data_4UQG
# 
_entry.id   4UQG 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4UQG         
PDBE  EBI-61019    
WWPDB D_1290061019 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4UQG 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-06-23 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tomas-Gamasa, M.' 1 
'Serdjukov, S.'    2 
'Su, M.'           3 
'Mueller, M.'      4 
'Carell, T.'       5 
# 
_citation.id                        primary 
_citation.title                     
;"Post-it" type connected DNA created with a reversible covalent cross-link.
;
_citation.journal_abbrev            'Angew. Chem. Int. Ed. Engl.' 
_citation.journal_volume            54 
_citation.page_first                796 
_citation.page_last                 800 
_citation.year                      2015 
_citation.journal_id_ASTM           ACIEAY 
_citation.country                   GE 
_citation.journal_id_ISSN           1521-3773 
_citation.journal_id_CSD            0179 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25446281 
_citation.pdbx_database_id_DOI      10.1002/anie.201407854 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tomas-Gamasa, M.' 1 ? 
primary 'Serdjukow, S.'    2 ? 
primary 'Su, M.'           3 ? 
primary 'Muller, M.'       4 ? 
primary 'Carell, T.'       5 ? 
# 
_cell.entry_id           4UQG 
_cell.length_a           87.442 
_cell.length_b           93.996 
_cell.length_c           105.416 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4UQG 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA POLYMERASE'                                    66148.828 1   2.7.7.7 ? 'POLYMERASE DOMAIN, RESIDUES 2-580' 
?                                 
2 polymer     syn 
;5'-D(*GP*AP*CP*C T0TP*TP*CP*CP*CP*TP)-3'
;
3025.090  1   ?       ? ?                                   'LINK TO CHAIN C VIA RESIDUE SAY' 
3 polymer     syn 
;5'-D(*AP*GP*GP*GP*A SAYP*GP*GP*TP*CP)-3'
;
3121.061  1   ?       ? ?                                   'LINK TO CHAIN B VIA RESIDUE T0T' 
4 branched    man 'beta-D-fructofuranose-(2-1)-alpha-D-glucopyranose' 342.297   1   ?       ? ?                                   
?                                 
5 non-polymer syn 'SULFATE ION'                                       96.063    4   ?       ? ?                                   
?                                 
6 water       nat water                                               18.015    210 ?       ? ?                                   
?                                 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'DNA POLYMERASE I FRAGMENT' 
2 'POLYDEOXYRIBONUCLEOTIDE B' 
3 'POLYDEOXYRIBONUCLEOTIDE C' 
4 sucrose                     
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no  
;KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAA
VALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWAL
ERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVI
LFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLS
STEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEV
TPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDIT
SRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVT
LRVPLKVDYHYGSTWYDAK
;
;KMAFTLADRVTEEMLADKAALVVEVVEENYHDAPIVGIAVVNEHGRFFLRPETALADPQFVAWLGDETKKKSMFDSKRAA
VALKWKGIELCGVSFDLLLAAYLLDPAQGVDDVAAAAKMKQYEAVRPDEAVYGKGAKRAVPDEPVLAEHLVRKAAAIWAL
ERPFLDELRRNEQDRLLVELEQPLSSILAEMEFAGVKVDTKRLEQMGEELAEQLRTVEQRIYELAGQEFNINSPKQLGVI
LFEKLQLPVLKKSKTGYSTSADVLEKLAPYHEIVENILHYRQLGKLQSTYIEGLLKVVRPDTKKVHTIFNQALTQTGRLS
STEPNLQNIPIRLEEGRKIRQAFVPSESDWLIFAADYSQIELRVLAHIAEDDNLMEAFRRDLDIHTKTAMDIFQVSEDEV
TPNMRRQAKAVNFGIVYGISDYGLAQNLNISRKEAAEFIERYFESFPGVKRYMENIVQEAKQKGYVTTLLHRRRYLPDIT
SRNFNVRSFAERMAMNTPIQGSAADIIKKAMIDLNARLKEERLQARLLLQVHDELILEAPKEEMERLCRLVPEVMEQAVT
LRVPLKVDYHYGSTWYDAK
;
A ? 
2 polydeoxyribonucleotide no yes '(DG)(DA)(DC)(DC)(T0T)(DT)(DC)(DC)(DC)(DT)' GACCXTCCCT B ? 
3 polydeoxyribonucleotide no yes '(DA)(DG)(DG)(DG)(DA)(SAY)(DG)(DG)(DT)(DC)' AGGGAXGGTC C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LYS n 
1 2   MET n 
1 3   ALA n 
1 4   PHE n 
1 5   THR n 
1 6   LEU n 
1 7   ALA n 
1 8   ASP n 
1 9   ARG n 
1 10  VAL n 
1 11  THR n 
1 12  GLU n 
1 13  GLU n 
1 14  MET n 
1 15  LEU n 
1 16  ALA n 
1 17  ASP n 
1 18  LYS n 
1 19  ALA n 
1 20  ALA n 
1 21  LEU n 
1 22  VAL n 
1 23  VAL n 
1 24  GLU n 
1 25  VAL n 
1 26  VAL n 
1 27  GLU n 
1 28  GLU n 
1 29  ASN n 
1 30  TYR n 
1 31  HIS n 
1 32  ASP n 
1 33  ALA n 
1 34  PRO n 
1 35  ILE n 
1 36  VAL n 
1 37  GLY n 
1 38  ILE n 
1 39  ALA n 
1 40  VAL n 
1 41  VAL n 
1 42  ASN n 
1 43  GLU n 
1 44  HIS n 
1 45  GLY n 
1 46  ARG n 
1 47  PHE n 
1 48  PHE n 
1 49  LEU n 
1 50  ARG n 
1 51  PRO n 
1 52  GLU n 
1 53  THR n 
1 54  ALA n 
1 55  LEU n 
1 56  ALA n 
1 57  ASP n 
1 58  PRO n 
1 59  GLN n 
1 60  PHE n 
1 61  VAL n 
1 62  ALA n 
1 63  TRP n 
1 64  LEU n 
1 65  GLY n 
1 66  ASP n 
1 67  GLU n 
1 68  THR n 
1 69  LYS n 
1 70  LYS n 
1 71  LYS n 
1 72  SER n 
1 73  MET n 
1 74  PHE n 
1 75  ASP n 
1 76  SER n 
1 77  LYS n 
1 78  ARG n 
1 79  ALA n 
1 80  ALA n 
1 81  VAL n 
1 82  ALA n 
1 83  LEU n 
1 84  LYS n 
1 85  TRP n 
1 86  LYS n 
1 87  GLY n 
1 88  ILE n 
1 89  GLU n 
1 90  LEU n 
1 91  CYS n 
1 92  GLY n 
1 93  VAL n 
1 94  SER n 
1 95  PHE n 
1 96  ASP n 
1 97  LEU n 
1 98  LEU n 
1 99  LEU n 
1 100 ALA n 
1 101 ALA n 
1 102 TYR n 
1 103 LEU n 
1 104 LEU n 
1 105 ASP n 
1 106 PRO n 
1 107 ALA n 
1 108 GLN n 
1 109 GLY n 
1 110 VAL n 
1 111 ASP n 
1 112 ASP n 
1 113 VAL n 
1 114 ALA n 
1 115 ALA n 
1 116 ALA n 
1 117 ALA n 
1 118 LYS n 
1 119 MET n 
1 120 LYS n 
1 121 GLN n 
1 122 TYR n 
1 123 GLU n 
1 124 ALA n 
1 125 VAL n 
1 126 ARG n 
1 127 PRO n 
1 128 ASP n 
1 129 GLU n 
1 130 ALA n 
1 131 VAL n 
1 132 TYR n 
1 133 GLY n 
1 134 LYS n 
1 135 GLY n 
1 136 ALA n 
1 137 LYS n 
1 138 ARG n 
1 139 ALA n 
1 140 VAL n 
1 141 PRO n 
1 142 ASP n 
1 143 GLU n 
1 144 PRO n 
1 145 VAL n 
1 146 LEU n 
1 147 ALA n 
1 148 GLU n 
1 149 HIS n 
1 150 LEU n 
1 151 VAL n 
1 152 ARG n 
1 153 LYS n 
1 154 ALA n 
1 155 ALA n 
1 156 ALA n 
1 157 ILE n 
1 158 TRP n 
1 159 ALA n 
1 160 LEU n 
1 161 GLU n 
1 162 ARG n 
1 163 PRO n 
1 164 PHE n 
1 165 LEU n 
1 166 ASP n 
1 167 GLU n 
1 168 LEU n 
1 169 ARG n 
1 170 ARG n 
1 171 ASN n 
1 172 GLU n 
1 173 GLN n 
1 174 ASP n 
1 175 ARG n 
1 176 LEU n 
1 177 LEU n 
1 178 VAL n 
1 179 GLU n 
1 180 LEU n 
1 181 GLU n 
1 182 GLN n 
1 183 PRO n 
1 184 LEU n 
1 185 SER n 
1 186 SER n 
1 187 ILE n 
1 188 LEU n 
1 189 ALA n 
1 190 GLU n 
1 191 MET n 
1 192 GLU n 
1 193 PHE n 
1 194 ALA n 
1 195 GLY n 
1 196 VAL n 
1 197 LYS n 
1 198 VAL n 
1 199 ASP n 
1 200 THR n 
1 201 LYS n 
1 202 ARG n 
1 203 LEU n 
1 204 GLU n 
1 205 GLN n 
1 206 MET n 
1 207 GLY n 
1 208 GLU n 
1 209 GLU n 
1 210 LEU n 
1 211 ALA n 
1 212 GLU n 
1 213 GLN n 
1 214 LEU n 
1 215 ARG n 
1 216 THR n 
1 217 VAL n 
1 218 GLU n 
1 219 GLN n 
1 220 ARG n 
1 221 ILE n 
1 222 TYR n 
1 223 GLU n 
1 224 LEU n 
1 225 ALA n 
1 226 GLY n 
1 227 GLN n 
1 228 GLU n 
1 229 PHE n 
1 230 ASN n 
1 231 ILE n 
1 232 ASN n 
1 233 SER n 
1 234 PRO n 
1 235 LYS n 
1 236 GLN n 
1 237 LEU n 
1 238 GLY n 
1 239 VAL n 
1 240 ILE n 
1 241 LEU n 
1 242 PHE n 
1 243 GLU n 
1 244 LYS n 
1 245 LEU n 
1 246 GLN n 
1 247 LEU n 
1 248 PRO n 
1 249 VAL n 
1 250 LEU n 
1 251 LYS n 
1 252 LYS n 
1 253 SER n 
1 254 LYS n 
1 255 THR n 
1 256 GLY n 
1 257 TYR n 
1 258 SER n 
1 259 THR n 
1 260 SER n 
1 261 ALA n 
1 262 ASP n 
1 263 VAL n 
1 264 LEU n 
1 265 GLU n 
1 266 LYS n 
1 267 LEU n 
1 268 ALA n 
1 269 PRO n 
1 270 TYR n 
1 271 HIS n 
1 272 GLU n 
1 273 ILE n 
1 274 VAL n 
1 275 GLU n 
1 276 ASN n 
1 277 ILE n 
1 278 LEU n 
1 279 HIS n 
1 280 TYR n 
1 281 ARG n 
1 282 GLN n 
1 283 LEU n 
1 284 GLY n 
1 285 LYS n 
1 286 LEU n 
1 287 GLN n 
1 288 SER n 
1 289 THR n 
1 290 TYR n 
1 291 ILE n 
1 292 GLU n 
1 293 GLY n 
1 294 LEU n 
1 295 LEU n 
1 296 LYS n 
1 297 VAL n 
1 298 VAL n 
1 299 ARG n 
1 300 PRO n 
1 301 ASP n 
1 302 THR n 
1 303 LYS n 
1 304 LYS n 
1 305 VAL n 
1 306 HIS n 
1 307 THR n 
1 308 ILE n 
1 309 PHE n 
1 310 ASN n 
1 311 GLN n 
1 312 ALA n 
1 313 LEU n 
1 314 THR n 
1 315 GLN n 
1 316 THR n 
1 317 GLY n 
1 318 ARG n 
1 319 LEU n 
1 320 SER n 
1 321 SER n 
1 322 THR n 
1 323 GLU n 
1 324 PRO n 
1 325 ASN n 
1 326 LEU n 
1 327 GLN n 
1 328 ASN n 
1 329 ILE n 
1 330 PRO n 
1 331 ILE n 
1 332 ARG n 
1 333 LEU n 
1 334 GLU n 
1 335 GLU n 
1 336 GLY n 
1 337 ARG n 
1 338 LYS n 
1 339 ILE n 
1 340 ARG n 
1 341 GLN n 
1 342 ALA n 
1 343 PHE n 
1 344 VAL n 
1 345 PRO n 
1 346 SER n 
1 347 GLU n 
1 348 SER n 
1 349 ASP n 
1 350 TRP n 
1 351 LEU n 
1 352 ILE n 
1 353 PHE n 
1 354 ALA n 
1 355 ALA n 
1 356 ASP n 
1 357 TYR n 
1 358 SER n 
1 359 GLN n 
1 360 ILE n 
1 361 GLU n 
1 362 LEU n 
1 363 ARG n 
1 364 VAL n 
1 365 LEU n 
1 366 ALA n 
1 367 HIS n 
1 368 ILE n 
1 369 ALA n 
1 370 GLU n 
1 371 ASP n 
1 372 ASP n 
1 373 ASN n 
1 374 LEU n 
1 375 MET n 
1 376 GLU n 
1 377 ALA n 
1 378 PHE n 
1 379 ARG n 
1 380 ARG n 
1 381 ASP n 
1 382 LEU n 
1 383 ASP n 
1 384 ILE n 
1 385 HIS n 
1 386 THR n 
1 387 LYS n 
1 388 THR n 
1 389 ALA n 
1 390 MET n 
1 391 ASP n 
1 392 ILE n 
1 393 PHE n 
1 394 GLN n 
1 395 VAL n 
1 396 SER n 
1 397 GLU n 
1 398 ASP n 
1 399 GLU n 
1 400 VAL n 
1 401 THR n 
1 402 PRO n 
1 403 ASN n 
1 404 MET n 
1 405 ARG n 
1 406 ARG n 
1 407 GLN n 
1 408 ALA n 
1 409 LYS n 
1 410 ALA n 
1 411 VAL n 
1 412 ASN n 
1 413 PHE n 
1 414 GLY n 
1 415 ILE n 
1 416 VAL n 
1 417 TYR n 
1 418 GLY n 
1 419 ILE n 
1 420 SER n 
1 421 ASP n 
1 422 TYR n 
1 423 GLY n 
1 424 LEU n 
1 425 ALA n 
1 426 GLN n 
1 427 ASN n 
1 428 LEU n 
1 429 ASN n 
1 430 ILE n 
1 431 SER n 
1 432 ARG n 
1 433 LYS n 
1 434 GLU n 
1 435 ALA n 
1 436 ALA n 
1 437 GLU n 
1 438 PHE n 
1 439 ILE n 
1 440 GLU n 
1 441 ARG n 
1 442 TYR n 
1 443 PHE n 
1 444 GLU n 
1 445 SER n 
1 446 PHE n 
1 447 PRO n 
1 448 GLY n 
1 449 VAL n 
1 450 LYS n 
1 451 ARG n 
1 452 TYR n 
1 453 MET n 
1 454 GLU n 
1 455 ASN n 
1 456 ILE n 
1 457 VAL n 
1 458 GLN n 
1 459 GLU n 
1 460 ALA n 
1 461 LYS n 
1 462 GLN n 
1 463 LYS n 
1 464 GLY n 
1 465 TYR n 
1 466 VAL n 
1 467 THR n 
1 468 THR n 
1 469 LEU n 
1 470 LEU n 
1 471 HIS n 
1 472 ARG n 
1 473 ARG n 
1 474 ARG n 
1 475 TYR n 
1 476 LEU n 
1 477 PRO n 
1 478 ASP n 
1 479 ILE n 
1 480 THR n 
1 481 SER n 
1 482 ARG n 
1 483 ASN n 
1 484 PHE n 
1 485 ASN n 
1 486 VAL n 
1 487 ARG n 
1 488 SER n 
1 489 PHE n 
1 490 ALA n 
1 491 GLU n 
1 492 ARG n 
1 493 MET n 
1 494 ALA n 
1 495 MET n 
1 496 ASN n 
1 497 THR n 
1 498 PRO n 
1 499 ILE n 
1 500 GLN n 
1 501 GLY n 
1 502 SER n 
1 503 ALA n 
1 504 ALA n 
1 505 ASP n 
1 506 ILE n 
1 507 ILE n 
1 508 LYS n 
1 509 LYS n 
1 510 ALA n 
1 511 MET n 
1 512 ILE n 
1 513 ASP n 
1 514 LEU n 
1 515 ASN n 
1 516 ALA n 
1 517 ARG n 
1 518 LEU n 
1 519 LYS n 
1 520 GLU n 
1 521 GLU n 
1 522 ARG n 
1 523 LEU n 
1 524 GLN n 
1 525 ALA n 
1 526 ARG n 
1 527 LEU n 
1 528 LEU n 
1 529 LEU n 
1 530 GLN n 
1 531 VAL n 
1 532 HIS n 
1 533 ASP n 
1 534 GLU n 
1 535 LEU n 
1 536 ILE n 
1 537 LEU n 
1 538 GLU n 
1 539 ALA n 
1 540 PRO n 
1 541 LYS n 
1 542 GLU n 
1 543 GLU n 
1 544 MET n 
1 545 GLU n 
1 546 ARG n 
1 547 LEU n 
1 548 CYS n 
1 549 ARG n 
1 550 LEU n 
1 551 VAL n 
1 552 PRO n 
1 553 GLU n 
1 554 VAL n 
1 555 MET n 
1 556 GLU n 
1 557 GLN n 
1 558 ALA n 
1 559 VAL n 
1 560 THR n 
1 561 LEU n 
1 562 ARG n 
1 563 VAL n 
1 564 PRO n 
1 565 LEU n 
1 566 LYS n 
1 567 VAL n 
1 568 ASP n 
1 569 TYR n 
1 570 HIS n 
1 571 TYR n 
1 572 GLY n 
1 573 SER n 
1 574 THR n 
1 575 TRP n 
1 576 TYR n 
1 577 ASP n 
1 578 ALA n 
1 579 LYS n 
2 1   DG  n 
2 2   DA  n 
2 3   DC  n 
2 4   DC  n 
2 5   T0T n 
2 6   DT  n 
2 7   DC  n 
2 8   DC  n 
2 9   DC  n 
2 10  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DG  n 
3 4   DG  n 
3 5   DA  n 
3 6   SAY n 
3 7   DG  n 
3 8   DG  n 
3 9   DT  n 
3 10  DC  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    'DSM 22' 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'GEOBACILLUS STEAROTHERMOPHILUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1422 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   'GERMAN COLLECTION OF MICROORGANISMS (DSM)' 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample ? ? 'synthetic construct' ? 32630 ? 
3 1 sample ? ? 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP E1C9K5_GEOSE 1 ? ? E1C9K5 ? 
2 PDB 4UQG         2 ? ? 4UQG   ? 
3 PDB 4UQG         3 ? ? 4UQG   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4UQG A 1 ? 579 ? E1C9K5 2  ? 580 ? 298 876 
2 2 4UQG B 1 ? 10  ? 4UQG   20 ? 29  ? 20  29  
3 3 4UQG C 1 ? 10  ? 4UQG   4  ? 13  ? 4   13  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE ?                                                               'C3 H7 N O2'      
89.093  
ARG 'L-peptide linking'           y ARGININE ?                                                               'C6 H15 N4 O2 1'  
175.209 
ASN 'L-peptide linking'           y ASPARAGINE ?                                                               'C4 H8 N2 O3'     
132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID' ?                                                               'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking'           y CYSTEINE ?                                                               'C3 H7 N O2 S'    
121.158 
DA  'DNA linking'                 y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'                 y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'                 y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'                 y "THYMIDINE-5'-MONOPHOSPHATE" ?                                                               
'C10 H15 N2 O8 P' 322.208 
FRU 'D-saccharide, beta linking'  . beta-D-fructofuranose ?                                                               
'C6 H12 O6'       180.156 
GLC 'D-saccharide, alpha linking' . alpha-D-glucopyranose ?                                                               
'C6 H12 O6'       180.156 
GLN 'L-peptide linking'           y GLUTAMINE ?                                                               'C5 H10 N2 O3'    
146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID' ?                                                               'C5 H9 N O4' 
147.129 
GLY 'peptide linking'             y GLYCINE ?                                                               'C2 H5 N O2'      
75.067  
HIS 'L-peptide linking'           y HISTIDINE ?                                                               'C6 H10 N3 O2 1'  
156.162 
HOH non-polymer                   . WATER ?                                                               'H2 O'            18.015 
ILE 'L-peptide linking'           y ISOLEUCINE ?                                                               'C6 H13 N O2'     
131.173 
LEU 'L-peptide linking'           y LEUCINE ?                                                               'C6 H13 N O2'     
131.173 
LYS 'L-peptide linking'           y LYSINE ?                                                               'C6 H15 N2 O2 1'  
147.195 
MET 'L-peptide linking'           y METHIONINE ?                                                               'C5 H11 N O2 S'   
149.211 
PHE 'L-peptide linking'           y PHENYLALANINE ?                                                               'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking'           y PROLINE ?                                                               'C5 H9 N O2'      
115.130 
SAY 'DNA linking'                 . 
'[(2R,3S,5R)-3-hydroxy-5-(3-hydroxy-4-methanoyl-phenyl)oxolan-2-yl]methyl dihydrogen phosphate'          
"2'-DEOXY-1'-(3-HYDROXY-4-FORMYLPHENYL)RIBOSE-5'-MONOPHOSPHATE" 'C12 H15 O8 P'    318.216 
SER 'L-peptide linking'           y SERINE ?                                                               'C3 H7 N O3'      
105.093 
SO4 non-polymer                   . 'SULFATE ION' ?                                                               'O4 S -2' 96.063 
T0T 'DNA linking'                 . 
'(1R)-1-{4-[(E)-2-(2-aminophenyl)ethenyl]phenyl}-1,4-anhydro-2-deoxy-5-O-phosphonato-D-erythro-pentitol' ? 'C19 H22 N O6 P'  
391.355 
THR 'L-peptide linking'           y THREONINE ?                                                               'C4 H9 N O3'      
119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN ?                                                               'C11 H12 N2 O2'   
204.225 
TYR 'L-peptide linking'           y TYROSINE ?                                                               'C9 H11 N O3'     
181.189 
VAL 'L-peptide linking'           y VALINE ?                                                               'C5 H11 N O2'     
117.146 
# 
_exptl.entry_id          4UQG 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.28 
_exptl_crystal.density_percent_sol   62.57 
_exptl_crystal.description           NONE 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '46-49% AMMONIUM SULFATE, 2-3% MPD, 100MM MES PH5.8' 
# 
_diffrn.id                               1 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.crystal_id                       1 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2013-12-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X06SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X06SA 
_diffrn_source.pdbx_wavelength             1.0 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4UQG 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             70.16 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   59562 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.6 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.05 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              8.8 
_reflns.pdbx_CC_half                 ? 
_reflns.pdbx_Rpim_I_all              ? 
_reflns.pdbx_Rrim_I_all              ? 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.00 
_reflns_shell.d_res_low              2.07 
_reflns_shell.percent_possible_all   96.3 
_reflns_shell.Rmerge_I_obs           0.92 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.59 
_reflns_shell.pdbx_redundancy        8.8 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_CC_half           ? 
_reflns_shell.pdbx_Rpim_I_all        ? 
_reflns_shell.pdbx_Rrim_I_all        ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4UQG 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     56624 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             70.16 
_refine.ls_d_res_high                            2.00 
_refine.ls_percent_reflns_obs                    99.62 
_refine.ls_R_factor_obs                          0.17977 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.17814 
_refine.ls_R_factor_R_free                       0.21116 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  2937 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.948 
_refine.B_iso_mean                               34.730 
_refine.aniso_B[1][1]                            4.10 
_refine.aniso_B[2][2]                            -2.23 
_refine.aniso_B[3][3]                            -1.87 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            -0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS.' 
_refine.pdbx_starting_model                      'PDB ENTRY 2XY5' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.138 
_refine.pdbx_overall_ESU_R_Free                  0.130 
_refine.overall_SU_ML                            0.106 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             3.904 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4538 
_refine_hist.pdbx_number_atoms_nucleic_acid   411 
_refine_hist.pdbx_number_atoms_ligand         43 
_refine_hist.number_atoms_solvent             210 
_refine_hist.number_atoms_total               5202 
_refine_hist.d_res_high                       2.00 
_refine_hist.d_res_low                        70.16 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.018  0.019  ? 5127  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.007  0.020  ? 4729  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.663  1.910  ? 7035  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            1.138  3.000  ? 10857 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.824  5.000  ? 580   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.070 24.159 ? 214   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       13.491 15.000 ? 811   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       18.478 15.000 ? 36    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.106  0.200  ? 792   'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.009  0.020  ? 5486  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1146  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  2.900  3.212  ? 2317  'X-RAY DIFFRACTION' ? 
r_mcbond_other               2.888  3.211  ? 2316  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 3.547  4.797  ? 2895  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  4.362  3.826  ? 2810  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.995 
_refine_ls_shell.d_res_low                        2.047 
_refine_ls_shell.number_reflns_R_work             3928 
_refine_ls_shell.R_factor_R_work                  0.294 
_refine_ls_shell.percent_reflns_obs               95.07 
_refine_ls_shell.R_factor_R_free                  0.305 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             222 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                  4UQG 
_struct.title                     'A new bio-isosteric base pair based on reversible bonding' 
_struct.pdbx_descriptor           'DNA POLYMERASE (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4UQG 
_struct_keywords.pdbx_keywords   TRANSFERASE/DNA 
_struct_keywords.text            'TRANSFERASE-DNA COMPLEX, UNNATURAL BASE PAIR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 6 ? 
J N N 6 ? 
K N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 11  ? ALA A 16  ? THR A 308 ALA A 313 5 ? 6  
HELX_P HELX_P2  2  ARG A 50  ? LEU A 55  ? ARG A 347 LEU A 352 1 ? 6  
HELX_P HELX_P3  3  ASP A 57  ? GLY A 65  ? ASP A 354 GLY A 362 1 ? 9  
HELX_P HELX_P4  4  ASP A 75  ? TRP A 85  ? ASP A 372 TRP A 382 1 ? 11 
HELX_P HELX_P5  5  LEU A 97  ? ASP A 105 ? LEU A 394 ASP A 402 1 ? 9  
HELX_P HELX_P6  6  PRO A 106 ? GLY A 109 ? PRO A 403 GLY A 406 5 ? 4  
HELX_P HELX_P7  7  ASP A 112 ? MET A 119 ? ASP A 409 MET A 416 1 ? 8  
HELX_P HELX_P8  8  PRO A 127 ? GLY A 133 ? PRO A 424 GLY A 430 1 ? 7  
HELX_P HELX_P9  9  LYS A 134 ? ARG A 138 ? LYS A 431 ARG A 435 5 ? 5  
HELX_P HELX_P10 10 ASP A 142 ? ASN A 171 ? ASP A 439 ASN A 468 1 ? 30 
HELX_P HELX_P11 11 GLN A 173 ? LEU A 180 ? GLN A 470 LEU A 477 1 ? 8  
HELX_P HELX_P12 12 LEU A 180 ? GLY A 195 ? LEU A 477 GLY A 492 1 ? 16 
HELX_P HELX_P13 13 ASP A 199 ? GLY A 226 ? ASP A 496 GLY A 523 1 ? 28 
HELX_P HELX_P14 14 SER A 233 ? GLU A 243 ? SER A 530 GLU A 540 1 ? 11 
HELX_P HELX_P15 15 SER A 260 ? ALA A 268 ? SER A 557 ALA A 565 1 ? 9  
HELX_P HELX_P16 16 PRO A 269 ? HIS A 271 ? PRO A 566 HIS A 568 5 ? 3  
HELX_P HELX_P17 17 GLU A 272 ? TYR A 290 ? GLU A 569 TYR A 587 1 ? 19 
HELX_P HELX_P18 18 TYR A 290 ? VAL A 298 ? TYR A 587 VAL A 595 1 ? 9  
HELX_P HELX_P19 19 LEU A 333 ? LYS A 338 ? LEU A 630 LYS A 635 1 ? 6  
HELX_P HELX_P20 20 ILE A 339 ? GLN A 341 ? ILE A 636 GLN A 638 5 ? 3  
HELX_P HELX_P21 21 GLN A 359 ? GLU A 370 ? GLN A 656 GLU A 667 1 ? 12 
HELX_P HELX_P22 22 ASP A 371 ? ARG A 380 ? ASP A 668 ARG A 677 1 ? 10 
HELX_P HELX_P23 23 ASP A 383 ? GLN A 394 ? ASP A 680 GLN A 691 1 ? 12 
HELX_P HELX_P24 24 SER A 396 ? VAL A 400 ? SER A 693 VAL A 697 5 ? 5  
HELX_P HELX_P25 25 THR A 401 ? TYR A 417 ? THR A 698 TYR A 714 1 ? 17 
HELX_P HELX_P26 26 SER A 420 ? ASN A 429 ? SER A 717 ASN A 726 1 ? 10 
HELX_P HELX_P27 27 SER A 431 ? PHE A 446 ? SER A 728 PHE A 743 1 ? 16 
HELX_P HELX_P28 28 PHE A 446 ? GLY A 464 ? PHE A 743 GLY A 761 1 ? 19 
HELX_P HELX_P29 29 PRO A 477 ? SER A 481 ? PRO A 774 SER A 778 5 ? 5  
HELX_P HELX_P30 30 ASN A 483 ? GLU A 521 ? ASN A 780 GLU A 818 1 ? 39 
HELX_P HELX_P31 31 GLU A 543 ? GLN A 557 ? GLU A 840 GLN A 854 1 ? 15 
HELX_P HELX_P32 32 THR A 574 ? ALA A 578 ? THR A 871 ALA A 875 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
covale1  covale one  ? B DC  4  "O3'" ? ? ? 1_555 B T0T 5  P   ? ? B DC  23 B T0T 24 1_555 ? ? ? ? ? ? ?            1.597 ?    ? 
covale2  covale one  ? B T0T 5  "O3'" ? ? ? 1_555 B DT  6  P   ? ? B T0T 24 B DT  25 1_555 ? ? ? ? ? ? ?            1.585 ?    ? 
covale3  covale one  ? B T0T 5  N15   ? ? ? 1_555 C SAY 6  CAG ? ? B T0T 24 C SAY 9  1_555 ? ? ? ? ? ? ?            1.247 ?    ? 
covale4  covale both ? C DA  5  "O3'" ? ? ? 1_555 C SAY 6  P   ? ? C DA  8  C SAY 9  1_555 ? ? ? ? ? ? ?            1.584 ?    ? 
covale5  covale one  ? C SAY 6  "O3'" ? ? ? 1_555 C DG  7  P   ? ? C SAY 9  C DG  10 1_555 ? ? ? ? ? ? ?            1.588 ?    ? 
covale6  covale both ? D GLC .  C1    ? ? ? 1_555 D FRU .  O2  ? ? D GLC 1  D FRU 2  1_555 ? ? ? ? ? ? ?            1.455 sing ? 
hydrog1  hydrog ?    ? B DG  1  N1    ? ? ? 1_555 C DC  10 N3  ? ? B DG  20 C DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog2  hydrog ?    ? B DG  1  N2    ? ? ? 1_555 C DC  10 O2  ? ? B DG  20 C DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog3  hydrog ?    ? B DG  1  O6    ? ? ? 1_555 C DC  10 N4  ? ? B DG  20 C DC  13 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog4  hydrog ?    ? B DA  2  N1    ? ? ? 1_555 C DT  9  N3  ? ? B DA  21 C DT  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog5  hydrog ?    ? B DA  2  N6    ? ? ? 1_555 C DT  9  O4  ? ? B DA  21 C DT  12 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog6  hydrog ?    ? B DC  3  N3    ? ? ? 1_555 C DG  8  N1  ? ? B DC  22 C DG  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog7  hydrog ?    ? B DC  3  N4    ? ? ? 1_555 C DG  8  O6  ? ? B DC  22 C DG  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog8  hydrog ?    ? B DC  3  O2    ? ? ? 1_555 C DG  8  N2  ? ? B DC  22 C DG  11 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog9  hydrog ?    ? B DC  4  N3    ? ? ? 1_555 C DG  7  N1  ? ? B DC  23 C DG  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog10 hydrog ?    ? B DC  4  N4    ? ? ? 1_555 C DG  7  O6  ? ? B DC  23 C DG  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog11 hydrog ?    ? B DC  4  O2    ? ? ? 1_555 C DG  7  N2  ? ? B DC  23 C DG  10 1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog12 hydrog ?    ? B DT  6  N3    ? ? ? 1_555 C DA  5  N1  ? ? B DT  25 C DA  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog13 hydrog ?    ? B DT  6  O4    ? ? ? 1_555 C DA  5  N6  ? ? B DT  25 C DA  8  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog14 hydrog ?    ? B DC  7  N3    ? ? ? 1_555 C DG  4  N1  ? ? B DC  26 C DG  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog15 hydrog ?    ? B DC  7  N4    ? ? ? 1_555 C DG  4  O6  ? ? B DC  26 C DG  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog16 hydrog ?    ? B DC  7  O2    ? ? ? 1_555 C DG  4  N2  ? ? B DC  26 C DG  7  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog17 hydrog ?    ? B DC  8  N3    ? ? ? 1_555 C DG  3  N1  ? ? B DC  27 C DG  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog18 hydrog ?    ? B DC  8  N4    ? ? ? 1_555 C DG  3  O6  ? ? B DC  27 C DG  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog19 hydrog ?    ? B DC  8  O2    ? ? ? 1_555 C DG  3  N2  ? ? B DC  27 C DG  6  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog20 hydrog ?    ? B DC  9  N3    ? ? ? 1_555 C DG  2  N1  ? ? B DC  28 C DG  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog21 hydrog ?    ? B DC  9  N4    ? ? ? 1_555 C DG  2  O6  ? ? B DC  28 C DG  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog22 hydrog ?    ? B DC  9  O2    ? ? ? 1_555 C DG  2  N2  ? ? B DC  28 C DG  5  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog23 hydrog ?    ? B DT  10 N3    ? ? ? 1_555 C DA  1  N1  ? ? B DT  29 C DA  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
hydrog24 hydrog ?    ? B DT  10 O4    ? ? ? 1_555 C DA  1  N6  ? ? B DT  29 C DA  4  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ?    ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLU 
_struct_mon_prot_cis.label_seq_id           323 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLU 
_struct_mon_prot_cis.auth_seq_id            620 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    324 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     621 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       4.17 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 3 ? 
AC ? 2 ? 
AD ? 2 ? 
AE ? 4 ? 
AF ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AA 4 5 ? parallel      
AA 5 6 ? parallel      
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 THR A 5   ? LEU A 6   ? THR A 302 LEU A 303 
AA 2 GLY A 45  ? LEU A 49  ? GLY A 342 LEU A 346 
AA 3 GLY A 37  ? ASN A 42  ? GLY A 334 ASN A 339 
AA 4 LYS A 18  ? GLU A 24  ? LYS A 315 GLU A 321 
AA 5 LYS A 70  ? MET A 73  ? LYS A 367 MET A 370 
AA 6 VAL A 93  ? ASP A 96  ? VAL A 390 ASP A 393 
AB 1 LYS A 304 ? VAL A 305 ? LYS A 601 VAL A 602 
AB 2 VAL A 196 ? VAL A 198 ? VAL A 493 VAL A 495 
AB 3 PHE A 343 ? VAL A 344 ? PHE A 640 VAL A 641 
AC 1 LYS A 252 ? SER A 253 ? LYS A 549 SER A 550 
AC 2 GLY A 256 ? TYR A 257 ? GLY A 553 TYR A 554 
AD 1 ILE A 308 ? ASN A 310 ? ILE A 605 ASN A 607 
AD 2 SER A 320 ? THR A 322 ? SER A 617 THR A 619 
AE 1 ARG A 526 ? GLN A 530 ? ARG A 823 GLN A 827 
AE 2 GLU A 534 ? PRO A 540 ? GLU A 831 PRO A 837 
AE 3 TRP A 350 ? TYR A 357 ? TRP A 647 TYR A 654 
AE 4 VAL A 567 ? GLY A 572 ? VAL A 864 GLY A 869 
AF 1 TYR A 465 ? THR A 467 ? TYR A 762 THR A 764 
AF 2 ARG A 473 ? TYR A 475 ? ARG A 770 TYR A 772 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N THR A 5   ? N THR A 302 O ARG A 46  ? O ARG A 343 
AA 2 3 N LEU A 49  ? N LEU A 346 O ILE A 38  ? O ILE A 335 
AA 3 4 N VAL A 41  ? N VAL A 338 O ALA A 20  ? O ALA A 317 
AA 4 5 N ALA A 19  ? N ALA A 316 O LYS A 70  ? O LYS A 367 
AA 5 6 O LYS A 71  ? O LYS A 368 N SER A 94  ? N SER A 391 
AB 1 2 N VAL A 305 ? N VAL A 602 O VAL A 196 ? O VAL A 493 
AB 2 3 N LYS A 197 ? N LYS A 494 O VAL A 344 ? O VAL A 641 
AC 1 2 N SER A 253 ? N SER A 550 O GLY A 256 ? O GLY A 553 
AD 1 2 N ASN A 310 ? N ASN A 607 O SER A 320 ? O SER A 617 
AE 1 2 N LEU A 528 ? N LEU A 825 O ILE A 536 ? O ILE A 833 
AE 2 3 N ALA A 539 ? N ALA A 836 O LEU A 351 ? O LEU A 648 
AE 3 4 N ASP A 356 ? N ASP A 653 O ASP A 568 ? O ASP A 865 
AF 1 2 N VAL A 466 ? N VAL A 763 O ARG A 474 ? O ARG A 771 
# 
_database_PDB_matrix.entry_id          4UQG 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4UQG 
_atom_sites.fract_transf_matrix[1][1]   0.011436 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010639 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009486 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N     . LYS A 1 1   ? -10.919 -39.373 51.290  1.00 43.24  ? 298  LYS A N     1 
ATOM   2    C CA    . LYS A 1 1   ? -11.689 -38.361 52.110  1.00 44.17  ? 298  LYS A CA    1 
ATOM   3    C C     . LYS A 1 1   ? -10.744 -37.506 52.915  1.00 46.18  ? 298  LYS A C     1 
ATOM   4    O O     . LYS A 1 1   ? -10.432 -37.843 54.054  1.00 43.27  ? 298  LYS A O     1 
ATOM   5    C CB    . LYS A 1 1   ? -12.603 -39.074 53.081  1.00 35.14  ? 298  LYS A CB    1 
ATOM   6    N N     . MET A 1 2   ? -10.342 -36.381 52.323  1.00 48.83  ? 299  MET A N     1 
ATOM   7    C CA    . MET A 1 2   ? -9.133  -35.635 52.676  1.00 41.73  ? 299  MET A CA    1 
ATOM   8    C C     . MET A 1 2   ? -9.198  -35.060 54.058  1.00 39.34  ? 299  MET A C     1 
ATOM   9    O O     . MET A 1 2   ? -10.214 -34.510 54.446  1.00 41.89  ? 299  MET A O     1 
ATOM   10   C CB    . MET A 1 2   ? -8.936  -34.485 51.648  1.00 39.51  ? 299  MET A CB    1 
ATOM   11   C CG    . MET A 1 2   ? -7.811  -33.538 51.944  1.00 32.84  ? 299  MET A CG    1 
ATOM   12   S SD    . MET A 1 2   ? -7.405  -32.427 50.556  1.00 32.54  ? 299  MET A SD    1 
ATOM   13   C CE    . MET A 1 2   ? -6.522  -33.486 49.418  1.00 30.19  ? 299  MET A CE    1 
ATOM   14   N N     . ALA A 1 3   ? -8.074  -35.101 54.774  1.00 33.50  ? 300  ALA A N     1 
ATOM   15   C CA    . ALA A 1 3   ? -8.054  -34.610 56.122  1.00 34.70  ? 300  ALA A CA    1 
ATOM   16   C C     . ALA A 1 3   ? -8.101  -33.111 56.198  1.00 37.44  ? 300  ALA A C     1 
ATOM   17   O O     . ALA A 1 3   ? -7.325  -32.444 55.499  1.00 33.37  ? 300  ALA A O     1 
ATOM   18   C CB    . ALA A 1 3   ? -6.783  -35.092 56.848  1.00 36.85  ? 300  ALA A CB    1 
ATOM   19   N N     . PHE A 1 4   ? -8.938  -32.588 57.107  1.00 30.55  ? 301  PHE A N     1 
ATOM   20   C CA    . PHE A 1 4   ? -8.936  -31.203 57.435  1.00 34.38  ? 301  PHE A CA    1 
ATOM   21   C C     . PHE A 1 4   ? -9.678  -30.928 58.735  1.00 37.17  ? 301  PHE A C     1 
ATOM   22   O O     . PHE A 1 4   ? -10.502 -31.725 59.182  1.00 34.79  ? 301  PHE A O     1 
ATOM   23   C CB    . PHE A 1 4   ? -9.607  -30.393 56.293  1.00 35.90  ? 301  PHE A CB    1 
ATOM   24   C CG    . PHE A 1 4   ? -11.039 -30.746 56.049  1.00 31.90  ? 301  PHE A CG    1 
ATOM   25   C CD1   . PHE A 1 4   ? -11.383 -31.756 55.189  1.00 34.77  ? 301  PHE A CD1   1 
ATOM   26   C CD2   . PHE A 1 4   ? -12.042 -30.047 56.707  1.00 32.19  ? 301  PHE A CD2   1 
ATOM   27   C CE1   . PHE A 1 4   ? -12.733 -32.099 54.940  1.00 34.64  ? 301  PHE A CE1   1 
ATOM   28   C CE2   . PHE A 1 4   ? -13.374 -30.380 56.481  1.00 33.26  ? 301  PHE A CE2   1 
ATOM   29   C CZ    . PHE A 1 4   ? -13.718 -31.404 55.580  1.00 29.76  ? 301  PHE A CZ    1 
ATOM   30   N N     . THR A 1 5   ? -9.414  -29.765 59.292  1.00 34.55  ? 302  THR A N     1 
ATOM   31   C CA    . THR A 1 5   ? -10.154 -29.266 60.432  1.00 40.53  ? 302  THR A CA    1 
ATOM   32   C C     . THR A 1 5   ? -11.368 -28.446 60.026  1.00 43.58  ? 302  THR A C     1 
ATOM   33   O O     . THR A 1 5   ? -11.254 -27.396 59.323  1.00 35.59  ? 302  THR A O     1 
ATOM   34   C CB    . THR A 1 5   ? -9.258  -28.352 61.236  1.00 39.89  ? 302  THR A CB    1 
ATOM   35   O OG1   . THR A 1 5   ? -7.992  -28.999 61.362  1.00 42.82  ? 302  THR A OG1   1 
ATOM   36   C CG2   . THR A 1 5   ? -9.873  -28.062 62.573  1.00 38.48  ? 302  THR A CG2   1 
ATOM   37   N N     . LEU A 1 6   ? -12.532 -28.958 60.414  1.00 38.67  ? 303  LEU A N     1 
ATOM   38   C CA    . LEU A 1 6   ? -13.762 -28.204 60.314  1.00 44.22  ? 303  LEU A CA    1 
ATOM   39   C C     . LEU A 1 6   ? -13.834 -27.269 61.500  1.00 45.73  ? 303  LEU A C     1 
ATOM   40   O O     . LEU A 1 6   ? -14.250 -27.679 62.539  1.00 47.12  ? 303  LEU A O     1 
ATOM   41   C CB    . LEU A 1 6   ? -14.981 -29.141 60.253  1.00 45.61  ? 303  LEU A CB    1 
ATOM   42   C CG    . LEU A 1 6   ? -16.090 -28.519 59.381  1.00 51.12  ? 303  LEU A CG    1 
ATOM   43   C CD1   . LEU A 1 6   ? -17.101 -29.542 58.920  1.00 55.97  ? 303  LEU A CD1   1 
ATOM   44   C CD2   . LEU A 1 6   ? -16.767 -27.334 60.087  1.00 49.89  ? 303  LEU A CD2   1 
ATOM   45   N N     . ALA A 1 7   ? -13.402 -26.023 61.325  1.00 41.47  ? 304  ALA A N     1 
ATOM   46   C CA    . ALA A 1 7   ? -13.059 -25.135 62.449  1.00 43.71  ? 304  ALA A CA    1 
ATOM   47   C C     . ALA A 1 7   ? -14.286 -24.324 62.925  1.00 47.25  ? 304  ALA A C     1 
ATOM   48   O O     . ALA A 1 7   ? -15.165 -24.022 62.148  1.00 47.29  ? 304  ALA A O     1 
ATOM   49   C CB    . ALA A 1 7   ? -11.916 -24.230 62.080  1.00 43.42  ? 304  ALA A CB    1 
ATOM   50   N N     . ASP A 1 8   ? -14.398 -24.111 64.235  1.00 43.91  ? 305  ASP A N     1 
ATOM   51   C CA    . ASP A 1 8   ? -15.534 -23.382 64.822  1.00 47.97  ? 305  ASP A CA    1 
ATOM   52   C C     . ASP A 1 8   ? -15.130 -21.963 65.035  1.00 43.59  ? 305  ASP A C     1 
ATOM   53   O O     . ASP A 1 8   ? -15.981 -21.105 65.160  1.00 54.54  ? 305  ASP A O     1 
ATOM   54   C CB    . ASP A 1 8   ? -15.965 -23.978 66.193  1.00 54.06  ? 305  ASP A CB    1 
ATOM   55   C CG    . ASP A 1 8   ? -16.742 -25.287 66.052  1.00 62.44  ? 305  ASP A CG    1 
ATOM   56   O OD1   . ASP A 1 8   ? -17.529 -25.443 65.088  1.00 72.39  ? 305  ASP A OD1   1 
ATOM   57   O OD2   . ASP A 1 8   ? -16.575 -26.173 66.916  1.00 78.15  ? 305  ASP A OD2   1 
ATOM   58   N N     . ARG A 1 9   ? -13.829 -21.728 65.167  1.00 42.85  ? 306  ARG A N     1 
ATOM   59   C CA    . ARG A 1 9   ? -13.310 -20.384 65.303  1.00 44.70  ? 306  ARG A CA    1 
ATOM   60   C C     . ARG A 1 9   ? -11.969 -20.259 64.545  1.00 40.35  ? 306  ARG A C     1 
ATOM   61   O O     . ARG A 1 9   ? -11.317 -21.246 64.254  1.00 37.90  ? 306  ARG A O     1 
ATOM   62   C CB    . ARG A 1 9   ? -13.144 -20.026 66.781  1.00 47.92  ? 306  ARG A CB    1 
ATOM   63   C CG    . ARG A 1 9   ? -12.171 -20.915 67.546  1.00 57.16  ? 306  ARG A CG    1 
ATOM   64   C CD    . ARG A 1 9   ? -11.772 -20.363 68.924  1.00 65.79  ? 306  ARG A CD    1 
ATOM   65   N NE    . ARG A 1 9   ? -10.344 -20.649 69.228  1.00 79.63  ? 306  ARG A NE    1 
ATOM   66   C CZ    . ARG A 1 9   ? -9.305  -19.798 69.076  1.00 77.57  ? 306  ARG A CZ    1 
ATOM   67   N NH1   . ARG A 1 9   ? -9.472  -18.550 68.632  1.00 74.96  ? 306  ARG A NH1   1 
ATOM   68   N NH2   . ARG A 1 9   ? -8.068  -20.188 69.390  1.00 72.50  ? 306  ARG A NH2   1 
ATOM   69   N N     . VAL A 1 10  ? -11.573 -19.039 64.261  1.00 39.77  ? 307  VAL A N     1 
ATOM   70   C CA    . VAL A 1 10  ? -10.273 -18.730 63.658  1.00 44.83  ? 307  VAL A CA    1 
ATOM   71   C C     . VAL A 1 10  ? -9.121  -18.833 64.665  1.00 44.82  ? 307  VAL A C     1 
ATOM   72   O O     . VAL A 1 10  ? -9.206  -18.269 65.720  1.00 44.40  ? 307  VAL A O     1 
ATOM   73   C CB    . VAL A 1 10  ? -10.272 -17.294 63.063  1.00 42.12  ? 307  VAL A CB    1 
ATOM   74   C CG1   . VAL A 1 10  ? -8.910  -16.962 62.477  1.00 41.62  ? 307  VAL A CG1   1 
ATOM   75   C CG2   . VAL A 1 10  ? -11.396 -17.168 62.021  1.00 40.97  ? 307  VAL A CG2   1 
ATOM   76   N N     . THR A 1 11  ? -8.005  -19.477 64.285  1.00 39.54  ? 308  THR A N     1 
ATOM   77   C CA    . THR A 1 11  ? -6.814  -19.543 65.109  1.00 36.60  ? 308  THR A CA    1 
ATOM   78   C C     . THR A 1 11  ? -5.604  -18.998 64.362  1.00 44.38  ? 308  THR A C     1 
ATOM   79   O O     . THR A 1 11  ? -5.655  -18.822 63.120  1.00 39.07  ? 308  THR A O     1 
ATOM   80   C CB    . THR A 1 11  ? -6.523  -20.997 65.476  1.00 39.84  ? 308  THR A CB    1 
ATOM   81   O OG1   . THR A 1 11  ? -6.212  -21.722 64.264  1.00 44.70  ? 308  THR A OG1   1 
ATOM   82   C CG2   . THR A 1 11  ? -7.731  -21.667 66.121  1.00 34.41  ? 308  THR A CG2   1 
ATOM   83   N N     . GLU A 1 12  ? -4.530  -18.709 65.127  1.00 37.71  ? 309  GLU A N     1 
ATOM   84   C CA    . GLU A 1 12  ? -3.340  -18.062 64.601  1.00 36.99  ? 309  GLU A CA    1 
ATOM   85   C C     . GLU A 1 12  ? -2.719  -18.879 63.470  1.00 39.11  ? 309  GLU A C     1 
ATOM   86   O O     . GLU A 1 12  ? -2.153  -18.320 62.531  1.00 35.77  ? 309  GLU A O     1 
ATOM   87   C CB    . GLU A 1 12  ? -2.260  -17.839 65.680  1.00 35.71  ? 309  GLU A CB    1 
ATOM   88   N N     . GLU A 1 13  ? -2.818  -20.190 63.557  1.00 37.52  ? 310  GLU A N     1 
ATOM   89   C CA    . GLU A 1 13  ? -2.128  -21.015 62.587  1.00 44.71  ? 310  GLU A CA    1 
ATOM   90   C C     . GLU A 1 13  ? -2.840  -20.953 61.208  1.00 38.48  ? 310  GLU A C     1 
ATOM   91   O O     . GLU A 1 13  ? -2.244  -21.275 60.201  1.00 37.73  ? 310  GLU A O     1 
ATOM   92   C CB    . GLU A 1 13  ? -1.947  -22.441 63.110  1.00 42.33  ? 310  GLU A CB    1 
ATOM   93   C CG    . GLU A 1 13  ? -3.209  -23.270 63.272  1.00 45.98  ? 310  GLU A CG    1 
ATOM   94   C CD    . GLU A 1 13  ? -2.882  -24.745 63.544  1.00 50.61  ? 310  GLU A CD    1 
ATOM   95   O OE1   . GLU A 1 13  ? -1.675  -25.014 63.726  1.00 52.16  ? 310  GLU A OE1   1 
ATOM   96   O OE2   . GLU A 1 13  ? -3.804  -25.637 63.540  1.00 48.83  ? 310  GLU A OE2   1 
ATOM   97   N N     . MET A 1 14  ? -4.099  -20.508 61.202  1.00 36.83  ? 311  MET A N     1 
ATOM   98   C CA    . MET A 1 14  ? -4.823  -20.196 59.974  1.00 38.49  ? 311  MET A CA    1 
ATOM   99   C C     . MET A 1 14  ? -4.363  -18.906 59.280  1.00 36.29  ? 311  MET A C     1 
ATOM   100  O O     . MET A 1 14  ? -4.736  -18.678 58.148  1.00 36.71  ? 311  MET A O     1 
ATOM   101  C CB    . MET A 1 14  ? -6.329  -20.084 60.244  1.00 40.01  ? 311  MET A CB    1 
ATOM   102  C CG    . MET A 1 14  ? -6.916  -21.333 60.843  1.00 39.88  ? 311  MET A CG    1 
ATOM   103  S SD    . MET A 1 14  ? -8.669  -21.192 61.239  1.00 42.07  ? 311  MET A SD    1 
ATOM   104  C CE    . MET A 1 14  ? -8.798  -22.695 62.230  1.00 44.83  ? 311  MET A CE    1 
ATOM   105  N N     . LEU A 1 15  ? -3.546  -18.100 59.942  1.00 30.98  ? 312  LEU A N     1 
ATOM   106  C CA    . LEU A 1 15  ? -3.141  -16.809 59.473  1.00 33.36  ? 312  LEU A CA    1 
ATOM   107  C C     . LEU A 1 15  ? -1.674  -16.749 59.182  1.00 34.01  ? 312  LEU A C     1 
ATOM   108  O O     . LEU A 1 15  ? -1.052  -15.700 59.322  1.00 32.57  ? 312  LEU A O     1 
ATOM   109  C CB    . LEU A 1 15  ? -3.541  -15.673 60.476  1.00 33.60  ? 312  LEU A CB    1 
ATOM   110  C CG    . LEU A 1 15  ? -4.949  -15.872 61.008  1.00 34.92  ? 312  LEU A CG    1 
ATOM   111  C CD1   . LEU A 1 15  ? -5.251  -14.896 62.104  1.00 42.17  ? 312  LEU A CD1   1 
ATOM   112  C CD2   . LEU A 1 15  ? -5.975  -15.767 59.875  1.00 37.62  ? 312  LEU A CD2   1 
ATOM   113  N N     . ALA A 1 16  ? -1.128  -17.823 58.635  1.00 35.15  ? 313  ALA A N     1 
ATOM   114  C CA    . ALA A 1 16  ? 0.261   -17.817 58.167  1.00 33.89  ? 313  ALA A CA    1 
ATOM   115  C C     . ALA A 1 16  ? 0.411   -16.892 56.997  1.00 31.99  ? 313  ALA A C     1 
ATOM   116  O O     . ALA A 1 16  ? -0.570  -16.482 56.366  1.00 41.59  ? 313  ALA A O     1 
ATOM   117  C CB    . ALA A 1 16  ? 0.691   -19.224 57.752  1.00 37.94  ? 313  ALA A CB    1 
ATOM   118  N N     . ASP A 1 17  ? 1.634   -16.540 56.686  1.00 27.55  ? 314  ASP A N     1 
ATOM   119  C CA    . ASP A 1 17  ? 1.870   -15.549 55.698  1.00 36.09  ? 314  ASP A CA    1 
ATOM   120  C C     . ASP A 1 17  ? 2.043   -16.130 54.282  1.00 30.70  ? 314  ASP A C     1 
ATOM   121  O O     . ASP A 1 17  ? 2.391   -15.424 53.349  1.00 33.12  ? 314  ASP A O     1 
ATOM   122  C CB    . ASP A 1 17  ? 3.047   -14.682 56.107  1.00 44.01  ? 314  ASP A CB    1 
ATOM   123  C CG    . ASP A 1 17  ? 4.289   -15.396 56.090  1.00 46.46  ? 314  ASP A CG    1 
ATOM   124  O OD1   . ASP A 1 17  ? 4.208   -16.541 55.635  1.00 44.99  ? 314  ASP A OD1   1 
ATOM   125  O OD2   . ASP A 1 17  ? 5.319   -14.844 56.597  1.00 54.97  ? 314  ASP A OD2   1 
ATOM   126  N N     . LYS A 1 18  ? 1.718   -17.402 54.152  1.00 31.25  ? 315  LYS A N     1 
ATOM   127  C CA    . LYS A 1 18  ? 1.547   -18.009 52.858  1.00 34.79  ? 315  LYS A CA    1 
ATOM   128  C C     . LYS A 1 18  ? 0.446   -19.077 52.902  1.00 29.60  ? 315  LYS A C     1 
ATOM   129  O O     . LYS A 1 18  ? 0.452   -19.973 53.714  1.00 29.75  ? 315  LYS A O     1 
ATOM   130  C CB    . LYS A 1 18  ? 2.909   -18.582 52.432  1.00 35.39  ? 315  LYS A CB    1 
ATOM   131  C CG    . LYS A 1 18  ? 2.862   -19.520 51.262  1.00 38.61  ? 315  LYS A CG    1 
ATOM   132  C CD    . LYS A 1 18  ? 2.583   -18.807 49.971  1.00 36.03  ? 315  LYS A CD    1 
ATOM   133  C CE    . LYS A 1 18  ? 3.286   -19.566 48.803  1.00 33.69  ? 315  LYS A CE    1 
ATOM   134  N NZ    . LYS A 1 18  ? 3.080   -18.744 47.587  1.00 34.95  ? 315  LYS A NZ    1 
ATOM   135  N N     . ALA A 1 19  ? -0.509  -18.983 51.994  1.00 29.78  ? 316  ALA A N     1 
ATOM   136  C CA    . ALA A 1 19  ? -1.622  -19.900 51.985  1.00 26.53  ? 316  ALA A CA    1 
ATOM   137  C C     . ALA A 1 19  ? -2.328  -19.955 50.664  1.00 25.38  ? 316  ALA A C     1 
ATOM   138  O O     . ALA A 1 19  ? -2.320  -18.994 49.935  1.00 26.63  ? 316  ALA A O     1 
ATOM   139  C CB    . ALA A 1 19  ? -2.634  -19.499 53.067  1.00 25.52  ? 316  ALA A CB    1 
ATOM   140  N N     . ALA A 1 20  ? -2.970  -21.081 50.405  1.00 22.87  ? 317  ALA A N     1 
ATOM   141  C CA    . ALA A 1 20  ? -3.992  -21.220 49.426  1.00 23.68  ? 317  ALA A CA    1 
ATOM   142  C C     . ALA A 1 20  ? -5.313  -20.889 50.117  1.00 27.24  ? 317  ALA A C     1 
ATOM   143  O O     . ALA A 1 20  ? -5.601  -21.428 51.194  1.00 27.64  ? 317  ALA A O     1 
ATOM   144  C CB    . ALA A 1 20  ? -4.010  -22.617 48.862  1.00 23.97  ? 317  ALA A CB    1 
ATOM   145  N N     . LEU A 1 21  ? -6.133  -20.064 49.459  1.00 24.87  ? 318  LEU A N     1 
ATOM   146  C CA    . LEU A 1 21  ? -7.323  -19.573 50.002  1.00 23.45  ? 318  LEU A CA    1 
ATOM   147  C C     . LEU A 1 21  ? -8.476  -19.804 49.011  1.00 24.93  ? 318  LEU A C     1 
ATOM   148  O O     . LEU A 1 21  ? -8.360  -19.476 47.838  1.00 26.22  ? 318  LEU A O     1 
ATOM   149  C CB    . LEU A 1 21  ? -7.144  -18.057 50.336  1.00 23.35  ? 318  LEU A CB    1 
ATOM   150  C CG    . LEU A 1 21  ? -8.428  -17.300 50.706  1.00 24.88  ? 318  LEU A CG    1 
ATOM   151  C CD1   . LEU A 1 21  ? -8.977  -17.761 52.043  1.00 25.02  ? 318  LEU A CD1   1 
ATOM   152  C CD2   . LEU A 1 21  ? -8.182  -15.843 50.760  1.00 24.92  ? 318  LEU A CD2   1 
ATOM   153  N N     . VAL A 1 22  ? -9.593  -20.297 49.517  1.00 22.24  ? 319  VAL A N     1 
ATOM   154  C CA    . VAL A 1 22  ? -10.812 -20.442 48.766  1.00 24.25  ? 319  VAL A CA    1 
ATOM   155  C C     . VAL A 1 22  ? -11.877 -19.641 49.502  1.00 26.31  ? 319  VAL A C     1 
ATOM   156  O O     . VAL A 1 22  ? -12.161 -19.895 50.666  1.00 26.60  ? 319  VAL A O     1 
ATOM   157  C CB    . VAL A 1 22  ? -11.214 -21.895 48.616  1.00 25.60  ? 319  VAL A CB    1 
ATOM   158  C CG1   . VAL A 1 22  ? -12.573 -22.034 47.927  1.00 26.47  ? 319  VAL A CG1   1 
ATOM   159  C CG2   . VAL A 1 22  ? -10.155 -22.582 47.747  1.00 27.82  ? 319  VAL A CG2   1 
ATOM   160  N N     . VAL A 1 23  ? -12.428 -18.640 48.815  1.00 25.00  ? 320  VAL A N     1 
ATOM   161  C CA    . VAL A 1 23  ? -13.610 -17.904 49.288  1.00 25.99  ? 320  VAL A CA    1 
ATOM   162  C C     . VAL A 1 23  ? -14.716 -18.162 48.299  1.00 28.62  ? 320  VAL A C     1 
ATOM   163  O O     . VAL A 1 23  ? -14.747 -17.547 47.236  1.00 27.67  ? 320  VAL A O     1 
ATOM   164  C CB    . VAL A 1 23  ? -13.322 -16.397 49.369  1.00 24.74  ? 320  VAL A CB    1 
ATOM   165  C CG1   . VAL A 1 23  ? -14.601 -15.683 49.828  1.00 27.11  ? 320  VAL A CG1   1 
ATOM   166  C CG2   . VAL A 1 23  ? -12.129 -16.065 50.277  1.00 24.70  ? 320  VAL A CG2   1 
ATOM   167  N N     . GLU A 1 24  ? -15.632 -19.069 48.617  1.00 25.73  ? 321  GLU A N     1 
ATOM   168  C CA    . GLU A 1 24  ? -16.430 -19.639 47.567  1.00 26.48  ? 321  GLU A CA    1 
ATOM   169  C C     . GLU A 1 24  ? -17.695 -18.856 47.332  1.00 27.53  ? 321  GLU A C     1 
ATOM   170  O O     . GLU A 1 24  ? -18.544 -18.682 48.265  1.00 26.45  ? 321  GLU A O     1 
ATOM   171  C CB    . GLU A 1 24  ? -16.788 -21.099 47.909  1.00 27.72  ? 321  GLU A CB    1 
ATOM   172  C CG    . GLU A 1 24  ? -17.539 -21.878 46.829  1.00 29.79  ? 321  GLU A CG    1 
ATOM   173  C CD    . GLU A 1 24  ? -16.555 -22.516 45.817  1.00 30.11  ? 321  GLU A CD    1 
ATOM   174  O OE1   . GLU A 1 24  ? -15.401 -22.033 45.697  1.00 32.85  ? 321  GLU A OE1   1 
ATOM   175  O OE2   . GLU A 1 24  ? -16.883 -23.528 45.192  1.00 31.31  ? 321  GLU A OE2   1 
ATOM   176  N N     . VAL A 1 25  ? -17.859 -18.427 46.098  1.00 24.69  ? 322  VAL A N     1 
ATOM   177  C CA    . VAL A 1 25  ? -19.076 -17.724 45.592  1.00 25.99  ? 322  VAL A CA    1 
ATOM   178  C C     . VAL A 1 25  ? -19.640 -18.542 44.450  1.00 27.07  ? 322  VAL A C     1 
ATOM   179  O O     . VAL A 1 25  ? -19.081 -18.576 43.363  1.00 25.67  ? 322  VAL A O     1 
ATOM   180  C CB    . VAL A 1 25  ? -18.744 -16.289 45.092  1.00 26.56  ? 322  VAL A CB    1 
ATOM   181  C CG1   . VAL A 1 25  ? -19.981 -15.571 44.609  1.00 26.11  ? 322  VAL A CG1   1 
ATOM   182  C CG2   . VAL A 1 25  ? -18.027 -15.516 46.201  1.00 28.77  ? 322  VAL A CG2   1 
ATOM   183  N N     . VAL A 1 26  ? -20.766 -19.208 44.700  1.00 25.95  ? 323  VAL A N     1 
ATOM   184  C CA    . VAL A 1 26  ? -21.320 -20.179 43.778  1.00 27.82  ? 323  VAL A CA    1 
ATOM   185  C C     . VAL A 1 26  ? -22.210 -19.562 42.767  1.00 27.06  ? 323  VAL A C     1 
ATOM   186  O O     . VAL A 1 26  ? -22.295 -20.042 41.647  1.00 28.05  ? 323  VAL A O     1 
ATOM   187  C CB    . VAL A 1 26  ? -22.101 -21.260 44.568  1.00 30.07  ? 323  VAL A CB    1 
ATOM   188  C CG1   . VAL A 1 26  ? -22.789 -22.242 43.619  1.00 34.00  ? 323  VAL A CG1   1 
ATOM   189  C CG2   . VAL A 1 26  ? -21.108 -22.003 45.432  1.00 31.00  ? 323  VAL A CG2   1 
ATOM   190  N N     . GLU A 1 27  ? -22.894 -18.488 43.121  1.00 27.33  ? 324  GLU A N     1 
ATOM   191  C CA    . GLU A 1 27  ? -23.692 -17.749 42.118  1.00 29.59  ? 324  GLU A CA    1 
ATOM   192  C C     . GLU A 1 27  ? -22.789 -17.285 40.986  1.00 29.45  ? 324  GLU A C     1 
ATOM   193  O O     . GLU A 1 27  ? -21.719 -16.782 41.272  1.00 29.01  ? 324  GLU A O     1 
ATOM   194  C CB    . GLU A 1 27  ? -24.350 -16.504 42.731  1.00 32.65  ? 324  GLU A CB    1 
ATOM   195  C CG    . GLU A 1 27  ? -25.499 -16.726 43.632  1.00 43.39  ? 324  GLU A CG    1 
ATOM   196  C CD    . GLU A 1 27  ? -26.729 -17.178 42.880  1.00 54.99  ? 324  GLU A CD    1 
ATOM   197  O OE1   . GLU A 1 27  ? -26.872 -16.916 41.651  1.00 61.33  ? 324  GLU A OE1   1 
ATOM   198  O OE2   . GLU A 1 27  ? -27.577 -17.783 43.543  1.00 65.90  ? 324  GLU A OE2   1 
ATOM   199  N N     . GLU A 1 28  ? -23.241 -17.411 39.748  1.00 27.04  ? 325  GLU A N     1 
ATOM   200  C CA    . GLU A 1 28  ? -22.445 -17.100 38.559  1.00 32.19  ? 325  GLU A CA    1 
ATOM   201  C C     . GLU A 1 28  ? -22.068 -15.626 38.570  1.00 31.06  ? 325  GLU A C     1 
ATOM   202  O O     . GLU A 1 28  ? -20.906 -15.264 38.328  1.00 26.69  ? 325  GLU A O     1 
ATOM   203  C CB    . GLU A 1 28  ? -23.218 -17.433 37.262  1.00 37.60  ? 325  GLU A CB    1 
ATOM   204  C CG    . GLU A 1 28  ? -23.019 -18.883 36.719  1.00 46.74  ? 325  GLU A CG    1 
ATOM   205  C CD    . GLU A 1 28  ? -23.393 -19.045 35.218  1.00 46.81  ? 325  GLU A CD    1 
ATOM   206  N N     . ASN A 1 29  ? -23.069 -14.805 38.873  1.00 27.46  ? 326  ASN A N     1 
ATOM   207  C CA    . ASN A 1 29  ? -22.917 -13.370 39.064  1.00 28.26  ? 326  ASN A CA    1 
ATOM   208  C C     . ASN A 1 29  ? -22.596 -13.103 40.526  1.00 26.86  ? 326  ASN A C     1 
ATOM   209  O O     . ASN A 1 29  ? -23.431 -13.227 41.398  1.00 25.02  ? 326  ASN A O     1 
ATOM   210  C CB    . ASN A 1 29  ? -24.172 -12.623 38.605  1.00 26.12  ? 326  ASN A CB    1 
ATOM   211  C CG    . ASN A 1 29  ? -23.968 -11.115 38.588  1.00 27.42  ? 326  ASN A CG    1 
ATOM   212  O OD1   . ASN A 1 29  ? -23.266 -10.555 39.443  1.00 25.46  ? 326  ASN A OD1   1 
ATOM   213  N ND2   . ASN A 1 29  ? -24.622 -10.447 37.674  1.00 28.73  ? 326  ASN A ND2   1 
ATOM   214  N N     . TYR A 1 30  ? -21.350 -12.787 40.790  1.00 20.90  ? 327  TYR A N     1 
ATOM   215  C CA    . TYR A 1 30  ? -20.886 -12.600 42.134  1.00 23.52  ? 327  TYR A CA    1 
ATOM   216  C C     . TYR A 1 30  ? -21.152 -11.246 42.834  1.00 22.16  ? 327  TYR A C     1 
ATOM   217  O O     . TYR A 1 30  ? -20.819 -11.110 43.988  1.00 23.95  ? 327  TYR A O     1 
ATOM   218  C CB    . TYR A 1 30  ? -19.411 -12.919 42.178  1.00 23.26  ? 327  TYR A CB    1 
ATOM   219  C CG    . TYR A 1 30  ? -18.534 -12.253 41.137  1.00 22.37  ? 327  TYR A CG    1 
ATOM   220  C CD1   . TYR A 1 30  ? -18.307 -10.886 41.158  1.00 23.92  ? 327  TYR A CD1   1 
ATOM   221  C CD2   . TYR A 1 30  ? -17.891 -13.004 40.172  1.00 22.34  ? 327  TYR A CD2   1 
ATOM   222  C CE1   . TYR A 1 30  ? -17.437 -10.282 40.268  1.00 23.70  ? 327  TYR A CE1   1 
ATOM   223  C CE2   . TYR A 1 30  ? -17.031 -12.423 39.282  1.00 23.59  ? 327  TYR A CE2   1 
ATOM   224  C CZ    . TYR A 1 30  ? -16.791 -11.066 39.319  1.00 20.94  ? 327  TYR A CZ    1 
ATOM   225  O OH    . TYR A 1 30  ? -15.929 -10.484 38.405  1.00 23.45  ? 327  TYR A OH    1 
ATOM   226  N N     . HIS A 1 31  ? -21.821 -10.308 42.163  1.00 22.64  ? 328  HIS A N     1 
ATOM   227  C CA    . HIS A 1 31  ? -22.083 -9.016  42.716  1.00 24.68  ? 328  HIS A CA    1 
ATOM   228  C C     . HIS A 1 31  ? -23.124 -9.148  43.828  1.00 24.45  ? 328  HIS A C     1 
ATOM   229  O O     . HIS A 1 31  ? -24.233 -9.571  43.588  1.00 23.90  ? 328  HIS A O     1 
ATOM   230  C CB    . HIS A 1 31  ? -22.577 -8.023  41.613  1.00 26.84  ? 328  HIS A CB    1 
ATOM   231  C CG    . HIS A 1 31  ? -21.458 -7.554  40.701  1.00 26.48  ? 328  HIS A CG    1 
ATOM   232  N ND1   . HIS A 1 31  ? -20.401 -6.777  41.148  1.00 24.79  ? 328  HIS A ND1   1 
ATOM   233  C CD2   . HIS A 1 31  ? -21.194 -7.814  39.397  1.00 25.12  ? 328  HIS A CD2   1 
ATOM   234  C CE1   . HIS A 1 31  ? -19.546 -6.567  40.161  1.00 25.30  ? 328  HIS A CE1   1 
ATOM   235  N NE2   . HIS A 1 31  ? -20.016 -7.172  39.083  1.00 25.52  ? 328  HIS A NE2   1 
ATOM   236  N N     . ASP A 1 32  ? -22.732 -8.757  45.024  1.00 25.13  ? 329  ASP A N     1 
ATOM   237  C CA    . ASP A 1 32  ? -23.587 -8.806  46.234  1.00 27.87  ? 329  ASP A CA    1 
ATOM   238  C C     . ASP A 1 32  ? -24.104 -10.201 46.525  1.00 26.21  ? 329  ASP A C     1 
ATOM   239  O O     . ASP A 1 32  ? -25.179 -10.377 47.066  1.00 24.84  ? 329  ASP A O     1 
ATOM   240  C CB    . ASP A 1 32  ? -24.789 -7.900  46.105  1.00 28.47  ? 329  ASP A CB    1 
ATOM   241  C CG    . ASP A 1 32  ? -25.096 -7.122  47.397  1.00 28.97  ? 329  ASP A CG    1 
ATOM   242  O OD1   . ASP A 1 32  ? -24.333 -7.223  48.407  1.00 28.51  ? 329  ASP A OD1   1 
ATOM   243  O OD2   . ASP A 1 32  ? -26.102 -6.366  47.326  1.00 28.71  ? 329  ASP A OD2   1 
ATOM   244  N N     . ALA A 1 33  ? -23.304 -11.191 46.173  1.00 26.43  ? 330  ALA A N     1 
ATOM   245  C CA    . ALA A 1 33  ? -23.708 -12.563 46.273  1.00 24.55  ? 330  ALA A CA    1 
ATOM   246  C C     . ALA A 1 33  ? -23.158 -13.161 47.539  1.00 24.30  ? 330  ALA A C     1 
ATOM   247  O O     . ALA A 1 33  ? -22.168 -12.663 48.100  1.00 26.36  ? 330  ALA A O     1 
ATOM   248  C CB    . ALA A 1 33  ? -23.210 -13.349 45.042  1.00 25.35  ? 330  ALA A CB    1 
ATOM   249  N N     . PRO A 1 34  ? -23.757 -14.273 47.988  1.00 27.67  ? 331  PRO A N     1 
ATOM   250  C CA    . PRO A 1 34  ? -23.233 -14.944 49.192  1.00 28.04  ? 331  PRO A CA    1 
ATOM   251  C C     . PRO A 1 34  ? -21.895 -15.633 49.008  1.00 25.86  ? 331  PRO A C     1 
ATOM   252  O O     . PRO A 1 34  ? -21.616 -16.186 47.931  1.00 28.69  ? 331  PRO A O     1 
ATOM   253  C CB    . PRO A 1 34  ? -24.306 -16.025 49.491  1.00 27.80  ? 331  PRO A CB    1 
ATOM   254  C CG    . PRO A 1 34  ? -25.476 -15.685 48.665  1.00 32.68  ? 331  PRO A CG    1 
ATOM   255  C CD    . PRO A 1 34  ? -24.937 -14.950 47.432  1.00 27.52  ? 331  PRO A CD    1 
ATOM   256  N N     . ILE A 1 35  ? -21.118 -15.621 50.063  1.00 26.93  ? 332  ILE A N     1 
ATOM   257  C CA    . ILE A 1 35  ? -19.974 -16.470 50.219  1.00 27.43  ? 332  ILE A CA    1 
ATOM   258  C C     . ILE A 1 35  ? -20.397 -17.686 51.021  1.00 30.41  ? 332  ILE A C     1 
ATOM   259  O O     . ILE A 1 35  ? -20.867 -17.531 52.102  1.00 28.05  ? 332  ILE A O     1 
ATOM   260  C CB    . ILE A 1 35  ? -18.882 -15.676 50.922  1.00 27.14  ? 332  ILE A CB    1 
ATOM   261  C CG1   . ILE A 1 35  ? -18.420 -14.563 50.004  1.00 28.70  ? 332  ILE A CG1   1 
ATOM   262  C CG2   . ILE A 1 35  ? -17.721 -16.566 51.301  1.00 29.68  ? 332  ILE A CG2   1 
ATOM   263  C CD1   . ILE A 1 35  ? -17.544 -13.503 50.670  1.00 28.98  ? 332  ILE A CD1   1 
ATOM   264  N N     . VAL A 1 36  ? -20.281 -18.885 50.460  1.00 26.79  ? 333  VAL A N     1 
ATOM   265  C CA    . VAL A 1 36  ? -20.858 -20.072 51.035  1.00 27.71  ? 333  VAL A CA    1 
ATOM   266  C C     . VAL A 1 36  ? -19.889 -20.849 51.940  1.00 31.27  ? 333  VAL A C     1 
ATOM   267  O O     . VAL A 1 36  ? -20.292 -21.714 52.659  1.00 27.31  ? 333  VAL A O     1 
ATOM   268  C CB    . VAL A 1 36  ? -21.495 -21.009 50.021  1.00 31.37  ? 333  VAL A CB    1 
ATOM   269  C CG1   . VAL A 1 36  ? -22.550 -20.273 49.210  1.00 31.73  ? 333  VAL A CG1   1 
ATOM   270  C CG2   . VAL A 1 36  ? -20.444 -21.675 49.119  1.00 30.61  ? 333  VAL A CG2   1 
ATOM   271  N N     . GLY A 1 37  ? -18.627 -20.510 51.919  1.00 27.79  ? 334  GLY A N     1 
ATOM   272  C CA    . GLY A 1 37  ? -17.639 -21.210 52.683  1.00 28.74  ? 334  GLY A CA    1 
ATOM   273  C C     . GLY A 1 37  ? -16.225 -20.774 52.352  1.00 28.93  ? 334  GLY A C     1 
ATOM   274  O O     . GLY A 1 37  ? -15.972 -20.161 51.321  1.00 27.78  ? 334  GLY A O     1 
ATOM   275  N N     . ILE A 1 38  ? -15.328 -21.068 53.260  1.00 26.91  ? 335  ILE A N     1 
ATOM   276  C CA    . ILE A 1 38  ? -13.959 -20.631 53.177  1.00 26.67  ? 335  ILE A CA    1 
ATOM   277  C C     . ILE A 1 38  ? -13.078 -21.821 53.464  1.00 31.14  ? 335  ILE A C     1 
ATOM   278  O O     . ILE A 1 38  ? -13.395 -22.619 54.325  1.00 30.70  ? 335  ILE A O     1 
ATOM   279  C CB    . ILE A 1 38  ? -13.672 -19.465 54.147  1.00 28.63  ? 335  ILE A CB    1 
ATOM   280  C CG1   . ILE A 1 38  ? -14.418 -18.219 53.667  1.00 28.90  ? 335  ILE A CG1   1 
ATOM   281  C CG2   . ILE A 1 38  ? -12.173 -19.143 54.237  1.00 29.02  ? 335  ILE A CG2   1 
ATOM   282  C CD1   . ILE A 1 38  ? -14.473 -17.098 54.623  1.00 29.14  ? 335  ILE A CD1   1 
ATOM   283  N N     . ALA A 1 39  ? -11.975 -21.952 52.720  1.00 27.58  ? 336  ALA A N     1 
ATOM   284  C CA    . ALA A 1 39  ? -10.968 -22.927 53.056  1.00 25.04  ? 336  ALA A CA    1 
ATOM   285  C C     . ALA A 1 39  ? -9.631  -22.324 52.944  1.00 24.98  ? 336  ALA A C     1 
ATOM   286  O O     . ALA A 1 39  ? -9.379  -21.479 52.044  1.00 25.37  ? 336  ALA A O     1 
ATOM   287  C CB    . ALA A 1 39  ? -11.070 -24.153 52.200  1.00 24.69  ? 336  ALA A CB    1 
ATOM   288  N N     . VAL A 1 40  ? -8.767  -22.751 53.850  1.00 24.41  ? 337  VAL A N     1 
ATOM   289  C CA    . VAL A 1 40  ? -7.371  -22.271 53.912  1.00 25.45  ? 337  VAL A CA    1 
ATOM   290  C C     . VAL A 1 40  ? -6.473  -23.520 53.957  1.00 26.85  ? 337  VAL A C     1 
ATOM   291  O O     . VAL A 1 40  ? -6.687  -24.449 54.723  1.00 29.08  ? 337  VAL A O     1 
ATOM   292  C CB    . VAL A 1 40  ? -7.141  -21.424 55.199  1.00 26.79  ? 337  VAL A CB    1 
ATOM   293  C CG1   . VAL A 1 40  ? -5.676  -21.056 55.371  1.00 27.49  ? 337  VAL A CG1   1 
ATOM   294  C CG2   . VAL A 1 40  ? -7.969  -20.160 55.190  1.00 29.04  ? 337  VAL A CG2   1 
ATOM   295  N N     . VAL A 1 41  ? -5.410  -23.517 53.190  1.00 29.85  ? 338  VAL A N     1 
ATOM   296  C CA    . VAL A 1 41  ? -4.386  -24.580 53.280  1.00 25.12  ? 338  VAL A CA    1 
ATOM   297  C C     . VAL A 1 41  ? -3.098  -23.832 53.344  1.00 29.06  ? 338  VAL A C     1 
ATOM   298  O O     . VAL A 1 41  ? -2.787  -22.860 52.523  1.00 30.46  ? 338  VAL A O     1 
ATOM   299  C CB    . VAL A 1 41  ? -4.364  -25.512 52.091  1.00 28.46  ? 338  VAL A CB    1 
ATOM   300  C CG1   . VAL A 1 41  ? -3.099  -26.378 52.066  1.00 28.10  ? 338  VAL A CG1   1 
ATOM   301  C CG2   . VAL A 1 41  ? -5.581  -26.432 52.069  1.00 28.84  ? 338  VAL A CG2   1 
ATOM   302  N N     . ASN A 1 42  ? -2.331  -24.215 54.336  1.00 27.36  ? 339  ASN A N     1 
ATOM   303  C CA    . ASN A 1 42  ? -1.026  -23.625 54.557  1.00 28.07  ? 339  ASN A CA    1 
ATOM   304  C C     . ASN A 1 42  ? -0.105  -24.646 55.213  1.00 31.11  ? 339  ASN A C     1 
ATOM   305  O O     . ASN A 1 42  ? -0.452  -25.814 55.294  1.00 31.62  ? 339  ASN A O     1 
ATOM   306  C CB    . ASN A 1 42  ? -1.145  -22.350 55.382  1.00 29.30  ? 339  ASN A CB    1 
ATOM   307  C CG    . ASN A 1 42  ? -1.662  -22.596 56.781  1.00 33.99  ? 339  ASN A CG    1 
ATOM   308  O OD1   . ASN A 1 42  ? -1.453  -23.674 57.373  1.00 34.46  ? 339  ASN A OD1   1 
ATOM   309  N ND2   . ASN A 1 42  ? -2.352  -21.601 57.322  1.00 32.98  ? 339  ASN A ND2   1 
ATOM   310  N N     . GLU A 1 43  ? 1.100   -24.215 55.592  1.00 33.14  ? 340  GLU A N     1 
ATOM   311  C CA    . GLU A 1 43  ? 2.115   -25.124 56.165  1.00 34.60  ? 340  GLU A CA    1 
ATOM   312  C C     . GLU A 1 43  ? 1.604   -25.872 57.411  1.00 34.73  ? 340  GLU A C     1 
ATOM   313  O O     . GLU A 1 43  ? 2.075   -26.936 57.713  1.00 37.75  ? 340  GLU A O     1 
ATOM   314  C CB    . GLU A 1 43  ? 3.384   -24.320 56.494  1.00 40.85  ? 340  GLU A CB    1 
ATOM   315  C CG    . GLU A 1 43  ? 3.121   -23.255 57.563  1.00 45.36  ? 340  GLU A CG    1 
ATOM   316  C CD    . GLU A 1 43  ? 4.190   -22.136 57.687  1.00 60.47  ? 340  GLU A CD    1 
ATOM   317  O OE1   . GLU A 1 43  ? 5.279   -22.423 58.239  1.00 55.59  ? 340  GLU A OE1   1 
ATOM   318  O OE2   . GLU A 1 43  ? 3.931   -20.948 57.266  1.00 62.64  ? 340  GLU A OE2   1 
ATOM   319  N N     . HIS A 1 44  ? 0.652   -25.311 58.152  1.00 35.39  ? 341  HIS A N     1 
ATOM   320  C CA    . HIS A 1 44  ? 0.123   -25.921 59.369  1.00 34.79  ? 341  HIS A CA    1 
ATOM   321  C C     . HIS A 1 44  ? -1.057  -26.864 59.175  1.00 38.93  ? 341  HIS A C     1 
ATOM   322  O O     . HIS A 1 44  ? -1.465  -27.558 60.111  1.00 42.10  ? 341  HIS A O     1 
ATOM   323  C CB    . HIS A 1 44  ? -0.304  -24.823 60.375  1.00 35.27  ? 341  HIS A CB    1 
ATOM   324  C CG    . HIS A 1 44  ? 0.727   -23.767 60.585  1.00 39.02  ? 341  HIS A CG    1 
ATOM   325  N ND1   . HIS A 1 44  ? 1.991   -24.050 61.048  1.00 40.88  ? 341  HIS A ND1   1 
ATOM   326  C CD2   . HIS A 1 44  ? 0.686   -22.420 60.406  1.00 43.33  ? 341  HIS A CD2   1 
ATOM   327  C CE1   . HIS A 1 44  ? 2.694   -22.936 61.116  1.00 38.21  ? 341  HIS A CE1   1 
ATOM   328  N NE2   . HIS A 1 44  ? 1.929   -21.936 60.725  1.00 41.32  ? 341  HIS A NE2   1 
ATOM   329  N N     . GLY A 1 45  ? -1.638  -26.914 57.982  1.00 37.74  ? 342  GLY A N     1 
ATOM   330  C CA    . GLY A 1 45  ? -2.723  -27.857 57.709  1.00 33.27  ? 342  GLY A CA    1 
ATOM   331  C C     . GLY A 1 45  ? -3.769  -27.312 56.781  1.00 31.01  ? 342  GLY A C     1 
ATOM   332  O O     . GLY A 1 45  ? -3.510  -26.395 56.043  1.00 31.68  ? 342  GLY A O     1 
ATOM   333  N N     . ARG A 1 46  ? -4.949  -27.911 56.856  1.00 28.46  ? 343  ARG A N     1 
ATOM   334  C CA    . ARG A 1 46  ? -6.074  -27.641 55.999  1.00 30.73  ? 343  ARG A CA    1 
ATOM   335  C C     . ARG A 1 46  ? -7.231  -27.301 56.888  1.00 34.05  ? 343  ARG A C     1 
ATOM   336  O O     . ARG A 1 46  ? -7.493  -28.041 57.822  1.00 31.87  ? 343  ARG A O     1 
ATOM   337  C CB    . ARG A 1 46  ? -6.412  -28.865 55.191  1.00 28.41  ? 343  ARG A CB    1 
ATOM   338  C CG    . ARG A 1 46  ? -5.191  -29.564 54.543  1.00 28.02  ? 343  ARG A CG    1 
ATOM   339  C CD    . ARG A 1 46  ? -5.628  -30.407 53.408  1.00 29.22  ? 343  ARG A CD    1 
ATOM   340  N NE    . ARG A 1 46  ? -4.542  -31.203 52.857  1.00 33.49  ? 343  ARG A NE    1 
ATOM   341  C CZ    . ARG A 1 46  ? -4.285  -32.465 53.203  1.00 32.95  ? 343  ARG A CZ    1 
ATOM   342  N NH1   . ARG A 1 46  ? -5.017  -33.100 54.098  1.00 32.63  ? 343  ARG A NH1   1 
ATOM   343  N NH2   . ARG A 1 46  ? -3.282  -33.065 52.653  1.00 33.60  ? 343  ARG A NH2   1 
ATOM   344  N N     . PHE A 1 47  ? -7.954  -26.221 56.563  1.00 29.10  ? 344  PHE A N     1 
ATOM   345  C CA    . PHE A 1 47  ? -9.012  -25.688 57.424  1.00 29.04  ? 344  PHE A CA    1 
ATOM   346  C C     . PHE A 1 47  ? -10.221 -25.285 56.579  1.00 32.09  ? 344  PHE A C     1 
ATOM   347  O O     . PHE A 1 47  ? -10.088 -24.749 55.469  1.00 28.24  ? 344  PHE A O     1 
ATOM   348  C CB    . PHE A 1 47  ? -8.498  -24.442 58.158  1.00 29.26  ? 344  PHE A CB    1 
ATOM   349  C CG    . PHE A 1 47  ? -7.192  -24.641 58.850  1.00 30.48  ? 344  PHE A CG    1 
ATOM   350  C CD1   . PHE A 1 47  ? -7.122  -25.182 60.133  1.00 33.40  ? 344  PHE A CD1   1 
ATOM   351  C CD2   . PHE A 1 47  ? -6.012  -24.344 58.190  1.00 34.16  ? 344  PHE A CD2   1 
ATOM   352  C CE1   . PHE A 1 47  ? -5.897  -25.368 60.760  1.00 30.70  ? 344  PHE A CE1   1 
ATOM   353  C CE2   . PHE A 1 47  ? -4.789  -24.510 58.790  1.00 32.60  ? 344  PHE A CE2   1 
ATOM   354  C CZ    . PHE A 1 47  ? -4.723  -25.052 60.072  1.00 33.15  ? 344  PHE A CZ    1 
ATOM   355  N N     . PHE A 1 48  ? -11.394 -25.604 57.066  1.00 29.74  ? 345  PHE A N     1 
ATOM   356  C CA    . PHE A 1 48  ? -12.624 -25.041 56.564  1.00 29.98  ? 345  PHE A CA    1 
ATOM   357  C C     . PHE A 1 48  ? -13.242 -24.160 57.619  1.00 34.15  ? 345  PHE A C     1 
ATOM   358  O O     . PHE A 1 48  ? -13.306 -24.537 58.791  1.00 36.63  ? 345  PHE A O     1 
ATOM   359  C CB    . PHE A 1 48  ? -13.588 -26.126 56.204  1.00 31.39  ? 345  PHE A CB    1 
ATOM   360  C CG    . PHE A 1 48  ? -14.935 -25.645 55.814  1.00 32.00  ? 345  PHE A CG    1 
ATOM   361  C CD1   . PHE A 1 48  ? -15.188 -25.299 54.517  1.00 31.04  ? 345  PHE A CD1   1 
ATOM   362  C CD2   . PHE A 1 48  ? -15.957 -25.540 56.750  1.00 31.20  ? 345  PHE A CD2   1 
ATOM   363  C CE1   . PHE A 1 48  ? -16.461 -24.888 54.118  1.00 33.75  ? 345  PHE A CE1   1 
ATOM   364  C CE2   . PHE A 1 48  ? -17.223 -25.097 56.372  1.00 33.01  ? 345  PHE A CE2   1 
ATOM   365  C CZ    . PHE A 1 48  ? -17.474 -24.780 55.050  1.00 34.09  ? 345  PHE A CZ    1 
ATOM   366  N N     . LEU A 1 49  ? -13.699 -22.984 57.200  1.00 31.76  ? 346  LEU A N     1 
ATOM   367  C CA    . LEU A 1 49  ? -14.328 -22.019 58.057  1.00 33.65  ? 346  LEU A CA    1 
ATOM   368  C C     . LEU A 1 49  ? -15.645 -21.619 57.471  1.00 35.18  ? 346  LEU A C     1 
ATOM   369  O O     . LEU A 1 49  ? -15.769 -21.359 56.263  1.00 32.26  ? 346  LEU A O     1 
ATOM   370  C CB    . LEU A 1 49  ? -13.477 -20.773 58.162  1.00 38.02  ? 346  LEU A CB    1 
ATOM   371  C CG    . LEU A 1 49  ? -12.203 -20.848 58.965  1.00 37.21  ? 346  LEU A CG    1 
ATOM   372  C CD1   . LEU A 1 49  ? -11.310 -19.686 58.591  1.00 35.74  ? 346  LEU A CD1   1 
ATOM   373  C CD2   . LEU A 1 49  ? -12.569 -20.804 60.418  1.00 39.81  ? 346  LEU A CD2   1 
ATOM   374  N N     . ARG A 1 50  ? -16.637 -21.543 58.327  1.00 33.08  ? 347  ARG A N     1 
ATOM   375  C CA    . ARG A 1 50  ? -17.932 -20.974 57.979  1.00 36.52  ? 347  ARG A CA    1 
ATOM   376  C C     . ARG A 1 50  ? -17.777 -19.465 57.820  1.00 32.01  ? 347  ARG A C     1 
ATOM   377  O O     . ARG A 1 50  ? -17.090 -18.779 58.588  1.00 35.02  ? 347  ARG A O     1 
ATOM   378  C CB    . ARG A 1 50  ? -18.971 -21.291 59.064  1.00 39.39  ? 347  ARG A CB    1 
ATOM   379  C CG    . ARG A 1 50  ? -19.207 -22.780 59.253  1.00 41.85  ? 347  ARG A CG    1 
ATOM   380  C CD    . ARG A 1 50  ? -20.201 -23.054 60.399  1.00 45.56  ? 347  ARG A CD    1 
ATOM   381  N NE    . ARG A 1 50  ? -20.331 -24.501 60.595  1.00 51.97  ? 347  ARG A NE    1 
ATOM   382  C CZ    . ARG A 1 50  ? -19.561 -25.251 61.402  1.00 51.39  ? 347  ARG A CZ    1 
ATOM   383  N NH1   . ARG A 1 50  ? -18.599 -24.721 62.151  1.00 50.03  ? 347  ARG A NH1   1 
ATOM   384  N NH2   . ARG A 1 50  ? -19.763 -26.553 61.458  1.00 51.45  ? 347  ARG A NH2   1 
ATOM   385  N N     . PRO A 1 51  ? -18.384 -18.918 56.797  1.00 32.52  ? 348  PRO A N     1 
ATOM   386  C CA    . PRO A 1 51  ? -18.159 -17.469 56.542  1.00 36.34  ? 348  PRO A CA    1 
ATOM   387  C C     . PRO A 1 51  ? -18.696 -16.519 57.609  1.00 35.25  ? 348  PRO A C     1 
ATOM   388  O O     . PRO A 1 51  ? -18.091 -15.450 57.827  1.00 35.93  ? 348  PRO A O     1 
ATOM   389  C CB    . PRO A 1 51  ? -18.863 -17.226 55.217  1.00 37.26  ? 348  PRO A CB    1 
ATOM   390  C CG    . PRO A 1 51  ? -19.791 -18.412 55.057  1.00 39.69  ? 348  PRO A CG    1 
ATOM   391  C CD    . PRO A 1 51  ? -19.284 -19.570 55.848  1.00 33.86  ? 348  PRO A CD    1 
ATOM   392  N N     . GLU A 1 52  ? -19.834 -16.888 58.221  1.00 36.01  ? 349  GLU A N     1 
ATOM   393  C CA    . GLU A 1 52  ? -20.452 -16.093 59.319  1.00 44.88  ? 349  GLU A CA    1 
ATOM   394  C C     . GLU A 1 52  ? -19.394 -15.865 60.375  1.00 44.11  ? 349  GLU A C     1 
ATOM   395  O O     . GLU A 1 52  ? -19.308 -14.820 60.949  1.00 53.11  ? 349  GLU A O     1 
ATOM   396  C CB    . GLU A 1 52  ? -21.622 -16.852 59.969  1.00 42.81  ? 349  GLU A CB    1 
ATOM   397  N N     . THR A 1 53  ? -18.565 -16.869 60.585  1.00 41.78  ? 350  THR A N     1 
ATOM   398  C CA    . THR A 1 53  ? -17.536 -16.888 61.617  1.00 41.92  ? 350  THR A CA    1 
ATOM   399  C C     . THR A 1 53  ? -16.296 -16.125 61.140  1.00 39.66  ? 350  THR A C     1 
ATOM   400  O O     . THR A 1 53  ? -15.844 -15.149 61.753  1.00 43.08  ? 350  THR A O     1 
ATOM   401  C CB    . THR A 1 53  ? -17.135 -18.393 61.916  1.00 43.89  ? 350  THR A CB    1 
ATOM   402  O OG1   . THR A 1 53  ? -18.279 -19.115 62.403  1.00 49.77  ? 350  THR A OG1   1 
ATOM   403  C CG2   . THR A 1 53  ? -15.968 -18.538 62.947  1.00 49.72  ? 350  THR A CG2   1 
ATOM   404  N N     . ALA A 1 54  ? -15.721 -16.586 60.030  1.00 36.26  ? 351  ALA A N     1 
ATOM   405  C CA    . ALA A 1 54  ? -14.479 -16.010 59.544  1.00 32.08  ? 351  ALA A CA    1 
ATOM   406  C C     . ALA A 1 54  ? -14.601 -14.530 59.269  1.00 29.25  ? 351  ALA A C     1 
ATOM   407  O O     . ALA A 1 54  ? -13.781 -13.758 59.707  1.00 29.96  ? 351  ALA A O     1 
ATOM   408  C CB    . ALA A 1 54  ? -13.996 -16.729 58.297  1.00 34.32  ? 351  ALA A CB    1 
ATOM   409  N N     . LEU A 1 55  ? -15.642 -14.141 58.543  1.00 30.75  ? 352  LEU A N     1 
ATOM   410  C CA    . LEU A 1 55  ? -15.789 -12.772 58.105  1.00 32.10  ? 352  LEU A CA    1 
ATOM   411  C C     . LEU A 1 55  ? -16.240 -11.786 59.193  1.00 34.41  ? 352  LEU A C     1 
ATOM   412  O O     . LEU A 1 55  ? -16.221 -10.596 58.951  1.00 34.61  ? 352  LEU A O     1 
ATOM   413  C CB    . LEU A 1 55  ? -16.716 -12.684 56.889  1.00 30.90  ? 352  LEU A CB    1 
ATOM   414  C CG    . LEU A 1 55  ? -16.199 -13.507 55.670  1.00 33.39  ? 352  LEU A CG    1 
ATOM   415  C CD1   . LEU A 1 55  ? -17.112 -13.379 54.481  1.00 36.48  ? 352  LEU A CD1   1 
ATOM   416  C CD2   . LEU A 1 55  ? -14.816 -13.051 55.273  1.00 32.69  ? 352  LEU A CD2   1 
ATOM   417  N N     . ALA A 1 56  ? -16.602 -12.292 60.358  1.00 34.45  ? 353  ALA A N     1 
ATOM   418  C CA    . ALA A 1 56  ? -16.875 -11.473 61.528  1.00 40.96  ? 353  ALA A CA    1 
ATOM   419  C C     . ALA A 1 56  ? -15.638 -11.404 62.422  1.00 41.16  ? 353  ALA A C     1 
ATOM   420  O O     . ALA A 1 56  ? -15.661 -10.759 63.445  1.00 44.71  ? 353  ALA A O     1 
ATOM   421  C CB    . ALA A 1 56  ? -18.045 -12.112 62.318  1.00 42.57  ? 353  ALA A CB    1 
ATOM   422  N N     . ASP A 1 57  ? -14.587 -12.147 62.109  1.00 36.84  ? 354  ASP A N     1 
ATOM   423  C CA    . ASP A 1 57  ? -13.455 -12.239 63.018  1.00 34.94  ? 354  ASP A CA    1 
ATOM   424  C C     . ASP A 1 57  ? -12.455 -11.181 62.618  1.00 37.24  ? 354  ASP A C     1 
ATOM   425  O O     . ASP A 1 57  ? -11.953 -11.204 61.511  1.00 35.11  ? 354  ASP A O     1 
ATOM   426  C CB    . ASP A 1 57  ? -12.852 -13.648 62.990  1.00 36.15  ? 354  ASP A CB    1 
ATOM   427  C CG    . ASP A 1 57  ? -11.647 -13.790 63.890  1.00 38.97  ? 354  ASP A CG    1 
ATOM   428  O OD1   . ASP A 1 57  ? -10.561 -13.187 63.668  1.00 47.02  ? 354  ASP A OD1   1 
ATOM   429  O OD2   . ASP A 1 57  ? -11.761 -14.564 64.823  1.00 45.87  ? 354  ASP A OD2   1 
ATOM   430  N N     . PRO A 1 58  ? -12.109 -10.251 63.531  1.00 35.19  ? 355  PRO A N     1 
ATOM   431  C CA    . PRO A 1 58  ? -11.205 -9.165  63.143  1.00 37.82  ? 355  PRO A CA    1 
ATOM   432  C C     . PRO A 1 58  ? -9.816  -9.591  62.674  1.00 37.54  ? 355  PRO A C     1 
ATOM   433  O O     . PRO A 1 58  ? -9.231  -8.890  61.871  1.00 29.60  ? 355  PRO A O     1 
ATOM   434  C CB    . PRO A 1 58  ? -11.029 -8.336  64.456  1.00 39.68  ? 355  PRO A CB    1 
ATOM   435  C CG    . PRO A 1 58  ? -12.225 -8.652  65.252  1.00 38.32  ? 355  PRO A CG    1 
ATOM   436  C CD    . PRO A 1 58  ? -12.670 -10.055 64.877  1.00 41.03  ? 355  PRO A CD    1 
ATOM   437  N N     . GLN A 1 59  ? -9.283  -10.663 63.244  1.00 37.50  ? 356  GLN A N     1 
ATOM   438  C CA    . GLN A 1 59  ? -7.951  -11.155 62.884  1.00 40.11  ? 356  GLN A CA    1 
ATOM   439  C C     . GLN A 1 59  ? -8.007  -11.736 61.466  1.00 36.15  ? 356  GLN A C     1 
ATOM   440  O O     . GLN A 1 59  ? -7.118  -11.521 60.673  1.00 36.13  ? 356  GLN A O     1 
ATOM   441  C CB    . GLN A 1 59  ? -7.508  -12.329 63.776  1.00 45.24  ? 356  GLN A CB    1 
ATOM   442  C CG    . GLN A 1 59  ? -8.003  -12.348 65.208  1.00 61.44  ? 356  GLN A CG    1 
ATOM   443  C CD    . GLN A 1 59  ? -7.536  -11.129 65.861  1.00 60.33  ? 356  GLN A CD    1 
ATOM   444  O OE1   . GLN A 1 59  ? -6.365  -10.817 65.739  1.00 71.44  ? 356  GLN A OE1   1 
ATOM   445  N NE2   . GLN A 1 59  ? -8.433  -10.376 66.463  1.00 60.94  ? 356  GLN A NE2   1 
ATOM   446  N N     . PHE A 1 60  ? -9.063  -12.483 61.179  1.00 34.15  ? 357  PHE A N     1 
ATOM   447  C CA    . PHE A 1 60  ? -9.199  -13.028 59.822  1.00 35.03  ? 357  PHE A CA    1 
ATOM   448  C C     . PHE A 1 60  ? -9.325  -11.932 58.756  1.00 34.00  ? 357  PHE A C     1 
ATOM   449  O O     . PHE A 1 60  ? -8.607  -11.919 57.706  1.00 32.35  ? 357  PHE A O     1 
ATOM   450  C CB    . PHE A 1 60  ? -10.341 -13.997 59.742  1.00 33.63  ? 357  PHE A CB    1 
ATOM   451  C CG    . PHE A 1 60  ? -10.354 -14.778 58.450  1.00 34.62  ? 357  PHE A CG    1 
ATOM   452  C CD1   . PHE A 1 60  ? -9.491  -15.845 58.272  1.00 35.22  ? 357  PHE A CD1   1 
ATOM   453  C CD2   . PHE A 1 60  ? -11.200 -14.411 57.401  1.00 33.43  ? 357  PHE A CD2   1 
ATOM   454  C CE1   . PHE A 1 60  ? -9.461  -16.565 57.055  1.00 36.80  ? 357  PHE A CE1   1 
ATOM   455  C CE2   . PHE A 1 60  ? -11.188 -15.133 56.179  1.00 35.53  ? 357  PHE A CE2   1 
ATOM   456  C CZ    . PHE A 1 60  ? -10.318 -16.214 56.027  1.00 32.41  ? 357  PHE A CZ    1 
ATOM   457  N N     . VAL A 1 61  ? -10.190 -10.968 59.042  1.00 32.83  ? 358  VAL A N     1 
ATOM   458  C CA    . VAL A 1 61  ? -10.385 -9.810  58.141  1.00 32.50  ? 358  VAL A CA    1 
ATOM   459  C C     . VAL A 1 61  ? -9.089  -9.014  57.967  1.00 32.77  ? 358  VAL A C     1 
ATOM   460  O O     . VAL A 1 61  ? -8.737  -8.593  56.860  1.00 31.37  ? 358  VAL A O     1 
ATOM   461  C CB    . VAL A 1 61  ? -11.556 -8.914  58.626  1.00 34.75  ? 358  VAL A CB    1 
ATOM   462  C CG1   . VAL A 1 61  ? -11.720 -7.664  57.765  1.00 35.30  ? 358  VAL A CG1   1 
ATOM   463  C CG2   . VAL A 1 61  ? -12.869 -9.726  58.627  1.00 36.33  ? 358  VAL A CG2   1 
ATOM   464  N N     . ALA A 1 62  ? -8.320  -8.842  59.031  1.00 31.41  ? 359  ALA A N     1 
ATOM   465  C CA    . ALA A 1 62  ? -7.053  -8.115  58.887  1.00 30.71  ? 359  ALA A CA    1 
ATOM   466  C C     . ALA A 1 62  ? -6.058  -8.962  58.068  1.00 26.77  ? 359  ALA A C     1 
ATOM   467  O O     . ALA A 1 62  ? -5.255  -8.427  57.310  1.00 29.11  ? 359  ALA A O     1 
ATOM   468  C CB    . ALA A 1 62  ? -6.444  -7.821  60.258  1.00 31.88  ? 359  ALA A CB    1 
ATOM   469  N N     . TRP A 1 63  ? -6.065  -10.270 58.279  1.00 28.23  ? 360  TRP A N     1 
ATOM   470  C CA    . TRP A 1 63  ? -5.245  -11.157 57.462  1.00 31.22  ? 360  TRP A CA    1 
ATOM   471  C C     . TRP A 1 63  ? -5.607  -11.086 55.955  1.00 27.44  ? 360  TRP A C     1 
ATOM   472  O O     . TRP A 1 63  ? -4.745  -10.936 55.105  1.00 29.42  ? 360  TRP A O     1 
ATOM   473  C CB    . TRP A 1 63  ? -5.335  -12.561 58.004  1.00 31.26  ? 360  TRP A CB    1 
ATOM   474  C CG    . TRP A 1 63  ? -4.542  -13.574 57.188  1.00 34.48  ? 360  TRP A CG    1 
ATOM   475  C CD1   . TRP A 1 63  ? -3.189  -13.859 57.264  1.00 33.31  ? 360  TRP A CD1   1 
ATOM   476  C CD2   . TRP A 1 63  ? -5.075  -14.433 56.178  1.00 31.09  ? 360  TRP A CD2   1 
ATOM   477  N NE1   . TRP A 1 63  ? -2.882  -14.868 56.383  1.00 31.80  ? 360  TRP A NE1   1 
ATOM   478  C CE2   . TRP A 1 63  ? -4.021  -15.243 55.718  1.00 31.50  ? 360  TRP A CE2   1 
ATOM   479  C CE3   . TRP A 1 63  ? -6.364  -14.619 55.636  1.00 29.31  ? 360  TRP A CE3   1 
ATOM   480  C CZ2   . TRP A 1 63  ? -4.205  -16.197 54.709  1.00 30.24  ? 360  TRP A CZ2   1 
ATOM   481  C CZ3   . TRP A 1 63  ? -6.534  -15.637 54.639  1.00 29.75  ? 360  TRP A CZ3   1 
ATOM   482  C CH2   . TRP A 1 63  ? -5.470  -16.347 54.181  1.00 29.14  ? 360  TRP A CH2   1 
ATOM   483  N N     . LEU A 1 64  ? -6.898  -11.107 55.650  1.00 25.82  ? 361  LEU A N     1 
ATOM   484  C CA    . LEU A 1 64  ? -7.342  -10.944 54.282  1.00 27.38  ? 361  LEU A CA    1 
ATOM   485  C C     . LEU A 1 64  ? -6.781  -9.680  53.639  1.00 31.09  ? 361  LEU A C     1 
ATOM   486  O O     . LEU A 1 64  ? -6.346  -9.715  52.476  1.00 29.68  ? 361  LEU A O     1 
ATOM   487  C CB    . LEU A 1 64  ? -8.880  -10.882 54.226  1.00 28.25  ? 361  LEU A CB    1 
ATOM   488  C CG    . LEU A 1 64  ? -9.612  -12.183 54.364  1.00 28.74  ? 361  LEU A CG    1 
ATOM   489  C CD1   . LEU A 1 64  ? -11.124 -11.953 54.420  1.00 28.00  ? 361  LEU A CD1   1 
ATOM   490  C CD2   . LEU A 1 64  ? -9.220  -13.182 53.259  1.00 27.89  ? 361  LEU A CD2   1 
ATOM   491  N N     . GLY A 1 65  ? -6.823  -8.577  54.405  1.00 30.73  ? 362  GLY A N     1 
ATOM   492  C CA    . GLY A 1 65  ? -6.431  -7.278  53.950  1.00 29.41  ? 362  GLY A CA    1 
ATOM   493  C C     . GLY A 1 65  ? -4.933  -6.904  54.030  1.00 32.70  ? 362  GLY A C     1 
ATOM   494  O O     . GLY A 1 65  ? -4.525  -5.802  53.701  1.00 30.76  ? 362  GLY A O     1 
ATOM   495  N N     . ASP A 1 66  ? -4.102  -7.804  54.479  1.00 34.70  ? 363  ASP A N     1 
ATOM   496  C CA    . ASP A 1 66  ? -2.706  -7.515  54.646  1.00 32.37  ? 363  ASP A CA    1 
ATOM   497  C C     . ASP A 1 66  ? -1.917  -8.025  53.386  1.00 33.51  ? 363  ASP A C     1 
ATOM   498  O O     . ASP A 1 66  ? -1.794  -9.225  53.153  1.00 30.31  ? 363  ASP A O     1 
ATOM   499  C CB    . ASP A 1 66  ? -2.258  -8.216  55.908  1.00 29.58  ? 363  ASP A CB    1 
ATOM   500  C CG    . ASP A 1 66  ? -0.811  -7.931  56.263  1.00 33.87  ? 363  ASP A CG    1 
ATOM   501  O OD1   . ASP A 1 66  ? -0.062  -7.369  55.424  1.00 32.25  ? 363  ASP A OD1   1 
ATOM   502  O OD2   . ASP A 1 66  ? -0.431  -8.304  57.388  1.00 35.71  ? 363  ASP A OD2   1 
ATOM   503  N N     . GLU A 1 67  ? -1.390  -7.082  52.619  1.00 31.48  ? 364  GLU A N     1 
ATOM   504  C CA    . GLU A 1 67  ? -0.609  -7.315  51.453  1.00 34.98  ? 364  GLU A CA    1 
ATOM   505  C C     . GLU A 1 67  ? 0.607   -8.208  51.696  1.00 33.91  ? 364  GLU A C     1 
ATOM   506  O O     . GLU A 1 67  ? 1.091   -8.784  50.757  1.00 34.82  ? 364  GLU A O     1 
ATOM   507  C CB    . GLU A 1 67  ? -0.163  -5.965  50.802  1.00 34.82  ? 364  GLU A CB    1 
ATOM   508  N N     . THR A 1 68  ? 1.110   -8.312  52.921  1.00 35.58  ? 365  THR A N     1 
ATOM   509  C CA    . THR A 1 68  ? 2.291   -9.116  53.187  1.00 33.45  ? 365  THR A CA    1 
ATOM   510  C C     . THR A 1 68  ? 1.979   -10.564 53.541  1.00 32.37  ? 365  THR A C     1 
ATOM   511  O O     . THR A 1 68  ? 2.875   -11.358 53.670  1.00 35.61  ? 365  THR A O     1 
ATOM   512  C CB    . THR A 1 68  ? 3.139   -8.570  54.378  1.00 35.85  ? 365  THR A CB    1 
ATOM   513  O OG1   . THR A 1 68  ? 2.364   -8.638  55.579  1.00 37.74  ? 365  THR A OG1   1 
ATOM   514  C CG2   . THR A 1 68  ? 3.601   -7.197  54.110  1.00 37.27  ? 365  THR A CG2   1 
ATOM   515  N N     . LYS A 1 69  ? 0.706   -10.872 53.760  1.00 32.22  ? 366  LYS A N     1 
ATOM   516  C CA    . LYS A 1 69  ? 0.197   -12.202 53.869  1.00 32.60  ? 366  LYS A CA    1 
ATOM   517  C C     . LYS A 1 69  ? -0.252  -12.709 52.476  1.00 32.07  ? 366  LYS A C     1 
ATOM   518  O O     . LYS A 1 69  ? -1.275  -12.248 51.944  1.00 29.30  ? 366  LYS A O     1 
ATOM   519  C CB    . LYS A 1 69  ? -0.988  -12.217 54.858  1.00 32.47  ? 366  LYS A CB    1 
ATOM   520  C CG    . LYS A 1 69  ? -0.650  -11.547 56.175  1.00 37.06  ? 366  LYS A CG    1 
ATOM   521  C CD    . LYS A 1 69  ? 0.406   -12.316 57.003  1.00 37.16  ? 366  LYS A CD    1 
ATOM   522  C CE    . LYS A 1 69  ? 0.615   -11.577 58.323  1.00 40.59  ? 366  LYS A CE    1 
ATOM   523  N NZ    . LYS A 1 69  ? 2.045   -11.560 58.605  1.00 48.68  ? 366  LYS A NZ    1 
ATOM   524  N N     . LYS A 1 70  ? 0.532   -13.615 51.898  1.00 28.91  ? 367  LYS A N     1 
ATOM   525  C CA    . LYS A 1 70  ? 0.377   -13.978 50.508  1.00 28.51  ? 367  LYS A CA    1 
ATOM   526  C C     . LYS A 1 70  ? -0.610  -15.132 50.330  1.00 28.46  ? 367  LYS A C     1 
ATOM   527  O O     . LYS A 1 70  ? -0.527  -16.133 51.029  1.00 28.38  ? 367  LYS A O     1 
ATOM   528  C CB    . LYS A 1 70  ? 1.735   -14.346 49.905  1.00 32.08  ? 367  LYS A CB    1 
ATOM   529  C CG    . LYS A 1 70  ? 2.810   -13.255 50.033  1.00 31.22  ? 367  LYS A CG    1 
ATOM   530  C CD    . LYS A 1 70  ? 2.317   -11.892 49.507  1.00 36.16  ? 367  LYS A CD    1 
ATOM   531  C CE    . LYS A 1 70  ? 3.474   -10.873 49.570  1.00 35.45  ? 367  LYS A CE    1 
ATOM   532  N NZ    . LYS A 1 70  ? 3.050   -9.597  48.944  1.00 39.51  ? 367  LYS A NZ    1 
ATOM   533  N N     . LYS A 1 71  ? -1.549  -14.954 49.394  1.00 27.21  ? 368  LYS A N     1 
ATOM   534  C CA    . LYS A 1 71  ? -2.544  -15.928 49.099  1.00 27.04  ? 368  LYS A CA    1 
ATOM   535  C C     . LYS A 1 71  ? -2.464  -16.387 47.638  1.00 28.78  ? 368  LYS A C     1 
ATOM   536  O O     . LYS A 1 71  ? -2.145  -15.618 46.716  1.00 28.75  ? 368  LYS A O     1 
ATOM   537  C CB    . LYS A 1 71  ? -3.940  -15.341 49.299  1.00 28.36  ? 368  LYS A CB    1 
ATOM   538  C CG    . LYS A 1 71  ? -4.268  -14.930 50.706  1.00 27.45  ? 368  LYS A CG    1 
ATOM   539  C CD    . LYS A 1 71  ? -4.135  -13.454 50.927  1.00 28.30  ? 368  LYS A CD    1 
ATOM   540  C CE    . LYS A 1 71  ? -4.366  -13.023 52.394  1.00 29.15  ? 368  LYS A CE    1 
ATOM   541  N NZ    . LYS A 1 71  ? -3.787  -11.670 52.521  1.00 30.18  ? 368  LYS A NZ    1 
ATOM   542  N N     . SER A 1 72  ? -2.739  -17.664 47.448  1.00 25.06  ? 369  SER A N     1 
ATOM   543  C CA    . SER A 1 72  ? -2.879  -18.277 46.143  1.00 24.18  ? 369  SER A CA    1 
ATOM   544  C C     . SER A 1 72  ? -4.315  -18.702 45.978  1.00 23.47  ? 369  SER A C     1 
ATOM   545  O O     . SER A 1 72  ? -4.920  -19.345 46.890  1.00 24.47  ? 369  SER A O     1 
ATOM   546  C CB    . SER A 1 72  ? -1.953  -19.494 46.064  1.00 26.65  ? 369  SER A CB    1 
ATOM   547  O OG    . SER A 1 72  ? -0.601  -19.065 46.204  1.00 29.57  ? 369  SER A OG    1 
ATOM   548  N N     . MET A 1 73  ? -4.915  -18.273 44.875  1.00 24.24  ? 370  MET A N     1 
ATOM   549  C CA    . MET A 1 73  ? -6.333  -18.529 44.679  1.00 23.56  ? 370  MET A CA    1 
ATOM   550  C C     . MET A 1 73  ? -6.648  -18.971 43.290  1.00 22.72  ? 370  MET A C     1 
ATOM   551  O O     . MET A 1 73  ? -5.786  -19.001 42.407  1.00 22.58  ? 370  MET A O     1 
ATOM   552  C CB    . MET A 1 73  ? -7.108  -17.257 44.947  1.00 24.81  ? 370  MET A CB    1 
ATOM   553  C CG    . MET A 1 73  ? -6.727  -16.615 46.291  1.00 28.29  ? 370  MET A CG    1 
ATOM   554  S SD    . MET A 1 73  ? -7.843  -15.311 46.866  1.00 25.72  ? 370  MET A SD    1 
ATOM   555  C CE    . MET A 1 73  ? -9.430  -16.094 46.938  1.00 24.12  ? 370  MET A CE    1 
ATOM   556  N N     . PHE A 1 74  ? -7.904  -19.331 43.083  1.00 20.82  ? 371  PHE A N     1 
ATOM   557  C CA    . PHE A 1 74  ? -8.433  -19.423 41.736  1.00 22.13  ? 371  PHE A CA    1 
ATOM   558  C C     . PHE A 1 74  ? -9.556  -18.415 41.522  1.00 23.46  ? 371  PHE A C     1 
ATOM   559  O O     . PHE A 1 74  ? -10.614 -18.485 42.197  1.00 24.74  ? 371  PHE A O     1 
ATOM   560  C CB    . PHE A 1 74  ? -8.929  -20.889 41.505  1.00 22.87  ? 371  PHE A CB    1 
ATOM   561  C CG    . PHE A 1 74  ? -9.415  -21.191 40.100  1.00 22.71  ? 371  PHE A CG    1 
ATOM   562  C CD1   . PHE A 1 74  ? -10.716 -20.889 39.704  1.00 24.17  ? 371  PHE A CD1   1 
ATOM   563  C CD2   . PHE A 1 74  ? -8.593  -21.889 39.201  1.00 24.63  ? 371  PHE A CD2   1 
ATOM   564  C CE1   . PHE A 1 74  ? -11.142 -21.192 38.425  1.00 21.96  ? 371  PHE A CE1   1 
ATOM   565  C CE2   . PHE A 1 74  ? -9.002  -22.212 37.927  1.00 21.88  ? 371  PHE A CE2   1 
ATOM   566  C CZ    . PHE A 1 74  ? -10.269 -21.841 37.513  1.00 23.81  ? 371  PHE A CZ    1 
ATOM   567  N N     . ASP A 1 75  ? -9.385  -17.505 40.566  1.00 23.43  ? 372  ASP A N     1 
ATOM   568  C CA    . ASP A 1 75  ? -10.409 -16.498 40.263  1.00 23.85  ? 372  ASP A CA    1 
ATOM   569  C C     . ASP A 1 75  ? -10.579 -15.562 41.491  1.00 23.80  ? 372  ASP A C     1 
ATOM   570  O O     . ASP A 1 75  ? -11.668 -15.434 42.110  1.00 24.84  ? 372  ASP A O     1 
ATOM   571  C CB    . ASP A 1 75  ? -11.770 -17.120 39.939  1.00 26.87  ? 372  ASP A CB    1 
ATOM   572  C CG    . ASP A 1 75  ? -12.735 -16.125 39.285  1.00 29.59  ? 372  ASP A CG    1 
ATOM   573  O OD1   . ASP A 1 75  ? -12.350 -14.935 39.065  1.00 26.70  ? 372  ASP A OD1   1 
ATOM   574  O OD2   . ASP A 1 75  ? -13.924 -16.493 39.029  1.00 27.59  ? 372  ASP A OD2   1 
ATOM   575  N N     . SER A 1 76  ? -9.483  -14.934 41.834  1.00 21.90  ? 373  SER A N     1 
ATOM   576  C CA    . SER A 1 76  ? -9.406  -14.026 42.922  1.00 23.54  ? 373  SER A CA    1 
ATOM   577  C C     . SER A 1 76  ? -10.305 -12.793 42.735  1.00 25.17  ? 373  SER A C     1 
ATOM   578  O O     . SER A 1 76  ? -10.767 -12.251 43.727  1.00 28.89  ? 373  SER A O     1 
ATOM   579  C CB    . SER A 1 76  ? -7.960  -13.672 43.232  1.00 23.83  ? 373  SER A CB    1 
ATOM   580  O OG    . SER A 1 76  ? -7.432  -12.830 42.230  1.00 25.94  ? 373  SER A OG    1 
ATOM   581  N N     . LYS A 1 77  ? -10.632 -12.425 41.491  1.00 23.31  ? 374  LYS A N     1 
ATOM   582  C CA    . LYS A 1 77  ? -11.544 -11.347 41.247  1.00 22.66  ? 374  LYS A CA    1 
ATOM   583  C C     . LYS A 1 77  ? -12.943 -11.578 41.784  1.00 23.76  ? 374  LYS A C     1 
ATOM   584  O O     . LYS A 1 77  ? -13.558 -10.676 42.379  1.00 22.28  ? 374  LYS A O     1 
ATOM   585  C CB    . LYS A 1 77  ? -11.556 -10.913 39.806  1.00 23.92  ? 374  LYS A CB    1 
ATOM   586  C CG    . LYS A 1 77  ? -12.527 -9.821  39.513  1.00 22.33  ? 374  LYS A CG    1 
ATOM   587  C CD    . LYS A 1 77  ? -12.258 -9.042  38.193  1.00 23.34  ? 374  LYS A CD    1 
ATOM   588  C CE    . LYS A 1 77  ? -12.232 -9.914  36.951  1.00 21.65  ? 374  LYS A CE    1 
ATOM   589  N NZ    . LYS A 1 77  ? -13.638 -10.360 36.603  1.00 20.84  ? 374  LYS A NZ    1 
ATOM   590  N N     . ARG A 1 78  ? -13.412 -12.782 41.625  1.00 21.89  ? 375  ARG A N     1 
ATOM   591  C CA    . ARG A 1 78  ? -14.725 -13.188 42.122  1.00 23.53  ? 375  ARG A CA    1 
ATOM   592  C C     . ARG A 1 78  ? -14.776 -12.975 43.616  1.00 25.00  ? 375  ARG A C     1 
ATOM   593  O O     . ARG A 1 78  ? -15.721 -12.372 44.109  1.00 24.28  ? 375  ARG A O     1 
ATOM   594  C CB    . ARG A 1 78  ? -14.984 -14.638 41.738  1.00 23.81  ? 375  ARG A CB    1 
ATOM   595  C CG    . ARG A 1 78  ? -16.068 -15.432 42.438  1.00 21.71  ? 375  ARG A CG    1 
ATOM   596  C CD    . ARG A 1 78  ? -16.210 -16.861 41.805  1.00 23.30  ? 375  ARG A CD    1 
ATOM   597  N NE    . ARG A 1 78  ? -16.700 -16.742 40.453  1.00 25.17  ? 375  ARG A NE    1 
ATOM   598  C CZ    . ARG A 1 78  ? -17.991 -16.658 40.101  1.00 26.86  ? 375  ARG A CZ    1 
ATOM   599  N NH1   . ARG A 1 78  ? -18.952 -16.759 40.987  1.00 28.35  ? 375  ARG A NH1   1 
ATOM   600  N NH2   . ARG A 1 78  ? -18.315 -16.413 38.867  1.00 24.67  ? 375  ARG A NH2   1 
ATOM   601  N N     . ALA A 1 79  ? -13.772 -13.465 44.341  1.00 22.23  ? 376  ALA A N     1 
ATOM   602  C CA    . ALA A 1 79  ? -13.735 -13.365 45.784  1.00 26.25  ? 376  ALA A CA    1 
ATOM   603  C C     . ALA A 1 79  ? -13.596 -11.909 46.199  1.00 25.70  ? 376  ALA A C     1 
ATOM   604  O O     . ALA A 1 79  ? -14.270 -11.460 47.132  1.00 23.36  ? 376  ALA A O     1 
ATOM   605  C CB    . ALA A 1 79  ? -12.550 -14.189 46.360  1.00 26.47  ? 376  ALA A CB    1 
ATOM   606  N N     . ALA A 1 80  ? -12.722 -11.173 45.499  1.00 22.88  ? 377  ALA A N     1 
ATOM   607  C CA    . ALA A 1 80  ? -12.448 -9.805  45.832  1.00 23.42  ? 377  ALA A CA    1 
ATOM   608  C C     . ALA A 1 80  ? -13.686 -8.925  45.700  1.00 25.52  ? 377  ALA A C     1 
ATOM   609  O O     . ALA A 1 80  ? -13.967 -8.130  46.598  1.00 26.43  ? 377  ALA A O     1 
ATOM   610  C CB    . ALA A 1 80  ? -11.293 -9.242  44.986  1.00 25.45  ? 377  ALA A CB    1 
ATOM   611  N N     . VAL A 1 81  ? -14.420 -9.091  44.611  1.00 21.82  ? 378  VAL A N     1 
ATOM   612  C CA    . VAL A 1 81  ? -15.596 -8.352  44.404  1.00 23.10  ? 378  VAL A CA    1 
ATOM   613  C C     . VAL A 1 81  ? -16.708 -8.746  45.442  1.00 25.59  ? 378  VAL A C     1 
ATOM   614  O O     . VAL A 1 81  ? -17.299 -7.882  46.060  1.00 23.96  ? 378  VAL A O     1 
ATOM   615  C CB    . VAL A 1 81  ? -16.127 -8.510  42.997  1.00 22.33  ? 378  VAL A CB    1 
ATOM   616  C CG1   . VAL A 1 81  ? -17.502 -7.867  42.889  1.00 23.23  ? 378  VAL A CG1   1 
ATOM   617  C CG2   . VAL A 1 81  ? -15.172 -7.884  42.005  1.00 23.07  ? 378  VAL A CG2   1 
ATOM   618  N N     . ALA A 1 82  ? -16.884 -10.036 45.699  1.00 25.04  ? 379  ALA A N     1 
ATOM   619  C CA    . ALA A 1 82  ? -17.904 -10.458 46.612  1.00 24.45  ? 379  ALA A CA    1 
ATOM   620  C C     . ALA A 1 82  ? -17.607 -9.888  47.996  1.00 25.89  ? 379  ALA A C     1 
ATOM   621  O O     . ALA A 1 82  ? -18.532 -9.515  48.750  1.00 25.51  ? 379  ALA A O     1 
ATOM   622  C CB    . ALA A 1 82  ? -17.994 -11.972 46.642  1.00 25.10  ? 379  ALA A CB    1 
ATOM   623  N N     . LEU A 1 83  ? -16.321 -9.847  48.345  1.00 25.08  ? 380  LEU A N     1 
ATOM   624  C CA    . LEU A 1 83  ? -15.866 -9.297  49.592  1.00 27.23  ? 380  LEU A CA    1 
ATOM   625  C C     . LEU A 1 83  ? -16.021 -7.762  49.657  1.00 28.93  ? 380  LEU A C     1 
ATOM   626  O O     . LEU A 1 83  ? -16.379 -7.230  50.716  1.00 29.11  ? 380  LEU A O     1 
ATOM   627  C CB    . LEU A 1 83  ? -14.429 -9.715  49.915  1.00 27.27  ? 380  LEU A CB    1 
ATOM   628  C CG    . LEU A 1 83  ? -14.240 -11.205 50.324  1.00 26.40  ? 380  LEU A CG    1 
ATOM   629  C CD1   . LEU A 1 83  ? -12.792 -11.608 50.261  1.00 27.88  ? 380  LEU A CD1   1 
ATOM   630  C CD2   . LEU A 1 83  ? -14.812 -11.531 51.667  1.00 25.63  ? 380  LEU A CD2   1 
ATOM   631  N N     . LYS A 1 84  ? -15.795 -7.070  48.540  1.00 25.77  ? 381  LYS A N     1 
ATOM   632  C CA    . LYS A 1 84  ? -16.024 -5.668  48.472  1.00 27.24  ? 381  LYS A CA    1 
ATOM   633  C C     . LYS A 1 84  ? -17.481 -5.321  48.818  1.00 26.41  ? 381  LYS A C     1 
ATOM   634  O O     . LYS A 1 84  ? -17.744 -4.323  49.508  1.00 24.74  ? 381  LYS A O     1 
ATOM   635  C CB    . LYS A 1 84  ? -15.711 -5.070  47.109  1.00 29.78  ? 381  LYS A CB    1 
ATOM   636  C CG    . LYS A 1 84  ? -14.263 -4.744  46.827  1.00 30.65  ? 381  LYS A CG    1 
ATOM   637  C CD    . LYS A 1 84  ? -14.079 -4.233  45.408  1.00 36.13  ? 381  LYS A CD    1 
ATOM   638  C CE    . LYS A 1 84  ? -12.622 -4.368  44.882  1.00 36.55  ? 381  LYS A CE    1 
ATOM   639  N NZ    . LYS A 1 84  ? -11.761 -3.315  45.432  1.00 41.87  ? 381  LYS A NZ    1 
ATOM   640  N N     . TRP A 1 85  ? -18.428 -6.084  48.296  1.00 25.75  ? 382  TRP A N     1 
ATOM   641  C CA    . TRP A 1 85  ? -19.814 -5.827  48.635  1.00 28.36  ? 382  TRP A CA    1 
ATOM   642  C C     . TRP A 1 85  ? -20.143 -5.989  50.131  1.00 29.85  ? 382  TRP A C     1 
ATOM   643  O O     . TRP A 1 85  ? -21.198 -5.588  50.553  1.00 28.25  ? 382  TRP A O     1 
ATOM   644  C CB    . TRP A 1 85  ? -20.727 -6.720  47.823  1.00 27.13  ? 382  TRP A CB    1 
ATOM   645  C CG    . TRP A 1 85  ? -20.910 -6.252  46.393  1.00 27.15  ? 382  TRP A CG    1 
ATOM   646  C CD1   . TRP A 1 85  ? -20.193 -6.680  45.288  1.00 26.51  ? 382  TRP A CD1   1 
ATOM   647  C CD2   . TRP A 1 85  ? -21.929 -5.398  45.891  1.00 26.31  ? 382  TRP A CD2   1 
ATOM   648  N NE1   . TRP A 1 85  ? -20.698 -6.124  44.157  1.00 25.74  ? 382  TRP A NE1   1 
ATOM   649  C CE2   . TRP A 1 85  ? -21.724 -5.289  44.471  1.00 27.33  ? 382  TRP A CE2   1 
ATOM   650  C CE3   . TRP A 1 85  ? -22.909 -4.621  46.482  1.00 25.74  ? 382  TRP A CE3   1 
ATOM   651  C CZ2   . TRP A 1 85  ? -22.519 -4.495  43.668  1.00 26.14  ? 382  TRP A CZ2   1 
ATOM   652  C CZ3   . TRP A 1 85  ? -23.719 -3.824  45.670  1.00 24.92  ? 382  TRP A CZ3   1 
ATOM   653  C CH2   . TRP A 1 85  ? -23.532 -3.770  44.301  1.00 25.07  ? 382  TRP A CH2   1 
ATOM   654  N N     . LYS A 1 86  ? -19.281 -6.670  50.856  1.00 30.36  ? 383  LYS A N     1 
ATOM   655  C CA    . LYS A 1 86  ? -19.435 -6.882  52.307  1.00 31.21  ? 383  LYS A CA    1 
ATOM   656  C C     . LYS A 1 86  ? -18.523 -5.954  53.044  1.00 32.70  ? 383  LYS A C     1 
ATOM   657  O O     . LYS A 1 86  ? -18.375 -6.084  54.240  1.00 32.71  ? 383  LYS A O     1 
ATOM   658  C CB    . LYS A 1 86  ? -19.143 -8.336  52.677  1.00 31.19  ? 383  LYS A CB    1 
ATOM   659  C CG    . LYS A 1 86  ? -20.200 -9.314  52.196  1.00 31.01  ? 383  LYS A CG    1 
ATOM   660  C CD    . LYS A 1 86  ? -19.740 -10.731 52.372  1.00 34.47  ? 383  LYS A CD    1 
ATOM   661  C CE    . LYS A 1 86  ? -20.779 -11.707 51.927  1.00 38.78  ? 383  LYS A CE    1 
ATOM   662  N NZ    . LYS A 1 86  ? -21.926 -11.651 52.835  1.00 46.45  ? 383  LYS A NZ    1 
ATOM   663  N N     . GLY A 1 87  ? -17.891 -5.007  52.342  1.00 28.75  ? 384  GLY A N     1 
ATOM   664  C CA    . GLY A 1 87  ? -16.996 -4.044  52.985  1.00 31.54  ? 384  GLY A CA    1 
ATOM   665  C C     . GLY A 1 87  ? -15.671 -4.632  53.427  1.00 33.41  ? 384  GLY A C     1 
ATOM   666  O O     . GLY A 1 87  ? -15.003 -4.049  54.274  1.00 32.38  ? 384  GLY A O     1 
ATOM   667  N N     . ILE A 1 88  ? -15.224 -5.738  52.819  1.00 31.28  ? 385  ILE A N     1 
ATOM   668  C CA    . ILE A 1 88  ? -13.929 -6.332  53.186  1.00 28.32  ? 385  ILE A CA    1 
ATOM   669  C C     . ILE A 1 88  ? -12.963 -6.299  52.020  1.00 33.40  ? 385  ILE A C     1 
ATOM   670  O O     . ILE A 1 88  ? -13.338 -6.600  50.887  1.00 29.17  ? 385  ILE A O     1 
ATOM   671  C CB    . ILE A 1 88  ? -14.164 -7.772  53.641  1.00 31.99  ? 385  ILE A CB    1 
ATOM   672  C CG1   . ILE A 1 88  ? -14.906 -7.778  54.981  1.00 31.90  ? 385  ILE A CG1   1 
ATOM   673  C CG2   . ILE A 1 88  ? -12.873 -8.565  53.724  1.00 32.32  ? 385  ILE A CG2   1 
ATOM   674  C CD1   . ILE A 1 88  ? -15.605 -9.061  55.285  1.00 30.72  ? 385  ILE A CD1   1 
ATOM   675  N N     . GLU A 1 89  ? -11.707 -5.960  52.304  1.00 29.66  ? 386  GLU A N     1 
ATOM   676  C CA    . GLU A 1 89  ? -10.656 -5.848  51.308  1.00 35.94  ? 386  GLU A CA    1 
ATOM   677  C C     . GLU A 1 89  ? -9.796  -7.098  51.269  1.00 36.14  ? 386  GLU A C     1 
ATOM   678  O O     . GLU A 1 89  ? -9.319  -7.555  52.284  1.00 33.92  ? 386  GLU A O     1 
ATOM   679  C CB    . GLU A 1 89  ? -9.747  -4.656  51.592  1.00 39.32  ? 386  GLU A CB    1 
ATOM   680  C CG    . GLU A 1 89  ? -10.441 -3.297  51.380  1.00 54.18  ? 386  GLU A CG    1 
ATOM   681  C CD    . GLU A 1 89  ? -11.115 -3.112  49.993  1.00 61.84  ? 386  GLU A CD    1 
ATOM   682  O OE1   . GLU A 1 89  ? -10.468 -3.377  48.963  1.00 65.03  ? 386  GLU A OE1   1 
ATOM   683  O OE2   . GLU A 1 89  ? -12.313 -2.731  49.922  1.00 64.51  ? 386  GLU A OE2   1 
ATOM   684  N N     . LEU A 1 90  ? -9.572  -7.603  50.067  1.00 32.85  ? 387  LEU A N     1 
ATOM   685  C CA    . LEU A 1 90  ? -8.738  -8.716  49.861  1.00 29.93  ? 387  LEU A CA    1 
ATOM   686  C C     . LEU A 1 90  ? -7.429  -8.221  49.258  1.00 31.71  ? 387  LEU A C     1 
ATOM   687  O O     . LEU A 1 90  ? -7.447  -7.675  48.209  1.00 29.04  ? 387  LEU A O     1 
ATOM   688  C CB    . LEU A 1 90  ? -9.417  -9.722  48.909  1.00 27.53  ? 387  LEU A CB    1 
ATOM   689  C CG    . LEU A 1 90  ? -8.590  -10.965 48.544  1.00 30.72  ? 387  LEU A CG    1 
ATOM   690  C CD1   . LEU A 1 90  ? -8.225  -11.874 49.758  1.00 28.14  ? 387  LEU A CD1   1 
ATOM   691  C CD2   . LEU A 1 90  ? -9.356  -11.760 47.514  1.00 33.62  ? 387  LEU A CD2   1 
ATOM   692  N N     . CYS A 1 91  ? -6.301  -8.478  49.910  1.00 27.47  ? 388  CYS A N     1 
ATOM   693  C CA    . CYS A 1 91  ? -5.011  -8.095  49.400  1.00 29.30  ? 388  CYS A CA    1 
ATOM   694  C C     . CYS A 1 91  ? -4.048  -9.281  49.514  1.00 26.40  ? 388  CYS A C     1 
ATOM   695  O O     . CYS A 1 91  ? -4.341  -10.297 50.140  1.00 26.83  ? 388  CYS A O     1 
ATOM   696  C CB    . CYS A 1 91  ? -4.402  -6.936  50.220  1.00 32.83  ? 388  CYS A CB    1 
ATOM   697  S SG    . CYS A 1 91  ? -5.447  -5.471  50.255  1.00 38.28  ? 388  CYS A SG    1 
ATOM   698  N N     . GLY A 1 92  ? -2.896  -9.112  48.875  1.00 24.39  ? 389  GLY A N     1 
ATOM   699  C CA    . GLY A 1 92  ? -1.830  -10.077 48.982  1.00 29.29  ? 389  GLY A CA    1 
ATOM   700  C C     . GLY A 1 92  ? -1.976  -11.337 48.139  1.00 26.15  ? 389  GLY A C     1 
ATOM   701  O O     . GLY A 1 92  ? -1.279  -12.311 48.386  1.00 26.34  ? 389  GLY A O     1 
ATOM   702  N N     . VAL A 1 93  ? -2.849  -11.318 47.123  1.00 28.70  ? 390  VAL A N     1 
ATOM   703  C CA    . VAL A 1 93  ? -3.013  -12.427 46.252  1.00 27.16  ? 390  VAL A CA    1 
ATOM   704  C C     . VAL A 1 93  ? -1.811  -12.428 45.286  1.00 29.17  ? 390  VAL A C     1 
ATOM   705  O O     . VAL A 1 93  ? -1.726  -11.613 44.439  1.00 26.74  ? 390  VAL A O     1 
ATOM   706  C CB    . VAL A 1 93  ? -4.347  -12.363 45.444  1.00 28.83  ? 390  VAL A CB    1 
ATOM   707  C CG1   . VAL A 1 93  ? -4.470  -13.620 44.619  1.00 30.77  ? 390  VAL A CG1   1 
ATOM   708  C CG2   . VAL A 1 93  ? -5.534  -12.352 46.398  1.00 27.80  ? 390  VAL A CG2   1 
ATOM   709  N N     . SER A 1 94  ? -0.879  -13.341 45.450  1.00 25.93  ? 391  SER A N     1 
ATOM   710  C CA    . SER A 1 94  ? 0.337   -13.363 44.640  1.00 26.23  ? 391  SER A CA    1 
ATOM   711  C C     . SER A 1 94  ? 0.279   -14.383 43.544  1.00 25.42  ? 391  SER A C     1 
ATOM   712  O O     . SER A 1 94  ? 1.131   -14.406 42.679  1.00 26.02  ? 391  SER A O     1 
ATOM   713  C CB    . SER A 1 94  ? 1.545   -13.644 45.536  1.00 26.76  ? 391  SER A CB    1 
ATOM   714  O OG    . SER A 1 94  ? 1.375   -14.834 46.185  1.00 28.64  ? 391  SER A OG    1 
ATOM   715  N N     . PHE A 1 95  ? -0.759  -15.184 43.490  1.00 23.78  ? 392  PHE A N     1 
ATOM   716  C CA    . PHE A 1 95  ? -0.856  -16.248 42.444  1.00 23.39  ? 392  PHE A CA    1 
ATOM   717  C C     . PHE A 1 95  ? -2.315  -16.599 42.204  1.00 24.15  ? 392  PHE A C     1 
ATOM   718  O O     . PHE A 1 95  ? -3.039  -16.917 43.163  1.00 22.84  ? 392  PHE A O     1 
ATOM   719  C CB    . PHE A 1 95  ? -0.149  -17.506 42.857  1.00 23.78  ? 392  PHE A CB    1 
ATOM   720  C CG    . PHE A 1 95  ? -0.287  -18.628 41.851  1.00 26.20  ? 392  PHE A CG    1 
ATOM   721  C CD1   . PHE A 1 95  ? 0.452   -18.627 40.651  1.00 25.59  ? 392  PHE A CD1   1 
ATOM   722  C CD2   . PHE A 1 95  ? -1.142  -19.676 42.082  1.00 22.36  ? 392  PHE A CD2   1 
ATOM   723  C CE1   . PHE A 1 95  ? 0.272   -19.662 39.725  1.00 23.19  ? 392  PHE A CE1   1 
ATOM   724  C CE2   . PHE A 1 95  ? -1.299  -20.688 41.162  1.00 26.00  ? 392  PHE A CE2   1 
ATOM   725  C CZ    . PHE A 1 95  ? -0.567  -20.689 39.987  1.00 24.90  ? 392  PHE A CZ    1 
ATOM   726  N N     . ASP A 1 96  ? -2.761  -16.411 40.965  1.00 21.77  ? 393  ASP A N     1 
ATOM   727  C CA    . ASP A 1 96  ? -4.128  -16.730 40.598  1.00 24.44  ? 393  ASP A CA    1 
ATOM   728  C C     . ASP A 1 96  ? -4.056  -17.860 39.574  1.00 22.26  ? 393  ASP A C     1 
ATOM   729  O O     . ASP A 1 96  ? -3.702  -17.623 38.438  1.00 24.88  ? 393  ASP A O     1 
ATOM   730  C CB    . ASP A 1 96  ? -4.849  -15.506 40.018  1.00 23.08  ? 393  ASP A CB    1 
ATOM   731  C CG    . ASP A 1 96  ? -6.345  -15.764 39.848  1.00 24.15  ? 393  ASP A CG    1 
ATOM   732  O OD1   . ASP A 1 96  ? -6.730  -16.894 39.450  1.00 23.23  ? 393  ASP A OD1   1 
ATOM   733  O OD2   . ASP A 1 96  ? -7.136  -14.882 40.178  1.00 23.89  ? 393  ASP A OD2   1 
ATOM   734  N N     . LEU A 1 97  ? -4.480  -19.061 39.971  1.00 21.20  ? 394  LEU A N     1 
ATOM   735  C CA    . LEU A 1 97  ? -4.375  -20.278 39.154  1.00 21.32  ? 394  LEU A CA    1 
ATOM   736  C C     . LEU A 1 97  ? -5.243  -20.194 37.915  1.00 22.11  ? 394  LEU A C     1 
ATOM   737  O O     . LEU A 1 97  ? -4.890  -20.782 36.862  1.00 21.25  ? 394  LEU A O     1 
ATOM   738  C CB    . LEU A 1 97  ? -4.769  -21.516 39.965  1.00 21.78  ? 394  LEU A CB    1 
ATOM   739  C CG    . LEU A 1 97  ? -4.810  -22.857 39.245  1.00 22.90  ? 394  LEU A CG    1 
ATOM   740  C CD1   . LEU A 1 97  ? -3.417  -23.158 38.665  1.00 25.07  ? 394  LEU A CD1   1 
ATOM   741  C CD2   . LEU A 1 97  ? -5.283  -23.953 40.165  1.00 24.58  ? 394  LEU A CD2   1 
ATOM   742  N N     . LEU A 1 98  ? -6.390  -19.526 38.006  1.00 21.47  ? 395  LEU A N     1 
ATOM   743  C CA    . LEU A 1 98  ? -7.214  -19.307 36.783  1.00 22.06  ? 395  LEU A CA    1 
ATOM   744  C C     . LEU A 1 98  ? -6.453  -18.519 35.705  1.00 22.05  ? 395  LEU A C     1 
ATOM   745  O O     . LEU A 1 98  ? -6.359  -18.925 34.533  1.00 22.24  ? 395  LEU A O     1 
ATOM   746  C CB    . LEU A 1 98  ? -8.500  -18.581 37.102  1.00 22.57  ? 395  LEU A CB    1 
ATOM   747  C CG    . LEU A 1 98  ? -9.336  -18.101 35.897  1.00 24.83  ? 395  LEU A CG    1 
ATOM   748  C CD1   . LEU A 1 98  ? -9.828  -19.256 35.040  1.00 26.31  ? 395  LEU A CD1   1 
ATOM   749  C CD2   . LEU A 1 98  ? -10.516 -17.294 36.341  1.00 26.97  ? 395  LEU A CD2   1 
ATOM   750  N N     . LEU A 1 99  ? -5.850  -17.428 36.109  1.00 19.28  ? 396  LEU A N     1 
ATOM   751  C CA    . LEU A 1 99  ? -5.070  -16.643 35.125  1.00 21.63  ? 396  LEU A CA    1 
ATOM   752  C C     . LEU A 1 99  ? -3.825  -17.360 34.657  1.00 22.60  ? 396  LEU A C     1 
ATOM   753  O O     . LEU A 1 99  ? -3.429  -17.183 33.481  1.00 24.47  ? 396  LEU A O     1 
ATOM   754  C CB    . LEU A 1 99  ? -4.691  -15.272 35.708  1.00 21.91  ? 396  LEU A CB    1 
ATOM   755  C CG    . LEU A 1 99  ? -5.925  -14.477 36.143  1.00 22.59  ? 396  LEU A CG    1 
ATOM   756  C CD1   . LEU A 1 99  ? -5.447  -13.222 36.892  1.00 23.69  ? 396  LEU A CD1   1 
ATOM   757  C CD2   . LEU A 1 99  ? -6.772  -14.062 34.887  1.00 24.24  ? 396  LEU A CD2   1 
ATOM   758  N N     . ALA A 1 100 ? -3.189  -18.133 35.552  1.00 22.16  ? 397  ALA A N     1 
ATOM   759  C CA    . ALA A 1 100 ? -2.031  -18.917 35.169  1.00 23.15  ? 397  ALA A CA    1 
ATOM   760  C C     . ALA A 1 100 ? -2.400  -19.926 34.076  1.00 24.49  ? 397  ALA A C     1 
ATOM   761  O O     . ALA A 1 100 ? -1.744  -20.017 33.029  1.00 23.64  ? 397  ALA A O     1 
ATOM   762  C CB    . ALA A 1 100 ? -1.359  -19.585 36.374  1.00 22.16  ? 397  ALA A CB    1 
ATOM   763  N N     . ALA A 1 101 ? -3.478  -20.647 34.292  1.00 24.65  ? 398  ALA A N     1 
ATOM   764  C CA    . ALA A 1 101 ? -3.937  -21.615 33.280  1.00 25.44  ? 398  ALA A CA    1 
ATOM   765  C C     . ALA A 1 101 ? -4.276  -20.991 31.949  1.00 25.52  ? 398  ALA A C     1 
ATOM   766  O O     . ALA A 1 101 ? -3.930  -21.530 30.868  1.00 22.74  ? 398  ALA A O     1 
ATOM   767  C CB    . ALA A 1 101 ? -5.113  -22.402 33.796  1.00 26.30  ? 398  ALA A CB    1 
ATOM   768  N N     . TYR A 1 102 ? -5.017  -19.901 32.010  1.00 23.14  ? 399  TYR A N     1 
ATOM   769  C CA    . TYR A 1 102 ? -5.404  -19.158 30.853  1.00 22.48  ? 399  TYR A CA    1 
ATOM   770  C C     . TYR A 1 102 ? -4.209  -18.711 30.003  1.00 24.20  ? 399  TYR A C     1 
ATOM   771  O O     . TYR A 1 102 ? -4.225  -18.852 28.816  1.00 27.32  ? 399  TYR A O     1 
ATOM   772  C CB    . TYR A 1 102 ? -6.155  -17.947 31.281  1.00 23.72  ? 399  TYR A CB    1 
ATOM   773  C CG    . TYR A 1 102 ? -6.540  -16.995 30.179  1.00 21.94  ? 399  TYR A CG    1 
ATOM   774  C CD1   . TYR A 1 102 ? -7.405  -17.381 29.207  1.00 24.71  ? 399  TYR A CD1   1 
ATOM   775  C CD2   . TYR A 1 102 ? -6.053  -15.677 30.157  1.00 22.87  ? 399  TYR A CD2   1 
ATOM   776  C CE1   . TYR A 1 102 ? -7.790  -16.503 28.205  1.00 24.66  ? 399  TYR A CE1   1 
ATOM   777  C CE2   . TYR A 1 102 ? -6.407  -14.793 29.162  1.00 24.50  ? 399  TYR A CE2   1 
ATOM   778  C CZ    . TYR A 1 102 ? -7.294  -15.203 28.196  1.00 23.36  ? 399  TYR A CZ    1 
ATOM   779  O OH    . TYR A 1 102 ? -7.704  -14.305 27.247  1.00 23.98  ? 399  TYR A OH    1 
ATOM   780  N N     . LEU A 1 103 ? -3.173  -18.206 30.632  1.00 22.38  ? 400  LEU A N     1 
ATOM   781  C CA    . LEU A 1 103 ? -1.990  -17.830 29.899  1.00 24.00  ? 400  LEU A CA    1 
ATOM   782  C C     . LEU A 1 103 ? -1.245  -19.016 29.262  1.00 23.54  ? 400  LEU A C     1 
ATOM   783  O O     . LEU A 1 103 ? -0.752  -18.901 28.150  1.00 23.31  ? 400  LEU A O     1 
ATOM   784  C CB    . LEU A 1 103 ? -1.049  -17.048 30.818  1.00 23.99  ? 400  LEU A CB    1 
ATOM   785  C CG    . LEU A 1 103 ? -1.492  -15.691 31.261  1.00 22.44  ? 400  LEU A CG    1 
ATOM   786  C CD1   . LEU A 1 103 ? -0.434  -15.022 32.101  1.00 23.04  ? 400  LEU A CD1   1 
ATOM   787  C CD2   . LEU A 1 103 ? -1.819  -14.832 30.032  1.00 24.86  ? 400  LEU A CD2   1 
ATOM   788  N N     . LEU A 1 104 ? -1.204  -20.144 29.966  1.00 24.96  ? 401  LEU A N     1 
ATOM   789  C CA    . LEU A 1 104 ? -0.518  -21.310 29.506  1.00 27.51  ? 401  LEU A CA    1 
ATOM   790  C C     . LEU A 1 104 ? -1.236  -21.891 28.315  1.00 26.91  ? 401  LEU A C     1 
ATOM   791  O O     . LEU A 1 104 ? -0.582  -22.317 27.373  1.00 27.06  ? 401  LEU A O     1 
ATOM   792  C CB    . LEU A 1 104 ? -0.383  -22.355 30.603  1.00 24.57  ? 401  LEU A CB    1 
ATOM   793  C CG    . LEU A 1 104 ? 0.690   -22.026 31.665  1.00 23.47  ? 401  LEU A CG    1 
ATOM   794  C CD1   . LEU A 1 104 ? 0.639   -23.124 32.699  1.00 26.75  ? 401  LEU A CD1   1 
ATOM   795  C CD2   . LEU A 1 104 ? 2.060   -21.937 31.009  1.00 24.48  ? 401  LEU A CD2   1 
ATOM   796  N N     . ASP A 1 105 ? -2.579  -21.911 28.354  1.00 26.22  ? 402  ASP A N     1 
ATOM   797  C CA    . ASP A 1 105 ? -3.327  -22.342 27.167  1.00 27.74  ? 402  ASP A CA    1 
ATOM   798  C C     . ASP A 1 105 ? -4.768  -21.919 27.214  1.00 24.89  ? 402  ASP A C     1 
ATOM   799  O O     . ASP A 1 105 ? -5.575  -22.629 27.804  1.00 25.07  ? 402  ASP A O     1 
ATOM   800  C CB    . ASP A 1 105 ? -3.201  -23.868 27.003  1.00 28.54  ? 402  ASP A CB    1 
ATOM   801  C CG    . ASP A 1 105 ? -3.865  -24.399 25.728  1.00 31.35  ? 402  ASP A CG    1 
ATOM   802  O OD1   . ASP A 1 105 ? -4.335  -23.665 24.852  1.00 30.74  ? 402  ASP A OD1   1 
ATOM   803  O OD2   . ASP A 1 105 ? -3.888  -25.586 25.595  1.00 30.67  ? 402  ASP A OD2   1 
ATOM   804  N N     . PRO A 1 106 ? -5.101  -20.821 26.529  1.00 23.70  ? 403  PRO A N     1 
ATOM   805  C CA    . PRO A 1 106 ? -6.480  -20.358 26.551  1.00 25.70  ? 403  PRO A CA    1 
ATOM   806  C C     . PRO A 1 106 ? -7.469  -21.304 25.936  1.00 27.20  ? 403  PRO A C     1 
ATOM   807  O O     . PRO A 1 106 ? -8.654  -21.242 26.256  1.00 28.37  ? 403  PRO A O     1 
ATOM   808  C CB    . PRO A 1 106 ? -6.451  -19.023 25.783  1.00 28.25  ? 403  PRO A CB    1 
ATOM   809  C CG    . PRO A 1 106 ? -5.035  -18.703 25.541  1.00 27.66  ? 403  PRO A CG    1 
ATOM   810  C CD    . PRO A 1 106 ? -4.224  -19.942 25.727  1.00 23.15  ? 403  PRO A CD    1 
ATOM   811  N N     . ALA A 1 107 ? -7.005  -22.184 25.066  1.00 25.28  ? 404  ALA A N     1 
ATOM   812  C CA    . ALA A 1 107 ? -7.908  -23.140 24.376  1.00 29.40  ? 404  ALA A CA    1 
ATOM   813  C C     . ALA A 1 107 ? -8.434  -24.238 25.284  1.00 33.78  ? 404  ALA A C     1 
ATOM   814  O O     . ALA A 1 107 ? -9.401  -24.915 24.901  1.00 28.60  ? 404  ALA A O     1 
ATOM   815  C CB    . ALA A 1 107 ? -7.203  -23.821 23.183  1.00 27.25  ? 404  ALA A CB    1 
ATOM   816  N N     . GLN A 1 108 ? -7.803  -24.479 26.449  1.00 29.72  ? 405  GLN A N     1 
ATOM   817  C CA    . GLN A 1 108 ? -8.311  -25.505 27.376  1.00 29.21  ? 405  GLN A CA    1 
ATOM   818  C C     . GLN A 1 108 ? -9.693  -25.134 27.993  1.00 31.05  ? 405  GLN A C     1 
ATOM   819  O O     . GLN A 1 108 ? -10.391 -25.975 28.460  1.00 33.01  ? 405  GLN A O     1 
ATOM   820  C CB    . GLN A 1 108 ? -7.341  -25.763 28.490  1.00 34.66  ? 405  GLN A CB    1 
ATOM   821  C CG    . GLN A 1 108 ? -6.161  -26.641 28.173  1.00 46.94  ? 405  GLN A CG    1 
ATOM   822  C CD    . GLN A 1 108 ? -6.565  -27.981 27.594  1.00 47.43  ? 405  GLN A CD    1 
ATOM   823  O OE1   . GLN A 1 108 ? -7.385  -28.710 28.161  1.00 52.80  ? 405  GLN A OE1   1 
ATOM   824  N NE2   . GLN A 1 108 ? -5.998  -28.303 26.463  1.00 63.67  ? 405  GLN A NE2   1 
ATOM   825  N N     . GLY A 1 109 ? -10.083 -23.874 27.977  1.00 32.13  ? 406  GLY A N     1 
ATOM   826  C CA    . GLY A 1 109 ? -11.380 -23.480 28.532  1.00 31.77  ? 406  GLY A CA    1 
ATOM   827  C C     . GLY A 1 109 ? -11.426 -23.690 30.054  1.00 33.16  ? 406  GLY A C     1 
ATOM   828  O O     . GLY A 1 109 ? -12.459 -23.981 30.580  1.00 31.47  ? 406  GLY A O     1 
ATOM   829  N N     . VAL A 1 110 ? -10.295 -23.575 30.751  1.00 27.82  ? 407  VAL A N     1 
ATOM   830  C CA    . VAL A 1 110 ? -10.227 -23.803 32.156  1.00 25.69  ? 407  VAL A CA    1 
ATOM   831  C C     . VAL A 1 110 ? -11.165 -22.812 32.841  1.00 26.60  ? 407  VAL A C     1 
ATOM   832  O O     . VAL A 1 110 ? -11.028 -21.618 32.669  1.00 28.51  ? 407  VAL A O     1 
ATOM   833  C CB    . VAL A 1 110 ? -8.784  -23.588 32.668  1.00 24.48  ? 407  VAL A CB    1 
ATOM   834  C CG1   . VAL A 1 110 ? -8.741  -23.534 34.154  1.00 27.68  ? 407  VAL A CG1   1 
ATOM   835  C CG2   . VAL A 1 110 ? -7.875  -24.725 32.183  1.00 26.37  ? 407  VAL A CG2   1 
ATOM   836  N N     . ASP A 1 111 ? -12.139 -23.336 33.571  1.00 25.99  ? 408  ASP A N     1 
ATOM   837  C CA    . ASP A 1 111 ? -13.057 -22.545 34.311  1.00 28.47  ? 408  ASP A CA    1 
ATOM   838  C C     . ASP A 1 111 ? -13.347 -23.104 35.708  1.00 29.74  ? 408  ASP A C     1 
ATOM   839  O O     . ASP A 1 111 ? -14.190 -22.587 36.384  1.00 25.79  ? 408  ASP A O     1 
ATOM   840  C CB    . ASP A 1 111 ? -14.371 -22.387 33.536  1.00 38.34  ? 408  ASP A CB    1 
ATOM   841  C CG    . ASP A 1 111 ? -15.112 -23.709 33.368  1.00 43.06  ? 408  ASP A CG    1 
ATOM   842  O OD1   . ASP A 1 111 ? -14.618 -24.762 33.816  1.00 46.52  ? 408  ASP A OD1   1 
ATOM   843  O OD2   . ASP A 1 111 ? -16.184 -23.676 32.757  1.00 52.81  ? 408  ASP A OD2   1 
ATOM   844  N N     . ASP A 1 112 ? -12.614 -24.117 36.128  1.00 26.34  ? 409  ASP A N     1 
ATOM   845  C CA    . ASP A 1 112 ? -12.584 -24.479 37.492  1.00 27.36  ? 409  ASP A CA    1 
ATOM   846  C C     . ASP A 1 112 ? -11.238 -25.062 37.844  1.00 24.38  ? 409  ASP A C     1 
ATOM   847  O O     . ASP A 1 112 ? -10.401 -25.336 36.971  1.00 25.00  ? 409  ASP A O     1 
ATOM   848  C CB    . ASP A 1 112 ? -13.768 -25.362 37.891  1.00 28.83  ? 409  ASP A CB    1 
ATOM   849  C CG    . ASP A 1 112 ? -13.778 -26.746 37.218  1.00 34.52  ? 409  ASP A CG    1 
ATOM   850  O OD1   . ASP A 1 112 ? -12.869 -27.094 36.441  1.00 35.86  ? 409  ASP A OD1   1 
ATOM   851  O OD2   . ASP A 1 112 ? -14.730 -27.516 37.506  1.00 36.86  ? 409  ASP A OD2   1 
ATOM   852  N N     . VAL A 1 113 ? -11.054 -25.264 39.131  1.00 23.63  ? 410  VAL A N     1 
ATOM   853  C CA    . VAL A 1 113 ? -9.783  -25.815 39.684  1.00 25.35  ? 410  VAL A CA    1 
ATOM   854  C C     . VAL A 1 113 ? -9.493  -27.195 39.097  1.00 25.29  ? 410  VAL A C     1 
ATOM   855  O O     . VAL A 1 113 ? -8.368  -27.467 38.687  1.00 23.71  ? 410  VAL A O     1 
ATOM   856  C CB    . VAL A 1 113 ? -9.810  -25.841 41.188  1.00 25.88  ? 410  VAL A CB    1 
ATOM   857  C CG1   . VAL A 1 113 ? -8.592  -26.587 41.751  1.00 26.05  ? 410  VAL A CG1   1 
ATOM   858  C CG2   . VAL A 1 113 ? -9.902  -24.420 41.748  1.00 26.90  ? 410  VAL A CG2   1 
ATOM   859  N N     . ALA A 1 114 ? -10.525 -28.031 38.949  1.00 25.13  ? 411  ALA A N     1 
ATOM   860  C CA    . ALA A 1 114 ? -10.297 -29.374 38.437  1.00 24.35  ? 411  ALA A CA    1 
ATOM   861  C C     . ALA A 1 114 ? -9.723  -29.377 37.019  1.00 26.66  ? 411  ALA A C     1 
ATOM   862  O O     . ALA A 1 114 ? -8.836  -30.203 36.696  1.00 24.40  ? 411  ALA A O     1 
ATOM   863  C CB    . ALA A 1 114 ? -11.573 -30.189 38.539  1.00 24.74  ? 411  ALA A CB    1 
ATOM   864  N N     . ALA A 1 115 ? -10.210 -28.462 36.165  1.00 24.54  ? 412  ALA A N     1 
ATOM   865  C CA    . ALA A 1 115 ? -9.708  -28.389 34.803  1.00 25.36  ? 412  ALA A CA    1 
ATOM   866  C C     . ALA A 1 115 ? -8.264  -27.892 34.742  1.00 22.64  ? 412  ALA A C     1 
ATOM   867  O O     . ALA A 1 115 ? -7.460  -28.395 33.992  1.00 24.72  ? 412  ALA A O     1 
ATOM   868  C CB    . ALA A 1 115 ? -10.606 -27.533 33.964  1.00 27.82  ? 412  ALA A CB    1 
ATOM   869  N N     . ALA A 1 116 ? -7.908  -26.941 35.575  1.00 21.74  ? 413  ALA A N     1 
ATOM   870  C CA    . ALA A 1 116 ? -6.556  -26.523 35.703  1.00 23.78  ? 413  ALA A CA    1 
ATOM   871  C C     . ALA A 1 116 ? -5.679  -27.658 36.208  1.00 24.18  ? 413  ALA A C     1 
ATOM   872  O O     . ALA A 1 116 ? -4.582  -27.896 35.696  1.00 28.07  ? 413  ALA A O     1 
ATOM   873  C CB    . ALA A 1 116 ? -6.453  -25.355 36.671  1.00 24.60  ? 413  ALA A CB    1 
ATOM   874  N N     . ALA A 1 117 ? -6.145  -28.359 37.228  1.00 25.17  ? 414  ALA A N     1 
ATOM   875  C CA    . ALA A 1 117 ? -5.344  -29.405 37.837  1.00 25.48  ? 414  ALA A CA    1 
ATOM   876  C C     . ALA A 1 117 ? -5.108  -30.562 36.853  1.00 25.44  ? 414  ALA A C     1 
ATOM   877  O O     . ALA A 1 117 ? -4.054  -31.201 36.838  1.00 26.38  ? 414  ALA A O     1 
ATOM   878  C CB    . ALA A 1 117 ? -6.023  -29.893 39.110  1.00 25.49  ? 414  ALA A CB    1 
ATOM   879  N N     . LYS A 1 118 ? -6.068  -30.807 35.980  1.00 26.51  ? 415  LYS A N     1 
ATOM   880  C CA    . LYS A 1 118 ? -5.930  -31.906 35.026  1.00 31.04  ? 415  LYS A CA    1 
ATOM   881  C C     . LYS A 1 118 ? -4.773  -31.679 34.039  1.00 33.02  ? 415  LYS A C     1 
ATOM   882  O O     . LYS A 1 118 ? -4.182  -32.615 33.518  1.00 32.93  ? 415  LYS A O     1 
ATOM   883  C CB    . LYS A 1 118 ? -7.270  -32.118 34.276  1.00 34.02  ? 415  LYS A CB    1 
ATOM   884  C CG    . LYS A 1 118 ? -7.430  -33.540 33.817  1.00 43.84  ? 415  LYS A CG    1 
ATOM   885  C CD    . LYS A 1 118 ? -8.852  -33.831 33.345  1.00 51.79  ? 415  LYS A CD    1 
ATOM   886  C CE    . LYS A 1 118 ? -9.053  -35.347 33.180  1.00 57.08  ? 415  LYS A CE    1 
ATOM   887  N NZ    . LYS A 1 118 ? -10.308 -35.635 32.454  1.00 68.44  ? 415  LYS A NZ    1 
ATOM   888  N N     . MET A 1 119 ? -4.417  -30.439 33.826  1.00 31.71  ? 416  MET A N     1 
ATOM   889  C CA    . MET A 1 119 ? -3.335  -30.080 32.920  1.00 35.01  ? 416  MET A CA    1 
ATOM   890  C C     . MET A 1 119 ? -1.996  -30.594 33.451  1.00 36.09  ? 416  MET A C     1 
ATOM   891  O O     . MET A 1 119 ? -1.057  -30.735 32.670  1.00 34.26  ? 416  MET A O     1 
ATOM   892  C CB    . MET A 1 119 ? -3.186  -28.535 32.742  1.00 34.21  ? 416  MET A CB    1 
ATOM   893  C CG    . MET A 1 119 ? -4.211  -27.798 31.862  1.00 39.70  ? 416  MET A CG    1 
ATOM   894  S SD    . MET A 1 119 ? -4.095  -25.977 32.108  1.00 43.18  ? 416  MET A SD    1 
ATOM   895  C CE    . MET A 1 119 ? -2.916  -25.419 30.893  1.00 48.31  ? 416  MET A CE    1 
ATOM   896  N N     . LYS A 1 120 ? -1.907  -30.830 34.752  1.00 27.85  ? 417  LYS A N     1 
ATOM   897  C CA    . LYS A 1 120 ? -0.720  -31.360 35.368  1.00 27.36  ? 417  LYS A CA    1 
ATOM   898  C C     . LYS A 1 120 ? -0.967  -32.760 36.028  1.00 25.71  ? 417  LYS A C     1 
ATOM   899  O O     . LYS A 1 120 ? -0.362  -33.113 37.026  1.00 26.62  ? 417  LYS A O     1 
ATOM   900  C CB    . LYS A 1 120 ? -0.191  -30.399 36.428  1.00 30.83  ? 417  LYS A CB    1 
ATOM   901  C CG    . LYS A 1 120 ? 0.187   -28.982 35.992  1.00 35.46  ? 417  LYS A CG    1 
ATOM   902  C CD    . LYS A 1 120 ? 1.470   -28.951 35.238  1.00 36.38  ? 417  LYS A CD    1 
ATOM   903  C CE    . LYS A 1 120 ? 1.752   -27.556 34.724  1.00 35.95  ? 417  LYS A CE    1 
ATOM   904  N NZ    . LYS A 1 120 ? 2.776   -27.680 33.633  1.00 34.91  ? 417  LYS A NZ    1 
ATOM   905  N N     . GLN A 1 121 ? -1.886  -33.520 35.498  1.00 26.87  ? 418  GLN A N     1 
ATOM   906  C CA    . GLN A 1 121 ? -2.148  -34.899 35.938  1.00 27.37  ? 418  GLN A CA    1 
ATOM   907  C C     . GLN A 1 121 ? -2.593  -34.988 37.425  1.00 26.83  ? 418  GLN A C     1 
ATOM   908  O O     . GLN A 1 121 ? -2.272  -35.940 38.125  1.00 26.67  ? 418  GLN A O     1 
ATOM   909  C CB    . GLN A 1 121 ? -0.926  -35.784 35.616  1.00 32.79  ? 418  GLN A CB    1 
ATOM   910  C CG    . GLN A 1 121 ? -0.379  -35.620 34.195  1.00 36.44  ? 418  GLN A CG    1 
ATOM   911  C CD    . GLN A 1 121 ? -1.431  -35.769 33.101  1.00 44.94  ? 418  GLN A CD    1 
ATOM   912  O OE1   . GLN A 1 121 ? -1.874  -36.883 32.779  1.00 47.41  ? 418  GLN A OE1   1 
ATOM   913  N NE2   . GLN A 1 121 ? -1.802  -34.634 32.472  1.00 46.16  ? 418  GLN A NE2   1 
ATOM   914  N N     . TYR A 1 122 ? -3.262  -33.935 37.918  1.00 26.58  ? 419  TYR A N     1 
ATOM   915  C CA    . TYR A 1 122 ? -3.737  -33.879 39.294  1.00 25.04  ? 419  TYR A CA    1 
ATOM   916  C C     . TYR A 1 122 ? -5.217  -34.040 39.172  1.00 26.82  ? 419  TYR A C     1 
ATOM   917  O O     . TYR A 1 122 ? -5.925  -33.184 38.545  1.00 24.19  ? 419  TYR A O     1 
ATOM   918  C CB    . TYR A 1 122 ? -3.335  -32.566 39.980  1.00 24.60  ? 419  TYR A CB    1 
ATOM   919  C CG    . TYR A 1 122 ? -3.652  -32.417 41.471  1.00 23.72  ? 419  TYR A CG    1 
ATOM   920  C CD1   . TYR A 1 122 ? -4.939  -32.282 41.916  1.00 23.52  ? 419  TYR A CD1   1 
ATOM   921  C CD2   . TYR A 1 122 ? -2.628  -32.427 42.424  1.00 22.94  ? 419  TYR A CD2   1 
ATOM   922  C CE1   . TYR A 1 122 ? -5.234  -32.164 43.258  1.00 24.45  ? 419  TYR A CE1   1 
ATOM   923  C CE2   . TYR A 1 122 ? -2.900  -32.341 43.763  1.00 24.88  ? 419  TYR A CE2   1 
ATOM   924  C CZ    . TYR A 1 122 ? -4.219  -32.169 44.184  1.00 24.87  ? 419  TYR A CZ    1 
ATOM   925  O OH    . TYR A 1 122 ? -4.498  -32.093 45.503  1.00 28.32  ? 419  TYR A OH    1 
ATOM   926  N N     . GLU A 1 123 ? -5.720  -35.136 39.761  1.00 27.06  ? 420  GLU A N     1 
ATOM   927  C CA    . GLU A 1 123 ? -7.145  -35.412 39.694  1.00 26.72  ? 420  GLU A CA    1 
ATOM   928  C C     . GLU A 1 123 ? -7.867  -35.565 41.035  1.00 26.81  ? 420  GLU A C     1 
ATOM   929  O O     . GLU A 1 123 ? -9.031  -35.973 41.060  1.00 27.01  ? 420  GLU A O     1 
ATOM   930  C CB    . GLU A 1 123 ? -7.400  -36.579 38.742  1.00 28.91  ? 420  GLU A CB    1 
ATOM   931  C CG    . GLU A 1 123 ? -7.141  -36.169 37.326  1.00 36.57  ? 420  GLU A CG    1 
ATOM   932  C CD    . GLU A 1 123 ? -7.392  -37.250 36.289  1.00 44.63  ? 420  GLU A CD    1 
ATOM   933  O OE1   . GLU A 1 123 ? -8.046  -38.273 36.571  1.00 40.39  ? 420  GLU A OE1   1 
ATOM   934  O OE2   . GLU A 1 123 ? -6.888  -37.040 35.171  1.00 42.77  ? 420  GLU A OE2   1 
ATOM   935  N N     . ALA A 1 124 ? -7.214  -35.201 42.126  1.00 25.59  ? 421  ALA A N     1 
ATOM   936  C CA    . ALA A 1 124 ? -7.789  -35.371 43.450  1.00 25.87  ? 421  ALA A CA    1 
ATOM   937  C C     . ALA A 1 124 ? -8.676  -34.168 43.869  1.00 25.30  ? 421  ALA A C     1 
ATOM   938  O O     . ALA A 1 124 ? -8.661  -33.705 45.019  1.00 28.07  ? 421  ALA A O     1 
ATOM   939  C CB    . ALA A 1 124 ? -6.672  -35.603 44.474  1.00 26.50  ? 421  ALA A CB    1 
ATOM   940  N N     . VAL A 1 125 ? -9.495  -33.718 42.940  1.00 25.86  ? 422  VAL A N     1 
ATOM   941  C CA    . VAL A 1 125 ? -10.421 -32.641 43.170  1.00 25.78  ? 422  VAL A CA    1 
ATOM   942  C C     . VAL A 1 125 ? -11.519 -32.798 42.112  1.00 24.91  ? 422  VAL A C     1 
ATOM   943  O O     . VAL A 1 125 ? -11.269 -33.169 40.974  1.00 27.13  ? 422  VAL A O     1 
ATOM   944  C CB    . VAL A 1 125 ? -9.721  -31.256 43.060  1.00 31.27  ? 422  VAL A CB    1 
ATOM   945  C CG1   . VAL A 1 125 ? -9.050  -31.102 41.723  1.00 30.33  ? 422  VAL A CG1   1 
ATOM   946  C CG2   . VAL A 1 125 ? -10.707 -30.089 43.326  1.00 30.71  ? 422  VAL A CG2   1 
ATOM   947  N N     . ARG A 1 126 ? -12.736 -32.541 42.503  1.00 23.64  ? 423  ARG A N     1 
ATOM   948  C CA    . ARG A 1 126 ? -13.886 -32.732 41.627  1.00 27.53  ? 423  ARG A CA    1 
ATOM   949  C C     . ARG A 1 126 ? -14.192 -31.444 40.791  1.00 24.79  ? 423  ARG A C     1 
ATOM   950  O O     . ARG A 1 126 ? -13.980 -30.323 41.253  1.00 25.71  ? 423  ARG A O     1 
ATOM   951  C CB    . ARG A 1 126 ? -15.114 -33.070 42.521  1.00 29.12  ? 423  ARG A CB    1 
ATOM   952  C CG    . ARG A 1 126 ? -15.114 -34.487 43.083  1.00 33.63  ? 423  ARG A CG    1 
ATOM   953  C CD    . ARG A 1 126 ? -16.146 -34.618 44.179  1.00 38.70  ? 423  ARG A CD    1 
ATOM   954  N NE    . ARG A 1 126 ? -17.416 -35.001 43.632  1.00 49.38  ? 423  ARG A NE    1 
ATOM   955  C CZ    . ARG A 1 126 ? -18.581 -34.755 44.241  1.00 53.25  ? 423  ARG A CZ    1 
ATOM   956  N NH1   . ARG A 1 126 ? -18.634 -34.140 45.445  1.00 49.51  ? 423  ARG A NH1   1 
ATOM   957  N NH2   . ARG A 1 126 ? -19.692 -35.138 43.634  1.00 49.27  ? 423  ARG A NH2   1 
ATOM   958  N N     . PRO A 1 127 ? -14.758 -31.615 39.599  1.00 31.34  ? 424  PRO A N     1 
ATOM   959  C CA    . PRO A 1 127 ? -15.262 -30.439 38.900  1.00 29.46  ? 424  PRO A CA    1 
ATOM   960  C C     . PRO A 1 127 ? -16.433 -29.768 39.711  1.00 31.38  ? 424  PRO A C     1 
ATOM   961  O O     . PRO A 1 127 ? -17.273 -30.458 40.281  1.00 28.09  ? 424  PRO A O     1 
ATOM   962  C CB    . PRO A 1 127 ? -15.710 -31.003 37.539  1.00 30.53  ? 424  PRO A CB    1 
ATOM   963  C CG    . PRO A 1 127 ? -15.175 -32.426 37.440  1.00 32.52  ? 424  PRO A CG    1 
ATOM   964  C CD    . PRO A 1 127 ? -15.016 -32.893 38.855  1.00 32.49  ? 424  PRO A CD    1 
ATOM   965  N N     . ASP A 1 128 ? -16.468 -28.435 39.760  1.00 27.16  ? 425  ASP A N     1 
ATOM   966  C CA    . ASP A 1 128 ? -17.517 -27.725 40.435  1.00 26.64  ? 425  ASP A CA    1 
ATOM   967  C C     . ASP A 1 128 ? -18.907 -28.189 39.985  1.00 30.52  ? 425  ASP A C     1 
ATOM   968  O O     . ASP A 1 128 ? -19.818 -28.291 40.796  1.00 30.24  ? 425  ASP A O     1 
ATOM   969  C CB    . ASP A 1 128 ? -17.427 -26.210 40.191  1.00 30.29  ? 425  ASP A CB    1 
ATOM   970  C CG    . ASP A 1 128 ? -16.218 -25.568 40.868  1.00 32.66  ? 425  ASP A CG    1 
ATOM   971  O OD1   . ASP A 1 128 ? -15.760 -26.083 41.873  1.00 32.18  ? 425  ASP A OD1   1 
ATOM   972  O OD2   . ASP A 1 128 ? -15.717 -24.534 40.370  1.00 36.74  ? 425  ASP A OD2   1 
ATOM   973  N N     . GLU A 1 129 ? -19.051 -28.477 38.695  1.00 31.35  ? 426  GLU A N     1 
ATOM   974  C CA    . GLU A 1 129 ? -20.338 -28.902 38.141  1.00 39.63  ? 426  GLU A CA    1 
ATOM   975  C C     . GLU A 1 129 ? -20.780 -30.268 38.734  1.00 40.83  ? 426  GLU A C     1 
ATOM   976  O O     . GLU A 1 129 ? -21.954 -30.469 39.005  1.00 35.89  ? 426  GLU A O     1 
ATOM   977  C CB    . GLU A 1 129 ? -20.241 -28.984 36.635  1.00 47.76  ? 426  GLU A CB    1 
ATOM   978  C CG    . GLU A 1 129 ? -21.566 -29.182 35.933  1.00 62.29  ? 426  GLU A CG    1 
ATOM   979  C CD    . GLU A 1 129 ? -21.421 -29.150 34.411  1.00 65.22  ? 426  GLU A CD    1 
ATOM   980  O OE1   . GLU A 1 129 ? -20.824 -28.194 33.877  1.00 66.14  ? 426  GLU A OE1   1 
ATOM   981  O OE2   . GLU A 1 129 ? -21.911 -30.081 33.754  1.00 70.12  ? 426  GLU A OE2   1 
ATOM   982  N N     . ALA A 1 130 ? -19.829 -31.143 39.023  1.00 33.74  ? 427  ALA A N     1 
ATOM   983  C CA    . ALA A 1 130 ? -20.137 -32.361 39.743  1.00 33.61  ? 427  ALA A CA    1 
ATOM   984  C C     . ALA A 1 130 ? -20.629 -32.100 41.166  1.00 36.26  ? 427  ALA A C     1 
ATOM   985  O O     . ALA A 1 130 ? -21.345 -32.888 41.721  1.00 35.66  ? 427  ALA A O     1 
ATOM   986  C CB    . ALA A 1 130 ? -18.922 -33.284 39.782  1.00 36.64  ? 427  ALA A CB    1 
ATOM   987  N N     . VAL A 1 131 ? -20.162 -31.053 41.827  1.00 35.51  ? 428  VAL A N     1 
ATOM   988  C CA    . VAL A 1 131 ? -20.520 -30.858 43.199  1.00 34.27  ? 428  VAL A CA    1 
ATOM   989  C C     . VAL A 1 131 ? -21.813 -30.080 43.288  1.00 36.03  ? 428  VAL A C     1 
ATOM   990  O O     . VAL A 1 131 ? -22.649 -30.417 44.067  1.00 33.16  ? 428  VAL A O     1 
ATOM   991  C CB    . VAL A 1 131 ? -19.407 -30.105 43.970  1.00 35.37  ? 428  VAL A CB    1 
ATOM   992  C CG1   . VAL A 1 131 ? -19.817 -29.795 45.386  1.00 38.84  ? 428  VAL A CG1   1 
ATOM   993  C CG2   . VAL A 1 131 ? -18.131 -30.929 43.961  1.00 32.47  ? 428  VAL A CG2   1 
ATOM   994  N N     . TYR A 1 132 ? -21.918 -28.998 42.529  1.00 31.07  ? 429  TYR A N     1 
ATOM   995  C CA    . TYR A 1 132 ? -23.044 -28.088 42.583  1.00 33.62  ? 429  TYR A CA    1 
ATOM   996  C C     . TYR A 1 132 ? -24.158 -28.473 41.633  1.00 35.88  ? 429  TYR A C     1 
ATOM   997  O O     . TYR A 1 132 ? -25.250 -27.996 41.793  1.00 38.04  ? 429  TYR A O     1 
ATOM   998  C CB    . TYR A 1 132 ? -22.569 -26.634 42.291  1.00 33.17  ? 429  TYR A CB    1 
ATOM   999  C CG    . TYR A 1 132 ? -21.554 -26.168 43.309  1.00 31.37  ? 429  TYR A CG    1 
ATOM   1000 C CD1   . TYR A 1 132 ? -21.873 -26.098 44.642  1.00 32.97  ? 429  TYR A CD1   1 
ATOM   1001 C CD2   . TYR A 1 132 ? -20.246 -25.835 42.925  1.00 33.22  ? 429  TYR A CD2   1 
ATOM   1002 C CE1   . TYR A 1 132 ? -20.914 -25.721 45.587  1.00 34.12  ? 429  TYR A CE1   1 
ATOM   1003 C CE2   . TYR A 1 132 ? -19.314 -25.410 43.840  1.00 29.45  ? 429  TYR A CE2   1 
ATOM   1004 C CZ    . TYR A 1 132 ? -19.635 -25.387 45.162  1.00 30.71  ? 429  TYR A CZ    1 
ATOM   1005 O OH    . TYR A 1 132 ? -18.696 -24.971 46.063  1.00 29.92  ? 429  TYR A OH    1 
ATOM   1006 N N     . GLY A 1 133 ? -23.896 -29.353 40.674  1.00 39.78  ? 430  GLY A N     1 
ATOM   1007 C CA    . GLY A 1 133 ? -24.899 -29.740 39.671  1.00 44.28  ? 430  GLY A CA    1 
ATOM   1008 C C     . GLY A 1 133 ? -25.011 -28.698 38.574  1.00 42.72  ? 430  GLY A C     1 
ATOM   1009 O O     . GLY A 1 133 ? -24.328 -27.705 38.635  1.00 43.63  ? 430  GLY A O     1 
ATOM   1010 N N     . LYS A 1 134 ? -25.887 -28.923 37.597  1.00 51.97  ? 431  LYS A N     1 
ATOM   1011 C CA    . LYS A 1 134 ? -26.078 -28.000 36.459  1.00 55.20  ? 431  LYS A CA    1 
ATOM   1012 C C     . LYS A 1 134 ? -27.510 -27.522 36.356  1.00 58.00  ? 431  LYS A C     1 
ATOM   1013 O O     . LYS A 1 134 ? -28.433 -28.243 36.720  1.00 54.83  ? 431  LYS A O     1 
ATOM   1014 C CB    . LYS A 1 134 ? -25.687 -28.667 35.134  1.00 54.55  ? 431  LYS A CB    1 
ATOM   1015 N N     . GLY A 1 135 ? -27.671 -26.280 35.899  1.00 59.31  ? 432  GLY A N     1 
ATOM   1016 C CA    . GLY A 1 135 ? -28.974 -25.699 35.573  1.00 65.43  ? 432  GLY A CA    1 
ATOM   1017 C C     . GLY A 1 135 ? -29.948 -25.616 36.732  1.00 65.88  ? 432  GLY A C     1 
ATOM   1018 O O     . GLY A 1 135 ? -29.634 -25.019 37.751  1.00 64.43  ? 432  GLY A O     1 
ATOM   1019 N N     . ALA A 1 136 ? -31.129 -26.221 36.558  1.00 69.04  ? 433  ALA A N     1 
ATOM   1020 C CA    . ALA A 1 136 ? -32.235 -26.186 37.564  1.00 67.32  ? 433  ALA A CA    1 
ATOM   1021 C C     . ALA A 1 136 ? -31.908 -27.005 38.812  1.00 64.14  ? 433  ALA A C     1 
ATOM   1022 O O     . ALA A 1 136 ? -32.424 -26.731 39.879  1.00 61.36  ? 433  ALA A O     1 
ATOM   1023 C CB    . ALA A 1 136 ? -33.566 -26.679 36.958  1.00 58.96  ? 433  ALA A CB    1 
ATOM   1024 N N     . LYS A 1 137 ? -31.071 -28.032 38.666  1.00 63.94  ? 434  LYS A N     1 
ATOM   1025 C CA    . LYS A 1 137 ? -30.633 -28.838 39.807  1.00 63.38  ? 434  LYS A CA    1 
ATOM   1026 C C     . LYS A 1 137 ? -29.439 -28.187 40.591  1.00 60.85  ? 434  LYS A C     1 
ATOM   1027 O O     . LYS A 1 137 ? -28.925 -28.770 41.559  1.00 50.65  ? 434  LYS A O     1 
ATOM   1028 C CB    . LYS A 1 137 ? -30.254 -30.246 39.324  1.00 59.41  ? 434  LYS A CB    1 
ATOM   1029 N N     . ARG A 1 138 ? -29.020 -26.986 40.187  1.00 53.57  ? 435  ARG A N     1 
ATOM   1030 C CA    . ARG A 1 138 ? -27.836 -26.380 40.743  1.00 52.64  ? 435  ARG A CA    1 
ATOM   1031 C C     . ARG A 1 138 ? -28.117 -26.019 42.176  1.00 50.55  ? 435  ARG A C     1 
ATOM   1032 O O     . ARG A 1 138 ? -29.110 -25.401 42.439  1.00 58.85  ? 435  ARG A O     1 
ATOM   1033 C CB    . ARG A 1 138 ? -27.429 -25.153 39.931  1.00 54.29  ? 435  ARG A CB    1 
ATOM   1034 C CG    . ARG A 1 138 ? -25.979 -24.739 40.092  1.00 59.52  ? 435  ARG A CG    1 
ATOM   1035 C CD    . ARG A 1 138 ? -25.620 -23.605 39.127  1.00 58.74  ? 435  ARG A CD    1 
ATOM   1036 N NE    . ARG A 1 138 ? -24.533 -22.779 39.688  1.00 63.46  ? 435  ARG A NE    1 
ATOM   1037 C CZ    . ARG A 1 138 ? -23.265 -23.137 39.651  1.00 56.94  ? 435  ARG A CZ    1 
ATOM   1038 N NH1   . ARG A 1 138 ? -22.928 -24.293 39.081  1.00 71.81  ? 435  ARG A NH1   1 
ATOM   1039 N NH2   . ARG A 1 138 ? -22.335 -22.374 40.178  1.00 49.72  ? 435  ARG A NH2   1 
ATOM   1040 N N     . ALA A 1 139 ? -27.244 -26.411 43.099  1.00 48.37  ? 436  ALA A N     1 
ATOM   1041 C CA    . ALA A 1 139 ? -27.482 -26.197 44.528  1.00 41.56  ? 436  ALA A CA    1 
ATOM   1042 C C     . ALA A 1 139 ? -26.198 -26.376 45.330  1.00 37.28  ? 436  ALA A C     1 
ATOM   1043 O O     . ALA A 1 139 ? -25.331 -27.136 44.949  1.00 32.50  ? 436  ALA A O     1 
ATOM   1044 C CB    . ALA A 1 139 ? -28.517 -27.211 45.023  1.00 42.15  ? 436  ALA A CB    1 
ATOM   1045 N N     . VAL A 1 140 ? -26.136 -25.714 46.478  1.00 37.09  ? 437  VAL A N     1 
ATOM   1046 C CA    . VAL A 1 140 ? -25.071 -25.854 47.460  1.00 37.95  ? 437  VAL A CA    1 
ATOM   1047 C C     . VAL A 1 140 ? -25.331 -27.101 48.284  1.00 39.10  ? 437  VAL A C     1 
ATOM   1048 O O     . VAL A 1 140 ? -26.391 -27.246 48.805  1.00 41.45  ? 437  VAL A O     1 
ATOM   1049 C CB    . VAL A 1 140 ? -25.015 -24.673 48.435  1.00 36.59  ? 437  VAL A CB    1 
ATOM   1050 C CG1   . VAL A 1 140 ? -23.746 -24.728 49.281  1.00 41.32  ? 437  VAL A CG1   1 
ATOM   1051 C CG2   . VAL A 1 140 ? -25.036 -23.376 47.669  1.00 39.19  ? 437  VAL A CG2   1 
ATOM   1052 N N     . PRO A 1 141 ? -24.361 -28.016 48.379  1.00 41.83  ? 438  PRO A N     1 
ATOM   1053 C CA    . PRO A 1 141 ? -24.647 -29.253 49.120  1.00 40.11  ? 438  PRO A CA    1 
ATOM   1054 C C     . PRO A 1 141 ? -24.459 -29.021 50.574  1.00 37.80  ? 438  PRO A C     1 
ATOM   1055 O O     . PRO A 1 141 ? -24.130 -27.900 51.003  1.00 39.03  ? 438  PRO A O     1 
ATOM   1056 C CB    . PRO A 1 141 ? -23.612 -30.248 48.578  1.00 38.69  ? 438  PRO A CB    1 
ATOM   1057 C CG    . PRO A 1 141 ? -22.499 -29.390 48.129  1.00 39.90  ? 438  PRO A CG    1 
ATOM   1058 C CD    . PRO A 1 141 ? -23.033 -28.041 47.750  1.00 37.16  ? 438  PRO A CD    1 
ATOM   1059 N N     . ASP A 1 142 ? -24.709 -30.063 51.341  1.00 39.49  ? 439  ASP A N     1 
ATOM   1060 C CA    . ASP A 1 142 ? -24.511 -30.037 52.791  1.00 43.08  ? 439  ASP A CA    1 
ATOM   1061 C C     . ASP A 1 142 ? -23.074 -29.791 53.167  1.00 35.66  ? 439  ASP A C     1 
ATOM   1062 O O     . ASP A 1 142 ? -22.159 -30.097 52.404  1.00 38.00  ? 439  ASP A O     1 
ATOM   1063 C CB    . ASP A 1 142 ? -24.957 -31.377 53.407  1.00 51.72  ? 439  ASP A CB    1 
ATOM   1064 C CG    . ASP A 1 142 ? -26.482 -31.532 53.388  1.00 59.28  ? 439  ASP A CG    1 
ATOM   1065 O OD1   . ASP A 1 142 ? -27.165 -30.486 53.292  1.00 60.05  ? 439  ASP A OD1   1 
ATOM   1066 O OD2   . ASP A 1 142 ? -26.988 -32.667 53.456  1.00 73.87  ? 439  ASP A OD2   1 
ATOM   1067 N N     . GLU A 1 143 ? -22.904 -29.305 54.372  1.00 34.73  ? 440  GLU A N     1 
ATOM   1068 C CA    . GLU A 1 143 ? -21.638 -28.897 54.876  1.00 38.98  ? 440  GLU A CA    1 
ATOM   1069 C C     . GLU A 1 143 ? -20.485 -29.876 54.649  1.00 43.42  ? 440  GLU A C     1 
ATOM   1070 O O     . GLU A 1 143 ? -19.377 -29.424 54.329  1.00 40.18  ? 440  GLU A O     1 
ATOM   1071 C CB    . GLU A 1 143 ? -21.720 -28.540 56.337  1.00 39.02  ? 440  GLU A CB    1 
ATOM   1072 C CG    . GLU A 1 143 ? -20.459 -27.844 56.803  1.00 42.26  ? 440  GLU A CG    1 
ATOM   1073 C CD    . GLU A 1 143 ? -20.550 -27.268 58.193  1.00 43.34  ? 440  GLU A CD    1 
ATOM   1074 O OE1   . GLU A 1 143 ? -20.274 -28.033 59.145  1.00 51.53  ? 440  GLU A OE1   1 
ATOM   1075 O OE2   . GLU A 1 143 ? -20.827 -26.058 58.348  1.00 44.32  ? 440  GLU A OE2   1 
ATOM   1076 N N     . PRO A 1 144 ? -20.702 -31.187 54.886  1.00 42.23  ? 441  PRO A N     1 
ATOM   1077 C CA    . PRO A 1 144 ? -19.521 -32.042 54.824  1.00 40.88  ? 441  PRO A CA    1 
ATOM   1078 C C     . PRO A 1 144 ? -19.065 -32.238 53.387  1.00 35.61  ? 441  PRO A C     1 
ATOM   1079 O O     . PRO A 1 144 ? -17.889 -32.383 53.172  1.00 36.60  ? 441  PRO A O     1 
ATOM   1080 C CB    . PRO A 1 144 ? -19.980 -33.381 55.469  1.00 41.96  ? 441  PRO A CB    1 
ATOM   1081 C CG    . PRO A 1 144 ? -21.251 -33.031 56.208  1.00 44.43  ? 441  PRO A CG    1 
ATOM   1082 C CD    . PRO A 1 144 ? -21.877 -31.920 55.401  1.00 43.31  ? 441  PRO A CD    1 
ATOM   1083 N N     . VAL A 1 145 ? -19.986 -32.226 52.428  1.00 33.48  ? 442  VAL A N     1 
ATOM   1084 C CA    . VAL A 1 145 ? -19.642 -32.354 51.027  1.00 32.32  ? 442  VAL A CA    1 
ATOM   1085 C C     . VAL A 1 145 ? -19.001 -31.033 50.583  1.00 32.24  ? 442  VAL A C     1 
ATOM   1086 O O     . VAL A 1 145 ? -17.983 -31.051 49.849  1.00 32.63  ? 442  VAL A O     1 
ATOM   1087 C CB    . VAL A 1 145 ? -20.907 -32.697 50.142  1.00 34.36  ? 442  VAL A CB    1 
ATOM   1088 C CG1   . VAL A 1 145 ? -20.596 -32.722 48.668  1.00 35.41  ? 442  VAL A CG1   1 
ATOM   1089 C CG2   . VAL A 1 145 ? -21.494 -34.029 50.548  1.00 38.11  ? 442  VAL A CG2   1 
ATOM   1090 N N     . LEU A 1 146 ? -19.566 -29.909 51.041  1.00 31.57  ? 443  LEU A N     1 
ATOM   1091 C CA    . LEU A 1 146 ? -19.090 -28.565 50.668  1.00 29.82  ? 443  LEU A CA    1 
ATOM   1092 C C     . LEU A 1 146 ? -17.688 -28.348 51.171  1.00 32.26  ? 443  LEU A C     1 
ATOM   1093 O O     . LEU A 1 146 ? -16.762 -27.950 50.393  1.00 30.94  ? 443  LEU A O     1 
ATOM   1094 C CB    . LEU A 1 146 ? -20.023 -27.494 51.200  1.00 32.13  ? 443  LEU A CB    1 
ATOM   1095 C CG    . LEU A 1 146 ? -19.623 -26.031 50.972  1.00 32.02  ? 443  LEU A CG    1 
ATOM   1096 C CD1   . LEU A 1 146 ? -19.496 -25.705 49.476  1.00 33.80  ? 443  LEU A CD1   1 
ATOM   1097 C CD2   . LEU A 1 146 ? -20.622 -25.129 51.679  1.00 32.95  ? 443  LEU A CD2   1 
ATOM   1098 N N     . ALA A 1 147 ? -17.503 -28.670 52.442  1.00 28.51  ? 444  ALA A N     1 
ATOM   1099 C CA    . ALA A 1 147 ? -16.218 -28.484 53.107  1.00 32.80  ? 444  ALA A CA    1 
ATOM   1100 C C     . ALA A 1 147 ? -15.114 -29.294 52.477  1.00 31.54  ? 444  ALA A C     1 
ATOM   1101 O O     . ALA A 1 147 ? -14.006 -28.791 52.295  1.00 31.64  ? 444  ALA A O     1 
ATOM   1102 C CB    . ALA A 1 147 ? -16.297 -28.752 54.603  1.00 34.24  ? 444  ALA A CB    1 
ATOM   1103 N N     . GLU A 1 148 ? -15.416 -30.529 52.103  1.00 33.61  ? 445  GLU A N     1 
ATOM   1104 C CA    . GLU A 1 148 ? -14.406 -31.326 51.510  1.00 33.32  ? 445  GLU A CA    1 
ATOM   1105 C C     . GLU A 1 148 ? -13.987 -30.816 50.153  1.00 30.04  ? 445  GLU A C     1 
ATOM   1106 O O     . GLU A 1 148 ? -12.797 -30.849 49.785  1.00 30.13  ? 445  GLU A O     1 
ATOM   1107 C CB    . GLU A 1 148 ? -14.775 -32.798 51.436  1.00 37.51  ? 445  GLU A CB    1 
ATOM   1108 C CG    . GLU A 1 148 ? -13.510 -33.606 51.073  1.00 43.72  ? 445  GLU A CG    1 
ATOM   1109 C CD    . GLU A 1 148 ? -13.765 -35.027 50.728  1.00 53.29  ? 445  GLU A CD    1 
ATOM   1110 O OE1   . GLU A 1 148 ? -14.912 -35.475 50.905  1.00 59.03  ? 445  GLU A OE1   1 
ATOM   1111 O OE2   . GLU A 1 148 ? -12.811 -35.684 50.274  1.00 51.09  ? 445  GLU A OE2   1 
ATOM   1112 N N     . HIS A 1 149 ? -14.987 -30.408 49.374  1.00 31.82  ? 446  HIS A N     1 
ATOM   1113 C CA    . HIS A 1 149 ? -14.731 -29.828 48.090  1.00 30.27  ? 446  HIS A CA    1 
ATOM   1114 C C     . HIS A 1 149 ? -13.861 -28.578 48.155  1.00 28.20  ? 446  HIS A C     1 
ATOM   1115 O O     . HIS A 1 149 ? -12.833 -28.497 47.470  1.00 26.62  ? 446  HIS A O     1 
ATOM   1116 C CB    . HIS A 1 149 ? -16.051 -29.575 47.357  1.00 29.33  ? 446  HIS A CB    1 
ATOM   1117 C CG    . HIS A 1 149 ? -15.882 -29.030 45.990  1.00 27.56  ? 446  HIS A CG    1 
ATOM   1118 N ND1   . HIS A 1 149 ? -15.028 -29.604 45.075  1.00 27.40  ? 446  HIS A ND1   1 
ATOM   1119 C CD2   . HIS A 1 149 ? -16.387 -27.921 45.395  1.00 25.52  ? 446  HIS A CD2   1 
ATOM   1120 C CE1   . HIS A 1 149 ? -15.042 -28.901 43.967  1.00 28.75  ? 446  HIS A CE1   1 
ATOM   1121 N NE2   . HIS A 1 149 ? -15.861 -27.881 44.132  1.00 29.31  ? 446  HIS A NE2   1 
ATOM   1122 N N     . LEU A 1 150 ? -14.199 -27.634 49.024  1.00 24.05  ? 447  LEU A N     1 
ATOM   1123 C CA    . LEU A 1 150 ? -13.411 -26.406 49.085  1.00 25.97  ? 447  LEU A CA    1 
ATOM   1124 C C     . LEU A 1 150 ? -11.980 -26.689 49.535  1.00 25.60  ? 447  LEU A C     1 
ATOM   1125 O O     . LEU A 1 150 ? -11.027 -26.047 49.052  1.00 25.01  ? 447  LEU A O     1 
ATOM   1126 C CB    . LEU A 1 150 ? -14.026 -25.322 49.978  1.00 26.39  ? 447  LEU A CB    1 
ATOM   1127 C CG    . LEU A 1 150 ? -15.451 -24.898 49.668  1.00 26.28  ? 447  LEU A CG    1 
ATOM   1128 C CD1   . LEU A 1 150 ? -15.782 -23.615 50.457  1.00 28.69  ? 447  LEU A CD1   1 
ATOM   1129 C CD2   . LEU A 1 150 ? -15.655 -24.704 48.192  1.00 31.12  ? 447  LEU A CD2   1 
ATOM   1130 N N     . VAL A 1 151 ? -11.825 -27.650 50.452  1.00 23.87  ? 448  VAL A N     1 
ATOM   1131 C CA    . VAL A 1 151 ? -10.510 -28.005 50.935  1.00 24.78  ? 448  VAL A CA    1 
ATOM   1132 C C     . VAL A 1 151 ? -9.649  -28.704 49.839  1.00 23.30  ? 448  VAL A C     1 
ATOM   1133 O O     . VAL A 1 151 ? -8.442  -28.441 49.744  1.00 22.57  ? 448  VAL A O     1 
ATOM   1134 C CB    . VAL A 1 151 ? -10.602 -28.899 52.183  1.00 30.00  ? 448  VAL A CB    1 
ATOM   1135 C CG1   . VAL A 1 151 ? -9.271  -29.544 52.505  1.00 30.64  ? 448  VAL A CG1   1 
ATOM   1136 C CG2   . VAL A 1 151 ? -11.054 -28.078 53.404  1.00 30.13  ? 448  VAL A CG2   1 
ATOM   1137 N N     . ARG A 1 152 ? -10.286 -29.554 49.044  1.00 25.92  ? 449  ARG A N     1 
ATOM   1138 C CA    . ARG A 1 152 ? -9.639  -30.209 47.941  1.00 26.60  ? 449  ARG A CA    1 
ATOM   1139 C C     . ARG A 1 152 ? -9.206  -29.166 46.917  1.00 25.20  ? 449  ARG A C     1 
ATOM   1140 O O     . ARG A 1 152 ? -8.074  -29.230 46.374  1.00 26.44  ? 449  ARG A O     1 
ATOM   1141 C CB    . ARG A 1 152 ? -10.516 -31.274 47.290  1.00 25.80  ? 449  ARG A CB    1 
ATOM   1142 C CG    . ARG A 1 152 ? -10.443 -32.605 48.079  1.00 29.74  ? 449  ARG A CG    1 
ATOM   1143 C CD    . ARG A 1 152 ? -11.280 -33.724 47.440  1.00 29.68  ? 449  ARG A CD    1 
ATOM   1144 N NE    . ARG A 1 152 ? -11.097 -34.988 48.168  1.00 30.25  ? 449  ARG A NE    1 
ATOM   1145 C CZ    . ARG A 1 152 ? -10.036 -35.787 48.094  1.00 33.26  ? 449  ARG A CZ    1 
ATOM   1146 N NH1   . ARG A 1 152 ? -9.023  -35.505 47.273  1.00 30.91  ? 449  ARG A NH1   1 
ATOM   1147 N NH2   . ARG A 1 152 ? -9.997  -36.906 48.830  1.00 29.89  ? 449  ARG A NH2   1 
ATOM   1148 N N     . LYS A 1 153 ? -10.048 -28.178 46.686  1.00 24.08  ? 450  LYS A N     1 
ATOM   1149 C CA    . LYS A 1 153 ? -9.636  -27.076 45.764  1.00 22.14  ? 450  LYS A CA    1 
ATOM   1150 C C     . LYS A 1 153 ? -8.440  -26.339 46.285  1.00 21.87  ? 450  LYS A C     1 
ATOM   1151 O O     . LYS A 1 153 ? -7.491  -26.068 45.536  1.00 24.47  ? 450  LYS A O     1 
ATOM   1152 C CB    . LYS A 1 153 ? -10.779 -26.121 45.476  1.00 23.09  ? 450  LYS A CB    1 
ATOM   1153 C CG    . LYS A 1 153 ? -11.855 -26.778 44.623  1.00 24.16  ? 450  LYS A CG    1 
ATOM   1154 C CD    . LYS A 1 153 ? -12.717 -25.780 43.837  1.00 27.88  ? 450  LYS A CD    1 
ATOM   1155 C CE    . LYS A 1 153 ? -13.501 -24.788 44.668  1.00 29.30  ? 450  LYS A CE    1 
ATOM   1156 N NZ    . LYS A 1 153 ? -14.536 -24.154 43.799  1.00 25.52  ? 450  LYS A NZ    1 
ATOM   1157 N N     . ALA A 1 154 ? -8.491  -25.915 47.545  1.00 24.08  ? 451  ALA A N     1 
ATOM   1158 C CA    . ALA A 1 154 ? -7.333  -25.293 48.173  1.00 22.68  ? 451  ALA A CA    1 
ATOM   1159 C C     . ALA A 1 154 ? -6.079  -26.109 48.139  1.00 22.50  ? 451  ALA A C     1 
ATOM   1160 O O     . ALA A 1 154 ? -4.988  -25.581 47.851  1.00 24.57  ? 451  ALA A O     1 
ATOM   1161 C CB    . ALA A 1 154 ? -7.661  -24.915 49.572  1.00 26.79  ? 451  ALA A CB    1 
ATOM   1162 N N     . ALA A 1 155 ? -6.198  -27.405 48.413  1.00 23.95  ? 452  ALA A N     1 
ATOM   1163 C CA    . ALA A 1 155 ? -5.055  -28.263 48.407  1.00 24.81  ? 452  ALA A CA    1 
ATOM   1164 C C     . ALA A 1 155 ? -4.489  -28.376 46.997  1.00 23.06  ? 452  ALA A C     1 
ATOM   1165 O O     . ALA A 1 155 ? -3.299  -28.455 46.826  1.00 23.64  ? 452  ALA A O     1 
ATOM   1166 C CB    . ALA A 1 155 ? -5.408  -29.652 48.902  1.00 25.04  ? 452  ALA A CB    1 
ATOM   1167 N N     . ALA A 1 156 ? -5.356  -28.358 45.994  1.00 25.18  ? 453  ALA A N     1 
ATOM   1168 C CA    . ALA A 1 156 ? -4.924  -28.411 44.583  1.00 26.69  ? 453  ALA A CA    1 
ATOM   1169 C C     . ALA A 1 156 ? -4.145  -27.162 44.238  1.00 25.16  ? 453  ALA A C     1 
ATOM   1170 O O     . ALA A 1 156 ? -3.036  -27.232 43.728  1.00 23.87  ? 453  ALA A O     1 
ATOM   1171 C CB    . ALA A 1 156 ? -6.149  -28.566 43.674  1.00 26.39  ? 453  ALA A CB    1 
ATOM   1172 N N     . ILE A 1 157 ? -4.703  -25.998 44.588  1.00 23.78  ? 454  ILE A N     1 
ATOM   1173 C CA    . ILE A 1 157 ? -4.000  -24.713 44.374  1.00 22.26  ? 454  ILE A CA    1 
ATOM   1174 C C     . ILE A 1 157 ? -2.624  -24.733 45.062  1.00 22.94  ? 454  ILE A C     1 
ATOM   1175 O O     . ILE A 1 157 ? -1.589  -24.415 44.438  1.00 26.01  ? 454  ILE A O     1 
ATOM   1176 C CB    . ILE A 1 157 ? -4.846  -23.524 44.857  1.00 22.73  ? 454  ILE A CB    1 
ATOM   1177 C CG1   . ILE A 1 157 ? -6.102  -23.352 43.977  1.00 27.16  ? 454  ILE A CG1   1 
ATOM   1178 C CG2   . ILE A 1 157 ? -4.079  -22.249 44.855  1.00 24.09  ? 454  ILE A CG2   1 
ATOM   1179 C CD1   . ILE A 1 157 ? -7.238  -22.648 44.760  1.00 26.65  ? 454  ILE A CD1   1 
ATOM   1180 N N     . TRP A 1 158 ? -2.591  -25.171 46.301  1.00 23.76  ? 455  TRP A N     1 
ATOM   1181 C CA    . TRP A 1 158 ? -1.328  -25.247 47.054  1.00 23.64  ? 455  TRP A CA    1 
ATOM   1182 C C     . TRP A 1 158 ? -0.332  -26.132 46.302  1.00 27.53  ? 455  TRP A C     1 
ATOM   1183 O O     . TRP A 1 158 ? 0.852   -25.762 46.191  1.00 26.48  ? 455  TRP A O     1 
ATOM   1184 C CB    . TRP A 1 158 ? -1.641  -25.818 48.422  1.00 27.86  ? 455  TRP A CB    1 
ATOM   1185 C CG    . TRP A 1 158 ? -0.512  -25.867 49.403  1.00 28.31  ? 455  TRP A CG    1 
ATOM   1186 C CD1   . TRP A 1 158 ? 0.088   -26.980 49.902  1.00 31.96  ? 455  TRP A CD1   1 
ATOM   1187 C CD2   . TRP A 1 158 ? 0.120   -24.748 50.055  1.00 32.03  ? 455  TRP A CD2   1 
ATOM   1188 N NE1   . TRP A 1 158 ? 1.026   -26.628 50.864  1.00 32.65  ? 455  TRP A NE1   1 
ATOM   1189 C CE2   . TRP A 1 158 ? 1.070   -25.264 50.963  1.00 32.75  ? 455  TRP A CE2   1 
ATOM   1190 C CE3   . TRP A 1 158 ? -0.048  -23.370 49.981  1.00 34.24  ? 455  TRP A CE3   1 
ATOM   1191 C CZ2   . TRP A 1 158 ? 1.864   -24.450 51.733  1.00 33.61  ? 455  TRP A CZ2   1 
ATOM   1192 C CZ3   . TRP A 1 158 ? 0.719   -22.571 50.759  1.00 34.22  ? 455  TRP A CZ3   1 
ATOM   1193 C CH2   . TRP A 1 158 ? 1.666   -23.099 51.629  1.00 32.80  ? 455  TRP A CH2   1 
ATOM   1194 N N     . ALA A 1 159 ? -0.791  -27.299 45.796  1.00 25.99  ? 456  ALA A N     1 
ATOM   1195 C CA    . ALA A 1 159 ? 0.096   -28.251 45.088  1.00 27.28  ? 456  ALA A CA    1 
ATOM   1196 C C     . ALA A 1 159 ? 0.513   -27.752 43.692  1.00 29.67  ? 456  ALA A C     1 
ATOM   1197 O O     . ALA A 1 159 ? 1.606   -28.022 43.251  1.00 31.04  ? 456  ALA A O     1 
ATOM   1198 C CB    . ALA A 1 159 ? -0.551  -29.614 44.957  1.00 27.92  ? 456  ALA A CB    1 
ATOM   1199 N N     . LEU A 1 160 ? -0.347  -27.000 43.002  1.00 25.23  ? 457  LEU A N     1 
ATOM   1200 C CA    . LEU A 1 160 ? -0.115  -26.645 41.633  1.00 24.80  ? 457  LEU A CA    1 
ATOM   1201 C C     . LEU A 1 160 ? 0.613   -25.324 41.362  1.00 25.99  ? 457  LEU A C     1 
ATOM   1202 O O     . LEU A 1 160 ? 1.081   -25.104 40.264  1.00 24.42  ? 457  LEU A O     1 
ATOM   1203 C CB    . LEU A 1 160 ? -1.456  -26.668 40.936  1.00 27.70  ? 457  LEU A CB    1 
ATOM   1204 C CG    . LEU A 1 160 ? -2.122  -28.027 40.882  1.00 28.80  ? 457  LEU A CG    1 
ATOM   1205 C CD1   . LEU A 1 160 ? -3.583  -27.874 40.443  1.00 32.04  ? 457  LEU A CD1   1 
ATOM   1206 C CD2   . LEU A 1 160 ? -1.398  -28.846 39.903  1.00 31.61  ? 457  LEU A CD2   1 
ATOM   1207 N N     . GLU A 1 161 ? 0.694   -24.444 42.353  1.00 25.24  ? 458  GLU A N     1 
ATOM   1208 C CA    . GLU A 1 161 ? 1.329   -23.187 42.188  1.00 25.17  ? 458  GLU A CA    1 
ATOM   1209 C C     . GLU A 1 161 ? 2.695   -23.361 41.562  1.00 27.28  ? 458  GLU A C     1 
ATOM   1210 O O     . GLU A 1 161 ? 3.015   -22.697 40.602  1.00 23.39  ? 458  GLU A O     1 
ATOM   1211 C CB    . GLU A 1 161 ? 1.460   -22.457 43.494  1.00 25.22  ? 458  GLU A CB    1 
ATOM   1212 C CG    . GLU A 1 161 ? 2.237   -21.142 43.387  1.00 27.05  ? 458  GLU A CG    1 
ATOM   1213 C CD    . GLU A 1 161 ? 2.181   -20.330 44.656  1.00 31.91  ? 458  GLU A CD    1 
ATOM   1214 O OE1   . GLU A 1 161 ? 1.354   -20.575 45.545  1.00 33.62  ? 458  GLU A OE1   1 
ATOM   1215 O OE2   . GLU A 1 161 ? 2.983   -19.451 44.808  1.00 37.06  ? 458  GLU A OE2   1 
ATOM   1216 N N     . ARG A 1 162 ? 3.503   -24.223 42.145  1.00 29.17  ? 459  ARG A N     1 
ATOM   1217 C CA    . ARG A 1 162 ? 4.882   -24.287 41.747  1.00 33.91  ? 459  ARG A CA    1 
ATOM   1218 C C     . ARG A 1 162 ? 5.054   -24.801 40.299  1.00 31.10  ? 459  ARG A C     1 
ATOM   1219 O O     . ARG A 1 162 ? 5.823   -24.239 39.543  1.00 27.68  ? 459  ARG A O     1 
ATOM   1220 C CB    . ARG A 1 162 ? 5.668   -25.124 42.763  1.00 38.40  ? 459  ARG A CB    1 
ATOM   1221 C CG    . ARG A 1 162 ? 7.052   -25.563 42.337  1.00 51.50  ? 459  ARG A CG    1 
ATOM   1222 C CD    . ARG A 1 162 ? 7.968   -24.371 42.155  1.00 65.16  ? 459  ARG A CD    1 
ATOM   1223 N NE    . ARG A 1 162 ? 9.346   -24.846 41.927  1.00 95.71  ? 459  ARG A NE    1 
ATOM   1224 C CZ    . ARG A 1 162 ? 10.394  -24.079 41.618  1.00 90.93  ? 459  ARG A CZ    1 
ATOM   1225 N NH1   . ARG A 1 162 ? 10.250  -22.769 41.504  1.00 93.42  ? 459  ARG A NH1   1 
ATOM   1226 N NH2   . ARG A 1 162 ? 11.588  -24.632 41.425  1.00 88.35  ? 459  ARG A NH2   1 
ATOM   1227 N N     . PRO A 1 163 ? 4.402   -25.921 39.927  1.00 31.29  ? 460  PRO A N     1 
ATOM   1228 C CA    . PRO A 1 163 ? 4.557   -26.321 38.519  1.00 30.57  ? 460  PRO A CA    1 
ATOM   1229 C C     . PRO A 1 163 ? 3.975   -25.330 37.534  1.00 27.81  ? 460  PRO A C     1 
ATOM   1230 O O     . PRO A 1 163 ? 4.515   -25.163 36.443  1.00 23.50  ? 460  PRO A O     1 
ATOM   1231 C CB    . PRO A 1 163 ? 3.767   -27.651 38.416  1.00 35.81  ? 460  PRO A CB    1 
ATOM   1232 C CG    . PRO A 1 163 ? 2.973   -27.718 39.679  1.00 35.23  ? 460  PRO A CG    1 
ATOM   1233 C CD    . PRO A 1 163 ? 3.791   -27.001 40.729  1.00 33.21  ? 460  PRO A CD    1 
ATOM   1234 N N     . PHE A 1 164 ? 2.855   -24.704 37.864  1.00 25.05  ? 461  PHE A N     1 
ATOM   1235 C CA    . PHE A 1 164 ? 2.316   -23.646 36.922  1.00 24.87  ? 461  PHE A CA    1 
ATOM   1236 C C     . PHE A 1 164 ? 3.305   -22.494 36.751  1.00 24.72  ? 461  PHE A C     1 
ATOM   1237 O O     . PHE A 1 164 ? 3.558   -22.047 35.634  1.00 25.14  ? 461  PHE A O     1 
ATOM   1238 C CB    . PHE A 1 164 ? 0.945   -23.126 37.388  1.00 21.75  ? 461  PHE A CB    1 
ATOM   1239 C CG    . PHE A 1 164 ? -0.204  -23.952 36.855  1.00 22.43  ? 461  PHE A CG    1 
ATOM   1240 C CD1   . PHE A 1 164 ? -0.458  -25.207 37.345  1.00 22.58  ? 461  PHE A CD1   1 
ATOM   1241 C CD2   . PHE A 1 164 ? -0.962  -23.480 35.849  1.00 22.51  ? 461  PHE A CD2   1 
ATOM   1242 C CE1   . PHE A 1 164 ? -1.460  -25.966 36.821  1.00 26.75  ? 461  PHE A CE1   1 
ATOM   1243 C CE2   . PHE A 1 164 ? -1.929  -24.252 35.288  1.00 24.22  ? 461  PHE A CE2   1 
ATOM   1244 C CZ    . PHE A 1 164 ? -2.211  -25.500 35.793  1.00 22.94  ? 461  PHE A CZ    1 
ATOM   1245 N N     . LEU A 1 165 ? 3.923   -22.052 37.849  1.00 24.37  ? 462  LEU A N     1 
ATOM   1246 C CA    . LEU A 1 165 ? 4.866   -20.969 37.780  1.00 28.07  ? 462  LEU A CA    1 
ATOM   1247 C C     . LEU A 1 165 ? 6.125   -21.379 37.017  1.00 29.06  ? 462  LEU A C     1 
ATOM   1248 O O     . LEU A 1 165 ? 6.681   -20.586 36.275  1.00 26.58  ? 462  LEU A O     1 
ATOM   1249 C CB    . LEU A 1 165 ? 5.267   -20.437 39.175  1.00 27.64  ? 462  LEU A CB    1 
ATOM   1250 C CG    . LEU A 1 165 ? 4.267   -19.507 39.857  1.00 26.63  ? 462  LEU A CG    1 
ATOM   1251 C CD1   . LEU A 1 165 ? 4.765   -19.175 41.284  1.00 31.42  ? 462  LEU A CD1   1 
ATOM   1252 C CD2   . LEU A 1 165 ? 4.018   -18.208 39.077  1.00 25.13  ? 462  LEU A CD2   1 
ATOM   1253 N N     . ASP A 1 166 ? 6.534   -22.615 37.181  1.00 28.70  ? 463  ASP A N     1 
ATOM   1254 C CA    . ASP A 1 166 ? 7.704   -23.125 36.433  1.00 31.73  ? 463  ASP A CA    1 
ATOM   1255 C C     . ASP A 1 166 ? 7.453   -23.104 34.953  1.00 29.54  ? 463  ASP A C     1 
ATOM   1256 O O     . ASP A 1 166 ? 8.305   -22.677 34.212  1.00 29.41  ? 463  ASP A O     1 
ATOM   1257 C CB    . ASP A 1 166 ? 8.017   -24.552 36.848  1.00 33.84  ? 463  ASP A CB    1 
ATOM   1258 C CG    . ASP A 1 166 ? 8.753   -24.622 38.190  1.00 39.01  ? 463  ASP A CG    1 
ATOM   1259 O OD1   . ASP A 1 166 ? 9.230   -23.574 38.653  1.00 46.66  ? 463  ASP A OD1   1 
ATOM   1260 O OD2   . ASP A 1 166 ? 8.840   -25.730 38.788  1.00 45.83  ? 463  ASP A OD2   1 
ATOM   1261 N N     . GLU A 1 167 ? 6.268   -23.568 34.527  1.00 29.98  ? 464  GLU A N     1 
ATOM   1262 C CA    . GLU A 1 167 ? 5.957   -23.570 33.116  1.00 29.66  ? 464  GLU A CA    1 
ATOM   1263 C C     . GLU A 1 167 ? 5.795   -22.161 32.558  1.00 28.01  ? 464  GLU A C     1 
ATOM   1264 O O     . GLU A 1 167 ? 6.263   -21.902 31.453  1.00 25.62  ? 464  GLU A O     1 
ATOM   1265 C CB    . GLU A 1 167 ? 4.768   -24.440 32.759  1.00 29.30  ? 464  GLU A CB    1 
ATOM   1266 C CG    . GLU A 1 167 ? 4.625   -24.703 31.275  1.00 28.87  ? 464  GLU A CG    1 
ATOM   1267 C CD    . GLU A 1 167 ? 3.398   -25.465 30.870  1.00 33.35  ? 464  GLU A CD    1 
ATOM   1268 O OE1   . GLU A 1 167 ? 2.669   -25.985 31.754  1.00 34.07  ? 464  GLU A OE1   1 
ATOM   1269 O OE2   . GLU A 1 167 ? 3.133   -25.500 29.645  1.00 33.19  ? 464  GLU A OE2   1 
ATOM   1270 N N     . LEU A 1 168 ? 5.186   -21.256 33.318  1.00 23.78  ? 465  LEU A N     1 
ATOM   1271 C CA    . LEU A 1 168 ? 5.096   -19.863 32.878  1.00 23.58  ? 465  LEU A CA    1 
ATOM   1272 C C     . LEU A 1 168 ? 6.499   -19.288 32.615  1.00 23.34  ? 465  LEU A C     1 
ATOM   1273 O O     . LEU A 1 168 ? 6.728   -18.587 31.629  1.00 24.25  ? 465  LEU A O     1 
ATOM   1274 C CB    . LEU A 1 168 ? 4.327   -19.024 33.871  1.00 22.55  ? 465  LEU A CB    1 
ATOM   1275 C CG    . LEU A 1 168 ? 2.796   -19.304 33.925  1.00 24.85  ? 465  LEU A CG    1 
ATOM   1276 C CD1   . LEU A 1 168 ? 2.213   -18.770 35.222  1.00 24.90  ? 465  LEU A CD1   1 
ATOM   1277 C CD2   . LEU A 1 168 ? 2.051   -18.688 32.745  1.00 25.51  ? 465  LEU A CD2   1 
ATOM   1278 N N     . ARG A 1 169 ? 7.426   -19.576 33.530  1.00 25.16  ? 466  ARG A N     1 
ATOM   1279 C CA    . ARG A 1 169 ? 8.766   -19.062 33.425  1.00 29.71  ? 466  ARG A CA    1 
ATOM   1280 C C     . ARG A 1 169 ? 9.492   -19.631 32.173  1.00 26.37  ? 466  ARG A C     1 
ATOM   1281 O O     . ARG A 1 169 ? 10.086  -18.905 31.439  1.00 27.34  ? 466  ARG A O     1 
ATOM   1282 C CB    . ARG A 1 169 ? 9.540   -19.371 34.715  1.00 36.98  ? 466  ARG A CB    1 
ATOM   1283 C CG    . ARG A 1 169 ? 11.031  -18.948 34.711  1.00 47.45  ? 466  ARG A CG    1 
ATOM   1284 C CD    . ARG A 1 169 ? 11.251  -17.488 35.185  1.00 55.85  ? 466  ARG A CD    1 
ATOM   1285 N NE    . ARG A 1 169 ? 12.666  -17.157 35.481  1.00 67.63  ? 466  ARG A NE    1 
ATOM   1286 C CZ    . ARG A 1 169 ? 13.085  -16.141 36.251  1.00 61.22  ? 466  ARG A CZ    1 
ATOM   1287 N N     . ARG A 1 170 ? 9.328   -20.903 31.899  1.00 26.24  ? 467  ARG A N     1 
ATOM   1288 C CA    . ARG A 1 170 ? 9.855   -21.515 30.700  1.00 31.38  ? 467  ARG A CA    1 
ATOM   1289 C C     . ARG A 1 170 ? 9.242   -20.886 29.465  1.00 29.27  ? 467  ARG A C     1 
ATOM   1290 O O     . ARG A 1 170 ? 9.918   -20.736 28.491  1.00 26.81  ? 467  ARG A O     1 
ATOM   1291 C CB    . ARG A 1 170 ? 9.600   -23.063 30.649  1.00 30.97  ? 467  ARG A CB    1 
ATOM   1292 C CG    . ARG A 1 170 ? 10.457  -23.862 31.617  1.00 37.12  ? 467  ARG A CG    1 
ATOM   1293 C CD    . ARG A 1 170 ? 10.423  -25.362 31.334  1.00 38.90  ? 467  ARG A CD    1 
ATOM   1294 N NE    . ARG A 1 170 ? 9.071   -25.936 31.457  1.00 42.95  ? 467  ARG A NE    1 
ATOM   1295 C CZ    . ARG A 1 170 ? 8.489   -26.321 32.608  1.00 39.35  ? 467  ARG A CZ    1 
ATOM   1296 N NH1   . ARG A 1 170 ? 9.125   -26.237 33.743  1.00 38.74  ? 467  ARG A NH1   1 
ATOM   1297 N NH2   . ARG A 1 170 ? 7.269   -26.842 32.602  1.00 34.14  ? 467  ARG A NH2   1 
ATOM   1298 N N     . ASN A 1 171 ? 7.957   -20.552 29.502  1.00 26.02  ? 468  ASN A N     1 
ATOM   1299 C CA    . ASN A 1 171 ? 7.325   -19.829 28.395  1.00 25.20  ? 468  ASN A CA    1 
ATOM   1300 C C     . ASN A 1 171 ? 7.662   -18.322 28.316  1.00 23.38  ? 468  ASN A C     1 
ATOM   1301 O O     . ASN A 1 171 ? 7.112   -17.654 27.478  1.00 27.24  ? 468  ASN A O     1 
ATOM   1302 C CB    . ASN A 1 171 ? 5.792   -19.963 28.571  1.00 25.13  ? 468  ASN A CB    1 
ATOM   1303 C CG    . ASN A 1 171 ? 5.253   -21.304 28.144  1.00 28.67  ? 468  ASN A CG    1 
ATOM   1304 O OD1   . ASN A 1 171 ? 5.997   -22.250 27.816  1.00 25.20  ? 468  ASN A OD1   1 
ATOM   1305 N ND2   . ASN A 1 171 ? 3.909   -21.413 28.177  1.00 30.72  ? 468  ASN A ND2   1 
ATOM   1306 N N     . GLU A 1 172 ? 8.473   -17.787 29.231  1.00 23.74  ? 469  GLU A N     1 
ATOM   1307 C CA    . GLU A 1 172 ? 8.652   -16.354 29.438  1.00 27.54  ? 469  GLU A CA    1 
ATOM   1308 C C     . GLU A 1 172 ? 7.343   -15.608 29.637  1.00 27.45  ? 469  GLU A C     1 
ATOM   1309 O O     . GLU A 1 172 ? 7.169   -14.549 29.103  1.00 25.68  ? 469  GLU A O     1 
ATOM   1310 C CB    . GLU A 1 172 ? 9.406   -15.721 28.247  1.00 33.12  ? 469  GLU A CB    1 
ATOM   1311 C CG    . GLU A 1 172 ? 10.698  -16.448 27.947  1.00 44.03  ? 469  GLU A CG    1 
ATOM   1312 C CD    . GLU A 1 172 ? 11.620  -15.653 26.998  1.00 54.70  ? 469  GLU A CD    1 
ATOM   1313 O OE1   . GLU A 1 172 ? 11.132  -14.955 26.080  1.00 57.20  ? 469  GLU A OE1   1 
ATOM   1314 O OE2   . GLU A 1 172 ? 12.841  -15.712 27.197  1.00 58.24  ? 469  GLU A OE2   1 
ATOM   1315 N N     . GLN A 1 173 ? 6.452   -16.169 30.442  1.00 27.06  ? 470  GLN A N     1 
ATOM   1316 C CA    . GLN A 1 173 ? 5.183   -15.599 30.725  1.00 24.40  ? 470  GLN A CA    1 
ATOM   1317 C C     . GLN A 1 173 ? 4.994   -15.276 32.173  1.00 26.33  ? 470  GLN A C     1 
ATOM   1318 O O     . GLN A 1 173 ? 3.905   -14.900 32.582  1.00 24.21  ? 470  GLN A O     1 
ATOM   1319 C CB    . GLN A 1 173 ? 4.092   -16.570 30.330  1.00 28.42  ? 470  GLN A CB    1 
ATOM   1320 C CG    . GLN A 1 173 ? 3.918   -16.810 28.838  1.00 26.86  ? 470  GLN A CG    1 
ATOM   1321 C CD    . GLN A 1 173 ? 2.822   -17.802 28.558  1.00 28.13  ? 470  GLN A CD    1 
ATOM   1322 O OE1   . GLN A 1 173 ? 2.794   -18.928 29.085  1.00 25.27  ? 470  GLN A OE1   1 
ATOM   1323 N NE2   . GLN A 1 173 ? 1.888   -17.394 27.708  1.00 25.22  ? 470  GLN A NE2   1 
ATOM   1324 N N     . ASP A 1 174 ? 6.057   -15.411 32.962  1.00 28.90  ? 471  ASP A N     1 
ATOM   1325 C CA    . ASP A 1 174 ? 5.974   -15.193 34.403  1.00 31.41  ? 471  ASP A CA    1 
ATOM   1326 C C     . ASP A 1 174 ? 5.677   -13.719 34.732  1.00 29.60  ? 471  ASP A C     1 
ATOM   1327 O O     . ASP A 1 174 ? 4.859   -13.431 35.603  1.00 27.23  ? 471  ASP A O     1 
ATOM   1328 C CB    . ASP A 1 174 ? 7.243   -15.701 35.147  1.00 33.85  ? 471  ASP A CB    1 
ATOM   1329 C CG    . ASP A 1 174 ? 8.506   -15.172 34.543  1.00 38.76  ? 471  ASP A CG    1 
ATOM   1330 O OD1   . ASP A 1 174 ? 8.704   -15.213 33.272  1.00 42.44  ? 471  ASP A OD1   1 
ATOM   1331 O OD2   . ASP A 1 174 ? 9.299   -14.648 35.307  1.00 45.07  ? 471  ASP A OD2   1 
ATOM   1332 N N     . ARG A 1 175 ? 6.338   -12.792 34.065  1.00 26.47  ? 472  ARG A N     1 
ATOM   1333 C CA    . ARG A 1 175 ? 6.013   -11.369 34.231  1.00 26.82  ? 472  ARG A CA    1 
ATOM   1334 C C     . ARG A 1 175 ? 4.639   -11.030 33.656  1.00 27.78  ? 472  ARG A C     1 
ATOM   1335 O O     . ARG A 1 175 ? 3.931   -10.233 34.225  1.00 26.61  ? 472  ARG A O     1 
ATOM   1336 C CB    . ARG A 1 175 ? 7.074   -10.498 33.574  1.00 31.27  ? 472  ARG A CB    1 
ATOM   1337 C CG    . ARG A 1 175 ? 8.457   -10.685 34.231  1.00 35.65  ? 472  ARG A CG    1 
ATOM   1338 C CD    . ARG A 1 175 ? 9.512   -9.776  33.589  1.00 41.37  ? 472  ARG A CD    1 
ATOM   1339 N NE    . ARG A 1 175 ? 9.230   -8.376  33.943  1.00 49.84  ? 472  ARG A NE    1 
ATOM   1340 C CZ    . ARG A 1 175 ? 9.669   -7.294  33.290  1.00 50.37  ? 472  ARG A CZ    1 
ATOM   1341 N NH1   . ARG A 1 175 ? 10.466  -7.401  32.250  1.00 52.30  ? 472  ARG A NH1   1 
ATOM   1342 N NH2   . ARG A 1 175 ? 9.342   -6.088  33.730  1.00 47.55  ? 472  ARG A NH2   1 
ATOM   1343 N N     . LEU A 1 176 ? 4.231   -11.686 32.568  1.00 23.45  ? 473  LEU A N     1 
ATOM   1344 C CA    . LEU A 1 176 ? 2.889   -11.460 32.057  1.00 24.39  ? 473  LEU A CA    1 
ATOM   1345 C C     . LEU A 1 176 ? 1.833   -11.757 33.108  1.00 25.26  ? 473  LEU A C     1 
ATOM   1346 O O     . LEU A 1 176 ? 0.844   -10.987 33.246  1.00 23.10  ? 473  LEU A O     1 
ATOM   1347 C CB    . LEU A 1 176 ? 2.636   -12.289 30.818  1.00 22.71  ? 473  LEU A CB    1 
ATOM   1348 C CG    . LEU A 1 176 ? 1.318   -12.190 30.042  1.00 23.48  ? 473  LEU A CG    1 
ATOM   1349 C CD1   . LEU A 1 176 ? 1.033   -10.833 29.552  1.00 25.69  ? 473  LEU A CD1   1 
ATOM   1350 C CD2   . LEU A 1 176 ? 1.423   -13.168 28.874  1.00 25.49  ? 473  LEU A CD2   1 
ATOM   1351 N N     . LEU A 1 177 ? 2.032   -12.844 33.875  1.00 24.15  ? 474  LEU A N     1 
ATOM   1352 C CA    . LEU A 1 177 ? 1.096   -13.139 34.984  1.00 23.17  ? 474  LEU A CA    1 
ATOM   1353 C C     . LEU A 1 177 ? 1.168   -12.116 36.129  1.00 25.93  ? 474  LEU A C     1 
ATOM   1354 O O     . LEU A 1 177 ? 0.174   -11.526 36.529  1.00 25.08  ? 474  LEU A O     1 
ATOM   1355 C CB    . LEU A 1 177 ? 1.288   -14.562 35.535  1.00 22.86  ? 474  LEU A CB    1 
ATOM   1356 C CG    . LEU A 1 177 ? 0.418   -14.886 36.772  1.00 22.81  ? 474  LEU A CG    1 
ATOM   1357 C CD1   . LEU A 1 177 ? -0.990  -14.990 36.275  1.00 23.41  ? 474  LEU A CD1   1 
ATOM   1358 C CD2   . LEU A 1 177 ? 0.844   -16.146 37.514  1.00 25.49  ? 474  LEU A CD2   1 
ATOM   1359 N N     . VAL A 1 178 ? 2.376   -11.915 36.634  1.00 25.61  ? 475  VAL A N     1 
ATOM   1360 C CA    . VAL A 1 178 ? 2.625   -11.190 37.858  1.00 26.92  ? 475  VAL A CA    1 
ATOM   1361 C C     . VAL A 1 178 ? 2.548   -9.664  37.731  1.00 23.61  ? 475  VAL A C     1 
ATOM   1362 O O     . VAL A 1 178 ? 2.081   -9.013  38.637  1.00 27.22  ? 475  VAL A O     1 
ATOM   1363 C CB    . VAL A 1 178 ? 4.025   -11.651 38.458  1.00 29.97  ? 475  VAL A CB    1 
ATOM   1364 C CG1   . VAL A 1 178 ? 4.410   -10.757 39.620  1.00 34.42  ? 475  VAL A CG1   1 
ATOM   1365 C CG2   . VAL A 1 178 ? 3.891   -13.117 38.959  1.00 30.48  ? 475  VAL A CG2   1 
ATOM   1366 N N     . GLU A 1 179 ? 2.932   -9.119  36.591  1.00 24.51  ? 476  GLU A N     1 
ATOM   1367 C CA    . GLU A 1 179 ? 2.966   -7.696  36.370  1.00 26.65  ? 476  GLU A CA    1 
ATOM   1368 C C     . GLU A 1 179 ? 1.835   -7.198  35.478  1.00 28.55  ? 476  GLU A C     1 
ATOM   1369 O O     . GLU A 1 179 ? 1.600   -6.016  35.423  1.00 24.49  ? 476  GLU A O     1 
ATOM   1370 C CB    . GLU A 1 179 ? 4.314   -7.314  35.743  1.00 27.70  ? 476  GLU A CB    1 
ATOM   1371 C CG    . GLU A 1 179 ? 5.466   -7.666  36.684  1.00 32.62  ? 476  GLU A CG    1 
ATOM   1372 C CD    . GLU A 1 179 ? 6.826   -7.310  36.105  1.00 36.26  ? 476  GLU A CD    1 
ATOM   1373 O OE1   . GLU A 1 179 ? 6.941   -6.320  35.394  1.00 51.85  ? 476  GLU A OE1   1 
ATOM   1374 O OE2   . GLU A 1 179 ? 7.799   -8.005  36.372  1.00 42.01  ? 476  GLU A OE2   1 
ATOM   1375 N N     . LEU A 1 180 ? 1.152   -8.067  34.738  1.00 23.71  ? 477  LEU A N     1 
ATOM   1376 C CA    . LEU A 1 180 ? 0.077   -7.593  33.898  1.00 21.17  ? 477  LEU A CA    1 
ATOM   1377 C C     . LEU A 1 180 ? -1.268  -8.144  34.325  1.00 23.72  ? 477  LEU A C     1 
ATOM   1378 O O     . LEU A 1 180 ? -2.110  -7.378  34.806  1.00 20.75  ? 477  LEU A O     1 
ATOM   1379 C CB    . LEU A 1 180 ? 0.362   -7.877  32.433  1.00 26.32  ? 477  LEU A CB    1 
ATOM   1380 C CG    . LEU A 1 180 ? -0.631  -7.189  31.468  1.00 26.35  ? 477  LEU A CG    1 
ATOM   1381 C CD1   . LEU A 1 180 ? 0.010   -5.961  30.869  1.00 30.84  ? 477  LEU A CD1   1 
ATOM   1382 C CD2   . LEU A 1 180 ? -1.048  -8.063  30.345  1.00 35.76  ? 477  LEU A CD2   1 
ATOM   1383 N N     . GLU A 1 181 ? -1.482  -9.469  34.182  1.00 22.56  ? 478  GLU A N     1 
ATOM   1384 C CA    . GLU A 1 181 ? -2.815  -9.974  34.336  1.00 23.40  ? 478  GLU A CA    1 
ATOM   1385 C C     . GLU A 1 181 ? -3.316  -9.888  35.831  1.00 21.41  ? 478  GLU A C     1 
ATOM   1386 O O     . GLU A 1 181 ? -4.464  -9.587  36.068  1.00 21.33  ? 478  GLU A O     1 
ATOM   1387 C CB    . GLU A 1 181 ? -2.904  -11.401 33.830  1.00 24.15  ? 478  GLU A CB    1 
ATOM   1388 C CG    . GLU A 1 181 ? -2.751  -11.638 32.347  1.00 25.40  ? 478  GLU A CG    1 
ATOM   1389 C CD    . GLU A 1 181 ? -3.793  -10.984 31.442  1.00 26.59  ? 478  GLU A CD    1 
ATOM   1390 O OE1   . GLU A 1 181 ? -4.795  -10.437 31.920  1.00 25.04  ? 478  GLU A OE1   1 
ATOM   1391 O OE2   . GLU A 1 181 ? -3.529  -10.943 30.238  1.00 25.96  ? 478  GLU A OE2   1 
ATOM   1392 N N     . GLN A 1 182 ? -2.462  -10.201 36.818  1.00 20.78  ? 479  GLN A N     1 
ATOM   1393 C CA    . GLN A 1 182 ? -2.867  -10.135 38.187  1.00 23.42  ? 479  GLN A CA    1 
ATOM   1394 C C     . GLN A 1 182 ? -3.137  -8.689  38.670  1.00 24.56  ? 479  GLN A C     1 
ATOM   1395 O O     . GLN A 1 182 ? -4.193  -8.446  39.212  1.00 21.63  ? 479  GLN A O     1 
ATOM   1396 C CB    . GLN A 1 182 ? -1.928  -10.900 39.110  1.00 22.44  ? 479  GLN A CB    1 
ATOM   1397 C CG    . GLN A 1 182 ? -2.023  -12.410 38.832  1.00 23.73  ? 479  GLN A CG    1 
ATOM   1398 C CD    . GLN A 1 182 ? -1.093  -13.294 39.662  1.00 23.42  ? 479  GLN A CD    1 
ATOM   1399 O OE1   . GLN A 1 182 ? -1.279  -14.503 39.664  1.00 24.20  ? 479  GLN A OE1   1 
ATOM   1400 N NE2   . GLN A 1 182 ? -0.163  -12.700 40.429  1.00 24.15  ? 479  GLN A NE2   1 
ATOM   1401 N N     . PRO A 1 183 ? -2.241  -7.727  38.383  1.00 24.06  ? 480  PRO A N     1 
ATOM   1402 C CA    . PRO A 1 183 ? -2.601  -6.372  38.755  1.00 29.13  ? 480  PRO A CA    1 
ATOM   1403 C C     . PRO A 1 183 ? -3.848  -5.886  37.961  1.00 27.83  ? 480  PRO A C     1 
ATOM   1404 O O     . PRO A 1 183 ? -4.694  -5.153  38.485  1.00 24.18  ? 480  PRO A O     1 
ATOM   1405 C CB    . PRO A 1 183 ? -1.364  -5.571  38.418  1.00 28.13  ? 480  PRO A CB    1 
ATOM   1406 C CG    . PRO A 1 183 ? -0.261  -6.562  38.415  1.00 30.10  ? 480  PRO A CG    1 
ATOM   1407 C CD    . PRO A 1 183 ? -0.858  -7.825  37.928  1.00 28.22  ? 480  PRO A CD    1 
ATOM   1408 N N     . LEU A 1 184 ? -3.997  -6.339  36.728  1.00 25.42  ? 481  LEU A N     1 
ATOM   1409 C CA    . LEU A 1 184 ? -5.187  -5.942  35.997  1.00 22.90  ? 481  LEU A CA    1 
ATOM   1410 C C     . LEU A 1 184 ? -6.458  -6.458  36.696  1.00 24.59  ? 481  LEU A C     1 
ATOM   1411 O O     . LEU A 1 184 ? -7.485  -5.815  36.639  1.00 22.36  ? 481  LEU A O     1 
ATOM   1412 C CB    . LEU A 1 184 ? -5.127  -6.418  34.577  1.00 21.19  ? 481  LEU A CB    1 
ATOM   1413 C CG    . LEU A 1 184 ? -6.398  -6.157  33.732  1.00 21.92  ? 481  LEU A CG    1 
ATOM   1414 C CD1   . LEU A 1 184 ? -6.562  -4.654  33.515  1.00 26.52  ? 481  LEU A CD1   1 
ATOM   1415 C CD2   . LEU A 1 184 ? -6.302  -6.832  32.386  1.00 25.57  ? 481  LEU A CD2   1 
ATOM   1416 N N     . SER A 1 185 ? -6.389  -7.663  37.272  1.00 22.93  ? 482  SER A N     1 
ATOM   1417 C CA    . SER A 1 185 ? -7.535  -8.248  37.856  1.00 23.91  ? 482  SER A CA    1 
ATOM   1418 C C     . SER A 1 185 ? -8.081  -7.361  39.008  1.00 24.06  ? 482  SER A C     1 
ATOM   1419 O O     . SER A 1 185 ? -9.285  -7.288  39.209  1.00 23.36  ? 482  SER A O     1 
ATOM   1420 C CB    . SER A 1 185 ? -7.190  -9.712  38.349  1.00 25.18  ? 482  SER A CB    1 
ATOM   1421 O OG    . SER A 1 185 ? -8.333  -10.366 38.794  1.00 33.98  ? 482  SER A OG    1 
ATOM   1422 N N     . SER A 1 186 ? -7.204  -6.788  39.815  1.00 23.99  ? 483  SER A N     1 
ATOM   1423 C CA    . SER A 1 186 ? -7.600  -5.809  40.805  1.00 27.74  ? 483  SER A CA    1 
ATOM   1424 C C     . SER A 1 186 ? -8.275  -4.583  40.222  1.00 24.53  ? 483  SER A C     1 
ATOM   1425 O O     . SER A 1 186 ? -9.227  -4.061  40.804  1.00 23.45  ? 483  SER A O     1 
ATOM   1426 C CB    . SER A 1 186 ? -6.378  -5.318  41.637  1.00 29.59  ? 483  SER A CB    1 
ATOM   1427 O OG    . SER A 1 186 ? -5.758  -6.440  42.146  1.00 33.74  ? 483  SER A OG    1 
ATOM   1428 N N     . ILE A 1 187 ? -7.756  -4.089  39.107  1.00 21.79  ? 484  ILE A N     1 
ATOM   1429 C CA    . ILE A 1 187 ? -8.304  -2.912  38.469  1.00 20.91  ? 484  ILE A CA    1 
ATOM   1430 C C     . ILE A 1 187 ? -9.696  -3.228  37.914  1.00 22.91  ? 484  ILE A C     1 
ATOM   1431 O O     . ILE A 1 187 ? -10.628 -2.434  38.104  1.00 21.33  ? 484  ILE A O     1 
ATOM   1432 C CB    . ILE A 1 187 ? -7.362  -2.406  37.340  1.00 22.59  ? 484  ILE A CB    1 
ATOM   1433 C CG1   . ILE A 1 187 ? -6.107  -1.858  37.986  1.00 20.67  ? 484  ILE A CG1   1 
ATOM   1434 C CG2   . ILE A 1 187 ? -8.028  -1.383  36.464  1.00 24.12  ? 484  ILE A CG2   1 
ATOM   1435 C CD1   . ILE A 1 187 ? -4.966  -1.572  37.026  1.00 25.73  ? 484  ILE A CD1   1 
ATOM   1436 N N     . LEU A 1 188 ? -9.863  -4.423  37.332  1.00 20.09  ? 485  LEU A N     1 
ATOM   1437 C CA    . LEU A 1 188 ? -11.165 -4.779  36.835  1.00 22.24  ? 485  LEU A CA    1 
ATOM   1438 C C     . LEU A 1 188 ? -12.168 -4.959  37.983  1.00 20.34  ? 485  LEU A C     1 
ATOM   1439 O O     . LEU A 1 188 ? -13.308 -4.667  37.815  1.00 21.83  ? 485  LEU A O     1 
ATOM   1440 C CB    . LEU A 1 188 ? -11.111 -6.078  36.023  1.00 23.17  ? 485  LEU A CB    1 
ATOM   1441 C CG    . LEU A 1 188 ? -10.244 -6.021  34.723  1.00 22.16  ? 485  LEU A CG    1 
ATOM   1442 C CD1   . LEU A 1 188 ? -10.167 -7.441  34.174  1.00 23.17  ? 485  LEU A CD1   1 
ATOM   1443 C CD2   . LEU A 1 188 ? -10.857 -5.091  33.693  1.00 22.61  ? 485  LEU A CD2   1 
ATOM   1444 N N     . ALA A 1 189 ? -11.723 -5.498  39.103  1.00 20.94  ? 486  ALA A N     1 
ATOM   1445 C CA    . ALA A 1 189 ? -12.576 -5.692  40.259  1.00 23.19  ? 486  ALA A CA    1 
ATOM   1446 C C     . ALA A 1 189 ? -13.135 -4.331  40.716  1.00 23.56  ? 486  ALA A C     1 
ATOM   1447 O O     . ALA A 1 189 ? -14.286 -4.232  41.052  1.00 22.01  ? 486  ALA A O     1 
ATOM   1448 C CB    . ALA A 1 189 ? -11.783 -6.321  41.415  1.00 22.36  ? 486  ALA A CB    1 
ATOM   1449 N N     . GLU A 1 190 ? -12.268 -3.318  40.787  1.00 22.26  ? 487  GLU A N     1 
ATOM   1450 C CA    . GLU A 1 190 ? -12.706 -1.939  41.159  1.00 23.98  ? 487  GLU A CA    1 
ATOM   1451 C C     . GLU A 1 190 ? -13.711 -1.395  40.115  1.00 25.64  ? 487  GLU A C     1 
ATOM   1452 O O     . GLU A 1 190 ? -14.702 -0.777  40.463  1.00 23.82  ? 487  GLU A O     1 
ATOM   1453 C CB    . GLU A 1 190 ? -11.534 -1.015  41.292  1.00 27.18  ? 487  GLU A CB    1 
ATOM   1454 C CG    . GLU A 1 190 ? -10.597 -1.324  42.433  1.00 30.04  ? 487  GLU A CG    1 
ATOM   1455 C CD    . GLU A 1 190 ? -9.199  -0.550  42.376  1.00 46.72  ? 487  GLU A CD    1 
ATOM   1456 O OE1   . GLU A 1 190 ? -8.941  0.388   41.541  1.00 51.58  ? 487  GLU A OE1   1 
ATOM   1457 O OE2   . GLU A 1 190 ? -8.264  -0.895  43.161  1.00 53.51  ? 487  GLU A OE2   1 
ATOM   1458 N N     . MET A 1 191 ? -13.489 -1.674  38.838  1.00 22.58  ? 488  MET A N     1 
ATOM   1459 C CA    . MET A 1 191 ? -14.393 -1.164  37.790  1.00 24.39  ? 488  MET A CA    1 
ATOM   1460 C C     . MET A 1 191 ? -15.780 -1.788  37.888  1.00 24.69  ? 488  MET A C     1 
ATOM   1461 O O     . MET A 1 191 ? -16.780 -1.093  37.775  1.00 23.56  ? 488  MET A O     1 
ATOM   1462 C CB    . MET A 1 191 ? -13.825 -1.422  36.373  1.00 23.99  ? 488  MET A CB    1 
ATOM   1463 C CG    . MET A 1 191 ? -12.542 -0.670  36.086  1.00 25.06  ? 488  MET A CG    1 
ATOM   1464 S SD    . MET A 1 191 ? -11.573 -1.324  34.710  1.00 23.19  ? 488  MET A SD    1 
ATOM   1465 C CE    . MET A 1 191 ? -12.668 -1.070  33.327  1.00 21.63  ? 488  MET A CE    1 
ATOM   1466 N N     . GLU A 1 192 ? -15.819 -3.097  38.089  1.00 23.00  ? 489  GLU A N     1 
ATOM   1467 C CA    . GLU A 1 192 ? -17.060 -3.841  38.193  1.00 24.60  ? 489  GLU A CA    1 
ATOM   1468 C C     . GLU A 1 192 ? -17.845 -3.389  39.432  1.00 22.45  ? 489  GLU A C     1 
ATOM   1469 O O     . GLU A 1 192 ? -19.056 -3.152  39.380  1.00 24.20  ? 489  GLU A O     1 
ATOM   1470 C CB    . GLU A 1 192 ? -16.771 -5.339  38.277  1.00 24.06  ? 489  GLU A CB    1 
ATOM   1471 C CG    . GLU A 1 192 ? -16.055 -5.924  37.015  1.00 23.59  ? 489  GLU A CG    1 
ATOM   1472 C CD    . GLU A 1 192 ? -15.700 -7.377  37.217  1.00 22.27  ? 489  GLU A CD    1 
ATOM   1473 O OE1   . GLU A 1 192 ? -15.990 -7.885  38.340  1.00 24.81  ? 489  GLU A OE1   1 
ATOM   1474 O OE2   . GLU A 1 192 ? -15.135 -8.029  36.284  1.00 22.69  ? 489  GLU A OE2   1 
ATOM   1475 N N     . PHE A 1 193 ? -17.133 -3.302  40.525  1.00 22.90  ? 490  PHE A N     1 
ATOM   1476 C CA    . PHE A 1 193 ? -17.701 -2.821  41.783  1.00 26.42  ? 490  PHE A CA    1 
ATOM   1477 C C     . PHE A 1 193 ? -18.283 -1.427  41.707  1.00 25.87  ? 490  PHE A C     1 
ATOM   1478 O O     . PHE A 1 193 ? -19.429 -1.212  42.122  1.00 24.64  ? 490  PHE A O     1 
ATOM   1479 C CB    . PHE A 1 193 ? -16.713 -2.988  42.934  1.00 23.49  ? 490  PHE A CB    1 
ATOM   1480 C CG    . PHE A 1 193 ? -17.285 -2.637  44.268  1.00 25.41  ? 490  PHE A CG    1 
ATOM   1481 C CD1   . PHE A 1 193 ? -18.297 -3.437  44.856  1.00 25.25  ? 490  PHE A CD1   1 
ATOM   1482 C CD2   . PHE A 1 193 ? -16.840 -1.505  44.970  1.00 26.75  ? 490  PHE A CD2   1 
ATOM   1483 C CE1   . PHE A 1 193 ? -18.871 -3.070  46.076  1.00 26.18  ? 490  PHE A CE1   1 
ATOM   1484 C CE2   . PHE A 1 193 ? -17.379 -1.160  46.238  1.00 25.54  ? 490  PHE A CE2   1 
ATOM   1485 C CZ    . PHE A 1 193 ? -18.387 -1.929  46.787  1.00 24.21  ? 490  PHE A CZ    1 
ATOM   1486 N N     . ALA A 1 194 ? -17.570 -0.488  41.114  1.00 25.08  ? 491  ALA A N     1 
ATOM   1487 C CA    . ALA A 1 194 ? -18.081 0.882   40.956  1.00 23.36  ? 491  ALA A CA    1 
ATOM   1488 C C     . ALA A 1 194 ? -19.336 0.860   40.092  1.00 28.59  ? 491  ALA A C     1 
ATOM   1489 O O     . ALA A 1 194 ? -20.359 1.503   40.428  1.00 23.74  ? 491  ALA A O     1 
ATOM   1490 C CB    . ALA A 1 194 ? -17.047 1.741   40.267  1.00 26.10  ? 491  ALA A CB    1 
ATOM   1491 N N     . GLY A 1 195 ? -19.299 0.085   39.010  1.00 25.00  ? 492  GLY A N     1 
ATOM   1492 C CA    . GLY A 1 195 ? -20.445 0.009   38.085  1.00 25.82  ? 492  GLY A CA    1 
ATOM   1493 C C     . GLY A 1 195 ? -20.656 1.292   37.297  1.00 24.01  ? 492  GLY A C     1 
ATOM   1494 O O     . GLY A 1 195 ? -19.902 2.250   37.436  1.00 22.90  ? 492  GLY A O     1 
ATOM   1495 N N     . VAL A 1 196 ? -21.710 1.315   36.472  1.00 23.42  ? 493  VAL A N     1 
ATOM   1496 C CA    . VAL A 1 196 ? -22.023 2.470   35.675  1.00 25.02  ? 493  VAL A CA    1 
ATOM   1497 C C     . VAL A 1 196 ? -23.483 2.825   35.936  1.00 28.90  ? 493  VAL A C     1 
ATOM   1498 O O     . VAL A 1 196 ? -24.389 1.948   35.896  1.00 26.83  ? 493  VAL A O     1 
ATOM   1499 C CB    . VAL A 1 196 ? -21.887 2.209   34.162  1.00 27.00  ? 493  VAL A CB    1 
ATOM   1500 C CG1   . VAL A 1 196 ? -22.142 3.485   33.364  1.00 29.28  ? 493  VAL A CG1   1 
ATOM   1501 C CG2   . VAL A 1 196 ? -20.536 1.664   33.812  1.00 27.35  ? 493  VAL A CG2   1 
ATOM   1502 N N     . LYS A 1 197 ? -23.716 4.119   36.162  1.00 27.06  ? 494  LYS A N     1 
ATOM   1503 C CA    . LYS A 1 197 ? -25.028 4.613   36.479  1.00 25.70  ? 494  LYS A CA    1 
ATOM   1504 C C     . LYS A 1 197 ? -25.889 4.668   35.249  1.00 23.66  ? 494  LYS A C     1 
ATOM   1505 O O     . LYS A 1 197 ? -25.479 5.140   34.229  1.00 24.05  ? 494  LYS A O     1 
ATOM   1506 C CB    . LYS A 1 197 ? -24.877 6.038   37.042  1.00 29.77  ? 494  LYS A CB    1 
ATOM   1507 C CG    . LYS A 1 197 ? -26.158 6.670   37.550  1.00 31.80  ? 494  LYS A CG    1 
ATOM   1508 C CD    . LYS A 1 197 ? -26.713 5.917   38.702  1.00 40.29  ? 494  LYS A CD    1 
ATOM   1509 C CE    . LYS A 1 197 ? -27.230 6.814   39.756  1.00 49.72  ? 494  LYS A CE    1 
ATOM   1510 N NZ    . LYS A 1 197 ? -26.078 7.195   40.612  1.00 56.73  ? 494  LYS A NZ    1 
ATOM   1511 N N     . VAL A 1 198 ? -27.151 4.284   35.378  1.00 24.35  ? 495  VAL A N     1 
ATOM   1512 C CA    . VAL A 1 198 ? -28.092 4.290   34.267  1.00 24.39  ? 495  VAL A CA    1 
ATOM   1513 C C     . VAL A 1 198 ? -29.284 5.170   34.572  1.00 27.01  ? 495  VAL A C     1 
ATOM   1514 O O     . VAL A 1 198 ? -29.837 5.085   35.659  1.00 25.12  ? 495  VAL A O     1 
ATOM   1515 C CB    . VAL A 1 198 ? -28.611 2.848   34.008  1.00 27.40  ? 495  VAL A CB    1 
ATOM   1516 C CG1   . VAL A 1 198 ? -29.578 2.814   32.887  1.00 30.24  ? 495  VAL A CG1   1 
ATOM   1517 C CG2   . VAL A 1 198 ? -27.465 1.918   33.714  1.00 29.57  ? 495  VAL A CG2   1 
ATOM   1518 N N     . ASP A 1 199 ? -29.697 5.950   33.584  1.00 29.13  ? 496  ASP A N     1 
ATOM   1519 C CA    . ASP A 1 199 ? -30.883 6.781   33.677  1.00 30.34  ? 496  ASP A CA    1 
ATOM   1520 C C     . ASP A 1 199 ? -32.079 5.952   33.256  1.00 31.56  ? 496  ASP A C     1 
ATOM   1521 O O     . ASP A 1 199 ? -32.443 5.908   32.091  1.00 29.47  ? 496  ASP A O     1 
ATOM   1522 C CB    . ASP A 1 199 ? -30.679 7.963   32.772  1.00 31.45  ? 496  ASP A CB    1 
ATOM   1523 C CG    . ASP A 1 199 ? -31.816 8.993   32.829  1.00 33.86  ? 496  ASP A CG    1 
ATOM   1524 O OD1   . ASP A 1 199 ? -32.907 8.710   33.348  1.00 35.04  ? 496  ASP A OD1   1 
ATOM   1525 O OD2   . ASP A 1 199 ? -31.605 10.060  32.262  1.00 36.03  ? 496  ASP A OD2   1 
ATOM   1526 N N     . THR A 1 200 ? -32.625 5.230   34.210  1.00 30.54  ? 497  THR A N     1 
ATOM   1527 C CA    . THR A 1 200 ? -33.654 4.262   33.873  1.00 34.37  ? 497  THR A CA    1 
ATOM   1528 C C     . THR A 1 200 ? -34.934 4.920   33.359  1.00 36.36  ? 497  THR A C     1 
ATOM   1529 O O     . THR A 1 200 ? -35.649 4.309   32.553  1.00 34.90  ? 497  THR A O     1 
ATOM   1530 C CB    . THR A 1 200 ? -34.013 3.358   35.043  1.00 32.01  ? 497  THR A CB    1 
ATOM   1531 O OG1   . THR A 1 200 ? -34.358 4.169   36.149  1.00 31.66  ? 497  THR A OG1   1 
ATOM   1532 C CG2   . THR A 1 200 ? -32.846 2.433   35.428  1.00 33.75  ? 497  THR A CG2   1 
ATOM   1533 N N     . LYS A 1 201 ? -35.228 6.150   33.802  1.00 36.23  ? 498  LYS A N     1 
ATOM   1534 C CA    . LYS A 1 201 ? -36.388 6.882   33.249  1.00 40.61  ? 498  LYS A CA    1 
ATOM   1535 C C     . LYS A 1 201 ? -36.219 7.113   31.775  1.00 35.85  ? 498  LYS A C     1 
ATOM   1536 O O     . LYS A 1 201 ? -37.149 6.886   31.025  1.00 35.00  ? 498  LYS A O     1 
ATOM   1537 C CB    . LYS A 1 201 ? -36.614 8.233   33.916  1.00 46.00  ? 498  LYS A CB    1 
ATOM   1538 C CG    . LYS A 1 201 ? -37.430 8.073   35.165  1.00 56.77  ? 498  LYS A CG    1 
ATOM   1539 C CD    . LYS A 1 201 ? -37.244 9.233   36.114  1.00 74.97  ? 498  LYS A CD    1 
ATOM   1540 C CE    . LYS A 1 201 ? -37.820 8.892   37.493  1.00 80.92  ? 498  LYS A CE    1 
ATOM   1541 N NZ    . LYS A 1 201 ? -37.268 9.807   38.532  1.00 89.63  ? 498  LYS A NZ    1 
ATOM   1542 N N     . ARG A 1 202 ? -35.032 7.567   31.371  1.00 33.48  ? 499  ARG A N     1 
ATOM   1543 C CA    . ARG A 1 202 ? -34.732 7.755   29.943  1.00 34.97  ? 499  ARG A CA    1 
ATOM   1544 C C     . ARG A 1 202 ? -34.885 6.465   29.128  1.00 37.76  ? 499  ARG A C     1 
ATOM   1545 O O     . ARG A 1 202 ? -35.462 6.501   28.032  1.00 33.21  ? 499  ARG A O     1 
ATOM   1546 C CB    . ARG A 1 202 ? -33.391 8.412   29.745  1.00 38.84  ? 499  ARG A CB    1 
ATOM   1547 C CG    . ARG A 1 202 ? -32.934 8.657   28.289  1.00 45.65  ? 499  ARG A CG    1 
ATOM   1548 C CD    . ARG A 1 202 ? -33.186 10.094  27.861  1.00 55.29  ? 499  ARG A CD    1 
ATOM   1549 N NE    . ARG A 1 202 ? -32.896 10.389  26.456  1.00 66.17  ? 499  ARG A NE    1 
ATOM   1550 C CZ    . ARG A 1 202 ? -33.763 10.253  25.429  1.00 75.35  ? 499  ARG A CZ    1 
ATOM   1551 N NH1   . ARG A 1 202 ? -35.013 9.784   25.592  1.00 69.58  ? 499  ARG A NH1   1 
ATOM   1552 N NH2   . ARG A 1 202 ? -33.371 10.569  24.197  1.00 80.95  ? 499  ARG A NH2   1 
ATOM   1553 N N     . LEU A 1 203 ? -34.393 5.340   29.654  1.00 36.14  ? 500  LEU A N     1 
ATOM   1554 C CA    . LEU A 1 203 ? -34.561 4.049   28.967  1.00 38.00  ? 500  LEU A CA    1 
ATOM   1555 C C     . LEU A 1 203 ? -36.032 3.646   28.885  1.00 37.05  ? 500  LEU A C     1 
ATOM   1556 O O     . LEU A 1 203 ? -36.465 3.132   27.901  1.00 34.28  ? 500  LEU A O     1 
ATOM   1557 C CB    . LEU A 1 203 ? -33.855 2.892   29.681  1.00 36.72  ? 500  LEU A CB    1 
ATOM   1558 C CG    . LEU A 1 203 ? -32.361 2.704   29.544  1.00 39.14  ? 500  LEU A CG    1 
ATOM   1559 C CD1   . LEU A 1 203 ? -31.955 1.479   30.333  1.00 36.73  ? 500  LEU A CD1   1 
ATOM   1560 C CD2   . LEU A 1 203 ? -31.976 2.567   28.069  1.00 39.33  ? 500  LEU A CD2   1 
ATOM   1561 N N     . GLU A 1 204 ? -36.772 3.824   29.963  1.00 37.21  ? 501  GLU A N     1 
ATOM   1562 C CA    . GLU A 1 204 ? -38.202 3.510   29.924  1.00 39.90  ? 501  GLU A CA    1 
ATOM   1563 C C     . GLU A 1 204 ? -38.967 4.340   28.914  1.00 37.12  ? 501  GLU A C     1 
ATOM   1564 O O     . GLU A 1 204 ? -39.857 3.829   28.269  1.00 41.10  ? 501  GLU A O     1 
ATOM   1565 C CB    . GLU A 1 204 ? -38.848 3.687   31.285  1.00 43.97  ? 501  GLU A CB    1 
ATOM   1566 C CG    . GLU A 1 204 ? -38.471 2.569   32.210  1.00 46.42  ? 501  GLU A CG    1 
ATOM   1567 C CD    . GLU A 1 204 ? -38.714 2.924   33.647  1.00 50.52  ? 501  GLU A CD    1 
ATOM   1568 O OE1   . GLU A 1 204 ? -39.099 4.078   33.963  1.00 48.78  ? 501  GLU A OE1   1 
ATOM   1569 O OE2   . GLU A 1 204 ? -38.452 2.043   34.462  1.00 52.82  ? 501  GLU A OE2   1 
ATOM   1570 N N     . GLN A 1 205 ? -38.647 5.615   28.765  1.00 38.32  ? 502  GLN A N     1 
ATOM   1571 C CA    A GLN A 1 205 ? -39.344 6.410   27.755  0.45 40.38  ? 502  GLN A CA    1 
ATOM   1572 C CA    B GLN A 1 205 ? -39.308 6.444   27.761  0.55 39.42  ? 502  GLN A CA    1 
ATOM   1573 C C     . GLN A 1 205 ? -38.895 6.026   26.338  1.00 42.87  ? 502  GLN A C     1 
ATOM   1574 O O     . GLN A 1 205 ? -39.715 6.012   25.428  1.00 38.10  ? 502  GLN A O     1 
ATOM   1575 C CB    A GLN A 1 205 ? -39.262 7.914   27.994  0.45 44.23  ? 502  GLN A CB    1 
ATOM   1576 C CB    B GLN A 1 205 ? -39.018 7.919   27.984  0.55 43.02  ? 502  GLN A CB    1 
ATOM   1577 C CG    A GLN A 1 205 ? -37.964 8.603   27.626  0.45 49.80  ? 502  GLN A CG    1 
ATOM   1578 C CG    B GLN A 1 205 ? -39.645 8.470   29.263  0.55 47.45  ? 502  GLN A CG    1 
ATOM   1579 C CD    A GLN A 1 205 ? -37.887 9.982   28.260  0.45 54.51  ? 502  GLN A CD    1 
ATOM   1580 C CD    B GLN A 1 205 ? -39.100 9.827   29.671  0.55 54.28  ? 502  GLN A CD    1 
ATOM   1581 O OE1   A GLN A 1 205 ? -38.479 10.230  29.313  0.45 64.25  ? 502  GLN A OE1   1 
ATOM   1582 O OE1   B GLN A 1 205 ? -38.132 10.349  29.089  0.55 60.57  ? 502  GLN A OE1   1 
ATOM   1583 N NE2   A GLN A 1 205 ? -37.167 10.881  27.627  0.45 52.91  ? 502  GLN A NE2   1 
ATOM   1584 N NE2   B GLN A 1 205 ? -39.709 10.404  30.700  0.55 54.37  ? 502  GLN A NE2   1 
ATOM   1585 N N     . MET A 1 206 ? -37.623 5.683   26.145  1.00 37.78  ? 503  MET A N     1 
ATOM   1586 C CA    . MET A 1 206 ? -37.205 5.108   24.861  1.00 39.93  ? 503  MET A CA    1 
ATOM   1587 C C     . MET A 1 206 ? -37.986 3.851   24.580  1.00 39.34  ? 503  MET A C     1 
ATOM   1588 O O     . MET A 1 206 ? -38.462 3.688   23.488  1.00 38.96  ? 503  MET A O     1 
ATOM   1589 C CB    . MET A 1 206 ? -35.744 4.771   24.836  1.00 40.14  ? 503  MET A CB    1 
ATOM   1590 C CG    . MET A 1 206 ? -34.879 5.993   24.715  1.00 43.93  ? 503  MET A CG    1 
ATOM   1591 S SD    . MET A 1 206 ? -33.129 5.646   25.000  1.00 53.13  ? 503  MET A SD    1 
ATOM   1592 C CE    . MET A 1 206 ? -32.527 7.291   24.648  1.00 54.84  ? 503  MET A CE    1 
ATOM   1593 N N     . GLY A 1 207 ? -38.095 2.971   25.572  1.00 41.66  ? 504  GLY A N     1 
ATOM   1594 C CA    . GLY A 1 207 ? -38.874 1.744   25.458  1.00 47.29  ? 504  GLY A CA    1 
ATOM   1595 C C     . GLY A 1 207 ? -40.335 1.930   25.076  1.00 47.91  ? 504  GLY A C     1 
ATOM   1596 O O     . GLY A 1 207 ? -40.927 1.104   24.329  1.00 41.91  ? 504  GLY A O     1 
ATOM   1597 N N     . GLU A 1 208 ? -40.924 3.006   25.591  1.00 48.11  ? 505  GLU A N     1 
ATOM   1598 C CA    . GLU A 1 208 ? -42.313 3.359   25.269  1.00 46.60  ? 505  GLU A CA    1 
ATOM   1599 C C     . GLU A 1 208 ? -42.445 3.805   23.822  1.00 43.78  ? 505  GLU A C     1 
ATOM   1600 O O     . GLU A 1 208 ? -43.383 3.367   23.124  1.00 44.03  ? 505  GLU A O     1 
ATOM   1601 C CB    . GLU A 1 208 ? -42.854 4.437   26.215  1.00 46.28  ? 505  GLU A CB    1 
ATOM   1602 C CG    . GLU A 1 208 ? -43.192 3.910   27.590  1.00 50.09  ? 505  GLU A CG    1 
ATOM   1603 N N     . GLU A 1 209 ? -41.541 4.671   23.368  1.00 42.66  ? 506  GLU A N     1 
ATOM   1604 C CA    . GLU A 1 209 ? -41.495 5.071   21.974  1.00 44.72  ? 506  GLU A CA    1 
ATOM   1605 C C     . GLU A 1 209 ? -41.273 3.857   21.059  1.00 53.72  ? 506  GLU A C     1 
ATOM   1606 O O     . GLU A 1 209 ? -42.037 3.615   20.115  1.00 50.83  ? 506  GLU A O     1 
ATOM   1607 C CB    . GLU A 1 209 ? -40.396 6.058   21.715  1.00 52.35  ? 506  GLU A CB    1 
ATOM   1608 C CG    . GLU A 1 209 ? -40.716 7.433   22.232  1.00 61.57  ? 506  GLU A CG    1 
ATOM   1609 C CD    . GLU A 1 209 ? -39.495 8.337   22.365  1.00 72.46  ? 506  GLU A CD    1 
ATOM   1610 O OE1   . GLU A 1 209 ? -38.338 7.881   22.173  1.00 81.64  ? 506  GLU A OE1   1 
ATOM   1611 O OE2   . GLU A 1 209 ? -39.696 9.526   22.685  1.00 79.37  ? 506  GLU A OE2   1 
ATOM   1612 N N     . LEU A 1 210 ? -40.249 3.066   21.345  1.00 46.42  ? 507  LEU A N     1 
ATOM   1613 C CA    . LEU A 1 210 ? -39.992 1.907   20.514  1.00 47.72  ? 507  LEU A CA    1 
ATOM   1614 C C     . LEU A 1 210 ? -41.233 1.022   20.441  1.00 46.53  ? 507  LEU A C     1 
ATOM   1615 O O     . LEU A 1 210 ? -41.499 0.424   19.409  1.00 47.21  ? 507  LEU A O     1 
ATOM   1616 C CB    . LEU A 1 210 ? -38.831 1.078   21.037  1.00 42.71  ? 507  LEU A CB    1 
ATOM   1617 C CG    . LEU A 1 210 ? -37.458 1.624   20.726  1.00 50.12  ? 507  LEU A CG    1 
ATOM   1618 C CD1   . LEU A 1 210 ? -36.383 0.897   21.528  1.00 49.92  ? 507  LEU A CD1   1 
ATOM   1619 C CD2   . LEU A 1 210 ? -37.168 1.452   19.242  1.00 50.22  ? 507  LEU A CD2   1 
ATOM   1620 N N     . ALA A 1 211 ? -41.948 0.874   21.542  1.00 44.34  ? 508  ALA A N     1 
ATOM   1621 C CA    . ALA A 1 211 ? -43.117 -0.043  21.576  1.00 48.14  ? 508  ALA A CA    1 
ATOM   1622 C C     . ALA A 1 211 ? -44.211 0.427   20.603  1.00 47.84  ? 508  ALA A C     1 
ATOM   1623 O O     . ALA A 1 211 ? -44.851 -0.366  19.942  1.00 49.27  ? 508  ALA A O     1 
ATOM   1624 C CB    . ALA A 1 211 ? -43.669 -0.186  22.978  1.00 47.53  ? 508  ALA A CB    1 
ATOM   1625 N N     . GLU A 1 212 ? -44.334 1.731   20.467  1.00 50.11  ? 509  GLU A N     1 
ATOM   1626 C CA    . GLU A 1 212 ? -45.304 2.347   19.585  1.00 53.80  ? 509  GLU A CA    1 
ATOM   1627 C C     . GLU A 1 212 ? -44.887 2.169   18.126  1.00 54.91  ? 509  GLU A C     1 
ATOM   1628 O O     . GLU A 1 212 ? -45.712 1.782   17.273  1.00 45.33  ? 509  GLU A O     1 
ATOM   1629 C CB    . GLU A 1 212 ? -45.425 3.829   19.922  1.00 53.59  ? 509  GLU A CB    1 
ATOM   1630 C CG    . GLU A 1 212 ? -46.490 4.545   19.139  1.00 66.79  ? 509  GLU A CG    1 
ATOM   1631 C CD    . GLU A 1 212 ? -46.969 5.799   19.834  1.00 83.49  ? 509  GLU A CD    1 
ATOM   1632 O OE1   . GLU A 1 212 ? -46.171 6.433   20.559  1.00 101.04 ? 509  GLU A OE1   1 
ATOM   1633 O OE2   . GLU A 1 212 ? -48.156 6.146   19.670  1.00 94.45  ? 509  GLU A OE2   1 
ATOM   1634 N N     . GLN A 1 213 ? -43.616 2.451   17.849  1.00 47.63  ? 510  GLN A N     1 
ATOM   1635 C CA    . GLN A 1 213 ? -43.072 2.229   16.528  1.00 46.79  ? 510  GLN A CA    1 
ATOM   1636 C C     . GLN A 1 213 ? -43.100 0.777   16.105  1.00 46.25  ? 510  GLN A C     1 
ATOM   1637 O O     . GLN A 1 213 ? -43.367 0.497   14.933  1.00 50.94  ? 510  GLN A O     1 
ATOM   1638 C CB    . GLN A 1 213 ? -41.669 2.792   16.405  1.00 52.34  ? 510  GLN A CB    1 
ATOM   1639 C CG    . GLN A 1 213 ? -41.677 4.308   16.456  1.00 51.63  ? 510  GLN A CG    1 
ATOM   1640 C CD    . GLN A 1 213 ? -40.300 4.905   16.493  1.00 60.64  ? 510  GLN A CD    1 
ATOM   1641 O OE1   . GLN A 1 213 ? -40.082 5.909   17.153  1.00 67.03  ? 510  GLN A OE1   1 
ATOM   1642 N NE2   . GLN A 1 213 ? -39.362 4.300   15.792  1.00 67.74  ? 510  GLN A NE2   1 
ATOM   1643 N N     . LEU A 1 214 ? -42.884 -0.149  17.033  1.00 41.63  ? 511  LEU A N     1 
ATOM   1644 C CA    . LEU A 1 214 ? -42.960 -1.547  16.696  1.00 41.67  ? 511  LEU A CA    1 
ATOM   1645 C C     . LEU A 1 214 ? -44.383 -1.957  16.301  1.00 49.88  ? 511  LEU A C     1 
ATOM   1646 O O     . LEU A 1 214 ? -44.528 -2.786  15.369  1.00 41.85  ? 511  LEU A O     1 
ATOM   1647 C CB    . LEU A 1 214 ? -42.492 -2.460  17.820  1.00 44.01  ? 511  LEU A CB    1 
ATOM   1648 C CG    . LEU A 1 214 ? -40.978 -2.733  17.970  1.00 50.88  ? 511  LEU A CG    1 
ATOM   1649 C CD1   . LEU A 1 214 ? -40.687 -3.342  19.343  1.00 46.47  ? 511  LEU A CD1   1 
ATOM   1650 C CD2   . LEU A 1 214 ? -40.457 -3.632  16.848  1.00 51.41  ? 511  LEU A CD2   1 
ATOM   1651 N N     . ARG A 1 215 ? -45.403 -1.434  17.027  1.00 43.26  ? 512  ARG A N     1 
ATOM   1652 C CA    . ARG A 1 215 ? -46.819 -1.770  16.777  1.00 46.87  ? 512  ARG A CA    1 
ATOM   1653 C C     . ARG A 1 215 ? -47.186 -1.288  15.370  1.00 45.47  ? 512  ARG A C     1 
ATOM   1654 O O     . ARG A 1 215 ? -47.816 -2.002  14.622  1.00 50.20  ? 512  ARG A O     1 
ATOM   1655 C CB    . ARG A 1 215 ? -47.781 -1.184  17.832  1.00 46.52  ? 512  ARG A CB    1 
ATOM   1656 C CG    . ARG A 1 215 ? -47.675 -1.834  19.202  1.00 52.10  ? 512  ARG A CG    1 
ATOM   1657 C CD    . ARG A 1 215 ? -48.489 -1.090  20.285  1.00 57.42  ? 512  ARG A CD    1 
ATOM   1658 N N     . THR A 1 216 ? -46.725 -0.102  15.013  1.00 46.15  ? 513  THR A N     1 
ATOM   1659 C CA    . THR A 1 216 ? -46.930 0.459   13.703  1.00 51.20  ? 513  THR A CA    1 
ATOM   1660 C C     . THR A 1 216 ? -46.299 -0.406  12.579  1.00 57.11  ? 513  THR A C     1 
ATOM   1661 O O     . THR A 1 216 ? -46.992 -0.806  11.623  1.00 44.04  ? 513  THR A O     1 
ATOM   1662 C CB    . THR A 1 216 ? -46.333 1.884   13.621  1.00 51.25  ? 513  THR A CB    1 
ATOM   1663 O OG1   . THR A 1 216 ? -46.861 2.680   14.674  1.00 59.38  ? 513  THR A OG1   1 
ATOM   1664 C CG2   . THR A 1 216 ? -46.624 2.563   12.275  1.00 50.99  ? 513  THR A CG2   1 
ATOM   1665 N N     . VAL A 1 217 ? -44.983 -0.643  12.666  1.00 44.79  ? 514  VAL A N     1 
ATOM   1666 C CA    . VAL A 1 217 ? -44.295 -1.436  11.645  1.00 45.93  ? 514  VAL A CA    1 
ATOM   1667 C C     . VAL A 1 217 ? -44.940 -2.846  11.549  1.00 44.57  ? 514  VAL A C     1 
ATOM   1668 O O     . VAL A 1 217 ? -45.138 -3.376  10.444  1.00 39.47  ? 514  VAL A O     1 
ATOM   1669 C CB    . VAL A 1 217 ? -42.764 -1.525  11.846  1.00 45.69  ? 514  VAL A CB    1 
ATOM   1670 C CG1   . VAL A 1 217 ? -42.129 -2.202  10.649  1.00 47.01  ? 514  VAL A CG1   1 
ATOM   1671 C CG2   . VAL A 1 217 ? -42.149 -0.148  11.944  1.00 52.68  ? 514  VAL A CG2   1 
ATOM   1672 N N     . GLU A 1 218 ? -45.307 -3.413  12.695  1.00 38.38  ? 515  GLU A N     1 
ATOM   1673 C CA    . GLU A 1 218 ? -45.854 -4.732  12.764  1.00 40.53  ? 515  GLU A CA    1 
ATOM   1674 C C     . GLU A 1 218 ? -47.159 -4.777  11.947  1.00 52.15  ? 515  GLU A C     1 
ATOM   1675 O O     . GLU A 1 218 ? -47.378 -5.737  11.178  1.00 45.47  ? 515  GLU A O     1 
ATOM   1676 C CB    . GLU A 1 218 ? -46.064 -5.140  14.216  1.00 45.10  ? 515  GLU A CB    1 
ATOM   1677 C CG    . GLU A 1 218 ? -46.851 -6.408  14.440  1.00 49.58  ? 515  GLU A CG    1 
ATOM   1678 C CD    . GLU A 1 218 ? -47.462 -6.533  15.853  1.00 57.66  ? 515  GLU A CD    1 
ATOM   1679 O OE1   . GLU A 1 218 ? -47.337 -5.582  16.657  1.00 53.99  ? 515  GLU A OE1   1 
ATOM   1680 O OE2   . GLU A 1 218 ? -48.085 -7.593  16.151  1.00 52.64  ? 515  GLU A OE2   1 
ATOM   1681 N N     . GLN A 1 219 ? -47.997 -3.737  12.106  1.00 49.87  ? 516  GLN A N     1 
ATOM   1682 C CA    . GLN A 1 219 ? -49.299 -3.692  11.447  1.00 54.53  ? 516  GLN A CA    1 
ATOM   1683 C C     . GLN A 1 219 ? -49.099 -3.613  9.954   1.00 49.00  ? 516  GLN A C     1 
ATOM   1684 O O     . GLN A 1 219 ? -49.800 -4.253  9.229   1.00 47.63  ? 516  GLN A O     1 
ATOM   1685 C CB    . GLN A 1 219 ? -50.197 -2.544  11.968  1.00 51.95  ? 516  GLN A CB    1 
ATOM   1686 C CG    . GLN A 1 219 ? -50.847 -2.844  13.345  1.00 60.17  ? 516  GLN A CG    1 
ATOM   1687 C CD    . GLN A 1 219 ? -51.470 -4.258  13.463  1.00 65.46  ? 516  GLN A CD    1 
ATOM   1688 O OE1   . GLN A 1 219 ? -52.300 -4.660  12.639  1.00 73.95  ? 516  GLN A OE1   1 
ATOM   1689 N NE2   . GLN A 1 219 ? -51.070 -5.009  14.486  1.00 63.81  ? 516  GLN A NE2   1 
ATOM   1690 N N     . ARG A 1 220 ? -48.113 -2.814  9.560   1.00 41.36  ? 517  ARG A N     1 
ATOM   1691 C CA    . ARG A 1 220 ? -47.708 -2.602  8.208   1.00 44.00  ? 517  ARG A CA    1 
ATOM   1692 C C     . ARG A 1 220 ? -47.232 -3.899  7.536   1.00 44.83  ? 517  ARG A C     1 
ATOM   1693 O O     . ARG A 1 220 ? -47.653 -4.203  6.421   1.00 40.15  ? 517  ARG A O     1 
ATOM   1694 C CB    . ARG A 1 220 ? -46.639 -1.521  8.152   1.00 42.84  ? 517  ARG A CB    1 
ATOM   1695 C CG    . ARG A 1 220 ? -46.153 -1.148  6.774   1.00 48.20  ? 517  ARG A CG    1 
ATOM   1696 C CD    . ARG A 1 220 ? -47.345 -0.793  5.917   1.00 57.40  ? 517  ARG A CD    1 
ATOM   1697 N NE    . ARG A 1 220 ? -47.023 -0.276  4.592   1.00 59.78  ? 517  ARG A NE    1 
ATOM   1698 C CZ    . ARG A 1 220 ? -47.914 -0.180  3.599   1.00 61.05  ? 517  ARG A CZ    1 
ATOM   1699 N NH1   . ARG A 1 220 ? -49.178 -0.556  3.782   1.00 58.25  ? 517  ARG A NH1   1 
ATOM   1700 N NH2   . ARG A 1 220 ? -47.535 0.284   2.418   1.00 60.39  ? 517  ARG A NH2   1 
ATOM   1701 N N     . ILE A 1 221 ? -46.432 -4.681  8.250   1.00 37.92  ? 518  ILE A N     1 
ATOM   1702 C CA    . ILE A 1 221 ? -46.031 -5.996  7.795   1.00 37.88  ? 518  ILE A CA    1 
ATOM   1703 C C     . ILE A 1 221 ? -47.202 -6.961  7.538   1.00 41.30  ? 518  ILE A C     1 
ATOM   1704 O O     . ILE A 1 221 ? -47.174 -7.713  6.535   1.00 38.89  ? 518  ILE A O     1 
ATOM   1705 C CB    . ILE A 1 221 ? -45.036 -6.623  8.773   1.00 33.33  ? 518  ILE A CB    1 
ATOM   1706 C CG1   . ILE A 1 221 ? -43.699 -5.844  8.697   1.00 33.98  ? 518  ILE A CG1   1 
ATOM   1707 C CG2   . ILE A 1 221 ? -44.824 -8.075  8.439   1.00 34.09  ? 518  ILE A CG2   1 
ATOM   1708 C CD1   . ILE A 1 221 ? -42.699 -6.210  9.795   1.00 37.91  ? 518  ILE A CD1   1 
ATOM   1709 N N     . TYR A 1 222 ? -48.184 -6.979  8.443   1.00 38.82  ? 519  TYR A N     1 
ATOM   1710 C CA    . TYR A 1 222 ? -49.374 -7.840  8.287   1.00 44.06  ? 519  TYR A CA    1 
ATOM   1711 C C     . TYR A 1 222 ? -50.257 -7.350  7.111   1.00 46.20  ? 519  TYR A C     1 
ATOM   1712 O O     . TYR A 1 222 ? -50.807 -8.125  6.359   1.00 49.35  ? 519  TYR A O     1 
ATOM   1713 C CB    . TYR A 1 222 ? -50.221 -7.904  9.580   1.00 44.97  ? 519  TYR A CB    1 
ATOM   1714 C CG    . TYR A 1 222 ? -49.503 -8.419  10.813  1.00 50.52  ? 519  TYR A CG    1 
ATOM   1715 C CD1   . TYR A 1 222 ? -48.470 -9.327  10.713  1.00 50.79  ? 519  TYR A CD1   1 
ATOM   1716 C CD2   . TYR A 1 222 ? -49.890 -8.000  12.111  1.00 55.63  ? 519  TYR A CD2   1 
ATOM   1717 C CE1   . TYR A 1 222 ? -47.820 -9.811  11.844  1.00 53.64  ? 519  TYR A CE1   1 
ATOM   1718 C CE2   . TYR A 1 222 ? -49.242 -8.473  13.248  1.00 51.40  ? 519  TYR A CE2   1 
ATOM   1719 C CZ    . TYR A 1 222 ? -48.199 -9.386  13.106  1.00 53.69  ? 519  TYR A CZ    1 
ATOM   1720 O OH    . TYR A 1 222 ? -47.480 -9.883  14.189  1.00 51.52  ? 519  TYR A OH    1 
ATOM   1721 N N     . GLU A 1 223 ? -50.354 -6.042  6.958   1.00 49.89  ? 520  GLU A N     1 
ATOM   1722 C CA    . GLU A 1 223 ? -51.043 -5.446  5.825   1.00 53.10  ? 520  GLU A CA    1 
ATOM   1723 C C     . GLU A 1 223 ? -50.358 -5.847  4.489   1.00 52.87  ? 520  GLU A C     1 
ATOM   1724 O O     . GLU A 1 223 ? -51.007 -6.408  3.588   1.00 47.72  ? 520  GLU A O     1 
ATOM   1725 C CB    . GLU A 1 223 ? -51.065 -3.937  6.002   1.00 57.82  ? 520  GLU A CB    1 
ATOM   1726 C CG    . GLU A 1 223 ? -51.969 -3.207  5.055   1.00 65.69  ? 520  GLU A CG    1 
ATOM   1727 C CD    . GLU A 1 223 ? -51.840 -1.698  5.176   1.00 78.84  ? 520  GLU A CD    1 
ATOM   1728 O OE1   . GLU A 1 223 ? -51.072 -1.199  6.037   1.00 81.36  ? 520  GLU A OE1   1 
ATOM   1729 O OE2   . GLU A 1 223 ? -52.507 -0.994  4.388   1.00 91.76  ? 520  GLU A OE2   1 
ATOM   1730 N N     . LEU A 1 224 ? -49.060 -5.581  4.373   1.00 47.22  ? 521  LEU A N     1 
ATOM   1731 C CA    . LEU A 1 224 ? -48.299 -5.943  3.171   1.00 47.98  ? 521  LEU A CA    1 
ATOM   1732 C C     . LEU A 1 224 ? -48.267 -7.455  2.901   1.00 46.04  ? 521  LEU A C     1 
ATOM   1733 O O     . LEU A 1 224 ? -48.214 -7.861  1.747   1.00 48.95  ? 521  LEU A O     1 
ATOM   1734 C CB    . LEU A 1 224 ? -46.870 -5.404  3.228   1.00 47.03  ? 521  LEU A CB    1 
ATOM   1735 C CG    . LEU A 1 224 ? -46.747 -3.887  3.086   1.00 48.00  ? 521  LEU A CG    1 
ATOM   1736 C CD1   . LEU A 1 224 ? -45.332 -3.421  3.386   1.00 46.22  ? 521  LEU A CD1   1 
ATOM   1737 C CD2   . LEU A 1 224 ? -47.176 -3.389  1.682   1.00 48.83  ? 521  LEU A CD2   1 
ATOM   1738 N N     . ALA A 1 225 ? -48.282 -8.273  3.941   1.00 44.14  ? 522  ALA A N     1 
ATOM   1739 C CA    . ALA A 1 225 ? -48.281 -9.734  3.752   1.00 46.99  ? 522  ALA A CA    1 
ATOM   1740 C C     . ALA A 1 225 ? -49.675 -10.253 3.368   1.00 56.16  ? 522  ALA A C     1 
ATOM   1741 O O     . ALA A 1 225 ? -49.782 -11.344 2.808   1.00 46.05  ? 522  ALA A O     1 
ATOM   1742 C CB    . ALA A 1 225 ? -47.847 -10.460 5.006   1.00 39.92  ? 522  ALA A CB    1 
ATOM   1743 N N     . GLY A 1 226 ? -50.717 -9.530  3.791   1.00 52.78  ? 523  GLY A N     1 
ATOM   1744 C CA    . GLY A 1 226 ? -52.103 -9.954  3.624   1.00 52.45  ? 523  GLY A CA    1 
ATOM   1745 C C     . GLY A 1 226 ? -52.558 -10.918 4.680   1.00 52.99  ? 523  GLY A C     1 
ATOM   1746 O O     . GLY A 1 226 ? -53.597 -11.560 4.526   1.00 61.78  ? 523  GLY A O     1 
ATOM   1747 N N     . GLN A 1 227 ? -51.798 -11.041 5.765   1.00 57.63  ? 524  GLN A N     1 
ATOM   1748 C CA    . GLN A 1 227 ? -52.211 -11.873 6.909   1.00 52.52  ? 524  GLN A CA    1 
ATOM   1749 C C     . GLN A 1 227 ? -51.299 -11.625 8.136   1.00 60.85  ? 524  GLN A C     1 
ATOM   1750 O O     . GLN A 1 227 ? -50.183 -11.074 7.998   1.00 48.33  ? 524  GLN A O     1 
ATOM   1751 C CB    . GLN A 1 227 ? -52.203 -13.373 6.543   1.00 54.51  ? 524  GLN A CB    1 
ATOM   1752 C CG    . GLN A 1 227 ? -50.837 -14.010 6.627   1.00 52.21  ? 524  GLN A CG    1 
ATOM   1753 C CD    . GLN A 1 227 ? -50.842 -15.504 6.424   1.00 55.72  ? 524  GLN A CD    1 
ATOM   1754 O OE1   . GLN A 1 227 ? -50.611 -16.265 7.355   1.00 57.16  ? 524  GLN A OE1   1 
ATOM   1755 N NE2   . GLN A 1 227 ? -51.061 -15.929 5.189   1.00 54.67  ? 524  GLN A NE2   1 
ATOM   1756 N N     . GLU A 1 228 ? -51.777 -12.069 9.309   1.00 51.38  ? 525  GLU A N     1 
ATOM   1757 C CA    . GLU A 1 228 ? -51.043 -11.971 10.528  1.00 51.28  ? 525  GLU A CA    1 
ATOM   1758 C C     . GLU A 1 228 ? -50.192 -13.230 10.654  1.00 49.41  ? 525  GLU A C     1 
ATOM   1759 O O     . GLU A 1 228 ? -50.588 -14.273 10.203  1.00 57.56  ? 525  GLU A O     1 
ATOM   1760 C CB    . GLU A 1 228 ? -51.991 -11.806 11.745  1.00 48.90  ? 525  GLU A CB    1 
ATOM   1761 N N     . PHE A 1 229 ? -49.027 -13.125 11.299  1.00 50.55  ? 526  PHE A N     1 
ATOM   1762 C CA    . PHE A 1 229 ? -48.135 -14.277 11.549  1.00 47.47  ? 526  PHE A CA    1 
ATOM   1763 C C     . PHE A 1 229 ? -47.105 -13.842 12.575  1.00 45.38  ? 526  PHE A C     1 
ATOM   1764 O O     . PHE A 1 229 ? -47.012 -12.655 12.886  1.00 50.51  ? 526  PHE A O     1 
ATOM   1765 C CB    . PHE A 1 229 ? -47.429 -14.761 10.235  1.00 49.26  ? 526  PHE A CB    1 
ATOM   1766 C CG    . PHE A 1 229 ? -46.543 -13.724 9.573   1.00 45.57  ? 526  PHE A CG    1 
ATOM   1767 C CD1   . PHE A 1 229 ? -47.089 -12.639 8.871   1.00 45.81  ? 526  PHE A CD1   1 
ATOM   1768 C CD2   . PHE A 1 229 ? -45.167 -13.827 9.650   1.00 41.13  ? 526  PHE A CD2   1 
ATOM   1769 C CE1   . PHE A 1 229 ? -46.259 -11.684 8.248   1.00 40.35  ? 526  PHE A CE1   1 
ATOM   1770 C CE2   . PHE A 1 229 ? -44.342 -12.894 9.053   1.00 41.25  ? 526  PHE A CE2   1 
ATOM   1771 C CZ    . PHE A 1 229 ? -44.888 -11.812 8.352   1.00 37.67  ? 526  PHE A CZ    1 
ATOM   1772 N N     . ASN A 1 230 ? -46.358 -14.793 13.119  1.00 47.09  ? 527  ASN A N     1 
ATOM   1773 C CA    . ASN A 1 230 ? -45.233 -14.449 13.975  1.00 49.03  ? 527  ASN A CA    1 
ATOM   1774 C C     . ASN A 1 230 ? -43.995 -14.075 13.158  1.00 44.05  ? 527  ASN A C     1 
ATOM   1775 O O     . ASN A 1 230 ? -43.227 -14.927 12.704  1.00 46.00  ? 527  ASN A O     1 
ATOM   1776 C CB    . ASN A 1 230 ? -44.877 -15.592 14.939  1.00 48.02  ? 527  ASN A CB    1 
ATOM   1777 C CG    . ASN A 1 230 ? -43.756 -15.195 15.915  1.00 54.48  ? 527  ASN A CG    1 
ATOM   1778 O OD1   . ASN A 1 230 ? -43.206 -14.089 15.856  1.00 50.17  ? 527  ASN A OD1   1 
ATOM   1779 N ND2   . ASN A 1 230 ? -43.418 -16.092 16.817  1.00 58.56  ? 527  ASN A ND2   1 
ATOM   1780 N N     . ILE A 1 231 ? -43.782 -12.783 13.048  1.00 39.84  ? 528  ILE A N     1 
ATOM   1781 C CA    . ILE A 1 231 ? -42.632 -12.244 12.364  1.00 40.80  ? 528  ILE A CA    1 
ATOM   1782 C C     . ILE A 1 231 ? -41.295 -12.810 12.869  1.00 43.21  ? 528  ILE A C     1 
ATOM   1783 O O     . ILE A 1 231 ? -40.342 -12.836 12.136  1.00 44.42  ? 528  ILE A O     1 
ATOM   1784 C CB    . ILE A 1 231 ? -42.656 -10.711 12.509  1.00 39.33  ? 528  ILE A CB    1 
ATOM   1785 C CG1   . ILE A 1 231 ? -43.979 -10.177 11.971  1.00 38.78  ? 528  ILE A CG1   1 
ATOM   1786 C CG2   . ILE A 1 231 ? -41.535 -10.061 11.757  1.00 39.38  ? 528  ILE A CG2   1 
ATOM   1787 C CD1   . ILE A 1 231 ? -44.234 -8.751  12.318  1.00 42.46  ? 528  ILE A CD1   1 
ATOM   1788 N N     . ASN A 1 232 ? -41.208 -13.267 14.116  1.00 51.29  ? 529  ASN A N     1 
ATOM   1789 C CA    . ASN A 1 232 ? -39.921 -13.800 14.666  1.00 49.00  ? 529  ASN A CA    1 
ATOM   1790 C C     . ASN A 1 232 ? -39.785 -15.301 14.491  1.00 45.38  ? 529  ASN A C     1 
ATOM   1791 O O     . ASN A 1 232 ? -38.809 -15.894 14.889  1.00 48.68  ? 529  ASN A O     1 
ATOM   1792 C CB    . ASN A 1 232 ? -39.743 -13.418 16.145  1.00 50.53  ? 529  ASN A CB    1 
ATOM   1793 C CG    . ASN A 1 232 ? -39.929 -11.942 16.378  1.00 51.00  ? 529  ASN A CG    1 
ATOM   1794 O OD1   . ASN A 1 232 ? -40.973 -11.505 16.843  1.00 60.94  ? 529  ASN A OD1   1 
ATOM   1795 N ND2   . ASN A 1 232 ? -38.938 -11.164 16.021  1.00 54.24  ? 529  ASN A ND2   1 
ATOM   1796 N N     . SER A 1 233 ? -40.792 -15.928 13.921  1.00 45.06  ? 530  SER A N     1 
ATOM   1797 C CA    . SER A 1 233 ? -40.738 -17.355 13.631  1.00 48.03  ? 530  SER A CA    1 
ATOM   1798 C C     . SER A 1 233 ? -40.070 -17.554 12.264  1.00 50.70  ? 530  SER A C     1 
ATOM   1799 O O     . SER A 1 233 ? -40.589 -17.090 11.263  1.00 56.71  ? 530  SER A O     1 
ATOM   1800 C CB    . SER A 1 233 ? -42.157 -17.929 13.610  1.00 50.53  ? 530  SER A CB    1 
ATOM   1801 O OG    . SER A 1 233 ? -42.183 -19.197 12.965  1.00 55.95  ? 530  SER A OG    1 
ATOM   1802 N N     . PRO A 1 234 ? -38.921 -18.228 12.210  1.00 54.71  ? 531  PRO A N     1 
ATOM   1803 C CA    . PRO A 1 234 ? -38.348 -18.484 10.875  1.00 54.12  ? 531  PRO A CA    1 
ATOM   1804 C C     . PRO A 1 234 ? -39.253 -19.351 9.963   1.00 53.23  ? 531  PRO A C     1 
ATOM   1805 O O     . PRO A 1 234 ? -39.200 -19.253 8.745   1.00 55.74  ? 531  PRO A O     1 
ATOM   1806 C CB    . PRO A 1 234 ? -37.011 -19.189 11.192  1.00 54.43  ? 531  PRO A CB    1 
ATOM   1807 C CG    . PRO A 1 234 ? -36.765 -18.973 12.660  1.00 53.47  ? 531  PRO A CG    1 
ATOM   1808 C CD    . PRO A 1 234 ? -38.124 -18.860 13.283  1.00 54.75  ? 531  PRO A CD    1 
ATOM   1809 N N     . LYS A 1 235 ? -40.109 -20.182 10.528  1.00 50.75  ? 532  LYS A N     1 
ATOM   1810 C CA    . LYS A 1 235 ? -40.947 -21.009 9.649   1.00 54.82  ? 532  LYS A CA    1 
ATOM   1811 C C     . LYS A 1 235 ? -42.026 -20.131 9.050   1.00 52.54  ? 532  LYS A C     1 
ATOM   1812 O O     . LYS A 1 235 ? -42.306 -20.181 7.850   1.00 47.33  ? 532  LYS A O     1 
ATOM   1813 C CB    . LYS A 1 235 ? -41.559 -22.234 10.372  1.00 53.47  ? 532  LYS A CB    1 
ATOM   1814 N N     . GLN A 1 236 ? -42.631 -19.300 9.876   1.00 48.96  ? 533  GLN A N     1 
ATOM   1815 C CA    . GLN A 1 236 ? -43.754 -18.515 9.388   1.00 49.75  ? 533  GLN A CA    1 
ATOM   1816 C C     . GLN A 1 236 ? -43.278 -17.415 8.448   1.00 44.84  ? 533  GLN A C     1 
ATOM   1817 O O     . GLN A 1 236 ? -43.939 -17.131 7.446   1.00 43.42  ? 533  GLN A O     1 
ATOM   1818 C CB    . GLN A 1 236 ? -44.513 -17.889 10.537  1.00 50.02  ? 533  GLN A CB    1 
ATOM   1819 C CG    . GLN A 1 236 ? -45.016 -18.914 11.546  1.00 57.73  ? 533  GLN A CG    1 
ATOM   1820 C CD    . GLN A 1 236 ? -46.047 -18.341 12.534  1.00 57.06  ? 533  GLN A CD    1 
ATOM   1821 O OE1   . GLN A 1 236 ? -46.784 -17.376 12.246  1.00 54.56  ? 533  GLN A OE1   1 
ATOM   1822 N NE2   . GLN A 1 236 ? -46.122 -18.969 13.698  1.00 61.43  ? 533  GLN A NE2   1 
ATOM   1823 N N     . LEU A 1 237 ? -42.139 -16.802 8.783   1.00 39.61  ? 534  LEU A N     1 
ATOM   1824 C CA    . LEU A 1 237 ? -41.612 -15.724 7.994   1.00 39.08  ? 534  LEU A CA    1 
ATOM   1825 C C     . LEU A 1 237 ? -41.105 -16.244 6.620   1.00 42.20  ? 534  LEU A C     1 
ATOM   1826 O O     . LEU A 1 237 ? -41.299 -15.591 5.579   1.00 36.55  ? 534  LEU A O     1 
ATOM   1827 C CB    . LEU A 1 237 ? -40.506 -15.029 8.727   1.00 35.56  ? 534  LEU A CB    1 
ATOM   1828 C CG    . LEU A 1 237 ? -39.886 -13.861 7.955   1.00 34.82  ? 534  LEU A CG    1 
ATOM   1829 C CD1   . LEU A 1 237 ? -40.873 -12.739 7.654   1.00 34.60  ? 534  LEU A CD1   1 
ATOM   1830 C CD2   . LEU A 1 237 ? -38.720 -13.357 8.768   1.00 38.44  ? 534  LEU A CD2   1 
ATOM   1831 N N     . GLY A 1 238 ? -40.443 -17.390 6.644   1.00 40.18  ? 535  GLY A N     1 
ATOM   1832 C CA    . GLY A 1 238 ? -39.928 -18.012 5.419   1.00 43.75  ? 535  GLY A CA    1 
ATOM   1833 C C     . GLY A 1 238 ? -41.070 -18.422 4.489   1.00 43.30  ? 535  GLY A C     1 
ATOM   1834 O O     . GLY A 1 238 ? -40.955 -18.299 3.287   1.00 41.16  ? 535  GLY A O     1 
ATOM   1835 N N     . VAL A 1 239 ? -42.192 -18.848 5.059   1.00 41.23  ? 536  VAL A N     1 
ATOM   1836 C CA    . VAL A 1 239 ? -43.377 -19.165 4.283   1.00 40.39  ? 536  VAL A CA    1 
ATOM   1837 C C     . VAL A 1 239 ? -43.967 -17.914 3.624   1.00 40.55  ? 536  VAL A C     1 
ATOM   1838 O O     . VAL A 1 239 ? -44.300 -17.917 2.428   1.00 41.44  ? 536  VAL A O     1 
ATOM   1839 C CB    . VAL A 1 239 ? -44.429 -19.883 5.175   1.00 42.77  ? 536  VAL A CB    1 
ATOM   1840 C CG1   . VAL A 1 239 ? -45.838 -19.730 4.651   1.00 38.78  ? 536  VAL A CG1   1 
ATOM   1841 C CG2   . VAL A 1 239 ? -44.092 -21.367 5.290   1.00 43.60  ? 536  VAL A CG2   1 
ATOM   1842 N N     . ILE A 1 240 ? -44.073 -16.837 4.387   1.00 37.18  ? 537  ILE A N     1 
ATOM   1843 C CA    . ILE A 1 240 ? -44.608 -15.586 3.853   1.00 35.25  ? 537  ILE A CA    1 
ATOM   1844 C C     . ILE A 1 240 ? -43.703 -15.067 2.725   1.00 35.55  ? 537  ILE A C     1 
ATOM   1845 O O     . ILE A 1 240 ? -44.160 -14.695 1.654   1.00 38.80  ? 537  ILE A O     1 
ATOM   1846 C CB    . ILE A 1 240 ? -44.701 -14.489 4.957   1.00 36.39  ? 537  ILE A CB    1 
ATOM   1847 C CG1   . ILE A 1 240 ? -45.709 -14.910 6.055   1.00 42.30  ? 537  ILE A CG1   1 
ATOM   1848 C CG2   . ILE A 1 240 ? -45.107 -13.116 4.371   1.00 30.71  ? 537  ILE A CG2   1 
ATOM   1849 C CD1   . ILE A 1 240 ? -47.154 -14.999 5.583   1.00 42.72  ? 537  ILE A CD1   1 
ATOM   1850 N N     . LEU A 1 241 ? -42.412 -15.025 2.970   1.00 31.62  ? 538  LEU A N     1 
ATOM   1851 C CA    . LEU A 1 241 ? -41.506 -14.404 2.005   1.00 33.32  ? 538  LEU A CA    1 
ATOM   1852 C C     . LEU A 1 241 ? -41.307 -15.233 0.774   1.00 33.83  ? 538  LEU A C     1 
ATOM   1853 O O     . LEU A 1 241 ? -41.463 -14.741 -0.354  1.00 30.08  ? 538  LEU A O     1 
ATOM   1854 C CB    . LEU A 1 241 ? -40.138 -14.161 2.659   1.00 32.21  ? 538  LEU A CB    1 
ATOM   1855 C CG    . LEU A 1 241 ? -40.153 -13.095 3.822   1.00 32.38  ? 538  LEU A CG    1 
ATOM   1856 C CD1   . LEU A 1 241 ? -38.711 -12.839 4.281   1.00 32.57  ? 538  LEU A CD1   1 
ATOM   1857 C CD2   . LEU A 1 241 ? -40.837 -11.797 3.461   1.00 28.56  ? 538  LEU A CD2   1 
ATOM   1858 N N     . PHE A 1 242 ? -40.912 -16.485 1.012   1.00 31.26  ? 539  PHE A N     1 
ATOM   1859 C CA    . PHE A 1 242 ? -40.403 -17.351 -0.037  1.00 34.47  ? 539  PHE A CA    1 
ATOM   1860 C C     . PHE A 1 242 ? -41.416 -18.271 -0.700  1.00 36.67  ? 539  PHE A C     1 
ATOM   1861 O O     . PHE A 1 242 ? -41.093 -18.814 -1.749  1.00 37.98  ? 539  PHE A O     1 
ATOM   1862 C CB    . PHE A 1 242 ? -39.219 -18.108 0.483   1.00 31.83  ? 539  PHE A CB    1 
ATOM   1863 C CG    . PHE A 1 242 ? -38.167 -17.189 1.016   1.00 39.50  ? 539  PHE A CG    1 
ATOM   1864 C CD1   . PHE A 1 242 ? -37.533 -16.224 0.176   1.00 33.93  ? 539  PHE A CD1   1 
ATOM   1865 C CD2   . PHE A 1 242 ? -37.814 -17.223 2.369   1.00 39.50  ? 539  PHE A CD2   1 
ATOM   1866 C CE1   . PHE A 1 242 ? -36.551 -15.360 0.698   1.00 36.21  ? 539  PHE A CE1   1 
ATOM   1867 C CE2   . PHE A 1 242 ? -36.837 -16.355 2.875   1.00 33.35  ? 539  PHE A CE2   1 
ATOM   1868 C CZ    . PHE A 1 242 ? -36.220 -15.431 2.064   1.00 31.12  ? 539  PHE A CZ    1 
ATOM   1869 N N     . GLU A 1 243 ? -42.632 -18.367 -0.144  1.00 36.07  ? 540  GLU A N     1 
ATOM   1870 C CA    . GLU A 1 243 ? -43.718 -19.149 -0.747  1.00 35.35  ? 540  GLU A CA    1 
ATOM   1871 C C     . GLU A 1 243 ? -44.879 -18.242 -1.121  1.00 37.54  ? 540  GLU A C     1 
ATOM   1872 O O     . GLU A 1 243 ? -45.169 -18.072 -2.313  1.00 38.55  ? 540  GLU A O     1 
ATOM   1873 C CB    . GLU A 1 243 ? -44.162 -20.253 0.211   1.00 41.47  ? 540  GLU A CB    1 
ATOM   1874 C CG    . GLU A 1 243 ? -42.998 -21.232 0.472   1.00 42.77  ? 540  GLU A CG    1 
ATOM   1875 C CD    . GLU A 1 243 ? -43.296 -22.328 1.487   1.00 44.66  ? 540  GLU A CD    1 
ATOM   1876 O OE1   . GLU A 1 243 ? -44.486 -22.629 1.754   1.00 46.48  ? 540  GLU A OE1   1 
ATOM   1877 O OE2   . GLU A 1 243 ? -42.307 -22.875 2.010   1.00 38.25  ? 540  GLU A OE2   1 
ATOM   1878 N N     . LYS A 1 244 ? -45.514 -17.595 -0.129  1.00 37.36  ? 541  LYS A N     1 
ATOM   1879 C CA    . LYS A 1 244 ? -46.633 -16.673 -0.456  1.00 40.08  ? 541  LYS A CA    1 
ATOM   1880 C C     . LYS A 1 244 ? -46.278 -15.480 -1.401  1.00 40.54  ? 541  LYS A C     1 
ATOM   1881 O O     . LYS A 1 244 ? -47.026 -15.162 -2.346  1.00 39.96  ? 541  LYS A O     1 
ATOM   1882 C CB    . LYS A 1 244 ? -47.262 -16.131 0.801   1.00 37.01  ? 541  LYS A CB    1 
ATOM   1883 C CG    . LYS A 1 244 ? -48.473 -15.270 0.536   1.00 41.30  ? 541  LYS A CG    1 
ATOM   1884 C CD    . LYS A 1 244 ? -49.392 -15.363 1.736   1.00 46.90  ? 541  LYS A CD    1 
ATOM   1885 C CE    . LYS A 1 244 ? -50.378 -14.215 1.874   1.00 44.01  ? 541  LYS A CE    1 
ATOM   1886 N NZ    . LYS A 1 244 ? -50.511 -13.262 0.733   1.00 44.69  ? 541  LYS A NZ    1 
ATOM   1887 N N     . LEU A 1 245 ? -45.161 -14.818 -1.131  1.00 32.00  ? 542  LEU A N     1 
ATOM   1888 C CA    . LEU A 1 245 ? -44.761 -13.657 -1.920  1.00 30.72  ? 542  LEU A CA    1 
ATOM   1889 C C     . LEU A 1 245 ? -43.719 -13.999 -2.979  1.00 32.21  ? 542  LEU A C     1 
ATOM   1890 O O     . LEU A 1 245 ? -43.351 -13.120 -3.738  1.00 33.21  ? 542  LEU A O     1 
ATOM   1891 C CB    . LEU A 1 245 ? -44.262 -12.519 -0.998  1.00 29.91  ? 542  LEU A CB    1 
ATOM   1892 C CG    . LEU A 1 245 ? -45.303 -12.081 0.074   1.00 33.64  ? 542  LEU A CG    1 
ATOM   1893 C CD1   . LEU A 1 245 ? -44.675 -10.991 0.950   1.00 37.10  ? 542  LEU A CD1   1 
ATOM   1894 C CD2   . LEU A 1 245 ? -46.617 -11.607 -0.551  1.00 37.03  ? 542  LEU A CD2   1 
ATOM   1895 N N     . GLN A 1 246 ? -43.255 -15.254 -3.010  1.00 32.68  ? 543  GLN A N     1 
ATOM   1896 C CA    . GLN A 1 246 ? -42.414 -15.749 -4.091  1.00 36.70  ? 543  GLN A CA    1 
ATOM   1897 C C     . GLN A 1 246 ? -41.052 -15.057 -4.250  1.00 42.15  ? 543  GLN A C     1 
ATOM   1898 O O     . GLN A 1 246 ? -40.456 -15.058 -5.360  1.00 40.61  ? 543  GLN A O     1 
ATOM   1899 C CB    . GLN A 1 246 ? -43.212 -15.659 -5.440  1.00 38.84  ? 543  GLN A CB    1 
ATOM   1900 C CG    . GLN A 1 246 ? -44.373 -16.687 -5.526  1.00 36.89  ? 543  GLN A CG    1 
ATOM   1901 C CD    . GLN A 1 246 ? -43.822 -18.094 -5.632  1.00 37.98  ? 543  GLN A CD    1 
ATOM   1902 O OE1   . GLN A 1 246 ? -43.107 -18.407 -6.579  1.00 39.29  ? 543  GLN A OE1   1 
ATOM   1903 N NE2   . GLN A 1 246 ? -44.034 -18.894 -4.610  1.00 38.60  ? 543  GLN A NE2   1 
ATOM   1904 N N     . LEU A 1 247 ? -40.519 -14.499 -3.154  1.00 37.18  ? 544  LEU A N     1 
ATOM   1905 C CA    . LEU A 1 247 ? -39.230 -13.826 -3.235  1.00 32.99  ? 544  LEU A CA    1 
ATOM   1906 C C     . LEU A 1 247 ? -38.183 -14.852 -3.613  1.00 34.92  ? 544  LEU A C     1 
ATOM   1907 O O     . LEU A 1 247 ? -38.317 -16.019 -3.266  1.00 31.24  ? 544  LEU A O     1 
ATOM   1908 C CB    . LEU A 1 247 ? -38.904 -13.116 -1.907  1.00 29.67  ? 544  LEU A CB    1 
ATOM   1909 C CG    . LEU A 1 247 ? -39.955 -12.043 -1.558  1.00 33.69  ? 544  LEU A CG    1 
ATOM   1910 C CD1   . LEU A 1 247 ? -39.565 -11.207 -0.354  1.00 36.24  ? 544  LEU A CD1   1 
ATOM   1911 C CD2   . LEU A 1 247 ? -40.229 -11.075 -2.712  1.00 33.70  ? 544  LEU A CD2   1 
ATOM   1912 N N     . PRO A 1 248 ? -37.139 -14.428 -4.324  1.00 33.76  ? 545  PRO A N     1 
ATOM   1913 C CA    . PRO A 1 248 ? -36.100 -15.382 -4.643  1.00 38.12  ? 545  PRO A CA    1 
ATOM   1914 C C     . PRO A 1 248 ? -35.431 -15.937 -3.392  1.00 36.88  ? 545  PRO A C     1 
ATOM   1915 O O     . PRO A 1 248 ? -35.226 -15.189 -2.411  1.00 34.72  ? 545  PRO A O     1 
ATOM   1916 C CB    . PRO A 1 248 ? -35.060 -14.542 -5.428  1.00 37.02  ? 545  PRO A CB    1 
ATOM   1917 C CG    . PRO A 1 248 ? -35.758 -13.312 -5.867  1.00 36.65  ? 545  PRO A CG    1 
ATOM   1918 C CD    . PRO A 1 248 ? -36.838 -13.080 -4.841  1.00 38.13  ? 545  PRO A CD    1 
ATOM   1919 N N     . VAL A 1 249 ? -35.085 -17.217 -3.449  1.00 36.91  ? 546  VAL A N     1 
ATOM   1920 C CA    . VAL A 1 249 ? -34.367 -17.876 -2.374  1.00 41.31  ? 546  VAL A CA    1 
ATOM   1921 C C     . VAL A 1 249 ? -32.899 -17.798 -2.721  1.00 46.28  ? 546  VAL A C     1 
ATOM   1922 O O     . VAL A 1 249 ? -32.438 -18.544 -3.565  1.00 44.90  ? 546  VAL A O     1 
ATOM   1923 C CB    . VAL A 1 249 ? -34.773 -19.355 -2.210  1.00 42.74  ? 546  VAL A CB    1 
ATOM   1924 C CG1   . VAL A 1 249 ? -34.023 -19.947 -1.007  1.00 42.26  ? 546  VAL A CG1   1 
ATOM   1925 C CG2   . VAL A 1 249 ? -36.293 -19.474 -2.026  1.00 42.00  ? 546  VAL A CG2   1 
ATOM   1926 N N     . LEU A 1 250 ? -32.183 -16.884 -2.086  1.00 46.93  ? 547  LEU A N     1 
ATOM   1927 C CA    . LEU A 1 250 ? -30.754 -16.643 -2.389  1.00 48.03  ? 547  LEU A CA    1 
ATOM   1928 C C     . LEU A 1 250 ? -29.845 -17.459 -1.462  1.00 46.88  ? 547  LEU A C     1 
ATOM   1929 O O     . LEU A 1 250 ? -28.690 -17.634 -1.751  1.00 55.03  ? 547  LEU A O     1 
ATOM   1930 C CB    . LEU A 1 250 ? -30.418 -15.159 -2.200  1.00 47.68  ? 547  LEU A CB    1 
ATOM   1931 C CG    . LEU A 1 250 ? -31.270 -14.151 -2.963  1.00 54.49  ? 547  LEU A CG    1 
ATOM   1932 C CD1   . LEU A 1 250 ? -30.831 -12.716 -2.643  1.00 53.01  ? 547  LEU A CD1   1 
ATOM   1933 C CD2   . LEU A 1 250 ? -31.195 -14.444 -4.470  1.00 49.12  ? 547  LEU A CD2   1 
ATOM   1934 N N     . LYS A 1 251 ? -30.356 -17.910 -0.327  1.00 47.42  ? 548  LYS A N     1 
ATOM   1935 C CA    . LYS A 1 251 ? -29.528 -18.606 0.677   1.00 49.85  ? 548  LYS A CA    1 
ATOM   1936 C C     . LYS A 1 251 ? -30.443 -19.390 1.575   1.00 48.34  ? 548  LYS A C     1 
ATOM   1937 O O     . LYS A 1 251 ? -31.477 -18.922 2.009   1.00 47.11  ? 548  LYS A O     1 
ATOM   1938 C CB    . LYS A 1 251 ? -28.618 -17.665 1.524   1.00 50.23  ? 548  LYS A CB    1 
ATOM   1939 N N     . LYS A 1 252 ? -30.051 -20.630 1.800   1.00 52.10  ? 549  LYS A N     1 
ATOM   1940 C CA    . LYS A 1 252 ? -30.770 -21.520 2.665   1.00 55.96  ? 549  LYS A CA    1 
ATOM   1941 C C     . LYS A 1 252 ? -29.932 -21.735 3.900   1.00 55.06  ? 549  LYS A C     1 
ATOM   1942 O O     . LYS A 1 252 ? -28.737 -21.497 3.914   1.00 53.85  ? 549  LYS A O     1 
ATOM   1943 C CB    . LYS A 1 252 ? -31.055 -22.850 1.966   1.00 62.45  ? 549  LYS A CB    1 
ATOM   1944 C CG    . LYS A 1 252 ? -32.324 -22.839 1.116   1.00 67.73  ? 549  LYS A CG    1 
ATOM   1945 C CD    . LYS A 1 252 ? -32.854 -24.243 0.830   1.00 73.83  ? 549  LYS A CD    1 
ATOM   1946 C CE    . LYS A 1 252 ? -34.391 -24.281 0.945   1.00 80.28  ? 549  LYS A CE    1 
ATOM   1947 N NZ    . LYS A 1 252 ? -35.011 -25.634 0.818   1.00 77.92  ? 549  LYS A NZ    1 
ATOM   1948 N N     . SER A 1 253 ? -30.601 -22.115 4.960   1.00 60.66  ? 550  SER A N     1 
ATOM   1949 C CA    . SER A 1 253 ? -29.954 -22.541 6.187   1.00 64.42  ? 550  SER A CA    1 
ATOM   1950 C C     . SER A 1 253 ? -30.129 -24.080 6.302   1.00 66.95  ? 550  SER A C     1 
ATOM   1951 O O     . SER A 1 253 ? -30.977 -24.665 5.626   1.00 65.85  ? 550  SER A O     1 
ATOM   1952 C CB    . SER A 1 253 ? -30.669 -21.873 7.358   1.00 63.35  ? 550  SER A CB    1 
ATOM   1953 O OG    . SER A 1 253 ? -31.947 -22.505 7.530   1.00 55.05  ? 550  SER A OG    1 
ATOM   1954 N N     . LYS A 1 254 ? -29.402 -24.713 7.214   1.00 69.33  ? 551  LYS A N     1 
ATOM   1955 C CA    . LYS A 1 254 ? -29.485 -26.154 7.379   1.00 68.51  ? 551  LYS A CA    1 
ATOM   1956 C C     . LYS A 1 254 ? -30.935 -26.616 7.599   1.00 66.60  ? 551  LYS A C     1 
ATOM   1957 O O     . LYS A 1 254 ? -31.276 -27.721 7.265   1.00 64.82  ? 551  LYS A O     1 
ATOM   1958 C CB    . LYS A 1 254 ? -28.572 -26.613 8.537   1.00 66.27  ? 551  LYS A CB    1 
ATOM   1959 N N     . THR A 1 255 ? -31.791 -25.767 8.155   1.00 69.39  ? 552  THR A N     1 
ATOM   1960 C CA    . THR A 1 255 ? -33.207 -26.137 8.447   1.00 70.93  ? 552  THR A CA    1 
ATOM   1961 C C     . THR A 1 255 ? -34.281 -25.601 7.465   1.00 73.13  ? 552  THR A C     1 
ATOM   1962 O O     . THR A 1 255 ? -35.420 -26.079 7.442   1.00 77.79  ? 552  THR A O     1 
ATOM   1963 C CB    . THR A 1 255 ? -33.595 -25.596 9.844   1.00 75.86  ? 552  THR A CB    1 
ATOM   1964 O OG1   . THR A 1 255 ? -32.571 -25.909 10.795  1.00 83.05  ? 552  THR A OG1   1 
ATOM   1965 C CG2   . THR A 1 255 ? -34.931 -26.155 10.321  1.00 74.62  ? 552  THR A CG2   1 
ATOM   1966 N N     . GLY A 1 256 ? -33.944 -24.583 6.680   1.00 73.17  ? 553  GLY A N     1 
ATOM   1967 C CA    . GLY A 1 256 ? -34.974 -23.808 5.973   1.00 59.41  ? 553  GLY A CA    1 
ATOM   1968 C C     . GLY A 1 256 ? -34.369 -22.678 5.171   1.00 52.88  ? 553  GLY A C     1 
ATOM   1969 O O     . GLY A 1 256 ? -33.286 -22.822 4.570   1.00 57.71  ? 553  GLY A O     1 
ATOM   1970 N N     . TYR A 1 257 ? -35.053 -21.542 5.156   1.00 48.15  ? 554  TYR A N     1 
ATOM   1971 C CA    . TYR A 1 257 ? -34.585 -20.387 4.377   1.00 47.35  ? 554  TYR A CA    1 
ATOM   1972 C C     . TYR A 1 257 ? -33.857 -19.362 5.266   1.00 48.09  ? 554  TYR A C     1 
ATOM   1973 O O     . TYR A 1 257 ? -34.318 -19.074 6.392   1.00 43.09  ? 554  TYR A O     1 
ATOM   1974 C CB    . TYR A 1 257 ? -35.760 -19.649 3.773   1.00 45.24  ? 554  TYR A CB    1 
ATOM   1975 C CG    . TYR A 1 257 ? -36.828 -20.463 3.109   1.00 46.11  ? 554  TYR A CG    1 
ATOM   1976 C CD1   . TYR A 1 257 ? -36.632 -20.969 1.835   1.00 42.79  ? 554  TYR A CD1   1 
ATOM   1977 C CD2   . TYR A 1 257 ? -38.076 -20.638 3.718   1.00 43.28  ? 554  TYR A CD2   1 
ATOM   1978 C CE1   . TYR A 1 257 ? -37.623 -21.689 1.208   1.00 42.53  ? 554  TYR A CE1   1 
ATOM   1979 C CE2   . TYR A 1 257 ? -39.075 -21.338 3.088   1.00 44.20  ? 554  TYR A CE2   1 
ATOM   1980 C CZ    . TYR A 1 257 ? -38.838 -21.851 1.816   1.00 43.71  ? 554  TYR A CZ    1 
ATOM   1981 O OH    . TYR A 1 257 ? -39.834 -22.558 1.139   1.00 49.05  ? 554  TYR A OH    1 
ATOM   1982 N N     . SER A 1 258 ? -32.783 -18.776 4.743   1.00 45.04  ? 555  SER A N     1 
ATOM   1983 C CA    . SER A 1 258 ? -32.099 -17.679 5.427   1.00 49.61  ? 555  SER A CA    1 
ATOM   1984 C C     . SER A 1 258 ? -32.839 -16.355 5.266   1.00 45.34  ? 555  SER A C     1 
ATOM   1985 O O     . SER A 1 258 ? -33.195 -15.961 4.166   1.00 40.74  ? 555  SER A O     1 
ATOM   1986 C CB    . SER A 1 258 ? -30.659 -17.496 4.942   1.00 48.89  ? 555  SER A CB    1 
ATOM   1987 O OG    . SER A 1 258 ? -30.091 -16.329 5.569   1.00 55.86  ? 555  SER A OG    1 
ATOM   1988 N N     . THR A 1 259 ? -33.061 -15.660 6.377   1.00 42.54  ? 556  THR A N     1 
ATOM   1989 C CA    . THR A 1 259 ? -33.566 -14.292 6.338   1.00 38.80  ? 556  THR A CA    1 
ATOM   1990 C C     . THR A 1 259 ? -32.657 -13.303 7.063   1.00 41.53  ? 556  THR A C     1 
ATOM   1991 O O     . THR A 1 259 ? -33.114 -12.269 7.624   1.00 39.23  ? 556  THR A O     1 
ATOM   1992 C CB    . THR A 1 259 ? -34.966 -14.232 6.969   1.00 39.91  ? 556  THR A CB    1 
ATOM   1993 O OG1   . THR A 1 259 ? -34.854 -14.435 8.387   1.00 37.33  ? 556  THR A OG1   1 
ATOM   1994 C CG2   . THR A 1 259 ? -35.860 -15.271 6.341   1.00 39.25  ? 556  THR A CG2   1 
ATOM   1995 N N     . SER A 1 260 ? -31.371 -13.595 7.026   1.00 41.01  ? 557  SER A N     1 
ATOM   1996 C CA    . SER A 1 260 ? -30.391 -12.664 7.555   1.00 43.32  ? 557  SER A CA    1 
ATOM   1997 C C     . SER A 1 260 ? -30.490 -11.316 6.856   1.00 43.39  ? 557  SER A C     1 
ATOM   1998 O O     . SER A 1 260 ? -31.009 -11.213 5.739   1.00 42.19  ? 557  SER A O     1 
ATOM   1999 C CB    . SER A 1 260 ? -28.994 -13.269 7.455   1.00 43.59  ? 557  SER A CB    1 
ATOM   2000 O OG    . SER A 1 260 ? -28.628 -13.490 6.139   1.00 44.64  ? 557  SER A OG    1 
ATOM   2001 N N     . ALA A 1 261 ? -30.026 -10.258 7.530   1.00 39.10  ? 558  ALA A N     1 
ATOM   2002 C CA    . ALA A 1 261 ? -30.160 -8.927  6.999   1.00 36.30  ? 558  ALA A CA    1 
ATOM   2003 C C     . ALA A 1 261 ? -29.507 -8.782  5.625   1.00 36.45  ? 558  ALA A C     1 
ATOM   2004 O O     . ALA A 1 261 ? -30.025 -8.045  4.757   1.00 39.37  ? 558  ALA A O     1 
ATOM   2005 C CB    . ALA A 1 261 ? -29.595 -7.889  7.976   1.00 37.27  ? 558  ALA A CB    1 
ATOM   2006 N N     . ASP A 1 262 ? -28.384 -9.451  5.421   1.00 38.26  ? 559  ASP A N     1 
ATOM   2007 C CA    . ASP A 1 262 ? -27.706 -9.405  4.094   1.00 48.63  ? 559  ASP A CA    1 
ATOM   2008 C C     . ASP A 1 262 ? -28.551 -9.981  2.941   1.00 41.75  ? 559  ASP A C     1 
ATOM   2009 O O     . ASP A 1 262 ? -28.505 -9.491  1.838   1.00 46.52  ? 559  ASP A O     1 
ATOM   2010 C CB    . ASP A 1 262 ? -26.330 -10.094 4.126   1.00 52.97  ? 559  ASP A CB    1 
ATOM   2011 C CG    . ASP A 1 262 ? -26.379 -11.532 4.670   1.00 65.58  ? 559  ASP A CG    1 
ATOM   2012 O OD1   . ASP A 1 262 ? -27.186 -11.840 5.589   1.00 66.66  ? 559  ASP A OD1   1 
ATOM   2013 O OD2   . ASP A 1 262 ? -25.572 -12.363 4.191   1.00 74.78  ? 559  ASP A OD2   1 
ATOM   2014 N N     . VAL A 1 263 ? -29.327 -11.008 3.227   1.00 40.24  ? 560  VAL A N     1 
ATOM   2015 C CA    . VAL A 1 263 ? -30.245 -11.579 2.257   1.00 41.24  ? 560  VAL A CA    1 
ATOM   2016 C C     . VAL A 1 263 ? -31.404 -10.607 2.043   1.00 39.42  ? 560  VAL A C     1 
ATOM   2017 O O     . VAL A 1 263 ? -31.758 -10.286 0.911   1.00 44.23  ? 560  VAL A O     1 
ATOM   2018 C CB    . VAL A 1 263 ? -30.793 -12.942 2.753   1.00 43.43  ? 560  VAL A CB    1 
ATOM   2019 C CG1   . VAL A 1 263 ? -31.874 -13.511 1.806   1.00 44.75  ? 560  VAL A CG1   1 
ATOM   2020 C CG2   . VAL A 1 263 ? -29.654 -13.944 2.920   1.00 42.51  ? 560  VAL A CG2   1 
ATOM   2021 N N     . LEU A 1 264 ? -32.013 -10.144 3.123   1.00 35.36  ? 561  LEU A N     1 
ATOM   2022 C CA    . LEU A 1 264 ? -33.153 -9.255  2.992   1.00 35.73  ? 561  LEU A CA    1 
ATOM   2023 C C     . LEU A 1 264 ? -32.842 -8.004  2.210   1.00 34.81  ? 561  LEU A C     1 
ATOM   2024 O O     . LEU A 1 264 ? -33.659 -7.546  1.421   1.00 34.46  ? 561  LEU A O     1 
ATOM   2025 C CB    . LEU A 1 264 ? -33.737 -8.870  4.348   1.00 35.12  ? 561  LEU A CB    1 
ATOM   2026 C CG    . LEU A 1 264 ? -34.266 -10.028 5.144   1.00 37.97  ? 561  LEU A CG    1 
ATOM   2027 C CD1   . LEU A 1 264 ? -35.034 -9.436  6.308   1.00 41.96  ? 561  LEU A CD1   1 
ATOM   2028 C CD2   . LEU A 1 264 ? -35.177 -10.969 4.388   1.00 42.95  ? 561  LEU A CD2   1 
ATOM   2029 N N     . GLU A 1 265 ? -31.681 -7.423  2.460   1.00 39.01  ? 562  GLU A N     1 
ATOM   2030 C CA    . GLU A 1 265 ? -31.275 -6.250  1.712   1.00 40.81  ? 562  GLU A CA    1 
ATOM   2031 C C     . GLU A 1 265 ? -31.314 -6.485  0.211   1.00 40.21  ? 562  GLU A C     1 
ATOM   2032 O O     . GLU A 1 265 ? -31.762 -5.632  -0.526  1.00 39.71  ? 562  GLU A O     1 
ATOM   2033 C CB    . GLU A 1 265 ? -29.887 -5.757  2.102   1.00 42.98  ? 562  GLU A CB    1 
ATOM   2034 C CG    . GLU A 1 265 ? -29.928 -4.701  3.216   1.00 58.66  ? 562  GLU A CG    1 
ATOM   2035 C CD    . GLU A 1 265 ? -28.848 -4.905  4.280   1.00 66.96  ? 562  GLU A CD    1 
ATOM   2036 O OE1   . GLU A 1 265 ? -27.790 -5.510  3.981   1.00 75.53  ? 562  GLU A OE1   1 
ATOM   2037 O OE2   . GLU A 1 265 ? -29.062 -4.470  5.430   1.00 72.31  ? 562  GLU A OE2   1 
ATOM   2038 N N     . LYS A 1 266 ? -30.837 -7.628  -0.238  1.00 39.11  ? 563  LYS A N     1 
ATOM   2039 C CA    . LYS A 1 266 ? -30.886 -7.950  -1.672  1.00 41.14  ? 563  LYS A CA    1 
ATOM   2040 C C     . LYS A 1 266 ? -32.320 -8.169  -2.183  1.00 41.93  ? 563  LYS A C     1 
ATOM   2041 O O     . LYS A 1 266 ? -32.551 -7.995  -3.356  1.00 40.15  ? 563  LYS A O     1 
ATOM   2042 C CB    . LYS A 1 266 ? -30.017 -9.161  -1.950  1.00 44.07  ? 563  LYS A CB    1 
ATOM   2043 C CG    . LYS A 1 266 ? -28.534 -8.791  -1.869  1.00 53.11  ? 563  LYS A CG    1 
ATOM   2044 C CD    . LYS A 1 266 ? -27.575 -9.973  -1.962  1.00 58.42  ? 563  LYS A CD    1 
ATOM   2045 C CE    . LYS A 1 266 ? -26.137 -9.576  -1.570  1.00 59.79  ? 563  LYS A CE    1 
ATOM   2046 N NZ    . LYS A 1 266 ? -25.290 -10.779 -1.300  1.00 60.95  ? 563  LYS A NZ    1 
ATOM   2047 N N     . LEU A 1 267 ? -33.272 -8.540  -1.311  1.00 35.91  ? 564  LEU A N     1 
ATOM   2048 C CA    . LEU A 1 267 ? -34.661 -8.747  -1.713  1.00 35.96  ? 564  LEU A CA    1 
ATOM   2049 C C     . LEU A 1 267 ? -35.585 -7.515  -1.707  1.00 37.22  ? 564  LEU A C     1 
ATOM   2050 O O     . LEU A 1 267 ? -36.716 -7.526  -2.251  1.00 35.02  ? 564  LEU A O     1 
ATOM   2051 C CB    . LEU A 1 267 ? -35.275 -9.829  -0.797  1.00 39.18  ? 564  LEU A CB    1 
ATOM   2052 C CG    . LEU A 1 267 ? -34.578 -11.194 -0.741  1.00 38.85  ? 564  LEU A CG    1 
ATOM   2053 C CD1   . LEU A 1 267 ? -35.339 -12.093 0.202   1.00 40.01  ? 564  LEU A CD1   1 
ATOM   2054 C CD2   . LEU A 1 267 ? -34.431 -11.823 -2.134  1.00 41.36  ? 564  LEU A CD2   1 
ATOM   2055 N N     . ALA A 1 268 ? -35.139 -6.452  -1.059  1.00 38.32  ? 565  ALA A N     1 
ATOM   2056 C CA    . ALA A 1 268 ? -35.946 -5.256  -0.892  1.00 38.75  ? 565  ALA A CA    1 
ATOM   2057 C C     . ALA A 1 268 ? -36.570 -4.662  -2.185  1.00 34.41  ? 565  ALA A C     1 
ATOM   2058 O O     . ALA A 1 268 ? -37.729 -4.280  -2.166  1.00 35.90  ? 565  ALA A O     1 
ATOM   2059 C CB    . ALA A 1 268 ? -35.155 -4.196  -0.110  1.00 43.64  ? 565  ALA A CB    1 
ATOM   2060 N N     . PRO A 1 269 ? -35.858 -4.690  -3.315  1.00 36.06  ? 566  PRO A N     1 
ATOM   2061 C CA    . PRO A 1 269 ? -36.497 -4.146  -4.530  1.00 41.37  ? 566  PRO A CA    1 
ATOM   2062 C C     . PRO A 1 269 ? -37.717 -4.917  -5.037  1.00 37.81  ? 566  PRO A C     1 
ATOM   2063 O O     . PRO A 1 269 ? -38.510 -4.357  -5.786  1.00 37.10  ? 566  PRO A O     1 
ATOM   2064 C CB    . PRO A 1 269 ? -35.402 -4.205  -5.577  1.00 40.95  ? 566  PRO A CB    1 
ATOM   2065 C CG    . PRO A 1 269 ? -34.117 -4.401  -4.807  1.00 40.43  ? 566  PRO A CG    1 
ATOM   2066 C CD    . PRO A 1 269 ? -34.488 -5.156  -3.565  1.00 37.28  ? 566  PRO A CD    1 
ATOM   2067 N N     . TYR A 1 270 ? -37.883 -6.171  -4.597  1.00 36.19  ? 567  TYR A N     1 
ATOM   2068 C CA    . TYR A 1 270 ? -39.038 -6.981  -5.036  1.00 32.76  ? 567  TYR A CA    1 
ATOM   2069 C C     . TYR A 1 270 ? -40.310 -6.747  -4.317  1.00 37.11  ? 567  TYR A C     1 
ATOM   2070 O O     . TYR A 1 270 ? -41.383 -7.010  -4.856  1.00 38.21  ? 567  TYR A O     1 
ATOM   2071 C CB    . TYR A 1 270 ? -38.703 -8.482  -4.912  1.00 36.48  ? 567  TYR A CB    1 
ATOM   2072 C CG    . TYR A 1 270 ? -37.593 -8.884  -5.818  1.00 34.69  ? 567  TYR A CG    1 
ATOM   2073 C CD1   . TYR A 1 270 ? -37.819 -9.009  -7.171  1.00 37.17  ? 567  TYR A CD1   1 
ATOM   2074 C CD2   . TYR A 1 270 ? -36.311 -9.087  -5.349  1.00 37.26  ? 567  TYR A CD2   1 
ATOM   2075 C CE1   . TYR A 1 270 ? -36.814 -9.353  -8.036  1.00 32.43  ? 567  TYR A CE1   1 
ATOM   2076 C CE2   . TYR A 1 270 ? -35.276 -9.401  -6.212  1.00 40.12  ? 567  TYR A CE2   1 
ATOM   2077 C CZ    . TYR A 1 270 ? -35.565 -9.571  -7.560  1.00 38.19  ? 567  TYR A CZ    1 
ATOM   2078 O OH    . TYR A 1 270 ? -34.594 -9.923  -8.449  1.00 40.32  ? 567  TYR A OH    1 
ATOM   2079 N N     . HIS A 1 271 ? -40.229 -6.293  -3.068  1.00 36.79  ? 568  HIS A N     1 
ATOM   2080 C CA    . HIS A 1 271 ? -41.450 -6.168  -2.282  1.00 35.69  ? 568  HIS A CA    1 
ATOM   2081 C C     . HIS A 1 271 ? -41.229 -5.241  -1.073  1.00 39.04  ? 568  HIS A C     1 
ATOM   2082 O O     . HIS A 1 271 ? -40.172 -5.302  -0.387  1.00 33.53  ? 568  HIS A O     1 
ATOM   2083 C CB    . HIS A 1 271 ? -41.927 -7.533  -1.776  1.00 34.99  ? 568  HIS A CB    1 
ATOM   2084 C CG    . HIS A 1 271 ? -43.392 -7.579  -1.517  1.00 37.65  ? 568  HIS A CG    1 
ATOM   2085 N ND1   . HIS A 1 271 ? -43.980 -6.907  -0.462  1.00 40.51  ? 568  HIS A ND1   1 
ATOM   2086 C CD2   . HIS A 1 271 ? -44.404 -8.175  -2.192  1.00 37.89  ? 568  HIS A CD2   1 
ATOM   2087 C CE1   . HIS A 1 271 ? -45.292 -7.105  -0.487  1.00 43.44  ? 568  HIS A CE1   1 
ATOM   2088 N NE2   . HIS A 1 271 ? -45.576 -7.859  -1.539  1.00 40.39  ? 568  HIS A NE2   1 
ATOM   2089 N N     . GLU A 1 272 ? -42.235 -4.412  -0.812  1.00 36.69  ? 569  GLU A N     1 
ATOM   2090 C CA    . GLU A 1 272 ? -42.166 -3.407  0.249   1.00 37.90  ? 569  GLU A CA    1 
ATOM   2091 C C     . GLU A 1 272 ? -42.186 -4.032  1.683   1.00 38.48  ? 569  GLU A C     1 
ATOM   2092 O O     . GLU A 1 272 ? -41.787 -3.379  2.671   1.00 34.82  ? 569  GLU A O     1 
ATOM   2093 C CB    . GLU A 1 272 ? -43.320 -2.426  0.079   1.00 43.09  ? 569  GLU A CB    1 
ATOM   2094 C CG    . GLU A 1 272 ? -43.199 -1.124  0.887   1.00 50.09  ? 569  GLU A CG    1 
ATOM   2095 C CD    . GLU A 1 272 ? -44.453 -0.257  0.789   1.00 57.04  ? 569  GLU A CD    1 
ATOM   2096 O OE1   . GLU A 1 272 ? -45.284 -0.502  -0.108  1.00 60.07  ? 569  GLU A OE1   1 
ATOM   2097 O OE2   . GLU A 1 272 ? -44.627 0.651   1.628   1.00 54.15  ? 569  GLU A OE2   1 
ATOM   2098 N N     . ILE A 1 273 ? -42.641 -5.280  1.805   1.00 34.75  ? 570  ILE A N     1 
ATOM   2099 C CA    . ILE A 1 273 ? -42.595 -5.959  3.058   1.00 31.67  ? 570  ILE A CA    1 
ATOM   2100 C C     . ILE A 1 273 ? -41.164 -6.016  3.605   1.00 33.75  ? 570  ILE A C     1 
ATOM   2101 O O     . ILE A 1 273 ? -40.987 -5.948  4.810   1.00 35.67  ? 570  ILE A O     1 
ATOM   2102 C CB    . ILE A 1 273 ? -43.198 -7.383  3.024   1.00 34.61  ? 570  ILE A CB    1 
ATOM   2103 C CG1   . ILE A 1 273 ? -43.570 -7.828  4.447   1.00 34.22  ? 570  ILE A CG1   1 
ATOM   2104 C CG2   . ILE A 1 273 ? -42.223 -8.365  2.347   1.00 35.97  ? 570  ILE A CG2   1 
ATOM   2105 C CD1   . ILE A 1 273 ? -44.363 -9.103  4.591   1.00 36.20  ? 570  ILE A CD1   1 
ATOM   2106 N N     . VAL A 1 274 ? -40.157 -6.120  2.731   1.00 29.74  ? 571  VAL A N     1 
ATOM   2107 C CA    . VAL A 1 274 ? -38.823 -6.419  3.162   1.00 33.60  ? 571  VAL A CA    1 
ATOM   2108 C C     . VAL A 1 274 ? -38.161 -5.274  3.993   1.00 35.89  ? 571  VAL A C     1 
ATOM   2109 O O     . VAL A 1 274 ? -37.554 -5.555  5.044   1.00 37.54  ? 571  VAL A O     1 
ATOM   2110 C CB    . VAL A 1 274 ? -37.919 -6.800  1.972   1.00 34.94  ? 571  VAL A CB    1 
ATOM   2111 C CG1   . VAL A 1 274 ? -36.489 -7.057  2.468   1.00 35.60  ? 571  VAL A CG1   1 
ATOM   2112 C CG2   . VAL A 1 274 ? -38.462 -8.062  1.251   1.00 34.37  ? 571  VAL A CG2   1 
ATOM   2113 N N     . GLU A 1 275 ? -38.270 -4.022  3.541   1.00 34.93  ? 572  GLU A N     1 
ATOM   2114 C CA    . GLU A 1 275 ? -37.725 -2.895  4.299   1.00 36.64  ? 572  GLU A CA    1 
ATOM   2115 C C     . GLU A 1 275 ? -38.403 -2.839  5.691   1.00 35.91  ? 572  GLU A C     1 
ATOM   2116 O O     . GLU A 1 275 ? -37.768 -2.492  6.675   1.00 35.04  ? 572  GLU A O     1 
ATOM   2117 C CB    . GLU A 1 275 ? -37.856 -1.533  3.551   1.00 40.34  ? 572  GLU A CB    1 
ATOM   2118 C CG    . GLU A 1 275 ? -39.296 -1.137  3.211   1.00 46.55  ? 572  GLU A CG    1 
ATOM   2119 C CD    . GLU A 1 275 ? -39.492 0.243   2.582   1.00 59.02  ? 572  GLU A CD    1 
ATOM   2120 O OE1   . GLU A 1 275 ? -39.600 1.245   3.313   1.00 66.38  ? 572  GLU A OE1   1 
ATOM   2121 O OE2   . GLU A 1 275 ? -39.658 0.315   1.349   1.00 67.55  ? 572  GLU A OE2   1 
ATOM   2122 N N     . ASN A 1 276 ? -39.700 -3.119  5.750   1.00 32.61  ? 573  ASN A N     1 
ATOM   2123 C CA    . ASN A 1 276 ? -40.435 -3.117  7.002   1.00 36.39  ? 573  ASN A CA    1 
ATOM   2124 C C     . ASN A 1 276 ? -40.008 -4.203  7.941   1.00 37.63  ? 573  ASN A C     1 
ATOM   2125 O O     . ASN A 1 276 ? -39.988 -3.971  9.135   1.00 36.30  ? 573  ASN A O     1 
ATOM   2126 C CB    . ASN A 1 276 ? -41.940 -3.267  6.761   1.00 35.44  ? 573  ASN A CB    1 
ATOM   2127 C CG    . ASN A 1 276 ? -42.567 -1.997  6.232   1.00 42.89  ? 573  ASN A CG    1 
ATOM   2128 O OD1   . ASN A 1 276 ? -42.866 -1.095  7.002   1.00 40.13  ? 573  ASN A OD1   1 
ATOM   2129 N ND2   . ASN A 1 276 ? -42.708 -1.893  4.901   1.00 39.22  ? 573  ASN A ND2   1 
ATOM   2130 N N     . ILE A 1 277 ? -39.694 -5.397  7.412   1.00 32.66  ? 574  ILE A N     1 
ATOM   2131 C CA    . ILE A 1 277 ? -39.157 -6.468  8.256   1.00 33.63  ? 574  ILE A CA    1 
ATOM   2132 C C     . ILE A 1 277 ? -37.782 -6.092  8.796   1.00 32.54  ? 574  ILE A C     1 
ATOM   2133 O O     . ILE A 1 277 ? -37.530 -6.302  9.960   1.00 33.19  ? 574  ILE A O     1 
ATOM   2134 C CB    . ILE A 1 277 ? -39.087 -7.807  7.527   1.00 33.05  ? 574  ILE A CB    1 
ATOM   2135 C CG1   . ILE A 1 277 ? -40.506 -8.350  7.369   1.00 34.41  ? 574  ILE A CG1   1 
ATOM   2136 C CG2   . ILE A 1 277 ? -38.201 -8.827  8.269   1.00 32.33  ? 574  ILE A CG2   1 
ATOM   2137 C CD1   . ILE A 1 277 ? -40.606 -9.365  6.286   1.00 44.96  ? 574  ILE A CD1   1 
ATOM   2138 N N     . LEU A 1 278 ? -36.935 -5.501  7.967   1.00 32.03  ? 575  LEU A N     1 
ATOM   2139 C CA    . LEU A 1 278 ? -35.629 -5.063  8.405   1.00 35.71  ? 575  LEU A CA    1 
ATOM   2140 C C     . LEU A 1 278 ? -35.756 -4.010  9.543   1.00 37.09  ? 575  LEU A C     1 
ATOM   2141 O O     . LEU A 1 278 ? -35.070 -4.087  10.554  1.00 37.07  ? 575  LEU A O     1 
ATOM   2142 C CB    . LEU A 1 278 ? -34.857 -4.453  7.249   1.00 35.77  ? 575  LEU A CB    1 
ATOM   2143 C CG    . LEU A 1 278 ? -34.283 -5.429  6.211   1.00 39.32  ? 575  LEU A CG    1 
ATOM   2144 C CD1   . LEU A 1 278 ? -34.083 -4.748  4.871   1.00 40.00  ? 575  LEU A CD1   1 
ATOM   2145 C CD2   . LEU A 1 278 ? -33.001 -6.000  6.762   1.00 41.30  ? 575  LEU A CD2   1 
ATOM   2146 N N     . HIS A 1 279 ? -36.628 -3.032  9.334   1.00 32.75  ? 576  HIS A N     1 
ATOM   2147 C CA    . HIS A 1 279 ? -36.880 -1.971  10.308  1.00 34.88  ? 576  HIS A CA    1 
ATOM   2148 C C     . HIS A 1 279 ? -37.400 -2.561  11.618  1.00 36.24  ? 576  HIS A C     1 
ATOM   2149 O O     . HIS A 1 279 ? -36.904 -2.247  12.681  1.00 34.54  ? 576  HIS A O     1 
ATOM   2150 C CB    . HIS A 1 279 ? -37.874 -0.981  9.739   1.00 38.01  ? 576  HIS A CB    1 
ATOM   2151 C CG    . HIS A 1 279 ? -37.970 0.297   10.510  1.00 47.58  ? 576  HIS A CG    1 
ATOM   2152 N ND1   . HIS A 1 279 ? -36.861 0.969   10.996  1.00 52.10  ? 576  HIS A ND1   1 
ATOM   2153 C CD2   . HIS A 1 279 ? -39.052 1.021   10.897  1.00 51.56  ? 576  HIS A CD2   1 
ATOM   2154 C CE1   . HIS A 1 279 ? -37.258 2.045   11.649  1.00 47.12  ? 576  HIS A CE1   1 
ATOM   2155 N NE2   . HIS A 1 279 ? -38.581 2.092   11.614  1.00 51.05  ? 576  HIS A NE2   1 
ATOM   2156 N N     . TYR A 1 280 ? -38.373 -3.457  11.523  1.00 33.80  ? 577  TYR A N     1 
ATOM   2157 C CA    . TYR A 1 280 ? -38.884 -4.211  12.651  1.00 34.37  ? 577  TYR A CA    1 
ATOM   2158 C C     . TYR A 1 280 ? -37.807 -4.954  13.467  1.00 39.43  ? 577  TYR A C     1 
ATOM   2159 O O     . TYR A 1 280 ? -37.881 -5.052  14.683  1.00 34.90  ? 577  TYR A O     1 
ATOM   2160 C CB    . TYR A 1 280 ? -39.952 -5.176  12.196  1.00 37.15  ? 577  TYR A CB    1 
ATOM   2161 C CG    . TYR A 1 280 ? -40.565 -6.003  13.286  1.00 38.13  ? 577  TYR A CG    1 
ATOM   2162 C CD1   . TYR A 1 280 ? -41.632 -5.535  14.050  1.00 44.89  ? 577  TYR A CD1   1 
ATOM   2163 C CD2   . TYR A 1 280 ? -40.063 -7.255  13.560  1.00 40.57  ? 577  TYR A CD2   1 
ATOM   2164 C CE1   . TYR A 1 280 ? -42.182 -6.316  15.070  1.00 46.06  ? 577  TYR A CE1   1 
ATOM   2165 C CE2   . TYR A 1 280 ? -40.581 -8.026  14.545  1.00 45.41  ? 577  TYR A CE2   1 
ATOM   2166 C CZ    . TYR A 1 280 ? -41.638 -7.574  15.303  1.00 49.66  ? 577  TYR A CZ    1 
ATOM   2167 O OH    . TYR A 1 280 ? -42.101 -8.450  16.276  1.00 56.94  ? 577  TYR A OH    1 
ATOM   2168 N N     . ARG A 1 281 ? -36.813 -5.459  12.781  1.00 38.53  ? 578  ARG A N     1 
ATOM   2169 C CA    . ARG A 1 281 ? -35.744 -6.132  13.425  1.00 41.69  ? 578  ARG A CA    1 
ATOM   2170 C C     . ARG A 1 281 ? -34.763 -5.187  14.087  1.00 34.63  ? 578  ARG A C     1 
ATOM   2171 O O     . ARG A 1 281 ? -34.285 -5.534  15.135  1.00 40.46  ? 578  ARG A O     1 
ATOM   2172 C CB    . ARG A 1 281 ? -34.987 -6.983  12.426  1.00 41.32  ? 578  ARG A CB    1 
ATOM   2173 C CG    . ARG A 1 281 ? -35.727 -8.262  12.151  1.00 42.90  ? 578  ARG A CG    1 
ATOM   2174 C CD    . ARG A 1 281 ? -34.771 -9.399  12.045  1.00 43.76  ? 578  ARG A CD    1 
ATOM   2175 N NE    . ARG A 1 281 ? -35.453 -10.565 11.514  1.00 42.24  ? 578  ARG A NE    1 
ATOM   2176 C CZ    . ARG A 1 281 ? -34.990 -11.318 10.535  1.00 39.27  ? 578  ARG A CZ    1 
ATOM   2177 N NH1   . ARG A 1 281 ? -33.825 -11.036 9.960   1.00 35.02  ? 578  ARG A NH1   1 
ATOM   2178 N NH2   . ARG A 1 281 ? -35.714 -12.352 10.131  1.00 40.08  ? 578  ARG A NH2   1 
ATOM   2179 N N     . GLN A 1 282 ? -34.407 -4.069  13.449  1.00 35.92  ? 579  GLN A N     1 
ATOM   2180 C CA    . GLN A 1 282 ? -33.617 -3.057  14.120  1.00 40.74  ? 579  GLN A CA    1 
ATOM   2181 C C     . GLN A 1 282 ? -34.335 -2.640  15.445  1.00 36.67  ? 579  GLN A C     1 
ATOM   2182 O O     . GLN A 1 282 ? -33.753 -2.651  16.530  1.00 39.89  ? 579  GLN A O     1 
ATOM   2183 C CB    . GLN A 1 282 ? -33.337 -1.847  13.232  1.00 48.54  ? 579  GLN A CB    1 
ATOM   2184 C CG    . GLN A 1 282 ? -32.242 -0.938  13.857  1.00 60.37  ? 579  GLN A CG    1 
ATOM   2185 C CD    . GLN A 1 282 ? -32.206 0.498   13.326  1.00 72.32  ? 579  GLN A CD    1 
ATOM   2186 O OE1   . GLN A 1 282 ? -32.739 0.761   12.254  1.00 74.68  ? 579  GLN A OE1   1 
ATOM   2187 N NE2   . GLN A 1 282 ? -31.565 1.439   14.088  1.00 79.70  ? 579  GLN A NE2   1 
ATOM   2188 N N     . LEU A 1 283 ? -35.613 -2.309  15.351  1.00 35.05  ? 580  LEU A N     1 
ATOM   2189 C CA    . LEU A 1 283 ? -36.361 -1.832  16.535  1.00 39.91  ? 580  LEU A CA    1 
ATOM   2190 C C     . LEU A 1 283 ? -36.474 -2.871  17.601  1.00 37.92  ? 580  LEU A C     1 
ATOM   2191 O O     . LEU A 1 283 ? -36.232 -2.575  18.788  1.00 36.32  ? 580  LEU A O     1 
ATOM   2192 C CB    . LEU A 1 283 ? -37.760 -1.365  16.175  1.00 41.78  ? 580  LEU A CB    1 
ATOM   2193 C CG    . LEU A 1 283 ? -37.862 -0.177  15.233  1.00 44.35  ? 580  LEU A CG    1 
ATOM   2194 C CD1   . LEU A 1 283 ? -39.324 0.047   14.821  1.00 49.85  ? 580  LEU A CD1   1 
ATOM   2195 C CD2   . LEU A 1 283 ? -37.308 1.092   15.853  1.00 45.43  ? 580  LEU A CD2   1 
ATOM   2196 N N     . GLY A 1 284 ? -36.819 -4.091  17.187  1.00 33.97  ? 581  GLY A N     1 
ATOM   2197 C CA    . GLY A 1 284 ? -36.955 -5.211  18.118  1.00 32.55  ? 581  GLY A CA    1 
ATOM   2198 C C     . GLY A 1 284 ? -35.671 -5.608  18.867  1.00 33.97  ? 581  GLY A C     1 
ATOM   2199 O O     . GLY A 1 284 ? -35.714 -6.097  19.992  1.00 32.37  ? 581  GLY A O     1 
ATOM   2200 N N     . LYS A 1 285 ? -34.551 -5.471  18.203  1.00 30.58  ? 582  LYS A N     1 
ATOM   2201 C CA    . LYS A 1 285 ? -33.253 -5.734  18.778  1.00 32.52  ? 582  LYS A CA    1 
ATOM   2202 C C     . LYS A 1 285 ? -32.979 -4.686  19.834  1.00 31.60  ? 582  LYS A C     1 
ATOM   2203 O O     . LYS A 1 285 ? -32.579 -5.018  20.930  1.00 31.43  ? 582  LYS A O     1 
ATOM   2204 C CB    . LYS A 1 285 ? -32.184 -5.650  17.684  1.00 35.14  ? 582  LYS A CB    1 
ATOM   2205 C CG    . LYS A 1 285 ? -30.754 -5.881  18.159  1.00 40.66  ? 582  LYS A CG    1 
ATOM   2206 C CD    . LYS A 1 285 ? -30.506 -7.293  18.666  1.00 43.84  ? 582  LYS A CD    1 
ATOM   2207 C CE    . LYS A 1 285 ? -29.044 -7.670  18.459  1.00 44.60  ? 582  LYS A CE    1 
ATOM   2208 N NZ    . LYS A 1 285 ? -28.739 -9.073  18.881  1.00 45.24  ? 582  LYS A NZ    1 
ATOM   2209 N N     . LEU A 1 286 ? -33.219 -3.424  19.502  1.00 33.07  ? 583  LEU A N     1 
ATOM   2210 C CA    . LEU A 1 286 ? -33.063 -2.353  20.493  1.00 37.92  ? 583  LEU A CA    1 
ATOM   2211 C C     . LEU A 1 286 ? -33.914 -2.614  21.725  1.00 38.83  ? 583  LEU A C     1 
ATOM   2212 O O     . LEU A 1 286 ? -33.397 -2.552  22.847  1.00 33.04  ? 583  LEU A O     1 
ATOM   2213 C CB    . LEU A 1 286 ? -33.385 -0.978  19.920  1.00 35.22  ? 583  LEU A CB    1 
ATOM   2214 C CG    . LEU A 1 286 ? -32.384 -0.499  18.861  1.00 41.09  ? 583  LEU A CG    1 
ATOM   2215 C CD1   . LEU A 1 286 ? -32.832 0.838   18.304  1.00 42.13  ? 583  LEU A CD1   1 
ATOM   2216 C CD2   . LEU A 1 286 ? -30.961 -0.320  19.406  1.00 41.81  ? 583  LEU A CD2   1 
ATOM   2217 N N     . GLN A 1 287 ? -35.183 -2.962  21.487  1.00 34.48  ? 584  GLN A N     1 
ATOM   2218 C CA    . GLN A 1 287 ? -36.165 -3.126  22.535  1.00 39.50  ? 584  GLN A CA    1 
ATOM   2219 C C     . GLN A 1 287 ? -35.801 -4.289  23.407  1.00 39.74  ? 584  GLN A C     1 
ATOM   2220 O O     . GLN A 1 287 ? -35.665 -4.160  24.620  1.00 38.82  ? 584  GLN A O     1 
ATOM   2221 C CB    . GLN A 1 287 ? -37.574 -3.340  21.972  1.00 40.87  ? 584  GLN A CB    1 
ATOM   2222 C CG    . GLN A 1 287 ? -38.668 -3.478  23.023  1.00 45.52  ? 584  GLN A CG    1 
ATOM   2223 C CD    . GLN A 1 287 ? -38.961 -2.115  23.672  1.00 47.74  ? 584  GLN A CD    1 
ATOM   2224 O OE1   . GLN A 1 287 ? -38.061 -1.472  24.235  1.00 49.40  ? 584  GLN A OE1   1 
ATOM   2225 N NE2   . GLN A 1 287 ? -40.194 -1.645  23.557  1.00 43.86  ? 584  GLN A NE2   1 
ATOM   2226 N N     . SER A 1 288 ? -35.628 -5.431  22.782  1.00 38.33  ? 585  SER A N     1 
ATOM   2227 C CA    . SER A 1 288 ? -35.389 -6.647  23.492  1.00 38.15  ? 585  SER A CA    1 
ATOM   2228 C C     . SER A 1 288 ? -34.033 -6.692  24.217  1.00 39.23  ? 585  SER A C     1 
ATOM   2229 O O     . SER A 1 288 ? -33.945 -7.014  25.375  1.00 39.17  ? 585  SER A O     1 
ATOM   2230 C CB    . SER A 1 288 ? -35.389 -7.804  22.506  1.00 42.85  ? 585  SER A CB    1 
ATOM   2231 O OG    . SER A 1 288 ? -35.398 -9.012  23.226  1.00 56.43  ? 585  SER A OG    1 
ATOM   2232 N N     . THR A 1 289 ? -32.973 -6.437  23.481  1.00 38.31  ? 586  THR A N     1 
ATOM   2233 C CA    . THR A 1 289 ? -31.644 -6.626  24.019  1.00 40.35  ? 586  THR A CA    1 
ATOM   2234 C C     . THR A 1 289 ? -31.189 -5.469  24.848  1.00 39.75  ? 586  THR A C     1 
ATOM   2235 O O     . THR A 1 289 ? -30.599 -5.689  25.875  1.00 45.33  ? 586  THR A O     1 
ATOM   2236 C CB    . THR A 1 289 ? -30.670 -6.814  22.894  1.00 42.32  ? 586  THR A CB    1 
ATOM   2237 O OG1   . THR A 1 289 ? -31.025 -8.041  22.267  1.00 38.25  ? 586  THR A OG1   1 
ATOM   2238 C CG2   . THR A 1 289 ? -29.198 -6.881  23.403  1.00 40.03  ? 586  THR A CG2   1 
ATOM   2239 N N     . TYR A 1 290 ? -31.421 -4.237  24.386  1.00 34.45  ? 587  TYR A N     1 
ATOM   2240 C CA    . TYR A 1 290 ? -30.825 -3.140  25.036  1.00 35.92  ? 587  TYR A CA    1 
ATOM   2241 C C     . TYR A 1 290 ? -31.726 -2.495  26.092  1.00 39.20  ? 587  TYR A C     1 
ATOM   2242 O O     . TYR A 1 290 ? -31.341 -2.457  27.264  1.00 51.75  ? 587  TYR A O     1 
ATOM   2243 C CB    . TYR A 1 290 ? -30.262 -2.179  24.033  1.00 32.51  ? 587  TYR A CB    1 
ATOM   2244 C CG    . TYR A 1 290 ? -29.150 -2.840  23.253  1.00 31.89  ? 587  TYR A CG    1 
ATOM   2245 C CD1   . TYR A 1 290 ? -27.891 -3.099  23.844  1.00 33.64  ? 587  TYR A CD1   1 
ATOM   2246 C CD2   . TYR A 1 290 ? -29.344 -3.246  21.954  1.00 30.76  ? 587  TYR A CD2   1 
ATOM   2247 C CE1   . TYR A 1 290 ? -26.872 -3.769  23.135  1.00 31.50  ? 587  TYR A CE1   1 
ATOM   2248 C CE2   . TYR A 1 290 ? -28.338 -3.903  21.255  1.00 34.67  ? 587  TYR A CE2   1 
ATOM   2249 C CZ    . TYR A 1 290 ? -27.119 -4.188  21.873  1.00 31.03  ? 587  TYR A CZ    1 
ATOM   2250 O OH    . TYR A 1 290 ? -26.135 -4.739  21.122  1.00 31.05  ? 587  TYR A OH    1 
ATOM   2251 N N     . ILE A 1 291 ? -32.927 -2.101  25.728  1.00 37.07  ? 588  ILE A N     1 
ATOM   2252 C CA    . ILE A 1 291 ? -33.853 -1.559  26.704  1.00 35.34  ? 588  ILE A CA    1 
ATOM   2253 C C     . ILE A 1 291 ? -34.239 -2.561  27.757  1.00 37.68  ? 588  ILE A C     1 
ATOM   2254 O O     . ILE A 1 291 ? -33.910 -2.375  28.932  1.00 35.17  ? 588  ILE A O     1 
ATOM   2255 C CB    . ILE A 1 291 ? -35.143 -1.010  26.076  1.00 38.20  ? 588  ILE A CB    1 
ATOM   2256 C CG1   . ILE A 1 291 ? -34.875 0.024   24.996  1.00 39.95  ? 588  ILE A CG1   1 
ATOM   2257 C CG2   . ILE A 1 291 ? -36.072 -0.439  27.155  1.00 34.33  ? 588  ILE A CG2   1 
ATOM   2258 C CD1   . ILE A 1 291 ? -33.872 1.091   25.321  1.00 50.54  ? 588  ILE A CD1   1 
ATOM   2259 N N     . GLU A 1 292 ? -34.935 -3.630  27.373  1.00 36.57  ? 589  GLU A N     1 
ATOM   2260 C CA    . GLU A 1 292 ? -35.436 -4.588  28.366  1.00 38.78  ? 589  GLU A CA    1 
ATOM   2261 C C     . GLU A 1 292 ? -34.297 -5.317  29.038  1.00 36.76  ? 589  GLU A C     1 
ATOM   2262 O O     . GLU A 1 292 ? -34.291 -5.513  30.230  1.00 37.72  ? 589  GLU A O     1 
ATOM   2263 C CB    . GLU A 1 292 ? -36.356 -5.590  27.738  1.00 40.78  ? 589  GLU A CB    1 
ATOM   2264 C CG    . GLU A 1 292 ? -37.711 -5.026  27.438  1.00 46.52  ? 589  GLU A CG    1 
ATOM   2265 C CD    . GLU A 1 292 ? -38.507 -5.912  26.433  1.00 58.38  ? 589  GLU A CD    1 
ATOM   2266 O OE1   . GLU A 1 292 ? -38.164 -7.118  26.217  1.00 53.95  ? 589  GLU A OE1   1 
ATOM   2267 O OE2   . GLU A 1 292 ? -39.477 -5.391  25.846  1.00 64.80  ? 589  GLU A OE2   1 
ATOM   2268 N N     . GLY A 1 293 ? -33.312 -5.689  28.251  1.00 37.22  ? 590  GLY A N     1 
ATOM   2269 C CA    . GLY A 1 293 ? -32.130 -6.314  28.767  1.00 36.89  ? 590  GLY A CA    1 
ATOM   2270 C C     . GLY A 1 293 ? -31.369 -5.523  29.790  1.00 35.90  ? 590  GLY A C     1 
ATOM   2271 O O     . GLY A 1 293 ? -30.990 -6.079  30.798  1.00 34.86  ? 590  GLY A O     1 
ATOM   2272 N N     . LEU A 1 294 ? -31.183 -4.227  29.559  1.00 36.33  ? 591  LEU A N     1 
ATOM   2273 C CA    . LEU A 1 294 ? -30.496 -3.364  30.559  1.00 35.23  ? 591  LEU A CA    1 
ATOM   2274 C C     . LEU A 1 294 ? -31.350 -3.191  31.765  1.00 35.55  ? 591  LEU A C     1 
ATOM   2275 O O     . LEU A 1 294 ? -30.884 -3.282  32.880  1.00 39.54  ? 591  LEU A O     1 
ATOM   2276 C CB    . LEU A 1 294 ? -30.188 -1.961  30.000  1.00 35.28  ? 591  LEU A CB    1 
ATOM   2277 C CG    . LEU A 1 294 ? -28.929 -1.893  29.178  1.00 39.68  ? 591  LEU A CG    1 
ATOM   2278 C CD1   . LEU A 1 294 ? -28.835 -0.514  28.556  1.00 39.88  ? 591  LEU A CD1   1 
ATOM   2279 C CD2   . LEU A 1 294 ? -27.647 -2.224  29.975  1.00 35.27  ? 591  LEU A CD2   1 
ATOM   2280 N N     . LEU A 1 295 ? -32.622 -2.896  31.547  1.00 34.25  ? 592  LEU A N     1 
ATOM   2281 C CA    . LEU A 1 295 ? -33.517 -2.672  32.665  1.00 34.63  ? 592  LEU A CA    1 
ATOM   2282 C C     . LEU A 1 295 ? -33.591 -3.874  33.574  1.00 31.77  ? 592  LEU A C     1 
ATOM   2283 O O     . LEU A 1 295 ? -33.669 -3.711  34.750  1.00 35.53  ? 592  LEU A O     1 
ATOM   2284 C CB    . LEU A 1 295 ? -34.910 -2.213  32.174  1.00 34.50  ? 592  LEU A CB    1 
ATOM   2285 C CG    . LEU A 1 295 ? -34.945 -0.819  31.535  1.00 36.50  ? 592  LEU A CG    1 
ATOM   2286 C CD1   . LEU A 1 295 ? -36.265 -0.547  30.786  1.00 35.23  ? 592  LEU A CD1   1 
ATOM   2287 C CD2   . LEU A 1 295 ? -34.736 0.251   32.607  1.00 38.92  ? 592  LEU A CD2   1 
ATOM   2288 N N     . LYS A 1 296 ? -33.502 -5.095  33.069  1.00 30.31  ? 593  LYS A N     1 
ATOM   2289 C CA    . LYS A 1 296 ? -33.557 -6.211  33.966  1.00 34.50  ? 593  LYS A CA    1 
ATOM   2290 C C     . LYS A 1 296 ? -32.282 -6.412  34.794  1.00 32.40  ? 593  LYS A C     1 
ATOM   2291 O O     . LYS A 1 296 ? -32.313 -7.065  35.790  1.00 34.71  ? 593  LYS A O     1 
ATOM   2292 C CB    . LYS A 1 296 ? -34.008 -7.540  33.297  1.00 41.84  ? 593  LYS A CB    1 
ATOM   2293 C CG    . LYS A 1 296 ? -33.244 -8.058  32.141  1.00 53.41  ? 593  LYS A CG    1 
ATOM   2294 C CD    . LYS A 1 296 ? -34.079 -9.126  31.383  1.00 57.53  ? 593  LYS A CD    1 
ATOM   2295 N N     . VAL A 1 297 ? -31.165 -5.872  34.392  1.00 29.67  ? 594  VAL A N     1 
ATOM   2296 C CA    . VAL A 1 297 ? -29.965 -6.039  35.194  1.00 33.90  ? 594  VAL A CA    1 
ATOM   2297 C C     . VAL A 1 297 ? -29.569 -4.800  35.994  1.00 34.15  ? 594  VAL A C     1 
ATOM   2298 O O     . VAL A 1 297 ? -28.619 -4.874  36.729  1.00 33.15  ? 594  VAL A O     1 
ATOM   2299 C CB    . VAL A 1 297 ? -28.761 -6.563  34.388  1.00 34.88  ? 594  VAL A CB    1 
ATOM   2300 C CG1   . VAL A 1 297 ? -29.112 -7.899  33.796  1.00 41.15  ? 594  VAL A CG1   1 
ATOM   2301 C CG2   . VAL A 1 297 ? -28.326 -5.591  33.327  1.00 33.46  ? 594  VAL A CG2   1 
ATOM   2302 N N     . VAL A 1 298 ? -30.261 -3.668  35.831  1.00 33.36  ? 595  VAL A N     1 
ATOM   2303 C CA    . VAL A 1 298 ? -29.968 -2.495  36.635  1.00 33.04  ? 595  VAL A CA    1 
ATOM   2304 C C     . VAL A 1 298 ? -30.319 -2.790  38.059  1.00 31.87  ? 595  VAL A C     1 
ATOM   2305 O O     . VAL A 1 298 ? -31.389 -3.341  38.321  1.00 33.67  ? 595  VAL A O     1 
ATOM   2306 C CB    . VAL A 1 298 ? -30.753 -1.271  36.174  1.00 36.38  ? 595  VAL A CB    1 
ATOM   2307 C CG1   . VAL A 1 298 ? -30.467 -0.079  37.059  1.00 38.38  ? 595  VAL A CG1   1 
ATOM   2308 C CG2   . VAL A 1 298 ? -30.302 -0.882  34.796  1.00 39.80  ? 595  VAL A CG2   1 
ATOM   2309 N N     . ARG A 1 299 ? -29.439 -2.466  39.014  1.00 29.44  ? 596  ARG A N     1 
ATOM   2310 C CA    . ARG A 1 299 ? -29.812 -2.653  40.425  1.00 29.58  ? 596  ARG A CA    1 
ATOM   2311 C C     . ARG A 1 299 ? -30.776 -1.589  40.857  1.00 29.30  ? 596  ARG A C     1 
ATOM   2312 O O     . ARG A 1 299 ? -30.514 -0.397  40.684  1.00 33.63  ? 596  ARG A O     1 
ATOM   2313 C CB    . ARG A 1 299 ? -28.603 -2.707  41.324  1.00 30.72  ? 596  ARG A CB    1 
ATOM   2314 C CG    . ARG A 1 299 ? -27.564 -3.572  40.688  1.00 36.80  ? 596  ARG A CG    1 
ATOM   2315 C CD    . ARG A 1 299 ? -26.905 -4.494  41.629  1.00 39.80  ? 596  ARG A CD    1 
ATOM   2316 N NE    . ARG A 1 299 ? -26.450 -5.648  40.890  1.00 41.49  ? 596  ARG A NE    1 
ATOM   2317 C CZ    . ARG A 1 299 ? -26.312 -6.841  41.445  1.00 37.29  ? 596  ARG A CZ    1 
ATOM   2318 N NH1   . ARG A 1 299 ? -26.582 -6.996  42.721  1.00 34.25  ? 596  ARG A NH1   1 
ATOM   2319 N NH2   . ARG A 1 299 ? -25.943 -7.858  40.704  1.00 37.61  ? 596  ARG A NH2   1 
ATOM   2320 N N     . PRO A 1 300 ? -31.920 -2.014  41.446  1.00 32.67  ? 597  PRO A N     1 
ATOM   2321 C CA    . PRO A 1 300 ? -32.908 -0.984  41.647  1.00 31.03  ? 597  PRO A CA    1 
ATOM   2322 C C     . PRO A 1 300 ? -32.544 0.010   42.756  1.00 35.21  ? 597  PRO A C     1 
ATOM   2323 O O     . PRO A 1 300 ? -33.049 1.110   42.805  1.00 37.93  ? 597  PRO A O     1 
ATOM   2324 C CB    . PRO A 1 300 ? -34.152 -1.781  41.976  1.00 34.87  ? 597  PRO A CB    1 
ATOM   2325 C CG    . PRO A 1 300 ? -33.667 -2.991  42.595  1.00 33.43  ? 597  PRO A CG    1 
ATOM   2326 C CD    . PRO A 1 300 ? -32.496 -3.349  41.741  1.00 34.02  ? 597  PRO A CD    1 
ATOM   2327 N N     . ASP A 1 301 ? -31.667 -0.377  43.643  1.00 31.36  ? 598  ASP A N     1 
ATOM   2328 C CA    . ASP A 1 301 ? -31.309 0.479   44.728  1.00 39.92  ? 598  ASP A CA    1 
ATOM   2329 C C     . ASP A 1 301 ? -30.352 1.599   44.322  1.00 43.03  ? 598  ASP A C     1 
ATOM   2330 O O     . ASP A 1 301 ? -30.540 2.721   44.735  1.00 48.93  ? 598  ASP A O     1 
ATOM   2331 C CB    . ASP A 1 301 ? -30.707 -0.349  45.855  1.00 37.29  ? 598  ASP A CB    1 
ATOM   2332 C CG    . ASP A 1 301 ? -29.678 -1.289  45.379  1.00 35.23  ? 598  ASP A CG    1 
ATOM   2333 O OD1   . ASP A 1 301 ? -29.890 -1.919  44.321  1.00 40.27  ? 598  ASP A OD1   1 
ATOM   2334 O OD2   . ASP A 1 301 ? -28.703 -1.473  46.107  1.00 42.66  ? 598  ASP A OD2   1 
ATOM   2335 N N     . THR A 1 302 ? -29.360 1.302   43.507  1.00 38.15  ? 599  THR A N     1 
ATOM   2336 C CA    . THR A 1 302 ? -28.438 2.324   43.031  1.00 34.72  ? 599  THR A CA    1 
ATOM   2337 C C     . THR A 1 302 ? -28.570 2.778   41.600  1.00 32.04  ? 599  THR A C     1 
ATOM   2338 O O     . THR A 1 302 ? -27.894 3.704   41.183  1.00 33.70  ? 599  THR A O     1 
ATOM   2339 C CB    . THR A 1 302 ? -27.064 1.772   43.150  1.00 34.88  ? 599  THR A CB    1 
ATOM   2340 O OG1   . THR A 1 302 ? -26.987 0.638   42.303  1.00 31.35  ? 599  THR A OG1   1 
ATOM   2341 C CG2   . THR A 1 302 ? -26.806 1.406   44.632  1.00 39.10  ? 599  THR A CG2   1 
ATOM   2342 N N     . LYS A 1 303 ? -29.441 2.141   40.850  1.00 29.83  ? 600  LYS A N     1 
ATOM   2343 C CA    . LYS A 1 303 ? -29.632 2.436   39.441  1.00 34.43  ? 600  LYS A CA    1 
ATOM   2344 C C     . LYS A 1 303 ? -28.308 2.245   38.678  1.00 32.23  ? 600  LYS A C     1 
ATOM   2345 O O     . LYS A 1 303 ? -28.076 2.862   37.681  1.00 35.72  ? 600  LYS A O     1 
ATOM   2346 C CB    . LYS A 1 303 ? -30.251 3.827   39.243  1.00 34.84  ? 600  LYS A CB    1 
ATOM   2347 C CG    . LYS A 1 303 ? -31.729 3.855   39.723  1.00 38.57  ? 600  LYS A CG    1 
ATOM   2348 N N     . LYS A 1 304 ? -27.456 1.367   39.167  1.00 26.94  ? 601  LYS A N     1 
ATOM   2349 C CA    . LYS A 1 304 ? -26.239 1.044   38.465  1.00 27.42  ? 601  LYS A CA    1 
ATOM   2350 C C     . LYS A 1 304 ? -26.330 -0.374  37.816  1.00 24.46  ? 601  LYS A C     1 
ATOM   2351 O O     . LYS A 1 304 ? -26.974 -1.266  38.325  1.00 27.97  ? 601  LYS A O     1 
ATOM   2352 C CB    . LYS A 1 304 ? -25.076 1.100   39.435  1.00 27.85  ? 601  LYS A CB    1 
ATOM   2353 C CG    . LYS A 1 304 ? -24.574 2.485   39.777  1.00 27.20  ? 601  LYS A CG    1 
ATOM   2354 C CD    . LYS A 1 304 ? -23.512 2.368   40.865  1.00 29.52  ? 601  LYS A CD    1 
ATOM   2355 C CE    . LYS A 1 304 ? -22.834 3.705   40.991  1.00 32.96  ? 601  LYS A CE    1 
ATOM   2356 N NZ    . LYS A 1 304 ? -21.595 3.508   41.738  1.00 36.82  ? 601  LYS A NZ    1 
ATOM   2357 N N     . VAL A 1 305 ? -25.571 -0.554  36.746  1.00 24.73  ? 602  VAL A N     1 
ATOM   2358 C CA    . VAL A 1 305 ? -25.243 -1.906  36.223  1.00 25.25  ? 602  VAL A CA    1 
ATOM   2359 C C     . VAL A 1 305 ? -23.776 -2.248  36.549  1.00 26.80  ? 602  VAL A C     1 
ATOM   2360 O O     . VAL A 1 305 ? -22.862 -1.422  36.365  1.00 27.23  ? 602  VAL A O     1 
ATOM   2361 C CB    . VAL A 1 305 ? -25.400 -2.021  34.709  1.00 26.58  ? 602  VAL A CB    1 
ATOM   2362 C CG1   . VAL A 1 305 ? -26.872 -1.991  34.359  1.00 29.26  ? 602  VAL A CG1   1 
ATOM   2363 C CG2   . VAL A 1 305 ? -24.625 -1.008  33.908  1.00 25.91  ? 602  VAL A CG2   1 
ATOM   2364 N N     . HIS A 1 306 ? -23.582 -3.460  36.993  1.00 23.21  ? 603  HIS A N     1 
ATOM   2365 C CA    . HIS A 1 306 ? -22.265 -3.969  37.341  1.00 24.35  ? 603  HIS A CA    1 
ATOM   2366 C C     . HIS A 1 306 ? -21.925 -5.171  36.449  1.00 23.39  ? 603  HIS A C     1 
ATOM   2367 O O     . HIS A 1 306 ? -22.322 -6.318  36.732  1.00 24.08  ? 603  HIS A O     1 
ATOM   2368 C CB    . HIS A 1 306 ? -22.250 -4.352  38.796  1.00 24.03  ? 603  HIS A CB    1 
ATOM   2369 C CG    . HIS A 1 306 ? -22.589 -3.243  39.735  1.00 25.81  ? 603  HIS A CG    1 
ATOM   2370 N ND1   . HIS A 1 306 ? -21.648 -2.528  40.429  1.00 28.00  ? 603  HIS A ND1   1 
ATOM   2371 C CD2   . HIS A 1 306 ? -23.786 -2.747  40.114  1.00 28.65  ? 603  HIS A CD2   1 
ATOM   2372 C CE1   . HIS A 1 306 ? -22.243 -1.659  41.225  1.00 27.25  ? 603  HIS A CE1   1 
ATOM   2373 N NE2   . HIS A 1 306 ? -23.535 -1.720  40.983  1.00 29.18  ? 603  HIS A NE2   1 
ATOM   2374 N N     . THR A 1 307 ? -21.172 -4.905  35.366  1.00 23.07  ? 604  THR A N     1 
ATOM   2375 C CA    . THR A 1 307 ? -20.751 -5.950  34.484  1.00 22.46  ? 604  THR A CA    1 
ATOM   2376 C C     . THR A 1 307 ? -19.782 -6.869  35.196  1.00 23.38  ? 604  THR A C     1 
ATOM   2377 O O     . THR A 1 307 ? -19.191 -6.546  36.256  1.00 25.09  ? 604  THR A O     1 
ATOM   2378 C CB    . THR A 1 307 ? -20.111 -5.363  33.163  1.00 22.80  ? 604  THR A CB    1 
ATOM   2379 O OG1   . THR A 1 307 ? -20.075 -6.356  32.123  1.00 23.32  ? 604  THR A OG1   1 
ATOM   2380 C CG2   . THR A 1 307 ? -18.733 -4.819  33.421  1.00 22.76  ? 604  THR A CG2   1 
ATOM   2381 N N     . ILE A 1 308 ? -19.599 -8.044  34.605  1.00 25.17  ? 605  ILE A N     1 
ATOM   2382 C CA    . ILE A 1 308 ? -18.462 -8.895  34.902  1.00 23.86  ? 605  ILE A CA    1 
ATOM   2383 C C     . ILE A 1 308 ? -17.535 -9.012  33.681  1.00 25.21  ? 605  ILE A C     1 
ATOM   2384 O O     . ILE A 1 308 ? -17.949 -9.413  32.599  1.00 22.19  ? 605  ILE A O     1 
ATOM   2385 C CB    . ILE A 1 308 ? -18.914 -10.235 35.430  1.00 27.37  ? 605  ILE A CB    1 
ATOM   2386 C CG1   . ILE A 1 308 ? -19.635 -10.005 36.774  1.00 26.13  ? 605  ILE A CG1   1 
ATOM   2387 C CG2   . ILE A 1 308 ? -17.709 -11.147 35.579  1.00 28.58  ? 605  ILE A CG2   1 
ATOM   2388 C CD1   . ILE A 1 308 ? -20.207 -11.228 37.428  1.00 28.38  ? 605  ILE A CD1   1 
ATOM   2389 N N     . PHE A 1 309 ? -16.281 -8.607  33.856  1.00 22.42  ? 606  PHE A N     1 
ATOM   2390 C CA    . PHE A 1 309 ? -15.321 -8.756  32.775  1.00 24.10  ? 606  PHE A CA    1 
ATOM   2391 C C     . PHE A 1 309 ? -14.685 -10.146 32.905  1.00 26.21  ? 606  PHE A C     1 
ATOM   2392 O O     . PHE A 1 309 ? -14.019 -10.463 33.897  1.00 30.82  ? 606  PHE A O     1 
ATOM   2393 C CB    . PHE A 1 309 ? -14.274 -7.698  32.822  1.00 24.69  ? 606  PHE A CB    1 
ATOM   2394 C CG    . PHE A 1 309 ? -14.742 -6.360  32.440  1.00 23.81  ? 606  PHE A CG    1 
ATOM   2395 C CD1   . PHE A 1 309 ? -15.002 -6.032  31.126  1.00 25.91  ? 606  PHE A CD1   1 
ATOM   2396 C CD2   . PHE A 1 309 ? -14.916 -5.360  33.442  1.00 25.54  ? 606  PHE A CD2   1 
ATOM   2397 C CE1   . PHE A 1 309 ? -15.423 -4.755  30.789  1.00 28.30  ? 606  PHE A CE1   1 
ATOM   2398 C CE2   . PHE A 1 309 ? -15.328 -4.084  33.075  1.00 23.01  ? 606  PHE A CE2   1 
ATOM   2399 C CZ    . PHE A 1 309 ? -15.586 -3.781  31.798  1.00 28.19  ? 606  PHE A CZ    1 
ATOM   2400 N N     . ASN A 1 310 ? -14.920 -10.998 31.924  1.00 24.32  ? 607  ASN A N     1 
ATOM   2401 C CA    . ASN A 1 310 ? -14.246 -12.269 31.904  1.00 22.43  ? 607  ASN A CA    1 
ATOM   2402 C C     . ASN A 1 310 ? -12.849 -12.054 31.386  1.00 22.27  ? 607  ASN A C     1 
ATOM   2403 O O     . ASN A 1 310 ? -12.644 -11.744 30.181  1.00 23.79  ? 607  ASN A O     1 
ATOM   2404 C CB    . ASN A 1 310 ? -15.051 -13.296 31.103  1.00 24.85  ? 607  ASN A CB    1 
ATOM   2405 C CG    . ASN A 1 310 ? -14.588 -14.720 31.419  1.00 28.21  ? 607  ASN A CG    1 
ATOM   2406 O OD1   . ASN A 1 310 ? -13.423 -14.957 31.756  1.00 26.89  ? 607  ASN A OD1   1 
ATOM   2407 N ND2   . ASN A 1 310 ? -15.462 -15.660 31.268  1.00 27.93  ? 607  ASN A ND2   1 
ATOM   2408 N N     . GLN A 1 311 ? -11.887 -12.227 32.267  1.00 20.66  ? 608  GLN A N     1 
ATOM   2409 C CA    . GLN A 1 311 ? -10.485 -12.032 31.973  1.00 21.18  ? 608  GLN A CA    1 
ATOM   2410 C C     . GLN A 1 311 ? -9.768  -13.303 31.479  1.00 22.98  ? 608  GLN A C     1 
ATOM   2411 O O     . GLN A 1 311 ? -8.634  -13.226 31.017  1.00 25.40  ? 608  GLN A O     1 
ATOM   2412 C CB    . GLN A 1 311 ? -9.775  -11.517 33.218  1.00 21.96  ? 608  GLN A CB    1 
ATOM   2413 C CG    . GLN A 1 311 ? -8.389  -10.950 32.996  1.00 23.18  ? 608  GLN A CG    1 
ATOM   2414 C CD    . GLN A 1 311 ? -7.701  -10.507 34.261  1.00 21.90  ? 608  GLN A CD    1 
ATOM   2415 O OE1   . GLN A 1 311 ? -8.338  -10.426 35.295  1.00 24.65  ? 608  GLN A OE1   1 
ATOM   2416 N NE2   . GLN A 1 311 ? -6.410  -10.192 34.184  1.00 22.80  ? 608  GLN A NE2   1 
ATOM   2417 N N     . ALA A 1 312 ? -10.435 -14.444 31.488  1.00 23.24  ? 609  ALA A N     1 
ATOM   2418 C CA    . ALA A 1 312 ? -9.774  -15.734 31.199  1.00 26.76  ? 609  ALA A CA    1 
ATOM   2419 C C     . ALA A 1 312 ? -10.561 -16.563 30.214  1.00 24.64  ? 609  ALA A C     1 
ATOM   2420 O O     . ALA A 1 312 ? -10.783 -17.742 30.416  1.00 28.57  ? 609  ALA A O     1 
ATOM   2421 C CB    . ALA A 1 312 ? -9.542  -16.507 32.481  1.00 28.22  ? 609  ALA A CB    1 
ATOM   2422 N N     . LEU A 1 313 ? -11.048 -15.913 29.184  1.00 23.97  ? 610  LEU A N     1 
ATOM   2423 C CA    . LEU A 1 313 ? -11.943 -16.505 28.200  1.00 24.32  ? 610  LEU A CA    1 
ATOM   2424 C C     . LEU A 1 313 ? -11.451 -16.459 26.744  1.00 24.56  ? 610  LEU A C     1 
ATOM   2425 O O     . LEU A 1 313 ? -11.349 -17.499 26.099  1.00 24.17  ? 610  LEU A O     1 
ATOM   2426 C CB    . LEU A 1 313 ? -13.330 -15.906 28.277  1.00 26.90  ? 610  LEU A CB    1 
ATOM   2427 C CG    . LEU A 1 313 ? -14.300 -16.502 27.243  1.00 34.58  ? 610  LEU A CG    1 
ATOM   2428 C CD1   . LEU A 1 313 ? -14.377 -18.023 27.419  1.00 39.16  ? 610  LEU A CD1   1 
ATOM   2429 C CD2   . LEU A 1 313 ? -15.689 -15.955 27.391  1.00 42.57  ? 610  LEU A CD2   1 
ATOM   2430 N N     . THR A 1 314 ? -11.160 -15.282 26.219  1.00 23.86  ? 611  THR A N     1 
ATOM   2431 C CA    . THR A 1 314 ? -10.950 -15.179 24.796  1.00 26.74  ? 611  THR A CA    1 
ATOM   2432 C C     . THR A 1 314 ? -9.616  -15.760 24.400  1.00 26.05  ? 611  THR A C     1 
ATOM   2433 O O     . THR A 1 314 ? -8.641  -15.720 25.147  1.00 26.35  ? 611  THR A O     1 
ATOM   2434 C CB    . THR A 1 314 ? -10.980 -13.726 24.265  1.00 25.65  ? 611  THR A CB    1 
ATOM   2435 O OG1   . THR A 1 314 ? -9.790  -13.064 24.673  1.00 22.68  ? 611  THR A OG1   1 
ATOM   2436 C CG2   . THR A 1 314 ? -12.184 -13.018 24.774  1.00 25.37  ? 611  THR A CG2   1 
ATOM   2437 N N     . GLN A 1 315 ? -9.573  -16.275 23.195  1.00 27.08  ? 612  GLN A N     1 
ATOM   2438 C CA    . GLN A 1 315 ? -8.405  -16.978 22.707  1.00 27.34  ? 612  GLN A CA    1 
ATOM   2439 C C     . GLN A 1 315 ? -7.252  -16.034 22.364  1.00 27.60  ? 612  GLN A C     1 
ATOM   2440 O O     . GLN A 1 315 ? -6.147  -16.489 22.169  1.00 30.77  ? 612  GLN A O     1 
ATOM   2441 C CB    . GLN A 1 315 ? -8.814  -17.779 21.448  1.00 27.70  ? 612  GLN A CB    1 
ATOM   2442 C CG    . GLN A 1 315 ? -9.898  -18.817 21.730  1.00 28.10  ? 612  GLN A CG    1 
ATOM   2443 C CD    . GLN A 1 315 ? -9.453  -19.762 22.827  1.00 31.09  ? 612  GLN A CD    1 
ATOM   2444 O OE1   . GLN A 1 315 ? -8.394  -20.387 22.739  1.00 31.07  ? 612  GLN A OE1   1 
ATOM   2445 N NE2   . GLN A 1 315 ? -10.188 -19.754 23.954  1.00 33.80  ? 612  GLN A NE2   1 
ATOM   2446 N N     . THR A 1 316 ? -7.529  -14.731 22.271  1.00 27.69  ? 613  THR A N     1 
ATOM   2447 C CA    . THR A 1 316 ? -6.522  -13.727 21.895  1.00 26.92  ? 613  THR A CA    1 
ATOM   2448 C C     . THR A 1 316 ? -6.017  -12.811 23.024  1.00 28.18  ? 613  THR A C     1 
ATOM   2449 O O     . THR A 1 316 ? -5.192  -11.993 22.756  1.00 29.26  ? 613  THR A O     1 
ATOM   2450 C CB    . THR A 1 316 ? -7.123  -12.764 20.842  1.00 27.27  ? 613  THR A CB    1 
ATOM   2451 O OG1   . THR A 1 316 ? -8.372  -12.250 21.323  1.00 26.80  ? 613  THR A OG1   1 
ATOM   2452 C CG2   . THR A 1 316 ? -7.350  -13.478 19.535  1.00 27.79  ? 613  THR A CG2   1 
ATOM   2453 N N     . GLY A 1 317 ? -6.592  -12.887 24.239  1.00 25.51  ? 614  GLY A N     1 
ATOM   2454 C CA    . GLY A 1 317 ? -6.186  -12.014 25.337  1.00 24.61  ? 614  GLY A CA    1 
ATOM   2455 C C     . GLY A 1 317 ? -7.056  -10.790 25.540  1.00 26.14  ? 614  GLY A C     1 
ATOM   2456 O O     . GLY A 1 317 ? -6.807  -9.970  26.428  1.00 25.61  ? 614  GLY A O     1 
ATOM   2457 N N     . ARG A 1 318 ? -8.119  -10.660 24.735  1.00 23.25  ? 615  ARG A N     1 
ATOM   2458 C CA    . ARG A 1 318 ? -9.115  -9.662  25.017  1.00 23.71  ? 615  ARG A CA    1 
ATOM   2459 C C     . ARG A 1 318 ? -9.938  -10.062 26.224  1.00 23.50  ? 615  ARG A C     1 
ATOM   2460 O O     . ARG A 1 318 ? -9.989  -11.232 26.638  1.00 24.42  ? 615  ARG A O     1 
ATOM   2461 C CB    . ARG A 1 318 ? -10.074 -9.517  23.844  1.00 24.75  ? 615  ARG A CB    1 
ATOM   2462 C CG    . ARG A 1 318 ? -9.552  -8.767  22.653  1.00 25.38  ? 615  ARG A CG    1 
ATOM   2463 C CD    . ARG A 1 318 ? -10.671 -8.529  21.669  1.00 25.39  ? 615  ARG A CD    1 
ATOM   2464 N NE    . ARG A 1 318 ? -10.290 -7.656  20.580  1.00 27.52  ? 615  ARG A NE    1 
ATOM   2465 C CZ    . ARG A 1 318 ? -11.107 -7.295  19.600  1.00 28.39  ? 615  ARG A CZ    1 
ATOM   2466 N NH1   . ARG A 1 318 ? -12.368 -7.728  19.534  1.00 26.83  ? 615  ARG A NH1   1 
ATOM   2467 N NH2   . ARG A 1 318 ? -10.657 -6.503  18.674  1.00 29.08  ? 615  ARG A NH2   1 
ATOM   2468 N N     . LEU A 1 319 ? -10.562 -9.052  26.820  1.00 24.60  ? 616  LEU A N     1 
ATOM   2469 C CA    . LEU A 1 319 ? -11.593 -9.247  27.811  1.00 21.84  ? 616  LEU A CA    1 
ATOM   2470 C C     . LEU A 1 319 ? -12.895 -9.553  27.112  1.00 23.83  ? 616  LEU A C     1 
ATOM   2471 O O     . LEU A 1 319 ? -13.031 -9.210  25.946  1.00 23.22  ? 616  LEU A O     1 
ATOM   2472 C CB    . LEU A 1 319 ? -11.785 -7.924  28.581  1.00 23.47  ? 616  LEU A CB    1 
ATOM   2473 C CG    . LEU A 1 319 ? -10.542 -7.437  29.284  1.00 22.58  ? 616  LEU A CG    1 
ATOM   2474 C CD1   . LEU A 1 319 ? -10.943 -6.168  29.975  1.00 24.95  ? 616  LEU A CD1   1 
ATOM   2475 C CD2   . LEU A 1 319 ? -10.075 -8.468  30.329  1.00 21.42  ? 616  LEU A CD2   1 
ATOM   2476 N N     . SER A 1 320 ? -13.867 -10.132 27.847  1.00 22.14  ? 617  SER A N     1 
ATOM   2477 C CA    . SER A 1 320 ? -15.262 -10.081 27.447  1.00 22.72  ? 617  SER A CA    1 
ATOM   2478 C C     . SER A 1 320 ? -16.053 -9.532  28.603  1.00 22.80  ? 617  SER A C     1 
ATOM   2479 O O     . SER A 1 320 ? -15.484 -9.385  29.685  1.00 21.75  ? 617  SER A O     1 
ATOM   2480 C CB    . SER A 1 320 ? -15.794 -11.434 27.013  1.00 24.54  ? 617  SER A CB    1 
ATOM   2481 O OG    . SER A 1 320 ? -15.995 -12.298 28.086  1.00 28.66  ? 617  SER A OG    1 
ATOM   2482 N N     . SER A 1 321 ? -17.312 -9.159  28.354  1.00 20.21  ? 618  SER A N     1 
ATOM   2483 C CA    . SER A 1 321 ? -18.146 -8.465  29.310  1.00 22.80  ? 618  SER A CA    1 
ATOM   2484 C C     . SER A 1 321 ? -19.481 -9.123  29.293  1.00 25.92  ? 618  SER A C     1 
ATOM   2485 O O     . SER A 1 321 ? -20.041 -9.435  28.219  1.00 24.36  ? 618  SER A O     1 
ATOM   2486 C CB    . SER A 1 321 ? -18.223 -6.970  28.993  1.00 24.65  ? 618  SER A CB    1 
ATOM   2487 O OG    . SER A 1 321 ? -19.318 -6.264  29.578  1.00 26.50  ? 618  SER A OG    1 
ATOM   2488 N N     . THR A 1 322 ? -20.009 -9.323  30.505  1.00 24.44  ? 619  THR A N     1 
ATOM   2489 C CA    . THR A 1 322 ? -21.261 -10.012 30.640  1.00 29.14  ? 619  THR A CA    1 
ATOM   2490 C C     . THR A 1 322 ? -22.246 -9.439  31.695  1.00 28.72  ? 619  THR A C     1 
ATOM   2491 O O     . THR A 1 322 ? -21.821 -8.853  32.690  1.00 26.55  ? 619  THR A O     1 
ATOM   2492 C CB    . THR A 1 322 ? -20.869 -11.486 30.967  1.00 33.23  ? 619  THR A CB    1 
ATOM   2493 O OG1   . THR A 1 322 ? -21.890 -12.334 30.556  1.00 53.70  ? 619  THR A OG1   1 
ATOM   2494 C CG2   . THR A 1 322 ? -20.597 -11.697 32.368  1.00 26.99  ? 619  THR A CG2   1 
ATOM   2495 N N     . GLU A 1 323 ? -23.545 -9.564  31.407  1.00 27.55  ? 620  GLU A N     1 
ATOM   2496 C CA    . GLU A 1 323 ? -24.599 -9.372  32.377  1.00 31.84  ? 620  GLU A CA    1 
ATOM   2497 C C     . GLU A 1 323 ? -24.535 -7.994  33.153  1.00 33.08  ? 620  GLU A C     1 
ATOM   2498 O O     . GLU A 1 323 ? -24.482 -7.999  34.350  1.00 36.00  ? 620  GLU A O     1 
ATOM   2499 C CB    . GLU A 1 323 ? -24.581 -10.570 33.328  1.00 37.72  ? 620  GLU A CB    1 
ATOM   2500 C CG    . GLU A 1 323 ? -25.971 -11.128 33.650  1.00 51.42  ? 620  GLU A CG    1 
ATOM   2501 C CD    . GLU A 1 323 ? -25.921 -12.093 34.840  1.00 54.83  ? 620  GLU A CD    1 
ATOM   2502 O OE1   . GLU A 1 323 ? -24.999 -12.957 34.916  1.00 49.79  ? 620  GLU A OE1   1 
ATOM   2503 O OE2   . GLU A 1 323 ? -26.753 -11.921 35.753  1.00 59.53  ? 620  GLU A OE2   1 
ATOM   2504 N N     . PRO A 1 324 ? -24.557 -6.855  32.445  1.00 30.03  ? 621  PRO A N     1 
ATOM   2505 C CA    . PRO A 1 324 ? -24.733 -6.928  30.986  1.00 29.61  ? 621  PRO A CA    1 
ATOM   2506 C C     . PRO A 1 324 ? -23.397 -6.853  30.229  1.00 26.88  ? 621  PRO A C     1 
ATOM   2507 O O     . PRO A 1 324 ? -22.375 -6.488  30.816  1.00 27.92  ? 621  PRO A O     1 
ATOM   2508 C CB    . PRO A 1 324 ? -25.495 -5.634  30.715  1.00 31.51  ? 621  PRO A CB    1 
ATOM   2509 C CG    . PRO A 1 324 ? -24.805 -4.663  31.642  1.00 31.01  ? 621  PRO A CG    1 
ATOM   2510 C CD    . PRO A 1 324 ? -24.472 -5.422  32.857  1.00 30.19  ? 621  PRO A CD    1 
ATOM   2511 N N     . ASN A 1 325 ? -23.434 -7.097  28.935  1.00 24.48  ? 622  ASN A N     1 
ATOM   2512 C CA    . ASN A 1 325 ? -22.336 -6.829  28.042  1.00 23.57  ? 622  ASN A CA    1 
ATOM   2513 C C     . ASN A 1 325 ? -22.360 -5.353  27.725  1.00 26.50  ? 622  ASN A C     1 
ATOM   2514 O O     . ASN A 1 325 ? -23.307 -4.852  27.129  1.00 26.92  ? 622  ASN A O     1 
ATOM   2515 C CB    . ASN A 1 325 ? -22.482 -7.688  26.780  1.00 24.77  ? 622  ASN A CB    1 
ATOM   2516 C CG    . ASN A 1 325 ? -21.295 -7.520  25.820  1.00 25.79  ? 622  ASN A CG    1 
ATOM   2517 O OD1   . ASN A 1 325 ? -20.425 -6.720  26.061  1.00 23.22  ? 622  ASN A OD1   1 
ATOM   2518 N ND2   . ASN A 1 325 ? -21.252 -8.300  24.746  1.00 24.41  ? 622  ASN A ND2   1 
ATOM   2519 N N     . LEU A 1 326 ? -21.319 -4.630  28.156  1.00 23.67  ? 623  LEU A N     1 
ATOM   2520 C CA    . LEU A 1 326 ? -21.239 -3.227  27.926  1.00 24.21  ? 623  LEU A CA    1 
ATOM   2521 C C     . LEU A 1 326 ? -20.207 -2.953  26.818  1.00 26.70  ? 623  LEU A C     1 
ATOM   2522 O O     . LEU A 1 326 ? -19.861 -1.800  26.547  1.00 25.48  ? 623  LEU A O     1 
ATOM   2523 C CB    . LEU A 1 326 ? -20.852 -2.497  29.228  1.00 28.05  ? 623  LEU A CB    1 
ATOM   2524 C CG    . LEU A 1 326 ? -21.941 -2.585  30.311  1.00 29.21  ? 623  LEU A CG    1 
ATOM   2525 C CD1   . LEU A 1 326 ? -21.574 -1.851  31.561  1.00 30.38  ? 623  LEU A CD1   1 
ATOM   2526 C CD2   . LEU A 1 326 ? -23.308 -2.089  29.805  1.00 29.90  ? 623  LEU A CD2   1 
ATOM   2527 N N     . GLN A 1 327 ? -19.756 -4.005  26.141  1.00 26.12  ? 624  GLN A N     1 
ATOM   2528 C CA    . GLN A 1 327 ? -18.843 -3.820  24.969  1.00 24.33  ? 624  GLN A CA    1 
ATOM   2529 C C     . GLN A 1 327 ? -19.556 -3.963  23.632  1.00 26.21  ? 624  GLN A C     1 
ATOM   2530 O O     . GLN A 1 327 ? -18.932 -3.962  22.600  1.00 28.52  ? 624  GLN A O     1 
ATOM   2531 C CB    . GLN A 1 327 ? -17.705 -4.835  25.059  1.00 26.39  ? 624  GLN A CB    1 
ATOM   2532 C CG    . GLN A 1 327 ? -16.890 -4.760  26.323  1.00 25.45  ? 624  GLN A CG    1 
ATOM   2533 C CD    . GLN A 1 327 ? -15.790 -5.807  26.377  1.00 28.50  ? 624  GLN A CD    1 
ATOM   2534 O OE1   . GLN A 1 327 ? -15.999 -6.942  26.000  1.00 24.85  ? 624  GLN A OE1   1 
ATOM   2535 N NE2   . GLN A 1 327 ? -14.616 -5.401  26.801  1.00 26.45  ? 624  GLN A NE2   1 
ATOM   2536 N N     . ASN A 1 328 ? -20.871 -4.064  23.641  1.00 27.58  ? 625  ASN A N     1 
ATOM   2537 C CA    . ASN A 1 328 ? -21.617 -4.035  22.395  1.00 29.13  ? 625  ASN A CA    1 
ATOM   2538 C C     . ASN A 1 328 ? -22.871 -3.131  22.416  1.00 29.86  ? 625  ASN A C     1 
ATOM   2539 O O     . ASN A 1 328 ? -23.840 -3.419  21.757  1.00 28.93  ? 625  ASN A O     1 
ATOM   2540 C CB    . ASN A 1 328 ? -21.929 -5.484  21.913  1.00 28.55  ? 625  ASN A CB    1 
ATOM   2541 C CG    . ASN A 1 328 ? -23.043 -6.109  22.689  1.00 30.00  ? 625  ASN A CG    1 
ATOM   2542 O OD1   . ASN A 1 328 ? -23.349 -5.680  23.795  1.00 28.12  ? 625  ASN A OD1   1 
ATOM   2543 N ND2   . ASN A 1 328 ? -23.706 -7.081  22.094  1.00 28.96  ? 625  ASN A ND2   1 
ATOM   2544 N N     . ILE A 1 329 ? -22.802 -2.010  23.125  1.00 28.55  ? 626  ILE A N     1 
ATOM   2545 C CA    . ILE A 1 329 ? -23.866 -1.038  23.132  1.00 30.11  ? 626  ILE A CA    1 
ATOM   2546 C C     . ILE A 1 329 ? -23.835 -0.325  21.791  1.00 28.92  ? 626  ILE A C     1 
ATOM   2547 O O     . ILE A 1 329 ? -22.760 0.022   21.283  1.00 29.99  ? 626  ILE A O     1 
ATOM   2548 C CB    . ILE A 1 329 ? -23.730 0.013   24.273  1.00 29.18  ? 626  ILE A CB    1 
ATOM   2549 C CG1   . ILE A 1 329 ? -23.626 -0.643  25.623  1.00 29.46  ? 626  ILE A CG1   1 
ATOM   2550 C CG2   . ILE A 1 329 ? -24.875 0.968   24.255  1.00 30.05  ? 626  ILE A CG2   1 
ATOM   2551 C CD1   . ILE A 1 329 ? -24.780 -1.561  26.008  1.00 30.37  ? 626  ILE A CD1   1 
ATOM   2552 N N     . PRO A 1 330 ? -25.025 -0.112  21.172  1.00 30.07  ? 627  PRO A N     1 
ATOM   2553 C CA    . PRO A 1 330 ? -25.079 0.399   19.828  1.00 30.38  ? 627  PRO A CA    1 
ATOM   2554 C C     . PRO A 1 330 ? -24.406 1.730   19.659  1.00 33.61  ? 627  PRO A C     1 
ATOM   2555 O O     . PRO A 1 330 ? -24.421 2.569   20.554  1.00 30.59  ? 627  PRO A O     1 
ATOM   2556 C CB    . PRO A 1 330 ? -26.587 0.476   19.521  1.00 30.94  ? 627  PRO A CB    1 
ATOM   2557 C CG    . PRO A 1 330 ? -27.168 -0.558  20.356  1.00 30.52  ? 627  PRO A CG    1 
ATOM   2558 C CD    . PRO A 1 330 ? -26.347 -0.536  21.639  1.00 29.65  ? 627  PRO A CD    1 
ATOM   2559 N N     . ILE A 1 331 ? -23.807 1.907   18.489  1.00 35.41  ? 628  ILE A N     1 
ATOM   2560 C CA    . ILE A 1 331 ? -23.190 3.175   18.154  1.00 37.02  ? 628  ILE A CA    1 
ATOM   2561 C C     . ILE A 1 331 ? -23.236 3.509   16.662  1.00 37.00  ? 628  ILE A C     1 
ATOM   2562 O O     . ILE A 1 331 ? -23.126 4.655   16.275  1.00 33.61  ? 628  ILE A O     1 
ATOM   2563 C CB    . ILE A 1 331 ? -21.716 3.187   18.620  1.00 35.38  ? 628  ILE A CB    1 
ATOM   2564 C CG1   . ILE A 1 331 ? -21.134 4.604   18.568  1.00 38.43  ? 628  ILE A CG1   1 
ATOM   2565 C CG2   . ILE A 1 331 ? -20.842 2.306   17.753  1.00 37.69  ? 628  ILE A CG2   1 
ATOM   2566 C CD1   . ILE A 1 331 ? -19.819 4.755   19.301  1.00 40.42  ? 628  ILE A CD1   1 
ATOM   2567 N N     . ARG A 1 332 ? -23.300 2.486   15.838  1.00 38.46  ? 629  ARG A N     1 
ATOM   2568 C CA    . ARG A 1 332 ? -23.153 2.643   14.398  1.00 42.87  ? 629  ARG A CA    1 
ATOM   2569 C C     . ARG A 1 332 ? -24.310 3.404   13.721  1.00 39.32  ? 629  ARG A C     1 
ATOM   2570 O O     . ARG A 1 332 ? -24.074 4.206   12.884  1.00 40.29  ? 629  ARG A O     1 
ATOM   2571 C CB    . ARG A 1 332 ? -23.023 1.272   13.771  1.00 49.07  ? 629  ARG A CB    1 
ATOM   2572 C CG    . ARG A 1 332 ? -22.200 1.241   12.524  1.00 55.65  ? 629  ARG A CG    1 
ATOM   2573 C CD    . ARG A 1 332 ? -22.130 -0.174  11.952  1.00 64.24  ? 629  ARG A CD    1 
ATOM   2574 N NE    . ARG A 1 332 ? -23.196 -0.330  10.990  1.00 72.89  ? 629  ARG A NE    1 
ATOM   2575 C CZ    . ARG A 1 332 ? -24.427 -0.781  11.248  1.00 81.19  ? 629  ARG A CZ    1 
ATOM   2576 N NH1   . ARG A 1 332 ? -24.803 -1.200  12.483  1.00 77.81  ? 629  ARG A NH1   1 
ATOM   2577 N NH2   . ARG A 1 332 ? -25.292 -0.822  10.233  1.00 66.87  ? 629  ARG A NH2   1 
ATOM   2578 N N     . LEU A 1 333 ? -25.541 3.084   14.071  1.00 34.28  ? 630  LEU A N     1 
ATOM   2579 C CA    . LEU A 1 333 ? -26.730 3.784   13.575  1.00 35.48  ? 630  LEU A CA    1 
ATOM   2580 C C     . LEU A 1 333 ? -27.218 4.676   14.707  1.00 35.68  ? 630  LEU A C     1 
ATOM   2581 O O     . LEU A 1 333 ? -27.256 4.272   15.878  1.00 33.40  ? 630  LEU A O     1 
ATOM   2582 C CB    . LEU A 1 333 ? -27.813 2.798   13.198  1.00 36.15  ? 630  LEU A CB    1 
ATOM   2583 C CG    . LEU A 1 333 ? -27.410 1.750   12.123  1.00 42.00  ? 630  LEU A CG    1 
ATOM   2584 C CD1   . LEU A 1 333 ? -28.584 0.759   11.998  1.00 43.83  ? 630  LEU A CD1   1 
ATOM   2585 C CD2   . LEU A 1 333 ? -27.048 2.432   10.796  1.00 39.27  ? 630  LEU A CD2   1 
ATOM   2586 N N     . GLU A 1 334 ? -27.575 5.887   14.340  1.00 34.00  ? 631  GLU A N     1 
ATOM   2587 C CA    . GLU A 1 334 ? -27.990 6.929   15.268  1.00 36.49  ? 631  GLU A CA    1 
ATOM   2588 C C     . GLU A 1 334 ? -29.132 6.530   16.178  1.00 37.01  ? 631  GLU A C     1 
ATOM   2589 O O     . GLU A 1 334 ? -29.100 6.848   17.378  1.00 36.36  ? 631  GLU A O     1 
ATOM   2590 C CB    . GLU A 1 334 ? -28.318 8.190   14.480  1.00 40.32  ? 631  GLU A CB    1 
ATOM   2591 C CG    . GLU A 1 334 ? -28.755 9.430   15.291  1.00 40.69  ? 631  GLU A CG    1 
ATOM   2592 C CD    . GLU A 1 334 ? -27.771 9.824   16.393  1.00 41.01  ? 631  GLU A CD    1 
ATOM   2593 O OE1   . GLU A 1 334 ? -26.531 9.728   16.174  1.00 45.86  ? 631  GLU A OE1   1 
ATOM   2594 O OE2   . GLU A 1 334 ? -28.228 10.216  17.485  1.00 46.26  ? 631  GLU A OE2   1 
ATOM   2595 N N     . GLU A 1 335 ? -30.115 5.816   15.645  1.00 38.08  ? 632  GLU A N     1 
ATOM   2596 C CA    . GLU A 1 335 ? -31.274 5.418   16.448  1.00 39.47  ? 632  GLU A CA    1 
ATOM   2597 C C     . GLU A 1 335 ? -30.823 4.526   17.579  1.00 42.40  ? 632  GLU A C     1 
ATOM   2598 O O     . GLU A 1 335 ? -31.269 4.680   18.709  1.00 42.87  ? 632  GLU A O     1 
ATOM   2599 C CB    . GLU A 1 335 ? -32.356 4.751   15.595  1.00 37.11  ? 632  GLU A CB    1 
ATOM   2600 N N     . GLY A 1 336 ? -29.889 3.624   17.292  1.00 37.07  ? 633  GLY A N     1 
ATOM   2601 C CA    . GLY A 1 336 ? -29.356 2.744   18.317  1.00 36.89  ? 633  GLY A CA    1 
ATOM   2602 C C     . GLY A 1 336 ? -28.431 3.470   19.296  1.00 33.39  ? 633  GLY A C     1 
ATOM   2603 O O     . GLY A 1 336 ? -28.433 3.179   20.465  1.00 32.47  ? 633  GLY A O     1 
ATOM   2604 N N     . ARG A 1 337 ? -27.644 4.382   18.759  1.00 29.81  ? 634  ARG A N     1 
ATOM   2605 C CA    . ARG A 1 337 ? -26.623 5.102   19.489  1.00 32.90  ? 634  ARG A CA    1 
ATOM   2606 C C     . ARG A 1 337 ? -27.222 5.886   20.622  1.00 29.65  ? 634  ARG A C     1 
ATOM   2607 O O     . ARG A 1 337 ? -26.625 6.060   21.678  1.00 28.11  ? 634  ARG A O     1 
ATOM   2608 C CB    . ARG A 1 337 ? -25.904 6.062   18.523  1.00 33.25  ? 634  ARG A CB    1 
ATOM   2609 C CG    . ARG A 1 337 ? -24.706 6.801   19.048  1.00 36.68  ? 634  ARG A CG    1 
ATOM   2610 C CD    . ARG A 1 337 ? -24.064 7.607   17.876  1.00 41.33  ? 634  ARG A CD    1 
ATOM   2611 N NE    . ARG A 1 337 ? -22.829 8.280   18.283  1.00 57.56  ? 634  ARG A NE    1 
ATOM   2612 C CZ    . ARG A 1 337 ? -21.690 8.373   17.560  1.00 72.77  ? 634  ARG A CZ    1 
ATOM   2613 N NH1   . ARG A 1 337 ? -21.583 7.853   16.331  1.00 76.64  ? 634  ARG A NH1   1 
ATOM   2614 N NH2   . ARG A 1 337 ? -20.620 8.998   18.076  1.00 66.22  ? 634  ARG A NH2   1 
ATOM   2615 N N     . LYS A 1 338 ? -28.428 6.348   20.429  1.00 28.91  ? 635  LYS A N     1 
ATOM   2616 C CA    . LYS A 1 338 ? -29.128 7.076   21.497  1.00 33.49  ? 635  LYS A CA    1 
ATOM   2617 C C     . LYS A 1 338 ? -29.311 6.309   22.811  1.00 33.48  ? 635  LYS A C     1 
ATOM   2618 O O     . LYS A 1 338 ? -29.537 6.910   23.844  1.00 31.94  ? 635  LYS A O     1 
ATOM   2619 C CB    . LYS A 1 338 ? -30.497 7.537   20.991  1.00 36.00  ? 635  LYS A CB    1 
ATOM   2620 C CG    . LYS A 1 338 ? -30.368 8.613   19.907  1.00 43.29  ? 635  LYS A CG    1 
ATOM   2621 C CD    . LYS A 1 338 ? -31.578 9.532   19.864  1.00 55.32  ? 635  LYS A CD    1 
ATOM   2622 C CE    . LYS A 1 338 ? -31.226 10.936  19.374  1.00 59.27  ? 635  LYS A CE    1 
ATOM   2623 N NZ    . LYS A 1 338 ? -30.864 10.981  17.933  1.00 57.93  ? 635  LYS A NZ    1 
ATOM   2624 N N     . ILE A 1 339 ? -29.231 4.994   22.762  1.00 31.95  ? 636  ILE A N     1 
ATOM   2625 C CA    . ILE A 1 339 ? -29.211 4.173   23.990  1.00 33.79  ? 636  ILE A CA    1 
ATOM   2626 C C     . ILE A 1 339 ? -28.130 4.677   24.951  1.00 30.23  ? 636  ILE A C     1 
ATOM   2627 O O     . ILE A 1 339 ? -28.309 4.655   26.154  1.00 28.32  ? 636  ILE A O     1 
ATOM   2628 C CB    . ILE A 1 339 ? -28.932 2.682   23.675  1.00 36.61  ? 636  ILE A CB    1 
ATOM   2629 C CG1   . ILE A 1 339 ? -30.067 2.047   22.835  1.00 43.72  ? 636  ILE A CG1   1 
ATOM   2630 C CG2   . ILE A 1 339 ? -28.741 1.863   24.929  1.00 38.13  ? 636  ILE A CG2   1 
ATOM   2631 C CD1   . ILE A 1 339 ? -31.382 1.914   23.554  1.00 46.73  ? 636  ILE A CD1   1 
ATOM   2632 N N     . ARG A 1 340 ? -27.035 5.183   24.412  1.00 30.72  ? 637  ARG A N     1 
ATOM   2633 C CA    . ARG A 1 340 ? -25.917 5.640   25.221  1.00 29.14  ? 637  ARG A CA    1 
ATOM   2634 C C     . ARG A 1 340 ? -26.234 6.865   26.013  1.00 28.13  ? 637  ARG A C     1 
ATOM   2635 O O     . ARG A 1 340 ? -25.483 7.219   26.935  1.00 27.40  ? 637  ARG A O     1 
ATOM   2636 C CB    . ARG A 1 340 ? -24.696 5.881   24.334  1.00 31.53  ? 637  ARG A CB    1 
ATOM   2637 C CG    . ARG A 1 340 ? -24.161 4.565   23.779  1.00 30.58  ? 637  ARG A CG    1 
ATOM   2638 C CD    . ARG A 1 340 ? -22.948 4.820   22.928  1.00 34.13  ? 637  ARG A CD    1 
ATOM   2639 N NE    . ARG A 1 340 ? -22.409 3.583   22.464  1.00 35.16  ? 637  ARG A NE    1 
ATOM   2640 C CZ    . ARG A 1 340 ? -21.122 3.218   22.412  1.00 33.57  ? 637  ARG A CZ    1 
ATOM   2641 N NH1   . ARG A 1 340 ? -20.134 3.993   22.828  1.00 28.45  ? 637  ARG A NH1   1 
ATOM   2642 N NH2   . ARG A 1 340 ? -20.874 2.005   21.988  1.00 32.00  ? 637  ARG A NH2   1 
ATOM   2643 N N     . GLN A 1 341 ? -27.290 7.571   25.640  1.00 27.34  ? 638  GLN A N     1 
ATOM   2644 C CA    . GLN A 1 341 ? -27.765 8.675   26.462  1.00 28.77  ? 638  GLN A CA    1 
ATOM   2645 C C     . GLN A 1 341 ? -28.195 8.248   27.866  1.00 31.35  ? 638  GLN A C     1 
ATOM   2646 O O     . GLN A 1 341 ? -28.297 9.074   28.766  1.00 30.88  ? 638  GLN A O     1 
ATOM   2647 C CB    . GLN A 1 341 ? -28.918 9.436   25.809  1.00 30.58  ? 638  GLN A CB    1 
ATOM   2648 C CG    . GLN A 1 341 ? -28.517 10.151  24.584  1.00 32.56  ? 638  GLN A CG    1 
ATOM   2649 C CD    . GLN A 1 341 ? -29.697 10.702  23.822  1.00 39.55  ? 638  GLN A CD    1 
ATOM   2650 O OE1   . GLN A 1 341 ? -30.818 10.317  24.050  1.00 45.14  ? 638  GLN A OE1   1 
ATOM   2651 N NE2   . GLN A 1 341 ? -29.424 11.556  22.875  1.00 48.01  ? 638  GLN A NE2   1 
ATOM   2652 N N     . ALA A 1 342 ? -28.447 6.961   28.053  1.00 28.60  ? 639  ALA A N     1 
ATOM   2653 C CA    . ALA A 1 342 ? -28.910 6.465   29.345  1.00 30.34  ? 639  ALA A CA    1 
ATOM   2654 C C     . ALA A 1 342 ? -27.774 6.100   30.290  1.00 27.91  ? 639  ALA A C     1 
ATOM   2655 O O     . ALA A 1 342 ? -28.017 5.762   31.435  1.00 29.23  ? 639  ALA A O     1 
ATOM   2656 C CB    . ALA A 1 342 ? -29.794 5.277   29.107  1.00 33.89  ? 639  ALA A CB    1 
ATOM   2657 N N     . PHE A 1 343 ? -26.540 6.141   29.800  1.00 26.22  ? 640  PHE A N     1 
ATOM   2658 C CA    . PHE A 1 343 ? -25.361 5.883   30.638  1.00 24.70  ? 640  PHE A CA    1 
ATOM   2659 C C     . PHE A 1 343 ? -24.758 7.181   31.115  1.00 24.89  ? 640  PHE A C     1 
ATOM   2660 O O     . PHE A 1 343 ? -24.313 8.002   30.302  1.00 26.17  ? 640  PHE A O     1 
ATOM   2661 C CB    . PHE A 1 343 ? -24.343 5.024   29.913  1.00 25.24  ? 640  PHE A CB    1 
ATOM   2662 C CG    . PHE A 1 343 ? -24.817 3.625   29.640  1.00 27.99  ? 640  PHE A CG    1 
ATOM   2663 C CD1   . PHE A 1 343 ? -25.613 3.342   28.524  1.00 31.25  ? 640  PHE A CD1   1 
ATOM   2664 C CD2   . PHE A 1 343 ? -24.507 2.595   30.478  1.00 29.29  ? 640  PHE A CD2   1 
ATOM   2665 C CE1   . PHE A 1 343 ? -26.055 2.042   28.283  1.00 31.73  ? 640  PHE A CE1   1 
ATOM   2666 C CE2   . PHE A 1 343 ? -24.931 1.295   30.247  1.00 29.49  ? 640  PHE A CE2   1 
ATOM   2667 C CZ    . PHE A 1 343 ? -25.703 1.019   29.124  1.00 31.01  ? 640  PHE A CZ    1 
ATOM   2668 N N     . VAL A 1 344 ? -24.789 7.396   32.440  1.00 25.55  ? 641  VAL A N     1 
ATOM   2669 C CA    . VAL A 1 344 ? -24.567 8.723   32.947  1.00 24.73  ? 641  VAL A CA    1 
ATOM   2670 C C     . VAL A 1 344 ? -23.530 8.659   34.028  1.00 24.23  ? 641  VAL A C     1 
ATOM   2671 O O     . VAL A 1 344 ? -23.300 7.588   34.577  1.00 24.82  ? 641  VAL A O     1 
ATOM   2672 C CB    . VAL A 1 344 ? -25.868 9.403   33.444  1.00 25.49  ? 641  VAL A CB    1 
ATOM   2673 C CG1   . VAL A 1 344 ? -26.901 9.460   32.324  1.00 27.05  ? 641  VAL A CG1   1 
ATOM   2674 C CG2   . VAL A 1 344 ? -26.449 8.674   34.643  1.00 25.95  ? 641  VAL A CG2   1 
ATOM   2675 N N     . PRO A 1 345 ? -22.922 9.806   34.383  1.00 24.13  ? 642  PRO A N     1 
ATOM   2676 C CA    . PRO A 1 345 ? -22.028 9.793   35.576  1.00 25.31  ? 642  PRO A CA    1 
ATOM   2677 C C     . PRO A 1 345 ? -22.795 9.481   36.884  1.00 26.20  ? 642  PRO A C     1 
ATOM   2678 O O     . PRO A 1 345 ? -23.961 9.732   36.968  1.00 25.64  ? 642  PRO A O     1 
ATOM   2679 C CB    . PRO A 1 345 ? -21.470 11.203  35.600  1.00 25.40  ? 642  PRO A CB    1 
ATOM   2680 C CG    . PRO A 1 345 ? -21.763 11.788  34.290  1.00 23.93  ? 642  PRO A CG    1 
ATOM   2681 C CD    . PRO A 1 345 ? -23.031 11.163  33.822  1.00 25.89  ? 642  PRO A CD    1 
ATOM   2682 N N     . SER A 1 346 ? -22.117 8.883   37.858  1.00 28.13  ? 643  SER A N     1 
ATOM   2683 C CA    . SER A 1 346 ? -22.725 8.383   39.056  1.00 29.73  ? 643  SER A CA    1 
ATOM   2684 C C     . SER A 1 346 ? -22.811 9.491   40.148  1.00 28.73  ? 643  SER A C     1 
ATOM   2685 O O     . SER A 1 346 ? -23.415 9.260   41.158  1.00 31.16  ? 643  SER A O     1 
ATOM   2686 C CB    . SER A 1 346 ? -21.919 7.217   39.592  1.00 26.76  ? 643  SER A CB    1 
ATOM   2687 O OG    . SER A 1 346 ? -20.644 7.632   40.070  1.00 30.28  ? 643  SER A OG    1 
ATOM   2688 N N     . GLU A 1 347 ? -22.242 10.672  39.910  1.00 27.80  ? 644  GLU A N     1 
ATOM   2689 C CA    . GLU A 1 347 ? -22.376 11.794  40.876  1.00 32.51  ? 644  GLU A CA    1 
ATOM   2690 C C     . GLU A 1 347 ? -22.692 13.051  40.129  1.00 32.97  ? 644  GLU A C     1 
ATOM   2691 O O     . GLU A 1 347 ? -22.383 13.240  38.940  1.00 27.34  ? 644  GLU A O     1 
ATOM   2692 C CB    . GLU A 1 347 ? -21.100 11.973  41.715  1.00 38.05  ? 644  GLU A CB    1 
ATOM   2693 C CG    . GLU A 1 347 ? -20.591 10.667  42.235  1.00 45.67  ? 644  GLU A CG    1 
ATOM   2694 C CD    . GLU A 1 347 ? -19.561 10.745  43.300  1.00 54.24  ? 644  GLU A CD    1 
ATOM   2695 O OE1   . GLU A 1 347 ? -19.416 11.809  43.953  1.00 73.34  ? 644  GLU A OE1   1 
ATOM   2696 O OE2   . GLU A 1 347 ? -18.890 9.707   43.478  1.00 64.52  ? 644  GLU A OE2   1 
ATOM   2697 N N     . SER A 1 348 ? -23.295 13.976  40.824  1.00 35.65  ? 645  SER A N     1 
ATOM   2698 C CA    . SER A 1 348 ? -23.689 15.200  40.155  1.00 36.30  ? 645  SER A CA    1 
ATOM   2699 C C     . SER A 1 348 ? -22.453 16.061  39.839  1.00 29.91  ? 645  SER A C     1 
ATOM   2700 O O     . SER A 1 348 ? -21.436 16.046  40.568  1.00 30.94  ? 645  SER A O     1 
ATOM   2701 C CB    . SER A 1 348 ? -24.760 15.963  41.013  1.00 41.83  ? 645  SER A CB    1 
ATOM   2702 O OG    . SER A 1 348 ? -24.321 16.013  42.308  1.00 47.30  ? 645  SER A OG    1 
ATOM   2703 N N     . ASP A 1 349 ? -22.508 16.782  38.737  1.00 29.52  ? 646  ASP A N     1 
ATOM   2704 C CA    . ASP A 1 349 ? -21.337 17.590  38.283  1.00 32.74  ? 646  ASP A CA    1 
ATOM   2705 C C     . ASP A 1 349 ? -20.104 16.768  37.866  1.00 35.12  ? 646  ASP A C     1 
ATOM   2706 O O     . ASP A 1 349 ? -18.960 17.274  37.941  1.00 30.05  ? 646  ASP A O     1 
ATOM   2707 C CB    . ASP A 1 349 ? -20.917 18.617  39.356  1.00 34.42  ? 646  ASP A CB    1 
ATOM   2708 C CG    . ASP A 1 349 ? -22.097 19.522  39.778  1.00 45.45  ? 646  ASP A CG    1 
ATOM   2709 O OD1   . ASP A 1 349 ? -22.701 20.153  38.882  1.00 45.91  ? 646  ASP A OD1   1 
ATOM   2710 O OD2   . ASP A 1 349 ? -22.444 19.530  40.989  1.00 53.41  ? 646  ASP A OD2   1 
ATOM   2711 N N     . TRP A 1 350 ? -20.327 15.486  37.558  1.00 32.09  ? 647  TRP A N     1 
ATOM   2712 C CA    . TRP A 1 350 ? -19.296 14.638  36.998  1.00 27.98  ? 647  TRP A CA    1 
ATOM   2713 C C     . TRP A 1 350 ? -19.645 14.495  35.533  1.00 26.95  ? 647  TRP A C     1 
ATOM   2714 O O     . TRP A 1 350 ? -20.779 14.765  35.080  1.00 26.29  ? 647  TRP A O     1 
ATOM   2715 C CB    . TRP A 1 350 ? -19.190 13.279  37.721  1.00 26.53  ? 647  TRP A CB    1 
ATOM   2716 C CG    . TRP A 1 350 ? -18.492 13.278  39.009  1.00 25.68  ? 647  TRP A CG    1 
ATOM   2717 C CD1   . TRP A 1 350 ? -18.552 14.286  40.009  1.00 30.31  ? 647  TRP A CD1   1 
ATOM   2718 C CD2   . TRP A 1 350 ? -17.598 12.285  39.534  1.00 25.16  ? 647  TRP A CD2   1 
ATOM   2719 N NE1   . TRP A 1 350 ? -17.770 13.931  41.036  1.00 26.83  ? 647  TRP A NE1   1 
ATOM   2720 C CE2   . TRP A 1 350 ? -17.165 12.730  40.783  1.00 26.80  ? 647  TRP A CE2   1 
ATOM   2721 C CE3   . TRP A 1 350 ? -17.074 11.070  39.028  1.00 27.61  ? 647  TRP A CE3   1 
ATOM   2722 C CZ2   . TRP A 1 350 ? -16.268 11.993  41.573  1.00 30.44  ? 647  TRP A CZ2   1 
ATOM   2723 C CZ3   . TRP A 1 350 ? -16.230 10.357  39.779  1.00 27.64  ? 647  TRP A CZ3   1 
ATOM   2724 C CH2   . TRP A 1 350 ? -15.808 10.806  41.061  1.00 28.30  ? 647  TRP A CH2   1 
ATOM   2725 N N     . LEU A 1 351 ? -18.648 14.141  34.741  1.00 24.46  ? 648  LEU A N     1 
ATOM   2726 C CA    . LEU A 1 351 ? -18.824 13.897  33.327  1.00 25.02  ? 648  LEU A CA    1 
ATOM   2727 C C     . LEU A 1 351 ? -18.239 12.526  32.903  1.00 24.66  ? 648  LEU A C     1 
ATOM   2728 O O     . LEU A 1 351 ? -17.412 11.978  33.632  1.00 25.35  ? 648  LEU A O     1 
ATOM   2729 C CB    . LEU A 1 351 ? -18.126 15.036  32.556  1.00 26.90  ? 648  LEU A CB    1 
ATOM   2730 C CG    . LEU A 1 351 ? -18.762 16.456  32.733  1.00 28.99  ? 648  LEU A CG    1 
ATOM   2731 C CD1   . LEU A 1 351 ? -17.887 17.512  31.988  1.00 31.00  ? 648  LEU A CD1   1 
ATOM   2732 C CD2   . LEU A 1 351 ? -20.175 16.527  32.206  1.00 30.34  ? 648  LEU A CD2   1 
ATOM   2733 N N     . ILE A 1 352 ? -18.675 12.009  31.745  1.00 23.13  ? 649  ILE A N     1 
ATOM   2734 C CA    . ILE A 1 352 ? -18.113 10.829  31.124  1.00 24.48  ? 649  ILE A CA    1 
ATOM   2735 C C     . ILE A 1 352 ? -16.965 11.267  30.175  1.00 25.39  ? 649  ILE A C     1 
ATOM   2736 O O     . ILE A 1 352 ? -17.124 12.172  29.397  1.00 26.91  ? 649  ILE A O     1 
ATOM   2737 C CB    . ILE A 1 352 ? -19.166 10.062  30.334  1.00 25.83  ? 649  ILE A CB    1 
ATOM   2738 C CG1   . ILE A 1 352 ? -20.377 9.650   31.232  1.00 25.44  ? 649  ILE A CG1   1 
ATOM   2739 C CG2   . ILE A 1 352 ? -18.563 8.858   29.637  1.00 27.97  ? 649  ILE A CG2   1 
ATOM   2740 C CD1   . ILE A 1 352 ? -20.031 8.846   32.455  1.00 25.22  ? 649  ILE A CD1   1 
ATOM   2741 N N     . PHE A 1 353 ? -15.819 10.607  30.299  1.00 26.02  ? 650  PHE A N     1 
ATOM   2742 C CA    . PHE A 1 353 ? -14.626 10.813  29.476  1.00 26.15  ? 650  PHE A CA    1 
ATOM   2743 C C     . PHE A 1 353 ? -14.287 9.478   28.793  1.00 24.94  ? 650  PHE A C     1 
ATOM   2744 O O     . PHE A 1 353 ? -14.179 8.474   29.474  1.00 22.14  ? 650  PHE A O     1 
ATOM   2745 C CB    . PHE A 1 353 ? -13.466 11.235  30.392  1.00 24.31  ? 650  PHE A CB    1 
ATOM   2746 C CG    . PHE A 1 353 ? -12.208 11.554  29.661  1.00 23.03  ? 650  PHE A CG    1 
ATOM   2747 C CD1   . PHE A 1 353 ? -11.373 10.576  29.272  1.00 23.70  ? 650  PHE A CD1   1 
ATOM   2748 C CD2   . PHE A 1 353 ? -11.871 12.856  29.360  1.00 27.64  ? 650  PHE A CD2   1 
ATOM   2749 C CE1   . PHE A 1 353 ? -10.171 10.888  28.578  1.00 23.83  ? 650  PHE A CE1   1 
ATOM   2750 C CE2   . PHE A 1 353 ? -10.738 13.167  28.632  1.00 26.38  ? 650  PHE A CE2   1 
ATOM   2751 C CZ    . PHE A 1 353 ? -9.862  12.167  28.264  1.00 24.30  ? 650  PHE A CZ    1 
ATOM   2752 N N     . ALA A 1 354 ? -14.091 9.491   27.484  1.00 23.77  ? 651  ALA A N     1 
ATOM   2753 C CA    . ALA A 1 354 ? -13.783 8.305   26.704  1.00 24.99  ? 651  ALA A CA    1 
ATOM   2754 C C     . ALA A 1 354 ? -12.559 8.585   25.821  1.00 26.90  ? 651  ALA A C     1 
ATOM   2755 O O     . ALA A 1 354 ? -12.498 9.586   25.126  1.00 26.35  ? 651  ALA A O     1 
ATOM   2756 C CB    . ALA A 1 354 ? -14.938 7.931   25.858  1.00 25.11  ? 651  ALA A CB    1 
ATOM   2757 N N     . ALA A 1 355 ? -11.570 7.703   25.892  1.00 24.29  ? 652  ALA A N     1 
ATOM   2758 C CA    . ALA A 1 355 ? -10.368 7.811   25.101  1.00 23.14  ? 652  ALA A CA    1 
ATOM   2759 C C     . ALA A 1 355 ? -10.212 6.531   24.326  1.00 25.05  ? 652  ALA A C     1 
ATOM   2760 O O     . ALA A 1 355 ? -10.348 5.418   24.890  1.00 25.61  ? 652  ALA A O     1 
ATOM   2761 C CB    . ALA A 1 355 ? -9.156  8.085   25.960  1.00 23.16  ? 652  ALA A CB    1 
ATOM   2762 N N     . ASP A 1 356 ? -9.862  6.656   23.043  1.00 22.75  ? 653  ASP A N     1 
ATOM   2763 C CA    . ASP A 1 356 ? -9.726  5.477   22.182  1.00 23.78  ? 653  ASP A CA    1 
ATOM   2764 C C     . ASP A 1 356 ? -8.485  5.550   21.285  1.00 23.23  ? 653  ASP A C     1 
ATOM   2765 O O     . ASP A 1 356 ? -8.162  6.623   20.730  1.00 24.18  ? 653  ASP A O     1 
ATOM   2766 C CB    . ASP A 1 356 ? -10.995 5.314   21.335  1.00 25.38  ? 653  ASP A CB    1 
ATOM   2767 C CG    . ASP A 1 356 ? -11.100 6.385   20.266  1.00 33.07  ? 653  ASP A CG    1 
ATOM   2768 O OD1   . ASP A 1 356 ? -11.341 7.530   20.641  1.00 33.36  ? 653  ASP A OD1   1 
ATOM   2769 O OD2   . ASP A 1 356 ? -10.866 6.085   19.063  1.00 37.82  ? 653  ASP A OD2   1 
ATOM   2770 N N     . TYR A 1 357 ? -7.811  4.429   21.120  1.00 20.17  ? 654  TYR A N     1 
ATOM   2771 C CA    . TYR A 1 357 ? -6.721  4.344   20.153  1.00 22.53  ? 654  TYR A CA    1 
ATOM   2772 C C     . TYR A 1 357 ? -7.254  4.438   18.749  1.00 24.25  ? 654  TYR A C     1 
ATOM   2773 O O     . TYR A 1 357 ? -8.267  3.817   18.393  1.00 23.15  ? 654  TYR A O     1 
ATOM   2774 C CB    . TYR A 1 357 ? -5.983  3.025   20.241  1.00 24.06  ? 654  TYR A CB    1 
ATOM   2775 C CG    . TYR A 1 357 ? -5.187  2.824   21.527  1.00 23.90  ? 654  TYR A CG    1 
ATOM   2776 C CD1   . TYR A 1 357 ? -3.938  3.378   21.655  1.00 22.83  ? 654  TYR A CD1   1 
ATOM   2777 C CD2   . TYR A 1 357 ? -5.674  2.034   22.573  1.00 23.41  ? 654  TYR A CD2   1 
ATOM   2778 C CE1   . TYR A 1 357 ? -3.162  3.203   22.796  1.00 24.62  ? 654  TYR A CE1   1 
ATOM   2779 C CE2   . TYR A 1 357 ? -4.908  1.889   23.761  1.00 25.23  ? 654  TYR A CE2   1 
ATOM   2780 C CZ    . TYR A 1 357 ? -3.651  2.471   23.850  1.00 24.44  ? 654  TYR A CZ    1 
ATOM   2781 O OH    . TYR A 1 357 ? -2.869  2.319   24.961  1.00 23.25  ? 654  TYR A OH    1 
ATOM   2782 N N     . SER A 1 358 ? -6.510  5.164   17.923  1.00 23.50  ? 655  SER A N     1 
ATOM   2783 C CA    . SER A 1 358 ? -6.768  5.278   16.540  1.00 23.72  ? 655  SER A CA    1 
ATOM   2784 C C     . SER A 1 358 ? -5.972  4.215   15.794  1.00 24.70  ? 655  SER A C     1 
ATOM   2785 O O     . SER A 1 358 ? -4.715  4.249   15.752  1.00 23.05  ? 655  SER A O     1 
ATOM   2786 C CB    . SER A 1 358 ? -6.391  6.682   16.048  1.00 24.88  ? 655  SER A CB    1 
ATOM   2787 O OG    . SER A 1 358 ? -6.740  6.779   14.691  1.00 27.94  ? 655  SER A OG    1 
ATOM   2788 N N     . GLN A 1 359 ? -6.723  3.303   15.171  1.00 24.09  ? 656  GLN A N     1 
ATOM   2789 C CA    . GLN A 1 359 ? -6.162  2.212   14.323  1.00 25.29  ? 656  GLN A CA    1 
ATOM   2790 C C     . GLN A 1 359 ? -5.059  1.432   15.031  1.00 23.08  ? 656  GLN A C     1 
ATOM   2791 O O     . GLN A 1 359 ? -3.950  1.241   14.478  1.00 22.41  ? 656  GLN A O     1 
ATOM   2792 C CB    . GLN A 1 359 ? -5.590  2.818   13.049  1.00 26.08  ? 656  GLN A CB    1 
ATOM   2793 C CG    . GLN A 1 359 ? -6.620  3.533   12.165  1.00 25.97  ? 656  GLN A CG    1 
ATOM   2794 C CD    . GLN A 1 359 ? -7.768  2.624   11.687  1.00 29.40  ? 656  GLN A CD    1 
ATOM   2795 O OE1   . GLN A 1 359 ? -7.612  1.456   11.542  1.00 34.37  ? 656  GLN A OE1   1 
ATOM   2796 N NE2   . GLN A 1 359 ? -8.927  3.184   11.473  1.00 32.00  ? 656  GLN A NE2   1 
ATOM   2797 N N     . ILE A 1 360 ? -5.321  1.008   16.266  1.00 22.91  ? 657  ILE A N     1 
ATOM   2798 C CA    . ILE A 1 360 ? -4.262  0.291   17.007  1.00 23.85  ? 657  ILE A CA    1 
ATOM   2799 C C     . ILE A 1 360 ? -3.814  -0.988  16.258  1.00 22.97  ? 657  ILE A C     1 
ATOM   2800 O O     . ILE A 1 360 ? -2.607  -1.293  16.158  1.00 20.77  ? 657  ILE A O     1 
ATOM   2801 C CB    . ILE A 1 360 ? -4.586  0.021   18.477  1.00 25.67  ? 657  ILE A CB    1 
ATOM   2802 C CG1   . ILE A 1 360 ? -3.283  -0.381  19.234  1.00 26.18  ? 657  ILE A CG1   1 
ATOM   2803 C CG2   . ILE A 1 360 ? -5.757  -0.944  18.636  1.00 26.88  ? 657  ILE A CG2   1 
ATOM   2804 C CD1   . ILE A 1 360 ? -3.460  -0.474  20.731  1.00 30.43  ? 657  ILE A CD1   1 
ATOM   2805 N N     . GLU A 1 361 ? -4.756  -1.698  15.666  1.00 24.13  ? 658  GLU A N     1 
ATOM   2806 C CA    . GLU A 1 361 ? -4.402  -2.991  15.069  1.00 22.44  ? 658  GLU A CA    1 
ATOM   2807 C C     . GLU A 1 361 ? -3.509  -2.797  13.851  1.00 23.57  ? 658  GLU A C     1 
ATOM   2808 O O     . GLU A 1 361 ? -2.581  -3.524  13.676  1.00 23.63  ? 658  GLU A O     1 
ATOM   2809 C CB    . GLU A 1 361 ? -5.634  -3.768  14.694  1.00 25.06  ? 658  GLU A CB    1 
ATOM   2810 C CG    . GLU A 1 361 ? -6.463  -4.318  15.883  1.00 29.89  ? 658  GLU A CG    1 
ATOM   2811 C CD    . GLU A 1 361 ? -7.618  -5.277  15.406  1.00 43.39  ? 658  GLU A CD    1 
ATOM   2812 O OE1   . GLU A 1 361 ? -8.298  -4.979  14.366  1.00 49.81  ? 658  GLU A OE1   1 
ATOM   2813 O OE2   . GLU A 1 361 ? -7.855  -6.349  16.047  1.00 52.02  ? 658  GLU A OE2   1 
ATOM   2814 N N     . LEU A 1 362 ? -3.791  -1.800  13.000  1.00 23.00  ? 659  LEU A N     1 
ATOM   2815 C CA    . LEU A 1 362 ? -2.929  -1.535  11.872  1.00 21.90  ? 659  LEU A CA    1 
ATOM   2816 C C     . LEU A 1 362 ? -1.594  -0.977  12.261  1.00 22.73  ? 659  LEU A C     1 
ATOM   2817 O O     . LEU A 1 362 ? -0.619  -1.267  11.613  1.00 23.26  ? 659  LEU A O     1 
ATOM   2818 C CB    . LEU A 1 362 ? -3.640  -0.721  10.794  1.00 23.80  ? 659  LEU A CB    1 
ATOM   2819 C CG    . LEU A 1 362 ? -4.679  -1.457  9.977   1.00 25.78  ? 659  LEU A CG    1 
ATOM   2820 C CD1   . LEU A 1 362 ? -5.556  -0.477  9.194   1.00 30.08  ? 659  LEU A CD1   1 
ATOM   2821 C CD2   . LEU A 1 362 ? -3.976  -2.443  9.049   1.00 24.91  ? 659  LEU A CD2   1 
ATOM   2822 N N     . ARG A 1 363 ? -1.523  -0.177  13.314  1.00 20.94  ? 660  ARG A N     1 
ATOM   2823 C CA    . ARG A 1 363 ? -0.278  0.305   13.786  1.00 22.70  ? 660  ARG A CA    1 
ATOM   2824 C C     . ARG A 1 363 ? 0.601   -0.813  14.379  1.00 23.75  ? 660  ARG A C     1 
ATOM   2825 O O     . ARG A 1 363 ? 1.801   -0.882  14.109  1.00 23.56  ? 660  ARG A O     1 
ATOM   2826 C CB    . ARG A 1 363 ? -0.456  1.426   14.832  1.00 22.28  ? 660  ARG A CB    1 
ATOM   2827 C CG    . ARG A 1 363 ? -0.993  2.731   14.253  1.00 23.72  ? 660  ARG A CG    1 
ATOM   2828 C CD    . ARG A 1 363 ? -1.347  3.761   15.337  1.00 23.78  ? 660  ARG A CD    1 
ATOM   2829 N NE    . ARG A 1 363 ? -2.009  4.881   14.732  1.00 22.52  ? 660  ARG A NE    1 
ATOM   2830 C CZ    . ARG A 1 363 ? -1.461  6.066   14.493  1.00 22.53  ? 660  ARG A CZ    1 
ATOM   2831 N NH1   . ARG A 1 363 ? -0.194  6.336   14.770  1.00 23.72  ? 660  ARG A NH1   1 
ATOM   2832 N NH2   . ARG A 1 363 ? -2.187  6.962   13.898  1.00 24.59  ? 660  ARG A NH2   1 
ATOM   2833 N N     . VAL A 1 364 ? -0.015  -1.711  15.152  1.00 21.71  ? 661  VAL A N     1 
ATOM   2834 C CA    . VAL A 1 364 ? 0.684   -2.936  15.605  1.00 21.38  ? 661  VAL A CA    1 
ATOM   2835 C C     . VAL A 1 364 ? 1.210   -3.767  14.408  1.00 22.21  ? 661  VAL A C     1 
ATOM   2836 O O     . VAL A 1 364 ? 2.317   -4.237  14.429  1.00 20.75  ? 661  VAL A O     1 
ATOM   2837 C CB    . VAL A 1 364 ? -0.252  -3.791  16.502  1.00 20.84  ? 661  VAL A CB    1 
ATOM   2838 C CG1   . VAL A 1 364 ? 0.245   -5.191  16.673  1.00 20.34  ? 661  VAL A CG1   1 
ATOM   2839 C CG2   . VAL A 1 364 ? -0.382  -3.118  17.850  1.00 23.45  ? 661  VAL A CG2   1 
ATOM   2840 N N     . LEU A 1 365 ? 0.393   -3.924  13.392  1.00 22.10  ? 662  LEU A N     1 
ATOM   2841 C CA    . LEU A 1 365 ? 0.787   -4.653  12.211  1.00 24.67  ? 662  LEU A CA    1 
ATOM   2842 C C     . LEU A 1 365 ? 1.992   -3.978  11.515  1.00 23.69  ? 662  LEU A C     1 
ATOM   2843 O O     . LEU A 1 365 ? 2.914   -4.658  11.131  1.00 22.22  ? 662  LEU A O     1 
ATOM   2844 C CB    . LEU A 1 365 ? -0.377  -4.719  11.202  1.00 24.74  ? 662  LEU A CB    1 
ATOM   2845 C CG    . LEU A 1 365 ? 0.014   -5.341  9.841   1.00 24.01  ? 662  LEU A CG    1 
ATOM   2846 C CD1   . LEU A 1 365 ? 0.590   -6.744  10.032  1.00 24.48  ? 662  LEU A CD1   1 
ATOM   2847 C CD2   . LEU A 1 365 ? -1.172  -5.418  8.959   1.00 24.36  ? 662  LEU A CD2   1 
ATOM   2848 N N     . ALA A 1 366 ? 1.953   -2.637  11.392  1.00 20.37  ? 663  ALA A N     1 
ATOM   2849 C CA    . ALA A 1 366 ? 3.045   -1.886  10.871  1.00 23.25  ? 663  ALA A CA    1 
ATOM   2850 C C     . ALA A 1 366 ? 4.324   -2.207  11.643  1.00 24.08  ? 663  ALA A C     1 
ATOM   2851 O O     . ALA A 1 366 ? 5.423   -2.378  11.073  1.00 22.31  ? 663  ALA A O     1 
ATOM   2852 C CB    . ALA A 1 366 ? 2.749   -0.399  10.862  1.00 23.56  ? 663  ALA A CB    1 
ATOM   2853 N N     . HIS A 1 367 ? 4.182   -2.261  12.927  1.00 24.88  ? 664  HIS A N     1 
ATOM   2854 C CA    . HIS A 1 367 ? 5.328   -2.493  13.814  1.00 24.67  ? 664  HIS A CA    1 
ATOM   2855 C C     . HIS A 1 367 ? 5.879   -3.904  13.675  1.00 25.44  ? 664  HIS A C     1 
ATOM   2856 O O     . HIS A 1 367 ? 7.103   -4.093  13.574  1.00 27.05  ? 664  HIS A O     1 
ATOM   2857 C CB    . HIS A 1 367 ? 4.896   -2.301  15.266  1.00 26.11  ? 664  HIS A CB    1 
ATOM   2858 C CG    . HIS A 1 367 ? 5.916   -2.749  16.267  1.00 24.72  ? 664  HIS A CG    1 
ATOM   2859 N ND1   . HIS A 1 367 ? 6.988   -1.973  16.628  1.00 26.87  ? 664  HIS A ND1   1 
ATOM   2860 C CD2   . HIS A 1 367 ? 6.057   -3.915  16.944  1.00 26.17  ? 664  HIS A CD2   1 
ATOM   2861 C CE1   . HIS A 1 367 ? 7.721   -2.598  17.528  1.00 26.78  ? 664  HIS A CE1   1 
ATOM   2862 N NE2   . HIS A 1 367 ? 7.185   -3.796  17.729  1.00 27.30  ? 664  HIS A NE2   1 
ATOM   2863 N N     . ILE A 1 368 ? 5.009   -4.901  13.772  1.00 25.77  ? 665  ILE A N     1 
ATOM   2864 C CA    . ILE A 1 368 ? 5.483   -6.265  13.756  1.00 25.11  ? 665  ILE A CA    1 
ATOM   2865 C C     . ILE A 1 368 ? 6.003   -6.722  12.377  1.00 27.85  ? 665  ILE A C     1 
ATOM   2866 O O     . ILE A 1 368 ? 6.916   -7.523  12.315  1.00 26.11  ? 665  ILE A O     1 
ATOM   2867 C CB    . ILE A 1 368 ? 4.474   -7.286  14.275  1.00 30.14  ? 665  ILE A CB    1 
ATOM   2868 C CG1   . ILE A 1 368 ? 3.271   -7.361  13.378  1.00 36.76  ? 665  ILE A CG1   1 
ATOM   2869 C CG2   . ILE A 1 368 ? 4.058   -6.945  15.729  1.00 27.75  ? 665  ILE A CG2   1 
ATOM   2870 C CD1   . ILE A 1 368 ? 2.104   -8.158  13.995  1.00 41.81  ? 665  ILE A CD1   1 
ATOM   2871 N N     . ALA A 1 369 ? 5.391   -6.252  11.304  1.00 24.82  ? 666  ALA A N     1 
ATOM   2872 C CA    . ALA A 1 369 ? 5.810   -6.595  9.954   1.00 26.17  ? 666  ALA A CA    1 
ATOM   2873 C C     . ALA A 1 369 ? 6.968   -5.746  9.516   1.00 27.51  ? 666  ALA A C     1 
ATOM   2874 O O     . ALA A 1 369 ? 7.616   -6.063  8.568   1.00 28.08  ? 666  ALA A O     1 
ATOM   2875 C CB    . ALA A 1 369 ? 4.640   -6.392  8.987   1.00 29.25  ? 666  ALA A CB    1 
ATOM   2876 N N     . GLU A 1 370 ? 7.170   -4.610  10.149  1.00 29.73  ? 667  GLU A N     1 
ATOM   2877 C CA    . GLU A 1 370 ? 8.130   -3.604  9.746   1.00 31.08  ? 667  GLU A CA    1 
ATOM   2878 C C     . GLU A 1 370 ? 7.954   -3.330  8.285   1.00 34.09  ? 667  GLU A C     1 
ATOM   2879 O O     . GLU A 1 370 ? 8.914   -3.318  7.553   1.00 30.06  ? 667  GLU A O     1 
ATOM   2880 C CB    . GLU A 1 370 ? 9.556   -4.038  10.037  1.00 36.27  ? 667  GLU A CB    1 
ATOM   2881 C CG    . GLU A 1 370 ? 9.730   -4.418  11.495  1.00 37.73  ? 667  GLU A CG    1 
ATOM   2882 C CD    . GLU A 1 370 ? 11.112  -4.994  11.759  1.00 45.61  ? 667  GLU A CD    1 
ATOM   2883 O OE1   . GLU A 1 370 ? 12.107  -4.271  11.575  1.00 47.11  ? 667  GLU A OE1   1 
ATOM   2884 O OE2   . GLU A 1 370 ? 11.198  -6.177  12.109  1.00 45.98  ? 667  GLU A OE2   1 
ATOM   2885 N N     . ASP A 1 371 ? 6.716   -3.077  7.854   1.00 27.73  ? 668  ASP A N     1 
ATOM   2886 C CA    . ASP A 1 371 ? 6.501   -2.700  6.501   1.00 26.70  ? 668  ASP A CA    1 
ATOM   2887 C C     . ASP A 1 371 ? 6.827   -1.182  6.343   1.00 29.44  ? 668  ASP A C     1 
ATOM   2888 O O     . ASP A 1 371 ? 6.281   -0.341  7.044   1.00 25.82  ? 668  ASP A O     1 
ATOM   2889 C CB    . ASP A 1 371 ? 5.078   -2.988  6.132   1.00 29.11  ? 668  ASP A CB    1 
ATOM   2890 C CG    . ASP A 1 371 ? 4.792   -2.702  4.691   1.00 29.33  ? 668  ASP A CG    1 
ATOM   2891 O OD1   . ASP A 1 371 ? 4.558   -1.551  4.324   1.00 29.92  ? 668  ASP A OD1   1 
ATOM   2892 O OD2   . ASP A 1 371 ? 4.818   -3.630  3.888   1.00 37.10  ? 668  ASP A OD2   1 
ATOM   2893 N N     . ASP A 1 372 ? 7.746   -0.841  5.440   1.00 31.53  ? 669  ASP A N     1 
ATOM   2894 C CA    . ASP A 1 372 ? 8.237   0.560   5.276   1.00 30.28  ? 669  ASP A CA    1 
ATOM   2895 C C     . ASP A 1 372 ? 7.124   1.479   4.867   1.00 27.49  ? 669  ASP A C     1 
ATOM   2896 O O     . ASP A 1 372 ? 7.011   2.558   5.387   1.00 28.08  ? 669  ASP A O     1 
ATOM   2897 C CB    . ASP A 1 372 ? 9.356   0.628   4.228   1.00 34.51  ? 669  ASP A CB    1 
ATOM   2898 C CG    . ASP A 1 372 ? 10.653  -0.027  4.705   1.00 41.46  ? 669  ASP A CG    1 
ATOM   2899 O OD1   . ASP A 1 372 ? 10.949  0.022   5.892   1.00 49.00  ? 669  ASP A OD1   1 
ATOM   2900 O OD2   . ASP A 1 372 ? 11.391  -0.570  3.892   1.00 50.23  ? 669  ASP A OD2   1 
ATOM   2901 N N     . ASN A 1 373 ? 6.266   1.015   3.968   1.00 26.13  ? 670  ASN A N     1 
ATOM   2902 C CA    . ASN A 1 373 ? 5.184   1.845   3.465   1.00 29.12  ? 670  ASN A CA    1 
ATOM   2903 C C     . ASN A 1 373 ? 4.141   2.103   4.569   1.00 28.47  ? 670  ASN A C     1 
ATOM   2904 O O     . ASN A 1 373 ? 3.735   3.227   4.800   1.00 24.80  ? 670  ASN A O     1 
ATOM   2905 C CB    . ASN A 1 373 ? 4.587   1.165   2.217   1.00 28.43  ? 670  ASN A CB    1 
ATOM   2906 C CG    . ASN A 1 373 ? 3.545   2.014   1.473   1.00 33.85  ? 670  ASN A CG    1 
ATOM   2907 O OD1   . ASN A 1 373 ? 3.599   3.244   1.413   1.00 35.53  ? 670  ASN A OD1   1 
ATOM   2908 N ND2   . ASN A 1 373 ? 2.623   1.334   0.813   1.00 39.46  ? 670  ASN A ND2   1 
ATOM   2909 N N     . LEU A 1 374 ? 3.707   1.045   5.263   1.00 26.70  ? 671  LEU A N     1 
ATOM   2910 C CA    . LEU A 1 374 ? 2.732   1.181   6.336   1.00 24.65  ? 671  LEU A CA    1 
ATOM   2911 C C     . LEU A 1 374 ? 3.254   2.046   7.471   1.00 24.40  ? 671  LEU A C     1 
ATOM   2912 O O     . LEU A 1 374 ? 2.516   2.805   8.034   1.00 25.14  ? 671  LEU A O     1 
ATOM   2913 C CB    . LEU A 1 374 ? 2.339   -0.206  6.856   1.00 28.15  ? 671  LEU A CB    1 
ATOM   2914 C CG    . LEU A 1 374 ? 1.009   -0.260  7.633   1.00 29.51  ? 671  LEU A CG    1 
ATOM   2915 C CD1   . LEU A 1 374 ? -0.176  0.270   6.837   1.00 26.89  ? 671  LEU A CD1   1 
ATOM   2916 C CD2   . LEU A 1 374 ? 0.698   -1.703  8.096   1.00 32.15  ? 671  LEU A CD2   1 
ATOM   2917 N N     . MET A 1 375 ? 4.543   1.908   7.839   1.00 24.15  ? 672  MET A N     1 
ATOM   2918 C CA    . MET A 1 375 ? 5.127   2.644   8.906   1.00 23.31  ? 672  MET A CA    1 
ATOM   2919 C C     . MET A 1 375 ? 5.237   4.111   8.553   1.00 26.81  ? 672  MET A C     1 
ATOM   2920 O O     . MET A 1 375 ? 4.892   5.004   9.387   1.00 26.40  ? 672  MET A O     1 
ATOM   2921 C CB    . MET A 1 375 ? 6.533   2.126   9.230   1.00 25.24  ? 672  MET A CB    1 
ATOM   2922 C CG    . MET A 1 375 ? 6.521   0.795   9.938   1.00 28.35  ? 672  MET A CG    1 
ATOM   2923 S SD    . MET A 1 375 ? 8.194   0.291   10.516  1.00 32.68  ? 672  MET A SD    1 
ATOM   2924 C CE    . MET A 1 375 ? 9.085   0.034   9.049   1.00 28.26  ? 672  MET A CE    1 
ATOM   2925 N N     . GLU A 1 376 ? 5.645   4.378   7.323   1.00 27.06  ? 673  GLU A N     1 
ATOM   2926 C CA    . GLU A 1 376 ? 5.644   5.778   6.854   1.00 28.80  ? 673  GLU A CA    1 
ATOM   2927 C C     . GLU A 1 376 ? 4.221   6.405   6.890   1.00 27.07  ? 673  GLU A C     1 
ATOM   2928 O O     . GLU A 1 376 ? 4.074   7.588   7.278   1.00 25.50  ? 673  GLU A O     1 
ATOM   2929 C CB    . GLU A 1 376 ? 6.194   5.930   5.419   1.00 29.42  ? 673  GLU A CB    1 
ATOM   2930 C CG    . GLU A 1 376 ? 6.148   7.383   4.845   1.00 28.70  ? 673  GLU A CG    1 
ATOM   2931 C CD    . GLU A 1 376 ? 7.206   8.323   5.461   1.00 33.69  ? 673  GLU A CD    1 
ATOM   2932 O OE1   . GLU A 1 376 ? 8.004   7.901   6.344   1.00 34.59  ? 673  GLU A OE1   1 
ATOM   2933 O OE2   . GLU A 1 376 ? 7.279   9.495   5.012   1.00 31.20  ? 673  GLU A OE2   1 
ATOM   2934 N N     . ALA A 1 377 ? 3.237   5.656   6.441   1.00 23.17  ? 674  ALA A N     1 
ATOM   2935 C CA    . ALA A 1 377 ? 1.855   6.124   6.486   1.00 25.76  ? 674  ALA A CA    1 
ATOM   2936 C C     . ALA A 1 377 ? 1.442   6.545   7.906   1.00 26.13  ? 674  ALA A C     1 
ATOM   2937 O O     . ALA A 1 377 ? 0.903   7.624   8.097   1.00 24.59  ? 674  ALA A O     1 
ATOM   2938 C CB    . ALA A 1 377 ? 0.919   5.093   5.930   1.00 25.19  ? 674  ALA A CB    1 
ATOM   2939 N N     . PHE A 1 378 ? 1.779   5.751   8.920   1.00 26.66  ? 675  PHE A N     1 
ATOM   2940 C CA    . PHE A 1 378 ? 1.445   6.130   10.266  1.00 25.28  ? 675  PHE A CA    1 
ATOM   2941 C C     . PHE A 1 378 ? 2.348   7.215   10.885  1.00 26.12  ? 675  PHE A C     1 
ATOM   2942 O O     . PHE A 1 378 ? 1.921   7.975   11.740  1.00 26.25  ? 675  PHE A O     1 
ATOM   2943 C CB    . PHE A 1 378 ? 1.394   4.894   11.175  1.00 25.51  ? 675  PHE A CB    1 
ATOM   2944 C CG    . PHE A 1 378 ? 0.178   4.094   10.963  1.00 24.41  ? 675  PHE A CG    1 
ATOM   2945 C CD1   . PHE A 1 378 ? -1.066  4.661   11.082  1.00 22.05  ? 675  PHE A CD1   1 
ATOM   2946 C CD2   . PHE A 1 378 ? 0.276   2.734   10.587  1.00 25.50  ? 675  PHE A CD2   1 
ATOM   2947 C CE1   . PHE A 1 378 ? -2.215  3.917   10.839  1.00 24.71  ? 675  PHE A CE1   1 
ATOM   2948 C CE2   . PHE A 1 378 ? -0.853  2.010   10.360  1.00 24.67  ? 675  PHE A CE2   1 
ATOM   2949 C CZ    . PHE A 1 378 ? -2.093  2.571   10.456  1.00 24.01  ? 675  PHE A CZ    1 
ATOM   2950 N N     . ARG A 1 379 ? 3.583   7.301   10.406  1.00 26.23  ? 676  ARG A N     1 
ATOM   2951 C CA    . ARG A 1 379 ? 4.462   8.359   10.796  1.00 25.81  ? 676  ARG A CA    1 
ATOM   2952 C C     . ARG A 1 379 ? 3.970   9.720   10.292  1.00 26.52  ? 676  ARG A C     1 
ATOM   2953 O O     . ARG A 1 379 ? 4.178   10.771  10.942  1.00 29.14  ? 676  ARG A O     1 
ATOM   2954 C CB    . ARG A 1 379 ? 5.885   8.055   10.348  1.00 26.43  ? 676  ARG A CB    1 
ATOM   2955 C CG    . ARG A 1 379 ? 6.530   7.014   11.235  1.00 29.15  ? 676  ARG A CG    1 
ATOM   2956 C CD    . ARG A 1 379 ? 7.843   6.522   10.671  1.00 32.26  ? 676  ARG A CD    1 
ATOM   2957 N NE    . ARG A 1 379 ? 8.372   5.488   11.510  1.00 34.18  ? 676  ARG A NE    1 
ATOM   2958 C CZ    . ARG A 1 379 ? 9.313   4.604   11.162  1.00 42.28  ? 676  ARG A CZ    1 
ATOM   2959 N NH1   . ARG A 1 379 ? 9.804   4.577   9.924   1.00 38.75  ? 676  ARG A NH1   1 
ATOM   2960 N NH2   . ARG A 1 379 ? 9.774   3.737   12.065  1.00 41.76  ? 676  ARG A NH2   1 
ATOM   2961 N N     . ARG A 1 380 ? 3.292   9.706   9.164   1.00 25.65  ? 677  ARG A N     1 
ATOM   2962 C CA    . ARG A 1 380 ? 2.681   10.898  8.634   1.00 25.33  ? 677  ARG A CA    1 
ATOM   2963 C C     . ARG A 1 380 ? 1.271   11.125  9.194   1.00 27.06  ? 677  ARG A C     1 
ATOM   2964 O O     . ARG A 1 380 ? 0.623   12.108  8.809   1.00 28.16  ? 677  ARG A O     1 
ATOM   2965 C CB    . ARG A 1 380 ? 2.590   10.832  7.127   1.00 27.62  ? 677  ARG A CB    1 
ATOM   2966 C CG    . ARG A 1 380 ? 3.909   10.843  6.383   1.00 31.22  ? 677  ARG A CG    1 
ATOM   2967 C CD    . ARG A 1 380 ? 3.650   10.889  4.876   1.00 30.75  ? 677  ARG A CD    1 
ATOM   2968 N NE    . ARG A 1 380 ? 4.868   10.532  4.158   1.00 33.80  ? 677  ARG A NE    1 
ATOM   2969 C CZ    . ARG A 1 380 ? 4.928   10.461  2.831   1.00 33.25  ? 677  ARG A CZ    1 
ATOM   2970 N NH1   . ARG A 1 380 ? 3.865   10.762  2.103   1.00 31.34  ? 677  ARG A NH1   1 
ATOM   2971 N NH2   . ARG A 1 380 ? 6.023   10.115  2.235   1.00 34.91  ? 677  ARG A NH2   1 
ATOM   2972 N N     . ASP A 1 381 ? 0.811   10.240  10.076  1.00 25.91  ? 678  ASP A N     1 
ATOM   2973 C CA    . ASP A 1 381 ? -0.581  10.213  10.539  1.00 26.68  ? 678  ASP A CA    1 
ATOM   2974 C C     . ASP A 1 381 ? -1.633  10.354  9.395   1.00 29.77  ? 678  ASP A C     1 
ATOM   2975 O O     . ASP A 1 381 ? -2.583  11.087  9.521   1.00 29.07  ? 678  ASP A O     1 
ATOM   2976 C CB    . ASP A 1 381 ? -0.823  11.292  11.578  1.00 29.57  ? 678  ASP A CB    1 
ATOM   2977 C CG    . ASP A 1 381 ? -2.069  11.015  12.399  1.00 35.18  ? 678  ASP A CG    1 
ATOM   2978 O OD1   . ASP A 1 381 ? -2.489  9.850   12.538  1.00 33.11  ? 678  ASP A OD1   1 
ATOM   2979 O OD2   . ASP A 1 381 ? -2.602  11.959  12.968  1.00 34.28  ? 678  ASP A OD2   1 
ATOM   2980 N N     . LEU A 1 382 ? -1.442  9.658   8.296   1.00 26.54  ? 679  LEU A N     1 
ATOM   2981 C CA    . LEU A 1 382 ? -2.350  9.703   7.176   1.00 29.98  ? 679  LEU A CA    1 
ATOM   2982 C C     . LEU A 1 382 ? -3.637  8.982   7.513   1.00 27.68  ? 679  LEU A C     1 
ATOM   2983 O O     . LEU A 1 382 ? -3.663  8.098   8.343   1.00 29.16  ? 679  LEU A O     1 
ATOM   2984 C CB    . LEU A 1 382 ? -1.717  8.987   5.952   1.00 31.20  ? 679  LEU A CB    1 
ATOM   2985 C CG    . LEU A 1 382 ? -0.453  9.586   5.335   1.00 31.81  ? 679  LEU A CG    1 
ATOM   2986 C CD1   . LEU A 1 382 ? 0.046   8.760   4.141   1.00 35.22  ? 679  LEU A CD1   1 
ATOM   2987 C CD2   . LEU A 1 382 ? -0.679  10.996  4.868   1.00 34.08  ? 679  LEU A CD2   1 
ATOM   2988 N N     . ASP A 1 383 ? -4.670  9.288   6.781   1.00 27.30  ? 680  ASP A N     1 
ATOM   2989 C CA    . ASP A 1 383 ? -5.889  8.497   6.762   1.00 29.70  ? 680  ASP A CA    1 
ATOM   2990 C C     . ASP A 1 383 ? -5.580  7.144   6.083   1.00 27.43  ? 680  ASP A C     1 
ATOM   2991 O O     . ASP A 1 383 ? -5.271  7.090   4.885   1.00 27.69  ? 680  ASP A O     1 
ATOM   2992 C CB    . ASP A 1 383 ? -6.922  9.218   5.933   1.00 30.61  ? 680  ASP A CB    1 
ATOM   2993 C CG    . ASP A 1 383 ? -8.224  8.407   5.849   1.00 33.98  ? 680  ASP A CG    1 
ATOM   2994 O OD1   . ASP A 1 383 ? -8.246  7.159   5.701   1.00 32.23  ? 680  ASP A OD1   1 
ATOM   2995 O OD2   . ASP A 1 383 ? -9.244  9.030   6.007   1.00 40.99  ? 680  ASP A OD2   1 
ATOM   2996 N N     . ILE A 1 384 ? -5.613  6.061   6.838   1.00 25.35  ? 681  ILE A N     1 
ATOM   2997 C CA    . ILE A 1 384 ? -4.949  4.840   6.383   1.00 23.82  ? 681  ILE A CA    1 
ATOM   2998 C C     . ILE A 1 384 ? -5.752  4.214   5.284   1.00 24.48  ? 681  ILE A C     1 
ATOM   2999 O O     . ILE A 1 384 ? -5.218  3.575   4.402   1.00 27.26  ? 681  ILE A O     1 
ATOM   3000 C CB    . ILE A 1 384 ? -4.667  3.854   7.539   1.00 25.85  ? 681  ILE A CB    1 
ATOM   3001 C CG1   . ILE A 1 384 ? -3.881  2.677   7.083   1.00 29.70  ? 681  ILE A CG1   1 
ATOM   3002 C CG2   . ILE A 1 384 ? -5.914  3.356   8.162   1.00 28.34  ? 681  ILE A CG2   1 
ATOM   3003 C CD1   . ILE A 1 384 ? -2.614  3.087   6.293   1.00 35.05  ? 681  ILE A CD1   1 
ATOM   3004 N N     . HIS A 1 385 ? -7.060  4.430   5.310   1.00 25.71  ? 682  HIS A N     1 
ATOM   3005 C CA    . HIS A 1 385 ? -7.883  3.822   4.291   1.00 25.70  ? 682  HIS A CA    1 
ATOM   3006 C C     . HIS A 1 385 ? -7.757  4.547   2.927   1.00 26.83  ? 682  HIS A C     1 
ATOM   3007 O O     . HIS A 1 385 ? -7.784  3.898   1.911   1.00 24.85  ? 682  HIS A O     1 
ATOM   3008 C CB    . HIS A 1 385 ? -9.319  3.756   4.734   1.00 25.02  ? 682  HIS A CB    1 
ATOM   3009 C CG    . HIS A 1 385 ? -9.506  3.026   6.000   1.00 26.03  ? 682  HIS A CG    1 
ATOM   3010 N ND1   . HIS A 1 385 ? -8.947  1.794   6.228   1.00 28.88  ? 682  HIS A ND1   1 
ATOM   3011 C CD2   . HIS A 1 385 ? -10.206 3.334   7.112   1.00 27.01  ? 682  HIS A CD2   1 
ATOM   3012 C CE1   . HIS A 1 385 ? -9.285  1.375   7.430   1.00 28.56  ? 682  HIS A CE1   1 
ATOM   3013 N NE2   . HIS A 1 385 ? -10.027 2.304   7.994   1.00 27.40  ? 682  HIS A NE2   1 
ATOM   3014 N N     . THR A 1 386 ? -7.680  5.871   2.943   1.00 24.81  ? 683  THR A N     1 
ATOM   3015 C CA    . THR A 1 386 ? -7.410  6.649   1.763   1.00 25.64  ? 683  THR A CA    1 
ATOM   3016 C C     . THR A 1 386 ? -6.067  6.324   1.206   1.00 27.95  ? 683  THR A C     1 
ATOM   3017 O O     . THR A 1 386 ? -5.927  6.087   0.018   1.00 27.75  ? 683  THR A O     1 
ATOM   3018 C CB    . THR A 1 386 ? -7.563  8.155   2.104   1.00 26.17  ? 683  THR A CB    1 
ATOM   3019 O OG1   . THR A 1 386 ? -8.945  8.371   2.457   1.00 26.43  ? 683  THR A OG1   1 
ATOM   3020 C CG2   . THR A 1 386 ? -7.180  9.047   0.984   1.00 26.94  ? 683  THR A CG2   1 
ATOM   3021 N N     . LYS A 1 387 ? -5.057  6.242   2.078   1.00 27.12  ? 684  LYS A N     1 
ATOM   3022 C CA    . LYS A 1 387 ? -3.751  5.858   1.597   1.00 25.34  ? 684  LYS A CA    1 
ATOM   3023 C C     . LYS A 1 387 ? -3.668  4.455   0.963   1.00 26.04  ? 684  LYS A C     1 
ATOM   3024 O O     . LYS A 1 387 ? -3.010  4.261   -0.077  1.00 27.41  ? 684  LYS A O     1 
ATOM   3025 C CB    . LYS A 1 387 ? -2.769  6.015   2.725   1.00 29.03  ? 684  LYS A CB    1 
ATOM   3026 C CG    . LYS A 1 387 ? -1.530  5.218   2.554   1.00 31.52  ? 684  LYS A CG    1 
ATOM   3027 C CD    . LYS A 1 387 ? -0.640  5.822   1.550   1.00 40.45  ? 684  LYS A CD    1 
ATOM   3028 C CE    . LYS A 1 387 ? 0.625   4.963   1.562   1.00 46.36  ? 684  LYS A CE    1 
ATOM   3029 N NZ    . LYS A 1 387 ? 1.426   5.256   0.388   1.00 47.26  ? 684  LYS A NZ    1 
ATOM   3030 N N     . THR A 1 388 ? -4.341  3.475   1.555   1.00 25.53  ? 685  THR A N     1 
ATOM   3031 C CA    . THR A 1 388 ? -4.403  2.122   1.008   1.00 26.92  ? 685  THR A CA    1 
ATOM   3032 C C     . THR A 1 388 ? -5.150  2.131   -0.346  1.00 28.06  ? 685  THR A C     1 
ATOM   3033 O O     . THR A 1 388 ? -4.739  1.469   -1.272  1.00 28.85  ? 685  THR A O     1 
ATOM   3034 C CB    . THR A 1 388 ? -5.116  1.159   2.011   1.00 28.38  ? 685  THR A CB    1 
ATOM   3035 O OG1   . THR A 1 388 ? -4.307  1.055   3.189   1.00 31.99  ? 685  THR A OG1   1 
ATOM   3036 C CG2   . THR A 1 388 ? -5.339  -0.220  1.428   1.00 30.17  ? 685  THR A CG2   1 
ATOM   3037 N N     . ALA A 1 389 ? -6.221  2.916   -0.455  1.00 27.34  ? 686  ALA A N     1 
ATOM   3038 C CA    . ALA A 1 389 ? -6.868  3.106   -1.780  1.00 26.46  ? 686  ALA A CA    1 
ATOM   3039 C C     . ALA A 1 389 ? -5.908  3.690   -2.815  1.00 28.57  ? 686  ALA A C     1 
ATOM   3040 O O     . ALA A 1 389 ? -5.842  3.258   -3.969  1.00 31.31  ? 686  ALA A O     1 
ATOM   3041 C CB    . ALA A 1 389 ? -8.103  3.976   -1.602  1.00 24.23  ? 686  ALA A CB    1 
ATOM   3042 N N     . MET A 1 390 ? -5.167  4.713   -2.428  1.00 29.32  ? 687  MET A N     1 
ATOM   3043 C CA    . MET A 1 390 ? -4.253  5.330   -3.354  1.00 31.89  ? 687  MET A CA    1 
ATOM   3044 C C     . MET A 1 390 ? -3.265  4.334   -3.868  1.00 35.12  ? 687  MET A C     1 
ATOM   3045 O O     . MET A 1 390 ? -3.006  4.291   -5.070  1.00 34.49  ? 687  MET A O     1 
ATOM   3046 C CB    . MET A 1 390 ? -3.476  6.455   -2.715  1.00 34.32  ? 687  MET A CB    1 
ATOM   3047 C CG    . MET A 1 390 ? -4.326  7.694   -2.506  1.00 35.14  ? 687  MET A CG    1 
ATOM   3048 S SD    . MET A 1 390 ? -3.556  8.920   -1.397  1.00 36.17  ? 687  MET A SD    1 
ATOM   3049 C CE    . MET A 1 390 ? -1.958  9.191   -2.222  1.00 37.96  ? 687  MET A CE    1 
ATOM   3050 N N     . ASP A 1 391 ? -2.720  3.519   -2.969  1.00 33.24  ? 688  ASP A N     1 
ATOM   3051 C CA    . ASP A 1 391 ? -1.774  2.474   -3.341  1.00 33.38  ? 688  ASP A CA    1 
ATOM   3052 C C     . ASP A 1 391 ? -2.353  1.333   -4.190  1.00 36.11  ? 688  ASP A C     1 
ATOM   3053 O O     . ASP A 1 391 ? -1.728  0.951   -5.173  1.00 35.98  ? 688  ASP A O     1 
ATOM   3054 C CB    . ASP A 1 391 ? -1.077  1.849   -2.125  1.00 32.62  ? 688  ASP A CB    1 
ATOM   3055 C CG    . ASP A 1 391 ? -0.097  2.762   -1.487  1.00 36.58  ? 688  ASP A CG    1 
ATOM   3056 O OD1   . ASP A 1 391 ? 0.133   3.836   -1.973  1.00 41.92  ? 688  ASP A OD1   1 
ATOM   3057 O OD2   . ASP A 1 391 ? 0.473   2.414   -0.454  1.00 47.01  ? 688  ASP A OD2   1 
ATOM   3058 N N     . ILE A 1 392 ? -3.476  0.752   -3.797  1.00 28.98  ? 689  ILE A N     1 
ATOM   3059 C CA    . ILE A 1 392 ? -3.945  -0.419  -4.498  1.00 36.60  ? 689  ILE A CA    1 
ATOM   3060 C C     . ILE A 1 392 ? -4.542  -0.045  -5.840  1.00 39.88  ? 689  ILE A C     1 
ATOM   3061 O O     . ILE A 1 392 ? -4.534  -0.865  -6.760  1.00 41.42  ? 689  ILE A O     1 
ATOM   3062 C CB    . ILE A 1 392 ? -4.950  -1.322  -3.726  1.00 39.89  ? 689  ILE A CB    1 
ATOM   3063 C CG1   . ILE A 1 392 ? -6.246  -0.675  -3.402  1.00 47.21  ? 689  ILE A CG1   1 
ATOM   3064 C CG2   . ILE A 1 392 ? -4.370  -1.862  -2.411  1.00 38.15  ? 689  ILE A CG2   1 
ATOM   3065 C CD1   . ILE A 1 392 ? -7.093  -1.621  -2.566  1.00 47.40  ? 689  ILE A CD1   1 
ATOM   3066 N N     . PHE A 1 393 ? -5.108  1.159   -5.926  1.00 36.36  ? 690  PHE A N     1 
ATOM   3067 C CA    . PHE A 1 393 ? -5.740  1.597   -7.209  1.00 36.95  ? 690  PHE A CA    1 
ATOM   3068 C C     . PHE A 1 393 ? -4.785  2.462   -8.016  1.00 40.87  ? 690  PHE A C     1 
ATOM   3069 O O     . PHE A 1 393 ? -5.124  2.863   -9.093  1.00 43.71  ? 690  PHE A O     1 
ATOM   3070 C CB    . PHE A 1 393 ? -7.059  2.322   -6.943  1.00 32.65  ? 690  PHE A CB    1 
ATOM   3071 C CG    . PHE A 1 393 ? -8.080  1.468   -6.252  1.00 34.68  ? 690  PHE A CG    1 
ATOM   3072 C CD1   . PHE A 1 393 ? -8.491  0.295   -6.809  1.00 40.72  ? 690  PHE A CD1   1 
ATOM   3073 C CD2   . PHE A 1 393 ? -8.620  1.820   -5.042  1.00 36.21  ? 690  PHE A CD2   1 
ATOM   3074 C CE1   . PHE A 1 393 ? -9.370  -0.518  -6.157  1.00 36.37  ? 690  PHE A CE1   1 
ATOM   3075 C CE2   . PHE A 1 393 ? -9.545  1.034   -4.413  1.00 42.61  ? 690  PHE A CE2   1 
ATOM   3076 C CZ    . PHE A 1 393 ? -9.909  -0.147  -4.959  1.00 40.11  ? 690  PHE A CZ    1 
ATOM   3077 N N     . GLN A 1 394 ? -3.607  2.761   -7.470  1.00 40.24  ? 691  GLN A N     1 
ATOM   3078 C CA    . GLN A 1 394 ? -2.568  3.520   -8.150  1.00 45.86  ? 691  GLN A CA    1 
ATOM   3079 C C     . GLN A 1 394 ? -3.092  4.871   -8.608  1.00 49.37  ? 691  GLN A C     1 
ATOM   3080 O O     . GLN A 1 394 ? -2.952  5.213   -9.774  1.00 48.85  ? 691  GLN A O     1 
ATOM   3081 C CB    . GLN A 1 394 ? -2.019  2.770   -9.366  1.00 51.76  ? 691  GLN A CB    1 
ATOM   3082 C CG    . GLN A 1 394 ? -1.427  1.384   -9.119  1.00 57.78  ? 691  GLN A CG    1 
ATOM   3083 C CD    . GLN A 1 394 ? -1.673  0.428   -10.322 1.00 69.35  ? 691  GLN A CD    1 
ATOM   3084 O OE1   . GLN A 1 394 ? -1.847  0.876   -11.469 1.00 70.60  ? 691  GLN A OE1   1 
ATOM   3085 N NE2   . GLN A 1 394 ? -1.715  -0.893  -10.054 1.00 67.75  ? 691  GLN A NE2   1 
ATOM   3086 N N     . VAL A 1 395 ? -3.727  5.611   -7.697  1.00 41.69  ? 692  VAL A N     1 
ATOM   3087 C CA    . VAL A 1 395 ? -4.261  6.935   -7.978  1.00 38.98  ? 692  VAL A CA    1 
ATOM   3088 C C     . VAL A 1 395 ? -3.747  7.946   -6.939  1.00 44.01  ? 692  VAL A C     1 
ATOM   3089 O O     . VAL A 1 395 ? -3.320  7.567   -5.828  1.00 37.87  ? 692  VAL A O     1 
ATOM   3090 C CB    . VAL A 1 395 ? -5.825  6.941   -8.022  1.00 35.94  ? 692  VAL A CB    1 
ATOM   3091 C CG1   . VAL A 1 395 ? -6.375  5.875   -8.995  1.00 37.78  ? 692  VAL A CG1   1 
ATOM   3092 C CG2   . VAL A 1 395 ? -6.453  6.728   -6.674  1.00 34.68  ? 692  VAL A CG2   1 
ATOM   3093 N N     . SER A 1 396 ? -3.892  9.230   -7.263  1.00 37.66  ? 693  SER A N     1 
ATOM   3094 C CA    . SER A 1 396 ? -3.643  10.322  -6.332  1.00 37.13  ? 693  SER A CA    1 
ATOM   3095 C C     . SER A 1 396 ? -4.810  10.545  -5.378  1.00 38.39  ? 693  SER A C     1 
ATOM   3096 O O     . SER A 1 396 ? -5.940  10.090  -5.590  1.00 37.22  ? 693  SER A O     1 
ATOM   3097 C CB    . SER A 1 396 ? -3.420  11.645  -7.102  1.00 38.42  ? 693  SER A CB    1 
ATOM   3098 O OG    . SER A 1 396 ? -4.620  11.989  -7.791  1.00 42.03  ? 693  SER A OG    1 
ATOM   3099 N N     . GLU A 1 397 ? -4.540  11.310  -4.338  1.00 37.88  ? 694  GLU A N     1 
ATOM   3100 C CA    . GLU A 1 397 ? -5.479  11.500  -3.277  1.00 41.32  ? 694  GLU A CA    1 
ATOM   3101 C C     . GLU A 1 397 ? -6.809  12.026  -3.789  1.00 43.94  ? 694  GLU A C     1 
ATOM   3102 O O     . GLU A 1 397 ? -7.872  11.552  -3.370  1.00 36.41  ? 694  GLU A O     1 
ATOM   3103 C CB    . GLU A 1 397 ? -4.919  12.407  -2.182  1.00 38.14  ? 694  GLU A CB    1 
ATOM   3104 C CG    . GLU A 1 397 ? -5.923  12.575  -1.045  1.00 39.35  ? 694  GLU A CG    1 
ATOM   3105 C CD    . GLU A 1 397 ? -5.345  13.127  0.264   1.00 42.87  ? 694  GLU A CD    1 
ATOM   3106 O OE1   . GLU A 1 397 ? -4.170  13.386  0.340   1.00 51.22  ? 694  GLU A OE1   1 
ATOM   3107 O OE2   . GLU A 1 397 ? -6.100  13.291  1.240   1.00 47.68  ? 694  GLU A OE2   1 
ATOM   3108 N N     . ASP A 1 398 ? -6.717  13.006  -4.674  1.00 41.75  ? 695  ASP A N     1 
ATOM   3109 C CA    . ASP A 1 398 ? -7.862  13.618  -5.352  1.00 45.58  ? 695  ASP A CA    1 
ATOM   3110 C C     . ASP A 1 398 ? -8.691  12.649  -6.205  1.00 37.63  ? 695  ASP A C     1 
ATOM   3111 O O     . ASP A 1 398 ? -9.781  12.944  -6.547  1.00 43.65  ? 695  ASP A O     1 
ATOM   3112 C CB    . ASP A 1 398 ? -7.375  14.741  -6.312  1.00 49.12  ? 695  ASP A CB    1 
ATOM   3113 C CG    . ASP A 1 398 ? -6.997  16.026  -5.585  1.00 65.21  ? 695  ASP A CG    1 
ATOM   3114 O OD1   . ASP A 1 398 ? -7.127  16.087  -4.341  1.00 78.55  ? 695  ASP A OD1   1 
ATOM   3115 O OD2   . ASP A 1 398 ? -6.569  16.996  -6.262  1.00 70.76  ? 695  ASP A OD2   1 
ATOM   3116 N N     . GLU A 1 399 ? -8.152  11.533  -6.614  1.00 34.73  ? 696  GLU A N     1 
ATOM   3117 C CA    . GLU A 1 399 ? -8.919  10.591  -7.406  1.00 35.53  ? 696  GLU A CA    1 
ATOM   3118 C C     . GLU A 1 399 ? -9.502  9.476   -6.573  1.00 39.06  ? 696  GLU A C     1 
ATOM   3119 O O     . GLU A 1 399 ? -10.028 8.557   -7.137  1.00 36.40  ? 696  GLU A O     1 
ATOM   3120 C CB    . GLU A 1 399 ? -8.019  9.969   -8.477  1.00 40.01  ? 696  GLU A CB    1 
ATOM   3121 C CG    . GLU A 1 399 ? -7.346  10.997  -9.397  1.00 47.05  ? 696  GLU A CG    1 
ATOM   3122 C CD    . GLU A 1 399 ? -6.260  10.341  -10.226 1.00 55.09  ? 696  GLU A CD    1 
ATOM   3123 O OE1   . GLU A 1 399 ? -6.613  9.745   -11.249 1.00 66.20  ? 696  GLU A OE1   1 
ATOM   3124 O OE2   . GLU A 1 399 ? -5.071  10.324  -9.819  1.00 62.08  ? 696  GLU A OE2   1 
ATOM   3125 N N     . VAL A 1 400 ? -9.387  9.497   -5.232  1.00 35.43  ? 697  VAL A N     1 
ATOM   3126 C CA    . VAL A 1 400 ? -10.006 8.432   -4.441  1.00 30.15  ? 697  VAL A CA    1 
ATOM   3127 C C     . VAL A 1 400 ? -11.441 8.813   -4.258  1.00 29.33  ? 697  VAL A C     1 
ATOM   3128 O O     . VAL A 1 400 ? -11.730 9.833   -3.711  1.00 30.47  ? 697  VAL A O     1 
ATOM   3129 C CB    . VAL A 1 400 ? -9.369  8.261   -3.067  1.00 32.62  ? 697  VAL A CB    1 
ATOM   3130 C CG1   . VAL A 1 400 ? -10.146 7.239   -2.265  1.00 31.93  ? 697  VAL A CG1   1 
ATOM   3131 C CG2   . VAL A 1 400 ? -7.922  7.819   -3.217  1.00 33.52  ? 697  VAL A CG2   1 
ATOM   3132 N N     . THR A 1 401 ? -12.330 7.996   -4.773  1.00 25.45  ? 698  THR A N     1 
ATOM   3133 C CA    . THR A 1 401 ? -13.742 8.177   -4.607  1.00 26.64  ? 698  THR A CA    1 
ATOM   3134 C C     . THR A 1 401 ? -14.198 7.554   -3.302  1.00 27.72  ? 698  THR A C     1 
ATOM   3135 O O     . THR A 1 401 ? -13.501 6.758   -2.757  1.00 28.56  ? 698  THR A O     1 
ATOM   3136 C CB    . THR A 1 401 ? -14.476 7.457   -5.783  1.00 28.46  ? 698  THR A CB    1 
ATOM   3137 O OG1   . THR A 1 401 ? -14.077 6.069   -5.819  1.00 29.00  ? 698  THR A OG1   1 
ATOM   3138 C CG2   . THR A 1 401 ? -14.114 8.151   -7.203  1.00 28.00  ? 698  THR A CG2   1 
ATOM   3139 N N     . PRO A 1 402 ? -15.419 7.851   -2.844  1.00 27.03  ? 699  PRO A N     1 
ATOM   3140 C CA    . PRO A 1 402 ? -15.939 7.181   -1.691  1.00 27.32  ? 699  PRO A CA    1 
ATOM   3141 C C     . PRO A 1 402 ? -15.976 5.685   -1.791  1.00 30.12  ? 699  PRO A C     1 
ATOM   3142 O O     . PRO A 1 402 ? -15.579 5.035   -0.832  1.00 27.81  ? 699  PRO A O     1 
ATOM   3143 C CB    . PRO A 1 402 ? -17.356 7.761   -1.542  1.00 29.59  ? 699  PRO A CB    1 
ATOM   3144 C CG    . PRO A 1 402 ? -17.232 9.194   -2.075  1.00 27.72  ? 699  PRO A CG    1 
ATOM   3145 C CD    . PRO A 1 402 ? -16.224 9.031   -3.231  1.00 30.04  ? 699  PRO A CD    1 
ATOM   3146 N N     . ASN A 1 403 ? -16.372 5.119   -2.940  1.00 24.68  ? 700  ASN A N     1 
ATOM   3147 C CA    . ASN A 1 403 ? -16.405 3.731   -3.038  1.00 25.70  ? 700  ASN A CA    1 
ATOM   3148 C C     . ASN A 1 403 ? -15.035 3.072   -2.988  1.00 28.20  ? 700  ASN A C     1 
ATOM   3149 O O     . ASN A 1 403 ? -14.890 1.983   -2.432  1.00 26.72  ? 700  ASN A O     1 
ATOM   3150 C CB    . ASN A 1 403 ? -17.184 3.288   -4.287  1.00 26.70  ? 700  ASN A CB    1 
ATOM   3151 C CG    . ASN A 1 403 ? -17.703 1.877   -4.175  1.00 27.52  ? 700  ASN A CG    1 
ATOM   3152 O OD1   . ASN A 1 403 ? -18.295 1.464   -3.144  1.00 26.99  ? 700  ASN A OD1   1 
ATOM   3153 N ND2   . ASN A 1 403 ? -17.469 1.141   -5.176  1.00 27.35  ? 700  ASN A ND2   1 
ATOM   3154 N N     . MET A 1 404 ? -14.054 3.674   -3.655  1.00 25.84  ? 701  MET A N     1 
ATOM   3155 C CA    . MET A 1 404 ? -12.692 3.220   -3.556  1.00 29.83  ? 701  MET A CA    1 
ATOM   3156 C C     . MET A 1 404 ? -12.170 3.176   -2.089  1.00 30.16  ? 701  MET A C     1 
ATOM   3157 O O     . MET A 1 404 ? -11.561 2.190   -1.714  1.00 28.33  ? 701  MET A O     1 
ATOM   3158 C CB    . MET A 1 404 ? -11.745 4.098   -4.351  1.00 29.44  ? 701  MET A CB    1 
ATOM   3159 C CG    . MET A 1 404 ? -11.833 3.855   -5.841  1.00 37.85  ? 701  MET A CG    1 
ATOM   3160 S SD    . MET A 1 404 ? -11.137 5.244   -6.820  1.00 40.73  ? 701  MET A SD    1 
ATOM   3161 C CE    . MET A 1 404 ? -9.526  4.982   -6.259  1.00 36.35  ? 701  MET A CE    1 
ATOM   3162 N N     . ARG A 1 405 ? -12.427 4.227   -1.303  1.00 28.37  ? 702  ARG A N     1 
ATOM   3163 C CA    . ARG A 1 405 ? -12.021 4.239   0.090   1.00 29.03  ? 702  ARG A CA    1 
ATOM   3164 C C     . ARG A 1 405 ? -12.735 3.161   0.862   1.00 27.89  ? 702  ARG A C     1 
ATOM   3165 O O     . ARG A 1 405 ? -12.141 2.508   1.691   1.00 29.22  ? 702  ARG A O     1 
ATOM   3166 C CB    . ARG A 1 405 ? -12.262 5.588   0.763   1.00 27.76  ? 702  ARG A CB    1 
ATOM   3167 C CG    . ARG A 1 405 ? -11.692 5.657   2.175   1.00 26.73  ? 702  ARG A CG    1 
ATOM   3168 C CD    . ARG A 1 405 ? -12.103 6.965   2.866   1.00 29.44  ? 702  ARG A CD    1 
ATOM   3169 N NE    . ARG A 1 405 ? -11.424 7.125   4.134   1.00 29.66  ? 702  ARG A NE    1 
ATOM   3170 C CZ    . ARG A 1 405 ? -11.883 6.699   5.271   1.00 32.27  ? 702  ARG A CZ    1 
ATOM   3171 N NH1   . ARG A 1 405 ? -13.015 6.072   5.301   1.00 32.42  ? 702  ARG A NH1   1 
ATOM   3172 N NH2   . ARG A 1 405 ? -11.173 6.854   6.381   1.00 33.09  ? 702  ARG A NH2   1 
ATOM   3173 N N     . ARG A 1 406 ? -14.001 2.967   0.603   1.00 28.48  ? 703  ARG A N     1 
ATOM   3174 C CA    . ARG A 1 406 ? -14.790 1.933   1.259   1.00 29.81  ? 703  ARG A CA    1 
ATOM   3175 C C     . ARG A 1 406 ? -14.205 0.494   1.046   1.00 33.54  ? 703  ARG A C     1 
ATOM   3176 O O     . ARG A 1 406 ? -14.072 -0.292  1.994   1.00 29.17  ? 703  ARG A O     1 
ATOM   3177 C CB    . ARG A 1 406 ? -16.243 1.967   0.764   1.00 34.47  ? 703  ARG A CB    1 
ATOM   3178 C CG    . ARG A 1 406 ? -17.112 0.884   1.462   1.00 36.24  ? 703  ARG A CG    1 
ATOM   3179 C CD    . ARG A 1 406 ? -18.584 0.921   0.993   1.00 36.25  ? 703  ARG A CD    1 
ATOM   3180 N NE    . ARG A 1 406 ? -18.614 0.445   -0.375  1.00 37.67  ? 703  ARG A NE    1 
ATOM   3181 C CZ    . ARG A 1 406 ? -18.592 -0.828  -0.777  1.00 42.81  ? 703  ARG A CZ    1 
ATOM   3182 N NH1   . ARG A 1 406 ? -18.577 -1.842  0.092   1.00 42.15  ? 703  ARG A NH1   1 
ATOM   3183 N NH2   . ARG A 1 406 ? -18.552 -1.087  -2.076  1.00 38.50  ? 703  ARG A NH2   1 
ATOM   3184 N N     . GLN A 1 407 ? -13.859 0.181   -0.193  1.00 29.58  ? 704  GLN A N     1 
ATOM   3185 C CA    . GLN A 1 407 ? -13.279 -1.047  -0.514  1.00 31.45  ? 704  GLN A CA    1 
ATOM   3186 C C     . GLN A 1 407 ? -11.853 -1.194  0.014   1.00 34.43  ? 704  GLN A C     1 
ATOM   3187 O O     . GLN A 1 407 ? -11.478 -2.278  0.455   1.00 28.62  ? 704  GLN A O     1 
ATOM   3188 C CB    . GLN A 1 407 ? -13.347 -1.276  -2.008  1.00 34.56  ? 704  GLN A CB    1 
ATOM   3189 C CG    . GLN A 1 407 ? -14.815 -1.398  -2.449  1.00 38.76  ? 704  GLN A CG    1 
ATOM   3190 C CD    . GLN A 1 407 ? -14.937 -2.083  -3.784  1.00 42.28  ? 704  GLN A CD    1 
ATOM   3191 O OE1   . GLN A 1 407 ? -15.321 -3.227  -3.891  1.00 52.13  ? 704  GLN A OE1   1 
ATOM   3192 N NE2   . GLN A 1 407 ? -14.562 -1.403  -4.771  1.00 45.62  ? 704  GLN A NE2   1 
ATOM   3193 N N     . ALA A 1 408 ? -11.064 -0.134  0.008   1.00 30.07  ? 705  ALA A N     1 
ATOM   3194 C CA    . ALA A 1 408 ? -9.732  -0.243  0.617   1.00 29.04  ? 705  ALA A CA    1 
ATOM   3195 C C     . ALA A 1 408 ? -9.819  -0.527  2.118   1.00 29.84  ? 705  ALA A C     1 
ATOM   3196 O O     . ALA A 1 408 ? -9.030  -1.283  2.664   1.00 30.49  ? 705  ALA A O     1 
ATOM   3197 C CB    . ALA A 1 408 ? -8.919  0.978   0.352   1.00 28.63  ? 705  ALA A CB    1 
ATOM   3198 N N     . LYS A 1 409 ? -10.814 0.062   2.759   1.00 29.64  ? 706  LYS A N     1 
ATOM   3199 C CA    . LYS A 1 409 ? -11.099 -0.173  4.141   1.00 33.13  ? 706  LYS A CA    1 
ATOM   3200 C C     . LYS A 1 409 ? -11.414 -1.651  4.441   1.00 33.80  ? 706  LYS A C     1 
ATOM   3201 O O     . LYS A 1 409 ? -10.883 -2.241  5.431   1.00 30.83  ? 706  LYS A O     1 
ATOM   3202 C CB    . LYS A 1 409 ? -12.232 0.728   4.575   1.00 31.98  ? 706  LYS A CB    1 
ATOM   3203 C CG    . LYS A 1 409 ? -12.621 0.593   6.032   1.00 37.11  ? 706  LYS A CG    1 
ATOM   3204 C CD    . LYS A 1 409 ? -13.798 1.475   6.367   1.00 37.34  ? 706  LYS A CD    1 
ATOM   3205 C CE    . LYS A 1 409 ? -14.039 1.462   7.872   1.00 45.33  ? 706  LYS A CE    1 
ATOM   3206 N NZ    . LYS A 1 409 ? -15.003 2.495   8.286   1.00 45.89  ? 706  LYS A NZ    1 
ATOM   3207 N N     . ALA A 1 410 ? -12.294 -2.240  3.620   1.00 30.21  ? 707  ALA A N     1 
ATOM   3208 C CA    . ALA A 1 410 ? -12.621 -3.647  3.740   1.00 31.82  ? 707  ALA A CA    1 
ATOM   3209 C C     . ALA A 1 410 ? -11.357 -4.516  3.534   1.00 30.17  ? 707  ALA A C     1 
ATOM   3210 O O     . ALA A 1 410 ? -11.252 -5.563  4.070   1.00 31.56  ? 707  ALA A O     1 
ATOM   3211 C CB    . ALA A 1 410 ? -13.729 -4.048  2.739   1.00 33.40  ? 707  ALA A CB    1 
ATOM   3212 N N     . VAL A 1 411 ? -10.467 -4.121  2.654   1.00 30.43  ? 708  VAL A N     1 
ATOM   3213 C CA    . VAL A 1 411 ? -9.281  -4.877  2.396   1.00 29.20  ? 708  VAL A CA    1 
ATOM   3214 C C     . VAL A 1 411 ? -8.415  -4.817  3.643   1.00 34.18  ? 708  VAL A C     1 
ATOM   3215 O O     . VAL A 1 411 ? -7.834  -5.836  3.976   1.00 33.30  ? 708  VAL A O     1 
ATOM   3216 C CB    . VAL A 1 411 ? -8.515  -4.350  1.186   1.00 32.08  ? 708  VAL A CB    1 
ATOM   3217 C CG1   . VAL A 1 411 ? -7.108  -4.938  1.073   1.00 32.46  ? 708  VAL A CG1   1 
ATOM   3218 C CG2   . VAL A 1 411 ? -9.285  -4.581  -0.092  1.00 32.40  ? 708  VAL A CG2   1 
ATOM   3219 N N     . ASN A 1 412 ? -8.356  -3.656  4.322   1.00 31.16  ? 709  ASN A N     1 
ATOM   3220 C CA    . ASN A 1 412 ? -7.527  -3.472  5.510   1.00 32.96  ? 709  ASN A CA    1 
ATOM   3221 C C     . ASN A 1 412 ? -8.029  -4.328  6.633   1.00 40.72  ? 709  ASN A C     1 
ATOM   3222 O O     . ASN A 1 412 ? -7.226  -4.964  7.309   1.00 35.75  ? 709  ASN A O     1 
ATOM   3223 C CB    . ASN A 1 412 ? -7.437  -2.016  5.977   1.00 29.50  ? 709  ASN A CB    1 
ATOM   3224 C CG    . ASN A 1 412 ? -6.449  -1.192  5.165   1.00 28.98  ? 709  ASN A CG    1 
ATOM   3225 O OD1   . ASN A 1 412 ? -5.436  -1.704  4.699   1.00 29.23  ? 709  ASN A OD1   1 
ATOM   3226 N ND2   . ASN A 1 412 ? -6.714  0.110   5.042   1.00 33.06  ? 709  ASN A ND2   1 
ATOM   3227 N N     . PHE A 1 413 ? -9.333  -4.379  6.812   1.00 36.39  ? 710  PHE A N     1 
ATOM   3228 C CA    . PHE A 1 413 ? -9.904  -5.328  7.788   1.00 42.81  ? 710  PHE A CA    1 
ATOM   3229 C C     . PHE A 1 413 ? -9.606  -6.799  7.413   1.00 43.70  ? 710  PHE A C     1 
ATOM   3230 O O     . PHE A 1 413 ? -9.259  -7.627  8.224   1.00 47.12  ? 710  PHE A O     1 
ATOM   3231 C CB    . PHE A 1 413 ? -11.399 -5.171  7.839   1.00 42.55  ? 710  PHE A CB    1 
ATOM   3232 C CG    . PHE A 1 413 ? -11.866 -3.983  8.588   1.00 50.21  ? 710  PHE A CG    1 
ATOM   3233 C CD1   . PHE A 1 413 ? -11.243 -2.738  8.467   1.00 59.06  ? 710  PHE A CD1   1 
ATOM   3234 C CD2   . PHE A 1 413 ? -12.994 -4.092  9.427   1.00 70.53  ? 710  PHE A CD2   1 
ATOM   3235 C CE1   . PHE A 1 413 ? -11.700 -1.625  9.168   1.00 58.31  ? 710  PHE A CE1   1 
ATOM   3236 C CE2   . PHE A 1 413 ? -13.462 -2.975  10.135  1.00 73.90  ? 710  PHE A CE2   1 
ATOM   3237 C CZ    . PHE A 1 413 ? -12.811 -1.740  10.001  1.00 69.73  ? 710  PHE A CZ    1 
ATOM   3238 N N     . GLY A 1 414 ? -9.731  -7.099  6.147   1.00 39.46  ? 711  GLY A N     1 
ATOM   3239 C CA    . GLY A 1 414 ? -9.471  -8.420  5.659   1.00 43.05  ? 711  GLY A CA    1 
ATOM   3240 C C     . GLY A 1 414 ? -8.028  -8.862  5.888   1.00 48.43  ? 711  GLY A C     1 
ATOM   3241 O O     . GLY A 1 414 ? -7.745  -10.018 6.251   1.00 40.86  ? 711  GLY A O     1 
ATOM   3242 N N     . ILE A 1 415 ? -7.103  -7.933  5.667   1.00 43.62  ? 712  ILE A N     1 
ATOM   3243 C CA    . ILE A 1 415 ? -5.710  -8.198  5.864   1.00 38.15  ? 712  ILE A CA    1 
ATOM   3244 C C     . ILE A 1 415 ? -5.496  -8.503  7.373   1.00 36.58  ? 712  ILE A C     1 
ATOM   3245 O O     . ILE A 1 415 ? -4.778  -9.433  7.705   1.00 31.72  ? 712  ILE A O     1 
ATOM   3246 C CB    . ILE A 1 415 ? -4.812  -7.025  5.400   1.00 37.29  ? 712  ILE A CB    1 
ATOM   3247 C CG1   . ILE A 1 415 ? -4.756  -6.957  3.905   1.00 39.65  ? 712  ILE A CG1   1 
ATOM   3248 C CG2   . ILE A 1 415 ? -3.363  -7.185  5.871   1.00 41.69  ? 712  ILE A CG2   1 
ATOM   3249 C CD1   . ILE A 1 415 ? -4.060  -8.134  3.237   1.00 38.81  ? 712  ILE A CD1   1 
ATOM   3250 N N     . VAL A 1 416 ? -6.093  -7.712  8.261   1.00 32.59  ? 713  VAL A N     1 
ATOM   3251 C CA    . VAL A 1 416 ? -5.938  -7.910  9.702   1.00 35.97  ? 713  VAL A CA    1 
ATOM   3252 C C     . VAL A 1 416 ? -6.520  -9.244  10.146  1.00 36.85  ? 713  VAL A C     1 
ATOM   3253 O O     . VAL A 1 416 ? -5.915  -9.947  10.968  1.00 37.11  ? 713  VAL A O     1 
ATOM   3254 C CB    . VAL A 1 416 ? -6.555  -6.736  10.493  1.00 38.75  ? 713  VAL A CB    1 
ATOM   3255 C CG1   . VAL A 1 416 ? -6.680  -7.064  11.959  1.00 43.05  ? 713  VAL A CG1   1 
ATOM   3256 C CG2   . VAL A 1 416 ? -5.678  -5.504  10.355  1.00 37.72  ? 713  VAL A CG2   1 
ATOM   3257 N N     . TYR A 1 417 ? -7.655  -9.612  9.551   1.00 36.75  ? 714  TYR A N     1 
ATOM   3258 C CA    . TYR A 1 417 ? -8.411  -10.801 9.984   1.00 40.32  ? 714  TYR A CA    1 
ATOM   3259 C C     . TYR A 1 417 ? -7.954  -12.081 9.304   1.00 41.03  ? 714  TYR A C     1 
ATOM   3260 O O     . TYR A 1 417 ? -8.610  -13.134 9.427   1.00 43.84  ? 714  TYR A O     1 
ATOM   3261 C CB    . TYR A 1 417 ? -9.891  -10.601 9.685   1.00 35.18  ? 714  TYR A CB    1 
ATOM   3262 C CG    . TYR A 1 417 ? -10.531 -9.531  10.444  1.00 35.52  ? 714  TYR A CG    1 
ATOM   3263 C CD1   . TYR A 1 417 ? -9.947  -8.982  11.537  1.00 34.96  ? 714  TYR A CD1   1 
ATOM   3264 C CD2   . TYR A 1 417 ? -11.783 -9.070  10.072  1.00 42.86  ? 714  TYR A CD2   1 
ATOM   3265 C CE1   . TYR A 1 417 ? -10.567 -8.007  12.242  1.00 40.36  ? 714  TYR A CE1   1 
ATOM   3266 C CE2   . TYR A 1 417 ? -12.411 -8.068  10.784  1.00 42.46  ? 714  TYR A CE2   1 
ATOM   3267 C CZ    . TYR A 1 417 ? -11.780 -7.549  11.861  1.00 40.89  ? 714  TYR A CZ    1 
ATOM   3268 O OH    . TYR A 1 417 ? -12.390 -6.571  12.585  1.00 47.97  ? 714  TYR A OH    1 
ATOM   3269 N N     . GLY A 1 418 ? -6.859  -11.995 8.545   1.00 41.56  ? 715  GLY A N     1 
ATOM   3270 C CA    . GLY A 1 418 ? -6.364  -13.134 7.836   1.00 46.75  ? 715  GLY A CA    1 
ATOM   3271 C C     . GLY A 1 418 ? -6.741  -13.367 6.380   1.00 50.85  ? 715  GLY A C     1 
ATOM   3272 O O     . GLY A 1 418 ? -6.683  -14.496 5.931   1.00 69.07  ? 715  GLY A O     1 
ATOM   3273 N N     . ILE A 1 419 ? -7.146  -12.347 5.651   1.00 56.88  ? 716  ILE A N     1 
ATOM   3274 C CA    . ILE A 1 419 ? -7.019  -12.325 4.154   1.00 61.01  ? 716  ILE A CA    1 
ATOM   3275 C C     . ILE A 1 419 ? -7.481  -13.621 3.461   1.00 56.86  ? 716  ILE A C     1 
ATOM   3276 O O     . ILE A 1 419 ? -6.649  -14.456 3.149   1.00 71.65  ? 716  ILE A O     1 
ATOM   3277 C CB    . ILE A 1 419 ? -5.548  -12.034 3.663   1.00 48.85  ? 716  ILE A CB    1 
ATOM   3278 N N     . SER A 1 420 ? -8.774  -13.800 3.224   1.00 53.67  ? 717  SER A N     1 
ATOM   3279 C CA    . SER A 1 420 ? -9.276  -14.933 2.398   1.00 58.68  ? 717  SER A CA    1 
ATOM   3280 C C     . SER A 1 420 ? -9.894  -14.454 1.057   1.00 61.47  ? 717  SER A C     1 
ATOM   3281 O O     . SER A 1 420 ? -10.734 -13.575 1.016   1.00 58.22  ? 717  SER A O     1 
ATOM   3282 C CB    . SER A 1 420 ? -10.307 -15.744 3.177   1.00 64.53  ? 717  SER A CB    1 
ATOM   3283 O OG    . SER A 1 420 ? -11.032 -14.915 4.098   1.00 73.57  ? 717  SER A OG    1 
ATOM   3284 N N     . ASP A 1 421 ? -9.475  -15.066 -0.034  1.00 58.72  ? 718  ASP A N     1 
ATOM   3285 C CA    . ASP A 1 421 ? -10.053 -14.812 -1.346  1.00 61.16  ? 718  ASP A CA    1 
ATOM   3286 C C     . ASP A 1 421 ? -11.559 -14.762 -1.339  1.00 63.10  ? 718  ASP A C     1 
ATOM   3287 O O     . ASP A 1 421 ? -12.147 -13.777 -1.782  1.00 57.96  ? 718  ASP A O     1 
ATOM   3288 C CB    . ASP A 1 421 ? -9.757  -16.005 -2.259  1.00 66.75  ? 718  ASP A CB    1 
ATOM   3289 C CG    . ASP A 1 421 ? -8.739  -15.706 -3.251  1.00 71.72  ? 718  ASP A CG    1 
ATOM   3290 O OD1   . ASP A 1 421 ? -8.378  -14.521 -3.337  1.00 77.55  ? 718  ASP A OD1   1 
ATOM   3291 O OD2   . ASP A 1 421 ? -8.308  -16.641 -3.952  1.00 71.34  ? 718  ASP A OD2   1 
ATOM   3292 N N     . TYR A 1 422 ? -12.161 -15.864 -0.887  1.00 56.29  ? 719  TYR A N     1 
ATOM   3293 C CA    . TYR A 1 422 ? -13.608 -15.999 -0.777  1.00 64.24  ? 719  TYR A CA    1 
ATOM   3294 C C     . TYR A 1 422 ? -14.195 -15.080 0.309   1.00 58.27  ? 719  TYR A C     1 
ATOM   3295 O O     . TYR A 1 422 ? -15.227 -14.437 0.105   1.00 58.36  ? 719  TYR A O     1 
ATOM   3296 C CB    . TYR A 1 422 ? -13.992 -17.469 -0.490  1.00 66.46  ? 719  TYR A CB    1 
ATOM   3297 N N     . GLY A 1 423 ? -13.521 -14.989 1.440   1.00 50.44  ? 720  GLY A N     1 
ATOM   3298 C CA    . GLY A 1 423 ? -14.016 -14.138 2.524   1.00 57.42  ? 720  GLY A CA    1 
ATOM   3299 C C     . GLY A 1 423 ? -14.107 -12.641 2.194   1.00 55.01  ? 720  GLY A C     1 
ATOM   3300 O O     . GLY A 1 423 ? -15.011 -11.918 2.668   1.00 53.01  ? 720  GLY A O     1 
ATOM   3301 N N     . LEU A 1 424 ? -13.156 -12.146 1.410   1.00 51.47  ? 721  LEU A N     1 
ATOM   3302 C CA    . LEU A 1 424 ? -13.215 -10.713 1.043   1.00 56.08  ? 721  LEU A CA    1 
ATOM   3303 C C     . LEU A 1 424 ? -14.374 -10.510 0.011   1.00 52.71  ? 721  LEU A C     1 
ATOM   3304 O O     . LEU A 1 424 ? -15.085 -9.518  0.030   1.00 57.50  ? 721  LEU A O     1 
ATOM   3305 C CB    . LEU A 1 424 ? -11.863 -10.254 0.480   1.00 49.69  ? 721  LEU A CB    1 
ATOM   3306 C CG    . LEU A 1 424 ? -11.713 -8.762  0.101   1.00 44.72  ? 721  LEU A CG    1 
ATOM   3307 C CD1   . LEU A 1 424 ? -11.924 -7.810  1.251   1.00 43.73  ? 721  LEU A CD1   1 
ATOM   3308 C CD2   . LEU A 1 424 ? -10.361 -8.560  -0.523  1.00 42.93  ? 721  LEU A CD2   1 
ATOM   3309 N N     . ALA A 1 425 ? -14.530 -11.498 -0.847  1.00 54.03  ? 722  ALA A N     1 
ATOM   3310 C CA    . ALA A 1 425 ? -15.583 -11.528 -1.860  1.00 60.16  ? 722  ALA A CA    1 
ATOM   3311 C C     . ALA A 1 425 ? -16.969 -11.436 -1.225  1.00 57.65  ? 722  ALA A C     1 
ATOM   3312 O O     . ALA A 1 425 ? -17.773 -10.571 -1.587  1.00 55.00  ? 722  ALA A O     1 
ATOM   3313 C CB    . ALA A 1 425 ? -15.441 -12.787 -2.700  1.00 56.51  ? 722  ALA A CB    1 
ATOM   3314 N N     . GLN A 1 426 ? -17.221 -12.259 -0.210  1.00 60.35  ? 723  GLN A N     1 
ATOM   3315 C CA    . GLN A 1 426 ? -18.527 -12.217 0.462   1.00 58.11  ? 723  GLN A CA    1 
ATOM   3316 C C     . GLN A 1 426 ? -18.728 -10.826 0.987   1.00 60.60  ? 723  GLN A C     1 
ATOM   3317 O O     . GLN A 1 426 ? -19.797 -10.248 0.899   1.00 64.91  ? 723  GLN A O     1 
ATOM   3318 C CB    . GLN A 1 426 ? -18.601 -13.217 1.624   1.00 58.02  ? 723  GLN A CB    1 
ATOM   3319 N N     . ASN A 1 427 ? -17.656 -10.289 1.540   1.00 65.90  ? 724  ASN A N     1 
ATOM   3320 C CA    . ASN A 1 427 ? -17.696 -9.017  2.224   1.00 60.57  ? 724  ASN A CA    1 
ATOM   3321 C C     . ASN A 1 427 ? -17.985 -7.820  1.329   1.00 59.11  ? 724  ASN A C     1 
ATOM   3322 O O     . ASN A 1 427 ? -18.676 -6.885  1.709   1.00 49.74  ? 724  ASN A O     1 
ATOM   3323 C CB    . ASN A 1 427 ? -16.338 -8.796  2.828   1.00 73.32  ? 724  ASN A CB    1 
ATOM   3324 C CG    . ASN A 1 427 ? -16.429 -8.487  4.265   1.00 74.05  ? 724  ASN A CG    1 
ATOM   3325 O OD1   . ASN A 1 427 ? -17.011 -7.477  4.637   1.00 89.64  ? 724  ASN A OD1   1 
ATOM   3326 N ND2   . ASN A 1 427 ? -15.869 -9.357  5.101   1.00 71.16  ? 724  ASN A ND2   1 
ATOM   3327 N N     . LEU A 1 428 ? -17.412 -7.836  0.139   1.00 52.05  ? 725  LEU A N     1 
ATOM   3328 C CA    . LEU A 1 428 ? -17.542 -6.689  -0.736  1.00 50.44  ? 725  LEU A CA    1 
ATOM   3329 C C     . LEU A 1 428 ? -18.678 -6.941  -1.731  1.00 56.28  ? 725  LEU A C     1 
ATOM   3330 O O     . LEU A 1 428 ? -18.921 -6.126  -2.608  1.00 50.09  ? 725  LEU A O     1 
ATOM   3331 C CB    . LEU A 1 428 ? -16.214 -6.471  -1.468  1.00 48.16  ? 725  LEU A CB    1 
ATOM   3332 C CG    . LEU A 1 428 ? -15.166 -5.847  -0.536  1.00 45.68  ? 725  LEU A CG    1 
ATOM   3333 C CD1   . LEU A 1 428 ? -13.808 -5.783  -1.226  1.00 44.03  ? 725  LEU A CD1   1 
ATOM   3334 C CD2   . LEU A 1 428 ? -15.648 -4.465  -0.123  1.00 43.89  ? 725  LEU A CD2   1 
ATOM   3335 N N     . ASN A 1 429 ? -19.356 -8.079  -1.560  1.00 58.15  ? 726  ASN A N     1 
ATOM   3336 C CA    . ASN A 1 429 ? -20.268 -8.588  -2.541  1.00 59.51  ? 726  ASN A CA    1 
ATOM   3337 C C     . ASN A 1 429 ? -19.666 -8.600  -3.978  1.00 54.36  ? 726  ASN A C     1 
ATOM   3338 O O     . ASN A 1 429 ? -20.205 -7.977  -4.866  1.00 51.93  ? 726  ASN A O     1 
ATOM   3339 C CB    . ASN A 1 429 ? -21.543 -7.765  -2.439  1.00 62.35  ? 726  ASN A CB    1 
ATOM   3340 C CG    . ASN A 1 429 ? -22.726 -8.484  -3.024  1.00 74.90  ? 726  ASN A CG    1 
ATOM   3341 O OD1   . ASN A 1 429 ? -22.780 -9.712  -2.993  1.00 85.15  ? 726  ASN A OD1   1 
ATOM   3342 N ND2   . ASN A 1 429 ? -23.665 -7.735  -3.593  1.00 72.92  ? 726  ASN A ND2   1 
ATOM   3343 N N     . ILE A 1 430 ? -18.530 -9.272  -4.169  1.00 48.45  ? 727  ILE A N     1 
ATOM   3344 C CA    . ILE A 1 430 ? -17.828 -9.326  -5.474  1.00 52.94  ? 727  ILE A CA    1 
ATOM   3345 C C     . ILE A 1 430 ? -17.390 -10.758 -5.751  1.00 50.80  ? 727  ILE A C     1 
ATOM   3346 O O     . ILE A 1 430 ? -17.704 -11.602 -4.955  1.00 58.59  ? 727  ILE A O     1 
ATOM   3347 C CB    . ILE A 1 430 ? -16.617 -8.361  -5.543  1.00 50.26  ? 727  ILE A CB    1 
ATOM   3348 C CG1   . ILE A 1 430 ? -15.551 -8.726  -4.474  1.00 56.56  ? 727  ILE A CG1   1 
ATOM   3349 C CG2   . ILE A 1 430 ? -17.122 -6.937  -5.365  1.00 48.91  ? 727  ILE A CG2   1 
ATOM   3350 C CD1   . ILE A 1 430 ? -14.314 -7.799  -4.405  1.00 51.83  ? 727  ILE A CD1   1 
ATOM   3351 N N     . SER A 1 431 ? -16.675 -11.032 -6.854  1.00 52.45  ? 728  SER A N     1 
ATOM   3352 C CA    . SER A 1 431 ? -16.255 -12.414 -7.189  1.00 50.62  ? 728  SER A CA    1 
ATOM   3353 C C     . SER A 1 431 ? -14.960 -12.783 -6.515  1.00 59.92  ? 728  SER A C     1 
ATOM   3354 O O     . SER A 1 431 ? -14.228 -11.933 -6.032  1.00 66.15  ? 728  SER A O     1 
ATOM   3355 C CB    . SER A 1 431 ? -16.027 -12.616 -8.683  1.00 50.45  ? 728  SER A CB    1 
ATOM   3356 O OG    . SER A 1 431 ? -14.812 -11.978 -9.119  1.00 51.29  ? 728  SER A OG    1 
ATOM   3357 N N     . ARG A 1 432 ? -14.656 -14.074 -6.534  1.00 58.40  ? 729  ARG A N     1 
ATOM   3358 C CA    . ARG A 1 432 ? -13.467 -14.596 -5.902  1.00 59.41  ? 729  ARG A CA    1 
ATOM   3359 C C     . ARG A 1 432 ? -12.212 -14.117 -6.623  1.00 59.50  ? 729  ARG A C     1 
ATOM   3360 O O     . ARG A 1 432 ? -11.250 -13.687 -5.985  1.00 56.32  ? 729  ARG A O     1 
ATOM   3361 C CB    . ARG A 1 432 ? -13.531 -16.117 -5.884  1.00 64.68  ? 729  ARG A CB    1 
ATOM   3362 C CG    . ARG A 1 432 ? -12.391 -16.809 -5.152  1.00 67.96  ? 729  ARG A CG    1 
ATOM   3363 C CD    . ARG A 1 432 ? -12.069 -18.135 -5.821  1.00 68.56  ? 729  ARG A CD    1 
ATOM   3364 N NE    . ARG A 1 432 ? -11.363 -17.938 -7.090  1.00 70.32  ? 729  ARG A NE    1 
ATOM   3365 N N     . LYS A 1 433 ? -12.208 -14.167 -7.945  1.00 53.34  ? 730  LYS A N     1 
ATOM   3366 C CA    . LYS A 1 433 ? -11.018 -13.717 -8.684  1.00 52.62  ? 730  LYS A CA    1 
ATOM   3367 C C     . LYS A 1 433 ? -10.792 -12.217 -8.413  1.00 60.04  ? 730  LYS A C     1 
ATOM   3368 O O     . LYS A 1 433 ? -9.658  -11.723 -8.367  1.00 55.67  ? 730  LYS A O     1 
ATOM   3369 C CB    . LYS A 1 433 ? -11.177 -13.939 -10.180 1.00 53.29  ? 730  LYS A CB    1 
ATOM   3370 N N     . GLU A 1 434 ? -11.897 -11.486 -8.249  1.00 61.45  ? 731  GLU A N     1 
ATOM   3371 C CA    . GLU A 1 434 ? -11.809 -10.031 -8.068  1.00 62.52  ? 731  GLU A CA    1 
ATOM   3372 C C     . GLU A 1 434 ? -11.086 -9.716  -6.736  1.00 55.57  ? 731  GLU A C     1 
ATOM   3373 O O     . GLU A 1 434 ? -10.083 -9.024  -6.738  1.00 49.85  ? 731  GLU A O     1 
ATOM   3374 C CB    . GLU A 1 434 ? -13.198 -9.381  -8.113  1.00 62.26  ? 731  GLU A CB    1 
ATOM   3375 C CG    . GLU A 1 434 ? -13.599 -8.937  -9.518  1.00 64.38  ? 731  GLU A CG    1 
ATOM   3376 C CD    . GLU A 1 434 ? -15.070 -8.596  -9.649  1.00 63.80  ? 731  GLU A CD    1 
ATOM   3377 O OE1   . GLU A 1 434 ? -15.961 -9.034  -8.843  1.00 64.72  ? 731  GLU A OE1   1 
ATOM   3378 O OE2   . GLU A 1 434 ? -15.335 -7.884  -10.614 1.00 68.21  ? 731  GLU A OE2   1 
ATOM   3379 N N     . ALA A 1 435 ? -11.605 -10.301 -5.653  1.00 48.26  ? 732  ALA A N     1 
ATOM   3380 C CA    . ALA A 1 435 ? -11.000 -10.257 -4.324  1.00 51.14  ? 732  ALA A CA    1 
ATOM   3381 C C     . ALA A 1 435 ? -9.498  -10.601 -4.318  1.00 54.25  ? 732  ALA A C     1 
ATOM   3382 O O     . ALA A 1 435 ? -8.713  -9.881  -3.672  1.00 46.53  ? 732  ALA A O     1 
ATOM   3383 C CB    . ALA A 1 435 ? -11.779 -11.153 -3.362  1.00 52.91  ? 732  ALA A CB    1 
ATOM   3384 N N     . ALA A 1 436 ? -9.093  -11.643 -5.049  1.00 44.81  ? 733  ALA A N     1 
ATOM   3385 C CA    . ALA A 1 436 ? -7.644  -11.998 -5.179  1.00 50.85  ? 733  ALA A CA    1 
ATOM   3386 C C     . ALA A 1 436 ? -6.784  -10.920 -5.782  1.00 52.22  ? 733  ALA A C     1 
ATOM   3387 O O     . ALA A 1 436 ? -5.554  -10.830 -5.497  1.00 51.01  ? 733  ALA A O     1 
ATOM   3388 C CB    . ALA A 1 436 ? -7.444  -13.273 -6.031  1.00 52.91  ? 733  ALA A CB    1 
ATOM   3389 N N     . GLU A 1 437 ? -7.376  -10.159 -6.698  1.00 49.75  ? 734  GLU A N     1 
ATOM   3390 C CA    . GLU A 1 437 ? -6.629  -9.099  -7.382  1.00 53.60  ? 734  GLU A CA    1 
ATOM   3391 C C     . GLU A 1 437 ? -6.367  -7.973  -6.370  1.00 45.57  ? 734  GLU A C     1 
ATOM   3392 O O     . GLU A 1 437 ? -5.289  -7.350  -6.422  1.00 46.57  ? 734  GLU A O     1 
ATOM   3393 C CB    . GLU A 1 437 ? -7.385  -8.538  -8.612  1.00 50.88  ? 734  GLU A CB    1 
ATOM   3394 N N     . PHE A 1 438 ? -7.355  -7.720  -5.489  1.00 43.18  ? 735  PHE A N     1 
ATOM   3395 C CA    . PHE A 1 438 ? -7.251  -6.656  -4.466  1.00 43.97  ? 735  PHE A CA    1 
ATOM   3396 C C     . PHE A 1 438 ? -6.119  -7.018  -3.493  1.00 43.06  ? 735  PHE A C     1 
ATOM   3397 O O     . PHE A 1 438 ? -5.211  -6.216  -3.253  1.00 49.20  ? 735  PHE A O     1 
ATOM   3398 C CB    . PHE A 1 438 ? -8.553  -6.490  -3.660  1.00 49.84  ? 735  PHE A CB    1 
ATOM   3399 C CG    . PHE A 1 438 ? -9.651  -5.707  -4.359  1.00 50.96  ? 735  PHE A CG    1 
ATOM   3400 C CD1   . PHE A 1 438 ? -9.457  -5.080  -5.570  1.00 56.11  ? 735  PHE A CD1   1 
ATOM   3401 C CD2   . PHE A 1 438 ? -10.920 -5.657  -3.796  1.00 58.22  ? 735  PHE A CD2   1 
ATOM   3402 C CE1   . PHE A 1 438 ? -10.499 -4.409  -6.203  1.00 59.28  ? 735  PHE A CE1   1 
ATOM   3403 C CE2   . PHE A 1 438 ? -11.960 -4.964  -4.412  1.00 59.79  ? 735  PHE A CE2   1 
ATOM   3404 C CZ    . PHE A 1 438 ? -11.746 -4.347  -5.612  1.00 55.53  ? 735  PHE A CZ    1 
ATOM   3405 N N     . ILE A 1 439 ? -6.144  -8.261  -3.021  1.00 41.31  ? 736  ILE A N     1 
ATOM   3406 C CA    . ILE A 1 439 ? -5.119  -8.803  -2.125  1.00 41.07  ? 736  ILE A CA    1 
ATOM   3407 C C     . ILE A 1 439 ? -3.740  -8.795  -2.749  1.00 40.98  ? 736  ILE A C     1 
ATOM   3408 O O     . ILE A 1 439 ? -2.781  -8.357  -2.096  1.00 43.29  ? 736  ILE A O     1 
ATOM   3409 C CB    . ILE A 1 439 ? -5.497  -10.209 -1.693  1.00 46.00  ? 736  ILE A CB    1 
ATOM   3410 C CG1   . ILE A 1 439 ? -6.754  -10.157 -0.834  1.00 41.42  ? 736  ILE A CG1   1 
ATOM   3411 C CG2   . ILE A 1 439 ? -4.347  -10.838 -0.914  1.00 53.11  ? 736  ILE A CG2   1 
ATOM   3412 C CD1   . ILE A 1 439 ? -7.424  -11.497 -0.703  1.00 45.79  ? 736  ILE A CD1   1 
ATOM   3413 N N     . GLU A 1 440 ? -3.614  -9.216  -4.012  1.00 41.45  ? 737  GLU A N     1 
ATOM   3414 C CA    . GLU A 1 440 ? -2.289  -9.168  -4.685  1.00 40.64  ? 737  GLU A CA    1 
ATOM   3415 C C     . GLU A 1 440 ? -1.760  -7.750  -4.782  1.00 40.66  ? 737  GLU A C     1 
ATOM   3416 O O     . GLU A 1 440 ? -0.583  -7.537  -4.570  1.00 41.24  ? 737  GLU A O     1 
ATOM   3417 C CB    . GLU A 1 440 ? -2.253  -9.801  -6.112  1.00 41.33  ? 737  GLU A CB    1 
ATOM   3418 N N     . ARG A 1 441 ? -2.620  -6.788  -5.142  1.00 37.89  ? 738  ARG A N     1 
ATOM   3419 C CA    . ARG A 1 441 ? -2.216  -5.371  -5.252  1.00 38.96  ? 738  ARG A CA    1 
ATOM   3420 C C     . ARG A 1 441 ? -1.881  -4.832  -3.823  1.00 36.57  ? 738  ARG A C     1 
ATOM   3421 O O     . ARG A 1 441 ? -0.912  -4.102  -3.629  1.00 37.80  ? 738  ARG A O     1 
ATOM   3422 C CB    . ARG A 1 441 ? -3.332  -4.521  -5.896  1.00 40.68  ? 738  ARG A CB    1 
ATOM   3423 C CG    . ARG A 1 441 ? -3.354  -4.458  -7.437  1.00 46.77  ? 738  ARG A CG    1 
ATOM   3424 C CD    . ARG A 1 441 ? -2.241  -3.592  -8.018  1.00 48.54  ? 738  ARG A CD    1 
ATOM   3425 N N     . TYR A 1 442 ? -2.652  -5.250  -2.817  1.00 36.58  ? 739  TYR A N     1 
ATOM   3426 C CA    . TYR A 1 442 ? -2.293  -4.881  -1.444  1.00 37.39  ? 739  TYR A CA    1 
ATOM   3427 C C     . TYR A 1 442 ? -0.851  -5.336  -1.131  1.00 34.59  ? 739  TYR A C     1 
ATOM   3428 O O     . TYR A 1 442 ? -0.042  -4.581  -0.664  1.00 35.88  ? 739  TYR A O     1 
ATOM   3429 C CB    . TYR A 1 442 ? -3.257  -5.511  -0.418  1.00 35.90  ? 739  TYR A CB    1 
ATOM   3430 C CG    . TYR A 1 442 ? -2.928  -5.050  0.989   1.00 30.86  ? 739  TYR A CG    1 
ATOM   3431 C CD1   . TYR A 1 442 ? -2.010  -5.755  1.766   1.00 33.57  ? 739  TYR A CD1   1 
ATOM   3432 C CD2   . TYR A 1 442 ? -3.495  -3.917  1.533   1.00 31.22  ? 739  TYR A CD2   1 
ATOM   3433 C CE1   . TYR A 1 442 ? -1.639  -5.325  3.026   1.00 28.71  ? 739  TYR A CE1   1 
ATOM   3434 C CE2   . TYR A 1 442 ? -3.147  -3.476  2.818   1.00 30.57  ? 739  TYR A CE2   1 
ATOM   3435 C CZ    . TYR A 1 442 ? -2.209  -4.216  3.562   1.00 31.49  ? 739  TYR A CZ    1 
ATOM   3436 O OH    . TYR A 1 442 ? -1.806  -3.812  4.807   1.00 36.02  ? 739  TYR A OH    1 
ATOM   3437 N N     . PHE A 1 443 ? -0.565  -6.602  -1.392  1.00 35.18  ? 740  PHE A N     1 
ATOM   3438 C CA    . PHE A 1 443 ? 0.698   -7.159  -0.988  1.00 35.31  ? 740  PHE A CA    1 
ATOM   3439 C C     . PHE A 1 443 ? 1.817   -6.576  -1.823  1.00 35.41  ? 740  PHE A C     1 
ATOM   3440 O O     . PHE A 1 443 ? 2.928   -6.444  -1.323  1.00 36.21  ? 740  PHE A O     1 
ATOM   3441 C CB    . PHE A 1 443 ? 0.679   -8.693  -1.069  1.00 33.91  ? 740  PHE A CB    1 
ATOM   3442 C CG    . PHE A 1 443 ? -0.054  -9.343  0.026   1.00 33.01  ? 740  PHE A CG    1 
ATOM   3443 C CD1   . PHE A 1 443 ? 0.101   -8.931  1.329   1.00 35.52  ? 740  PHE A CD1   1 
ATOM   3444 C CD2   . PHE A 1 443 ? -0.874  -10.411 -0.224  1.00 40.84  ? 740  PHE A CD2   1 
ATOM   3445 C CE1   . PHE A 1 443 ? -0.566  -9.543  2.338   1.00 34.83  ? 740  PHE A CE1   1 
ATOM   3446 C CE2   . PHE A 1 443 ? -1.544  -11.054 0.786   1.00 39.32  ? 740  PHE A CE2   1 
ATOM   3447 C CZ    . PHE A 1 443 ? -1.398  -10.630 2.073   1.00 36.41  ? 740  PHE A CZ    1 
ATOM   3448 N N     . GLU A 1 444 ? 1.524   -6.154  -3.062  1.00 35.19  ? 741  GLU A N     1 
ATOM   3449 C CA    . GLU A 1 444 ? 2.530   -5.429  -3.875  1.00 34.98  ? 741  GLU A CA    1 
ATOM   3450 C C     . GLU A 1 444 ? 2.838   -4.075  -3.278  1.00 41.50  ? 741  GLU A C     1 
ATOM   3451 O O     . GLU A 1 444 ? 3.973   -3.609  -3.344  1.00 39.05  ? 741  GLU A O     1 
ATOM   3452 C CB    . GLU A 1 444 ? 2.101   -5.267  -5.366  1.00 40.44  ? 741  GLU A CB    1 
ATOM   3453 N N     . SER A 1 445 ? 1.852   -3.425  -2.652  1.00 37.53  ? 742  SER A N     1 
ATOM   3454 C CA    . SER A 1 445 ? 2.134   -2.123  -1.989  1.00 36.55  ? 742  SER A CA    1 
ATOM   3455 C C     . SER A 1 445 ? 2.682   -2.277  -0.589  1.00 32.29  ? 742  SER A C     1 
ATOM   3456 O O     . SER A 1 445 ? 3.364   -1.375  -0.099  1.00 28.67  ? 742  SER A O     1 
ATOM   3457 C CB    . SER A 1 445 ? 0.876   -1.291  -1.910  1.00 42.36  ? 742  SER A CB    1 
ATOM   3458 O OG    . SER A 1 445 ? 0.337   -1.106  -3.203  1.00 43.99  ? 742  SER A OG    1 
ATOM   3459 N N     . PHE A 1 446 ? 2.379   -3.411  0.066   1.00 28.65  ? 743  PHE A N     1 
ATOM   3460 C CA    . PHE A 1 446 ? 2.843   -3.630  1.447   1.00 28.84  ? 743  PHE A CA    1 
ATOM   3461 C C     . PHE A 1 446 ? 3.604   -4.973  1.568   1.00 26.64  ? 743  PHE A C     1 
ATOM   3462 O O     . PHE A 1 446 ? 3.109   -5.919  2.153   1.00 23.84  ? 743  PHE A O     1 
ATOM   3463 C CB    . PHE A 1 446 ? 1.618   -3.581  2.373   1.00 28.74  ? 743  PHE A CB    1 
ATOM   3464 C CG    . PHE A 1 446 ? 0.901   -2.267  2.346   1.00 29.46  ? 743  PHE A CG    1 
ATOM   3465 C CD1   . PHE A 1 446 ? 1.415   -1.183  3.044   1.00 31.11  ? 743  PHE A CD1   1 
ATOM   3466 C CD2   . PHE A 1 446 ? -0.269  -2.109  1.630   1.00 28.99  ? 743  PHE A CD2   1 
ATOM   3467 C CE1   . PHE A 1 446 ? 0.780   0.048   3.031   1.00 29.65  ? 743  PHE A CE1   1 
ATOM   3468 C CE2   . PHE A 1 446 ? -0.926  -0.885  1.584   1.00 30.03  ? 743  PHE A CE2   1 
ATOM   3469 C CZ    . PHE A 1 446 ? -0.377  0.215   2.278   1.00 31.50  ? 743  PHE A CZ    1 
ATOM   3470 N N     . PRO A 1 447 ? 4.795   -5.073  0.949   1.00 29.26  ? 744  PRO A N     1 
ATOM   3471 C CA    . PRO A 1 447 ? 5.455   -6.361  0.805   1.00 30.60  ? 744  PRO A CA    1 
ATOM   3472 C C     . PRO A 1 447 ? 5.931   -6.861  2.173   1.00 28.94  ? 744  PRO A C     1 
ATOM   3473 O O     . PRO A 1 447 ? 6.050   -8.066  2.395   1.00 24.54  ? 744  PRO A O     1 
ATOM   3474 C CB    . PRO A 1 447 ? 6.683   -6.046  -0.139  1.00 31.20  ? 744  PRO A CB    1 
ATOM   3475 C CG    . PRO A 1 447 ? 6.887   -4.541  0.000   1.00 30.59  ? 744  PRO A CG    1 
ATOM   3476 C CD    . PRO A 1 447 ? 5.486   -4.009  0.178   1.00 28.76  ? 744  PRO A CD    1 
ATOM   3477 N N     . GLY A 1 448 ? 6.134   -5.955  3.110   1.00 24.98  ? 745  GLY A N     1 
ATOM   3478 C CA    . GLY A 1 448 ? 6.513   -6.271  4.494   1.00 24.78  ? 745  GLY A CA    1 
ATOM   3479 C C     . GLY A 1 448 ? 5.376   -7.027  5.213   1.00 24.86  ? 745  GLY A C     1 
ATOM   3480 O O     . GLY A 1 448 ? 5.594   -7.984  5.972   1.00 25.89  ? 745  GLY A O     1 
ATOM   3481 N N     . VAL A 1 449 ? 4.140   -6.628  4.943   1.00 23.05  ? 746  VAL A N     1 
ATOM   3482 C CA    . VAL A 1 449 ? 2.965   -7.303  5.505   1.00 24.15  ? 746  VAL A CA    1 
ATOM   3483 C C     . VAL A 1 449 ? 2.834   -8.681  4.870   1.00 24.63  ? 746  VAL A C     1 
ATOM   3484 O O     . VAL A 1 449 ? 2.527   -9.673  5.529   1.00 26.46  ? 746  VAL A O     1 
ATOM   3485 C CB    . VAL A 1 449 ? 1.707   -6.500  5.252   1.00 25.13  ? 746  VAL A CB    1 
ATOM   3486 C CG1   . VAL A 1 449 ? 0.463   -7.252  5.719   1.00 28.17  ? 746  VAL A CG1   1 
ATOM   3487 C CG2   . VAL A 1 449 ? 1.817   -5.125  5.965   1.00 28.54  ? 746  VAL A CG2   1 
ATOM   3488 N N     . LYS A 1 450 ? 3.120   -8.774  3.595   1.00 26.97  ? 747  LYS A N     1 
ATOM   3489 C CA    . LYS A 1 450 ? 3.092   -10.107 2.934   1.00 28.49  ? 747  LYS A CA    1 
ATOM   3490 C C     . LYS A 1 450 ? 4.119   -11.024 3.580   1.00 27.18  ? 747  LYS A C     1 
ATOM   3491 O O     . LYS A 1 450 ? 3.830   -12.179 3.866   1.00 27.46  ? 747  LYS A O     1 
ATOM   3492 C CB    . LYS A 1 450 ? 3.416   -9.954  1.436   1.00 32.38  ? 747  LYS A CB    1 
ATOM   3493 C CG    . LYS A 1 450 ? 3.331   -11.240 0.582   1.00 37.02  ? 747  LYS A CG    1 
ATOM   3494 C CD    . LYS A 1 450 ? 4.000   -10.983 -0.798  1.00 42.30  ? 747  LYS A CD    1 
ATOM   3495 C CE    . LYS A 1 450 ? 4.194   -12.194 -1.723  1.00 49.30  ? 747  LYS A CE    1 
ATOM   3496 N NZ    . LYS A 1 450 ? 2.898   -12.874 -1.887  1.00 51.59  ? 747  LYS A NZ    1 
ATOM   3497 N N     . ARG A 1 451 ? 5.351   -10.538 3.716   1.00 29.30  ? 748  ARG A N     1 
ATOM   3498 C CA    . ARG A 1 451 ? 6.420   -11.327 4.353   1.00 32.03  ? 748  ARG A CA    1 
ATOM   3499 C C     . ARG A 1 451 ? 5.968   -11.819 5.754   1.00 30.31  ? 748  ARG A C     1 
ATOM   3500 O O     . ARG A 1 451 ? 6.140   -12.973 6.087   1.00 27.02  ? 748  ARG A O     1 
ATOM   3501 C CB    . ARG A 1 451 ? 7.738   -10.555 4.434   1.00 29.46  ? 748  ARG A CB    1 
ATOM   3502 N N     . TYR A 1 452 ? 5.403   -10.916 6.549   1.00 26.35  ? 749  TYR A N     1 
ATOM   3503 C CA    . TYR A 1 452 ? 4.883   -11.229 7.866   1.00 26.75  ? 749  TYR A CA    1 
ATOM   3504 C C     . TYR A 1 452 ? 3.864   -12.328 7.826   1.00 25.36  ? 749  TYR A C     1 
ATOM   3505 O O     . TYR A 1 452 ? 3.971   -13.264 8.587   1.00 26.76  ? 749  TYR A O     1 
ATOM   3506 C CB    . TYR A 1 452 ? 4.303   -9.971  8.607   1.00 25.69  ? 749  TYR A CB    1 
ATOM   3507 C CG    . TYR A 1 452 ? 3.375   -10.355 9.757   1.00 23.17  ? 749  TYR A CG    1 
ATOM   3508 C CD1   . TYR A 1 452 ? 3.882   -10.809 10.958  1.00 26.87  ? 749  TYR A CD1   1 
ATOM   3509 C CD2   . TYR A 1 452 ? 1.989   -10.319 9.595   1.00 25.97  ? 749  TYR A CD2   1 
ATOM   3510 C CE1   . TYR A 1 452 ? 3.050   -11.261 11.969  1.00 25.80  ? 749  TYR A CE1   1 
ATOM   3511 C CE2   . TYR A 1 452 ? 1.121   -10.739 10.616  1.00 26.57  ? 749  TYR A CE2   1 
ATOM   3512 C CZ    . TYR A 1 452 ? 1.670   -11.208 11.808  1.00 27.99  ? 749  TYR A CZ    1 
ATOM   3513 O OH    . TYR A 1 452 ? 0.796   -11.663 12.845  1.00 28.71  ? 749  TYR A OH    1 
ATOM   3514 N N     . MET A 1 453 ? 2.920   -12.240 6.921   1.00 24.25  ? 750  MET A N     1 
ATOM   3515 C CA    . MET A 1 453 ? 1.879   -13.214 6.825   1.00 25.46  ? 750  MET A CA    1 
ATOM   3516 C C     . MET A 1 453 ? 2.408   -14.607 6.481   1.00 29.60  ? 750  MET A C     1 
ATOM   3517 O O     . MET A 1 453 ? 1.929   -15.558 7.019   1.00 27.95  ? 750  MET A O     1 
ATOM   3518 C CB    . MET A 1 453 ? 0.856   -12.817 5.797   1.00 25.97  ? 750  MET A CB    1 
ATOM   3519 C CG    . MET A 1 453 ? 0.052   -11.555 6.149   1.00 31.25  ? 750  MET A CG    1 
ATOM   3520 S SD    . MET A 1 453 ? -0.993  -11.654 7.666   1.00 38.44  ? 750  MET A SD    1 
ATOM   3521 C CE    . MET A 1 453 ? -1.462  -9.923  7.922   1.00 38.45  ? 750  MET A CE    1 
ATOM   3522 N N     . GLU A 1 454 ? 3.396   -14.692 5.570   1.00 25.90  ? 751  GLU A N     1 
ATOM   3523 C CA    . GLU A 1 454 ? 4.033   -15.931 5.233   1.00 26.63  ? 751  GLU A CA    1 
ATOM   3524 C C     . GLU A 1 454 ? 4.846   -16.462 6.398   1.00 24.22  ? 751  GLU A C     1 
ATOM   3525 O O     . GLU A 1 454 ? 4.795   -17.645 6.725   1.00 24.44  ? 751  GLU A O     1 
ATOM   3526 C CB    . GLU A 1 454 ? 4.996   -15.727 4.011   1.00 28.70  ? 751  GLU A CB    1 
ATOM   3527 C CG    . GLU A 1 454 ? 4.267   -15.412 2.703   1.00 30.72  ? 751  GLU A CG    1 
ATOM   3528 C CD    . GLU A 1 454 ? 5.240   -14.873 1.610   1.00 38.42  ? 751  GLU A CD    1 
ATOM   3529 O OE1   . GLU A 1 454 ? 6.414   -14.452 1.891   1.00 40.68  ? 751  GLU A OE1   1 
ATOM   3530 O OE2   . GLU A 1 454 ? 4.805   -14.839 0.451   1.00 44.01  ? 751  GLU A OE2   1 
ATOM   3531 N N     . ASN A 1 455 ? 5.604   -15.579 7.015   1.00 24.35  ? 752  ASN A N     1 
ATOM   3532 C CA    . ASN A 1 455 ? 6.501   -15.963 8.089   1.00 24.94  ? 752  ASN A CA    1 
ATOM   3533 C C     . ASN A 1 455 ? 5.774   -16.435 9.336   1.00 27.43  ? 752  ASN A C     1 
ATOM   3534 O O     . ASN A 1 455 ? 6.195   -17.368 9.961   1.00 27.65  ? 752  ASN A O     1 
ATOM   3535 C CB    . ASN A 1 455 ? 7.419   -14.836 8.440   1.00 27.99  ? 752  ASN A CB    1 
ATOM   3536 C CG    . ASN A 1 455 ? 8.522   -14.619 7.405   1.00 32.12  ? 752  ASN A CG    1 
ATOM   3537 O OD1   . ASN A 1 455 ? 8.683   -15.377 6.521   1.00 30.70  ? 752  ASN A OD1   1 
ATOM   3538 N ND2   . ASN A 1 455 ? 9.264   -13.556 7.548   1.00 35.36  ? 752  ASN A ND2   1 
ATOM   3539 N N     . ILE A 1 456 ? 4.661   -15.794 9.679   1.00 25.12  ? 753  ILE A N     1 
ATOM   3540 C CA    . ILE A 1 456 ? 3.951   -16.148 10.879  1.00 25.21  ? 753  ILE A CA    1 
ATOM   3541 C C     . ILE A 1 456 ? 3.277   -17.500 10.757  1.00 23.71  ? 753  ILE A C     1 
ATOM   3542 O O     . ILE A 1 456 ? 3.235   -18.253 11.719  1.00 25.04  ? 753  ILE A O     1 
ATOM   3543 C CB    . ILE A 1 456 ? 2.997   -15.024 11.324  1.00 25.20  ? 753  ILE A CB    1 
ATOM   3544 C CG1   . ILE A 1 456 ? 2.631   -15.223 12.806  1.00 27.16  ? 753  ILE A CG1   1 
ATOM   3545 C CG2   . ILE A 1 456 ? 1.775   -14.964 10.419  1.00 26.59  ? 753  ILE A CG2   1 
ATOM   3546 C CD1   . ILE A 1 456 ? 3.763   -14.955 13.796  1.00 26.40  ? 753  ILE A CD1   1 
ATOM   3547 N N     . VAL A 1 457 ? 2.748   -17.821 9.574   1.00 23.71  ? 754  VAL A N     1 
ATOM   3548 C CA    . VAL A 1 457 ? 2.226   -19.114 9.304   1.00 23.74  ? 754  VAL A CA    1 
ATOM   3549 C C     . VAL A 1 457 ? 3.286   -20.250 9.422   1.00 26.15  ? 754  VAL A C     1 
ATOM   3550 O O     . VAL A 1 457 ? 3.024   -21.281 10.037  1.00 25.19  ? 754  VAL A O     1 
ATOM   3551 C CB    . VAL A 1 457 ? 1.530   -19.147 7.954   1.00 26.90  ? 754  VAL A CB    1 
ATOM   3552 C CG1   . VAL A 1 457 ? 1.261   -20.565 7.476   1.00 27.02  ? 754  VAL A CG1   1 
ATOM   3553 C CG2   . VAL A 1 457 ? 0.285   -18.368 8.004   1.00 25.95  ? 754  VAL A CG2   1 
ATOM   3554 N N     . GLN A 1 458 ? 4.433   -20.088 8.807   1.00 27.62  ? 755  GLN A N     1 
ATOM   3555 C CA    . GLN A 1 458 ? 5.559   -20.978 8.988   1.00 30.15  ? 755  GLN A CA    1 
ATOM   3556 C C     . GLN A 1 458 ? 6.035   -21.074 10.467  1.00 27.96  ? 755  GLN A C     1 
ATOM   3557 O O     . GLN A 1 458 ? 6.349   -22.157 10.970  1.00 25.26  ? 755  GLN A O     1 
ATOM   3558 C CB    . GLN A 1 458 ? 6.761   -20.520 8.113   1.00 32.37  ? 755  GLN A CB    1 
ATOM   3559 N N     . GLU A 1 459 ? 6.056   -19.968 11.190  1.00 25.03  ? 756  GLU A N     1 
ATOM   3560 C CA    . GLU A 1 459 ? 6.400   -20.005 12.594  1.00 26.67  ? 756  GLU A CA    1 
ATOM   3561 C C     . GLU A 1 459 ? 5.358   -20.786 13.429  1.00 28.41  ? 756  GLU A C     1 
ATOM   3562 O O     . GLU A 1 459 ? 5.733   -21.593 14.315  1.00 26.98  ? 756  GLU A O     1 
ATOM   3563 C CB    . GLU A 1 459 ? 6.611   -18.599 13.150  1.00 32.24  ? 756  GLU A CB    1 
ATOM   3564 C CG    . GLU A 1 459 ? 7.430   -18.612 14.413  1.00 41.53  ? 756  GLU A CG    1 
ATOM   3565 C CD    . GLU A 1 459 ? 7.329   -17.301 15.170  1.00 49.03  ? 756  GLU A CD    1 
ATOM   3566 O OE1   . GLU A 1 459 ? 7.387   -16.240 14.546  1.00 47.63  ? 756  GLU A OE1   1 
ATOM   3567 O OE2   . GLU A 1 459 ? 7.133   -17.346 16.394  1.00 64.89  ? 756  GLU A OE2   1 
ATOM   3568 N N     . ALA A 1 460 ? 4.061   -20.615 13.139  1.00 24.83  ? 757  ALA A N     1 
ATOM   3569 C CA    . ALA A 1 460 ? 3.068   -21.359 13.868  1.00 25.16  ? 757  ALA A CA    1 
ATOM   3570 C C     . ALA A 1 460 ? 3.203   -22.894 13.638  1.00 26.80  ? 757  ALA A C     1 
ATOM   3571 O O     . ALA A 1 460 ? 2.910   -23.738 14.520  1.00 23.06  ? 757  ALA A O     1 
ATOM   3572 C CB    . ALA A 1 460 ? 1.695   -20.928 13.393  1.00 25.13  ? 757  ALA A CB    1 
ATOM   3573 N N     . LYS A 1 461 ? 3.528   -23.246 12.402  1.00 27.17  ? 758  LYS A N     1 
ATOM   3574 C CA    . LYS A 1 461 ? 3.728   -24.650 12.043  1.00 33.40  ? 758  LYS A CA    1 
ATOM   3575 C C     . LYS A 1 461 ? 4.981   -25.253 12.767  1.00 29.81  ? 758  LYS A C     1 
ATOM   3576 O O     . LYS A 1 461 ? 4.920   -26.354 13.333  1.00 28.12  ? 758  LYS A O     1 
ATOM   3577 C CB    . LYS A 1 461 ? 3.903   -24.797 10.513  1.00 31.28  ? 758  LYS A CB    1 
ATOM   3578 C CG    . LYS A 1 461 ? 4.184   -26.244 10.116  1.00 37.80  ? 758  LYS A CG    1 
ATOM   3579 C CD    . LYS A 1 461 ? 3.798   -26.578 8.672   1.00 44.19  ? 758  LYS A CD    1 
ATOM   3580 N N     . GLN A 1 462 ? 6.070   -24.498 12.758  1.00 26.80  ? 759  GLN A N     1 
ATOM   3581 C CA    . GLN A 1 462 ? 7.350   -24.877 13.370  1.00 31.30  ? 759  GLN A CA    1 
ATOM   3582 C C     . GLN A 1 462 ? 7.288   -25.023 14.886  1.00 28.37  ? 759  GLN A C     1 
ATOM   3583 O O     . GLN A 1 462 ? 7.663   -26.051 15.402  1.00 27.16  ? 759  GLN A O     1 
ATOM   3584 C CB    . GLN A 1 462 ? 8.449   -23.884 12.998  1.00 31.71  ? 759  GLN A CB    1 
ATOM   3585 C CG    . GLN A 1 462 ? 9.835   -24.269 13.477  1.00 34.84  ? 759  GLN A CG    1 
ATOM   3586 C CD    . GLN A 1 462 ? 10.311  -23.492 14.746  1.00 41.62  ? 759  GLN A CD    1 
ATOM   3587 O OE1   . GLN A 1 462 ? 10.491  -22.277 14.669  1.00 40.73  ? 759  GLN A OE1   1 
ATOM   3588 N NE2   . GLN A 1 462 ? 10.519  -24.205 15.941  1.00 34.68  ? 759  GLN A NE2   1 
ATOM   3589 N N     . LYS A 1 463 ? 6.768   -24.011 15.569  1.00 25.55  ? 760  LYS A N     1 
ATOM   3590 C CA    . LYS A 1 463 ? 6.757   -23.937 17.018  1.00 26.26  ? 760  LYS A CA    1 
ATOM   3591 C C     . LYS A 1 463 ? 5.491   -24.581 17.610  1.00 26.63  ? 760  LYS A C     1 
ATOM   3592 O O     . LYS A 1 463 ? 5.522   -25.093 18.718  1.00 25.19  ? 760  LYS A O     1 
ATOM   3593 C CB    . LYS A 1 463 ? 6.857   -22.482 17.472  1.00 29.18  ? 760  LYS A CB    1 
ATOM   3594 C CG    . LYS A 1 463 ? 8.177   -21.886 17.153  1.00 35.57  ? 760  LYS A CG    1 
ATOM   3595 C CD    . LYS A 1 463 ? 8.422   -20.580 17.841  1.00 40.26  ? 760  LYS A CD    1 
ATOM   3596 C CE    . LYS A 1 463 ? 9.749   -20.023 17.331  1.00 45.01  ? 760  LYS A CE    1 
ATOM   3597 N NZ    . LYS A 1 463 ? 10.412  -19.369 18.453  1.00 51.62  ? 760  LYS A NZ    1 
ATOM   3598 N N     . GLY A 1 464 ? 4.396   -24.569 16.860  1.00 25.26  ? 761  GLY A N     1 
ATOM   3599 C CA    . GLY A 1 464 ? 3.126   -25.038 17.378  1.00 25.47  ? 761  GLY A CA    1 
ATOM   3600 C C     . GLY A 1 464 ? 2.204   -23.931 17.903  1.00 23.16  ? 761  GLY A C     1 
ATOM   3601 O O     . GLY A 1 464 ? 1.052   -24.197 18.243  1.00 25.57  ? 761  GLY A O     1 
ATOM   3602 N N     . TYR A 1 465 ? 2.713   -22.700 17.963  1.00 22.22  ? 762  TYR A N     1 
ATOM   3603 C CA    . TYR A 1 465 ? 1.960   -21.602 18.525  1.00 23.17  ? 762  TYR A CA    1 
ATOM   3604 C C     . TYR A 1 465 ? 2.463   -20.273 17.963  1.00 25.88  ? 762  TYR A C     1 
ATOM   3605 O O     . TYR A 1 465 ? 3.526   -20.221 17.365  1.00 23.40  ? 762  TYR A O     1 
ATOM   3606 C CB    . TYR A 1 465 ? 2.074   -21.645 20.025  1.00 23.38  ? 762  TYR A CB    1 
ATOM   3607 C CG    . TYR A 1 465 ? 3.498   -21.484 20.518  1.00 24.39  ? 762  TYR A CG    1 
ATOM   3608 C CD1   . TYR A 1 465 ? 4.359   -22.612 20.644  1.00 25.57  ? 762  TYR A CD1   1 
ATOM   3609 C CD2   . TYR A 1 465 ? 4.021   -20.192 20.821  1.00 25.90  ? 762  TYR A CD2   1 
ATOM   3610 C CE1   . TYR A 1 465 ? 5.663   -22.436 21.080  1.00 26.78  ? 762  TYR A CE1   1 
ATOM   3611 C CE2   . TYR A 1 465 ? 5.342   -20.016 21.267  1.00 26.42  ? 762  TYR A CE2   1 
ATOM   3612 C CZ    . TYR A 1 465 ? 6.154   -21.141 21.365  1.00 29.51  ? 762  TYR A CZ    1 
ATOM   3613 O OH    . TYR A 1 465 ? 7.430   -20.993 21.790  1.00 23.32  ? 762  TYR A OH    1 
ATOM   3614 N N     . VAL A 1 466 ? 1.670   -19.210 18.175  1.00 23.95  ? 763  VAL A N     1 
ATOM   3615 C CA    . VAL A 1 466 ? 2.089   -17.851 17.895  1.00 24.17  ? 763  VAL A CA    1 
ATOM   3616 C C     . VAL A 1 466 ? 2.087   -17.046 19.175  1.00 23.31  ? 763  VAL A C     1 
ATOM   3617 O O     . VAL A 1 466 ? 1.410   -17.418 20.153  1.00 25.17  ? 763  VAL A O     1 
ATOM   3618 C CB    . VAL A 1 466 ? 1.231   -17.175 16.797  1.00 23.76  ? 763  VAL A CB    1 
ATOM   3619 C CG1   . VAL A 1 466 ? 1.359   -17.888 15.461  1.00 26.54  ? 763  VAL A CG1   1 
ATOM   3620 C CG2   . VAL A 1 466 ? -0.222  -17.131 17.185  1.00 22.72  ? 763  VAL A CG2   1 
ATOM   3621 N N     . THR A 1 467 ? 2.791   -15.934 19.184  1.00 23.63  ? 764  THR A N     1 
ATOM   3622 C CA    . THR A 1 467 ? 2.899   -15.117 20.385  1.00 25.24  ? 764  THR A CA    1 
ATOM   3623 C C     . THR A 1 467 ? 2.620   -13.656 20.125  1.00 25.61  ? 764  THR A C     1 
ATOM   3624 O O     . THR A 1 467 ? 2.630   -13.185 18.963  1.00 25.13  ? 764  THR A O     1 
ATOM   3625 C CB    . THR A 1 467 ? 4.293   -15.236 21.069  1.00 28.95  ? 764  THR A CB    1 
ATOM   3626 O OG1   . THR A 1 467 ? 5.214   -14.677 20.205  1.00 32.20  ? 764  THR A OG1   1 
ATOM   3627 C CG2   . THR A 1 467 ? 4.714   -16.643 21.309  1.00 29.52  ? 764  THR A CG2   1 
ATOM   3628 N N     . THR A 1 468 ? 2.288   -12.932 21.200  1.00 24.48  ? 765  THR A N     1 
ATOM   3629 C CA    . THR A 1 468 ? 2.056   -11.484 21.138  1.00 22.68  ? 765  THR A CA    1 
ATOM   3630 C C     . THR A 1 468 ? 3.258   -10.725 21.670  1.00 25.32  ? 765  THR A C     1 
ATOM   3631 O O     . THR A 1 468 ? 4.161   -11.303 22.254  1.00 23.79  ? 765  THR A O     1 
ATOM   3632 C CB    . THR A 1 468 ? 0.845   -11.091 21.993  1.00 22.14  ? 765  THR A CB    1 
ATOM   3633 O OG1   . THR A 1 468 ? 1.169   -11.304 23.365  1.00 23.18  ? 765  THR A OG1   1 
ATOM   3634 C CG2   . THR A 1 468 ? -0.394  -11.822 21.572  1.00 23.92  ? 765  THR A CG2   1 
ATOM   3635 N N     . LEU A 1 469 ? 3.208   -9.417  21.538  1.00 25.76  ? 766  LEU A N     1 
ATOM   3636 C CA    . LEU A 1 469 ? 4.238   -8.508  22.104  1.00 28.61  ? 766  LEU A CA    1 
ATOM   3637 C C     . LEU A 1 469 ? 4.645   -8.786  23.525  1.00 27.58  ? 766  LEU A C     1 
ATOM   3638 O O     . LEU A 1 469 ? 5.803   -8.752  23.859  1.00 24.43  ? 766  LEU A O     1 
ATOM   3639 C CB    . LEU A 1 469 ? 3.713   -7.120  22.093  1.00 35.32  ? 766  LEU A CB    1 
ATOM   3640 C CG    . LEU A 1 469 ? 4.648   -6.001  21.823  1.00 47.48  ? 766  LEU A CG    1 
ATOM   3641 C CD1   . LEU A 1 469 ? 5.007   -6.098  20.329  1.00 47.19  ? 766  LEU A CD1   1 
ATOM   3642 C CD2   . LEU A 1 469 ? 3.888   -4.717  22.176  1.00 47.60  ? 766  LEU A CD2   1 
ATOM   3643 N N     . LEU A 1 470 ? 3.681   -9.051  24.387  1.00 26.08  ? 767  LEU A N     1 
ATOM   3644 C CA    . LEU A 1 470 ? 3.996   -9.305  25.752  1.00 27.48  ? 767  LEU A CA    1 
ATOM   3645 C C     . LEU A 1 470 ? 4.024   -10.801 26.113  1.00 26.83  ? 767  LEU A C     1 
ATOM   3646 O O     . LEU A 1 470 ? 3.975   -11.125 27.265  1.00 27.23  ? 767  LEU A O     1 
ATOM   3647 C CB    . LEU A 1 470 ? 3.055   -8.493  26.682  1.00 28.25  ? 767  LEU A CB    1 
ATOM   3648 C CG    . LEU A 1 470 ? 3.069   -6.967  26.519  1.00 30.99  ? 767  LEU A CG    1 
ATOM   3649 C CD1   . LEU A 1 470 ? 2.401   -6.271  27.684  1.00 31.09  ? 767  LEU A CD1   1 
ATOM   3650 C CD2   . LEU A 1 470 ? 4.466   -6.378  26.400  1.00 32.71  ? 767  LEU A CD2   1 
ATOM   3651 N N     . HIS A 1 471 ? 4.077   -11.695 25.115  1.00 25.10  ? 768  HIS A N     1 
ATOM   3652 C CA    . HIS A 1 471 ? 4.342   -13.108 25.297  1.00 26.48  ? 768  HIS A CA    1 
ATOM   3653 C C     . HIS A 1 471 ? 3.144   -13.957 25.617  1.00 27.02  ? 768  HIS A C     1 
ATOM   3654 O O     . HIS A 1 471 ? 3.303   -15.080 26.078  1.00 23.87  ? 768  HIS A O     1 
ATOM   3655 C CB    . HIS A 1 471 ? 5.457   -13.391 26.342  1.00 29.79  ? 768  HIS A CB    1 
ATOM   3656 C CG    . HIS A 1 471 ? 6.766   -12.744 26.010  1.00 34.16  ? 768  HIS A CG    1 
ATOM   3657 N ND1   . HIS A 1 471 ? 7.642   -12.292 26.973  1.00 48.14  ? 768  HIS A ND1   1 
ATOM   3658 C CD2   . HIS A 1 471 ? 7.308   -12.385 24.818  1.00 42.30  ? 768  HIS A CD2   1 
ATOM   3659 C CE1   . HIS A 1 471 ? 8.663   -11.684 26.394  1.00 46.02  ? 768  HIS A CE1   1 
ATOM   3660 N NE2   . HIS A 1 471 ? 8.491   -11.736 25.089  1.00 42.01  ? 768  HIS A NE2   1 
ATOM   3661 N N     . ARG A 1 472 ? 1.944   -13.439 25.370  1.00 23.55  ? 769  ARG A N     1 
ATOM   3662 C CA    . ARG A 1 472 ? 0.751   -14.241 25.380  1.00 24.90  ? 769  ARG A CA    1 
ATOM   3663 C C     . ARG A 1 472 ? 0.912   -15.286 24.273  1.00 25.86  ? 769  ARG A C     1 
ATOM   3664 O O     . ARG A 1 472 ? 1.529   -14.988 23.264  1.00 24.88  ? 769  ARG A O     1 
ATOM   3665 C CB    . ARG A 1 472 ? -0.454  -13.349 25.057  1.00 24.98  ? 769  ARG A CB    1 
ATOM   3666 C CG    . ARG A 1 472 ? -1.783  -13.973 25.345  1.00 28.96  ? 769  ARG A CG    1 
ATOM   3667 C CD    . ARG A 1 472 ? -2.945  -13.003 25.130  1.00 26.13  ? 769  ARG A CD    1 
ATOM   3668 N NE    . ARG A 1 472 ? -2.692  -11.752 25.828  1.00 26.84  ? 769  ARG A NE    1 
ATOM   3669 C CZ    . ARG A 1 472 ? -2.922  -11.588 27.119  1.00 27.04  ? 769  ARG A CZ    1 
ATOM   3670 N NH1   . ARG A 1 472 ? -3.446  -12.573 27.827  1.00 28.69  ? 769  ARG A NH1   1 
ATOM   3671 N NH2   . ARG A 1 472 ? -2.640  -10.458 27.718  1.00 27.01  ? 769  ARG A NH2   1 
ATOM   3672 N N     . ARG A 1 473 ? 0.333   -16.475 24.403  1.00 24.10  ? 770  ARG A N     1 
ATOM   3673 C CA    . ARG A 1 473 ? 0.419   -17.427 23.319  1.00 25.04  ? 770  ARG A CA    1 
ATOM   3674 C C     . ARG A 1 473 ? -0.867  -18.046 22.946  1.00 25.24  ? 770  ARG A C     1 
ATOM   3675 O O     . ARG A 1 473 ? -1.799  -18.154 23.757  1.00 22.80  ? 770  ARG A O     1 
ATOM   3676 C CB    . ARG A 1 473 ? 1.510   -18.473 23.578  1.00 30.02  ? 770  ARG A CB    1 
ATOM   3677 C CG    . ARG A 1 473 ? 1.381   -19.399 24.695  1.00 33.69  ? 770  ARG A CG    1 
ATOM   3678 C CD    . ARG A 1 473 ? 2.467   -20.505 24.605  1.00 30.80  ? 770  ARG A CD    1 
ATOM   3679 N NE    . ARG A 1 473 ? 3.845   -20.033 24.670  1.00 31.16  ? 770  ARG A NE    1 
ATOM   3680 C CZ    . ARG A 1 473 ? 4.933   -20.820 24.672  1.00 30.26  ? 770  ARG A CZ    1 
ATOM   3681 N NH1   . ARG A 1 473 ? 4.817   -22.126 24.603  1.00 31.20  ? 770  ARG A NH1   1 
ATOM   3682 N NH2   . ARG A 1 473 ? 6.140   -20.308 24.739  1.00 30.18  ? 770  ARG A NH2   1 
ATOM   3683 N N     . ARG A 1 474 ? -0.887  -18.557 21.732  1.00 22.21  ? 771  ARG A N     1 
ATOM   3684 C CA    . ARG A 1 474 ? -2.026  -19.320 21.243  1.00 22.26  ? 771  ARG A CA    1 
ATOM   3685 C C     . ARG A 1 474 ? -1.499  -20.535 20.445  1.00 23.66  ? 771  ARG A C     1 
ATOM   3686 O O     . ARG A 1 474 ? -0.802  -20.335 19.425  1.00 20.91  ? 771  ARG A O     1 
ATOM   3687 C CB    . ARG A 1 474 ? -2.938  -18.431 20.374  1.00 23.10  ? 771  ARG A CB    1 
ATOM   3688 C CG    . ARG A 1 474 ? -4.236  -19.156 19.969  1.00 24.55  ? 771  ARG A CG    1 
ATOM   3689 C CD    . ARG A 1 474 ? -5.132  -18.223 19.222  1.00 26.86  ? 771  ARG A CD    1 
ATOM   3690 N NE    . ARG A 1 474 ? -6.453  -18.794 18.940  1.00 28.13  ? 771  ARG A NE    1 
ATOM   3691 C CZ    . ARG A 1 474 ? -7.382  -18.193 18.205  1.00 26.66  ? 771  ARG A CZ    1 
ATOM   3692 N NH1   . ARG A 1 474 ? -7.172  -16.981 17.730  1.00 25.99  ? 771  ARG A NH1   1 
ATOM   3693 N NH2   . ARG A 1 474 ? -8.559  -18.759 18.011  1.00 27.38  ? 771  ARG A NH2   1 
ATOM   3694 N N     . TYR A 1 475 ? -1.835  -21.756 20.882  1.00 24.23  ? 772  TYR A N     1 
ATOM   3695 C CA    . TYR A 1 475 ? -1.482  -22.973 20.157  1.00 23.04  ? 772  TYR A CA    1 
ATOM   3696 C C     . TYR A 1 475 ? -2.380  -23.154 18.972  1.00 22.91  ? 772  TYR A C     1 
ATOM   3697 O O     . TYR A 1 475 ? -3.560  -22.919 19.041  1.00 22.61  ? 772  TYR A O     1 
ATOM   3698 C CB    . TYR A 1 475 ? -1.555  -24.209 21.097  1.00 23.20  ? 772  TYR A CB    1 
ATOM   3699 C CG    . TYR A 1 475 ? -0.456  -24.192 22.158  1.00 20.68  ? 772  TYR A CG    1 
ATOM   3700 C CD1   . TYR A 1 475 ? 0.821   -24.588 21.870  1.00 24.40  ? 772  TYR A CD1   1 
ATOM   3701 C CD2   . TYR A 1 475 ? -0.693  -23.678 23.416  1.00 23.35  ? 772  TYR A CD2   1 
ATOM   3702 C CE1   . TYR A 1 475 ? 1.860   -24.520 22.813  1.00 23.21  ? 772  TYR A CE1   1 
ATOM   3703 C CE2   . TYR A 1 475 ? 0.322   -23.587 24.368  1.00 24.17  ? 772  TYR A CE2   1 
ATOM   3704 C CZ    . TYR A 1 475 ? 1.613   -24.011 24.057  1.00 24.36  ? 772  TYR A CZ    1 
ATOM   3705 O OH    . TYR A 1 475 ? 2.635   -23.947 25.009  1.00 25.17  ? 772  TYR A OH    1 
ATOM   3706 N N     . LEU A 1 476 ? -1.811  -23.542 17.845  1.00 23.21  ? 773  LEU A N     1 
ATOM   3707 C CA    . LEU A 1 476 ? -2.596  -23.727 16.630  1.00 24.97  ? 773  LEU A CA    1 
ATOM   3708 C C     . LEU A 1 476 ? -2.321  -25.094 15.980  1.00 26.44  ? 773  LEU A C     1 
ATOM   3709 O O     . LEU A 1 476 ? -1.769  -25.144 14.870  1.00 25.51  ? 773  LEU A O     1 
ATOM   3710 C CB    . LEU A 1 476 ? -2.225  -22.618 15.643  1.00 26.42  ? 773  LEU A CB    1 
ATOM   3711 C CG    . LEU A 1 476 ? -2.613  -21.234 16.102  1.00 24.13  ? 773  LEU A CG    1 
ATOM   3712 C CD1   . LEU A 1 476 ? -2.042  -20.232 15.183  1.00 25.94  ? 773  LEU A CD1   1 
ATOM   3713 C CD2   . LEU A 1 476 ? -4.128  -21.118 16.139  1.00 28.97  ? 773  LEU A CD2   1 
ATOM   3714 N N     . PRO A 1 477 ? -2.744  -26.167 16.644  1.00 28.06  ? 774  PRO A N     1 
ATOM   3715 C CA    . PRO A 1 477 ? -2.543  -27.554 16.138  1.00 31.11  ? 774  PRO A CA    1 
ATOM   3716 C C     . PRO A 1 477 ? -3.260  -27.802 14.825  1.00 30.36  ? 774  PRO A C     1 
ATOM   3717 O O     . PRO A 1 477 ? -2.787  -28.607 14.029  1.00 32.10  ? 774  PRO A O     1 
ATOM   3718 C CB    . PRO A 1 477 ? -3.085  -28.432 17.277  1.00 30.70  ? 774  PRO A CB    1 
ATOM   3719 C CG    . PRO A 1 477 ? -4.149  -27.555 17.926  1.00 28.55  ? 774  PRO A CG    1 
ATOM   3720 C CD    . PRO A 1 477 ? -3.571  -26.159 17.860  1.00 26.74  ? 774  PRO A CD    1 
ATOM   3721 N N     . ASP A 1 478 ? -4.342  -27.080 14.518  1.00 28.53  ? 775  ASP A N     1 
ATOM   3722 C CA    . ASP A 1 478 ? -5.006  -27.279 13.194  1.00 30.58  ? 775  ASP A CA    1 
ATOM   3723 C C     . ASP A 1 478 ? -4.189  -26.769 11.994  1.00 30.33  ? 775  ASP A C     1 
ATOM   3724 O O     . ASP A 1 478 ? -4.565  -26.967 10.827  1.00 27.59  ? 775  ASP A O     1 
ATOM   3725 C CB    . ASP A 1 478 ? -6.391  -26.640 13.127  1.00 33.49  ? 775  ASP A CB    1 
ATOM   3726 C CG    . ASP A 1 478 ? -7.408  -27.330 14.032  1.00 39.09  ? 775  ASP A CG    1 
ATOM   3727 O OD1   . ASP A 1 478 ? -7.099  -28.360 14.582  1.00 37.29  ? 775  ASP A OD1   1 
ATOM   3728 O OD2   . ASP A 1 478 ? -8.538  -26.796 14.210  1.00 43.55  ? 775  ASP A OD2   1 
ATOM   3729 N N     . ILE A 1 479 ? -3.105  -26.059 12.244  1.00 25.26  ? 776  ILE A N     1 
ATOM   3730 C CA    . ILE A 1 479 ? -2.298  -25.579 11.172  1.00 27.55  ? 776  ILE A CA    1 
ATOM   3731 C C     . ILE A 1 479 ? -1.630  -26.683 10.324  1.00 29.61  ? 776  ILE A C     1 
ATOM   3732 O O     . ILE A 1 479 ? -1.242  -26.435 9.229   1.00 31.85  ? 776  ILE A O     1 
ATOM   3733 C CB    . ILE A 1 479 ? -1.270  -24.533 11.678  1.00 31.78  ? 776  ILE A CB    1 
ATOM   3734 C CG1   . ILE A 1 479 ? -0.979  -23.543 10.590  1.00 35.88  ? 776  ILE A CG1   1 
ATOM   3735 C CG2   . ILE A 1 479 ? 0.000   -25.211 12.152  1.00 34.82  ? 776  ILE A CG2   1 
ATOM   3736 C CD1   . ILE A 1 479 ? -0.842  -22.140 11.013  1.00 37.71  ? 776  ILE A CD1   1 
ATOM   3737 N N     . THR A 1 480 ? -1.502  -27.894 10.850  1.00 31.61  ? 777  THR A N     1 
ATOM   3738 C CA    . THR A 1 480 ? -0.956  -29.050 10.073  1.00 33.68  ? 777  THR A CA    1 
ATOM   3739 C C     . THR A 1 480 ? -2.054  -29.980 9.496   1.00 38.54  ? 777  THR A C     1 
ATOM   3740 O O     . THR A 1 480 ? -1.764  -31.028 8.914   1.00 37.12  ? 777  THR A O     1 
ATOM   3741 C CB    . THR A 1 480 ? -0.008  -29.879 10.952  1.00 34.84  ? 777  THR A CB    1 
ATOM   3742 O OG1   . THR A 1 480 ? -0.718  -30.372 12.116  1.00 37.74  ? 777  THR A OG1   1 
ATOM   3743 C CG2   . THR A 1 480 ? 1.161   -29.019 11.415  1.00 38.61  ? 777  THR A CG2   1 
ATOM   3744 N N     . SER A 1 481 ? -3.313  -29.608 9.659   1.00 32.82  ? 778  SER A N     1 
ATOM   3745 C CA    . SER A 1 481 ? -4.397  -30.408 9.182   1.00 35.84  ? 778  SER A CA    1 
ATOM   3746 C C     . SER A 1 481 ? -4.298  -30.578 7.665   1.00 31.66  ? 778  SER A C     1 
ATOM   3747 O O     . SER A 1 481 ? -3.897  -29.664 6.942   1.00 33.70  ? 778  SER A O     1 
ATOM   3748 C CB    . SER A 1 481 ? -5.723  -29.768 9.579   1.00 35.94  ? 778  SER A CB    1 
ATOM   3749 O OG    . SER A 1 481 ? -6.859  -30.410 9.051   1.00 37.53  ? 778  SER A OG    1 
ATOM   3750 N N     . ARG A 1 482 ? -4.690  -31.757 7.186   1.00 34.69  ? 779  ARG A N     1 
ATOM   3751 C CA    . ARG A 1 482 ? -4.756  -31.963 5.750   1.00 39.11  ? 779  ARG A CA    1 
ATOM   3752 C C     . ARG A 1 482 ? -6.116  -31.576 5.199   1.00 39.99  ? 779  ARG A C     1 
ATOM   3753 O O     . ARG A 1 482 ? -6.325  -31.681 4.013   1.00 42.14  ? 779  ARG A O     1 
ATOM   3754 C CB    . ARG A 1 482 ? -4.373  -33.407 5.356   1.00 41.52  ? 779  ARG A CB    1 
ATOM   3755 C CG    . ARG A 1 482 ? -2.865  -33.674 5.241   1.00 38.11  ? 779  ARG A CG    1 
ATOM   3756 C CD    . ARG A 1 482 ? -2.192  -33.715 6.626   1.00 42.95  ? 779  ARG A CD    1 
ATOM   3757 N NE    . ARG A 1 482 ? -2.603  -34.868 7.418   1.00 43.30  ? 779  ARG A NE    1 
ATOM   3758 C CZ    . ARG A 1 482 ? -2.825  -34.868 8.735   1.00 44.72  ? 779  ARG A CZ    1 
ATOM   3759 N NH1   . ARG A 1 482 ? -2.714  -33.773 9.476   1.00 43.24  ? 779  ARG A NH1   1 
ATOM   3760 N NH2   . ARG A 1 482 ? -3.181  -35.989 9.337   1.00 44.25  ? 779  ARG A NH2   1 
ATOM   3761 N N     . ASN A 1 483 ? -7.035  -31.100 6.042   1.00 39.82  ? 780  ASN A N     1 
ATOM   3762 C CA    . ASN A 1 483 ? -8.310  -30.515 5.553   1.00 36.10  ? 780  ASN A CA    1 
ATOM   3763 C C     . ASN A 1 483 ? -8.164  -28.983 5.288   1.00 39.88  ? 780  ASN A C     1 
ATOM   3764 O O     . ASN A 1 483 ? -7.823  -28.178 6.176   1.00 35.01  ? 780  ASN A O     1 
ATOM   3765 C CB    . ASN A 1 483 ? -9.416  -30.793 6.578   1.00 40.21  ? 780  ASN A CB    1 
ATOM   3766 C CG    . ASN A 1 483 ? -10.763 -30.135 6.220   1.00 47.59  ? 780  ASN A CG    1 
ATOM   3767 O OD1   . ASN A 1 483 ? -10.968 -28.932 6.343   1.00 50.06  ? 780  ASN A OD1   1 
ATOM   3768 N ND2   . ASN A 1 483 ? -11.680 -30.935 5.780   1.00 53.06  ? 780  ASN A ND2   1 
ATOM   3769 N N     . PHE A 1 484 ? -8.459  -28.576 4.059   1.00 39.63  ? 781  PHE A N     1 
ATOM   3770 C CA    . PHE A 1 484 ? -8.270  -27.220 3.613   1.00 35.88  ? 781  PHE A CA    1 
ATOM   3771 C C     . PHE A 1 484 ? -8.930  -26.142 4.499   1.00 38.41  ? 781  PHE A C     1 
ATOM   3772 O O     . PHE A 1 484 ? -8.290  -25.169 4.881   1.00 36.65  ? 781  PHE A O     1 
ATOM   3773 C CB    . PHE A 1 484 ? -8.736  -27.075 2.179   1.00 35.98  ? 781  PHE A CB    1 
ATOM   3774 C CG    . PHE A 1 484 ? -8.511  -25.703 1.624   1.00 36.31  ? 781  PHE A CG    1 
ATOM   3775 C CD1   . PHE A 1 484 ? -7.244  -25.317 1.193   1.00 37.61  ? 781  PHE A CD1   1 
ATOM   3776 C CD2   . PHE A 1 484 ? -9.551  -24.784 1.570   1.00 39.57  ? 781  PHE A CD2   1 
ATOM   3777 C CE1   . PHE A 1 484 ? -7.015  -24.040 0.712   1.00 43.41  ? 781  PHE A CE1   1 
ATOM   3778 C CE2   . PHE A 1 484 ? -9.329  -23.488 1.112   1.00 42.12  ? 781  PHE A CE2   1 
ATOM   3779 C CZ    . PHE A 1 484 ? -8.069  -23.127 0.652   1.00 43.07  ? 781  PHE A CZ    1 
ATOM   3780 N N     . ASN A 1 485 ? -10.205 -26.314 4.802   1.00 36.66  ? 782  ASN A N     1 
ATOM   3781 C CA    . ASN A 1 485 ? -10.938 -25.339 5.582   1.00 42.32  ? 782  ASN A CA    1 
ATOM   3782 C C     . ASN A 1 485 ? -10.428 -25.213 7.035   1.00 38.60  ? 782  ASN A C     1 
ATOM   3783 O O     . ASN A 1 485 ? -10.338 -24.126 7.529   1.00 39.08  ? 782  ASN A O     1 
ATOM   3784 C CB    . ASN A 1 485 ? -12.421 -25.714 5.622   1.00 43.08  ? 782  ASN A CB    1 
ATOM   3785 C CG    . ASN A 1 485 ? -13.115 -25.510 4.271   1.00 51.94  ? 782  ASN A CG    1 
ATOM   3786 O OD1   . ASN A 1 485 ? -12.609 -24.825 3.368   1.00 49.24  ? 782  ASN A OD1   1 
ATOM   3787 N ND2   . ASN A 1 485 ? -14.273 -26.109 4.132   1.00 57.47  ? 782  ASN A ND2   1 
ATOM   3788 N N     . VAL A 1 486 ? -10.183 -26.346 7.681   1.00 33.30  ? 783  VAL A N     1 
ATOM   3789 C CA    . VAL A 1 486 ? -9.599  -26.398 9.016   1.00 34.61  ? 783  VAL A CA    1 
ATOM   3790 C C     . VAL A 1 486 ? -8.209  -25.757 9.050   1.00 34.01  ? 783  VAL A C     1 
ATOM   3791 O O     . VAL A 1 486 ? -7.982  -24.915 9.907   1.00 32.74  ? 783  VAL A O     1 
ATOM   3792 C CB    . VAL A 1 486 ? -9.571  -27.821 9.547   1.00 35.82  ? 783  VAL A CB    1 
ATOM   3793 C CG1   . VAL A 1 486 ? -8.848  -27.915 10.865  1.00 34.35  ? 783  VAL A CG1   1 
ATOM   3794 C CG2   . VAL A 1 486 ? -10.997 -28.325 9.759   1.00 41.81  ? 783  VAL A CG2   1 
ATOM   3795 N N     . ARG A 1 487 ? -7.321  -26.135 8.117   1.00 30.07  ? 784  ARG A N     1 
ATOM   3796 C CA    . ARG A 1 487 ? -5.983  -25.577 8.021   1.00 31.42  ? 784  ARG A CA    1 
ATOM   3797 C C     . ARG A 1 487 ? -6.003  -24.045 7.736   1.00 29.65  ? 784  ARG A C     1 
ATOM   3798 O O     . ARG A 1 487 ? -5.315  -23.270 8.377   1.00 26.44  ? 784  ARG A O     1 
ATOM   3799 C CB    . ARG A 1 487 ? -5.149  -26.299 6.932   1.00 30.09  ? 784  ARG A CB    1 
ATOM   3800 C CG    . ARG A 1 487 ? -3.715  -25.897 6.944   1.00 32.48  ? 784  ARG A CG    1 
ATOM   3801 C CD    . ARG A 1 487 ? -2.751  -26.607 5.945   1.00 36.13  ? 784  ARG A CD    1 
ATOM   3802 N NE    . ARG A 1 487 ? -3.184  -26.414 4.575   1.00 39.68  ? 784  ARG A NE    1 
ATOM   3803 C CZ    . ARG A 1 487 ? -3.918  -27.294 3.875   1.00 40.77  ? 784  ARG A CZ    1 
ATOM   3804 N NH1   . ARG A 1 487 ? -4.279  -28.489 4.376   1.00 38.62  ? 784  ARG A NH1   1 
ATOM   3805 N NH2   . ARG A 1 487 ? -4.343  -26.923 2.682   1.00 43.44  ? 784  ARG A NH2   1 
ATOM   3806 N N     . SER A 1 488 ? -6.803  -23.619 6.782   1.00 29.03  ? 785  SER A N     1 
ATOM   3807 C CA    . SER A 1 488 ? -6.901  -22.207 6.427   1.00 30.72  ? 785  SER A CA    1 
ATOM   3808 C C     . SER A 1 488 ? -7.375  -21.345 7.600   1.00 30.73  ? 785  SER A C     1 
ATOM   3809 O O     . SER A 1 488 ? -6.893  -20.244 7.781   1.00 30.66  ? 785  SER A O     1 
ATOM   3810 C CB    . SER A 1 488 ? -7.901  -22.004 5.276   1.00 35.98  ? 785  SER A CB    1 
ATOM   3811 O OG    . SER A 1 488 ? -7.470  -22.736 4.148   1.00 39.01  ? 785  SER A OG    1 
ATOM   3812 N N     . PHE A 1 489 ? -8.323  -21.854 8.381   1.00 30.64  ? 786  PHE A N     1 
ATOM   3813 C CA    . PHE A 1 489 ? -8.797  -21.089 9.525   1.00 30.14  ? 786  PHE A CA    1 
ATOM   3814 C C     . PHE A 1 489 ? -7.653  -20.909 10.543  1.00 29.40  ? 786  PHE A C     1 
ATOM   3815 O O     . PHE A 1 489 ? -7.470  -19.832 11.104  1.00 28.41  ? 786  PHE A O     1 
ATOM   3816 C CB    . PHE A 1 489 ? -10.075 -21.765 10.106  1.00 32.69  ? 786  PHE A CB    1 
ATOM   3817 C CG    . PHE A 1 489 ? -10.848 -20.928 11.122  1.00 40.96  ? 786  PHE A CG    1 
ATOM   3818 C CD1   . PHE A 1 489 ? -10.675 -19.507 11.233  1.00 44.07  ? 786  PHE A CD1   1 
ATOM   3819 C CD2   . PHE A 1 489 ? -11.772 -21.542 11.971  1.00 47.82  ? 786  PHE A CD2   1 
ATOM   3820 C CE1   . PHE A 1 489 ? -11.391 -18.740 12.172  1.00 42.26  ? 786  PHE A CE1   1 
ATOM   3821 C CE2   . PHE A 1 489 ? -12.501 -20.779 12.905  1.00 49.63  ? 786  PHE A CE2   1 
ATOM   3822 C CZ    . PHE A 1 489 ? -12.289 -19.377 13.016  1.00 47.95  ? 786  PHE A CZ    1 
ATOM   3823 N N     . ALA A 1 490 ? -6.904  -21.983 10.809  1.00 29.68  ? 787  ALA A N     1 
ATOM   3824 C CA    . ALA A 1 490 ? -5.694  -21.882 11.649  1.00 26.14  ? 787  ALA A CA    1 
ATOM   3825 C C     . ALA A 1 490 ? -4.710  -20.868 11.132  1.00 25.84  ? 787  ALA A C     1 
ATOM   3826 O O     . ALA A 1 490 ? -4.092  -20.155 11.913  1.00 24.98  ? 787  ALA A O     1 
ATOM   3827 C CB    . ALA A 1 490 ? -5.014  -23.221 11.826  1.00 26.73  ? 787  ALA A CB    1 
ATOM   3828 N N     . GLU A 1 491 ? -4.525  -20.820 9.827   1.00 24.77  ? 788  GLU A N     1 
ATOM   3829 C CA    . GLU A 1 491 ? -3.598  -19.847 9.235   1.00 29.67  ? 788  GLU A CA    1 
ATOM   3830 C C     . GLU A 1 491 ? -4.054  -18.414 9.467   1.00 29.79  ? 788  GLU A C     1 
ATOM   3831 O O     . GLU A 1 491 ? -3.230  -17.563 9.773   1.00 25.20  ? 788  GLU A O     1 
ATOM   3832 C CB    . GLU A 1 491 ? -3.416  -20.114 7.712   1.00 30.07  ? 788  GLU A CB    1 
ATOM   3833 C CG    . GLU A 1 491 ? -2.580  -21.329 7.468   1.00 30.20  ? 788  GLU A CG    1 
ATOM   3834 C CD    . GLU A 1 491 ? -2.560  -21.835 6.038   1.00 36.27  ? 788  GLU A CD    1 
ATOM   3835 O OE1   . GLU A 1 491 ? -3.297  -21.325 5.221   1.00 33.09  ? 788  GLU A OE1   1 
ATOM   3836 O OE2   . GLU A 1 491 ? -1.822  -22.808 5.737   1.00 36.99  ? 788  GLU A OE2   1 
ATOM   3837 N N     . ARG A 1 492 ? -5.363  -18.169 9.350   1.00 29.36  ? 789  ARG A N     1 
ATOM   3838 C CA    . ARG A 1 492 ? -5.902  -16.847 9.628   1.00 28.74  ? 789  ARG A CA    1 
ATOM   3839 C C     . ARG A 1 492 ? -5.669  -16.469 11.090  1.00 25.44  ? 789  ARG A C     1 
ATOM   3840 O O     . ARG A 1 492 ? -5.328  -15.374 11.357  1.00 25.66  ? 789  ARG A O     1 
ATOM   3841 C CB    . ARG A 1 492 ? -7.395  -16.767 9.262   1.00 28.07  ? 789  ARG A CB    1 
ATOM   3842 C CG    . ARG A 1 492 ? -7.692  -16.873 7.755   1.00 37.68  ? 789  ARG A CG    1 
ATOM   3843 C CD    . ARG A 1 492 ? -9.134  -16.411 7.388   1.00 34.40  ? 789  ARG A CD    1 
ATOM   3844 N NE    . ARG A 1 492 ? -10.015 -17.488 7.677   1.00 42.14  ? 789  ARG A NE    1 
ATOM   3845 C CZ    . ARG A 1 492 ? -10.220 -18.544 6.884   1.00 51.51  ? 789  ARG A CZ    1 
ATOM   3846 N NH1   . ARG A 1 492 ? -9.628  -18.670 5.687   1.00 60.22  ? 789  ARG A NH1   1 
ATOM   3847 N NH2   . ARG A 1 492 ? -11.013 -19.500 7.305   1.00 52.91  ? 789  ARG A NH2   1 
ATOM   3848 N N     . MET A 1 493 ? -5.830  -17.414 12.006  1.00 24.65  ? 790  MET A N     1 
ATOM   3849 C CA    . MET A 1 493 ? -5.619  -17.227 13.411  1.00 24.33  ? 790  MET A CA    1 
ATOM   3850 C C     . MET A 1 493 ? -4.177  -16.926 13.681  1.00 24.79  ? 790  MET A C     1 
ATOM   3851 O O     . MET A 1 493 ? -3.879  -16.075 14.509  1.00 25.15  ? 790  MET A O     1 
ATOM   3852 C CB    . MET A 1 493 ? -6.042  -18.475 14.243  0.87 24.50  ? 790  MET A CB    1 
ATOM   3853 C CG    . MET A 1 493 ? -7.537  -18.711 14.261  0.99 25.88  ? 790  MET A CG    1 
ATOM   3854 S SD    . MET A 1 493 ? -7.928  -20.232 15.159  0.72 25.90  ? 790  MET A SD    1 
ATOM   3855 C CE    . MET A 1 493 ? -9.676  -20.328 14.713  1.00 32.98  ? 790  MET A CE    1 
ATOM   3856 N N     . ALA A 1 494 ? -3.278  -17.578 12.955  1.00 21.51  ? 791  ALA A N     1 
ATOM   3857 C CA    . ALA A 1 494 ? -1.867  -17.264 13.063  1.00 21.83  ? 791  ALA A CA    1 
ATOM   3858 C C     . ALA A 1 494 ? -1.518  -15.851 12.651  1.00 22.78  ? 791  ALA A C     1 
ATOM   3859 O O     . ALA A 1 494 ? -0.706  -15.189 13.291  1.00 22.67  ? 791  ALA A O     1 
ATOM   3860 C CB    . ALA A 1 494 ? -1.036  -18.219 12.254  1.00 24.23  ? 791  ALA A CB    1 
ATOM   3861 N N     . MET A 1 495 ? -2.103  -15.397 11.566  1.00 22.65  ? 792  MET A N     1 
ATOM   3862 C CA    . MET A 1 495 ? -1.864  -14.034 11.114  1.00 25.28  ? 792  MET A CA    1 
ATOM   3863 C C     . MET A 1 495 ? -2.499  -12.961 12.046  1.00 24.57  ? 792  MET A C     1 
ATOM   3864 O O     . MET A 1 495 ? -1.914  -11.917 12.346  1.00 27.37  ? 792  MET A O     1 
ATOM   3865 C CB    . MET A 1 495 ? -2.462  -13.906 9.686   1.00 24.66  ? 792  MET A CB    1 
ATOM   3866 C CG    . MET A 1 495 ? -1.780  -14.804 8.632   1.00 33.01  ? 792  MET A CG    1 
ATOM   3867 S SD    . MET A 1 495 ? -2.635  -14.653 7.043   1.00 36.37  ? 792  MET A SD    1 
ATOM   3868 C CE    . MET A 1 495 ? -2.543  -16.338 6.422   1.00 46.04  ? 792  MET A CE    1 
ATOM   3869 N N     . ASN A 1 496 ? -3.708  -13.239 12.501  1.00 24.10  ? 793  ASN A N     1 
ATOM   3870 C CA    . ASN A 1 496 ? -4.480  -12.248 13.290  1.00 25.90  ? 793  ASN A CA    1 
ATOM   3871 C C     . ASN A 1 496 ? -4.122  -12.166 14.790  1.00 25.86  ? 793  ASN A C     1 
ATOM   3872 O O     . ASN A 1 496 ? -4.139  -11.101 15.362  1.00 22.93  ? 793  ASN A O     1 
ATOM   3873 C CB    . ASN A 1 496 ? -5.956  -12.539 13.184  1.00 24.52  ? 793  ASN A CB    1 
ATOM   3874 C CG    . ASN A 1 496 ? -6.772  -11.598 14.035  1.00 27.34  ? 793  ASN A CG    1 
ATOM   3875 O OD1   . ASN A 1 496 ? -7.276  -11.968 15.111  1.00 27.60  ? 793  ASN A OD1   1 
ATOM   3876 N ND2   . ASN A 1 496 ? -6.868  -10.353 13.592  1.00 27.70  ? 793  ASN A ND2   1 
ATOM   3877 N N     . THR A 1 497 ? -3.790  -13.296 15.419  1.00 22.94  ? 794  THR A N     1 
ATOM   3878 C CA    . THR A 1 497 ? -3.602  -13.362 16.856  1.00 22.56  ? 794  THR A CA    1 
ATOM   3879 C C     . THR A 1 497 ? -2.512  -12.440 17.387  1.00 25.03  ? 794  THR A C     1 
ATOM   3880 O O     . THR A 1 497 ? -2.732  -11.718 18.378  1.00 25.13  ? 794  THR A O     1 
ATOM   3881 C CB    . THR A 1 497 ? -3.527  -14.841 17.372  1.00 23.33  ? 794  THR A CB    1 
ATOM   3882 O OG1   . THR A 1 497 ? -4.827  -15.478 17.171  1.00 26.06  ? 794  THR A OG1   1 
ATOM   3883 C CG2   . THR A 1 497 ? -3.140  -14.930 18.898  1.00 21.79  ? 794  THR A CG2   1 
ATOM   3884 N N     . PRO A 1 498 ? -1.353  -12.360 16.712  1.00 21.96  ? 795  PRO A N     1 
ATOM   3885 C CA    . PRO A 1 498 ? -0.330  -11.480 17.217  1.00 21.25  ? 795  PRO A CA    1 
ATOM   3886 C C     . PRO A 1 498 ? -0.737  -10.001 17.103  1.00 23.94  ? 795  PRO A C     1 
ATOM   3887 O O     . PRO A 1 498 ? -0.250  -9.169  17.845  1.00 25.04  ? 795  PRO A O     1 
ATOM   3888 C CB    . PRO A 1 498 ? 0.864   -11.764 16.298  1.00 24.96  ? 795  PRO A CB    1 
ATOM   3889 C CG    . PRO A 1 498 ? 0.634   -13.166 15.833  1.00 23.89  ? 795  PRO A CG    1 
ATOM   3890 C CD    . PRO A 1 498 ? -0.878  -13.267 15.690  1.00 21.52  ? 795  PRO A CD    1 
ATOM   3891 N N     . ILE A 1 499 ? -1.631  -9.688  16.170  1.00 22.90  ? 796  ILE A N     1 
ATOM   3892 C CA    . ILE A 1 499 ? -2.133  -8.354  16.001  1.00 22.41  ? 796  ILE A CA    1 
ATOM   3893 C C     . ILE A 1 499 ? -3.189  -8.021  17.078  1.00 23.85  ? 796  ILE A C     1 
ATOM   3894 O O     . ILE A 1 499 ? -3.013  -7.082  17.880  1.00 24.51  ? 796  ILE A O     1 
ATOM   3895 C CB    . ILE A 1 499 ? -2.788  -8.145  14.602  1.00 21.73  ? 796  ILE A CB    1 
ATOM   3896 C CG1   . ILE A 1 499 ? -1.748  -8.402  13.510  1.00 23.49  ? 796  ILE A CG1   1 
ATOM   3897 C CG2   . ILE A 1 499 ? -3.285  -6.723  14.545  1.00 22.31  ? 796  ILE A CG2   1 
ATOM   3898 C CD1   . ILE A 1 499 ? -2.321  -8.445  12.121  1.00 27.63  ? 796  ILE A CD1   1 
ATOM   3899 N N     . GLN A 1 500 ? -4.301  -8.740  17.053  1.00 21.32  ? 797  GLN A N     1 
ATOM   3900 C CA    . GLN A 1 500 ? -5.396  -8.519  18.042  1.00 21.97  ? 797  GLN A CA    1 
ATOM   3901 C C     . GLN A 1 500 ? -4.893  -8.703  19.487  1.00 23.25  ? 797  GLN A C     1 
ATOM   3902 O O     . GLN A 1 500 ? -5.230  -7.932  20.386  1.00 20.77  ? 797  GLN A O     1 
ATOM   3903 C CB    . GLN A 1 500 ? -6.561  -9.465  17.764  1.00 23.75  ? 797  GLN A CB    1 
ATOM   3904 C CG    . GLN A 1 500 ? -7.766  -9.217  18.707  1.00 27.26  ? 797  GLN A CG    1 
ATOM   3905 C CD    . GLN A 1 500 ? -8.905  -10.201 18.551  1.00 30.07  ? 797  GLN A CD    1 
ATOM   3906 O OE1   . GLN A 1 500 ? -9.388  -10.816 19.534  1.00 31.31  ? 797  GLN A OE1   1 
ATOM   3907 N NE2   . GLN A 1 500 ? -9.377  -10.354 17.312  1.00 31.14  ? 797  GLN A NE2   1 
ATOM   3908 N N     . GLY A 1 501 ? -4.067  -9.733  19.687  1.00 21.74  ? 798  GLY A N     1 
ATOM   3909 C CA    . GLY A 1 501 ? -3.459  -10.048 20.977  1.00 21.02  ? 798  GLY A CA    1 
ATOM   3910 C C     . GLY A 1 501 ? -2.504  -8.984  21.476  1.00 22.23  ? 798  GLY A C     1 
ATOM   3911 O O     . GLY A 1 501 ? -2.534  -8.682  22.625  1.00 23.58  ? 798  GLY A O     1 
ATOM   3912 N N     . SER A 1 502 ? -1.621  -8.441  20.614  1.00 21.42  ? 799  SER A N     1 
ATOM   3913 C CA    . SER A 1 502 ? -0.720  -7.416  21.022  1.00 20.48  ? 799  SER A CA    1 
ATOM   3914 C C     . SER A 1 502 ? -1.492  -6.133  21.311  1.00 20.09  ? 799  SER A C     1 
ATOM   3915 O O     . SER A 1 502 ? -1.130  -5.402  22.197  1.00 20.44  ? 799  SER A O     1 
ATOM   3916 C CB    . SER A 1 502 ? 0.375   -7.162  19.980  1.00 21.75  ? 799  SER A CB    1 
ATOM   3917 O OG    . SER A 1 502 ? 1.163   -8.330  19.794  1.00 20.31  ? 799  SER A OG    1 
ATOM   3918 N N     . ALA A 1 503 ? -2.571  -5.879  20.587  1.00 21.03  ? 800  ALA A N     1 
ATOM   3919 C CA    . ALA A 1 503 ? -3.364  -4.713  20.895  1.00 22.87  ? 800  ALA A CA    1 
ATOM   3920 C C     . ALA A 1 503 ? -4.024  -4.872  22.278  1.00 20.17  ? 800  ALA A C     1 
ATOM   3921 O O     . ALA A 1 503 ? -4.153  -3.886  23.012  1.00 21.37  ? 800  ALA A O     1 
ATOM   3922 C CB    . ALA A 1 503 ? -4.438  -4.469  19.810  1.00 20.65  ? 800  ALA A CB    1 
ATOM   3923 N N     . ALA A 1 504 ? -4.429  -6.084  22.614  1.00 20.07  ? 801  ALA A N     1 
ATOM   3924 C CA    . ALA A 1 504 ? -5.006  -6.377  23.904  1.00 22.08  ? 801  ALA A CA    1 
ATOM   3925 C C     . ALA A 1 504 ? -3.932  -6.201  24.992  1.00 23.01  ? 801  ALA A C     1 
ATOM   3926 O O     . ALA A 1 504 ? -4.194  -5.544  26.023  1.00 21.32  ? 801  ALA A O     1 
ATOM   3927 C CB    . ALA A 1 504 ? -5.588  -7.801  23.943  1.00 23.78  ? 801  ALA A CB    1 
ATOM   3928 N N     . ASP A 1 505 ? -2.720  -6.661  24.723  1.00 19.30  ? 802  ASP A N     1 
ATOM   3929 C CA    . ASP A 1 505 ? -1.624  -6.465  25.689  1.00 19.97  ? 802  ASP A CA    1 
ATOM   3930 C C     . ASP A 1 505 ? -1.430  -4.976  25.998  1.00 20.92  ? 802  ASP A C     1 
ATOM   3931 O O     . ASP A 1 505 ? -1.251  -4.578  27.151  1.00 24.37  ? 802  ASP A O     1 
ATOM   3932 C CB    . ASP A 1 505 ? -0.305  -7.003  25.160  1.00 21.98  ? 802  ASP A CB    1 
ATOM   3933 C CG    . ASP A 1 505 ? -0.257  -8.523  25.036  1.00 25.09  ? 802  ASP A CG    1 
ATOM   3934 O OD1   . ASP A 1 505 ? -1.084  -9.209  25.650  1.00 25.51  ? 802  ASP A OD1   1 
ATOM   3935 O OD2   . ASP A 1 505 ? 0.653   -9.018  24.324  1.00 25.19  ? 802  ASP A OD2   1 
ATOM   3936 N N     . ILE A 1 506 ? -1.410  -4.162  24.963  1.00 19.33  ? 803  ILE A N     1 
ATOM   3937 C CA    . ILE A 1 506 ? -1.113  -2.741  25.087  1.00 21.62  ? 803  ILE A CA    1 
ATOM   3938 C C     . ILE A 1 506 ? -2.151  -2.029  25.910  1.00 21.02  ? 803  ILE A C     1 
ATOM   3939 O O     . ILE A 1 506 ? -1.809  -1.245  26.791  1.00 20.53  ? 803  ILE A O     1 
ATOM   3940 C CB    . ILE A 1 506 ? -0.986  -2.085  23.708  1.00 22.35  ? 803  ILE A CB    1 
ATOM   3941 C CG1   . ILE A 1 506 ? 0.273   -2.637  22.995  1.00 23.57  ? 803  ILE A CG1   1 
ATOM   3942 C CG2   . ILE A 1 506 ? -0.923  -0.531  23.797  1.00 22.93  ? 803  ILE A CG2   1 
ATOM   3943 C CD1   . ILE A 1 506 ? 0.335   -2.312  21.519  1.00 25.06  ? 803  ILE A CD1   1 
ATOM   3944 N N     . ILE A 1 507 ? -3.423  -2.254  25.591  1.00 21.13  ? 804  ILE A N     1 
ATOM   3945 C CA    . ILE A 1 507 ? -4.453  -1.548  26.353  1.00 22.90  ? 804  ILE A CA    1 
ATOM   3946 C C     . ILE A 1 507 ? -4.501  -1.998  27.810  1.00 21.45  ? 804  ILE A C     1 
ATOM   3947 O O     . ILE A 1 507 ? -4.789  -1.180  28.686  1.00 24.44  ? 804  ILE A O     1 
ATOM   3948 C CB    . ILE A 1 507 ? -5.843  -1.546  25.702  1.00 25.49  ? 804  ILE A CB    1 
ATOM   3949 C CG1   . ILE A 1 507 ? -6.780  -0.640  26.507  1.00 28.47  ? 804  ILE A CG1   1 
ATOM   3950 C CG2   . ILE A 1 507 ? -6.454  -2.934  25.646  1.00 27.14  ? 804  ILE A CG2   1 
ATOM   3951 C CD1   . ILE A 1 507 ? -8.017  -0.201  25.741  1.00 29.70  ? 804  ILE A CD1   1 
ATOM   3952 N N     . LYS A 1 508 ? -4.188  -3.277  28.073  1.00 21.58  ? 805  LYS A N     1 
ATOM   3953 C CA    . LYS A 1 508 ? -4.095  -3.764  29.456  1.00 20.20  ? 805  LYS A CA    1 
ATOM   3954 C C     . LYS A 1 508 ? -2.984  -3.079  30.212  1.00 21.66  ? 805  LYS A C     1 
ATOM   3955 O O     . LYS A 1 508 ? -3.181  -2.666  31.339  1.00 20.34  ? 805  LYS A O     1 
ATOM   3956 C CB    . LYS A 1 508 ? -3.912  -5.277  29.520  1.00 21.35  ? 805  LYS A CB    1 
ATOM   3957 C CG    . LYS A 1 508 ? -5.176  -6.068  29.078  1.00 21.39  ? 805  LYS A CG    1 
ATOM   3958 C CD    . LYS A 1 508 ? -4.874  -7.561  29.105  1.00 23.03  ? 805  LYS A CD    1 
ATOM   3959 C CE    . LYS A 1 508 ? -6.147  -8.387  29.068  1.00 25.96  ? 805  LYS A CE    1 
ATOM   3960 N NZ    . LYS A 1 508 ? -5.828  -9.837  28.998  1.00 28.08  ? 805  LYS A NZ    1 
ATOM   3961 N N     . LYS A 1 509 ? -1.826  -2.948  29.573  1.00 21.97  ? 806  LYS A N     1 
ATOM   3962 C CA    . LYS A 1 509 ? -0.754  -2.217  30.178  1.00 23.35  ? 806  LYS A CA    1 
ATOM   3963 C C     . LYS A 1 509 ? -1.117  -0.744  30.405  1.00 25.01  ? 806  LYS A C     1 
ATOM   3964 O O     . LYS A 1 509 ? -0.754  -0.151  31.430  1.00 23.23  ? 806  LYS A O     1 
ATOM   3965 C CB    . LYS A 1 509 ? 0.541   -2.314  29.323  1.00 26.57  ? 806  LYS A CB    1 
ATOM   3966 C CG    . LYS A 1 509 ? 1.686   -1.600  30.063  1.00 30.00  ? 806  LYS A CG    1 
ATOM   3967 C CD    . LYS A 1 509 ? 3.056   -1.908  29.504  1.00 36.10  ? 806  LYS A CD    1 
ATOM   3968 C CE    . LYS A 1 509 ? 4.152   -1.254  30.385  1.00 34.37  ? 806  LYS A CE    1 
ATOM   3969 N NZ    . LYS A 1 509 ? 4.082   0.236   30.299  1.00 31.86  ? 806  LYS A NZ    1 
ATOM   3970 N N     . ALA A 1 510 ? -1.821  -0.130  29.455  1.00 21.61  ? 807  ALA A N     1 
ATOM   3971 C CA    . ALA A 1 510 ? -2.205  1.254   29.625  1.00 22.23  ? 807  ALA A CA    1 
ATOM   3972 C C     . ALA A 1 510 ? -3.147  1.388   30.874  1.00 22.93  ? 807  ALA A C     1 
ATOM   3973 O O     . ALA A 1 510 ? -3.092  2.391   31.560  1.00 22.66  ? 807  ALA A O     1 
ATOM   3974 C CB    . ALA A 1 510 ? -2.925  1.807   28.380  1.00 21.77  ? 807  ALA A CB    1 
ATOM   3975 N N     . MET A 1 511 ? -4.044  0.436   31.088  1.00 21.64  ? 808  MET A N     1 
ATOM   3976 C CA    . MET A 1 511 ? -4.974  0.468   32.199  1.00 22.16  ? 808  MET A CA    1 
ATOM   3977 C C     . MET A 1 511 ? -4.205  0.474   33.506  1.00 23.45  ? 808  MET A C     1 
ATOM   3978 O O     . MET A 1 511 ? -4.498  1.226   34.399  1.00 21.74  ? 808  MET A O     1 
ATOM   3979 C CB    . MET A 1 511 ? -5.928  -0.732  32.173  1.00 23.15  ? 808  MET A CB    1 
ATOM   3980 C CG    . MET A 1 511 ? -6.896  -0.634  31.005  1.00 23.68  ? 808  MET A CG    1 
ATOM   3981 S SD    . MET A 1 511 ? -7.948  -2.078  30.775  1.00 24.01  ? 808  MET A SD    1 
ATOM   3982 C CE    . MET A 1 511 ? -9.124  -1.886  32.155  1.00 22.36  ? 808  MET A CE    1 
ATOM   3983 N N     . ILE A 1 512 ? -3.232  -0.415  33.606  1.00 24.95  ? 809  ILE A N     1 
ATOM   3984 C CA    . ILE A 1 512 ? -2.347  -0.455  34.752  1.00 22.73  ? 809  ILE A CA    1 
ATOM   3985 C C     . ILE A 1 512 ? -1.635  0.868   34.982  1.00 23.59  ? 809  ILE A C     1 
ATOM   3986 O O     . ILE A 1 512 ? -1.711  1.426   36.116  1.00 21.22  ? 809  ILE A O     1 
ATOM   3987 C CB    . ILE A 1 512 ? -1.368  -1.610  34.704  1.00 22.59  ? 809  ILE A CB    1 
ATOM   3988 C CG1   . ILE A 1 512 ? -2.152  -2.919  34.792  1.00 25.24  ? 809  ILE A CG1   1 
ATOM   3989 C CG2   . ILE A 1 512 ? -0.330  -1.529  35.849  1.00 25.12  ? 809  ILE A CG2   1 
ATOM   3990 C CD1   . ILE A 1 512 ? -1.400  -4.097  34.216  1.00 31.29  ? 809  ILE A CD1   1 
ATOM   3991 N N     . ASP A 1 513 ? -0.979  1.383   33.952  1.00 22.55  ? 810  ASP A N     1 
ATOM   3992 C CA    . ASP A 1 513 ? -0.299  2.660   34.060  1.00 23.63  ? 810  ASP A CA    1 
ATOM   3993 C C     . ASP A 1 513 ? -1.257  3.798   34.416  1.00 23.88  ? 810  ASP A C     1 
ATOM   3994 O O     . ASP A 1 513 ? -0.956  4.670   35.213  1.00 22.90  ? 810  ASP A O     1 
ATOM   3995 C CB    . ASP A 1 513 ? 0.422   3.018   32.743  1.00 24.43  ? 810  ASP A CB    1 
ATOM   3996 C CG    . ASP A 1 513 ? 1.518   2.049   32.352  1.00 28.60  ? 810  ASP A CG    1 
ATOM   3997 O OD1   . ASP A 1 513 ? 1.950   1.200   33.130  1.00 31.62  ? 810  ASP A OD1   1 
ATOM   3998 O OD2   . ASP A 1 513 ? 1.998   2.152   31.190  1.00 34.18  ? 810  ASP A OD2   1 
ATOM   3999 N N     . LEU A 1 514 ? -2.429  3.811   33.802  1.00 22.76  ? 811  LEU A N     1 
ATOM   4000 C CA    . LEU A 1 514 ? -3.364  4.823   34.118  1.00 23.97  ? 811  LEU A CA    1 
ATOM   4001 C C     . LEU A 1 514 ? -3.815  4.829   35.574  1.00 25.51  ? 811  LEU A C     1 
ATOM   4002 O O     . LEU A 1 514 ? -3.887  5.877   36.222  1.00 25.46  ? 811  LEU A O     1 
ATOM   4003 C CB    . LEU A 1 514 ? -4.562  4.701   33.200  1.00 22.94  ? 811  LEU A CB    1 
ATOM   4004 C CG    . LEU A 1 514 ? -5.645  5.713   33.434  1.00 26.11  ? 811  LEU A CG    1 
ATOM   4005 C CD1   . LEU A 1 514 ? -5.100  7.126   33.194  1.00 27.77  ? 811  LEU A CD1   1 
ATOM   4006 C CD2   . LEU A 1 514 ? -6.782  5.407   32.474  1.00 27.31  ? 811  LEU A CD2   1 
ATOM   4007 N N     . ASN A 1 515 ? -4.153  3.668   36.086  1.00 21.57  ? 812  ASN A N     1 
ATOM   4008 C CA    . ASN A 1 515 ? -4.556  3.528   37.433  1.00 24.86  ? 812  ASN A CA    1 
ATOM   4009 C C     . ASN A 1 515 ? -3.475  4.083   38.387  1.00 24.49  ? 812  ASN A C     1 
ATOM   4010 O O     . ASN A 1 515 ? -3.751  4.803   39.366  1.00 21.21  ? 812  ASN A O     1 
ATOM   4011 C CB    . ASN A 1 515 ? -4.788  2.075   37.697  1.00 27.45  ? 812  ASN A CB    1 
ATOM   4012 C CG    . ASN A 1 515 ? -5.102  1.796   39.119  1.00 37.32  ? 812  ASN A CG    1 
ATOM   4013 O OD1   . ASN A 1 515 ? -4.220  1.375   39.863  1.00 43.55  ? 812  ASN A OD1   1 
ATOM   4014 N ND2   . ASN A 1 515 ? -6.356  1.947   39.494  1.00 34.76  ? 812  ASN A ND2   1 
ATOM   4015 N N     . ALA A 1 516 ? -2.221  3.844   38.034  1.00 22.96  ? 813  ALA A N     1 
ATOM   4016 C CA    . ALA A 1 516 ? -1.140  4.324   38.882  1.00 25.27  ? 813  ALA A CA    1 
ATOM   4017 C C     . ALA A 1 516 ? -0.975  5.873   38.771  1.00 27.63  ? 813  ALA A C     1 
ATOM   4018 O O     . ALA A 1 516 ? -0.753  6.551   39.780  1.00 27.32  ? 813  ALA A O     1 
ATOM   4019 C CB    . ALA A 1 516 ? 0.122   3.579   38.554  1.00 28.17  ? 813  ALA A CB    1 
ATOM   4020 N N     . ARG A 1 517 ? -1.153  6.437   37.578  1.00 25.17  ? 814  ARG A N     1 
ATOM   4021 C CA    . ARG A 1 517 ? -1.067  7.864   37.384  1.00 26.90  ? 814  ARG A CA    1 
ATOM   4022 C C     . ARG A 1 517 ? -2.208  8.599   38.070  1.00 25.11  ? 814  ARG A C     1 
ATOM   4023 O O     . ARG A 1 517 ? -2.002  9.662   38.662  1.00 23.53  ? 814  ARG A O     1 
ATOM   4024 C CB    . ARG A 1 517 ? -1.012  8.250   35.897  1.00 30.66  ? 814  ARG A CB    1 
ATOM   4025 C CG    . ARG A 1 517 ? 0.258   7.756   35.194  1.00 38.83  ? 814  ARG A CG    1 
ATOM   4026 C CD    . ARG A 1 517 ? 1.520   8.399   35.745  1.00 43.43  ? 814  ARG A CD    1 
ATOM   4027 N NE    . ARG A 1 517 ? 1.278   9.825   36.018  1.00 51.72  ? 814  ARG A NE    1 
ATOM   4028 C CZ    . ARG A 1 517 ? 1.285   10.766  35.092  1.00 56.59  ? 814  ARG A CZ    1 
ATOM   4029 N NH1   . ARG A 1 517 ? 1.568   10.468  33.806  1.00 64.47  ? 814  ARG A NH1   1 
ATOM   4030 N NH2   . ARG A 1 517 ? 1.027   12.012  35.451  1.00 55.05  ? 814  ARG A NH2   1 
ATOM   4031 N N     . LEU A 1 518 ? -3.412  8.079   37.931  1.00 21.84  ? 815  LEU A N     1 
ATOM   4032 C CA    . LEU A 1 518 ? -4.565  8.661   38.622  1.00 23.81  ? 815  LEU A CA    1 
ATOM   4033 C C     . LEU A 1 518 ? -4.376  8.776   40.137  1.00 26.93  ? 815  LEU A C     1 
ATOM   4034 O O     . LEU A 1 518 ? -4.809  9.766   40.748  1.00 27.42  ? 815  LEU A O     1 
ATOM   4035 C CB    . LEU A 1 518 ? -5.810  7.888   38.333  1.00 23.39  ? 815  LEU A CB    1 
ATOM   4036 C CG    . LEU A 1 518 ? -6.354  7.918   36.916  1.00 23.87  ? 815  LEU A CG    1 
ATOM   4037 C CD1   . LEU A 1 518 ? -7.545  6.986   36.904  1.00 24.47  ? 815  LEU A CD1   1 
ATOM   4038 C CD2   . LEU A 1 518 ? -6.732  9.337   36.478  1.00 26.72  ? 815  LEU A CD2   1 
ATOM   4039 N N     . LYS A 1 519 ? -3.728  7.791   40.727  1.00 28.08  ? 816  LYS A N     1 
ATOM   4040 C CA    . LYS A 1 519 ? -3.448  7.765   42.184  1.00 29.91  ? 816  LYS A CA    1 
ATOM   4041 C C     . LYS A 1 519 ? -2.362  8.743   42.569  1.00 26.86  ? 816  LYS A C     1 
ATOM   4042 O O     . LYS A 1 519 ? -2.474  9.424   43.571  1.00 25.12  ? 816  LYS A O     1 
ATOM   4043 C CB    . LYS A 1 519 ? -3.054  6.376   42.679  1.00 33.21  ? 816  LYS A CB    1 
ATOM   4044 C CG    . LYS A 1 519 ? -4.269  5.478   42.864  1.00 46.56  ? 816  LYS A CG    1 
ATOM   4045 C CD    . LYS A 1 519 ? -3.896  4.053   43.286  1.00 55.20  ? 816  LYS A CD    1 
ATOM   4046 C CE    . LYS A 1 519 ? -5.042  3.076   42.979  1.00 68.18  ? 816  LYS A CE    1 
ATOM   4047 N NZ    . LYS A 1 519 ? -4.649  1.624   43.017  1.00 72.04  ? 816  LYS A NZ    1 
ATOM   4048 N N     . GLU A 1 520 ? -1.295  8.783   41.777  1.00 26.24  ? 817  GLU A N     1 
ATOM   4049 C CA    . GLU A 1 520 ? -0.198  9.698   41.992  1.00 29.92  ? 817  GLU A CA    1 
ATOM   4050 C C     . GLU A 1 520 ? -0.671  11.178  41.921  1.00 30.64  ? 817  GLU A C     1 
ATOM   4051 O O     . GLU A 1 520 ? -0.224  12.006  42.673  1.00 28.79  ? 817  GLU A O     1 
ATOM   4052 C CB    . GLU A 1 520 ? 0.839   9.502   40.899  1.00 32.35  ? 817  GLU A CB    1 
ATOM   4053 C CG    . GLU A 1 520 ? 1.750   8.349   41.106  1.00 39.49  ? 817  GLU A CG    1 
ATOM   4054 C CD    . GLU A 1 520 ? 2.620   8.084   39.846  1.00 43.88  ? 817  GLU A CD    1 
ATOM   4055 O OE1   . GLU A 1 520 ? 2.626   8.898   38.875  1.00 38.66  ? 817  GLU A OE1   1 
ATOM   4056 O OE2   . GLU A 1 520 ? 3.301   7.033   39.856  1.00 51.36  ? 817  GLU A OE2   1 
ATOM   4057 N N     . GLU A 1 521 ? -1.558  11.459  40.973  1.00 26.90  ? 818  GLU A N     1 
ATOM   4058 C CA    . GLU A 1 521 ? -2.144  12.776  40.760  1.00 30.33  ? 818  GLU A CA    1 
ATOM   4059 C C     . GLU A 1 521 ? -3.295  13.053  41.740  1.00 30.24  ? 818  GLU A C     1 
ATOM   4060 O O     . GLU A 1 521 ? -3.788  14.134  41.804  1.00 29.55  ? 818  GLU A O     1 
ATOM   4061 C CB    . GLU A 1 521 ? -2.647  12.878  39.325  1.00 31.75  ? 818  GLU A CB    1 
ATOM   4062 C CG    . GLU A 1 521 ? -1.550  12.799  38.269  1.00 36.90  ? 818  GLU A CG    1 
ATOM   4063 C CD    . GLU A 1 521 ? -0.545  13.896  38.498  1.00 47.58  ? 818  GLU A CD    1 
ATOM   4064 O OE1   . GLU A 1 521 ? -1.012  15.035  38.785  1.00 52.73  ? 818  GLU A OE1   1 
ATOM   4065 O OE2   . GLU A 1 521 ? 0.685   13.608  38.495  1.00 47.03  ? 818  GLU A OE2   1 
ATOM   4066 N N     . ARG A 1 522 ? -3.664  12.072  42.533  1.00 28.59  ? 819  ARG A N     1 
ATOM   4067 C CA    . ARG A 1 522 ? -4.802  12.167  43.459  1.00 31.07  ? 819  ARG A CA    1 
ATOM   4068 C C     . ARG A 1 522 ? -6.086  12.646  42.771  1.00 30.18  ? 819  ARG A C     1 
ATOM   4069 O O     . ARG A 1 522 ? -6.842  13.446  43.307  1.00 30.64  ? 819  ARG A O     1 
ATOM   4070 C CB    . ARG A 1 522 ? -4.434  13.053  44.664  1.00 37.54  ? 819  ARG A CB    1 
ATOM   4071 C CG    . ARG A 1 522 ? -2.931  12.972  45.070  1.00 36.50  ? 819  ARG A CG    1 
ATOM   4072 C CD    . ARG A 1 522 ? -2.811  11.871  45.988  1.00 35.33  ? 819  ARG A CD    1 
ATOM   4073 N NE    . ARG A 1 522 ? -1.577  11.769  46.760  1.00 34.22  ? 819  ARG A NE    1 
ATOM   4074 C CZ    . ARG A 1 522 ? -0.704  10.761  46.705  1.00 32.98  ? 819  ARG A CZ    1 
ATOM   4075 N NH1   . ARG A 1 522 ? -0.775  9.817   45.752  1.00 30.31  ? 819  ARG A NH1   1 
ATOM   4076 N NH2   . ARG A 1 522 ? 0.313   10.741  47.578  1.00 31.80  ? 819  ARG A NH2   1 
ATOM   4077 N N     . LEU A 1 523 ? -6.374  12.100  41.607  1.00 28.38  ? 820  LEU A N     1 
ATOM   4078 C CA    . LEU A 1 523 ? -7.602  12.500  40.865  1.00 27.28  ? 820  LEU A CA    1 
ATOM   4079 C C     . LEU A 1 523 ? -8.685  11.609  41.374  1.00 27.29  ? 820  LEU A C     1 
ATOM   4080 O O     . LEU A 1 523 ? -8.357  10.548  41.824  1.00 27.26  ? 820  LEU A O     1 
ATOM   4081 C CB    . LEU A 1 523 ? -7.401  12.346  39.378  1.00 27.68  ? 820  LEU A CB    1 
ATOM   4082 C CG    . LEU A 1 523 ? -6.489  13.369  38.742  1.00 27.58  ? 820  LEU A CG    1 
ATOM   4083 C CD1   . LEU A 1 523 ? -6.009  12.911  37.392  1.00 28.54  ? 820  LEU A CD1   1 
ATOM   4084 C CD2   . LEU A 1 523 ? -7.168  14.727  38.639  1.00 29.36  ? 820  LEU A CD2   1 
ATOM   4085 N N     . GLN A 1 524 ? -9.930  12.087  41.407  1.00 25.68  ? 821  GLN A N     1 
ATOM   4086 C CA    . GLN A 1 524 ? -11.083 11.279  41.707  1.00 28.81  ? 821  GLN A CA    1 
ATOM   4087 C C     . GLN A 1 524 ? -11.627 10.495  40.518  1.00 31.14  ? 821  GLN A C     1 
ATOM   4088 O O     . GLN A 1 524 ? -12.542 9.663   40.702  1.00 28.71  ? 821  GLN A O     1 
ATOM   4089 C CB    . GLN A 1 524 ? -12.231 12.146  42.238  1.00 29.41  ? 821  GLN A CB    1 
ATOM   4090 C CG    . GLN A 1 524 ? -11.830 12.878  43.503  1.00 32.89  ? 821  GLN A CG    1 
ATOM   4091 C CD    . GLN A 1 524 ? -12.947 13.688  44.093  1.00 36.42  ? 821  GLN A CD    1 
ATOM   4092 O OE1   . GLN A 1 524 ? -12.873 14.907  44.144  1.00 47.24  ? 821  GLN A OE1   1 
ATOM   4093 N NE2   . GLN A 1 524 ? -13.972 13.031  44.543  1.00 38.79  ? 821  GLN A NE2   1 
ATOM   4094 N N     . ALA A 1 525 ? -11.129 10.811  39.307  1.00 25.26  ? 822  ALA A N     1 
ATOM   4095 C CA    . ALA A 1 525 ? -11.492 10.115  38.066  1.00 26.16  ? 822  ALA A CA    1 
ATOM   4096 C C     . ALA A 1 525 ? -11.437 8.625   38.245  1.00 24.00  ? 822  ALA A C     1 
ATOM   4097 O O     . ALA A 1 525 ? -10.526 8.105   38.881  1.00 24.46  ? 822  ALA A O     1 
ATOM   4098 C CB    . ALA A 1 525 ? -10.567 10.512  36.929  1.00 26.97  ? 822  ALA A CB    1 
ATOM   4099 N N     . ARG A 1 526 ? -12.421 7.925   37.724  1.00 25.52  ? 823  ARG A N     1 
ATOM   4100 C CA    . ARG A 1 526 ? -12.381 6.441   37.817  1.00 29.09  ? 823  ARG A CA    1 
ATOM   4101 C C     . ARG A 1 526 ? -12.664 5.746   36.519  1.00 27.41  ? 823  ARG A C     1 
ATOM   4102 O O     . ARG A 1 526 ? -13.564 6.169   35.786  1.00 24.83  ? 823  ARG A O     1 
ATOM   4103 C CB    . ARG A 1 526 ? -13.324 5.912   38.915  1.00 29.63  ? 823  ARG A CB    1 
ATOM   4104 C CG    . ARG A 1 526 ? -14.740 5.937   38.569  1.00 33.25  ? 823  ARG A CG    1 
ATOM   4105 C CD    . ARG A 1 526 ? -15.574 5.232   39.647  1.00 38.02  ? 823  ARG A CD    1 
ATOM   4106 N NE    . ARG A 1 526 ? -15.454 5.893   40.942  1.00 40.47  ? 823  ARG A NE    1 
ATOM   4107 C CZ    . ARG A 1 526 ? -16.276 6.806   41.444  1.00 44.19  ? 823  ARG A CZ    1 
ATOM   4108 N NH1   . ARG A 1 526 ? -17.332 7.232   40.809  1.00 43.08  ? 823  ARG A NH1   1 
ATOM   4109 N NH2   . ARG A 1 526 ? -16.028 7.303   42.638  1.00 49.56  ? 823  ARG A NH2   1 
ATOM   4110 N N     . LEU A 1 527 ? -11.883 4.699   36.258  1.00 24.96  ? 824  LEU A N     1 
ATOM   4111 C CA    . LEU A 1 527 ? -12.120 3.804   35.177  1.00 25.24  ? 824  LEU A CA    1 
ATOM   4112 C C     . LEU A 1 527 ? -13.409 3.076   35.379  1.00 21.61  ? 824  LEU A C     1 
ATOM   4113 O O     . LEU A 1 527 ? -13.626 2.498   36.430  1.00 23.36  ? 824  LEU A O     1 
ATOM   4114 C CB    . LEU A 1 527 ? -11.031 2.777   35.075  1.00 28.11  ? 824  LEU A CB    1 
ATOM   4115 C CG    . LEU A 1 527 ? -9.840  2.994   34.211  1.00 34.64  ? 824  LEU A CG    1 
ATOM   4116 C CD1   . LEU A 1 527 ? -8.865  1.819   34.466  1.00 35.47  ? 824  LEU A CD1   1 
ATOM   4117 C CD2   . LEU A 1 527 ? -10.258 3.074   32.742  1.00 33.66  ? 824  LEU A CD2   1 
ATOM   4118 N N     . LEU A 1 528 ? -14.245 3.098   34.369  1.00 22.77  ? 825  LEU A N     1 
ATOM   4119 C CA    . LEU A 1 528 ? -15.516 2.373   34.397  1.00 24.69  ? 825  LEU A CA    1 
ATOM   4120 C C     . LEU A 1 528 ? -15.529 1.149   33.444  1.00 25.86  ? 825  LEU A C     1 
ATOM   4121 O O     . LEU A 1 528 ? -16.004 0.090   33.831  1.00 23.69  ? 825  LEU A O     1 
ATOM   4122 C CB    . LEU A 1 528 ? -16.641 3.291   34.073  1.00 25.04  ? 825  LEU A CB    1 
ATOM   4123 C CG    . LEU A 1 528 ? -16.912 4.413   35.105  1.00 27.01  ? 825  LEU A CG    1 
ATOM   4124 C CD1   . LEU A 1 528 ? -18.132 5.157   34.589  1.00 30.16  ? 825  LEU A CD1   1 
ATOM   4125 C CD2   . LEU A 1 528 ? -17.123 3.921   36.512  1.00 32.80  ? 825  LEU A CD2   1 
ATOM   4126 N N     . LEU A 1 529 ? -15.070 1.339   32.205  1.00 22.08  ? 826  LEU A N     1 
ATOM   4127 C CA    . LEU A 1 529 ? -15.178 0.336   31.172  1.00 24.06  ? 826  LEU A CA    1 
ATOM   4128 C C     . LEU A 1 529 ? -13.951 0.303   30.290  1.00 23.99  ? 826  LEU A C     1 
ATOM   4129 O O     . LEU A 1 529 ? -13.291 1.308   30.124  1.00 21.99  ? 826  LEU A O     1 
ATOM   4130 C CB    . LEU A 1 529 ? -16.398 0.619   30.282  1.00 25.13  ? 826  LEU A CB    1 
ATOM   4131 C CG    . LEU A 1 529 ? -17.769 0.572   30.978  1.00 30.26  ? 826  LEU A CG    1 
ATOM   4132 C CD1   . LEU A 1 529 ? -18.832 0.938   29.928  1.00 27.77  ? 826  LEU A CD1   1 
ATOM   4133 C CD2   . LEU A 1 529 ? -18.114 -0.791  31.639  1.00 29.63  ? 826  LEU A CD2   1 
ATOM   4134 N N     . GLN A 1 530 ? -13.699 -0.869  29.712  1.00 23.11  ? 827  GLN A N     1 
ATOM   4135 C CA    . GLN A 1 530 ? -12.760 -1.060  28.609  1.00 22.05  ? 827  GLN A CA    1 
ATOM   4136 C C     . GLN A 1 530 ? -13.593 -1.673  27.495  1.00 23.59  ? 827  GLN A C     1 
ATOM   4137 O O     . GLN A 1 530 ? -14.376 -2.586  27.741  1.00 24.28  ? 827  GLN A O     1 
ATOM   4138 C CB    . GLN A 1 530 ? -11.644 -1.994  28.986  1.00 22.84  ? 827  GLN A CB    1 
ATOM   4139 C CG    . GLN A 1 530 ? -10.505 -2.116  27.972  1.00 25.44  ? 827  GLN A CG    1 
ATOM   4140 C CD    . GLN A 1 530 ? -10.491 -3.473  27.276  1.00 27.18  ? 827  GLN A CD    1 
ATOM   4141 O OE1   . GLN A 1 530 ? -11.513 -3.988  26.903  1.00 28.50  ? 827  GLN A OE1   1 
ATOM   4142 N NE2   . GLN A 1 530 ? -9.359  -4.064  27.202  1.00 30.89  ? 827  GLN A NE2   1 
ATOM   4143 N N     . VAL A 1 531 ? -13.494 -1.140  26.287  1.00 22.28  ? 828  VAL A N     1 
ATOM   4144 C CA    . VAL A 1 531 ? -14.182 -1.742  25.096  1.00 22.31  ? 828  VAL A CA    1 
ATOM   4145 C C     . VAL A 1 531 ? -13.078 -1.981  23.999  1.00 23.29  ? 828  VAL A C     1 
ATOM   4146 O O     . VAL A 1 531 ? -13.047 -1.365  22.988  1.00 25.14  ? 828  VAL A O     1 
ATOM   4147 C CB    . VAL A 1 531 ? -15.270 -0.830  24.562  1.00 25.12  ? 828  VAL A CB    1 
ATOM   4148 C CG1   . VAL A 1 531 ? -16.114 -1.567  23.523  1.00 26.44  ? 828  VAL A CG1   1 
ATOM   4149 C CG2   . VAL A 1 531 ? -16.176 -0.327  25.691  1.00 25.64  ? 828  VAL A CG2   1 
ATOM   4150 N N     . HIS A 1 532 ? -12.149 -2.871  24.299  1.00 24.39  ? 829  HIS A N     1 
ATOM   4151 C CA    . HIS A 1 532 ? -11.148 -3.436  23.387  1.00 23.98  ? 829  HIS A CA    1 
ATOM   4152 C C     . HIS A 1 532 ? -10.037 -2.478  23.011  1.00 26.14  ? 829  HIS A C     1 
ATOM   4153 O O     . HIS A 1 532 ? -8.853  -2.825  23.166  1.00 25.64  ? 829  HIS A O     1 
ATOM   4154 C CB    . HIS A 1 532 ? -11.787 -4.103  22.154  1.00 25.76  ? 829  HIS A CB    1 
ATOM   4155 C CG    . HIS A 1 532 ? -12.875 -5.060  22.493  1.00 22.94  ? 829  HIS A CG    1 
ATOM   4156 N ND1   . HIS A 1 532 ? -12.717 -6.029  23.448  1.00 23.78  ? 829  HIS A ND1   1 
ATOM   4157 C CD2   . HIS A 1 532 ? -14.150 -5.162  22.053  1.00 22.81  ? 829  HIS A CD2   1 
ATOM   4158 C CE1   . HIS A 1 532 ? -13.843 -6.702  23.569  1.00 24.48  ? 829  HIS A CE1   1 
ATOM   4159 N NE2   . HIS A 1 532 ? -14.745 -6.160  22.763  1.00 25.32  ? 829  HIS A NE2   1 
ATOM   4160 N N     . ASP A 1 533 ? -10.380 -1.293  22.492  1.00 25.54  ? 830  ASP A N     1 
ATOM   4161 C CA    . ASP A 1 533 ? -9.341  -0.272  22.240  1.00 25.56  ? 830  ASP A CA    1 
ATOM   4162 C C     . ASP A 1 533 ? -9.677  1.080   22.804  1.00 25.97  ? 830  ASP A C     1 
ATOM   4163 O O     . ASP A 1 533 ? -9.134  2.093   22.363  1.00 22.83  ? 830  ASP A O     1 
ATOM   4164 C CB    . ASP A 1 533 ? -9.082  -0.108  20.766  1.00 27.02  ? 830  ASP A CB    1 
ATOM   4165 C CG    . ASP A 1 533 ? -10.309 0.416   20.009  1.00 29.98  ? 830  ASP A CG    1 
ATOM   4166 O OD1   . ASP A 1 533 ? -11.430 0.446   20.607  1.00 28.53  ? 830  ASP A OD1   1 
ATOM   4167 O OD2   . ASP A 1 533 ? -10.124 0.854   18.858  1.00 31.97  ? 830  ASP A OD2   1 
ATOM   4168 N N     . GLU A 1 534 ? -10.646 1.090   23.716  1.00 25.07  ? 831  GLU A N     1 
ATOM   4169 C CA    . GLU A 1 534 ? -10.990 2.282   24.382  1.00 27.45  ? 831  GLU A CA    1 
ATOM   4170 C C     . GLU A 1 534 ? -11.247 2.152   25.839  1.00 24.62  ? 831  GLU A C     1 
ATOM   4171 O O     . GLU A 1 534 ? -11.601 1.101   26.292  1.00 22.47  ? 831  GLU A O     1 
ATOM   4172 C CB    . GLU A 1 534 ? -12.175 2.946   23.721  1.00 32.70  ? 831  GLU A CB    1 
ATOM   4173 C CG    . GLU A 1 534 ? -13.445 2.265   23.814  1.00 36.40  ? 831  GLU A CG    1 
ATOM   4174 C CD    . GLU A 1 534 ? -14.553 3.166   23.222  1.00 47.59  ? 831  GLU A CD    1 
ATOM   4175 O OE1   . GLU A 1 534 ? -14.475 4.439   23.362  1.00 49.07  ? 831  GLU A OE1   1 
ATOM   4176 O OE2   . GLU A 1 534 ? -15.473 2.584   22.620  1.00 41.72  ? 831  GLU A OE2   1 
ATOM   4177 N N     . LEU A 1 535 ? -11.046 3.246   26.537  1.00 22.75  ? 832  LEU A N     1 
ATOM   4178 C CA    . LEU A 1 535 ? -11.307 3.330   27.961  1.00 26.77  ? 832  LEU A CA    1 
ATOM   4179 C C     . LEU A 1 535 ? -12.287 4.412   28.254  1.00 24.62  ? 832  LEU A C     1 
ATOM   4180 O O     . LEU A 1 535 ? -12.188 5.502   27.714  1.00 22.80  ? 832  LEU A O     1 
ATOM   4181 C CB    . LEU A 1 535 ? -10.025 3.644   28.725  1.00 26.18  ? 832  LEU A CB    1 
ATOM   4182 C CG    . LEU A 1 535 ? -8.924  2.639   28.494  1.00 25.60  ? 832  LEU A CG    1 
ATOM   4183 C CD1   . LEU A 1 535 ? -7.705  3.107   29.275  1.00 25.66  ? 832  LEU A CD1   1 
ATOM   4184 C CD2   . LEU A 1 535 ? -9.378  1.250   28.981  1.00 26.87  ? 832  LEU A CD2   1 
ATOM   4185 N N     . ILE A 1 536 ? -13.213 4.104   29.158  1.00 25.67  ? 833  ILE A N     1 
ATOM   4186 C CA    . ILE A 1 536 ? -14.278 4.971   29.507  1.00 23.69  ? 833  ILE A CA    1 
ATOM   4187 C C     . ILE A 1 536 ? -14.163 5.221   30.986  1.00 24.75  ? 833  ILE A C     1 
ATOM   4188 O O     . ILE A 1 536 ? -14.133 4.279   31.793  1.00 25.39  ? 833  ILE A O     1 
ATOM   4189 C CB    . ILE A 1 536 ? -15.639 4.355   29.241  1.00 27.87  ? 833  ILE A CB    1 
ATOM   4190 C CG1   . ILE A 1 536 ? -15.735 3.737   27.845  1.00 28.22  ? 833  ILE A CG1   1 
ATOM   4191 C CG2   . ILE A 1 536 ? -16.737 5.371   29.541  1.00 28.96  ? 833  ILE A CG2   1 
ATOM   4192 C CD1   . ILE A 1 536 ? -15.610 4.734   26.764  1.00 32.24  ? 833  ILE A CD1   1 
ATOM   4193 N N     . LEU A 1 537 ? -14.161 6.496   31.346  1.00 22.17  ? 834  LEU A N     1 
ATOM   4194 C CA    . LEU A 1 537 ? -14.067 6.979   32.713  1.00 22.62  ? 834  LEU A CA    1 
ATOM   4195 C C     . LEU A 1 537 ? -15.156 7.994   33.095  1.00 23.42  ? 834  LEU A C     1 
ATOM   4196 O O     . LEU A 1 537 ? -15.847 8.517   32.213  1.00 23.18  ? 834  LEU A O     1 
ATOM   4197 C CB    . LEU A 1 537 ? -12.738 7.679   32.969  1.00 24.52  ? 834  LEU A CB    1 
ATOM   4198 C CG    . LEU A 1 537 ? -11.439 6.961   32.755  1.00 25.59  ? 834  LEU A CG    1 
ATOM   4199 C CD1   . LEU A 1 537 ? -10.969 7.005   31.320  1.00 30.51  ? 834  LEU A CD1   1 
ATOM   4200 C CD2   . LEU A 1 537 ? -10.348 7.538   33.631  1.00 28.39  ? 834  LEU A CD2   1 
ATOM   4201 N N     . GLU A 1 538 ? -15.364 8.194   34.410  1.00 22.20  ? 835  GLU A N     1 
ATOM   4202 C CA    . GLU A 1 538 ? -16.172 9.318   34.864  1.00 22.42  ? 835  GLU A CA    1 
ATOM   4203 C C     . GLU A 1 538 ? -15.316 10.104  35.838  1.00 24.44  ? 835  GLU A C     1 
ATOM   4204 O O     . GLU A 1 538 ? -14.485 9.546   36.537  1.00 21.89  ? 835  GLU A O     1 
ATOM   4205 C CB    . GLU A 1 538 ? -17.485 8.894   35.533  1.00 21.72  ? 835  GLU A CB    1 
ATOM   4206 C CG    . GLU A 1 538 ? -17.288 8.138   36.804  1.00 23.63  ? 835  GLU A CG    1 
ATOM   4207 C CD    . GLU A 1 538 ? -18.619 7.646   37.440  1.00 29.83  ? 835  GLU A CD    1 
ATOM   4208 O OE1   . GLU A 1 538 ? -19.683 7.871   36.826  1.00 27.30  ? 835  GLU A OE1   1 
ATOM   4209 O OE2   . GLU A 1 538 ? -18.589 7.005   38.548  1.00 26.92  ? 835  GLU A OE2   1 
ATOM   4210 N N     . ALA A 1 539 ? -15.496 11.417  35.841  1.00 24.07  ? 836  ALA A N     1 
ATOM   4211 C CA    . ALA A 1 539 ? -14.728 12.265  36.736  1.00 26.11  ? 836  ALA A CA    1 
ATOM   4212 C C     . ALA A 1 539 ? -15.475 13.590  36.981  1.00 23.70  ? 836  ALA A C     1 
ATOM   4213 O O     . ALA A 1 539 ? -16.352 13.992  36.173  1.00 23.72  ? 836  ALA A O     1 
ATOM   4214 C CB    . ALA A 1 539 ? -13.347 12.547  36.120  1.00 26.21  ? 836  ALA A CB    1 
ATOM   4215 N N     . PRO A 1 540 ? -15.081 14.298  38.034  1.00 25.85  ? 837  PRO A N     1 
ATOM   4216 C CA    . PRO A 1 540 ? -15.611 15.681  38.235  1.00 27.01  ? 837  PRO A CA    1 
ATOM   4217 C C     . PRO A 1 540 ? -15.364 16.545  37.054  1.00 28.03  ? 837  PRO A C     1 
ATOM   4218 O O     . PRO A 1 540 ? -14.332 16.400  36.334  1.00 27.36  ? 837  PRO A O     1 
ATOM   4219 C CB    . PRO A 1 540 ? -14.840 16.183  39.483  1.00 25.29  ? 837  PRO A CB    1 
ATOM   4220 C CG    . PRO A 1 540 ? -14.371 14.955  40.173  1.00 27.03  ? 837  PRO A CG    1 
ATOM   4221 C CD    . PRO A 1 540 ? -14.123 13.896  39.091  1.00 24.58  ? 837  PRO A CD    1 
ATOM   4222 N N     . LYS A 1 541 ? -16.305 17.416  36.751  1.00 26.91  ? 838  LYS A N     1 
ATOM   4223 C CA    . LYS A 1 541 ? -16.089 18.311  35.660  1.00 30.25  ? 838  LYS A CA    1 
ATOM   4224 C C     . LYS A 1 541 ? -14.784 19.066  35.766  1.00 27.64  ? 838  LYS A C     1 
ATOM   4225 O O     . LYS A 1 541 ? -14.227 19.412  34.770  1.00 26.28  ? 838  LYS A O     1 
ATOM   4226 C CB    . LYS A 1 541 ? -17.250 19.293  35.459  1.00 35.26  ? 838  LYS A CB    1 
ATOM   4227 C CG    . LYS A 1 541 ? -17.489 20.158  36.647  1.00 43.20  ? 838  LYS A CG    1 
ATOM   4228 C CD    . LYS A 1 541 ? -18.704 21.078  36.455  1.00 53.22  ? 838  LYS A CD    1 
ATOM   4229 C CE    . LYS A 1 541 ? -18.974 21.841  37.782  1.00 59.27  ? 838  LYS A CE    1 
ATOM   4230 N NZ    . LYS A 1 541 ? -20.385 22.315  37.832  1.00 65.44  ? 838  LYS A NZ    1 
ATOM   4231 N N     . GLU A 1 542 ? -14.359 19.359  36.989  1.00 26.23  ? 839  GLU A N     1 
ATOM   4232 C CA    . GLU A 1 542 ? -13.169 20.106  37.247  1.00 32.01  ? 839  GLU A CA    1 
ATOM   4233 C C     . GLU A 1 542 ? -11.885 19.327  36.931  1.00 33.57  ? 839  GLU A C     1 
ATOM   4234 O O     . GLU A 1 542 ? -10.802 19.910  36.965  1.00 28.79  ? 839  GLU A O     1 
ATOM   4235 C CB    . GLU A 1 542 ? -13.091 20.546  38.713  1.00 33.28  ? 839  GLU A CB    1 
ATOM   4236 C CG    . GLU A 1 542 ? -14.181 21.521  39.106  1.00 40.75  ? 839  GLU A CG    1 
ATOM   4237 C CD    . GLU A 1 542 ? -15.519 20.848  39.554  1.00 51.43  ? 839  GLU A CD    1 
ATOM   4238 O OE1   . GLU A 1 542 ? -15.624 19.582  39.639  1.00 37.84  ? 839  GLU A OE1   1 
ATOM   4239 O OE2   . GLU A 1 542 ? -16.503 21.617  39.766  1.00 57.78  ? 839  GLU A OE2   1 
ATOM   4240 N N     . GLU A 1 543 ? -11.993 18.019  36.664  1.00 29.13  ? 840  GLU A N     1 
ATOM   4241 C CA    . GLU A 1 543 ? -10.826 17.251  36.233  1.00 26.31  ? 840  GLU A CA    1 
ATOM   4242 C C     . GLU A 1 543 ? -10.691 17.052  34.733  1.00 25.18  ? 840  GLU A C     1 
ATOM   4243 O O     . GLU A 1 543 ? -9.701  16.461  34.291  1.00 24.43  ? 840  GLU A O     1 
ATOM   4244 C CB    . GLU A 1 543 ? -10.835 15.868  36.946  1.00 25.55  ? 840  GLU A CB    1 
ATOM   4245 C CG    . GLU A 1 543 ? -10.660 15.965  38.464  1.00 28.16  ? 840  GLU A CG    1 
ATOM   4246 C CD    . GLU A 1 543 ? -10.573 14.613  39.115  1.00 31.47  ? 840  GLU A CD    1 
ATOM   4247 O OE1   . GLU A 1 543 ? -10.624 13.534  38.396  1.00 28.90  ? 840  GLU A OE1   1 
ATOM   4248 O OE2   . GLU A 1 543 ? -10.462 14.618  40.347  1.00 32.10  ? 840  GLU A OE2   1 
ATOM   4249 N N     . MET A 1 544 ? -11.674 17.455  33.938  1.00 24.32  ? 841  MET A N     1 
ATOM   4250 C CA    . MET A 1 544 ? -11.612 17.206  32.524  1.00 26.65  ? 841  MET A CA    1 
ATOM   4251 C C     . MET A 1 544 ? -10.363 17.722  31.803  1.00 26.10  ? 841  MET A C     1 
ATOM   4252 O O     . MET A 1 544 ? -9.780  17.016  31.020  1.00 23.62  ? 841  MET A O     1 
ATOM   4253 C CB    . MET A 1 544 ? -12.836 17.768  31.749  1.00 27.56  ? 841  MET A CB    1 
ATOM   4254 C CG    . MET A 1 544 ? -14.150 17.092  32.124  1.00 31.07  ? 841  MET A CG    1 
ATOM   4255 S SD    . MET A 1 544 ? -14.241 15.335  31.659  1.00 32.25  ? 841  MET A SD    1 
ATOM   4256 C CE    . MET A 1 544 ? -13.884 14.597  33.178  1.00 29.70  ? 841  MET A CE    1 
ATOM   4257 N N     . GLU A 1 545 ? -9.984  18.969  32.063  1.00 25.25  ? 842  GLU A N     1 
ATOM   4258 C CA    . GLU A 1 545 ? -8.850  19.555  31.340  1.00 26.86  ? 842  GLU A CA    1 
ATOM   4259 C C     . GLU A 1 545 ? -7.633  18.741  31.618  1.00 25.52  ? 842  GLU A C     1 
ATOM   4260 O O     . GLU A 1 545 ? -6.863  18.445  30.693  1.00 23.21  ? 842  GLU A O     1 
ATOM   4261 C CB    . GLU A 1 545 ? -8.669  21.023  31.738  1.00 27.87  ? 842  GLU A CB    1 
ATOM   4262 C CG    . GLU A 1 545 ? -9.821  21.850  31.218  1.00 28.79  ? 842  GLU A CG    1 
ATOM   4263 C CD    . GLU A 1 545 ? -9.518  23.324  31.281  1.00 29.72  ? 842  GLU A CD    1 
ATOM   4264 O OE1   . GLU A 1 545 ? -8.638  23.782  30.525  1.00 28.31  ? 842  GLU A OE1   1 
ATOM   4265 O OE2   . GLU A 1 545 ? -10.046 23.969  32.200  1.00 30.38  ? 842  GLU A OE2   1 
ATOM   4266 N N     . ARG A 1 546 ? -7.449  18.346  32.886  1.00 25.11  ? 843  ARG A N     1 
ATOM   4267 C CA    . ARG A 1 546 ? -6.302  17.495  33.219  1.00 27.13  ? 843  ARG A CA    1 
ATOM   4268 C C     . ARG A 1 546 ? -6.367  16.109  32.569  1.00 25.84  ? 843  ARG A C     1 
ATOM   4269 O O     . ARG A 1 546 ? -5.368  15.618  32.085  1.00 25.59  ? 843  ARG A O     1 
ATOM   4270 C CB    . ARG A 1 546 ? -6.133  17.373  34.691  1.00 26.59  ? 843  ARG A CB    1 
ATOM   4271 C CG    . ARG A 1 546 ? -5.696  18.695  35.254  1.00 32.19  ? 843  ARG A CG    1 
ATOM   4272 C CD    . ARG A 1 546 ? -4.654  18.421  36.298  1.00 42.07  ? 843  ARG A CD    1 
ATOM   4273 N NE    . ARG A 1 546 ? -5.299  18.146  37.531  1.00 46.74  ? 843  ARG A NE    1 
ATOM   4274 C CZ    . ARG A 1 546 ? -4.779  17.491  38.569  1.00 48.77  ? 843  ARG A CZ    1 
ATOM   4275 N NH1   . ARG A 1 546 ? -3.588  16.868  38.549  1.00 51.70  ? 843  ARG A NH1   1 
ATOM   4276 N NH2   . ARG A 1 546 ? -5.553  17.435  39.626  1.00 44.05  ? 843  ARG A NH2   1 
ATOM   4277 N N     . LEU A 1 547 ? -7.543  15.497  32.537  1.00 26.75  ? 844  LEU A N     1 
ATOM   4278 C CA    . LEU A 1 547 ? -7.675  14.140  31.907  1.00 26.31  ? 844  LEU A CA    1 
ATOM   4279 C C     . LEU A 1 547 ? -7.424  14.173  30.417  1.00 24.98  ? 844  LEU A C     1 
ATOM   4280 O O     . LEU A 1 547 ? -6.886  13.193  29.859  1.00 25.64  ? 844  LEU A O     1 
ATOM   4281 C CB    . LEU A 1 547 ? -9.027  13.535  32.188  1.00 26.09  ? 844  LEU A CB    1 
ATOM   4282 C CG    . LEU A 1 547 ? -9.307  13.158  33.615  1.00 26.60  ? 844  LEU A CG    1 
ATOM   4283 C CD1   . LEU A 1 547 ? -10.720 12.677  33.713  1.00 33.46  ? 844  LEU A CD1   1 
ATOM   4284 C CD2   . LEU A 1 547 ? -8.359  12.064  34.091  1.00 25.98  ? 844  LEU A CD2   1 
ATOM   4285 N N     . CYS A 1 548 ? -7.692  15.339  29.778  1.00 26.03  ? 845  CYS A N     1 
ATOM   4286 C CA    . CYS A 1 548 ? -7.487  15.515  28.361  1.00 23.63  ? 845  CYS A CA    1 
ATOM   4287 C C     . CYS A 1 548 ? -6.021  15.374  27.995  1.00 27.19  ? 845  CYS A C     1 
ATOM   4288 O O     . CYS A 1 548 ? -5.677  15.004  26.867  1.00 29.11  ? 845  CYS A O     1 
ATOM   4289 C CB    . CYS A 1 548 ? -8.062  16.877  27.856  1.00 29.17  ? 845  CYS A CB    1 
ATOM   4290 S SG    . CYS A 1 548 ? -9.858  16.849  27.701  1.00 33.29  ? 845  CYS A SG    1 
ATOM   4291 N N     . ARG A 1 549 ? -5.174  15.774  28.904  1.00 23.32  ? 846  ARG A N     1 
ATOM   4292 C CA    . ARG A 1 549 ? -3.741  15.628  28.718  1.00 29.66  ? 846  ARG A CA    1 
ATOM   4293 C C     . ARG A 1 549 ? -3.211  14.343  29.242  1.00 29.65  ? 846  ARG A C     1 
ATOM   4294 O O     . ARG A 1 549 ? -2.441  13.686  28.573  1.00 27.74  ? 846  ARG A O     1 
ATOM   4295 C CB    . ARG A 1 549 ? -2.985  16.764  29.398  1.00 32.07  ? 846  ARG A CB    1 
ATOM   4296 C CG    . ARG A 1 549 ? -2.858  17.981  28.493  1.00 34.74  ? 846  ARG A CG    1 
ATOM   4297 C CD    . ARG A 1 549 ? -2.284  19.205  29.200  1.00 31.15  ? 846  ARG A CD    1 
ATOM   4298 N NE    . ARG A 1 549 ? -0.850  19.116  29.539  1.00 35.49  ? 846  ARG A NE    1 
ATOM   4299 C CZ    . ARG A 1 549 ? 0.111   19.354  28.665  1.00 37.51  ? 846  ARG A CZ    1 
ATOM   4300 N NH1   . ARG A 1 549 ? -0.216  19.648  27.422  1.00 35.75  ? 846  ARG A NH1   1 
ATOM   4301 N NH2   . ARG A 1 549 ? 1.380   19.337  29.032  1.00 43.37  ? 846  ARG A NH2   1 
ATOM   4302 N N     . LEU A 1 550 ? -3.666  13.933  30.414  1.00 27.99  ? 847  LEU A N     1 
ATOM   4303 C CA    . LEU A 1 550 ? -3.149  12.729  31.027  1.00 25.85  ? 847  LEU A CA    1 
ATOM   4304 C C     . LEU A 1 550 ? -3.522  11.399  30.370  1.00 26.63  ? 847  LEU A C     1 
ATOM   4305 O O     . LEU A 1 550 ? -2.659  10.580  30.118  1.00 24.82  ? 847  LEU A O     1 
ATOM   4306 C CB    . LEU A 1 550 ? -3.531  12.730  32.497  1.00 28.43  ? 847  LEU A CB    1 
ATOM   4307 C CG    . LEU A 1 550 ? -3.043  11.626  33.425  1.00 32.55  ? 847  LEU A CG    1 
ATOM   4308 C CD1   . LEU A 1 550 ? -3.354  12.001  34.868  1.00 37.81  ? 847  LEU A CD1   1 
ATOM   4309 C CD2   . LEU A 1 550 ? -3.768  10.333  33.151  1.00 39.64  ? 847  LEU A CD2   1 
ATOM   4310 N N     . VAL A 1 551 ? -4.787  11.177  30.096  1.00 24.14  ? 848  VAL A N     1 
ATOM   4311 C CA    . VAL A 1 551 ? -5.211  9.917   29.603  1.00 25.60  ? 848  VAL A CA    1 
ATOM   4312 C C     . VAL A 1 551 ? -4.595  9.567   28.245  1.00 25.48  ? 848  VAL A C     1 
ATOM   4313 O O     . VAL A 1 551 ? -4.061  8.514   28.115  1.00 25.60  ? 848  VAL A O     1 
ATOM   4314 C CB    . VAL A 1 551 ? -6.755  9.771   29.594  1.00 24.89  ? 848  VAL A CB    1 
ATOM   4315 C CG1   . VAL A 1 551 ? -7.140  8.407   29.061  1.00 25.53  ? 848  VAL A CG1   1 
ATOM   4316 C CG2   . VAL A 1 551 ? -7.292  9.942   31.039  1.00 21.70  ? 848  VAL A CG2   1 
ATOM   4317 N N     . PRO A 1 552 ? -4.649  10.460  27.250  1.00 26.68  ? 849  PRO A N     1 
ATOM   4318 C CA    . PRO A 1 552 ? -4.078  10.077  25.992  1.00 24.87  ? 849  PRO A CA    1 
ATOM   4319 C C     . PRO A 1 552 ? -2.585  9.806   26.122  1.00 25.54  ? 849  PRO A C     1 
ATOM   4320 O O     . PRO A 1 552 ? -2.065  8.881   25.489  1.00 25.28  ? 849  PRO A O     1 
ATOM   4321 C CB    . PRO A 1 552 ? -4.332  11.312  25.104  1.00 24.00  ? 849  PRO A CB    1 
ATOM   4322 C CG    . PRO A 1 552 ? -5.522  11.932  25.678  1.00 25.73  ? 849  PRO A CG    1 
ATOM   4323 C CD    . PRO A 1 552 ? -5.368  11.748  27.143  1.00 24.84  ? 849  PRO A CD    1 
ATOM   4324 N N     . GLU A 1 553 ? -1.921  10.600  26.919  1.00 24.25  ? 850  GLU A N     1 
ATOM   4325 C CA    . GLU A 1 553 ? -0.491  10.435  27.064  1.00 27.76  ? 850  GLU A CA    1 
ATOM   4326 C C     . GLU A 1 553 ? -0.138  9.065   27.669  1.00 27.41  ? 850  GLU A C     1 
ATOM   4327 O O     . GLU A 1 553 ? 0.784   8.395   27.201  1.00 23.39  ? 850  GLU A O     1 
ATOM   4328 C CB    . GLU A 1 553 ? 0.113   11.548  27.872  1.00 28.99  ? 850  GLU A CB    1 
ATOM   4329 C CG    . GLU A 1 553 ? 1.586   11.353  28.186  1.00 36.45  ? 850  GLU A CG    1 
ATOM   4330 C CD    . GLU A 1 553 ? 2.538   11.574  26.951  1.00 46.00  ? 850  GLU A CD    1 
ATOM   4331 O OE1   . GLU A 1 553 ? 2.085   11.934  25.839  1.00 59.87  ? 850  GLU A OE1   1 
ATOM   4332 O OE2   . GLU A 1 553 ? 3.784   11.392  27.081  1.00 63.63  ? 850  GLU A OE2   1 
ATOM   4333 N N     . VAL A 1 554 ? -0.843  8.649   28.716  1.00 23.56  ? 851  VAL A N     1 
ATOM   4334 C CA    . VAL A 1 554 ? -0.580  7.363   29.321  1.00 23.75  ? 851  VAL A CA    1 
ATOM   4335 C C     . VAL A 1 554 ? -0.822  6.218   28.327  1.00 22.95  ? 851  VAL A C     1 
ATOM   4336 O O     . VAL A 1 554 ? -0.059  5.235   28.271  1.00 24.25  ? 851  VAL A O     1 
ATOM   4337 C CB    . VAL A 1 554 ? -1.502  7.156   30.574  1.00 25.34  ? 851  VAL A CB    1 
ATOM   4338 C CG1   . VAL A 1 554 ? -1.364  5.746   31.119  1.00 29.10  ? 851  VAL A CG1   1 
ATOM   4339 C CG2   . VAL A 1 554 ? -1.138  8.107   31.663  1.00 28.12  ? 851  VAL A CG2   1 
ATOM   4340 N N     . MET A 1 555 ? -1.937  6.310   27.574  1.00 20.37  ? 852  MET A N     1 
ATOM   4341 C CA    . MET A 1 555 ? -2.275  5.319   26.630  1.00 20.67  ? 852  MET A CA    1 
ATOM   4342 C C     . MET A 1 555 ? -1.263  5.240   25.455  1.00 25.02  ? 852  MET A C     1 
ATOM   4343 O O     . MET A 1 555 ? -0.943  4.129   24.965  1.00 24.62  ? 852  MET A O     1 
ATOM   4344 C CB    . MET A 1 555 ? -3.717  5.554   26.139  1.00 22.81  ? 852  MET A CB    1 
ATOM   4345 C CG    . MET A 1 555 ? -4.745  5.367   27.272  1.00 22.71  ? 852  MET A CG    1 
ATOM   4346 S SD    . MET A 1 555 ? -6.428  5.678   26.670  1.00 24.68  ? 852  MET A SD    1 
ATOM   4347 C CE    . MET A 1 555 ? -6.700  4.400   25.493  1.00 27.77  ? 852  MET A CE    1 
ATOM   4348 N N     . GLU A 1 556 ? -0.796  6.398   25.011  1.00 21.71  ? 853  GLU A N     1 
ATOM   4349 C CA    . GLU A 1 556 ? 0.148   6.492   23.904  1.00 24.00  ? 853  GLU A CA    1 
ATOM   4350 C C     . GLU A 1 556 ? 1.523   6.017   24.287  1.00 26.24  ? 853  GLU A C     1 
ATOM   4351 O O     . GLU A 1 556 ? 2.205   5.471   23.490  1.00 28.74  ? 853  GLU A O     1 
ATOM   4352 C CB    . GLU A 1 556 ? 0.230   7.940   23.365  1.00 25.40  ? 853  GLU A CB    1 
ATOM   4353 C CG    . GLU A 1 556 ? -0.992  8.373   22.568  1.00 25.55  ? 853  GLU A CG    1 
ATOM   4354 C CD    . GLU A 1 556 ? -1.008  9.844   22.219  1.00 32.03  ? 853  GLU A CD    1 
ATOM   4355 O OE1   . GLU A 1 556 ? -0.161  10.602  22.713  1.00 30.46  ? 853  GLU A OE1   1 
ATOM   4356 O OE2   . GLU A 1 556 ? -1.901  10.235  21.411  1.00 38.94  ? 853  GLU A OE2   1 
ATOM   4357 N N     . GLN A 1 557 ? 1.896   6.155   25.537  1.00 25.74  ? 854  GLN A N     1 
ATOM   4358 C CA    . GLN A 1 557 ? 3.209   5.774   26.006  1.00 27.41  ? 854  GLN A CA    1 
ATOM   4359 C C     . GLN A 1 557 ? 3.259   4.409   26.678  1.00 28.26  ? 854  GLN A C     1 
ATOM   4360 O O     . GLN A 1 557 ? 4.282   4.024   27.200  1.00 26.46  ? 854  GLN A O     1 
ATOM   4361 C CB    . GLN A 1 557 ? 3.710   6.869   27.015  1.00 26.74  ? 854  GLN A CB    1 
ATOM   4362 C CG    . GLN A 1 557 ? 3.886   8.224   26.326  1.00 31.64  ? 854  GLN A CG    1 
ATOM   4363 C CD    . GLN A 1 557 ? 4.800   8.198   25.066  1.00 36.09  ? 854  GLN A CD    1 
ATOM   4364 O OE1   . GLN A 1 557 ? 5.895   7.625   25.099  1.00 44.25  ? 854  GLN A OE1   1 
ATOM   4365 N NE2   . GLN A 1 557 ? 4.350   8.784   23.972  1.00 40.75  ? 854  GLN A NE2   1 
ATOM   4366 N N     . ALA A 1 558 ? 2.152   3.679   26.686  1.00 26.35  ? 855  ALA A N     1 
ATOM   4367 C CA    . ALA A 1 558 ? 2.103   2.375   27.354  1.00 26.40  ? 855  ALA A CA    1 
ATOM   4368 C C     . ALA A 1 558 ? 3.193   1.407   26.826  1.00 29.99  ? 855  ALA A C     1 
ATOM   4369 O O     . ALA A 1 558 ? 3.800   0.723   27.625  1.00 27.65  ? 855  ALA A O     1 
ATOM   4370 C CB    . ALA A 1 558 ? 0.742   1.772   27.132  1.00 28.85  ? 855  ALA A CB    1 
ATOM   4371 N N     . VAL A 1 559 ? 3.416   1.389   25.497  1.00 26.72  ? 856  VAL A N     1 
ATOM   4372 C CA    . VAL A 1 559 ? 4.537   0.704   24.879  1.00 28.40  ? 856  VAL A CA    1 
ATOM   4373 C C     . VAL A 1 559 ? 5.160   1.639   23.842  1.00 29.17  ? 856  VAL A C     1 
ATOM   4374 O O     . VAL A 1 559 ? 4.555   2.603   23.436  1.00 33.75  ? 856  VAL A O     1 
ATOM   4375 C CB    . VAL A 1 559 ? 4.132   -0.640  24.221  1.00 30.01  ? 856  VAL A CB    1 
ATOM   4376 C CG1   . VAL A 1 559 ? 3.398   -1.535  25.198  1.00 27.59  ? 856  VAL A CG1   1 
ATOM   4377 C CG2   . VAL A 1 559 ? 3.279   -0.379  22.999  1.00 35.95  ? 856  VAL A CG2   1 
ATOM   4378 N N     . THR A 1 560 ? 6.374   1.345   23.422  1.00 30.42  ? 857  THR A N     1 
ATOM   4379 C CA    . THR A 1 560 ? 7.044   2.085   22.341  1.00 30.57  ? 857  THR A CA    1 
ATOM   4380 C C     . THR A 1 560 ? 7.143   1.157   21.129  1.00 29.37  ? 857  THR A C     1 
ATOM   4381 O O     . THR A 1 560 ? 7.717   0.145   21.209  1.00 30.98  ? 857  THR A O     1 
ATOM   4382 C CB    . THR A 1 560 ? 8.464   2.534   22.712  1.00 36.44  ? 857  THR A CB    1 
ATOM   4383 O OG1   . THR A 1 560 ? 8.434   3.197   23.966  1.00 41.41  ? 857  THR A OG1   1 
ATOM   4384 C CG2   . THR A 1 560 ? 9.040   3.572   21.617  1.00 38.17  ? 857  THR A CG2   1 
ATOM   4385 N N     . LEU A 1 561 ? 6.474   1.498   20.038  1.00 29.25  ? 858  LEU A N     1 
ATOM   4386 C CA    . LEU A 1 561 ? 6.504   0.761   18.802  1.00 27.20  ? 858  LEU A CA    1 
ATOM   4387 C C     . LEU A 1 561 ? 7.323   1.584   17.805  1.00 28.60  ? 858  LEU A C     1 
ATOM   4388 O O     . LEU A 1 561 ? 7.651   2.740   18.084  1.00 29.87  ? 858  LEU A O     1 
ATOM   4389 C CB    . LEU A 1 561 ? 5.081   0.600   18.262  1.00 26.42  ? 858  LEU A CB    1 
ATOM   4390 C CG    . LEU A 1 561 ? 4.090   -0.081  19.225  1.00 26.61  ? 858  LEU A CG    1 
ATOM   4391 C CD1   . LEU A 1 561 ? 2.730   -0.205  18.514  1.00 26.62  ? 858  LEU A CD1   1 
ATOM   4392 C CD2   . LEU A 1 561 ? 4.577   -1.427  19.684  1.00 28.00  ? 858  LEU A CD2   1 
ATOM   4393 N N     . ARG A 1 562 ? 7.592   1.005   16.656  1.00 26.09  ? 859  ARG A N     1 
ATOM   4394 C CA    . ARG A 1 562 ? 8.300   1.663   15.543  1.00 30.04  ? 859  ARG A CA    1 
ATOM   4395 C C     . ARG A 1 562 ? 7.446   2.740   14.883  1.00 30.93  ? 859  ARG A C     1 
ATOM   4396 O O     . ARG A 1 562 ? 7.954   3.520   14.103  1.00 29.30  ? 859  ARG A O     1 
ATOM   4397 C CB    . ARG A 1 562 ? 8.684   0.648   14.462  1.00 29.59  ? 859  ARG A CB    1 
ATOM   4398 C CG    . ARG A 1 562 ? 9.771   -0.292  14.932  1.00 31.04  ? 859  ARG A CG    1 
ATOM   4399 C CD    . ARG A 1 562 ? 9.943   -1.471  13.939  1.00 32.82  ? 859  ARG A CD    1 
ATOM   4400 N NE    . ARG A 1 562 ? 10.945  -2.338  14.514  1.00 39.91  ? 859  ARG A NE    1 
ATOM   4401 C CZ    . ARG A 1 562 ? 10.739  -3.533  15.069  1.00 44.86  ? 859  ARG A CZ    1 
ATOM   4402 N NH1   . ARG A 1 562 ? 9.562   -4.171  15.026  1.00 40.80  ? 859  ARG A NH1   1 
ATOM   4403 N NH2   . ARG A 1 562 ? 11.777  -4.129  15.625  1.00 48.80  ? 859  ARG A NH2   1 
ATOM   4404 N N     . VAL A 1 563 ? 6.158   2.783   15.216  1.00 28.00  ? 860  VAL A N     1 
ATOM   4405 C CA    . VAL A 1 563 ? 5.301   3.887   14.835  1.00 26.42  ? 860  VAL A CA    1 
ATOM   4406 C C     . VAL A 1 563 ? 4.677   4.500   16.073  1.00 26.86  ? 860  VAL A C     1 
ATOM   4407 O O     . VAL A 1 563 ? 4.596   3.839   17.103  1.00 26.41  ? 860  VAL A O     1 
ATOM   4408 C CB    . VAL A 1 563 ? 4.158   3.422   13.878  1.00 25.62  ? 860  VAL A CB    1 
ATOM   4409 C CG1   . VAL A 1 563 ? 4.771   2.840   12.629  1.00 28.51  ? 860  VAL A CG1   1 
ATOM   4410 C CG2   . VAL A 1 563 ? 3.259   2.394   14.551  1.00 26.61  ? 860  VAL A CG2   1 
ATOM   4411 N N     . PRO A 1 564 ? 4.270   5.761   16.001  1.00 25.56  ? 861  PRO A N     1 
ATOM   4412 C CA    . PRO A 1 564 ? 3.556   6.364   17.135  1.00 29.53  ? 861  PRO A CA    1 
ATOM   4413 C C     . PRO A 1 564 ? 2.237   5.655   17.387  1.00 25.72  ? 861  PRO A C     1 
ATOM   4414 O O     . PRO A 1 564 ? 1.641   5.076   16.466  1.00 27.98  ? 861  PRO A O     1 
ATOM   4415 C CB    . PRO A 1 564 ? 3.257   7.814   16.632  1.00 31.04  ? 861  PRO A CB    1 
ATOM   4416 C CG    . PRO A 1 564 ? 4.184   8.028   15.474  1.00 30.73  ? 861  PRO A CG    1 
ATOM   4417 C CD    . PRO A 1 564 ? 4.237   6.665   14.831  1.00 29.67  ? 861  PRO A CD    1 
ATOM   4418 N N     . LEU A 1 565 ? 1.793   5.670   18.615  1.00 23.81  ? 862  LEU A N     1 
ATOM   4419 C CA    . LEU A 1 565 ? 0.396   5.381   18.939  1.00 26.30  ? 862  LEU A CA    1 
ATOM   4420 C C     . LEU A 1 565 ? -0.309  6.754   19.072  1.00 29.09  ? 862  LEU A C     1 
ATOM   4421 O O     . LEU A 1 565 ? 0.285   7.712   19.517  1.00 28.95  ? 862  LEU A O     1 
ATOM   4422 C CB    . LEU A 1 565 ? 0.311   4.599   20.230  1.00 26.40  ? 862  LEU A CB    1 
ATOM   4423 C CG    . LEU A 1 565 ? 0.749   3.149   20.116  1.00 30.51  ? 862  LEU A CG    1 
ATOM   4424 C CD1   . LEU A 1 565 ? 0.849   2.501   21.469  1.00 31.94  ? 862  LEU A CD1   1 
ATOM   4425 C CD2   . LEU A 1 565 ? -0.189  2.346   19.222  1.00 30.96  ? 862  LEU A CD2   1 
ATOM   4426 N N     . LYS A 1 566 ? -1.556  6.803   18.678  1.00 25.27  ? 863  LYS A N     1 
ATOM   4427 C CA    . LYS A 1 566 ? -2.375  7.956   18.751  1.00 24.53  ? 863  LYS A CA    1 
ATOM   4428 C C     . LYS A 1 566 ? -3.700  7.610   19.415  1.00 24.98  ? 863  LYS A C     1 
ATOM   4429 O O     . LYS A 1 566 ? -4.380  6.629   19.040  1.00 26.58  ? 863  LYS A O     1 
ATOM   4430 C CB    . LYS A 1 566 ? -2.693  8.438   17.364  1.00 28.78  ? 863  LYS A CB    1 
ATOM   4431 C CG    . LYS A 1 566 ? -3.472  9.751   17.341  1.00 35.44  ? 863  LYS A CG    1 
ATOM   4432 C CD    . LYS A 1 566 ? -3.507  10.312  15.955  1.00 45.01  ? 863  LYS A CD    1 
ATOM   4433 C CE    . LYS A 1 566 ? -4.555  11.400  15.795  1.00 52.28  ? 863  LYS A CE    1 
ATOM   4434 N NZ    . LYS A 1 566 ? -4.982  11.480  14.365  1.00 51.89  ? 863  LYS A NZ    1 
ATOM   4435 N N     . VAL A 1 567 ? -4.117  8.478   20.314  1.00 25.55  ? 864  VAL A N     1 
ATOM   4436 C CA    . VAL A 1 567 ? -5.342  8.322   21.111  1.00 23.50  ? 864  VAL A CA    1 
ATOM   4437 C C     . VAL A 1 567 ? -6.209  9.558   20.992  1.00 28.26  ? 864  VAL A C     1 
ATOM   4438 O O     . VAL A 1 567 ? -5.715  10.670  21.164  1.00 29.52  ? 864  VAL A O     1 
ATOM   4439 C CB    . VAL A 1 567 ? -4.952  8.128   22.567  1.00 24.37  ? 864  VAL A CB    1 
ATOM   4440 C CG1   . VAL A 1 567 ? -6.172  8.067   23.509  1.00 24.08  ? 864  VAL A CG1   1 
ATOM   4441 C CG2   . VAL A 1 567 ? -4.212  6.793   22.702  1.00 26.03  ? 864  VAL A CG2   1 
ATOM   4442 N N     . ASP A 1 568 ? -7.467  9.379   20.629  1.00 23.94  ? 865  ASP A N     1 
ATOM   4443 C CA    . ASP A 1 568 ? -8.446  10.480  20.559  1.00 26.49  ? 865  ASP A CA    1 
ATOM   4444 C C     . ASP A 1 568 ? -9.333  10.414  21.789  1.00 26.37  ? 865  ASP A C     1 
ATOM   4445 O O     . ASP A 1 568 ? -9.431  9.385   22.420  1.00 27.32  ? 865  ASP A O     1 
ATOM   4446 C CB    . ASP A 1 568 ? -9.366  10.379  19.347  1.00 29.00  ? 865  ASP A CB    1 
ATOM   4447 C CG    . ASP A 1 568 ? -8.592  10.449  18.030  1.00 33.02  ? 865  ASP A CG    1 
ATOM   4448 O OD1   . ASP A 1 568 ? -7.646  11.215  17.930  1.00 37.79  ? 865  ASP A OD1   1 
ATOM   4449 O OD2   . ASP A 1 568 ? -8.908  9.696   17.129  1.00 37.01  ? 865  ASP A OD2   1 
ATOM   4450 N N     . TYR A 1 569 ? -9.936  11.533  22.138  1.00 26.53  ? 866  TYR A N     1 
ATOM   4451 C CA    . TYR A 1 569 ? -10.717 11.623  23.380  1.00 26.63  ? 866  TYR A CA    1 
ATOM   4452 C C     . TYR A 1 569 ? -11.870 12.561  23.245  1.00 26.98  ? 866  TYR A C     1 
ATOM   4453 O O     . TYR A 1 569 ? -11.837 13.474  22.429  1.00 26.37  ? 866  TYR A O     1 
ATOM   4454 C CB    . TYR A 1 569 ? -9.829  12.059  24.556  1.00 27.25  ? 866  TYR A CB    1 
ATOM   4455 C CG    . TYR A 1 569 ? -9.177  13.366  24.337  1.00 29.73  ? 866  TYR A CG    1 
ATOM   4456 C CD1   . TYR A 1 569 ? -7.936  13.440  23.699  1.00 38.62  ? 866  TYR A CD1   1 
ATOM   4457 C CD2   . TYR A 1 569 ? -9.805  14.530  24.720  1.00 35.58  ? 866  TYR A CD2   1 
ATOM   4458 C CE1   . TYR A 1 569 ? -7.326  14.676  23.489  1.00 40.30  ? 866  TYR A CE1   1 
ATOM   4459 C CE2   . TYR A 1 569 ? -9.218  15.767  24.485  1.00 41.26  ? 866  TYR A CE2   1 
ATOM   4460 C CZ    . TYR A 1 569 ? -7.964  15.808  23.876  1.00 42.13  ? 866  TYR A CZ    1 
ATOM   4461 O OH    . TYR A 1 569 ? -7.374  17.025  23.646  1.00 52.53  ? 866  TYR A OH    1 
ATOM   4462 N N     . HIS A 1 570 ? -12.867 12.350  24.083  1.00 28.77  ? 867  HIS A N     1 
ATOM   4463 C CA    . HIS A 1 570 ? -14.059 13.153  24.092  1.00 28.22  ? 867  HIS A CA    1 
ATOM   4464 C C     . HIS A 1 570 ? -14.674 13.041  25.485  1.00 29.67  ? 867  HIS A C     1 
ATOM   4465 O O     . HIS A 1 570 ? -14.468 12.084  26.203  1.00 27.18  ? 867  HIS A O     1 
ATOM   4466 C CB    . HIS A 1 570 ? -15.105 12.669  23.054  1.00 29.83  ? 867  HIS A CB    1 
ATOM   4467 C CG    . HIS A 1 570 ? -14.551 12.448  21.696  1.00 31.79  ? 867  HIS A CG    1 
ATOM   4468 N ND1   . HIS A 1 570 ? -14.377 13.470  20.788  1.00 36.15  ? 867  HIS A ND1   1 
ATOM   4469 C CD2   . HIS A 1 570 ? -14.119 11.316  21.092  1.00 30.60  ? 867  HIS A CD2   1 
ATOM   4470 C CE1   . HIS A 1 570 ? -13.842 12.971  19.678  1.00 35.93  ? 867  HIS A CE1   1 
ATOM   4471 N NE2   . HIS A 1 570 ? -13.710 11.664  19.835  1.00 34.62  ? 867  HIS A NE2   1 
ATOM   4472 N N     . TYR A 1 571 ? -15.457 14.025  25.865  1.00 24.37  ? 868  TYR A N     1 
ATOM   4473 C CA    . TYR A 1 571 ? -16.187 13.921  27.120  1.00 25.14  ? 868  TYR A CA    1 
ATOM   4474 C C     . TYR A 1 571 ? -17.535 14.626  27.036  1.00 23.91  ? 868  TYR A C     1 
ATOM   4475 O O     . TYR A 1 571 ? -17.753 15.423  26.153  1.00 26.06  ? 868  TYR A O     1 
ATOM   4476 C CB    . TYR A 1 571 ? -15.321 14.437  28.251  1.00 27.09  ? 868  TYR A CB    1 
ATOM   4477 C CG    . TYR A 1 571 ? -14.983 15.888  28.138  1.00 28.39  ? 868  TYR A CG    1 
ATOM   4478 C CD1   . TYR A 1 571 ? -15.868 16.862  28.590  1.00 28.20  ? 868  TYR A CD1   1 
ATOM   4479 C CD2   . TYR A 1 571 ? -13.759 16.286  27.629  1.00 30.71  ? 868  TYR A CD2   1 
ATOM   4480 C CE1   . TYR A 1 571 ? -15.559 18.205  28.513  1.00 32.96  ? 868  TYR A CE1   1 
ATOM   4481 C CE2   . TYR A 1 571 ? -13.450 17.619  27.538  1.00 37.29  ? 868  TYR A CE2   1 
ATOM   4482 C CZ    . TYR A 1 571 ? -14.363 18.568  27.976  1.00 37.89  ? 868  TYR A CZ    1 
ATOM   4483 O OH    . TYR A 1 571 ? -14.052 19.869  27.868  1.00 41.73  ? 868  TYR A OH    1 
ATOM   4484 N N     . GLY A 1 572 ? -18.435 14.330  27.949  1.00 24.78  ? 869  GLY A N     1 
ATOM   4485 C CA    . GLY A 1 572 ? -19.738 14.999  27.931  1.00 24.59  ? 869  GLY A CA    1 
ATOM   4486 C C     . GLY A 1 572 ? -20.597 14.487  29.053  1.00 26.35  ? 869  GLY A C     1 
ATOM   4487 O O     . GLY A 1 572 ? -20.163 13.720  29.912  1.00 25.61  ? 869  GLY A O     1 
ATOM   4488 N N     . SER A 1 573 ? -21.846 14.869  29.030  1.00 26.98  ? 870  SER A N     1 
ATOM   4489 C CA    . SER A 1 573 ? -22.773 14.596  30.144  1.00 28.99  ? 870  SER A CA    1 
ATOM   4490 C C     . SER A 1 573 ? -23.217 13.138  30.203  1.00 29.83  ? 870  SER A C     1 
ATOM   4491 O O     . SER A 1 573 ? -23.722 12.705  31.185  1.00 28.48  ? 870  SER A O     1 
ATOM   4492 C CB    . SER A 1 573 ? -24.042 15.410  29.909  1.00 33.46  ? 870  SER A CB    1 
ATOM   4493 O OG    . SER A 1 573 ? -23.681 16.751  30.047  1.00 41.96  ? 870  SER A OG    1 
ATOM   4494 N N     . THR A 1 574 ? -23.160 12.442  29.091  1.00 26.58  ? 871  THR A N     1 
ATOM   4495 C CA    . THR A 1 574 ? -23.575 11.081  29.042  1.00 26.52  ? 871  THR A CA    1 
ATOM   4496 C C     . THR A 1 574 ? -22.558 10.396  28.132  1.00 28.43  ? 871  THR A C     1 
ATOM   4497 O O     . THR A 1 574 ? -21.752 11.076  27.442  1.00 24.21  ? 871  THR A O     1 
ATOM   4498 C CB    . THR A 1 574 ? -24.970 10.916  28.387  1.00 29.87  ? 871  THR A CB    1 
ATOM   4499 O OG1   . THR A 1 574 ? -24.845 11.157  27.011  1.00 27.53  ? 871  THR A OG1   1 
ATOM   4500 C CG2   . THR A 1 574 ? -26.008 11.905  28.951  1.00 30.39  ? 871  THR A CG2   1 
ATOM   4501 N N     . TRP A 1 575 ? -22.639 9.072   28.081  1.00 25.68  ? 872  TRP A N     1 
ATOM   4502 C CA    . TRP A 1 575 ? -21.722 8.299   27.224  1.00 24.84  ? 872  TRP A CA    1 
ATOM   4503 C C     . TRP A 1 575 ? -21.930 8.633   25.766  1.00 26.14  ? 872  TRP A C     1 
ATOM   4504 O O     . TRP A 1 575 ? -21.013 8.772   25.014  1.00 26.44  ? 872  TRP A O     1 
ATOM   4505 C CB    . TRP A 1 575 ? -21.954 6.817   27.492  1.00 24.91  ? 872  TRP A CB    1 
ATOM   4506 C CG    . TRP A 1 575 ? -20.950 5.893   26.859  1.00 26.09  ? 872  TRP A CG    1 
ATOM   4507 C CD1   . TRP A 1 575 ? -19.769 6.239   26.244  1.00 29.04  ? 872  TRP A CD1   1 
ATOM   4508 C CD2   . TRP A 1 575 ? -21.026 4.466   26.815  1.00 27.73  ? 872  TRP A CD2   1 
ATOM   4509 N NE1   . TRP A 1 575 ? -19.086 5.083   25.834  1.00 26.71  ? 872  TRP A NE1   1 
ATOM   4510 C CE2   . TRP A 1 575 ? -19.820 3.994   26.210  1.00 30.32  ? 872  TRP A CE2   1 
ATOM   4511 C CE3   . TRP A 1 575 ? -21.959 3.522   27.297  1.00 30.55  ? 872  TRP A CE3   1 
ATOM   4512 C CZ2   . TRP A 1 575 ? -19.568 2.609   26.017  1.00 33.60  ? 872  TRP A CZ2   1 
ATOM   4513 C CZ3   . TRP A 1 575 ? -21.702 2.152   27.096  1.00 32.39  ? 872  TRP A CZ3   1 
ATOM   4514 C CH2   . TRP A 1 575 ? -20.529 1.716   26.446  1.00 29.95  ? 872  TRP A CH2   1 
ATOM   4515 N N     . TYR A 1 576 ? -23.171 8.857   25.377  1.00 27.76  ? 873  TYR A N     1 
ATOM   4516 C CA    . TYR A 1 576 ? -23.470 9.333   24.039  1.00 29.76  ? 873  TYR A CA    1 
ATOM   4517 C C     . TYR A 1 576 ? -22.713 10.591  23.670  1.00 33.01  ? 873  TYR A C     1 
ATOM   4518 O O     . TYR A 1 576 ? -22.269 10.718  22.558  1.00 30.57  ? 873  TYR A O     1 
ATOM   4519 C CB    . TYR A 1 576 ? -24.994 9.585   23.921  1.00 29.93  ? 873  TYR A CB    1 
ATOM   4520 C CG    . TYR A 1 576 ? -25.469 10.177  22.643  1.00 30.65  ? 873  TYR A CG    1 
ATOM   4521 C CD1   . TYR A 1 576 ? -25.551 11.579  22.480  1.00 36.63  ? 873  TYR A CD1   1 
ATOM   4522 C CD2   . TYR A 1 576 ? -25.883 9.377   21.603  1.00 35.43  ? 873  TYR A CD2   1 
ATOM   4523 C CE1   . TYR A 1 576 ? -26.013 12.129  21.293  1.00 37.65  ? 873  TYR A CE1   1 
ATOM   4524 C CE2   . TYR A 1 576 ? -26.355 9.908   20.428  1.00 37.99  ? 873  TYR A CE2   1 
ATOM   4525 C CZ    . TYR A 1 576 ? -26.406 11.284  20.264  1.00 38.12  ? 873  TYR A CZ    1 
ATOM   4526 O OH    . TYR A 1 576 ? -26.880 11.756  19.072  1.00 34.85  ? 873  TYR A OH    1 
ATOM   4527 N N     . ASP A 1 577 ? -22.584 11.532  24.599  1.00 33.11  ? 874  ASP A N     1 
ATOM   4528 C CA    . ASP A 1 577 ? -21.960 12.814  24.297  1.00 33.72  ? 874  ASP A CA    1 
ATOM   4529 C C     . ASP A 1 577 ? -20.490 12.745  24.327  1.00 38.35  ? 874  ASP A C     1 
ATOM   4530 O O     . ASP A 1 577 ? -19.880 13.700  23.944  1.00 38.89  ? 874  ASP A O     1 
ATOM   4531 C CB    . ASP A 1 577 ? -22.374 13.908  25.269  1.00 35.23  ? 874  ASP A CB    1 
ATOM   4532 C CG    . ASP A 1 577 ? -23.839 14.102  25.293  1.00 40.61  ? 874  ASP A CG    1 
ATOM   4533 O OD1   . ASP A 1 577 ? -24.363 14.547  24.259  1.00 39.76  ? 874  ASP A OD1   1 
ATOM   4534 O OD2   . ASP A 1 577 ? -24.475 13.775  26.329  1.00 47.65  ? 874  ASP A OD2   1 
ATOM   4535 N N     . ALA A 1 578 ? -19.915 11.661  24.829  1.00 33.90  ? 875  ALA A N     1 
ATOM   4536 C CA    . ALA A 1 578 ? -18.492 11.546  24.858  1.00 37.61  ? 875  ALA A CA    1 
ATOM   4537 C C     . ALA A 1 578 ? -17.988 11.009  23.531  1.00 46.03  ? 875  ALA A C     1 
ATOM   4538 O O     . ALA A 1 578 ? -17.355 9.966   23.467  1.00 32.79  ? 875  ALA A O     1 
ATOM   4539 C CB    . ALA A 1 578 ? -18.074 10.640  25.999  1.00 38.68  ? 875  ALA A CB    1 
ATOM   4540 N N     . LYS A 1 579 ? -18.237 11.741  22.458  1.00 53.36  ? 876  LYS A N     1 
ATOM   4541 C CA    . LYS A 1 579 ? -17.838 11.239  21.112  1.00 57.55  ? 876  LYS A CA    1 
ATOM   4542 C C     . LYS A 1 579 ? -18.187 12.278  20.057  1.00 54.62  ? 876  LYS A C     1 
ATOM   4543 O O     . LYS A 1 579 ? -19.327 12.723  20.052  1.00 67.52  ? 876  LYS A O     1 
ATOM   4544 C CB    . LYS A 1 579 ? -18.488 9.865   20.801  1.00 57.55  ? 876  LYS A CB    1 
ATOM   4545 P P     . DG  B 2 1   ? -33.023 -27.230 32.974  1.00 85.50  ? 20   DG  B P     1 
ATOM   4546 O OP1   . DG  B 2 1   ? -32.718 -25.790 32.815  1.00 87.59  ? 20   DG  B OP1   1 
ATOM   4547 O OP2   . DG  B 2 1   ? -32.294 -27.999 34.011  1.00 95.58  ? 20   DG  B OP2   1 
ATOM   4548 O "O5'" . DG  B 2 1   ? -32.850 -27.953 31.564  1.00 79.46  ? 20   DG  B "O5'" 1 
ATOM   4549 C "C5'" . DG  B 2 1   ? -32.159 -29.212 31.458  1.00 83.97  ? 20   DG  B "C5'" 1 
ATOM   4550 C "C4'" . DG  B 2 1   ? -31.657 -29.432 30.047  1.00 94.29  ? 20   DG  B "C4'" 1 
ATOM   4551 O "O4'" . DG  B 2 1   ? -32.716 -29.199 29.090  1.00 89.86  ? 20   DG  B "O4'" 1 
ATOM   4552 C "C3'" . DG  B 2 1   ? -30.479 -28.554 29.609  1.00 86.75  ? 20   DG  B "C3'" 1 
ATOM   4553 O "O3'" . DG  B 2 1   ? -29.504 -29.378 28.971  1.00 86.46  ? 20   DG  B "O3'" 1 
ATOM   4554 C "C2'" . DG  B 2 1   ? -31.087 -27.572 28.623  1.00 78.40  ? 20   DG  B "C2'" 1 
ATOM   4555 C "C1'" . DG  B 2 1   ? -32.261 -28.343 28.054  1.00 84.46  ? 20   DG  B "C1'" 1 
ATOM   4556 N N9    . DG  B 2 1   ? -33.395 -27.529 27.632  1.00 79.54  ? 20   DG  B N9    1 
ATOM   4557 C C8    . DG  B 2 1   ? -34.016 -26.520 28.329  1.00 72.59  ? 20   DG  B C8    1 
ATOM   4558 N N7    . DG  B 2 1   ? -35.033 -26.009 27.688  1.00 72.03  ? 20   DG  B N7    1 
ATOM   4559 C C5    . DG  B 2 1   ? -35.087 -26.725 26.499  1.00 65.89  ? 20   DG  B C5    1 
ATOM   4560 C C6    . DG  B 2 1   ? -35.975 -26.620 25.400  1.00 59.49  ? 20   DG  B C6    1 
ATOM   4561 O O6    . DG  B 2 1   ? -36.935 -25.858 25.257  1.00 58.01  ? 20   DG  B O6    1 
ATOM   4562 N N1    . DG  B 2 1   ? -35.665 -27.537 24.405  1.00 63.89  ? 20   DG  B N1    1 
ATOM   4563 C C2    . DG  B 2 1   ? -34.632 -28.442 24.455  1.00 64.60  ? 20   DG  B C2    1 
ATOM   4564 N N2    . DG  B 2 1   ? -34.491 -29.250 23.397  1.00 68.72  ? 20   DG  B N2    1 
ATOM   4565 N N3    . DG  B 2 1   ? -33.803 -28.555 25.474  1.00 70.11  ? 20   DG  B N3    1 
ATOM   4566 C C4    . DG  B 2 1   ? -34.086 -27.672 26.454  1.00 70.62  ? 20   DG  B C4    1 
ATOM   4567 P P     . DA  B 2 2   ? -28.073 -28.781 28.599  1.00 95.99  ? 21   DA  B P     1 
ATOM   4568 O OP1   . DA  B 2 2   ? -27.052 -29.631 29.258  1.00 94.08  ? 21   DA  B OP1   1 
ATOM   4569 O OP2   . DA  B 2 2   ? -28.109 -27.313 28.866  1.00 88.42  ? 21   DA  B OP2   1 
ATOM   4570 O "O5'" . DA  B 2 2   ? -27.954 -29.065 27.032  1.00 83.54  ? 21   DA  B "O5'" 1 
ATOM   4571 C "C5'" . DA  B 2 2   ? -28.630 -30.187 26.403  1.00 80.12  ? 21   DA  B "C5'" 1 
ATOM   4572 C "C4'" . DA  B 2 2   ? -28.957 -29.858 24.965  1.00 79.66  ? 21   DA  B "C4'" 1 
ATOM   4573 O "O4'" . DA  B 2 2   ? -30.154 -29.047 24.896  1.00 80.07  ? 21   DA  B "O4'" 1 
ATOM   4574 C "C3'" . DA  B 2 2   ? -27.858 -29.076 24.240  1.00 79.84  ? 21   DA  B "C3'" 1 
ATOM   4575 O "O3'" . DA  B 2 2   ? -27.403 -29.873 23.142  1.00 79.03  ? 21   DA  B "O3'" 1 
ATOM   4576 C "C2'" . DA  B 2 2   ? -28.489 -27.727 23.905  1.00 74.43  ? 21   DA  B "C2'" 1 
ATOM   4577 C "C1'" . DA  B 2 2   ? -29.982 -28.001 23.949  1.00 70.68  ? 21   DA  B "C1'" 1 
ATOM   4578 N N9    . DA  B 2 2   ? -30.833 -26.880 24.361  1.00 62.94  ? 21   DA  B N9    1 
ATOM   4579 C C8    . DA  B 2 2   ? -30.759 -26.121 25.506  1.00 59.82  ? 21   DA  B C8    1 
ATOM   4580 N N7    . DA  B 2 2   ? -31.692 -25.200 25.593  1.00 57.93  ? 21   DA  B N7    1 
ATOM   4581 C C5    . DA  B 2 2   ? -32.432 -25.365 24.427  1.00 65.60  ? 21   DA  B C5    1 
ATOM   4582 C C6    . DA  B 2 2   ? -33.569 -24.705 23.921  1.00 65.04  ? 21   DA  B C6    1 
ATOM   4583 N N6    . DA  B 2 2   ? -34.193 -23.705 24.549  1.00 63.51  ? 21   DA  B N6    1 
ATOM   4584 N N1    . DA  B 2 2   ? -34.049 -25.112 22.725  1.00 73.95  ? 21   DA  B N1    1 
ATOM   4585 C C2    . DA  B 2 2   ? -33.434 -26.120 22.093  1.00 69.63  ? 21   DA  B C2    1 
ATOM   4586 N N3    . DA  B 2 2   ? -32.365 -26.821 22.466  1.00 64.24  ? 21   DA  B N3    1 
ATOM   4587 C C4    . DA  B 2 2   ? -31.915 -26.398 23.661  1.00 65.00  ? 21   DA  B C4    1 
ATOM   4588 P P     . DC  B 2 3   ? -26.191 -29.350 22.237  1.00 92.80  ? 22   DC  B P     1 
ATOM   4589 O OP1   . DC  B 2 3   ? -25.500 -30.520 21.645  1.00 73.86  ? 22   DC  B OP1   1 
ATOM   4590 O OP2   . DC  B 2 3   ? -25.427 -28.337 23.016  1.00 88.97  ? 22   DC  B OP2   1 
ATOM   4591 O "O5'" . DC  B 2 3   ? -26.938 -28.607 21.044  1.00 85.26  ? 22   DC  B "O5'" 1 
ATOM   4592 C "C5'" . DC  B 2 3   ? -27.782 -29.347 20.153  1.00 72.40  ? 22   DC  B "C5'" 1 
ATOM   4593 C "C4'" . DC  B 2 3   ? -28.357 -28.393 19.137  1.00 69.68  ? 22   DC  B "C4'" 1 
ATOM   4594 O "O4'" . DC  B 2 3   ? -29.248 -27.482 19.808  1.00 67.04  ? 22   DC  B "O4'" 1 
ATOM   4595 C "C3'" . DC  B 2 3   ? -27.318 -27.516 18.435  1.00 68.75  ? 22   DC  B "C3'" 1 
ATOM   4596 O "O3'" . DC  B 2 3   ? -27.540 -27.663 17.043  1.00 68.61  ? 22   DC  B "O3'" 1 
ATOM   4597 C "C2'" . DC  B 2 3   ? -27.592 -26.108 18.939  1.00 62.36  ? 22   DC  B "C2'" 1 
ATOM   4598 C "C1'" . DC  B 2 3   ? -29.059 -26.186 19.284  1.00 60.62  ? 22   DC  B "C1'" 1 
ATOM   4599 N N1    . DC  B 2 3   ? -29.547 -25.246 20.289  1.00 57.31  ? 22   DC  B N1    1 
ATOM   4600 C C2    . DC  B 2 3   ? -30.786 -24.639 20.084  1.00 55.39  ? 22   DC  B C2    1 
ATOM   4601 O O2    . DC  B 2 3   ? -31.383 -24.845 19.023  1.00 60.64  ? 22   DC  B O2    1 
ATOM   4602 N N3    . DC  B 2 3   ? -31.280 -23.810 21.024  1.00 51.18  ? 22   DC  B N3    1 
ATOM   4603 C C4    . DC  B 2 3   ? -30.597 -23.597 22.148  1.00 54.32  ? 22   DC  B C4    1 
ATOM   4604 N N4    . DC  B 2 3   ? -31.125 -22.764 23.043  1.00 54.70  ? 22   DC  B N4    1 
ATOM   4605 C C5    . DC  B 2 3   ? -29.343 -24.230 22.401  1.00 49.33  ? 22   DC  B C5    1 
ATOM   4606 C C6    . DC  B 2 3   ? -28.868 -25.051 21.459  1.00 58.05  ? 22   DC  B C6    1 
ATOM   4607 P P     . DC  B 2 4   ? -26.465 -27.125 16.033  1.00 74.42  ? 23   DC  B P     1 
ATOM   4608 O OP1   . DC  B 2 4   ? -26.428 -28.045 14.872  1.00 72.27  ? 23   DC  B OP1   1 
ATOM   4609 O OP2   . DC  B 2 4   ? -25.223 -26.760 16.773  1.00 68.61  ? 23   DC  B OP2   1 
ATOM   4610 O "O5'" . DC  B 2 4   ? -27.115 -25.756 15.568  1.00 66.96  ? 23   DC  B "O5'" 1 
ATOM   4611 C "C5'" . DC  B 2 4   ? -28.482 -25.687 15.118  1.00 61.03  ? 23   DC  B "C5'" 1 
ATOM   4612 C "C4'" . DC  B 2 4   ? -28.800 -24.225 14.937  1.00 58.15  ? 23   DC  B "C4'" 1 
ATOM   4613 O "O4'" . DC  B 2 4   ? -29.256 -23.657 16.195  1.00 60.19  ? 23   DC  B "O4'" 1 
ATOM   4614 C "C3'" . DC  B 2 4   ? -27.560 -23.417 14.539  1.00 63.50  ? 23   DC  B "C3'" 1 
ATOM   4615 O "O3'" . DC  B 2 4   ? -27.909 -22.396 13.607  1.00 69.42  ? 23   DC  B "O3'" 1 
ATOM   4616 C "C2'" . DC  B 2 4   ? -27.119 -22.775 15.839  1.00 59.21  ? 23   DC  B "C2'" 1 
ATOM   4617 C "C1'" . DC  B 2 4   ? -28.477 -22.497 16.449  1.00 60.11  ? 23   DC  B "C1'" 1 
ATOM   4618 N N1    . DC  B 2 4   ? -28.477 -22.220 17.891  1.00 58.79  ? 23   DC  B N1    1 
ATOM   4619 C C2    . DC  B 2 4   ? -29.585 -21.577 18.436  1.00 51.67  ? 23   DC  B C2    1 
ATOM   4620 O O2    . DC  B 2 4   ? -30.567 -21.370 17.715  1.00 58.20  ? 23   DC  B O2    1 
ATOM   4621 N N3    . DC  B 2 4   ? -29.562 -21.204 19.735  1.00 54.92  ? 23   DC  B N3    1 
ATOM   4622 C C4    . DC  B 2 4   ? -28.485 -21.460 20.483  1.00 54.55  ? 23   DC  B C4    1 
ATOM   4623 N N4    . DC  B 2 4   ? -28.513 -21.095 21.765  1.00 57.73  ? 23   DC  B N4    1 
ATOM   4624 C C5    . DC  B 2 4   ? -27.326 -22.084 19.943  1.00 62.36  ? 23   DC  B C5    1 
ATOM   4625 C C6    . DC  B 2 4   ? -27.355 -22.426 18.649  1.00 60.82  ? 23   DC  B C6    1 
HETATM 4626 P P     . T0T B 2 5   ? -27.511 -22.535 12.067  1.00 64.62  ? 24   T0T B P     1 
HETATM 4627 C C1    . T0T B 2 5   ? -29.444 -18.307 14.742  1.00 49.81  ? 24   T0T B C1    1 
HETATM 4628 C C2    . T0T B 2 5   ? -30.005 -17.618 15.822  1.00 53.69  ? 24   T0T B C2    1 
HETATM 4629 C C3    . T0T B 2 5   ? -29.394 -17.655 17.083  1.00 53.93  ? 24   T0T B C3    1 
HETATM 4630 C C4    . T0T B 2 5   ? -28.214 -18.357 17.292  1.00 52.36  ? 24   T0T B C4    1 
HETATM 4631 C C5    . T0T B 2 5   ? -27.639 -19.030 16.209  1.00 55.18  ? 24   T0T B C5    1 
HETATM 4632 C C6    . T0T B 2 5   ? -28.242 -19.002 14.937  1.00 53.26  ? 24   T0T B C6    1 
HETATM 4633 C C7    . T0T B 2 5   ? -27.645 -18.348 18.677  1.00 51.37  ? 24   T0T B C7    1 
HETATM 4634 C C8    . T0T B 2 5   ? -26.528 -18.981 19.035  1.00 49.44  ? 24   T0T B C8    1 
HETATM 4635 C C9    . T0T B 2 5   ? -25.948 -18.974 20.420  1.00 49.38  ? 24   T0T B C9    1 
HETATM 4636 C "C1'" . T0T B 2 5   ? -30.148 -18.249 13.425  1.00 47.97  ? 24   T0T B "C1'" 1 
HETATM 4637 C C10   . T0T B 2 5   ? -24.781 -19.746 20.516  1.00 50.27  ? 24   T0T B C10   1 
HETATM 4638 C C11   . T0T B 2 5   ? -24.096 -19.835 21.734  1.00 52.31  ? 24   T0T B C11   1 
HETATM 4639 C C12   . T0T B 2 5   ? -24.577 -19.196 22.876  1.00 43.27  ? 24   T0T B C12   1 
HETATM 4640 C C13   . T0T B 2 5   ? -25.756 -18.443 22.812  1.00 44.88  ? 24   T0T B C13   1 
HETATM 4641 C C14   . T0T B 2 5   ? -26.476 -18.349 21.595  1.00 46.06  ? 24   T0T B C14   1 
HETATM 4642 N N15   . T0T B 2 5   ? -27.608 -17.501 21.604  1.00 45.84  ? 24   T0T B N15   1 
HETATM 4643 C "C2'" . T0T B 2 5   ? -29.347 -17.662 12.305  1.00 50.73  ? 24   T0T B "C2'" 1 
HETATM 4644 C "C3'" . T0T B 2 5   ? -29.828 -18.452 11.078  1.00 52.69  ? 24   T0T B "C3'" 1 
HETATM 4645 O "O3'" . T0T B 2 5   ? -30.997 -17.966 10.496  1.00 45.00  ? 24   T0T B "O3'" 1 
HETATM 4646 C "C4'" . T0T B 2 5   ? -30.010 -19.815 11.634  1.00 56.52  ? 24   T0T B "C4'" 1 
HETATM 4647 O "O4'" . T0T B 2 5   ? -30.459 -19.610 13.002  1.00 52.98  ? 24   T0T B "O4'" 1 
HETATM 4648 C "C5'" . T0T B 2 5   ? -28.660 -20.435 11.629  1.00 63.15  ? 24   T0T B "C5'" 1 
HETATM 4649 O "O5'" . T0T B 2 5   ? -28.714 -21.774 11.402  1.00 64.16  ? 24   T0T B "O5'" 1 
HETATM 4650 O OP1   . T0T B 2 5   ? -27.595 -24.002 11.659  1.00 75.18  ? 24   T0T B OP1   1 
HETATM 4651 O OP2   . T0T B 2 5   ? -26.256 -21.760 11.864  1.00 56.41  ? 24   T0T B OP2   1 
ATOM   4652 P P     . DT  B 2 6   ? -30.877 -16.690 9.563   1.00 44.87  ? 25   DT  B P     1 
ATOM   4653 O OP1   . DT  B 2 6   ? -32.199 -16.504 8.839   1.00 40.48  ? 25   DT  B OP1   1 
ATOM   4654 O OP2   . DT  B 2 6   ? -29.623 -16.812 8.803   1.00 38.56  ? 25   DT  B OP2   1 
ATOM   4655 O "O5'" . DT  B 2 6   ? -30.686 -15.467 10.589  1.00 39.88  ? 25   DT  B "O5'" 1 
ATOM   4656 C "C5'" . DT  B 2 6   ? -31.801 -14.935 11.367  1.00 40.17  ? 25   DT  B "C5'" 1 
ATOM   4657 C "C4'" . DT  B 2 6   ? -31.315 -13.925 12.389  1.00 40.37  ? 25   DT  B "C4'" 1 
ATOM   4658 O "O4'" . DT  B 2 6   ? -30.519 -14.595 13.402  1.00 44.89  ? 25   DT  B "O4'" 1 
ATOM   4659 C "C3'" . DT  B 2 6   ? -30.413 -12.819 11.826  1.00 38.00  ? 25   DT  B "C3'" 1 
ATOM   4660 O "O3'" . DT  B 2 6   ? -31.105 -11.584 11.792  1.00 35.40  ? 25   DT  B "O3'" 1 
ATOM   4661 C "C2'" . DT  B 2 6   ? -29.212 -12.793 12.757  1.00 39.51  ? 25   DT  B "C2'" 1 
ATOM   4662 C "C1'" . DT  B 2 6   ? -29.666 -13.622 13.947  1.00 40.44  ? 25   DT  B "C1'" 1 
ATOM   4663 N N1    . DT  B 2 6   ? -28.561 -14.307 14.655  1.00 45.54  ? 25   DT  B N1    1 
ATOM   4664 C C2    . DT  B 2 6   ? -28.354 -14.023 15.990  1.00 45.46  ? 25   DT  B C2    1 
ATOM   4665 O O2    . DT  B 2 6   ? -29.079 -13.290 16.641  1.00 43.42  ? 25   DT  B O2    1 
ATOM   4666 N N3    . DT  B 2 6   ? -27.258 -14.634 16.539  1.00 40.15  ? 25   DT  B N3    1 
ATOM   4667 C C4    . DT  B 2 6   ? -26.367 -15.475 15.908  1.00 44.23  ? 25   DT  B C4    1 
ATOM   4668 O O4    . DT  B 2 6   ? -25.447 -15.974 16.541  1.00 47.94  ? 25   DT  B O4    1 
ATOM   4669 C C5    . DT  B 2 6   ? -26.631 -15.719 14.512  1.00 46.26  ? 25   DT  B C5    1 
ATOM   4670 C C7    . DT  B 2 6   ? -25.710 -16.618 13.751  1.00 47.71  ? 25   DT  B C7    1 
ATOM   4671 C C6    . DT  B 2 6   ? -27.681 -15.106 13.953  1.00 44.72  ? 25   DT  B C6    1 
ATOM   4672 P P     . DC  B 2 7   ? -30.460 -10.310 11.192  1.00 34.21  ? 26   DC  B P     1 
ATOM   4673 O OP1   . DC  B 2 7   ? -31.591 -9.406  10.778  1.00 36.83  ? 26   DC  B OP1   1 
ATOM   4674 O OP2   . DC  B 2 7   ? -29.404 -10.655 10.231  1.00 33.96  ? 26   DC  B OP2   1 
ATOM   4675 O "O5'" . DC  B 2 7   ? -29.751 -9.641  12.446  1.00 38.04  ? 26   DC  B "O5'" 1 
ATOM   4676 C "C5'" . DC  B 2 7   ? -30.516 -9.357  13.640  1.00 35.37  ? 26   DC  B "C5'" 1 
ATOM   4677 C "C4'" . DC  B 2 7   ? -29.654 -8.589  14.616  1.00 35.87  ? 26   DC  B "C4'" 1 
ATOM   4678 O "O4'" . DC  B 2 7   ? -28.827 -9.503  15.375  1.00 35.18  ? 26   DC  B "O4'" 1 
ATOM   4679 C "C3'" . DC  B 2 7   ? -28.690 -7.607  13.953  1.00 33.40  ? 26   DC  B "C3'" 1 
ATOM   4680 O "O3'" . DC  B 2 7   ? -28.639 -6.497  14.830  1.00 38.45  ? 26   DC  B "O3'" 1 
ATOM   4681 C "C2'" . DC  B 2 7   ? -27.384 -8.376  13.913  1.00 34.72  ? 26   DC  B "C2'" 1 
ATOM   4682 C "C1'" . DC  B 2 7   ? -27.473 -9.101  15.242  1.00 36.30  ? 26   DC  B "C1'" 1 
ATOM   4683 N N1    . DC  B 2 7   ? -26.598 -10.282 15.409  1.00 39.83  ? 26   DC  B N1    1 
ATOM   4684 C C2    . DC  B 2 7   ? -26.052 -10.546 16.678  1.00 36.18  ? 26   DC  B C2    1 
ATOM   4685 O O2    . DC  B 2 7   ? -26.417 -9.857  17.644  1.00 38.18  ? 26   DC  B O2    1 
ATOM   4686 N N3    . DC  B 2 7   ? -25.206 -11.591 16.825  1.00 33.31  ? 26   DC  B N3    1 
ATOM   4687 C C4    . DC  B 2 7   ? -24.865 -12.332 15.764  1.00 35.01  ? 26   DC  B C4    1 
ATOM   4688 N N4    . DC  B 2 7   ? -24.016 -13.345 15.954  1.00 36.33  ? 26   DC  B N4    1 
ATOM   4689 C C5    . DC  B 2 7   ? -25.377 -12.064 14.462  1.00 33.04  ? 26   DC  B C5    1 
ATOM   4690 C C6    . DC  B 2 7   ? -26.244 -11.051 14.335  1.00 34.03  ? 26   DC  B C6    1 
ATOM   4691 P P     . DC  B 2 8   ? -28.406 -5.007  14.309  1.00 42.21  ? 27   DC  B P     1 
ATOM   4692 O OP1   . DC  B 2 8   ? -29.670 -4.313  14.452  1.00 38.63  ? 27   DC  B OP1   1 
ATOM   4693 O OP2   . DC  B 2 8   ? -27.677 -5.010  13.031  1.00 37.62  ? 27   DC  B OP2   1 
ATOM   4694 O "O5'" . DC  B 2 8   ? -27.192 -4.480  15.231  1.00 42.26  ? 27   DC  B "O5'" 1 
ATOM   4695 C "C5'" . DC  B 2 8   ? -27.436 -3.917  16.499  1.00 39.35  ? 27   DC  B "C5'" 1 
ATOM   4696 C "C4'" . DC  B 2 8   ? -26.305 -4.216  17.457  1.00 37.20  ? 27   DC  B "C4'" 1 
ATOM   4697 O "O4'" . DC  B 2 8   ? -26.188 -5.628  17.700  1.00 36.40  ? 27   DC  B "O4'" 1 
ATOM   4698 C "C3'" . DC  B 2 8   ? -24.903 -3.801  17.065  1.00 30.71  ? 27   DC  B "C3'" 1 
ATOM   4699 O "O3'" . DC  B 2 8   ? -24.701 -2.385  17.190  1.00 28.96  ? 27   DC  B "O3'" 1 
ATOM   4700 C "C2'" . DC  B 2 8   ? -24.106 -4.571  18.096  1.00 31.45  ? 27   DC  B "C2'" 1 
ATOM   4701 C "C1'" . DC  B 2 8   ? -24.885 -5.880  18.195  1.00 33.36  ? 27   DC  B "C1'" 1 
ATOM   4702 N N1    . DC  B 2 8   ? -24.307 -6.984  17.407  1.00 32.50  ? 27   DC  B N1    1 
ATOM   4703 C C2    . DC  B 2 8   ? -23.395 -7.808  18.047  1.00 29.67  ? 27   DC  B C2    1 
ATOM   4704 O O2    . DC  B 2 8   ? -23.092 -7.552  19.222  1.00 28.42  ? 27   DC  B O2    1 
ATOM   4705 N N3    . DC  B 2 8   ? -22.826 -8.826  17.365  1.00 30.52  ? 27   DC  B N3    1 
ATOM   4706 C C4    . DC  B 2 8   ? -23.113 -9.004  16.071  1.00 30.57  ? 27   DC  B C4    1 
ATOM   4707 N N4    . DC  B 2 8   ? -22.533 -10.018 15.443  1.00 28.11  ? 27   DC  B N4    1 
ATOM   4708 C C5    . DC  B 2 8   ? -24.021 -8.155  15.379  1.00 31.96  ? 27   DC  B C5    1 
ATOM   4709 C C6    . DC  B 2 8   ? -24.600 -7.170  16.085  1.00 30.94  ? 27   DC  B C6    1 
ATOM   4710 P P     . DC  B 2 9   ? -23.502 -1.712  16.464  1.00 34.13  ? 28   DC  B P     1 
ATOM   4711 O OP1   . DC  B 2 9   ? -23.662 -0.244  16.577  1.00 33.70  ? 28   DC  B OP1   1 
ATOM   4712 O OP2   . DC  B 2 9   ? -23.336 -2.286  15.156  1.00 31.49  ? 28   DC  B OP2   1 
ATOM   4713 O "O5'" . DC  B 2 9   ? -22.221 -2.176  17.295  1.00 29.75  ? 28   DC  B "O5'" 1 
ATOM   4714 C "C5'" . DC  B 2 9   ? -22.007 -1.666  18.612  1.00 29.22  ? 28   DC  B "C5'" 1 
ATOM   4715 C "C4'" . DC  B 2 9   ? -20.816 -2.347  19.240  1.00 28.60  ? 28   DC  B "C4'" 1 
ATOM   4716 O "O4'" . DC  B 2 9   ? -21.014 -3.768  19.283  1.00 31.01  ? 28   DC  B "O4'" 1 
ATOM   4717 C "C3'" . DC  B 2 9   ? -19.502 -2.169  18.496  1.00 29.99  ? 28   DC  B "C3'" 1 
ATOM   4718 O "O3'" . DC  B 2 9   ? -18.936 -0.914  18.889  1.00 28.89  ? 28   DC  B "O3'" 1 
ATOM   4719 C "C2'" . DC  B 2 9   ? -18.695 -3.341  19.020  1.00 29.17  ? 28   DC  B "C2'" 1 
ATOM   4720 C "C1'" . DC  B 2 9   ? -19.743 -4.410  19.255  1.00 31.42  ? 28   DC  B "C1'" 1 
ATOM   4721 N N1    . DC  B 2 9   ? -19.767 -5.447  18.212  1.00 31.11  ? 28   DC  B N1    1 
ATOM   4722 C C2    . DC  B 2 9   ? -18.847 -6.488  18.302  1.00 32.05  ? 28   DC  B C2    1 
ATOM   4723 O O2    . DC  B 2 9   ? -18.083 -6.527  19.280  1.00 29.83  ? 28   DC  B O2    1 
ATOM   4724 N N3    . DC  B 2 9   ? -18.821 -7.436  17.335  1.00 31.60  ? 28   DC  B N3    1 
ATOM   4725 C C4    . DC  B 2 9   ? -19.674 -7.363  16.311  1.00 32.52  ? 28   DC  B C4    1 
ATOM   4726 N N4    . DC  B 2 9   ? -19.617 -8.314  15.384  1.00 35.38  ? 28   DC  B N4    1 
ATOM   4727 C C5    . DC  B 2 9   ? -20.582 -6.279  16.165  1.00 35.05  ? 28   DC  B C5    1 
ATOM   4728 C C6    . DC  B 2 9   ? -20.592 -5.347  17.126  1.00 34.09  ? 28   DC  B C6    1 
ATOM   4729 P P     . DT  B 2 10  ? -17.773 -0.264  18.027  1.00 35.31  ? 29   DT  B P     1 
ATOM   4730 O OP1   . DT  B 2 10  ? -17.490 1.049   18.584  1.00 34.45  ? 29   DT  B OP1   1 
ATOM   4731 O OP2   . DT  B 2 10  ? -18.096 -0.519  16.630  1.00 30.47  ? 29   DT  B OP2   1 
ATOM   4732 O "O5'" . DT  B 2 10  ? -16.462 -1.120  18.342  1.00 34.27  ? 29   DT  B "O5'" 1 
ATOM   4733 C "C5'" . DT  B 2 10  ? -15.884 -1.116  19.644  1.00 30.43  ? 29   DT  B "C5'" 1 
ATOM   4734 C "C4'" . DT  B 2 10  ? -14.706 -2.060  19.701  1.00 29.60  ? 29   DT  B "C4'" 1 
ATOM   4735 O "O4'" . DT  B 2 10  ? -15.073 -3.418  19.300  1.00 28.10  ? 29   DT  B "O4'" 1 
ATOM   4736 C "C3'" . DT  B 2 10  ? -13.546 -1.613  18.791  1.00 31.08  ? 29   DT  B "C3'" 1 
ATOM   4737 O "O3'" . DT  B 2 10  ? -12.292 -1.752  19.460  1.00 33.17  ? 29   DT  B "O3'" 1 
ATOM   4738 C "C2'" . DT  B 2 10  ? -13.549 -2.608  17.648  1.00 30.60  ? 29   DT  B "C2'" 1 
ATOM   4739 C "C1'" . DT  B 2 10  ? -14.172 -3.860  18.269  1.00 30.84  ? 29   DT  B "C1'" 1 
ATOM   4740 N N1    . DT  B 2 10  ? -14.941 -4.651  17.296  1.00 29.10  ? 29   DT  B N1    1 
ATOM   4741 C C2    . DT  B 2 10  ? -14.514 -5.929  17.002  1.00 28.42  ? 29   DT  B C2    1 
ATOM   4742 O O2    . DT  B 2 10  ? -13.499 -6.422  17.471  1.00 28.17  ? 29   DT  B O2    1 
ATOM   4743 N N3    . DT  B 2 10  ? -15.256 -6.571  16.052  1.00 27.51  ? 29   DT  B N3    1 
ATOM   4744 C C4    . DT  B 2 10  ? -16.336 -6.064  15.352  1.00 28.53  ? 29   DT  B C4    1 
ATOM   4745 O O4    . DT  B 2 10  ? -16.913 -6.771  14.548  1.00 34.54  ? 29   DT  B O4    1 
ATOM   4746 C C5    . DT  B 2 10  ? -16.703 -4.708  15.678  1.00 32.01  ? 29   DT  B C5    1 
ATOM   4747 C C7    . DT  B 2 10  ? -17.885 -4.088  15.000  1.00 35.76  ? 29   DT  B C7    1 
ATOM   4748 C C6    . DT  B 2 10  ? -15.994 -4.076  16.623  1.00 30.02  ? 29   DT  B C6    1 
ATOM   4749 O "O5'" . DA  C 3 1   ? -10.869 -14.526 10.733  1.00 35.43  ? 4    DA  C "O5'" 1 
ATOM   4750 C "C5'" . DA  C 3 1   ? -9.887  -15.067 11.600  1.00 25.97  ? 4    DA  C "C5'" 1 
ATOM   4751 C "C4'" . DA  C 3 1   ? -9.620  -14.132 12.756  1.00 26.05  ? 4    DA  C "C4'" 1 
ATOM   4752 O "O4'" . DA  C 3 1   ? -9.810  -12.705 12.466  1.00 30.33  ? 4    DA  C "O4'" 1 
ATOM   4753 C "C3'" . DA  C 3 1   ? -10.482 -14.401 13.990  1.00 25.77  ? 4    DA  C "C3'" 1 
ATOM   4754 O "O3'" . DA  C 3 1   ? -10.007 -15.495 14.782  1.00 24.67  ? 4    DA  C "O3'" 1 
ATOM   4755 C "C2'" . DA  C 3 1   ? -10.320 -13.103 14.736  1.00 26.50  ? 4    DA  C "C2'" 1 
ATOM   4756 C "C1'" . DA  C 3 1   ? -10.337 -12.063 13.632  1.00 26.38  ? 4    DA  C "C1'" 1 
ATOM   4757 N N9    . DA  C 3 1   ? -11.660 -11.560 13.290  1.00 25.73  ? 4    DA  C N9    1 
ATOM   4758 C C8    . DA  C 3 1   ? -12.507 -11.932 12.269  1.00 26.29  ? 4    DA  C C8    1 
ATOM   4759 N N7    . DA  C 3 1   ? -13.659 -11.306 12.283  1.00 27.02  ? 4    DA  C N7    1 
ATOM   4760 C C5    . DA  C 3 1   ? -13.540 -10.414 13.347  1.00 27.38  ? 4    DA  C C5    1 
ATOM   4761 C C6    . DA  C 3 1   ? -14.392 -9.413  13.848  1.00 26.24  ? 4    DA  C C6    1 
ATOM   4762 N N6    . DA  C 3 1   ? -15.591 -9.120  13.329  1.00 27.23  ? 4    DA  C N6    1 
ATOM   4763 N N1    . DA  C 3 1   ? -13.975 -8.717  14.931  1.00 28.23  ? 4    DA  C N1    1 
ATOM   4764 C C2    . DA  C 3 1   ? -12.761 -8.999  15.456  1.00 26.05  ? 4    DA  C C2    1 
ATOM   4765 N N3    . DA  C 3 1   ? -11.840 -9.866  15.026  1.00 26.96  ? 4    DA  C N3    1 
ATOM   4766 C C4    . DA  C 3 1   ? -12.305 -10.559 13.970  1.00 27.06  ? 4    DA  C C4    1 
ATOM   4767 P P     . DG  C 3 2   ? -10.985 -16.303 15.759  1.00 25.40  ? 5    DG  C P     1 
ATOM   4768 O OP1   . DG  C 3 2   ? -10.195 -17.322 16.372  1.00 27.17  ? 5    DG  C OP1   1 
ATOM   4769 O OP2   . DG  C 3 2   ? -12.215 -16.632 15.039  1.00 26.09  ? 5    DG  C OP2   1 
ATOM   4770 O "O5'" . DG  C 3 2   ? -11.374 -15.229 16.882  1.00 25.67  ? 5    DG  C "O5'" 1 
ATOM   4771 C "C5'" . DG  C 3 2   ? -10.382 -14.833 17.856  1.00 25.86  ? 5    DG  C "C5'" 1 
ATOM   4772 C "C4'" . DG  C 3 2   ? -10.969 -13.766 18.757  1.00 23.86  ? 5    DG  C "C4'" 1 
ATOM   4773 O "O4'" . DG  C 3 2   ? -11.423 -12.647 17.967  1.00 25.06  ? 5    DG  C "O4'" 1 
ATOM   4774 C "C3'" . DG  C 3 2   ? -12.224 -14.151 19.519  1.00 24.55  ? 5    DG  C "C3'" 1 
ATOM   4775 O "O3'" . DG  C 3 2   ? -11.903 -15.007 20.621  1.00 25.64  ? 5    DG  C "O3'" 1 
ATOM   4776 C "C2'" . DG  C 3 2   ? -12.733 -12.781 19.923  1.00 23.47  ? 5    DG  C "C2'" 1 
ATOM   4777 C "C1'" . DG  C 3 2   ? -12.439 -11.959 18.687  1.00 25.11  ? 5    DG  C "C1'" 1 
ATOM   4778 N N9    . DG  C 3 2   ? -13.584 -11.846 17.786  1.00 25.10  ? 5    DG  C N9    1 
ATOM   4779 C C8    . DG  C 3 2   ? -13.871 -12.638 16.702  1.00 22.56  ? 5    DG  C C8    1 
ATOM   4780 N N7    . DG  C 3 2   ? -14.958 -12.277 16.080  1.00 24.12  ? 5    DG  C N7    1 
ATOM   4781 C C5    . DG  C 3 2   ? -15.457 -11.223 16.845  1.00 25.81  ? 5    DG  C C5    1 
ATOM   4782 C C6    . DG  C 3 2   ? -16.612 -10.433 16.668  1.00 27.71  ? 5    DG  C C6    1 
ATOM   4783 O O6    . DG  C 3 2   ? -17.465 -10.514 15.780  1.00 25.61  ? 5    DG  C O6    1 
ATOM   4784 N N1    . DG  C 3 2   ? -16.724 -9.450  17.655  1.00 25.19  ? 5    DG  C N1    1 
ATOM   4785 C C2    . DG  C 3 2   ? -15.831 -9.264  18.680  1.00 25.33  ? 5    DG  C C2    1 
ATOM   4786 N N2    . DG  C 3 2   ? -16.117 -8.282  19.535  1.00 24.40  ? 5    DG  C N2    1 
ATOM   4787 N N3    . DG  C 3 2   ? -14.736 -9.991  18.848  1.00 23.92  ? 5    DG  C N3    1 
ATOM   4788 C C4    . DG  C 3 2   ? -14.624 -10.954 17.906  1.00 24.23  ? 5    DG  C C4    1 
ATOM   4789 P P     . DG  C 3 3   ? -13.073 -15.813 21.408  1.00 29.41  ? 6    DG  C P     1 
ATOM   4790 O OP1   . DG  C 3 3   ? -12.380 -16.657 22.373  1.00 25.14  ? 6    DG  C OP1   1 
ATOM   4791 O OP2   . DG  C 3 3   ? -14.026 -16.349 20.432  1.00 28.04  ? 6    DG  C OP2   1 
ATOM   4792 O "O5'" . DG  C 3 3   ? -13.838 -14.660 22.202  1.00 32.32  ? 6    DG  C "O5'" 1 
ATOM   4793 C "C5'" . DG  C 3 3   ? -15.207 -14.787 22.566  1.00 28.70  ? 6    DG  C "C5'" 1 
ATOM   4794 C "C4'" . DG  C 3 3   ? -15.742 -13.403 22.856  1.00 31.19  ? 6    DG  C "C4'" 1 
ATOM   4795 O "O4'" . DG  C 3 3   ? -15.750 -12.571 21.657  1.00 28.26  ? 6    DG  C "O4'" 1 
ATOM   4796 C "C3'" . DG  C 3 3   ? -17.175 -13.404 23.371  1.00 29.11  ? 6    DG  C "C3'" 1 
ATOM   4797 O "O3'" . DG  C 3 3   ? -17.132 -13.500 24.789  1.00 27.45  ? 6    DG  C "O3'" 1 
ATOM   4798 C "C2'" . DG  C 3 3   ? -17.714 -12.070 22.911  1.00 28.26  ? 6    DG  C "C2'" 1 
ATOM   4799 C "C1'" . DG  C 3 3   ? -16.911 -11.748 21.651  1.00 30.28  ? 6    DG  C "C1'" 1 
ATOM   4800 N N9    . DG  C 3 3   ? -17.639 -11.990 20.419  1.00 30.64  ? 6    DG  C N9    1 
ATOM   4801 C C8    . DG  C 3 3   ? -17.395 -12.949 19.460  1.00 28.54  ? 6    DG  C C8    1 
ATOM   4802 N N7    . DG  C 3 3   ? -18.218 -12.878 18.449  1.00 29.15  ? 6    DG  C N7    1 
ATOM   4803 C C5    . DG  C 3 3   ? -19.025 -11.785 18.735  1.00 31.53  ? 6    DG  C C5    1 
ATOM   4804 C C6    . DG  C 3 3   ? -20.114 -11.239 18.016  1.00 31.20  ? 6    DG  C C6    1 
ATOM   4805 O O6    . DG  C 3 3   ? -20.573 -11.602 16.934  1.00 29.03  ? 6    DG  C O6    1 
ATOM   4806 N N1    . DG  C 3 3   ? -20.714 -10.187 18.709  1.00 26.93  ? 6    DG  C N1    1 
ATOM   4807 C C2    . DG  C 3 3   ? -20.281 -9.697  19.921  1.00 30.35  ? 6    DG  C C2    1 
ATOM   4808 N N2    . DG  C 3 3   ? -20.947 -8.655  20.415  1.00 29.90  ? 6    DG  C N2    1 
ATOM   4809 N N3    . DG  C 3 3   ? -19.270 -10.201 20.603  1.00 26.80  ? 6    DG  C N3    1 
ATOM   4810 C C4    . DG  C 3 3   ? -18.705 -11.249 19.965  1.00 32.35  ? 6    DG  C C4    1 
ATOM   4811 P P     . DG  C 3 4   ? -18.343 -14.158 25.603  1.00 29.64  ? 7    DG  C P     1 
ATOM   4812 O OP1   . DG  C 3 4   ? -17.993 -14.020 27.021  1.00 30.97  ? 7    DG  C OP1   1 
ATOM   4813 O OP2   . DG  C 3 4   ? -18.618 -15.458 25.020  1.00 30.26  ? 7    DG  C OP2   1 
ATOM   4814 O "O5'" . DG  C 3 4   ? -19.600 -13.219 25.256  1.00 29.58  ? 7    DG  C "O5'" 1 
ATOM   4815 C "C5'" . DG  C 3 4   ? -19.649 -11.895 25.780  1.00 30.33  ? 7    DG  C "C5'" 1 
ATOM   4816 C "C4'" . DG  C 3 4   ? -21.062 -11.379 25.846  1.00 30.09  ? 7    DG  C "C4'" 1 
ATOM   4817 O "O4'" . DG  C 3 4   ? -21.536 -11.126 24.513  1.00 28.66  ? 7    DG  C "O4'" 1 
ATOM   4818 C "C3'" . DG  C 3 4   ? -22.072 -12.318 26.500  1.00 31.47  ? 7    DG  C "C3'" 1 
ATOM   4819 O "O3'" . DG  C 3 4   ? -23.041 -11.479 27.124  1.00 31.50  ? 7    DG  C "O3'" 1 
ATOM   4820 C "C2'" . DG  C 3 4   ? -22.665 -13.058 25.320  1.00 30.04  ? 7    DG  C "C2'" 1 
ATOM   4821 C "C1'" . DG  C 3 4   ? -22.623 -12.008 24.214  1.00 31.50  ? 7    DG  C "C1'" 1 
ATOM   4822 N N9    . DG  C 3 4   ? -22.405 -12.547 22.876  1.00 33.96  ? 7    DG  C N9    1 
ATOM   4823 C C8    . DG  C 3 4   ? -21.524 -13.544 22.515  1.00 33.60  ? 7    DG  C C8    1 
ATOM   4824 N N7    . DG  C 3 4   ? -21.531 -13.792 21.233  1.00 34.80  ? 7    DG  C N7    1 
ATOM   4825 C C5    . DG  C 3 4   ? -22.464 -12.902 20.715  1.00 32.44  ? 7    DG  C C5    1 
ATOM   4826 C C6    . DG  C 3 4   ? -22.927 -12.741 19.395  1.00 35.66  ? 7    DG  C C6    1 
ATOM   4827 O O6    . DG  C 3 4   ? -22.592 -13.367 18.387  1.00 34.78  ? 7    DG  C O6    1 
ATOM   4828 N N1    . DG  C 3 4   ? -23.911 -11.758 19.312  1.00 32.57  ? 7    DG  C N1    1 
ATOM   4829 C C2    . DG  C 3 4   ? -24.360 -11.002 20.367  1.00 32.81  ? 7    DG  C C2    1 
ATOM   4830 N N2    . DG  C 3 4   ? -25.270 -10.066 20.078  1.00 29.66  ? 7    DG  C N2    1 
ATOM   4831 N N3    . DG  C 3 4   ? -23.937 -11.150 21.612  1.00 29.18  ? 7    DG  C N3    1 
ATOM   4832 C C4    . DG  C 3 4   ? -23.008 -12.123 21.714  1.00 31.50  ? 7    DG  C C4    1 
ATOM   4833 P P     . DA  C 3 5   ? -24.177 -12.092 28.119  1.00 35.02  ? 8    DA  C P     1 
ATOM   4834 O OP1   . DA  C 3 5   ? -24.427 -11.016 29.147  1.00 35.18  ? 8    DA  C OP1   1 
ATOM   4835 O OP2   . DA  C 3 5   ? -23.851 -13.448 28.487  1.00 35.15  ? 8    DA  C OP2   1 
ATOM   4836 O "O5'" . DA  C 3 5   ? -25.453 -12.164 27.187  1.00 34.62  ? 8    DA  C "O5'" 1 
ATOM   4837 C "C5'" . DA  C 3 5   ? -25.953 -10.922 26.669  1.00 37.61  ? 8    DA  C "C5'" 1 
ATOM   4838 C "C4'" . DA  C 3 5   ? -27.030 -11.190 25.644  1.00 46.59  ? 8    DA  C "C4'" 1 
ATOM   4839 O "O4'" . DA  C 3 5   ? -26.449 -11.724 24.436  1.00 44.77  ? 8    DA  C "O4'" 1 
ATOM   4840 C "C3'" . DA  C 3 5   ? -28.073 -12.217 26.086  1.00 50.00  ? 8    DA  C "C3'" 1 
ATOM   4841 O "O3'" . DA  C 3 5   ? -29.341 -11.620 25.829  1.00 71.14  ? 8    DA  C "O3'" 1 
ATOM   4842 C "C2'" . DA  C 3 5   ? -27.785 -13.435 25.223  1.00 50.76  ? 8    DA  C "C2'" 1 
ATOM   4843 C "C1'" . DA  C 3 5   ? -27.271 -12.756 23.963  1.00 44.50  ? 8    DA  C "C1'" 1 
ATOM   4844 N N9    . DA  C 3 5   ? -26.477 -13.590 23.081  1.00 38.09  ? 8    DA  C N9    1 
ATOM   4845 C C8    . DA  C 3 5   ? -25.545 -14.541 23.406  1.00 39.12  ? 8    DA  C C8    1 
ATOM   4846 N N7    . DA  C 3 5   ? -25.029 -15.151 22.367  1.00 42.98  ? 8    DA  C N7    1 
ATOM   4847 C C5    . DA  C 3 5   ? -25.697 -14.587 21.286  1.00 41.65  ? 8    DA  C C5    1 
ATOM   4848 C C6    . DA  C 3 5   ? -25.629 -14.823 19.906  1.00 43.77  ? 8    DA  C C6    1 
ATOM   4849 N N6    . DA  C 3 5   ? -24.800 -15.705 19.346  1.00 45.79  ? 8    DA  C N6    1 
ATOM   4850 N N1    . DA  C 3 5   ? -26.432 -14.090 19.104  1.00 48.13  ? 8    DA  C N1    1 
ATOM   4851 C C2    . DA  C 3 5   ? -27.250 -13.193 19.661  1.00 43.81  ? 8    DA  C C2    1 
ATOM   4852 N N3    . DA  C 3 5   ? -27.414 -12.891 20.946  1.00 41.28  ? 8    DA  C N3    1 
ATOM   4853 C C4    . DA  C 3 5   ? -26.599 -13.635 21.713  1.00 38.47  ? 8    DA  C C4    1 
HETATM 4854 P P     . SAY C 3 6   ? -30.539 -11.861 26.837  1.00 67.40  ? 9    SAY C P     1 
HETATM 4855 O O1P   . SAY C 3 6   ? -30.583 -10.714 27.773  1.00 55.60  ? 9    SAY C O1P   1 
HETATM 4856 O O2P   . SAY C 3 6   ? -30.432 -13.282 27.266  1.00 52.02  ? 9    SAY C O2P   1 
HETATM 4857 O "O5'" . SAY C 3 6   ? -31.811 -11.564 25.956  1.00 57.07  ? 9    SAY C "O5'" 1 
HETATM 4858 C "C5'" . SAY C 3 6   ? -31.824 -10.613 24.878  1.00 58.22  ? 9    SAY C "C5'" 1 
HETATM 4859 C "C4'" . SAY C 3 6   ? -32.643 -11.199 23.755  1.00 58.86  ? 9    SAY C "C4'" 1 
HETATM 4860 O "O4'" . SAY C 3 6   ? -31.825 -12.027 22.910  1.00 62.07  ? 9    SAY C "O4'" 1 
HETATM 4861 C "C3'" . SAY C 3 6   ? -33.816 -12.029 24.230  1.00 58.16  ? 9    SAY C "C3'" 1 
HETATM 4862 O "O3'" . SAY C 3 6   ? -34.972 -11.566 23.595  1.00 65.21  ? 9    SAY C "O3'" 1 
HETATM 4863 C "C2'" . SAY C 3 6   ? -33.451 -13.449 23.852  1.00 59.15  ? 9    SAY C "C2'" 1 
HETATM 4864 C "C1'" . SAY C 3 6   ? -32.443 -13.297 22.721  1.00 61.38  ? 9    SAY C "C1'" 1 
HETATM 4865 C CAA   . SAY C 3 6   ? -31.356 -14.322 22.691  1.00 54.83  ? 9    SAY C CAA   1 
HETATM 4866 C CAB   . SAY C 3 6   ? -30.821 -14.728 21.475  1.00 54.81  ? 9    SAY C CAB   1 
HETATM 4867 C CAF   . SAY C 3 6   ? -30.821 -14.851 23.865  1.00 53.23  ? 9    SAY C CAF   1 
HETATM 4868 C CAE   . SAY C 3 6   ? -29.785 -15.772 23.837  1.00 53.82  ? 9    SAY C CAE   1 
HETATM 4869 C CAD   . SAY C 3 6   ? -29.277 -16.184 22.620  1.00 51.59  ? 9    SAY C CAD   1 
HETATM 4870 C CAG   . SAY C 3 6   ? -28.175 -17.131 22.651  1.00 47.51  ? 9    SAY C CAG   1 
HETATM 4871 C CAC   . SAY C 3 6   ? -29.806 -15.675 21.451  1.00 50.44  ? 9    SAY C CAC   1 
HETATM 4872 O OAR   . SAY C 3 6   ? -29.275 -16.052 20.291  1.00 56.89  ? 9    SAY C OAR   1 
ATOM   4873 P P     . DG  C 3 7   ? -36.394 -12.099 24.061  1.00 65.79  ? 10   DG  C P     1 
ATOM   4874 O OP1   . DG  C 3 7   ? -37.346 -10.984 23.985  1.00 62.33  ? 10   DG  C OP1   1 
ATOM   4875 O OP2   . DG  C 3 7   ? -36.226 -12.891 25.293  1.00 64.86  ? 10   DG  C OP2   1 
ATOM   4876 O "O5'" . DG  C 3 7   ? -36.701 -13.203 22.963  1.00 57.42  ? 10   DG  C "O5'" 1 
ATOM   4877 C "C5'" . DG  C 3 7   ? -36.705 -12.871 21.572  1.00 57.28  ? 10   DG  C "C5'" 1 
ATOM   4878 C "C4'" . DG  C 3 7   ? -36.693 -14.160 20.789  1.00 61.66  ? 10   DG  C "C4'" 1 
ATOM   4879 O "O4'" . DG  C 3 7   ? -35.452 -14.851 21.039  1.00 61.00  ? 10   DG  C "O4'" 1 
ATOM   4880 C "C3'" . DG  C 3 7   ? -37.802 -15.137 21.184  1.00 58.31  ? 10   DG  C "C3'" 1 
ATOM   4881 O "O3'" . DG  C 3 7   ? -38.737 -15.145 20.098  1.00 72.31  ? 10   DG  C "O3'" 1 
ATOM   4882 C "C2'" . DG  C 3 7   ? -37.082 -16.448 21.462  1.00 56.20  ? 10   DG  C "C2'" 1 
ATOM   4883 C "C1'" . DG  C 3 7   ? -35.686 -16.232 20.913  1.00 63.32  ? 10   DG  C "C1'" 1 
ATOM   4884 N N9    . DG  C 3 7   ? -34.582 -16.914 21.579  1.00 60.91  ? 10   DG  C N9    1 
ATOM   4885 C C8    . DG  C 3 7   ? -34.189 -16.758 22.884  1.00 60.49  ? 10   DG  C C8    1 
ATOM   4886 N N7    . DG  C 3 7   ? -33.117 -17.441 23.181  1.00 59.53  ? 10   DG  C N7    1 
ATOM   4887 C C5    . DG  C 3 7   ? -32.769 -18.069 21.994  1.00 50.81  ? 10   DG  C C5    1 
ATOM   4888 C C6    . DG  C 3 7   ? -31.686 -18.930 21.700  1.00 53.78  ? 10   DG  C C6    1 
ATOM   4889 O O6    . DG  C 3 7   ? -30.811 -19.360 22.466  1.00 54.49  ? 10   DG  C O6    1 
ATOM   4890 N N1    . DG  C 3 7   ? -31.699 -19.328 20.367  1.00 57.68  ? 10   DG  C N1    1 
ATOM   4891 C C2    . DG  C 3 7   ? -32.634 -18.943 19.436  1.00 58.73  ? 10   DG  C C2    1 
ATOM   4892 N N2    . DG  C 3 7   ? -32.484 -19.440 18.200  1.00 55.54  ? 10   DG  C N2    1 
ATOM   4893 N N3    . DG  C 3 7   ? -33.652 -18.142 19.701  1.00 57.63  ? 10   DG  C N3    1 
ATOM   4894 C C4    . DG  C 3 7   ? -33.651 -17.739 20.989  1.00 61.35  ? 10   DG  C C4    1 
ATOM   4895 P P     . DG  C 3 8   ? -40.138 -15.913 20.213  1.00 59.49  ? 11   DG  C P     1 
ATOM   4896 O OP1   . DG  C 3 8   ? -41.205 -15.036 19.660  1.00 60.94  ? 11   DG  C OP1   1 
ATOM   4897 O OP2   . DG  C 3 8   ? -40.234 -16.515 21.548  1.00 58.44  ? 11   DG  C OP2   1 
ATOM   4898 O "O5'" . DG  C 3 8   ? -39.936 -17.149 19.243  1.00 59.28  ? 11   DG  C "O5'" 1 
ATOM   4899 C "C5'" . DG  C 3 8   ? -39.273 -16.952 18.011  1.00 53.35  ? 11   DG  C "C5'" 1 
ATOM   4900 C "C4'" . DG  C 3 8   ? -39.000 -18.283 17.360  1.00 54.55  ? 11   DG  C "C4'" 1 
ATOM   4901 O "O4'" . DG  C 3 8   ? -37.793 -18.850 17.896  1.00 47.42  ? 11   DG  C "O4'" 1 
ATOM   4902 C "C3'" . DG  C 3 8   ? -40.083 -19.345 17.520  1.00 54.18  ? 11   DG  C "C3'" 1 
ATOM   4903 O "O3'" . DG  C 3 8   ? -40.253 -19.882 16.203  1.00 56.53  ? 11   DG  C "O3'" 1 
ATOM   4904 C "C2'" . DG  C 3 8   ? -39.502 -20.315 18.541  1.00 49.54  ? 11   DG  C "C2'" 1 
ATOM   4905 C "C1'" . DG  C 3 8   ? -37.997 -20.173 18.338  1.00 52.65  ? 11   DG  C "C1'" 1 
ATOM   4906 N N9    . DG  C 3 8   ? -37.178 -20.335 19.531  1.00 49.47  ? 11   DG  C N9    1 
ATOM   4907 C C8    . DG  C 3 8   ? -37.392 -19.722 20.741  1.00 52.26  ? 11   DG  C C8    1 
ATOM   4908 N N7    . DG  C 3 8   ? -36.454 -19.971 21.612  1.00 53.33  ? 11   DG  C N7    1 
ATOM   4909 C C5    . DG  C 3 8   ? -35.544 -20.757 20.923  1.00 49.79  ? 11   DG  C C5    1 
ATOM   4910 C C6    . DG  C 3 8   ? -34.312 -21.324 21.346  1.00 50.06  ? 11   DG  C C6    1 
ATOM   4911 O O6    . DG  C 3 8   ? -33.771 -21.256 22.452  1.00 59.40  ? 11   DG  C O6    1 
ATOM   4912 N N1    . DG  C 3 8   ? -33.713 -22.060 20.333  1.00 53.43  ? 11   DG  C N1    1 
ATOM   4913 C C2    . DG  C 3 8   ? -34.217 -22.214 19.067  1.00 54.38  ? 11   DG  C C2    1 
ATOM   4914 N N2    . DG  C 3 8   ? -33.473 -22.950 18.230  1.00 53.94  ? 11   DG  C N2    1 
ATOM   4915 N N3    . DG  C 3 8   ? -35.364 -21.690 18.655  1.00 51.15  ? 11   DG  C N3    1 
ATOM   4916 C C4    . DG  C 3 8   ? -35.964 -20.968 19.626  1.00 50.75  ? 11   DG  C C4    1 
ATOM   4917 P P     . DT  C 3 9   ? -41.345 -21.007 15.945  1.00 58.52  ? 12   DT  C P     1 
ATOM   4918 O OP1   . DT  C 3 9   ? -41.599 -21.053 14.476  1.00 67.80  ? 12   DT  C OP1   1 
ATOM   4919 O OP2   . DT  C 3 9   ? -42.473 -20.757 16.890  1.00 51.99  ? 12   DT  C OP2   1 
ATOM   4920 O "O5'" . DT  C 3 9   ? -40.492 -22.319 16.193  1.00 55.22  ? 12   DT  C "O5'" 1 
ATOM   4921 C "C5'" . DT  C 3 9   ? -39.232 -22.442 15.523  1.00 56.14  ? 12   DT  C "C5'" 1 
ATOM   4922 C "C4'" . DT  C 3 9   ? -38.594 -23.769 15.853  1.00 65.93  ? 12   DT  C "C4'" 1 
ATOM   4923 O "O4'" . DT  C 3 9   ? -37.802 -23.651 17.062  1.00 72.21  ? 12   DT  C "O4'" 1 
ATOM   4924 C "C3'" . DT  C 3 9   ? -39.561 -24.938 16.084  1.00 71.07  ? 12   DT  C "C3'" 1 
ATOM   4925 O "O3'" . DT  C 3 9   ? -39.220 -26.010 15.194  1.00 80.43  ? 12   DT  C "O3'" 1 
ATOM   4926 C "C2'" . DT  C 3 9   ? -39.369 -25.312 17.550  1.00 70.03  ? 12   DT  C "C2'" 1 
ATOM   4927 C "C1'" . DT  C 3 9   ? -37.960 -24.821 17.854  1.00 69.61  ? 12   DT  C "C1'" 1 
ATOM   4928 N N1    . DT  C 3 9   ? -37.693 -24.444 19.259  1.00 59.82  ? 12   DT  C N1    1 
ATOM   4929 C C2    . DT  C 3 9   ? -36.494 -24.808 19.841  1.00 62.25  ? 12   DT  C C2    1 
ATOM   4930 O O2    . DT  C 3 9   ? -35.643 -25.475 19.272  1.00 55.33  ? 12   DT  C O2    1 
ATOM   4931 N N3    . DT  C 3 9   ? -36.327 -24.361 21.128  1.00 57.29  ? 12   DT  C N3    1 
ATOM   4932 C C4    . DT  C 3 9   ? -37.209 -23.599 21.869  1.00 57.58  ? 12   DT  C C4    1 
ATOM   4933 O O4    . DT  C 3 9   ? -36.920 -23.276 23.017  1.00 62.65  ? 12   DT  C O4    1 
ATOM   4934 C C5    . DT  C 3 9   ? -38.433 -23.235 21.189  1.00 58.00  ? 12   DT  C C5    1 
ATOM   4935 C C7    . DT  C 3 9   ? -39.447 -22.403 21.908  1.00 58.06  ? 12   DT  C C7    1 
ATOM   4936 C C6    . DT  C 3 9   ? -38.608 -23.668 19.935  1.00 63.61  ? 12   DT  C C6    1 
ATOM   4937 P P     . DC  C 3 10  ? -40.207 -27.286 15.045  1.00 90.30  ? 13   DC  C P     1 
ATOM   4938 O OP1   . DC  C 3 10  ? -40.206 -27.693 13.624  1.00 81.07  ? 13   DC  C OP1   1 
ATOM   4939 O OP2   . DC  C 3 10  ? -41.491 -26.981 15.756  1.00 70.58  ? 13   DC  C OP2   1 
ATOM   4940 O "O5'" . DC  C 3 10  ? -39.424 -28.436 15.820  1.00 81.96  ? 13   DC  C "O5'" 1 
ATOM   4941 C "C5'" . DC  C 3 10  ? -38.036 -28.707 15.518  1.00 83.86  ? 13   DC  C "C5'" 1 
ATOM   4942 C "C4'" . DC  C 3 10  ? -37.383 -29.482 16.643  1.00 81.34  ? 13   DC  C "C4'" 1 
ATOM   4943 O "O4'" . DC  C 3 10  ? -37.134 -28.625 17.773  1.00 82.25  ? 13   DC  C "O4'" 1 
ATOM   4944 C "C3'" . DC  C 3 10  ? -38.198 -30.651 17.194  1.00 80.06  ? 13   DC  C "C3'" 1 
ATOM   4945 O "O3'" . DC  C 3 10  ? -37.774 -31.847 16.534  1.00 81.66  ? 13   DC  C "O3'" 1 
ATOM   4946 C "C2'" . DC  C 3 10  ? -37.857 -30.688 18.678  1.00 81.45  ? 13   DC  C "C2'" 1 
ATOM   4947 C "C1'" . DC  C 3 10  ? -37.072 -29.409 18.953  1.00 74.41  ? 13   DC  C "C1'" 1 
ATOM   4948 N N1    . DC  C 3 10  ? -37.603 -28.598 20.065  1.00 73.51  ? 13   DC  C N1    1 
ATOM   4949 C C2    . DC  C 3 10  ? -36.826 -28.456 21.215  1.00 74.60  ? 13   DC  C C2    1 
ATOM   4950 O O2    . DC  C 3 10  ? -35.722 -29.019 21.262  1.00 67.66  ? 13   DC  C O2    1 
ATOM   4951 N N3    . DC  C 3 10  ? -37.298 -27.717 22.248  1.00 67.51  ? 13   DC  C N3    1 
ATOM   4952 C C4    . DC  C 3 10  ? -38.484 -27.112 22.147  1.00 70.10  ? 13   DC  C C4    1 
ATOM   4953 N N4    . DC  C 3 10  ? -38.901 -26.375 23.181  1.00 69.18  ? 13   DC  C N4    1 
ATOM   4954 C C5    . DC  C 3 10  ? -39.298 -27.242 20.985  1.00 72.27  ? 13   DC  C C5    1 
ATOM   4955 C C6    . DC  C 3 10  ? -38.829 -27.997 19.982  1.00 70.55  ? 13   DC  C C6    1 
HETATM 4956 C C1    . GLC D 4 .   ? -18.182 -17.844 35.341  0.83 41.82  ? 1    GLC D C1    1 
HETATM 4957 C C2    . GLC D 4 .   ? -19.265 -18.583 34.584  0.83 41.41  ? 1    GLC D C2    1 
HETATM 4958 C C3    . GLC D 4 .   ? -19.531 -17.886 33.261  0.83 41.74  ? 1    GLC D C3    1 
HETATM 4959 C C4    . GLC D 4 .   ? -20.001 -16.476 33.677  0.83 43.39  ? 1    GLC D C4    1 
HETATM 4960 C C5    . GLC D 4 .   ? -18.893 -15.734 34.427  0.83 42.87  ? 1    GLC D C5    1 
HETATM 4961 C C6    . GLC D 4 .   ? -19.372 -14.370 34.806  0.83 43.84  ? 1    GLC D C6    1 
HETATM 4962 O O2    . GLC D 4 .   ? -18.818 -19.912 34.374  0.83 45.03  ? 1    GLC D O2    1 
HETATM 4963 O O3    . GLC D 4 .   ? -20.574 -18.598 32.593  0.83 42.48  ? 1    GLC D O3    1 
HETATM 4964 O O4    . GLC D 4 .   ? -20.383 -15.718 32.542  0.83 45.60  ? 1    GLC D O4    1 
HETATM 4965 O O5    . GLC D 4 .   ? -18.575 -16.479 35.606  0.83 43.81  ? 1    GLC D O5    1 
HETATM 4966 O O6    . GLC D 4 .   ? -20.475 -14.498 35.730  0.83 37.00  ? 1    GLC D O6    1 
HETATM 4967 C C1    . FRU D 4 .   ? -15.859 -19.740 35.670  0.83 45.50  ? 2    FRU D C1    1 
HETATM 4968 C C2    . FRU D 4 .   ? -15.784 -18.302 35.149  0.83 45.05  ? 2    FRU D C2    1 
HETATM 4969 C C3    . FRU D 4 .   ? -14.613 -17.977 34.209  0.83 42.68  ? 2    FRU D C3    1 
HETATM 4970 C C4    . FRU D 4 .   ? -14.495 -16.447 34.413  0.83 44.46  ? 2    FRU D C4    1 
HETATM 4971 C C5    . FRU D 4 .   ? -14.834 -16.280 35.903  0.83 45.35  ? 2    FRU D C5    1 
HETATM 4972 C C6    . FRU D 4 .   ? -15.607 -15.043 36.342  0.83 42.75  ? 2    FRU D C6    1 
HETATM 4973 O O1    . FRU D 4 .   ? -14.510 -20.011 36.085  0.83 53.67  ? 2    FRU D O1    1 
HETATM 4974 O O2    . FRU D 4 .   ? -16.995 -17.917 34.503  0.83 40.02  ? 2    FRU D O2    1 
HETATM 4975 O O3    . FRU D 4 .   ? -14.857 -18.349 32.825  0.83 39.65  ? 2    FRU D O3    1 
HETATM 4976 O O4    . FRU D 4 .   ? -13.196 -15.907 34.046  0.83 36.47  ? 2    FRU D O4    1 
HETATM 4977 O O5    . FRU D 4 .   ? -15.619 -17.439 36.275  0.83 46.85  ? 2    FRU D O5    1 
HETATM 4978 O O6    . FRU D 4 .   ? -15.846 -15.275 37.752  0.83 32.38  ? 2    FRU D O6    1 
HETATM 4979 S S     . SO4 E 5 .   ? 4.573   10.130  -1.369  1.00 47.22  ? 878  SO4 A S     1 
HETATM 4980 O O1    . SO4 E 5 .   ? 5.286   11.239  -0.737  1.00 61.90  ? 878  SO4 A O1    1 
HETATM 4981 O O2    . SO4 E 5 .   ? 5.529   9.459   -2.234  1.00 62.69  ? 878  SO4 A O2    1 
HETATM 4982 O O3    . SO4 E 5 .   ? 3.292   10.509  -1.971  1.00 54.37  ? 878  SO4 A O3    1 
HETATM 4983 O O4    . SO4 E 5 .   ? 4.234   9.063   -0.446  1.00 69.14  ? 878  SO4 A O4    1 
HETATM 4984 S S     . SO4 F 5 .   ? -2.736  -38.503 6.364   1.00 49.44  ? 879  SO4 A S     1 
HETATM 4985 O O1    . SO4 F 5 .   ? -3.065  -37.095 5.960   1.00 51.73  ? 879  SO4 A O1    1 
HETATM 4986 O O2    . SO4 F 5 .   ? -1.397  -38.816 5.756   1.00 55.03  ? 879  SO4 A O2    1 
HETATM 4987 O O3    . SO4 F 5 .   ? -3.729  -39.495 5.899   1.00 56.18  ? 879  SO4 A O3    1 
HETATM 4988 O O4    . SO4 F 5 .   ? -2.625  -38.480 7.823   1.00 45.92  ? 879  SO4 A O4    1 
HETATM 4989 S S     . SO4 G 5 .   ? -13.221 5.619   9.149   1.00 61.44  ? 880  SO4 A S     1 
HETATM 4990 O O1    . SO4 G 5 .   ? -13.939 6.838   9.519   1.00 64.16  ? 880  SO4 A O1    1 
HETATM 4991 O O2    . SO4 G 5 .   ? -11.820 5.953   8.861   1.00 59.13  ? 880  SO4 A O2    1 
HETATM 4992 O O3    . SO4 G 5 .   ? -13.929 5.078   7.988   1.00 61.14  ? 880  SO4 A O3    1 
HETATM 4993 O O4    . SO4 G 5 .   ? -13.104 4.564   10.186  1.00 63.94  ? 880  SO4 A O4    1 
HETATM 4994 S S     . SO4 H 5 .   ? -17.450 -21.444 41.379  0.71 58.18  ? 881  SO4 A S     1 
HETATM 4995 O O1    . SO4 H 5 .   ? -16.623 -20.669 42.363  0.71 38.58  ? 881  SO4 A O1    1 
HETATM 4996 O O2    . SO4 H 5 .   ? -16.644 -22.154 40.376  0.71 41.62  ? 881  SO4 A O2    1 
HETATM 4997 O O3    . SO4 H 5 .   ? -18.342 -20.508 40.612  0.71 41.89  ? 881  SO4 A O3    1 
HETATM 4998 O O4    . SO4 H 5 .   ? -18.153 -22.529 42.137  0.71 45.14  ? 881  SO4 A O4    1 
HETATM 4999 O O     . HOH I 6 .   ? -12.763 -31.352 61.999  1.00 43.67  ? 2001 HOH A O     1 
HETATM 5000 O O     . HOH I 6 .   ? -5.913  -29.069 59.748  1.00 40.02  ? 2002 HOH A O     1 
HETATM 5001 O O     . HOH I 6 .   ? -5.652  -24.208 64.624  1.00 44.63  ? 2003 HOH A O     1 
HETATM 5002 O O     . HOH I 6 .   ? -2.740  -18.776 56.310  1.00 33.81  ? 2004 HOH A O     1 
HETATM 5003 O O     . HOH I 6 .   ? -1.203  -15.743 53.731  1.00 37.85  ? 2005 HOH A O     1 
HETATM 5004 O O     . HOH I 6 .   ? 2.296   -21.604 54.986  1.00 31.10  ? 2006 HOH A O     1 
HETATM 5005 O O     . HOH I 6 .   ? 0.619   -17.233 47.742  1.00 39.32  ? 2007 HOH A O     1 
HETATM 5006 O O     . HOH I 6 .   ? -9.488  -19.796 45.297  1.00 20.17  ? 2008 HOH A O     1 
HETATM 5007 O O     . HOH I 6 .   ? -11.895 -18.649 45.911  1.00 23.75  ? 2009 HOH A O     1 
HETATM 5008 O O     . HOH I 6 .   ? -15.436 -17.874 44.614  1.00 27.96  ? 2010 HOH A O     1 
HETATM 5009 O O     . HOH I 6 .   ? -13.755 -20.292 44.839  1.00 31.49  ? 2011 HOH A O     1 
HETATM 5010 O O     . HOH I 6 .   ? -22.898 -17.811 46.176  1.00 29.90  ? 2012 HOH A O     1 
HETATM 5011 O O     . HOH I 6 .   ? -25.935 -15.484 39.139  1.00 35.95  ? 2013 HOH A O     1 
HETATM 5012 O O     . HOH I 6 .   ? -24.522 -7.527  37.164  1.00 38.06  ? 2014 HOH A O     1 
HETATM 5013 O O     . HOH I 6 .   ? -13.828 -12.945 37.839  1.00 28.50  ? 2015 HOH A O     1 
HETATM 5014 O O     . HOH I 6 .   ? -26.012 -12.307 48.878  1.00 36.32  ? 2016 HOH A O     1 
HETATM 5015 O O     . HOH I 6 .   ? -23.111 -9.051  49.862  1.00 24.47  ? 2017 HOH A O     1 
HETATM 5016 O O     . HOH I 6 .   ? -23.801 -5.193  50.070  1.00 29.78  ? 2018 HOH A O     1 
HETATM 5017 O O     . HOH I 6 .   ? -27.103 -5.256  45.156  1.00 26.65  ? 2019 HOH A O     1 
HETATM 5018 O O     . HOH I 6 .   ? -21.134 -10.127 48.360  1.00 25.35  ? 2020 HOH A O     1 
HETATM 5019 O O     . HOH I 6 .   ? -22.510 -14.651 52.466  1.00 35.05  ? 2021 HOH A O     1 
HETATM 5020 O O     . HOH I 6 .   ? 0.091   -28.754 55.334  1.00 52.04  ? 2022 HOH A O     1 
HETATM 5021 O O     . HOH I 6 .   ? -2.606  -30.165 51.173  1.00 30.93  ? 2023 HOH A O     1 
HETATM 5022 O O     . HOH I 6 .   ? -9.642  -7.000  54.829  1.00 32.33  ? 2024 HOH A O     1 
HETATM 5023 O O     . HOH I 6 .   ? -13.012 -19.489 42.349  1.00 38.14  ? 2025 HOH A O     1 
HETATM 5024 O O     . HOH I 6 .   ? -12.691 -16.706 44.118  1.00 30.34  ? 2026 HOH A O     1 
HETATM 5025 O O     . HOH I 6 .   ? -8.972  -13.088 38.956  1.00 24.83  ? 2027 HOH A O     1 
HETATM 5026 O O     . HOH I 6 .   ? -7.629  -10.143 41.720  1.00 35.47  ? 2028 HOH A O     1 
HETATM 5027 O O     . HOH I 6 .   ? -12.258 -13.156 35.055  1.00 26.88  ? 2029 HOH A O     1 
HETATM 5028 O O     . HOH I 6 .   ? -12.212 -7.270  48.484  1.00 23.51  ? 2030 HOH A O     1 
HETATM 5029 O O     . HOH I 6 .   ? -16.159 -2.087  50.031  1.00 37.99  ? 2031 HOH A O     1 
HETATM 5030 O O     . HOH I 6 .   ? -4.052  -8.799  45.815  1.00 33.22  ? 2032 HOH A O     1 
HETATM 5031 O O     . HOH I 6 .   ? -8.102  -11.501 29.084  1.00 26.78  ? 2033 HOH A O     1 
HETATM 5032 O O     . HOH I 6 .   ? -1.475  -16.927 26.464  1.00 25.81  ? 2034 HOH A O     1 
HETATM 5033 O O     . HOH I 6 .   ? 1.771   -23.446 27.525  1.00 27.24  ? 2035 HOH A O     1 
HETATM 5034 O O     . HOH I 6 .   ? -7.732  -22.254 29.455  1.00 30.74  ? 2036 HOH A O     1 
HETATM 5035 O O     . HOH I 6 .   ? -4.056  -21.858 22.825  1.00 27.02  ? 2037 HOH A O     1 
HETATM 5036 O O     . HOH I 6 .   ? -2.717  -27.274 26.899  1.00 44.48  ? 2038 HOH A O     1 
HETATM 5037 O O     . HOH I 6 .   ? -10.408 -19.862 27.729  1.00 38.44  ? 2039 HOH A O     1 
HETATM 5038 O O     . HOH I 6 .   ? -8.966  -20.200 30.785  1.00 38.51  ? 2040 HOH A O     1 
HETATM 5039 O O     . HOH I 6 .   ? -12.312 -19.345 32.014  1.00 35.09  ? 2041 HOH A O     1 
HETATM 5040 O O     . HOH I 6 .   ? -13.763 -29.286 35.094  1.00 35.37  ? 2042 HOH A O     1 
HETATM 5041 O O     . HOH I 6 .   ? -17.213 -27.816 36.586  1.00 31.04  ? 2043 HOH A O     1 
HETATM 5042 O O     . HOH I 6 .   ? -13.111 -27.745 40.546  1.00 24.37  ? 2044 HOH A O     1 
HETATM 5043 O O     . HOH I 6 .   ? -13.185 -23.939 40.607  1.00 31.42  ? 2045 HOH A O     1 
HETATM 5044 O O     . HOH I 6 .   ? -8.438  -32.605 37.903  1.00 26.35  ? 2046 HOH A O     1 
HETATM 5045 O O     . HOH I 6 .   ? -25.110 -18.908 47.165  1.00 31.99  ? 2047 HOH A O     1 
HETATM 5046 O O     . HOH I 6 .   ? -6.969  -31.753 46.216  1.00 27.15  ? 2048 HOH A O     1 
HETATM 5047 O O     . HOH I 6 .   ? -2.483  -32.427 47.482  1.00 29.44  ? 2049 HOH A O     1 
HETATM 5048 O O     . HOH I 6 .   ? -10.734 -33.973 38.630  1.00 28.47  ? 2050 HOH A O     1 
HETATM 5049 O O     . HOH I 6 .   ? -12.096 -36.119 42.030  1.00 37.49  ? 2051 HOH A O     1 
HETATM 5050 O O     . HOH I 6 .   ? -11.709 -35.887 44.723  1.00 36.69  ? 2052 HOH A O     1 
HETATM 5051 O O     . HOH I 6 .   ? -13.458 -31.826 45.234  1.00 29.43  ? 2053 HOH A O     1 
HETATM 5052 O O     . HOH I 6 .   ? -18.911 -36.665 41.707  1.00 50.18  ? 2054 HOH A O     1 
HETATM 5053 O O     . HOH I 6 .   ? -17.049 -33.025 48.325  1.00 30.22  ? 2055 HOH A O     1 
HETATM 5054 O O     . HOH I 6 .   ? -20.415 -24.942 39.239  1.00 37.25  ? 2056 HOH A O     1 
HETATM 5055 O O     . HOH I 6 .   ? -23.953 -25.962 53.092  1.00 51.99  ? 2057 HOH A O     1 
HETATM 5056 O O     . HOH I 6 .   ? -25.397 -28.799 55.798  1.00 51.92  ? 2058 HOH A O     1 
HETATM 5057 O O     . HOH I 6 .   ? -13.901 -36.190 46.308  1.00 37.28  ? 2059 HOH A O     1 
HETATM 5058 O O     . HOH I 6 .   ? -1.918  -29.924 48.477  1.00 27.77  ? 2060 HOH A O     1 
HETATM 5059 O O     . HOH I 6 .   ? 3.184   -25.490 44.753  1.00 28.19  ? 2061 HOH A O     1 
HETATM 5060 O O     . HOH I 6 .   ? -14.769 -33.570 46.888  1.00 28.99  ? 2062 HOH A O     1 
HETATM 5061 O O     . HOH I 6 .   ? 0.870   -25.650 28.542  1.00 36.26  ? 2063 HOH A O     1 
HETATM 5062 O O     . HOH I 6 .   ? 4.997   -24.925 28.073  1.00 30.35  ? 2064 HOH A O     1 
HETATM 5063 O O     . HOH I 6 .   ? 8.095   -23.384 26.775  1.00 37.55  ? 2065 HOH A O     1 
HETATM 5064 O O     . HOH I 6 .   ? 7.226   -26.118 29.077  1.00 44.12  ? 2066 HOH A O     1 
HETATM 5065 O O     . HOH I 6 .   ? 4.814   -17.371 25.485  1.00 31.59  ? 2067 HOH A O     1 
HETATM 5066 O O     . HOH I 6 .   ? 6.357   -12.379 30.827  1.00 30.30  ? 2068 HOH A O     1 
HETATM 5067 O O     . HOH I 6 .   ? 5.470   -10.209 29.536  1.00 42.05  ? 2069 HOH A O     1 
HETATM 5068 O O     . HOH I 6 .   ? 0.928   -9.984  40.913  1.00 27.93  ? 2070 HOH A O     1 
HETATM 5069 O O     . HOH I 6 .   ? -13.221 2.883   41.233  1.00 30.24  ? 2071 HOH A O     1 
HETATM 5070 O O     . HOH I 6 .   ? -3.487  -3.384  40.336  1.00 34.88  ? 2072 HOH A O     1 
HETATM 5071 O O     . HOH I 6 .   ? -10.088 0.575   38.754  1.00 32.65  ? 2073 HOH A O     1 
HETATM 5072 O O     . HOH I 6 .   ? -14.317 0.590   42.724  1.00 29.60  ? 2074 HOH A O     1 
HETATM 5073 O O     . HOH I 6 .   ? -18.108 -0.786  35.440  1.00 23.13  ? 2075 HOH A O     1 
HETATM 5074 O O     . HOH I 6 .   ? -19.656 4.461   39.227  1.00 31.46  ? 2076 HOH A O     1 
HETATM 5075 O O     . HOH I 6 .   ? -21.582 6.078   35.887  1.00 24.75  ? 2077 HOH A O     1 
HETATM 5076 O O     . HOH I 6 .   ? -33.625 7.777   35.745  1.00 33.75  ? 2078 HOH A O     1 
HETATM 5077 O O     . HOH I 6 .   ? -29.489 10.790  30.112  1.00 34.42  ? 2079 HOH A O     1 
HETATM 5078 O O     . HOH I 6 .   ? -48.807 0.660   10.244  1.00 41.92  ? 2080 HOH A O     1 
HETATM 5079 O O     . HOH I 6 .   ? -23.277 0.254   44.597  1.00 30.79  ? 2081 HOH A O     1 
HETATM 5080 O O     . HOH I 6 .   ? -45.346 -10.854 14.765  1.00 45.09  ? 2082 HOH A O     1 
HETATM 5081 O O     . HOH I 6 .   ? -47.559 -18.125 16.408  1.00 55.43  ? 2083 HOH A O     1 
HETATM 5082 O O     . HOH I 6 .   ? -13.796 1.293   12.070  1.00 59.55  ? 2084 HOH A O     1 
HETATM 5083 O O     . HOH I 6 .   ? -39.572 -18.188 -3.971  1.00 39.13  ? 2085 HOH A O     1 
HETATM 5084 O O     . HOH I 6 .   ? -39.429 -16.863 -6.872  1.00 36.39  ? 2086 HOH A O     1 
HETATM 5085 O O     . HOH I 6 .   ? -40.527 -19.362 -6.631  1.00 47.26  ? 2087 HOH A O     1 
HETATM 5086 O O     . HOH I 6 .   ? -33.362 -15.165 -0.390  1.00 33.24  ? 2088 HOH A O     1 
HETATM 5087 O O     . HOH I 6 .   ? -35.567 -18.792 -5.650  1.00 40.11  ? 2089 HOH A O     1 
HETATM 5088 O O     . HOH I 6 .   ? -15.303 8.681   1.481   1.00 45.83  ? 2090 HOH A O     1 
HETATM 5089 O O     . HOH I 6 .   ? -38.635 -3.351  0.795   1.00 35.25  ? 2091 HOH A O     1 
HETATM 5090 O O     . HOH I 6 .   ? -44.342 -4.304  -2.779  1.00 45.37  ? 2092 HOH A O     1 
HETATM 5091 O O     . HOH I 6 .   ? 1.085   -28.073 16.168  1.00 34.49  ? 2093 HOH A O     1 
HETATM 5092 O O     . HOH I 6 .   ? -7.300  -25.798 17.890  1.00 39.52  ? 2094 HOH A O     1 
HETATM 5093 O O     . HOH I 6 .   ? -31.833 -6.141  13.846  1.00 43.19  ? 2095 HOH A O     1 
HETATM 5094 O O     . HOH I 6 .   ? -28.917 0.295   16.198  1.00 37.10  ? 2096 HOH A O     1 
HETATM 5095 O O     . HOH I 6 .   ? -27.010 -2.400  44.738  1.00 30.28  ? 2097 HOH A O     1 
HETATM 5096 O O     . HOH I 6 .   ? -29.475 -4.767  44.347  1.00 33.36  ? 2098 HOH A O     1 
HETATM 5097 O O     . HOH I 6 .   ? -25.093 -0.842  43.223  1.00 33.51  ? 2099 HOH A O     1 
HETATM 5098 O O     . HOH I 6 .   ? -18.764 4.510   41.814  1.00 42.03  ? 2100 HOH A O     1 
HETATM 5099 O O     . HOH I 6 .   ? -20.788 6.456   42.569  1.00 43.63  ? 2101 HOH A O     1 
HETATM 5100 O O     . HOH I 6 .   ? -0.414  15.530  32.337  1.00 43.60  ? 2102 HOH A O     1 
HETATM 5101 O O     . HOH I 6 .   ? -20.443 -2.158  34.981  1.00 22.66  ? 2103 HOH A O     1 
HETATM 5102 O O     . HOH I 6 .   ? 6.187   21.304  32.183  1.00 48.78  ? 2104 HOH A O     1 
HETATM 5103 O O     . HOH I 6 .   ? -11.150 -13.070 28.192  1.00 21.72  ? 2105 HOH A O     1 
HETATM 5104 O O     . HOH I 6 .   ? -10.115 -12.708 36.537  1.00 33.91  ? 2106 HOH A O     1 
HETATM 5105 O O     . HOH I 6 .   ? -12.994 -18.781 23.748  1.00 34.75  ? 2107 HOH A O     1 
HETATM 5106 O O     . HOH I 6 .   ? -7.422  -21.054 20.551  1.00 31.56  ? 2108 HOH A O     1 
HETATM 5107 O O     . HOH I 6 .   ? -7.571  -6.549  20.908  1.00 25.12  ? 2109 HOH A O     1 
HETATM 5108 O O     . HOH I 6 .   ? -13.939 -9.331  21.432  1.00 30.80  ? 2110 HOH A O     1 
HETATM 5109 O O     . HOH I 6 .   ? -10.025 -2.927  18.605  1.00 38.52  ? 2111 HOH A O     1 
HETATM 5110 O O     . HOH I 6 .   ? -10.697 -6.511  25.235  1.00 27.34  ? 2112 HOH A O     1 
HETATM 5111 O O     . HOH I 6 .   ? -14.897 -10.051 24.033  1.00 24.63  ? 2113 HOH A O     1 
HETATM 5112 O O     . HOH I 6 .   ? -17.310 -8.987  25.094  1.00 28.50  ? 2114 HOH A O     1 
HETATM 5113 O O     . HOH I 6 .   ? -22.204 -15.327 28.549  1.00 38.45  ? 2115 HOH A O     1 
HETATM 5114 O O     . HOH I 6 .   ? -25.252 -5.541  25.572  1.00 36.79  ? 2116 HOH A O     1 
HETATM 5115 O O     . HOH I 6 .   ? -18.996 -8.483  22.798  1.00 25.05  ? 2117 HOH A O     1 
HETATM 5116 O O     . HOH I 6 .   ? -20.326 -0.842  24.111  1.00 31.41  ? 2118 HOH A O     1 
HETATM 5117 O O     . HOH I 6 .   ? -17.483 -6.105  21.871  1.00 27.26  ? 2119 HOH A O     1 
HETATM 5118 O O     . HOH I 6 .   ? -26.343 0.490   15.486  1.00 36.91  ? 2120 HOH A O     1 
HETATM 5119 O O     . HOH I 6 .   ? -21.788 8.241   21.089  1.00 32.59  ? 2121 HOH A O     1 
HETATM 5120 O O     . HOH I 6 .   ? -17.834 1.646   20.967  1.00 43.99  ? 2122 HOH A O     1 
HETATM 5121 O O     . HOH I 6 .   ? -25.872 11.762  36.701  1.00 44.14  ? 2123 HOH A O     1 
HETATM 5122 O O     . HOH I 6 .   ? -24.704 9.706   43.588  1.00 48.96  ? 2124 HOH A O     1 
HETATM 5123 O O     . HOH I 6 .   ? -24.689 16.962  37.558  1.00 46.79  ? 2125 HOH A O     1 
HETATM 5124 O O     . HOH I 6 .   ? -10.934 3.669   17.667  1.00 31.38  ? 2126 HOH A O     1 
HETATM 5125 O O     . HOH I 6 .   ? -10.491 7.701   16.956  1.00 38.16  ? 2127 HOH A O     1 
HETATM 5126 O O     . HOH I 6 .   ? -9.557  3.290   15.201  1.00 29.72  ? 2128 HOH A O     1 
HETATM 5127 O O     . HOH I 6 .   ? -8.096  1.288   17.102  1.00 25.28  ? 2129 HOH A O     1 
HETATM 5128 O O     . HOH I 6 .   ? -3.169  4.356   18.104  1.00 23.21  ? 2130 HOH A O     1 
HETATM 5129 O O     . HOH I 6 .   ? -4.524  6.230   12.962  1.00 26.06  ? 2131 HOH A O     1 
HETATM 5130 O O     . HOH I 6 .   ? -9.803  6.296   14.344  1.00 42.96  ? 2132 HOH A O     1 
HETATM 5131 O O     . HOH I 6 .   ? -6.474  -0.674  12.976  1.00 26.26  ? 2133 HOH A O     1 
HETATM 5132 O O     . HOH I 6 .   ? -11.746 2.581   10.483  1.00 39.96  ? 2134 HOH A O     1 
HETATM 5133 O O     . HOH I 6 .   ? -7.599  -1.126  15.514  1.00 33.48  ? 2135 HOH A O     1 
HETATM 5134 O O     . HOH I 6 .   ? -8.616  -8.365  15.149  1.00 35.90  ? 2136 HOH A O     1 
HETATM 5135 O O     . HOH I 6 .   ? 0.581   8.900   13.974  1.00 24.76  ? 2137 HOH A O     1 
HETATM 5136 O O     . HOH I 6 .   ? -2.843  7.668   10.929  1.00 39.10  ? 2138 HOH A O     1 
HETATM 5137 O O     . HOH I 6 .   ? 6.634   -1.618  2.325   1.00 38.00  ? 2139 HOH A O     1 
HETATM 5138 O O     . HOH I 6 .   ? 8.978   -3.203  3.562   1.00 37.55  ? 2140 HOH A O     1 
HETATM 5139 O O     . HOH I 6 .   ? 9.172   5.910   7.645   1.00 30.97  ? 2141 HOH A O     1 
HETATM 5140 O O     . HOH I 6 .   ? 9.831   9.227   7.758   1.00 36.08  ? 2142 HOH A O     1 
HETATM 5141 O O     . HOH I 6 .   ? 0.346   13.906  6.764   1.00 32.84  ? 2143 HOH A O     1 
HETATM 5142 O O     . HOH I 6 .   ? 2.059   13.051  2.958   1.00 38.69  ? 2144 HOH A O     1 
HETATM 5143 O O     . HOH I 6 .   ? -6.007  6.389   9.666   1.00 36.73  ? 2145 HOH A O     1 
HETATM 5144 O O     . HOH I 6 .   ? -4.531  11.564  4.995   1.00 43.31  ? 2146 HOH A O     1 
HETATM 5145 O O     . HOH I 6 .   ? -2.854  -1.224  5.244   1.00 34.30  ? 2147 HOH A O     1 
HETATM 5146 O O     . HOH I 6 .   ? -12.911 9.405   -0.070  1.00 46.54  ? 2148 HOH A O     1 
HETATM 5147 O O     . HOH I 6 .   ? -16.073 5.993   1.439   1.00 36.24  ? 2149 HOH A O     1 
HETATM 5148 O O     . HOH I 6 .   ? -19.151 3.509   -0.792  1.00 32.15  ? 2150 HOH A O     1 
HETATM 5149 O O     . HOH I 6 .   ? -15.677 -0.852  3.981   1.00 34.31  ? 2151 HOH A O     1 
HETATM 5150 O O     . HOH I 6 .   ? 4.058   -19.661 5.067   1.00 36.19  ? 2152 HOH A O     1 
HETATM 5151 O O     . HOH I 6 .   ? 4.628   -15.498 17.214  1.00 33.35  ? 2153 HOH A O     1 
HETATM 5152 O O     . HOH I 6 .   ? 5.803   -18.365 18.130  1.00 36.12  ? 2154 HOH A O     1 
HETATM 5153 O O     . HOH I 6 .   ? 2.594   -27.162 14.453  1.00 46.65  ? 2155 HOH A O     1 
HETATM 5154 O O     . HOH I 6 .   ? 11.484  -23.694 18.555  1.00 32.28  ? 2156 HOH A O     1 
HETATM 5155 O O     . HOH I 6 .   ? 4.273   -26.198 20.839  1.00 24.92  ? 2157 HOH A O     1 
HETATM 5156 O O     . HOH I 6 .   ? 0.359   -26.735 18.624  1.00 26.93  ? 2158 HOH A O     1 
HETATM 5157 O O     . HOH I 6 .   ? -3.914  -15.536 27.145  1.00 29.72  ? 2159 HOH A O     1 
HETATM 5158 O O     . HOH I 6 .   ? 7.155   -24.177 24.114  1.00 30.14  ? 2160 HOH A O     1 
HETATM 5159 O O     . HOH I 6 .   ? -7.111  -14.682 15.851  1.00 35.52  ? 2161 HOH A O     1 
HETATM 5160 O O     . HOH I 6 .   ? -9.438  -21.732 18.625  1.00 38.18  ? 2162 HOH A O     1 
HETATM 5161 O O     . HOH I 6 .   ? -5.630  -24.915 15.847  1.00 26.26  ? 2163 HOH A O     1 
HETATM 5162 O O     . HOH I 6 .   ? -3.960  -31.157 12.555  1.00 47.30  ? 2164 HOH A O     1 
HETATM 5163 O O     . HOH I 6 .   ? -8.945  -24.503 12.423  1.00 29.93  ? 2165 HOH A O     1 
HETATM 5164 O O     . HOH I 6 .   ? -0.481  -24.152 7.328   1.00 36.35  ? 2166 HOH A O     1 
HETATM 5165 O O     . HOH I 6 .   ? -2.472  -33.368 12.405  1.00 45.90  ? 2167 HOH A O     1 
HETATM 5166 O O     . HOH I 6 .   ? -6.223  -33.723 8.692   1.00 37.60  ? 2168 HOH A O     1 
HETATM 5167 O O     . HOH I 6 .   ? -7.590  -31.938 11.119  1.00 55.33  ? 2169 HOH A O     1 
HETATM 5168 O O     . HOH I 6 .   ? -8.823  -30.608 1.750   1.00 47.44  ? 2170 HOH A O     1 
HETATM 5169 O O     . HOH I 6 .   ? -5.579  -29.755 2.364   1.00 43.18  ? 2171 HOH A O     1 
HETATM 5170 O O     . HOH I 6 .   ? -11.796 -28.518 3.307   1.00 49.08  ? 2172 HOH A O     1 
HETATM 5171 O O     . HOH I 6 .   ? -14.915 -29.766 4.626   1.00 63.46  ? 2173 HOH A O     1 
HETATM 5172 O O     . HOH I 6 .   ? -11.728 -22.208 6.218   1.00 42.48  ? 2174 HOH A O     1 
HETATM 5173 O O     . HOH I 6 .   ? -3.285  -24.370 1.806   1.00 34.54  ? 2175 HOH A O     1 
HETATM 5174 O O     . HOH I 6 .   ? -1.456  -24.336 3.549   1.00 39.57  ? 2176 HOH A O     1 
HETATM 5175 O O     . HOH I 6 .   ? -7.444  -23.214 14.347  1.00 36.13  ? 2177 HOH A O     1 
HETATM 5176 O O     . HOH I 6 .   ? -6.395  -2.357  21.885  1.00 24.18  ? 2178 HOH A O     1 
HETATM 5177 O O     . HOH I 6 .   ? -1.704  0.397   38.436  1.00 27.42  ? 2179 HOH A O     1 
HETATM 5178 O O     . HOH I 6 .   ? 1.896   4.608   29.935  1.00 25.52  ? 2180 HOH A O     1 
HETATM 5179 O O     . HOH I 6 .   ? 0.467   5.329   41.826  1.00 30.27  ? 2181 HOH A O     1 
HETATM 5180 O O     . HOH I 6 .   ? -0.488  14.533  43.763  1.00 31.99  ? 2182 HOH A O     1 
HETATM 5181 O O     . HOH I 6 .   ? -2.771  15.944  35.788  1.00 45.73  ? 2183 HOH A O     1 
HETATM 5182 O O     . HOH I 6 .   ? -10.057 4.003   38.391  1.00 33.17  ? 2184 HOH A O     1 
HETATM 5183 O O     . HOH I 6 .   ? -12.329 2.002   38.859  1.00 24.28  ? 2185 HOH A O     1 
HETATM 5184 O O     . HOH I 6 .   ? -7.742  -4.005  19.938  1.00 36.37  ? 2186 HOH A O     1 
HETATM 5185 O O     . HOH I 6 .   ? -8.333  -5.487  23.639  1.00 27.29  ? 2187 HOH A O     1 
HETATM 5186 O O     . HOH I 6 .   ? -11.741 20.604  33.939  1.00 29.61  ? 2188 HOH A O     1 
HETATM 5187 O O     . HOH I 6 .   ? -8.771  19.845  35.035  1.00 21.44  ? 2189 HOH A O     1 
HETATM 5188 O O     . HOH I 6 .   ? -8.526  18.835  38.905  1.00 33.86  ? 2190 HOH A O     1 
HETATM 5189 O O     . HOH I 6 .   ? -5.722  20.666  29.507  1.00 31.88  ? 2191 HOH A O     1 
HETATM 5190 O O     . HOH I 6 .   ? -2.908  16.424  33.081  1.00 28.04  ? 2192 HOH A O     1 
HETATM 5191 O O     . HOH I 6 .   ? -4.070  15.177  24.910  1.00 35.63  ? 2193 HOH A O     1 
HETATM 5192 O O     . HOH I 6 .   ? -2.084  14.246  25.848  1.00 35.04  ? 2194 HOH A O     1 
HETATM 5193 O O     . HOH I 6 .   ? 1.193   18.914  32.192  1.00 36.43  ? 2195 HOH A O     1 
HETATM 5194 O O     . HOH I 6 .   ? -2.586  19.184  32.745  1.00 36.93  ? 2196 HOH A O     1 
HETATM 5195 O O     . HOH I 6 .   ? 3.378   19.712  31.215  1.00 44.39  ? 2197 HOH A O     1 
HETATM 5196 O O     . HOH I 6 .   ? -3.141  12.444  21.050  1.00 43.25  ? 2198 HOH A O     1 
HETATM 5197 O O     . HOH I 6 .   ? 6.819   5.580   23.324  1.00 44.72  ? 2199 HOH A O     1 
HETATM 5198 O O     . HOH I 6 .   ? 7.748   -0.525  25.096  1.00 38.08  ? 2200 HOH A O     1 
HETATM 5199 O O     . HOH I 6 .   ? 5.193   3.951   19.826  1.00 26.22  ? 2201 HOH A O     1 
HETATM 5200 O O     . HOH I 6 .   ? -9.567  13.723  20.201  1.00 34.65  ? 2202 HOH A O     1 
HETATM 5201 O O     . HOH I 6 .   ? -10.964 16.031  20.971  1.00 45.47  ? 2203 HOH A O     1 
HETATM 5202 O O     . HOH I 6 .   ? -15.361 16.378  23.890  1.00 35.30  ? 2204 HOH A O     1 
HETATM 5203 O O     . HOH I 6 .   ? -22.383 17.057  27.028  1.00 32.31  ? 2205 HOH A O     1 
HETATM 5204 O O     . HOH J 6 .   ? -31.635 -6.857  11.146  1.00 35.52  ? 2001 HOH B O     1 
HETATM 5205 O O     . HOH J 6 .   ? -22.668 -14.218 13.347  1.00 43.01  ? 2002 HOH B O     1 
HETATM 5206 O O     . HOH J 6 .   ? -24.968 -5.901  12.831  1.00 42.74  ? 2003 HOH B O     1 
HETATM 5207 O O     . HOH J 6 .   ? -16.124 -0.653  15.123  1.00 43.89  ? 2004 HOH B O     1 
HETATM 5208 O O     . HOH K 6 .   ? -15.600 -15.389 18.543  1.00 35.01  ? 2001 HOH C O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LYS 1   298 298 LYS LYS A . n 
A 1 2   MET 2   299 299 MET MET A . n 
A 1 3   ALA 3   300 300 ALA ALA A . n 
A 1 4   PHE 4   301 301 PHE PHE A . n 
A 1 5   THR 5   302 302 THR THR A . n 
A 1 6   LEU 6   303 303 LEU LEU A . n 
A 1 7   ALA 7   304 304 ALA ALA A . n 
A 1 8   ASP 8   305 305 ASP ASP A . n 
A 1 9   ARG 9   306 306 ARG ARG A . n 
A 1 10  VAL 10  307 307 VAL VAL A . n 
A 1 11  THR 11  308 308 THR THR A . n 
A 1 12  GLU 12  309 309 GLU GLU A . n 
A 1 13  GLU 13  310 310 GLU GLU A . n 
A 1 14  MET 14  311 311 MET MET A . n 
A 1 15  LEU 15  312 312 LEU LEU A . n 
A 1 16  ALA 16  313 313 ALA ALA A . n 
A 1 17  ASP 17  314 314 ASP ASP A . n 
A 1 18  LYS 18  315 315 LYS LYS A . n 
A 1 19  ALA 19  316 316 ALA ALA A . n 
A 1 20  ALA 20  317 317 ALA ALA A . n 
A 1 21  LEU 21  318 318 LEU LEU A . n 
A 1 22  VAL 22  319 319 VAL VAL A . n 
A 1 23  VAL 23  320 320 VAL VAL A . n 
A 1 24  GLU 24  321 321 GLU GLU A . n 
A 1 25  VAL 25  322 322 VAL VAL A . n 
A 1 26  VAL 26  323 323 VAL VAL A . n 
A 1 27  GLU 27  324 324 GLU GLU A . n 
A 1 28  GLU 28  325 325 GLU GLU A . n 
A 1 29  ASN 29  326 326 ASN ASN A . n 
A 1 30  TYR 30  327 327 TYR TYR A . n 
A 1 31  HIS 31  328 328 HIS HIS A . n 
A 1 32  ASP 32  329 329 ASP ASP A . n 
A 1 33  ALA 33  330 330 ALA ALA A . n 
A 1 34  PRO 34  331 331 PRO PRO A . n 
A 1 35  ILE 35  332 332 ILE ILE A . n 
A 1 36  VAL 36  333 333 VAL VAL A . n 
A 1 37  GLY 37  334 334 GLY GLY A . n 
A 1 38  ILE 38  335 335 ILE ILE A . n 
A 1 39  ALA 39  336 336 ALA ALA A . n 
A 1 40  VAL 40  337 337 VAL VAL A . n 
A 1 41  VAL 41  338 338 VAL VAL A . n 
A 1 42  ASN 42  339 339 ASN ASN A . n 
A 1 43  GLU 43  340 340 GLU GLU A . n 
A 1 44  HIS 44  341 341 HIS HIS A . n 
A 1 45  GLY 45  342 342 GLY GLY A . n 
A 1 46  ARG 46  343 343 ARG ARG A . n 
A 1 47  PHE 47  344 344 PHE PHE A . n 
A 1 48  PHE 48  345 345 PHE PHE A . n 
A 1 49  LEU 49  346 346 LEU LEU A . n 
A 1 50  ARG 50  347 347 ARG ARG A . n 
A 1 51  PRO 51  348 348 PRO PRO A . n 
A 1 52  GLU 52  349 349 GLU GLU A . n 
A 1 53  THR 53  350 350 THR THR A . n 
A 1 54  ALA 54  351 351 ALA ALA A . n 
A 1 55  LEU 55  352 352 LEU LEU A . n 
A 1 56  ALA 56  353 353 ALA ALA A . n 
A 1 57  ASP 57  354 354 ASP ASP A . n 
A 1 58  PRO 58  355 355 PRO PRO A . n 
A 1 59  GLN 59  356 356 GLN GLN A . n 
A 1 60  PHE 60  357 357 PHE PHE A . n 
A 1 61  VAL 61  358 358 VAL VAL A . n 
A 1 62  ALA 62  359 359 ALA ALA A . n 
A 1 63  TRP 63  360 360 TRP TRP A . n 
A 1 64  LEU 64  361 361 LEU LEU A . n 
A 1 65  GLY 65  362 362 GLY GLY A . n 
A 1 66  ASP 66  363 363 ASP ASP A . n 
A 1 67  GLU 67  364 364 GLU GLU A . n 
A 1 68  THR 68  365 365 THR THR A . n 
A 1 69  LYS 69  366 366 LYS LYS A . n 
A 1 70  LYS 70  367 367 LYS LYS A . n 
A 1 71  LYS 71  368 368 LYS LYS A . n 
A 1 72  SER 72  369 369 SER SER A . n 
A 1 73  MET 73  370 370 MET MET A . n 
A 1 74  PHE 74  371 371 PHE PHE A . n 
A 1 75  ASP 75  372 372 ASP ASP A . n 
A 1 76  SER 76  373 373 SER SER A . n 
A 1 77  LYS 77  374 374 LYS LYS A . n 
A 1 78  ARG 78  375 375 ARG ARG A . n 
A 1 79  ALA 79  376 376 ALA ALA A . n 
A 1 80  ALA 80  377 377 ALA ALA A . n 
A 1 81  VAL 81  378 378 VAL VAL A . n 
A 1 82  ALA 82  379 379 ALA ALA A . n 
A 1 83  LEU 83  380 380 LEU LEU A . n 
A 1 84  LYS 84  381 381 LYS LYS A . n 
A 1 85  TRP 85  382 382 TRP TRP A . n 
A 1 86  LYS 86  383 383 LYS LYS A . n 
A 1 87  GLY 87  384 384 GLY GLY A . n 
A 1 88  ILE 88  385 385 ILE ILE A . n 
A 1 89  GLU 89  386 386 GLU GLU A . n 
A 1 90  LEU 90  387 387 LEU LEU A . n 
A 1 91  CYS 91  388 388 CYS CYS A . n 
A 1 92  GLY 92  389 389 GLY GLY A . n 
A 1 93  VAL 93  390 390 VAL VAL A . n 
A 1 94  SER 94  391 391 SER SER A . n 
A 1 95  PHE 95  392 392 PHE PHE A . n 
A 1 96  ASP 96  393 393 ASP ASP A . n 
A 1 97  LEU 97  394 394 LEU LEU A . n 
A 1 98  LEU 98  395 395 LEU LEU A . n 
A 1 99  LEU 99  396 396 LEU LEU A . n 
A 1 100 ALA 100 397 397 ALA ALA A . n 
A 1 101 ALA 101 398 398 ALA ALA A . n 
A 1 102 TYR 102 399 399 TYR TYR A . n 
A 1 103 LEU 103 400 400 LEU LEU A . n 
A 1 104 LEU 104 401 401 LEU LEU A . n 
A 1 105 ASP 105 402 402 ASP ASP A . n 
A 1 106 PRO 106 403 403 PRO PRO A . n 
A 1 107 ALA 107 404 404 ALA ALA A . n 
A 1 108 GLN 108 405 405 GLN GLN A . n 
A 1 109 GLY 109 406 406 GLY GLY A . n 
A 1 110 VAL 110 407 407 VAL VAL A . n 
A 1 111 ASP 111 408 408 ASP ASP A . n 
A 1 112 ASP 112 409 409 ASP ASP A . n 
A 1 113 VAL 113 410 410 VAL VAL A . n 
A 1 114 ALA 114 411 411 ALA ALA A . n 
A 1 115 ALA 115 412 412 ALA ALA A . n 
A 1 116 ALA 116 413 413 ALA ALA A . n 
A 1 117 ALA 117 414 414 ALA ALA A . n 
A 1 118 LYS 118 415 415 LYS LYS A . n 
A 1 119 MET 119 416 416 MET MET A . n 
A 1 120 LYS 120 417 417 LYS LYS A . n 
A 1 121 GLN 121 418 418 GLN GLN A . n 
A 1 122 TYR 122 419 419 TYR TYR A . n 
A 1 123 GLU 123 420 420 GLU GLU A . n 
A 1 124 ALA 124 421 421 ALA ALA A . n 
A 1 125 VAL 125 422 422 VAL VAL A . n 
A 1 126 ARG 126 423 423 ARG ARG A . n 
A 1 127 PRO 127 424 424 PRO PRO A . n 
A 1 128 ASP 128 425 425 ASP ASP A . n 
A 1 129 GLU 129 426 426 GLU GLU A . n 
A 1 130 ALA 130 427 427 ALA ALA A . n 
A 1 131 VAL 131 428 428 VAL VAL A . n 
A 1 132 TYR 132 429 429 TYR TYR A . n 
A 1 133 GLY 133 430 430 GLY GLY A . n 
A 1 134 LYS 134 431 431 LYS LYS A . n 
A 1 135 GLY 135 432 432 GLY GLY A . n 
A 1 136 ALA 136 433 433 ALA ALA A . n 
A 1 137 LYS 137 434 434 LYS LYS A . n 
A 1 138 ARG 138 435 435 ARG ARG A . n 
A 1 139 ALA 139 436 436 ALA ALA A . n 
A 1 140 VAL 140 437 437 VAL VAL A . n 
A 1 141 PRO 141 438 438 PRO PRO A . n 
A 1 142 ASP 142 439 439 ASP ASP A . n 
A 1 143 GLU 143 440 440 GLU GLU A . n 
A 1 144 PRO 144 441 441 PRO PRO A . n 
A 1 145 VAL 145 442 442 VAL VAL A . n 
A 1 146 LEU 146 443 443 LEU LEU A . n 
A 1 147 ALA 147 444 444 ALA ALA A . n 
A 1 148 GLU 148 445 445 GLU GLU A . n 
A 1 149 HIS 149 446 446 HIS HIS A . n 
A 1 150 LEU 150 447 447 LEU LEU A . n 
A 1 151 VAL 151 448 448 VAL VAL A . n 
A 1 152 ARG 152 449 449 ARG ARG A . n 
A 1 153 LYS 153 450 450 LYS LYS A . n 
A 1 154 ALA 154 451 451 ALA ALA A . n 
A 1 155 ALA 155 452 452 ALA ALA A . n 
A 1 156 ALA 156 453 453 ALA ALA A . n 
A 1 157 ILE 157 454 454 ILE ILE A . n 
A 1 158 TRP 158 455 455 TRP TRP A . n 
A 1 159 ALA 159 456 456 ALA ALA A . n 
A 1 160 LEU 160 457 457 LEU LEU A . n 
A 1 161 GLU 161 458 458 GLU GLU A . n 
A 1 162 ARG 162 459 459 ARG ARG A . n 
A 1 163 PRO 163 460 460 PRO PRO A . n 
A 1 164 PHE 164 461 461 PHE PHE A . n 
A 1 165 LEU 165 462 462 LEU LEU A . n 
A 1 166 ASP 166 463 463 ASP ASP A . n 
A 1 167 GLU 167 464 464 GLU GLU A . n 
A 1 168 LEU 168 465 465 LEU LEU A . n 
A 1 169 ARG 169 466 466 ARG ARG A . n 
A 1 170 ARG 170 467 467 ARG ARG A . n 
A 1 171 ASN 171 468 468 ASN ASN A . n 
A 1 172 GLU 172 469 469 GLU GLU A . n 
A 1 173 GLN 173 470 470 GLN GLN A . n 
A 1 174 ASP 174 471 471 ASP ASP A . n 
A 1 175 ARG 175 472 472 ARG ARG A . n 
A 1 176 LEU 176 473 473 LEU LEU A . n 
A 1 177 LEU 177 474 474 LEU LEU A . n 
A 1 178 VAL 178 475 475 VAL VAL A . n 
A 1 179 GLU 179 476 476 GLU GLU A . n 
A 1 180 LEU 180 477 477 LEU LEU A . n 
A 1 181 GLU 181 478 478 GLU GLU A . n 
A 1 182 GLN 182 479 479 GLN GLN A . n 
A 1 183 PRO 183 480 480 PRO PRO A . n 
A 1 184 LEU 184 481 481 LEU LEU A . n 
A 1 185 SER 185 482 482 SER SER A . n 
A 1 186 SER 186 483 483 SER SER A . n 
A 1 187 ILE 187 484 484 ILE ILE A . n 
A 1 188 LEU 188 485 485 LEU LEU A . n 
A 1 189 ALA 189 486 486 ALA ALA A . n 
A 1 190 GLU 190 487 487 GLU GLU A . n 
A 1 191 MET 191 488 488 MET MET A . n 
A 1 192 GLU 192 489 489 GLU GLU A . n 
A 1 193 PHE 193 490 490 PHE PHE A . n 
A 1 194 ALA 194 491 491 ALA ALA A . n 
A 1 195 GLY 195 492 492 GLY GLY A . n 
A 1 196 VAL 196 493 493 VAL VAL A . n 
A 1 197 LYS 197 494 494 LYS LYS A . n 
A 1 198 VAL 198 495 495 VAL VAL A . n 
A 1 199 ASP 199 496 496 ASP ASP A . n 
A 1 200 THR 200 497 497 THR THR A . n 
A 1 201 LYS 201 498 498 LYS LYS A . n 
A 1 202 ARG 202 499 499 ARG ARG A . n 
A 1 203 LEU 203 500 500 LEU LEU A . n 
A 1 204 GLU 204 501 501 GLU GLU A . n 
A 1 205 GLN 205 502 502 GLN GLN A . n 
A 1 206 MET 206 503 503 MET MET A . n 
A 1 207 GLY 207 504 504 GLY GLY A . n 
A 1 208 GLU 208 505 505 GLU GLU A . n 
A 1 209 GLU 209 506 506 GLU GLU A . n 
A 1 210 LEU 210 507 507 LEU LEU A . n 
A 1 211 ALA 211 508 508 ALA ALA A . n 
A 1 212 GLU 212 509 509 GLU GLU A . n 
A 1 213 GLN 213 510 510 GLN GLN A . n 
A 1 214 LEU 214 511 511 LEU LEU A . n 
A 1 215 ARG 215 512 512 ARG ARG A . n 
A 1 216 THR 216 513 513 THR THR A . n 
A 1 217 VAL 217 514 514 VAL VAL A . n 
A 1 218 GLU 218 515 515 GLU GLU A . n 
A 1 219 GLN 219 516 516 GLN GLN A . n 
A 1 220 ARG 220 517 517 ARG ARG A . n 
A 1 221 ILE 221 518 518 ILE ILE A . n 
A 1 222 TYR 222 519 519 TYR TYR A . n 
A 1 223 GLU 223 520 520 GLU GLU A . n 
A 1 224 LEU 224 521 521 LEU LEU A . n 
A 1 225 ALA 225 522 522 ALA ALA A . n 
A 1 226 GLY 226 523 523 GLY GLY A . n 
A 1 227 GLN 227 524 524 GLN GLN A . n 
A 1 228 GLU 228 525 525 GLU GLU A . n 
A 1 229 PHE 229 526 526 PHE PHE A . n 
A 1 230 ASN 230 527 527 ASN ASN A . n 
A 1 231 ILE 231 528 528 ILE ILE A . n 
A 1 232 ASN 232 529 529 ASN ASN A . n 
A 1 233 SER 233 530 530 SER SER A . n 
A 1 234 PRO 234 531 531 PRO PRO A . n 
A 1 235 LYS 235 532 532 LYS LYS A . n 
A 1 236 GLN 236 533 533 GLN GLN A . n 
A 1 237 LEU 237 534 534 LEU LEU A . n 
A 1 238 GLY 238 535 535 GLY GLY A . n 
A 1 239 VAL 239 536 536 VAL VAL A . n 
A 1 240 ILE 240 537 537 ILE ILE A . n 
A 1 241 LEU 241 538 538 LEU LEU A . n 
A 1 242 PHE 242 539 539 PHE PHE A . n 
A 1 243 GLU 243 540 540 GLU GLU A . n 
A 1 244 LYS 244 541 541 LYS LYS A . n 
A 1 245 LEU 245 542 542 LEU LEU A . n 
A 1 246 GLN 246 543 543 GLN GLN A . n 
A 1 247 LEU 247 544 544 LEU LEU A . n 
A 1 248 PRO 248 545 545 PRO PRO A . n 
A 1 249 VAL 249 546 546 VAL VAL A . n 
A 1 250 LEU 250 547 547 LEU LEU A . n 
A 1 251 LYS 251 548 548 LYS LYS A . n 
A 1 252 LYS 252 549 549 LYS LYS A . n 
A 1 253 SER 253 550 550 SER SER A . n 
A 1 254 LYS 254 551 551 LYS LYS A . n 
A 1 255 THR 255 552 552 THR THR A . n 
A 1 256 GLY 256 553 553 GLY GLY A . n 
A 1 257 TYR 257 554 554 TYR TYR A . n 
A 1 258 SER 258 555 555 SER SER A . n 
A 1 259 THR 259 556 556 THR THR A . n 
A 1 260 SER 260 557 557 SER SER A . n 
A 1 261 ALA 261 558 558 ALA ALA A . n 
A 1 262 ASP 262 559 559 ASP ASP A . n 
A 1 263 VAL 263 560 560 VAL VAL A . n 
A 1 264 LEU 264 561 561 LEU LEU A . n 
A 1 265 GLU 265 562 562 GLU GLU A . n 
A 1 266 LYS 266 563 563 LYS LYS A . n 
A 1 267 LEU 267 564 564 LEU LEU A . n 
A 1 268 ALA 268 565 565 ALA ALA A . n 
A 1 269 PRO 269 566 566 PRO PRO A . n 
A 1 270 TYR 270 567 567 TYR TYR A . n 
A 1 271 HIS 271 568 568 HIS HIS A . n 
A 1 272 GLU 272 569 569 GLU GLU A . n 
A 1 273 ILE 273 570 570 ILE ILE A . n 
A 1 274 VAL 274 571 571 VAL VAL A . n 
A 1 275 GLU 275 572 572 GLU GLU A . n 
A 1 276 ASN 276 573 573 ASN ASN A . n 
A 1 277 ILE 277 574 574 ILE ILE A . n 
A 1 278 LEU 278 575 575 LEU LEU A . n 
A 1 279 HIS 279 576 576 HIS HIS A . n 
A 1 280 TYR 280 577 577 TYR TYR A . n 
A 1 281 ARG 281 578 578 ARG ARG A . n 
A 1 282 GLN 282 579 579 GLN GLN A . n 
A 1 283 LEU 283 580 580 LEU LEU A . n 
A 1 284 GLY 284 581 581 GLY GLY A . n 
A 1 285 LYS 285 582 582 LYS LYS A . n 
A 1 286 LEU 286 583 583 LEU LEU A . n 
A 1 287 GLN 287 584 584 GLN GLN A . n 
A 1 288 SER 288 585 585 SER SER A . n 
A 1 289 THR 289 586 586 THR THR A . n 
A 1 290 TYR 290 587 587 TYR TYR A . n 
A 1 291 ILE 291 588 588 ILE ILE A . n 
A 1 292 GLU 292 589 589 GLU GLU A . n 
A 1 293 GLY 293 590 590 GLY GLY A . n 
A 1 294 LEU 294 591 591 LEU LEU A . n 
A 1 295 LEU 295 592 592 LEU LEU A . n 
A 1 296 LYS 296 593 593 LYS LYS A . n 
A 1 297 VAL 297 594 594 VAL VAL A . n 
A 1 298 VAL 298 595 595 VAL VAL A . n 
A 1 299 ARG 299 596 596 ARG ARG A . n 
A 1 300 PRO 300 597 597 PRO PRO A . n 
A 1 301 ASP 301 598 598 ASP ASP A . n 
A 1 302 THR 302 599 599 THR THR A . n 
A 1 303 LYS 303 600 600 LYS LYS A . n 
A 1 304 LYS 304 601 601 LYS LYS A . n 
A 1 305 VAL 305 602 602 VAL VAL A . n 
A 1 306 HIS 306 603 603 HIS HIS A . n 
A 1 307 THR 307 604 604 THR THR A . n 
A 1 308 ILE 308 605 605 ILE ILE A . n 
A 1 309 PHE 309 606 606 PHE PHE A . n 
A 1 310 ASN 310 607 607 ASN ASN A . n 
A 1 311 GLN 311 608 608 GLN GLN A . n 
A 1 312 ALA 312 609 609 ALA ALA A . n 
A 1 313 LEU 313 610 610 LEU LEU A . n 
A 1 314 THR 314 611 611 THR THR A . n 
A 1 315 GLN 315 612 612 GLN GLN A . n 
A 1 316 THR 316 613 613 THR THR A . n 
A 1 317 GLY 317 614 614 GLY GLY A . n 
A 1 318 ARG 318 615 615 ARG ARG A . n 
A 1 319 LEU 319 616 616 LEU LEU A . n 
A 1 320 SER 320 617 617 SER SER A . n 
A 1 321 SER 321 618 618 SER SER A . n 
A 1 322 THR 322 619 619 THR THR A . n 
A 1 323 GLU 323 620 620 GLU GLU A . n 
A 1 324 PRO 324 621 621 PRO PRO A . n 
A 1 325 ASN 325 622 622 ASN ASN A . n 
A 1 326 LEU 326 623 623 LEU LEU A . n 
A 1 327 GLN 327 624 624 GLN GLN A . n 
A 1 328 ASN 328 625 625 ASN ASN A . n 
A 1 329 ILE 329 626 626 ILE ILE A . n 
A 1 330 PRO 330 627 627 PRO PRO A . n 
A 1 331 ILE 331 628 628 ILE ILE A . n 
A 1 332 ARG 332 629 629 ARG ARG A . n 
A 1 333 LEU 333 630 630 LEU LEU A . n 
A 1 334 GLU 334 631 631 GLU GLU A . n 
A 1 335 GLU 335 632 632 GLU GLU A . n 
A 1 336 GLY 336 633 633 GLY GLY A . n 
A 1 337 ARG 337 634 634 ARG ARG A . n 
A 1 338 LYS 338 635 635 LYS LYS A . n 
A 1 339 ILE 339 636 636 ILE ILE A . n 
A 1 340 ARG 340 637 637 ARG ARG A . n 
A 1 341 GLN 341 638 638 GLN GLN A . n 
A 1 342 ALA 342 639 639 ALA ALA A . n 
A 1 343 PHE 343 640 640 PHE PHE A . n 
A 1 344 VAL 344 641 641 VAL VAL A . n 
A 1 345 PRO 345 642 642 PRO PRO A . n 
A 1 346 SER 346 643 643 SER SER A . n 
A 1 347 GLU 347 644 644 GLU GLU A . n 
A 1 348 SER 348 645 645 SER SER A . n 
A 1 349 ASP 349 646 646 ASP ASP A . n 
A 1 350 TRP 350 647 647 TRP TRP A . n 
A 1 351 LEU 351 648 648 LEU LEU A . n 
A 1 352 ILE 352 649 649 ILE ILE A . n 
A 1 353 PHE 353 650 650 PHE PHE A . n 
A 1 354 ALA 354 651 651 ALA ALA A . n 
A 1 355 ALA 355 652 652 ALA ALA A . n 
A 1 356 ASP 356 653 653 ASP ASP A . n 
A 1 357 TYR 357 654 654 TYR TYR A . n 
A 1 358 SER 358 655 655 SER SER A . n 
A 1 359 GLN 359 656 656 GLN GLN A . n 
A 1 360 ILE 360 657 657 ILE ILE A . n 
A 1 361 GLU 361 658 658 GLU GLU A . n 
A 1 362 LEU 362 659 659 LEU LEU A . n 
A 1 363 ARG 363 660 660 ARG ARG A . n 
A 1 364 VAL 364 661 661 VAL VAL A . n 
A 1 365 LEU 365 662 662 LEU LEU A . n 
A 1 366 ALA 366 663 663 ALA ALA A . n 
A 1 367 HIS 367 664 664 HIS HIS A . n 
A 1 368 ILE 368 665 665 ILE ILE A . n 
A 1 369 ALA 369 666 666 ALA ALA A . n 
A 1 370 GLU 370 667 667 GLU GLU A . n 
A 1 371 ASP 371 668 668 ASP ASP A . n 
A 1 372 ASP 372 669 669 ASP ASP A . n 
A 1 373 ASN 373 670 670 ASN ASN A . n 
A 1 374 LEU 374 671 671 LEU LEU A . n 
A 1 375 MET 375 672 672 MET MET A . n 
A 1 376 GLU 376 673 673 GLU GLU A . n 
A 1 377 ALA 377 674 674 ALA ALA A . n 
A 1 378 PHE 378 675 675 PHE PHE A . n 
A 1 379 ARG 379 676 676 ARG ARG A . n 
A 1 380 ARG 380 677 677 ARG ARG A . n 
A 1 381 ASP 381 678 678 ASP ASP A . n 
A 1 382 LEU 382 679 679 LEU LEU A . n 
A 1 383 ASP 383 680 680 ASP ASP A . n 
A 1 384 ILE 384 681 681 ILE ILE A . n 
A 1 385 HIS 385 682 682 HIS HIS A . n 
A 1 386 THR 386 683 683 THR THR A . n 
A 1 387 LYS 387 684 684 LYS LYS A . n 
A 1 388 THR 388 685 685 THR THR A . n 
A 1 389 ALA 389 686 686 ALA ALA A . n 
A 1 390 MET 390 687 687 MET MET A . n 
A 1 391 ASP 391 688 688 ASP ASP A . n 
A 1 392 ILE 392 689 689 ILE ILE A . n 
A 1 393 PHE 393 690 690 PHE PHE A . n 
A 1 394 GLN 394 691 691 GLN GLN A . n 
A 1 395 VAL 395 692 692 VAL VAL A . n 
A 1 396 SER 396 693 693 SER SER A . n 
A 1 397 GLU 397 694 694 GLU GLU A . n 
A 1 398 ASP 398 695 695 ASP ASP A . n 
A 1 399 GLU 399 696 696 GLU GLU A . n 
A 1 400 VAL 400 697 697 VAL VAL A . n 
A 1 401 THR 401 698 698 THR THR A . n 
A 1 402 PRO 402 699 699 PRO PRO A . n 
A 1 403 ASN 403 700 700 ASN ASN A . n 
A 1 404 MET 404 701 701 MET MET A . n 
A 1 405 ARG 405 702 702 ARG ARG A . n 
A 1 406 ARG 406 703 703 ARG ARG A . n 
A 1 407 GLN 407 704 704 GLN GLN A . n 
A 1 408 ALA 408 705 705 ALA ALA A . n 
A 1 409 LYS 409 706 706 LYS LYS A . n 
A 1 410 ALA 410 707 707 ALA ALA A . n 
A 1 411 VAL 411 708 708 VAL VAL A . n 
A 1 412 ASN 412 709 709 ASN ASN A . n 
A 1 413 PHE 413 710 710 PHE PHE A . n 
A 1 414 GLY 414 711 711 GLY GLY A . n 
A 1 415 ILE 415 712 712 ILE ILE A . n 
A 1 416 VAL 416 713 713 VAL VAL A . n 
A 1 417 TYR 417 714 714 TYR TYR A . n 
A 1 418 GLY 418 715 715 GLY GLY A . n 
A 1 419 ILE 419 716 716 ILE ILE A . n 
A 1 420 SER 420 717 717 SER SER A . n 
A 1 421 ASP 421 718 718 ASP ASP A . n 
A 1 422 TYR 422 719 719 TYR TYR A . n 
A 1 423 GLY 423 720 720 GLY GLY A . n 
A 1 424 LEU 424 721 721 LEU LEU A . n 
A 1 425 ALA 425 722 722 ALA ALA A . n 
A 1 426 GLN 426 723 723 GLN GLN A . n 
A 1 427 ASN 427 724 724 ASN ASN A . n 
A 1 428 LEU 428 725 725 LEU LEU A . n 
A 1 429 ASN 429 726 726 ASN ASN A . n 
A 1 430 ILE 430 727 727 ILE ILE A . n 
A 1 431 SER 431 728 728 SER SER A . n 
A 1 432 ARG 432 729 729 ARG ARG A . n 
A 1 433 LYS 433 730 730 LYS LYS A . n 
A 1 434 GLU 434 731 731 GLU GLU A . n 
A 1 435 ALA 435 732 732 ALA ALA A . n 
A 1 436 ALA 436 733 733 ALA ALA A . n 
A 1 437 GLU 437 734 734 GLU GLU A . n 
A 1 438 PHE 438 735 735 PHE PHE A . n 
A 1 439 ILE 439 736 736 ILE ILE A . n 
A 1 440 GLU 440 737 737 GLU GLU A . n 
A 1 441 ARG 441 738 738 ARG ARG A . n 
A 1 442 TYR 442 739 739 TYR TYR A . n 
A 1 443 PHE 443 740 740 PHE PHE A . n 
A 1 444 GLU 444 741 741 GLU GLU A . n 
A 1 445 SER 445 742 742 SER SER A . n 
A 1 446 PHE 446 743 743 PHE PHE A . n 
A 1 447 PRO 447 744 744 PRO PRO A . n 
A 1 448 GLY 448 745 745 GLY GLY A . n 
A 1 449 VAL 449 746 746 VAL VAL A . n 
A 1 450 LYS 450 747 747 LYS LYS A . n 
A 1 451 ARG 451 748 748 ARG ARG A . n 
A 1 452 TYR 452 749 749 TYR TYR A . n 
A 1 453 MET 453 750 750 MET MET A . n 
A 1 454 GLU 454 751 751 GLU GLU A . n 
A 1 455 ASN 455 752 752 ASN ASN A . n 
A 1 456 ILE 456 753 753 ILE ILE A . n 
A 1 457 VAL 457 754 754 VAL VAL A . n 
A 1 458 GLN 458 755 755 GLN GLN A . n 
A 1 459 GLU 459 756 756 GLU GLU A . n 
A 1 460 ALA 460 757 757 ALA ALA A . n 
A 1 461 LYS 461 758 758 LYS LYS A . n 
A 1 462 GLN 462 759 759 GLN GLN A . n 
A 1 463 LYS 463 760 760 LYS LYS A . n 
A 1 464 GLY 464 761 761 GLY GLY A . n 
A 1 465 TYR 465 762 762 TYR TYR A . n 
A 1 466 VAL 466 763 763 VAL VAL A . n 
A 1 467 THR 467 764 764 THR THR A . n 
A 1 468 THR 468 765 765 THR THR A . n 
A 1 469 LEU 469 766 766 LEU LEU A . n 
A 1 470 LEU 470 767 767 LEU LEU A . n 
A 1 471 HIS 471 768 768 HIS HIS A . n 
A 1 472 ARG 472 769 769 ARG ARG A . n 
A 1 473 ARG 473 770 770 ARG ARG A . n 
A 1 474 ARG 474 771 771 ARG ARG A . n 
A 1 475 TYR 475 772 772 TYR TYR A . n 
A 1 476 LEU 476 773 773 LEU LEU A . n 
A 1 477 PRO 477 774 774 PRO PRO A . n 
A 1 478 ASP 478 775 775 ASP ASP A . n 
A 1 479 ILE 479 776 776 ILE ILE A . n 
A 1 480 THR 480 777 777 THR THR A . n 
A 1 481 SER 481 778 778 SER SER A . n 
A 1 482 ARG 482 779 779 ARG ARG A . n 
A 1 483 ASN 483 780 780 ASN ASN A . n 
A 1 484 PHE 484 781 781 PHE PHE A . n 
A 1 485 ASN 485 782 782 ASN ASN A . n 
A 1 486 VAL 486 783 783 VAL VAL A . n 
A 1 487 ARG 487 784 784 ARG ARG A . n 
A 1 488 SER 488 785 785 SER SER A . n 
A 1 489 PHE 489 786 786 PHE PHE A . n 
A 1 490 ALA 490 787 787 ALA ALA A . n 
A 1 491 GLU 491 788 788 GLU GLU A . n 
A 1 492 ARG 492 789 789 ARG ARG A . n 
A 1 493 MET 493 790 790 MET MET A . n 
A 1 494 ALA 494 791 791 ALA ALA A . n 
A 1 495 MET 495 792 792 MET MET A . n 
A 1 496 ASN 496 793 793 ASN ASN A . n 
A 1 497 THR 497 794 794 THR THR A . n 
A 1 498 PRO 498 795 795 PRO PRO A . n 
A 1 499 ILE 499 796 796 ILE ILE A . n 
A 1 500 GLN 500 797 797 GLN GLN A . n 
A 1 501 GLY 501 798 798 GLY GLY A . n 
A 1 502 SER 502 799 799 SER SER A . n 
A 1 503 ALA 503 800 800 ALA ALA A . n 
A 1 504 ALA 504 801 801 ALA ALA A . n 
A 1 505 ASP 505 802 802 ASP ASP A . n 
A 1 506 ILE 506 803 803 ILE ILE A . n 
A 1 507 ILE 507 804 804 ILE ILE A . n 
A 1 508 LYS 508 805 805 LYS LYS A . n 
A 1 509 LYS 509 806 806 LYS LYS A . n 
A 1 510 ALA 510 807 807 ALA ALA A . n 
A 1 511 MET 511 808 808 MET MET A . n 
A 1 512 ILE 512 809 809 ILE ILE A . n 
A 1 513 ASP 513 810 810 ASP ASP A . n 
A 1 514 LEU 514 811 811 LEU LEU A . n 
A 1 515 ASN 515 812 812 ASN ASN A . n 
A 1 516 ALA 516 813 813 ALA ALA A . n 
A 1 517 ARG 517 814 814 ARG ARG A . n 
A 1 518 LEU 518 815 815 LEU LEU A . n 
A 1 519 LYS 519 816 816 LYS LYS A . n 
A 1 520 GLU 520 817 817 GLU GLU A . n 
A 1 521 GLU 521 818 818 GLU GLU A . n 
A 1 522 ARG 522 819 819 ARG ARG A . n 
A 1 523 LEU 523 820 820 LEU LEU A . n 
A 1 524 GLN 524 821 821 GLN GLN A . n 
A 1 525 ALA 525 822 822 ALA ALA A . n 
A 1 526 ARG 526 823 823 ARG ARG A . n 
A 1 527 LEU 527 824 824 LEU LEU A . n 
A 1 528 LEU 528 825 825 LEU LEU A . n 
A 1 529 LEU 529 826 826 LEU LEU A . n 
A 1 530 GLN 530 827 827 GLN GLN A . n 
A 1 531 VAL 531 828 828 VAL VAL A . n 
A 1 532 HIS 532 829 829 HIS HIS A . n 
A 1 533 ASP 533 830 830 ASP ASP A . n 
A 1 534 GLU 534 831 831 GLU GLU A . n 
A 1 535 LEU 535 832 832 LEU LEU A . n 
A 1 536 ILE 536 833 833 ILE ILE A . n 
A 1 537 LEU 537 834 834 LEU LEU A . n 
A 1 538 GLU 538 835 835 GLU GLU A . n 
A 1 539 ALA 539 836 836 ALA ALA A . n 
A 1 540 PRO 540 837 837 PRO PRO A . n 
A 1 541 LYS 541 838 838 LYS LYS A . n 
A 1 542 GLU 542 839 839 GLU GLU A . n 
A 1 543 GLU 543 840 840 GLU GLU A . n 
A 1 544 MET 544 841 841 MET MET A . n 
A 1 545 GLU 545 842 842 GLU GLU A . n 
A 1 546 ARG 546 843 843 ARG ARG A . n 
A 1 547 LEU 547 844 844 LEU LEU A . n 
A 1 548 CYS 548 845 845 CYS CYS A . n 
A 1 549 ARG 549 846 846 ARG ARG A . n 
A 1 550 LEU 550 847 847 LEU LEU A . n 
A 1 551 VAL 551 848 848 VAL VAL A . n 
A 1 552 PRO 552 849 849 PRO PRO A . n 
A 1 553 GLU 553 850 850 GLU GLU A . n 
A 1 554 VAL 554 851 851 VAL VAL A . n 
A 1 555 MET 555 852 852 MET MET A . n 
A 1 556 GLU 556 853 853 GLU GLU A . n 
A 1 557 GLN 557 854 854 GLN GLN A . n 
A 1 558 ALA 558 855 855 ALA ALA A . n 
A 1 559 VAL 559 856 856 VAL VAL A . n 
A 1 560 THR 560 857 857 THR THR A . n 
A 1 561 LEU 561 858 858 LEU LEU A . n 
A 1 562 ARG 562 859 859 ARG ARG A . n 
A 1 563 VAL 563 860 860 VAL VAL A . n 
A 1 564 PRO 564 861 861 PRO PRO A . n 
A 1 565 LEU 565 862 862 LEU LEU A . n 
A 1 566 LYS 566 863 863 LYS LYS A . n 
A 1 567 VAL 567 864 864 VAL VAL A . n 
A 1 568 ASP 568 865 865 ASP ASP A . n 
A 1 569 TYR 569 866 866 TYR TYR A . n 
A 1 570 HIS 570 867 867 HIS HIS A . n 
A 1 571 TYR 571 868 868 TYR TYR A . n 
A 1 572 GLY 572 869 869 GLY GLY A . n 
A 1 573 SER 573 870 870 SER SER A . n 
A 1 574 THR 574 871 871 THR THR A . n 
A 1 575 TRP 575 872 872 TRP TRP A . n 
A 1 576 TYR 576 873 873 TYR TYR A . n 
A 1 577 ASP 577 874 874 ASP ASP A . n 
A 1 578 ALA 578 875 875 ALA ALA A . n 
A 1 579 LYS 579 876 876 LYS LYS A . n 
B 2 1   DG  1   20  20  DG  DG  B . n 
B 2 2   DA  2   21  21  DA  DA  B . n 
B 2 3   DC  3   22  22  DC  DC  B . n 
B 2 4   DC  4   23  23  DC  DC  B . n 
B 2 5   T0T 5   24  24  T0T T0T B . n 
B 2 6   DT  6   25  25  DT  DT  B . n 
B 2 7   DC  7   26  26  DC  DC  B . n 
B 2 8   DC  8   27  27  DC  DC  B . n 
B 2 9   DC  9   28  28  DC  DC  B . n 
B 2 10  DT  10  29  29  DT  DT  B . n 
C 3 1   DA  1   4   4   DA  DA  C . n 
C 3 2   DG  2   5   5   DG  DG  C . n 
C 3 3   DG  3   6   6   DG  DG  C . n 
C 3 4   DG  4   7   7   DG  DG  C . n 
C 3 5   DA  5   8   8   DA  DA  C . n 
C 3 6   SAY 6   9   9   SAY SAY C . n 
C 3 7   DG  7   10  10  DG  DG  C . n 
C 3 8   DG  8   11  11  DG  DG  C . n 
C 3 9   DT  9   12  12  DT  DT  C . n 
C 3 10  DC  10  13  13  DC  DC  C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 5 SO4 1   878  878  SO4 SO4 A . 
F 5 SO4 1   879  879  SO4 SO4 A . 
G 5 SO4 1   880  880  SO4 SO4 A . 
H 5 SO4 1   881  881  SO4 SO4 A . 
I 6 HOH 1   2001 2001 HOH HOH A . 
I 6 HOH 2   2002 2002 HOH HOH A . 
I 6 HOH 3   2003 2003 HOH HOH A . 
I 6 HOH 4   2004 2004 HOH HOH A . 
I 6 HOH 5   2005 2005 HOH HOH A . 
I 6 HOH 6   2006 2006 HOH HOH A . 
I 6 HOH 7   2007 2007 HOH HOH A . 
I 6 HOH 8   2008 2008 HOH HOH A . 
I 6 HOH 9   2009 2009 HOH HOH A . 
I 6 HOH 10  2010 2010 HOH HOH A . 
I 6 HOH 11  2011 2011 HOH HOH A . 
I 6 HOH 12  2012 2012 HOH HOH A . 
I 6 HOH 13  2013 2013 HOH HOH A . 
I 6 HOH 14  2014 2014 HOH HOH A . 
I 6 HOH 15  2015 2015 HOH HOH A . 
I 6 HOH 16  2016 2016 HOH HOH A . 
I 6 HOH 17  2017 2017 HOH HOH A . 
I 6 HOH 18  2018 2018 HOH HOH A . 
I 6 HOH 19  2019 2019 HOH HOH A . 
I 6 HOH 20  2020 2020 HOH HOH A . 
I 6 HOH 21  2021 2021 HOH HOH A . 
I 6 HOH 22  2022 2022 HOH HOH A . 
I 6 HOH 23  2023 2023 HOH HOH A . 
I 6 HOH 24  2024 2024 HOH HOH A . 
I 6 HOH 25  2025 2025 HOH HOH A . 
I 6 HOH 26  2026 2026 HOH HOH A . 
I 6 HOH 27  2027 2027 HOH HOH A . 
I 6 HOH 28  2028 2028 HOH HOH A . 
I 6 HOH 29  2029 2029 HOH HOH A . 
I 6 HOH 30  2030 2030 HOH HOH A . 
I 6 HOH 31  2031 2031 HOH HOH A . 
I 6 HOH 32  2032 2032 HOH HOH A . 
I 6 HOH 33  2033 2033 HOH HOH A . 
I 6 HOH 34  2034 2034 HOH HOH A . 
I 6 HOH 35  2035 2035 HOH HOH A . 
I 6 HOH 36  2036 2036 HOH HOH A . 
I 6 HOH 37  2037 2037 HOH HOH A . 
I 6 HOH 38  2038 2038 HOH HOH A . 
I 6 HOH 39  2039 2039 HOH HOH A . 
I 6 HOH 40  2040 2040 HOH HOH A . 
I 6 HOH 41  2041 2041 HOH HOH A . 
I 6 HOH 42  2042 2042 HOH HOH A . 
I 6 HOH 43  2043 2043 HOH HOH A . 
I 6 HOH 44  2044 2044 HOH HOH A . 
I 6 HOH 45  2045 2045 HOH HOH A . 
I 6 HOH 46  2046 2046 HOH HOH A . 
I 6 HOH 47  2047 2047 HOH HOH A . 
I 6 HOH 48  2048 2048 HOH HOH A . 
I 6 HOH 49  2049 2049 HOH HOH A . 
I 6 HOH 50  2050 2050 HOH HOH A . 
I 6 HOH 51  2051 2051 HOH HOH A . 
I 6 HOH 52  2052 2052 HOH HOH A . 
I 6 HOH 53  2053 2053 HOH HOH A . 
I 6 HOH 54  2054 2054 HOH HOH A . 
I 6 HOH 55  2055 2055 HOH HOH A . 
I 6 HOH 56  2056 2056 HOH HOH A . 
I 6 HOH 57  2057 2057 HOH HOH A . 
I 6 HOH 58  2058 2058 HOH HOH A . 
I 6 HOH 59  2059 2059 HOH HOH A . 
I 6 HOH 60  2060 2060 HOH HOH A . 
I 6 HOH 61  2061 2061 HOH HOH A . 
I 6 HOH 62  2062 2062 HOH HOH A . 
I 6 HOH 63  2063 2063 HOH HOH A . 
I 6 HOH 64  2064 2064 HOH HOH A . 
I 6 HOH 65  2065 2065 HOH HOH A . 
I 6 HOH 66  2066 2066 HOH HOH A . 
I 6 HOH 67  2067 2067 HOH HOH A . 
I 6 HOH 68  2068 2068 HOH HOH A . 
I 6 HOH 69  2069 2069 HOH HOH A . 
I 6 HOH 70  2070 2070 HOH HOH A . 
I 6 HOH 71  2071 2071 HOH HOH A . 
I 6 HOH 72  2072 2072 HOH HOH A . 
I 6 HOH 73  2073 2073 HOH HOH A . 
I 6 HOH 74  2074 2074 HOH HOH A . 
I 6 HOH 75  2075 2075 HOH HOH A . 
I 6 HOH 76  2076 2076 HOH HOH A . 
I 6 HOH 77  2077 2077 HOH HOH A . 
I 6 HOH 78  2078 2078 HOH HOH A . 
I 6 HOH 79  2079 2079 HOH HOH A . 
I 6 HOH 80  2080 2080 HOH HOH A . 
I 6 HOH 81  2081 2081 HOH HOH A . 
I 6 HOH 82  2082 2082 HOH HOH A . 
I 6 HOH 83  2083 2083 HOH HOH A . 
I 6 HOH 84  2084 2084 HOH HOH A . 
I 6 HOH 85  2085 2085 HOH HOH A . 
I 6 HOH 86  2086 2086 HOH HOH A . 
I 6 HOH 87  2087 2087 HOH HOH A . 
I 6 HOH 88  2088 2088 HOH HOH A . 
I 6 HOH 89  2089 2089 HOH HOH A . 
I 6 HOH 90  2090 2090 HOH HOH A . 
I 6 HOH 91  2091 2091 HOH HOH A . 
I 6 HOH 92  2092 2092 HOH HOH A . 
I 6 HOH 93  2093 2093 HOH HOH A . 
I 6 HOH 94  2094 2094 HOH HOH A . 
I 6 HOH 95  2095 2095 HOH HOH A . 
I 6 HOH 96  2096 2096 HOH HOH A . 
I 6 HOH 97  2097 2097 HOH HOH A . 
I 6 HOH 98  2098 2098 HOH HOH A . 
I 6 HOH 99  2099 2099 HOH HOH A . 
I 6 HOH 100 2100 2100 HOH HOH A . 
I 6 HOH 101 2101 2101 HOH HOH A . 
I 6 HOH 102 2102 2102 HOH HOH A . 
I 6 HOH 103 2103 2103 HOH HOH A . 
I 6 HOH 104 2104 2104 HOH HOH A . 
I 6 HOH 105 2105 2105 HOH HOH A . 
I 6 HOH 106 2106 2106 HOH HOH A . 
I 6 HOH 107 2107 2107 HOH HOH A . 
I 6 HOH 108 2108 2108 HOH HOH A . 
I 6 HOH 109 2109 2109 HOH HOH A . 
I 6 HOH 110 2110 2110 HOH HOH A . 
I 6 HOH 111 2111 2111 HOH HOH A . 
I 6 HOH 112 2112 2112 HOH HOH A . 
I 6 HOH 113 2113 2113 HOH HOH A . 
I 6 HOH 114 2114 2114 HOH HOH A . 
I 6 HOH 115 2115 2115 HOH HOH A . 
I 6 HOH 116 2116 2116 HOH HOH A . 
I 6 HOH 117 2117 2117 HOH HOH A . 
I 6 HOH 118 2118 2118 HOH HOH A . 
I 6 HOH 119 2119 2119 HOH HOH A . 
I 6 HOH 120 2120 2120 HOH HOH A . 
I 6 HOH 121 2121 2121 HOH HOH A . 
I 6 HOH 122 2122 2122 HOH HOH A . 
I 6 HOH 123 2123 2123 HOH HOH A . 
I 6 HOH 124 2124 2124 HOH HOH A . 
I 6 HOH 125 2125 2125 HOH HOH A . 
I 6 HOH 126 2126 2126 HOH HOH A . 
I 6 HOH 127 2127 2127 HOH HOH A . 
I 6 HOH 128 2128 2128 HOH HOH A . 
I 6 HOH 129 2129 2129 HOH HOH A . 
I 6 HOH 130 2130 2130 HOH HOH A . 
I 6 HOH 131 2131 2131 HOH HOH A . 
I 6 HOH 132 2132 2132 HOH HOH A . 
I 6 HOH 133 2133 2133 HOH HOH A . 
I 6 HOH 134 2134 2134 HOH HOH A . 
I 6 HOH 135 2135 2135 HOH HOH A . 
I 6 HOH 136 2136 2136 HOH HOH A . 
I 6 HOH 137 2137 2137 HOH HOH A . 
I 6 HOH 138 2138 2138 HOH HOH A . 
I 6 HOH 139 2139 2139 HOH HOH A . 
I 6 HOH 140 2140 2140 HOH HOH A . 
I 6 HOH 141 2141 2141 HOH HOH A . 
I 6 HOH 142 2142 2142 HOH HOH A . 
I 6 HOH 143 2143 2143 HOH HOH A . 
I 6 HOH 144 2144 2144 HOH HOH A . 
I 6 HOH 145 2145 2145 HOH HOH A . 
I 6 HOH 146 2146 2146 HOH HOH A . 
I 6 HOH 147 2147 2147 HOH HOH A . 
I 6 HOH 148 2148 2148 HOH HOH A . 
I 6 HOH 149 2149 2149 HOH HOH A . 
I 6 HOH 150 2150 2150 HOH HOH A . 
I 6 HOH 151 2151 2151 HOH HOH A . 
I 6 HOH 152 2152 2152 HOH HOH A . 
I 6 HOH 153 2153 2153 HOH HOH A . 
I 6 HOH 154 2154 2154 HOH HOH A . 
I 6 HOH 155 2155 2155 HOH HOH A . 
I 6 HOH 156 2156 2156 HOH HOH A . 
I 6 HOH 157 2157 2157 HOH HOH A . 
I 6 HOH 158 2158 2158 HOH HOH A . 
I 6 HOH 159 2159 2159 HOH HOH A . 
I 6 HOH 160 2160 2160 HOH HOH A . 
I 6 HOH 161 2161 2161 HOH HOH A . 
I 6 HOH 162 2162 2162 HOH HOH A . 
I 6 HOH 163 2163 2163 HOH HOH A . 
I 6 HOH 164 2164 2164 HOH HOH A . 
I 6 HOH 165 2165 2165 HOH HOH A . 
I 6 HOH 166 2166 2166 HOH HOH A . 
I 6 HOH 167 2167 2167 HOH HOH A . 
I 6 HOH 168 2168 2168 HOH HOH A . 
I 6 HOH 169 2169 2169 HOH HOH A . 
I 6 HOH 170 2170 2170 HOH HOH A . 
I 6 HOH 171 2171 2171 HOH HOH A . 
I 6 HOH 172 2172 2172 HOH HOH A . 
I 6 HOH 173 2173 2173 HOH HOH A . 
I 6 HOH 174 2174 2174 HOH HOH A . 
I 6 HOH 175 2175 2175 HOH HOH A . 
I 6 HOH 176 2176 2176 HOH HOH A . 
I 6 HOH 177 2177 2177 HOH HOH A . 
I 6 HOH 178 2178 2178 HOH HOH A . 
I 6 HOH 179 2179 2179 HOH HOH A . 
I 6 HOH 180 2180 2180 HOH HOH A . 
I 6 HOH 181 2181 2181 HOH HOH A . 
I 6 HOH 182 2182 2182 HOH HOH A . 
I 6 HOH 183 2183 2183 HOH HOH A . 
I 6 HOH 184 2184 2184 HOH HOH A . 
I 6 HOH 185 2185 2185 HOH HOH A . 
I 6 HOH 186 2186 2186 HOH HOH A . 
I 6 HOH 187 2187 2187 HOH HOH A . 
I 6 HOH 188 2188 2188 HOH HOH A . 
I 6 HOH 189 2189 2189 HOH HOH A . 
I 6 HOH 190 2190 2190 HOH HOH A . 
I 6 HOH 191 2191 2191 HOH HOH A . 
I 6 HOH 192 2192 2192 HOH HOH A . 
I 6 HOH 193 2193 2193 HOH HOH A . 
I 6 HOH 194 2194 2194 HOH HOH A . 
I 6 HOH 195 2195 2195 HOH HOH A . 
I 6 HOH 196 2196 2196 HOH HOH A . 
I 6 HOH 197 2197 2197 HOH HOH A . 
I 6 HOH 198 2198 2198 HOH HOH A . 
I 6 HOH 199 2199 2199 HOH HOH A . 
I 6 HOH 200 2200 2200 HOH HOH A . 
I 6 HOH 201 2201 2201 HOH HOH A . 
I 6 HOH 202 2202 2202 HOH HOH A . 
I 6 HOH 203 2203 2203 HOH HOH A . 
I 6 HOH 204 2204 2204 HOH HOH A . 
I 6 HOH 205 2205 2205 HOH HOH A . 
J 6 HOH 1   2001 2001 HOH HOH B . 
J 6 HOH 2   2002 2002 HOH HOH B . 
J 6 HOH 3   2003 2003 HOH HOH B . 
J 6 HOH 4   2004 2004 HOH HOH B . 
K 6 HOH 1   2001 2001 HOH HOH C . 
# 
_pdbx_molecule_features.prd_id    PRD_900003 
_pdbx_molecule_features.name      sucrose 
_pdbx_molecule_features.type      Oligosaccharide 
_pdbx_molecule_features.class     Nutrient 
_pdbx_molecule_features.details   'oligosaccharide with reducing-end-to-reducing-end glycosidic bond' 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_900003 
_pdbx_molecule.asym_id       D 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5880  ? 
1 MORE         -56.7 ? 
1 'SSA (A^2)'  26930 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-12-03 
2 'Structure model' 1 1 2014-12-10 
3 'Structure model' 1 2 2015-01-28 
4 'Structure model' 1 3 2017-08-23 
5 'Structure model' 1 4 2019-02-20 
6 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 6 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Database references'     
2  2 'Structure model' Other                     
3  2 'Structure model' 'Refinement description'  
4  3 'Structure model' 'Database references'     
5  4 'Structure model' Advisory                  
6  4 'Structure model' 'Data collection'         
7  5 'Structure model' 'Data collection'         
8  5 'Structure model' 'Database references'     
9  5 'Structure model' 'Derived calculations'    
10 5 'Structure model' 'Source and taxonomy'     
11 6 'Structure model' 'Atomic model'            
12 6 'Structure model' 'Data collection'         
13 6 'Structure model' 'Derived calculations'    
14 6 'Structure model' 'Non-polymer description' 
15 6 'Structure model' Other                     
16 6 'Structure model' 'Structure summary'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  4 'Structure model' diffrn_detector               
2  4 'Structure model' pdbx_validate_polymer_linkage 
3  5 'Structure model' citation                      
4  5 'Structure model' pdbx_database_proc            
5  5 'Structure model' pdbx_entity_src_syn           
6  5 'Structure model' pdbx_seq_map_depositor_info   
7  5 'Structure model' struct_conn                   
8  6 'Structure model' atom_site                     
9  6 'Structure model' chem_comp                     
10 6 'Structure model' entity                        
11 6 'Structure model' entity_name_com               
12 6 'Structure model' pdbx_branch_scheme            
13 6 'Structure model' pdbx_chem_comp_identifier     
14 6 'Structure model' pdbx_database_status          
15 6 'Structure model' pdbx_entity_branch            
16 6 'Structure model' pdbx_entity_branch_descriptor 
17 6 'Structure model' pdbx_entity_branch_link       
18 6 'Structure model' pdbx_entity_branch_list       
19 6 'Structure model' pdbx_entity_nonpoly           
20 6 'Structure model' pdbx_molecule_features        
21 6 'Structure model' pdbx_nonpoly_scheme           
22 6 'Structure model' struct_conn                   
23 6 'Structure model' struct_site                   
24 6 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_diffrn_detector.type'                            
2  5 'Structure model' '_citation.journal_abbrev'                         
3  5 'Structure model' '_citation.journal_id_ASTM'                        
4  5 'Structure model' '_citation.journal_id_CSD'                         
5  5 'Structure model' '_citation.journal_id_ISSN'                        
6  5 'Structure model' '_citation.page_last'                              
7  5 'Structure model' '_citation.pdbx_database_id_DOI'                   
8  5 'Structure model' '_citation.title'                                  
9  5 'Structure model' '_pdbx_entity_src_syn.ncbi_taxonomy_id'            
10 5 'Structure model' '_pdbx_entity_src_syn.organism_scientific'         
11 5 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' 
12 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'              
13 6 'Structure model' '_atom_site.B_iso_or_equiv'                        
14 6 'Structure model' '_atom_site.Cartn_x'                               
15 6 'Structure model' '_atom_site.Cartn_y'                               
16 6 'Structure model' '_atom_site.Cartn_z'                               
17 6 'Structure model' '_atom_site.auth_asym_id'                          
18 6 'Structure model' '_atom_site.auth_atom_id'                          
19 6 'Structure model' '_atom_site.auth_comp_id'                          
20 6 'Structure model' '_atom_site.auth_seq_id'                           
21 6 'Structure model' '_atom_site.label_atom_id'                         
22 6 'Structure model' '_atom_site.label_comp_id'                         
23 6 'Structure model' '_atom_site.type_symbol'                           
24 6 'Structure model' '_chem_comp.formula'                               
25 6 'Structure model' '_chem_comp.formula_weight'                        
26 6 'Structure model' '_chem_comp.id'                                    
27 6 'Structure model' '_chem_comp.mon_nstd_flag'                         
28 6 'Structure model' '_chem_comp.name'                                  
29 6 'Structure model' '_chem_comp.pdbx_synonyms'                         
30 6 'Structure model' '_chem_comp.type'                                  
31 6 'Structure model' '_entity.formula_weight'                           
32 6 'Structure model' '_entity.pdbx_description'                         
33 6 'Structure model' '_entity.type'                                     
34 6 'Structure model' '_pdbx_database_status.status_code_sf'             
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
REFMAC refinement       5.8.0073 ? 1 ? ? ? ? 
XDS    'data reduction' .        ? 2 ? ? ? ? 
PHASER phasing          .        ? 3 ? ? ? ? 
# 
_pdbx_entry_details.entry_id                 4UQG 
_pdbx_entry_details.compound_details         ? 
_pdbx_entry_details.source_details           ? 
_pdbx_entry_details.nonpolymer_details       ? 
_pdbx_entry_details.sequence_details         'SYNTHETIC CONSTRUCT' 
_pdbx_entry_details.has_ligand_of_interest   ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE    A ARG 637 ? ? CZ A ARG 637 ? ? NH2 A ARG 637 ? ? 116.58 120.30 -3.72 0.50 N 
2 1 NE    A ARG 843 ? ? CZ A ARG 843 ? ? NH1 A ARG 843 ? ? 124.18 120.30 3.88  0.50 N 
3 1 NE    A ARG 843 ? ? CZ A ARG 843 ? ? NH2 A ARG 843 ? ? 114.73 120.30 -5.57 0.50 N 
4 1 NE    A ARG 859 ? ? CZ A ARG 859 ? ? NH1 A ARG 859 ? ? 123.31 120.30 3.01  0.50 N 
5 1 NE    A ARG 859 ? ? CZ A ARG 859 ? ? NH2 A ARG 859 ? ? 117.29 120.30 -3.01 0.50 N 
6 1 "O5'" B DC  27  ? ? P  B DC  27  ? ? OP2 B DC  27  ? ? 97.14  105.70 -8.56 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 402 ? ? -162.49 98.89  
2 1 ALA A 421 ? ? -86.66  44.05  
3 1 LEU A 610 ? ? -122.21 -56.97 
4 1 ILE A 628 ? ? -148.41 -26.35 
5 1 ILE A 716 ? ? 46.41   82.36  
6 1 HIS A 768 ? ? 85.63   16.89  
7 1 HIS A 829 ? ? 73.08   -54.53 
# 
_pdbx_validate_polymer_linkage.id               1 
_pdbx_validate_polymer_linkage.PDB_model_num    1 
_pdbx_validate_polymer_linkage.auth_atom_id_1   "C3'" 
_pdbx_validate_polymer_linkage.auth_asym_id_1   C 
_pdbx_validate_polymer_linkage.auth_comp_id_1   SAY 
_pdbx_validate_polymer_linkage.auth_seq_id_1    9 
_pdbx_validate_polymer_linkage.PDB_ins_code_1   ? 
_pdbx_validate_polymer_linkage.label_alt_id_1   ? 
_pdbx_validate_polymer_linkage.auth_atom_id_2   P 
_pdbx_validate_polymer_linkage.auth_asym_id_2   C 
_pdbx_validate_polymer_linkage.auth_comp_id_2   DG 
_pdbx_validate_polymer_linkage.auth_seq_id_2    10 
_pdbx_validate_polymer_linkage.PDB_ins_code_2   ? 
_pdbx_validate_polymer_linkage.label_alt_id_2   ? 
_pdbx_validate_polymer_linkage.dist             2.58 
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2104 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.07 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A LYS 298 ? CG  ? A LYS 1   CG  
2   1 Y 1 A LYS 298 ? CD  ? A LYS 1   CD  
3   1 Y 1 A LYS 298 ? CE  ? A LYS 1   CE  
4   1 Y 1 A LYS 298 ? NZ  ? A LYS 1   NZ  
5   1 Y 1 A GLU 309 ? CG  ? A GLU 12  CG  
6   1 Y 1 A GLU 309 ? CD  ? A GLU 12  CD  
7   1 Y 1 A GLU 309 ? OE1 ? A GLU 12  OE1 
8   1 Y 1 A GLU 309 ? OE2 ? A GLU 12  OE2 
9   1 Y 1 A GLU 325 ? OE1 ? A GLU 28  OE1 
10  1 Y 1 A GLU 325 ? OE2 ? A GLU 28  OE2 
11  1 Y 1 A GLU 349 ? CG  ? A GLU 52  CG  
12  1 Y 1 A GLU 349 ? CD  ? A GLU 52  CD  
13  1 Y 1 A GLU 349 ? OE1 ? A GLU 52  OE1 
14  1 Y 1 A GLU 349 ? OE2 ? A GLU 52  OE2 
15  1 Y 1 A GLU 364 ? CG  ? A GLU 67  CG  
16  1 Y 1 A GLU 364 ? CD  ? A GLU 67  CD  
17  1 Y 1 A GLU 364 ? OE1 ? A GLU 67  OE1 
18  1 Y 1 A GLU 364 ? OE2 ? A GLU 67  OE2 
19  1 Y 1 A LYS 431 ? CG  ? A LYS 134 CG  
20  1 Y 1 A LYS 431 ? CD  ? A LYS 134 CD  
21  1 Y 1 A LYS 431 ? CE  ? A LYS 134 CE  
22  1 Y 1 A LYS 431 ? NZ  ? A LYS 134 NZ  
23  1 Y 1 A LYS 434 ? CG  ? A LYS 137 CG  
24  1 Y 1 A LYS 434 ? CD  ? A LYS 137 CD  
25  1 Y 1 A LYS 434 ? CE  ? A LYS 137 CE  
26  1 Y 1 A LYS 434 ? NZ  ? A LYS 137 NZ  
27  1 Y 1 A ARG 466 ? NH1 ? A ARG 169 NH1 
28  1 Y 1 A ARG 466 ? NH2 ? A ARG 169 NH2 
29  1 Y 1 A GLU 505 ? CD  ? A GLU 208 CD  
30  1 Y 1 A GLU 505 ? OE1 ? A GLU 208 OE1 
31  1 Y 1 A GLU 505 ? OE2 ? A GLU 208 OE2 
32  1 Y 1 A ARG 512 ? NE  ? A ARG 215 NE  
33  1 Y 1 A ARG 512 ? CZ  ? A ARG 215 CZ  
34  1 Y 1 A ARG 512 ? NH1 ? A ARG 215 NH1 
35  1 Y 1 A ARG 512 ? NH2 ? A ARG 215 NH2 
36  1 Y 1 A GLU 525 ? CG  ? A GLU 228 CG  
37  1 Y 1 A GLU 525 ? CD  ? A GLU 228 CD  
38  1 Y 1 A GLU 525 ? OE1 ? A GLU 228 OE1 
39  1 Y 1 A GLU 525 ? OE2 ? A GLU 228 OE2 
40  1 Y 1 A LYS 532 ? CG  ? A LYS 235 CG  
41  1 Y 1 A LYS 532 ? CD  ? A LYS 235 CD  
42  1 Y 1 A LYS 532 ? CE  ? A LYS 235 CE  
43  1 Y 1 A LYS 532 ? NZ  ? A LYS 235 NZ  
44  1 Y 1 A LYS 548 ? CG  ? A LYS 251 CG  
45  1 Y 1 A LYS 548 ? CD  ? A LYS 251 CD  
46  1 Y 1 A LYS 548 ? CE  ? A LYS 251 CE  
47  1 Y 1 A LYS 548 ? NZ  ? A LYS 251 NZ  
48  1 Y 1 A LYS 551 ? CG  ? A LYS 254 CG  
49  1 Y 1 A LYS 551 ? CD  ? A LYS 254 CD  
50  1 Y 1 A LYS 551 ? CE  ? A LYS 254 CE  
51  1 Y 1 A LYS 551 ? NZ  ? A LYS 254 NZ  
52  1 Y 1 A LYS 593 ? CE  ? A LYS 296 CE  
53  1 Y 1 A LYS 593 ? NZ  ? A LYS 296 NZ  
54  1 Y 1 A LYS 600 ? CD  ? A LYS 303 CD  
55  1 Y 1 A LYS 600 ? CE  ? A LYS 303 CE  
56  1 Y 1 A LYS 600 ? NZ  ? A LYS 303 NZ  
57  1 Y 1 A GLU 632 ? CG  ? A GLU 335 CG  
58  1 Y 1 A GLU 632 ? CD  ? A GLU 335 CD  
59  1 Y 1 A GLU 632 ? OE1 ? A GLU 335 OE1 
60  1 Y 1 A GLU 632 ? OE2 ? A GLU 335 OE2 
61  1 Y 1 A ILE 716 ? CG1 ? A ILE 419 CG1 
62  1 Y 1 A ILE 716 ? CG2 ? A ILE 419 CG2 
63  1 Y 1 A ILE 716 ? CD1 ? A ILE 419 CD1 
64  1 Y 1 A TYR 719 ? CG  ? A TYR 422 CG  
65  1 Y 1 A TYR 719 ? CD1 ? A TYR 422 CD1 
66  1 Y 1 A TYR 719 ? CD2 ? A TYR 422 CD2 
67  1 Y 1 A TYR 719 ? CE1 ? A TYR 422 CE1 
68  1 Y 1 A TYR 719 ? CE2 ? A TYR 422 CE2 
69  1 Y 1 A TYR 719 ? CZ  ? A TYR 422 CZ  
70  1 Y 1 A TYR 719 ? OH  ? A TYR 422 OH  
71  1 Y 1 A GLN 723 ? CG  ? A GLN 426 CG  
72  1 Y 1 A GLN 723 ? CD  ? A GLN 426 CD  
73  1 Y 1 A GLN 723 ? OE1 ? A GLN 426 OE1 
74  1 Y 1 A GLN 723 ? NE2 ? A GLN 426 NE2 
75  1 Y 1 A ARG 729 ? CZ  ? A ARG 432 CZ  
76  1 Y 1 A ARG 729 ? NH1 ? A ARG 432 NH1 
77  1 Y 1 A ARG 729 ? NH2 ? A ARG 432 NH2 
78  1 Y 1 A LYS 730 ? CG  ? A LYS 433 CG  
79  1 Y 1 A LYS 730 ? CD  ? A LYS 433 CD  
80  1 Y 1 A LYS 730 ? CE  ? A LYS 433 CE  
81  1 Y 1 A LYS 730 ? NZ  ? A LYS 433 NZ  
82  1 Y 1 A GLU 734 ? CG  ? A GLU 437 CG  
83  1 Y 1 A GLU 734 ? CD  ? A GLU 437 CD  
84  1 Y 1 A GLU 734 ? OE1 ? A GLU 437 OE1 
85  1 Y 1 A GLU 734 ? OE2 ? A GLU 437 OE2 
86  1 Y 1 A GLU 737 ? CG  ? A GLU 440 CG  
87  1 Y 1 A GLU 737 ? CD  ? A GLU 440 CD  
88  1 Y 1 A GLU 737 ? OE1 ? A GLU 440 OE1 
89  1 Y 1 A GLU 737 ? OE2 ? A GLU 440 OE2 
90  1 Y 1 A ARG 738 ? NE  ? A ARG 441 NE  
91  1 Y 1 A ARG 738 ? CZ  ? A ARG 441 CZ  
92  1 Y 1 A ARG 738 ? NH1 ? A ARG 441 NH1 
93  1 Y 1 A ARG 738 ? NH2 ? A ARG 441 NH2 
94  1 Y 1 A GLU 741 ? CG  ? A GLU 444 CG  
95  1 Y 1 A GLU 741 ? CD  ? A GLU 444 CD  
96  1 Y 1 A GLU 741 ? OE1 ? A GLU 444 OE1 
97  1 Y 1 A GLU 741 ? OE2 ? A GLU 444 OE2 
98  1 Y 1 A ARG 748 ? CG  ? A ARG 451 CG  
99  1 Y 1 A ARG 748 ? CD  ? A ARG 451 CD  
100 1 Y 1 A ARG 748 ? NE  ? A ARG 451 NE  
101 1 Y 1 A ARG 748 ? CZ  ? A ARG 451 CZ  
102 1 Y 1 A ARG 748 ? NH1 ? A ARG 451 NH1 
103 1 Y 1 A ARG 748 ? NH2 ? A ARG 451 NH2 
104 1 Y 1 A GLN 755 ? CG  ? A GLN 458 CG  
105 1 Y 1 A GLN 755 ? CD  ? A GLN 458 CD  
106 1 Y 1 A GLN 755 ? OE1 ? A GLN 458 OE1 
107 1 Y 1 A GLN 755 ? NE2 ? A GLN 458 NE2 
108 1 Y 1 A LYS 758 ? CE  ? A LYS 461 CE  
109 1 Y 1 A LYS 758 ? NZ  ? A LYS 461 NZ  
110 1 Y 1 A LYS 876 ? CG  ? A LYS 579 CG  
111 1 Y 1 A LYS 876 ? CD  ? A LYS 579 CD  
112 1 Y 1 A LYS 876 ? CE  ? A LYS 579 CE  
113 1 Y 1 A LYS 876 ? NZ  ? A LYS 579 NZ  
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
4UQG 'double helix'        
4UQG 'a-form double helix' 
4UQG 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DG 1  1_555 C DC 10 1_555 -0.192 -0.278 0.194  -1.800  -12.919 3.732  1 B_DG20:DC13_C B 20 ? C 13 ? 19 1 
1 B DA 2  1_555 C DT 9  1_555 0.390  -0.013 -0.017 -6.718  -13.850 4.175  2 B_DA21:DT12_C B 21 ? C 12 ? 20 1 
1 B DC 3  1_555 C DG 8  1_555 0.116  0.041  -0.414 -0.413  -7.639  1.870  3 B_DC22:DG11_C B 22 ? C 11 ? 19 1 
1 B DC 4  1_555 C DG 7  1_555 0.424  -0.164 -0.524 10.556  -6.866  1.620  4 B_DC23:DG10_C B 23 ? C 10 ? 19 1 
1 B DT 6  1_555 C DA 5  1_555 -0.371 -0.214 -0.284 -10.416 -8.958  2.511  5 B_DT25:DA8_C  B 25 ? C 8  ? 20 1 
1 B DC 7  1_555 C DG 4  1_555 0.209  -0.276 -0.508 0.670   4.955   -1.205 6 B_DC26:DG7_C  B 26 ? C 7  ? 19 1 
1 B DC 8  1_555 C DG 3  1_555 0.248  -0.164 -0.198 9.503   -9.902  1.712  7 B_DC27:DG6_C  B 27 ? C 6  ? 19 1 
1 B DC 9  1_555 C DG 2  1_555 0.281  -0.056 -0.016 10.815  -5.596  3.803  8 B_DC28:DG5_C  B 28 ? C 5  ? 19 1 
1 B DT 10 1_555 C DA 1  1_555 -0.020 -0.132 -0.602 22.931  -6.312  3.726  9 B_DT29:DA4_C  B 29 ? C 4  ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DG 1 1_555 C DC 10 1_555 B DA 2  1_555 C DT 9 1_555 -0.138 0.098  3.470 0.130  0.462  37.109 0.088  0.236  3.470 0.726  -0.204 
37.112 1 BB_DG20DA21:DT12DC13_CC B 20 ? C 13 ? B 21 ? C 12 ? 
1 B DA 2 1_555 C DT 9  1_555 B DC 3  1_555 C DG 8 1_555 -0.405 -0.227 3.072 2.401  3.919  30.556 -1.133 1.194  2.980 7.383  -4.523 
30.892 2 BB_DA21DC22:DG11DT12_CC B 21 ? C 12 ? B 22 ? C 11 ? 
1 B DC 3 1_555 C DG 8  1_555 B DC 4  1_555 C DG 7 1_555 0.919  0.505  3.023 3.251  6.127  31.803 -0.119 -1.099 3.139 11.018 -5.846 
32.532 3 BB_DC22DC23:DG10DG11_CC B 22 ? C 11 ? B 23 ? C 10 ? 
1 B DT 6 1_555 C DA 5  1_555 B DC 7  1_555 C DG 4 1_555 -0.061 -0.364 3.228 2.083  7.989  27.863 -2.434 0.567  2.998 16.148 -4.209 
29.038 4 BB_DT25DC26:DG7DA8_CC   B 25 ? C 8  ? B 26 ? C 7  ? 
1 B DC 7 1_555 C DG 4  1_555 B DC 8  1_555 C DG 3 1_555 0.013  -0.416 3.306 -7.801 8.222  37.013 -1.640 -0.980 3.083 12.594 11.949 
38.651 5 BB_DC26DC27:DG6DG7_CC   B 26 ? C 7  ? B 27 ? C 6  ? 
1 B DC 8 1_555 C DG 3  1_555 B DC 9  1_555 C DG 2 1_555 -0.508 -1.866 3.411 -3.878 11.171 24.147 -6.709 0.161  2.381 24.884 8.639  
26.848 6 BB_DC27DC28:DG5DG6_CC   B 27 ? C 6  ? B 28 ? C 5  ? 
1 B DC 9 1_555 C DG 2  1_555 B DT 10 1_555 C DA 1 1_555 -0.295 -1.322 3.179 2.271  9.188  28.132 -4.340 1.010  2.596 18.260 -4.513 
29.651 7 BB_DC28DT29:DA4DG5_CC   B 28 ? C 5  ? B 29 ? C 4  ? 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
D 4 GLC 1 D GLC 1 A SUC 877 n 
D 4 FRU 2 D FRU 2 A SUC 877 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FRU 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DFrufb             
FRU 'COMMON NAME'                         GMML     1.0 b-D-fructofuranose 
FRU 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-Fruf           
FRU 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fru                
GLC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpa             
GLC 'COMMON NAME'                         GMML     1.0 a-D-glucopyranose  
GLC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-D-Glcp           
GLC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Glc                
# 
_pdbx_entity_branch.entity_id   4 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 4 DFrufb2-1DGlcpa                                            'Glycam Condensed Sequence' GMML       1.0   
2 4 'WURCS=2.0/2,2,1/[ha122h-2b_2-5][a2122h-1a_1-5]/1-2/a2-b1' WURCS                       PDB2Glycan 1.1.0 
3 4 '[][b-D-Fruf]{[(2+1)][a-D-Glcp]{}}'                        LINUCS                      PDB-CARE   ?     
# 
_pdbx_entity_branch_link.link_id                    1 
_pdbx_entity_branch_link.entity_id                  4 
_pdbx_entity_branch_link.entity_branch_list_num_1   1 
_pdbx_entity_branch_link.comp_id_1                  GLC 
_pdbx_entity_branch_link.atom_id_1                  C1 
_pdbx_entity_branch_link.leaving_atom_id_1          O1 
_pdbx_entity_branch_link.entity_branch_list_num_2   2 
_pdbx_entity_branch_link.comp_id_2                  FRU 
_pdbx_entity_branch_link.atom_id_2                  O2 
_pdbx_entity_branch_link.leaving_atom_id_2          HO2 
_pdbx_entity_branch_link.value_order                sing 
_pdbx_entity_branch_link.details                    ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
4 GLC 1 n 
4 FRU 2 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
5 'SULFATE ION' SO4 
6 water         HOH 
#