOH G O     1 
HETATM 7701 O  O     . HOH BA 6 .   ? 184.029 -6.756  177.514 1.00 58.07  ? 2029 HOH G O     1 
HETATM 7702 O  O     . HOH BA 6 .   ? 156.807 6.168   178.325 1.00 51.27  ? 2030 HOH G O     1 
HETATM 7703 O  O     . HOH CA 6 .   ? 179.600 12.947  165.175 1.00 61.68  ? 2001 HOH H O     1 
HETATM 7704 O  O     . HOH CA 6 .   ? 142.365 11.631  178.443 1.00 56.41  ? 2002 HOH H O     1 
HETATM 7705 O  O     . HOH CA 6 .   ? 127.290 -7.261  201.199 1.00 55.33  ? 2003 HOH H O     1 
HETATM 7706 O  O     . HOH DA 6 .   ? 143.489 15.276  173.673 1.00 74.35  ? 2001 HOH I O     1 
HETATM 7707 O  O     . HOH DA 6 .   ? 158.581 3.172   169.264 1.00 50.72  ? 2002 HOH I O     1 
HETATM 7708 O  O     . HOH EA 6 .   ? 92.397  -0.853  210.627 1.00 56.67  ? 2001 HOH M O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   1   ?   ?   ?   A . n 
A 1 2   HIS 2   2   ?   ?   ?   A . n 
A 1 3   ASN 3   3   ?   ?   ?   A . n 
A 1 4   ASN 4   4   4   ASN ASN A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   ASN 6   6   6   ASN ASN A . n 
A 1 7   VAL 7   7   7   VAL VAL A . n 
A 1 8   SER 8   8   8   SER SER A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  ALA 12  12  12  ALA ALA A . n 
A 1 13  TYR 13  13  13  TYR TYR A . n 
A 1 14  LEU 14  14  14  LEU LEU A . n 
A 1 15  LEU 15  15  15  LEU LEU A . n 
A 1 16  GLY 16  16  16  GLY GLY A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  ILE 18  18  18  ILE ILE A . n 
A 1 19  ILE 19  19  19  ILE ILE A . n 
A 1 20  GLY 20  20  20  GLY GLY A . n 
A 1 21  ASP 21  21  21  ASP ASP A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  TYR 25  25  25  TYR TYR A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  LEU 27  27  27  LEU LEU A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  TYR 29  29  29  TYR TYR A . n 
A 1 30  LYS 30  30  30  LYS LYS A . n 
A 1 31  GLY 31  31  31  GLY GLY A . n 
A 1 32  ASN 32  32  32  ASN ASN A . n 
A 1 33  ARG 33  33  33  ARG ARG A . n 
A 1 34  SER 34  34  34  SER SER A . n 
A 1 35  GLU 35  35  35  GLU GLU A . n 
A 1 36  TYR 36  36  36  TYR TYR A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  VAL 38  38  38  VAL VAL A . n 
A 1 39  VAL 39  39  39  VAL VAL A . n 
A 1 40  ILE 40  40  40  ILE ILE A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  GLN 42  42  42  GLN GLN A . n 
A 1 43  LYS 43  43  43  LYS LYS A . n 
A 1 44  SER 44  44  44  SER SER A . n 
A 1 45  GLU 45  45  45  GLU GLU A . n 
A 1 46  ASN 46  46  46  ASN ASN A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  ILE 48  48  48  ILE ILE A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  GLN 50  50  50  GLN GLN A . n 
A 1 51  HIS 51  51  51  HIS HIS A . n 
A 1 52  ILE 52  52  52  ILE ILE A . n 
A 1 53  ALA 53  53  53  ALA ALA A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  MET 56  56  56  MET MET A . n 
A 1 57  GLN 57  57  57  GLN GLN A . n 
A 1 58  PHE 58  58  58  PHE PHE A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  ILE 60  60  60  ILE ILE A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  GLU 62  62  62  GLU GLU A . n 
A 1 63  LEU 63  63  63  LEU LEU A . n 
A 1 64  ASN 64  64  64  ASN ASN A . n 
A 1 65  VAL 65  65  65  VAL VAL A . n 
A 1 66  LYS 66  66  66  LYS LYS A . n 
A 1 67  SER 67  67  67  SER SER A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  ILE 69  69  69  ILE ILE A . n 
A 1 70  GLN 70  70  70  GLN GLN A . n 
A 1 71  ILE 71  71  71  ILE ILE A . n 
A 1 72  VAL 72  72  72  VAL VAL A . n 
A 1 73  LYS 73  73  73  LYS LYS A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  ASP 75  75  75  ASP ASP A . n 
A 1 76  THR 76  76  76  THR THR A . n 
A 1 77  ARG 77  77  77  ARG ARG A . n 
A 1 78  TYR 78  78  78  TYR TYR A . n 
A 1 79  GLU 79  79  79  GLU GLU A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ARG 81  81  81  ARG ARG A . n 
A 1 82  VAL 82  82  82  VAL VAL A . n 
A 1 83  SER 83  83  83  SER SER A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  LYS 85  85  85  LYS LYS A . n 
A 1 86  LYS 86  86  86  LYS LYS A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  TYR 88  88  88  TYR TYR A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  TYR 90  90  90  TYR TYR A . n 
A 1 91  PHE 91  91  91  PHE PHE A . n 
A 1 92  ALA 92  92  92  ALA ALA A . n 
A 1 93  ASN 93  93  93  ASN ASN A . n 
A 1 94  MET 94  94  94  MET MET A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  GLU 96  96  96  GLU GLU A . n 
A 1 97  ARG 97  97  97  ARG ARG A . n 
A 1 98  ILE 98  98  98  ILE ILE A . n 
A 1 99  ARG 99  99  99  ARG ARG A . n 
A 1 100 LEU 100 100 100 LEU LEU A . n 
A 1 101 PHE 101 101 101 PHE PHE A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 MET 103 103 103 MET MET A . n 
A 1 104 ARG 104 104 104 ARG ARG A . n 
A 1 105 GLU 105 105 105 GLU GLU A . n 
A 1 106 GLN 106 106 106 GLN GLN A . n 
A 1 107 ILE 107 107 107 ILE ILE A . n 
A 1 108 ALA 108 108 108 ALA ALA A . n 
A 1 109 PHE 109 109 109 PHE PHE A . n 
A 1 110 ILE 110 110 110 ILE ILE A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 GLY 112 112 112 GLY GLY A . n 
A 1 113 LEU 113 113 113 LEU LEU A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 ALA 116 116 116 ALA ALA A . n 
A 1 117 GLU 117 117 117 GLU GLU A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 LYS 120 120 120 LYS LYS A . n 
A 1 121 THR 121 121 121 THR THR A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 LYS 123 123 123 LYS LYS A . n 
A 1 124 ARG 124 124 124 ARG ARG A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 ARG 126 126 126 ARG ARG A . n 
A 1 127 ILE 127 127 127 ILE ILE A . n 
A 1 128 TRP 128 128 128 TRP TRP A . n 
A 1 129 ASN 129 129 129 ASN ASN A . n 
A 1 130 LYS 130 130 130 LYS LYS A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 LYS 132 132 132 LYS LYS A . n 
A 1 133 ALA 133 133 133 ALA ALA A . n 
A 1 134 LEU 134 134 134 LEU LEU A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 GLU 136 136 136 GLU GLU A . n 
A 1 137 ILE 137 137 137 ILE ILE A . n 
A 1 138 VAL 138 138 138 VAL VAL A . n 
A 1 139 SER 139 139 139 SER SER A . n 
A 1 140 ARG 140 140 140 ARG ARG A . n 
A 1 141 TRP 141 141 141 TRP TRP A . n 
A 1 142 LEU 142 142 142 LEU LEU A . n 
A 1 143 ASN 143 143 143 ASN ASN A . n 
A 1 144 ASN 144 144 144 ASN ASN A . n 
A 1 145 LEU 145 145 145 LEU LEU A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 VAL 147 147 147 VAL VAL A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 THR 150 150 150 THR THR A . n 
A 1 151 ILE 151 151 151 ILE ILE A . n 
A 1 152 HIS 152 152 152 HIS HIS A . n 
A 1 153 LEU 153 153 153 LEU LEU A . n 
A 1 154 ASP 154 154 154 ASP ASP A . n 
A 1 155 ASP 155 155 155 ASP ASP A . n 
A 1 156 HIS 156 156 156 HIS HIS A . n 
A 1 157 ARG 157 157 157 ARG ARG A . n 
A 1 158 HIS 158 158 158 HIS HIS A . n 
A 1 159 GLY 159 159 159 GLY GLY A . n 
A 1 160 VAL 160 160 160 VAL VAL A . n 
A 1 161 TYR 161 161 161 TYR TYR A . n 
A 1 162 VAL 162 162 162 VAL VAL A . n 
A 1 163 LEU 163 163 163 LEU LEU A . n 
A 1 164 ASN 164 164 164 ASN ASN A . n 
A 1 165 ILE 165 165 165 ILE ILE A . n 
A 1 166 SER 166 166 166 SER SER A . n 
A 1 167 LEU 167 167 167 LEU LEU A . n 
A 1 168 ARG 168 168 168 ARG ARG A . n 
A 1 169 ASP 169 169 169 ASP ASP A . n 
A 1 170 ARG 170 170 170 ARG ARG A . n 
A 1 171 ILE 171 171 171 ILE ILE A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 PHE 173 173 173 PHE PHE A . n 
A 1 174 VAL 174 174 174 VAL VAL A . n 
A 1 175 HIS 175 175 175 HIS HIS A . n 
A 1 176 THR 176 176 176 THR THR A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 LEU 178 178 178 LEU LEU A . n 
A 1 179 SER 179 179 179 SER SER A . n 
A 1 180 SER 180 180 180 SER SER A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 LEU 182 182 182 LEU LEU A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 LEU 185 185 185 LEU LEU A . n 
A 1 186 PRO 186 186 186 PRO PRO A . n 
A 1 187 PRO 187 187 187 PRO PRO A . n 
A 1 188 GLU 188 188 ?   ?   ?   A . n 
A 1 189 ALA 189 189 ?   ?   ?   A . n 
A 1 190 ALA 190 190 ?   ?   ?   A . n 
A 1 191 ALA 191 191 ?   ?   ?   A . n 
A 1 192 LEU 192 192 ?   ?   ?   A . n 
A 1 193 GLU 193 193 ?   ?   ?   A . n 
A 1 194 HIS 194 194 ?   ?   ?   A . n 
A 1 195 HIS 195 195 ?   ?   ?   A . n 
A 1 196 HIS 196 196 ?   ?   ?   A . n 
A 1 197 HIS 197 197 ?   ?   ?   A . n 
A 1 198 HIS 198 198 ?   ?   ?   A . n 
A 1 199 HIS 199 199 ?   ?   ?   A . n 
B 2 1   DG  1   1   1   DG  DG  B . n 
B 2 2   DC  2   2   2   DC  DC  B . n 
B 2 3   DC  3   3   3   DC  DC  B . n 
B 2 4   DT  4   4   4   DT  DT  B . n 
B 2 5   DT  5   5   5   DT  DT  B . n 
B 2 6   DG  6   6   6   DG  DG  B . n 
B 2 7   DC  7   7   7   DC  DC  B . n 
B 2 8   DC  8   8   8   DC  DC  B . n 
B 2 9   DG  9   9   9   DG  DG  B . n 
B 2 10  DG  10  10  10  DG  DG  B . n 
B 2 11  DG  11  11  11  DG  DG  B . n 
B 2 12  DT  12  12  12  DT  DT  B . n 
B 2 13  DA  13  13  13  DA  DA  B . n 
B 2 14  DA  14  14  14  DA  DA  B . n 
B 2 15  DG  15  15  15  DG  DG  B . n 
B 2 16  DT  16  16  16  DT  DT  B . n 
B 2 17  DT  17  17  17  DT  DT  B . n 
B 2 18  DC  18  18  18  DC  DC  B . n 
B 2 19  DC  19  19  19  DC  DC  B . n 
B 2 20  DG  20  20  20  DG  DG  B . n 
B 2 21  DG  21  21  21  DG  DG  B . n 
B 2 22  DC  22  22  22  DC  DC  B . n 
B 2 23  DG  23  23  23  DG  DG  B . n 
B 2 24  DC  24  24  24  DC  DC  B . n 
B 2 25  DG  25  25  25  DG  DG  B . n 
C 3 1   DC  1   1   1   DC  DC  C . n 
C 3 2   DG  2   2   2   DG  DG  C . n 
C 3 3   DC  3   3   3   DC  DC  C . n 
C 3 4   DG  4   4   4   DG  DG  C . n 
C 3 5   DC  5   5   5   DC  DC  C . n 
C 3 6   DC  6   6   6   DC  DC  C . n 
C 3 7   DG  7   7   7   DG  DG  C . n 
C 3 8   DG  8   8   8   DG  DG  C . n 
C 3 9   DA  9   9   9   DA  DA  C . n 
C 3 10  DA  10  10  10  DA  DA  C . n 
C 3 11  DC  11  11  11  DC  DC  C . n 
C 3 12  DT  12  12  12  DT  DT  C . n 
C 3 13  DT  13  13  13  DT  DT  C . n 
C 3 14  DA  14  14  14  DA  DA  C . n 
C 3 15  DC  15  15  15  DC  DC  C . n 
D 1 1   ALA 1   1   ?   ?   ?   D . n 
D 1 2   HIS 2   2   ?   ?   ?   D . n 
D 1 3   ASN 3   3   ?   ?   ?   D . n 
D 1 4   ASN 4   4   4   ASN ASN D . n 
D 1 5   GLU 5   5   5   GLU GLU D . n 
D 1 6   ASN 6   6   6   ASN ASN D . n 
D 1 7   VAL 7   7   7   VAL VAL D . n 
D 1 8   SER 8   8   8   SER SER D . n 
D 1 9   GLY 9   9   9   GLY GLY D . n 
D 1 10  ILE 10  10  10  ILE ILE D . n 
D 1 11  SER 11  11  11  SER SER D . n 
D 1 12  ALA 12  12  12  ALA ALA D . n 
D 1 13  TYR 13  13  13  TYR TYR D . n 
D 1 14  LEU 14  14  14  LEU LEU D . n 
D 1 15  LEU 15  15  15  LEU LEU D . n 
D 1 16  GLY 16  16  16  GLY GLY D . n 
D 1 17  LEU 17  17  17  LEU LEU D . n 
D 1 18  ILE 18  18  18  ILE ILE D . n 
D 1 19  ILE 19  19  19  ILE ILE D . n 
D 1 20  GLY 20  20  20  GLY GLY D . n 
D 1 21  ASP 21  21  21  ASP ASP D . n 
D 1 22  GLY 22  22  22  GLY GLY D . n 
D 1 23  GLY 23  23  23  GLY GLY D . n 
D 1 24  LEU 24  24  24  LEU LEU D . n 
D 1 25  TYR 25  25  25  TYR TYR D . n 
D 1 26  LYS 26  26  26  LYS LYS D . n 
D 1 27  LEU 27  27  27  LEU LEU D . n 
D 1 28  LYS 28  28  28  LYS LYS D . n 
D 1 29  TYR 29  29  29  TYR TYR D . n 
D 1 30  LYS 30  30  30  LYS LYS D . n 
D 1 31  GLY 31  31  31  GLY GLY D . n 
D 1 32  ASN 32  32  32  ASN ASN D . n 
D 1 33  ARG 33  33  33  ARG ARG D . n 
D 1 34  SER 34  34  34  SER SER D . n 
D 1 35  GLU 35  35  35  GLU GLU D . n 
D 1 36  TYR 36  36  36  TYR TYR D . n 
D 1 37  ARG 37  37  37  ARG ARG D . n 
D 1 38  VAL 38  38  38  VAL VAL D . n 
D 1 39  VAL 39  39  39  VAL VAL D . n 
D 1 40  ILE 40  40  40  ILE ILE D . n 
D 1 41  THR 41  41  41  THR THR D . n 
D 1 42  GLN 42  42  42  GLN GLN D . n 
D 1 43  LYS 43  43  43  LYS LYS D . n 
D 1 44  SER 44  44  44  SER SER D . n 
D 1 45  GLU 45  45  45  GLU GLU D . n 
D 1 46  ASN 46  46  46  ASN ASN D . n 
D 1 47  LEU 47  47  47  LEU LEU D . n 
D 1 48  ILE 48  48  48  ILE ILE D . n 
D 1 49  LYS 49  49  49  LYS LYS D . n 
D 1 50  GLN 50  50  50  GLN GLN D . n 
D 1 51  HIS 51  51  51  HIS HIS D . n 
D 1 52  ILE 52  52  52  ILE ILE D . n 
D 1 53  ALA 53  53  53  ALA ALA D . n 
D 1 54  PRO 54  54  54  PRO PRO D . n 
D 1 55  LEU 55  55  55  LEU LEU D . n 
D 1 56  MET 56  56  56  MET MET D . n 
D 1 57  GLN 57  57  57  GLN GLN D . n 
D 1 58  PHE 58  58  58  PHE PHE D . n 
D 1 59  LEU 59  59  59  LEU LEU D . n 
D 1 60  ILE 60  60  60  ILE ILE D . n 
D 1 61  ASP 61  61  61  ASP ASP D . n 
D 1 62  GLU 62  62  62  GLU GLU D . n 
D 1 63  LEU 63  63  63  LEU LEU D . n 
D 1 64  ASN 64  64  64  ASN ASN D . n 
D 1 65  VAL 65  65  65  VAL VAL D . n 
D 1 66  LYS 66  66  66  LYS LYS D . n 
D 1 67  SER 67  67  67  SER SER D . n 
D 1 68  LYS 68  68  68  LYS LYS D . n 
D 1 69  ILE 69  69  69  ILE ILE D . n 
D 1 70  GLN 70  70  70  GLN GLN D . n 
D 1 71  ILE 71  71  71  ILE ILE D . n 
D 1 72  VAL 72  72  72  VAL VAL D . n 
D 1 73  LYS 73  73  73  LYS LYS D . n 
D 1 74  GLY 74  74  74  GLY GLY D . n 
D 1 75  ASP 75  75  75  ASP ASP D . n 
D 1 76  THR 76  76  76  THR THR D . n 
D 1 77  ARG 77  77  77  ARG ARG D . n 
D 1 78  TYR 78  78  78  TYR TYR D . n 
D 1 79  GLU 79  79  79  GLU GLU D . n 
D 1 80  LEU 80  80  80  LEU LEU D . n 
D 1 81  ARG 81  81  81  ARG ARG D . n 
D 1 82  VAL 82  82  82  VAL VAL D . n 
D 1 83  SER 83  83  83  SER SER D . n 
D 1 84  SER 84  84  84  SER SER D . n 
D 1 85  LYS 85  85  85  LYS LYS D . n 
D 1 86  LYS 86  86  86  LYS LYS D . n 
D 1 87  LEU 87  87  87  LEU LEU D . n 
D 1 88  TYR 88  88  88  TYR TYR D . n 
D 1 89  TYR 89  89  89  TYR TYR D . n 
D 1 90  TYR 90  90  90  TYR TYR D . n 
D 1 91  PHE 91  91  91  PHE PHE D . n 
D 1 92  ALA 92  92  92  ALA ALA D . n 
D 1 93  ASN 93  93  93  ASN ASN D . n 
D 1 94  MET 94  94  94  MET MET D . n 
D 1 95  LEU 95  95  95  LEU LEU D . n 
D 1 96  GLU 96  96  96  GLU GLU D . n 
D 1 97  ARG 97  97  97  ARG ARG D . n 
D 1 98  ILE 98  98  98  ILE ILE D . n 
D 1 99  ARG 99  99  99  ARG ARG D . n 
D 1 100 LEU 100 100 100 LEU LEU D . n 
D 1 101 PHE 101 101 101 PHE PHE D . n 
D 1 102 ASN 102 102 102 ASN ASN D . n 
D 1 103 MET 103 103 103 MET MET D . n 
D 1 104 ARG 104 104 104 ARG ARG D . n 
D 1 105 GLU 105 105 105 GLU GLU D . n 
D 1 106 GLN 106 106 106 GLN GLN D . n 
D 1 107 ILE 107 107 107 ILE ILE D . n 
D 1 108 ALA 108 108 108 ALA ALA D . n 
D 1 109 PHE 109 109 109 PHE PHE D . n 
D 1 110 ILE 110 110 110 ILE ILE D . n 
D 1 111 LYS 111 111 111 LYS LYS D . n 
D 1 112 GLY 112 112 112 GLY GLY D . n 
D 1 113 LEU 113 113 113 LEU LEU D . n 
D 1 114 TYR 114 114 114 TYR TYR D . n 
D 1 115 VAL 115 115 115 VAL VAL D . n 
D 1 116 ALA 116 116 116 ALA ALA D . n 
D 1 117 GLU 117 117 117 GLU GLU D . n 
D 1 118 GLY 118 118 118 GLY GLY D . n 
D 1 119 ASP 119 119 119 ASP ASP D . n 
D 1 120 LYS 120 120 120 LYS LYS D . n 
D 1 121 THR 121 121 121 THR THR D . n 
D 1 122 LEU 122 122 122 LEU LEU D . n 
D 1 123 LYS 123 123 123 LYS LYS D . n 
D 1 124 ARG 124 124 124 ARG ARG D . n 
D 1 125 LEU 125 125 125 LEU LEU D . n 
D 1 126 ARG 126 126 126 ARG ARG D . n 
D 1 127 ILE 127 127 127 ILE ILE D . n 
D 1 128 TRP 128 128 128 TRP TRP D . n 
D 1 129 ASN 129 129 129 ASN ASN D . n 
D 1 130 LYS 130 130 130 LYS LYS D . n 
D 1 131 ASN 131 131 131 ASN ASN D . n 
D 1 132 LYS 132 132 132 LYS LYS D . n 
D 1 133 ALA 133 133 133 ALA ALA D . n 
D 1 134 LEU 134 134 134 LEU LEU D . n 
D 1 135 LEU 135 135 135 LEU LEU D . n 
D 1 136 GLU 136 136 136 GLU GLU D . n 
D 1 137 ILE 137 137 137 ILE ILE D . n 
D 1 138 VAL 138 138 138 VAL VAL D . n 
D 1 139 SER 139 139 139 SER SER D . n 
D 1 140 ARG 140 140 140 ARG ARG D . n 
D 1 141 TRP 141 141 141 TRP TRP D . n 
D 1 142 LEU 142 142 142 LEU LEU D . n 
D 1 143 ASN 143 143 143 ASN ASN D . n 
D 1 144 ASN 144 144 144 ASN ASN D . n 
D 1 145 LEU 145 145 145 LEU LEU D . n 
D 1 146 GLY 146 146 146 GLY GLY D . n 
D 1 147 VAL 147 147 147 VAL VAL D . n 
D 1 148 ARG 148 148 148 ARG ARG D . n 
D 1 149 ASN 149 149 149 ASN ASN D . n 
D 1 150 THR 150 150 150 THR THR D . n 
D 1 151 ILE 151 151 151 ILE ILE D . n 
D 1 152 HIS 152 152 152 HIS HIS D . n 
D 1 153 LEU 153 153 153 LEU LEU D . n 
D 1 154 ASP 154 154 154 ASP ASP D . n 
D 1 155 ASP 155 155 155 ASP ASP D . n 
D 1 156 HIS 156 156 156 HIS HIS D . n 
D 1 157 ARG 157 157 157 ARG ARG D . n 
D 1 158 HIS 158 158 158 HIS HIS D . n 
D 1 159 GLY 159 159 159 GLY GLY D . n 
D 1 160 VAL 160 160 160 VAL VAL D . n 
D 1 161 TYR 161 161 161 TYR TYR D . n 
D 1 162 VAL 162 162 162 VAL VAL D . n 
D 1 163 LEU 163 163 163 LEU LEU D . n 
D 1 164 ASN 164 164 164 ASN ASN D . n 
D 1 165 ILE 165 165 165 ILE ILE D . n 
D 1 166 SER 166 166 166 SER SER D . n 
D 1 167 LEU 167 167 167 LEU LEU D . n 
D 1 168 ARG 168 168 168 ARG ARG D . n 
D 1 169 ASP 169 169 169 ASP ASP D . n 
D 1 170 ARG 170 170 170 ARG ARG D . n 
D 1 171 ILE 171 171 171 ILE ILE D . n 
D 1 172 LYS 172 172 172 LYS LYS D . n 
D 1 173 PHE 173 173 173 PHE PHE D . n 
D 1 174 VAL 174 174 174 VAL VAL D . n 
D 1 175 HIS 175 175 175 HIS HIS D . n 
D 1 176 THR 176 176 176 THR THR D . n 
D 1 177 ILE 177 177 177 ILE ILE D . n 
D 1 178 LEU 178 178 178 LEU LEU D . n 
D 1 179 SER 179 179 179 SER SER D . n 
D 1 180 SER 180 180 180 SER SER D . n 
D 1 181 HIS 181 181 181 HIS HIS D . n 
D 1 182 LEU 182 182 182 LEU LEU D . n 
D 1 183 ASN 183 183 183 ASN ASN D . n 
D 1 184 PRO 184 184 184 PRO PRO D . n 
D 1 185 LEU 185 185 185 LEU LEU D . n 
D 1 186 PRO 186 186 186 PRO PRO D . n 
D 1 187 PRO 187 187 187 PRO PRO D . n 
D 1 188 GLU 188 188 ?   ?   ?   D . n 
D 1 189 ALA 189 189 ?   ?   ?   D . n 
D 1 190 ALA 190 190 ?   ?   ?   D . n 
D 1 191 ALA 191 191 ?   ?   ?   D . n 
D 1 192 LEU 192 192 ?   ?   ?   D . n 
D 1 193 GLU 193 193 ?   ?   ?   D . n 
D 1 194 HIS 194 194 ?   ?   ?   D . n 
D 1 195 HIS 195 195 ?   ?   ?   D . n 
D 1 196 HIS 196 196 ?   ?   ?   D . n 
D 1 197 HIS 197 197 ?   ?   ?   D . n 
D 1 198 HIS 198 198 ?   ?   ?   D . n 
D 1 199 HIS 199 199 ?   ?   ?   D . n 
E 2 1   DG  1   1   1   DG  DG  E . n 
E 2 2   DC  2   2   2   DC  DC  E . n 
E 2 3   DC  3   3   3   DC  DC  E . n 
E 2 4   DT  4   4   4   DT  DT  E . n 
E 2 5   DT  5   5   5   DT  DT  E . n 
E 2 6   DG  6   6   6   DG  DG  E . n 
E 2 7   DC  7   7   7   DC  DC  E . n 
E 2 8   DC  8   8   8   DC  DC  E . n 
E 2 9   DG  9   9   9   DG  DG  E . n 
E 2 10  DG  10  10  10  DG  DG  E . n 
E 2 11  DG  11  11  11  DG  DG  E . n 
E 2 12  DT  12  12  12  DT  DT  E . n 
E 2 13  DA  13  13  13  DA  DA  E . n 
E 2 14  DA  14  14  14  DA  DA  E . n 
E 2 15  DG  15  15  15  DG  DG  E . n 
E 2 16  DT  16  16  16  DT  DT  E . n 
E 2 17  DT  17  17  17  DT  DT  E . n 
E 2 18  DC  18  18  18  DC  DC  E . n 
E 2 19  DC  19  19  19  DC  DC  E . n 
E 2 20  DG  20  20  20  DG  DG  E . n 
E 2 21  DG  21  21  21  DG  DG  E . n 
E 2 22  DC  22  22  22  DC  DC  E . n 
E 2 23  DG  23  23  23  DG  DG  E . n 
E 2 24  DC  24  24  24  DC  DC  E . n 
E 2 25  DG  25  25  25  DG  DG  E . n 
F 3 1   DC  1   1   1   DC  DC  F . n 
F 3 2   DG  2   2   2   DG  DG  F . n 
F 3 3   DC  3   3   3   DC  DC  F . n 
F 3 4   DG  4   4   4   DG  DG  F . n 
F 3 5   DC  5   5   5   DC  DC  F . n 
F 3 6   DC  6   6   6   DC  DC  F . n 
F 3 7   DG  7   7   7   DG  DG  F . n 
F 3 8   DG  8   8   8   DG  DG  F . n 
F 3 9   DA  9   9   9   DA  DA  F . n 
F 3 10  DA  10  10  10  DA  DA  F . n 
F 3 11  DC  11  11  11  DC  DC  F . n 
F 3 12  DT  12  12  12  DT  DT  F . n 
F 3 13  DT  13  13  13  DT  DT  F . n 
F 3 14  DA  14  14  14  DA  DA  F . n 
F 3 15  DC  15  15  15  DC  DC  F . n 
G 1 1   ALA 1   1   ?   ?   ?   G . n 
G 1 2   HIS 2   2   ?   ?   ?   G . n 
G 1 3   ASN 3   3   ?   ?   ?   G . n 
G 1 4   ASN 4   4   4   ASN ASN G . n 
G 1 5   GLU 5   5   5   GLU GLU G . n 
G 1 6   ASN 6   6   6   ASN ASN G . n 
G 1 7   VAL 7   7   7   VAL VAL G . n 
G 1 8   SER 8   8   8   SER SER G . n 
G 1 9   GLY 9   9   9   GLY GLY G . n 
G 1 10  ILE 10  10  10  ILE ILE G . n 
G 1 11  SER 11  11  11  SER SER G . n 
G 1 12  ALA 12  12  12  ALA ALA G . n 
G 1 13  TYR 13  13  13  TYR TYR G . n 
G 1 14  LEU 14  14  14  LEU LEU G . n 
G 1 15  LEU 15  15  15  LEU LEU G . n 
G 1 16  GLY 16  16  16  GLY GLY G . n 
G 1 17  LEU 17  17  17  LEU LEU G . n 
G 1 18  ILE 18  18  18  ILE ILE G . n 
G 1 19  ILE 19  19  19  ILE ILE G . n 
G 1 20  GLY 20  20  20  GLY GLY G . n 
G 1 21  ASP 21  21  21  ASP ASP G . n 
G 1 22  GLY 22  22  22  GLY GLY G . n 
G 1 23  GLY 23  23  23  GLY GLY G . n 
G 1 24  LEU 24  24  24  LEU LEU G . n 
G 1 25  TYR 25  25  25  TYR TYR G . n 
G 1 26  LYS 26  26  26  LYS LYS G . n 
G 1 27  LEU 27  27  27  LEU LEU G . n 
G 1 28  LYS 28  28  28  LYS LYS G . n 
G 1 29  TYR 29  29  29  TYR TYR G . n 
G 1 30  LYS 30  30  30  LYS LYS G . n 
G 1 31  GLY 31  31  31  GLY GLY G . n 
G 1 32  ASN 32  32  32  ASN ASN G . n 
G 1 33  ARG 33  33  33  ARG ARG G . n 
G 1 34  SER 34  34  34  SER SER G . n 
G 1 35  GLU 35  35  35  GLU GLU G . n 
G 1 36  TYR 36  36  36  TYR TYR G . n 
G 1 37  ARG 37  37  37  ARG ARG G . n 
G 1 38  VAL 38  38  38  VAL VAL G . n 
G 1 39  VAL 39  39  39  VAL VAL G . n 
G 1 40  ILE 40  40  40  ILE ILE G . n 
G 1 41  THR 41  41  41  THR THR G . n 
G 1 42  GLN 42  42  42  GLN GLN G . n 
G 1 43  LYS 43  43  43  LYS LYS G . n 
G 1 44  SER 44  44  44  SER SER G . n 
G 1 45  GLU 45  45  45  GLU GLU G . n 
G 1 46  ASN 46  46  46  ASN ASN G . n 
G 1 47  LEU 47  47  47  LEU LEU G . n 
G 1 48  ILE 48  48  48  ILE ILE G . n 
G 1 49  LYS 49  49  49  LYS LYS G . n 
G 1 50  GLN 50  50  50  GLN GLN G . n 
G 1 51  HIS 51  51  51  HIS HIS G . n 
G 1 52  ILE 52  52  52  ILE ILE G . n 
G 1 53  ALA 53  53  53  ALA ALA G . n 
G 1 54  PRO 54  54  54  PRO PRO G . n 
G 1 55  LEU 55  55  55  LEU LEU G . n 
G 1 56  MET 56  56  56  MET MET G . n 
G 1 57  GLN 57  57  57  GLN GLN G . n 
G 1 58  PHE 58  58  58  PHE PHE G . n 
G 1 59  LEU 59  59  59  LEU LEU G . n 
G 1 60  ILE 60  60  60  ILE ILE G . n 
G 1 61  ASP 61  61  61  ASP ASP G . n 
G 1 62  GLU 62  62  62  GLU GLU G . n 
G 1 63  LEU 63  63  63  LEU LEU G . n 
G 1 64  ASN 64  64  64  ASN ASN G . n 
G 1 65  VAL 65  65  65  VAL VAL G . n 
G 1 66  LYS 66  66  66  LYS LYS G . n 
G 1 67  SER 67  67  67  SER SER G . n 
G 1 68  LYS 68  68  68  LYS LYS G . n 
G 1 69  ILE 69  69  69  ILE ILE G . n 
G 1 70  GLN 70  70  70  GLN GLN G . n 
G 1 71  ILE 71  71  71  ILE ILE G . n 
G 1 72  VAL 72  72  72  VAL VAL G . n 
G 1 73  LYS 73  73  73  LYS LYS G . n 
G 1 74  GLY 74  74  74  GLY GLY G . n 
G 1 75  ASP 75  75  75  ASP ASP G . n 
G 1 76  THR 76  76  76  THR THR G . n 
G 1 77  ARG 77  77  77  ARG ARG G . n 
G 1 78  TYR 78  78  78  TYR TYR G . n 
G 1 79  GLU 79  79  79  GLU GLU G . n 
G 1 80  LEU 80  80  80  LEU LEU G . n 
G 1 81  ARG 81  81  81  ARG ARG G . n 
G 1 82  VAL 82  82  82  VAL VAL G . n 
G 1 83  SER 83  83  83  SER SER G . n 
G 1 84  SER 84  84  84  SER SER G . n 
G 1 85  LYS 85  85  85  LYS LYS G . n 
G 1 86  LYS 86  86  86  LYS LYS G . n 
G 1 87  LEU 87  87  87  LEU LEU G . n 
G 1 88  TYR 88  88  88  TYR TYR G . n 
G 1 89  TYR 89  89  89  TYR TYR G . n 
G 1 90  TYR 90  90  90  TYR TYR G . n 
G 1 91  PHE 91  91  91  PHE PHE G . n 
G 1 92  ALA 92  92  92  ALA ALA G . n 
G 1 93  ASN 93  93  93  ASN ASN G . n 
G 1 94  MET 94  94  94  MET MET G . n 
G 1 95  LEU 95  95  95  LEU LEU G . n 
G 1 96  GLU 96  96  96  GLU GLU G . n 
G 1 97  ARG 97  97  97  ARG ARG G . n 
G 1 98  ILE 98  98  98  ILE ILE G . n 
G 1 99  ARG 99  99  99  ARG ARG G . n 
G 1 100 LEU 100 100 100 LEU LEU G . n 
G 1 101 PHE 101 101 101 PHE PHE G . n 
G 1 102 ASN 102 102 102 ASN ASN G . n 
G 1 103 MET 103 103 103 MET MET G . n 
G 1 104 ARG 104 104 104 ARG ARG G . n 
G 1 105 GLU 105 105 105 GLU GLU G . n 
G 1 106 GLN 106 106 106 GLN GLN G . n 
G 1 107 ILE 107 107 107 ILE ILE G . n 
G 1 108 ALA 108 108 108 ALA ALA G . n 
G 1 109 PHE 109 109 109 PHE PHE G . n 
G 1 110 ILE 110 110 110 ILE ILE G . n 
G 1 111 LYS 111 111 111 LYS LYS G . n 
G 1 112 GLY 112 112 112 GLY GLY G . n 
G 1 113 LEU 113 113 113 LEU LEU G . n 
G 1 114 TYR 114 114 114 TYR TYR G . n 
G 1 115 VAL 115 115 115 VAL VAL G . n 
G 1 116 ALA 116 116 116 ALA ALA G . n 
G 1 117 GLU 117 117 117 GLU GLU G . n 
G 1 118 GLY 118 118 118 GLY GLY G . n 
G 1 119 ASP 119 119 119 ASP ASP G . n 
G 1 120 LYS 120 120 120 LYS LYS G . n 
G 1 121 THR 121 121 121 THR THR G . n 
G 1 122 LEU 122 122 122 LEU LEU G . n 
G 1 123 LYS 123 123 123 LYS LYS G . n 
G 1 124 ARG 124 124 124 ARG ARG G . n 
G 1 125 LEU 125 125 125 LEU LEU G . n 
G 1 126 ARG 126 126 126 ARG ARG G . n 
G 1 127 ILE 127 127 127 ILE ILE G . n 
G 1 128 TRP 128 128 128 TRP TRP G . n 
G 1 129 ASN 129 129 129 ASN ASN G . n 
G 1 130 LYS 130 130 130 LYS LYS G . n 
G 1 131 ASN 131 131 131 ASN ASN G . n 
G 1 132 LYS 132 132 132 LYS LYS G . n 
G 1 133 ALA 133 133 133 ALA ALA G . n 
G 1 134 LEU 134 134 134 LEU LEU G . n 
G 1 135 LEU 135 135 135 LEU LEU G . n 
G 1 136 GLU 136 136 136 GLU GLU G . n 
G 1 137 ILE 137 137 137 ILE ILE G . n 
G 1 138 VAL 138 138 138 VAL VAL G . n 
G 1 139 SER 139 139 139 SER SER G . n 
G 1 140 ARG 140 140 140 ARG ARG G . n 
G 1 141 TRP 141 141 141 TRP TRP G . n 
G 1 142 LEU 142 142 142 LEU LEU G . n 
G 1 143 ASN 143 143 143 ASN ASN G . n 
G 1 144 ASN 144 144 144 ASN ASN G . n 
G 1 145 LEU 145 145 145 LEU LEU G . n 
G 1 146 GLY 146 146 146 GLY GLY G . n 
G 1 147 VAL 147 147 147 VAL VAL G . n 
G 1 148 ARG 148 148 148 ARG ARG G . n 
G 1 149 ASN 149 149 149 ASN ASN G . n 
G 1 150 THR 150 150 150 THR THR G . n 
G 1 151 ILE 151 151 151 ILE ILE G . n 
G 1 152 HIS 152 152 152 HIS HIS G . n 
G 1 153 LEU 153 153 153 LEU LEU G . n 
G 1 154 ASP 154 154 154 ASP ASP G . n 
G 1 155 ASP 155 155 155 ASP ASP G . n 
G 1 156 HIS 156 156 156 HIS HIS G . n 
G 1 157 ARG 157 157 157 ARG ARG G . n 
G 1 158 HIS 158 158 158 HIS HIS G . n 
G 1 159 GLY 159 159 159 GLY GLY G . n 
G 1 160 VAL 160 160 160 VAL VAL G . n 
G 1 161 TYR 161 161 161 TYR TYR G . n 
G 1 162 VAL 162 162 162 VAL VAL G . n 
G 1 163 LEU 163 163 163 LEU LEU G . n 
G 1 164 ASN 164 164 164 ASN ASN G . n 
G 1 165 ILE 165 165 165 ILE ILE G . n 
G 1 166 SER 166 166 166 SER SER G . n 
G 1 167 LEU 167 167 167 LEU LEU G . n 
G 1 168 ARG 168 168 168 ARG ARG G . n 
G 1 169 ASP 169 169 169 ASP ASP G . n 
G 1 170 ARG 170 170 170 ARG ARG G . n 
G 1 171 ILE 171 171 171 ILE ILE G . n 
G 1 172 LYS 172 172 172 LYS LYS G . n 
G 1 173 PHE 173 173 173 PHE PHE G . n 
G 1 174 VAL 174 174 174 VAL VAL G . n 
G 1 175 HIS 175 175 175 HIS HIS G . n 
G 1 176 THR 176 176 176 THR THR G . n 
G 1 177 ILE 177 177 177 ILE ILE G . n 
G 1 178 LEU 178 178 178 LEU LEU G . n 
G 1 179 SER 179 179 179 SER SER G . n 
G 1 180 SER 180 180 ?   ?   ?   G . n 
G 1 181 HIS 181 181 ?   ?   ?   G . n 
G 1 182 LEU 182 182 ?   ?   ?   G . n 
G 1 183 ASN 183 183 ?   ?   ?   G . n 
G 1 184 PRO 184 184 ?   ?   ?   G . n 
G 1 185 LEU 185 185 ?   ?   ?   G . n 
G 1 186 PRO 186 186 ?   ?   ?   G . n 
G 1 187 PRO 187 187 ?   ?   ?   G . n 
G 1 188 GLU 188 188 ?   ?   ?   G . n 
G 1 189 ALA 189 189 ?   ?   ?   G . n 
G 1 190 ALA 190 190 ?   ?   ?   G . n 
G 1 191 ALA 191 191 ?   ?   ?   G . n 
G 1 192 LEU 192 192 ?   ?   ?   G . n 
G 1 193 GLU 193 193 ?   ?   ?   G . n 
G 1 194 HIS 194 194 ?   ?   ?   G . n 
G 1 195 HIS 195 195 ?   ?   ?   G . n 
G 1 196 HIS 196 196 ?   ?   ?   G . n 
G 1 197 HIS 197 197 ?   ?   ?   G . n 
G 1 198 HIS 198 198 ?   ?   ?   G . n 
G 1 199 HIS 199 199 ?   ?   ?   G . n 
H 2 1   DG  1   1   1   DG  DG  H . n 
H 2 2   DC  2   2   2   DC  DC  H . n 
H 2 3   DC  3   3   3   DC  DC  H . n 
H 2 4   DT  4   4   4   DT  DT  H . n 
H 2 5   DT  5   5   5   DT  DT  H . n 
H 2 6   DG  6   6   6   DG  DG  H . n 
H 2 7   DC  7   7   7   DC  DC  H . n 
H 2 8   DC  8   8   8   DC  DC  H . n 
H 2 9   DG  9   9   9   DG  DG  H . n 
H 2 10  DG  10  10  10  DG  DG  H . n 
H 2 11  DG  11  11  11  DG  DG  H . n 
H 2 12  DT  12  12  12  DT  DT  H . n 
H 2 13  DA  13  13  13  DA  DA  H . n 
H 2 14  DA  14  14  14  DA  DA  H . n 
H 2 15  DG  15  15  15  DG  DG  H . n 
H 2 16  DT  16  16  16  DT  DT  H . n 
H 2 17  DT  17  17  17  DT  DT  H . n 
H 2 18  DC  18  18  18  DC  DC  H . n 
H 2 19  DC  19  19  19  DC  DC  H . n 
H 2 20  DG  20  20  20  DG  DG  H . n 
H 2 21  DG  21  21  21  DG  DG  H . n 
H 2 22  DC  22  22  22  DC  DC  H . n 
H 2 23  DG  23  23  23  DG  DG  H . n 
H 2 24  DC  24  24  24  DC  DC  H . n 
H 2 25  DG  25  25  25  DG  DG  H . n 
I 3 1   DC  1   1   1   DC  DC  I . n 
I 3 2   DG  2   2   2   DG  DG  I . n 
I 3 3   DC  3   3   3   DC  DC  I . n 
I 3 4   DG  4   4   4   DG  DG  I . n 
I 3 5   DC  5   5   5   DC  DC  I . n 
I 3 6   DC  6   6   6   DC  DC  I . n 
I 3 7   DG  7   7   7   DG  DG  I . n 
I 3 8   DG  8   8   8   DG  DG  I . n 
I 3 9   DA  9   9   9   DA  DA  I . n 
I 3 10  DA  10  10  10  DA  DA  I . n 
I 3 11  DC  11  11  11  DC  DC  I . n 
I 3 12  DT  12  12  12  DT  DT  I . n 
I 3 13  DT  13  13  13  DT  DT  I . n 
I 3 14  DA  14  14  14  DA  DA  I . n 
I 3 15  DC  15  15  15  DC  DC  I . n 
J 4 1   DC  1   16  16  DC  DC  K . n 
J 4 2   DC  2   17  17  DC  DC  K . n 
J 4 3   DG  3   18  18  DG  DG  K . n 
J 4 4   DG  4   19  19  DG  DG  K . n 
J 4 5   DC  5   20  20  DC  DC  K . n 
J 4 6   DA  6   21  21  DA  DA  K . n 
J 4 7   DA  7   22  22  DA  DA  K . n 
J 4 8   DG  8   23  23  DG  DG  K . n 
J 4 9   DG  9   24  24  DG  DG  K . n 
J 4 10  DC  10  25  25  DC  DC  K . n 
K 4 1   DC  1   16  16  DC  DC  M . n 
K 4 2   DC  2   17  17  DC  DC  M . n 
K 4 3   DG  3   18  18  DG  DG  M . n 
K 4 4   DG  4   19  19  DG  DG  M . n 
K 4 5   DC  5   20  20  DC  DC  M . n 
K 4 6   DA  6   21  21  DA  DA  M . n 
K 4 7   DA  7   22  22  DA  DA  M . n 
K 4 8   DG  8   23  23  DG  DG  M . n 
K 4 9   DG  9   24  24  DG  DG  M . n 
K 4 10  DC  10  25  25  DC  DC  M . n 
L 4 1   DC  1   16  16  DC  DC  O . n 
L 4 2   DC  2   17  17  DC  DC  O . n 
L 4 3   DG  3   18  18  DG  DG  O . n 
L 4 4   DG  4   19  19  DG  DG  O . n 
L 4 5   DC  5   20  20  DC  DC  O . n 
L 4 6   DA  6   21  21  DA  DA  O . n 
L 4 7   DA  7   22  22  DA  DA  O . n 
L 4 8   DG  8   23  23  DG  DG  O . n 
L 4 9   DG  9   24  24  DG  DG  O . n 
L 4 10  DC  10  25  25  DC  DC  O . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
M  5 MN  1  1188 1188 MN  MN  A . 
N  5 MN  1  1189 1189 MN  MN  A . 
O  5 MN  1  1190 1190 MN  MN  A . 
P  5 MN  1  1189 1189 MN  MN  D . 
Q  5 MN  1  1190 1190 MN  MN  D . 
R  5 MN  1  1191 1191 MN  MN  D . 
S  5 MN  1  1180 1180 MN  MN  G . 
T  5 MN  1  1181 1181 MN  MN  G . 
U  5 MN  1  1182 1182 MN  MN  G . 
V  6 HOH 1  2001 2001 HOH HOH A . 
V  6 HOH 2  2002 2002 HOH HOH A . 
V  6 HOH 3  2003 2003 HOH HOH A . 
V  6 HOH 4  2004 2004 HOH HOH A . 
V  6 HOH 5  2005 2005 HOH HOH A . 
V  6 HOH 6  2006 2006 HOH HOH A . 
V  6 HOH 7  2007 2007 HOH HOH A . 
V  6 HOH 8  2008 2008 HOH HOH A . 
V  6 HOH 9  2009 2009 HOH HOH A . 
V  6 HOH 10 2010 2010 HOH HOH A . 
V  6 HOH 11 2011 2011 HOH HOH A . 
V  6 HOH 12 2012 2012 HOH HOH A . 
V  6 HOH 13 2013 2013 HOH HOH A . 
V  6 HOH 14 2014 2014 HOH HOH A . 
V  6 HOH 15 2015 2015 HOH HOH A . 
V  6 HOH 16 2016 2016 HOH HOH A . 
V  6 HOH 17 2017 2017 HOH HOH A . 
V  6 HOH 18 2018 2018 HOH HOH A . 
V  6 HOH 19 2019 2019 HOH HOH A . 
V  6 HOH 20 2020 2020 HOH HOH A . 
V  6 HOH 21 2021 2021 HOH HOH A . 
V  6 HOH 22 2022 2022 HOH HOH A . 
V  6 HOH 23 2023 2023 HOH HOH A . 
V  6 HOH 24 2024 2024 HOH HOH A . 
V  6 HOH 25 2025 2025 HOH HOH A . 
V  6 HOH 26 2026 2026 HOH HOH A . 
V  6 HOH 27 2027 2027 HOH HOH A . 
V  6 HOH 28 2028 2028 HOH HOH A . 
V  6 HOH 29 2029 2029 HOH HOH A . 
V  6 HOH 30 2030 2030 HOH HOH A . 
V  6 HOH 31 2031 2031 HOH HOH A . 
V  6 HOH 32 2032 2032 HOH HOH A . 
V  6 HOH 33 2033 2033 HOH HOH A . 
V  6 HOH 34 2034 2034 HOH HOH A . 
V  6 HOH 35 2035 2035 HOH HOH A . 
W  6 HOH 1  2001 2001 HOH HOH B . 
W  6 HOH 2  2002 2002 HOH HOH B . 
W  6 HOH 3  2003 2003 HOH HOH B . 
W  6 HOH 4  2004 2004 HOH HOH B . 
W  6 HOH 5  2005 2005 HOH HOH B . 
W  6 HOH 6  2006 2006 HOH HOH B . 
W  6 HOH 7  2007 2007 HOH HOH B . 
W  6 HOH 8  2008 2008 HOH HOH B . 
X  6 HOH 1  2001 2001 HOH HOH C . 
X  6 HOH 2  2002 2002 HOH HOH C . 
Y  6 HOH 1  2001 2001 HOH HOH D . 
Y  6 HOH 2  2002 2002 HOH HOH D . 
Y  6 HOH 3  2003 2003 HOH HOH D . 
Y  6 HOH 4  2004 2004 HOH HOH D . 
Y  6 HOH 5  2005 2005 HOH HOH D . 
Y  6 HOH 6  2006 2006 HOH HOH D . 
Y  6 HOH 7  2007 2007 HOH HOH D . 
Y  6 HOH 8  2008 2008 HOH HOH D . 
Y  6 HOH 9  2009 2009 HOH HOH D . 
Y  6 HOH 10 2010 2010 HOH HOH D . 
Y  6 HOH 11 2011 2011 HOH HOH D . 
Y  6 HOH 12 2012 2012 HOH HOH D . 
Y  6 HOH 13 2013 2013 HOH HOH D . 
Y  6 HOH 14 2014 2014 HOH HOH D . 
Y  6 HOH 15 2015 2015 HOH HOH D . 
Y  6 HOH 16 2016 2016 HOH HOH D . 
Y  6 HOH 17 2017 2017 HOH HOH D . 
Y  6 HOH 18 2018 2018 HOH HOH D . 
Y  6 HOH 19 2019 2019 HOH HOH D . 
Y  6 HOH 20 2020 2020 HOH HOH D . 
Y  6 HOH 21 2021 2021 HOH HOH D . 
Y  6 HOH 22 2022 2022 HOH HOH D . 
Y  6 HOH 23 2023 2023 HOH HOH D . 
Y  6 HOH 24 2024 2024 HOH HOH D . 
Y  6 HOH 25 2025 2025 HOH HOH D . 
Y  6 HOH 26 2026 2026 HOH HOH D . 
Y  6 HOH 27 2027 2027 HOH HOH D . 
Y  6 HOH 28 2028 2028 HOH HOH D . 
Y  6 HOH 29 2029 2029 HOH HOH D . 
Y  6 HOH 30 2030 2030 HOH HOH D . 
Z  6 HOH 1  2001 2001 HOH HOH E . 
Z  6 HOH 2  2002 2002 HOH HOH E . 
Z  6 HOH 3  2003 2003 HOH HOH E . 
Z  6 HOH 4  2004 2004 HOH HOH E . 
Z  6 HOH 5  2005 2005 HOH HOH E . 
AA 6 HOH 1  2001 2001 HOH HOH F . 
AA 6 HOH 2  2002 2002 HOH HOH F . 
AA 6 HOH 3  2003 2003 HOH HOH F . 
BA 6 HOH 1  2001 2001 HOH HOH G . 
BA 6 HOH 2  2002 2002 HOH HOH G . 
BA 6 HOH 3  2003 2003 HOH HOH G . 
BA 6 HOH 4  2004 2004 HOH HOH G . 
BA 6 HOH 5  2005 2005 HOH HOH G . 
BA 6 HOH 6  2006 2006 HOH HOH G . 
BA 6 HOH 7  2007 2007 HOH HOH G . 
BA 6 HOH 8  2008 2008 HOH HOH G . 
BA 6 HOH 9  2009 2009 HOH HOH G . 
BA 6 HOH 10 2010 2010 HOH HOH G . 
BA 6 HOH 11 2011 2011 HOH HOH G . 
BA 6 HOH 12 2012 2012 HOH HOH G . 
BA 6 HOH 13 2013 2013 HOH HOH G . 
BA 6 HOH 14 2014 2014 HOH HOH G . 
BA 6 HOH 15 2015 2015 HOH HOH G . 
BA 6 HOH 16 2016 2016 HOH HOH G . 
BA 6 HOH 17 2017 2017 HOH HOH G . 
BA 6 HOH 18 2018 2018 HOH HOH G . 
BA 6 HOH 19 2019 2019 HOH HOH G . 
BA 6 HOH 20 2020 2020 HOH HOH G . 
BA 6 HOH 21 2021 2021 HOH HOH G . 
BA 6 HOH 22 2022 2022 HOH HOH G . 
BA 6 HOH 23 2023 2023 HOH HOH G . 
BA 6 HOH 24 2024 2024 HOH HOH G . 
BA 6 HOH 25 2025 2025 HOH HOH G . 
BA 6 HOH 26 2026 2026 HOH HOH G . 
BA 6 HOH 27 2027 2027 HOH HOH G . 
BA 6 HOH 28 2028 2028 HOH HOH G . 
BA 6 HOH 29 2029 2029 HOH HOH G . 
BA 6 HOH 30 2030 2030 HOH HOH G . 
CA 6 HOH 1  2001 2001 HOH HOH H . 
CA 6 HOH 2  2002 2002 HOH HOH H . 
CA 6 HOH 3  2003 2003 HOH HOH H . 
DA 6 HOH 1  2001 2001 HOH HOH I . 
DA 6 HOH 2  2002 2002 HOH HOH I . 
EA 6 HOH 1  2001 2001 HOH HOH M . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA tetrameric 4 
2 author_and_software_defined_assembly PISA tetrameric 4 
3 author_and_software_defined_assembly PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,C,J,M,N,O,V,W,X     
2 1 G,H,I,L,S,T,U,BA,CA,DA  
3 1 D,E,F,K,P,Q,R,Y,Z,AA,EA 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8210  ? 
1 MORE         -63.3 ? 
1 'SSA (A^2)'  14120 ? 
2 'ABSA (A^2)' 8130  ? 
2 MORE         -63.6 ? 
2 'SSA (A^2)'  13890 ? 
3 'ABSA (A^2)' 8480  ? 
3 MORE         -66.0 ? 
3 'SSA (A^2)'  13760 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1   OD2   ? A  ASP 21  ? A ASP 21   ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 O     ? A  ALA 116 ? A ALA 116  ? 1_555 94.6  ? 
2   OD2   ? A  ASP 21  ? A ASP 21   ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 O     ? V  HOH .   ? A HOH 2003 ? 1_555 86.5  ? 
3   O     ? A  ALA 116 ? A ALA 116  ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 O     ? V  HOH .   ? A HOH 2003 ? 1_555 90.1  ? 
4   OD2   ? A  ASP 21  ? A ASP 21   ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 OP2   ? J  DC  1   ? K DC  16   ? 1_555 174.2 ? 
5   O     ? A  ALA 116 ? A ALA 116  ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 OP2   ? J  DC  1   ? K DC  16   ? 1_555 83.2  ? 
6   O     ? V  HOH .   ? A HOH 2003 ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 OP2   ? J  DC  1   ? K DC  16   ? 1_555 98.8  ? 
7   OD2   ? A  ASP 21  ? A ASP 21   ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 OP3   ? J  DC  1   ? K DC  16   ? 1_555 116.8 ? 
8   O     ? A  ALA 116 ? A ALA 116  ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 OP3   ? J  DC  1   ? K DC  16   ? 1_555 78.7  ? 
9   O     ? V  HOH .   ? A HOH 2003 ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 OP3   ? J  DC  1   ? K DC  16   ? 1_555 154.6 ? 
10  OP2   ? J  DC  1   ? K DC  16   ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 OP3   ? J  DC  1   ? K DC  16   ? 1_555 57.6  ? 
11  OD2   ? A  ASP 21  ? A ASP 21   ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 OP1   ? B  DA  14  ? B DA  14   ? 1_555 102.6 ? 
12  O     ? A  ALA 116 ? A ALA 116  ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 OP1   ? B  DA  14  ? B DA  14   ? 1_555 162.3 ? 
13  O     ? V  HOH .   ? A HOH 2003 ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 OP1   ? B  DA  14  ? B DA  14   ? 1_555 86.6  ? 
14  OP2   ? J  DC  1   ? K DC  16   ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 OP1   ? B  DA  14  ? B DA  14   ? 1_555 80.1  ? 
15  OP3   ? J  DC  1   ? K DC  16   ? 1_555 MN ? M MN . ? A MN 1188 ? 1_555 OP1   ? B  DA  14  ? B DA  14   ? 1_555 97.1  ? 
16  OE2   ? A  GLU 117 ? A GLU 117  ? 1_555 MN ? N MN . ? A MN 1189 ? 1_555 OP1   ? C  DC  15  ? C DC  15   ? 1_555 82.5  ? 
17  OE2   ? A  GLU 117 ? A GLU 117  ? 1_555 MN ? N MN . ? A MN 1189 ? 1_555 O     ? V  HOH .   ? A HOH 2002 ? 1_555 89.1  ? 
18  OP1   ? C  DC  15  ? C DC  15   ? 1_555 MN ? N MN . ? A MN 1189 ? 1_555 O     ? V  HOH .   ? A HOH 2002 ? 1_555 82.8  ? 
19  OE2   ? A  GLU 117 ? A GLU 117  ? 1_555 MN ? N MN . ? A MN 1189 ? 1_555 O     ? A  GLY 20  ? A GLY 20   ? 1_555 89.4  ? 
20  OP1   ? C  DC  15  ? C DC  15   ? 1_555 MN ? N MN . ? A MN 1189 ? 1_555 O     ? A  GLY 20  ? A GLY 20   ? 1_555 171.6 ? 
21  O     ? V  HOH .   ? A HOH 2002 ? 1_555 MN ? N MN . ? A MN 1189 ? 1_555 O     ? A  GLY 20  ? A GLY 20   ? 1_555 94.8  ? 
22  OE2   ? A  GLU 117 ? A GLU 117  ? 1_555 MN ? N MN . ? A MN 1189 ? 1_555 OP2   ? B  DG  15  ? B DG  15   ? 1_555 100.7 ? 
23  OP1   ? C  DC  15  ? C DC  15   ? 1_555 MN ? N MN . ? A MN 1189 ? 1_555 OP2   ? B  DG  15  ? B DG  15   ? 1_555 108.0 ? 
24  O     ? V  HOH .   ? A HOH 2002 ? 1_555 MN ? N MN . ? A MN 1189 ? 1_555 OP2   ? B  DG  15  ? B DG  15   ? 1_555 166.2 ? 
25  O     ? A  GLY 20  ? A GLY 20   ? 1_555 MN ? N MN . ? A MN 1189 ? 1_555 OP2   ? B  DG  15  ? B DG  15   ? 1_555 75.8  ? 
26  OD1   ? A  ASP 21  ? A ASP 21   ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 OE1   ? A  GLU 117 ? A GLU 117  ? 1_555 95.3  ? 
27  OD1   ? A  ASP 21  ? A ASP 21   ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 "O3'" ? B  DA  14  ? B DA  14   ? 1_555 81.8  ? 
28  OE1   ? A  GLU 117 ? A GLU 117  ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 "O3'" ? B  DA  14  ? B DA  14   ? 1_555 143.3 ? 
29  OD1   ? A  ASP 21  ? A ASP 21   ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 OP2   ? B  DG  15  ? B DG  15   ? 1_555 93.0  ? 
30  OE1   ? A  GLU 117 ? A GLU 117  ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 OP2   ? B  DG  15  ? B DG  15   ? 1_555 86.4  ? 
31  "O3'" ? B  DA  14  ? B DA  14   ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 OP2   ? B  DG  15  ? B DG  15   ? 1_555 57.4  ? 
32  OD1   ? A  ASP 21  ? A ASP 21   ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 "O3'" ? C  DC  15  ? C DC  15   ? 1_555 159.0 ? 
33  OE1   ? A  GLU 117 ? A GLU 117  ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 "O3'" ? C  DC  15  ? C DC  15   ? 1_555 84.2  ? 
34  "O3'" ? B  DA  14  ? B DA  14   ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 "O3'" ? C  DC  15  ? C DC  15   ? 1_555 110.9 ? 
35  OP2   ? B  DG  15  ? B DG  15   ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 "O3'" ? C  DC  15  ? C DC  15   ? 1_555 107.9 ? 
36  OD1   ? A  ASP 21  ? A ASP 21   ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 OP3   ? J  DC  1   ? K DC  16   ? 1_555 87.3  ? 
37  OE1   ? A  GLU 117 ? A GLU 117  ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 OP3   ? J  DC  1   ? K DC  16   ? 1_555 105.0 ? 
38  "O3'" ? B  DA  14  ? B DA  14   ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 OP3   ? J  DC  1   ? K DC  16   ? 1_555 111.4 ? 
39  OP2   ? B  DG  15  ? B DG  15   ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 OP3   ? J  DC  1   ? K DC  16   ? 1_555 168.5 ? 
40  "O3'" ? C  DC  15  ? C DC  15   ? 1_555 MN ? O MN . ? A MN 1190 ? 1_555 OP3   ? J  DC  1   ? K DC  16   ? 1_555 72.6  ? 
41  OE2   ? D  GLU 117 ? D GLU 117  ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 O     ? Y  HOH .   ? D HOH 2002 ? 1_555 105.0 ? 
42  OE2   ? D  GLU 117 ? D GLU 117  ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 O     ? D  GLY 20  ? D GLY 20   ? 1_555 94.5  ? 
43  O     ? Y  HOH .   ? D HOH 2002 ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 O     ? D  GLY 20  ? D GLY 20   ? 1_555 89.3  ? 
44  OE2   ? D  GLU 117 ? D GLU 117  ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 OP2   ? E  DG  15  ? E DG  15   ? 1_555 105.1 ? 
45  O     ? Y  HOH .   ? D HOH 2002 ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 OP2   ? E  DG  15  ? E DG  15   ? 1_555 147.7 ? 
46  O     ? D  GLY 20  ? D GLY 20   ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 OP2   ? E  DG  15  ? E DG  15   ? 1_555 76.9  ? 
47  OE2   ? D  GLU 117 ? D GLU 117  ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 OP1   ? F  DC  15  ? F DC  15   ? 1_555 89.0  ? 
48  O     ? Y  HOH .   ? D HOH 2002 ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 OP1   ? F  DC  15  ? F DC  15   ? 1_555 85.9  ? 
49  O     ? D  GLY 20  ? D GLY 20   ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 OP1   ? F  DC  15  ? F DC  15   ? 1_555 174.7 ? 
50  OP2   ? E  DG  15  ? E DG  15   ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 OP1   ? F  DC  15  ? F DC  15   ? 1_555 106.1 ? 
51  OE2   ? D  GLU 117 ? D GLU 117  ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 O     ? Y  HOH .   ? D HOH 2003 ? 1_555 171.3 ? 
52  O     ? Y  HOH .   ? D HOH 2002 ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 O     ? Y  HOH .   ? D HOH 2003 ? 1_555 76.7  ? 
53  O     ? D  GLY 20  ? D GLY 20   ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 O     ? Y  HOH .   ? D HOH 2003 ? 1_555 94.1  ? 
54  OP2   ? E  DG  15  ? E DG  15   ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 O     ? Y  HOH .   ? D HOH 2003 ? 1_555 75.3  ? 
55  OP1   ? F  DC  15  ? F DC  15   ? 1_555 MN ? P MN . ? D MN 1189 ? 1_555 O     ? Y  HOH .   ? D HOH 2003 ? 1_555 82.6  ? 
56  OD2   ? D  ASP 21  ? D ASP 21   ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 O     ? D  ALA 116 ? D ALA 116  ? 1_555 93.6  ? 
57  OD2   ? D  ASP 21  ? D ASP 21   ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 OP1   ? E  DA  14  ? E DA  14   ? 1_555 92.9  ? 
58  O     ? D  ALA 116 ? D ALA 116  ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 OP1   ? E  DA  14  ? E DA  14   ? 1_555 167.9 ? 
59  OD2   ? D  ASP 21  ? D ASP 21   ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 OP3   ? K  DC  1   ? M DC  16   ? 1_555 171.6 ? 
60  O     ? D  ALA 116 ? D ALA 116  ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 OP3   ? K  DC  1   ? M DC  16   ? 1_555 87.7  ? 
61  OP1   ? E  DA  14  ? E DA  14   ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 OP3   ? K  DC  1   ? M DC  16   ? 1_555 87.3  ? 
62  OD2   ? D  ASP 21  ? D ASP 21   ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 OP2   ? K  DC  1   ? M DC  16   ? 1_555 109.8 ? 
63  O     ? D  ALA 116 ? D ALA 116  ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 OP2   ? K  DC  1   ? M DC  16   ? 1_555 80.3  ? 
64  OP1   ? E  DA  14  ? E DA  14   ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 OP2   ? K  DC  1   ? M DC  16   ? 1_555 106.9 ? 
65  OP3   ? K  DC  1   ? M DC  16   ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 OP2   ? K  DC  1   ? M DC  16   ? 1_555 62.3  ? 
66  OD2   ? D  ASP 21  ? D ASP 21   ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 O     ? Y  HOH .   ? D HOH 2004 ? 1_555 83.9  ? 
67  O     ? D  ALA 116 ? D ALA 116  ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 O     ? Y  HOH .   ? D HOH 2004 ? 1_555 82.4  ? 
68  OP1   ? E  DA  14  ? E DA  14   ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 O     ? Y  HOH .   ? D HOH 2004 ? 1_555 88.2  ? 
69  OP3   ? K  DC  1   ? M DC  16   ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 O     ? Y  HOH .   ? D HOH 2004 ? 1_555 104.5 ? 
70  OP2   ? K  DC  1   ? M DC  16   ? 1_555 MN ? Q MN . ? D MN 1190 ? 1_555 O     ? Y  HOH .   ? D HOH 2004 ? 1_555 158.5 ? 
71  OP2   ? K  DC  1   ? M DC  16   ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 OD1   ? D  ASP 21  ? D ASP 21   ? 1_555 89.3  ? 
72  OP2   ? K  DC  1   ? M DC  16   ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 OE1   ? D  GLU 117 ? D GLU 117  ? 1_555 101.2 ? 
73  OD1   ? D  ASP 21  ? D ASP 21   ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 OE1   ? D  GLU 117 ? D GLU 117  ? 1_555 86.6  ? 
74  OP2   ? K  DC  1   ? M DC  16   ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 "O3'" ? E  DA  14  ? E DA  14   ? 1_555 108.3 ? 
75  OD1   ? D  ASP 21  ? D ASP 21   ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 "O3'" ? E  DA  14  ? E DA  14   ? 1_555 88.4  ? 
76  OE1   ? D  GLU 117 ? D GLU 117  ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 "O3'" ? E  DA  14  ? E DA  14   ? 1_555 150.0 ? 
77  OP2   ? K  DC  1   ? M DC  16   ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 OP2   ? E  DG  15  ? E DG  15   ? 1_555 165.9 ? 
78  OD1   ? D  ASP 21  ? D ASP 21   ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 OP2   ? E  DG  15  ? E DG  15   ? 1_555 95.3  ? 
79  OE1   ? D  GLU 117 ? D GLU 117  ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 OP2   ? E  DG  15  ? E DG  15   ? 1_555 92.4  ? 
80  "O3'" ? E  DA  14  ? E DA  14   ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 OP2   ? E  DG  15  ? E DG  15   ? 1_555 58.7  ? 
81  OP2   ? K  DC  1   ? M DC  16   ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 "O3'" ? F  DC  15  ? F DC  15   ? 1_555 73.3  ? 
82  OD1   ? D  ASP 21  ? D ASP 21   ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 "O3'" ? F  DC  15  ? F DC  15   ? 1_555 162.2 ? 
83  OE1   ? D  GLU 117 ? D GLU 117  ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 "O3'" ? F  DC  15  ? F DC  15   ? 1_555 93.0  ? 
84  "O3'" ? E  DA  14  ? E DA  14   ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 "O3'" ? F  DC  15  ? F DC  15   ? 1_555 100.4 ? 
85  OP2   ? E  DG  15  ? E DG  15   ? 1_555 MN ? R MN . ? D MN 1191 ? 1_555 "O3'" ? F  DC  15  ? F DC  15   ? 1_555 102.5 ? 
86  OP1   ? H  DA  14  ? H DA  14   ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 O     ? G  ALA 116 ? G ALA 116  ? 1_555 174.7 ? 
87  OP1   ? H  DA  14  ? H DA  14   ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 OP3   ? L  DC  1   ? O DC  16   ? 1_555 94.9  ? 
88  O     ? G  ALA 116 ? G ALA 116  ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 OP3   ? L  DC  1   ? O DC  16   ? 1_555 83.9  ? 
89  OP1   ? H  DA  14  ? H DA  14   ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 OP2   ? L  DC  1   ? O DC  16   ? 1_555 89.0  ? 
90  O     ? G  ALA 116 ? G ALA 116  ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 OP2   ? L  DC  1   ? O DC  16   ? 1_555 85.9  ? 
91  OP3   ? L  DC  1   ? O DC  16   ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 OP2   ? L  DC  1   ? O DC  16   ? 1_555 63.4  ? 
92  OP1   ? H  DA  14  ? H DA  14   ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 O     ? BA HOH .   ? G HOH 2002 ? 1_555 96.3  ? 
93  O     ? G  ALA 116 ? G ALA 116  ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 O     ? BA HOH .   ? G HOH 2002 ? 1_555 82.7  ? 
94  OP3   ? L  DC  1   ? O DC  16   ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 O     ? BA HOH .   ? G HOH 2002 ? 1_555 153.8 ? 
95  OP2   ? L  DC  1   ? O DC  16   ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 O     ? BA HOH .   ? G HOH 2002 ? 1_555 93.2  ? 
96  OP1   ? H  DA  14  ? H DA  14   ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 OD2   ? G  ASP 21  ? G ASP 21   ? 1_555 89.4  ? 
97  O     ? G  ALA 116 ? G ALA 116  ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 OD2   ? G  ASP 21  ? G ASP 21   ? 1_555 95.7  ? 
98  OP3   ? L  DC  1   ? O DC  16   ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 OD2   ? G  ASP 21  ? G ASP 21   ? 1_555 119.0 ? 
99  OP2   ? L  DC  1   ? O DC  16   ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 OD2   ? G  ASP 21  ? G ASP 21   ? 1_555 177.3 ? 
100 O     ? BA HOH .   ? G HOH 2002 ? 1_555 MN ? S MN . ? G MN 1180 ? 1_555 OD2   ? G  ASP 21  ? G ASP 21   ? 1_555 84.8  ? 
101 O     ? BA HOH .   ? G HOH 2030 ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 O     ? G  GLY 20  ? G GLY 20   ? 1_555 105.2 ? 
102 O     ? BA HOH .   ? G HOH 2030 ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 OE2   ? G  GLU 117 ? G GLU 117  ? 1_555 158.9 ? 
103 O     ? G  GLY 20  ? G GLY 20   ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 OE2   ? G  GLU 117 ? G GLU 117  ? 1_555 88.1  ? 
104 O     ? BA HOH .   ? G HOH 2030 ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 OP1   ? I  DC  15  ? I DC  15   ? 1_555 82.3  ? 
105 O     ? G  GLY 20  ? G GLY 20   ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 OP1   ? I  DC  15  ? I DC  15   ? 1_555 171.9 ? 
106 OE2   ? G  GLU 117 ? G GLU 117  ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 OP1   ? I  DC  15  ? I DC  15   ? 1_555 85.5  ? 
107 O     ? BA HOH .   ? G HOH 2030 ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 O     ? BA HOH .   ? G HOH 2001 ? 1_555 73.0  ? 
108 O     ? G  GLY 20  ? G GLY 20   ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 O     ? BA HOH .   ? G HOH 2001 ? 1_555 93.0  ? 
109 OE2   ? G  GLU 117 ? G GLU 117  ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 O     ? BA HOH .   ? G HOH 2001 ? 1_555 123.4 ? 
110 OP1   ? I  DC  15  ? I DC  15   ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 O     ? BA HOH .   ? G HOH 2001 ? 1_555 86.4  ? 
111 O     ? BA HOH .   ? G HOH 2030 ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 OP2   ? H  DG  15  ? H DG  15   ? 1_555 69.4  ? 
112 O     ? G  GLY 20  ? G GLY 20   ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 OP2   ? H  DG  15  ? H DG  15   ? 1_555 86.0  ? 
113 OE2   ? G  GLU 117 ? G GLU 117  ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 OP2   ? H  DG  15  ? H DG  15   ? 1_555 95.9  ? 
114 OP1   ? I  DC  15  ? I DC  15   ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 OP2   ? H  DG  15  ? H DG  15   ? 1_555 99.6  ? 
115 O     ? BA HOH .   ? G HOH 2001 ? 1_555 MN ? T MN . ? G MN 1181 ? 1_555 OP2   ? H  DG  15  ? H DG  15   ? 1_555 140.7 ? 
116 OP3   ? L  DC  1   ? O DC  16   ? 1_555 MN ? U MN . ? G MN 1182 ? 1_555 OD1   ? G  ASP 21  ? G ASP 21   ? 1_555 74.6  ? 
117 OP3   ? L  DC  1   ? O DC  16   ? 1_555 MN ? U MN . ? G MN 1182 ? 1_555 "O3'" ? I  DC  15  ? I DC  15   ? 1_555 70.3  ? 
118 OD1   ? G  ASP 21  ? G ASP 21   ? 1_555 MN ? U MN . ? G MN 1182 ? 1_555 "O3'" ? I  DC  15  ? I DC  15   ? 1_555 144.5 ? 
119 OP3   ? L  DC  1   ? O DC  16   ? 1_555 MN ? U MN . ? G MN 1182 ? 1_555 "O3'" ? H  DA  14  ? H DA  14   ? 1_555 101.2 ? 
120 OD1   ? G  ASP 21  ? G ASP 21   ? 1_555 MN ? U MN . ? G MN 1182 ? 1_555 "O3'" ? H  DA  14  ? H DA  14   ? 1_555 88.3  ? 
121 "O3'" ? I  DC  15  ? I DC  15   ? 1_555 MN ? U MN . ? G MN 1182 ? 1_555 "O3'" ? H  DA  14  ? H DA  14   ? 1_555 103.6 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-12-17 
2 'Structure model' 1 1 2015-01-21 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE)' ? 1 
XDS    'data reduction' .                 ? 2 
SCALA  'data scaling'   .                 ? 3 
PHASER phasing          .                 ? 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O2  B DT  12  ? ? O   B HOH 2003 ? ? 2.08 
2 1 O   G LYS 172 ? ? OG1 G THR 176  ? ? 2.11 
3 1 NH1 D ARG 33  ? ? O6  E DG  21   ? ? 2.15 
4 1 NE2 D GLN 57  ? ? O   D HOH 2012 ? ? 2.16 
5 1 OP2 B DT  4   ? ? O   B HOH 2001 ? ? 2.19 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    NH2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    ARG 
_pdbx_validate_symm_contact.auth_seq_id_1     104 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OP1 
_pdbx_validate_symm_contact.auth_asym_id_2    E 
_pdbx_validate_symm_contact.auth_comp_id_2    DC 
_pdbx_validate_symm_contact.auth_seq_id_2     19 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_10410 
_pdbx_validate_symm_contact.dist              2.11 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "O3'" F DC 5  ? ? "C3'" F DC 5  ? ? 1.382 1.419 -0.037 0.006 N 
2 1 "O3'" H DT 12 ? ? "C3'" H DT 12 ? ? 1.376 1.419 -0.043 0.006 N 
3 1 "O3'" H DG 15 ? ? "C3'" H DG 15 ? ? 1.376 1.419 -0.043 0.006 N 
4 1 "O3'" H DT 16 ? ? "C3'" H DT 16 ? ? 1.382 1.419 -0.037 0.006 N 
5 1 "O3'" I DG 4  ? ? "C3'" I DG 4  ? ? 1.376 1.419 -0.043 0.006 N 
6 1 "O3'" I DC 5  ? ? "C3'" I DC 5  ? ? 1.373 1.419 -0.046 0.006 N 
7 1 P     K DC 16 ? ? OP3   K DC 16 ? ? 1.484 1.607 -0.123 0.012 N 
8 1 P     M DC 16 ? ? OP3   M DC 16 ? ? 1.490 1.607 -0.117 0.012 N 
9 1 P     O DC 16 ? ? OP3   O DC 16 ? ? 1.521 1.607 -0.086 0.012 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 "C3'" B DT 12 ? ? "C2'" B DT 12 ? ? "C1'" B DT 12 ? ? 97.59  102.40 -4.81  0.80 N 
2  1 "C3'" B DA 14 ? ? "O3'" B DA 14 ? ? P     B DG 15 ? ? 127.12 119.70 7.42   1.20 Y 
3  1 "O3'" B DA 14 ? ? P     B DG 15 ? ? OP1   B DG 15 ? ? 117.96 110.50 7.46   1.10 Y 
4  1 OP1   B DG 15 ? ? P     B DG 15 ? ? OP2   B DG 15 ? ? 107.01 119.60 -12.59 1.50 N 
5  1 "O4'" B DG 15 ? ? "C1'" B DG 15 ? ? N9    B DG 15 ? ? 110.13 108.30 1.83   0.30 N 
6  1 "O4'" E DT 5  ? ? "C1'" E DT 5  ? ? N1    E DT 5  ? ? 111.24 108.30 2.94   0.30 N 
7  1 OP1   E DG 15 ? ? P     E DG 15 ? ? OP2   E DG 15 ? ? 108.44 119.60 -11.16 1.50 N 
8  1 "O4'" E DG 20 ? ? "C1'" E DG 20 ? ? N9    E DG 20 ? ? 111.37 108.30 3.07   0.30 N 
9  1 "O4'" F DA 9  ? ? "C1'" F DA 9  ? ? N9    F DA 9  ? ? 110.20 108.30 1.90   0.30 N 
10 1 "O4'" H DC 19 ? ? "C1'" H DC 19 ? ? N1    H DC 19 ? ? 110.15 108.30 1.85   0.30 N 
11 1 "O4'" H DG 21 ? ? "C1'" H DG 21 ? ? N9    H DG 21 ? ? 111.16 108.30 2.86   0.30 N 
12 1 "O4'" I DA 9  ? ? "C1'" I DA 9  ? ? N9    I DA 9  ? ? 111.54 108.30 3.24   0.30 N 
13 1 "O4'" K DG 18 ? ? "C1'" K DG 18 ? ? N9    K DG 18 ? ? 111.33 108.30 3.03   0.30 N 
14 1 "O4'" M DG 18 ? ? "C1'" M DG 18 ? ? N9    M DG 18 ? ? 111.97 108.30 3.67   0.30 N 
15 1 "O4'" O DG 18 ? ? "C1'" O DG 18 ? ? N9    O DG 18 ? ? 112.56 108.30 4.26   0.30 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 32  ? ? 58.02   15.04  
2  1 GLN A 42  ? ? -170.45 144.76 
3  1 ASP A 75  ? ? -20.75  -79.48 
4  1 ARG A 77  ? ? -179.25 147.09 
5  1 SER A 84  ? ? -169.25 114.73 
6  1 LEU A 122 ? ? 57.62   -0.13  
7  1 ASN A 129 ? ? -170.90 142.19 
8  1 SER A 179 ? ? -103.66 54.78  
9  1 ASN A 183 ? ? 24.26   81.53  
10 1 GLN D 42  ? ? -171.83 142.99 
11 1 LEU D 122 ? ? 58.21   -1.84  
12 1 HIS D 181 ? ? -84.65  30.82  
13 1 ARG G 77  ? ? -176.44 149.60 
14 1 SER G 84  ? ? -163.41 111.12 
15 1 LEU G 122 ? ? 52.34   0.34   
16 1 ILE G 177 ? ? -101.01 -64.71 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A PRO 187 ? CG ? A PRO 187 CG 
2 1 Y 1 A PRO 187 ? CD ? A PRO 187 CD 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 1   ? A ALA 1   
2  1 Y 1 A HIS 2   ? A HIS 2   
3  1 Y 1 A ASN 3   ? A ASN 3   
4  1 Y 1 A GLU 188 ? A GLU 188 
5  1 Y 1 A ALA 189 ? A ALA 189 
6  1 Y 1 A ALA 190 ? A ALA 190 
7  1 Y 1 A ALA 191 ? A ALA 191 
8  1 Y 1 A LEU 192 ? A LEU 192 
9  1 Y 1 A GLU 193 ? A GLU 193 
10 1 Y 1 A HIS 194 ? A HIS 194 
11 1 Y 1 A HIS 195 ? A HIS 195 
12 1 Y 1 A HIS 196 ? A HIS 196 
13 1 Y 1 A HIS 197 ? A HIS 197 
14 1 Y 1 A HIS 198 ? A HIS 198 
15 1 Y 1 A HIS 199 ? A HIS 199 
16 1 Y 1 D ALA 1   ? D ALA 1   
17 1 Y 1 D HIS 2   ? D HIS 2   
18 1 Y 1 D ASN 3   ? D ASN 3   
19 1 Y 1 D GLU 188 ? D GLU 188 
20 1 Y 1 D ALA 189 ? D ALA 189 
21 1 Y 1 D ALA 190 ? D ALA 190 
22 1 Y 1 D ALA 191 ? D ALA 191 
23 1 Y 1 D LEU 192 ? D LEU 192 
24 1 Y 1 D GLU 193 ? D GLU 193 
25 1 Y 1 D HIS 194 ? D HIS 194 
26 1 Y 1 D HIS 195 ? D HIS 195 
27 1 Y 1 D HIS 196 ? D HIS 196 
28 1 Y 1 D HIS 197 ? D HIS 197 
29 1 Y 1 D HIS 198 ? D HIS 198 
30 1 Y 1 D HIS 199 ? D HIS 199 
31 1 Y 1 G ALA 1   ? G ALA 1   
32 1 Y 1 G HIS 2   ? G HIS 2   
33 1 Y 1 G ASN 3   ? G ASN 3   
34 1 Y 1 G SER 180 ? G SER 180 
35 1 Y 1 G HIS 181 ? G HIS 181 
36 1 Y 1 G LEU 182 ? G LEU 182 
37 1 Y 1 G ASN 183 ? G ASN 183 
38 1 Y 1 G PRO 184 ? G PRO 184 
39 1 Y 1 G LEU 185 ? G LEU 185 
40 1 Y 1 G PRO 186 ? G PRO 186 
41 1 Y 1 G PRO 187 ? G PRO 187 
42 1 Y 1 G GLU 188 ? G GLU 188 
43 1 Y 1 G ALA 189 ? G ALA 189 
44 1 Y 1 G ALA 190 ? G ALA 190 
45 1 Y 1 G ALA 191 ? G ALA 191 
46 1 Y 1 G LEU 192 ? G LEU 192 
47 1 Y 1 G GLU 193 ? G GLU 193 
48 1 Y 1 G HIS 194 ? G HIS 194 
49 1 Y 1 G HIS 195 ? G HIS 195 
50 1 Y 1 G HIS 196 ? G HIS 196 
51 1 Y 1 G HIS 197 ? G HIS 197 
52 1 Y 1 G HIS 198 ? G HIS 198 
53 1 Y 1 G HIS 199 ? G HIS 199 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4UNA 'double helix'        
4UNA 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 J DC 10 1_555 0.096  -0.163 -0.278 -1.517  -8.805  -0.356 1  B_DG1:DC25_K  B 1  ? K 25 ? 19 1 
1 B DC 2  1_555 J DG 9  1_555 0.256  -0.304 -0.097 4.218   -5.470  2.757  2  B_DC2:DG24_K  B 2  ? K 24 ? 19 1 
1 B DC 3  1_555 J DG 8  1_555 -0.537 -0.072 -0.022 3.053   -5.773  -2.124 3  B_DC3:DG23_K  B 3  ? K 23 ? 19 1 
1 B DT 4  1_555 J DA 7  1_555 -0.302 -0.175 0.412  -9.369  -15.342 -3.293 4  B_DT4:DA22_K  B 4  ? K 22 ? 20 1 
1 B DT 5  1_555 J DA 6  1_555 0.150  0.092  0.109  -7.103  -3.602  3.846  5  B_DT5:DA21_K  B 5  ? K 21 ? 20 1 
1 B DG 6  1_555 J DC 5  1_555 -0.527 -0.210 0.466  0.672   -6.843  -3.094 6  B_DG6:DC20_K  B 6  ? K 20 ? 19 1 
1 B DC 7  1_555 J DG 4  1_555 0.232  -0.443 0.332  -8.084  -1.927  -3.935 7  B_DC7:DG19_K  B 7  ? K 19 ? 19 1 
1 B DC 8  1_555 J DG 3  1_555 0.145  -0.142 0.027  -1.353  -1.156  6.577  8  B_DC8:DG18_K  B 8  ? K 18 ? 19 1 
1 B DG 9  1_555 J DC 2  1_555 -0.047 -0.141 0.242  5.523   -4.247  1.137  9  B_DG9:DC17_K  B 9  ? K 17 ? 19 1 
1 B DG 10 1_555 J DC 1  1_555 -0.272 -0.302 -0.228 -3.771  -12.650 -0.423 10 B_DG10:DC16_K B 10 ? K 16 ? 19 1 
1 B DG 11 1_555 C DC 15 1_555 0.194  -0.228 0.583  17.460  -14.754 0.664  11 B_DG11:DC15_C B 11 ? C 15 ? 19 1 
1 B DT 12 1_555 C DA 14 1_555 -0.376 -0.105 0.224  16.806  -33.679 -4.882 12 B_DT12:DA14_C B 12 ? C 14 ? 20 1 
1 B DA 13 1_555 C DT 13 1_555 0.070  -0.506 0.288  0.208   -7.281  -1.312 13 B_DA13:DT13_C B 13 ? C 13 ? 20 1 
1 B DA 14 1_555 C DT 12 1_555 0.697  -0.458 0.030  -5.962  -12.644 1.134  14 B_DA14:DT12_C B 14 ? C 12 ? 20 1 
1 B DG 15 1_555 C DC 11 1_555 -0.777 -0.177 -0.011 -6.456  -15.234 3.389  15 B_DG15:DC11_C B 15 ? C 11 ? 19 1 
1 B DT 16 1_555 C DA 10 1_555 -0.211 -0.050 0.561  -13.979 -7.825  1.681  16 B_DT16:DA10_C B 16 ? C 10 ? 20 1 
1 B DT 17 1_555 C DA 9  1_555 -0.430 -0.108 -0.083 -7.271  4.190   4.425  17 B_DT17:DA9_C  B 17 ? C 9  ? 20 1 
1 B DC 18 1_555 C DG 8  1_555 0.648  -0.388 0.245  -1.788  -17.745 4.795  18 B_DC18:DG8_C  B 18 ? C 8  ? 19 1 
1 B DC 19 1_555 C DG 7  1_555 0.237  -0.454 0.294  -7.064  -3.245  1.730  19 B_DC19:DG7_C  B 19 ? C 7  ? 19 1 
1 B DG 20 1_555 C DC 6  1_555 -0.199 -0.544 0.172  10.367  -3.031  -2.168 20 B_DG20:DC6_C  B 20 ? C 6  ? 19 1 
1 B DG 21 1_555 C DC 5  1_555 -0.457 -0.243 0.247  -0.441  -9.028  -1.656 21 B_DG21:DC5_C  B 21 ? C 5  ? 19 1 
1 B DC 22 1_555 C DG 4  1_555 0.411  -0.244 0.192  -4.041  -1.345  -0.229 22 B_DC22:DG4_C  B 22 ? C 4  ? 19 1 
1 B DG 23 1_555 C DC 3  1_555 -0.065 -0.290 0.102  -1.112  -0.737  0.174  23 B_DG23:DC3_C  B 23 ? C 3  ? 19 1 
1 B DC 24 1_555 C DG 2  1_555 -0.037 -0.309 -0.092 3.064   -2.145  -0.916 24 B_DC24:DG2_C  B 24 ? C 2  ? 19 1 
1 B DG 25 1_555 C DC 1  1_555 -0.044 -0.359 0.212  12.547  8.062   -2.482 25 B_DG25:DC1_C  B 25 ? C 1  ? 19 1 
1 E DG 1  1_555 K DC 10 1_555 0.205  0.150  0.116  -0.539  -10.711 5.280  26 E_DG1:DC25_M  E 1  ? M 25 ? 19 1 
1 E DC 2  1_555 K DG 9  1_555 0.181  -0.475 0.161  2.306   -12.104 -7.023 27 E_DC2:DG24_M  E 2  ? M 24 ? 19 1 
1 E DC 3  1_555 K DG 8  1_555 -0.233 -0.390 0.420  5.730   -12.204 -0.441 28 E_DC3:DG23_M  E 3  ? M 23 ? 19 1 
1 E DT 4  1_555 K DA 7  1_555 -0.541 -0.034 0.611  -8.012  -18.774 -5.954 29 E_DT4:DA22_M  E 4  ? M 22 ? 20 1 
1 E DT 5  1_555 K DA 6  1_555 0.295  0.045  0.137  -8.044  -10.256 5.396  30 E_DT5:DA21_M  E 5  ? M 21 ? 20 1 
1 E DG 6  1_555 K DC 5  1_555 -0.310 -0.013 0.174  -3.333  -10.222 0.637  31 E_DG6:DC20_M  E 6  ? M 20 ? 19 1 
1 E DC 7  1_555 K DG 4  1_555 -0.470 -0.303 0.217  -1.641  -7.101  -4.639 32 E_DC7:DG19_M  E 7  ? M 19 ? 19 1 
1 E DC 8  1_555 K DG 3  1_555 0.004  -0.297 -0.120 -2.643  -4.156  -0.004 33 E_DC8:DG18_M  E 8  ? M 18 ? 19 1 
1 E DG 9  1_555 K DC 2  1_555 -0.313 -0.329 -0.200 1.948   -6.906  -1.059 34 E_DG9:DC17_M  E 9  ? M 17 ? 19 1 
1 E DG 10 1_555 K DC 1  1_555 -0.097 -0.001 0.123  3.187   -12.714 0.100  35 E_DG10:DC16_M E 10 ? M 16 ? 19 1 
1 E DG 11 1_555 F DC 15 1_555 0.077  -0.274 0.469  17.527  -17.540 0.196  36 E_DG11:DC15_F E 11 ? F 15 ? 19 1 
1 E DT 12 1_555 F DA 14 1_555 0.036  -0.147 0.414  12.153  -30.401 -2.353 37 E_DT12:DA14_F E 12 ? F 14 ? 20 1 
1 E DA 13 1_555 F DT 13 1_555 0.113  -0.271 0.232  -5.959  -9.325  4.504  38 E_DA13:DT13_F E 13 ? F 13 ? 20 1 
1 E DA 14 1_555 F DT 12 1_555 0.338  -0.219 0.189  -12.598 -14.084 -2.485 39 E_DA14:DT12_F E 14 ? F 12 ? 20 1 
1 E DG 15 1_555 F DC 11 1_555 -0.301 -0.120 0.055  -14.141 -15.740 4.765  40 E_DG15:DC11_F E 15 ? F 11 ? 19 1 
1 E DT 16 1_555 F DA 10 1_555 0.066  -0.189 0.371  -9.232  -11.631 -1.619 41 E_DT16:DA10_F E 16 ? F 10 ? 20 1 
1 E DT 17 1_555 F DA 9  1_555 -0.245 -0.077 -0.095 -6.189  2.529   -0.657 42 E_DT17:DA9_F  E 17 ? F 9  ? 20 1 
1 E DC 18 1_555 F DG 8  1_555 0.488  -0.273 0.070  0.091   -16.542 1.152  43 E_DC18:DG8_F  E 18 ? F 8  ? 19 1 
1 E DC 19 1_555 F DG 7  1_555 0.249  -0.502 0.224  -6.648  -2.830  -0.349 44 E_DC19:DG7_F  E 19 ? F 7  ? 19 1 
1 E DG 20 1_555 F DC 6  1_555 -0.206 -0.494 -0.012 8.358   -3.278  -4.750 45 E_DG20:DC6_F  E 20 ? F 6  ? 19 1 
1 E DG 21 1_555 F DC 5  1_555 -0.403 -0.142 0.042  -5.520  -14.848 0.703  46 E_DG21:DC5_F  E 21 ? F 5  ? 19 1 
1 E DC 22 1_555 F DG 4  1_555 0.261  -0.187 0.070  -1.931  -7.263  0.805  47 E_DC22:DG4_F  E 22 ? F 4  ? 19 1 
1 E DG 23 1_555 F DC 3  1_555 -0.382 -0.202 -0.132 -0.617  2.213   4.264  48 E_DG23:DC3_F  E 23 ? F 3  ? 19 1 
1 E DC 24 1_555 F DG 2  1_555 0.275  -0.277 -0.304 7.609   -5.004  1.854  49 E_DC24:DG2_F  E 24 ? F 2  ? 19 1 
1 E DG 25 1_555 F DC 1  1_555 0.010  -0.333 0.177  12.184  4.923   -1.980 50 E_DG25:DC1_F  E 25 ? F 1  ? 19 1 
1 H DG 1  1_555 L DC 10 1_555 0.164  0.213  0.179  6.773   -3.161  -2.416 51 H_DG1:DC25_O  H 1  ? O 25 ? 19 1 
1 H DC 2  1_555 L DG 9  1_555 0.305  0.002  0.186  5.250   -7.699  4.363  52 H_DC2:DG24_O  H 2  ? O 24 ? 19 1 
1 H DC 3  1_555 L DG 8  1_555 0.017  -0.308 0.353  1.304   -6.875  -2.064 53 H_DC3:DG23_O  H 3  ? O 23 ? 19 1 
1 H DT 4  1_555 L DA 7  1_555 -0.391 -0.132 0.626  -7.963  -9.270  1.113  54 H_DT4:DA22_O  H 4  ? O 22 ? 20 1 
1 H DT 5  1_555 L DA 6  1_555 -0.082 -0.231 0.145  -5.363  -7.728  0.957  55 H_DT5:DA21_O  H 5  ? O 21 ? 20 1 
1 H DG 6  1_555 L DC 5  1_555 -0.424 -0.138 -0.127 -7.129  -8.196  2.688  56 H_DG6:DC20_O  H 6  ? O 20 ? 19 1 
1 H DC 7  1_555 L DG 4  1_555 0.026  -0.144 0.224  -11.372 -5.432  -1.813 57 H_DC7:DG19_O  H 7  ? O 19 ? 19 1 
1 H DC 8  1_555 L DG 3  1_555 0.227  -0.174 -0.054 -0.478  -4.480  3.533  58 H_DC8:DG18_O  H 8  ? O 18 ? 19 1 
1 H DG 9  1_555 L DC 2  1_555 -0.059 -0.137 0.217  5.073   -4.112  1.849  59 H_DG9:DC17_O  H 9  ? O 17 ? 19 1 
1 H DG 10 1_555 L DC 1  1_555 -0.088 -0.061 -0.236 -1.168  -12.339 -0.421 60 H_DG10:DC16_O H 10 ? O 16 ? 19 1 
1 H DG 11 1_555 I DC 15 1_555 -0.072 -0.119 0.527  19.717  -13.824 1.785  61 H_DG11:DC15_I H 11 ? I 15 ? 19 1 
1 H DT 12 1_555 I DA 14 1_555 -0.382 -0.052 0.603  10.217  -30.398 -2.188 62 H_DT12:DA14_I H 12 ? I 14 ? 20 1 
1 H DA 13 1_555 I DT 13 1_555 0.002  -0.364 0.231  -1.639  -8.808  -0.227 63 H_DA13:DT13_I H 13 ? I 13 ? 20 1 
1 H DA 14 1_555 I DT 12 1_555 0.092  -0.191 -0.137 -17.225 -13.297 1.854  64 H_DA14:DT12_I H 14 ? I 12 ? 20 1 
1 H DG 15 1_555 I DC 11 1_555 -0.779 -0.160 0.257  -6.991  -9.787  3.677  65 H_DG15:DC11_I H 15 ? I 11 ? 19 1 
1 H DT 16 1_555 I DA 10 1_555 -0.314 -0.102 0.127  -11.109 -8.251  -0.917 66 H_DT16:DA10_I H 16 ? I 10 ? 20 1 
1 H DT 17 1_555 I DA 9  1_555 -0.447 -0.181 0.071  -10.281 2.729   -0.381 67 H_DT17:DA9_I  H 17 ? I 9  ? 20 1 
1 H DC 18 1_555 I DG 8  1_555 0.375  -0.329 0.067  -2.053  -13.480 1.932  68 H_DC18:DG8_I  H 18 ? I 8  ? 19 1 
1 H DC 19 1_555 I DG 7  1_555 0.047  -0.295 0.007  -4.107  -4.964  -1.213 69 H_DC19:DG7_I  H 19 ? I 7  ? 19 1 
1 H DG 20 1_555 I DC 6  1_555 -0.042 -0.101 0.124  13.472  -1.924  -3.282 70 H_DG20:DC6_I  H 20 ? I 6  ? 19 1 
1 H DG 21 1_555 I DC 5  1_555 -0.471 -0.277 0.143  -4.187  -8.676  -2.425 71 H_DG21:DC5_I  H 21 ? I 5  ? 19 1 
1 H DC 22 1_555 I DG 4  1_555 0.276  -0.281 -0.184 0.867   -6.606  -0.418 72 H_DC22:DG4_I  H 22 ? I 4  ? 19 1 
1 H DG 23 1_555 I DC 3  1_555 -0.346 -0.372 -0.069 2.440   -1.053  1.785  73 H_DG23:DC3_I  H 23 ? I 3  ? 19 1 
1 H DC 24 1_555 I DG 2  1_555 0.675  -0.308 -0.011 -2.519  -6.580  7.680  74 H_DC24:DG2_I  H 24 ? I 2  ? 19 1 
1 H DG 25 1_555 I DC 1  1_555 -0.476 -0.286 -0.080 13.123  7.611   -2.082 75 H_DG25:DC1_I  H 25 ? I 1  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1  1_555 J DC 10 1_555 B DC 2  1_555 J DG 9  1_555 0.620  -0.057 3.050 -1.667 4.324   29.958 -0.916 -1.497 2.974 8.301   
3.200   30.306 1  BB_DG1DC2:DG24DC25_KK   B 1  ? K 25 ? B 2  ? K 24 ? 
1 B DC 2  1_555 J DG 9  1_555 B DC 3  1_555 J DG 8  1_555 0.236  -0.255 3.385 2.726  1.989   31.868 -0.834 0.081  3.372 3.610   
-4.947  32.041 2  BB_DC2DC3:DG23DG24_KK   B 2  ? K 24 ? B 3  ? K 23 ? 
1 B DC 3  1_555 J DG 8  1_555 B DT 4  1_555 J DA 7  1_555 -0.005 -0.773 3.605 -0.324 5.605   31.564 -2.493 -0.054 3.420 10.203  
0.591   32.047 3  BB_DC3DT4:DA22DG23_KK   B 3  ? K 23 ? B 4  ? K 22 ? 
1 B DT 4  1_555 J DA 7  1_555 B DT 5  1_555 J DA 6  1_555 1.083  0.158  3.317 4.257  2.563   38.744 -0.083 -1.091 3.416 3.843   
-6.385  39.049 4  BB_DT4DT5:DA21DA22_KK   B 4  ? K 22 ? B 5  ? K 21 ? 
1 B DT 5  1_555 J DA 6  1_555 B DG 6  1_555 J DC 5  1_555 -1.068 0.216  3.081 -8.726 1.175   34.299 0.185  0.491  3.252 1.953   
14.502  35.379 5  BB_DT5DG6:DC20DA21_KK   B 5  ? K 21 ? B 6  ? K 20 ? 
1 B DG 6  1_555 J DC 5  1_555 B DC 7  1_555 J DG 4  1_555 0.230  -1.108 3.511 1.138  -0.977  36.156 -1.636 -0.197 3.544 -1.574  
-1.832  36.186 6  BB_DG6DC7:DG19DC20_KK   B 6  ? K 20 ? B 7  ? K 19 ? 
1 B DC 7  1_555 J DG 4  1_555 B DC 8  1_555 J DG 3  1_555 1.022  0.283  3.168 6.540  8.506   32.999 -0.846 -0.699 3.276 14.504  
-11.153 34.654 7  BB_DC7DC8:DG18DG19_KK   B 7  ? K 19 ? B 8  ? K 18 ? 
1 B DC 8  1_555 J DG 3  1_555 B DG 9  1_555 J DC 2  1_555 -1.324 0.503  3.156 -5.582 8.635   30.072 -0.705 1.371  3.355 16.063  
10.383  31.743 8  BB_DC8DG9:DC17DG18_KK   B 8  ? K 18 ? B 9  ? K 17 ? 
1 B DG 9  1_555 J DC 2  1_555 B DG 10 1_555 J DC 1  1_555 -0.845 -0.526 3.482 0.334  7.258   36.185 -1.862 1.383  3.311 11.543  
-0.532  36.884 9  BB_DG9DG10:DC16DC17_KK  B 9  ? K 17 ? B 10 ? K 16 ? 
1 B DG 10 1_555 J DC 1  1_555 B DG 11 1_555 C DC 15 1_555 0.361  0.319  2.829 -6.890 5.589   31.980 -0.251 -1.633 2.711 9.909   
12.215  33.157 10 BB_DG10DG11:DC15DC16_CK B 10 ? K 16 ? B 11 ? C 15 ? 
1 B DG 11 1_555 C DC 15 1_555 B DT 12 1_555 C DA 14 1_555 -1.008 0.719  3.636 2.924  -19.848 36.703 3.226  1.744  2.820 -29.016 
-4.275  41.662 11 BB_DG11DT12:DA14DC15_CC B 11 ? C 15 ? B 12 ? C 14 ? 
1 B DT 12 1_555 C DA 14 1_555 B DA 13 1_555 C DT 13 1_555 1.046  1.938  3.894 0.623  -19.811 51.521 3.397  -1.093 3.028 -21.890 
-0.688  54.958 12 BB_DT12DA13:DT13DA14_CC B 12 ? C 14 ? B 13 ? C 13 ? 
1 B DA 13 1_555 C DT 13 1_555 B DA 14 1_555 C DT 12 1_555 0.554  -0.630 3.679 1.011  -3.854  35.329 -0.392 -0.739 3.738 -6.326  
-1.659  35.546 13 BB_DA13DA14:DT12DT13_CC B 13 ? C 13 ? B 14 ? C 12 ? 
1 B DA 14 1_555 C DT 12 1_555 B DG 15 1_555 C DC 11 1_555 -0.006 -0.551 3.523 2.088  4.430   27.206 -2.300 0.552  3.382 9.322   
-4.394  27.635 14 BB_DA14DG15:DC11DT12_CC B 14 ? C 12 ? B 15 ? C 11 ? 
1 B DG 15 1_555 C DC 11 1_555 B DT 16 1_555 C DA 10 1_555 -0.627 -0.807 3.635 -2.702 3.773   35.888 -1.886 0.589  3.571 6.091   
4.363   36.177 15 BB_DG15DT16:DA10DC11_CC B 15 ? C 11 ? B 16 ? C 10 ? 
1 B DT 16 1_555 C DA 10 1_555 B DT 17 1_555 C DA 9  1_555 0.809  0.328  3.222 5.929  -3.750  36.579 1.012  -0.479 3.261 -5.908  
-9.341  37.223 16 BB_DT16DT17:DA9DA10_CC  B 16 ? C 10 ? B 17 ? C 9  ? 
1 B DT 17 1_555 C DA 9  1_555 B DC 18 1_555 C DG 8  1_555 -0.532 0.129  3.685 -6.150 -8.949  37.987 1.393  -0.038 3.605 -13.416 
9.220   39.453 17 BB_DT17DC18:DG8DA9_CC   B 17 ? C 9  ? B 18 ? C 8  ? 
1 B DC 18 1_555 C DG 8  1_555 B DC 19 1_555 C DG 7  1_555 -0.436 -1.399 3.387 0.963  4.484   26.216 -4.214 1.198  3.091 9.789   
-2.102  26.607 18 BB_DC18DC19:DG7DG8_CC   B 18 ? C 8  ? B 19 ? C 7  ? 
1 B DC 19 1_555 C DG 7  1_555 B DG 20 1_555 C DC 6  1_555 0.028  -0.459 2.879 2.421  10.343  27.863 -2.746 0.380  2.543 20.558  
-4.812  29.781 19 BB_DC19DG20:DC6DG7_CC   B 19 ? C 7  ? B 20 ? C 6  ? 
1 B DG 20 1_555 C DC 6  1_555 B DG 21 1_555 C DC 5  1_555 0.725  -1.825 3.452 0.193  -1.293  28.337 -3.405 -1.432 3.535 -2.640  
-0.395  28.366 20 BB_DG20DG21:DC5DC6_CC   B 20 ? C 6  ? B 21 ? C 5  ? 
1 B DG 21 1_555 C DC 5  1_555 B DC 22 1_555 C DG 4  1_555 0.461  -0.998 3.377 3.010  4.341   41.944 -1.840 -0.325 3.287 6.036   
-4.185  42.260 21 BB_DG21DC22:DG4DC5_CC   B 21 ? C 5  ? B 22 ? C 4  ? 
1 B DC 22 1_555 C DG 4  1_555 B DG 23 1_555 C DC 3  1_555 -0.189 -0.960 3.270 -2.435 -1.731  35.507 -1.316 -0.047 3.317 -2.833  
3.985   35.628 22 BB_DC22DG23:DC3DG4_CC   B 22 ? C 4  ? B 23 ? C 3  ? 
1 B DG 23 1_555 C DC 3  1_555 B DC 24 1_555 C DG 2  1_555 -0.384 -0.564 3.202 1.177  5.287   23.911 -2.896 1.254  2.987 12.556  
-2.795  24.508 23 BB_DG23DC24:DG2DC3_CC   B 23 ? C 3  ? B 24 ? C 2  ? 
1 B DC 24 1_555 C DG 2  1_555 B DG 25 1_555 C DC 1  1_555 -0.779 0.340  3.113 -3.947 10.087  35.296 -0.803 0.707  3.155 16.172  
6.328   36.871 24 BB_DC24DG25:DC1DG2_CC   B 24 ? C 2  ? B 25 ? C 1  ? 
1 E DG 1  1_555 K DC 10 1_555 E DC 2  1_555 K DG 9  1_555 -0.424 -0.253 3.186 -1.760 2.009   34.246 -0.735 0.449  3.184 3.405   
2.984   34.347 25 EE_DG1DC2:DG24DC25_MM   E 1  ? M 25 ? E 2  ? M 24 ? 
1 E DC 2  1_555 K DG 9  1_555 E DC 3  1_555 K DG 8  1_555 0.502  -0.484 3.139 0.809  6.219   32.679 -1.831 -0.749 3.009 10.927  
-1.421  33.260 26 EE_DC2DC3:DG23DG24_MM   E 2  ? M 24 ? E 3  ? M 23 ? 
1 E DC 3  1_555 K DG 8  1_555 E DT 4  1_555 K DA 7  1_555 -0.300 -0.354 3.566 0.458  2.562   33.189 -1.081 0.606  3.525 4.477   
-0.799  33.288 27 EE_DC3DT4:DA22DG23_MM   E 3  ? M 23 ? E 4  ? M 22 ? 
1 E DT 4  1_555 K DA 7  1_555 E DT 5  1_555 K DA 6  1_555 1.391  0.372  3.368 6.757  1.910   38.988 0.310  -1.208 3.564 2.834   
-10.026 39.591 28 EE_DT4DT5:DA21DA22_MM   E 4  ? M 22 ? E 5  ? M 21 ? 
1 E DT 5  1_555 K DA 6  1_555 E DG 6  1_555 K DC 5  1_555 -1.234 0.472  3.088 -5.744 2.780   35.191 0.377  1.198  3.269 4.551   
9.405   35.747 29 EE_DT5DG6:DC20DA21_MM   E 5  ? M 21 ? E 6  ? M 20 ? 
1 E DG 6  1_555 K DC 5  1_555 E DC 7  1_555 K DG 4  1_555 0.102  -0.787 3.270 -1.128 1.043   30.506 -1.701 -0.416 3.237 1.981   
2.142   30.544 30 EE_DG6DC7:DG19DC20_MM   E 6  ? M 20 ? E 7  ? M 19 ? 
1 E DC 7  1_555 K DG 4  1_555 E DC 8  1_555 K DG 3  1_555 0.721  -0.331 3.243 4.124  9.231   38.341 -1.562 -0.585 3.142 13.765  
-6.149  39.604 31 EE_DC7DC8:DG18DG19_MM   E 7  ? M 19 ? E 8  ? M 18 ? 
1 E DC 8  1_555 K DG 3  1_555 E DG 9  1_555 K DC 2  1_555 -1.164 0.481  3.201 -2.653 8.862   28.264 -0.957 1.702  3.291 17.562  
5.258   29.710 32 EE_DC8DG9:DC17DG18_MM   E 8  ? M 18 ? E 9  ? M 17 ? 
1 E DG 9  1_555 K DC 2  1_555 E DG 10 1_555 K DC 1  1_555 -0.459 -0.201 3.290 -3.984 2.809   37.773 -0.669 0.192  3.297 4.317   
6.123   38.075 33 EE_DG9DG10:DC16DC17_MM  E 9  ? M 17 ? E 10 ? M 16 ? 
1 E DG 10 1_555 K DC 1  1_555 E DG 11 1_555 F DC 15 1_555 0.297  0.245  2.973 -2.893 10.766  31.600 -1.208 -0.955 2.864 19.043  
5.118   33.461 34 EE_DG10DG11:DC15DC16_FM E 10 ? M 16 ? E 11 ? F 15 ? 
1 E DG 11 1_555 F DC 15 1_555 E DT 12 1_555 F DA 14 1_555 -0.975 0.817  3.705 -0.747 -19.803 39.590 3.114  1.223  3.006 -27.266 
1.028   44.094 35 EE_DG11DT12:DA14DC15_FF E 11 ? F 15 ? E 12 ? F 14 ? 
1 E DT 12 1_555 F DA 14 1_555 E DA 13 1_555 F DT 13 1_555 0.914  2.077  3.876 2.706  -18.675 50.145 3.606  -0.830 3.022 -21.191 
-3.071  53.362 36 EE_DT12DA13:DT13DA14_FF E 12 ? F 14 ? E 13 ? F 13 ? 
1 E DA 13 1_555 F DT 13 1_555 E DA 14 1_555 F DT 12 1_555 0.195  -0.519 3.672 -1.804 -2.890  33.056 -0.362 -0.681 3.687 -5.062  
3.160   33.227 37 EE_DA13DA14:DT12DT13_FF E 13 ? F 13 ? E 14 ? F 12 ? 
1 E DA 14 1_555 F DT 12 1_555 E DG 15 1_555 F DC 11 1_555 0.186  -0.325 3.661 0.592  5.981   31.866 -1.752 -0.218 3.545 10.774  
-1.067  32.413 38 EE_DA14DG15:DC11DT12_FF E 14 ? F 12 ? E 15 ? F 11 ? 
1 E DG 15 1_555 F DC 11 1_555 E DT 16 1_555 F DA 10 1_555 -0.701 -0.676 3.285 -2.074 2.096   35.399 -1.416 0.844  3.275 3.439   
3.403   35.518 39 EE_DG15DT16:DA10DC11_FF E 15 ? F 11 ? E 16 ? F 10 ? 
1 E DT 16 1_555 F DA 10 1_555 E DT 17 1_555 F DA 9  1_555 0.669  0.436  3.400 3.645  -1.932  35.548 1.000  -0.539 3.422 -3.151  
-5.946  35.778 40 EE_DT16DT17:DA9DA10_FF  E 16 ? F 10 ? E 17 ? F 9  ? 
1 E DT 17 1_555 F DA 9  1_555 E DC 18 1_555 F DG 8  1_555 -0.575 -0.127 3.695 -5.037 -13.243 33.973 1.885  0.119  3.547 -21.539 
8.192   36.729 41 EE_DT17DC18:DG8DA9_FF   E 17 ? F 9  ? E 18 ? F 8  ? 
1 E DC 18 1_555 F DG 8  1_555 E DC 19 1_555 F DG 7  1_555 0.002  -1.444 3.506 0.376  6.179   30.673 -3.882 0.069  3.162 11.533  
-0.702  31.277 42 EE_DC18DC19:DG7DG8_FF   E 18 ? F 8  ? E 19 ? F 7  ? 
1 E DC 19 1_555 F DG 7  1_555 E DG 20 1_555 F DC 6  1_555 0.083  -0.701 2.928 4.148  11.830  27.396 -3.426 0.568  2.413 23.481  
-8.233  30.078 43 EE_DC19DG20:DC6DG7_FF   E 19 ? F 7  ? E 20 ? F 6  ? 
1 E DG 20 1_555 F DC 6  1_555 E DG 21 1_555 F DC 5  1_555 0.670  -1.682 3.672 1.572  -0.218  30.461 -3.149 -0.920 3.713 -0.415  
-2.988  30.502 44 EE_DG20DG21:DC5DC6_FF   E 20 ? F 6  ? E 21 ? F 5  ? 
1 E DG 21 1_555 F DC 5  1_555 E DC 22 1_555 F DG 4  1_555 0.675  -0.806 3.158 4.026  6.654   39.960 -1.865 -0.544 3.042 9.626   
-5.825  40.679 45 EE_DG21DC22:DG4DC5_FF   E 21 ? F 5  ? E 22 ? F 4  ? 
1 E DC 22 1_555 F DG 4  1_555 E DG 23 1_555 F DC 3  1_555 -0.001 -0.517 3.393 -0.471 1.810   30.520 -1.351 -0.094 3.358 3.434   
0.893   30.576 46 EE_DC22DG23:DC3DG4_FF   E 22 ? F 4  ? E 23 ? F 3  ? 
1 E DG 23 1_555 F DC 3  1_555 E DC 24 1_555 F DG 2  1_555 -0.334 -0.548 3.107 1.297  5.241   30.939 -1.932 0.845  2.960 9.731   
-2.409  31.395 47 EE_DG23DC24:DG2DC3_FF   E 23 ? F 3  ? E 24 ? F 2  ? 
1 E DC 24 1_555 F DG 2  1_555 E DG 25 1_555 F DC 1  1_555 -0.569 0.130  3.194 -4.462 9.131   36.103 -0.988 0.305  3.178 14.385  
7.029   37.460 48 EE_DC24DG25:DC1DG2_FF   E 24 ? F 2  ? E 25 ? F 1  ? 
1 H DG 1  1_555 L DC 10 1_555 H DC 2  1_555 L DG 9  1_555 0.633  -0.153 3.323 -0.550 1.335   35.199 -0.454 -1.129 3.305 2.206   
0.909   35.227 49 HH_DG1DC2:DG24DC25_OO   H 1  ? O 25 ? H 2  ? O 24 ? 
1 H DC 2  1_555 L DG 9  1_555 H DC 3  1_555 L DG 8  1_555 -0.049 -0.303 3.417 0.191  3.273   35.782 -0.978 0.108  3.377 5.313   
-0.310  35.927 50 HH_DC2DC3:DG23DG24_OO   H 2  ? O 24 ? H 3  ? O 23 ? 
1 H DC 3  1_555 L DG 8  1_555 H DT 4  1_555 L DA 7  1_555 0.270  -0.546 3.490 0.817  4.424   31.075 -1.888 -0.337 3.387 8.204   
-1.514  31.391 51 HH_DC3DT4:DA22DG23_OO   H 3  ? O 23 ? H 4  ? O 22 ? 
1 H DT 4  1_555 L DA 7  1_555 H DT 5  1_555 L DA 6  1_555 0.687  0.415  3.293 6.101  5.664   36.300 -0.129 -0.238 3.385 8.947   
-9.637  37.211 52 HH_DT4DT5:DA21DA22_OO   H 4  ? O 22 ? H 5  ? O 21 ? 
1 H DT 5  1_555 L DA 6  1_555 H DG 6  1_555 L DC 5  1_555 -0.648 0.509  3.289 -3.262 2.700   37.680 0.431  0.572  3.358 4.165   
5.031   37.908 53 HH_DT5DG6:DC20DA21_OO   H 5  ? O 21 ? H 6  ? O 20 ? 
1 H DG 6  1_555 L DC 5  1_555 H DC 7  1_555 L DG 4  1_555 -0.297 -0.852 3.416 -3.706 3.771   33.474 -2.090 -0.108 3.316 6.497   
6.385   33.877 54 HH_DG6DC7:DG19DC20_OO   H 6  ? O 20 ? H 7  ? O 19 ? 
1 H DC 7  1_555 L DG 4  1_555 H DC 8  1_555 L DG 3  1_555 0.974  0.259  3.156 5.221  8.779   34.060 -0.857 -0.835 3.231 14.586  
-8.674  35.515 55 HH_DC7DC8:DG18DG19_OO   H 7  ? O 19 ? H 8  ? O 18 ? 
1 H DC 8  1_555 L DG 3  1_555 H DG 9  1_555 L DC 2  1_555 -1.227 0.474  3.140 -6.242 7.934   29.222 -0.680 1.069  3.336 15.166  
11.932  30.881 56 HH_DC8DG9:DC17DG18_OO   H 8  ? O 18 ? H 9  ? O 17 ? 
1 H DG 9  1_555 L DC 2  1_555 H DG 10 1_555 L DC 1  1_555 -0.838 -0.450 3.484 0.812  6.235   37.199 -1.545 1.408  3.350 9.690   
-1.262  37.708 57 HH_DG9DG10:DC16DC17_OO  H 9  ? O 17 ? H 10 ? O 16 ? 
1 H DG 10 1_555 L DC 1  1_555 H DG 11 1_555 I DC 15 1_555 0.474  0.407  2.797 -5.407 5.978   30.454 -0.206 -1.738 2.704 11.138  
10.074  31.478 58 HH_DG10DG11:DC15DC16_IO H 10 ? O 16 ? H 11 ? I 15 ? 
1 H DG 11 1_555 I DC 15 1_555 H DT 12 1_555 I DA 14 1_555 -0.998 0.714  3.947 -1.075 -19.017 38.042 3.256  1.252  3.274 -27.195 
1.537   42.386 59 HH_DG11DT12:DA14DC15_II H 11 ? I 15 ? H 12 ? I 14 ? 
1 H DT 12 1_555 I DA 14 1_555 H DA 13 1_555 I DT 13 1_555 0.796  1.692  3.856 3.389  -19.967 49.694 3.273  -0.650 3.060 -22.702 
-3.854  53.419 60 HH_DT12DA13:DT13DA14_II H 12 ? I 14 ? H 13 ? I 13 ? 
1 H DA 13 1_555 I DT 13 1_555 H DA 14 1_555 I DT 12 1_555 0.462  -0.648 3.960 0.189  -3.217  30.296 -0.449 -0.833 4.008 -6.133  
-0.360  30.463 61 HH_DA13DA14:DT12DT13_II H 13 ? I 13 ? H 14 ? I 12 ? 
1 H DA 14 1_555 I DT 12 1_555 H DG 15 1_555 I DC 11 1_555 0.049  -0.580 3.157 -1.667 1.307   31.572 -1.296 -0.387 3.124 2.399   
3.059   31.641 62 HH_DA14DG15:DC11DT12_II H 14 ? I 12 ? H 15 ? I 11 ? 
1 H DG 15 1_555 I DC 11 1_555 H DT 16 1_555 I DA 10 1_555 -0.779 -0.853 3.520 2.643  3.055   35.135 -1.880 1.694  3.371 5.041   
-4.360  35.359 63 HH_DG15DT16:DA10DC11_II H 15 ? I 11 ? H 16 ? I 10 ? 
1 H DT 16 1_555 I DA 10 1_555 H DT 17 1_555 I DA 9  1_555 0.648  0.391  3.368 0.879  -0.713  37.559 0.703  -0.888 3.375 -1.108  
-1.366  37.575 64 HH_DT16DT17:DA9DA10_II  H 16 ? I 10 ? H 17 ? I 9  ? 
1 H DT 17 1_555 I DA 9  1_555 H DC 18 1_555 I DG 8  1_555 -0.850 -0.053 3.461 -5.682 -10.693 35.309 1.452  0.515  3.425 -17.023 
9.044   37.265 65 HH_DT17DC18:DG8DA9_II   H 17 ? I 9  ? H 18 ? I 8  ? 
1 H DC 18 1_555 I DG 8  1_555 H DC 19 1_555 I DG 7  1_555 -0.402 -1.309 3.469 2.744  3.147   27.265 -3.539 1.534  3.245 6.627   
-5.778  27.576 66 HH_DC18DC19:DG7DG8_II   H 18 ? I 8  ? H 19 ? I 7  ? 
1 H DC 19 1_555 I DG 7  1_555 H DG 20 1_555 I DC 6  1_555 0.156  -0.488 2.866 0.933  11.972  28.695 -2.865 -0.140 2.473 22.930  
-1.786  31.057 67 HH_DC19DG20:DC6DG7_II   H 19 ? I 7  ? H 20 ? I 6  ? 
1 H DG 20 1_555 I DC 6  1_555 H DG 21 1_555 I DC 5  1_555 0.460  -1.889 3.729 -0.454 0.769   28.555 -4.027 -1.048 3.670 1.559   
0.921   28.568 68 HH_DG20DG21:DC5DC6_II   H 20 ? I 6  ? H 21 ? I 5  ? 
1 H DG 21 1_555 I DC 5  1_555 H DC 22 1_555 I DG 4  1_555 0.855  -0.729 3.147 6.505  3.755   39.317 -1.485 -0.524 3.163 5.519   
-9.562  40.001 69 HH_DG21DC22:DG4DC5_II   H 21 ? I 5  ? H 22 ? I 4  ? 
1 H DC 22 1_555 I DG 4  1_555 H DG 23 1_555 I DC 3  1_555 0.374  -0.557 3.354 -1.619 4.477   31.578 -1.835 -0.977 3.224 8.169   
2.953   31.926 70 HH_DC22DG23:DC3DG4_II   H 22 ? I 4  ? H 23 ? I 3  ? 
1 H DG 23 1_555 I DC 3  1_555 H DC 24 1_555 I DG 2  1_555 -0.352 -0.638 3.345 0.466  5.980   35.878 -1.861 0.629  3.196 9.624   
-0.751  36.360 71 HH_DG23DC24:DG2DC3_II   H 23 ? I 3  ? H 24 ? I 2  ? 
1 H DC 24 1_555 I DG 2  1_555 H DG 25 1_555 I DC 1  1_555 -0.742 0.026  2.983 0.428  9.114   24.379 -2.228 1.756  2.796 20.678  
-0.970  26.006 72 HH_DC24DG25:DC1DG2_II   H 24 ? I 2  ? H 25 ? I 1  ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'MANGANESE (II) ION' MN  
6 water                HOH 
#