data_4UT2
# 
_entry.id   4UT2 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4UT2         
PDBE  EBI-61266    
WWPDB D_1290061266 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4UT3 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'X-RAY STRUCTURE OF THE HUMAN PP1 GAMMA CATALYTIC SUBUNIT TREATED WITH HYDROGEN PEROXIDE' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4UT2 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-17 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kopec, J.'     1 
'Zeh Silva, M.' 2 
'Fotinou, C.'   3 
'Steiner, R.A.' 4 
# 
_citation.id                        primary 
_citation.title                     
'Targeted Redox Inhibition of Protein Phosphatase 1 by Nox4 Regulates Eif2Alpha-Mediated Stress Signaling.' 
_citation.journal_abbrev            'Embo J.' 
_citation.journal_volume            35 
_citation.page_first                319 
_citation.page_last                 ? 
_citation.year                      2016 
_citation.journal_id_ASTM           EMJODG 
_citation.country                   UK 
_citation.journal_id_ISSN           0261-4189 
_citation.journal_id_CSD            0897 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26742780 
_citation.pdbx_database_id_DOI      10.15252/EMBJ.201592394 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Santos, C.X.'   1  
primary 'Hafstad, A.D.'  2  
primary 'Beretta, M.'    3  
primary 'Zhang, M.'      4  
primary 'Molenaar, C.'   5  
primary 'Kopec, J.'      6  
primary 'Fotinou, D.'    7  
primary 'Murray, T.V.'   8  
primary 'Cobb, A.M.'     9  
primary 'Martin, D.'     10 
primary 'Zeh Silva, M.'  11 
primary 'Anilkumar, N.'  12 
primary 'Schroder, K.'   13 
primary 'Shanahan, C.M.' 14 
primary 'Brewer, A.C.'   15 
primary 'Brandes, R.P.'  16 
primary 'Blanc, E.'      17 
primary 'Parsons, M.'    18 
primary 'Belousov, V.'   19 
primary 'Cammack, R.'    20 
primary 'Hider, R.C.'    21 
primary 'Steiner, R.A.'  22 
primary 'Shah, A.M.'     23 
# 
_cell.entry_id           4UT2 
_cell.length_a           38.550 
_cell.length_b           90.240 
_cell.length_c           91.130 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.05 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4UT2 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUBUNIT' 37078.777 2   3.1.3.16 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'                                               54.938    4   ?        ? ? ? 
3 non-polymer syn 'PHOSPHATE ION'                                                    94.971    2   ?        ? ? ? 
4 water       nat water                                                              18.015    234 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PROTEIN PHOSPHATASE 1 GAMMA ISOFORM, PP-1G, PROTEIN PHOSPHATE' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGG
FPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHE(CSO)ASINRIYGFYDECKRRYNIKLWKTFTDCF
NCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFL
HKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNY(CSO)GEFDNAGAMMSVDETLM(CSO)SFQILKPAEKKKPNATR
PVTPPRGMITKQAKK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGG
FPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLP
IAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHD
LDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQ
AKK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ASP n 
1 4   LEU n 
1 5   ASP n 
1 6   LYS n 
1 7   LEU n 
1 8   ASN n 
1 9   ILE n 
1 10  ASP n 
1 11  SER n 
1 12  ILE n 
1 13  ILE n 
1 14  GLN n 
1 15  ARG n 
1 16  LEU n 
1 17  LEU n 
1 18  GLU n 
1 19  VAL n 
1 20  ARG n 
1 21  GLY n 
1 22  SER n 
1 23  LYS n 
1 24  PRO n 
1 25  GLY n 
1 26  LYS n 
1 27  ASN n 
1 28  VAL n 
1 29  GLN n 
1 30  LEU n 
1 31  GLN n 
1 32  GLU n 
1 33  ASN n 
1 34  GLU n 
1 35  ILE n 
1 36  ARG n 
1 37  GLY n 
1 38  LEU n 
1 39  CYS n 
1 40  LEU n 
1 41  LYS n 
1 42  SER n 
1 43  ARG n 
1 44  GLU n 
1 45  ILE n 
1 46  PHE n 
1 47  LEU n 
1 48  SER n 
1 49  GLN n 
1 50  PRO n 
1 51  ILE n 
1 52  LEU n 
1 53  LEU n 
1 54  GLU n 
1 55  LEU n 
1 56  GLU n 
1 57  ALA n 
1 58  PRO n 
1 59  LEU n 
1 60  LYS n 
1 61  ILE n 
1 62  CYS n 
1 63  GLY n 
1 64  ASP n 
1 65  ILE n 
1 66  HIS n 
1 67  GLY n 
1 68  GLN n 
1 69  TYR n 
1 70  TYR n 
1 71  ASP n 
1 72  LEU n 
1 73  LEU n 
1 74  ARG n 
1 75  LEU n 
1 76  PHE n 
1 77  GLU n 
1 78  TYR n 
1 79  GLY n 
1 80  GLY n 
1 81  PHE n 
1 82  PRO n 
1 83  PRO n 
1 84  GLU n 
1 85  SER n 
1 86  ASN n 
1 87  TYR n 
1 88  LEU n 
1 89  PHE n 
1 90  LEU n 
1 91  GLY n 
1 92  ASP n 
1 93  TYR n 
1 94  VAL n 
1 95  ASP n 
1 96  ARG n 
1 97  GLY n 
1 98  LYS n 
1 99  GLN n 
1 100 SER n 
1 101 LEU n 
1 102 GLU n 
1 103 THR n 
1 104 ILE n 
1 105 CYS n 
1 106 LEU n 
1 107 LEU n 
1 108 LEU n 
1 109 ALA n 
1 110 TYR n 
1 111 LYS n 
1 112 ILE n 
1 113 LYS n 
1 114 TYR n 
1 115 PRO n 
1 116 GLU n 
1 117 ASN n 
1 118 PHE n 
1 119 PHE n 
1 120 LEU n 
1 121 LEU n 
1 122 ARG n 
1 123 GLY n 
1 124 ASN n 
1 125 HIS n 
1 126 GLU n 
1 127 CSO n 
1 128 ALA n 
1 129 SER n 
1 130 ILE n 
1 131 ASN n 
1 132 ARG n 
1 133 ILE n 
1 134 TYR n 
1 135 GLY n 
1 136 PHE n 
1 137 TYR n 
1 138 ASP n 
1 139 GLU n 
1 140 CYS n 
1 141 LYS n 
1 142 ARG n 
1 143 ARG n 
1 144 TYR n 
1 145 ASN n 
1 146 ILE n 
1 147 LYS n 
1 148 LEU n 
1 149 TRP n 
1 150 LYS n 
1 151 THR n 
1 152 PHE n 
1 153 THR n 
1 154 ASP n 
1 155 CYS n 
1 156 PHE n 
1 157 ASN n 
1 158 CYS n 
1 159 LEU n 
1 160 PRO n 
1 161 ILE n 
1 162 ALA n 
1 163 ALA n 
1 164 ILE n 
1 165 VAL n 
1 166 ASP n 
1 167 GLU n 
1 168 LYS n 
1 169 ILE n 
1 170 PHE n 
1 171 CYS n 
1 172 CYS n 
1 173 HIS n 
1 174 GLY n 
1 175 GLY n 
1 176 LEU n 
1 177 SER n 
1 178 PRO n 
1 179 ASP n 
1 180 LEU n 
1 181 GLN n 
1 182 SER n 
1 183 MET n 
1 184 GLU n 
1 185 GLN n 
1 186 ILE n 
1 187 ARG n 
1 188 ARG n 
1 189 ILE n 
1 190 MET n 
1 191 ARG n 
1 192 PRO n 
1 193 THR n 
1 194 ASP n 
1 195 VAL n 
1 196 PRO n 
1 197 ASP n 
1 198 GLN n 
1 199 GLY n 
1 200 LEU n 
1 201 LEU n 
1 202 CYS n 
1 203 ASP n 
1 204 LEU n 
1 205 LEU n 
1 206 TRP n 
1 207 SER n 
1 208 ASP n 
1 209 PRO n 
1 210 ASP n 
1 211 LYS n 
1 212 ASP n 
1 213 VAL n 
1 214 LEU n 
1 215 GLY n 
1 216 TRP n 
1 217 GLY n 
1 218 GLU n 
1 219 ASN n 
1 220 ASP n 
1 221 ARG n 
1 222 GLY n 
1 223 VAL n 
1 224 SER n 
1 225 PHE n 
1 226 THR n 
1 227 PHE n 
1 228 GLY n 
1 229 ALA n 
1 230 GLU n 
1 231 VAL n 
1 232 VAL n 
1 233 ALA n 
1 234 LYS n 
1 235 PHE n 
1 236 LEU n 
1 237 HIS n 
1 238 LYS n 
1 239 HIS n 
1 240 ASP n 
1 241 LEU n 
1 242 ASP n 
1 243 LEU n 
1 244 ILE n 
1 245 CYS n 
1 246 ARG n 
1 247 ALA n 
1 248 HIS n 
1 249 GLN n 
1 250 VAL n 
1 251 VAL n 
1 252 GLU n 
1 253 ASP n 
1 254 GLY n 
1 255 TYR n 
1 256 GLU n 
1 257 PHE n 
1 258 PHE n 
1 259 ALA n 
1 260 LYS n 
1 261 ARG n 
1 262 GLN n 
1 263 LEU n 
1 264 VAL n 
1 265 THR n 
1 266 LEU n 
1 267 PHE n 
1 268 SER n 
1 269 ALA n 
1 270 PRO n 
1 271 ASN n 
1 272 TYR n 
1 273 CSO n 
1 274 GLY n 
1 275 GLU n 
1 276 PHE n 
1 277 ASP n 
1 278 ASN n 
1 279 ALA n 
1 280 GLY n 
1 281 ALA n 
1 282 MET n 
1 283 MET n 
1 284 SER n 
1 285 VAL n 
1 286 ASP n 
1 287 GLU n 
1 288 THR n 
1 289 LEU n 
1 290 MET n 
1 291 CSO n 
1 292 SER n 
1 293 PHE n 
1 294 GLN n 
1 295 ILE n 
1 296 LEU n 
1 297 LYS n 
1 298 PRO n 
1 299 ALA n 
1 300 GLU n 
1 301 LYS n 
1 302 LYS n 
1 303 LYS n 
1 304 PRO n 
1 305 ASN n 
1 306 ALA n 
1 307 THR n 
1 308 ARG n 
1 309 PRO n 
1 310 VAL n 
1 311 THR n 
1 312 PRO n 
1 313 PRO n 
1 314 ARG n 
1 315 GLY n 
1 316 MET n 
1 317 ILE n 
1 318 THR n 
1 319 LYS n 
1 320 GLN n 
1 321 ALA n 
1 322 LYS n 
1 323 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               HUMAN 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'HOMO SAPIENS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI DH5[ALPHA]' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     668369 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PP1G_HUMAN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          P36873 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4UT2 A 1 ? 323 ? P36873 1 ? 323 ? 1 323 
2 1 4UT2 B 1 ? 323 ? P36873 1 ? 323 ? 1 323 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE              ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE             ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE           ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'      ? 'C4 H7 N O4'     133.103 
CSO 'L-peptide linking' n S-HYDROXYCYSTEINE    ? 'C3 H7 N O3 S'   137.158 
CYS 'L-peptide linking' y CYSTEINE             ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE            ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'      ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE              ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE            ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE           ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE              ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE               ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE           ? 'C5 H11 N O2 S'  149.211 
MN  non-polymer         . 'MANGANESE (II) ION' ? 'Mn 2'           54.938  
PHE 'L-peptide linking' y PHENYLALANINE        ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION'      ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE              ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE               ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE            ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN           ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE             ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE               ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4UT2 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.14 
_exptl_crystal.density_percent_sol   42.64 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;19.3 % PEG 3350, 200 MM NACL, 100 MM TRIS PH 9.0 SOAKING IN RESERVOIR ENRICHED BY 25MM ASCORBATE FOR 30 MINUTES CRYOPROTECTION 20% GLYCEROL
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 2M' 
_diffrn_detector.pdbx_collection_date   2013-02-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.920 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04-1' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04-1 
_diffrn_source.pdbx_wavelength             0.920 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4UT2 
_reflns.observed_criterion_sigma_I   -1.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             64.12 
_reflns.d_resolution_high            1.96 
_reflns.number_obs                   42357 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         94.7 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        11.70 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              4.0 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.96 
_reflns_shell.d_res_low              2.01 
_reflns_shell.percent_possible_all   95.6 
_reflns_shell.Rmerge_I_obs           0.61 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.50 
_reflns_shell.pdbx_redundancy        4.0 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4UT2 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     40219 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             64.12 
_refine.ls_d_res_high                            1.96 
_refine.ls_percent_reflns_obs                    94.25 
_refine.ls_R_factor_obs                          0.16836 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.16667 
_refine.ls_R_factor_R_free                       0.20065 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2111 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.962 
_refine.correlation_coeff_Fo_to_Fc_free          0.945 
_refine.B_iso_mean                               31.321 
_refine.aniso_B[1][1]                            -16.21 
_refine.aniso_B[2][2]                            33.48 
_refine.aniso_B[3][3]                            -17.27 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            2.22 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES REFINED INDIVIDUALLY' 
_refine.pdbx_starting_model                      'PDB ENTRY 2O8A' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.036 
_refine.pdbx_overall_ESU_R_Free                  0.030 
_refine.overall_SU_ML                            0.077 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             2.591 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4748 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         14 
_refine_hist.number_atoms_solvent             234 
_refine_hist.number_atoms_total               4996 
_refine_hist.d_res_high                       1.96 
_refine_hist.d_res_low                        64.12 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.005  0.019  ? 4870  'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 4619  'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          0.998  1.975  ? 6570  'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.757  3.000  ? 10645 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.472  5.000  ? 588   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       35.047 24.108 ? 241   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       12.835 15.000 ? 855   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       12.957 15.000 ? 32    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.062  0.200  ? 703   'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.003  0.020  ? 5467  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 1145  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.097  3.061  ? 2352  'X-RAY DIFFRACTION' ? 
r_mcbond_other               1.094  3.060  ? 2351  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.844  4.583  ? 2937  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scbond_it                  1.116  3.188  ? 2518  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_it                 ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       1.959 
_refine_ls_shell.d_res_low                        2.010 
_refine_ls_shell.number_reflns_R_work             2908 
_refine_ls_shell.R_factor_R_work                  0.238 
_refine_ls_shell.percent_reflns_obs               91.90 
_refine_ls_shell.R_factor_R_free                  0.295 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             142 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4UT2 
_struct.title                     'X-ray structure of the human PP1 gamma catalytic subunit treated with ascorbate' 
_struct.pdbx_descriptor           'SERINE/THREONINE-PROTEIN PHOSPHATASE PP1-GAMMA CATALYTIC SUBUNIT (E.C.3.1.3.16)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4UT2 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, METAL CENTER, METALLOPROTEIN, ENZYME ACTIVATION, PHOSPHOPROTEIN PHOSPHATASES' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 8   ? VAL A 19  ? ASN A 8   VAL A 19  1 ? 12 
HELX_P HELX_P2  2  GLN A 31  ? GLN A 49  ? GLN A 31  GLN A 49  1 ? 19 
HELX_P HELX_P3  3  GLN A 68  ? GLY A 80  ? GLN A 68  GLY A 80  1 ? 13 
HELX_P HELX_P4  4  GLN A 99  ? TYR A 114 ? GLN A 99  TYR A 114 1 ? 16 
HELX_P HELX_P5  5  CSO A 127 ? ARG A 132 ? CSO A 127 ARG A 132 1 ? 6  
HELX_P HELX_P6  6  GLY A 135 ? TYR A 144 ? GLY A 135 TYR A 144 1 ? 10 
HELX_P HELX_P7  7  ASN A 145 ? ASN A 157 ? ASN A 145 ASN A 157 1 ? 13 
HELX_P HELX_P8  8  SER A 182 ? ARG A 188 ? SER A 182 ARG A 188 1 ? 7  
HELX_P HELX_P9  9  GLY A 199 ? SER A 207 ? GLY A 199 SER A 207 1 ? 9  
HELX_P HELX_P10 10 GLY A 228 ? ASP A 240 ? GLY A 228 ASP A 240 1 ? 13 
HELX_P HELX_P11 11 ASN A 271 ? GLU A 275 ? ASN A 271 GLU A 275 5 ? 5  
HELX_P HELX_P12 12 ASN B 8   ? VAL B 19  ? ASN B 8   VAL B 19  1 ? 12 
HELX_P HELX_P13 13 GLN B 31  ? GLN B 49  ? GLN B 31  GLN B 49  1 ? 19 
HELX_P HELX_P14 14 GLN B 68  ? GLY B 80  ? GLN B 68  GLY B 80  1 ? 13 
HELX_P HELX_P15 15 GLN B 99  ? TYR B 114 ? GLN B 99  TYR B 114 1 ? 16 
HELX_P HELX_P16 16 CSO B 127 ? ARG B 132 ? CSO B 127 ARG B 132 1 ? 6  
HELX_P HELX_P17 17 GLY B 135 ? TYR B 144 ? GLY B 135 TYR B 144 1 ? 10 
HELX_P HELX_P18 18 ASN B 145 ? ASN B 157 ? ASN B 145 ASN B 157 1 ? 13 
HELX_P HELX_P19 19 SER B 182 ? ARG B 188 ? SER B 182 ARG B 188 1 ? 7  
HELX_P HELX_P20 20 GLY B 199 ? SER B 207 ? GLY B 199 SER B 207 1 ? 9  
HELX_P HELX_P21 21 GLY B 228 ? ASP B 240 ? GLY B 228 ASP B 240 1 ? 13 
HELX_P HELX_P22 22 ASN B 271 ? GLU B 275 ? ASN B 271 GLU B 275 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A GLU 126 C  ? ? ? 1_555 A CSO 127 N   ? ? A GLU 126 A CSO 127  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale2  covale ? ? A CSO 127 C  ? ? ? 1_555 A ALA 128 N   ? ? A CSO 127 A ALA 128  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale3  covale ? ? A TYR 272 C  ? ? ? 1_555 A CSO 273 N   ? ? A TYR 272 A CSO 273  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale4  covale ? ? A CSO 273 C  ? ? ? 1_555 A GLY 274 N   ? ? A CSO 273 A GLY 274  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale5  covale ? ? A MET 290 C  ? ? ? 1_555 A CSO 291 N   ? ? A MET 290 A CSO 291  1_555 ? ? ? ? ? ? ? 1.330 ? 
covale6  covale ? ? A CSO 291 C  ? ? ? 1_555 A SER 292 N   ? ? A CSO 291 A SER 292  1_555 ? ? ? ? ? ? ? 1.335 ? 
metalc1  metalc ? ? C MN  .   MN ? ? ? 1_555 I HOH .   O   ? ? A MN  400 A HOH 2041 1_555 ? ? ? ? ? ? ? 2.436 ? 
metalc2  metalc ? ? C MN  .   MN ? ? ? 1_555 E PO4 .   O2  ? ? A MN  400 A PO4 501  1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc3  metalc ? ? C MN  .   MN ? ? ? 1_555 A ASP 92  OD2 ? ? A MN  400 A ASP 92   1_555 ? ? ? ? ? ? ? 2.336 ? 
metalc4  metalc ? ? C MN  .   MN ? ? ? 1_555 I HOH .   O   ? ? A MN  400 A HOH 2040 1_555 ? ? ? ? ? ? ? 2.018 ? 
metalc5  metalc ? ? C MN  .   MN ? ? ? 1_555 A ASP 64  OD2 ? ? A MN  400 A ASP 64   1_555 ? ? ? ? ? ? ? 2.104 ? 
metalc6  metalc ? ? C MN  .   MN ? ? ? 1_555 A HIS 66  NE2 ? ? A MN  400 A HIS 66   1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc7  metalc ? ? D MN  .   MN ? ? ? 1_555 A ASN 124 OD1 ? ? A MN  401 A ASN 124  1_555 ? ? ? ? ? ? ? 2.151 ? 
metalc8  metalc ? ? D MN  .   MN ? ? ? 1_555 A HIS 173 NE2 ? ? A MN  401 A HIS 173  1_555 ? ? ? ? ? ? ? 2.360 ? 
metalc9  metalc ? ? D MN  .   MN ? ? ? 1_555 A HIS 248 ND1 ? ? A MN  401 A HIS 248  1_555 ? ? ? ? ? ? ? 2.179 ? 
metalc10 metalc ? ? D MN  .   MN ? ? ? 1_555 A ASP 92  OD2 ? ? A MN  401 A ASP 92   1_555 ? ? ? ? ? ? ? 2.311 ? 
metalc11 metalc ? ? D MN  .   MN ? ? ? 1_555 E PO4 .   O3  ? ? A MN  401 A PO4 501  1_555 ? ? ? ? ? ? ? 2.044 ? 
metalc12 metalc ? ? D MN  .   MN ? ? ? 1_555 I HOH .   O   ? ? A MN  401 A HOH 2040 1_555 ? ? ? ? ? ? ? 2.064 ? 
covale7  covale ? ? B GLU 126 C  ? ? ? 1_555 B CSO 127 N   ? ? B GLU 126 B CSO 127  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale8  covale ? ? B CSO 127 C  ? ? ? 1_555 B ALA 128 N   ? ? B CSO 127 B ALA 128  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale9  covale ? ? B TYR 272 C  ? ? ? 1_555 B CSO 273 N   ? ? B TYR 272 B CSO 273  1_555 ? ? ? ? ? ? ? 1.335 ? 
covale10 covale ? ? B CSO 273 C  ? ? ? 1_555 B GLY 274 N   ? ? B CSO 273 B GLY 274  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale11 covale ? ? B MET 290 C  ? ? ? 1_555 B CSO 291 N   ? ? B MET 290 B CSO 291  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale12 covale ? ? B CSO 291 C  ? ? ? 1_555 B SER 292 N   ? ? B CSO 291 B SER 292  1_555 ? ? ? ? ? ? ? 1.334 ? 
metalc13 metalc ? ? F MN  .   MN ? ? ? 1_555 J HOH .   O   ? ? B MN  400 B HOH 2039 1_555 ? ? ? ? ? ? ? 2.071 ? 
metalc14 metalc ? ? F MN  .   MN ? ? ? 1_555 J HOH .   O   ? ? B MN  400 B HOH 2038 1_555 ? ? ? ? ? ? ? 1.986 ? 
metalc15 metalc ? ? F MN  .   MN ? ? ? 1_555 H PO4 .   O4  ? ? B MN  400 B PO4 501  1_555 ? ? ? ? ? ? ? 2.354 ? 
metalc16 metalc ? ? F MN  .   MN ? ? ? 1_555 B ASP 92  OD2 ? ? B MN  400 B ASP 92   1_555 ? ? ? ? ? ? ? 2.486 ? 
metalc17 metalc ? ? F MN  .   MN ? ? ? 1_555 B HIS 66  NE2 ? ? B MN  400 B HIS 66   1_555 ? ? ? ? ? ? ? 2.356 ? 
metalc18 metalc ? ? F MN  .   MN ? ? ? 1_555 B ASP 64  OD2 ? ? B MN  400 B ASP 64   1_555 ? ? ? ? ? ? ? 2.084 ? 
metalc19 metalc ? ? G MN  .   MN ? ? ? 1_555 B HIS 173 NE2 ? ? B MN  401 B HIS 173  1_555 ? ? ? ? ? ? ? 2.189 ? 
metalc20 metalc ? ? G MN  .   MN ? ? ? 1_555 J HOH .   O   ? ? B MN  401 B HOH 2038 1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc21 metalc ? ? G MN  .   MN ? ? ? 1_555 B ASP 92  OD2 ? ? B MN  401 B ASP 92   1_555 ? ? ? ? ? ? ? 2.231 ? 
metalc22 metalc ? ? G MN  .   MN ? ? ? 1_555 B HIS 248 ND1 ? ? B MN  401 B HIS 248  1_555 ? ? ? ? ? ? ? 2.234 ? 
metalc23 metalc ? ? G MN  .   MN ? ? ? 1_555 H PO4 .   O1  ? ? B MN  401 B PO4 501  1_555 ? ? ? ? ? ? ? 2.479 ? 
metalc24 metalc ? ? G MN  .   MN ? ? ? 1_555 B ASN 124 OD1 ? ? B MN  401 B ASN 124  1_555 ? ? ? ? ? ? ? 2.101 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ALA 57  A . ? ALA 57  A PRO 58  A ? PRO 58  A 1 4.95  
2 PRO 82  A . ? PRO 82  A PRO 83  A ? PRO 83  A 1 5.35  
3 ARG 191 A . ? ARG 191 A PRO 192 A ? PRO 192 A 1 -2.09 
4 ALA 57  B . ? ALA 57  B PRO 58  B ? PRO 58  B 1 5.07  
5 PRO 82  B . ? PRO 82  B PRO 83  B ? PRO 83  B 1 5.78  
6 ARG 191 B . ? ARG 191 B PRO 192 B ? PRO 192 B 1 -0.71 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 6 ? 
AB ? 5 ? 
AC ? 3 ? 
BA ? 6 ? 
BB ? 5 ? 
BC ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? parallel      
AA 2 3 ? anti-parallel 
AA 3 4 ? parallel      
AA 4 5 ? parallel      
AA 5 6 ? anti-parallel 
AB 1 2 ? parallel      
AB 2 3 ? parallel      
AB 3 4 ? anti-parallel 
AB 4 5 ? anti-parallel 
AC 1 2 ? parallel      
AC 2 3 ? anti-parallel 
BA 1 2 ? parallel      
BA 2 3 ? anti-parallel 
BA 3 4 ? parallel      
BA 4 5 ? parallel      
BA 5 6 ? anti-parallel 
BB 1 2 ? parallel      
BB 2 3 ? parallel      
BB 3 4 ? anti-parallel 
BB 4 5 ? anti-parallel 
BC 1 2 ? parallel      
BC 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 52  ? LEU A 55  ? LEU A 52  LEU A 55  
AA 2 ALA A 162 ? VAL A 165 ? ALA A 162 VAL A 165 
AA 3 ILE A 169 ? CYS A 171 ? ILE A 169 CYS A 171 
AA 4 LEU A 243 ? ARG A 246 ? LEU A 243 ARG A 246 
AA 5 LEU A 263 ? LEU A 266 ? LEU A 263 LEU A 266 
AA 6 TYR A 255 ? PHE A 258 ? TYR A 255 PHE A 258 
AB 1 PHE A 118 ? LEU A 120 ? PHE A 118 LEU A 120 
AB 2 TYR A 87  ? PHE A 89  ? TYR A 87  PHE A 89  
AB 3 LEU A 59  ? CYS A 62  ? LEU A 59  CYS A 62  
AB 4 GLY A 280 ? VAL A 285 ? GLY A 280 VAL A 285 
AB 5 CSO A 291 ? LEU A 296 ? CSO A 291 LEU A 296 
AC 1 ASP A 208 ? PRO A 209 ? ASP A 208 PRO A 209 
AC 2 PHE A 225 ? PHE A 227 ? PHE A 225 PHE A 227 
AC 3 TRP A 216 ? GLU A 218 ? TRP A 216 GLU A 218 
BA 1 LEU B 52  ? LEU B 55  ? LEU B 52  LEU B 55  
BA 2 ALA B 162 ? VAL B 165 ? ALA B 162 VAL B 165 
BA 3 ILE B 169 ? CYS B 171 ? ILE B 169 CYS B 171 
BA 4 LEU B 243 ? ARG B 246 ? LEU B 243 ARG B 246 
BA 5 LEU B 263 ? LEU B 266 ? LEU B 263 LEU B 266 
BA 6 TYR B 255 ? PHE B 258 ? TYR B 255 PHE B 258 
BB 1 PHE B 118 ? LEU B 120 ? PHE B 118 LEU B 120 
BB 2 TYR B 87  ? PHE B 89  ? TYR B 87  PHE B 89  
BB 3 LEU B 59  ? CYS B 62  ? LEU B 59  CYS B 62  
BB 4 GLY B 280 ? VAL B 285 ? GLY B 280 VAL B 285 
BB 5 CSO B 291 ? LEU B 296 ? CSO B 291 LEU B 296 
BC 1 ASP B 208 ? PRO B 209 ? ASP B 208 PRO B 209 
BC 2 PHE B 225 ? PHE B 227 ? PHE B 225 PHE B 227 
BC 3 TRP B 216 ? GLU B 218 ? TRP B 216 GLU B 218 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LEU A 53  ? N LEU A 53  O ALA A 162 ? O ALA A 162 
AA 2 3 N VAL A 165 ? N VAL A 165 O ILE A 169 ? O ILE A 169 
AA 3 4 N PHE A 170 ? N PHE A 170 O LEU A 243 ? O LEU A 243 
AA 4 5 N ARG A 246 ? N ARG A 246 O VAL A 264 ? O VAL A 264 
AA 5 6 N THR A 265 ? N THR A 265 O GLU A 256 ? O GLU A 256 
AB 1 2 N PHE A 119 ? N PHE A 119 O TYR A 87  ? O TYR A 87  
AB 2 3 N LEU A 88  ? N LEU A 88  O LYS A 60  ? O LYS A 60  
AB 3 4 N ILE A 61  ? N ILE A 61  O MET A 283 ? O MET A 283 
AB 4 5 N SER A 284 ? N SER A 284 O SER A 292 ? O SER A 292 
AC 1 2 N ASP A 208 ? N ASP A 208 O PHE A 225 ? O PHE A 225 
AC 2 3 N THR A 226 ? N THR A 226 O GLY A 217 ? O GLY A 217 
BA 1 2 N LEU B 53  ? N LEU B 53  O ALA B 162 ? O ALA B 162 
BA 2 3 N VAL B 165 ? N VAL B 165 O ILE B 169 ? O ILE B 169 
BA 3 4 N PHE B 170 ? N PHE B 170 O LEU B 243 ? O LEU B 243 
BA 4 5 N ARG B 246 ? N ARG B 246 O VAL B 264 ? O VAL B 264 
BA 5 6 N THR B 265 ? N THR B 265 O GLU B 256 ? O GLU B 256 
BB 1 2 N PHE B 119 ? N PHE B 119 O TYR B 87  ? O TYR B 87  
BB 2 3 N LEU B 88  ? N LEU B 88  O LYS B 60  ? O LYS B 60  
BB 3 4 N ILE B 61  ? N ILE B 61  O MET B 283 ? O MET B 283 
BB 4 5 N SER B 284 ? N SER B 284 O SER B 292 ? O SER B 292 
BC 1 2 N ASP B 208 ? N ASP B 208 O PHE B 225 ? O PHE B 225 
BC 2 3 N THR B 226 ? N THR B 226 O GLY B 217 ? O GLY B 217 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MN A 400'  
AC2 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MN A 401'  
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PO4 A 501' 
AC4 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MN B 400'  
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE MN B 401'  
AC6 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE PO4 B 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 7  ASP A 64  ? ASP A 64   . ? 1_555 ? 
2  AC1 7  HIS A 66  ? HIS A 66   . ? 1_555 ? 
3  AC1 7  ASP A 92  ? ASP A 92   . ? 1_555 ? 
4  AC1 7  MN  D .   ? MN  A 401  . ? 1_555 ? 
5  AC1 7  PO4 E .   ? PO4 A 501  . ? 1_555 ? 
6  AC1 7  HOH I .   ? HOH A 2040 . ? 1_555 ? 
7  AC1 7  HOH I .   ? HOH A 2041 . ? 1_555 ? 
8  AC2 7  ASP A 92  ? ASP A 92   . ? 1_555 ? 
9  AC2 7  ASN A 124 ? ASN A 124  . ? 1_555 ? 
10 AC2 7  HIS A 173 ? HIS A 173  . ? 1_555 ? 
11 AC2 7  HIS A 248 ? HIS A 248  . ? 1_555 ? 
12 AC2 7  MN  C .   ? MN  A 400  . ? 1_555 ? 
13 AC2 7  PO4 E .   ? PO4 A 501  . ? 1_555 ? 
14 AC2 7  HOH I .   ? HOH A 2040 . ? 1_555 ? 
15 AC3 13 HIS A 66  ? HIS A 66   . ? 1_555 ? 
16 AC3 13 ASP A 92  ? ASP A 92   . ? 1_555 ? 
17 AC3 13 ARG A 96  ? ARG A 96   . ? 1_555 ? 
18 AC3 13 ASN A 124 ? ASN A 124  . ? 1_555 ? 
19 AC3 13 HIS A 125 ? HIS A 125  . ? 1_555 ? 
20 AC3 13 ARG A 221 ? ARG A 221  . ? 1_555 ? 
21 AC3 13 HIS A 248 ? HIS A 248  . ? 1_555 ? 
22 AC3 13 MN  C .   ? MN  A 400  . ? 1_555 ? 
23 AC3 13 MN  D .   ? MN  A 401  . ? 1_555 ? 
24 AC3 13 HOH I .   ? HOH A 2040 . ? 1_555 ? 
25 AC3 13 HOH I .   ? HOH A 2041 . ? 1_555 ? 
26 AC3 13 HOH I .   ? HOH A 2116 . ? 1_555 ? 
27 AC3 13 HOH I .   ? HOH A 2132 . ? 1_555 ? 
28 AC4 7  ASP B 64  ? ASP B 64   . ? 1_555 ? 
29 AC4 7  HIS B 66  ? HIS B 66   . ? 1_555 ? 
30 AC4 7  ASP B 92  ? ASP B 92   . ? 1_555 ? 
31 AC4 7  MN  G .   ? MN  B 401  . ? 1_555 ? 
32 AC4 7  PO4 H .   ? PO4 B 501  . ? 1_555 ? 
33 AC4 7  HOH J .   ? HOH B 2038 . ? 1_555 ? 
34 AC4 7  HOH J .   ? HOH B 2039 . ? 1_555 ? 
35 AC5 7  ASP B 92  ? ASP B 92   . ? 1_555 ? 
36 AC5 7  ASN B 124 ? ASN B 124  . ? 1_555 ? 
37 AC5 7  HIS B 173 ? HIS B 173  . ? 1_555 ? 
38 AC5 7  HIS B 248 ? HIS B 248  . ? 1_555 ? 
39 AC5 7  MN  F .   ? MN  B 400  . ? 1_555 ? 
40 AC5 7  PO4 H .   ? PO4 B 501  . ? 1_555 ? 
41 AC5 7  HOH J .   ? HOH B 2038 . ? 1_555 ? 
42 AC6 13 HIS B 66  ? HIS B 66   . ? 1_555 ? 
43 AC6 13 ASP B 92  ? ASP B 92   . ? 1_555 ? 
44 AC6 13 ARG B 96  ? ARG B 96   . ? 1_555 ? 
45 AC6 13 ASN B 124 ? ASN B 124  . ? 1_555 ? 
46 AC6 13 HIS B 125 ? HIS B 125  . ? 1_555 ? 
47 AC6 13 ARG B 221 ? ARG B 221  . ? 1_555 ? 
48 AC6 13 HIS B 248 ? HIS B 248  . ? 1_555 ? 
49 AC6 13 MN  F .   ? MN  B 400  . ? 1_555 ? 
50 AC6 13 MN  G .   ? MN  B 401  . ? 1_555 ? 
51 AC6 13 HOH J .   ? HOH B 2038 . ? 1_555 ? 
52 AC6 13 HOH J .   ? HOH B 2039 . ? 1_555 ? 
53 AC6 13 HOH J .   ? HOH B 2090 . ? 1_555 ? 
54 AC6 13 HOH J .   ? HOH B 2101 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4UT2 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4UT2 
_atom_sites.fract_transf_matrix[1][1]   0.025940 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000023 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011082 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010973 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . LYS A 1 6   ? 34.240 26.094  105.077 1.00 61.25 ? 6    LYS A N   1 
ATOM   2    C  CA  . LYS A 1 6   ? 34.176 25.930  106.561 1.00 60.84 ? 6    LYS A CA  1 
ATOM   3    C  C   . LYS A 1 6   ? 35.297 25.032  107.085 1.00 58.79 ? 6    LYS A C   1 
ATOM   4    O  O   . LYS A 1 6   ? 35.925 25.344  108.097 1.00 60.14 ? 6    LYS A O   1 
ATOM   5    C  CB  . LYS A 1 6   ? 32.817 25.358  106.976 1.00 62.00 ? 6    LYS A CB  1 
ATOM   6    C  CG  . LYS A 1 6   ? 32.524 25.464  108.464 1.00 62.88 ? 6    LYS A CG  1 
ATOM   7    C  CD  . LYS A 1 6   ? 31.152 24.903  108.803 1.00 63.65 ? 6    LYS A CD  1 
ATOM   8    C  CE  . LYS A 1 6   ? 30.862 25.014  110.290 1.00 63.50 ? 6    LYS A CE  1 
ATOM   9    N  NZ  . LYS A 1 6   ? 29.538 24.436  110.648 1.00 62.89 ? 6    LYS A NZ  1 
ATOM   10   N  N   . LEU A 1 7   ? 35.545 23.925  106.387 1.00 56.55 ? 7    LEU A N   1 
ATOM   11   C  CA  . LEU A 1 7   ? 36.509 22.920  106.834 1.00 52.30 ? 7    LEU A CA  1 
ATOM   12   C  C   . LEU A 1 7   ? 37.947 23.312  106.486 1.00 49.31 ? 7    LEU A C   1 
ATOM   13   O  O   . LEU A 1 7   ? 38.301 23.426  105.312 1.00 48.23 ? 7    LEU A O   1 
ATOM   14   C  CB  . LEU A 1 7   ? 36.164 21.562  106.213 1.00 51.93 ? 7    LEU A CB  1 
ATOM   15   C  CG  . LEU A 1 7   ? 36.891 20.320  106.732 1.00 51.38 ? 7    LEU A CG  1 
ATOM   16   C  CD1 . LEU A 1 7   ? 36.776 20.192  108.243 1.00 51.91 ? 7    LEU A CD1 1 
ATOM   17   C  CD2 . LEU A 1 7   ? 36.333 19.082  106.045 1.00 51.32 ? 7    LEU A CD2 1 
ATOM   18   N  N   . ASN A 1 8   ? 38.768 23.512  107.514 1.00 45.57 ? 8    ASN A N   1 
ATOM   19   C  CA  . ASN A 1 8   ? 40.170 23.876  107.334 1.00 43.94 ? 8    ASN A CA  1 
ATOM   20   C  C   . ASN A 1 8   ? 41.039 22.623  107.200 1.00 42.43 ? 8    ASN A C   1 
ATOM   21   O  O   . ASN A 1 8   ? 41.598 22.135  108.182 1.00 42.27 ? 8    ASN A O   1 
ATOM   22   C  CB  . ASN A 1 8   ? 40.638 24.744  108.507 1.00 44.39 ? 8    ASN A CB  1 
ATOM   23   C  CG  . ASN A 1 8   ? 41.967 25.434  108.240 1.00 45.05 ? 8    ASN A CG  1 
ATOM   24   O  OD1 . ASN A 1 8   ? 42.739 25.030  107.369 1.00 44.91 ? 8    ASN A OD1 1 
ATOM   25   N  ND2 . ASN A 1 8   ? 42.238 26.489  108.998 1.00 46.07 ? 8    ASN A ND2 1 
ATOM   26   N  N   . ILE A 1 9   ? 41.156 22.121  105.972 1.00 40.95 ? 9    ILE A N   1 
ATOM   27   C  CA  . ILE A 1 9   ? 41.848 20.860  105.704 1.00 40.27 ? 9    ILE A CA  1 
ATOM   28   C  C   . ILE A 1 9   ? 43.350 20.961  105.982 1.00 38.31 ? 9    ILE A C   1 
ATOM   29   O  O   . ILE A 1 9   ? 43.938 20.041  106.554 1.00 36.90 ? 9    ILE A O   1 
ATOM   30   C  CB  . ILE A 1 9   ? 41.612 20.380  104.248 1.00 41.18 ? 9    ILE A CB  1 
ATOM   31   C  CG1 . ILE A 1 9   ? 40.132 20.051  104.012 1.00 41.93 ? 9    ILE A CG1 1 
ATOM   32   C  CG2 . ILE A 1 9   ? 42.468 19.161  103.921 1.00 40.54 ? 9    ILE A CG2 1 
ATOM   33   C  CD1 . ILE A 1 9   ? 39.640 18.786  104.692 1.00 42.23 ? 9    ILE A CD1 1 
ATOM   34   N  N   . ASP A 1 10  ? 43.963 22.075  105.592 1.00 37.31 ? 10   ASP A N   1 
ATOM   35   C  CA  . ASP A 1 10  ? 45.397 22.274  105.807 1.00 36.75 ? 10   ASP A CA  1 
ATOM   36   C  C   . ASP A 1 10  ? 45.767 22.206  107.284 1.00 35.68 ? 10   ASP A C   1 
ATOM   37   O  O   . ASP A 1 10  ? 46.770 21.595  107.649 1.00 33.94 ? 10   ASP A O   1 
ATOM   38   C  CB  . ASP A 1 10  ? 45.855 23.613  105.224 1.00 38.33 ? 10   ASP A CB  1 
ATOM   39   C  CG  . ASP A 1 10  ? 45.777 23.653  103.712 1.00 39.76 ? 10   ASP A CG  1 
ATOM   40   O  OD1 . ASP A 1 10  ? 45.736 22.577  103.076 1.00 41.21 ? 10   ASP A OD1 1 
ATOM   41   O  OD2 . ASP A 1 10  ? 45.766 24.768  103.153 1.00 42.19 ? 10   ASP A OD2 1 
ATOM   42   N  N   . SER A 1 11  ? 44.957 22.843  108.123 1.00 35.36 ? 11   SER A N   1 
ATOM   43   C  CA  . SER A 1 11  ? 45.168 22.829  109.568 1.00 35.73 ? 11   SER A CA  1 
ATOM   44   C  C   . SER A 1 11  ? 45.017 21.416  110.132 1.00 34.92 ? 11   SER A C   1 
ATOM   45   O  O   . SER A 1 11  ? 45.811 20.991  110.970 1.00 37.07 ? 11   SER A O   1 
ATOM   46   C  CB  . SER A 1 11  ? 44.183 23.775  110.255 1.00 36.03 ? 11   SER A CB  1 
ATOM   47   O  OG  . SER A 1 11  ? 44.317 23.722  111.662 1.00 36.87 ? 11   SER A OG  1 
ATOM   48   N  N   . ILE A 1 12  ? 43.994 20.703  109.664 1.00 34.21 ? 12   ILE A N   1 
ATOM   49   C  CA  . ILE A 1 12  ? 43.725 19.332  110.102 1.00 33.62 ? 12   ILE A CA  1 
ATOM   50   C  C   . ILE A 1 12  ? 44.908 18.412  109.764 1.00 32.40 ? 12   ILE A C   1 
ATOM   51   O  O   . ILE A 1 12  ? 45.373 17.660  110.616 1.00 30.90 ? 12   ILE A O   1 
ATOM   52   C  CB  . ILE A 1 12  ? 42.411 18.793  109.485 1.00 33.96 ? 12   ILE A CB  1 
ATOM   53   C  CG1 . ILE A 1 12  ? 41.202 19.496  110.118 1.00 34.50 ? 12   ILE A CG1 1 
ATOM   54   C  CG2 . ILE A 1 12  ? 42.287 17.287  109.686 1.00 34.17 ? 12   ILE A CG2 1 
ATOM   55   C  CD1 . ILE A 1 12  ? 39.907 19.332  109.352 1.00 34.40 ? 12   ILE A CD1 1 
ATOM   56   N  N   . ILE A 1 13  ? 45.388 18.483  108.525 1.00 31.46 ? 13   ILE A N   1 
ATOM   57   C  CA  . ILE A 1 13  ? 46.511 17.651  108.082 1.00 31.46 ? 13   ILE A CA  1 
ATOM   58   C  C   . ILE A 1 13  ? 47.790 17.985  108.850 1.00 31.68 ? 13   ILE A C   1 
ATOM   59   O  O   . ILE A 1 13  ? 48.550 17.089  109.225 1.00 30.39 ? 13   ILE A O   1 
ATOM   60   C  CB  . ILE A 1 13  ? 46.766 17.793  106.562 1.00 31.00 ? 13   ILE A CB  1 
ATOM   61   C  CG1 . ILE A 1 13  ? 45.605 17.178  105.777 1.00 31.17 ? 13   ILE A CG1 1 
ATOM   62   C  CG2 . ILE A 1 13  ? 48.076 17.116  106.167 1.00 31.02 ? 13   ILE A CG2 1 
ATOM   63   C  CD1 . ILE A 1 13  ? 45.631 17.464  104.290 1.00 31.88 ? 13   ILE A CD1 1 
ATOM   64   N  N   . GLN A 1 14  ? 48.021 19.274  109.084 1.00 32.89 ? 14   GLN A N   1 
ATOM   65   C  CA  . GLN A 1 14  ? 49.210 19.724  109.807 1.00 34.86 ? 14   GLN A CA  1 
ATOM   66   C  C   . GLN A 1 14  ? 49.247 19.153  111.229 1.00 33.92 ? 14   GLN A C   1 
ATOM   67   O  O   . GLN A 1 14  ? 50.284 18.677  111.687 1.00 33.88 ? 14   GLN A O   1 
ATOM   68   C  CB  . GLN A 1 14  ? 49.273 21.260  109.818 1.00 36.71 ? 14   GLN A CB  1 
ATOM   69   C  CG  . GLN A 1 14  ? 50.452 21.851  110.585 1.00 38.76 ? 14   GLN A CG  1 
ATOM   70   C  CD  . GLN A 1 14  ? 50.142 22.092  112.055 1.00 39.97 ? 14   GLN A CD  1 
ATOM   71   O  OE1 . GLN A 1 14  ? 50.809 21.549  112.939 1.00 42.32 ? 14   GLN A OE1 1 
ATOM   72   N  NE2 . GLN A 1 14  ? 49.116 22.897  112.322 1.00 40.90 ? 14   GLN A NE2 1 
ATOM   73   N  N   . ARG A 1 15  ? 48.115 19.194  111.925 1.00 34.37 ? 15   ARG A N   1 
ATOM   74   C  CA  . ARG A 1 15  ? 48.052 18.645  113.280 1.00 33.18 ? 15   ARG A CA  1 
ATOM   75   C  C   . ARG A 1 15  ? 48.228 17.126  113.266 1.00 31.82 ? 15   ARG A C   1 
ATOM   76   O  O   . ARG A 1 15  ? 48.921 16.573  114.115 1.00 30.97 ? 15   ARG A O   1 
ATOM   77   C  CB  . ARG A 1 15  ? 46.753 19.043  113.979 1.00 34.42 ? 15   ARG A CB  1 
ATOM   78   C  CG  . ARG A 1 15  ? 46.827 20.396  114.669 1.00 35.35 ? 15   ARG A CG  1 
ATOM   79   C  CD  . ARG A 1 15  ? 45.456 20.826  115.156 1.00 36.16 ? 15   ARG A CD  1 
ATOM   80   N  NE  . ARG A 1 15  ? 44.602 21.207  114.035 1.00 37.03 ? 15   ARG A NE  1 
ATOM   81   C  CZ  . ARG A 1 15  ? 43.273 21.129  114.017 1.00 36.44 ? 15   ARG A CZ  1 
ATOM   82   N  NH1 . ARG A 1 15  ? 42.592 20.675  115.066 1.00 37.37 ? 15   ARG A NH1 1 
ATOM   83   N  NH2 . ARG A 1 15  ? 42.619 21.505  112.926 1.00 36.72 ? 15   ARG A NH2 1 
ATOM   84   N  N   . LEU A 1 16  ? 47.620 16.458  112.288 1.00 30.96 ? 16   LEU A N   1 
ATOM   85   C  CA  . LEU A 1 16  ? 47.792 15.012  112.136 1.00 29.99 ? 16   LEU A CA  1 
ATOM   86   C  C   . LEU A 1 16  ? 49.258 14.649  111.878 1.00 30.31 ? 16   LEU A C   1 
ATOM   87   O  O   . LEU A 1 16  ? 49.761 13.674  112.434 1.00 31.16 ? 16   LEU A O   1 
ATOM   88   C  CB  . LEU A 1 16  ? 46.886 14.465  111.023 1.00 29.08 ? 16   LEU A CB  1 
ATOM   89   C  CG  . LEU A 1 16  ? 45.404 14.311  111.389 1.00 28.57 ? 16   LEU A CG  1 
ATOM   90   C  CD1 . LEU A 1 16  ? 44.563 14.079  110.142 1.00 28.12 ? 16   LEU A CD1 1 
ATOM   91   C  CD2 . LEU A 1 16  ? 45.190 13.183  112.389 1.00 28.67 ? 16   LEU A CD2 1 
ATOM   92   N  N   . LEU A 1 17  ? 49.948 15.448  111.067 1.00 30.28 ? 17   LEU A N   1 
ATOM   93   C  CA  . LEU A 1 17  ? 51.355 15.193  110.751 1.00 31.04 ? 17   LEU A CA  1 
ATOM   94   C  C   . LEU A 1 17  ? 52.333 15.742  111.795 1.00 32.56 ? 17   LEU A C   1 
ATOM   95   O  O   . LEU A 1 17  ? 53.511 15.407  111.766 1.00 30.10 ? 17   LEU A O   1 
ATOM   96   C  CB  . LEU A 1 17  ? 51.705 15.760  109.374 1.00 31.46 ? 17   LEU A CB  1 
ATOM   97   C  CG  . LEU A 1 17  ? 50.934 15.158  108.194 1.00 31.21 ? 17   LEU A CG  1 
ATOM   98   C  CD1 . LEU A 1 17  ? 51.341 15.851  106.903 1.00 31.51 ? 17   LEU A CD1 1 
ATOM   99   C  CD2 . LEU A 1 17  ? 51.155 13.656  108.096 1.00 30.73 ? 17   LEU A CD2 1 
ATOM   100  N  N   . GLU A 1 18  ? 51.847 16.575  112.714 1.00 35.20 ? 18   GLU A N   1 
ATOM   101  C  CA  . GLU A 1 18  ? 52.696 17.152  113.762 1.00 37.82 ? 18   GLU A CA  1 
ATOM   102  C  C   . GLU A 1 18  ? 53.355 16.102  114.662 1.00 37.91 ? 18   GLU A C   1 
ATOM   103  O  O   . GLU A 1 18  ? 54.441 16.336  115.188 1.00 38.03 ? 18   GLU A O   1 
ATOM   104  C  CB  . GLU A 1 18  ? 51.886 18.124  114.620 1.00 39.44 ? 18   GLU A CB  1 
ATOM   105  C  CG  . GLU A 1 18  ? 52.717 18.921  115.610 1.00 42.41 ? 18   GLU A CG  1 
ATOM   106  C  CD  . GLU A 1 18  ? 51.940 20.059  116.242 1.00 43.99 ? 18   GLU A CD  1 
ATOM   107  O  OE1 . GLU A 1 18  ? 50.759 19.857  116.585 1.00 45.77 ? 18   GLU A OE1 1 
ATOM   108  O  OE2 . GLU A 1 18  ? 52.515 21.156  116.399 1.00 47.15 ? 18   GLU A OE2 1 
ATOM   109  N  N   . VAL A 1 19  ? 52.702 14.953  114.833 1.00 39.11 ? 19   VAL A N   1 
ATOM   110  C  CA  . VAL A 1 19  ? 53.218 13.889  115.711 1.00 39.43 ? 19   VAL A CA  1 
ATOM   111  C  C   . VAL A 1 19  ? 54.235 12.966  115.032 1.00 39.55 ? 19   VAL A C   1 
ATOM   112  O  O   . VAL A 1 19  ? 54.648 11.967  115.615 1.00 39.37 ? 19   VAL A O   1 
ATOM   113  C  CB  . VAL A 1 19  ? 52.071 13.044  116.332 1.00 39.76 ? 19   VAL A CB  1 
ATOM   114  C  CG1 . VAL A 1 19  ? 51.149 13.930  117.159 1.00 40.64 ? 19   VAL A CG1 1 
ATOM   115  C  CG2 . VAL A 1 19  ? 51.272 12.293  115.270 1.00 39.49 ? 19   VAL A CG2 1 
ATOM   116  N  N   . ARG A 1 20  ? 54.644 13.308  113.811 1.00 39.63 ? 20   ARG A N   1 
ATOM   117  C  CA  . ARG A 1 20  ? 55.605 12.509  113.048 1.00 39.84 ? 20   ARG A CA  1 
ATOM   118  C  C   . ARG A 1 20  ? 56.940 12.402  113.782 1.00 40.84 ? 20   ARG A C   1 
ATOM   119  O  O   . ARG A 1 20  ? 57.411 13.376  114.359 1.00 38.69 ? 20   ARG A O   1 
ATOM   120  C  CB  . ARG A 1 20  ? 55.847 13.152  111.682 1.00 40.37 ? 20   ARG A CB  1 
ATOM   121  C  CG  . ARG A 1 20  ? 55.726 12.227  110.495 1.00 39.93 ? 20   ARG A CG  1 
ATOM   122  C  CD  . ARG A 1 20  ? 56.167 12.977  109.249 1.00 39.77 ? 20   ARG A CD  1 
ATOM   123  N  NE  . ARG A 1 20  ? 57.521 12.668  108.814 1.00 39.56 ? 20   ARG A NE  1 
ATOM   124  C  CZ  . ARG A 1 20  ? 58.126 13.251  107.781 1.00 40.39 ? 20   ARG A CZ  1 
ATOM   125  N  NH1 . ARG A 1 20  ? 57.504 14.189  107.071 1.00 41.09 ? 20   ARG A NH1 1 
ATOM   126  N  NH2 . ARG A 1 20  ? 59.362 12.898  107.454 1.00 40.54 ? 20   ARG A NH2 1 
ATOM   127  N  N   . GLY A 1 21  ? 57.541 11.216  113.759 1.00 42.58 ? 21   GLY A N   1 
ATOM   128  C  CA  . GLY A 1 21  ? 58.808 10.976  114.446 1.00 43.21 ? 21   GLY A CA  1 
ATOM   129  C  C   . GLY A 1 21  ? 58.667 10.593  115.911 1.00 44.67 ? 21   GLY A C   1 
ATOM   130  O  O   . GLY A 1 21  ? 59.614 10.075  116.503 1.00 45.84 ? 21   GLY A O   1 
ATOM   131  N  N   . SER A 1 22  ? 57.491 10.836  116.496 1.00 45.60 ? 22   SER A N   1 
ATOM   132  C  CA  . SER A 1 22  ? 57.233 10.527  117.902 1.00 45.72 ? 22   SER A CA  1 
ATOM   133  C  C   . SER A 1 22  ? 57.162 9.026   118.134 1.00 46.94 ? 22   SER A C   1 
ATOM   134  O  O   . SER A 1 22  ? 57.025 8.243   117.191 1.00 46.66 ? 22   SER A O   1 
ATOM   135  C  CB  . SER A 1 22  ? 55.906 11.139  118.360 1.00 44.92 ? 22   SER A CB  1 
ATOM   136  O  OG  . SER A 1 22  ? 55.817 12.505  118.011 1.00 45.07 ? 22   SER A OG  1 
ATOM   137  N  N   . LYS A 1 23  ? 57.241 8.638   119.403 1.00 47.34 ? 23   LYS A N   1 
ATOM   138  C  CA  . LYS A 1 23  ? 57.038 7.249   119.793 1.00 47.28 ? 23   LYS A CA  1 
ATOM   139  C  C   . LYS A 1 23  ? 55.559 6.904   119.576 1.00 45.60 ? 23   LYS A C   1 
ATOM   140  O  O   . LYS A 1 23  ? 54.684 7.653   120.009 1.00 44.58 ? 23   LYS A O   1 
ATOM   141  C  CB  . LYS A 1 23  ? 57.425 7.043   121.258 1.00 48.01 ? 23   LYS A CB  1 
ATOM   142  C  CG  . LYS A 1 23  ? 57.545 5.584   121.673 1.00 48.78 ? 23   LYS A CG  1 
ATOM   143  C  CD  . LYS A 1 23  ? 57.462 5.426   123.186 1.00 48.85 ? 23   LYS A CD  1 
ATOM   144  C  CE  . LYS A 1 23  ? 57.321 3.965   123.587 1.00 49.69 ? 23   LYS A CE  1 
ATOM   145  N  NZ  . LYS A 1 23  ? 56.544 3.816   124.845 1.00 49.58 ? 23   LYS A NZ  1 
ATOM   146  N  N   . PRO A 1 24  ? 55.274 5.783   118.882 1.00 45.76 ? 24   PRO A N   1 
ATOM   147  C  CA  . PRO A 1 24  ? 53.885 5.370   118.643 1.00 45.23 ? 24   PRO A CA  1 
ATOM   148  C  C   . PRO A 1 24  ? 53.019 5.362   119.904 1.00 45.02 ? 24   PRO A C   1 
ATOM   149  O  O   . PRO A 1 24  ? 53.505 5.018   120.986 1.00 46.46 ? 24   PRO A O   1 
ATOM   150  C  CB  . PRO A 1 24  ? 54.038 3.953   118.087 1.00 45.34 ? 24   PRO A CB  1 
ATOM   151  C  CG  . PRO A 1 24  ? 55.354 3.972   117.393 1.00 45.21 ? 24   PRO A CG  1 
ATOM   152  C  CD  . PRO A 1 24  ? 56.232 4.910   118.178 1.00 45.17 ? 24   PRO A CD  1 
ATOM   153  N  N   . GLY A 1 25  ? 51.749 5.738   119.754 1.00 43.01 ? 25   GLY A N   1 
ATOM   154  C  CA  . GLY A 1 25  ? 50.820 5.842   120.877 1.00 41.96 ? 25   GLY A CA  1 
ATOM   155  C  C   . GLY A 1 25  ? 50.246 7.237   121.069 1.00 40.57 ? 25   GLY A C   1 
ATOM   156  O  O   . GLY A 1 25  ? 49.075 7.386   121.427 1.00 38.92 ? 25   GLY A O   1 
ATOM   157  N  N   . LYS A 1 26  ? 51.068 8.260   120.838 1.00 40.44 ? 26   LYS A N   1 
ATOM   158  C  CA  . LYS A 1 26  ? 50.645 9.650   121.034 1.00 40.68 ? 26   LYS A CA  1 
ATOM   159  C  C   . LYS A 1 26  ? 49.495 10.021  120.099 1.00 40.35 ? 26   LYS A C   1 
ATOM   160  O  O   . LYS A 1 26  ? 49.591 9.856   118.878 1.00 39.49 ? 26   LYS A O   1 
ATOM   161  C  CB  . LYS A 1 26  ? 51.818 10.612  120.824 1.00 41.58 ? 26   LYS A CB  1 
ATOM   162  C  CG  . LYS A 1 26  ? 51.497 12.057  121.173 1.00 42.96 ? 26   LYS A CG  1 
ATOM   163  C  CD  . LYS A 1 26  ? 52.689 12.971  120.941 1.00 43.93 ? 26   LYS A CD  1 
ATOM   164  C  CE  . LYS A 1 26  ? 52.388 14.386  121.412 1.00 45.21 ? 26   LYS A CE  1 
ATOM   165  N  NZ  . LYS A 1 26  ? 53.141 15.401  120.625 1.00 46.25 ? 26   LYS A NZ  1 
ATOM   166  N  N   . ASN A 1 27  ? 48.412 10.527  120.681 1.00 40.14 ? 27   ASN A N   1 
ATOM   167  C  CA  . ASN A 1 27  ? 47.215 10.859  119.919 1.00 40.44 ? 27   ASN A CA  1 
ATOM   168  C  C   . ASN A 1 27  ? 47.266 12.257  119.316 1.00 40.03 ? 27   ASN A C   1 
ATOM   169  O  O   . ASN A 1 27  ? 48.062 13.102  119.729 1.00 38.42 ? 27   ASN A O   1 
ATOM   170  C  CB  . ASN A 1 27  ? 45.971 10.737  120.803 1.00 42.12 ? 27   ASN A CB  1 
ATOM   171  C  CG  . ASN A 1 27  ? 45.665 9.303   121.192 1.00 43.72 ? 27   ASN A CG  1 
ATOM   172  O  OD1 . ASN A 1 27  ? 46.071 8.359   120.514 1.00 45.23 ? 27   ASN A OD1 1 
ATOM   173  N  ND2 . ASN A 1 27  ? 44.929 9.133   122.282 1.00 45.11 ? 27   ASN A ND2 1 
ATOM   174  N  N   . VAL A 1 28  ? 46.417 12.465  118.313 1.00 39.30 ? 28   VAL A N   1 
ATOM   175  C  CA  . VAL A 1 28  ? 46.096 13.785  117.798 1.00 38.90 ? 28   VAL A CA  1 
ATOM   176  C  C   . VAL A 1 28  ? 44.625 14.010  118.113 1.00 39.89 ? 28   VAL A C   1 
ATOM   177  O  O   . VAL A 1 28  ? 43.776 13.201  117.731 1.00 41.01 ? 28   VAL A O   1 
ATOM   178  C  CB  . VAL A 1 28  ? 46.319 13.877  116.278 1.00 38.09 ? 28   VAL A CB  1 
ATOM   179  C  CG1 . VAL A 1 28  ? 45.945 15.261  115.760 1.00 38.27 ? 28   VAL A CG1 1 
ATOM   180  C  CG2 . VAL A 1 28  ? 47.763 13.546  115.933 1.00 37.55 ? 28   VAL A CG2 1 
ATOM   181  N  N   . GLN A 1 29  ? 44.329 15.099  118.818 1.00 41.05 ? 29   GLN A N   1 
ATOM   182  C  CA  . GLN A 1 29  ? 42.975 15.379  119.289 1.00 41.43 ? 29   GLN A CA  1 
ATOM   183  C  C   . GLN A 1 29  ? 42.297 16.410  118.391 1.00 40.26 ? 29   GLN A C   1 
ATOM   184  O  O   . GLN A 1 29  ? 42.290 17.605  118.689 1.00 41.11 ? 29   GLN A O   1 
ATOM   185  C  CB  . GLN A 1 29  ? 43.022 15.861  120.749 1.00 43.34 ? 29   GLN A CB  1 
ATOM   186  C  CG  . GLN A 1 29  ? 41.672 16.167  121.392 1.00 44.34 ? 29   GLN A CG  1 
ATOM   187  C  CD  . GLN A 1 29  ? 40.774 14.950  121.537 1.00 45.28 ? 29   GLN A CD  1 
ATOM   188  O  OE1 . GLN A 1 29  ? 41.215 13.809  121.397 1.00 47.35 ? 29   GLN A OE1 1 
ATOM   189  N  NE2 . GLN A 1 29  ? 39.500 15.192  121.826 1.00 46.72 ? 29   GLN A NE2 1 
ATOM   190  N  N   . LEU A 1 30  ? 41.738 15.942  117.280 1.00 38.49 ? 30   LEU A N   1 
ATOM   191  C  CA  . LEU A 1 30  ? 40.915 16.792  116.429 1.00 37.16 ? 30   LEU A CA  1 
ATOM   192  C  C   . LEU A 1 30  ? 39.581 17.020  117.129 1.00 36.39 ? 30   LEU A C   1 
ATOM   193  O  O   . LEU A 1 30  ? 39.213 16.274  118.038 1.00 36.00 ? 30   LEU A O   1 
ATOM   194  C  CB  . LEU A 1 30  ? 40.688 16.145  115.058 1.00 35.97 ? 30   LEU A CB  1 
ATOM   195  C  CG  . LEU A 1 30  ? 41.930 15.871  114.201 1.00 35.01 ? 30   LEU A CG  1 
ATOM   196  C  CD1 . LEU A 1 30  ? 41.564 15.027  112.989 1.00 34.59 ? 30   LEU A CD1 1 
ATOM   197  C  CD2 . LEU A 1 30  ? 42.592 17.169  113.765 1.00 34.73 ? 30   LEU A CD2 1 
ATOM   198  N  N   . GLN A 1 31  ? 38.869 18.060  116.716 1.00 36.96 ? 31   GLN A N   1 
ATOM   199  C  CA  . GLN A 1 31  ? 37.565 18.373  117.290 1.00 37.84 ? 31   GLN A CA  1 
ATOM   200  C  C   . GLN A 1 31  ? 36.487 17.577  116.577 1.00 36.78 ? 31   GLN A C   1 
ATOM   201  O  O   . GLN A 1 31  ? 36.635 17.232  115.401 1.00 35.09 ? 31   GLN A O   1 
ATOM   202  C  CB  . GLN A 1 31  ? 37.282 19.871  117.188 1.00 40.18 ? 31   GLN A CB  1 
ATOM   203  C  CG  . GLN A 1 31  ? 38.293 20.721  117.939 1.00 42.92 ? 31   GLN A CG  1 
ATOM   204  C  CD  . GLN A 1 31  ? 38.023 22.207  117.820 1.00 45.43 ? 31   GLN A CD  1 
ATOM   205  O  OE1 . GLN A 1 31  ? 37.922 22.912  118.826 1.00 47.89 ? 31   GLN A OE1 1 
ATOM   206  N  NE2 . GLN A 1 31  ? 37.901 22.693  116.588 1.00 46.09 ? 31   GLN A NE2 1 
ATOM   207  N  N   . GLU A 1 32  ? 35.405 17.286  117.293 1.00 34.75 ? 32   GLU A N   1 
ATOM   208  C  CA  . GLU A 1 32  ? 34.334 16.444  116.773 1.00 35.97 ? 32   GLU A CA  1 
ATOM   209  C  C   . GLU A 1 32  ? 33.757 16.992  115.474 1.00 36.16 ? 32   GLU A C   1 
ATOM   210  O  O   . GLU A 1 32  ? 33.538 16.235  114.530 1.00 34.42 ? 32   GLU A O   1 
ATOM   211  C  CB  . GLU A 1 32  ? 33.220 16.286  117.806 1.00 36.16 ? 32   GLU A CB  1 
ATOM   212  C  CG  . GLU A 1 32  ? 32.108 15.337  117.382 1.00 36.94 ? 32   GLU A CG  1 
ATOM   213  C  CD  . GLU A 1 32  ? 31.052 15.144  118.453 1.00 37.30 ? 32   GLU A CD  1 
ATOM   214  O  OE1 . GLU A 1 32  ? 31.198 15.712  119.553 1.00 38.02 ? 32   GLU A OE1 1 
ATOM   215  O  OE2 . GLU A 1 32  ? 30.075 14.416  118.193 1.00 38.14 ? 32   GLU A OE2 1 
ATOM   216  N  N   . ASN A 1 33  ? 33.507 18.301  115.439 1.00 36.53 ? 33   ASN A N   1 
ATOM   217  C  CA  . ASN A 1 33  ? 32.979 18.957  114.240 1.00 37.64 ? 33   ASN A CA  1 
ATOM   218  C  C   . ASN A 1 33  ? 33.897 18.798  113.020 1.00 36.45 ? 33   ASN A C   1 
ATOM   219  O  O   . ASN A 1 33  ? 33.416 18.685  111.891 1.00 37.41 ? 33   ASN A O   1 
ATOM   220  C  CB  . ASN A 1 33  ? 32.696 20.442  114.505 1.00 38.88 ? 33   ASN A CB  1 
ATOM   221  C  CG  . ASN A 1 33  ? 33.958 21.241  114.789 1.00 40.80 ? 33   ASN A CG  1 
ATOM   222  O  OD1 . ASN A 1 33  ? 34.597 21.065  115.829 1.00 43.75 ? 33   ASN A OD1 1 
ATOM   223  N  ND2 . ASN A 1 33  ? 34.325 22.124  113.865 1.00 41.36 ? 33   ASN A ND2 1 
ATOM   224  N  N   . GLU A 1 34  ? 35.207 18.779  113.255 1.00 35.85 ? 34   GLU A N   1 
ATOM   225  C  CA  . GLU A 1 34  ? 36.191 18.601  112.179 1.00 35.89 ? 34   GLU A CA  1 
ATOM   226  C  C   . GLU A 1 34  ? 36.167 17.183  111.607 1.00 34.70 ? 34   GLU A C   1 
ATOM   227  O  O   . GLU A 1 34  ? 36.181 17.004  110.387 1.00 34.69 ? 34   GLU A O   1 
ATOM   228  C  CB  . GLU A 1 34  ? 37.599 18.930  112.670 1.00 35.81 ? 34   GLU A CB  1 
ATOM   229  C  CG  . GLU A 1 34  ? 37.781 20.377  113.104 1.00 36.60 ? 34   GLU A CG  1 
ATOM   230  C  CD  . GLU A 1 34  ? 39.169 20.655  113.645 1.00 36.25 ? 34   GLU A CD  1 
ATOM   231  O  OE1 . GLU A 1 34  ? 39.643 19.900  114.523 1.00 36.96 ? 34   GLU A OE1 1 
ATOM   232  O  OE2 . GLU A 1 34  ? 39.786 21.643  113.203 1.00 37.51 ? 34   GLU A OE2 1 
ATOM   233  N  N   . ILE A 1 35  ? 36.130 16.186  112.489 1.00 33.10 ? 35   ILE A N   1 
ATOM   234  C  CA  . ILE A 1 35  ? 36.079 14.781  112.073 1.00 33.27 ? 35   ILE A CA  1 
ATOM   235  C  C   . ILE A 1 35  ? 34.762 14.487  111.350 1.00 33.43 ? 35   ILE A C   1 
ATOM   236  O  O   . ILE A 1 35  ? 34.737 13.739  110.374 1.00 32.50 ? 35   ILE A O   1 
ATOM   237  C  CB  . ILE A 1 35  ? 36.258 13.812  113.266 1.00 33.53 ? 35   ILE A CB  1 
ATOM   238  C  CG1 . ILE A 1 35  ? 37.625 14.023  113.930 1.00 33.22 ? 35   ILE A CG1 1 
ATOM   239  C  CG2 . ILE A 1 35  ? 36.143 12.358  112.808 1.00 33.31 ? 35   ILE A CG2 1 
ATOM   240  C  CD1 . ILE A 1 35  ? 37.847 13.186  115.172 1.00 33.15 ? 35   ILE A CD1 1 
ATOM   241  N  N   . ARG A 1 36  ? 33.674 15.076  111.841 1.00 33.27 ? 36   ARG A N   1 
ATOM   242  C  CA  . ARG A 1 36  ? 32.383 15.003  111.166 1.00 34.49 ? 36   ARG A CA  1 
ATOM   243  C  C   . ARG A 1 36  ? 32.460 15.658  109.783 1.00 33.29 ? 36   ARG A C   1 
ATOM   244  O  O   . ARG A 1 36  ? 31.936 15.119  108.809 1.00 31.83 ? 36   ARG A O   1 
ATOM   245  C  CB  . ARG A 1 36  ? 31.303 15.678  112.018 1.00 36.90 ? 36   ARG A CB  1 
ATOM   246  C  CG  . ARG A 1 36  ? 29.879 15.361  111.597 1.00 39.69 ? 36   ARG A CG  1 
ATOM   247  C  CD  . ARG A 1 36  ? 28.860 15.812  112.634 1.00 41.98 ? 36   ARG A CD  1 
ATOM   248  N  NE  . ARG A 1 36  ? 27.613 15.063  112.510 1.00 45.50 ? 36   ARG A NE  1 
ATOM   249  C  CZ  . ARG A 1 36  ? 26.631 15.346  111.650 1.00 47.87 ? 36   ARG A CZ  1 
ATOM   250  N  NH1 . ARG A 1 36  ? 26.725 16.376  110.808 1.00 49.27 ? 36   ARG A NH1 1 
ATOM   251  N  NH2 . ARG A 1 36  ? 25.539 14.587  111.633 1.00 48.34 ? 36   ARG A NH2 1 
ATOM   252  N  N   . GLY A 1 37  ? 33.127 16.807  109.704 1.00 32.16 ? 37   GLY A N   1 
ATOM   253  C  CA  . GLY A 1 37  ? 33.364 17.487  108.431 1.00 32.19 ? 37   GLY A CA  1 
ATOM   254  C  C   . GLY A 1 37  ? 34.113 16.632  107.415 1.00 31.48 ? 37   GLY A C   1 
ATOM   255  O  O   . GLY A 1 37  ? 33.749 16.602  106.238 1.00 31.71 ? 37   GLY A O   1 
ATOM   256  N  N   . LEU A 1 38  ? 35.154 15.934  107.867 1.00 30.10 ? 38   LEU A N   1 
ATOM   257  C  CA  . LEU A 1 38  ? 35.907 15.009  107.006 1.00 30.07 ? 38   LEU A CA  1 
ATOM   258  C  C   . LEU A 1 38  ? 35.015 13.896  106.444 1.00 29.59 ? 38   LEU A C   1 
ATOM   259  O  O   . LEU A 1 38  ? 35.116 13.547  105.268 1.00 29.42 ? 38   LEU A O   1 
ATOM   260  C  CB  . LEU A 1 38  ? 37.081 14.386  107.768 1.00 29.71 ? 38   LEU A CB  1 
ATOM   261  C  CG  . LEU A 1 38  ? 38.228 15.287  108.231 1.00 29.81 ? 38   LEU A CG  1 
ATOM   262  C  CD1 . LEU A 1 38  ? 39.144 14.515  109.171 1.00 29.97 ? 38   LEU A CD1 1 
ATOM   263  C  CD2 . LEU A 1 38  ? 39.017 15.851  107.061 1.00 30.70 ? 38   LEU A CD2 1 
ATOM   264  N  N   . CYS A 1 39  ? 34.138 13.352  107.285 1.00 29.94 ? 39   CYS A N   1 
ATOM   265  C  CA  . CYS A 1 39  ? 33.215 12.296  106.865 1.00 30.68 ? 39   CYS A CA  1 
ATOM   266  C  C   . CYS A 1 39  ? 32.212 12.772  105.819 1.00 31.41 ? 39   CYS A C   1 
ATOM   267  O  O   . CYS A 1 39  ? 31.973 12.087  104.835 1.00 31.07 ? 39   CYS A O   1 
ATOM   268  C  CB  . CYS A 1 39  ? 32.450 11.728  108.059 1.00 30.94 ? 39   CYS A CB  1 
ATOM   269  S  SG  . CYS A 1 39  ? 33.446 10.740  109.189 1.00 32.10 ? 39   CYS A SG  1 
ATOM   270  N  N   . LEU A 1 40  ? 31.625 13.943  106.042 1.00 32.64 ? 40   LEU A N   1 
ATOM   271  C  CA  . LEU A 1 40  ? 30.566 14.446  105.166 1.00 33.92 ? 40   LEU A CA  1 
ATOM   272  C  C   . LEU A 1 40  ? 31.107 14.864  103.801 1.00 32.88 ? 40   LEU A C   1 
ATOM   273  O  O   . LEU A 1 40  ? 30.486 14.591  102.772 1.00 32.88 ? 40   LEU A O   1 
ATOM   274  C  CB  . LEU A 1 40  ? 29.836 15.619  105.830 1.00 34.76 ? 40   LEU A CB  1 
ATOM   275  C  CG  . LEU A 1 40  ? 29.124 15.289  107.150 1.00 35.73 ? 40   LEU A CG  1 
ATOM   276  C  CD1 . LEU A 1 40  ? 28.736 16.563  107.886 1.00 36.34 ? 40   LEU A CD1 1 
ATOM   277  C  CD2 . LEU A 1 40  ? 27.905 14.408  106.915 1.00 36.33 ? 40   LEU A CD2 1 
ATOM   278  N  N   . LYS A 1 41  ? 32.265 15.517  103.801 1.00 32.72 ? 41   LYS A N   1 
ATOM   279  C  CA  . LYS A 1 41  ? 32.886 15.999  102.572 1.00 33.42 ? 41   LYS A CA  1 
ATOM   280  C  C   . LYS A 1 41  ? 33.474 14.864  101.737 1.00 32.44 ? 41   LYS A C   1 
ATOM   281  O  O   . LYS A 1 41  ? 33.303 14.837  100.519 1.00 33.22 ? 41   LYS A O   1 
ATOM   282  C  CB  . LYS A 1 41  ? 33.966 17.041  102.895 1.00 33.96 ? 41   LYS A CB  1 
ATOM   283  C  CG  . LYS A 1 41  ? 34.642 17.670  101.684 1.00 35.45 ? 41   LYS A CG  1 
ATOM   284  C  CD  . LYS A 1 41  ? 33.665 18.442  100.803 1.00 36.35 ? 41   LYS A CD  1 
ATOM   285  C  CE  . LYS A 1 41  ? 34.162 18.551  99.371  1.00 36.72 ? 41   LYS A CE  1 
ATOM   286  N  NZ  . LYS A 1 41  ? 33.061 18.865  98.421  1.00 37.19 ? 41   LYS A NZ  1 
ATOM   287  N  N   . SER A 1 42  ? 34.168 13.931  102.384 1.00 31.30 ? 42   SER A N   1 
ATOM   288  C  CA  . SER A 1 42  ? 34.720 12.778  101.677 1.00 30.20 ? 42   SER A CA  1 
ATOM   289  C  C   . SER A 1 42  ? 33.596 11.916  101.085 1.00 30.26 ? 42   SER A C   1 
ATOM   290  O  O   . SER A 1 42  ? 33.705 11.427  99.958  1.00 29.17 ? 42   SER A O   1 
ATOM   291  C  CB  . SER A 1 42  ? 35.612 11.948  102.602 1.00 29.82 ? 42   SER A CB  1 
ATOM   292  O  OG  . SER A 1 42  ? 34.881 11.428  103.692 1.00 29.10 ? 42   SER A OG  1 
ATOM   293  N  N   . ARG A 1 43  ? 32.520 11.753  101.850 1.00 30.60 ? 43   ARG A N   1 
ATOM   294  C  CA  . ARG A 1 43  ? 31.333 11.034  101.389 1.00 31.47 ? 43   ARG A CA  1 
ATOM   295  C  C   . ARG A 1 43  ? 30.809 11.602  100.066 1.00 30.59 ? 43   ARG A C   1 
ATOM   296  O  O   . ARG A 1 43  ? 30.512 10.844  99.144  1.00 29.68 ? 43   ARG A O   1 
ATOM   297  C  CB  . ARG A 1 43  ? 30.237 11.085  102.460 1.00 32.77 ? 43   ARG A CB  1 
ATOM   298  C  CG  . ARG A 1 43  ? 28.986 10.285  102.139 1.00 33.73 ? 43   ARG A CG  1 
ATOM   299  C  CD  . ARG A 1 43  ? 27.988 10.380  103.280 1.00 34.23 ? 43   ARG A CD  1 
ATOM   300  N  NE  . ARG A 1 43  ? 26.850 9.477   103.113 1.00 34.35 ? 43   ARG A NE  1 
ATOM   301  C  CZ  . ARG A 1 43  ? 25.779 9.725   102.355 1.00 35.43 ? 43   ARG A CZ  1 
ATOM   302  N  NH1 . ARG A 1 43  ? 25.676 10.854  101.660 1.00 35.73 ? 43   ARG A NH1 1 
ATOM   303  N  NH2 . ARG A 1 43  ? 24.802 8.828   102.285 1.00 35.53 ? 43   ARG A NH2 1 
ATOM   304  N  N   . GLU A 1 44  ? 30.700 12.929  99.981  1.00 30.68 ? 44   GLU A N   1 
ATOM   305  C  CA  . GLU A 1 44  ? 30.274 13.603  98.742  1.00 31.13 ? 44   GLU A CA  1 
ATOM   306  C  C   . GLU A 1 44  ? 31.185 13.277  97.561  1.00 29.65 ? 44   GLU A C   1 
ATOM   307  O  O   . GLU A 1 44  ? 30.715 13.077  96.443  1.00 29.69 ? 44   GLU A O   1 
ATOM   308  C  CB  . GLU A 1 44  ? 30.266 15.124  98.916  1.00 33.33 ? 44   GLU A CB  1 
ATOM   309  C  CG  . GLU A 1 44  ? 29.055 15.684  99.637  1.00 36.31 ? 44   GLU A CG  1 
ATOM   310  C  CD  . GLU A 1 44  ? 28.967 17.197  99.535  1.00 38.45 ? 44   GLU A CD  1 
ATOM   311  O  OE1 . GLU A 1 44  ? 30.006 17.845  99.256  1.00 39.98 ? 44   GLU A OE1 1 
ATOM   312  O  OE2 . GLU A 1 44  ? 27.857 17.738  99.729  1.00 39.37 ? 44   GLU A OE2 1 
ATOM   313  N  N   . ILE A 1 45  ? 32.489 13.251  97.815  1.00 27.83 ? 45   ILE A N   1 
ATOM   314  C  CA  . ILE A 1 45  ? 33.476 12.955  96.776  1.00 27.32 ? 45   ILE A CA  1 
ATOM   315  C  C   . ILE A 1 45  ? 33.361 11.498  96.332  1.00 26.38 ? 45   ILE A C   1 
ATOM   316  O  O   . ILE A 1 45  ? 33.377 11.216  95.130  1.00 26.22 ? 45   ILE A O   1 
ATOM   317  C  CB  . ILE A 1 45  ? 34.910 13.273  97.257  1.00 27.68 ? 45   ILE A CB  1 
ATOM   318  C  CG1 . ILE A 1 45  ? 35.052 14.779  97.513  1.00 28.02 ? 45   ILE A CG1 1 
ATOM   319  C  CG2 . ILE A 1 45  ? 35.935 12.816  96.229  1.00 27.92 ? 45   ILE A CG2 1 
ATOM   320  C  CD1 . ILE A 1 45  ? 36.216 15.145  98.404  1.00 28.87 ? 45   ILE A CD1 1 
ATOM   321  N  N   . PHE A 1 46  ? 33.233 10.581  97.292  1.00 25.54 ? 46   PHE A N   1 
ATOM   322  C  CA  . PHE A 1 46  ? 33.055 9.160   96.978  1.00 25.32 ? 46   PHE A CA  1 
ATOM   323  C  C   . PHE A 1 46  ? 31.849 8.955   96.056  1.00 26.46 ? 46   PHE A C   1 
ATOM   324  O  O   . PHE A 1 46  ? 31.960 8.312   95.015  1.00 27.42 ? 46   PHE A O   1 
ATOM   325  C  CB  . PHE A 1 46  ? 32.901 8.297   98.243  1.00 24.93 ? 46   PHE A CB  1 
ATOM   326  C  CG  . PHE A 1 46  ? 34.108 8.306   99.162  1.00 25.07 ? 46   PHE A CG  1 
ATOM   327  C  CD1 . PHE A 1 46  ? 35.398 8.264   98.655  1.00 24.72 ? 46   PHE A CD1 1 
ATOM   328  C  CD2 . PHE A 1 46  ? 33.941 8.316   100.544 1.00 24.82 ? 46   PHE A CD2 1 
ATOM   329  C  CE1 . PHE A 1 46  ? 36.496 8.273   99.497  1.00 25.20 ? 46   PHE A CE1 1 
ATOM   330  C  CE2 . PHE A 1 46  ? 35.037 8.318   101.395 1.00 24.10 ? 46   PHE A CE2 1 
ATOM   331  C  CZ  . PHE A 1 46  ? 36.317 8.294   100.870 1.00 24.71 ? 46   PHE A CZ  1 
ATOM   332  N  N   . LEU A 1 47  ? 30.705 9.521   96.423  1.00 27.21 ? 47   LEU A N   1 
ATOM   333  C  CA  . LEU A 1 47  ? 29.503 9.421   95.581  1.00 27.82 ? 47   LEU A CA  1 
ATOM   334  C  C   . LEU A 1 47  ? 29.647 10.115  94.214  1.00 28.05 ? 47   LEU A C   1 
ATOM   335  O  O   . LEU A 1 47  ? 29.036 9.690   93.241  1.00 28.58 ? 47   LEU A O   1 
ATOM   336  C  CB  . LEU A 1 47  ? 28.275 9.953   96.330  1.00 27.56 ? 47   LEU A CB  1 
ATOM   337  C  CG  . LEU A 1 47  ? 27.835 9.129   97.548  1.00 27.43 ? 47   LEU A CG  1 
ATOM   338  C  CD1 . LEU A 1 47  ? 26.660 9.784   98.259  1.00 27.43 ? 47   LEU A CD1 1 
ATOM   339  C  CD2 . LEU A 1 47  ? 27.478 7.702   97.154  1.00 27.22 ? 47   LEU A CD2 1 
ATOM   340  N  N   . SER A 1 48  ? 30.442 11.177  94.137  1.00 29.30 ? 48   SER A N   1 
ATOM   341  C  CA  . SER A 1 48  ? 30.659 11.867  92.865  1.00 29.73 ? 48   SER A CA  1 
ATOM   342  C  C   . SER A 1 48  ? 31.547 11.070  91.903  1.00 29.52 ? 48   SER A C   1 
ATOM   343  O  O   . SER A 1 48  ? 31.459 11.250  90.693  1.00 30.22 ? 48   SER A O   1 
ATOM   344  C  CB  . SER A 1 48  ? 31.278 13.246  93.092  1.00 30.09 ? 48   SER A CB  1 
ATOM   345  O  OG  . SER A 1 48  ? 32.668 13.144  93.358  1.00 31.31 ? 48   SER A OG  1 
ATOM   346  N  N   . GLN A 1 49  ? 32.418 10.219  92.442  1.00 28.13 ? 49   GLN A N   1 
ATOM   347  C  CA  . GLN A 1 49  ? 33.333 9.435   91.623  1.00 27.97 ? 49   GLN A CA  1 
ATOM   348  C  C   . GLN A 1 49  ? 32.771 8.031   91.410  1.00 27.58 ? 49   GLN A C   1 
ATOM   349  O  O   . GLN A 1 49  ? 31.936 7.580   92.188  1.00 28.23 ? 49   GLN A O   1 
ATOM   350  C  CB  . GLN A 1 49  ? 34.710 9.372   92.291  1.00 27.99 ? 49   GLN A CB  1 
ATOM   351  C  CG  . GLN A 1 49  ? 35.387 10.730  92.395  1.00 28.08 ? 49   GLN A CG  1 
ATOM   352  C  CD  . GLN A 1 49  ? 36.771 10.665  93.022  1.00 27.75 ? 49   GLN A CD  1 
ATOM   353  O  OE1 . GLN A 1 49  ? 37.099 9.722   93.739  1.00 27.38 ? 49   GLN A OE1 1 
ATOM   354  N  NE2 . GLN A 1 49  ? 37.585 11.685  92.765  1.00 28.25 ? 49   GLN A NE2 1 
ATOM   355  N  N   . PRO A 1 50  ? 33.237 7.334   90.359  1.00 27.49 ? 50   PRO A N   1 
ATOM   356  C  CA  . PRO A 1 50  ? 32.717 5.993   90.094  1.00 26.96 ? 50   PRO A CA  1 
ATOM   357  C  C   . PRO A 1 50  ? 33.045 4.952   91.170  1.00 26.46 ? 50   PRO A C   1 
ATOM   358  O  O   . PRO A 1 50  ? 34.062 5.058   91.874  1.00 26.41 ? 50   PRO A O   1 
ATOM   359  C  CB  . PRO A 1 50  ? 33.353 5.607   88.752  1.00 27.08 ? 50   PRO A CB  1 
ATOM   360  C  CG  . PRO A 1 50  ? 34.437 6.592   88.502  1.00 27.74 ? 50   PRO A CG  1 
ATOM   361  C  CD  . PRO A 1 50  ? 34.143 7.814   89.301  1.00 27.13 ? 50   PRO A CD  1 
ATOM   362  N  N   . ILE A 1 51  ? 32.173 3.952   91.268  1.00 25.84 ? 51   ILE A N   1 
ATOM   363  C  CA  . ILE A 1 51  ? 32.317 2.851   92.221  1.00 25.33 ? 51   ILE A CA  1 
ATOM   364  C  C   . ILE A 1 51  ? 33.378 1.852   91.757  1.00 25.30 ? 51   ILE A C   1 
ATOM   365  O  O   . ILE A 1 51  ? 33.943 1.116   92.566  1.00 24.81 ? 51   ILE A O   1 
ATOM   366  C  CB  . ILE A 1 51  ? 30.962 2.131   92.433  1.00 25.06 ? 51   ILE A CB  1 
ATOM   367  C  CG1 . ILE A 1 51  ? 31.008 1.239   93.674  1.00 24.96 ? 51   ILE A CG1 1 
ATOM   368  C  CG2 . ILE A 1 51  ? 30.561 1.322   91.204  1.00 24.63 ? 51   ILE A CG2 1 
ATOM   369  C  CD1 . ILE A 1 51  ? 29.649 0.741   94.106  1.00 24.91 ? 51   ILE A CD1 1 
ATOM   370  N  N   . LEU A 1 52  ? 33.619 1.814   90.449  1.00 25.43 ? 52   LEU A N   1 
ATOM   371  C  CA  . LEU A 1 52  ? 34.734 1.066   89.871  1.00 25.49 ? 52   LEU A CA  1 
ATOM   372  C  C   . LEU A 1 52  ? 35.712 2.082   89.304  1.00 24.55 ? 52   LEU A C   1 
ATOM   373  O  O   . LEU A 1 52  ? 35.485 2.629   88.228  1.00 23.12 ? 52   LEU A O   1 
ATOM   374  C  CB  . LEU A 1 52  ? 34.247 0.114   88.778  1.00 26.09 ? 52   LEU A CB  1 
ATOM   375  C  CG  . LEU A 1 52  ? 35.320 -0.624  87.959  1.00 27.92 ? 52   LEU A CG  1 
ATOM   376  C  CD1 . LEU A 1 52  ? 36.218 -1.482  88.842  1.00 28.81 ? 52   LEU A CD1 1 
ATOM   377  C  CD2 . LEU A 1 52  ? 34.668 -1.478  86.883  1.00 27.84 ? 52   LEU A CD2 1 
ATOM   378  N  N   . LEU A 1 53  ? 36.794 2.338   90.035  1.00 24.13 ? 53   LEU A N   1 
ATOM   379  C  CA  . LEU A 1 53  ? 37.732 3.395   89.666  1.00 24.21 ? 53   LEU A CA  1 
ATOM   380  C  C   . LEU A 1 53  ? 38.606 2.991   88.483  1.00 25.69 ? 53   LEU A C   1 
ATOM   381  O  O   . LEU A 1 53  ? 39.022 1.838   88.366  1.00 25.77 ? 53   LEU A O   1 
ATOM   382  C  CB  . LEU A 1 53  ? 38.610 3.782   90.855  1.00 23.67 ? 53   LEU A CB  1 
ATOM   383  C  CG  . LEU A 1 53  ? 37.889 4.328   92.097  1.00 23.61 ? 53   LEU A CG  1 
ATOM   384  C  CD1 . LEU A 1 53  ? 38.848 4.368   93.279  1.00 23.56 ? 53   LEU A CD1 1 
ATOM   385  C  CD2 . LEU A 1 53  ? 37.292 5.704   91.848  1.00 23.34 ? 53   LEU A CD2 1 
ATOM   386  N  N   . GLU A 1 54  ? 38.853 3.947   87.591  1.00 26.93 ? 54   GLU A N   1 
ATOM   387  C  CA  . GLU A 1 54  ? 39.758 3.742   86.472  1.00 28.19 ? 54   GLU A CA  1 
ATOM   388  C  C   . GLU A 1 54  ? 40.925 4.693   86.660  1.00 27.60 ? 54   GLU A C   1 
ATOM   389  O  O   . GLU A 1 54  ? 40.775 5.902   86.498  1.00 28.79 ? 54   GLU A O   1 
ATOM   390  C  CB  . GLU A 1 54  ? 39.038 3.978   85.142  1.00 30.57 ? 54   GLU A CB  1 
ATOM   391  C  CG  . GLU A 1 54  ? 37.878 3.018   84.922  1.00 32.98 ? 54   GLU A CG  1 
ATOM   392  C  CD  . GLU A 1 54  ? 37.276 3.107   83.535  1.00 34.93 ? 54   GLU A CD  1 
ATOM   393  O  OE1 . GLU A 1 54  ? 38.040 3.122   82.545  1.00 37.63 ? 54   GLU A OE1 1 
ATOM   394  O  OE2 . GLU A 1 54  ? 36.031 3.141   83.434  1.00 37.08 ? 54   GLU A OE2 1 
ATOM   395  N  N   . LEU A 1 55  ? 42.079 4.140   87.030  1.00 26.81 ? 55   LEU A N   1 
ATOM   396  C  CA  . LEU A 1 55  ? 43.241 4.938   87.416  1.00 26.14 ? 55   LEU A CA  1 
ATOM   397  C  C   . LEU A 1 55  ? 44.430 4.732   86.487  1.00 27.25 ? 55   LEU A C   1 
ATOM   398  O  O   . LEU A 1 55  ? 44.533 3.709   85.795  1.00 27.37 ? 55   LEU A O   1 
ATOM   399  C  CB  . LEU A 1 55  ? 43.661 4.600   88.851  1.00 25.26 ? 55   LEU A CB  1 
ATOM   400  C  CG  . LEU A 1 55  ? 42.592 4.737   89.936  1.00 25.11 ? 55   LEU A CG  1 
ATOM   401  C  CD1 . LEU A 1 55  ? 43.123 4.231   91.272  1.00 25.04 ? 55   LEU A CD1 1 
ATOM   402  C  CD2 . LEU A 1 55  ? 42.114 6.173   90.058  1.00 24.98 ? 55   LEU A CD2 1 
ATOM   403  N  N   . GLU A 1 56  ? 45.335 5.706   86.507  1.00 28.20 ? 56   GLU A N   1 
ATOM   404  C  CA  . GLU A 1 56  ? 46.527 5.702   85.659  1.00 30.79 ? 56   GLU A CA  1 
ATOM   405  C  C   . GLU A 1 56  ? 47.794 5.820   86.510  1.00 30.77 ? 56   GLU A C   1 
ATOM   406  O  O   . GLU A 1 56  ? 47.827 6.584   87.471  1.00 30.72 ? 56   GLU A O   1 
ATOM   407  C  CB  . GLU A 1 56  ? 46.452 6.863   84.661  1.00 31.69 ? 56   GLU A CB  1 
ATOM   408  C  CG  . GLU A 1 56  ? 45.187 6.861   83.804  1.00 33.15 ? 56   GLU A CG  1 
ATOM   409  C  CD  . GLU A 1 56  ? 44.987 8.156   83.030  1.00 35.73 ? 56   GLU A CD  1 
ATOM   410  O  OE1 . GLU A 1 56  ? 45.994 8.778   82.613  1.00 34.62 ? 56   GLU A OE1 1 
ATOM   411  O  OE2 . GLU A 1 56  ? 43.813 8.555   82.835  1.00 38.00 ? 56   GLU A OE2 1 
ATOM   412  N  N   . ALA A 1 57  ? 48.824 5.054   86.151  1.00 31.46 ? 57   ALA A N   1 
ATOM   413  C  CA  . ALA A 1 57  ? 50.149 5.143   86.774  1.00 32.93 ? 57   ALA A CA  1 
ATOM   414  C  C   . ALA A 1 57  ? 50.804 6.485   86.414  1.00 32.93 ? 57   ALA A C   1 
ATOM   415  O  O   . ALA A 1 57  ? 50.451 7.066   85.385  1.00 33.97 ? 57   ALA A O   1 
ATOM   416  C  CB  . ALA A 1 57  ? 51.020 3.990   86.297  1.00 34.15 ? 57   ALA A CB  1 
ATOM   417  N  N   . PRO A 1 58  ? 51.758 6.986   87.206  1.00 30.95 ? 58   PRO A N   1 
ATOM   418  C  CA  . PRO A 1 58  ? 52.344 6.323   88.379  1.00 30.49 ? 58   PRO A CA  1 
ATOM   419  C  C   . PRO A 1 58  ? 51.436 6.288   89.611  1.00 28.32 ? 58   PRO A C   1 
ATOM   420  O  O   . PRO A 1 58  ? 50.656 7.212   89.822  1.00 28.34 ? 58   PRO A O   1 
ATOM   421  C  CB  . PRO A 1 58  ? 53.573 7.183   88.671  1.00 30.34 ? 58   PRO A CB  1 
ATOM   422  C  CG  . PRO A 1 58  ? 53.183 8.542   88.212  1.00 30.56 ? 58   PRO A CG  1 
ATOM   423  C  CD  . PRO A 1 58  ? 52.331 8.327   86.990  1.00 31.06 ? 58   PRO A CD  1 
ATOM   424  N  N   . LEU A 1 59  ? 51.554 5.229   90.411  1.00 26.86 ? 59   LEU A N   1 
ATOM   425  C  CA  . LEU A 1 59  ? 50.676 5.017   91.574  1.00 26.23 ? 59   LEU A CA  1 
ATOM   426  C  C   . LEU A 1 59  ? 51.346 4.124   92.627  1.00 25.43 ? 59   LEU A C   1 
ATOM   427  O  O   . LEU A 1 59  ? 52.070 3.185   92.283  1.00 26.29 ? 59   LEU A O   1 
ATOM   428  C  CB  . LEU A 1 59  ? 49.358 4.379   91.100  1.00 26.19 ? 59   LEU A CB  1 
ATOM   429  C  CG  . LEU A 1 59  ? 48.178 4.222   92.058  1.00 25.92 ? 59   LEU A CG  1 
ATOM   430  C  CD1 . LEU A 1 59  ? 47.642 5.571   92.506  1.00 26.36 ? 59   LEU A CD1 1 
ATOM   431  C  CD2 . LEU A 1 59  ? 47.072 3.427   91.383  1.00 26.35 ? 59   LEU A CD2 1 
ATOM   432  N  N   . LYS A 1 60  ? 51.123 4.436   93.905  1.00 24.65 ? 60   LYS A N   1 
ATOM   433  C  CA  . LYS A 1 60  ? 51.559 3.584   95.016  1.00 23.99 ? 60   LYS A CA  1 
ATOM   434  C  C   . LYS A 1 60  ? 50.338 2.868   95.585  1.00 23.36 ? 60   LYS A C   1 
ATOM   435  O  O   . LYS A 1 60  ? 49.348 3.522   95.920  1.00 23.08 ? 60   LYS A O   1 
ATOM   436  C  CB  . LYS A 1 60  ? 52.199 4.416   96.127  1.00 24.35 ? 60   LYS A CB  1 
ATOM   437  C  CG  . LYS A 1 60  ? 53.377 5.275   95.707  1.00 25.26 ? 60   LYS A CG  1 
ATOM   438  C  CD  . LYS A 1 60  ? 54.660 4.479   95.598  1.00 24.69 ? 60   LYS A CD  1 
ATOM   439  C  CE  . LYS A 1 60  ? 55.837 5.401   95.342  1.00 24.94 ? 60   LYS A CE  1 
ATOM   440  N  NZ  . LYS A 1 60  ? 57.106 4.637   95.249  1.00 24.57 ? 60   LYS A NZ  1 
ATOM   441  N  N   . ILE A 1 61  ? 50.406 1.541   95.703  1.00 22.44 ? 61   ILE A N   1 
ATOM   442  C  CA  . ILE A 1 61  ? 49.293 0.751   96.222  1.00 21.55 ? 61   ILE A CA  1 
ATOM   443  C  C   . ILE A 1 61  ? 49.648 0.111   97.569  1.00 21.33 ? 61   ILE A C   1 
ATOM   444  O  O   . ILE A 1 61  ? 50.722 -0.481  97.729  1.00 21.61 ? 61   ILE A O   1 
ATOM   445  C  CB  . ILE A 1 61  ? 48.844 -0.331  95.216  1.00 21.75 ? 61   ILE A CB  1 
ATOM   446  C  CG1 . ILE A 1 61  ? 48.557 0.304   93.850  1.00 21.75 ? 61   ILE A CG1 1 
ATOM   447  C  CG2 . ILE A 1 61  ? 47.596 -1.046  95.726  1.00 21.76 ? 61   ILE A CG2 1 
ATOM   448  C  CD1 . ILE A 1 61  ? 48.277 -0.689  92.741  1.00 22.31 ? 61   ILE A CD1 1 
ATOM   449  N  N   . CYS A 1 62  ? 48.731 0.238   98.522  1.00 20.52 ? 62   CYS A N   1 
ATOM   450  C  CA  . CYS A 1 62  ? 48.920 -0.240  99.896  1.00 20.80 ? 62   CYS A CA  1 
ATOM   451  C  C   . CYS A 1 62  ? 47.759 -1.138  100.319 1.00 20.24 ? 62   CYS A C   1 
ATOM   452  O  O   . CYS A 1 62  ? 46.607 -0.893  99.944  1.00 20.15 ? 62   CYS A O   1 
ATOM   453  C  CB  . CYS A 1 62  ? 49.003 0.950   100.858 1.00 21.35 ? 62   CYS A CB  1 
ATOM   454  S  SG  . CYS A 1 62  ? 50.416 2.062   100.622 1.00 23.07 ? 62   CYS A SG  1 
ATOM   455  N  N   . GLY A 1 63  ? 48.067 -2.160  101.118 1.00 20.33 ? 63   GLY A N   1 
ATOM   456  C  CA  . GLY A 1 63  ? 47.055 -3.026  101.733 1.00 20.46 ? 63   GLY A CA  1 
ATOM   457  C  C   . GLY A 1 63  ? 46.666 -2.619  103.148 1.00 19.78 ? 63   GLY A C   1 
ATOM   458  O  O   . GLY A 1 63  ? 46.740 -1.448  103.506 1.00 19.25 ? 63   GLY A O   1 
ATOM   459  N  N   . ASP A 1 64  ? 46.263 -3.598  103.961 1.00 20.49 ? 64   ASP A N   1 
ATOM   460  C  CA  . ASP A 1 64  ? 45.664 -3.334  105.279 1.00 20.17 ? 64   ASP A CA  1 
ATOM   461  C  C   . ASP A 1 64  ? 46.548 -2.473  106.194 1.00 21.15 ? 64   ASP A C   1 
ATOM   462  O  O   . ASP A 1 64  ? 47.770 -2.675  106.266 1.00 19.26 ? 64   ASP A O   1 
ATOM   463  C  CB  . ASP A 1 64  ? 45.379 -4.644  106.027 1.00 20.92 ? 64   ASP A CB  1 
ATOM   464  C  CG  . ASP A 1 64  ? 44.461 -5.582  105.276 1.00 20.88 ? 64   ASP A CG  1 
ATOM   465  O  OD1 . ASP A 1 64  ? 44.416 -5.540  104.025 1.00 21.92 ? 64   ASP A OD1 1 
ATOM   466  O  OD2 . ASP A 1 64  ? 43.803 -6.397  105.955 1.00 22.28 ? 64   ASP A OD2 1 
ATOM   467  N  N   . ILE A 1 65  ? 45.910 -1.534  106.897 1.00 21.44 ? 65   ILE A N   1 
ATOM   468  C  CA  . ILE A 1 65  ? 46.576 -0.651  107.867 1.00 22.11 ? 65   ILE A CA  1 
ATOM   469  C  C   . ILE A 1 65  ? 46.109 -0.940  109.298 1.00 21.97 ? 65   ILE A C   1 
ATOM   470  O  O   . ILE A 1 65  ? 46.917 -0.972  110.227 1.00 22.76 ? 65   ILE A O   1 
ATOM   471  C  CB  . ILE A 1 65  ? 46.300 0.842   107.554 1.00 22.56 ? 65   ILE A CB  1 
ATOM   472  C  CG1 . ILE A 1 65  ? 46.686 1.192   106.111 1.00 22.77 ? 65   ILE A CG1 1 
ATOM   473  C  CG2 . ILE A 1 65  ? 47.029 1.746   108.537 1.00 23.04 ? 65   ILE A CG2 1 
ATOM   474  C  CD1 . ILE A 1 65  ? 48.140 0.953   105.755 1.00 23.06 ? 65   ILE A CD1 1 
ATOM   475  N  N   . HIS A 1 66  ? 44.801 -1.118  109.478 1.00 22.04 ? 66   HIS A N   1 
ATOM   476  C  CA  . HIS A 1 66  ? 44.223 -1.501  110.775 1.00 22.05 ? 66   HIS A CA  1 
ATOM   477  C  C   . HIS A 1 66  ? 44.663 -0.640  111.962 1.00 22.26 ? 66   HIS A C   1 
ATOM   478  O  O   . HIS A 1 66  ? 45.192 -1.136  112.963 1.00 22.42 ? 66   HIS A O   1 
ATOM   479  C  CB  . HIS A 1 66  ? 44.488 -2.987  111.053 1.00 21.85 ? 66   HIS A CB  1 
ATOM   480  C  CG  . HIS A 1 66  ? 43.552 -3.901  110.332 1.00 21.85 ? 66   HIS A CG  1 
ATOM   481  N  ND1 . HIS A 1 66  ? 42.184 -3.818  110.472 1.00 21.97 ? 66   HIS A ND1 1 
ATOM   482  C  CD2 . HIS A 1 66  ? 43.779 -4.912  109.463 1.00 21.65 ? 66   HIS A CD2 1 
ATOM   483  C  CE1 . HIS A 1 66  ? 41.609 -4.742  109.728 1.00 21.60 ? 66   HIS A CE1 1 
ATOM   484  N  NE2 . HIS A 1 66  ? 42.554 -5.415  109.101 1.00 22.03 ? 66   HIS A NE2 1 
ATOM   485  N  N   . GLY A 1 67  ? 44.437 0.661   111.835 1.00 22.75 ? 67   GLY A N   1 
ATOM   486  C  CA  . GLY A 1 67  ? 44.679 1.607   112.916 1.00 22.43 ? 67   GLY A CA  1 
ATOM   487  C  C   . GLY A 1 67  ? 46.106 1.713   113.441 1.00 22.82 ? 67   GLY A C   1 
ATOM   488  O  O   . GLY A 1 67  ? 46.324 2.253   114.520 1.00 22.63 ? 67   GLY A O   1 
ATOM   489  N  N   . GLN A 1 68  ? 47.077 1.212   112.687 1.00 23.23 ? 68   GLN A N   1 
ATOM   490  C  CA  . GLN A 1 68  ? 48.476 1.361   113.059 1.00 23.50 ? 68   GLN A CA  1 
ATOM   491  C  C   . GLN A 1 68  ? 48.981 2.668   112.466 1.00 23.15 ? 68   GLN A C   1 
ATOM   492  O  O   . GLN A 1 68  ? 49.696 2.683   111.465 1.00 24.04 ? 68   GLN A O   1 
ATOM   493  C  CB  . GLN A 1 68  ? 49.282 0.157   112.587 1.00 24.01 ? 68   GLN A CB  1 
ATOM   494  C  CG  . GLN A 1 68  ? 48.878 -1.113  113.323 1.00 24.03 ? 68   GLN A CG  1 
ATOM   495  C  CD  . GLN A 1 68  ? 49.668 -2.344  112.917 1.00 24.54 ? 68   GLN A CD  1 
ATOM   496  O  OE1 . GLN A 1 68  ? 49.192 -3.466  113.082 1.00 25.34 ? 68   GLN A OE1 1 
ATOM   497  N  NE2 . GLN A 1 68  ? 50.871 -2.147  112.392 1.00 24.18 ? 68   GLN A NE2 1 
ATOM   498  N  N   . TYR A 1 69  ? 48.587 3.766   113.107 1.00 22.92 ? 69   TYR A N   1 
ATOM   499  C  CA  . TYR A 1 69  ? 48.780 5.107   112.567 1.00 23.12 ? 69   TYR A CA  1 
ATOM   500  C  C   . TYR A 1 69  ? 50.237 5.431   112.273 1.00 23.99 ? 69   TYR A C   1 
ATOM   501  O  O   . TYR A 1 69  ? 50.544 6.046   111.252 1.00 23.18 ? 69   TYR A O   1 
ATOM   502  C  CB  . TYR A 1 69  ? 48.204 6.164   113.516 1.00 22.54 ? 69   TYR A CB  1 
ATOM   503  C  CG  . TYR A 1 69  ? 48.286 7.579   112.968 1.00 22.84 ? 69   TYR A CG  1 
ATOM   504  C  CD1 . TYR A 1 69  ? 47.734 7.895   111.733 1.00 23.27 ? 69   TYR A CD1 1 
ATOM   505  C  CD2 . TYR A 1 69  ? 48.917 8.598   113.681 1.00 22.81 ? 69   TYR A CD2 1 
ATOM   506  C  CE1 . TYR A 1 69  ? 47.795 9.183   111.222 1.00 23.05 ? 69   TYR A CE1 1 
ATOM   507  C  CE2 . TYR A 1 69  ? 48.983 9.891   113.177 1.00 23.02 ? 69   TYR A CE2 1 
ATOM   508  C  CZ  . TYR A 1 69  ? 48.423 10.173  111.943 1.00 23.14 ? 69   TYR A CZ  1 
ATOM   509  O  OH  . TYR A 1 69  ? 48.472 11.451  111.429 1.00 23.73 ? 69   TYR A OH  1 
ATOM   510  N  N   . TYR A 1 70  ? 51.140 5.023   113.160 1.00 24.82 ? 70   TYR A N   1 
ATOM   511  C  CA  . TYR A 1 70  ? 52.548 5.366   112.978 1.00 25.52 ? 70   TYR A CA  1 
ATOM   512  C  C   . TYR A 1 70  ? 53.193 4.558   111.854 1.00 25.45 ? 70   TYR A C   1 
ATOM   513  O  O   . TYR A 1 70  ? 54.197 4.977   111.289 1.00 24.58 ? 70   TYR A O   1 
ATOM   514  C  CB  . TYR A 1 70  ? 53.311 5.282   114.307 1.00 26.21 ? 70   TYR A CB  1 
ATOM   515  C  CG  . TYR A 1 70  ? 52.948 6.454   115.187 1.00 26.97 ? 70   TYR A CG  1 
ATOM   516  C  CD1 . TYR A 1 70  ? 51.757 6.466   115.910 1.00 27.73 ? 70   TYR A CD1 1 
ATOM   517  C  CD2 . TYR A 1 70  ? 53.755 7.582   115.239 1.00 27.62 ? 70   TYR A CD2 1 
ATOM   518  C  CE1 . TYR A 1 70  ? 51.405 7.560   116.685 1.00 28.81 ? 70   TYR A CE1 1 
ATOM   519  C  CE2 . TYR A 1 70  ? 53.406 8.681   116.010 1.00 28.56 ? 70   TYR A CE2 1 
ATOM   520  C  CZ  . TYR A 1 70  ? 52.237 8.663   116.732 1.00 28.60 ? 70   TYR A CZ  1 
ATOM   521  O  OH  . TYR A 1 70  ? 51.885 9.746   117.508 1.00 29.54 ? 70   TYR A OH  1 
ATOM   522  N  N   . ASP A 1 71  ? 52.573 3.440   111.490 1.00 25.80 ? 71   ASP A N   1 
ATOM   523  C  CA  . ASP A 1 71  ? 52.962 2.709   110.290 1.00 25.76 ? 71   ASP A CA  1 
ATOM   524  C  C   . ASP A 1 71  ? 52.369 3.325   109.006 1.00 24.64 ? 71   ASP A C   1 
ATOM   525  O  O   . ASP A 1 71  ? 52.984 3.225   107.951 1.00 24.01 ? 71   ASP A O   1 
ATOM   526  C  CB  . ASP A 1 71  ? 52.616 1.223   110.429 1.00 27.17 ? 71   ASP A CB  1 
ATOM   527  C  CG  . ASP A 1 71  ? 53.425 0.542   111.528 1.00 28.08 ? 71   ASP A CG  1 
ATOM   528  O  OD1 . ASP A 1 71  ? 54.661 0.741   111.580 1.00 29.23 ? 71   ASP A OD1 1 
ATOM   529  O  OD2 . ASP A 1 71  ? 52.831 -0.191  112.342 1.00 29.84 ? 71   ASP A OD2 1 
ATOM   530  N  N   . LEU A 1 72  ? 51.198 3.968   109.093 1.00 23.53 ? 72   LEU A N   1 
ATOM   531  C  CA  . LEU A 1 72  ? 50.695 4.786   107.979 1.00 23.07 ? 72   LEU A CA  1 
ATOM   532  C  C   . LEU A 1 72  ? 51.654 5.950   107.705 1.00 23.24 ? 72   LEU A C   1 
ATOM   533  O  O   . LEU A 1 72  ? 52.017 6.209   106.561 1.00 23.09 ? 72   LEU A O   1 
ATOM   534  C  CB  . LEU A 1 72  ? 49.281 5.332   108.246 1.00 21.93 ? 72   LEU A CB  1 
ATOM   535  C  CG  . LEU A 1 72  ? 48.685 6.216   107.135 1.00 21.71 ? 72   LEU A CG  1 
ATOM   536  C  CD1 . LEU A 1 72  ? 48.560 5.458   105.818 1.00 21.65 ? 72   LEU A CD1 1 
ATOM   537  C  CD2 . LEU A 1 72  ? 47.334 6.794   107.532 1.00 21.57 ? 72   LEU A CD2 1 
ATOM   538  N  N   . LEU A 1 73  ? 52.051 6.655   108.762 1.00 24.03 ? 73   LEU A N   1 
ATOM   539  C  CA  . LEU A 1 73  ? 53.031 7.738   108.628 1.00 24.58 ? 73   LEU A CA  1 
ATOM   540  C  C   . LEU A 1 73  ? 54.337 7.219   108.022 1.00 25.05 ? 73   LEU A C   1 
ATOM   541  O  O   . LEU A 1 73  ? 54.954 7.898   107.202 1.00 24.52 ? 73   LEU A O   1 
ATOM   542  C  CB  . LEU A 1 73  ? 53.302 8.420   109.975 1.00 25.14 ? 73   LEU A CB  1 
ATOM   543  C  CG  . LEU A 1 73  ? 52.132 9.140   110.655 1.00 25.67 ? 73   LEU A CG  1 
ATOM   544  C  CD1 . LEU A 1 73  ? 52.577 9.678   112.003 1.00 26.28 ? 73   LEU A CD1 1 
ATOM   545  C  CD2 . LEU A 1 73  ? 51.582 10.265  109.794 1.00 26.17 ? 73   LEU A CD2 1 
ATOM   546  N  N   . ARG A 1 74  ? 54.740 6.013   108.419 1.00 25.75 ? 74   ARG A N   1 
ATOM   547  C  CA  . ARG A 1 74  ? 55.917 5.357   107.845 1.00 27.03 ? 74   ARG A CA  1 
ATOM   548  C  C   . ARG A 1 74  ? 55.778 5.129   106.347 1.00 26.62 ? 74   ARG A C   1 
ATOM   549  O  O   . ARG A 1 74  ? 56.681 5.462   105.579 1.00 26.11 ? 74   ARG A O   1 
ATOM   550  C  CB  . ARG A 1 74  ? 56.201 4.010   108.518 1.00 28.70 ? 74   ARG A CB  1 
ATOM   551  C  CG  . ARG A 1 74  ? 57.254 4.067   109.607 1.00 29.97 ? 74   ARG A CG  1 
ATOM   552  C  CD  . ARG A 1 74  ? 58.322 3.004   109.405 1.00 31.40 ? 74   ARG A CD  1 
ATOM   553  N  NE  . ARG A 1 74  ? 57.870 1.664   109.759 1.00 31.64 ? 74   ARG A NE  1 
ATOM   554  C  CZ  . ARG A 1 74  ? 58.557 0.548   109.524 1.00 31.59 ? 74   ARG A CZ  1 
ATOM   555  N  NH1 . ARG A 1 74  ? 59.737 0.584   108.912 1.00 31.86 ? 74   ARG A NH1 1 
ATOM   556  N  NH2 . ARG A 1 74  ? 58.051 -0.623  109.895 1.00 32.63 ? 74   ARG A NH2 1 
ATOM   557  N  N   . LEU A 1 75  ? 54.651 4.552   105.935 1.00 25.03 ? 75   LEU A N   1 
ATOM   558  C  CA  . LEU A 1 75  ? 54.390 4.329   104.514 1.00 24.79 ? 75   LEU A CA  1 
ATOM   559  C  C   . LEU A 1 75  ? 54.580 5.609   103.705 1.00 23.41 ? 75   LEU A C   1 
ATOM   560  O  O   . LEU A 1 75  ? 55.167 5.583   102.631 1.00 22.77 ? 75   LEU A O   1 
ATOM   561  C  CB  . LEU A 1 75  ? 52.975 3.775   104.290 1.00 24.96 ? 75   LEU A CB  1 
ATOM   562  C  CG  . LEU A 1 75  ? 52.731 2.331   104.742 1.00 24.98 ? 75   LEU A CG  1 
ATOM   563  C  CD1 . LEU A 1 75  ? 51.241 2.038   104.850 1.00 24.73 ? 75   LEU A CD1 1 
ATOM   564  C  CD2 . LEU A 1 75  ? 53.406 1.338   103.809 1.00 25.59 ? 75   LEU A CD2 1 
ATOM   565  N  N   . PHE A 1 76  ? 54.095 6.731   104.224 1.00 23.97 ? 76   PHE A N   1 
ATOM   566  C  CA  . PHE A 1 76  ? 54.217 7.993   103.505 1.00 24.28 ? 76   PHE A CA  1 
ATOM   567  C  C   . PHE A 1 76  ? 55.660 8.496   103.452 1.00 25.69 ? 76   PHE A C   1 
ATOM   568  O  O   . PHE A 1 76  ? 56.061 9.081   102.450 1.00 25.64 ? 76   PHE A O   1 
ATOM   569  C  CB  . PHE A 1 76  ? 53.296 9.069   104.088 1.00 24.45 ? 76   PHE A CB  1 
ATOM   570  C  CG  . PHE A 1 76  ? 51.831 8.851   103.787 1.00 24.01 ? 76   PHE A CG  1 
ATOM   571  C  CD1 . PHE A 1 76  ? 51.395 8.635   102.488 1.00 23.49 ? 76   PHE A CD1 1 
ATOM   572  C  CD2 . PHE A 1 76  ? 50.893 8.881   104.803 1.00 23.60 ? 76   PHE A CD2 1 
ATOM   573  C  CE1 . PHE A 1 76  ? 50.052 8.432   102.210 1.00 23.99 ? 76   PHE A CE1 1 
ATOM   574  C  CE2 . PHE A 1 76  ? 49.546 8.682   104.533 1.00 23.78 ? 76   PHE A CE2 1 
ATOM   575  C  CZ  . PHE A 1 76  ? 49.124 8.462   103.234 1.00 23.42 ? 76   PHE A CZ  1 
ATOM   576  N  N   . GLU A 1 77  ? 56.438 8.288   104.511 1.00 26.58 ? 77   GLU A N   1 
ATOM   577  C  CA  . GLU A 1 77  ? 57.849 8.705   104.473 1.00 28.69 ? 77   GLU A CA  1 
ATOM   578  C  C   . GLU A 1 77  ? 58.705 7.797   103.574 1.00 27.25 ? 77   GLU A C   1 
ATOM   579  O  O   . GLU A 1 77  ? 59.733 8.236   103.078 1.00 26.58 ? 77   GLU A O   1 
ATOM   580  C  CB  . GLU A 1 77  ? 58.468 8.929   105.871 1.00 30.59 ? 77   GLU A CB  1 
ATOM   581  C  CG  . GLU A 1 77  ? 58.244 7.851   106.914 1.00 32.12 ? 77   GLU A CG  1 
ATOM   582  C  CD  . GLU A 1 77  ? 58.474 8.332   108.346 1.00 33.63 ? 77   GLU A CD  1 
ATOM   583  O  OE1 . GLU A 1 77  ? 57.992 9.422   108.724 1.00 35.79 ? 77   GLU A OE1 1 
ATOM   584  O  OE2 . GLU A 1 77  ? 59.130 7.603   109.109 1.00 34.23 ? 77   GLU A OE2 1 
ATOM   585  N  N   . TYR A 1 78  ? 58.268 6.558   103.336 1.00 26.09 ? 78   TYR A N   1 
ATOM   586  C  CA  . TYR A 1 78  ? 58.889 5.722   102.299 1.00 25.80 ? 78   TYR A CA  1 
ATOM   587  C  C   . TYR A 1 78  ? 58.363 6.085   100.906 1.00 24.95 ? 78   TYR A C   1 
ATOM   588  O  O   . TYR A 1 78  ? 59.134 6.270   99.973  1.00 24.59 ? 78   TYR A O   1 
ATOM   589  C  CB  . TYR A 1 78  ? 58.626 4.234   102.530 1.00 25.41 ? 78   TYR A CB  1 
ATOM   590  C  CG  . TYR A 1 78  ? 59.470 3.547   103.586 1.00 25.85 ? 78   TYR A CG  1 
ATOM   591  C  CD1 . TYR A 1 78  ? 59.454 3.970   104.915 1.00 26.41 ? 78   TYR A CD1 1 
ATOM   592  C  CD2 . TYR A 1 78  ? 60.245 2.433   103.266 1.00 25.49 ? 78   TYR A CD2 1 
ATOM   593  C  CE1 . TYR A 1 78  ? 60.200 3.322   105.883 1.00 26.17 ? 78   TYR A CE1 1 
ATOM   594  C  CE2 . TYR A 1 78  ? 60.992 1.779   104.231 1.00 25.20 ? 78   TYR A CE2 1 
ATOM   595  C  CZ  . TYR A 1 78  ? 60.969 2.227   105.532 1.00 25.81 ? 78   TYR A CZ  1 
ATOM   596  O  OH  . TYR A 1 78  ? 61.700 1.582   106.493 1.00 27.15 ? 78   TYR A OH  1 
ATOM   597  N  N   . GLY A 1 79  ? 57.041 6.168   100.764 1.00 23.77 ? 79   GLY A N   1 
ATOM   598  C  CA  . GLY A 1 79  ? 56.425 6.359   99.455  1.00 23.61 ? 79   GLY A CA  1 
ATOM   599  C  C   . GLY A 1 79  ? 56.412 7.795   98.964  1.00 24.00 ? 79   GLY A C   1 
ATOM   600  O  O   . GLY A 1 79  ? 56.331 8.038   97.762  1.00 23.85 ? 79   GLY A O   1 
ATOM   601  N  N   . GLY A 1 80  ? 56.495 8.740   99.897  1.00 24.70 ? 80   GLY A N   1 
ATOM   602  C  CA  . GLY A 1 80  ? 56.362 10.165  99.594  1.00 26.11 ? 80   GLY A CA  1 
ATOM   603  C  C   . GLY A 1 80  ? 55.007 10.658  100.059 1.00 26.62 ? 80   GLY A C   1 
ATOM   604  O  O   . GLY A 1 80  ? 53.993 10.003  99.825  1.00 27.05 ? 80   GLY A O   1 
ATOM   605  N  N   . PHE A 1 81  ? 54.985 11.795  100.743 1.00 28.05 ? 81   PHE A N   1 
ATOM   606  C  CA  . PHE A 1 81  ? 53.736 12.364  101.236 1.00 28.29 ? 81   PHE A CA  1 
ATOM   607  C  C   . PHE A 1 81  ? 52.972 12.999  100.079 1.00 27.71 ? 81   PHE A C   1 
ATOM   608  O  O   . PHE A 1 81  ? 53.585 13.635  99.221  1.00 29.20 ? 81   PHE A O   1 
ATOM   609  C  CB  . PHE A 1 81  ? 54.005 13.398  102.341 1.00 29.67 ? 81   PHE A CB  1 
ATOM   610  C  CG  . PHE A 1 81  ? 54.363 12.781  103.665 1.00 30.86 ? 81   PHE A CG  1 
ATOM   611  C  CD1 . PHE A 1 81  ? 55.670 12.413  103.945 1.00 31.75 ? 81   PHE A CD1 1 
ATOM   612  C  CD2 . PHE A 1 81  ? 53.384 12.547  104.625 1.00 31.63 ? 81   PHE A CD2 1 
ATOM   613  C  CE1 . PHE A 1 81  ? 56.000 11.827  105.157 1.00 31.92 ? 81   PHE A CE1 1 
ATOM   614  C  CE2 . PHE A 1 81  ? 53.706 11.965  105.842 1.00 32.14 ? 81   PHE A CE2 1 
ATOM   615  C  CZ  . PHE A 1 81  ? 55.019 11.605  106.107 1.00 32.41 ? 81   PHE A CZ  1 
ATOM   616  N  N   . PRO A 1 82  ? 51.634 12.829  100.043 1.00 27.39 ? 82   PRO A N   1 
ATOM   617  C  CA  . PRO A 1 82  ? 50.846 13.480  98.993  1.00 27.83 ? 82   PRO A CA  1 
ATOM   618  C  C   . PRO A 1 82  ? 51.117 14.985  98.969  1.00 28.53 ? 82   PRO A C   1 
ATOM   619  O  O   . PRO A 1 82  ? 51.244 15.575  100.039 1.00 30.87 ? 82   PRO A O   1 
ATOM   620  C  CB  . PRO A 1 82  ? 49.398 13.211  99.417  1.00 27.05 ? 82   PRO A CB  1 
ATOM   621  C  CG  . PRO A 1 82  ? 49.463 11.979  100.249 1.00 26.96 ? 82   PRO A CG  1 
ATOM   622  C  CD  . PRO A 1 82  ? 50.791 12.034  100.953 1.00 26.62 ? 82   PRO A CD  1 
ATOM   623  N  N   . PRO A 1 83  ? 51.197 15.611  97.795  1.00 28.46 ? 83   PRO A N   1 
ATOM   624  C  CA  . PRO A 1 83  ? 50.935 14.990  96.501  1.00 28.69 ? 83   PRO A CA  1 
ATOM   625  C  C   . PRO A 1 83  ? 52.197 14.558  95.737  1.00 30.08 ? 83   PRO A C   1 
ATOM   626  O  O   . PRO A 1 83  ? 52.162 14.459  94.508  1.00 28.89 ? 83   PRO A O   1 
ATOM   627  C  CB  . PRO A 1 83  ? 50.218 16.111  95.746  1.00 29.01 ? 83   PRO A CB  1 
ATOM   628  C  CG  . PRO A 1 83  ? 50.855 17.360  96.274  1.00 28.27 ? 83   PRO A CG  1 
ATOM   629  C  CD  . PRO A 1 83  ? 51.388 17.065  97.658  1.00 28.89 ? 83   PRO A CD  1 
ATOM   630  N  N   . GLU A 1 84  ? 53.296 14.295  96.445  1.00 30.20 ? 84   GLU A N   1 
ATOM   631  C  CA  . GLU A 1 84  ? 54.531 13.842  95.793  1.00 30.40 ? 84   GLU A CA  1 
ATOM   632  C  C   . GLU A 1 84  ? 54.295 12.538  95.031  1.00 28.49 ? 84   GLU A C   1 
ATOM   633  O  O   . GLU A 1 84  ? 54.829 12.346  93.937  1.00 27.63 ? 84   GLU A O   1 
ATOM   634  C  CB  . GLU A 1 84  ? 55.645 13.655  96.827  1.00 33.38 ? 84   GLU A CB  1 
ATOM   635  C  CG  . GLU A 1 84  ? 57.003 13.301  96.238  1.00 36.23 ? 84   GLU A CG  1 
ATOM   636  C  CD  . GLU A 1 84  ? 58.057 13.081  97.305  1.00 37.57 ? 84   GLU A CD  1 
ATOM   637  O  OE1 . GLU A 1 84  ? 58.157 13.926  98.217  1.00 39.44 ? 84   GLU A OE1 1 
ATOM   638  O  OE2 . GLU A 1 84  ? 58.782 12.062  97.235  1.00 39.20 ? 84   GLU A OE2 1 
ATOM   639  N  N   . SER A 1 85  ? 53.488 11.654  95.619  1.00 26.26 ? 85   SER A N   1 
ATOM   640  C  CA  . SER A 1 85  ? 53.084 10.406  94.987  1.00 24.66 ? 85   SER A CA  1 
ATOM   641  C  C   . SER A 1 85  ? 51.560 10.274  94.997  1.00 23.44 ? 85   SER A C   1 
ATOM   642  O  O   . SER A 1 85  ? 50.880 10.907  95.802  1.00 22.23 ? 85   SER A O   1 
ATOM   643  C  CB  . SER A 1 85  ? 53.717 9.225   95.719  1.00 25.39 ? 85   SER A CB  1 
ATOM   644  O  OG  . SER A 1 85  ? 55.136 9.306   95.689  1.00 26.39 ? 85   SER A OG  1 
ATOM   645  N  N   . ASN A 1 86  ? 51.037 9.464   94.084  1.00 22.73 ? 86   ASN A N   1 
ATOM   646  C  CA  . ASN A 1 86  ? 49.612 9.136   94.044  1.00 22.43 ? 86   ASN A CA  1 
ATOM   647  C  C   . ASN A 1 86  ? 49.404 7.829   94.787  1.00 20.75 ? 86   ASN A C   1 
ATOM   648  O  O   . ASN A 1 86  ? 50.260 6.953   94.722  1.00 19.94 ? 86   ASN A O   1 
ATOM   649  C  CB  . ASN A 1 86  ? 49.139 8.975   92.603  1.00 23.28 ? 86   ASN A CB  1 
ATOM   650  C  CG  . ASN A 1 86  ? 49.409 10.202  91.763  1.00 23.82 ? 86   ASN A CG  1 
ATOM   651  O  OD1 . ASN A 1 86  ? 49.129 11.319  92.182  1.00 25.00 ? 86   ASN A OD1 1 
ATOM   652  N  ND2 . ASN A 1 86  ? 49.950 10.001  90.568  1.00 24.86 ? 86   ASN A ND2 1 
ATOM   653  N  N   . TYR A 1 87  ? 48.264 7.685   95.464  1.00 19.34 ? 87   TYR A N   1 
ATOM   654  C  CA  . TYR A 1 87  ? 48.008 6.512   96.304  1.00 18.26 ? 87   TYR A CA  1 
ATOM   655  C  C   . TYR A 1 87  ? 46.675 5.824   96.013  1.00 17.98 ? 87   TYR A C   1 
ATOM   656  O  O   . TYR A 1 87  ? 45.652 6.474   95.772  1.00 17.83 ? 87   TYR A O   1 
ATOM   657  C  CB  . TYR A 1 87  ? 48.084 6.889   97.797  1.00 17.88 ? 87   TYR A CB  1 
ATOM   658  C  CG  . TYR A 1 87  ? 49.501 7.102   98.295  1.00 17.68 ? 87   TYR A CG  1 
ATOM   659  C  CD1 . TYR A 1 87  ? 50.246 6.043   98.804  1.00 17.68 ? 87   TYR A CD1 1 
ATOM   660  C  CD2 . TYR A 1 87  ? 50.098 8.360   98.254  1.00 18.06 ? 87   TYR A CD2 1 
ATOM   661  C  CE1 . TYR A 1 87  ? 51.549 6.218   99.245  1.00 17.38 ? 87   TYR A CE1 1 
ATOM   662  C  CE2 . TYR A 1 87  ? 51.408 8.549   98.688  1.00 17.92 ? 87   TYR A CE2 1 
ATOM   663  C  CZ  . TYR A 1 87  ? 52.127 7.474   99.184  1.00 18.25 ? 87   TYR A CZ  1 
ATOM   664  O  OH  . TYR A 1 87  ? 53.434 7.643   99.619  1.00 19.58 ? 87   TYR A OH  1 
ATOM   665  N  N   . LEU A 1 88  ? 46.707 4.495   96.042  1.00 17.74 ? 88   LEU A N   1 
ATOM   666  C  CA  . LEU A 1 88  ? 45.509 3.682   96.145  1.00 17.98 ? 88   LEU A CA  1 
ATOM   667  C  C   . LEU A 1 88  ? 45.637 2.779   97.380  1.00 17.89 ? 88   LEU A C   1 
ATOM   668  O  O   . LEU A 1 88  ? 46.572 1.980   97.486  1.00 17.66 ? 88   LEU A O   1 
ATOM   669  C  CB  . LEU A 1 88  ? 45.314 2.828   94.889  1.00 18.15 ? 88   LEU A CB  1 
ATOM   670  C  CG  . LEU A 1 88  ? 44.150 1.833   94.901  1.00 18.08 ? 88   LEU A CG  1 
ATOM   671  C  CD1 . LEU A 1 88  ? 42.810 2.549   95.023  1.00 18.10 ? 88   LEU A CD1 1 
ATOM   672  C  CD2 . LEU A 1 88  ? 44.166 0.954   93.660  1.00 18.29 ? 88   LEU A CD2 1 
ATOM   673  N  N   . PHE A 1 89  ? 44.700 2.914   98.306  1.00 17.11 ? 89   PHE A N   1 
ATOM   674  C  CA  . PHE A 1 89  ? 44.596 2.013   99.450  1.00 16.90 ? 89   PHE A CA  1 
ATOM   675  C  C   . PHE A 1 89  ? 43.469 1.010   99.212  1.00 17.33 ? 89   PHE A C   1 
ATOM   676  O  O   . PHE A 1 89  ? 42.424 1.352   98.635  1.00 16.46 ? 89   PHE A O   1 
ATOM   677  C  CB  . PHE A 1 89  ? 44.354 2.803   100.730 1.00 16.85 ? 89   PHE A CB  1 
ATOM   678  C  CG  . PHE A 1 89  ? 45.564 3.540   101.230 1.00 17.26 ? 89   PHE A CG  1 
ATOM   679  C  CD1 . PHE A 1 89  ? 45.905 4.790   100.713 1.00 17.48 ? 89   PHE A CD1 1 
ATOM   680  C  CD2 . PHE A 1 89  ? 46.363 2.995   102.226 1.00 17.11 ? 89   PHE A CD2 1 
ATOM   681  C  CE1 . PHE A 1 89  ? 47.027 5.465   101.172 1.00 17.60 ? 89   PHE A CE1 1 
ATOM   682  C  CE2 . PHE A 1 89  ? 47.485 3.669   102.690 1.00 17.22 ? 89   PHE A CE2 1 
ATOM   683  C  CZ  . PHE A 1 89  ? 47.820 4.903   102.162 1.00 17.48 ? 89   PHE A CZ  1 
ATOM   684  N  N   . LEU A 1 90  ? 43.683 -0.224  99.665  1.00 17.62 ? 90   LEU A N   1 
ATOM   685  C  CA  . LEU A 1 90  ? 42.774 -1.324  99.374  1.00 17.95 ? 90   LEU A CA  1 
ATOM   686  C  C   . LEU A 1 90  ? 41.800 -1.690  100.504 1.00 17.89 ? 90   LEU A C   1 
ATOM   687  O  O   . LEU A 1 90  ? 41.210 -2.767  100.466 1.00 17.44 ? 90   LEU A O   1 
ATOM   688  C  CB  . LEU A 1 90  ? 43.579 -2.561  98.973  1.00 18.42 ? 90   LEU A CB  1 
ATOM   689  C  CG  . LEU A 1 90  ? 44.594 -2.381  97.840  1.00 18.82 ? 90   LEU A CG  1 
ATOM   690  C  CD1 . LEU A 1 90  ? 45.381 -3.671  97.649  1.00 19.53 ? 90   LEU A CD1 1 
ATOM   691  C  CD2 . LEU A 1 90  ? 43.926 -1.966  96.538  1.00 19.13 ? 90   LEU A CD2 1 
ATOM   692  N  N   . GLY A 1 91  ? 41.651 -0.829  101.510 1.00 17.56 ? 91   GLY A N   1 
ATOM   693  C  CA  . GLY A 1 91  ? 40.681 -1.068  102.586 1.00 18.54 ? 91   GLY A CA  1 
ATOM   694  C  C   . GLY A 1 91  ? 41.260 -1.502  103.928 1.00 18.62 ? 91   GLY A C   1 
ATOM   695  O  O   . GLY A 1 91  ? 42.481 -1.610  104.100 1.00 19.53 ? 91   GLY A O   1 
ATOM   696  N  N   . ASP A 1 92  ? 40.369 -1.748  104.883 1.00 18.52 ? 92   ASP A N   1 
ATOM   697  C  CA  . ASP A 1 92  ? 40.741 -2.162  106.247 1.00 18.73 ? 92   ASP A CA  1 
ATOM   698  C  C   . ASP A 1 92  ? 41.652 -1.149  106.939 1.00 18.37 ? 92   ASP A C   1 
ATOM   699  O  O   . ASP A 1 92  ? 42.792 -1.433  107.332 1.00 19.48 ? 92   ASP A O   1 
ATOM   700  C  CB  . ASP A 1 92  ? 41.325 -3.596  106.253 1.00 19.18 ? 92   ASP A CB  1 
ATOM   701  C  CG  . ASP A 1 92  ? 40.246 -4.662  106.156 1.00 20.15 ? 92   ASP A CG  1 
ATOM   702  O  OD1 . ASP A 1 92  ? 39.075 -4.298  105.932 1.00 21.83 ? 92   ASP A OD1 1 
ATOM   703  O  OD2 . ASP A 1 92  ? 40.550 -5.873  106.299 1.00 20.74 ? 92   ASP A OD2 1 
ATOM   704  N  N   . TYR A 1 93  ? 41.096 0.044   107.089 1.00 17.80 ? 93   TYR A N   1 
ATOM   705  C  CA  . TYR A 1 93  ? 41.770 1.178   107.693 1.00 17.64 ? 93   TYR A CA  1 
ATOM   706  C  C   . TYR A 1 93  ? 41.640 1.145   109.201 1.00 18.02 ? 93   TYR A C   1 
ATOM   707  O  O   . TYR A 1 93  ? 42.526 1.625   109.912 1.00 17.00 ? 93   TYR A O   1 
ATOM   708  C  CB  . TYR A 1 93  ? 41.162 2.474   107.154 1.00 17.07 ? 93   TYR A CB  1 
ATOM   709  C  CG  . TYR A 1 93  ? 41.050 2.443   105.659 1.00 16.65 ? 93   TYR A CG  1 
ATOM   710  C  CD1 . TYR A 1 93  ? 42.190 2.318   104.883 1.00 16.56 ? 93   TYR A CD1 1 
ATOM   711  C  CD2 . TYR A 1 93  ? 39.813 2.497   105.016 1.00 16.19 ? 93   TYR A CD2 1 
ATOM   712  C  CE1 . TYR A 1 93  ? 42.118 2.261   103.521 1.00 16.56 ? 93   TYR A CE1 1 
ATOM   713  C  CE2 . TYR A 1 93  ? 39.733 2.436   103.634 1.00 16.20 ? 93   TYR A CE2 1 
ATOM   714  C  CZ  . TYR A 1 93  ? 40.901 2.321   102.896 1.00 16.17 ? 93   TYR A CZ  1 
ATOM   715  O  OH  . TYR A 1 93  ? 40.881 2.254   101.526 1.00 17.19 ? 93   TYR A OH  1 
ATOM   716  N  N   . VAL A 1 94  ? 40.542 0.557   109.681 1.00 18.43 ? 94   VAL A N   1 
ATOM   717  C  CA  . VAL A 1 94  ? 40.200 0.592   111.094 1.00 19.94 ? 94   VAL A CA  1 
ATOM   718  C  C   . VAL A 1 94  ? 40.171 -0.811  111.705 1.00 20.80 ? 94   VAL A C   1 
ATOM   719  O  O   . VAL A 1 94  ? 40.329 -1.811  111.000 1.00 21.28 ? 94   VAL A O   1 
ATOM   720  C  CB  . VAL A 1 94  ? 38.844 1.298   111.326 1.00 19.77 ? 94   VAL A CB  1 
ATOM   721  C  CG1 . VAL A 1 94  ? 38.869 2.699   110.727 1.00 19.98 ? 94   VAL A CG1 1 
ATOM   722  C  CG2 . VAL A 1 94  ? 37.689 0.488   110.752 1.00 20.25 ? 94   VAL A CG2 1 
ATOM   723  N  N   . ASP A 1 95  ? 39.956 -0.848  113.019 1.00 22.52 ? 95   ASP A N   1 
ATOM   724  C  CA  . ASP A 1 95  ? 39.929 -2.074  113.840 1.00 23.74 ? 95   ASP A CA  1 
ATOM   725  C  C   . ASP A 1 95  ? 41.317 -2.625  114.158 1.00 24.25 ? 95   ASP A C   1 
ATOM   726  O  O   . ASP A 1 95  ? 42.269 -2.445  113.391 1.00 22.80 ? 95   ASP A O   1 
ATOM   727  C  CB  . ASP A 1 95  ? 39.053 -3.187  113.235 1.00 23.80 ? 95   ASP A CB  1 
ATOM   728  C  CG  . ASP A 1 95  ? 37.574 -2.844  113.236 1.00 24.55 ? 95   ASP A CG  1 
ATOM   729  O  OD1 . ASP A 1 95  ? 37.138 -2.040  114.082 1.00 26.58 ? 95   ASP A OD1 1 
ATOM   730  O  OD2 . ASP A 1 95  ? 36.843 -3.395  112.383 1.00 24.78 ? 95   ASP A OD2 1 
ATOM   731  N  N   . ARG A 1 96  ? 41.393 -3.286  115.315 1.00 26.36 ? 96   ARG A N   1 
ATOM   732  C  CA  . ARG A 1 96  ? 42.572 -4.012  115.807 1.00 28.59 ? 96   ARG A CA  1 
ATOM   733  C  C   . ARG A 1 96  ? 43.678 -3.115  116.353 1.00 28.87 ? 96   ARG A C   1 
ATOM   734  O  O   . ARG A 1 96  ? 44.124 -3.312  117.484 1.00 28.30 ? 96   ARG A O   1 
ATOM   735  C  CB  . ARG A 1 96  ? 43.105 -5.012  114.773 1.00 30.83 ? 96   ARG A CB  1 
ATOM   736  C  CG  . ARG A 1 96  ? 42.040 -5.996  114.311 1.00 33.96 ? 96   ARG A CG  1 
ATOM   737  C  CD  . ARG A 1 96  ? 42.572 -7.413  114.201 1.00 36.68 ? 96   ARG A CD  1 
ATOM   738  N  NE  . ARG A 1 96  ? 41.519 -8.368  113.857 1.00 39.82 ? 96   ARG A NE  1 
ATOM   739  C  CZ  . ARG A 1 96  ? 41.001 -8.539  112.640 1.00 42.10 ? 96   ARG A CZ  1 
ATOM   740  N  NH1 . ARG A 1 96  ? 41.421 -7.815  111.604 1.00 44.43 ? 96   ARG A NH1 1 
ATOM   741  N  NH2 . ARG A 1 96  ? 40.041 -9.441  112.456 1.00 43.53 ? 96   ARG A NH2 1 
ATOM   742  N  N   . GLY A 1 97  ? 44.113 -2.128  115.577 1.00 29.25 ? 97   GLY A N   1 
ATOM   743  C  CA  . GLY A 1 97  ? 45.110 -1.175  116.058 1.00 29.85 ? 97   GLY A CA  1 
ATOM   744  C  C   . GLY A 1 97  ? 44.557 -0.237  117.113 1.00 29.75 ? 97   GLY A C   1 
ATOM   745  O  O   . GLY A 1 97  ? 43.359 -0.224  117.385 1.00 30.08 ? 97   GLY A O   1 
ATOM   746  N  N   . LYS A 1 98  ? 45.439 0.567   117.695 1.00 31.10 ? 98   LYS A N   1 
ATOM   747  C  CA  . LYS A 1 98  ? 45.073 1.448   118.800 1.00 31.01 ? 98   LYS A CA  1 
ATOM   748  C  C   . LYS A 1 98  ? 44.693 2.856   118.341 1.00 29.63 ? 98   LYS A C   1 
ATOM   749  O  O   . LYS A 1 98  ? 44.133 3.628   119.122 1.00 29.23 ? 98   LYS A O   1 
ATOM   750  C  CB  . LYS A 1 98  ? 46.220 1.495   119.813 1.00 33.70 ? 98   LYS A CB  1 
ATOM   751  C  CG  . LYS A 1 98  ? 46.503 0.131   120.429 1.00 35.79 ? 98   LYS A CG  1 
ATOM   752  C  CD  . LYS A 1 98  ? 47.695 0.138   121.373 1.00 38.50 ? 98   LYS A CD  1 
ATOM   753  C  CE  . LYS A 1 98  ? 47.920 -1.248  121.969 1.00 39.72 ? 98   LYS A CE  1 
ATOM   754  N  NZ  . LYS A 1 98  ? 49.364 -1.529  122.208 1.00 41.18 ? 98   LYS A NZ  1 
ATOM   755  N  N   . GLN A 1 99  ? 44.963 3.186   117.077 1.00 27.08 ? 99   GLN A N   1 
ATOM   756  C  CA  . GLN A 1 99  ? 44.705 4.535   116.564 1.00 26.37 ? 99   GLN A CA  1 
ATOM   757  C  C   . GLN A 1 99  ? 44.007 4.516   115.195 1.00 25.21 ? 99   GLN A C   1 
ATOM   758  O  O   . GLN A 1 99  ? 44.537 5.019   114.201 1.00 25.21 ? 99   GLN A O   1 
ATOM   759  C  CB  . GLN A 1 99  ? 46.014 5.331   116.509 1.00 26.18 ? 99   GLN A CB  1 
ATOM   760  C  CG  . GLN A 1 99  ? 46.618 5.587   117.883 1.00 27.18 ? 99   GLN A CG  1 
ATOM   761  C  CD  . GLN A 1 99  ? 47.895 6.399   117.821 1.00 27.31 ? 99   GLN A CD  1 
ATOM   762  O  OE1 . GLN A 1 99  ? 48.985 5.846   117.720 1.00 26.89 ? 99   GLN A OE1 1 
ATOM   763  N  NE2 . GLN A 1 99  ? 47.765 7.723   117.889 1.00 28.02 ? 99   GLN A NE2 1 
ATOM   764  N  N   . SER A 1 100 ? 42.814 3.927   115.167 1.00 24.12 ? 100  SER A N   1 
ATOM   765  C  CA  . SER A 1 100 ? 41.976 3.904   113.970 1.00 23.32 ? 100  SER A CA  1 
ATOM   766  C  C   . SER A 1 100 ? 41.528 5.305   113.577 1.00 23.52 ? 100  SER A C   1 
ATOM   767  O  O   . SER A 1 100 ? 41.358 5.591   112.393 1.00 23.45 ? 100  SER A O   1 
ATOM   768  C  CB  . SER A 1 100 ? 40.740 3.024   114.188 1.00 23.12 ? 100  SER A CB  1 
ATOM   769  O  OG  . SER A 1 100 ? 41.092 1.660   114.313 1.00 23.01 ? 100  SER A OG  1 
ATOM   770  N  N   . LEU A 1 101 ? 41.323 6.168   114.572 1.00 23.75 ? 101  LEU A N   1 
ATOM   771  C  CA  . LEU A 1 101 ? 40.789 7.507   114.328 1.00 24.16 ? 101  LEU A CA  1 
ATOM   772  C  C   . LEU A 1 101 ? 41.780 8.389   113.590 1.00 23.10 ? 101  LEU A C   1 
ATOM   773  O  O   . LEU A 1 101 ? 41.415 9.033   112.604 1.00 23.56 ? 101  LEU A O   1 
ATOM   774  C  CB  . LEU A 1 101 ? 40.348 8.172   115.640 1.00 24.70 ? 101  LEU A CB  1 
ATOM   775  C  CG  . LEU A 1 101 ? 38.983 7.707   116.152 1.00 25.08 ? 101  LEU A CG  1 
ATOM   776  C  CD1 . LEU A 1 101 ? 38.785 8.123   117.603 1.00 25.76 ? 101  LEU A CD1 1 
ATOM   777  C  CD2 . LEU A 1 101 ? 37.858 8.233   115.274 1.00 25.35 ? 101  LEU A CD2 1 
ATOM   778  N  N   . GLU A 1 102 ? 43.029 8.415   114.056 1.00 22.78 ? 102  GLU A N   1 
ATOM   779  C  CA  . GLU A 1 102 ? 44.083 9.159   113.364 1.00 22.27 ? 102  GLU A CA  1 
ATOM   780  C  C   . GLU A 1 102 ? 44.303 8.598   111.962 1.00 21.28 ? 102  GLU A C   1 
ATOM   781  O  O   . GLU A 1 102 ? 44.501 9.350   111.004 1.00 20.88 ? 102  GLU A O   1 
ATOM   782  C  CB  . GLU A 1 102 ? 45.405 9.132   114.141 1.00 22.97 ? 102  GLU A CB  1 
ATOM   783  C  CG  . GLU A 1 102 ? 45.444 10.009  115.386 1.00 23.86 ? 102  GLU A CG  1 
ATOM   784  C  CD  . GLU A 1 102 ? 44.830 9.367   116.616 1.00 23.74 ? 102  GLU A CD  1 
ATOM   785  O  OE1 . GLU A 1 102 ? 44.149 8.325   116.501 1.00 24.38 ? 102  GLU A OE1 1 
ATOM   786  O  OE2 . GLU A 1 102 ? 45.027 9.920   117.718 1.00 24.47 ? 102  GLU A OE2 1 
ATOM   787  N  N   . THR A 1 103 ? 44.252 7.279   111.842 1.00 20.76 ? 103  THR A N   1 
ATOM   788  C  CA  . THR A 1 103 ? 44.473 6.617   110.559 1.00 20.32 ? 103  THR A CA  1 
ATOM   789  C  C   . THR A 1 103 ? 43.433 7.038   109.525 1.00 20.41 ? 103  THR A C   1 
ATOM   790  O  O   . THR A 1 103 ? 43.787 7.576   108.473 1.00 20.92 ? 103  THR A O   1 
ATOM   791  C  CB  . THR A 1 103 ? 44.480 5.089   110.734 1.00 20.42 ? 103  THR A CB  1 
ATOM   792  O  OG1 . THR A 1 103 ? 45.546 4.726   111.625 1.00 20.20 ? 103  THR A OG1 1 
ATOM   793  C  CG2 . THR A 1 103 ? 44.676 4.379   109.402 1.00 20.51 ? 103  THR A CG2 1 
ATOM   794  N  N   . ILE A 1 104 ? 42.157 6.812   109.824 1.00 19.73 ? 104  ILE A N   1 
ATOM   795  C  CA  . ILE A 1 104 ? 41.095 7.145   108.874 1.00 20.03 ? 104  ILE A CA  1 
ATOM   796  C  C   . ILE A 1 104 ? 41.022 8.653   108.620 1.00 20.53 ? 104  ILE A C   1 
ATOM   797  O  O   . ILE A 1 104 ? 40.807 9.078   107.483 1.00 19.33 ? 104  ILE A O   1 
ATOM   798  C  CB  . ILE A 1 104 ? 39.714 6.582   109.301 1.00 19.53 ? 104  ILE A CB  1 
ATOM   799  C  CG1 . ILE A 1 104 ? 38.692 6.696   108.162 1.00 19.26 ? 104  ILE A CG1 1 
ATOM   800  C  CG2 . ILE A 1 104 ? 39.173 7.289   110.544 1.00 19.70 ? 104  ILE A CG2 1 
ATOM   801  C  CD1 . ILE A 1 104 ? 39.043 5.936   106.904 1.00 19.45 ? 104  ILE A CD1 1 
ATOM   802  N  N   . CYS A 1 105 ? 41.228 9.459   109.661 1.00 21.04 ? 105  CYS A N   1 
ATOM   803  C  CA  . CYS A 1 105 ? 41.186 10.919  109.501 1.00 21.67 ? 105  CYS A CA  1 
ATOM   804  C  C   . CYS A 1 105 ? 42.207 11.480  108.509 1.00 22.19 ? 105  CYS A C   1 
ATOM   805  O  O   . CYS A 1 105 ? 41.872 12.366  107.711 1.00 22.40 ? 105  CYS A O   1 
ATOM   806  C  CB  . CYS A 1 105 ? 41.310 11.626  110.854 1.00 22.66 ? 105  CYS A CB  1 
ATOM   807  S  SG  . CYS A 1 105 ? 39.762 11.605  111.780 1.00 24.94 ? 105  CYS A SG  1 
ATOM   808  N  N   . LEU A 1 106 ? 43.445 10.989  108.558 1.00 21.50 ? 106  LEU A N   1 
ATOM   809  C  CA  . LEU A 1 106 ? 44.477 11.454  107.630 1.00 21.50 ? 106  LEU A CA  1 
ATOM   810  C  C   . LEU A 1 106 ? 44.183 10.999  106.212 1.00 20.80 ? 106  LEU A C   1 
ATOM   811  O  O   . LEU A 1 106 ? 44.404 11.748  105.265 1.00 20.79 ? 106  LEU A O   1 
ATOM   812  C  CB  . LEU A 1 106 ? 45.865 10.970  108.051 1.00 21.81 ? 106  LEU A CB  1 
ATOM   813  C  CG  . LEU A 1 106 ? 47.035 11.460  107.197 1.00 21.80 ? 106  LEU A CG  1 
ATOM   814  C  CD1 . LEU A 1 106 ? 47.085 12.984  107.158 1.00 22.57 ? 106  LEU A CD1 1 
ATOM   815  C  CD2 . LEU A 1 106 ? 48.343 10.903  107.717 1.00 21.87 ? 106  LEU A CD2 1 
ATOM   816  N  N   . LEU A 1 107 ? 43.673 9.778   106.074 1.00 20.15 ? 107  LEU A N   1 
ATOM   817  C  CA  . LEU A 1 107 ? 43.266 9.252   104.773 1.00 19.59 ? 107  LEU A CA  1 
ATOM   818  C  C   . LEU A 1 107 ? 42.104 10.042  104.152 1.00 20.31 ? 107  LEU A C   1 
ATOM   819  O  O   . LEU A 1 107 ? 42.109 10.322  102.949 1.00 20.16 ? 107  LEU A O   1 
ATOM   820  C  CB  . LEU A 1 107 ? 42.868 7.778   104.898 1.00 19.15 ? 107  LEU A CB  1 
ATOM   821  C  CG  . LEU A 1 107 ? 43.982 6.805   105.288 1.00 18.74 ? 107  LEU A CG  1 
ATOM   822  C  CD1 . LEU A 1 107 ? 43.407 5.413   105.500 1.00 18.46 ? 107  LEU A CD1 1 
ATOM   823  C  CD2 . LEU A 1 107 ? 45.097 6.776   104.254 1.00 18.42 ? 107  LEU A CD2 1 
ATOM   824  N  N   . LEU A 1 108 ? 41.111 10.392  104.968 1.00 19.78 ? 108  LEU A N   1 
ATOM   825  C  CA  . LEU A 1 108 ? 39.989 11.185  104.489 1.00 20.60 ? 108  LEU A CA  1 
ATOM   826  C  C   . LEU A 1 108 ? 40.415 12.623  104.202 1.00 20.83 ? 108  LEU A C   1 
ATOM   827  O  O   . LEU A 1 108 ? 39.946 13.229  103.235 1.00 20.94 ? 108  LEU A O   1 
ATOM   828  C  CB  . LEU A 1 108 ? 38.822 11.161  105.484 1.00 20.40 ? 108  LEU A CB  1 
ATOM   829  C  CG  . LEU A 1 108 ? 38.124 9.823   105.714 1.00 20.37 ? 108  LEU A CG  1 
ATOM   830  C  CD1 . LEU A 1 108 ? 37.031 9.985   106.755 1.00 19.43 ? 108  LEU A CD1 1 
ATOM   831  C  CD2 . LEU A 1 108 ? 37.560 9.244   104.423 1.00 20.65 ? 108  LEU A CD2 1 
ATOM   832  N  N   . ALA A 1 109 ? 41.310 13.158  105.025 1.00 21.65 ? 109  ALA A N   1 
ATOM   833  C  CA  . ALA A 1 109 ? 41.844 14.501  104.808 1.00 22.04 ? 109  ALA A CA  1 
ATOM   834  C  C   . ALA A 1 109 ? 42.553 14.589  103.459 1.00 22.66 ? 109  ALA A C   1 
ATOM   835  O  O   . ALA A 1 109 ? 42.266 15.479  102.656 1.00 22.89 ? 109  ALA A O   1 
ATOM   836  C  CB  . ALA A 1 109 ? 42.790 14.889  105.931 1.00 22.05 ? 109  ALA A CB  1 
ATOM   837  N  N   . TYR A 1 110 ? 43.466 13.653  103.209 1.00 23.23 ? 110  TYR A N   1 
ATOM   838  C  CA  . TYR A 1 110 ? 44.165 13.591  101.930 1.00 22.80 ? 110  TYR A CA  1 
ATOM   839  C  C   . TYR A 1 110 ? 43.237 13.349  100.728 1.00 22.32 ? 110  TYR A C   1 
ATOM   840  O  O   . TYR A 1 110 ? 43.522 13.839  99.638  1.00 22.13 ? 110  TYR A O   1 
ATOM   841  C  CB  . TYR A 1 110 ? 45.272 12.528  101.949 1.00 23.23 ? 110  TYR A CB  1 
ATOM   842  C  CG  . TYR A 1 110 ? 46.587 12.959  102.579 1.00 23.24 ? 110  TYR A CG  1 
ATOM   843  C  CD1 . TYR A 1 110 ? 47.131 14.224  102.348 1.00 23.54 ? 110  TYR A CD1 1 
ATOM   844  C  CD2 . TYR A 1 110 ? 47.309 12.077  103.368 1.00 23.34 ? 110  TYR A CD2 1 
ATOM   845  C  CE1 . TYR A 1 110 ? 48.346 14.590  102.905 1.00 24.12 ? 110  TYR A CE1 1 
ATOM   846  C  CE2 . TYR A 1 110 ? 48.515 12.436  103.934 1.00 23.84 ? 110  TYR A CE2 1 
ATOM   847  C  CZ  . TYR A 1 110 ? 49.028 13.689  103.705 1.00 24.34 ? 110  TYR A CZ  1 
ATOM   848  O  OH  . TYR A 1 110 ? 50.229 14.023  104.279 1.00 26.00 ? 110  TYR A OH  1 
ATOM   849  N  N   . LYS A 1 111 ? 42.149 12.598  100.918 1.00 22.33 ? 111  LYS A N   1 
ATOM   850  C  CA  . LYS A 1 111 ? 41.149 12.400  99.862  1.00 22.71 ? 111  LYS A CA  1 
ATOM   851  C  C   . LYS A 1 111 ? 40.451 13.713  99.487  1.00 24.15 ? 111  LYS A C   1 
ATOM   852  O  O   . LYS A 1 111 ? 40.215 13.984  98.312  1.00 24.06 ? 111  LYS A O   1 
ATOM   853  C  CB  . LYS A 1 111 ? 40.096 11.360  100.276 1.00 22.39 ? 111  LYS A CB  1 
ATOM   854  C  CG  . LYS A 1 111 ? 39.014 11.082  99.234  1.00 22.49 ? 111  LYS A CG  1 
ATOM   855  C  CD  . LYS A 1 111 ? 39.601 10.462  97.974  1.00 22.38 ? 111  LYS A CD  1 
ATOM   856  C  CE  . LYS A 1 111 ? 38.613 10.421  96.828  1.00 22.51 ? 111  LYS A CE  1 
ATOM   857  N  NZ  . LYS A 1 111 ? 39.269 9.926   95.586  1.00 23.01 ? 111  LYS A NZ  1 
ATOM   858  N  N   . ILE A 1 112 ? 40.118 14.513  100.493 1.00 24.41 ? 112  ILE A N   1 
ATOM   859  C  CA  . ILE A 1 112 ? 39.461 15.795  100.273 1.00 25.19 ? 112  ILE A CA  1 
ATOM   860  C  C   . ILE A 1 112 ? 40.452 16.790  99.662  1.00 25.58 ? 112  ILE A C   1 
ATOM   861  O  O   . ILE A 1 112 ? 40.110 17.527  98.738  1.00 25.40 ? 112  ILE A O   1 
ATOM   862  C  CB  . ILE A 1 112 ? 38.877 16.347  101.590 1.00 25.35 ? 112  ILE A CB  1 
ATOM   863  C  CG1 . ILE A 1 112 ? 37.782 15.405  102.103 1.00 25.45 ? 112  ILE A CG1 1 
ATOM   864  C  CG2 . ILE A 1 112 ? 38.316 17.751  101.384 1.00 25.23 ? 112  ILE A CG2 1 
ATOM   865  C  CD1 . ILE A 1 112 ? 37.491 15.539  103.579 1.00 25.49 ? 112  ILE A CD1 1 
ATOM   866  N  N   . LYS A 1 113 ? 41.680 16.782  100.175 1.00 25.73 ? 113  LYS A N   1 
ATOM   867  C  CA  . LYS A 1 113 ? 42.751 17.648  99.677  1.00 26.78 ? 113  LYS A CA  1 
ATOM   868  C  C   . LYS A 1 113 ? 43.176 17.315  98.238  1.00 26.80 ? 113  LYS A C   1 
ATOM   869  O  O   . LYS A 1 113 ? 43.380 18.217  97.423  1.00 26.43 ? 113  LYS A O   1 
ATOM   870  C  CB  . LYS A 1 113 ? 43.958 17.561  100.620 1.00 27.04 ? 113  LYS A CB  1 
ATOM   871  C  CG  . LYS A 1 113 ? 45.134 18.460  100.266 1.00 28.03 ? 113  LYS A CG  1 
ATOM   872  C  CD  . LYS A 1 113 ? 44.821 19.929  100.469 1.00 28.78 ? 113  LYS A CD  1 
ATOM   873  C  CE  . LYS A 1 113 ? 45.988 20.790  100.024 1.00 29.43 ? 113  LYS A CE  1 
ATOM   874  N  NZ  . LYS A 1 113 ? 45.741 22.223  100.322 1.00 29.99 ? 113  LYS A NZ  1 
ATOM   875  N  N   . TYR A 1 114 ? 43.312 16.030  97.926  1.00 26.67 ? 114  TYR A N   1 
ATOM   876  C  CA  . TYR A 1 114 ? 43.796 15.610  96.603  1.00 27.12 ? 114  TYR A CA  1 
ATOM   877  C  C   . TYR A 1 114 ? 42.876 14.554  95.986  1.00 26.56 ? 114  TYR A C   1 
ATOM   878  O  O   . TYR A 1 114 ? 43.293 13.416  95.762  1.00 27.43 ? 114  TYR A O   1 
ATOM   879  C  CB  . TYR A 1 114 ? 45.228 15.070  96.712  1.00 27.72 ? 114  TYR A CB  1 
ATOM   880  C  CG  . TYR A 1 114 ? 46.197 16.022  97.388  1.00 29.38 ? 114  TYR A CG  1 
ATOM   881  C  CD1 . TYR A 1 114 ? 46.531 17.243  96.801  1.00 29.97 ? 114  TYR A CD1 1 
ATOM   882  C  CD2 . TYR A 1 114 ? 46.778 15.703  98.612  1.00 29.47 ? 114  TYR A CD2 1 
ATOM   883  C  CE1 . TYR A 1 114 ? 47.415 18.118  97.416  1.00 30.18 ? 114  TYR A CE1 1 
ATOM   884  C  CE2 . TYR A 1 114 ? 47.666 16.569  99.231  1.00 30.43 ? 114  TYR A CE2 1 
ATOM   885  C  CZ  . TYR A 1 114 ? 47.983 17.772  98.627  1.00 30.39 ? 114  TYR A CZ  1 
ATOM   886  O  OH  . TYR A 1 114 ? 48.851 18.635  99.250  1.00 30.88 ? 114  TYR A OH  1 
ATOM   887  N  N   . PRO A 1 115 ? 41.630 14.939  95.664  1.00 26.64 ? 115  PRO A N   1 
ATOM   888  C  CA  . PRO A 1 115 ? 40.616 13.963  95.252  1.00 26.59 ? 115  PRO A CA  1 
ATOM   889  C  C   . PRO A 1 115 ? 40.878 13.243  93.930  1.00 26.94 ? 115  PRO A C   1 
ATOM   890  O  O   . PRO A 1 115 ? 40.291 12.186  93.703  1.00 26.34 ? 115  PRO A O   1 
ATOM   891  C  CB  . PRO A 1 115 ? 39.335 14.801  95.169  1.00 26.36 ? 115  PRO A CB  1 
ATOM   892  C  CG  . PRO A 1 115 ? 39.804 16.179  94.872  1.00 26.30 ? 115  PRO A CG  1 
ATOM   893  C  CD  . PRO A 1 115 ? 41.146 16.328  95.534  1.00 26.26 ? 115  PRO A CD  1 
ATOM   894  N  N   . GLU A 1 116 ? 41.739 13.805  93.076  1.00 28.76 ? 116  GLU A N   1 
ATOM   895  C  CA  . GLU A 1 116 ? 42.109 13.182  91.800  1.00 29.99 ? 116  GLU A CA  1 
ATOM   896  C  C   . GLU A 1 116 ? 43.434 12.421  91.861  1.00 28.40 ? 116  GLU A C   1 
ATOM   897  O  O   . GLU A 1 116 ? 43.855 11.840  90.858  1.00 27.68 ? 116  GLU A O   1 
ATOM   898  C  CB  . GLU A 1 116 ? 42.207 14.248  90.695  1.00 32.97 ? 116  GLU A CB  1 
ATOM   899  C  CG  . GLU A 1 116 ? 40.958 15.102  90.503  1.00 35.60 ? 116  GLU A CG  1 
ATOM   900  C  CD  . GLU A 1 116 ? 39.727 14.287  90.164  1.00 38.06 ? 116  GLU A CD  1 
ATOM   901  O  OE1 . GLU A 1 116 ? 39.867 13.215  89.539  1.00 41.28 ? 116  GLU A OE1 1 
ATOM   902  O  OE2 . GLU A 1 116 ? 38.615 14.715  90.531  1.00 41.56 ? 116  GLU A OE2 1 
ATOM   903  N  N   . ASN A 1 117 ? 44.104 12.445  93.016  1.00 25.48 ? 117  ASN A N   1 
ATOM   904  C  CA  . ASN A 1 117 ? 45.409 11.802  93.173  1.00 24.43 ? 117  ASN A CA  1 
ATOM   905  C  C   . ASN A 1 117 ? 45.507 10.868  94.392  1.00 22.43 ? 117  ASN A C   1 
ATOM   906  O  O   . ASN A 1 117 ? 46.581 10.380  94.710  1.00 21.78 ? 117  ASN A O   1 
ATOM   907  C  CB  . ASN A 1 117 ? 46.500 12.879  93.269  1.00 25.21 ? 117  ASN A CB  1 
ATOM   908  C  CG  . ASN A 1 117 ? 46.561 13.765  92.032  1.00 26.58 ? 117  ASN A CG  1 
ATOM   909  O  OD1 . ASN A 1 117 ? 45.718 14.645  91.845  1.00 27.80 ? 117  ASN A OD1 1 
ATOM   910  N  ND2 . ASN A 1 117 ? 47.558 13.543  91.186  1.00 27.59 ? 117  ASN A ND2 1 
ATOM   911  N  N   . PHE A 1 118 ? 44.392 10.629  95.069  1.00 20.60 ? 118  PHE A N   1 
ATOM   912  C  CA  . PHE A 1 118 ? 44.398 9.856   96.307  1.00 20.40 ? 118  PHE A CA  1 
ATOM   913  C  C   . PHE A 1 118 ? 43.107 9.061   96.363  1.00 20.23 ? 118  PHE A C   1 
ATOM   914  O  O   . PHE A 1 118 ? 42.023 9.635   96.282  1.00 20.81 ? 118  PHE A O   1 
ATOM   915  C  CB  . PHE A 1 118 ? 44.526 10.804  97.501  1.00 19.79 ? 118  PHE A CB  1 
ATOM   916  C  CG  . PHE A 1 118 ? 44.950 10.135  98.774  1.00 19.52 ? 118  PHE A CG  1 
ATOM   917  C  CD1 . PHE A 1 118 ? 46.296 10.007  99.091  1.00 19.28 ? 118  PHE A CD1 1 
ATOM   918  C  CD2 . PHE A 1 118 ? 44.004 9.652   99.669  1.00 19.21 ? 118  PHE A CD2 1 
ATOM   919  C  CE1 . PHE A 1 118 ? 46.694 9.404   100.269 1.00 18.98 ? 118  PHE A CE1 1 
ATOM   920  C  CE2 . PHE A 1 118 ? 44.396 9.046   100.855 1.00 19.10 ? 118  PHE A CE2 1 
ATOM   921  C  CZ  . PHE A 1 118 ? 45.745 8.918   101.150 1.00 19.08 ? 118  PHE A CZ  1 
ATOM   922  N  N   . PHE A 1 119 ? 43.215 7.739   96.475  1.00 20.55 ? 119  PHE A N   1 
ATOM   923  C  CA  . PHE A 1 119 ? 42.042 6.875   96.385  1.00 20.19 ? 119  PHE A CA  1 
ATOM   924  C  C   . PHE A 1 119 ? 41.986 5.820   97.494  1.00 19.93 ? 119  PHE A C   1 
ATOM   925  O  O   . PHE A 1 119 ? 43.012 5.282   97.908  1.00 19.08 ? 119  PHE A O   1 
ATOM   926  C  CB  . PHE A 1 119 ? 41.973 6.241   94.993  1.00 19.98 ? 119  PHE A CB  1 
ATOM   927  C  CG  . PHE A 1 119 ? 41.874 7.257   93.890  1.00 20.04 ? 119  PHE A CG  1 
ATOM   928  C  CD1 . PHE A 1 119 ? 43.022 7.798   93.323  1.00 19.98 ? 119  PHE A CD1 1 
ATOM   929  C  CD2 . PHE A 1 119 ? 40.638 7.715   93.462  1.00 19.83 ? 119  PHE A CD2 1 
ATOM   930  C  CE1 . PHE A 1 119 ? 42.935 8.762   92.333  1.00 20.42 ? 119  PHE A CE1 1 
ATOM   931  C  CE2 . PHE A 1 119 ? 40.540 8.678   92.465  1.00 20.14 ? 119  PHE A CE2 1 
ATOM   932  C  CZ  . PHE A 1 119 ? 41.690 9.200   91.898  1.00 20.43 ? 119  PHE A CZ  1 
ATOM   933  N  N   . LEU A 1 120 ? 40.769 5.557   97.964  1.00 20.01 ? 120  LEU A N   1 
ATOM   934  C  CA  . LEU A 1 120 ? 40.500 4.605   99.035  1.00 20.47 ? 120  LEU A CA  1 
ATOM   935  C  C   . LEU A 1 120 ? 39.402 3.636   98.612  1.00 20.26 ? 120  LEU A C   1 
ATOM   936  O  O   . LEU A 1 120 ? 38.307 4.060   98.253  1.00 20.10 ? 120  LEU A O   1 
ATOM   937  C  CB  . LEU A 1 120 ? 40.020 5.338   100.289 1.00 21.24 ? 120  LEU A CB  1 
ATOM   938  C  CG  . LEU A 1 120 ? 40.909 6.401   100.912 1.00 21.38 ? 120  LEU A CG  1 
ATOM   939  C  CD1 . LEU A 1 120 ? 40.161 7.052   102.059 1.00 22.14 ? 120  LEU A CD1 1 
ATOM   940  C  CD2 . LEU A 1 120 ? 42.225 5.813   101.389 1.00 21.57 ? 120  LEU A CD2 1 
ATOM   941  N  N   . LEU A 1 121 ? 39.700 2.341   98.672  1.00 19.91 ? 121  LEU A N   1 
ATOM   942  C  CA  . LEU A 1 121 ? 38.710 1.300   98.462  1.00 19.33 ? 121  LEU A CA  1 
ATOM   943  C  C   . LEU A 1 121 ? 38.132 0.795   99.781  1.00 19.17 ? 121  LEU A C   1 
ATOM   944  O  O   . LEU A 1 121 ? 38.739 0.930   100.842 1.00 19.13 ? 121  LEU A O   1 
ATOM   945  C  CB  . LEU A 1 121 ? 39.318 0.115   97.706  1.00 19.13 ? 121  LEU A CB  1 
ATOM   946  C  CG  . LEU A 1 121 ? 39.878 0.366   96.305  1.00 19.02 ? 121  LEU A CG  1 
ATOM   947  C  CD1 . LEU A 1 121 ? 40.152 -0.971  95.636  1.00 18.92 ? 121  LEU A CD1 1 
ATOM   948  C  CD2 . LEU A 1 121 ? 38.939 1.206   95.454  1.00 19.23 ? 121  LEU A CD2 1 
ATOM   949  N  N   . ARG A 1 122 ? 36.953 0.191   99.687  1.00 18.86 ? 122  ARG A N   1 
ATOM   950  C  CA  . ARG A 1 122 ? 36.280 -0.377  100.845 1.00 18.68 ? 122  ARG A CA  1 
ATOM   951  C  C   . ARG A 1 122 ? 36.834 -1.758  101.186 1.00 19.11 ? 122  ARG A C   1 
ATOM   952  O  O   . ARG A 1 122 ? 36.904 -2.625  100.322 1.00 19.07 ? 122  ARG A O   1 
ATOM   953  C  CB  . ARG A 1 122 ? 34.789 -0.494  100.561 1.00 18.41 ? 122  ARG A CB  1 
ATOM   954  C  CG  . ARG A 1 122 ? 33.949 -0.657  101.809 1.00 18.64 ? 122  ARG A CG  1 
ATOM   955  C  CD  . ARG A 1 122 ? 32.466 -0.629  101.485 1.00 18.78 ? 122  ARG A CD  1 
ATOM   956  N  NE  . ARG A 1 122 ? 31.675 -0.689  102.716 1.00 19.14 ? 122  ARG A NE  1 
ATOM   957  C  CZ  . ARG A 1 122 ? 30.348 -0.647  102.771 1.00 19.86 ? 122  ARG A CZ  1 
ATOM   958  N  NH1 . ARG A 1 122 ? 29.625 -0.545  101.657 1.00 20.71 ? 122  ARG A NH1 1 
ATOM   959  N  NH2 . ARG A 1 122 ? 29.743 -0.701  103.953 1.00 20.16 ? 122  ARG A NH2 1 
ATOM   960  N  N   . GLY A 1 123 ? 37.204 -1.958  102.449 1.00 19.32 ? 123  GLY A N   1 
ATOM   961  C  CA  . GLY A 1 123 ? 37.547 -3.287  102.959 1.00 19.86 ? 123  GLY A CA  1 
ATOM   962  C  C   . GLY A 1 123 ? 36.392 -3.831  103.773 1.00 20.49 ? 123  GLY A C   1 
ATOM   963  O  O   . GLY A 1 123 ? 35.452 -3.099  104.067 1.00 21.95 ? 123  GLY A O   1 
ATOM   964  N  N   . ASN A 1 124 ? 36.451 -5.110  104.145 1.00 22.03 ? 124  ASN A N   1 
ATOM   965  C  CA  . ASN A 1 124 ? 35.368 -5.725  104.928 1.00 22.66 ? 124  ASN A CA  1 
ATOM   966  C  C   . ASN A 1 124 ? 35.206 -5.142  106.339 1.00 23.46 ? 124  ASN A C   1 
ATOM   967  O  O   . ASN A 1 124 ? 34.169 -5.338  106.967 1.00 25.53 ? 124  ASN A O   1 
ATOM   968  C  CB  . ASN A 1 124 ? 35.492 -7.267  104.987 1.00 22.61 ? 124  ASN A CB  1 
ATOM   969  C  CG  . ASN A 1 124 ? 36.789 -7.749  105.627 1.00 21.85 ? 124  ASN A CG  1 
ATOM   970  O  OD1 . ASN A 1 124 ? 37.872 -7.380  105.206 1.00 20.86 ? 124  ASN A OD1 1 
ATOM   971  N  ND2 . ASN A 1 124 ? 36.672 -8.607  106.636 1.00 22.61 ? 124  ASN A ND2 1 
ATOM   972  N  N   . HIS A 1 125 ? 36.217 -4.427  106.834 1.00 23.58 ? 125  HIS A N   1 
ATOM   973  C  CA  . HIS A 1 125 ? 36.110 -3.750  108.130 1.00 23.37 ? 125  HIS A CA  1 
ATOM   974  C  C   . HIS A 1 125 ? 35.459 -2.379  108.035 1.00 23.59 ? 125  HIS A C   1 
ATOM   975  O  O   . HIS A 1 125 ? 35.099 -1.796  109.053 1.00 23.82 ? 125  HIS A O   1 
ATOM   976  C  CB  . HIS A 1 125 ? 37.477 -3.670  108.817 1.00 23.46 ? 125  HIS A CB  1 
ATOM   977  C  CG  . HIS A 1 125 ? 37.918 -4.976  109.391 1.00 23.77 ? 125  HIS A CG  1 
ATOM   978  N  ND1 . HIS A 1 125 ? 37.819 -5.267  110.733 1.00 24.64 ? 125  HIS A ND1 1 
ATOM   979  C  CD2 . HIS A 1 125 ? 38.414 -6.089  108.801 1.00 24.14 ? 125  HIS A CD2 1 
ATOM   980  C  CE1 . HIS A 1 125 ? 38.253 -6.494  110.951 1.00 24.24 ? 125  HIS A CE1 1 
ATOM   981  N  NE2 . HIS A 1 125 ? 38.619 -7.014  109.795 1.00 24.46 ? 125  HIS A NE2 1 
ATOM   982  N  N   . GLU A 1 126 ? 35.277 -1.870  106.818 1.00 24.19 ? 126  GLU A N   1 
ATOM   983  C  CA  . GLU A 1 126 ? 34.525 -0.636  106.617 1.00 24.41 ? 126  GLU A CA  1 
ATOM   984  C  C   . GLU A 1 126 ? 33.034 -0.987  106.501 1.00 24.91 ? 126  GLU A C   1 
ATOM   985  O  O   . GLU A 1 126 ? 32.392 -0.758  105.477 1.00 24.66 ? 126  GLU A O   1 
ATOM   986  C  CB  . GLU A 1 126 ? 35.058 0.145   105.406 1.00 24.43 ? 126  GLU A CB  1 
ATOM   987  C  CG  . GLU A 1 126 ? 36.355 0.902   105.692 1.00 24.33 ? 126  GLU A CG  1 
ATOM   988  C  CD  . GLU A 1 126 ? 37.560 -0.014  105.846 1.00 24.47 ? 126  GLU A CD  1 
ATOM   989  O  OE1 . GLU A 1 126 ? 37.817 -0.804  104.917 1.00 23.03 ? 126  GLU A OE1 1 
ATOM   990  O  OE2 . GLU A 1 126 ? 38.262 0.066   106.883 1.00 24.39 ? 126  GLU A OE2 1 
HETATM 991  N  N   . CSO A 1 127 ? 32.516 -1.555  107.589 1.00 25.76 ? 127  CSO A N   1 
HETATM 992  C  CA  . CSO A 1 127 ? 31.141 -2.054  107.691 1.00 26.69 ? 127  CSO A CA  1 
HETATM 993  C  CB  . CSO A 1 127 ? 31.074 -3.474  107.122 1.00 29.01 ? 127  CSO A CB  1 
HETATM 994  S  SG  . CSO A 1 127 ? 29.431 -4.132  107.118 1.00 34.03 ? 127  CSO A SG  1 
HETATM 995  C  C   . CSO A 1 127 ? 30.812 -2.064  109.156 1.00 25.40 ? 127  CSO A C   1 
HETATM 996  O  O   . CSO A 1 127 ? 31.571 -2.620  109.952 1.00 23.35 ? 127  CSO A O   1 
HETATM 997  O  OD  . CSO A 1 127 ? 28.541 -2.969  106.188 1.00 32.36 ? 127  CSO A OD  1 
ATOM   998  N  N   . ALA A 1 128 ? 29.688 -1.453  109.527 1.00 25.40 ? 128  ALA A N   1 
ATOM   999  C  CA  . ALA A 1 128 ? 29.325 -1.260  110.941 1.00 25.97 ? 128  ALA A CA  1 
ATOM   1000 C  C   . ALA A 1 128 ? 29.282 -2.560  111.734 1.00 26.94 ? 128  ALA A C   1 
ATOM   1001 O  O   . ALA A 1 128 ? 29.702 -2.593  112.890 1.00 26.06 ? 128  ALA A O   1 
ATOM   1002 C  CB  . ALA A 1 128 ? 27.987 -0.537  111.055 1.00 25.93 ? 128  ALA A CB  1 
ATOM   1003 N  N   . SER A 1 129 ? 28.781 -3.625  111.111 1.00 28.04 ? 129  SER A N   1 
ATOM   1004 C  CA  . SER A 1 129 ? 28.647 -4.920  111.781 1.00 29.77 ? 129  SER A CA  1 
ATOM   1005 C  C   . SER A 1 129 ? 29.993 -5.519  112.190 1.00 29.86 ? 129  SER A C   1 
ATOM   1006 O  O   . SER A 1 129 ? 30.087 -6.207  113.209 1.00 29.61 ? 129  SER A O   1 
ATOM   1007 C  CB  . SER A 1 129 ? 27.887 -5.902  110.885 1.00 30.67 ? 129  SER A CB  1 
ATOM   1008 O  OG  . SER A 1 129 ? 28.569 -6.100  109.657 1.00 31.75 ? 129  SER A OG  1 
ATOM   1009 N  N   . ILE A 1 130 ? 31.032 -5.246  111.404 1.00 29.47 ? 130  ILE A N   1 
ATOM   1010 C  CA  . ILE A 1 130 ? 32.368 -5.742  111.698 1.00 29.65 ? 130  ILE A CA  1 
ATOM   1011 C  C   . ILE A 1 130 ? 33.090 -4.800  112.655 1.00 30.39 ? 130  ILE A C   1 
ATOM   1012 O  O   . ILE A 1 130 ? 33.569 -5.236  113.704 1.00 31.31 ? 130  ILE A O   1 
ATOM   1013 C  CB  . ILE A 1 130 ? 33.198 -5.936  110.402 1.00 29.38 ? 130  ILE A CB  1 
ATOM   1014 C  CG1 . ILE A 1 130 ? 32.535 -6.976  109.489 1.00 29.40 ? 130  ILE A CG1 1 
ATOM   1015 C  CG2 . ILE A 1 130 ? 34.634 -6.339  110.722 1.00 28.90 ? 130  ILE A CG2 1 
ATOM   1016 C  CD1 . ILE A 1 130 ? 32.459 -8.378  110.067 1.00 30.09 ? 130  ILE A CD1 1 
ATOM   1017 N  N   . ASN A 1 131 ? 33.167 -3.511  112.316 1.00 30.25 ? 131  ASN A N   1 
ATOM   1018 C  CA  . ASN A 1 131 ? 33.927 -2.575  113.152 1.00 30.69 ? 131  ASN A CA  1 
ATOM   1019 C  C   . ASN A 1 131 ? 33.259 -2.210  114.485 1.00 31.91 ? 131  ASN A C   1 
ATOM   1020 O  O   . ASN A 1 131 ? 33.861 -1.516  115.309 1.00 32.51 ? 131  ASN A O   1 
ATOM   1021 C  CB  . ASN A 1 131 ? 34.443 -1.338  112.365 1.00 29.35 ? 131  ASN A CB  1 
ATOM   1022 C  CG  . ASN A 1 131 ? 33.350 -0.363  111.945 1.00 29.47 ? 131  ASN A CG  1 
ATOM   1023 O  OD1 . ASN A 1 131 ? 32.448 -0.035  112.712 1.00 29.66 ? 131  ASN A OD1 1 
ATOM   1024 N  ND2 . ASN A 1 131 ? 33.468 0.154   110.721 1.00 28.61 ? 131  ASN A ND2 1 
ATOM   1025 N  N   . ARG A 1 132 ? 32.044 -2.707  114.716 1.00 33.31 ? 132  ARG A N   1 
ATOM   1026 C  CA  . ARG A 1 132 ? 31.455 -2.639  116.057 1.00 34.32 ? 132  ARG A CA  1 
ATOM   1027 C  C   . ARG A 1 132 ? 32.109 -3.640  117.011 1.00 34.22 ? 132  ARG A C   1 
ATOM   1028 O  O   . ARG A 1 132 ? 32.143 -3.410  118.217 1.00 34.73 ? 132  ARG A O   1 
ATOM   1029 C  CB  . ARG A 1 132 ? 29.941 -2.873  116.037 1.00 35.54 ? 132  ARG A CB  1 
ATOM   1030 C  CG  . ARG A 1 132 ? 29.228 -2.259  117.240 1.00 38.04 ? 132  ARG A CG  1 
ATOM   1031 C  CD  . ARG A 1 132 ? 28.334 -3.254  117.957 1.00 39.93 ? 132  ARG A CD  1 
ATOM   1032 N  NE  . ARG A 1 132 ? 27.918 -2.772  119.277 1.00 42.65 ? 132  ARG A NE  1 
ATOM   1033 C  CZ  . ARG A 1 132 ? 28.696 -2.727  120.362 1.00 43.50 ? 132  ARG A CZ  1 
ATOM   1034 N  NH1 . ARG A 1 132 ? 29.968 -3.118  120.317 1.00 44.35 ? 132  ARG A NH1 1 
ATOM   1035 N  NH2 . ARG A 1 132 ? 28.199 -2.273  121.508 1.00 45.53 ? 132  ARG A NH2 1 
ATOM   1036 N  N   . ILE A 1 133 ? 32.618 -4.743  116.464 1.00 34.43 ? 133  ILE A N   1 
ATOM   1037 C  CA  . ILE A 1 133 ? 33.211 -5.820  117.259 1.00 34.18 ? 133  ILE A CA  1 
ATOM   1038 C  C   . ILE A 1 133 ? 34.717 -5.658  117.471 1.00 33.83 ? 133  ILE A C   1 
ATOM   1039 O  O   . ILE A 1 133 ? 35.217 -5.924  118.563 1.00 33.25 ? 133  ILE A O   1 
ATOM   1040 C  CB  . ILE A 1 133 ? 32.966 -7.197  116.595 1.00 35.30 ? 133  ILE A CB  1 
ATOM   1041 C  CG1 . ILE A 1 133 ? 31.461 -7.497  116.529 1.00 35.27 ? 133  ILE A CG1 1 
ATOM   1042 C  CG2 . ILE A 1 133 ? 33.696 -8.303  117.351 1.00 36.69 ? 133  ILE A CG2 1 
ATOM   1043 C  CD1 . ILE A 1 133 ? 31.101 -8.693  115.667 1.00 35.28 ? 133  ILE A CD1 1 
ATOM   1044 N  N   . TYR A 1 134 ? 35.435 -5.227  116.437 1.00 32.09 ? 134  TYR A N   1 
ATOM   1045 C  CA  . TYR A 1 134 ? 36.895 -5.356  116.423 1.00 31.37 ? 134  TYR A CA  1 
ATOM   1046 C  C   . TYR A 1 134 ? 37.682 -4.099  116.789 1.00 29.17 ? 134  TYR A C   1 
ATOM   1047 O  O   . TYR A 1 134 ? 38.890 -4.040  116.552 1.00 29.15 ? 134  TYR A O   1 
ATOM   1048 C  CB  . TYR A 1 134 ? 37.353 -5.907  115.067 1.00 31.85 ? 134  TYR A CB  1 
ATOM   1049 C  CG  . TYR A 1 134 ? 36.942 -7.342  114.860 1.00 33.95 ? 134  TYR A CG  1 
ATOM   1050 C  CD1 . TYR A 1 134 ? 37.671 -8.385  115.429 1.00 35.42 ? 134  TYR A CD1 1 
ATOM   1051 C  CD2 . TYR A 1 134 ? 35.816 -7.661  114.111 1.00 34.81 ? 134  TYR A CD2 1 
ATOM   1052 C  CE1 . TYR A 1 134 ? 37.292 -9.704  115.245 1.00 36.57 ? 134  TYR A CE1 1 
ATOM   1053 C  CE2 . TYR A 1 134 ? 35.431 -8.975  113.920 1.00 36.18 ? 134  TYR A CE2 1 
ATOM   1054 C  CZ  . TYR A 1 134 ? 36.171 -9.991  114.487 1.00 37.05 ? 134  TYR A CZ  1 
ATOM   1055 O  OH  . TYR A 1 134 ? 35.780 -11.294 114.294 1.00 40.17 ? 134  TYR A OH  1 
ATOM   1056 N  N   . GLY A 1 135 ? 37.012 -3.102  117.365 1.00 28.00 ? 135  GLY A N   1 
ATOM   1057 C  CA  . GLY A 1 135 ? 37.712 -2.009  118.037 1.00 26.59 ? 135  GLY A CA  1 
ATOM   1058 C  C   . GLY A 1 135 ? 37.312 -0.585  117.708 1.00 26.07 ? 135  GLY A C   1 
ATOM   1059 O  O   . GLY A 1 135 ? 37.491 0.307   118.543 1.00 25.31 ? 135  GLY A O   1 
ATOM   1060 N  N   . PHE A 1 136 ? 36.785 -0.347  116.508 1.00 25.48 ? 136  PHE A N   1 
ATOM   1061 C  CA  . PHE A 1 136 ? 36.559 1.032   116.054 1.00 25.58 ? 136  PHE A CA  1 
ATOM   1062 C  C   . PHE A 1 136 ? 35.425 1.712   116.813 1.00 26.41 ? 136  PHE A C   1 
ATOM   1063 O  O   . PHE A 1 136 ? 35.530 2.886   117.181 1.00 25.58 ? 136  PHE A O   1 
ATOM   1064 C  CB  . PHE A 1 136 ? 36.290 1.080   114.545 1.00 25.28 ? 136  PHE A CB  1 
ATOM   1065 C  CG  . PHE A 1 136 ? 36.232 2.478   113.980 1.00 24.51 ? 136  PHE A CG  1 
ATOM   1066 C  CD1 . PHE A 1 136 ? 37.213 3.420   114.297 1.00 24.11 ? 136  PHE A CD1 1 
ATOM   1067 C  CD2 . PHE A 1 136 ? 35.212 2.847   113.114 1.00 24.11 ? 136  PHE A CD2 1 
ATOM   1068 C  CE1 . PHE A 1 136 ? 37.172 4.700   113.766 1.00 23.85 ? 136  PHE A CE1 1 
ATOM   1069 C  CE2 . PHE A 1 136 ? 35.163 4.128   112.584 1.00 24.41 ? 136  PHE A CE2 1 
ATOM   1070 C  CZ  . PHE A 1 136 ? 36.148 5.053   112.903 1.00 24.07 ? 136  PHE A CZ  1 
ATOM   1071 N  N   . TYR A 1 137 ? 34.341 0.975   117.029 1.00 27.99 ? 137  TYR A N   1 
ATOM   1072 C  CA  . TYR A 1 137 ? 33.233 1.443   117.860 1.00 29.04 ? 137  TYR A CA  1 
ATOM   1073 C  C   . TYR A 1 137 ? 33.724 1.811   119.262 1.00 29.13 ? 137  TYR A C   1 
ATOM   1074 O  O   . TYR A 1 137 ? 33.397 2.878   119.779 1.00 27.87 ? 137  TYR A O   1 
ATOM   1075 C  CB  . TYR A 1 137 ? 32.148 0.363   117.929 1.00 29.82 ? 137  TYR A CB  1 
ATOM   1076 C  CG  . TYR A 1 137 ? 31.063 0.582   118.968 1.00 30.53 ? 137  TYR A CG  1 
ATOM   1077 C  CD1 . TYR A 1 137 ? 31.243 0.169   120.286 1.00 30.92 ? 137  TYR A CD1 1 
ATOM   1078 C  CD2 . TYR A 1 137 ? 29.849 1.171   118.625 1.00 31.10 ? 137  TYR A CD2 1 
ATOM   1079 C  CE1 . TYR A 1 137 ? 30.253 0.360   121.241 1.00 32.16 ? 137  TYR A CE1 1 
ATOM   1080 C  CE2 . TYR A 1 137 ? 28.848 1.359   119.570 1.00 31.97 ? 137  TYR A CE2 1 
ATOM   1081 C  CZ  . TYR A 1 137 ? 29.059 0.951   120.875 1.00 32.72 ? 137  TYR A CZ  1 
ATOM   1082 O  OH  . TYR A 1 137 ? 28.078 1.131   121.821 1.00 35.63 ? 137  TYR A OH  1 
ATOM   1083 N  N   . ASP A 1 138 ? 34.512 0.924   119.863 1.00 29.83 ? 138  ASP A N   1 
ATOM   1084 C  CA  . ASP A 1 138 ? 35.075 1.161   121.198 1.00 29.87 ? 138  ASP A CA  1 
ATOM   1085 C  C   . ASP A 1 138 ? 35.991 2.376   121.238 1.00 28.81 ? 138  ASP A C   1 
ATOM   1086 O  O   . ASP A 1 138 ? 35.995 3.116   122.222 1.00 27.91 ? 138  ASP A O   1 
ATOM   1087 C  CB  . ASP A 1 138 ? 35.849 -0.066  121.695 1.00 30.77 ? 138  ASP A CB  1 
ATOM   1088 C  CG  . ASP A 1 138 ? 34.946 -1.237  122.019 1.00 31.99 ? 138  ASP A CG  1 
ATOM   1089 O  OD1 . ASP A 1 138 ? 33.790 -1.008  122.434 1.00 35.16 ? 138  ASP A OD1 1 
ATOM   1090 O  OD2 . ASP A 1 138 ? 35.396 -2.390  121.869 1.00 33.44 ? 138  ASP A OD2 1 
ATOM   1091 N  N   . GLU A 1 139 ? 36.769 2.583   120.176 1.00 27.41 ? 139  GLU A N   1 
ATOM   1092 C  CA  . GLU A 1 139 ? 37.656 3.740   120.107 1.00 26.44 ? 139  GLU A CA  1 
ATOM   1093 C  C   . GLU A 1 139 ? 36.857 5.041   119.979 1.00 26.71 ? 139  GLU A C   1 
ATOM   1094 O  O   . GLU A 1 139 ? 37.142 6.024   120.677 1.00 27.60 ? 139  GLU A O   1 
ATOM   1095 C  CB  . GLU A 1 139 ? 38.660 3.599   118.953 1.00 26.16 ? 139  GLU A CB  1 
ATOM   1096 C  CG  . GLU A 1 139 ? 39.780 4.621   119.012 1.00 25.44 ? 139  GLU A CG  1 
ATOM   1097 C  CD  . GLU A 1 139 ? 40.767 4.504   117.868 1.00 25.10 ? 139  GLU A CD  1 
ATOM   1098 O  OE1 . GLU A 1 139 ? 41.049 3.373   117.414 1.00 25.06 ? 139  GLU A OE1 1 
ATOM   1099 O  OE2 . GLU A 1 139 ? 41.285 5.546   117.439 1.00 24.23 ? 139  GLU A OE2 1 
ATOM   1100 N  N   . CYS A 1 140 ? 35.858 5.041   119.101 1.00 26.94 ? 140  CYS A N   1 
ATOM   1101 C  CA  . CYS A 1 140 ? 34.969 6.194   118.933 1.00 27.79 ? 140  CYS A CA  1 
ATOM   1102 C  C   . CYS A 1 140 ? 34.237 6.559   120.224 1.00 28.90 ? 140  CYS A C   1 
ATOM   1103 O  O   . CYS A 1 140 ? 34.064 7.737   120.532 1.00 28.47 ? 140  CYS A O   1 
ATOM   1104 C  CB  . CYS A 1 140 ? 33.936 5.926   117.837 1.00 27.91 ? 140  CYS A CB  1 
ATOM   1105 S  SG  . CYS A 1 140 ? 34.594 6.020   116.157 1.00 27.73 ? 140  CYS A SG  1 
ATOM   1106 N  N   . LYS A 1 141 ? 33.809 5.543   120.964 1.00 30.55 ? 141  LYS A N   1 
ATOM   1107 C  CA  . LYS A 1 141 ? 33.098 5.749   122.225 1.00 33.35 ? 141  LYS A CA  1 
ATOM   1108 C  C   . LYS A 1 141 ? 34.024 6.338   123.289 1.00 34.24 ? 141  LYS A C   1 
ATOM   1109 O  O   . LYS A 1 141 ? 33.665 7.308   123.957 1.00 35.51 ? 141  LYS A O   1 
ATOM   1110 C  CB  . LYS A 1 141 ? 32.494 4.430   122.713 1.00 34.49 ? 141  LYS A CB  1 
ATOM   1111 C  CG  . LYS A 1 141 ? 31.520 4.587   123.865 1.00 35.50 ? 141  LYS A CG  1 
ATOM   1112 C  CD  . LYS A 1 141 ? 31.031 3.242   124.364 1.00 36.72 ? 141  LYS A CD  1 
ATOM   1113 C  CE  . LYS A 1 141 ? 30.281 3.396   125.676 1.00 37.99 ? 141  LYS A CE  1 
ATOM   1114 N  NZ  . LYS A 1 141 ? 29.787 2.093   126.196 1.00 39.03 ? 141  LYS A NZ  1 
ATOM   1115 N  N   . ARG A 1 142 ? 35.211 5.755   123.432 1.00 35.16 ? 142  ARG A N   1 
ATOM   1116 C  CA  . ARG A 1 142 ? 36.191 6.214   124.415 1.00 36.20 ? 142  ARG A CA  1 
ATOM   1117 C  C   . ARG A 1 142 ? 36.629 7.658   124.183 1.00 37.20 ? 142  ARG A C   1 
ATOM   1118 O  O   . ARG A 1 142 ? 36.741 8.436   125.133 1.00 35.37 ? 142  ARG A O   1 
ATOM   1119 C  CB  . ARG A 1 142 ? 37.427 5.303   124.413 1.00 38.48 ? 142  ARG A CB  1 
ATOM   1120 C  CG  . ARG A 1 142 ? 38.571 5.808   125.283 1.00 40.35 ? 142  ARG A CG  1 
ATOM   1121 C  CD  . ARG A 1 142 ? 39.672 4.779   125.472 1.00 41.84 ? 142  ARG A CD  1 
ATOM   1122 N  NE  . ARG A 1 142 ? 40.641 4.820   124.376 1.00 44.59 ? 142  ARG A NE  1 
ATOM   1123 C  CZ  . ARG A 1 142 ? 40.614 4.052   123.287 1.00 44.98 ? 142  ARG A CZ  1 
ATOM   1124 N  NH1 . ARG A 1 142 ? 39.663 3.138   123.103 1.00 45.52 ? 142  ARG A NH1 1 
ATOM   1125 N  NH2 . ARG A 1 142 ? 41.561 4.200   122.364 1.00 46.38 ? 142  ARG A NH2 1 
ATOM   1126 N  N   . ARG A 1 143 ? 36.880 8.006   122.923 1.00 35.98 ? 143  ARG A N   1 
ATOM   1127 C  CA  . ARG A 1 143 ? 37.486 9.290   122.584 1.00 36.18 ? 143  ARG A CA  1 
ATOM   1128 C  C   . ARG A 1 143 ? 36.484 10.371  122.178 1.00 35.70 ? 143  ARG A C   1 
ATOM   1129 O  O   . ARG A 1 143 ? 36.783 11.556  122.308 1.00 33.65 ? 143  ARG A O   1 
ATOM   1130 C  CB  . ARG A 1 143 ? 38.526 9.101   121.479 1.00 37.78 ? 143  ARG A CB  1 
ATOM   1131 C  CG  . ARG A 1 143 ? 39.731 8.268   121.904 1.00 38.95 ? 143  ARG A CG  1 
ATOM   1132 C  CD  . ARG A 1 143 ? 40.913 8.503   120.976 1.00 40.95 ? 143  ARG A CD  1 
ATOM   1133 N  NE  . ARG A 1 143 ? 41.366 9.894   121.035 1.00 43.48 ? 143  ARG A NE  1 
ATOM   1134 C  CZ  . ARG A 1 143 ? 42.116 10.503  120.115 1.00 45.96 ? 143  ARG A CZ  1 
ATOM   1135 N  NH1 . ARG A 1 143 ? 42.527 9.863   119.025 1.00 45.48 ? 143  ARG A NH1 1 
ATOM   1136 N  NH2 . ARG A 1 143 ? 42.457 11.775  120.290 1.00 47.78 ? 143  ARG A NH2 1 
ATOM   1137 N  N   . TYR A 1 144 ? 35.316 9.973   121.675 1.00 35.19 ? 144  TYR A N   1 
ATOM   1138 C  CA  . TYR A 1 144 ? 34.292 10.931  121.243 1.00 36.37 ? 144  TYR A CA  1 
ATOM   1139 C  C   . TYR A 1 144 ? 32.895 10.451  121.657 1.00 37.34 ? 144  TYR A C   1 
ATOM   1140 O  O   . TYR A 1 144 ? 32.561 10.507  122.839 1.00 39.76 ? 144  TYR A O   1 
ATOM   1141 C  CB  . TYR A 1 144 ? 34.416 11.198  119.732 1.00 36.05 ? 144  TYR A CB  1 
ATOM   1142 C  CG  . TYR A 1 144 ? 35.733 11.848  119.358 1.00 36.13 ? 144  TYR A CG  1 
ATOM   1143 C  CD1 . TYR A 1 144 ? 36.852 11.077  119.056 1.00 35.42 ? 144  TYR A CD1 1 
ATOM   1144 C  CD2 . TYR A 1 144 ? 35.867 13.234  119.333 1.00 36.14 ? 144  TYR A CD2 1 
ATOM   1145 C  CE1 . TYR A 1 144 ? 38.063 11.666  118.732 1.00 35.20 ? 144  TYR A CE1 1 
ATOM   1146 C  CE2 . TYR A 1 144 ? 37.073 13.830  119.008 1.00 36.47 ? 144  TYR A CE2 1 
ATOM   1147 C  CZ  . TYR A 1 144 ? 38.167 13.041  118.706 1.00 35.89 ? 144  TYR A CZ  1 
ATOM   1148 O  OH  . TYR A 1 144 ? 39.365 13.629  118.380 1.00 35.39 ? 144  TYR A OH  1 
ATOM   1149 N  N   . ASN A 1 145 ? 32.081 9.985   120.711 1.00 37.29 ? 145  ASN A N   1 
ATOM   1150 C  CA  . ASN A 1 145 ? 30.770 9.425   121.036 1.00 37.41 ? 145  ASN A CA  1 
ATOM   1151 C  C   . ASN A 1 145 ? 30.281 8.475   119.948 1.00 37.35 ? 145  ASN A C   1 
ATOM   1152 O  O   . ASN A 1 145 ? 30.891 8.375   118.876 1.00 35.27 ? 145  ASN A O   1 
ATOM   1153 C  CB  . ASN A 1 145 ? 29.744 10.542  121.288 1.00 37.62 ? 145  ASN A CB  1 
ATOM   1154 C  CG  . ASN A 1 145 ? 29.634 11.516  120.125 1.00 38.10 ? 145  ASN A CG  1 
ATOM   1155 O  OD1 . ASN A 1 145 ? 29.368 11.122  118.984 1.00 36.77 ? 145  ASN A OD1 1 
ATOM   1156 N  ND2 . ASN A 1 145 ? 29.824 12.800  120.412 1.00 36.84 ? 145  ASN A ND2 1 
ATOM   1157 N  N   . ILE A 1 146 ? 29.174 7.792   120.230 1.00 36.78 ? 146  ILE A N   1 
ATOM   1158 C  CA  . ILE A 1 146 ? 28.606 6.798   119.317 1.00 37.58 ? 146  ILE A CA  1 
ATOM   1159 C  C   . ILE A 1 146 ? 28.032 7.440   118.052 1.00 35.76 ? 146  ILE A C   1 
ATOM   1160 O  O   . ILE A 1 146 ? 28.053 6.828   116.987 1.00 36.01 ? 146  ILE A O   1 
ATOM   1161 C  CB  . ILE A 1 146 ? 27.510 5.949   120.014 1.00 39.07 ? 146  ILE A CB  1 
ATOM   1162 C  CG1 . ILE A 1 146 ? 28.057 5.288   121.285 1.00 39.62 ? 146  ILE A CG1 1 
ATOM   1163 C  CG2 . ILE A 1 146 ? 26.960 4.883   119.071 1.00 39.63 ? 146  ILE A CG2 1 
ATOM   1164 C  CD1 . ILE A 1 146 ? 29.360 4.545   121.092 1.00 39.50 ? 146  ILE A CD1 1 
ATOM   1165 N  N   . LYS A 1 147 ? 27.524 8.666   118.164 1.00 35.28 ? 147  LYS A N   1 
ATOM   1166 C  CA  . LYS A 1 147 ? 27.022 9.395   116.992 1.00 34.36 ? 147  LYS A CA  1 
ATOM   1167 C  C   . LYS A 1 147 ? 28.102 9.609   115.932 1.00 32.76 ? 147  LYS A C   1 
ATOM   1168 O  O   . LYS A 1 147 ? 27.819 9.526   114.735 1.00 30.94 ? 147  LYS A O   1 
ATOM   1169 C  CB  . LYS A 1 147 ? 26.407 10.743  117.397 1.00 36.10 ? 147  LYS A CB  1 
ATOM   1170 C  CG  . LYS A 1 147 ? 24.952 10.632  117.820 1.00 37.16 ? 147  LYS A CG  1 
ATOM   1171 C  CD  . LYS A 1 147 ? 24.414 11.937  118.386 1.00 38.15 ? 147  LYS A CD  1 
ATOM   1172 C  CE  . LYS A 1 147 ? 22.911 11.843  118.593 1.00 38.71 ? 147  LYS A CE  1 
ATOM   1173 N  NZ  . LYS A 1 147 ? 22.330 13.083  119.164 1.00 39.19 ? 147  LYS A NZ  1 
ATOM   1174 N  N   . LEU A 1 148 ? 29.331 9.874   116.373 1.00 30.94 ? 148  LEU A N   1 
ATOM   1175 C  CA  . LEU A 1 148 ? 30.454 10.064  115.454 1.00 30.59 ? 148  LEU A CA  1 
ATOM   1176 C  C   . LEU A 1 148 ? 30.758 8.774   114.700 1.00 31.23 ? 148  LEU A C   1 
ATOM   1177 O  O   . LEU A 1 148 ? 31.017 8.796   113.498 1.00 31.23 ? 148  LEU A O   1 
ATOM   1178 C  CB  . LEU A 1 148 ? 31.705 10.516  116.209 1.00 30.51 ? 148  LEU A CB  1 
ATOM   1179 C  CG  . LEU A 1 148 ? 32.908 10.886  115.333 1.00 30.05 ? 148  LEU A CG  1 
ATOM   1180 C  CD1 . LEU A 1 148 ? 32.589 12.105  114.479 1.00 30.16 ? 148  LEU A CD1 1 
ATOM   1181 C  CD2 . LEU A 1 148 ? 34.143 11.134  116.180 1.00 30.28 ? 148  LEU A CD2 1 
ATOM   1182 N  N   . TRP A 1 149 ? 30.736 7.656   115.422 1.00 30.58 ? 149  TRP A N   1 
ATOM   1183 C  CA  . TRP A 1 149 ? 30.893 6.340   114.816 1.00 29.59 ? 149  TRP A CA  1 
ATOM   1184 C  C   . TRP A 1 149 ? 29.835 6.069   113.733 1.00 29.49 ? 149  TRP A C   1 
ATOM   1185 O  O   . TRP A 1 149 ? 30.150 5.495   112.684 1.00 27.47 ? 149  TRP A O   1 
ATOM   1186 C  CB  . TRP A 1 149 ? 30.844 5.259   115.898 1.00 29.00 ? 149  TRP A CB  1 
ATOM   1187 C  CG  . TRP A 1 149 ? 30.915 3.869   115.369 1.00 28.77 ? 149  TRP A CG  1 
ATOM   1188 C  CD1 . TRP A 1 149 ? 32.009 3.244   114.842 1.00 28.67 ? 149  TRP A CD1 1 
ATOM   1189 C  CD2 . TRP A 1 149 ? 29.847 2.917   115.323 1.00 29.34 ? 149  TRP A CD2 1 
ATOM   1190 N  NE1 . TRP A 1 149 ? 31.684 1.961   114.467 1.00 28.48 ? 149  TRP A NE1 1 
ATOM   1191 C  CE2 . TRP A 1 149 ? 30.363 1.736   114.750 1.00 29.34 ? 149  TRP A CE2 1 
ATOM   1192 C  CE3 . TRP A 1 149 ? 28.500 2.949   115.708 1.00 30.40 ? 149  TRP A CE3 1 
ATOM   1193 C  CZ2 . TRP A 1 149 ? 29.581 0.595   114.553 1.00 30.15 ? 149  TRP A CZ2 1 
ATOM   1194 C  CZ3 . TRP A 1 149 ? 27.723 1.815   115.508 1.00 30.63 ? 149  TRP A CZ3 1 
ATOM   1195 C  CH2 . TRP A 1 149 ? 28.269 0.653   114.939 1.00 30.26 ? 149  TRP A CH2 1 
ATOM   1196 N  N   . LYS A 1 150 ? 28.590 6.474   113.982 1.00 30.49 ? 150  LYS A N   1 
ATOM   1197 C  CA  . LYS A 1 150 ? 27.528 6.317   112.977 1.00 31.31 ? 150  LYS A CA  1 
ATOM   1198 C  C   . LYS A 1 150 ? 27.787 7.187   111.749 1.00 30.02 ? 150  LYS A C   1 
ATOM   1199 O  O   . LYS A 1 150 ? 27.463 6.788   110.627 1.00 28.28 ? 150  LYS A O   1 
ATOM   1200 C  CB  . LYS A 1 150 ? 26.143 6.616   113.567 1.00 33.68 ? 150  LYS A CB  1 
ATOM   1201 C  CG  . LYS A 1 150 ? 25.649 5.557   114.541 1.00 35.69 ? 150  LYS A CG  1 
ATOM   1202 C  CD  . LYS A 1 150 ? 24.179 5.743   114.897 1.00 38.46 ? 150  LYS A CD  1 
ATOM   1203 C  CE  . LYS A 1 150 ? 23.646 4.549   115.677 1.00 40.54 ? 150  LYS A CE  1 
ATOM   1204 N  NZ  . LYS A 1 150 ? 22.177 4.624   115.906 1.00 42.15 ? 150  LYS A NZ  1 
ATOM   1205 N  N   . THR A 1 151 ? 28.373 8.366   111.956 1.00 28.80 ? 151  THR A N   1 
ATOM   1206 C  CA  . THR A 1 151 ? 28.754 9.238   110.843 1.00 29.12 ? 151  THR A CA  1 
ATOM   1207 C  C   . THR A 1 151 ? 29.853 8.607   109.975 1.00 28.78 ? 151  THR A C   1 
ATOM   1208 O  O   . THR A 1 151 ? 29.856 8.783   108.751 1.00 28.17 ? 151  THR A O   1 
ATOM   1209 C  CB  . THR A 1 151 ? 29.195 10.631  111.339 1.00 30.19 ? 151  THR A CB  1 
ATOM   1210 O  OG1 . THR A 1 151 ? 28.105 11.260  112.028 1.00 30.58 ? 151  THR A OG1 1 
ATOM   1211 C  CG2 . THR A 1 151 ? 29.612 11.518  110.181 1.00 30.40 ? 151  THR A CG2 1 
ATOM   1212 N  N   . PHE A 1 152 ? 30.778 7.877   110.598 1.00 27.61 ? 152  PHE A N   1 
ATOM   1213 C  CA  . PHE A 1 152 ? 31.785 7.124   109.840 1.00 27.81 ? 152  PHE A CA  1 
ATOM   1214 C  C   . PHE A 1 152 ? 31.136 6.026   108.998 1.00 28.83 ? 152  PHE A C   1 
ATOM   1215 O  O   . PHE A 1 152 ? 31.508 5.824   107.839 1.00 27.74 ? 152  PHE A O   1 
ATOM   1216 C  CB  . PHE A 1 152 ? 32.846 6.518   110.769 1.00 27.58 ? 152  PHE A CB  1 
ATOM   1217 C  CG  . PHE A 1 152 ? 33.983 7.448   111.085 1.00 27.31 ? 152  PHE A CG  1 
ATOM   1218 C  CD1 . PHE A 1 152 ? 34.917 7.773   110.113 1.00 26.69 ? 152  PHE A CD1 1 
ATOM   1219 C  CD2 . PHE A 1 152 ? 34.138 7.981   112.361 1.00 27.06 ? 152  PHE A CD2 1 
ATOM   1220 C  CE1 . PHE A 1 152 ? 35.974 8.624   110.397 1.00 26.70 ? 152  PHE A CE1 1 
ATOM   1221 C  CE2 . PHE A 1 152 ? 35.196 8.826   112.652 1.00 26.31 ? 152  PHE A CE2 1 
ATOM   1222 C  CZ  . PHE A 1 152 ? 36.117 9.147   111.670 1.00 26.60 ? 152  PHE A CZ  1 
ATOM   1223 N  N   . THR A 1 153 ? 30.160 5.332   109.586 1.00 29.20 ? 153  THR A N   1 
ATOM   1224 C  CA  . THR A 1 153 ? 29.405 4.288   108.893 1.00 29.38 ? 153  THR A CA  1 
ATOM   1225 C  C   . THR A 1 153 ? 28.769 4.786   107.595 1.00 29.11 ? 153  THR A C   1 
ATOM   1226 O  O   . THR A 1 153 ? 28.905 4.150   106.551 1.00 26.15 ? 153  THR A O   1 
ATOM   1227 C  CB  . THR A 1 153 ? 28.299 3.715   109.801 1.00 30.49 ? 153  THR A CB  1 
ATOM   1228 O  OG1 . THR A 1 153 ? 28.902 3.101   110.944 1.00 30.53 ? 153  THR A OG1 1 
ATOM   1229 C  CG2 . THR A 1 153 ? 27.441 2.687   109.055 1.00 30.88 ? 153  THR A CG2 1 
ATOM   1230 N  N   . ASP A 1 154 ? 28.071 5.916   107.674 1.00 29.65 ? 154  ASP A N   1 
ATOM   1231 C  CA  . ASP A 1 154 ? 27.449 6.546   106.505 1.00 30.34 ? 154  ASP A CA  1 
ATOM   1232 C  C   . ASP A 1 154 ? 28.488 6.884   105.425 1.00 29.11 ? 154  ASP A C   1 
ATOM   1233 O  O   . ASP A 1 154 ? 28.226 6.729   104.223 1.00 28.84 ? 154  ASP A O   1 
ATOM   1234 C  CB  . ASP A 1 154 ? 26.672 7.804   106.945 1.00 33.36 ? 154  ASP A CB  1 
ATOM   1235 C  CG  . ASP A 1 154 ? 25.348 7.470   107.625 1.00 36.08 ? 154  ASP A CG  1 
ATOM   1236 O  OD1 . ASP A 1 154 ? 24.891 6.304   107.556 1.00 37.06 ? 154  ASP A OD1 1 
ATOM   1237 O  OD2 . ASP A 1 154 ? 24.751 8.382   108.232 1.00 39.02 ? 154  ASP A OD2 1 
ATOM   1238 N  N   . CYS A 1 155 ? 29.671 7.314   105.857 1.00 26.61 ? 155  CYS A N   1 
ATOM   1239 C  CA  . CYS A 1 155 ? 30.797 7.570   104.958 1.00 26.31 ? 155  CYS A CA  1 
ATOM   1240 C  C   . CYS A 1 155 ? 31.296 6.278   104.309 1.00 24.64 ? 155  CYS A C   1 
ATOM   1241 O  O   . CYS A 1 155 ? 31.394 6.188   103.080 1.00 23.99 ? 155  CYS A O   1 
ATOM   1242 C  CB  . CYS A 1 155 ? 31.934 8.245   105.733 1.00 27.18 ? 155  CYS A CB  1 
ATOM   1243 S  SG  . CYS A 1 155 ? 33.365 8.722   104.748 1.00 28.17 ? 155  CYS A SG  1 
ATOM   1244 N  N   . PHE A 1 156 ? 31.599 5.284   105.142 1.00 23.17 ? 156  PHE A N   1 
ATOM   1245 C  CA  . PHE A 1 156 ? 32.100 3.982   104.685 1.00 22.71 ? 156  PHE A CA  1 
ATOM   1246 C  C   . PHE A 1 156 ? 31.169 3.311   103.667 1.00 22.32 ? 156  PHE A C   1 
ATOM   1247 O  O   . PHE A 1 156 ? 31.637 2.704   102.698 1.00 21.09 ? 156  PHE A O   1 
ATOM   1248 C  CB  . PHE A 1 156 ? 32.310 3.027   105.873 1.00 22.79 ? 156  PHE A CB  1 
ATOM   1249 C  CG  . PHE A 1 156 ? 33.461 3.396   106.791 1.00 22.62 ? 156  PHE A CG  1 
ATOM   1250 C  CD1 . PHE A 1 156 ? 34.414 4.352   106.439 1.00 23.08 ? 156  PHE A CD1 1 
ATOM   1251 C  CD2 . PHE A 1 156 ? 33.608 2.738   108.007 1.00 23.04 ? 156  PHE A CD2 1 
ATOM   1252 C  CE1 . PHE A 1 156 ? 35.466 4.654   107.291 1.00 23.08 ? 156  PHE A CE1 1 
ATOM   1253 C  CE2 . PHE A 1 156 ? 34.657 3.038   108.864 1.00 23.27 ? 156  PHE A CE2 1 
ATOM   1254 C  CZ  . PHE A 1 156 ? 35.591 3.995   108.504 1.00 23.53 ? 156  PHE A CZ  1 
ATOM   1255 N  N   . ASN A 1 157 ? 29.860 3.420   103.896 1.00 21.18 ? 157  ASN A N   1 
ATOM   1256 C  CA  . ASN A 1 157 ? 28.858 2.859   102.985 1.00 22.13 ? 157  ASN A CA  1 
ATOM   1257 C  C   . ASN A 1 157 ? 28.883 3.431   101.563 1.00 21.57 ? 157  ASN A C   1 
ATOM   1258 O  O   . ASN A 1 157 ? 28.225 2.885   100.665 1.00 21.65 ? 157  ASN A O   1 
ATOM   1259 C  CB  . ASN A 1 157 ? 27.445 3.026   103.566 1.00 21.85 ? 157  ASN A CB  1 
ATOM   1260 C  CG  . ASN A 1 157 ? 27.198 2.154   104.784 1.00 22.22 ? 157  ASN A CG  1 
ATOM   1261 O  OD1 . ASN A 1 157 ? 27.974 1.250   105.092 1.00 23.06 ? 157  ASN A OD1 1 
ATOM   1262 N  ND2 . ASN A 1 157 ? 26.106 2.421   105.485 1.00 22.74 ? 157  ASN A ND2 1 
ATOM   1263 N  N   . CYS A 1 158 ? 29.617 4.528   101.366 1.00 22.04 ? 158  CYS A N   1 
ATOM   1264 C  CA  . CYS A 1 158 ? 29.775 5.157   100.049 1.00 22.45 ? 158  CYS A CA  1 
ATOM   1265 C  C   . CYS A 1 158 ? 31.142 4.941   99.375  1.00 22.79 ? 158  CYS A C   1 
ATOM   1266 O  O   . CYS A 1 158 ? 31.335 5.358   98.233  1.00 22.62 ? 158  CYS A O   1 
ATOM   1267 C  CB  . CYS A 1 158 ? 29.491 6.652   100.170 1.00 22.83 ? 158  CYS A CB  1 
ATOM   1268 S  SG  . CYS A 1 158 ? 27.794 7.003   100.700 1.00 24.09 ? 158  CYS A SG  1 
ATOM   1269 N  N   . LEU A 1 159 ? 32.082 4.299   100.064 1.00 23.16 ? 159  LEU A N   1 
ATOM   1270 C  CA  . LEU A 1 159 ? 33.401 3.993   99.481  1.00 23.21 ? 159  LEU A CA  1 
ATOM   1271 C  C   . LEU A 1 159 ? 33.317 3.177   98.186  1.00 23.06 ? 159  LEU A C   1 
ATOM   1272 O  O   . LEU A 1 159 ? 32.451 2.319   98.055  1.00 23.52 ? 159  LEU A O   1 
ATOM   1273 C  CB  . LEU A 1 159 ? 34.263 3.221   100.491 1.00 23.61 ? 159  LEU A CB  1 
ATOM   1274 C  CG  . LEU A 1 159 ? 34.899 4.027   101.624 1.00 23.78 ? 159  LEU A CG  1 
ATOM   1275 C  CD1 . LEU A 1 159 ? 35.419 3.111   102.725 1.00 24.16 ? 159  LEU A CD1 1 
ATOM   1276 C  CD2 . LEU A 1 159 ? 36.021 4.898   101.084 1.00 24.29 ? 159  LEU A CD2 1 
ATOM   1277 N  N   . PRO A 1 160 ? 34.229 3.435   97.223  1.00 22.03 ? 160  PRO A N   1 
ATOM   1278 C  CA  . PRO A 1 160 ? 34.268 2.596   96.022  1.00 21.94 ? 160  PRO A CA  1 
ATOM   1279 C  C   . PRO A 1 160 ? 34.754 1.184   96.336  1.00 21.46 ? 160  PRO A C   1 
ATOM   1280 O  O   . PRO A 1 160 ? 35.353 0.943   97.383  1.00 21.37 ? 160  PRO A O   1 
ATOM   1281 C  CB  . PRO A 1 160 ? 35.249 3.329   95.103  1.00 22.05 ? 160  PRO A CB  1 
ATOM   1282 C  CG  . PRO A 1 160 ? 36.113 4.109   96.023  1.00 21.89 ? 160  PRO A CG  1 
ATOM   1283 C  CD  . PRO A 1 160 ? 35.220 4.525   97.159  1.00 22.23 ? 160  PRO A CD  1 
ATOM   1284 N  N   . ILE A 1 161 ? 34.498 0.267   95.414  1.00 21.36 ? 161  ILE A N   1 
ATOM   1285 C  CA  . ILE A 1 161 ? 34.646 -1.162  95.669  1.00 21.31 ? 161  ILE A CA  1 
ATOM   1286 C  C   . ILE A 1 161 ? 35.811 -1.804  94.921  1.00 21.98 ? 161  ILE A C   1 
ATOM   1287 O  O   . ILE A 1 161 ? 36.328 -2.836  95.352  1.00 21.61 ? 161  ILE A O   1 
ATOM   1288 C  CB  . ILE A 1 161 ? 33.341 -1.890  95.296  1.00 21.46 ? 161  ILE A CB  1 
ATOM   1289 C  CG1 . ILE A 1 161 ? 32.174 -1.331  96.123  1.00 21.38 ? 161  ILE A CG1 1 
ATOM   1290 C  CG2 . ILE A 1 161 ? 33.457 -3.399  95.490  1.00 21.55 ? 161  ILE A CG2 1 
ATOM   1291 C  CD1 . ILE A 1 161 ? 32.394 -1.355  97.617  1.00 21.25 ? 161  ILE A CD1 1 
ATOM   1292 N  N   . ALA A 1 162 ? 36.214 -1.213  93.802  1.00 22.02 ? 162  ALA A N   1 
ATOM   1293 C  CA  . ALA A 1 162 ? 37.316 -1.759  93.021  1.00 22.03 ? 162  ALA A CA  1 
ATOM   1294 C  C   . ALA A 1 162 ? 37.924 -0.698  92.130  1.00 22.76 ? 162  ALA A C   1 
ATOM   1295 O  O   . ALA A 1 162 ? 37.328 0.362   91.904  1.00 23.33 ? 162  ALA A O   1 
ATOM   1296 C  CB  . ALA A 1 162 ? 36.842 -2.936  92.192  1.00 21.73 ? 162  ALA A CB  1 
ATOM   1297 N  N   . ALA A 1 163 ? 39.137 -0.974  91.661  1.00 22.61 ? 163  ALA A N   1 
ATOM   1298 C  CA  . ALA A 1 163 ? 39.824 -0.091  90.741  1.00 22.78 ? 163  ALA A CA  1 
ATOM   1299 C  C   . ALA A 1 163 ? 40.491 -0.919  89.650  1.00 23.55 ? 163  ALA A C   1 
ATOM   1300 O  O   . ALA A 1 163 ? 40.895 -2.062  89.884  1.00 24.37 ? 163  ALA A O   1 
ATOM   1301 C  CB  . ALA A 1 163 ? 40.859 0.748   91.476  1.00 22.74 ? 163  ALA A CB  1 
ATOM   1302 N  N   . ILE A 1 164 ? 40.589 -0.338  88.462  1.00 23.76 ? 164  ILE A N   1 
ATOM   1303 C  CA  . ILE A 1 164 ? 41.359 -0.920  87.373  1.00 23.70 ? 164  ILE A CA  1 
ATOM   1304 C  C   . ILE A 1 164 ? 42.427 0.102   87.010  1.00 22.93 ? 164  ILE A C   1 
ATOM   1305 O  O   . ILE A 1 164 ? 42.117 1.256   86.706  1.00 22.90 ? 164  ILE A O   1 
ATOM   1306 C  CB  . ILE A 1 164 ? 40.475 -1.295  86.163  1.00 23.93 ? 164  ILE A CB  1 
ATOM   1307 C  CG1 . ILE A 1 164 ? 39.483 -2.391  86.566  1.00 24.42 ? 164  ILE A CG1 1 
ATOM   1308 C  CG2 . ILE A 1 164 ? 41.334 -1.786  84.998  1.00 24.12 ? 164  ILE A CG2 1 
ATOM   1309 C  CD1 . ILE A 1 164 ? 38.444 -2.725  85.513  1.00 24.75 ? 164  ILE A CD1 1 
ATOM   1310 N  N   . VAL A 1 165 ? 43.685 -0.315  87.085  1.00 22.80 ? 165  VAL A N   1 
ATOM   1311 C  CA  . VAL A 1 165 ? 44.810 0.572   86.828  1.00 23.89 ? 165  VAL A CA  1 
ATOM   1312 C  C   . VAL A 1 165 ? 45.358 0.299   85.432  1.00 25.52 ? 165  VAL A C   1 
ATOM   1313 O  O   . VAL A 1 165 ? 45.791 -0.816  85.150  1.00 26.19 ? 165  VAL A O   1 
ATOM   1314 C  CB  . VAL A 1 165 ? 45.940 0.377   87.857  1.00 23.42 ? 165  VAL A CB  1 
ATOM   1315 C  CG1 . VAL A 1 165 ? 47.002 1.458   87.693  1.00 23.39 ? 165  VAL A CG1 1 
ATOM   1316 C  CG2 . VAL A 1 165 ? 45.372 0.378   89.273  1.00 23.22 ? 165  VAL A CG2 1 
ATOM   1317 N  N   . ASP A 1 166 ? 45.330 1.326   84.581  1.00 27.57 ? 166  ASP A N   1 
ATOM   1318 C  CA  . ASP A 1 166 ? 45.832 1.264   83.197  1.00 29.61 ? 166  ASP A CA  1 
ATOM   1319 C  C   . ASP A 1 166 ? 45.294 0.063   82.419  1.00 29.93 ? 166  ASP A C   1 
ATOM   1320 O  O   . ASP A 1 166 ? 46.030 -0.586  81.661  1.00 30.95 ? 166  ASP A O   1 
ATOM   1321 C  CB  . ASP A 1 166 ? 47.367 1.291   83.178  1.00 30.72 ? 166  ASP A CB  1 
ATOM   1322 C  CG  . ASP A 1 166 ? 47.931 2.621   83.647  1.00 32.17 ? 166  ASP A CG  1 
ATOM   1323 O  OD1 . ASP A 1 166 ? 47.588 3.671   83.053  1.00 32.58 ? 166  ASP A OD1 1 
ATOM   1324 O  OD2 . ASP A 1 166 ? 48.719 2.620   84.617  1.00 33.97 ? 166  ASP A OD2 1 
ATOM   1325 N  N   . GLU A 1 167 ? 44.008 -0.225  82.628  1.00 30.74 ? 167  GLU A N   1 
ATOM   1326 C  CA  . GLU A 1 167 ? 43.295 -1.294  81.928  1.00 31.29 ? 167  GLU A CA  1 
ATOM   1327 C  C   . GLU A 1 167 ? 43.913 -2.683  82.121  1.00 30.86 ? 167  GLU A C   1 
ATOM   1328 O  O   . GLU A 1 167 ? 43.594 -3.601  81.364  1.00 32.53 ? 167  GLU A O   1 
ATOM   1329 C  CB  . GLU A 1 167 ? 43.207 -0.971  80.424  1.00 32.67 ? 167  GLU A CB  1 
ATOM   1330 C  CG  . GLU A 1 167 ? 42.711 0.436   80.115  1.00 33.98 ? 167  GLU A CG  1 
ATOM   1331 C  CD  . GLU A 1 167 ? 42.531 0.701   78.628  1.00 35.88 ? 167  GLU A CD  1 
ATOM   1332 O  OE1 . GLU A 1 167 ? 43.098 -0.049  77.805  1.00 35.87 ? 167  GLU A OE1 1 
ATOM   1333 O  OE2 . GLU A 1 167 ? 41.820 1.670   78.281  1.00 37.17 ? 167  GLU A OE2 1 
ATOM   1334 N  N   . LYS A 1 168 ? 44.774 -2.846  83.130  1.00 29.77 ? 168  LYS A N   1 
ATOM   1335 C  CA  . LYS A 1 168 ? 45.537 -4.093  83.305  1.00 28.67 ? 168  LYS A CA  1 
ATOM   1336 C  C   . LYS A 1 168 ? 45.601 -4.676  84.725  1.00 26.51 ? 168  LYS A C   1 
ATOM   1337 O  O   . LYS A 1 168 ? 45.776 -5.887  84.876  1.00 25.87 ? 168  LYS A O   1 
ATOM   1338 C  CB  . LYS A 1 168 ? 46.964 -3.919  82.768  1.00 29.90 ? 168  LYS A CB  1 
ATOM   1339 C  CG  . LYS A 1 168 ? 47.062 -3.833  81.247  1.00 30.97 ? 168  LYS A CG  1 
ATOM   1340 C  CD  . LYS A 1 168 ? 46.498 -5.071  80.564  1.00 31.49 ? 168  LYS A CD  1 
ATOM   1341 C  CE  . LYS A 1 168 ? 46.704 -5.015  79.060  1.00 32.30 ? 168  LYS A CE  1 
ATOM   1342 N  NZ  . LYS A 1 168 ? 45.894 -6.055  78.373  1.00 33.25 ? 168  LYS A NZ  1 
ATOM   1343 N  N   . ILE A 1 169 ? 45.472 -3.841  85.753  1.00 24.18 ? 169  ILE A N   1 
ATOM   1344 C  CA  . ILE A 1 169 ? 45.497 -4.323  87.134  1.00 22.96 ? 169  ILE A CA  1 
ATOM   1345 C  C   . ILE A 1 169 ? 44.121 -4.145  87.776  1.00 22.05 ? 169  ILE A C   1 
ATOM   1346 O  O   . ILE A 1 169 ? 43.632 -3.023  87.875  1.00 22.11 ? 169  ILE A O   1 
ATOM   1347 C  CB  . ILE A 1 169 ? 46.558 -3.584  87.979  1.00 22.64 ? 169  ILE A CB  1 
ATOM   1348 C  CG1 . ILE A 1 169 ? 47.900 -3.529  87.236  1.00 22.88 ? 169  ILE A CG1 1 
ATOM   1349 C  CG2 . ILE A 1 169 ? 46.717 -4.257  89.342  1.00 22.30 ? 169  ILE A CG2 1 
ATOM   1350 C  CD1 . ILE A 1 169 ? 48.979 -2.755  87.968  1.00 22.68 ? 169  ILE A CD1 1 
ATOM   1351 N  N   . PHE A 1 170 ? 43.499 -5.252  88.182  1.00 21.08 ? 170  PHE A N   1 
ATOM   1352 C  CA  . PHE A 1 170 ? 42.212 -5.225  88.899  1.00 20.45 ? 170  PHE A CA  1 
ATOM   1353 C  C   . PHE A 1 170 ? 42.489 -5.209  90.392  1.00 20.38 ? 170  PHE A C   1 
ATOM   1354 O  O   . PHE A 1 170 ? 43.150 -6.101  90.900  1.00 20.25 ? 170  PHE A O   1 
ATOM   1355 C  CB  . PHE A 1 170 ? 41.363 -6.453  88.559  1.00 20.35 ? 170  PHE A CB  1 
ATOM   1356 C  CG  . PHE A 1 170 ? 39.995 -6.458  89.214  1.00 19.71 ? 170  PHE A CG  1 
ATOM   1357 C  CD1 . PHE A 1 170 ? 38.949 -5.723  88.671  1.00 19.86 ? 170  PHE A CD1 1 
ATOM   1358 C  CD2 . PHE A 1 170 ? 39.758 -7.203  90.363  1.00 19.68 ? 170  PHE A CD2 1 
ATOM   1359 C  CE1 . PHE A 1 170 ? 37.694 -5.729  89.256  1.00 19.29 ? 170  PHE A CE1 1 
ATOM   1360 C  CE2 . PHE A 1 170 ? 38.505 -7.207  90.962  1.00 19.55 ? 170  PHE A CE2 1 
ATOM   1361 C  CZ  . PHE A 1 170 ? 37.471 -6.473  90.402  1.00 19.74 ? 170  PHE A CZ  1 
ATOM   1362 N  N   . CYS A 1 171 ? 41.978 -4.196  91.085  1.00 20.23 ? 171  CYS A N   1 
ATOM   1363 C  CA  . CYS A 1 171 ? 42.258 -4.006  92.506  1.00 20.31 ? 171  CYS A CA  1 
ATOM   1364 C  C   . CYS A 1 171 ? 40.984 -4.043  93.341  1.00 20.85 ? 171  CYS A C   1 
ATOM   1365 O  O   . CYS A 1 171 ? 40.028 -3.325  93.054  1.00 20.54 ? 171  CYS A O   1 
ATOM   1366 C  CB  . CYS A 1 171 ? 42.969 -2.672  92.724  1.00 20.31 ? 171  CYS A CB  1 
ATOM   1367 S  SG  . CYS A 1 171 ? 44.532 -2.501  91.830  1.00 20.97 ? 171  CYS A SG  1 
ATOM   1368 N  N   . CYS A 1 172 ? 40.974 -4.900  94.359  1.00 21.20 ? 172  CYS A N   1 
ATOM   1369 C  CA  . CYS A 1 172 ? 39.893 -4.939  95.342  1.00 22.60 ? 172  CYS A CA  1 
ATOM   1370 C  C   . CYS A 1 172 ? 40.433 -5.491  96.660  1.00 22.86 ? 172  CYS A C   1 
ATOM   1371 O  O   . CYS A 1 172 ? 41.533 -6.051  96.706  1.00 22.46 ? 172  CYS A O   1 
ATOM   1372 C  CB  . CYS A 1 172 ? 38.710 -5.771  94.841  1.00 22.76 ? 172  CYS A CB  1 
ATOM   1373 S  SG  . CYS A 1 172 ? 39.064 -7.530  94.651  1.00 24.41 ? 172  CYS A SG  1 
ATOM   1374 N  N   . HIS A 1 173 ? 39.677 -5.321  97.739  1.00 23.04 ? 173  HIS A N   1 
ATOM   1375 C  CA  . HIS A 1 173 ? 40.182 -5.731  99.045  1.00 22.87 ? 173  HIS A CA  1 
ATOM   1376 C  C   . HIS A 1 173 ? 40.382 -7.236  99.145  1.00 22.85 ? 173  HIS A C   1 
ATOM   1377 O  O   . HIS A 1 173 ? 41.486 -7.700  99.461  1.00 21.68 ? 173  HIS A O   1 
ATOM   1378 C  CB  . HIS A 1 173 ? 39.273 -5.293  100.176 1.00 22.01 ? 173  HIS A CB  1 
ATOM   1379 C  CG  . HIS A 1 173 ? 39.822 -5.634  101.523 1.00 22.15 ? 173  HIS A CG  1 
ATOM   1380 N  ND1 . HIS A 1 173 ? 40.973 -5.058  102.017 1.00 22.44 ? 173  HIS A ND1 1 
ATOM   1381 C  CD2 . HIS A 1 173 ? 39.419 -6.527  102.455 1.00 21.54 ? 173  HIS A CD2 1 
ATOM   1382 C  CE1 . HIS A 1 173 ? 41.235 -5.559  103.210 1.00 21.49 ? 173  HIS A CE1 1 
ATOM   1383 N  NE2 . HIS A 1 173 ? 40.308 -6.451  103.498 1.00 21.94 ? 173  HIS A NE2 1 
ATOM   1384 N  N   . GLY A 1 174 ? 39.310 -7.980  98.873  1.00 22.64 ? 174  GLY A N   1 
ATOM   1385 C  CA  . GLY A 1 174 ? 39.264 -9.422  99.100  1.00 23.47 ? 174  GLY A CA  1 
ATOM   1386 C  C   . GLY A 1 174 ? 39.673 -10.222 97.883  1.00 24.65 ? 174  GLY A C   1 
ATOM   1387 O  O   . GLY A 1 174 ? 40.815 -10.666 97.778  1.00 24.92 ? 174  GLY A O   1 
ATOM   1388 N  N   . GLY A 1 175 ? 38.740 -10.414 96.954  1.00 25.20 ? 175  GLY A N   1 
ATOM   1389 C  CA  . GLY A 1 175 ? 39.047 -11.149 95.734  1.00 25.72 ? 175  GLY A CA  1 
ATOM   1390 C  C   . GLY A 1 175 ? 37.889 -11.270 94.767  1.00 25.88 ? 175  GLY A C   1 
ATOM   1391 O  O   . GLY A 1 175 ? 37.001 -10.418 94.723  1.00 26.64 ? 175  GLY A O   1 
ATOM   1392 N  N   . LEU A 1 176 ? 37.908 -12.336 93.982  1.00 25.68 ? 176  LEU A N   1 
ATOM   1393 C  CA  . LEU A 1 176 ? 36.928 -12.530 92.925  1.00 25.85 ? 176  LEU A CA  1 
ATOM   1394 C  C   . LEU A 1 176 ? 35.627 -13.086 93.477  1.00 26.35 ? 176  LEU A C   1 
ATOM   1395 O  O   . LEU A 1 176 ? 35.564 -13.540 94.623  1.00 25.89 ? 176  LEU A O   1 
ATOM   1396 C  CB  . LEU A 1 176 ? 37.488 -13.479 91.865  1.00 25.82 ? 176  LEU A CB  1 
ATOM   1397 C  CG  . LEU A 1 176 ? 38.813 -13.063 91.216  1.00 26.34 ? 176  LEU A CG  1 
ATOM   1398 C  CD1 . LEU A 1 176 ? 39.309 -14.157 90.280  1.00 26.32 ? 176  LEU A CD1 1 
ATOM   1399 C  CD2 . LEU A 1 176 ? 38.662 -11.745 90.466  1.00 26.60 ? 176  LEU A CD2 1 
ATOM   1400 N  N   . SER A 1 177 ? 34.602 -13.063 92.635  1.00 27.38 ? 177  SER A N   1 
ATOM   1401 C  CA  . SER A 1 177 ? 33.289 -13.599 92.972  1.00 28.39 ? 177  SER A CA  1 
ATOM   1402 C  C   . SER A 1 177 ? 32.840 -14.581 91.892  1.00 28.62 ? 177  SER A C   1 
ATOM   1403 O  O   . SER A 1 177 ? 33.109 -14.357 90.714  1.00 28.39 ? 177  SER A O   1 
ATOM   1404 C  CB  . SER A 1 177 ? 32.267 -12.470 93.051  1.00 27.63 ? 177  SER A CB  1 
ATOM   1405 O  OG  . SER A 1 177 ? 30.996 -12.971 93.436  1.00 27.74 ? 177  SER A OG  1 
ATOM   1406 N  N   . PRO A 1 178 ? 32.138 -15.659 92.287  1.00 30.68 ? 178  PRO A N   1 
ATOM   1407 C  CA  . PRO A 1 178 ? 31.458 -16.523 91.305  1.00 31.78 ? 178  PRO A CA  1 
ATOM   1408 C  C   . PRO A 1 178 ? 30.382 -15.793 90.501  1.00 33.00 ? 178  PRO A C   1 
ATOM   1409 O  O   . PRO A 1 178 ? 30.033 -16.236 89.405  1.00 33.81 ? 178  PRO A O   1 
ATOM   1410 C  CB  . PRO A 1 178 ? 30.801 -17.607 92.170  1.00 31.52 ? 178  PRO A CB  1 
ATOM   1411 C  CG  . PRO A 1 178 ? 31.493 -17.553 93.479  1.00 30.56 ? 178  PRO A CG  1 
ATOM   1412 C  CD  . PRO A 1 178 ? 31.967 -16.150 93.664  1.00 30.41 ? 178  PRO A CD  1 
ATOM   1413 N  N   . ASP A 1 179 ? 29.852 -14.701 91.053  1.00 33.89 ? 179  ASP A N   1 
ATOM   1414 C  CA  . ASP A 1 179 ? 28.853 -13.883 90.369  1.00 35.23 ? 179  ASP A CA  1 
ATOM   1415 C  C   . ASP A 1 179 ? 29.455 -12.759 89.521  1.00 35.24 ? 179  ASP A C   1 
ATOM   1416 O  O   . ASP A 1 179 ? 28.709 -11.973 88.938  1.00 36.10 ? 179  ASP A O   1 
ATOM   1417 C  CB  . ASP A 1 179 ? 27.885 -13.269 91.385  1.00 36.18 ? 179  ASP A CB  1 
ATOM   1418 C  CG  . ASP A 1 179 ? 27.156 -14.314 92.209  1.00 37.63 ? 179  ASP A CG  1 
ATOM   1419 O  OD1 . ASP A 1 179 ? 27.077 -15.480 91.770  1.00 39.05 ? 179  ASP A OD1 1 
ATOM   1420 O  OD2 . ASP A 1 179 ? 26.655 -13.960 93.298  1.00 37.61 ? 179  ASP A OD2 1 
ATOM   1421 N  N   . LEU A 1 180 ? 30.784 -12.672 89.446  1.00 33.97 ? 180  LEU A N   1 
ATOM   1422 C  CA  . LEU A 1 180 ? 31.431 -11.635 88.649  1.00 33.25 ? 180  LEU A CA  1 
ATOM   1423 C  C   . LEU A 1 180 ? 31.691 -12.131 87.228  1.00 33.11 ? 180  LEU A C   1 
ATOM   1424 O  O   . LEU A 1 180 ? 32.701 -12.784 86.963  1.00 33.37 ? 180  LEU A O   1 
ATOM   1425 C  CB  . LEU A 1 180 ? 32.739 -11.170 89.308  1.00 32.81 ? 180  LEU A CB  1 
ATOM   1426 C  CG  . LEU A 1 180 ? 33.477 -10.014 88.622  1.00 32.00 ? 180  LEU A CG  1 
ATOM   1427 C  CD1 . LEU A 1 180 ? 32.554 -8.827  88.386  1.00 32.20 ? 180  LEU A CD1 1 
ATOM   1428 C  CD2 . LEU A 1 180 ? 34.693 -9.592  89.433  1.00 32.64 ? 180  LEU A CD2 1 
ATOM   1429 N  N   . GLN A 1 181 ? 30.757 -11.821 86.331  1.00 33.96 ? 181  GLN A N   1 
ATOM   1430 C  CA  . GLN A 1 181 ? 30.870 -12.141 84.901  1.00 34.14 ? 181  GLN A CA  1 
ATOM   1431 C  C   . GLN A 1 181 ? 31.251 -10.921 84.060  1.00 32.38 ? 181  GLN A C   1 
ATOM   1432 O  O   . GLN A 1 181 ? 31.917 -11.056 83.032  1.00 32.85 ? 181  GLN A O   1 
ATOM   1433 C  CB  . GLN A 1 181 ? 29.550 -12.724 84.375  1.00 35.48 ? 181  GLN A CB  1 
ATOM   1434 C  CG  . GLN A 1 181 ? 29.483 -14.242 84.413  1.00 37.55 ? 181  GLN A CG  1 
ATOM   1435 C  CD  . GLN A 1 181 ? 29.591 -14.797 85.819  1.00 38.46 ? 181  GLN A CD  1 
ATOM   1436 O  OE1 . GLN A 1 181 ? 28.772 -14.481 86.683  1.00 39.81 ? 181  GLN A OE1 1 
ATOM   1437 N  NE2 . GLN A 1 181 ? 30.596 -15.639 86.055  1.00 39.35 ? 181  GLN A NE2 1 
ATOM   1438 N  N   . SER A 1 182 ? 30.807 -9.743  84.489  1.00 30.88 ? 182  SER A N   1 
ATOM   1439 C  CA  . SER A 1 182 ? 31.072 -8.496  83.785  1.00 29.92 ? 182  SER A CA  1 
ATOM   1440 C  C   . SER A 1 182 ? 31.401 -7.375  84.774  1.00 28.26 ? 182  SER A C   1 
ATOM   1441 O  O   . SER A 1 182 ? 30.877 -7.346  85.888  1.00 26.75 ? 182  SER A O   1 
ATOM   1442 C  CB  . SER A 1 182 ? 29.848 -8.104  82.953  1.00 30.21 ? 182  SER A CB  1 
ATOM   1443 O  OG  . SER A 1 182 ? 29.970 -6.782  82.461  1.00 31.43 ? 182  SER A OG  1 
ATOM   1444 N  N   . MET A 1 183 ? 32.259 -6.451  84.348  1.00 27.63 ? 183  MET A N   1 
ATOM   1445 C  CA  . MET A 1 183 ? 32.614 -5.276  85.156  1.00 27.04 ? 183  MET A CA  1 
ATOM   1446 C  C   . MET A 1 183 ? 31.425 -4.334  85.354  1.00 27.45 ? 183  MET A C   1 
ATOM   1447 O  O   . MET A 1 183 ? 31.382 -3.571  86.327  1.00 26.65 ? 183  MET A O   1 
ATOM   1448 C  CB  . MET A 1 183 ? 33.767 -4.510  84.509  1.00 27.42 ? 183  MET A CB  1 
ATOM   1449 C  CG  . MET A 1 183 ? 35.072 -5.286  84.445  1.00 26.65 ? 183  MET A CG  1 
ATOM   1450 S  SD  . MET A 1 183 ? 35.676 -5.740  86.080  1.00 26.58 ? 183  MET A SD  1 
ATOM   1451 C  CE  . MET A 1 183 ? 37.244 -6.489  85.658  1.00 26.09 ? 183  MET A CE  1 
ATOM   1452 N  N   . GLU A 1 184 ? 30.467 -4.384  84.429  1.00 26.01 ? 184  GLU A N   1 
ATOM   1453 C  CA  . GLU A 1 184 ? 29.244 -3.600  84.548  1.00 26.77 ? 184  GLU A CA  1 
ATOM   1454 C  C   . GLU A 1 184 ? 28.481 -3.944  85.823  1.00 25.64 ? 184  GLU A C   1 
ATOM   1455 O  O   . GLU A 1 184 ? 27.833 -3.085  86.402  1.00 24.55 ? 184  GLU A O   1 
ATOM   1456 C  CB  . GLU A 1 184 ? 28.350 -3.807  83.316  1.00 27.28 ? 184  GLU A CB  1 
ATOM   1457 C  CG  . GLU A 1 184 ? 27.083 -2.957  83.277  1.00 28.66 ? 184  GLU A CG  1 
ATOM   1458 C  CD  . GLU A 1 184 ? 27.343 -1.459  83.225  1.00 29.05 ? 184  GLU A CD  1 
ATOM   1459 O  OE1 . GLU A 1 184 ? 28.477 -1.041  82.901  1.00 29.70 ? 184  GLU A OE1 1 
ATOM   1460 O  OE2 . GLU A 1 184 ? 26.397 -0.692  83.496  1.00 29.57 ? 184  GLU A OE2 1 
ATOM   1461 N  N   . GLN A 1 185 ? 28.575 -5.195  86.266  1.00 25.72 ? 185  GLN A N   1 
ATOM   1462 C  CA  . GLN A 1 185 ? 27.917 -5.618  87.506  1.00 25.66 ? 185  GLN A CA  1 
ATOM   1463 C  C   . GLN A 1 185 ? 28.445 -4.862  88.724  1.00 26.09 ? 185  GLN A C   1 
ATOM   1464 O  O   . GLN A 1 185 ? 27.680 -4.539  89.628  1.00 25.17 ? 185  GLN A O   1 
ATOM   1465 C  CB  . GLN A 1 185 ? 28.103 -7.112  87.735  1.00 26.25 ? 185  GLN A CB  1 
ATOM   1466 C  CG  . GLN A 1 185 ? 27.521 -8.007  86.655  1.00 27.05 ? 185  GLN A CG  1 
ATOM   1467 C  CD  . GLN A 1 185 ? 27.805 -9.462  86.933  1.00 27.60 ? 185  GLN A CD  1 
ATOM   1468 O  OE1 . GLN A 1 185 ? 28.651 -10.082 86.285  1.00 27.87 ? 185  GLN A OE1 1 
ATOM   1469 N  NE2 . GLN A 1 185 ? 27.134 -10.006 87.936  1.00 29.12 ? 185  GLN A NE2 1 
ATOM   1470 N  N   . ILE A 1 186 ? 29.750 -4.589  88.752  1.00 24.88 ? 186  ILE A N   1 
ATOM   1471 C  CA  . ILE A 1 186 ? 30.332 -3.785  89.823  1.00 24.91 ? 186  ILE A CA  1 
ATOM   1472 C  C   . ILE A 1 186 ? 29.826 -2.353  89.713  1.00 24.25 ? 186  ILE A C   1 
ATOM   1473 O  O   . ILE A 1 186 ? 29.457 -1.748  90.713  1.00 23.55 ? 186  ILE A O   1 
ATOM   1474 C  CB  . ILE A 1 186 ? 31.878 -3.785  89.785  1.00 25.13 ? 186  ILE A CB  1 
ATOM   1475 C  CG1 . ILE A 1 186 ? 32.419 -5.183  90.104  1.00 25.25 ? 186  ILE A CG1 1 
ATOM   1476 C  CG2 . ILE A 1 186 ? 32.440 -2.785  90.790  1.00 25.75 ? 186  ILE A CG2 1 
ATOM   1477 C  CD1 . ILE A 1 186 ? 33.892 -5.356  89.786  1.00 25.72 ? 186  ILE A CD1 1 
ATOM   1478 N  N   . ARG A 1 187 ? 29.790 -1.824  88.490  1.00 25.38 ? 187  ARG A N   1 
ATOM   1479 C  CA  . ARG A 1 187 ? 29.348 -0.449  88.272  1.00 26.76 ? 187  ARG A CA  1 
ATOM   1480 C  C   . ARG A 1 187 ? 27.882 -0.236  88.681  1.00 27.43 ? 187  ARG A C   1 
ATOM   1481 O  O   . ARG A 1 187 ? 27.495 0.883   89.005  1.00 27.80 ? 187  ARG A O   1 
ATOM   1482 C  CB  . ARG A 1 187 ? 29.540 -0.035  86.813  1.00 28.04 ? 187  ARG A CB  1 
ATOM   1483 C  CG  . ARG A 1 187 ? 30.981 -0.055  86.328  1.00 28.53 ? 187  ARG A CG  1 
ATOM   1484 C  CD  . ARG A 1 187 ? 31.142 0.696   85.017  1.00 29.78 ? 187  ARG A CD  1 
ATOM   1485 N  NE  . ARG A 1 187 ? 32.465 0.465   84.437  1.00 30.69 ? 187  ARG A NE  1 
ATOM   1486 C  CZ  . ARG A 1 187 ? 32.771 -0.505  83.574  1.00 31.33 ? 187  ARG A CZ  1 
ATOM   1487 N  NH1 . ARG A 1 187 ? 31.850 -1.362  83.134  1.00 32.30 ? 187  ARG A NH1 1 
ATOM   1488 N  NH2 . ARG A 1 187 ? 34.018 -0.609  83.132  1.00 31.75 ? 187  ARG A NH2 1 
ATOM   1489 N  N   . ARG A 1 188 ? 27.082 -1.302  88.652  1.00 28.49 ? 188  ARG A N   1 
ATOM   1490 C  CA  . ARG A 1 188 ? 25.656 -1.234  89.004  1.00 29.58 ? 188  ARG A CA  1 
ATOM   1491 C  C   . ARG A 1 188 ? 25.368 -1.451  90.498  1.00 28.46 ? 188  ARG A C   1 
ATOM   1492 O  O   . ARG A 1 188 ? 24.208 -1.443  90.903  1.00 29.60 ? 188  ARG A O   1 
ATOM   1493 C  CB  . ARG A 1 188 ? 24.850 -2.246  88.174  1.00 32.02 ? 188  ARG A CB  1 
ATOM   1494 C  CG  . ARG A 1 188 ? 24.707 -1.872  86.701  1.00 34.73 ? 188  ARG A CG  1 
ATOM   1495 C  CD  . ARG A 1 188 ? 23.646 -2.719  86.007  1.00 37.28 ? 188  ARG A CD  1 
ATOM   1496 N  NE  . ARG A 1 188 ? 24.001 -4.145  85.965  1.00 38.92 ? 188  ARG A NE  1 
ATOM   1497 C  CZ  . ARG A 1 188 ? 24.250 -4.860  84.861  1.00 40.96 ? 188  ARG A CZ  1 
ATOM   1498 N  NH1 . ARG A 1 188 ? 24.181 -4.322  83.643  1.00 42.59 ? 188  ARG A NH1 1 
ATOM   1499 N  NH2 . ARG A 1 188 ? 24.559 -6.147  84.976  1.00 41.72 ? 188  ARG A NH2 1 
ATOM   1500 N  N   . ILE A 1 189 ? 26.400 -1.646  91.317  1.00 27.57 ? 189  ILE A N   1 
ATOM   1501 C  CA  . ILE A 1 189 ? 26.201 -1.747  92.760  1.00 26.61 ? 189  ILE A CA  1 
ATOM   1502 C  C   . ILE A 1 189 ? 25.801 -0.368  93.272  1.00 26.29 ? 189  ILE A C   1 
ATOM   1503 O  O   . ILE A 1 189 ? 26.458 0.624   92.971  1.00 24.76 ? 189  ILE A O   1 
ATOM   1504 C  CB  . ILE A 1 189 ? 27.457 -2.243  93.507  1.00 26.52 ? 189  ILE A CB  1 
ATOM   1505 C  CG1 . ILE A 1 189 ? 27.748 -3.704  93.154  1.00 26.34 ? 189  ILE A CG1 1 
ATOM   1506 C  CG2 . ILE A 1 189 ? 27.268 -2.108  95.017  1.00 27.53 ? 189  ILE A CG2 1 
ATOM   1507 C  CD1 . ILE A 1 189 ? 29.128 -4.167  93.566  1.00 26.81 ? 189  ILE A CD1 1 
ATOM   1508 N  N   . MET A 1 190 ? 24.724 -0.321  94.048  1.00 25.89 ? 190  MET A N   1 
ATOM   1509 C  CA  . MET A 1 190 ? 24.154 0.940   94.504  1.00 27.11 ? 190  MET A CA  1 
ATOM   1510 C  C   . MET A 1 190 ? 24.709 1.364   95.869  1.00 26.55 ? 190  MET A C   1 
ATOM   1511 O  O   . MET A 1 190 ? 24.761 0.568   96.800  1.00 27.23 ? 190  MET A O   1 
ATOM   1512 C  CB  . MET A 1 190 ? 22.626 0.805   94.563  1.00 28.70 ? 190  MET A CB  1 
ATOM   1513 C  CG  . MET A 1 190 ? 21.886 2.104   94.830  1.00 30.33 ? 190  MET A CG  1 
ATOM   1514 S  SD  . MET A 1 190 ? 22.200 3.313   93.538  1.00 34.05 ? 190  MET A SD  1 
ATOM   1515 C  CE  . MET A 1 190 ? 21.890 4.849   94.398  1.00 33.88 ? 190  MET A CE  1 
ATOM   1516 N  N   . ARG A 1 191 ? 25.107 2.632   95.981  1.00 26.33 ? 191  ARG A N   1 
ATOM   1517 C  CA  . ARG A 1 191 ? 25.568 3.213   97.244  1.00 25.46 ? 191  ARG A CA  1 
ATOM   1518 C  C   . ARG A 1 191 ? 24.662 4.368   97.643  1.00 25.52 ? 191  ARG A C   1 
ATOM   1519 O  O   . ARG A 1 191 ? 24.103 5.029   96.769  1.00 26.28 ? 191  ARG A O   1 
ATOM   1520 C  CB  . ARG A 1 191 ? 26.986 3.747   97.096  1.00 24.95 ? 191  ARG A CB  1 
ATOM   1521 C  CG  . ARG A 1 191 ? 28.004 2.691   96.721  1.00 24.33 ? 191  ARG A CG  1 
ATOM   1522 C  CD  . ARG A 1 191 ? 29.337 3.344   96.430  1.00 23.79 ? 191  ARG A CD  1 
ATOM   1523 N  NE  . ARG A 1 191 ? 29.292 4.210   95.253  1.00 23.04 ? 191  ARG A NE  1 
ATOM   1524 C  CZ  . ARG A 1 191 ? 30.307 4.968   94.837  1.00 23.23 ? 191  ARG A CZ  1 
ATOM   1525 N  NH1 . ARG A 1 191 ? 31.455 4.988   95.512  1.00 22.35 ? 191  ARG A NH1 1 
ATOM   1526 N  NH2 . ARG A 1 191 ? 30.181 5.715   93.739  1.00 22.36 ? 191  ARG A NH2 1 
ATOM   1527 N  N   . PRO A 1 192 ? 24.498 4.628   98.940  1.00 25.06 ? 192  PRO A N   1 
ATOM   1528 C  CA  . PRO A 1 192 ? 25.094 3.854   100.028 1.00 24.26 ? 192  PRO A CA  1 
ATOM   1529 C  C   . PRO A 1 192 ? 24.449 2.484   100.243 1.00 23.55 ? 192  PRO A C   1 
ATOM   1530 O  O   . PRO A 1 192 ? 23.263 2.287   99.952  1.00 21.94 ? 192  PRO A O   1 
ATOM   1531 C  CB  . PRO A 1 192 ? 24.838 4.734   101.250 1.00 24.76 ? 192  PRO A CB  1 
ATOM   1532 C  CG  . PRO A 1 192 ? 23.603 5.481   100.905 1.00 25.68 ? 192  PRO A CG  1 
ATOM   1533 C  CD  . PRO A 1 192 ? 23.756 5.795   99.448  1.00 25.60 ? 192  PRO A CD  1 
ATOM   1534 N  N   . THR A 1 193 ? 25.245 1.545   100.737 1.00 22.25 ? 193  THR A N   1 
ATOM   1535 C  CA  . THR A 1 193 ? 24.745 0.223   101.110 1.00 22.31 ? 193  THR A CA  1 
ATOM   1536 C  C   . THR A 1 193 ? 25.656 -0.381  102.170 1.00 23.39 ? 193  THR A C   1 
ATOM   1537 O  O   . THR A 1 193 ? 26.859 -0.103  102.198 1.00 23.31 ? 193  THR A O   1 
ATOM   1538 C  CB  . THR A 1 193 ? 24.656 -0.728  99.898  1.00 22.18 ? 193  THR A CB  1 
ATOM   1539 O  OG1 . THR A 1 193 ? 24.080 -1.981  100.296 1.00 21.11 ? 193  THR A OG1 1 
ATOM   1540 C  CG2 . THR A 1 193 ? 26.032 -0.970  99.287  1.00 22.20 ? 193  THR A CG2 1 
ATOM   1541 N  N   . ASP A 1 194 ? 25.070 -1.192  103.046 1.00 24.02 ? 194  ASP A N   1 
ATOM   1542 C  CA  . ASP A 1 194 ? 25.842 -2.028  103.948 1.00 24.77 ? 194  ASP A CA  1 
ATOM   1543 C  C   . ASP A 1 194 ? 26.299 -3.242  103.148 1.00 25.33 ? 194  ASP A C   1 
ATOM   1544 O  O   . ASP A 1 194 ? 25.734 -3.544  102.092 1.00 24.39 ? 194  ASP A O   1 
ATOM   1545 C  CB  . ASP A 1 194 ? 25.007 -2.455  105.158 1.00 24.67 ? 194  ASP A CB  1 
ATOM   1546 C  CG  . ASP A 1 194 ? 24.569 -1.280  106.016 1.00 24.47 ? 194  ASP A CG  1 
ATOM   1547 O  OD1 . ASP A 1 194 ? 25.107 -0.166  105.851 1.00 25.44 ? 194  ASP A OD1 1 
ATOM   1548 O  OD2 . ASP A 1 194 ? 23.659 -1.462  106.853 1.00 24.60 ? 194  ASP A OD2 1 
ATOM   1549 N  N   . VAL A 1 195 ? 27.346 -3.910  103.627 1.00 25.24 ? 195  VAL A N   1 
ATOM   1550 C  CA  . VAL A 1 195 ? 27.871 -5.093  102.955 1.00 25.59 ? 195  VAL A CA  1 
ATOM   1551 C  C   . VAL A 1 195 ? 26.975 -6.277  103.306 1.00 26.71 ? 195  VAL A C   1 
ATOM   1552 O  O   . VAL A 1 195 ? 26.765 -6.552  104.486 1.00 27.36 ? 195  VAL A O   1 
ATOM   1553 C  CB  . VAL A 1 195 ? 29.331 -5.399  103.373 1.00 24.84 ? 195  VAL A CB  1 
ATOM   1554 C  CG1 . VAL A 1 195 ? 29.816 -6.691  102.724 1.00 25.31 ? 195  VAL A CG1 1 
ATOM   1555 C  CG2 . VAL A 1 195 ? 30.245 -4.243  102.996 1.00 25.15 ? 195  VAL A CG2 1 
ATOM   1556 N  N   . PRO A 1 196 ? 26.421 -6.967  102.289 1.00 27.61 ? 196  PRO A N   1 
ATOM   1557 C  CA  . PRO A 1 196 ? 25.544 -8.106  102.568 1.00 27.79 ? 196  PRO A CA  1 
ATOM   1558 C  C   . PRO A 1 196 ? 26.316 -9.363  102.973 1.00 29.33 ? 196  PRO A C   1 
ATOM   1559 O  O   . PRO A 1 196 ? 27.542 -9.414  102.823 1.00 28.97 ? 196  PRO A O   1 
ATOM   1560 C  CB  . PRO A 1 196 ? 24.804 -8.316  101.248 1.00 27.84 ? 196  PRO A CB  1 
ATOM   1561 C  CG  . PRO A 1 196 ? 25.715 -7.776  100.212 1.00 28.37 ? 196  PRO A CG  1 
ATOM   1562 C  CD  . PRO A 1 196 ? 26.522 -6.682  100.845 1.00 27.67 ? 196  PRO A CD  1 
ATOM   1563 N  N   . ASP A 1 197 ? 25.595 -10.361 103.483 1.00 29.50 ? 197  ASP A N   1 
ATOM   1564 C  CA  . ASP A 1 197 ? 26.208 -11.615 103.929 1.00 30.87 ? 197  ASP A CA  1 
ATOM   1565 C  C   . ASP A 1 197 ? 26.531 -12.563 102.778 1.00 30.80 ? 197  ASP A C   1 
ATOM   1566 O  O   . ASP A 1 197 ? 27.270 -13.526 102.975 1.00 30.53 ? 197  ASP A O   1 
ATOM   1567 C  CB  . ASP A 1 197 ? 25.301 -12.338 104.936 1.00 31.61 ? 197  ASP A CB  1 
ATOM   1568 C  CG  . ASP A 1 197 ? 25.196 -11.610 106.260 1.00 33.36 ? 197  ASP A CG  1 
ATOM   1569 O  OD1 . ASP A 1 197 ? 26.188 -10.977 106.682 1.00 35.55 ? 197  ASP A OD1 1 
ATOM   1570 O  OD2 . ASP A 1 197 ? 24.115 -11.672 106.882 1.00 35.15 ? 197  ASP A OD2 1 
ATOM   1571 N  N   . GLN A 1 198 ? 25.969 -12.291 101.596 1.00 31.11 ? 198  GLN A N   1 
ATOM   1572 C  CA  . GLN A 1 198 ? 26.212 -13.068 100.379 1.00 32.12 ? 198  GLN A CA  1 
ATOM   1573 C  C   . GLN A 1 198 ? 26.187 -12.162 99.155  1.00 30.69 ? 198  GLN A C   1 
ATOM   1574 O  O   . GLN A 1 198 ? 25.655 -11.052 99.203  1.00 31.48 ? 198  GLN A O   1 
ATOM   1575 C  CB  . GLN A 1 198 ? 25.140 -14.150 100.188 1.00 33.99 ? 198  GLN A CB  1 
ATOM   1576 C  CG  . GLN A 1 198 ? 25.335 -15.402 101.007 1.00 35.90 ? 198  GLN A CG  1 
ATOM   1577 C  CD  . GLN A 1 198 ? 24.127 -15.780 101.852 1.00 38.67 ? 198  GLN A CD  1 
ATOM   1578 O  OE1 . GLN A 1 198 ? 23.480 -14.928 102.480 1.00 39.71 ? 198  GLN A OE1 1 
ATOM   1579 N  NE2 . GLN A 1 198 ? 23.839 -17.075 101.899 1.00 39.81 ? 198  GLN A NE2 1 
ATOM   1580 N  N   . GLY A 1 199 ? 26.753 -12.654 98.059  1.00 30.09 ? 199  GLY A N   1 
ATOM   1581 C  CA  . GLY A 1 199 ? 26.666 -11.978 96.766  1.00 29.80 ? 199  GLY A CA  1 
ATOM   1582 C  C   . GLY A 1 199 ? 27.937 -11.265 96.354  1.00 28.66 ? 199  GLY A C   1 
ATOM   1583 O  O   . GLY A 1 199 ? 28.964 -11.333 97.042  1.00 26.88 ? 199  GLY A O   1 
ATOM   1584 N  N   . LEU A 1 200 ? 27.844 -10.552 95.237  1.00 28.42 ? 200  LEU A N   1 
ATOM   1585 C  CA  . LEU A 1 200 ? 28.999 -9.931  94.592  1.00 28.27 ? 200  LEU A CA  1 
ATOM   1586 C  C   . LEU A 1 200 ? 29.799 -8.993  95.502  1.00 27.71 ? 200  LEU A C   1 
ATOM   1587 O  O   . LEU A 1 200 ? 31.024 -9.125  95.597  1.00 27.13 ? 200  LEU A O   1 
ATOM   1588 C  CB  . LEU A 1 200 ? 28.548 -9.195  93.327  1.00 28.92 ? 200  LEU A CB  1 
ATOM   1589 C  CG  . LEU A 1 200 ? 29.617 -8.482  92.497  1.00 29.31 ? 200  LEU A CG  1 
ATOM   1590 C  CD1 . LEU A 1 200 ? 30.685 -9.454  92.025  1.00 29.89 ? 200  LEU A CD1 1 
ATOM   1591 C  CD2 . LEU A 1 200 ? 28.963 -7.778  91.319  1.00 29.73 ? 200  LEU A CD2 1 
ATOM   1592 N  N   . LEU A 1 201 ? 29.120 -8.055  96.166  1.00 27.34 ? 201  LEU A N   1 
ATOM   1593 C  CA  . LEU A 1 201 ? 29.795 -7.081  97.033  1.00 27.28 ? 201  LEU A CA  1 
ATOM   1594 C  C   . LEU A 1 201 ? 30.518 -7.779  98.186  1.00 27.38 ? 201  LEU A C   1 
ATOM   1595 O  O   . LEU A 1 201 ? 31.665 -7.444  98.509  1.00 27.38 ? 201  LEU A O   1 
ATOM   1596 C  CB  . LEU A 1 201 ? 28.806 -6.038  97.578  1.00 27.95 ? 201  LEU A CB  1 
ATOM   1597 C  CG  . LEU A 1 201 ? 29.332 -5.016  98.600  1.00 28.47 ? 201  LEU A CG  1 
ATOM   1598 C  CD1 . LEU A 1 201 ? 30.561 -4.285  98.083  1.00 29.05 ? 201  LEU A CD1 1 
ATOM   1599 C  CD2 . LEU A 1 201 ? 28.250 -4.017  98.971  1.00 28.21 ? 201  LEU A CD2 1 
ATOM   1600 N  N   . CYS A 1 202 ? 29.845 -8.752  98.794  1.00 26.32 ? 202  CYS A N   1 
ATOM   1601 C  CA  . CYS A 1 202 ? 30.450 -9.588  99.829  1.00 25.33 ? 202  CYS A CA  1 
ATOM   1602 C  C   . CYS A 1 202 ? 31.743 -10.245 99.352  1.00 24.63 ? 202  CYS A C   1 
ATOM   1603 O  O   . CYS A 1 202 ? 32.786 -10.097 99.994  1.00 24.05 ? 202  CYS A O   1 
ATOM   1604 C  CB  . CYS A 1 202 ? 29.467 -10.665 100.284 1.00 26.22 ? 202  CYS A CB  1 
ATOM   1605 S  SG  . CYS A 1 202 ? 30.097 -11.764 101.566 1.00 27.96 ? 202  CYS A SG  1 
ATOM   1606 N  N   . ASP A 1 203 ? 31.679 -10.960 98.229  1.00 23.63 ? 203  ASP A N   1 
ATOM   1607 C  CA  . ASP A 1 203 ? 32.839 -11.694 97.713  1.00 22.99 ? 203  ASP A CA  1 
ATOM   1608 C  C   . ASP A 1 203 ? 34.023 -10.781 97.423  1.00 22.22 ? 203  ASP A C   1 
ATOM   1609 O  O   . ASP A 1 203 ? 35.176 -11.123 97.720  1.00 21.55 ? 203  ASP A O   1 
ATOM   1610 C  CB  . ASP A 1 203 ? 32.482 -12.451 96.429  1.00 23.70 ? 203  ASP A CB  1 
ATOM   1611 C  CG  . ASP A 1 203 ? 31.454 -13.539 96.651  1.00 23.65 ? 203  ASP A CG  1 
ATOM   1612 O  OD1 . ASP A 1 203 ? 31.375 -14.096 97.766  1.00 25.85 ? 203  ASP A OD1 1 
ATOM   1613 O  OD2 . ASP A 1 203 ? 30.710 -13.829 95.702  1.00 24.07 ? 203  ASP A OD2 1 
ATOM   1614 N  N   . LEU A 1 204 ? 33.741 -9.620  96.842  1.00 21.55 ? 204  LEU A N   1 
ATOM   1615 C  CA  . LEU A 1 204 ? 34.787 -8.648  96.520  1.00 21.92 ? 204  LEU A CA  1 
ATOM   1616 C  C   . LEU A 1 204 ? 35.565 -8.158  97.751  1.00 21.90 ? 204  LEU A C   1 
ATOM   1617 O  O   . LEU A 1 204 ? 36.734 -7.754  97.635  1.00 20.57 ? 204  LEU A O   1 
ATOM   1618 C  CB  . LEU A 1 204 ? 34.195 -7.458  95.761  1.00 22.42 ? 204  LEU A CB  1 
ATOM   1619 C  CG  . LEU A 1 204 ? 33.733 -7.718  94.322  1.00 22.88 ? 204  LEU A CG  1 
ATOM   1620 C  CD1 . LEU A 1 204 ? 32.979 -6.515  93.771  1.00 22.71 ? 204  LEU A CD1 1 
ATOM   1621 C  CD2 . LEU A 1 204 ? 34.904 -8.066  93.413  1.00 23.15 ? 204  LEU A CD2 1 
ATOM   1622 N  N   . LEU A 1 205 ? 34.928 -8.204  98.922  1.00 21.69 ? 205  LEU A N   1 
ATOM   1623 C  CA  . LEU A 1 205 ? 35.553 -7.756  100.176 1.00 22.00 ? 205  LEU A CA  1 
ATOM   1624 C  C   . LEU A 1 205 ? 36.005 -8.892  101.108 1.00 22.20 ? 205  LEU A C   1 
ATOM   1625 O  O   . LEU A 1 205 ? 36.692 -8.629  102.103 1.00 22.73 ? 205  LEU A O   1 
ATOM   1626 C  CB  . LEU A 1 205 ? 34.597 -6.816  100.932 1.00 22.30 ? 205  LEU A CB  1 
ATOM   1627 C  CG  . LEU A 1 205 ? 34.635 -5.328  100.559 1.00 22.43 ? 205  LEU A CG  1 
ATOM   1628 C  CD1 . LEU A 1 205 ? 34.488 -5.114  99.059  1.00 22.76 ? 205  LEU A CD1 1 
ATOM   1629 C  CD2 . LEU A 1 205 ? 33.546 -4.568  101.306 1.00 22.92 ? 205  LEU A CD2 1 
ATOM   1630 N  N   . TRP A 1 206 ? 35.647 -10.143 100.791 1.00 22.10 ? 206  TRP A N   1 
ATOM   1631 C  CA  . TRP A 1 206 ? 35.838 -11.270 101.721 1.00 21.69 ? 206  TRP A CA  1 
ATOM   1632 C  C   . TRP A 1 206 ? 36.585 -12.506 101.199 1.00 22.40 ? 206  TRP A C   1 
ATOM   1633 O  O   . TRP A 1 206 ? 37.151 -13.245 101.996 1.00 22.96 ? 206  TRP A O   1 
ATOM   1634 C  CB  . TRP A 1 206 ? 34.479 -11.736 102.256 1.00 21.33 ? 206  TRP A CB  1 
ATOM   1635 C  CG  . TRP A 1 206 ? 33.914 -10.878 103.347 1.00 20.30 ? 206  TRP A CG  1 
ATOM   1636 C  CD1 . TRP A 1 206 ? 33.069 -9.825  103.201 1.00 20.79 ? 206  TRP A CD1 1 
ATOM   1637 C  CD2 . TRP A 1 206 ? 34.158 -11.001 104.754 1.00 20.44 ? 206  TRP A CD2 1 
ATOM   1638 N  NE1 . TRP A 1 206 ? 32.761 -9.285  104.424 1.00 20.63 ? 206  TRP A NE1 1 
ATOM   1639 C  CE2 . TRP A 1 206 ? 33.415 -9.988  105.397 1.00 20.23 ? 206  TRP A CE2 1 
ATOM   1640 C  CE3 . TRP A 1 206 ? 34.928 -11.868 105.533 1.00 20.45 ? 206  TRP A CE3 1 
ATOM   1641 C  CZ2 . TRP A 1 206 ? 33.425 -9.814  106.778 1.00 19.74 ? 206  TRP A CZ2 1 
ATOM   1642 C  CZ3 . TRP A 1 206 ? 34.935 -11.695 106.903 1.00 20.14 ? 206  TRP A CZ3 1 
ATOM   1643 C  CH2 . TRP A 1 206 ? 34.189 -10.677 107.513 1.00 20.33 ? 206  TRP A CH2 1 
ATOM   1644 N  N   . SER A 1 207 ? 36.584 -12.748 99.895  1.00 22.42 ? 207  SER A N   1 
ATOM   1645 C  CA  . SER A 1 207 ? 37.143 -13.994 99.364  1.00 23.61 ? 207  SER A CA  1 
ATOM   1646 C  C   . SER A 1 207 ? 38.675 -14.034 99.437  1.00 23.92 ? 207  SER A C   1 
ATOM   1647 O  O   . SER A 1 207 ? 39.331 -13.001 99.543  1.00 22.24 ? 207  SER A O   1 
ATOM   1648 C  CB  . SER A 1 207 ? 36.667 -14.228 97.926  1.00 23.66 ? 207  SER A CB  1 
ATOM   1649 O  OG  . SER A 1 207 ? 37.258 -13.311 97.026  1.00 24.64 ? 207  SER A OG  1 
ATOM   1650 N  N   . ASP A 1 208 ? 39.226 -15.247 99.419  1.00 25.57 ? 208  ASP A N   1 
ATOM   1651 C  CA  . ASP A 1 208 ? 40.672 -15.465 99.462  1.00 26.26 ? 208  ASP A CA  1 
ATOM   1652 C  C   . ASP A 1 208 ? 41.107 -16.404 98.345  1.00 27.60 ? 208  ASP A C   1 
ATOM   1653 O  O   . ASP A 1 208 ? 40.342 -17.264 97.923  1.00 27.19 ? 208  ASP A O   1 
ATOM   1654 C  CB  . ASP A 1 208 ? 41.097 -16.094 100.795 1.00 26.60 ? 208  ASP A CB  1 
ATOM   1655 C  CG  . ASP A 1 208 ? 40.736 -15.246 101.992 1.00 26.69 ? 208  ASP A CG  1 
ATOM   1656 O  OD1 . ASP A 1 208 ? 41.231 -14.101 102.104 1.00 26.76 ? 208  ASP A OD1 1 
ATOM   1657 O  OD2 . ASP A 1 208 ? 39.961 -15.733 102.841 1.00 26.24 ? 208  ASP A OD2 1 
ATOM   1658 N  N   . PRO A 1 209 ? 42.353 -16.257 97.871  1.00 28.66 ? 209  PRO A N   1 
ATOM   1659 C  CA  . PRO A 1 209 ? 42.916 -17.285 97.006  1.00 30.61 ? 209  PRO A CA  1 
ATOM   1660 C  C   . PRO A 1 209 ? 43.323 -18.498 97.838  1.00 32.82 ? 209  PRO A C   1 
ATOM   1661 O  O   . PRO A 1 209 ? 43.581 -18.359 99.036  1.00 32.87 ? 209  PRO A O   1 
ATOM   1662 C  CB  . PRO A 1 209 ? 44.146 -16.603 96.414  1.00 29.60 ? 209  PRO A CB  1 
ATOM   1663 C  CG  . PRO A 1 209 ? 44.580 -15.656 97.478  1.00 29.41 ? 209  PRO A CG  1 
ATOM   1664 C  CD  . PRO A 1 209 ? 43.319 -15.181 98.147  1.00 29.19 ? 209  PRO A CD  1 
ATOM   1665 N  N   . ASP A 1 210 ? 43.376 -19.669 97.207  1.00 36.72 ? 210  ASP A N   1 
ATOM   1666 C  CA  . ASP A 1 210 ? 43.782 -20.903 97.880  1.00 39.09 ? 210  ASP A CA  1 
ATOM   1667 C  C   . ASP A 1 210 ? 44.467 -21.835 96.877  1.00 40.69 ? 210  ASP A C   1 
ATOM   1668 O  O   . ASP A 1 210 ? 43.925 -22.115 95.804  1.00 41.34 ? 210  ASP A O   1 
ATOM   1669 C  CB  . ASP A 1 210 ? 42.561 -21.582 98.519  1.00 40.58 ? 210  ASP A CB  1 
ATOM   1670 C  CG  . ASP A 1 210 ? 42.937 -22.633 99.562  1.00 42.35 ? 210  ASP A CG  1 
ATOM   1671 O  OD1 . ASP A 1 210 ? 44.025 -23.240 99.461  1.00 42.20 ? 210  ASP A OD1 1 
ATOM   1672 O  OD2 . ASP A 1 210 ? 42.126 -22.859 100.487 1.00 44.21 ? 210  ASP A OD2 1 
ATOM   1673 N  N   . LYS A 1 211 ? 45.663 -22.301 97.232  1.00 43.47 ? 211  LYS A N   1 
ATOM   1674 C  CA  . LYS A 1 211 ? 46.464 -23.156 96.353  1.00 45.84 ? 211  LYS A CA  1 
ATOM   1675 C  C   . LYS A 1 211 ? 45.916 -24.579 96.266  1.00 46.77 ? 211  LYS A C   1 
ATOM   1676 O  O   . LYS A 1 211 ? 46.064 -25.242 95.238  1.00 47.62 ? 211  LYS A O   1 
ATOM   1677 C  CB  . LYS A 1 211 ? 47.921 -23.183 96.825  1.00 47.77 ? 211  LYS A CB  1 
ATOM   1678 C  CG  . LYS A 1 211 ? 48.600 -21.825 96.731  1.00 50.22 ? 211  LYS A CG  1 
ATOM   1679 C  CD  . LYS A 1 211 ? 50.053 -21.851 97.168  1.00 51.96 ? 211  LYS A CD  1 
ATOM   1680 C  CE  . LYS A 1 211 ? 50.719 -20.519 96.854  1.00 52.48 ? 211  LYS A CE  1 
ATOM   1681 N  NZ  . LYS A 1 211 ? 52.151 -20.493 97.255  1.00 53.81 ? 211  LYS A NZ  1 
ATOM   1682 N  N   . ASP A 1 212 ? 45.285 -25.041 97.342  1.00 47.14 ? 212  ASP A N   1 
ATOM   1683 C  CA  . ASP A 1 212 ? 44.753 -26.405 97.402  1.00 48.36 ? 212  ASP A CA  1 
ATOM   1684 C  C   . ASP A 1 212 ? 43.387 -26.558 96.729  1.00 47.97 ? 212  ASP A C   1 
ATOM   1685 O  O   . ASP A 1 212 ? 42.951 -27.679 96.475  1.00 49.88 ? 212  ASP A O   1 
ATOM   1686 C  CB  . ASP A 1 212 ? 44.676 -26.875 98.857  1.00 48.11 ? 212  ASP A CB  1 
ATOM   1687 C  CG  . ASP A 1 212 ? 46.037 -26.906 99.535  1.00 48.61 ? 212  ASP A CG  1 
ATOM   1688 O  OD1 . ASP A 1 212 ? 47.066 -26.782 98.837  1.00 47.40 ? 212  ASP A OD1 1 
ATOM   1689 O  OD2 . ASP A 1 212 ? 46.079 -27.054 100.773 1.00 50.74 ? 212  ASP A OD2 1 
ATOM   1690 N  N   . VAL A 1 213 ? 42.716 -25.442 96.446  1.00 48.45 ? 213  VAL A N   1 
ATOM   1691 C  CA  . VAL A 1 213 ? 41.443 -25.461 95.723  1.00 47.45 ? 213  VAL A CA  1 
ATOM   1692 C  C   . VAL A 1 213 ? 41.697 -25.252 94.235  1.00 46.53 ? 213  VAL A C   1 
ATOM   1693 O  O   . VAL A 1 213 ? 42.586 -24.497 93.845  1.00 45.24 ? 213  VAL A O   1 
ATOM   1694 C  CB  . VAL A 1 213 ? 40.480 -24.367 96.231  1.00 48.04 ? 213  VAL A CB  1 
ATOM   1695 C  CG1 . VAL A 1 213 ? 39.134 -24.460 95.523  1.00 48.22 ? 213  VAL A CG1 1 
ATOM   1696 C  CG2 . VAL A 1 213 ? 40.294 -24.483 97.735  1.00 48.07 ? 213  VAL A CG2 1 
ATOM   1697 N  N   . LEU A 1 214 ? 40.912 -25.935 93.409  1.00 46.46 ? 214  LEU A N   1 
ATOM   1698 C  CA  . LEU A 1 214 ? 41.040 -25.865 91.962  1.00 45.71 ? 214  LEU A CA  1 
ATOM   1699 C  C   . LEU A 1 214 ? 40.093 -24.835 91.357  1.00 45.53 ? 214  LEU A C   1 
ATOM   1700 O  O   . LEU A 1 214 ? 40.514 -23.968 90.582  1.00 46.57 ? 214  LEU A O   1 
ATOM   1701 C  CB  . LEU A 1 214 ? 40.735 -27.254 91.405  1.00 45.70 ? 214  LEU A CB  1 
ATOM   1702 C  CG  . LEU A 1 214 ? 41.081 -27.539 89.942  1.00 44.92 ? 214  LEU A CG  1 
ATOM   1703 C  CD1 . LEU A 1 214 ? 42.541 -27.944 89.833  1.00 45.07 ? 214  LEU A CD1 1 
ATOM   1704 C  CD2 . LEU A 1 214 ? 40.180 -28.615 89.345  1.00 44.63 ? 214  LEU A CD2 1 
ATOM   1705 N  N   . GLY A 1 215 ? 38.814 -24.947 91.702  1.00 45.23 ? 215  GLY A N   1 
ATOM   1706 C  CA  . GLY A 1 215 ? 37.792 -24.005 91.250  1.00 43.71 ? 215  GLY A CA  1 
ATOM   1707 C  C   . GLY A 1 215 ? 37.392 -23.090 92.391  1.00 43.31 ? 215  GLY A C   1 
ATOM   1708 O  O   . GLY A 1 215 ? 38.214 -22.317 92.887  1.00 43.00 ? 215  GLY A O   1 
ATOM   1709 N  N   . TRP A 1 216 ? 36.132 -23.186 92.807  1.00 42.34 ? 216  TRP A N   1 
ATOM   1710 C  CA  . TRP A 1 216 ? 35.629 -22.471 93.978  1.00 42.31 ? 216  TRP A CA  1 
ATOM   1711 C  C   . TRP A 1 216 ? 35.423 -23.447 95.133  1.00 42.59 ? 216  TRP A C   1 
ATOM   1712 O  O   . TRP A 1 216 ? 35.015 -24.589 94.918  1.00 44.01 ? 216  TRP A O   1 
ATOM   1713 C  CB  . TRP A 1 216 ? 34.310 -21.774 93.650  1.00 41.24 ? 216  TRP A CB  1 
ATOM   1714 C  CG  . TRP A 1 216 ? 34.448 -20.710 92.614  1.00 40.60 ? 216  TRP A CG  1 
ATOM   1715 C  CD1 . TRP A 1 216 ? 34.265 -20.844 91.270  1.00 40.14 ? 216  TRP A CD1 1 
ATOM   1716 C  CD2 . TRP A 1 216 ? 34.803 -19.341 92.836  1.00 39.40 ? 216  TRP A CD2 1 
ATOM   1717 N  NE1 . TRP A 1 216 ? 34.487 -19.643 90.638  1.00 39.99 ? 216  TRP A NE1 1 
ATOM   1718 C  CE2 . TRP A 1 216 ? 34.816 -18.704 91.578  1.00 39.12 ? 216  TRP A CE2 1 
ATOM   1719 C  CE3 . TRP A 1 216 ? 35.117 -18.593 93.976  1.00 39.07 ? 216  TRP A CE3 1 
ATOM   1720 C  CZ2 . TRP A 1 216 ? 35.126 -17.354 91.428  1.00 39.10 ? 216  TRP A CZ2 1 
ATOM   1721 C  CZ3 . TRP A 1 216 ? 35.422 -17.249 93.824  1.00 38.69 ? 216  TRP A CZ3 1 
ATOM   1722 C  CH2 . TRP A 1 216 ? 35.429 -16.647 92.559  1.00 38.60 ? 216  TRP A CH2 1 
ATOM   1723 N  N   . GLY A 1 217 ? 35.704 -22.992 96.352  1.00 42.03 ? 217  GLY A N   1 
ATOM   1724 C  CA  . GLY A 1 217 ? 35.537 -23.811 97.554  1.00 42.19 ? 217  GLY A CA  1 
ATOM   1725 C  C   . GLY A 1 217 ? 35.041 -22.996 98.731  1.00 42.80 ? 217  GLY A C   1 
ATOM   1726 O  O   . GLY A 1 217 ? 34.881 -21.780 98.626  1.00 42.24 ? 217  GLY A O   1 
ATOM   1727 N  N   . GLU A 1 218 ? 34.792 -23.666 99.854  1.00 44.55 ? 218  GLU A N   1 
ATOM   1728 C  CA  . GLU A 1 218 ? 34.307 -22.992 101.059 1.00 45.89 ? 218  GLU A CA  1 
ATOM   1729 C  C   . GLU A 1 218 ? 35.440 -22.237 101.753 1.00 44.15 ? 218  GLU A C   1 
ATOM   1730 O  O   . GLU A 1 218 ? 36.586 -22.692 101.776 1.00 43.93 ? 218  GLU A O   1 
ATOM   1731 C  CB  . GLU A 1 218 ? 33.665 -23.983 102.041 1.00 47.88 ? 218  GLU A CB  1 
ATOM   1732 C  CG  . GLU A 1 218 ? 32.357 -24.600 101.558 1.00 49.69 ? 218  GLU A CG  1 
ATOM   1733 C  CD  . GLU A 1 218 ? 32.532 -26.006 101.010 1.00 52.24 ? 218  GLU A CD  1 
ATOM   1734 O  OE1 . GLU A 1 218 ? 32.782 -26.929 101.817 1.00 53.66 ? 218  GLU A OE1 1 
ATOM   1735 O  OE2 . GLU A 1 218 ? 32.408 -26.193 99.779  1.00 53.57 ? 218  GLU A OE2 1 
ATOM   1736 N  N   . ASN A 1 219 ? 35.100 -21.081 102.315 1.00 42.56 ? 219  ASN A N   1 
ATOM   1737 C  CA  . ASN A 1 219 ? 36.066 -20.226 102.994 1.00 40.77 ? 219  ASN A CA  1 
ATOM   1738 C  C   . ASN A 1 219 ? 35.983 -20.439 104.499 1.00 39.05 ? 219  ASN A C   1 
ATOM   1739 O  O   . ASN A 1 219 ? 34.903 -20.347 105.081 1.00 37.91 ? 219  ASN A O   1 
ATOM   1740 C  CB  . ASN A 1 219 ? 35.794 -18.759 102.652 1.00 39.88 ? 219  ASN A CB  1 
ATOM   1741 C  CG  . ASN A 1 219 ? 36.955 -17.847 103.011 1.00 39.15 ? 219  ASN A CG  1 
ATOM   1742 O  OD1 . ASN A 1 219 ? 37.332 -17.734 104.175 1.00 39.42 ? 219  ASN A OD1 1 
ATOM   1743 N  ND2 . ASN A 1 219 ? 37.519 -17.179 102.013 1.00 38.55 ? 219  ASN A ND2 1 
ATOM   1744 N  N   . ASP A 1 220 ? 37.132 -20.694 105.123 1.00 39.04 ? 220  ASP A N   1 
ATOM   1745 C  CA  . ASP A 1 220 ? 37.210 -20.941 106.569 1.00 39.18 ? 220  ASP A CA  1 
ATOM   1746 C  C   . ASP A 1 220 ? 36.698 -19.782 107.431 1.00 37.39 ? 220  ASP A C   1 
ATOM   1747 O  O   . ASP A 1 220 ? 36.418 -19.976 108.615 1.00 37.20 ? 220  ASP A O   1 
ATOM   1748 C  CB  . ASP A 1 220 ? 38.648 -21.296 106.980 1.00 41.46 ? 220  ASP A CB  1 
ATOM   1749 C  CG  . ASP A 1 220 ? 39.082 -22.669 106.481 1.00 43.57 ? 220  ASP A CG  1 
ATOM   1750 O  OD1 . ASP A 1 220 ? 38.269 -23.617 106.541 1.00 45.69 ? 220  ASP A OD1 1 
ATOM   1751 O  OD2 . ASP A 1 220 ? 40.241 -22.807 106.037 1.00 45.31 ? 220  ASP A OD2 1 
ATOM   1752 N  N   . ARG A 1 221 ? 36.572 -18.588 106.845 1.00 34.45 ? 221  ARG A N   1 
ATOM   1753 C  CA  . ARG A 1 221 ? 36.008 -17.431 107.546 1.00 33.28 ? 221  ARG A CA  1 
ATOM   1754 C  C   . ARG A 1 221 ? 34.521 -17.590 107.867 1.00 34.17 ? 221  ARG A C   1 
ATOM   1755 O  O   . ARG A 1 221 ? 34.000 -16.881 108.724 1.00 34.19 ? 221  ARG A O   1 
ATOM   1756 C  CB  . ARG A 1 221 ? 36.190 -16.154 106.718 1.00 32.37 ? 221  ARG A CB  1 
ATOM   1757 C  CG  . ARG A 1 221 ? 37.628 -15.708 106.509 1.00 31.52 ? 221  ARG A CG  1 
ATOM   1758 C  CD  . ARG A 1 221 ? 37.665 -14.547 105.527 1.00 31.56 ? 221  ARG A CD  1 
ATOM   1759 N  NE  . ARG A 1 221 ? 39.003 -14.240 105.014 1.00 31.10 ? 221  ARG A NE  1 
ATOM   1760 C  CZ  . ARG A 1 221 ? 39.875 -13.403 105.581 1.00 31.25 ? 221  ARG A CZ  1 
ATOM   1761 N  NH1 . ARG A 1 221 ? 39.587 -12.778 106.718 1.00 30.92 ? 221  ARG A NH1 1 
ATOM   1762 N  NH2 . ARG A 1 221 ? 41.052 -13.188 105.001 1.00 30.66 ? 221  ARG A NH2 1 
ATOM   1763 N  N   . GLY A 1 222 ? 33.840 -18.495 107.164 1.00 34.51 ? 222  GLY A N   1 
ATOM   1764 C  CA  . GLY A 1 222 ? 32.409 -18.710 107.349 1.00 34.11 ? 222  GLY A CA  1 
ATOM   1765 C  C   . GLY A 1 222 ? 31.583 -17.757 106.506 1.00 34.24 ? 222  GLY A C   1 
ATOM   1766 O  O   . GLY A 1 222 ? 30.396 -17.559 106.758 1.00 33.59 ? 222  GLY A O   1 
ATOM   1767 N  N   . VAL A 1 223 ? 32.219 -17.167 105.500 1.00 34.78 ? 223  VAL A N   1 
ATOM   1768 C  CA  . VAL A 1 223 ? 31.556 -16.241 104.595 1.00 34.49 ? 223  VAL A CA  1 
ATOM   1769 C  C   . VAL A 1 223 ? 32.332 -16.209 103.281 1.00 33.69 ? 223  VAL A C   1 
ATOM   1770 O  O   . VAL A 1 223 ? 33.554 -16.374 103.271 1.00 33.64 ? 223  VAL A O   1 
ATOM   1771 C  CB  . VAL A 1 223 ? 31.427 -14.833 105.226 1.00 35.37 ? 223  VAL A CB  1 
ATOM   1772 C  CG1 . VAL A 1 223 ? 32.782 -14.309 105.685 1.00 35.04 ? 223  VAL A CG1 1 
ATOM   1773 C  CG2 . VAL A 1 223 ? 30.761 -13.855 104.266 1.00 35.16 ? 223  VAL A CG2 1 
ATOM   1774 N  N   . SER A 1 224 ? 31.613 -16.032 102.175 1.00 32.82 ? 224  SER A N   1 
ATOM   1775 C  CA  . SER A 1 224 ? 32.214 -15.980 100.839 1.00 33.19 ? 224  SER A CA  1 
ATOM   1776 C  C   . SER A 1 224 ? 32.890 -17.310 100.465 1.00 33.12 ? 224  SER A C   1 
ATOM   1777 O  O   . SER A 1 224 ? 32.557 -18.355 101.029 1.00 33.06 ? 224  SER A O   1 
ATOM   1778 C  CB  . SER A 1 224 ? 33.198 -14.808 100.740 1.00 32.98 ? 224  SER A CB  1 
ATOM   1779 O  OG  . SER A 1 224 ? 33.585 -14.591 99.399  1.00 32.32 ? 224  SER A OG  1 
ATOM   1780 N  N   . PHE A 1 225 ? 33.835 -17.264 99.524  1.00 33.13 ? 225  PHE A N   1 
ATOM   1781 C  CA  . PHE A 1 225 ? 34.465 -18.467 98.979  1.00 33.49 ? 225  PHE A CA  1 
ATOM   1782 C  C   . PHE A 1 225 ? 35.986 -18.338 98.944  1.00 33.30 ? 225  PHE A C   1 
ATOM   1783 O  O   . PHE A 1 225 ? 36.534 -17.267 99.215  1.00 32.35 ? 225  PHE A O   1 
ATOM   1784 C  CB  . PHE A 1 225 ? 33.953 -18.723 97.557  1.00 34.78 ? 225  PHE A CB  1 
ATOM   1785 C  CG  . PHE A 1 225 ? 32.452 -18.716 97.439  1.00 35.68 ? 225  PHE A CG  1 
ATOM   1786 C  CD1 . PHE A 1 225 ? 31.769 -17.537 97.175  1.00 35.98 ? 225  PHE A CD1 1 
ATOM   1787 C  CD2 . PHE A 1 225 ? 31.725 -19.885 97.588  1.00 36.23 ? 225  PHE A CD2 1 
ATOM   1788 C  CE1 . PHE A 1 225 ? 30.389 -17.523 97.062  1.00 36.62 ? 225  PHE A CE1 1 
ATOM   1789 C  CE2 . PHE A 1 225 ? 30.345 -19.881 97.480  1.00 37.04 ? 225  PHE A CE2 1 
ATOM   1790 C  CZ  . PHE A 1 225 ? 29.673 -18.696 97.217  1.00 37.25 ? 225  PHE A CZ  1 
ATOM   1791 N  N   . THR A 1 226 ? 36.658 -19.448 98.645  1.00 32.20 ? 226  THR A N   1 
ATOM   1792 C  CA  . THR A 1 226 ? 38.062 -19.436 98.233  1.00 31.84 ? 226  THR A CA  1 
ATOM   1793 C  C   . THR A 1 226 ? 38.119 -19.679 96.732  1.00 31.37 ? 226  THR A C   1 
ATOM   1794 O  O   . THR A 1 226 ? 37.184 -20.253 96.162  1.00 32.07 ? 226  THR A O   1 
ATOM   1795 C  CB  . THR A 1 226 ? 38.887 -20.530 98.947  1.00 31.71 ? 226  THR A CB  1 
ATOM   1796 O  OG1 . THR A 1 226 ? 38.209 -21.786 98.854  1.00 30.84 ? 226  THR A OG1 1 
ATOM   1797 C  CG2 . THR A 1 226 ? 39.097 -20.176 100.409 1.00 31.37 ? 226  THR A CG2 1 
ATOM   1798 N  N   . PHE A 1 227 ? 39.196 -19.237 96.083  1.00 30.85 ? 227  PHE A N   1 
ATOM   1799 C  CA  . PHE A 1 227 ? 39.370 -19.477 94.644  1.00 31.26 ? 227  PHE A CA  1 
ATOM   1800 C  C   . PHE A 1 227 ? 40.787 -19.938 94.294  1.00 31.86 ? 227  PHE A C   1 
ATOM   1801 O  O   . PHE A 1 227 ? 41.759 -19.540 94.940  1.00 31.18 ? 227  PHE A O   1 
ATOM   1802 C  CB  . PHE A 1 227 ? 38.959 -18.256 93.803  1.00 30.68 ? 227  PHE A CB  1 
ATOM   1803 C  CG  . PHE A 1 227 ? 39.675 -16.976 94.160  1.00 30.96 ? 227  PHE A CG  1 
ATOM   1804 C  CD1 . PHE A 1 227 ? 39.217 -16.169 95.192  1.00 30.32 ? 227  PHE A CD1 1 
ATOM   1805 C  CD2 . PHE A 1 227 ? 40.789 -16.557 93.430  1.00 31.30 ? 227  PHE A CD2 1 
ATOM   1806 C  CE1 . PHE A 1 227 ? 39.866 -14.985 95.511  1.00 30.85 ? 227  PHE A CE1 1 
ATOM   1807 C  CE2 . PHE A 1 227 ? 41.437 -15.371 93.739  1.00 30.48 ? 227  PHE A CE2 1 
ATOM   1808 C  CZ  . PHE A 1 227 ? 40.976 -14.584 94.783  1.00 30.63 ? 227  PHE A CZ  1 
ATOM   1809 N  N   . GLY A 1 228 ? 40.879 -20.783 93.268  1.00 32.52 ? 228  GLY A N   1 
ATOM   1810 C  CA  . GLY A 1 228 ? 42.144 -21.368 92.831  1.00 32.67 ? 228  GLY A CA  1 
ATOM   1811 C  C   . GLY A 1 228 ? 42.799 -20.605 91.699  1.00 32.74 ? 228  GLY A C   1 
ATOM   1812 O  O   . GLY A 1 228 ? 42.247 -19.629 91.186  1.00 32.72 ? 228  GLY A O   1 
ATOM   1813 N  N   . ALA A 1 229 ? 43.980 -21.069 91.300  1.00 32.62 ? 229  ALA A N   1 
ATOM   1814 C  CA  . ALA A 1 229 ? 44.791 -20.394 90.283  1.00 32.55 ? 229  ALA A CA  1 
ATOM   1815 C  C   . ALA A 1 229 ? 44.165 -20.390 88.889  1.00 33.01 ? 229  ALA A C   1 
ATOM   1816 O  O   . ALA A 1 229 ? 44.389 -19.455 88.113  1.00 31.63 ? 229  ALA A O   1 
ATOM   1817 C  CB  . ALA A 1 229 ? 46.183 -21.013 90.226  1.00 33.23 ? 229  ALA A CB  1 
ATOM   1818 N  N   . GLU A 1 230 ? 43.401 -21.430 88.562  1.00 33.75 ? 230  GLU A N   1 
ATOM   1819 C  CA  . GLU A 1 230 ? 42.743 -21.506 87.256  1.00 35.08 ? 230  GLU A CA  1 
ATOM   1820 C  C   . GLU A 1 230 ? 41.633 -20.464 87.143  1.00 32.97 ? 230  GLU A C   1 
ATOM   1821 O  O   . GLU A 1 230 ? 41.430 -19.884 86.076  1.00 31.03 ? 230  GLU A O   1 
ATOM   1822 C  CB  . GLU A 1 230 ? 42.177 -22.906 86.999  1.00 38.01 ? 230  GLU A CB  1 
ATOM   1823 C  CG  . GLU A 1 230 ? 41.798 -23.145 85.543  1.00 41.20 ? 230  GLU A CG  1 
ATOM   1824 C  CD  . GLU A 1 230 ? 41.023 -24.432 85.325  1.00 43.51 ? 230  GLU A CD  1 
ATOM   1825 O  OE1 . GLU A 1 230 ? 40.804 -25.184 86.298  1.00 45.36 ? 230  GLU A OE1 1 
ATOM   1826 O  OE2 . GLU A 1 230 ? 40.623 -24.693 84.171  1.00 46.04 ? 230  GLU A OE2 1 
ATOM   1827 N  N   . VAL A 1 231 ? 40.920 -20.233 88.247  1.00 32.26 ? 231  VAL A N   1 
ATOM   1828 C  CA  . VAL A 1 231 ? 39.907 -19.177 88.298  1.00 31.46 ? 231  VAL A CA  1 
ATOM   1829 C  C   . VAL A 1 231 ? 40.545 -17.813 88.013  1.00 30.21 ? 231  VAL A C   1 
ATOM   1830 O  O   . VAL A 1 231 ? 39.982 -17.004 87.276  1.00 29.04 ? 231  VAL A O   1 
ATOM   1831 C  CB  . VAL A 1 231 ? 39.174 -19.155 89.657  1.00 31.96 ? 231  VAL A CB  1 
ATOM   1832 C  CG1 . VAL A 1 231 ? 38.295 -17.914 89.785  1.00 31.96 ? 231  VAL A CG1 1 
ATOM   1833 C  CG2 . VAL A 1 231 ? 38.335 -20.419 89.823  1.00 32.56 ? 231  VAL A CG2 1 
ATOM   1834 N  N   . VAL A 1 232 ? 41.722 -17.575 88.590  1.00 30.41 ? 232  VAL A N   1 
ATOM   1835 C  CA  . VAL A 1 232 ? 42.481 -16.345 88.338  1.00 30.26 ? 232  VAL A CA  1 
ATOM   1836 C  C   . VAL A 1 232 ? 42.865 -16.259 86.859  1.00 30.18 ? 232  VAL A C   1 
ATOM   1837 O  O   . VAL A 1 232 ? 42.642 -15.233 86.215  1.00 29.70 ? 232  VAL A O   1 
ATOM   1838 C  CB  . VAL A 1 232 ? 43.747 -16.257 89.225  1.00 30.11 ? 232  VAL A CB  1 
ATOM   1839 C  CG1 . VAL A 1 232 ? 44.631 -15.087 88.809  1.00 30.49 ? 232  VAL A CG1 1 
ATOM   1840 C  CG2 . VAL A 1 232 ? 43.365 -16.142 90.694  1.00 30.14 ? 232  VAL A CG2 1 
ATOM   1841 N  N   . ALA A 1 233 ? 43.427 -17.342 86.327  1.00 31.21 ? 233  ALA A N   1 
ATOM   1842 C  CA  . ALA A 1 233 ? 43.836 -17.397 84.919  1.00 33.26 ? 233  ALA A CA  1 
ATOM   1843 C  C   . ALA A 1 233 ? 42.693 -17.072 83.954  1.00 33.25 ? 233  ALA A C   1 
ATOM   1844 O  O   . ALA A 1 233 ? 42.868 -16.297 83.013  1.00 33.71 ? 233  ALA A O   1 
ATOM   1845 C  CB  . ALA A 1 233 ? 44.420 -18.766 84.596  1.00 33.76 ? 233  ALA A CB  1 
ATOM   1846 N  N   . LYS A 1 234 ? 41.526 -17.663 84.190  1.00 34.53 ? 234  LYS A N   1 
ATOM   1847 C  CA  . LYS A 1 234 ? 40.363 -17.448 83.319  1.00 34.45 ? 234  LYS A CA  1 
ATOM   1848 C  C   . LYS A 1 234 ? 39.818 -16.023 83.422  1.00 33.22 ? 234  LYS A C   1 
ATOM   1849 O  O   . LYS A 1 234 ? 39.404 -15.439 82.415  1.00 31.85 ? 234  LYS A O   1 
ATOM   1850 C  CB  . LYS A 1 234 ? 39.258 -18.463 83.636  1.00 36.29 ? 234  LYS A CB  1 
ATOM   1851 C  CG  . LYS A 1 234 ? 39.603 -19.874 83.187  1.00 38.44 ? 234  LYS A CG  1 
ATOM   1852 C  CD  . LYS A 1 234 ? 38.601 -20.905 83.683  1.00 40.28 ? 234  LYS A CD  1 
ATOM   1853 C  CE  . LYS A 1 234 ? 38.884 -22.266 83.071  1.00 41.66 ? 234  LYS A CE  1 
ATOM   1854 N  NZ  . LYS A 1 234 ? 38.101 -23.349 83.728  1.00 42.80 ? 234  LYS A NZ  1 
ATOM   1855 N  N   . PHE A 1 235 ? 39.836 -15.465 84.633  1.00 31.49 ? 235  PHE A N   1 
ATOM   1856 C  CA  . PHE A 1 235 ? 39.387 -14.093 84.857  1.00 30.83 ? 235  PHE A CA  1 
ATOM   1857 C  C   . PHE A 1 235 ? 40.256 -13.087 84.097  1.00 30.38 ? 235  PHE A C   1 
ATOM   1858 O  O   . PHE A 1 235 ? 39.736 -12.208 83.404  1.00 29.68 ? 235  PHE A O   1 
ATOM   1859 C  CB  . PHE A 1 235 ? 39.382 -13.772 86.357  1.00 31.44 ? 235  PHE A CB  1 
ATOM   1860 C  CG  . PHE A 1 235 ? 38.864 -12.400 86.681  1.00 32.31 ? 235  PHE A CG  1 
ATOM   1861 C  CD1 . PHE A 1 235 ? 37.497 -12.160 86.745  1.00 32.51 ? 235  PHE A CD1 1 
ATOM   1862 C  CD2 . PHE A 1 235 ? 39.740 -11.351 86.923  1.00 32.73 ? 235  PHE A CD2 1 
ATOM   1863 C  CE1 . PHE A 1 235 ? 37.013 -10.900 87.039  1.00 32.33 ? 235  PHE A CE1 1 
ATOM   1864 C  CE2 . PHE A 1 235 ? 39.263 -10.085 87.215  1.00 32.87 ? 235  PHE A CE2 1 
ATOM   1865 C  CZ  . PHE A 1 235 ? 37.896 -9.860  87.274  1.00 32.75 ? 235  PHE A CZ  1 
ATOM   1866 N  N   . LEU A 1 236 ? 41.575 -13.226 84.219  1.00 30.66 ? 236  LEU A N   1 
ATOM   1867 C  CA  . LEU A 1 236 ? 42.513 -12.340 83.524  1.00 31.46 ? 236  LEU A CA  1 
ATOM   1868 C  C   . LEU A 1 236 ? 42.360 -12.415 82.003  1.00 32.80 ? 236  LEU A C   1 
ATOM   1869 O  O   . LEU A 1 236 ? 42.351 -11.385 81.324  1.00 33.56 ? 236  LEU A O   1 
ATOM   1870 C  CB  . LEU A 1 236 ? 43.963 -12.668 83.907  1.00 31.22 ? 236  LEU A CB  1 
ATOM   1871 C  CG  . LEU A 1 236 ? 44.421 -12.394 85.342  1.00 31.77 ? 236  LEU A CG  1 
ATOM   1872 C  CD1 . LEU A 1 236 ? 45.913 -12.661 85.450  1.00 31.48 ? 236  LEU A CD1 1 
ATOM   1873 C  CD2 . LEU A 1 236 ? 44.104 -10.974 85.794  1.00 31.88 ? 236  LEU A CD2 1 
ATOM   1874 N  N   . HIS A 1 237 ? 42.245 -13.631 81.478  1.00 34.12 ? 237  HIS A N   1 
ATOM   1875 C  CA  . HIS A 1 237 ? 42.075 -13.845 80.038  1.00 35.68 ? 237  HIS A CA  1 
ATOM   1876 C  C   . HIS A 1 237 ? 40.751 -13.278 79.524  1.00 35.98 ? 237  HIS A C   1 
ATOM   1877 O  O   . HIS A 1 237 ? 40.717 -12.610 78.490  1.00 36.02 ? 237  HIS A O   1 
ATOM   1878 C  CB  . HIS A 1 237 ? 42.159 -15.335 79.697  1.00 37.50 ? 237  HIS A CB  1 
ATOM   1879 C  CG  . HIS A 1 237 ? 41.956 -15.626 78.242  1.00 39.21 ? 237  HIS A CG  1 
ATOM   1880 N  ND1 . HIS A 1 237 ? 42.896 -15.312 77.283  1.00 40.61 ? 237  HIS A ND1 1 
ATOM   1881 C  CD2 . HIS A 1 237 ? 40.913 -16.182 77.579  1.00 39.81 ? 237  HIS A CD2 1 
ATOM   1882 C  CE1 . HIS A 1 237 ? 42.445 -15.668 76.093  1.00 40.47 ? 237  HIS A CE1 1 
ATOM   1883 N  NE2 . HIS A 1 237 ? 41.245 -16.200 76.245  1.00 41.10 ? 237  HIS A NE2 1 
ATOM   1884 N  N   . LYS A 1 238 ? 39.669 -13.537 80.254  1.00 35.79 ? 238  LYS A N   1 
ATOM   1885 C  CA  . LYS A 1 238 ? 38.338 -13.063 79.866  1.00 36.14 ? 238  LYS A CA  1 
ATOM   1886 C  C   . LYS A 1 238 ? 38.260 -11.539 79.773  1.00 35.67 ? 238  LYS A C   1 
ATOM   1887 O  O   . LYS A 1 238 ? 37.683 -11.005 78.829  1.00 36.25 ? 238  LYS A O   1 
ATOM   1888 C  CB  . LYS A 1 238 ? 37.284 -13.575 80.853  1.00 36.85 ? 238  LYS A CB  1 
ATOM   1889 C  CG  . LYS A 1 238 ? 35.863 -13.144 80.529  1.00 37.07 ? 238  LYS A CG  1 
ATOM   1890 C  CD  . LYS A 1 238 ? 34.848 -13.871 81.394  1.00 37.76 ? 238  LYS A CD  1 
ATOM   1891 C  CE  . LYS A 1 238 ? 33.441 -13.366 81.129  1.00 38.38 ? 238  LYS A CE  1 
ATOM   1892 N  NZ  . LYS A 1 238 ? 32.444 -13.971 82.053  1.00 38.48 ? 238  LYS A NZ  1 
ATOM   1893 N  N   . HIS A 1 239 ? 38.845 -10.848 80.751  1.00 34.43 ? 239  HIS A N   1 
ATOM   1894 C  CA  . HIS A 1 239 ? 38.766 -9.385  80.822  1.00 32.29 ? 239  HIS A CA  1 
ATOM   1895 C  C   . HIS A 1 239 ? 40.029 -8.680  80.319  1.00 31.84 ? 239  HIS A C   1 
ATOM   1896 O  O   . HIS A 1 239 ? 40.124 -7.452  80.380  1.00 30.65 ? 239  HIS A O   1 
ATOM   1897 C  CB  . HIS A 1 239 ? 38.446 -8.955  82.254  1.00 31.70 ? 239  HIS A CB  1 
ATOM   1898 C  CG  . HIS A 1 239 ? 37.138 -9.486  82.760  1.00 31.43 ? 239  HIS A CG  1 
ATOM   1899 N  ND1 . HIS A 1 239 ? 35.930 -8.896  82.460  1.00 31.28 ? 239  HIS A ND1 1 
ATOM   1900 C  CD2 . HIS A 1 239 ? 36.849 -10.562 83.529  1.00 31.34 ? 239  HIS A CD2 1 
ATOM   1901 C  CE1 . HIS A 1 239 ? 34.954 -9.581  83.028  1.00 31.82 ? 239  HIS A CE1 1 
ATOM   1902 N  NE2 . HIS A 1 239 ? 35.485 -10.597 83.683  1.00 31.48 ? 239  HIS A NE2 1 
ATOM   1903 N  N   . ASP A 1 240 ? 40.988 -9.452  79.818  1.00 31.70 ? 240  ASP A N   1 
ATOM   1904 C  CA  . ASP A 1 240 ? 42.201 -8.903  79.219  1.00 31.67 ? 240  ASP A CA  1 
ATOM   1905 C  C   . ASP A 1 240 ? 42.990 -8.073  80.236  1.00 29.80 ? 240  ASP A C   1 
ATOM   1906 O  O   . ASP A 1 240 ? 43.357 -6.927  79.978  1.00 29.48 ? 240  ASP A O   1 
ATOM   1907 C  CB  . ASP A 1 240 ? 41.842 -8.073  77.978  1.00 33.74 ? 240  ASP A CB  1 
ATOM   1908 C  CG  . ASP A 1 240 ? 43.035 -7.801  77.082  1.00 35.48 ? 240  ASP A CG  1 
ATOM   1909 O  OD1 . ASP A 1 240 ? 43.957 -8.646  77.020  1.00 36.70 ? 240  ASP A OD1 1 
ATOM   1910 O  OD2 . ASP A 1 240 ? 43.037 -6.736  76.425  1.00 37.78 ? 240  ASP A OD2 1 
ATOM   1911 N  N   . LEU A 1 241 ? 43.224 -8.670  81.401  1.00 28.73 ? 241  LEU A N   1 
ATOM   1912 C  CA  . LEU A 1 241 ? 44.011 -8.057  82.466  1.00 27.56 ? 241  LEU A CA  1 
ATOM   1913 C  C   . LEU A 1 241 ? 45.301 -8.854  82.664  1.00 27.72 ? 241  LEU A C   1 
ATOM   1914 O  O   . LEU A 1 241 ? 45.402 -10.004 82.228  1.00 27.32 ? 241  LEU A O   1 
ATOM   1915 C  CB  . LEU A 1 241 ? 43.209 -8.036  83.768  1.00 27.42 ? 241  LEU A CB  1 
ATOM   1916 C  CG  . LEU A 1 241 ? 41.864 -7.301  83.751  1.00 26.95 ? 241  LEU A CG  1 
ATOM   1917 C  CD1 . LEU A 1 241 ? 40.978 -7.789  84.888  1.00 27.05 ? 241  LEU A CD1 1 
ATOM   1918 C  CD2 . LEU A 1 241 ? 42.048 -5.797  83.818  1.00 27.03 ? 241  LEU A CD2 1 
ATOM   1919 N  N   . ASP A 1 242 ? 46.278 -8.232  83.318  1.00 27.58 ? 242  ASP A N   1 
ATOM   1920 C  CA  . ASP A 1 242 ? 47.573 -8.855  83.614  1.00 27.68 ? 242  ASP A CA  1 
ATOM   1921 C  C   . ASP A 1 242 ? 47.731 -9.293  85.075  1.00 27.44 ? 242  ASP A C   1 
ATOM   1922 O  O   . ASP A 1 242 ? 48.471 -10.237 85.359  1.00 27.23 ? 242  ASP A O   1 
ATOM   1923 C  CB  . ASP A 1 242 ? 48.708 -7.884  83.267  1.00 29.08 ? 242  ASP A CB  1 
ATOM   1924 C  CG  . ASP A 1 242 ? 48.839 -7.633  81.773  1.00 30.24 ? 242  ASP A CG  1 
ATOM   1925 O  OD1 . ASP A 1 242 ? 48.325 -8.438  80.972  1.00 32.39 ? 242  ASP A OD1 1 
ATOM   1926 O  OD2 . ASP A 1 242 ? 49.469 -6.623  81.392  1.00 31.34 ? 242  ASP A OD2 1 
ATOM   1927 N  N   . LEU A 1 243 ? 47.038 -8.619  85.996  1.00 25.46 ? 243  LEU A N   1 
ATOM   1928 C  CA  . LEU A 1 243 ? 47.273 -8.819  87.420  1.00 24.78 ? 243  LEU A CA  1 
ATOM   1929 C  C   . LEU A 1 243 ? 46.036 -8.530  88.263  1.00 23.80 ? 243  LEU A C   1 
ATOM   1930 O  O   . LEU A 1 243 ? 45.297 -7.592  87.985  1.00 23.95 ? 243  LEU A O   1 
ATOM   1931 C  CB  . LEU A 1 243 ? 48.414 -7.897  87.864  1.00 24.80 ? 243  LEU A CB  1 
ATOM   1932 C  CG  . LEU A 1 243 ? 48.896 -7.970  89.311  1.00 24.56 ? 243  LEU A CG  1 
ATOM   1933 C  CD1 . LEU A 1 243 ? 49.492 -9.329  89.635  1.00 25.13 ? 243  LEU A CD1 1 
ATOM   1934 C  CD2 . LEU A 1 243 ? 49.906 -6.863  89.574  1.00 24.87 ? 243  LEU A CD2 1 
ATOM   1935 N  N   . ILE A 1 244 ? 45.812 -9.359  89.278  1.00 23.82 ? 244  ILE A N   1 
ATOM   1936 C  CA  . ILE A 1 244 ? 44.888 -9.037  90.365  1.00 23.82 ? 244  ILE A CA  1 
ATOM   1937 C  C   . ILE A 1 244 ? 45.730 -8.577  91.548  1.00 23.53 ? 244  ILE A C   1 
ATOM   1938 O  O   . ILE A 1 244 ? 46.654 -9.283  91.973  1.00 23.21 ? 244  ILE A O   1 
ATOM   1939 C  CB  . ILE A 1 244 ? 44.042 -10.252 90.803  1.00 24.42 ? 244  ILE A CB  1 
ATOM   1940 C  CG1 . ILE A 1 244 ? 43.094 -10.678 89.681  1.00 25.13 ? 244  ILE A CG1 1 
ATOM   1941 C  CG2 . ILE A 1 244 ? 43.255 -9.925  92.071  1.00 24.64 ? 244  ILE A CG2 1 
ATOM   1942 C  CD1 . ILE A 1 244 ? 42.476 -12.045 89.906  1.00 25.65 ? 244  ILE A CD1 1 
ATOM   1943 N  N   . CYS A 1 245 ? 45.418 -7.394  92.069  1.00 22.42 ? 245  CYS A N   1 
ATOM   1944 C  CA  . CYS A 1 245 ? 46.096 -6.863  93.239  1.00 22.29 ? 245  CYS A CA  1 
ATOM   1945 C  C   . CYS A 1 245 ? 45.094 -6.752  94.388  1.00 21.52 ? 245  CYS A C   1 
ATOM   1946 O  O   . CYS A 1 245 ? 44.126 -6.009  94.294  1.00 21.23 ? 245  CYS A O   1 
ATOM   1947 C  CB  . CYS A 1 245 ? 46.704 -5.496  92.921  1.00 22.49 ? 245  CYS A CB  1 
ATOM   1948 S  SG  . CYS A 1 245 ? 47.556 -4.725  94.319  1.00 23.36 ? 245  CYS A SG  1 
ATOM   1949 N  N   . ARG A 1 246 ? 45.328 -7.497  95.466  1.00 21.22 ? 246  ARG A N   1 
ATOM   1950 C  CA  . ARG A 1 246 ? 44.411 -7.516  96.604  1.00 20.93 ? 246  ARG A CA  1 
ATOM   1951 C  C   . ARG A 1 246 ? 45.154 -7.515  97.943  1.00 21.32 ? 246  ARG A C   1 
ATOM   1952 O  O   . ARG A 1 246 ? 46.392 -7.472  97.974  1.00 20.78 ? 246  ARG A O   1 
ATOM   1953 C  CB  . ARG A 1 246 ? 43.435 -8.700  96.477  1.00 20.98 ? 246  ARG A CB  1 
ATOM   1954 C  CG  . ARG A 1 246 ? 44.065 -10.061 96.205  1.00 20.59 ? 246  ARG A CG  1 
ATOM   1955 C  CD  . ARG A 1 246 ? 44.527 -10.775 97.468  1.00 20.31 ? 246  ARG A CD  1 
ATOM   1956 N  NE  . ARG A 1 246 ? 43.414 -11.237 98.300  1.00 19.97 ? 246  ARG A NE  1 
ATOM   1957 C  CZ  . ARG A 1 246 ? 43.527 -12.098 99.313  1.00 19.56 ? 246  ARG A CZ  1 
ATOM   1958 N  NH1 . ARG A 1 246 ? 44.708 -12.617 99.650  1.00 20.08 ? 246  ARG A NH1 1 
ATOM   1959 N  NH2 . ARG A 1 246 ? 42.454 -12.448 100.001 1.00 18.57 ? 246  ARG A NH2 1 
ATOM   1960 N  N   . ALA A 1 247 ? 44.398 -7.540  99.040  1.00 20.21 ? 247  ALA A N   1 
ATOM   1961 C  CA  . ALA A 1 247 ? 44.973 -7.472  100.385 1.00 20.80 ? 247  ALA A CA  1 
ATOM   1962 C  C   . ALA A 1 247 ? 44.330 -8.529  101.295 1.00 21.18 ? 247  ALA A C   1 
ATOM   1963 O  O   . ALA A 1 247 ? 44.388 -9.714  100.962 1.00 22.68 ? 247  ALA A O   1 
ATOM   1964 C  CB  . ALA A 1 247 ? 44.824 -6.063  100.936 1.00 20.61 ? 247  ALA A CB  1 
ATOM   1965 N  N   . HIS A 1 248 ? 43.779 -8.135  102.448 1.00 21.97 ? 248  HIS A N   1 
ATOM   1966 C  CA  . HIS A 1 248 ? 42.841 -8.980  103.210 1.00 22.07 ? 248  HIS A CA  1 
ATOM   1967 C  C   . HIS A 1 248 ? 43.498 -10.107 104.020 1.00 22.86 ? 248  HIS A C   1 
ATOM   1968 O  O   . HIS A 1 248 ? 42.845 -10.690 104.887 1.00 21.96 ? 248  HIS A O   1 
ATOM   1969 C  CB  . HIS A 1 248 ? 41.767 -9.530  102.250 1.00 21.80 ? 248  HIS A CB  1 
ATOM   1970 C  CG  . HIS A 1 248 ? 40.575 -10.155 102.910 1.00 20.84 ? 248  HIS A CG  1 
ATOM   1971 N  ND1 . HIS A 1 248 ? 39.961 -9.629  104.024 1.00 20.94 ? 248  HIS A ND1 1 
ATOM   1972 C  CD2 . HIS A 1 248 ? 39.839 -11.234 102.556 1.00 21.36 ? 248  HIS A CD2 1 
ATOM   1973 C  CE1 . HIS A 1 248 ? 38.917 -10.370 104.345 1.00 20.55 ? 248  HIS A CE1 1 
ATOM   1974 N  NE2 . HIS A 1 248 ? 38.825 -11.356 103.472 1.00 20.70 ? 248  HIS A NE2 1 
ATOM   1975 N  N   . GLN A 1 249 ? 44.778 -10.397 103.762 1.00 24.24 ? 249  GLN A N   1 
ATOM   1976 C  CA  . GLN A 1 249 ? 45.481 -11.507 104.417 1.00 25.71 ? 249  GLN A CA  1 
ATOM   1977 C  C   . GLN A 1 249 ? 46.907 -11.115 104.796 1.00 26.60 ? 249  GLN A C   1 
ATOM   1978 O  O   . GLN A 1 249 ? 47.636 -10.539 103.988 1.00 26.49 ? 249  GLN A O   1 
ATOM   1979 C  CB  . GLN A 1 249 ? 45.512 -12.743 103.503 1.00 25.83 ? 249  GLN A CB  1 
ATOM   1980 C  CG  . GLN A 1 249 ? 44.218 -13.541 103.490 1.00 25.67 ? 249  GLN A CG  1 
ATOM   1981 C  CD  . GLN A 1 249 ? 44.320 -14.823 102.679 1.00 25.41 ? 249  GLN A CD  1 
ATOM   1982 O  OE1 . GLN A 1 249 ? 44.596 -14.794 101.480 1.00 24.56 ? 249  GLN A OE1 1 
ATOM   1983 N  NE2 . GLN A 1 249 ? 44.075 -15.961 103.330 1.00 26.04 ? 249  GLN A NE2 1 
ATOM   1984 N  N   . VAL A 1 250 ? 47.306 -11.447 106.023 1.00 27.56 ? 250  VAL A N   1 
ATOM   1985 C  CA  . VAL A 1 250 ? 48.646 -11.122 106.502 1.00 28.33 ? 250  VAL A CA  1 
ATOM   1986 C  C   . VAL A 1 250 ? 49.628 -12.006 105.757 1.00 28.77 ? 250  VAL A C   1 
ATOM   1987 O  O   . VAL A 1 250 ? 49.442 -13.215 105.702 1.00 27.81 ? 250  VAL A O   1 
ATOM   1988 C  CB  . VAL A 1 250 ? 48.832 -11.375 108.017 1.00 29.74 ? 250  VAL A CB  1 
ATOM   1989 C  CG1 . VAL A 1 250 ? 50.173 -10.816 108.482 1.00 30.59 ? 250  VAL A CG1 1 
ATOM   1990 C  CG2 . VAL A 1 250 ? 47.712 -10.750 108.828 1.00 30.79 ? 250  VAL A CG2 1 
ATOM   1991 N  N   . VAL A 1 251 ? 50.662 -11.402 105.179 1.00 29.92 ? 251  VAL A N   1 
ATOM   1992 C  CA  . VAL A 1 251 ? 51.713 -12.153 104.493 1.00 31.16 ? 251  VAL A CA  1 
ATOM   1993 C  C   . VAL A 1 251 ? 53.064 -11.743 105.074 1.00 32.62 ? 251  VAL A C   1 
ATOM   1994 O  O   . VAL A 1 251 ? 53.302 -10.564 105.353 1.00 30.77 ? 251  VAL A O   1 
ATOM   1995 C  CB  . VAL A 1 251 ? 51.668 -11.976 102.956 1.00 30.57 ? 251  VAL A CB  1 
ATOM   1996 C  CG1 . VAL A 1 251 ? 50.549 -12.815 102.361 1.00 30.74 ? 251  VAL A CG1 1 
ATOM   1997 C  CG2 . VAL A 1 251 ? 51.492 -10.518 102.565 1.00 30.95 ? 251  VAL A CG2 1 
ATOM   1998 N  N   . GLU A 1 252 ? 53.930 -12.732 105.277 1.00 34.16 ? 252  GLU A N   1 
ATOM   1999 C  CA  . GLU A 1 252 ? 55.153 -12.553 106.061 1.00 36.61 ? 252  GLU A CA  1 
ATOM   2000 C  C   . GLU A 1 252 ? 56.099 -11.510 105.475 1.00 34.73 ? 252  GLU A C   1 
ATOM   2001 O  O   . GLU A 1 252 ? 56.689 -10.729 106.217 1.00 33.87 ? 252  GLU A O   1 
ATOM   2002 C  CB  . GLU A 1 252 ? 55.891 -13.888 106.211 1.00 39.94 ? 252  GLU A CB  1 
ATOM   2003 C  CG  . GLU A 1 252 ? 57.068 -13.837 107.175 1.00 42.74 ? 252  GLU A CG  1 
ATOM   2004 C  CD  . GLU A 1 252 ? 57.620 -15.212 107.500 1.00 45.63 ? 252  GLU A CD  1 
ATOM   2005 O  OE1 . GLU A 1 252 ? 57.639 -16.083 106.598 1.00 48.51 ? 252  GLU A OE1 1 
ATOM   2006 O  OE2 . GLU A 1 252 ? 58.036 -15.418 108.660 1.00 48.41 ? 252  GLU A OE2 1 
ATOM   2007 N  N   . ASP A 1 253 ? 56.229 -11.496 104.152 1.00 34.38 ? 253  ASP A N   1 
ATOM   2008 C  CA  . ASP A 1 253 ? 57.150 -10.587 103.463 1.00 34.36 ? 253  ASP A CA  1 
ATOM   2009 C  C   . ASP A 1 253 ? 56.510 -9.252  103.062 1.00 32.42 ? 253  ASP A C   1 
ATOM   2010 O  O   . ASP A 1 253 ? 57.133 -8.463  102.349 1.00 30.65 ? 253  ASP A O   1 
ATOM   2011 C  CB  . ASP A 1 253 ? 57.705 -11.263 102.201 1.00 35.90 ? 253  ASP A CB  1 
ATOM   2012 C  CG  . ASP A 1 253 ? 58.318 -12.624 102.480 1.00 37.77 ? 253  ASP A CG  1 
ATOM   2013 O  OD1 . ASP A 1 253 ? 58.741 -12.876 103.629 1.00 38.98 ? 253  ASP A OD1 1 
ATOM   2014 O  OD2 . ASP A 1 253 ? 58.376 -13.441 101.537 1.00 40.43 ? 253  ASP A OD2 1 
ATOM   2015 N  N   . GLY A 1 254 ? 55.270 -9.003  103.488 1.00 31.06 ? 254  GLY A N   1 
ATOM   2016 C  CA  . GLY A 1 254 ? 54.545 -7.795  103.088 1.00 30.13 ? 254  GLY A CA  1 
ATOM   2017 C  C   . GLY A 1 254 ? 53.786 -7.941  101.775 1.00 30.10 ? 254  GLY A C   1 
ATOM   2018 O  O   . GLY A 1 254 ? 52.723 -7.341  101.598 1.00 30.15 ? 254  GLY A O   1 
ATOM   2019 N  N   . TYR A 1 255 ? 54.346 -8.709  100.845 1.00 30.01 ? 255  TYR A N   1 
ATOM   2020 C  CA  . TYR A 1 255 ? 53.655 -9.073  99.618  1.00 30.26 ? 255  TYR A CA  1 
ATOM   2021 C  C   . TYR A 1 255 ? 53.919 -10.535 99.286  1.00 31.12 ? 255  TYR A C   1 
ATOM   2022 O  O   . TYR A 1 255 ? 54.900 -11.132 99.753  1.00 31.20 ? 255  TYR A O   1 
ATOM   2023 C  CB  . TYR A 1 255 ? 54.073 -8.160  98.459  1.00 30.04 ? 255  TYR A CB  1 
ATOM   2024 C  CG  . TYR A 1 255 ? 55.445 -8.453  97.877  1.00 30.58 ? 255  TYR A CG  1 
ATOM   2025 C  CD1 . TYR A 1 255 ? 56.602 -8.006  98.505  1.00 29.64 ? 255  TYR A CD1 1 
ATOM   2026 C  CD2 . TYR A 1 255 ? 55.577 -9.168  96.684  1.00 30.42 ? 255  TYR A CD2 1 
ATOM   2027 C  CE1 . TYR A 1 255 ? 57.859 -8.268  97.969  1.00 30.25 ? 255  TYR A CE1 1 
ATOM   2028 C  CE2 . TYR A 1 255 ? 56.826 -9.428  96.138  1.00 30.65 ? 255  TYR A CE2 1 
ATOM   2029 C  CZ  . TYR A 1 255 ? 57.960 -8.980  96.784  1.00 30.29 ? 255  TYR A CZ  1 
ATOM   2030 O  OH  . TYR A 1 255 ? 59.190 -9.241  96.237  1.00 31.39 ? 255  TYR A OH  1 
ATOM   2031 N  N   . GLU A 1 256 ? 53.031 -11.108 98.483  1.00 32.00 ? 256  GLU A N   1 
ATOM   2032 C  CA  . GLU A 1 256 ? 53.115 -12.516 98.129  1.00 33.45 ? 256  GLU A CA  1 
ATOM   2033 C  C   . GLU A 1 256 ? 52.373 -12.772 96.823  1.00 32.83 ? 256  GLU A C   1 
ATOM   2034 O  O   . GLU A 1 256 ? 51.196 -12.412 96.682  1.00 30.57 ? 256  GLU A O   1 
ATOM   2035 C  CB  . GLU A 1 256 ? 52.527 -13.369 99.251  1.00 35.46 ? 256  GLU A CB  1 
ATOM   2036 C  CG  . GLU A 1 256 ? 52.749 -14.864 99.093  1.00 37.37 ? 256  GLU A CG  1 
ATOM   2037 C  CD  . GLU A 1 256 ? 52.112 -15.653 100.217 1.00 39.85 ? 256  GLU A CD  1 
ATOM   2038 O  OE1 . GLU A 1 256 ? 52.583 -15.545 101.369 1.00 41.88 ? 256  GLU A OE1 1 
ATOM   2039 O  OE2 . GLU A 1 256 ? 51.138 -16.383 99.949  1.00 42.95 ? 256  GLU A OE2 1 
ATOM   2040 N  N   . PHE A 1 257 ? 53.067 -13.388 95.872  1.00 31.64 ? 257  PHE A N   1 
ATOM   2041 C  CA  . PHE A 1 257 ? 52.477 -13.713 94.583  1.00 32.21 ? 257  PHE A CA  1 
ATOM   2042 C  C   . PHE A 1 257 ? 51.750 -15.052 94.636  1.00 32.00 ? 257  PHE A C   1 
ATOM   2043 O  O   . PHE A 1 257 ? 52.070 -15.920 95.453  1.00 30.16 ? 257  PHE A O   1 
ATOM   2044 C  CB  . PHE A 1 257 ? 53.536 -13.728 93.481  1.00 32.43 ? 257  PHE A CB  1 
ATOM   2045 C  CG  . PHE A 1 257 ? 53.907 -12.360 92.973  1.00 32.76 ? 257  PHE A CG  1 
ATOM   2046 C  CD1 . PHE A 1 257 ? 53.015 -11.631 92.199  1.00 32.49 ? 257  PHE A CD1 1 
ATOM   2047 C  CD2 . PHE A 1 257 ? 55.154 -11.810 93.251  1.00 32.97 ? 257  PHE A CD2 1 
ATOM   2048 C  CE1 . PHE A 1 257 ? 53.348 -10.374 91.723  1.00 33.27 ? 257  PHE A CE1 1 
ATOM   2049 C  CE2 . PHE A 1 257 ? 55.497 -10.555 92.772  1.00 33.66 ? 257  PHE A CE2 1 
ATOM   2050 C  CZ  . PHE A 1 257 ? 54.591 -9.835  92.005  1.00 33.60 ? 257  PHE A CZ  1 
ATOM   2051 N  N   . PHE A 1 258 ? 50.769 -15.194 93.749  1.00 32.35 ? 258  PHE A N   1 
ATOM   2052 C  CA  . PHE A 1 258 ? 49.935 -16.388 93.652  1.00 33.45 ? 258  PHE A CA  1 
ATOM   2053 C  C   . PHE A 1 258 ? 49.682 -16.665 92.172  1.00 32.88 ? 258  PHE A C   1 
ATOM   2054 O  O   . PHE A 1 258 ? 49.638 -15.735 91.363  1.00 31.69 ? 258  PHE A O   1 
ATOM   2055 C  CB  . PHE A 1 258 ? 48.624 -16.147 94.413  1.00 34.01 ? 258  PHE A CB  1 
ATOM   2056 C  CG  . PHE A 1 258 ? 47.628 -17.270 94.320  1.00 34.69 ? 258  PHE A CG  1 
ATOM   2057 C  CD1 . PHE A 1 258 ? 47.661 -18.325 95.222  1.00 35.56 ? 258  PHE A CD1 1 
ATOM   2058 C  CD2 . PHE A 1 258 ? 46.627 -17.251 93.358  1.00 34.86 ? 258  PHE A CD2 1 
ATOM   2059 C  CE1 . PHE A 1 258 ? 46.730 -19.350 95.148  1.00 36.05 ? 258  PHE A CE1 1 
ATOM   2060 C  CE2 . PHE A 1 258 ? 45.696 -18.274 93.276  1.00 35.12 ? 258  PHE A CE2 1 
ATOM   2061 C  CZ  . PHE A 1 258 ? 45.746 -19.328 94.171  1.00 35.57 ? 258  PHE A CZ  1 
ATOM   2062 N  N   . ALA A 1 259 ? 49.546 -17.943 91.821  1.00 34.43 ? 259  ALA A N   1 
ATOM   2063 C  CA  . ALA A 1 259 ? 49.237 -18.366 90.446  1.00 35.27 ? 259  ALA A CA  1 
ATOM   2064 C  C   . ALA A 1 259 ? 50.231 -17.824 89.416  1.00 36.79 ? 259  ALA A C   1 
ATOM   2065 O  O   . ALA A 1 259 ? 49.846 -17.164 88.449  1.00 36.24 ? 259  ALA A O   1 
ATOM   2066 C  CB  . ALA A 1 259 ? 47.811 -17.974 90.076  1.00 35.72 ? 259  ALA A CB  1 
ATOM   2067 N  N   . LYS A 1 260 ? 51.511 -18.112 89.638  1.00 38.50 ? 260  LYS A N   1 
ATOM   2068 C  CA  . LYS A 1 260 ? 52.589 -17.700 88.733  1.00 39.59 ? 260  LYS A CA  1 
ATOM   2069 C  C   . LYS A 1 260 ? 52.569 -16.192 88.448  1.00 38.74 ? 260  LYS A C   1 
ATOM   2070 O  O   . LYS A 1 260 ? 52.572 -15.764 87.293  1.00 39.14 ? 260  LYS A O   1 
ATOM   2071 C  CB  . LYS A 1 260 ? 52.536 -18.518 87.432  1.00 41.96 ? 260  LYS A CB  1 
ATOM   2072 C  CG  . LYS A 1 260 ? 52.982 -19.963 87.608  1.00 43.86 ? 260  LYS A CG  1 
ATOM   2073 C  CD  . LYS A 1 260 ? 52.402 -20.892 86.549  1.00 45.51 ? 260  LYS A CD  1 
ATOM   2074 C  CE  . LYS A 1 260 ? 51.194 -21.664 87.065  1.00 46.84 ? 260  LYS A CE  1 
ATOM   2075 N  NZ  . LYS A 1 260 ? 50.086 -20.789 87.551  1.00 47.96 ? 260  LYS A NZ  1 
ATOM   2076 N  N   . ARG A 1 261 ? 52.543 -15.407 89.524  1.00 37.77 ? 261  ARG A N   1 
ATOM   2077 C  CA  . ARG A 1 261 ? 52.569 -13.936 89.469  1.00 37.53 ? 261  ARG A CA  1 
ATOM   2078 C  C   . ARG A 1 261 ? 51.344 -13.282 88.795  1.00 34.46 ? 261  ARG A C   1 
ATOM   2079 O  O   . ARG A 1 261 ? 51.417 -12.136 88.343  1.00 34.25 ? 261  ARG A O   1 
ATOM   2080 C  CB  . ARG A 1 261 ? 53.883 -13.435 88.837  1.00 38.89 ? 261  ARG A CB  1 
ATOM   2081 C  CG  . ARG A 1 261 ? 55.090 -13.595 89.749  1.00 41.20 ? 261  ARG A CG  1 
ATOM   2082 C  CD  . ARG A 1 261 ? 56.403 -13.459 88.991  1.00 43.69 ? 261  ARG A CD  1 
ATOM   2083 N  NE  . ARG A 1 261 ? 56.725 -14.669 88.229  1.00 46.50 ? 261  ARG A NE  1 
ATOM   2084 C  CZ  . ARG A 1 261 ? 57.898 -14.917 87.641  1.00 49.12 ? 261  ARG A CZ  1 
ATOM   2085 N  NH1 . ARG A 1 261 ? 58.900 -14.044 87.718  1.00 50.41 ? 261  ARG A NH1 1 
ATOM   2086 N  NH2 . ARG A 1 261 ? 58.075 -16.054 86.973  1.00 50.94 ? 261  ARG A NH2 1 
ATOM   2087 N  N   . GLN A 1 262 ? 50.225 -14.000 88.745  1.00 31.73 ? 262  GLN A N   1 
ATOM   2088 C  CA  . GLN A 1 262 ? 48.979 -13.465 88.177  1.00 31.07 ? 262  GLN A CA  1 
ATOM   2089 C  C   . GLN A 1 262 ? 48.101 -12.789 89.235  1.00 29.12 ? 262  GLN A C   1 
ATOM   2090 O  O   . GLN A 1 262 ? 47.192 -12.032 88.893  1.00 29.44 ? 262  GLN A O   1 
ATOM   2091 C  CB  . GLN A 1 262 ? 48.194 -14.569 87.462  1.00 31.41 ? 262  GLN A CB  1 
ATOM   2092 C  CG  . GLN A 1 262 ? 48.818 -14.999 86.138  1.00 32.76 ? 262  GLN A CG  1 
ATOM   2093 C  CD  . GLN A 1 262 ? 47.969 -16.014 85.394  1.00 33.72 ? 262  GLN A CD  1 
ATOM   2094 O  OE1 . GLN A 1 262 ? 47.400 -15.712 84.345  1.00 35.05 ? 262  GLN A OE1 1 
ATOM   2095 N  NE2 . GLN A 1 262 ? 47.874 -17.221 85.939  1.00 33.90 ? 262  GLN A NE2 1 
ATOM   2096 N  N   . LEU A 1 263 ? 48.362 -13.079 90.508  1.00 27.81 ? 263  LEU A N   1 
ATOM   2097 C  CA  . LEU A 1 263 ? 47.731 -12.367 91.621  1.00 26.27 ? 263  LEU A CA  1 
ATOM   2098 C  C   . LEU A 1 263 ? 48.771 -12.014 92.675  1.00 26.39 ? 263  LEU A C   1 
ATOM   2099 O  O   . LEU A 1 263 ? 49.677 -12.808 92.946  1.00 26.86 ? 263  LEU A O   1 
ATOM   2100 C  CB  . LEU A 1 263 ? 46.620 -13.220 92.246  1.00 25.79 ? 263  LEU A CB  1 
ATOM   2101 C  CG  . LEU A 1 263 ? 45.853 -12.658 93.456  1.00 25.49 ? 263  LEU A CG  1 
ATOM   2102 C  CD1 . LEU A 1 263 ? 44.430 -13.194 93.494  1.00 25.52 ? 263  LEU A CD1 1 
ATOM   2103 C  CD2 . LEU A 1 263 ? 46.548 -12.946 94.780  1.00 24.70 ? 263  LEU A CD2 1 
ATOM   2104 N  N   . VAL A 1 264 ? 48.633 -10.830 93.275  1.00 24.90 ? 264  VAL A N   1 
ATOM   2105 C  CA  . VAL A 1 264 ? 49.469 -10.440 94.408  1.00 24.08 ? 264  VAL A CA  1 
ATOM   2106 C  C   . VAL A 1 264 ? 48.612 -9.998  95.590  1.00 23.68 ? 264  VAL A C   1 
ATOM   2107 O  O   . VAL A 1 264 ? 47.618 -9.283  95.417  1.00 22.47 ? 264  VAL A O   1 
ATOM   2108 C  CB  . VAL A 1 264 ? 50.488 -9.336  94.016  1.00 23.98 ? 264  VAL A CB  1 
ATOM   2109 C  CG1 . VAL A 1 264 ? 49.806 -7.991  93.785  1.00 23.42 ? 264  VAL A CG1 1 
ATOM   2110 C  CG2 . VAL A 1 264 ? 51.577 -9.211  95.071  1.00 24.44 ? 264  VAL A CG2 1 
ATOM   2111 N  N   . THR A 1 265 ? 49.000 -10.453 96.782  1.00 23.60 ? 265  THR A N   1 
ATOM   2112 C  CA  . THR A 1 265 ? 48.432 -9.993  98.043  1.00 23.95 ? 265  THR A CA  1 
ATOM   2113 C  C   . THR A 1 265 ? 49.381 -8.953  98.654  1.00 23.38 ? 265  THR A C   1 
ATOM   2114 O  O   . THR A 1 265 ? 50.580 -9.227  98.814  1.00 23.66 ? 265  THR A O   1 
ATOM   2115 C  CB  . THR A 1 265 ? 48.246 -11.168 99.027  1.00 24.28 ? 265  THR A CB  1 
ATOM   2116 O  OG1 . THR A 1 265 ? 47.356 -12.146 98.463  1.00 24.56 ? 265  THR A OG1 1 
ATOM   2117 C  CG2 . THR A 1 265 ? 47.672 -10.695 100.360 1.00 24.80 ? 265  THR A CG2 1 
ATOM   2118 N  N   . LEU A 1 266 ? 48.851 -7.768  98.978  1.00 22.95 ? 266  LEU A N   1 
ATOM   2119 C  CA  . LEU A 1 266 ? 49.598 -6.725  99.695  1.00 21.86 ? 266  LEU A CA  1 
ATOM   2120 C  C   . LEU A 1 266 ? 49.072 -6.555  101.119 1.00 22.57 ? 266  LEU A C   1 
ATOM   2121 O  O   . LEU A 1 266 ? 47.871 -6.653  101.361 1.00 21.40 ? 266  LEU A O   1 
ATOM   2122 C  CB  . LEU A 1 266 ? 49.492 -5.378  98.983  1.00 22.12 ? 266  LEU A CB  1 
ATOM   2123 C  CG  . LEU A 1 266 ? 49.832 -5.313  97.497  1.00 22.39 ? 266  LEU A CG  1 
ATOM   2124 C  CD1 . LEU A 1 266 ? 49.599 -3.901  96.975  1.00 22.39 ? 266  LEU A CD1 1 
ATOM   2125 C  CD2 . LEU A 1 266 ? 51.267 -5.745  97.242  1.00 22.39 ? 266  LEU A CD2 1 
ATOM   2126 N  N   . PHE A 1 267 ? 49.986 -6.295  102.049 1.00 21.68 ? 267  PHE A N   1 
ATOM   2127 C  CA  . PHE A 1 267 ? 49.651 -6.037  103.438 1.00 22.54 ? 267  PHE A CA  1 
ATOM   2128 C  C   . PHE A 1 267 ? 50.627 -4.986  103.955 1.00 22.88 ? 267  PHE A C   1 
ATOM   2129 O  O   . PHE A 1 267 ? 51.842 -5.141  103.817 1.00 23.18 ? 267  PHE A O   1 
ATOM   2130 C  CB  . PHE A 1 267 ? 49.751 -7.325  104.254 1.00 22.30 ? 267  PHE A CB  1 
ATOM   2131 C  CG  . PHE A 1 267 ? 49.018 -7.272  105.557 1.00 22.39 ? 267  PHE A CG  1 
ATOM   2132 C  CD1 . PHE A 1 267 ? 47.668 -7.570  105.618 1.00 22.82 ? 267  PHE A CD1 1 
ATOM   2133 C  CD2 . PHE A 1 267 ? 49.677 -6.914  106.727 1.00 22.05 ? 267  PHE A CD2 1 
ATOM   2134 C  CE1 . PHE A 1 267 ? 46.986 -7.519  106.823 1.00 22.31 ? 267  PHE A CE1 1 
ATOM   2135 C  CE2 . PHE A 1 267 ? 49.002 -6.864  107.930 1.00 22.65 ? 267  PHE A CE2 1 
ATOM   2136 C  CZ  . PHE A 1 267 ? 47.651 -7.162  107.980 1.00 22.26 ? 267  PHE A CZ  1 
ATOM   2137 N  N   . SER A 1 268 ? 50.105 -3.910  104.533 1.00 23.27 ? 268  SER A N   1 
ATOM   2138 C  CA  . SER A 1 268 ? 50.926 -2.738  104.822 1.00 23.14 ? 268  SER A CA  1 
ATOM   2139 C  C   . SER A 1 268 ? 51.044 -2.392  106.308 1.00 24.08 ? 268  SER A C   1 
ATOM   2140 O  O   . SER A 1 268 ? 51.492 -1.299  106.656 1.00 23.88 ? 268  SER A O   1 
ATOM   2141 C  CB  . SER A 1 268 ? 50.395 -1.544  104.031 1.00 22.64 ? 268  SER A CB  1 
ATOM   2142 O  OG  . SER A 1 268 ? 50.466 -1.805  102.644 1.00 21.94 ? 268  SER A OG  1 
ATOM   2143 N  N   . ALA A 1 269 ? 50.662 -3.329  107.174 1.00 23.93 ? 269  ALA A N   1 
ATOM   2144 C  CA  . ALA A 1 269 ? 50.786 -3.166  108.619 1.00 24.19 ? 269  ALA A CA  1 
ATOM   2145 C  C   . ALA A 1 269 ? 51.879 -4.095  109.162 1.00 24.65 ? 269  ALA A C   1 
ATOM   2146 O  O   . ALA A 1 269 ? 51.614 -5.267  109.446 1.00 25.64 ? 269  ALA A O   1 
ATOM   2147 C  CB  . ALA A 1 269 ? 49.452 -3.458  109.298 1.00 24.36 ? 269  ALA A CB  1 
ATOM   2148 N  N   . PRO A 1 270 ? 53.115 -3.583  109.301 1.00 24.65 ? 270  PRO A N   1 
ATOM   2149 C  CA  . PRO A 1 270 ? 54.182 -4.404  109.882 1.00 25.58 ? 270  PRO A CA  1 
ATOM   2150 C  C   . PRO A 1 270 ? 53.903 -4.773  111.335 1.00 25.43 ? 270  PRO A C   1 
ATOM   2151 O  O   . PRO A 1 270 ? 53.280 -3.997  112.058 1.00 26.37 ? 270  PRO A O   1 
ATOM   2152 C  CB  . PRO A 1 270 ? 55.426 -3.504  109.805 1.00 25.09 ? 270  PRO A CB  1 
ATOM   2153 C  CG  . PRO A 1 270 ? 55.052 -2.351  108.935 1.00 25.18 ? 270  PRO A CG  1 
ATOM   2154 C  CD  . PRO A 1 270 ? 53.566 -2.209  109.029 1.00 24.60 ? 270  PRO A CD  1 
ATOM   2155 N  N   . ASN A 1 271 ? 54.363 -5.947  111.750 1.00 26.63 ? 271  ASN A N   1 
ATOM   2156 C  CA  . ASN A 1 271 ? 54.143 -6.438  113.115 1.00 29.02 ? 271  ASN A CA  1 
ATOM   2157 C  C   . ASN A 1 271 ? 52.656 -6.376  113.473 1.00 28.66 ? 271  ASN A C   1 
ATOM   2158 O  O   . ASN A 1 271 ? 52.271 -5.886  114.536 1.00 28.68 ? 271  ASN A O   1 
ATOM   2159 C  CB  . ASN A 1 271 ? 54.984 -5.639  114.127 1.00 30.51 ? 271  ASN A CB  1 
ATOM   2160 C  CG  . ASN A 1 271 ? 55.069 -6.305  115.499 1.00 33.02 ? 271  ASN A CG  1 
ATOM   2161 O  OD1 . ASN A 1 271 ? 55.317 -5.638  116.505 1.00 35.87 ? 271  ASN A OD1 1 
ATOM   2162 N  ND2 . ASN A 1 271 ? 54.877 -7.619  115.546 1.00 33.28 ? 271  ASN A ND2 1 
ATOM   2163 N  N   . TYR A 1 272 ? 51.834 -6.891  112.563 1.00 29.41 ? 272  TYR A N   1 
ATOM   2164 C  CA  . TYR A 1 272 ? 50.377 -6.833  112.670 1.00 30.88 ? 272  TYR A CA  1 
ATOM   2165 C  C   . TYR A 1 272 ? 49.877 -7.302  114.036 1.00 33.24 ? 272  TYR A C   1 
ATOM   2166 O  O   . TYR A 1 272 ? 50.224 -8.397  114.482 1.00 33.72 ? 272  TYR A O   1 
ATOM   2167 C  CB  . TYR A 1 272 ? 49.772 -7.687  111.556 1.00 30.72 ? 272  TYR A CB  1 
ATOM   2168 C  CG  . TYR A 1 272 ? 48.265 -7.731  111.511 1.00 30.66 ? 272  TYR A CG  1 
ATOM   2169 C  CD1 . TYR A 1 272 ? 47.508 -6.567  111.510 1.00 30.50 ? 272  TYR A CD1 1 
ATOM   2170 C  CD2 . TYR A 1 272 ? 47.596 -8.946  111.442 1.00 30.84 ? 272  TYR A CD2 1 
ATOM   2171 C  CE1 . TYR A 1 272 ? 46.125 -6.616  111.460 1.00 30.90 ? 272  TYR A CE1 1 
ATOM   2172 C  CE2 . TYR A 1 272 ? 46.212 -9.005  111.383 1.00 30.80 ? 272  TYR A CE2 1 
ATOM   2173 C  CZ  . TYR A 1 272 ? 45.483 -7.841  111.395 1.00 30.28 ? 272  TYR A CZ  1 
ATOM   2174 O  OH  . TYR A 1 272 ? 44.113 -7.900  111.333 1.00 31.16 ? 272  TYR A OH  1 
HETATM 2175 N  N   . CSO A 1 273 ? 49.084 -6.454  114.695 1.00 36.65 ? 273  CSO A N   1 
HETATM 2176 C  CA  . CSO A 1 273 ? 48.500 -6.738  116.020 1.00 41.88 ? 273  CSO A CA  1 
HETATM 2177 C  CB  . CSO A 1 273 ? 47.692 -8.049  116.040 1.00 42.57 ? 273  CSO A CB  1 
HETATM 2178 S  SG  . CSO A 1 273 ? 46.214 -7.881  115.098 1.00 47.80 ? 273  CSO A SG  1 
HETATM 2179 C  C   . CSO A 1 273 ? 49.524 -6.791  117.132 1.00 42.28 ? 273  CSO A C   1 
HETATM 2180 O  O   . CSO A 1 273 ? 49.169 -7.035  118.283 1.00 43.74 ? 273  CSO A O   1 
HETATM 2181 O  OD  . CSO A 1 273 ? 45.690 -9.517  114.841 1.00 45.67 ? 273  CSO A OD  1 
ATOM   2182 N  N   . GLY A 1 274 ? 50.793 -6.545  116.813 1.00 44.88 ? 274  GLY A N   1 
ATOM   2183 C  CA  . GLY A 1 274 ? 51.890 -6.815  117.740 1.00 46.57 ? 274  GLY A CA  1 
ATOM   2184 C  C   . GLY A 1 274 ? 52.120 -8.298  117.998 1.00 48.06 ? 274  GLY A C   1 
ATOM   2185 O  O   . GLY A 1 274 ? 52.824 -8.661  118.943 1.00 49.59 ? 274  GLY A O   1 
ATOM   2186 N  N   . GLU A 1 275 ? 51.541 -9.155  117.159 1.00 48.77 ? 275  GLU A N   1 
ATOM   2187 C  CA  . GLU A 1 275 ? 51.624 -10.604 117.340 1.00 50.80 ? 275  GLU A CA  1 
ATOM   2188 C  C   . GLU A 1 275 ? 52.478 -11.257 116.261 1.00 49.77 ? 275  GLU A C   1 
ATOM   2189 O  O   . GLU A 1 275 ? 53.373 -12.045 116.566 1.00 52.45 ? 275  GLU A O   1 
ATOM   2190 C  CB  . GLU A 1 275 ? 50.223 -11.219 117.352 1.00 52.44 ? 275  GLU A CB  1 
ATOM   2191 C  CG  . GLU A 1 275 ? 49.389 -10.795 118.555 1.00 54.65 ? 275  GLU A CG  1 
ATOM   2192 C  CD  . GLU A 1 275 ? 48.137 -11.633 118.752 1.00 57.44 ? 275  GLU A CD  1 
ATOM   2193 O  OE1 . GLU A 1 275 ? 48.145 -12.834 118.398 1.00 59.59 ? 275  GLU A OE1 1 
ATOM   2194 O  OE2 . GLU A 1 275 ? 47.140 -11.089 119.275 1.00 59.43 ? 275  GLU A OE2 1 
ATOM   2195 N  N   . PHE A 1 276 ? 52.204 -10.922 115.004 1.00 48.12 ? 276  PHE A N   1 
ATOM   2196 C  CA  . PHE A 1 276 ? 52.953 -11.463 113.875 1.00 46.54 ? 276  PHE A CA  1 
ATOM   2197 C  C   . PHE A 1 276 ? 54.255 -10.683 113.728 1.00 46.16 ? 276  PHE A C   1 
ATOM   2198 O  O   . PHE A 1 276 ? 54.355 -9.553  114.198 1.00 46.44 ? 276  PHE A O   1 
ATOM   2199 C  CB  . PHE A 1 276 ? 52.122 -11.375 112.590 1.00 46.55 ? 276  PHE A CB  1 
ATOM   2200 C  CG  . PHE A 1 276 ? 50.851 -12.183 112.630 1.00 47.34 ? 276  PHE A CG  1 
ATOM   2201 C  CD1 . PHE A 1 276 ? 49.697 -11.671 113.217 1.00 47.12 ? 276  PHE A CD1 1 
ATOM   2202 C  CD2 . PHE A 1 276 ? 50.804 -13.455 112.075 1.00 47.74 ? 276  PHE A CD2 1 
ATOM   2203 C  CE1 . PHE A 1 276 ? 48.527 -12.412 113.252 1.00 48.16 ? 276  PHE A CE1 1 
ATOM   2204 C  CE2 . PHE A 1 276 ? 49.634 -14.201 112.107 1.00 47.74 ? 276  PHE A CE2 1 
ATOM   2205 C  CZ  . PHE A 1 276 ? 48.495 -13.679 112.695 1.00 47.80 ? 276  PHE A CZ  1 
ATOM   2206 N  N   . ASP A 1 277 ? 55.253 -11.293 113.097 1.00 45.35 ? 277  ASP A N   1 
ATOM   2207 C  CA  . ASP A 1 277 ? 56.545 -10.636 112.857 1.00 45.59 ? 277  ASP A CA  1 
ATOM   2208 C  C   . ASP A 1 277 ? 56.689 -10.277 111.378 1.00 42.29 ? 277  ASP A C   1 
ATOM   2209 O  O   . ASP A 1 277 ? 57.779 -10.346 110.805 1.00 42.88 ? 277  ASP A O   1 
ATOM   2210 C  CB  . ASP A 1 277 ? 57.697 -11.546 113.302 1.00 47.86 ? 277  ASP A CB  1 
ATOM   2211 C  CG  . ASP A 1 277 ? 57.790 -11.681 114.810 1.00 50.80 ? 277  ASP A CG  1 
ATOM   2212 O  OD1 . ASP A 1 277 ? 57.537 -10.683 115.524 1.00 53.13 ? 277  ASP A OD1 1 
ATOM   2213 O  OD2 . ASP A 1 277 ? 58.131 -12.787 115.283 1.00 53.38 ? 277  ASP A OD2 1 
ATOM   2214 N  N   . ASN A 1 278 ? 55.579 -9.873  110.769 1.00 37.86 ? 278  ASN A N   1 
ATOM   2215 C  CA  . ASN A 1 278 ? 55.527 -9.652  109.331 1.00 34.87 ? 278  ASN A CA  1 
ATOM   2216 C  C   . ASN A 1 278 ? 56.034 -8.267  108.949 1.00 33.06 ? 278  ASN A C   1 
ATOM   2217 O  O   . ASN A 1 278 ? 55.924 -7.315  109.723 1.00 32.38 ? 278  ASN A O   1 
ATOM   2218 C  CB  . ASN A 1 278 ? 54.091 -9.823  108.828 1.00 34.64 ? 278  ASN A CB  1 
ATOM   2219 C  CG  . ASN A 1 278 ? 53.157 -8.758  109.372 1.00 34.83 ? 278  ASN A CG  1 
ATOM   2220 O  OD1 . ASN A 1 278 ? 52.786 -8.788  110.544 1.00 34.12 ? 278  ASN A OD1 1 
ATOM   2221 N  ND2 . ASN A 1 278 ? 52.787 -7.801  108.529 1.00 34.30 ? 278  ASN A ND2 1 
ATOM   2222 N  N   . ALA A 1 279 ? 56.594 -8.172  107.750 1.00 31.14 ? 279  ALA A N   1 
ATOM   2223 C  CA  . ALA A 1 279 ? 56.885 -6.890  107.134 1.00 30.20 ? 279  ALA A CA  1 
ATOM   2224 C  C   . ALA A 1 279 ? 55.611 -6.340  106.502 1.00 28.95 ? 279  ALA A C   1 
ATOM   2225 O  O   . ALA A 1 279 ? 54.680 -7.090  106.205 1.00 30.37 ? 279  ALA A O   1 
ATOM   2226 C  CB  . ALA A 1 279 ? 57.958 -7.048  106.069 1.00 30.76 ? 279  ALA A CB  1 
ATOM   2227 N  N   . GLY A 1 280 ? 55.573 -5.025  106.327 1.00 27.51 ? 280  GLY A N   1 
ATOM   2228 C  CA  . GLY A 1 280 ? 54.595 -4.380  105.462 1.00 26.20 ? 280  GLY A CA  1 
ATOM   2229 C  C   . GLY A 1 280 ? 55.231 -4.167  104.103 1.00 25.65 ? 280  GLY A C   1 
ATOM   2230 O  O   . GLY A 1 280 ? 56.465 -4.162  103.981 1.00 24.29 ? 280  GLY A O   1 
ATOM   2231 N  N   . ALA A 1 281 ? 54.402 -4.008  103.075 1.00 24.71 ? 281  ALA A N   1 
ATOM   2232 C  CA  . ALA A 1 281 ? 54.890 -3.658  101.744 1.00 24.99 ? 281  ALA A CA  1 
ATOM   2233 C  C   . ALA A 1 281 ? 53.948 -2.702  101.024 1.00 25.58 ? 281  ALA A C   1 
ATOM   2234 O  O   . ALA A 1 281 ? 52.782 -2.536  101.402 1.00 24.36 ? 281  ALA A O   1 
ATOM   2235 C  CB  . ALA A 1 281 ? 55.127 -4.904  100.903 1.00 25.04 ? 281  ALA A CB  1 
ATOM   2236 N  N   . MET A 1 282 ? 54.491 -2.069  99.990  1.00 25.52 ? 282  MET A N   1 
ATOM   2237 C  CA  . MET A 1 282 ? 53.783 -1.088  99.189  1.00 26.77 ? 282  MET A CA  1 
ATOM   2238 C  C   . MET A 1 282 ? 54.216 -1.253  97.740  1.00 26.53 ? 282  MET A C   1 
ATOM   2239 O  O   . MET A 1 282 ? 55.411 -1.146  97.434  1.00 24.68 ? 282  MET A O   1 
ATOM   2240 C  CB  . MET A 1 282 ? 54.128 0.311   99.699  1.00 29.08 ? 282  MET A CB  1 
ATOM   2241 C  CG  . MET A 1 282 ? 53.737 1.465   98.791  1.00 31.49 ? 282  MET A CG  1 
ATOM   2242 S  SD  . MET A 1 282 ? 53.859 3.049   99.647  1.00 35.86 ? 282  MET A SD  1 
ATOM   2243 C  CE  . MET A 1 282 ? 55.533 2.972   100.293 1.00 35.62 ? 282  MET A CE  1 
ATOM   2244 N  N   . MET A 1 283 ? 53.255 -1.524  96.857  1.00 25.19 ? 283  MET A N   1 
ATOM   2245 C  CA  . MET A 1 283 ? 53.556 -1.743  95.445  1.00 25.68 ? 283  MET A CA  1 
ATOM   2246 C  C   . MET A 1 283 ? 53.562 -0.426  94.684  1.00 26.34 ? 283  MET A C   1 
ATOM   2247 O  O   . MET A 1 283 ? 52.640 0.380   94.806  1.00 26.80 ? 283  MET A O   1 
ATOM   2248 C  CB  . MET A 1 283 ? 52.554 -2.705  94.807  1.00 24.65 ? 283  MET A CB  1 
ATOM   2249 C  CG  . MET A 1 283 ? 52.892 -3.078  93.369  1.00 24.18 ? 283  MET A CG  1 
ATOM   2250 S  SD  . MET A 1 283 ? 52.021 -4.547  92.790  1.00 23.54 ? 283  MET A SD  1 
ATOM   2251 C  CE  . MET A 1 283 ? 50.423 -3.859  92.372  1.00 23.53 ? 283  MET A CE  1 
ATOM   2252 N  N   . SER A 1 284 ? 54.616 -0.220  93.908  1.00 26.35 ? 284  SER A N   1 
ATOM   2253 C  CA  . SER A 1 284 ? 54.759 0.948   93.060  1.00 27.93 ? 284  SER A CA  1 
ATOM   2254 C  C   . SER A 1 284 ? 54.507 0.510   91.613  1.00 28.37 ? 284  SER A C   1 
ATOM   2255 O  O   . SER A 1 284 ? 55.059 -0.491  91.167  1.00 28.60 ? 284  SER A O   1 
ATOM   2256 C  CB  . SER A 1 284 ? 56.170 1.517   93.234  1.00 28.65 ? 284  SER A CB  1 
ATOM   2257 O  OG  . SER A 1 284 ? 56.289 2.807   92.671  1.00 30.50 ? 284  SER A OG  1 
ATOM   2258 N  N   . VAL A 1 285 ? 53.646 1.236   90.901  1.00 28.17 ? 285  VAL A N   1 
ATOM   2259 C  CA  . VAL A 1 285 ? 53.388 0.987   89.485  1.00 28.88 ? 285  VAL A CA  1 
ATOM   2260 C  C   . VAL A 1 285 ? 53.827 2.223   88.703  1.00 29.90 ? 285  VAL A C   1 
ATOM   2261 O  O   . VAL A 1 285 ? 53.405 3.329   89.016  1.00 27.94 ? 285  VAL A O   1 
ATOM   2262 C  CB  . VAL A 1 285 ? 51.891 0.712   89.214  1.00 28.07 ? 285  VAL A CB  1 
ATOM   2263 C  CG1 . VAL A 1 285 ? 51.682 0.239   87.785  1.00 28.18 ? 285  VAL A CG1 1 
ATOM   2264 C  CG2 . VAL A 1 285 ? 51.343 -0.319  90.193  1.00 28.01 ? 285  VAL A CG2 1 
ATOM   2265 N  N   . ASP A 1 286 ? 54.681 2.040   87.697  1.00 33.11 ? 286  ASP A N   1 
ATOM   2266 C  CA  . ASP A 1 286 ? 55.174 3.171   86.894  1.00 36.09 ? 286  ASP A CA  1 
ATOM   2267 C  C   . ASP A 1 286 ? 54.496 3.246   85.517  1.00 39.98 ? 286  ASP A C   1 
ATOM   2268 O  O   . ASP A 1 286 ? 53.691 2.378   85.167  1.00 40.34 ? 286  ASP A O   1 
ATOM   2269 C  CB  . ASP A 1 286 ? 56.707 3.124   86.769  1.00 36.98 ? 286  ASP A CB  1 
ATOM   2270 C  CG  . ASP A 1 286 ? 57.207 1.979   85.898  1.00 37.33 ? 286  ASP A CG  1 
ATOM   2271 O  OD1 . ASP A 1 286 ? 56.403 1.357   85.165  1.00 37.16 ? 286  ASP A OD1 1 
ATOM   2272 O  OD2 . ASP A 1 286 ? 58.425 1.708   85.947  1.00 37.62 ? 286  ASP A OD2 1 
ATOM   2273 N  N   . GLU A 1 287 ? 54.839 4.279   84.745  1.00 42.81 ? 287  GLU A N   1 
ATOM   2274 C  CA  . GLU A 1 287 ? 54.211 4.550   83.443  1.00 45.00 ? 287  GLU A CA  1 
ATOM   2275 C  C   . GLU A 1 287 ? 54.303 3.398   82.436  1.00 45.86 ? 287  GLU A C   1 
ATOM   2276 O  O   . GLU A 1 287 ? 53.403 3.230   81.611  1.00 47.53 ? 287  GLU A O   1 
ATOM   2277 C  CB  . GLU A 1 287 ? 54.795 5.828   82.827  1.00 46.75 ? 287  GLU A CB  1 
ATOM   2278 C  CG  . GLU A 1 287 ? 54.244 7.104   83.448  1.00 48.40 ? 287  GLU A CG  1 
ATOM   2279 C  CD  . GLU A 1 287 ? 55.185 8.288   83.323  1.00 50.25 ? 287  GLU A CD  1 
ATOM   2280 O  OE1 . GLU A 1 287 ? 55.987 8.328   82.362  1.00 51.89 ? 287  GLU A OE1 1 
ATOM   2281 O  OE2 . GLU A 1 287 ? 55.126 9.178   84.200  1.00 50.43 ? 287  GLU A OE2 1 
ATOM   2282 N  N   . THR A 1 288 ? 55.371 2.605   82.508  1.00 45.49 ? 288  THR A N   1 
ATOM   2283 C  CA  . THR A 1 288 ? 55.530 1.444   81.625  1.00 46.25 ? 288  THR A CA  1 
ATOM   2284 C  C   . THR A 1 288 ? 54.800 0.200   82.147  1.00 45.40 ? 288  THR A C   1 
ATOM   2285 O  O   . THR A 1 288 ? 54.971 -0.894  81.603  1.00 45.18 ? 288  THR A O   1 
ATOM   2286 C  CB  . THR A 1 288 ? 57.022 1.099   81.415  1.00 46.34 ? 288  THR A CB  1 
ATOM   2287 O  OG1 . THR A 1 288 ? 57.656 0.910   82.683  1.00 46.80 ? 288  THR A OG1 1 
ATOM   2288 C  CG2 . THR A 1 288 ? 57.728 2.211   80.659  1.00 47.11 ? 288  THR A CG2 1 
ATOM   2289 N  N   . LEU A 1 289 ? 53.989 0.370   83.193  1.00 44.41 ? 289  LEU A N   1 
ATOM   2290 C  CA  . LEU A 1 289 ? 53.278 -0.732  83.832  1.00 42.80 ? 289  LEU A CA  1 
ATOM   2291 C  C   . LEU A 1 289 ? 54.249 -1.791  84.373  1.00 41.19 ? 289  LEU A C   1 
ATOM   2292 O  O   . LEU A 1 289 ? 54.042 -2.995  84.207  1.00 40.98 ? 289  LEU A O   1 
ATOM   2293 C  CB  . LEU A 1 289 ? 52.254 -1.336  82.864  1.00 44.27 ? 289  LEU A CB  1 
ATOM   2294 C  CG  . LEU A 1 289 ? 51.123 -2.197  83.439  1.00 44.72 ? 289  LEU A CG  1 
ATOM   2295 C  CD1 . LEU A 1 289 ? 50.381 -1.495  84.571  1.00 45.50 ? 289  LEU A CD1 1 
ATOM   2296 C  CD2 . LEU A 1 289 ? 50.163 -2.579  82.326  1.00 44.40 ? 289  LEU A CD2 1 
ATOM   2297 N  N   . MET A 1 290 ? 55.316 -1.320  85.013  1.00 38.73 ? 290  MET A N   1 
ATOM   2298 C  CA  . MET A 1 290 ? 56.241 -2.188  85.733  1.00 37.58 ? 290  MET A CA  1 
ATOM   2299 C  C   . MET A 1 290 ? 55.966 -2.048  87.224  1.00 33.88 ? 290  MET A C   1 
ATOM   2300 O  O   . MET A 1 290 ? 55.813 -0.937  87.726  1.00 33.98 ? 290  MET A O   1 
ATOM   2301 C  CB  . MET A 1 290 ? 57.694 -1.813  85.426  1.00 39.24 ? 290  MET A CB  1 
ATOM   2302 C  CG  . MET A 1 290 ? 58.125 -2.114  83.997  1.00 41.28 ? 290  MET A CG  1 
ATOM   2303 S  SD  . MET A 1 290 ? 58.067 -3.869  83.586  1.00 44.33 ? 290  MET A SD  1 
ATOM   2304 C  CE  . MET A 1 290 ? 59.318 -4.530  84.688  1.00 44.90 ? 290  MET A CE  1 
HETATM 2305 N  N   . CSO A 1 291 ? 55.910 -3.181  87.919  1.00 31.10 ? 291  CSO A N   1 
HETATM 2306 C  CA  . CSO A 1 291 ? 55.556 -3.222  89.339  1.00 28.81 ? 291  CSO A CA  1 
HETATM 2307 C  CB  . CSO A 1 291 ? 54.498 -4.307  89.544  1.00 27.83 ? 291  CSO A CB  1 
HETATM 2308 S  SG  . CSO A 1 291 ? 52.887 -3.759  89.044  1.00 27.51 ? 291  CSO A SG  1 
HETATM 2309 C  C   . CSO A 1 291 ? 56.786 -3.495  90.172  1.00 28.44 ? 291  CSO A C   1 
HETATM 2310 O  O   . CSO A 1 291 ? 57.547 -4.417  89.876  1.00 27.94 ? 291  CSO A O   1 
HETATM 2311 O  OD  . CSO A 1 291 ? 52.915 -3.608  87.303  1.00 23.77 ? 291  CSO A OD  1 
ATOM   2312 N  N   . SER A 1 292 ? 57.000 -2.684  91.210  1.00 26.49 ? 292  SER A N   1 
ATOM   2313 C  CA  . SER A 1 292 ? 58.084 -2.912  92.173  1.00 26.02 ? 292  SER A CA  1 
ATOM   2314 C  C   . SER A 1 292 ? 57.559 -2.733  93.595  1.00 25.07 ? 292  SER A C   1 
ATOM   2315 O  O   . SER A 1 292 ? 56.464 -2.200  93.793  1.00 24.10 ? 292  SER A O   1 
ATOM   2316 C  CB  . SER A 1 292 ? 59.251 -1.964  91.914  1.00 26.43 ? 292  SER A CB  1 
ATOM   2317 O  OG  . SER A 1 292 ? 58.836 -0.612  91.974  1.00 27.38 ? 292  SER A OG  1 
ATOM   2318 N  N   . PHE A 1 293 ? 58.350 -3.157  94.577  1.00 23.96 ? 293  PHE A N   1 
ATOM   2319 C  CA  . PHE A 1 293 ? 57.889 -3.215  95.967  1.00 23.90 ? 293  PHE A CA  1 
ATOM   2320 C  C   . PHE A 1 293 ? 58.864 -2.557  96.942  1.00 23.37 ? 293  PHE A C   1 
ATOM   2321 O  O   . PHE A 1 293 ? 60.080 -2.778  96.877  1.00 21.85 ? 293  PHE A O   1 
ATOM   2322 C  CB  . PHE A 1 293 ? 57.659 -4.670  96.362  1.00 24.02 ? 293  PHE A CB  1 
ATOM   2323 C  CG  . PHE A 1 293 ? 56.631 -5.363  95.515  1.00 24.52 ? 293  PHE A CG  1 
ATOM   2324 C  CD1 . PHE A 1 293 ? 55.288 -5.324  95.863  1.00 24.84 ? 293  PHE A CD1 1 
ATOM   2325 C  CD2 . PHE A 1 293 ? 57.002 -6.034  94.358  1.00 25.12 ? 293  PHE A CD2 1 
ATOM   2326 C  CE1 . PHE A 1 293 ? 54.335 -5.959  95.080  1.00 24.73 ? 293  PHE A CE1 1 
ATOM   2327 C  CE2 . PHE A 1 293 ? 56.057 -6.666  93.568  1.00 24.71 ? 293  PHE A CE2 1 
ATOM   2328 C  CZ  . PHE A 1 293 ? 54.719 -6.631  93.933  1.00 24.96 ? 293  PHE A CZ  1 
ATOM   2329 N  N   . GLN A 1 294 ? 58.323 -1.727  97.830  1.00 22.41 ? 294  GLN A N   1 
ATOM   2330 C  CA  . GLN A 1 294 ? 59.086 -1.161  98.929  1.00 22.74 ? 294  GLN A CA  1 
ATOM   2331 C  C   . GLN A 1 294 ? 58.687 -1.896  100.193 1.00 23.26 ? 294  GLN A C   1 
ATOM   2332 O  O   . GLN A 1 294 ? 57.491 -2.078  100.464 1.00 22.29 ? 294  GLN A O   1 
ATOM   2333 C  CB  . GLN A 1 294 ? 58.818 0.337   99.058  1.00 22.96 ? 294  GLN A CB  1 
ATOM   2334 C  CG  . GLN A 1 294 ? 59.202 1.124   97.815  1.00 23.10 ? 294  GLN A CG  1 
ATOM   2335 C  CD  . GLN A 1 294 ? 58.779 2.572   97.872  1.00 23.37 ? 294  GLN A CD  1 
ATOM   2336 O  OE1 . GLN A 1 294 ? 57.757 2.953   97.288  1.00 24.64 ? 294  GLN A OE1 1 
ATOM   2337 N  NE2 . GLN A 1 294 ? 59.553 3.395   98.577  1.00 23.39 ? 294  GLN A NE2 1 
ATOM   2338 N  N   . ILE A 1 295 ? 59.683 -2.322  100.965 1.00 23.65 ? 295  ILE A N   1 
ATOM   2339 C  CA  . ILE A 1 295 ? 59.439 -3.170  102.131 1.00 24.98 ? 295  ILE A CA  1 
ATOM   2340 C  C   . ILE A 1 295 ? 59.725 -2.448  103.444 1.00 25.34 ? 295  ILE A C   1 
ATOM   2341 O  O   . ILE A 1 295 ? 60.765 -1.795  103.604 1.00 24.83 ? 295  ILE A O   1 
ATOM   2342 C  CB  . ILE A 1 295 ? 60.245 -4.492  102.056 1.00 26.30 ? 295  ILE A CB  1 
ATOM   2343 C  CG1 . ILE A 1 295 ? 59.716 -5.373  100.907 1.00 27.38 ? 295  ILE A CG1 1 
ATOM   2344 C  CG2 . ILE A 1 295 ? 60.162 -5.261  103.373 1.00 26.11 ? 295  ILE A CG2 1 
ATOM   2345 C  CD1 . ILE A 1 295 ? 60.702 -5.580  99.782  1.00 28.21 ? 295  ILE A CD1 1 
ATOM   2346 N  N   . LEU A 1 296 ? 58.778 -2.585  104.372 1.00 24.88 ? 296  LEU A N   1 
ATOM   2347 C  CA  . LEU A 1 296 ? 58.839 -1.991  105.704 1.00 25.93 ? 296  LEU A CA  1 
ATOM   2348 C  C   . LEU A 1 296 ? 58.957 -3.118  106.724 1.00 26.72 ? 296  LEU A C   1 
ATOM   2349 O  O   . LEU A 1 296 ? 57.954 -3.743  107.084 1.00 25.82 ? 296  LEU A O   1 
ATOM   2350 C  CB  . LEU A 1 296 ? 57.555 -1.206  106.000 1.00 26.81 ? 296  LEU A CB  1 
ATOM   2351 C  CG  . LEU A 1 296 ? 57.038 -0.030  105.148 1.00 27.49 ? 296  LEU A CG  1 
ATOM   2352 C  CD1 . LEU A 1 296 ? 57.173 1.281   105.901 1.00 28.65 ? 296  LEU A CD1 1 
ATOM   2353 C  CD2 . LEU A 1 296 ? 57.650 0.076   103.760 1.00 27.93 ? 296  LEU A CD2 1 
ATOM   2354 N  N   . LYS A 1 297 ? 60.174 -3.384  107.189 1.00 27.61 ? 297  LYS A N   1 
ATOM   2355 C  CA  . LYS A 1 297 ? 60.385 -4.380  108.237 1.00 30.26 ? 297  LYS A CA  1 
ATOM   2356 C  C   . LYS A 1 297 ? 59.821 -3.867  109.558 1.00 31.18 ? 297  LYS A C   1 
ATOM   2357 O  O   . LYS A 1 297 ? 59.785 -2.654  109.788 1.00 32.13 ? 297  LYS A O   1 
ATOM   2358 C  CB  . LYS A 1 297 ? 61.878 -4.695  108.396 1.00 30.96 ? 297  LYS A CB  1 
ATOM   2359 C  CG  . LYS A 1 297 ? 62.483 -5.455  107.227 1.00 32.68 ? 297  LYS A CG  1 
ATOM   2360 C  CD  . LYS A 1 297 ? 61.897 -6.855  107.106 1.00 33.84 ? 297  LYS A CD  1 
ATOM   2361 C  CE  . LYS A 1 297 ? 62.871 -7.813  106.442 1.00 35.33 ? 297  LYS A CE  1 
ATOM   2362 N  NZ  . LYS A 1 297 ? 64.090 -8.036  107.266 1.00 36.60 ? 297  LYS A NZ  1 
ATOM   2363 N  N   . PRO A 1 298 ? 59.368 -4.783  110.430 1.00 34.08 ? 298  PRO A N   1 
ATOM   2364 C  CA  . PRO A 1 298 ? 58.869 -4.356  111.736 1.00 35.04 ? 298  PRO A CA  1 
ATOM   2365 C  C   . PRO A 1 298 ? 59.979 -3.786  112.616 1.00 37.85 ? 298  PRO A C   1 
ATOM   2366 O  O   . PRO A 1 298 ? 61.120 -4.250  112.547 1.00 37.58 ? 298  PRO A O   1 
ATOM   2367 C  CB  . PRO A 1 298 ? 58.310 -5.648  112.335 1.00 35.05 ? 298  PRO A CB  1 
ATOM   2368 C  CG  . PRO A 1 298 ? 59.071 -6.738  111.675 1.00 34.10 ? 298  PRO A CG  1 
ATOM   2369 C  CD  . PRO A 1 298 ? 59.358 -6.253  110.287 1.00 33.77 ? 298  PRO A CD  1 
ATOM   2370 N  N   . ALA A 1 299 ? 59.641 -2.776  113.417 1.00 41.79 ? 299  ALA A N   1 
ATOM   2371 C  CA  . ALA A 1 299 ? 60.591 -2.137  114.330 1.00 43.47 ? 299  ALA A CA  1 
ATOM   2372 C  C   . ALA A 1 299 ? 60.231 -2.449  115.779 1.00 44.12 ? 299  ALA A C   1 
ATOM   2373 O  O   . ALA A 1 299 ? 60.699 -3.438  116.348 1.00 46.22 ? 299  ALA A O   1 
ATOM   2374 C  CB  . ALA A 1 299 ? 60.611 -0.633  114.100 1.00 44.37 ? 299  ALA A CB  1 
ATOM   2375 N  N   . LYS B 1 6   ? 45.391 -66.754 122.975 1.00 65.36 ? 6    LYS B N   1 
ATOM   2376 C  CA  . LYS B 1 6   ? 45.349 -66.638 121.487 1.00 66.02 ? 6    LYS B CA  1 
ATOM   2377 C  C   . LYS B 1 6   ? 46.476 -65.753 120.948 1.00 63.77 ? 6    LYS B C   1 
ATOM   2378 O  O   . LYS B 1 6   ? 47.113 -66.091 119.948 1.00 65.32 ? 6    LYS B O   1 
ATOM   2379 C  CB  . LYS B 1 6   ? 43.995 -66.084 121.033 1.00 68.70 ? 6    LYS B CB  1 
ATOM   2380 C  CG  . LYS B 1 6   ? 43.729 -66.246 119.543 1.00 71.41 ? 6    LYS B CG  1 
ATOM   2381 C  CD  . LYS B 1 6   ? 42.362 -65.711 119.153 1.00 73.35 ? 6    LYS B CD  1 
ATOM   2382 C  CE  . LYS B 1 6   ? 42.109 -65.883 117.662 1.00 73.90 ? 6    LYS B CE  1 
ATOM   2383 N  NZ  . LYS B 1 6   ? 40.786 -65.337 117.253 1.00 74.38 ? 6    LYS B NZ  1 
ATOM   2384 N  N   . LEU B 1 7   ? 46.714 -64.625 121.615 1.00 60.15 ? 7    LEU B N   1 
ATOM   2385 C  CA  . LEU B 1 7   ? 47.679 -63.630 121.147 1.00 55.99 ? 7    LEU B CA  1 
ATOM   2386 C  C   . LEU B 1 7   ? 49.119 -64.018 121.495 1.00 53.08 ? 7    LEU B C   1 
ATOM   2387 O  O   . LEU B 1 7   ? 49.476 -64.121 122.669 1.00 51.52 ? 7    LEU B O   1 
ATOM   2388 C  CB  . LEU B 1 7   ? 47.337 -62.264 121.751 1.00 55.57 ? 7    LEU B CB  1 
ATOM   2389 C  CG  . LEU B 1 7   ? 48.066 -61.027 121.220 1.00 55.05 ? 7    LEU B CG  1 
ATOM   2390 C  CD1 . LEU B 1 7   ? 47.947 -60.912 119.706 1.00 54.95 ? 7    LEU B CD1 1 
ATOM   2391 C  CD2 . LEU B 1 7   ? 47.512 -59.783 121.899 1.00 54.53 ? 7    LEU B CD2 1 
ATOM   2392 N  N   . ASN B 1 8   ? 49.936 -64.230 120.464 1.00 50.66 ? 8    ASN B N   1 
ATOM   2393 C  CA  . ASN B 1 8   ? 51.341 -64.593 120.637 1.00 48.50 ? 8    ASN B CA  1 
ATOM   2394 C  C   . ASN B 1 8   ? 52.208 -63.339 120.758 1.00 47.13 ? 8    ASN B C   1 
ATOM   2395 O  O   . ASN B 1 8   ? 52.766 -62.858 119.770 1.00 47.14 ? 8    ASN B O   1 
ATOM   2396 C  CB  . ASN B 1 8   ? 51.805 -65.467 119.463 1.00 48.59 ? 8    ASN B CB  1 
ATOM   2397 C  CG  . ASN B 1 8   ? 53.133 -66.159 119.726 1.00 49.07 ? 8    ASN B CG  1 
ATOM   2398 O  OD1 . ASN B 1 8   ? 53.910 -65.751 120.596 1.00 48.97 ? 8    ASN B OD1 1 
ATOM   2399 N  ND2 . ASN B 1 8   ? 53.400 -67.218 118.971 1.00 48.81 ? 8    ASN B ND2 1 
ATOM   2400 N  N   . ILE B 1 9   ? 52.328 -62.827 121.981 1.00 45.13 ? 9    ILE B N   1 
ATOM   2401 C  CA  . ILE B 1 9   ? 53.023 -61.564 122.237 1.00 43.95 ? 9    ILE B CA  1 
ATOM   2402 C  C   . ILE B 1 9   ? 54.522 -61.673 121.952 1.00 42.08 ? 9    ILE B C   1 
ATOM   2403 O  O   . ILE B 1 9   ? 55.111 -60.756 121.378 1.00 40.68 ? 9    ILE B O   1 
ATOM   2404 C  CB  . ILE B 1 9   ? 52.793 -61.075 123.693 1.00 44.27 ? 9    ILE B CB  1 
ATOM   2405 C  CG1 . ILE B 1 9   ? 51.314 -60.742 123.930 1.00 45.01 ? 9    ILE B CG1 1 
ATOM   2406 C  CG2 . ILE B 1 9   ? 53.651 -59.853 124.011 1.00 43.67 ? 9    ILE B CG2 1 
ATOM   2407 C  CD1 . ILE B 1 9   ? 50.822 -59.481 123.241 1.00 45.09 ? 9    ILE B CD1 1 
ATOM   2408 N  N   . ASP B 1 10  ? 55.134 -62.784 122.354 1.00 41.26 ? 10   ASP B N   1 
ATOM   2409 C  CA  . ASP B 1 10  ? 56.569 -62.987 122.141 1.00 41.45 ? 10   ASP B CA  1 
ATOM   2410 C  C   . ASP B 1 10  ? 56.940 -62.934 120.661 1.00 40.26 ? 10   ASP B C   1 
ATOM   2411 O  O   . ASP B 1 10  ? 57.938 -62.323 120.288 1.00 41.94 ? 10   ASP B O   1 
ATOM   2412 C  CB  . ASP B 1 10  ? 57.026 -64.321 122.737 1.00 41.53 ? 10   ASP B CB  1 
ATOM   2413 C  CG  . ASP B 1 10  ? 56.954 -64.344 124.250 1.00 42.81 ? 10   ASP B CG  1 
ATOM   2414 O  OD1 . ASP B 1 10  ? 56.922 -63.259 124.875 1.00 43.15 ? 10   ASP B OD1 1 
ATOM   2415 O  OD2 . ASP B 1 10  ? 56.929 -65.456 124.819 1.00 43.34 ? 10   ASP B OD2 1 
ATOM   2416 N  N   . SER B 1 11  ? 56.130 -63.576 119.827 1.00 39.93 ? 11   SER B N   1 
ATOM   2417 C  CA  . SER B 1 11  ? 56.336 -63.566 118.379 1.00 40.05 ? 11   SER B CA  1 
ATOM   2418 C  C   . SER B 1 11  ? 56.185 -62.156 117.804 1.00 38.47 ? 11   SER B C   1 
ATOM   2419 O  O   . SER B 1 11  ? 56.979 -61.737 116.960 1.00 37.99 ? 11   SER B O   1 
ATOM   2420 C  CB  . SER B 1 11  ? 55.347 -64.515 117.700 1.00 40.54 ? 11   SER B CB  1 
ATOM   2421 O  OG  . SER B 1 11  ? 55.483 -64.473 116.294 1.00 42.22 ? 11   SER B OG  1 
ATOM   2422 N  N   . ILE B 1 12  ? 55.163 -61.439 118.268 1.00 37.01 ? 12   ILE B N   1 
ATOM   2423 C  CA  . ILE B 1 12  ? 54.892 -60.070 117.823 1.00 36.51 ? 12   ILE B CA  1 
ATOM   2424 C  C   . ILE B 1 12  ? 56.070 -59.146 118.155 1.00 36.03 ? 12   ILE B C   1 
ATOM   2425 O  O   . ILE B 1 12  ? 56.538 -58.406 117.294 1.00 36.84 ? 12   ILE B O   1 
ATOM   2426 C  CB  . ILE B 1 12  ? 53.578 -59.525 118.439 1.00 35.87 ? 12   ILE B CB  1 
ATOM   2427 C  CG1 . ILE B 1 12  ? 52.369 -60.233 117.811 1.00 36.11 ? 12   ILE B CG1 1 
ATOM   2428 C  CG2 . ILE B 1 12  ? 53.456 -58.021 118.227 1.00 35.15 ? 12   ILE B CG2 1 
ATOM   2429 C  CD1 . ILE B 1 12  ? 51.074 -60.063 118.578 1.00 35.92 ? 12   ILE B CD1 1 
ATOM   2430 N  N   . ILE B 1 13  ? 56.555 -59.210 119.393 1.00 35.76 ? 13   ILE B N   1 
ATOM   2431 C  CA  . ILE B 1 13  ? 57.681 -58.379 119.825 1.00 36.10 ? 13   ILE B CA  1 
ATOM   2432 C  C   . ILE B 1 13  ? 58.959 -58.720 119.051 1.00 36.41 ? 13   ILE B C   1 
ATOM   2433 O  O   . ILE B 1 13  ? 59.721 -57.828 118.674 1.00 35.14 ? 13   ILE B O   1 
ATOM   2434 C  CB  . ILE B 1 13  ? 57.940 -58.507 121.347 1.00 35.92 ? 13   ILE B CB  1 
ATOM   2435 C  CG1 . ILE B 1 13  ? 56.779 -57.885 122.133 1.00 36.35 ? 13   ILE B CG1 1 
ATOM   2436 C  CG2 . ILE B 1 13  ? 59.251 -57.830 121.737 1.00 36.20 ? 13   ILE B CG2 1 
ATOM   2437 C  CD1 . ILE B 1 13  ? 56.811 -58.157 123.625 1.00 36.50 ? 13   ILE B CD1 1 
ATOM   2438 N  N   . GLN B 1 14  ? 59.189 -60.010 118.827 1.00 37.22 ? 14   GLN B N   1 
ATOM   2439 C  CA  . GLN B 1 14  ? 60.376 -60.465 118.104 1.00 38.54 ? 14   GLN B CA  1 
ATOM   2440 C  C   . GLN B 1 14  ? 60.407 -59.903 116.678 1.00 36.77 ? 14   GLN B C   1 
ATOM   2441 O  O   . GLN B 1 14  ? 61.446 -59.428 116.214 1.00 35.98 ? 14   GLN B O   1 
ATOM   2442 C  CB  . GLN B 1 14  ? 60.439 -62.000 118.101 1.00 41.08 ? 14   GLN B CB  1 
ATOM   2443 C  CG  . GLN B 1 14  ? 61.615 -62.595 117.334 1.00 43.25 ? 14   GLN B CG  1 
ATOM   2444 C  CD  . GLN B 1 14  ? 61.300 -62.845 115.865 1.00 45.61 ? 14   GLN B CD  1 
ATOM   2445 O  OE1 . GLN B 1 14  ? 61.965 -62.308 114.974 1.00 47.08 ? 14   GLN B OE1 1 
ATOM   2446 N  NE2 . GLN B 1 14  ? 60.275 -63.654 115.606 1.00 46.26 ? 14   GLN B NE2 1 
ATOM   2447 N  N   . ARG B 1 15  ? 59.273 -59.945 115.988 1.00 35.61 ? 15   ARG B N   1 
ATOM   2448 C  CA  . ARG B 1 15  ? 59.206 -59.404 114.627 1.00 35.07 ? 15   ARG B CA  1 
ATOM   2449 C  C   . ARG B 1 15  ? 59.380 -57.888 114.629 1.00 34.12 ? 15   ARG B C   1 
ATOM   2450 O  O   . ARG B 1 15  ? 60.081 -57.340 113.781 1.00 33.57 ? 15   ARG B O   1 
ATOM   2451 C  CB  . ARG B 1 15  ? 57.907 -59.806 113.934 1.00 35.06 ? 15   ARG B CB  1 
ATOM   2452 C  CG  . ARG B 1 15  ? 57.981 -61.163 113.248 1.00 35.68 ? 15   ARG B CG  1 
ATOM   2453 C  CD  . ARG B 1 15  ? 56.609 -61.596 112.771 1.00 35.18 ? 15   ARG B CD  1 
ATOM   2454 N  NE  . ARG B 1 15  ? 55.762 -61.969 113.899 1.00 35.68 ? 15   ARG B NE  1 
ATOM   2455 C  CZ  . ARG B 1 15  ? 54.432 -61.894 113.923 1.00 35.59 ? 15   ARG B CZ  1 
ATOM   2456 N  NH1 . ARG B 1 15  ? 53.746 -61.449 112.873 1.00 36.31 ? 15   ARG B NH1 1 
ATOM   2457 N  NH2 . ARG B 1 15  ? 53.783 -62.265 115.018 1.00 35.93 ? 15   ARG B NH2 1 
ATOM   2458 N  N   . LEU B 1 16  ? 58.778 -57.215 115.607 1.00 34.17 ? 16   LEU B N   1 
ATOM   2459 C  CA  . LEU B 1 16  ? 58.957 -55.769 115.752 1.00 32.88 ? 16   LEU B CA  1 
ATOM   2460 C  C   . LEU B 1 16  ? 60.427 -55.404 116.001 1.00 32.71 ? 16   LEU B C   1 
ATOM   2461 O  O   . LEU B 1 16  ? 60.927 -54.430 115.443 1.00 30.46 ? 16   LEU B O   1 
ATOM   2462 C  CB  . LEU B 1 16  ? 58.055 -55.212 116.863 1.00 32.86 ? 16   LEU B CB  1 
ATOM   2463 C  CG  . LEU B 1 16  ? 56.571 -55.061 116.502 1.00 32.48 ? 16   LEU B CG  1 
ATOM   2464 C  CD1 . LEU B 1 16  ? 55.732 -54.820 117.747 1.00 31.91 ? 16   LEU B CD1 1 
ATOM   2465 C  CD2 . LEU B 1 16  ? 56.355 -53.943 115.494 1.00 32.29 ? 16   LEU B CD2 1 
ATOM   2466 N  N   . LEU B 1 17  ? 61.119 -56.196 116.816 1.00 33.29 ? 17   LEU B N   1 
ATOM   2467 C  CA  . LEU B 1 17  ? 62.525 -55.932 117.134 1.00 34.98 ? 17   LEU B CA  1 
ATOM   2468 C  C   . LEU B 1 17  ? 63.498 -56.484 116.093 1.00 37.18 ? 17   LEU B C   1 
ATOM   2469 O  O   . LEU B 1 17  ? 64.680 -56.144 116.120 1.00 37.07 ? 17   LEU B O   1 
ATOM   2470 C  CB  . LEU B 1 17  ? 62.875 -56.494 118.514 1.00 35.40 ? 17   LEU B CB  1 
ATOM   2471 C  CG  . LEU B 1 17  ? 62.106 -55.886 119.693 1.00 35.35 ? 17   LEU B CG  1 
ATOM   2472 C  CD1 . LEU B 1 17  ? 62.511 -56.574 120.989 1.00 35.02 ? 17   LEU B CD1 1 
ATOM   2473 C  CD2 . LEU B 1 17  ? 62.332 -54.384 119.787 1.00 35.19 ? 17   LEU B CD2 1 
ATOM   2474 N  N   . GLU B 1 18  ? 63.011 -57.324 115.180 1.00 39.13 ? 18   GLU B N   1 
ATOM   2475 C  CA  . GLU B 1 18  ? 63.858 -57.909 114.132 1.00 41.29 ? 18   GLU B CA  1 
ATOM   2476 C  C   . GLU B 1 18  ? 64.513 -56.866 113.219 1.00 41.09 ? 18   GLU B C   1 
ATOM   2477 O  O   . GLU B 1 18  ? 65.600 -57.100 112.698 1.00 39.95 ? 18   GLU B O   1 
ATOM   2478 C  CB  . GLU B 1 18  ? 63.047 -58.890 113.282 1.00 43.84 ? 18   GLU B CB  1 
ATOM   2479 C  CG  . GLU B 1 18  ? 63.879 -59.689 112.293 1.00 46.92 ? 18   GLU B CG  1 
ATOM   2480 C  CD  . GLU B 1 18  ? 63.102 -60.829 111.668 1.00 49.43 ? 18   GLU B CD  1 
ATOM   2481 O  OE1 . GLU B 1 18  ? 61.915 -60.629 111.329 1.00 53.19 ? 18   GLU B OE1 1 
ATOM   2482 O  OE2 . GLU B 1 18  ? 63.679 -61.927 111.513 1.00 51.66 ? 18   GLU B OE2 1 
ATOM   2483 N  N   . VAL B 1 19  ? 63.857 -55.719 113.038 1.00 41.36 ? 19   VAL B N   1 
ATOM   2484 C  CA  . VAL B 1 19  ? 64.371 -54.660 112.153 1.00 41.84 ? 19   VAL B CA  1 
ATOM   2485 C  C   . VAL B 1 19  ? 65.387 -53.733 112.826 1.00 42.39 ? 19   VAL B C   1 
ATOM   2486 O  O   . VAL B 1 19  ? 65.799 -52.737 112.229 1.00 41.67 ? 19   VAL B O   1 
ATOM   2487 C  CB  . VAL B 1 19  ? 63.224 -53.820 111.529 1.00 41.70 ? 19   VAL B CB  1 
ATOM   2488 C  CG1 . VAL B 1 19  ? 62.305 -54.710 110.708 1.00 42.24 ? 19   VAL B CG1 1 
ATOM   2489 C  CG2 . VAL B 1 19  ? 62.428 -53.064 112.591 1.00 41.84 ? 19   VAL B CG2 1 
ATOM   2490 N  N   . ARG B 1 20  ? 65.797 -54.065 114.052 1.00 44.02 ? 20   ARG B N   1 
ATOM   2491 C  CA  . ARG B 1 20  ? 66.763 -53.261 114.804 1.00 45.05 ? 20   ARG B CA  1 
ATOM   2492 C  C   . ARG B 1 20  ? 68.091 -53.167 114.053 1.00 45.76 ? 20   ARG B C   1 
ATOM   2493 O  O   . ARG B 1 20  ? 68.550 -54.148 113.480 1.00 44.07 ? 20   ARG B O   1 
ATOM   2494 C  CB  . ARG B 1 20  ? 67.023 -53.878 116.184 1.00 45.98 ? 20   ARG B CB  1 
ATOM   2495 C  CG  . ARG B 1 20  ? 66.950 -52.891 117.339 1.00 46.51 ? 20   ARG B CG  1 
ATOM   2496 C  CD  . ARG B 1 20  ? 67.802 -53.326 118.526 1.00 46.50 ? 20   ARG B CD  1 
ATOM   2497 N  NE  . ARG B 1 20  ? 67.395 -54.592 119.119 1.00 47.14 ? 20   ARG B NE  1 
ATOM   2498 C  CZ  . ARG B 1 20  ? 68.023 -55.175 120.139 1.00 48.39 ? 20   ARG B CZ  1 
ATOM   2499 N  NH1 . ARG B 1 20  ? 69.096 -54.611 120.689 1.00 49.79 ? 20   ARG B NH1 1 
ATOM   2500 N  NH2 . ARG B 1 20  ? 67.578 -56.331 120.614 1.00 48.32 ? 20   ARG B NH2 1 
ATOM   2501 N  N   . GLY B 1 21  ? 68.699 -51.983 114.060 1.00 48.36 ? 21   GLY B N   1 
ATOM   2502 C  CA  . GLY B 1 21  ? 69.967 -51.756 113.366 1.00 48.85 ? 21   GLY B CA  1 
ATOM   2503 C  C   . GLY B 1 21  ? 69.820 -51.368 111.904 1.00 50.52 ? 21   GLY B C   1 
ATOM   2504 O  O   . GLY B 1 21  ? 70.764 -50.849 111.307 1.00 50.61 ? 21   GLY B O   1 
ATOM   2505 N  N   . SER B 1 22  ? 68.641 -51.611 111.326 1.00 51.74 ? 22   SER B N   1 
ATOM   2506 C  CA  . SER B 1 22  ? 68.377 -51.301 109.922 1.00 51.36 ? 22   SER B CA  1 
ATOM   2507 C  C   . SER B 1 22  ? 68.303 -49.802 109.687 1.00 51.09 ? 22   SER B C   1 
ATOM   2508 O  O   . SER B 1 22  ? 68.170 -49.018 110.629 1.00 50.71 ? 22   SER B O   1 
ATOM   2509 C  CB  . SER B 1 22  ? 67.048 -51.915 109.474 1.00 51.58 ? 22   SER B CB  1 
ATOM   2510 O  OG  . SER B 1 22  ? 66.962 -53.280 109.830 1.00 53.58 ? 22   SER B OG  1 
ATOM   2511 N  N   . LYS B 1 23  ? 68.375 -49.414 108.417 1.00 49.89 ? 23   LYS B N   1 
ATOM   2512 C  CA  . LYS B 1 23  ? 68.170 -48.027 108.026 1.00 48.33 ? 23   LYS B CA  1 
ATOM   2513 C  C   . LYS B 1 23  ? 66.694 -47.681 108.250 1.00 45.47 ? 23   LYS B C   1 
ATOM   2514 O  O   . LYS B 1 23  ? 65.818 -48.433 107.820 1.00 43.97 ? 23   LYS B O   1 
ATOM   2515 C  CB  . LYS B 1 23  ? 68.551 -47.821 106.558 1.00 49.70 ? 23   LYS B CB  1 
ATOM   2516 C  CG  . LYS B 1 23  ? 68.676 -46.361 106.146 1.00 50.66 ? 23   LYS B CG  1 
ATOM   2517 C  CD  . LYS B 1 23  ? 68.597 -46.195 104.635 1.00 51.34 ? 23   LYS B CD  1 
ATOM   2518 C  CE  . LYS B 1 23  ? 68.469 -44.730 104.242 1.00 51.95 ? 23   LYS B CE  1 
ATOM   2519 N  NZ  . LYS B 1 23  ? 67.708 -44.570 102.975 1.00 52.61 ? 23   LYS B NZ  1 
ATOM   2520 N  N   . PRO B 1 24  ? 66.411 -46.559 108.942 1.00 43.18 ? 24   PRO B N   1 
ATOM   2521 C  CA  . PRO B 1 24  ? 65.024 -46.146 109.185 1.00 42.10 ? 24   PRO B CA  1 
ATOM   2522 C  C   . PRO B 1 24  ? 64.155 -46.138 107.925 1.00 41.64 ? 24   PRO B C   1 
ATOM   2523 O  O   . PRO B 1 24  ? 64.638 -45.798 106.842 1.00 41.79 ? 24   PRO B O   1 
ATOM   2524 C  CB  . PRO B 1 24  ? 65.179 -44.730 109.743 1.00 42.27 ? 24   PRO B CB  1 
ATOM   2525 C  CG  . PRO B 1 24  ? 66.497 -44.749 110.432 1.00 42.65 ? 24   PRO B CG  1 
ATOM   2526 C  CD  . PRO B 1 24  ? 67.371 -45.688 109.647 1.00 43.01 ? 24   PRO B CD  1 
ATOM   2527 N  N   . GLY B 1 25  ? 62.887 -46.517 108.079 1.00 39.94 ? 25   GLY B N   1 
ATOM   2528 C  CA  . GLY B 1 25  ? 61.957 -46.630 106.955 1.00 39.71 ? 25   GLY B CA  1 
ATOM   2529 C  C   . GLY B 1 25  ? 61.385 -48.027 106.773 1.00 38.92 ? 25   GLY B C   1 
ATOM   2530 O  O   . GLY B 1 25  ? 60.213 -48.179 106.421 1.00 39.94 ? 25   GLY B O   1 
ATOM   2531 N  N   . LYS B 1 26  ? 62.207 -49.050 107.007 1.00 37.93 ? 26   LYS B N   1 
ATOM   2532 C  CA  . LYS B 1 26  ? 61.786 -50.442 106.816 1.00 37.28 ? 26   LYS B CA  1 
ATOM   2533 C  C   . LYS B 1 26  ? 60.644 -50.812 107.759 1.00 36.14 ? 26   LYS B C   1 
ATOM   2534 O  O   . LYS B 1 26  ? 60.746 -50.644 108.978 1.00 35.84 ? 26   LYS B O   1 
ATOM   2535 C  CB  . LYS B 1 26  ? 62.963 -51.404 107.024 1.00 37.79 ? 26   LYS B CB  1 
ATOM   2536 C  CG  . LYS B 1 26  ? 62.643 -52.852 106.681 1.00 38.90 ? 26   LYS B CG  1 
ATOM   2537 C  CD  . LYS B 1 26  ? 63.837 -53.765 106.910 1.00 39.53 ? 26   LYS B CD  1 
ATOM   2538 C  CE  . LYS B 1 26  ? 63.532 -55.181 106.450 1.00 40.41 ? 26   LYS B CE  1 
ATOM   2539 N  NZ  . LYS B 1 26  ? 64.285 -56.190 107.243 1.00 41.61 ? 26   LYS B NZ  1 
ATOM   2540 N  N   . ASN B 1 27  ? 59.561 -51.322 107.186 1.00 35.20 ? 27   ASN B N   1 
ATOM   2541 C  CA  . ASN B 1 27  ? 58.370 -51.653 107.949 1.00 35.12 ? 27   ASN B CA  1 
ATOM   2542 C  C   . ASN B 1 27  ? 58.424 -53.046 108.558 1.00 36.12 ? 27   ASN B C   1 
ATOM   2543 O  O   . ASN B 1 27  ? 59.218 -53.893 108.141 1.00 34.28 ? 27   ASN B O   1 
ATOM   2544 C  CB  . ASN B 1 27  ? 57.124 -51.540 107.063 1.00 35.83 ? 27   ASN B CB  1 
ATOM   2545 C  CG  . ASN B 1 27  ? 56.812 -50.110 106.667 1.00 36.52 ? 27   ASN B CG  1 
ATOM   2546 O  OD1 . ASN B 1 27  ? 57.215 -49.161 107.339 1.00 37.14 ? 27   ASN B OD1 1 
ATOM   2547 N  ND2 . ASN B 1 27  ? 56.080 -49.948 105.573 1.00 36.96 ? 27   ASN B ND2 1 
ATOM   2548 N  N   . VAL B 1 28  ? 57.576 -53.253 109.562 1.00 35.75 ? 28   VAL B N   1 
ATOM   2549 C  CA  . VAL B 1 28  ? 57.254 -54.572 110.082 1.00 37.74 ? 28   VAL B CA  1 
ATOM   2550 C  C   . VAL B 1 28  ? 55.781 -54.799 109.766 1.00 39.12 ? 28   VAL B C   1 
ATOM   2551 O  O   . VAL B 1 28  ? 54.934 -53.993 110.147 1.00 39.69 ? 28   VAL B O   1 
ATOM   2552 C  CB  . VAL B 1 28  ? 57.479 -54.658 111.605 1.00 37.31 ? 28   VAL B CB  1 
ATOM   2553 C  CG1 . VAL B 1 28  ? 57.105 -56.040 112.130 1.00 37.77 ? 28   VAL B CG1 1 
ATOM   2554 C  CG2 . VAL B 1 28  ? 58.924 -54.326 111.944 1.00 37.39 ? 28   VAL B CG2 1 
ATOM   2555 N  N   . GLN B 1 29  ? 55.483 -55.890 109.067 1.00 41.15 ? 29   GLN B N   1 
ATOM   2556 C  CA  . GLN B 1 29  ? 54.128 -56.176 108.603 1.00 43.03 ? 29   GLN B CA  1 
ATOM   2557 C  C   . GLN B 1 29  ? 53.446 -57.203 109.507 1.00 42.18 ? 29   GLN B C   1 
ATOM   2558 O  O   . GLN B 1 29  ? 53.437 -58.400 109.217 1.00 43.05 ? 29   GLN B O   1 
ATOM   2559 C  CB  . GLN B 1 29  ? 54.173 -56.669 107.146 1.00 45.58 ? 29   GLN B CB  1 
ATOM   2560 C  CG  . GLN B 1 29  ? 52.822 -56.979 106.507 1.00 47.75 ? 29   GLN B CG  1 
ATOM   2561 C  CD  . GLN B 1 29  ? 51.923 -55.764 106.352 1.00 49.50 ? 29   GLN B CD  1 
ATOM   2562 O  OE1 . GLN B 1 29  ? 52.364 -54.620 106.484 1.00 52.13 ? 29   GLN B OE1 1 
ATOM   2563 N  NE2 . GLN B 1 29  ? 50.650 -56.010 106.068 1.00 49.99 ? 29   GLN B NE2 1 
ATOM   2564 N  N   . LEU B 1 30  ? 52.889 -56.728 110.616 1.00 40.82 ? 30   LEU B N   1 
ATOM   2565 C  CA  . LEU B 1 30  ? 52.071 -57.573 111.476 1.00 39.67 ? 30   LEU B CA  1 
ATOM   2566 C  C   . LEU B 1 30  ? 50.736 -57.810 110.780 1.00 40.24 ? 30   LEU B C   1 
ATOM   2567 O  O   . LEU B 1 30  ? 50.364 -57.067 109.870 1.00 38.95 ? 30   LEU B O   1 
ATOM   2568 C  CB  . LEU B 1 30  ? 51.850 -56.917 112.845 1.00 38.62 ? 30   LEU B CB  1 
ATOM   2569 C  CG  . LEU B 1 30  ? 53.093 -56.637 113.698 1.00 37.70 ? 30   LEU B CG  1 
ATOM   2570 C  CD1 . LEU B 1 30  ? 52.731 -55.786 114.906 1.00 37.26 ? 30   LEU B CD1 1 
ATOM   2571 C  CD2 . LEU B 1 30  ? 53.753 -57.933 114.145 1.00 37.20 ? 30   LEU B CD2 1 
ATOM   2572 N  N   . GLN B 1 31  ? 50.026 -58.850 111.200 1.00 40.84 ? 31   GLN B N   1 
ATOM   2573 C  CA  . GLN B 1 31  ? 48.718 -59.164 110.631 1.00 43.05 ? 31   GLN B CA  1 
ATOM   2574 C  C   . GLN B 1 31  ? 47.642 -58.359 111.340 1.00 42.41 ? 31   GLN B C   1 
ATOM   2575 O  O   . GLN B 1 31  ? 47.793 -58.006 112.514 1.00 41.04 ? 31   GLN B O   1 
ATOM   2576 C  CB  . GLN B 1 31  ? 48.433 -60.659 110.746 1.00 45.91 ? 31   GLN B CB  1 
ATOM   2577 C  CG  . GLN B 1 31  ? 49.445 -61.514 110.002 1.00 48.18 ? 31   GLN B CG  1 
ATOM   2578 C  CD  . GLN B 1 31  ? 49.178 -63.000 110.134 1.00 51.43 ? 31   GLN B CD  1 
ATOM   2579 O  OE1 . GLN B 1 31  ? 49.090 -63.715 109.134 1.00 56.04 ? 31   GLN B OE1 1 
ATOM   2580 N  NE2 . GLN B 1 31  ? 49.052 -63.477 111.370 1.00 51.64 ? 31   GLN B NE2 1 
ATOM   2581 N  N   . GLU B 1 32  ? 46.560 -58.070 110.622 1.00 41.36 ? 32   GLU B N   1 
ATOM   2582 C  CA  . GLU B 1 32  ? 45.488 -57.224 111.141 1.00 42.00 ? 32   GLU B CA  1 
ATOM   2583 C  C   . GLU B 1 32  ? 44.912 -57.763 112.446 1.00 41.49 ? 32   GLU B C   1 
ATOM   2584 O  O   . GLU B 1 32  ? 44.695 -57.000 113.387 1.00 40.01 ? 32   GLU B O   1 
ATOM   2585 C  CB  . GLU B 1 32  ? 44.371 -57.075 110.109 1.00 43.31 ? 32   GLU B CB  1 
ATOM   2586 C  CG  . GLU B 1 32  ? 43.259 -56.127 110.533 1.00 44.36 ? 32   GLU B CG  1 
ATOM   2587 C  CD  . GLU B 1 32  ? 42.187 -55.955 109.475 1.00 45.54 ? 32   GLU B CD  1 
ATOM   2588 O  OE1 . GLU B 1 32  ? 42.319 -56.543 108.384 1.00 46.17 ? 32   GLU B OE1 1 
ATOM   2589 O  OE2 . GLU B 1 32  ? 41.212 -55.218 109.732 1.00 48.04 ? 32   GLU B OE2 1 
ATOM   2590 N  N   . ASN B 1 33  ? 44.659 -59.071 112.493 1.00 41.21 ? 33   ASN B N   1 
ATOM   2591 C  CA  . ASN B 1 33  ? 44.136 -59.718 113.701 1.00 41.16 ? 33   ASN B CA  1 
ATOM   2592 C  C   . ASN B 1 33  ? 45.056 -59.550 114.917 1.00 40.13 ? 33   ASN B C   1 
ATOM   2593 O  O   . ASN B 1 33  ? 44.577 -59.428 116.045 1.00 40.08 ? 33   ASN B O   1 
ATOM   2594 C  CB  . ASN B 1 33  ? 43.852 -61.205 113.450 1.00 41.41 ? 33   ASN B CB  1 
ATOM   2595 C  CG  . ASN B 1 33  ? 45.114 -62.007 113.169 1.00 42.54 ? 33   ASN B CG  1 
ATOM   2596 O  OD1 . ASN B 1 33  ? 45.746 -61.845 112.123 1.00 42.92 ? 33   ASN B OD1 1 
ATOM   2597 N  ND2 . ASN B 1 33  ? 45.483 -62.884 114.100 1.00 43.01 ? 33   ASN B ND2 1 
ATOM   2598 N  N   . GLU B 1 34  ? 46.369 -59.536 114.679 1.00 40.02 ? 34   GLU B N   1 
ATOM   2599 C  CA  . GLU B 1 34  ? 47.352 -59.355 115.752 1.00 39.98 ? 34   GLU B CA  1 
ATOM   2600 C  C   . GLU B 1 34  ? 47.329 -57.934 116.310 1.00 38.04 ? 34   GLU B C   1 
ATOM   2601 O  O   . GLU B 1 34  ? 47.353 -57.744 117.528 1.00 38.31 ? 34   GLU B O   1 
ATOM   2602 C  CB  . GLU B 1 34  ? 48.760 -59.687 115.261 1.00 41.17 ? 34   GLU B CB  1 
ATOM   2603 C  CG  . GLU B 1 34  ? 48.941 -61.137 114.838 1.00 42.86 ? 34   GLU B CG  1 
ATOM   2604 C  CD  . GLU B 1 34  ? 50.327 -61.421 114.295 1.00 43.82 ? 34   GLU B CD  1 
ATOM   2605 O  OE1 . GLU B 1 34  ? 50.799 -60.668 113.414 1.00 43.76 ? 34   GLU B OE1 1 
ATOM   2606 O  OE2 . GLU B 1 34  ? 50.948 -62.406 114.748 1.00 45.74 ? 34   GLU B OE2 1 
ATOM   2607 N  N   . ILE B 1 35  ? 47.285 -56.946 115.418 1.00 36.12 ? 35   ILE B N   1 
ATOM   2608 C  CA  . ILE B 1 35  ? 47.243 -55.535 115.826 1.00 35.36 ? 35   ILE B CA  1 
ATOM   2609 C  C   . ILE B 1 35  ? 45.931 -55.238 116.551 1.00 34.47 ? 35   ILE B C   1 
ATOM   2610 O  O   . ILE B 1 35  ? 45.908 -54.483 117.524 1.00 33.52 ? 35   ILE B O   1 
ATOM   2611 C  CB  . ILE B 1 35  ? 47.420 -54.572 114.626 1.00 34.63 ? 35   ILE B CB  1 
ATOM   2612 C  CG1 . ILE B 1 35  ? 48.784 -54.790 113.963 1.00 33.96 ? 35   ILE B CG1 1 
ATOM   2613 C  CG2 . ILE B 1 35  ? 47.309 -53.116 115.075 1.00 34.08 ? 35   ILE B CG2 1 
ATOM   2614 C  CD1 . ILE B 1 35  ? 49.003 -53.963 112.715 1.00 34.08 ? 35   ILE B CD1 1 
ATOM   2615 N  N   . ARG B 1 36  ? 44.844 -55.829 116.069 1.00 35.18 ? 36   ARG B N   1 
ATOM   2616 C  CA  . ARG B 1 36  ? 43.553 -55.744 116.747 1.00 35.86 ? 36   ARG B CA  1 
ATOM   2617 C  C   . ARG B 1 36  ? 43.637 -56.384 118.136 1.00 34.85 ? 36   ARG B C   1 
ATOM   2618 O  O   . ARG B 1 36  ? 43.111 -55.842 119.107 1.00 34.38 ? 36   ARG B O   1 
ATOM   2619 C  CB  . ARG B 1 36  ? 42.472 -56.423 115.906 1.00 39.04 ? 36   ARG B CB  1 
ATOM   2620 C  CG  . ARG B 1 36  ? 41.047 -56.124 116.333 1.00 41.56 ? 36   ARG B CG  1 
ATOM   2621 C  CD  . ARG B 1 36  ? 40.074 -56.705 115.311 1.00 44.67 ? 36   ARG B CD  1 
ATOM   2622 N  NE  . ARG B 1 36  ? 40.133 -58.168 115.260 1.00 47.53 ? 36   ARG B NE  1 
ATOM   2623 C  CZ  . ARG B 1 36  ? 39.479 -58.994 116.080 1.00 48.95 ? 36   ARG B CZ  1 
ATOM   2624 N  NH1 . ARG B 1 36  ? 38.691 -58.526 117.046 1.00 50.72 ? 36   ARG B NH1 1 
ATOM   2625 N  NH2 . ARG B 1 36  ? 39.617 -60.308 115.932 1.00 50.22 ? 36   ARG B NH2 1 
ATOM   2626 N  N   . GLY B 1 37  ? 44.303 -57.534 118.223 1.00 34.08 ? 37   GLY B N   1 
ATOM   2627 C  CA  . GLY B 1 37  ? 44.540 -58.205 119.502 1.00 33.82 ? 37   GLY B CA  1 
ATOM   2628 C  C   . GLY B 1 37  ? 45.287 -57.343 120.513 1.00 33.11 ? 37   GLY B C   1 
ATOM   2629 O  O   . GLY B 1 37  ? 44.926 -57.310 121.689 1.00 33.88 ? 37   GLY B O   1 
ATOM   2630 N  N   . LEU B 1 38  ? 46.328 -56.650 120.054 1.00 32.17 ? 38   LEU B N   1 
ATOM   2631 C  CA  . LEU B 1 38  ? 47.084 -55.724 120.905 1.00 31.80 ? 38   LEU B CA  1 
ATOM   2632 C  C   . LEU B 1 38  ? 46.191 -54.610 121.465 1.00 31.36 ? 38   LEU B C   1 
ATOM   2633 O  O   . LEU B 1 38  ? 46.299 -54.248 122.639 1.00 30.24 ? 38   LEU B O   1 
ATOM   2634 C  CB  . LEU B 1 38  ? 48.252 -55.103 120.134 1.00 31.73 ? 38   LEU B CB  1 
ATOM   2635 C  CG  . LEU B 1 38  ? 49.397 -56.006 119.675 1.00 31.76 ? 38   LEU B CG  1 
ATOM   2636 C  CD1 . LEU B 1 38  ? 50.314 -55.244 118.726 1.00 31.24 ? 38   LEU B CD1 1 
ATOM   2637 C  CD2 . LEU B 1 38  ? 50.192 -56.562 120.849 1.00 32.08 ? 38   LEU B CD2 1 
ATOM   2638 N  N   . CYS B 1 39  ? 45.314 -54.071 120.620 1.00 31.22 ? 39   CYS B N   1 
ATOM   2639 C  CA  . CYS B 1 39  ? 44.401 -53.011 121.034 1.00 31.25 ? 39   CYS B CA  1 
ATOM   2640 C  C   . CYS B 1 39  ? 43.399 -53.479 122.084 1.00 31.45 ? 39   CYS B C   1 
ATOM   2641 O  O   . CYS B 1 39  ? 43.166 -52.784 123.065 1.00 29.39 ? 39   CYS B O   1 
ATOM   2642 C  CB  . CYS B 1 39  ? 43.635 -52.451 119.834 1.00 31.60 ? 39   CYS B CB  1 
ATOM   2643 S  SG  . CYS B 1 39  ? 44.634 -51.471 118.695 1.00 31.54 ? 39   CYS B SG  1 
ATOM   2644 N  N   . LEU B 1 40  ? 42.808 -54.650 121.870 1.00 32.83 ? 40   LEU B N   1 
ATOM   2645 C  CA  . LEU B 1 40  ? 41.748 -55.147 122.751 1.00 34.26 ? 40   LEU B CA  1 
ATOM   2646 C  C   . LEU B 1 40  ? 42.294 -55.557 124.117 1.00 34.20 ? 40   LEU B C   1 
ATOM   2647 O  O   . LEU B 1 40  ? 41.681 -55.270 125.146 1.00 35.04 ? 40   LEU B O   1 
ATOM   2648 C  CB  . LEU B 1 40  ? 41.014 -56.323 122.098 1.00 34.68 ? 40   LEU B CB  1 
ATOM   2649 C  CG  . LEU B 1 40  ? 40.300 -56.007 120.777 1.00 35.72 ? 40   LEU B CG  1 
ATOM   2650 C  CD1 . LEU B 1 40  ? 39.913 -57.291 120.054 1.00 36.28 ? 40   LEU B CD1 1 
ATOM   2651 C  CD2 . LEU B 1 40  ? 39.081 -55.124 121.003 1.00 36.00 ? 40   LEU B CD2 1 
ATOM   2652 N  N   . LYS B 1 41  ? 43.454 -56.207 124.120 1.00 34.98 ? 41   LYS B N   1 
ATOM   2653 C  CA  . LYS B 1 41  ? 44.081 -56.676 125.353 1.00 35.72 ? 41   LYS B CA  1 
ATOM   2654 C  C   . LYS B 1 41  ? 44.675 -55.532 126.181 1.00 34.94 ? 41   LYS B C   1 
ATOM   2655 O  O   . LYS B 1 41  ? 44.508 -55.496 127.400 1.00 33.48 ? 41   LYS B O   1 
ATOM   2656 C  CB  . LYS B 1 41  ? 45.159 -57.722 125.038 1.00 37.27 ? 41   LYS B CB  1 
ATOM   2657 C  CG  . LYS B 1 41  ? 45.842 -58.340 126.255 1.00 38.97 ? 41   LYS B CG  1 
ATOM   2658 C  CD  . LYS B 1 41  ? 44.872 -59.110 127.145 1.00 39.88 ? 41   LYS B CD  1 
ATOM   2659 C  CE  . LYS B 1 41  ? 45.375 -59.206 128.575 1.00 40.45 ? 41   LYS B CE  1 
ATOM   2660 N  NZ  . LYS B 1 41  ? 44.272 -59.512 129.526 1.00 41.44 ? 41   LYS B NZ  1 
ATOM   2661 N  N   . SER B 1 42  ? 45.369 -54.604 125.526 1.00 32.89 ? 42   SER B N   1 
ATOM   2662 C  CA  . SER B 1 42  ? 45.923 -53.445 126.225 1.00 31.44 ? 42   SER B CA  1 
ATOM   2663 C  C   . SER B 1 42  ? 44.805 -52.578 126.808 1.00 31.03 ? 42   SER B C   1 
ATOM   2664 O  O   . SER B 1 42  ? 44.911 -52.086 127.939 1.00 29.89 ? 42   SER B O   1 
ATOM   2665 C  CB  . SER B 1 42  ? 46.813 -52.622 125.293 1.00 31.23 ? 42   SER B CB  1 
ATOM   2666 O  OG  . SER B 1 42  ? 46.075 -52.115 124.199 1.00 30.46 ? 42   SER B OG  1 
ATOM   2667 N  N   . ARG B 1 43  ? 43.727 -52.418 126.042 1.00 30.08 ? 43   ARG B N   1 
ATOM   2668 C  CA  . ARG B 1 43  ? 42.539 -51.702 126.502 1.00 30.08 ? 43   ARG B CA  1 
ATOM   2669 C  C   . ARG B 1 43  ? 42.017 -52.263 127.828 1.00 29.49 ? 43   ARG B C   1 
ATOM   2670 O  O   . ARG B 1 43  ? 41.719 -51.499 128.746 1.00 28.23 ? 43   ARG B O   1 
ATOM   2671 C  CB  . ARG B 1 43  ? 41.442 -51.763 125.437 1.00 30.86 ? 43   ARG B CB  1 
ATOM   2672 C  CG  . ARG B 1 43  ? 40.193 -50.962 125.754 1.00 31.81 ? 43   ARG B CG  1 
ATOM   2673 C  CD  . ARG B 1 43  ? 39.194 -51.065 124.613 1.00 32.04 ? 43   ARG B CD  1 
ATOM   2674 N  NE  . ARG B 1 43  ? 38.055 -50.165 124.775 1.00 31.85 ? 43   ARG B NE  1 
ATOM   2675 C  CZ  . ARG B 1 43  ? 36.984 -50.416 125.529 1.00 32.46 ? 43   ARG B CZ  1 
ATOM   2676 N  NH1 . ARG B 1 43  ? 36.884 -51.540 126.233 1.00 32.49 ? 43   ARG B NH1 1 
ATOM   2677 N  NH2 . ARG B 1 43  ? 36.004 -49.523 125.589 1.00 33.01 ? 43   ARG B NH2 1 
ATOM   2678 N  N   . GLU B 1 44  ? 41.909 -53.589 127.921 1.00 29.74 ? 44   GLU B N   1 
ATOM   2679 C  CA  . GLU B 1 44  ? 41.481 -54.255 129.166 1.00 32.01 ? 44   GLU B CA  1 
ATOM   2680 C  C   . GLU B 1 44  ? 42.390 -53.915 130.345 1.00 30.03 ? 44   GLU B C   1 
ATOM   2681 O  O   . GLU B 1 44  ? 41.920 -53.708 131.460 1.00 30.59 ? 44   GLU B O   1 
ATOM   2682 C  CB  . GLU B 1 44  ? 41.473 -55.779 129.005 1.00 35.39 ? 44   GLU B CB  1 
ATOM   2683 C  CG  . GLU B 1 44  ? 40.264 -56.346 128.286 1.00 38.92 ? 44   GLU B CG  1 
ATOM   2684 C  CD  . GLU B 1 44  ? 40.184 -57.860 128.387 1.00 42.37 ? 44   GLU B CD  1 
ATOM   2685 O  OE1 . GLU B 1 44  ? 41.216 -58.504 128.691 1.00 43.87 ? 44   GLU B OE1 1 
ATOM   2686 O  OE2 . GLU B 1 44  ? 39.082 -58.407 128.171 1.00 45.85 ? 44   GLU B OE2 1 
ATOM   2687 N  N   . ILE B 1 45  ? 43.695 -53.894 130.093 1.00 28.20 ? 45   ILE B N   1 
ATOM   2688 C  CA  . ILE B 1 45  ? 44.684 -53.590 131.129 1.00 27.52 ? 45   ILE B CA  1 
ATOM   2689 C  C   . ILE B 1 45  ? 44.576 -52.130 131.564 1.00 26.62 ? 45   ILE B C   1 
ATOM   2690 O  O   . ILE B 1 45  ? 44.592 -51.839 132.767 1.00 26.22 ? 45   ILE B O   1 
ATOM   2691 C  CB  . ILE B 1 45  ? 46.117 -53.908 130.654 1.00 27.92 ? 45   ILE B CB  1 
ATOM   2692 C  CG1 . ILE B 1 45  ? 46.259 -55.415 130.407 1.00 28.75 ? 45   ILE B CG1 1 
ATOM   2693 C  CG2 . ILE B 1 45  ? 47.145 -53.442 131.680 1.00 27.89 ? 45   ILE B CG2 1 
ATOM   2694 C  CD1 . ILE B 1 45  ? 47.424 -55.788 129.516 1.00 29.80 ? 45   ILE B CD1 1 
ATOM   2695 N  N   . PHE B 1 46  ? 44.447 -51.221 130.598 1.00 25.56 ? 46   PHE B N   1 
ATOM   2696 C  CA  . PHE B 1 46  ? 44.264 -49.797 130.901 1.00 25.40 ? 46   PHE B CA  1 
ATOM   2697 C  C   . PHE B 1 46  ? 43.059 -49.587 131.820 1.00 25.97 ? 46   PHE B C   1 
ATOM   2698 O  O   . PHE B 1 46  ? 43.169 -48.936 132.852 1.00 25.60 ? 46   PHE B O   1 
ATOM   2699 C  CB  . PHE B 1 46  ? 44.106 -48.948 129.628 1.00 24.59 ? 46   PHE B CB  1 
ATOM   2700 C  CG  . PHE B 1 46  ? 45.310 -48.964 128.713 1.00 23.65 ? 46   PHE B CG  1 
ATOM   2701 C  CD1 . PHE B 1 46  ? 46.600 -48.914 129.220 1.00 22.86 ? 46   PHE B CD1 1 
ATOM   2702 C  CD2 . PHE B 1 46  ? 45.142 -48.983 127.329 1.00 23.25 ? 46   PHE B CD2 1 
ATOM   2703 C  CE1 . PHE B 1 46  ? 47.699 -48.925 128.377 1.00 22.85 ? 46   PHE B CE1 1 
ATOM   2704 C  CE2 . PHE B 1 46  ? 46.237 -48.987 126.481 1.00 22.15 ? 46   PHE B CE2 1 
ATOM   2705 C  CZ  . PHE B 1 46  ? 47.516 -48.962 127.007 1.00 22.70 ? 46   PHE B CZ  1 
ATOM   2706 N  N   . LEU B 1 47  ? 41.914 -50.157 131.456 1.00 27.61 ? 47   LEU B N   1 
ATOM   2707 C  CA  . LEU B 1 47  ? 40.711 -50.049 132.298 1.00 27.51 ? 47   LEU B CA  1 
ATOM   2708 C  C   . LEU B 1 47  ? 40.859 -50.731 133.667 1.00 28.37 ? 47   LEU B C   1 
ATOM   2709 O  O   . LEU B 1 47  ? 40.252 -50.294 134.637 1.00 29.74 ? 47   LEU B O   1 
ATOM   2710 C  CB  . LEU B 1 47  ? 39.481 -50.592 131.561 1.00 28.19 ? 47   LEU B CB  1 
ATOM   2711 C  CG  . LEU B 1 47  ? 39.040 -49.780 130.335 1.00 27.73 ? 47   LEU B CG  1 
ATOM   2712 C  CD1 . LEU B 1 47  ? 37.868 -50.446 129.626 1.00 28.43 ? 47   LEU B CD1 1 
ATOM   2713 C  CD2 . LEU B 1 47  ? 38.683 -48.352 130.718 1.00 27.56 ? 47   LEU B CD2 1 
ATOM   2714 N  N   . SER B 1 48  ? 41.659 -51.792 133.753 1.00 28.50 ? 48   SER B N   1 
ATOM   2715 C  CA  . SER B 1 48  ? 41.881 -52.469 135.029 1.00 29.22 ? 48   SER B CA  1 
ATOM   2716 C  C   . SER B 1 48  ? 42.779 -51.671 135.980 1.00 29.19 ? 48   SER B C   1 
ATOM   2717 O  O   . SER B 1 48  ? 42.686 -51.832 137.192 1.00 29.67 ? 48   SER B O   1 
ATOM   2718 C  CB  . SER B 1 48  ? 42.492 -53.852 134.812 1.00 29.28 ? 48   SER B CB  1 
ATOM   2719 O  OG  . SER B 1 48  ? 43.878 -53.754 134.549 1.00 30.33 ? 48   SER B OG  1 
ATOM   2720 N  N   . GLN B 1 49  ? 43.647 -50.821 135.433 1.00 27.74 ? 49   GLN B N   1 
ATOM   2721 C  CA  . GLN B 1 49  ? 44.558 -50.021 136.247 1.00 27.57 ? 49   GLN B CA  1 
ATOM   2722 C  C   . GLN B 1 49  ? 44.001 -48.616 136.443 1.00 27.29 ? 49   GLN B C   1 
ATOM   2723 O  O   . GLN B 1 49  ? 43.162 -48.173 135.658 1.00 27.74 ? 49   GLN B O   1 
ATOM   2724 C  CB  . GLN B 1 49  ? 45.935 -49.964 135.588 1.00 26.98 ? 49   GLN B CB  1 
ATOM   2725 C  CG  . GLN B 1 49  ? 46.608 -51.325 135.493 1.00 27.60 ? 49   GLN B CG  1 
ATOM   2726 C  CD  . GLN B 1 49  ? 47.991 -51.266 134.861 1.00 27.92 ? 49   GLN B CD  1 
ATOM   2727 O  OE1 . GLN B 1 49  ? 48.320 -50.321 134.145 1.00 28.21 ? 49   GLN B OE1 1 
ATOM   2728 N  NE2 . GLN B 1 49  ? 48.805 -52.284 135.119 1.00 27.76 ? 49   GLN B NE2 1 
ATOM   2729 N  N   . PRO B 1 50  ? 44.466 -47.905 137.487 1.00 26.85 ? 50   PRO B N   1 
ATOM   2730 C  CA  . PRO B 1 50  ? 43.937 -46.560 137.743 1.00 27.24 ? 50   PRO B CA  1 
ATOM   2731 C  C   . PRO B 1 50  ? 44.266 -45.527 136.663 1.00 27.79 ? 50   PRO B C   1 
ATOM   2732 O  O   . PRO B 1 50  ? 45.279 -45.639 135.962 1.00 26.84 ? 50   PRO B O   1 
ATOM   2733 C  CB  . PRO B 1 50  ? 44.569 -46.161 139.090 1.00 27.79 ? 50   PRO B CB  1 
ATOM   2734 C  CG  . PRO B 1 50  ? 45.651 -47.144 139.354 1.00 28.06 ? 50   PRO B CG  1 
ATOM   2735 C  CD  . PRO B 1 50  ? 45.357 -48.376 138.561 1.00 27.32 ? 50   PRO B CD  1 
ATOM   2736 N  N   . ILE B 1 51  ? 43.399 -44.525 136.562 1.00 27.35 ? 51   ILE B N   1 
ATOM   2737 C  CA  . ILE B 1 51  ? 43.540 -43.435 135.604 1.00 27.22 ? 51   ILE B CA  1 
ATOM   2738 C  C   . ILE B 1 51  ? 44.601 -42.431 136.059 1.00 26.85 ? 51   ILE B C   1 
ATOM   2739 O  O   . ILE B 1 51  ? 45.156 -41.702 135.247 1.00 25.58 ? 51   ILE B O   1 
ATOM   2740 C  CB  . ILE B 1 51  ? 42.179 -42.725 135.385 1.00 27.29 ? 51   ILE B CB  1 
ATOM   2741 C  CG1 . ILE B 1 51  ? 42.220 -41.843 134.138 1.00 27.18 ? 51   ILE B CG1 1 
ATOM   2742 C  CG2 . ILE B 1 51  ? 41.775 -41.903 136.609 1.00 26.99 ? 51   ILE B CG2 1 
ATOM   2743 C  CD1 . ILE B 1 51  ? 40.856 -41.351 133.703 1.00 27.71 ? 51   ILE B CD1 1 
ATOM   2744 N  N   . LEU B 1 52  ? 44.841 -42.377 137.368 1.00 27.89 ? 52   LEU B N   1 
ATOM   2745 C  CA  . LEU B 1 52  ? 45.949 -41.615 137.939 1.00 27.73 ? 52   LEU B CA  1 
ATOM   2746 C  C   . LEU B 1 52  ? 46.923 -42.623 138.521 1.00 27.88 ? 52   LEU B C   1 
ATOM   2747 O  O   . LEU B 1 52  ? 46.693 -43.160 139.603 1.00 28.77 ? 52   LEU B O   1 
ATOM   2748 C  CB  . LEU B 1 52  ? 45.456 -40.649 139.021 1.00 28.01 ? 52   LEU B CB  1 
ATOM   2749 C  CG  . LEU B 1 52  ? 46.522 -39.896 139.830 1.00 28.86 ? 52   LEU B CG  1 
ATOM   2750 C  CD1 . LEU B 1 52  ? 47.422 -39.048 138.941 1.00 29.55 ? 52   LEU B CD1 1 
ATOM   2751 C  CD2 . LEU B 1 52  ? 45.869 -39.029 140.896 1.00 28.87 ? 52   LEU B CD2 1 
ATOM   2752 N  N   . LEU B 1 53  ? 48.001 -42.893 137.794 1.00 27.17 ? 53   LEU B N   1 
ATOM   2753 C  CA  . LEU B 1 53  ? 48.938 -43.944 138.174 1.00 27.54 ? 53   LEU B CA  1 
ATOM   2754 C  C   . LEU B 1 53  ? 49.807 -43.519 139.356 1.00 27.54 ? 53   LEU B C   1 
ATOM   2755 O  O   . LEU B 1 53  ? 50.220 -42.364 139.462 1.00 28.17 ? 53   LEU B O   1 
ATOM   2756 C  CB  . LEU B 1 53  ? 49.821 -44.345 136.985 1.00 28.19 ? 53   LEU B CB  1 
ATOM   2757 C  CG  . LEU B 1 53  ? 49.106 -44.904 135.748 1.00 28.66 ? 53   LEU B CG  1 
ATOM   2758 C  CD1 . LEU B 1 53  ? 50.062 -44.957 134.565 1.00 28.73 ? 53   LEU B CD1 1 
ATOM   2759 C  CD2 . LEU B 1 53  ? 48.512 -46.281 136.013 1.00 28.72 ? 53   LEU B CD2 1 
ATOM   2760 N  N   . GLU B 1 54  ? 50.055 -44.461 140.257 1.00 28.06 ? 54   GLU B N   1 
ATOM   2761 C  CA  . GLU B 1 54  ? 50.960 -44.243 141.373 1.00 28.87 ? 54   GLU B CA  1 
ATOM   2762 C  C   . GLU B 1 54  ? 52.130 -45.195 141.199 1.00 28.50 ? 54   GLU B C   1 
ATOM   2763 O  O   . GLU B 1 54  ? 51.978 -46.402 141.365 1.00 28.13 ? 54   GLU B O   1 
ATOM   2764 C  CB  . GLU B 1 54  ? 50.239 -44.467 142.702 1.00 30.15 ? 54   GLU B CB  1 
ATOM   2765 C  CG  . GLU B 1 54  ? 49.076 -43.506 142.913 1.00 31.08 ? 54   GLU B CG  1 
ATOM   2766 C  CD  . GLU B 1 54  ? 48.475 -43.584 144.300 1.00 33.09 ? 54   GLU B CD  1 
ATOM   2767 O  OE1 . GLU B 1 54  ? 49.238 -43.589 145.290 1.00 33.20 ? 54   GLU B OE1 1 
ATOM   2768 O  OE2 . GLU B 1 54  ? 47.228 -43.618 144.409 1.00 35.57 ? 54   GLU B OE2 1 
ATOM   2769 N  N   . LEU B 1 55  ? 53.288 -44.639 140.836 1.00 28.50 ? 55   LEU B N   1 
ATOM   2770 C  CA  . LEU B 1 55  ? 54.456 -45.432 140.456 1.00 28.41 ? 55   LEU B CA  1 
ATOM   2771 C  C   . LEU B 1 55  ? 55.646 -45.195 141.383 1.00 30.70 ? 55   LEU B C   1 
ATOM   2772 O  O   . LEU B 1 55  ? 55.736 -44.164 142.062 1.00 31.05 ? 55   LEU B O   1 
ATOM   2773 C  CB  . LEU B 1 55  ? 54.869 -45.116 139.013 1.00 26.83 ? 55   LEU B CB  1 
ATOM   2774 C  CG  . LEU B 1 55  ? 53.801 -45.281 137.919 1.00 25.41 ? 55   LEU B CG  1 
ATOM   2775 C  CD1 . LEU B 1 55  ? 54.330 -44.786 136.579 1.00 25.15 ? 55   LEU B CD1 1 
ATOM   2776 C  CD2 . LEU B 1 55  ? 53.336 -46.724 137.814 1.00 24.88 ? 55   LEU B CD2 1 
ATOM   2777 N  N   . GLU B 1 56  ? 56.558 -46.162 141.381 1.00 32.78 ? 56   GLU B N   1 
ATOM   2778 C  CA  . GLU B 1 56  ? 57.746 -46.144 142.234 1.00 35.62 ? 56   GLU B CA  1 
ATOM   2779 C  C   . GLU B 1 56  ? 59.012 -46.281 141.389 1.00 35.08 ? 56   GLU B C   1 
ATOM   2780 O  O   . GLU B 1 56  ? 59.047 -47.065 140.440 1.00 35.69 ? 56   GLU B O   1 
ATOM   2781 C  CB  . GLU B 1 56  ? 57.670 -47.283 143.257 1.00 37.33 ? 56   GLU B CB  1 
ATOM   2782 C  CG  . GLU B 1 56  ? 56.412 -47.262 144.120 1.00 39.65 ? 56   GLU B CG  1 
ATOM   2783 C  CD  . GLU B 1 56  ? 56.231 -48.525 144.946 1.00 42.55 ? 56   GLU B CD  1 
ATOM   2784 O  OE1 . GLU B 1 56  ? 57.246 -49.125 145.369 1.00 43.64 ? 56   GLU B OE1 1 
ATOM   2785 O  OE2 . GLU B 1 56  ? 55.065 -48.922 145.175 1.00 44.59 ? 56   GLU B OE2 1 
ATOM   2786 N  N   . ALA B 1 57  ? 60.039 -45.504 141.733 1.00 35.51 ? 57   ALA B N   1 
ATOM   2787 C  CA  . ALA B 1 57  ? 61.363 -45.602 141.106 1.00 35.14 ? 57   ALA B CA  1 
ATOM   2788 C  C   . ALA B 1 57  ? 62.020 -46.935 141.487 1.00 34.56 ? 57   ALA B C   1 
ATOM   2789 O  O   . ALA B 1 57  ? 61.667 -47.501 142.522 1.00 33.83 ? 57   ALA B O   1 
ATOM   2790 C  CB  . ALA B 1 57  ? 62.228 -44.440 141.564 1.00 36.24 ? 57   ALA B CB  1 
ATOM   2791 N  N   . PRO B 1 58  ? 62.968 -47.449 140.698 1.00 33.18 ? 58   PRO B N   1 
ATOM   2792 C  CA  . PRO B 1 58  ? 63.547 -46.808 139.511 1.00 33.36 ? 58   PRO B CA  1 
ATOM   2793 C  C   . PRO B 1 58  ? 62.643 -46.799 138.270 1.00 31.66 ? 58   PRO B C   1 
ATOM   2794 O  O   . PRO B 1 58  ? 61.871 -47.733 138.062 1.00 30.73 ? 58   PRO B O   1 
ATOM   2795 C  CB  . PRO B 1 58  ? 64.782 -47.667 139.236 1.00 33.24 ? 58   PRO B CB  1 
ATOM   2796 C  CG  . PRO B 1 58  ? 64.389 -49.021 139.707 1.00 33.58 ? 58   PRO B CG  1 
ATOM   2797 C  CD  . PRO B 1 58  ? 63.536 -48.790 140.927 1.00 33.80 ? 58   PRO B CD  1 
ATOM   2798 N  N   . LEU B 1 59  ? 62.762 -45.752 137.454 1.00 32.13 ? 59   LEU B N   1 
ATOM   2799 C  CA  . LEU B 1 59  ? 61.888 -45.559 136.290 1.00 32.04 ? 59   LEU B CA  1 
ATOM   2800 C  C   . LEU B 1 59  ? 62.564 -44.678 135.227 1.00 31.40 ? 59   LEU B C   1 
ATOM   2801 O  O   . LEU B 1 59  ? 63.282 -43.732 135.562 1.00 32.93 ? 59   LEU B O   1 
ATOM   2802 C  CB  . LEU B 1 59  ? 60.571 -44.917 136.756 1.00 32.55 ? 59   LEU B CB  1 
ATOM   2803 C  CG  . LEU B 1 59  ? 59.386 -44.771 135.796 1.00 32.04 ? 59   LEU B CG  1 
ATOM   2804 C  CD1 . LEU B 1 59  ? 58.846 -46.126 135.364 1.00 33.02 ? 59   LEU B CD1 1 
ATOM   2805 C  CD2 . LEU B 1 59  ? 58.278 -43.972 136.463 1.00 32.46 ? 59   LEU B CD2 1 
ATOM   2806 N  N   . LYS B 1 60  ? 62.336 -45.002 133.953 1.00 29.17 ? 60   LYS B N   1 
ATOM   2807 C  CA  . LYS B 1 60  ? 62.763 -44.163 132.831 1.00 28.30 ? 60   LYS B CA  1 
ATOM   2808 C  C   . LYS B 1 60  ? 61.538 -43.456 132.251 1.00 27.30 ? 60   LYS B C   1 
ATOM   2809 O  O   . LYS B 1 60  ? 60.548 -44.114 131.922 1.00 26.58 ? 60   LYS B O   1 
ATOM   2810 C  CB  . LYS B 1 60  ? 63.394 -45.010 131.723 1.00 28.49 ? 60   LYS B CB  1 
ATOM   2811 C  CG  . LYS B 1 60  ? 64.571 -45.871 132.142 1.00 30.09 ? 60   LYS B CG  1 
ATOM   2812 C  CD  . LYS B 1 60  ? 65.855 -45.077 132.240 1.00 30.43 ? 60   LYS B CD  1 
ATOM   2813 C  CE  . LYS B 1 60  ? 67.032 -45.996 132.501 1.00 30.53 ? 60   LYS B CE  1 
ATOM   2814 N  NZ  . LYS B 1 60  ? 68.298 -45.226 132.586 1.00 30.90 ? 60   LYS B NZ  1 
ATOM   2815 N  N   . ILE B 1 61  ? 61.607 -42.132 132.121 1.00 25.47 ? 61   ILE B N   1 
ATOM   2816 C  CA  . ILE B 1 61  ? 60.495 -41.343 131.594 1.00 23.85 ? 61   ILE B CA  1 
ATOM   2817 C  C   . ILE B 1 61  ? 60.850 -40.716 130.241 1.00 22.87 ? 61   ILE B C   1 
ATOM   2818 O  O   . ILE B 1 61  ? 61.922 -40.131 130.075 1.00 22.55 ? 61   ILE B O   1 
ATOM   2819 C  CB  . ILE B 1 61  ? 60.043 -40.253 132.589 1.00 24.17 ? 61   ILE B CB  1 
ATOM   2820 C  CG1 . ILE B 1 61  ? 59.756 -40.873 133.964 1.00 23.80 ? 61   ILE B CG1 1 
ATOM   2821 C  CG2 . ILE B 1 61  ? 58.797 -39.546 132.075 1.00 25.06 ? 61   ILE B CG2 1 
ATOM   2822 C  CD1 . ILE B 1 61  ? 59.472 -39.868 135.061 1.00 24.01 ? 61   ILE B CD1 1 
ATOM   2823 N  N   . CYS B 1 62  ? 59.930 -40.855 129.288 1.00 21.12 ? 62   CYS B N   1 
ATOM   2824 C  CA  . CYS B 1 62  ? 60.112 -40.407 127.911 1.00 20.68 ? 62   CYS B CA  1 
ATOM   2825 C  C   . CYS B 1 62  ? 58.949 -39.522 127.471 1.00 19.66 ? 62   CYS B C   1 
ATOM   2826 O  O   . CYS B 1 62  ? 57.803 -39.758 127.858 1.00 18.34 ? 62   CYS B O   1 
ATOM   2827 C  CB  . CYS B 1 62  ? 60.193 -41.616 126.968 1.00 21.39 ? 62   CYS B CB  1 
ATOM   2828 S  SG  . CYS B 1 62  ? 61.599 -42.730 127.227 1.00 23.63 ? 62   CYS B SG  1 
ATOM   2829 N  N   . GLY B 1 63  ? 59.255 -38.511 126.659 1.00 20.13 ? 63   GLY B N   1 
ATOM   2830 C  CA  . GLY B 1 63  ? 58.248 -37.642 126.035 1.00 20.01 ? 63   GLY B CA  1 
ATOM   2831 C  C   . GLY B 1 63  ? 57.866 -38.064 124.624 1.00 20.07 ? 63   GLY B C   1 
ATOM   2832 O  O   . GLY B 1 63  ? 57.937 -39.241 124.281 1.00 19.78 ? 63   GLY B O   1 
ATOM   2833 N  N   . ASP B 1 64  ? 57.469 -37.096 123.800 1.00 20.68 ? 64   ASP B N   1 
ATOM   2834 C  CA  . ASP B 1 64  ? 56.858 -37.371 122.484 1.00 21.05 ? 64   ASP B CA  1 
ATOM   2835 C  C   . ASP B 1 64  ? 57.734 -38.234 121.575 1.00 21.09 ? 64   ASP B C   1 
ATOM   2836 O  O   . ASP B 1 64  ? 58.957 -38.039 121.505 1.00 20.36 ? 64   ASP B O   1 
ATOM   2837 C  CB  . ASP B 1 64  ? 56.573 -36.069 121.726 1.00 21.92 ? 64   ASP B CB  1 
ATOM   2838 C  CG  . ASP B 1 64  ? 55.655 -35.129 122.467 1.00 22.33 ? 64   ASP B CG  1 
ATOM   2839 O  OD1 . ASP B 1 64  ? 55.615 -35.159 123.722 1.00 24.04 ? 64   ASP B OD1 1 
ATOM   2840 O  OD2 . ASP B 1 64  ? 54.996 -34.320 121.777 1.00 22.77 ? 64   ASP B OD2 1 
ATOM   2841 N  N   . ILE B 1 65  ? 57.096 -39.181 120.891 1.00 20.32 ? 65   ILE B N   1 
ATOM   2842 C  CA  . ILE B 1 65  ? 57.757 -40.072 119.931 1.00 21.57 ? 65   ILE B CA  1 
ATOM   2843 C  C   . ILE B 1 65  ? 57.288 -39.793 118.500 1.00 20.39 ? 65   ILE B C   1 
ATOM   2844 O  O   . ILE B 1 65  ? 58.096 -39.774 117.565 1.00 20.33 ? 65   ILE B O   1 
ATOM   2845 C  CB  . ILE B 1 65  ? 57.480 -41.565 120.255 1.00 22.57 ? 65   ILE B CB  1 
ATOM   2846 C  CG1 . ILE B 1 65  ? 57.872 -41.902 121.701 1.00 23.52 ? 65   ILE B CG1 1 
ATOM   2847 C  CG2 . ILE B 1 65  ? 58.213 -42.478 119.281 1.00 23.42 ? 65   ILE B CG2 1 
ATOM   2848 C  CD1 . ILE B 1 65  ? 59.326 -41.662 122.054 1.00 24.12 ? 65   ILE B CD1 1 
ATOM   2849 N  N   . HIS B 1 66  ? 55.980 -39.616 118.320 1.00 19.61 ? 66   HIS B N   1 
ATOM   2850 C  CA  . HIS B 1 66  ? 55.402 -39.246 117.013 1.00 19.76 ? 66   HIS B CA  1 
ATOM   2851 C  C   . HIS B 1 66  ? 55.841 -40.123 115.832 1.00 20.32 ? 66   HIS B C   1 
ATOM   2852 O  O   . HIS B 1 66  ? 56.365 -39.635 114.820 1.00 20.51 ? 66   HIS B O   1 
ATOM   2853 C  CB  . HIS B 1 66  ? 55.671 -37.766 116.717 1.00 19.70 ? 66   HIS B CB  1 
ATOM   2854 C  CG  . HIS B 1 66  ? 54.737 -36.840 117.429 1.00 19.77 ? 66   HIS B CG  1 
ATOM   2855 N  ND1 . HIS B 1 66  ? 53.372 -36.927 117.293 1.00 19.83 ? 66   HIS B ND1 1 
ATOM   2856 C  CD2 . HIS B 1 66  ? 54.967 -35.819 118.286 1.00 20.45 ? 66   HIS B CD2 1 
ATOM   2857 C  CE1 . HIS B 1 66  ? 52.797 -35.996 118.030 1.00 20.04 ? 66   HIS B CE1 1 
ATOM   2858 N  NE2 . HIS B 1 66  ? 53.744 -35.317 118.649 1.00 20.52 ? 66   HIS B NE2 1 
ATOM   2859 N  N   . GLY B 1 67  ? 55.614 -41.421 115.971 1.00 20.62 ? 67   GLY B N   1 
ATOM   2860 C  CA  . GLY B 1 67  ? 55.852 -42.374 114.899 1.00 20.54 ? 67   GLY B CA  1 
ATOM   2861 C  C   . GLY B 1 67  ? 57.275 -42.490 114.376 1.00 20.72 ? 67   GLY B C   1 
ATOM   2862 O  O   . GLY B 1 67  ? 57.485 -43.035 113.297 1.00 21.33 ? 67   GLY B O   1 
ATOM   2863 N  N   . GLN B 1 68  ? 58.250 -41.982 115.121 1.00 20.61 ? 68   GLN B N   1 
ATOM   2864 C  CA  . GLN B 1 68  ? 59.648 -42.134 114.748 1.00 20.40 ? 68   GLN B CA  1 
ATOM   2865 C  C   . GLN B 1 68  ? 60.152 -43.436 115.352 1.00 20.68 ? 68   GLN B C   1 
ATOM   2866 O  O   . GLN B 1 68  ? 60.864 -43.444 116.361 1.00 20.45 ? 68   GLN B O   1 
ATOM   2867 C  CB  . GLN B 1 68  ? 60.457 -40.926 115.215 1.00 21.13 ? 68   GLN B CB  1 
ATOM   2868 C  CG  . GLN B 1 68  ? 60.055 -39.664 114.472 1.00 21.38 ? 68   GLN B CG  1 
ATOM   2869 C  CD  . GLN B 1 68  ? 60.838 -38.430 114.873 1.00 21.45 ? 68   GLN B CD  1 
ATOM   2870 O  OE1 . GLN B 1 68  ? 60.361 -37.309 114.693 1.00 22.21 ? 68   GLN B OE1 1 
ATOM   2871 N  NE2 . GLN B 1 68  ? 62.043 -38.620 115.393 1.00 21.82 ? 68   GLN B NE2 1 
ATOM   2872 N  N   . TYR B 1 69  ? 59.758 -44.536 114.715 1.00 20.27 ? 69   TYR B N   1 
ATOM   2873 C  CA  . TYR B 1 69  ? 59.945 -45.873 115.268 1.00 21.34 ? 69   TYR B CA  1 
ATOM   2874 C  C   . TYR B 1 69  ? 61.403 -46.197 115.567 1.00 22.20 ? 69   TYR B C   1 
ATOM   2875 O  O   . TYR B 1 69  ? 61.711 -46.806 116.593 1.00 22.32 ? 69   TYR B O   1 
ATOM   2876 C  CB  . TYR B 1 69  ? 59.366 -46.938 114.325 1.00 20.41 ? 69   TYR B CB  1 
ATOM   2877 C  CG  . TYR B 1 69  ? 59.445 -48.351 114.882 1.00 20.91 ? 69   TYR B CG  1 
ATOM   2878 C  CD1 . TYR B 1 69  ? 58.887 -48.660 116.114 1.00 21.00 ? 69   TYR B CD1 1 
ATOM   2879 C  CD2 . TYR B 1 69  ? 60.075 -49.373 114.175 1.00 21.56 ? 69   TYR B CD2 1 
ATOM   2880 C  CE1 . TYR B 1 69  ? 58.952 -49.940 116.631 1.00 21.22 ? 69   TYR B CE1 1 
ATOM   2881 C  CE2 . TYR B 1 69  ? 60.136 -50.661 114.683 1.00 21.65 ? 69   TYR B CE2 1 
ATOM   2882 C  CZ  . TYR B 1 69  ? 59.578 -50.934 115.916 1.00 21.08 ? 69   TYR B CZ  1 
ATOM   2883 O  OH  . TYR B 1 69  ? 59.640 -52.203 116.438 1.00 22.05 ? 69   TYR B OH  1 
ATOM   2884 N  N   . TYR B 1 70  ? 62.303 -45.792 114.683 1.00 23.59 ? 70   TYR B N   1 
ATOM   2885 C  CA  . TYR B 1 70  ? 63.709 -46.135 114.864 1.00 25.41 ? 70   TYR B CA  1 
ATOM   2886 C  C   . TYR B 1 70  ? 64.349 -45.326 115.989 1.00 25.51 ? 70   TYR B C   1 
ATOM   2887 O  O   . TYR B 1 70  ? 65.363 -45.736 116.551 1.00 26.85 ? 70   TYR B O   1 
ATOM   2888 C  CB  . TYR B 1 70  ? 64.464 -46.055 113.533 1.00 26.07 ? 70   TYR B CB  1 
ATOM   2889 C  CG  . TYR B 1 70  ? 64.093 -47.231 112.657 1.00 27.47 ? 70   TYR B CG  1 
ATOM   2890 C  CD1 . TYR B 1 70  ? 62.901 -47.244 111.935 1.00 27.78 ? 70   TYR B CD1 1 
ATOM   2891 C  CD2 . TYR B 1 70  ? 64.901 -48.358 112.600 1.00 28.02 ? 70   TYR B CD2 1 
ATOM   2892 C  CE1 . TYR B 1 70  ? 62.548 -48.336 111.158 1.00 28.74 ? 70   TYR B CE1 1 
ATOM   2893 C  CE2 . TYR B 1 70  ? 64.555 -49.450 111.824 1.00 28.78 ? 70   TYR B CE2 1 
ATOM   2894 C  CZ  . TYR B 1 70  ? 63.380 -49.435 111.106 1.00 29.20 ? 70   TYR B CZ  1 
ATOM   2895 O  OH  . TYR B 1 70  ? 63.034 -50.521 110.335 1.00 29.47 ? 70   TYR B OH  1 
ATOM   2896 N  N   . ASP B 1 71  ? 63.733 -44.205 116.346 1.00 25.36 ? 71   ASP B N   1 
ATOM   2897 C  CA  . ASP B 1 71  ? 64.133 -43.460 117.532 1.00 24.68 ? 71   ASP B CA  1 
ATOM   2898 C  C   . ASP B 1 71  ? 63.542 -44.064 118.817 1.00 23.65 ? 71   ASP B C   1 
ATOM   2899 O  O   . ASP B 1 71  ? 64.160 -43.958 119.875 1.00 22.66 ? 71   ASP B O   1 
ATOM   2900 C  CB  . ASP B 1 71  ? 63.792 -41.978 117.379 1.00 25.04 ? 71   ASP B CB  1 
ATOM   2901 C  CG  . ASP B 1 71  ? 64.603 -41.307 116.267 1.00 25.99 ? 71   ASP B CG  1 
ATOM   2902 O  OD1 . ASP B 1 71  ? 65.843 -41.506 116.215 1.00 24.92 ? 71   ASP B OD1 1 
ATOM   2903 O  OD2 . ASP B 1 71  ? 64.002 -40.581 115.449 1.00 26.67 ? 71   ASP B OD2 1 
ATOM   2904 N  N   . LEU B 1 72  ? 62.374 -44.710 118.733 1.00 22.54 ? 72   LEU B N   1 
ATOM   2905 C  CA  . LEU B 1 72  ? 61.873 -45.521 119.854 1.00 22.67 ? 72   LEU B CA  1 
ATOM   2906 C  C   . LEU B 1 72  ? 62.830 -46.686 120.137 1.00 23.05 ? 72   LEU B C   1 
ATOM   2907 O  O   . LEU B 1 72  ? 63.191 -46.938 121.292 1.00 21.92 ? 72   LEU B O   1 
ATOM   2908 C  CB  . LEU B 1 72  ? 60.456 -46.068 119.591 1.00 22.10 ? 72   LEU B CB  1 
ATOM   2909 C  CG  . LEU B 1 72  ? 59.861 -46.943 120.710 1.00 22.32 ? 72   LEU B CG  1 
ATOM   2910 C  CD1 . LEU B 1 72  ? 59.741 -46.174 122.021 1.00 22.47 ? 72   LEU B CD1 1 
ATOM   2911 C  CD2 . LEU B 1 72  ? 58.511 -47.524 120.319 1.00 22.29 ? 72   LEU B CD2 1 
ATOM   2912 N  N   . LEU B 1 73  ? 63.227 -47.396 119.084 1.00 22.79 ? 73   LEU B N   1 
ATOM   2913 C  CA  . LEU B 1 73  ? 64.197 -48.478 119.221 1.00 24.24 ? 73   LEU B CA  1 
ATOM   2914 C  C   . LEU B 1 73  ? 65.501 -47.956 119.827 1.00 24.36 ? 73   LEU B C   1 
ATOM   2915 O  O   . LEU B 1 73  ? 66.118 -48.632 120.652 1.00 23.31 ? 73   LEU B O   1 
ATOM   2916 C  CB  . LEU B 1 73  ? 64.467 -49.164 117.876 1.00 24.52 ? 73   LEU B CB  1 
ATOM   2917 C  CG  . LEU B 1 73  ? 63.299 -49.889 117.202 1.00 24.42 ? 73   LEU B CG  1 
ATOM   2918 C  CD1 . LEU B 1 73  ? 63.743 -50.432 115.852 1.00 24.98 ? 73   LEU B CD1 1 
ATOM   2919 C  CD2 . LEU B 1 73  ? 62.756 -51.012 118.070 1.00 24.58 ? 73   LEU B CD2 1 
ATOM   2920 N  N   . ARG B 1 74  ? 65.904 -46.751 119.425 1.00 25.93 ? 74   ARG B N   1 
ATOM   2921 C  CA  . ARG B 1 74  ? 67.088 -46.095 119.993 1.00 27.33 ? 74   ARG B CA  1 
ATOM   2922 C  C   . ARG B 1 74  ? 66.952 -45.856 121.492 1.00 27.04 ? 74   ARG B C   1 
ATOM   2923 O  O   . ARG B 1 74  ? 67.856 -46.182 122.260 1.00 26.27 ? 74   ARG B O   1 
ATOM   2924 C  CB  . ARG B 1 74  ? 67.376 -44.752 119.309 1.00 29.26 ? 74   ARG B CB  1 
ATOM   2925 C  CG  . ARG B 1 74  ? 68.428 -44.817 118.221 1.00 30.88 ? 74   ARG B CG  1 
ATOM   2926 C  CD  . ARG B 1 74  ? 69.497 -43.756 118.417 1.00 32.63 ? 74   ARG B CD  1 
ATOM   2927 N  NE  . ARG B 1 74  ? 69.045 -42.419 118.056 1.00 32.78 ? 74   ARG B NE  1 
ATOM   2928 C  CZ  . ARG B 1 74  ? 69.730 -41.302 118.284 1.00 34.30 ? 74   ARG B CZ  1 
ATOM   2929 N  NH1 . ARG B 1 74  ? 70.916 -41.336 118.890 1.00 34.81 ? 74   ARG B NH1 1 
ATOM   2930 N  NH2 . ARG B 1 74  ? 69.225 -40.135 117.901 1.00 35.28 ? 74   ARG B NH2 1 
ATOM   2931 N  N   . LEU B 1 75  ? 65.826 -45.274 121.903 1.00 26.47 ? 75   LEU B N   1 
ATOM   2932 C  CA  . LEU B 1 75  ? 65.566 -45.035 123.319 1.00 26.68 ? 75   LEU B CA  1 
ATOM   2933 C  C   . LEU B 1 75  ? 65.753 -46.306 124.139 1.00 26.94 ? 75   LEU B C   1 
ATOM   2934 O  O   . LEU B 1 75  ? 66.347 -46.270 125.215 1.00 27.35 ? 75   LEU B O   1 
ATOM   2935 C  CB  . LEU B 1 75  ? 64.151 -44.479 123.542 1.00 27.41 ? 75   LEU B CB  1 
ATOM   2936 C  CG  . LEU B 1 75  ? 63.910 -43.038 123.076 1.00 27.71 ? 75   LEU B CG  1 
ATOM   2937 C  CD1 . LEU B 1 75  ? 62.419 -42.743 122.969 1.00 28.14 ? 75   LEU B CD1 1 
ATOM   2938 C  CD2 . LEU B 1 75  ? 64.584 -42.037 124.003 1.00 28.10 ? 75   LEU B CD2 1 
ATOM   2939 N  N   . PHE B 1 76  ? 65.268 -47.433 123.627 1.00 26.92 ? 76   PHE B N   1 
ATOM   2940 C  CA  . PHE B 1 76  ? 65.391 -48.690 124.351 1.00 27.79 ? 76   PHE B CA  1 
ATOM   2941 C  C   . PHE B 1 76  ? 66.830 -49.205 124.404 1.00 28.36 ? 76   PHE B C   1 
ATOM   2942 O  O   . PHE B 1 76  ? 67.235 -49.771 125.414 1.00 27.78 ? 76   PHE B O   1 
ATOM   2943 C  CB  . PHE B 1 76  ? 64.465 -49.767 123.773 1.00 27.55 ? 76   PHE B CB  1 
ATOM   2944 C  CG  . PHE B 1 76  ? 63.005 -49.540 124.074 1.00 27.46 ? 76   PHE B CG  1 
ATOM   2945 C  CD1 . PHE B 1 76  ? 62.573 -49.308 125.377 1.00 26.94 ? 76   PHE B CD1 1 
ATOM   2946 C  CD2 . PHE B 1 76  ? 62.063 -49.590 123.060 1.00 27.18 ? 76   PHE B CD2 1 
ATOM   2947 C  CE1 . PHE B 1 76  ? 61.232 -49.107 125.656 1.00 27.34 ? 76   PHE B CE1 1 
ATOM   2948 C  CE2 . PHE B 1 76  ? 60.719 -49.396 123.331 1.00 27.72 ? 76   PHE B CE2 1 
ATOM   2949 C  CZ  . PHE B 1 76  ? 60.302 -49.153 124.631 1.00 27.05 ? 76   PHE B CZ  1 
ATOM   2950 N  N   . GLU B 1 77  ? 67.604 -49.009 123.342 1.00 29.40 ? 77   GLU B N   1 
ATOM   2951 C  CA  . GLU B 1 77  ? 69.022 -49.417 123.388 1.00 30.15 ? 77   GLU B CA  1 
ATOM   2952 C  C   . GLU B 1 77  ? 69.881 -48.499 124.278 1.00 29.64 ? 77   GLU B C   1 
ATOM   2953 O  O   . GLU B 1 77  ? 70.915 -48.933 124.776 1.00 27.79 ? 77   GLU B O   1 
ATOM   2954 C  CB  . GLU B 1 77  ? 69.637 -49.653 121.993 1.00 32.02 ? 77   GLU B CB  1 
ATOM   2955 C  CG  . GLU B 1 77  ? 69.413 -48.584 120.943 1.00 33.22 ? 77   GLU B CG  1 
ATOM   2956 C  CD  . GLU B 1 77  ? 69.644 -49.076 119.516 1.00 34.53 ? 77   GLU B CD  1 
ATOM   2957 O  OE1 . GLU B 1 77  ? 69.160 -50.172 119.143 1.00 36.42 ? 77   GLU B OE1 1 
ATOM   2958 O  OE2 . GLU B 1 77  ? 70.295 -48.345 118.748 1.00 35.75 ? 77   GLU B OE2 1 
ATOM   2959 N  N   . TYR B 1 78  ? 69.446 -47.259 124.508 1.00 29.12 ? 78   TYR B N   1 
ATOM   2960 C  CA  . TYR B 1 78  ? 70.067 -46.412 125.533 1.00 29.35 ? 78   TYR B CA  1 
ATOM   2961 C  C   . TYR B 1 78  ? 69.549 -46.759 126.933 1.00 29.59 ? 78   TYR B C   1 
ATOM   2962 O  O   . TYR B 1 78  ? 70.327 -46.935 127.863 1.00 31.75 ? 78   TYR B O   1 
ATOM   2963 C  CB  . TYR B 1 78  ? 69.801 -44.924 125.291 1.00 28.75 ? 78   TYR B CB  1 
ATOM   2964 C  CG  . TYR B 1 78  ? 70.642 -44.246 124.229 1.00 29.17 ? 78   TYR B CG  1 
ATOM   2965 C  CD1 . TYR B 1 78  ? 70.622 -44.678 122.905 1.00 28.86 ? 78   TYR B CD1 1 
ATOM   2966 C  CD2 . TYR B 1 78  ? 71.420 -43.130 124.541 1.00 29.16 ? 78   TYR B CD2 1 
ATOM   2967 C  CE1 . TYR B 1 78  ? 71.368 -44.039 121.931 1.00 28.63 ? 78   TYR B CE1 1 
ATOM   2968 C  CE2 . TYR B 1 78  ? 72.168 -42.485 123.574 1.00 28.63 ? 78   TYR B CE2 1 
ATOM   2969 C  CZ  . TYR B 1 78  ? 72.141 -42.946 122.272 1.00 28.75 ? 78   TYR B CZ  1 
ATOM   2970 O  OH  . TYR B 1 78  ? 72.877 -42.303 121.313 1.00 28.37 ? 78   TYR B OH  1 
ATOM   2971 N  N   . GLY B 1 79  ? 68.229 -46.828 127.083 1.00 29.23 ? 79   GLY B N   1 
ATOM   2972 C  CA  . GLY B 1 79  ? 67.612 -47.008 128.392 1.00 29.41 ? 79   GLY B CA  1 
ATOM   2973 C  C   . GLY B 1 79  ? 67.595 -48.441 128.893 1.00 29.72 ? 79   GLY B C   1 
ATOM   2974 O  O   . GLY B 1 79  ? 67.518 -48.670 130.096 1.00 29.96 ? 79   GLY B O   1 
ATOM   2975 N  N   . GLY B 1 80  ? 67.670 -49.397 127.970 1.00 30.43 ? 80   GLY B N   1 
ATOM   2976 C  CA  . GLY B 1 80  ? 67.533 -50.820 128.282 1.00 31.77 ? 80   GLY B CA  1 
ATOM   2977 C  C   . GLY B 1 80  ? 66.179 -51.315 127.816 1.00 32.93 ? 80   GLY B C   1 
ATOM   2978 O  O   . GLY B 1 80  ? 65.166 -50.657 128.047 1.00 33.84 ? 80   GLY B O   1 
ATOM   2979 N  N   . PHE B 1 81  ? 66.156 -52.461 127.141 1.00 33.90 ? 81   PHE B N   1 
ATOM   2980 C  CA  . PHE B 1 81  ? 64.908 -53.035 126.650 1.00 33.82 ? 81   PHE B CA  1 
ATOM   2981 C  C   . PHE B 1 81  ? 64.142 -53.654 127.814 1.00 33.76 ? 81   PHE B C   1 
ATOM   2982 O  O   . PHE B 1 81  ? 64.752 -54.280 128.683 1.00 34.47 ? 81   PHE B O   1 
ATOM   2983 C  CB  . PHE B 1 81  ? 65.172 -54.082 125.558 1.00 34.40 ? 81   PHE B CB  1 
ATOM   2984 C  CG  . PHE B 1 81  ? 65.530 -53.482 124.225 1.00 34.19 ? 81   PHE B CG  1 
ATOM   2985 C  CD1 . PHE B 1 81  ? 66.835 -53.115 123.945 1.00 34.22 ? 81   PHE B CD1 1 
ATOM   2986 C  CD2 . PHE B 1 81  ? 64.553 -53.259 123.259 1.00 34.57 ? 81   PHE B CD2 1 
ATOM   2987 C  CE1 . PHE B 1 81  ? 67.167 -52.544 122.728 1.00 34.69 ? 81   PHE B CE1 1 
ATOM   2988 C  CE2 . PHE B 1 81  ? 64.876 -52.687 122.037 1.00 34.65 ? 81   PHE B CE2 1 
ATOM   2989 C  CZ  . PHE B 1 81  ? 66.189 -52.331 121.770 1.00 35.05 ? 81   PHE B CZ  1 
ATOM   2990 N  N   . PRO B 1 82  ? 62.807 -53.472 127.849 1.00 32.38 ? 82   PRO B N   1 
ATOM   2991 C  CA  . PRO B 1 82  ? 62.015 -54.113 128.904 1.00 32.44 ? 82   PRO B CA  1 
ATOM   2992 C  C   . PRO B 1 82  ? 62.278 -55.620 128.945 1.00 32.68 ? 82   PRO B C   1 
ATOM   2993 O  O   . PRO B 1 82  ? 62.409 -56.223 127.885 1.00 32.29 ? 82   PRO B O   1 
ATOM   2994 C  CB  . PRO B 1 82  ? 60.570 -53.849 128.474 1.00 32.06 ? 82   PRO B CB  1 
ATOM   2995 C  CG  . PRO B 1 82  ? 60.639 -52.624 127.635 1.00 32.19 ? 82   PRO B CG  1 
ATOM   2996 C  CD  . PRO B 1 82  ? 61.964 -52.689 126.928 1.00 31.91 ? 82   PRO B CD  1 
ATOM   2997 N  N   . PRO B 1 83  ? 62.356 -56.231 130.129 1.00 33.30 ? 83   PRO B N   1 
ATOM   2998 C  CA  . PRO B 1 83  ? 62.090 -55.593 131.416 1.00 34.12 ? 83   PRO B CA  1 
ATOM   2999 C  C   . PRO B 1 83  ? 63.349 -55.151 132.182 1.00 35.58 ? 83   PRO B C   1 
ATOM   3000 O  O   . PRO B 1 83  ? 63.307 -55.036 133.411 1.00 35.35 ? 83   PRO B O   1 
ATOM   3001 C  CB  . PRO B 1 83  ? 61.375 -56.709 132.181 1.00 34.25 ? 83   PRO B CB  1 
ATOM   3002 C  CG  . PRO B 1 83  ? 62.018 -57.961 131.669 1.00 34.12 ? 83   PRO B CG  1 
ATOM   3003 C  CD  . PRO B 1 83  ? 62.555 -57.681 130.285 1.00 34.26 ? 83   PRO B CD  1 
ATOM   3004 N  N   . GLU B 1 84  ? 64.451 -54.900 131.477 1.00 36.25 ? 84   GLU B N   1 
ATOM   3005 C  CA  . GLU B 1 84  ? 65.688 -54.450 132.122 1.00 37.03 ? 84   GLU B CA  1 
ATOM   3006 C  C   . GLU B 1 84  ? 65.465 -53.138 132.871 1.00 35.82 ? 84   GLU B C   1 
ATOM   3007 O  O   . GLU B 1 84  ? 66.006 -52.939 133.962 1.00 35.07 ? 84   GLU B O   1 
ATOM   3008 C  CB  . GLU B 1 84  ? 66.803 -54.283 131.086 1.00 40.23 ? 84   GLU B CB  1 
ATOM   3009 C  CG  . GLU B 1 84  ? 68.162 -53.926 131.671 1.00 43.32 ? 84   GLU B CG  1 
ATOM   3010 C  CD  . GLU B 1 84  ? 69.214 -53.722 130.602 1.00 45.37 ? 84   GLU B CD  1 
ATOM   3011 O  OE1 . GLU B 1 84  ? 69.311 -54.580 129.699 1.00 47.92 ? 84   GLU B OE1 1 
ATOM   3012 O  OE2 . GLU B 1 84  ? 69.943 -52.705 130.661 1.00 46.69 ? 84   GLU B OE2 1 
ATOM   3013 N  N   . SER B 1 85  ? 64.664 -52.254 132.276 1.00 33.54 ? 85   SER B N   1 
ATOM   3014 C  CA  . SER B 1 85  ? 64.268 -50.999 132.898 1.00 32.00 ? 85   SER B CA  1 
ATOM   3015 C  C   . SER B 1 85  ? 62.745 -50.862 132.891 1.00 30.08 ? 85   SER B C   1 
ATOM   3016 O  O   . SER B 1 85  ? 62.059 -51.498 132.086 1.00 29.59 ? 85   SER B O   1 
ATOM   3017 C  CB  . SER B 1 85  ? 64.899 -49.822 132.154 1.00 31.92 ? 85   SER B CB  1 
ATOM   3018 O  OG  . SER B 1 85  ? 66.317 -49.910 132.175 1.00 33.26 ? 85   SER B OG  1 
ATOM   3019 N  N   . ASN B 1 86  ? 62.232 -50.035 133.798 1.00 28.04 ? 86   ASN B N   1 
ATOM   3020 C  CA  . ASN B 1 86  ? 60.809 -49.702 133.845 1.00 27.39 ? 86   ASN B CA  1 
ATOM   3021 C  C   . ASN B 1 86  ? 60.597 -48.405 133.089 1.00 24.58 ? 86   ASN B C   1 
ATOM   3022 O  O   . ASN B 1 86  ? 61.450 -47.529 133.145 1.00 25.11 ? 86   ASN B O   1 
ATOM   3023 C  CB  . ASN B 1 86  ? 60.341 -49.532 135.290 1.00 27.86 ? 86   ASN B CB  1 
ATOM   3024 C  CG  . ASN B 1 86  ? 60.612 -50.753 136.138 1.00 29.91 ? 86   ASN B CG  1 
ATOM   3025 O  OD1 . ASN B 1 86  ? 60.341 -51.877 135.723 1.00 29.41 ? 86   ASN B OD1 1 
ATOM   3026 N  ND2 . ASN B 1 86  ? 61.152 -50.539 137.343 1.00 31.34 ? 86   ASN B ND2 1 
ATOM   3027 N  N   . TYR B 1 87  ? 59.466 -48.277 132.403 1.00 22.50 ? 87   TYR B N   1 
ATOM   3028 C  CA  . TYR B 1 87  ? 59.210 -47.115 131.550 1.00 21.16 ? 87   TYR B CA  1 
ATOM   3029 C  C   . TYR B 1 87  ? 57.877 -46.427 131.833 1.00 20.31 ? 87   TYR B C   1 
ATOM   3030 O  O   . TYR B 1 87  ? 56.859 -47.077 132.099 1.00 19.02 ? 87   TYR B O   1 
ATOM   3031 C  CB  . TYR B 1 87  ? 59.288 -47.507 130.066 1.00 20.85 ? 87   TYR B CB  1 
ATOM   3032 C  CG  . TYR B 1 87  ? 60.700 -47.728 129.576 1.00 20.27 ? 87   TYR B CG  1 
ATOM   3033 C  CD1 . TYR B 1 87  ? 61.448 -46.676 129.068 1.00 20.55 ? 87   TYR B CD1 1 
ATOM   3034 C  CD2 . TYR B 1 87  ? 61.287 -48.988 129.617 1.00 20.66 ? 87   TYR B CD2 1 
ATOM   3035 C  CE1 . TYR B 1 87  ? 62.743 -46.859 128.618 1.00 20.35 ? 87   TYR B CE1 1 
ATOM   3036 C  CE2 . TYR B 1 87  ? 62.588 -49.187 129.173 1.00 20.47 ? 87   TYR B CE2 1 
ATOM   3037 C  CZ  . TYR B 1 87  ? 63.314 -48.118 128.678 1.00 20.78 ? 87   TYR B CZ  1 
ATOM   3038 O  OH  . TYR B 1 87  ? 64.612 -48.295 128.235 1.00 21.60 ? 87   TYR B OH  1 
ATOM   3039 N  N   . LEU B 1 88  ? 57.910 -45.096 131.791 1.00 19.92 ? 88   LEU B N   1 
ATOM   3040 C  CA  . LEU B 1 88  ? 56.708 -44.284 131.699 1.00 19.99 ? 88   LEU B CA  1 
ATOM   3041 C  C   . LEU B 1 88  ? 56.832 -43.393 130.462 1.00 19.74 ? 88   LEU B C   1 
ATOM   3042 O  O   . LEU B 1 88  ? 57.768 -42.595 130.351 1.00 20.41 ? 88   LEU B O   1 
ATOM   3043 C  CB  . LEU B 1 88  ? 56.517 -43.421 132.952 1.00 19.96 ? 88   LEU B CB  1 
ATOM   3044 C  CG  . LEU B 1 88  ? 55.354 -42.426 132.928 1.00 19.74 ? 88   LEU B CG  1 
ATOM   3045 C  CD1 . LEU B 1 88  ? 54.014 -43.147 132.813 1.00 19.89 ? 88   LEU B CD1 1 
ATOM   3046 C  CD2 . LEU B 1 88  ? 55.369 -41.532 134.153 1.00 20.09 ? 88   LEU B CD2 1 
ATOM   3047 N  N   . PHE B 1 89  ? 55.898 -43.548 129.531 1.00 19.05 ? 89   PHE B N   1 
ATOM   3048 C  CA  . PHE B 1 89  ? 55.798 -42.660 128.380 1.00 19.09 ? 89   PHE B CA  1 
ATOM   3049 C  C   . PHE B 1 89  ? 54.678 -41.655 128.613 1.00 19.56 ? 89   PHE B C   1 
ATOM   3050 O  O   . PHE B 1 89  ? 53.627 -41.989 129.187 1.00 19.01 ? 89   PHE B O   1 
ATOM   3051 C  CB  . PHE B 1 89  ? 55.557 -43.460 127.102 1.00 19.30 ? 89   PHE B CB  1 
ATOM   3052 C  CG  . PHE B 1 89  ? 56.769 -44.203 126.609 1.00 19.52 ? 89   PHE B CG  1 
ATOM   3053 C  CD1 . PHE B 1 89  ? 57.106 -45.451 127.131 1.00 19.41 ? 89   PHE B CD1 1 
ATOM   3054 C  CD2 . PHE B 1 89  ? 57.565 -43.667 125.605 1.00 19.41 ? 89   PHE B CD2 1 
ATOM   3055 C  CE1 . PHE B 1 89  ? 58.214 -46.135 126.669 1.00 19.50 ? 89   PHE B CE1 1 
ATOM   3056 C  CE2 . PHE B 1 89  ? 58.684 -44.345 125.145 1.00 19.51 ? 89   PHE B CE2 1 
ATOM   3057 C  CZ  . PHE B 1 89  ? 59.009 -45.584 125.676 1.00 19.49 ? 89   PHE B CZ  1 
ATOM   3058 N  N   . LEU B 1 90  ? 54.896 -40.425 128.155 1.00 20.10 ? 90   LEU B N   1 
ATOM   3059 C  CA  . LEU B 1 90  ? 53.980 -39.325 128.433 1.00 20.87 ? 90   LEU B CA  1 
ATOM   3060 C  C   . LEU B 1 90  ? 53.011 -38.969 127.289 1.00 20.95 ? 90   LEU B C   1 
ATOM   3061 O  O   . LEU B 1 90  ? 52.407 -37.893 127.315 1.00 21.88 ? 90   LEU B O   1 
ATOM   3062 C  CB  . LEU B 1 90  ? 54.781 -38.079 128.817 1.00 20.73 ? 90   LEU B CB  1 
ATOM   3063 C  CG  . LEU B 1 90  ? 55.794 -38.239 129.950 1.00 20.49 ? 90   LEU B CG  1 
ATOM   3064 C  CD1 . LEU B 1 90  ? 56.572 -36.945 130.119 1.00 20.90 ? 90   LEU B CD1 1 
ATOM   3065 C  CD2 . LEU B 1 90  ? 55.129 -38.639 131.256 1.00 20.82 ? 90   LEU B CD2 1 
ATOM   3066 N  N   . GLY B 1 91  ? 52.866 -39.838 126.292 1.00 20.62 ? 91   GLY B N   1 
ATOM   3067 C  CA  . GLY B 1 91  ? 51.889 -39.615 125.209 1.00 20.53 ? 91   GLY B CA  1 
ATOM   3068 C  C   . GLY B 1 91  ? 52.465 -39.200 123.863 1.00 19.86 ? 91   GLY B C   1 
ATOM   3069 O  O   . GLY B 1 91  ? 53.682 -39.090 123.688 1.00 21.29 ? 91   GLY B O   1 
ATOM   3070 N  N   . ASP B 1 92  ? 51.573 -38.958 122.906 1.00 19.17 ? 92   ASP B N   1 
ATOM   3071 C  CA  . ASP B 1 92  ? 51.940 -38.554 121.539 1.00 18.80 ? 92   ASP B CA  1 
ATOM   3072 C  C   . ASP B 1 92  ? 52.846 -39.579 120.862 1.00 18.79 ? 92   ASP B C   1 
ATOM   3073 O  O   . ASP B 1 92  ? 53.987 -39.299 120.460 1.00 18.88 ? 92   ASP B O   1 
ATOM   3074 C  CB  . ASP B 1 92  ? 52.523 -37.125 121.515 1.00 18.29 ? 92   ASP B CB  1 
ATOM   3075 C  CG  . ASP B 1 92  ? 51.441 -36.057 121.600 1.00 18.44 ? 92   ASP B CG  1 
ATOM   3076 O  OD1 . ASP B 1 92  ? 50.270 -36.419 121.831 1.00 18.07 ? 92   ASP B OD1 1 
ATOM   3077 O  OD2 . ASP B 1 92  ? 51.752 -34.853 121.441 1.00 18.53 ? 92   ASP B OD2 1 
ATOM   3078 N  N   . TYR B 1 93  ? 52.285 -40.770 120.719 1.00 19.16 ? 93   TYR B N   1 
ATOM   3079 C  CA  . TYR B 1 93  ? 52.959 -41.907 120.121 1.00 19.73 ? 93   TYR B CA  1 
ATOM   3080 C  C   . TYR B 1 93  ? 52.830 -41.876 118.608 1.00 19.85 ? 93   TYR B C   1 
ATOM   3081 O  O   . TYR B 1 93  ? 53.708 -42.367 117.900 1.00 18.82 ? 93   TYR B O   1 
ATOM   3082 C  CB  . TYR B 1 93  ? 52.352 -43.195 120.669 1.00 19.35 ? 93   TYR B CB  1 
ATOM   3083 C  CG  . TYR B 1 93  ? 52.249 -43.149 122.170 1.00 19.44 ? 93   TYR B CG  1 
ATOM   3084 C  CD1 . TYR B 1 93  ? 53.388 -43.019 122.940 1.00 19.44 ? 93   TYR B CD1 1 
ATOM   3085 C  CD2 . TYR B 1 93  ? 51.018 -43.204 122.815 1.00 19.47 ? 93   TYR B CD2 1 
ATOM   3086 C  CE1 . TYR B 1 93  ? 53.321 -42.954 124.309 1.00 19.83 ? 93   TYR B CE1 1 
ATOM   3087 C  CE2 . TYR B 1 93  ? 50.937 -43.137 124.197 1.00 19.89 ? 93   TYR B CE2 1 
ATOM   3088 C  CZ  . TYR B 1 93  ? 52.100 -43.012 124.937 1.00 19.47 ? 93   TYR B CZ  1 
ATOM   3089 O  OH  . TYR B 1 93  ? 52.075 -42.930 126.306 1.00 20.40 ? 93   TYR B OH  1 
ATOM   3090 N  N   . VAL B 1 94  ? 51.738 -41.284 118.124 1.00 19.96 ? 94   VAL B N   1 
ATOM   3091 C  CA  . VAL B 1 94  ? 51.385 -41.341 116.711 1.00 20.82 ? 94   VAL B CA  1 
ATOM   3092 C  C   . VAL B 1 94  ? 51.350 -39.947 116.089 1.00 21.21 ? 94   VAL B C   1 
ATOM   3093 O  O   . VAL B 1 94  ? 51.512 -38.940 116.786 1.00 21.22 ? 94   VAL B O   1 
ATOM   3094 C  CB  . VAL B 1 94  ? 50.026 -42.055 116.492 1.00 21.08 ? 94   VAL B CB  1 
ATOM   3095 C  CG1 . VAL B 1 94  ? 50.053 -43.450 117.097 1.00 21.37 ? 94   VAL B CG1 1 
ATOM   3096 C  CG2 . VAL B 1 94  ? 48.867 -41.243 117.057 1.00 21.23 ? 94   VAL B CG2 1 
ATOM   3097 N  N   . ASP B 1 95  ? 51.125 -39.919 114.776 1.00 22.36 ? 95   ASP B N   1 
ATOM   3098 C  CA  . ASP B 1 95  ? 51.101 -38.699 113.943 1.00 23.37 ? 95   ASP B CA  1 
ATOM   3099 C  C   . ASP B 1 95  ? 52.492 -38.151 113.621 1.00 23.42 ? 95   ASP B C   1 
ATOM   3100 O  O   . ASP B 1 95  ? 53.447 -38.322 114.391 1.00 22.80 ? 95   ASP B O   1 
ATOM   3101 C  CB  . ASP B 1 95  ? 50.230 -37.583 114.537 1.00 23.99 ? 95   ASP B CB  1 
ATOM   3102 C  CG  . ASP B 1 95  ? 48.749 -37.927 114.544 1.00 25.25 ? 95   ASP B CG  1 
ATOM   3103 O  OD1 . ASP B 1 95  ? 48.306 -38.735 113.703 1.00 27.30 ? 95   ASP B OD1 1 
ATOM   3104 O  OD2 . ASP B 1 95  ? 48.024 -37.372 115.397 1.00 26.82 ? 95   ASP B OD2 1 
ATOM   3105 N  N   . ARG B 1 96  ? 52.567 -37.498 112.460 1.00 23.64 ? 96   ARG B N   1 
ATOM   3106 C  CA  . ARG B 1 96  ? 53.744 -36.771 111.963 1.00 25.09 ? 96   ARG B CA  1 
ATOM   3107 C  C   . ARG B 1 96  ? 54.850 -37.672 111.419 1.00 24.65 ? 96   ARG B C   1 
ATOM   3108 O  O   . ARG B 1 96  ? 55.291 -37.479 110.289 1.00 24.54 ? 96   ARG B O   1 
ATOM   3109 C  CB  . ARG B 1 96  ? 54.280 -35.768 112.992 1.00 25.57 ? 96   ARG B CB  1 
ATOM   3110 C  CG  . ARG B 1 96  ? 53.216 -34.777 113.444 1.00 27.40 ? 96   ARG B CG  1 
ATOM   3111 C  CD  . ARG B 1 96  ? 53.748 -33.359 113.539 1.00 28.82 ? 96   ARG B CD  1 
ATOM   3112 N  NE  . ARG B 1 96  ? 52.696 -32.399 113.877 1.00 30.94 ? 96   ARG B NE  1 
ATOM   3113 C  CZ  . ARG B 1 96  ? 52.175 -32.223 115.094 1.00 32.67 ? 96   ARG B CZ  1 
ATOM   3114 N  NH1 . ARG B 1 96  ? 52.593 -32.945 116.132 1.00 34.11 ? 96   ARG B NH1 1 
ATOM   3115 N  NH2 . ARG B 1 96  ? 51.218 -31.319 115.275 1.00 33.24 ? 96   ARG B NH2 1 
ATOM   3116 N  N   . GLY B 1 97  ? 55.290 -38.652 112.201 1.00 24.26 ? 97   GLY B N   1 
ATOM   3117 C  CA  . GLY B 1 97  ? 56.291 -39.607 111.724 1.00 24.85 ? 97   GLY B CA  1 
ATOM   3118 C  C   . GLY B 1 97  ? 55.743 -40.558 110.679 1.00 25.07 ? 97   GLY B C   1 
ATOM   3119 O  O   . GLY B 1 97  ? 54.550 -40.571 110.399 1.00 26.34 ? 97   GLY B O   1 
ATOM   3120 N  N   . LYS B 1 98  ? 56.624 -41.371 110.112 1.00 25.57 ? 98   LYS B N   1 
ATOM   3121 C  CA  . LYS B 1 98  ? 56.257 -42.254 109.006 1.00 26.31 ? 98   LYS B CA  1 
ATOM   3122 C  C   . LYS B 1 98  ? 55.858 -43.651 109.477 1.00 24.73 ? 98   LYS B C   1 
ATOM   3123 O  O   . LYS B 1 98  ? 55.298 -44.421 108.701 1.00 25.49 ? 98   LYS B O   1 
ATOM   3124 C  CB  . LYS B 1 98  ? 57.410 -42.321 108.002 1.00 27.66 ? 98   LYS B CB  1 
ATOM   3125 C  CG  . LYS B 1 98  ? 57.726 -40.966 107.381 1.00 29.88 ? 98   LYS B CG  1 
ATOM   3126 C  CD  . LYS B 1 98  ? 58.929 -41.007 106.451 1.00 31.61 ? 98   LYS B CD  1 
ATOM   3127 C  CE  . LYS B 1 98  ? 59.201 -39.628 105.863 1.00 33.09 ? 98   LYS B CE  1 
ATOM   3128 N  NZ  . LYS B 1 98  ? 60.655 -39.384 105.651 1.00 33.43 ? 98   LYS B NZ  1 
ATOM   3129 N  N   . GLN B 1 99  ? 56.117 -43.973 110.745 1.00 23.45 ? 99   GLN B N   1 
ATOM   3130 C  CA  . GLN B 1 99  ? 55.857 -45.319 111.269 1.00 22.05 ? 99   GLN B CA  1 
ATOM   3131 C  C   . GLN B 1 99  ? 55.168 -45.293 112.637 1.00 21.75 ? 99   GLN B C   1 
ATOM   3132 O  O   . GLN B 1 99  ? 55.704 -45.793 113.638 1.00 21.01 ? 99   GLN B O   1 
ATOM   3133 C  CB  . GLN B 1 99  ? 57.164 -46.114 111.333 1.00 22.65 ? 99   GLN B CB  1 
ATOM   3134 C  CG  . GLN B 1 99  ? 57.771 -46.380 109.959 1.00 22.97 ? 99   GLN B CG  1 
ATOM   3135 C  CD  . GLN B 1 99  ? 59.046 -47.188 110.028 1.00 23.50 ? 99   GLN B CD  1 
ATOM   3136 O  OE1 . GLN B 1 99  ? 60.135 -46.630 110.132 1.00 23.69 ? 99   GLN B OE1 1 
ATOM   3137 N  NE2 . GLN B 1 99  ? 58.919 -48.512 109.950 1.00 24.04 ? 99   GLN B NE2 1 
ATOM   3138 N  N   . SER B 1 100 ? 53.976 -44.703 112.662 1.00 20.70 ? 100  SER B N   1 
ATOM   3139 C  CA  . SER B 1 100 ? 53.139 -44.675 113.855 1.00 20.88 ? 100  SER B CA  1 
ATOM   3140 C  C   . SER B 1 100 ? 52.687 -46.073 114.258 1.00 21.57 ? 100  SER B C   1 
ATOM   3141 O  O   . SER B 1 100 ? 52.530 -46.350 115.447 1.00 21.89 ? 100  SER B O   1 
ATOM   3142 C  CB  . SER B 1 100 ? 51.912 -43.793 113.634 1.00 20.35 ? 100  SER B CB  1 
ATOM   3143 O  OG  . SER B 1 100 ? 52.267 -42.432 113.502 1.00 20.19 ? 100  SER B OG  1 
ATOM   3144 N  N   . LEU B 1 101 ? 52.488 -46.946 113.271 1.00 21.82 ? 101  LEU B N   1 
ATOM   3145 C  CA  . LEU B 1 101 ? 51.961 -48.283 113.527 1.00 22.53 ? 101  LEU B CA  1 
ATOM   3146 C  C   . LEU B 1 101 ? 52.949 -49.156 114.275 1.00 22.31 ? 101  LEU B C   1 
ATOM   3147 O  O   . LEU B 1 101 ? 52.583 -49.791 115.262 1.00 21.57 ? 101  LEU B O   1 
ATOM   3148 C  CB  . LEU B 1 101 ? 51.518 -48.955 112.222 1.00 23.85 ? 101  LEU B CB  1 
ATOM   3149 C  CG  . LEU B 1 101 ? 50.153 -48.491 111.706 1.00 23.74 ? 101  LEU B CG  1 
ATOM   3150 C  CD1 . LEU B 1 101 ? 49.953 -48.913 110.258 1.00 24.36 ? 101  LEU B CD1 1 
ATOM   3151 C  CD2 . LEU B 1 101 ? 49.023 -49.010 112.586 1.00 24.68 ? 101  LEU B CD2 1 
ATOM   3152 N  N   . GLU B 1 102 ? 54.198 -49.189 113.809 1.00 22.31 ? 102  GLU B N   1 
ATOM   3153 C  CA  . GLU B 1 102 ? 55.245 -49.928 114.505 1.00 22.80 ? 102  GLU B CA  1 
ATOM   3154 C  C   . GLU B 1 102 ? 55.466 -49.356 115.904 1.00 22.23 ? 102  GLU B C   1 
ATOM   3155 O  O   . GLU B 1 102 ? 55.666 -50.099 116.861 1.00 22.42 ? 102  GLU B O   1 
ATOM   3156 C  CB  . GLU B 1 102 ? 56.568 -49.905 113.725 1.00 23.39 ? 102  GLU B CB  1 
ATOM   3157 C  CG  . GLU B 1 102 ? 56.598 -50.792 112.484 1.00 24.22 ? 102  GLU B CG  1 
ATOM   3158 C  CD  . GLU B 1 102 ? 55.985 -50.153 111.247 1.00 24.56 ? 102  GLU B CD  1 
ATOM   3159 O  OE1 . GLU B 1 102 ? 55.306 -49.111 111.358 1.00 24.72 ? 102  GLU B OE1 1 
ATOM   3160 O  OE2 . GLU B 1 102 ? 56.184 -50.711 110.144 1.00 24.52 ? 102  GLU B OE2 1 
ATOM   3161 N  N   . THR B 1 103 ? 55.418 -48.035 116.015 1.00 21.25 ? 103  THR B N   1 
ATOM   3162 C  CA  . THR B 1 103 ? 55.646 -47.364 117.287 1.00 21.17 ? 103  THR B CA  1 
ATOM   3163 C  C   . THR B 1 103 ? 54.607 -47.772 118.328 1.00 21.78 ? 103  THR B C   1 
ATOM   3164 O  O   . THR B 1 103 ? 54.964 -48.305 119.385 1.00 22.64 ? 103  THR B O   1 
ATOM   3165 C  CB  . THR B 1 103 ? 55.655 -45.836 117.102 1.00 20.22 ? 103  THR B CB  1 
ATOM   3166 O  OG1 . THR B 1 103 ? 56.722 -45.481 116.214 1.00 20.38 ? 103  THR B OG1 1 
ATOM   3167 C  CG2 . THR B 1 103 ? 55.854 -45.119 118.429 1.00 20.52 ? 103  THR B CG2 1 
ATOM   3168 N  N   . ILE B 1 104 ? 53.333 -47.551 118.024 1.00 21.76 ? 104  ILE B N   1 
ATOM   3169 C  CA  . ILE B 1 104 ? 52.270 -47.877 118.976 1.00 23.15 ? 104  ILE B CA  1 
ATOM   3170 C  C   . ILE B 1 104 ? 52.199 -49.383 119.238 1.00 23.43 ? 104  ILE B C   1 
ATOM   3171 O  O   . ILE B 1 104 ? 51.990 -49.797 120.380 1.00 23.51 ? 104  ILE B O   1 
ATOM   3172 C  CB  . ILE B 1 104 ? 50.892 -47.316 118.549 1.00 23.08 ? 104  ILE B CB  1 
ATOM   3173 C  CG1 . ILE B 1 104 ? 49.871 -47.422 119.691 1.00 23.94 ? 104  ILE B CG1 1 
ATOM   3174 C  CG2 . ILE B 1 104 ? 50.350 -48.033 117.309 1.00 23.47 ? 104  ILE B CG2 1 
ATOM   3175 C  CD1 . ILE B 1 104 ? 50.233 -46.655 120.952 1.00 23.69 ? 104  ILE B CD1 1 
ATOM   3176 N  N   . CYS B 1 105 ? 52.400 -50.196 118.200 1.00 23.76 ? 105  CYS B N   1 
ATOM   3177 C  CA  . CYS B 1 105 ? 52.354 -51.654 118.365 1.00 24.30 ? 105  CYS B CA  1 
ATOM   3178 C  C   . CYS B 1 105 ? 53.379 -52.208 119.360 1.00 24.00 ? 105  CYS B C   1 
ATOM   3179 O  O   . CYS B 1 105 ? 53.045 -53.084 120.169 1.00 24.17 ? 105  CYS B O   1 
ATOM   3180 C  CB  . CYS B 1 105 ? 52.480 -52.371 117.020 1.00 25.20 ? 105  CYS B CB  1 
ATOM   3181 S  SG  . CYS B 1 105 ? 50.935 -52.365 116.082 1.00 27.84 ? 105  CYS B SG  1 
ATOM   3182 N  N   . LEU B 1 106 ? 54.615 -51.719 119.303 1.00 22.92 ? 106  LEU B N   1 
ATOM   3183 C  CA  . LEU B 1 106 ? 55.647 -52.179 120.240 1.00 22.94 ? 106  LEU B CA  1 
ATOM   3184 C  C   . LEU B 1 106 ? 55.346 -51.712 121.659 1.00 22.86 ? 106  LEU B C   1 
ATOM   3185 O  O   . LEU B 1 106 ? 55.587 -52.446 122.619 1.00 23.33 ? 106  LEU B O   1 
ATOM   3186 C  CB  . LEU B 1 106 ? 57.034 -51.700 119.821 1.00 22.55 ? 106  LEU B CB  1 
ATOM   3187 C  CG  . LEU B 1 106 ? 58.207 -52.187 120.677 1.00 22.47 ? 106  LEU B CG  1 
ATOM   3188 C  CD1 . LEU B 1 106 ? 58.258 -53.707 120.726 1.00 22.54 ? 106  LEU B CD1 1 
ATOM   3189 C  CD2 . LEU B 1 106 ? 59.517 -51.630 120.151 1.00 21.96 ? 106  LEU B CD2 1 
ATOM   3190 N  N   . LEU B 1 107 ? 54.834 -50.491 121.787 1.00 22.00 ? 107  LEU B N   1 
ATOM   3191 C  CA  . LEU B 1 107 ? 54.444 -49.948 123.090 1.00 22.21 ? 107  LEU B CA  1 
ATOM   3192 C  C   . LEU B 1 107 ? 53.294 -50.737 123.715 1.00 22.45 ? 107  LEU B C   1 
ATOM   3193 O  O   . LEU B 1 107 ? 53.302 -51.007 124.922 1.00 21.26 ? 107  LEU B O   1 
ATOM   3194 C  CB  . LEU B 1 107 ? 54.055 -48.473 122.965 1.00 22.08 ? 107  LEU B CB  1 
ATOM   3195 C  CG  . LEU B 1 107 ? 55.172 -47.506 122.569 1.00 22.20 ? 107  LEU B CG  1 
ATOM   3196 C  CD1 . LEU B 1 107 ? 54.599 -46.116 122.345 1.00 22.46 ? 107  LEU B CD1 1 
ATOM   3197 C  CD2 . LEU B 1 107 ? 56.287 -47.468 123.607 1.00 22.20 ? 107  LEU B CD2 1 
ATOM   3198 N  N   . LEU B 1 108 ? 52.302 -51.095 122.900 1.00 22.73 ? 108  LEU B N   1 
ATOM   3199 C  CA  . LEU B 1 108 ? 51.176 -51.879 123.389 1.00 23.87 ? 108  LEU B CA  1 
ATOM   3200 C  C   . LEU B 1 108 ? 51.599 -53.314 123.684 1.00 24.84 ? 108  LEU B C   1 
ATOM   3201 O  O   . LEU B 1 108 ? 51.135 -53.909 124.658 1.00 24.82 ? 108  LEU B O   1 
ATOM   3202 C  CB  . LEU B 1 108 ? 50.011 -51.864 122.395 1.00 24.29 ? 108  LEU B CB  1 
ATOM   3203 C  CG  . LEU B 1 108 ? 49.313 -50.522 122.162 1.00 24.18 ? 108  LEU B CG  1 
ATOM   3204 C  CD1 . LEU B 1 108 ? 48.214 -50.691 121.127 1.00 23.83 ? 108  LEU B CD1 1 
ATOM   3205 C  CD2 . LEU B 1 108 ? 48.756 -49.937 123.453 1.00 24.07 ? 108  LEU B CD2 1 
ATOM   3206 N  N   . ALA B 1 109 ? 52.490 -53.858 122.859 1.00 25.58 ? 109  ALA B N   1 
ATOM   3207 C  CA  . ALA B 1 109 ? 53.025 -55.195 123.091 1.00 26.25 ? 109  ALA B CA  1 
ATOM   3208 C  C   . ALA B 1 109 ? 53.736 -55.271 124.446 1.00 27.40 ? 109  ALA B C   1 
ATOM   3209 O  O   . ALA B 1 109 ? 53.452 -56.157 125.250 1.00 27.14 ? 109  ALA B O   1 
ATOM   3210 C  CB  . ALA B 1 109 ? 53.968 -55.596 121.969 1.00 26.04 ? 109  ALA B CB  1 
ATOM   3211 N  N   . TYR B 1 110 ? 54.645 -54.331 124.693 1.00 28.18 ? 110  TYR B N   1 
ATOM   3212 C  CA  . TYR B 1 110 ? 55.347 -54.260 125.974 1.00 28.66 ? 110  TYR B CA  1 
ATOM   3213 C  C   . TYR B 1 110 ? 54.424 -54.012 127.171 1.00 28.97 ? 110  TYR B C   1 
ATOM   3214 O  O   . TYR B 1 110 ? 54.711 -54.493 128.268 1.00 29.50 ? 110  TYR B O   1 
ATOM   3215 C  CB  . TYR B 1 110 ? 56.454 -53.198 125.949 1.00 28.74 ? 110  TYR B CB  1 
ATOM   3216 C  CG  . TYR B 1 110 ? 57.767 -53.635 125.320 1.00 29.08 ? 110  TYR B CG  1 
ATOM   3217 C  CD1 . TYR B 1 110 ? 58.311 -54.899 125.558 1.00 29.45 ? 110  TYR B CD1 1 
ATOM   3218 C  CD2 . TYR B 1 110 ? 58.487 -52.761 124.512 1.00 28.83 ? 110  TYR B CD2 1 
ATOM   3219 C  CE1 . TYR B 1 110 ? 59.518 -55.279 124.989 1.00 29.82 ? 110  TYR B CE1 1 
ATOM   3220 C  CE2 . TYR B 1 110 ? 59.691 -53.132 123.945 1.00 29.41 ? 110  TYR B CE2 1 
ATOM   3221 C  CZ  . TYR B 1 110 ? 60.201 -54.388 124.179 1.00 29.21 ? 110  TYR B CZ  1 
ATOM   3222 O  OH  . TYR B 1 110 ? 61.403 -54.734 123.609 1.00 30.13 ? 110  TYR B OH  1 
ATOM   3223 N  N   . LYS B 1 111 ? 53.337 -53.262 126.974 1.00 28.78 ? 111  LYS B N   1 
ATOM   3224 C  CA  . LYS B 1 111 ? 52.344 -53.055 128.034 1.00 28.84 ? 111  LYS B CA  1 
ATOM   3225 C  C   . LYS B 1 111 ? 51.652 -54.364 128.416 1.00 30.00 ? 111  LYS B C   1 
ATOM   3226 O  O   . LYS B 1 111 ? 51.415 -54.626 129.593 1.00 30.35 ? 111  LYS B O   1 
ATOM   3227 C  CB  . LYS B 1 111 ? 51.291 -52.018 127.612 1.00 27.72 ? 111  LYS B CB  1 
ATOM   3228 C  CG  . LYS B 1 111 ? 50.214 -51.731 128.655 1.00 27.09 ? 111  LYS B CG  1 
ATOM   3229 C  CD  . LYS B 1 111 ? 50.805 -51.098 129.907 1.00 26.55 ? 111  LYS B CD  1 
ATOM   3230 C  CE  . LYS B 1 111 ? 49.824 -51.047 131.058 1.00 25.74 ? 111  LYS B CE  1 
ATOM   3231 N  NZ  . LYS B 1 111 ? 50.485 -50.547 132.293 1.00 25.20 ? 111  LYS B NZ  1 
ATOM   3232 N  N   . ILE B 1 112 ? 51.326 -55.175 127.415 1.00 29.85 ? 112  ILE B N   1 
ATOM   3233 C  CA  . ILE B 1 112 ? 50.664 -56.453 127.646 1.00 30.59 ? 112  ILE B CA  1 
ATOM   3234 C  C   . ILE B 1 112 ? 51.652 -57.439 128.265 1.00 31.92 ? 112  ILE B C   1 
ATOM   3235 O  O   . ILE B 1 112 ? 51.312 -58.170 129.197 1.00 31.47 ? 112  ILE B O   1 
ATOM   3236 C  CB  . ILE B 1 112 ? 50.076 -57.014 126.334 1.00 30.66 ? 112  ILE B CB  1 
ATOM   3237 C  CG1 . ILE B 1 112 ? 48.979 -56.078 125.813 1.00 30.65 ? 112  ILE B CG1 1 
ATOM   3238 C  CG2 . ILE B 1 112 ? 49.515 -58.418 126.546 1.00 30.58 ? 112  ILE B CG2 1 
ATOM   3239 C  CD1 . ILE B 1 112 ? 48.683 -56.225 124.339 1.00 30.64 ? 112  ILE B CD1 1 
ATOM   3240 N  N   . LYS B 1 113 ? 52.877 -57.439 127.746 1.00 31.83 ? 113  LYS B N   1 
ATOM   3241 C  CA  . LYS B 1 113 ? 53.946 -58.303 128.246 1.00 33.06 ? 113  LYS B CA  1 
ATOM   3242 C  C   . LYS B 1 113 ? 54.377 -57.960 129.684 1.00 32.22 ? 113  LYS B C   1 
ATOM   3243 O  O   . LYS B 1 113 ? 54.578 -58.857 130.502 1.00 30.79 ? 113  LYS B O   1 
ATOM   3244 C  CB  . LYS B 1 113 ? 55.148 -58.225 127.297 1.00 34.03 ? 113  LYS B CB  1 
ATOM   3245 C  CG  . LYS B 1 113 ? 56.324 -59.122 127.658 1.00 35.10 ? 113  LYS B CG  1 
ATOM   3246 C  CD  . LYS B 1 113 ? 56.009 -60.593 127.464 1.00 36.22 ? 113  LYS B CD  1 
ATOM   3247 C  CE  . LYS B 1 113 ? 57.179 -61.451 127.914 1.00 37.62 ? 113  LYS B CE  1 
ATOM   3248 N  NZ  . LYS B 1 113 ? 56.934 -62.888 127.628 1.00 38.76 ? 113  LYS B NZ  1 
ATOM   3249 N  N   . TYR B 1 114 ? 54.517 -56.672 129.989 1.00 32.14 ? 114  TYR B N   1 
ATOM   3250 C  CA  . TYR B 1 114 ? 54.997 -56.237 131.310 1.00 32.17 ? 114  TYR B CA  1 
ATOM   3251 C  C   . TYR B 1 114 ? 54.085 -55.178 131.930 1.00 31.10 ? 114  TYR B C   1 
ATOM   3252 O  O   . TYR B 1 114 ? 54.502 -54.036 132.137 1.00 29.44 ? 114  TYR B O   1 
ATOM   3253 C  CB  . TYR B 1 114 ? 56.424 -55.701 131.200 1.00 32.38 ? 114  TYR B CB  1 
ATOM   3254 C  CG  . TYR B 1 114 ? 57.386 -56.659 130.532 1.00 33.08 ? 114  TYR B CG  1 
ATOM   3255 C  CD1 . TYR B 1 114 ? 57.716 -57.875 131.127 1.00 34.07 ? 114  TYR B CD1 1 
ATOM   3256 C  CD2 . TYR B 1 114 ? 57.967 -56.350 129.309 1.00 34.07 ? 114  TYR B CD2 1 
ATOM   3257 C  CE1 . TYR B 1 114 ? 58.596 -58.757 130.518 1.00 34.54 ? 114  TYR B CE1 1 
ATOM   3258 C  CE2 . TYR B 1 114 ? 58.853 -57.221 128.696 1.00 34.59 ? 114  TYR B CE2 1 
ATOM   3259 C  CZ  . TYR B 1 114 ? 59.162 -58.421 129.306 1.00 34.65 ? 114  TYR B CZ  1 
ATOM   3260 O  OH  . TYR B 1 114 ? 60.032 -59.287 128.695 1.00 36.59 ? 114  TYR B OH  1 
ATOM   3261 N  N   . PRO B 1 115 ? 52.843 -55.564 132.269 1.00 32.09 ? 115  PRO B N   1 
ATOM   3262 C  CA  . PRO B 1 115 ? 51.830 -54.582 132.665 1.00 31.43 ? 115  PRO B CA  1 
ATOM   3263 C  C   . PRO B 1 115 ? 52.099 -53.848 133.981 1.00 31.84 ? 115  PRO B C   1 
ATOM   3264 O  O   . PRO B 1 115 ? 51.513 -52.788 134.199 1.00 30.77 ? 115  PRO B O   1 
ATOM   3265 C  CB  . PRO B 1 115 ? 50.550 -55.419 132.753 1.00 32.89 ? 115  PRO B CB  1 
ATOM   3266 C  CG  . PRO B 1 115 ? 51.018 -56.797 133.064 1.00 32.59 ? 115  PRO B CG  1 
ATOM   3267 C  CD  . PRO B 1 115 ? 52.354 -56.949 132.394 1.00 32.39 ? 115  PRO B CD  1 
ATOM   3268 N  N   . GLU B 1 116 ? 52.963 -54.404 134.838 1.00 31.76 ? 116  GLU B N   1 
ATOM   3269 C  CA  . GLU B 1 116 ? 53.339 -53.775 136.110 1.00 31.48 ? 116  GLU B CA  1 
ATOM   3270 C  C   . GLU B 1 116 ? 54.669 -53.019 136.043 1.00 30.54 ? 116  GLU B C   1 
ATOM   3271 O  O   . GLU B 1 116 ? 55.085 -52.424 137.037 1.00 28.63 ? 116  GLU B O   1 
ATOM   3272 C  CB  . GLU B 1 116 ? 53.443 -54.833 137.217 1.00 31.95 ? 116  GLU B CB  1 
ATOM   3273 C  CG  . GLU B 1 116 ? 52.193 -55.681 137.416 1.00 32.52 ? 116  GLU B CG  1 
ATOM   3274 C  CD  . GLU B 1 116 ? 50.967 -54.859 137.747 1.00 33.18 ? 116  GLU B CD  1 
ATOM   3275 O  OE1 . GLU B 1 116 ? 51.110 -53.784 138.364 1.00 35.54 ? 116  GLU B OE1 1 
ATOM   3276 O  OE2 . GLU B 1 116 ? 49.851 -55.286 137.391 1.00 34.86 ? 116  GLU B OE2 1 
ATOM   3277 N  N   . ASN B 1 117 ? 55.332 -53.046 134.885 1.00 29.12 ? 117  ASN B N   1 
ATOM   3278 C  CA  . ASN B 1 117 ? 56.634 -52.400 134.719 1.00 28.94 ? 117  ASN B CA  1 
ATOM   3279 C  C   . ASN B 1 117 ? 56.725 -51.478 133.494 1.00 26.67 ? 117  ASN B C   1 
ATOM   3280 O  O   . ASN B 1 117 ? 57.798 -50.981 133.175 1.00 26.31 ? 117  ASN B O   1 
ATOM   3281 C  CB  . ASN B 1 117 ? 57.731 -53.472 134.627 1.00 29.97 ? 117  ASN B CB  1 
ATOM   3282 C  CG  . ASN B 1 117 ? 57.797 -54.353 135.866 1.00 31.89 ? 117  ASN B CG  1 
ATOM   3283 O  OD1 . ASN B 1 117 ? 56.955 -55.232 136.059 1.00 34.50 ? 117  ASN B OD1 1 
ATOM   3284 N  ND2 . ASN B 1 117 ? 58.795 -54.121 136.711 1.00 32.77 ? 117  ASN B ND2 1 
ATOM   3285 N  N   . PHE B 1 118 ? 55.608 -51.243 132.816 1.00 24.83 ? 118  PHE B N   1 
ATOM   3286 C  CA  . PHE B 1 118 ? 55.608 -50.477 131.568 1.00 23.93 ? 118  PHE B CA  1 
ATOM   3287 C  C   . PHE B 1 118 ? 54.315 -49.679 131.498 1.00 24.30 ? 118  PHE B C   1 
ATOM   3288 O  O   . PHE B 1 118 ? 53.230 -50.251 131.590 1.00 24.62 ? 118  PHE B O   1 
ATOM   3289 C  CB  . PHE B 1 118 ? 55.727 -51.434 130.385 1.00 23.08 ? 118  PHE B CB  1 
ATOM   3290 C  CG  . PHE B 1 118 ? 56.146 -50.775 129.104 1.00 21.84 ? 118  PHE B CG  1 
ATOM   3291 C  CD1 . PHE B 1 118 ? 57.486 -50.646 128.787 1.00 21.19 ? 118  PHE B CD1 1 
ATOM   3292 C  CD2 . PHE B 1 118 ? 55.198 -50.301 128.205 1.00 21.51 ? 118  PHE B CD2 1 
ATOM   3293 C  CE1 . PHE B 1 118 ? 57.882 -50.050 127.600 1.00 20.94 ? 118  PHE B CE1 1 
ATOM   3294 C  CE2 . PHE B 1 118 ? 55.587 -49.705 127.013 1.00 20.89 ? 118  PHE B CE2 1 
ATOM   3295 C  CZ  . PHE B 1 118 ? 56.935 -49.577 126.714 1.00 20.89 ? 118  PHE B CZ  1 
ATOM   3296 N  N   . PHE B 1 119 ? 54.425 -48.356 131.386 1.00 24.31 ? 119  PHE B N   1 
ATOM   3297 C  CA  . PHE B 1 119 ? 53.251 -47.491 131.479 1.00 24.20 ? 119  PHE B CA  1 
ATOM   3298 C  C   . PHE B 1 119 ? 53.189 -46.444 130.374 1.00 23.13 ? 119  PHE B C   1 
ATOM   3299 O  O   . PHE B 1 119 ? 54.214 -45.909 129.952 1.00 21.74 ? 119  PHE B O   1 
ATOM   3300 C  CB  . PHE B 1 119 ? 53.187 -46.850 132.868 1.00 24.97 ? 119  PHE B CB  1 
ATOM   3301 C  CG  . PHE B 1 119 ? 53.090 -47.860 133.978 1.00 25.58 ? 119  PHE B CG  1 
ATOM   3302 C  CD1 . PHE B 1 119 ? 54.238 -48.396 134.549 1.00 26.42 ? 119  PHE B CD1 1 
ATOM   3303 C  CD2 . PHE B 1 119 ? 51.859 -48.317 134.405 1.00 25.85 ? 119  PHE B CD2 1 
ATOM   3304 C  CE1 . PHE B 1 119 ? 54.157 -49.352 135.545 1.00 26.52 ? 119  PHE B CE1 1 
ATOM   3305 C  CE2 . PHE B 1 119 ? 51.767 -49.268 135.410 1.00 26.41 ? 119  PHE B CE2 1 
ATOM   3306 C  CZ  . PHE B 1 119 ? 52.915 -49.783 135.984 1.00 27.11 ? 119  PHE B CZ  1 
ATOM   3307 N  N   . LEU B 1 120 ? 51.968 -46.193 129.899 1.00 22.11 ? 120  LEU B N   1 
ATOM   3308 C  CA  . LEU B 1 120 ? 51.702 -45.251 128.817 1.00 22.03 ? 120  LEU B CA  1 
ATOM   3309 C  C   . LEU B 1 120 ? 50.613 -44.276 129.230 1.00 21.41 ? 120  LEU B C   1 
ATOM   3310 O  O   . LEU B 1 120 ? 49.507 -44.699 129.586 1.00 20.45 ? 120  LEU B O   1 
ATOM   3311 C  CB  . LEU B 1 120 ? 51.218 -45.991 127.568 1.00 22.30 ? 120  LEU B CB  1 
ATOM   3312 C  CG  . LEU B 1 120 ? 52.107 -47.062 126.950 1.00 22.44 ? 120  LEU B CG  1 
ATOM   3313 C  CD1 . LEU B 1 120 ? 51.359 -47.723 125.807 1.00 22.94 ? 120  LEU B CD1 1 
ATOM   3314 C  CD2 . LEU B 1 120 ? 53.427 -46.481 126.468 1.00 22.98 ? 120  LEU B CD2 1 
ATOM   3315 N  N   . LEU B 1 121 ? 50.916 -42.982 129.157 1.00 20.19 ? 121  LEU B N   1 
ATOM   3316 C  CA  . LEU B 1 121 ? 49.919 -41.933 129.352 1.00 19.74 ? 121  LEU B CA  1 
ATOM   3317 C  C   . LEU B 1 121 ? 49.336 -41.442 128.029 1.00 19.72 ? 121  LEU B C   1 
ATOM   3318 O  O   . LEU B 1 121 ? 49.941 -41.591 126.963 1.00 19.34 ? 121  LEU B O   1 
ATOM   3319 C  CB  . LEU B 1 121 ? 50.525 -40.743 130.097 1.00 19.66 ? 121  LEU B CB  1 
ATOM   3320 C  CG  . LEU B 1 121 ? 51.086 -40.984 131.501 1.00 19.76 ? 121  LEU B CG  1 
ATOM   3321 C  CD1 . LEU B 1 121 ? 51.359 -39.640 132.160 1.00 20.09 ? 121  LEU B CD1 1 
ATOM   3322 C  CD2 . LEU B 1 121 ? 50.148 -41.816 132.357 1.00 20.55 ? 121  LEU B CD2 1 
ATOM   3323 N  N   . ARG B 1 122 ? 48.153 -40.848 128.115 1.00 18.83 ? 122  ARG B N   1 
ATOM   3324 C  CA  . ARG B 1 122 ? 47.475 -40.295 126.952 1.00 19.41 ? 122  ARG B CA  1 
ATOM   3325 C  C   . ARG B 1 122 ? 48.021 -38.915 126.601 1.00 19.56 ? 122  ARG B C   1 
ATOM   3326 O  O   . ARG B 1 122 ? 48.102 -38.044 127.460 1.00 20.90 ? 122  ARG B O   1 
ATOM   3327 C  CB  . ARG B 1 122 ? 45.985 -40.178 127.239 1.00 19.22 ? 122  ARG B CB  1 
ATOM   3328 C  CG  . ARG B 1 122 ? 45.146 -40.023 125.993 1.00 19.96 ? 122  ARG B CG  1 
ATOM   3329 C  CD  . ARG B 1 122 ? 43.661 -40.045 126.319 1.00 20.04 ? 122  ARG B CD  1 
ATOM   3330 N  NE  . ARG B 1 122 ? 42.872 -39.992 125.095 1.00 20.04 ? 122  ARG B NE  1 
ATOM   3331 C  CZ  . ARG B 1 122 ? 41.547 -40.041 125.042 1.00 20.22 ? 122  ARG B CZ  1 
ATOM   3332 N  NH1 . ARG B 1 122 ? 40.825 -40.150 126.156 1.00 19.86 ? 122  ARG B NH1 1 
ATOM   3333 N  NH2 . ARG B 1 122 ? 40.942 -39.994 123.860 1.00 20.69 ? 122  ARG B NH2 1 
ATOM   3334 N  N   . GLY B 1 123 ? 48.382 -38.723 125.338 1.00 19.61 ? 123  GLY B N   1 
ATOM   3335 C  CA  . GLY B 1 123 ? 48.739 -37.398 124.818 1.00 19.70 ? 123  GLY B CA  1 
ATOM   3336 C  C   . GLY B 1 123 ? 47.580 -36.861 124.003 1.00 19.53 ? 123  GLY B C   1 
ATOM   3337 O  O   . GLY B 1 123 ? 46.641 -37.601 123.715 1.00 20.12 ? 123  GLY B O   1 
ATOM   3338 N  N   . ASN B 1 124 ? 47.641 -35.586 123.615 1.00 19.16 ? 124  ASN B N   1 
ATOM   3339 C  CA  . ASN B 1 124 ? 46.566 -34.986 122.819 1.00 19.17 ? 124  ASN B CA  1 
ATOM   3340 C  C   . ASN B 1 124 ? 46.405 -35.582 121.417 1.00 19.34 ? 124  ASN B C   1 
ATOM   3341 O  O   . ASN B 1 124 ? 45.366 -35.395 120.784 1.00 20.67 ? 124  ASN B O   1 
ATOM   3342 C  CB  . ASN B 1 124 ? 46.691 -33.446 122.742 1.00 18.90 ? 124  ASN B CB  1 
ATOM   3343 C  CG  . ASN B 1 124 ? 47.988 -32.974 122.101 1.00 18.68 ? 124  ASN B CG  1 
ATOM   3344 O  OD1 . ASN B 1 124 ? 49.072 -33.339 122.530 1.00 18.37 ? 124  ASN B OD1 1 
ATOM   3345 N  ND2 . ASN B 1 124 ? 47.872 -32.131 121.081 1.00 18.67 ? 124  ASN B ND2 1 
ATOM   3346 N  N   . HIS B 1 125 ? 47.415 -36.301 120.930 1.00 19.26 ? 125  HIS B N   1 
ATOM   3347 C  CA  . HIS B 1 125 ? 47.303 -36.989 119.643 1.00 19.41 ? 125  HIS B CA  1 
ATOM   3348 C  C   . HIS B 1 125 ? 46.653 -38.363 119.753 1.00 19.77 ? 125  HIS B C   1 
ATOM   3349 O  O   . HIS B 1 125 ? 46.278 -38.949 118.738 1.00 19.31 ? 125  HIS B O   1 
ATOM   3350 C  CB  . HIS B 1 125 ? 48.665 -37.072 118.955 1.00 18.78 ? 125  HIS B CB  1 
ATOM   3351 C  CG  . HIS B 1 125 ? 49.103 -35.769 118.374 1.00 18.67 ? 125  HIS B CG  1 
ATOM   3352 N  ND1 . HIS B 1 125 ? 49.006 -35.489 117.029 1.00 18.59 ? 125  HIS B ND1 1 
ATOM   3353 C  CD2 . HIS B 1 125 ? 49.610 -34.657 118.954 1.00 18.51 ? 125  HIS B CD2 1 
ATOM   3354 C  CE1 . HIS B 1 125 ? 49.432 -34.261 116.805 1.00 18.01 ? 125  HIS B CE1 1 
ATOM   3355 N  NE2 . HIS B 1 125 ? 49.809 -33.737 117.955 1.00 18.60 ? 125  HIS B NE2 1 
ATOM   3356 N  N   . GLU B 1 126 ? 46.473 -38.858 120.975 1.00 20.84 ? 126  GLU B N   1 
ATOM   3357 C  CA  . GLU B 1 126 ? 45.721 -40.083 121.191 1.00 21.29 ? 126  GLU B CA  1 
ATOM   3358 C  C   . GLU B 1 126 ? 44.233 -39.725 121.309 1.00 22.72 ? 126  GLU B C   1 
ATOM   3359 O  O   . GLU B 1 126 ? 43.589 -39.957 122.334 1.00 21.97 ? 126  GLU B O   1 
ATOM   3360 C  CB  . GLU B 1 126 ? 46.259 -40.854 122.404 1.00 21.24 ? 126  GLU B CB  1 
ATOM   3361 C  CG  . GLU B 1 126 ? 47.554 -41.616 122.122 1.00 21.29 ? 126  GLU B CG  1 
ATOM   3362 C  CD  . GLU B 1 126 ? 48.755 -40.702 121.953 1.00 21.22 ? 126  GLU B CD  1 
ATOM   3363 O  OE1 . GLU B 1 126 ? 49.013 -39.902 122.875 1.00 21.56 ? 126  GLU B OE1 1 
ATOM   3364 O  OE2 . GLU B 1 126 ? 49.451 -40.788 120.917 1.00 21.24 ? 126  GLU B OE2 1 
HETATM 3365 N  N   . CSO B 1 127 ? 43.707 -39.172 120.216 1.00 24.69 ? 127  CSO B N   1 
HETATM 3366 C  CA  . CSO B 1 127 ? 42.333 -38.680 120.109 1.00 27.70 ? 127  CSO B CA  1 
HETATM 3367 C  CB  . CSO B 1 127 ? 42.263 -37.257 120.661 1.00 30.05 ? 127  CSO B CB  1 
HETATM 3368 S  SG  . CSO B 1 127 ? 40.616 -36.608 120.652 1.00 37.18 ? 127  CSO B SG  1 
HETATM 3369 C  C   . CSO B 1 127 ? 41.997 -38.684 118.640 1.00 27.15 ? 127  CSO B C   1 
HETATM 3370 O  O   . CSO B 1 127 ? 42.749 -38.136 117.837 1.00 25.62 ? 127  CSO B O   1 
HETATM 3371 O  OD  . CSO B 1 127 ? 39.729 -37.764 121.596 1.00 33.14 ? 127  CSO B OD  1 
ATOM   3372 N  N   . ALA B 1 128 ? 40.873 -39.303 118.276 1.00 28.45 ? 128  ALA B N   1 
ATOM   3373 C  CA  . ALA B 1 128 ? 40.504 -39.501 116.863 1.00 29.30 ? 128  ALA B CA  1 
ATOM   3374 C  C   . ALA B 1 128 ? 40.459 -38.206 116.056 1.00 30.19 ? 128  ALA B C   1 
ATOM   3375 O  O   . ALA B 1 128 ? 40.882 -38.180 114.902 1.00 29.86 ? 128  ALA B O   1 
ATOM   3376 C  CB  . ALA B 1 128 ? 39.167 -40.227 116.753 1.00 29.37 ? 128  ALA B CB  1 
ATOM   3377 N  N   . SER B 1 129 ? 39.953 -37.137 116.668 1.00 30.76 ? 129  SER B N   1 
ATOM   3378 C  CA  . SER B 1 129 ? 39.822 -35.848 115.990 1.00 31.28 ? 129  SER B CA  1 
ATOM   3379 C  C   . SER B 1 129 ? 41.169 -35.255 115.577 1.00 31.24 ? 129  SER B C   1 
ATOM   3380 O  O   . SER B 1 129 ? 41.263 -34.571 114.556 1.00 30.44 ? 129  SER B O   1 
ATOM   3381 C  CB  . SER B 1 129 ? 39.067 -34.858 116.880 1.00 32.19 ? 129  SER B CB  1 
ATOM   3382 O  OG  . SER B 1 129 ? 39.748 -34.656 118.104 1.00 32.89 ? 129  SER B OG  1 
ATOM   3383 N  N   . ILE B 1 130 ? 42.208 -35.517 116.371 1.00 30.01 ? 130  ILE B N   1 
ATOM   3384 C  CA  . ILE B 1 130 ? 43.546 -35.027 116.069 1.00 29.99 ? 130  ILE B CA  1 
ATOM   3385 C  C   . ILE B 1 130 ? 44.263 -35.977 115.116 1.00 29.76 ? 130  ILE B C   1 
ATOM   3386 O  O   . ILE B 1 130 ? 44.742 -35.545 114.062 1.00 30.64 ? 130  ILE B O   1 
ATOM   3387 C  CB  . ILE B 1 130 ? 44.383 -34.822 117.359 1.00 30.24 ? 130  ILE B CB  1 
ATOM   3388 C  CG1 . ILE B 1 130 ? 43.719 -33.773 118.263 1.00 30.53 ? 130  ILE B CG1 1 
ATOM   3389 C  CG2 . ILE B 1 130 ? 45.816 -34.422 117.030 1.00 29.78 ? 130  ILE B CG2 1 
ATOM   3390 C  CD1 . ILE B 1 130 ? 43.639 -32.379 117.671 1.00 31.37 ? 130  ILE B CD1 1 
ATOM   3391 N  N   . ASN B 1 131 ? 44.338 -37.263 115.465 1.00 29.54 ? 131  ASN B N   1 
ATOM   3392 C  CA  . ASN B 1 131 ? 45.102 -38.207 114.635 1.00 29.21 ? 131  ASN B CA  1 
ATOM   3393 C  C   . ASN B 1 131 ? 44.431 -38.573 113.302 1.00 29.40 ? 131  ASN B C   1 
ATOM   3394 O  O   . ASN B 1 131 ? 45.030 -39.270 112.480 1.00 28.62 ? 131  ASN B O   1 
ATOM   3395 C  CB  . ASN B 1 131 ? 45.620 -39.433 115.430 1.00 28.28 ? 131  ASN B CB  1 
ATOM   3396 C  CG  . ASN B 1 131 ? 44.531 -40.412 115.853 1.00 28.71 ? 131  ASN B CG  1 
ATOM   3397 O  OD1 . ASN B 1 131 ? 43.625 -40.742 115.089 1.00 29.40 ? 131  ASN B OD1 1 
ATOM   3398 N  ND2 . ASN B 1 131 ? 44.649 -40.919 117.080 1.00 28.51 ? 131  ASN B ND2 1 
ATOM   3399 N  N   . ARG B 1 132 ? 43.215 -38.077 113.071 1.00 30.67 ? 132  ARG B N   1 
ATOM   3400 C  CA  . ARG B 1 132 ? 42.623 -38.150 111.734 1.00 31.32 ? 132  ARG B CA  1 
ATOM   3401 C  C   . ARG B 1 132 ? 43.274 -37.156 110.775 1.00 31.54 ? 132  ARG B C   1 
ATOM   3402 O  O   . ARG B 1 132 ? 43.305 -37.391 109.566 1.00 32.55 ? 132  ARG B O   1 
ATOM   3403 C  CB  . ARG B 1 132 ? 41.109 -37.914 111.756 1.00 33.11 ? 132  ARG B CB  1 
ATOM   3404 C  CG  . ARG B 1 132 ? 40.392 -38.537 110.560 1.00 34.85 ? 132  ARG B CG  1 
ATOM   3405 C  CD  . ARG B 1 132 ? 39.492 -37.549 109.843 1.00 36.65 ? 132  ARG B CD  1 
ATOM   3406 N  NE  . ARG B 1 132 ? 39.073 -38.041 108.530 1.00 39.04 ? 132  ARG B NE  1 
ATOM   3407 C  CZ  . ARG B 1 132 ? 39.845 -38.087 107.443 1.00 40.55 ? 132  ARG B CZ  1 
ATOM   3408 N  NH1 . ARG B 1 132 ? 41.116 -37.690 107.480 1.00 41.43 ? 132  ARG B NH1 1 
ATOM   3409 N  NH2 . ARG B 1 132 ? 39.344 -38.548 106.300 1.00 42.09 ? 132  ARG B NH2 1 
ATOM   3410 N  N   . ILE B 1 133 ? 43.782 -36.050 111.314 1.00 31.36 ? 133  ILE B N   1 
ATOM   3411 C  CA  . ILE B 1 133 ? 44.375 -34.978 110.508 1.00 31.76 ? 133  ILE B CA  1 
ATOM   3412 C  C   . ILE B 1 133 ? 45.881 -35.144 110.297 1.00 30.68 ? 133  ILE B C   1 
ATOM   3413 O  O   . ILE B 1 133 ? 46.382 -34.880 109.204 1.00 29.97 ? 133  ILE B O   1 
ATOM   3414 C  CB  . ILE B 1 133 ? 44.133 -33.595 111.160 1.00 32.54 ? 133  ILE B CB  1 
ATOM   3415 C  CG1 . ILE B 1 133 ? 42.631 -33.295 111.226 1.00 33.00 ? 133  ILE B CG1 1 
ATOM   3416 C  CG2 . ILE B 1 133 ? 44.865 -32.493 110.394 1.00 33.83 ? 133  ILE B CG2 1 
ATOM   3417 C  CD1 . ILE B 1 133 ? 42.274 -32.093 112.081 1.00 33.42 ? 133  ILE B CD1 1 
ATOM   3418 N  N   . TYR B 1 134 ? 46.602 -35.567 111.335 1.00 29.79 ? 134  TYR B N   1 
ATOM   3419 C  CA  . TYR B 1 134 ? 48.066 -35.433 111.344 1.00 29.31 ? 134  TYR B CA  1 
ATOM   3420 C  C   . TYR B 1 134 ? 48.848 -36.692 110.986 1.00 27.49 ? 134  TYR B C   1 
ATOM   3421 O  O   . TYR B 1 134 ? 50.059 -36.753 111.218 1.00 27.04 ? 134  TYR B O   1 
ATOM   3422 C  CB  . TYR B 1 134 ? 48.529 -34.874 112.693 1.00 30.12 ? 134  TYR B CB  1 
ATOM   3423 C  CG  . TYR B 1 134 ? 48.120 -33.437 112.894 1.00 31.50 ? 134  TYR B CG  1 
ATOM   3424 C  CD1 . TYR B 1 134 ? 48.846 -32.399 112.317 1.00 31.61 ? 134  TYR B CD1 1 
ATOM   3425 C  CD2 . TYR B 1 134 ? 46.995 -33.115 113.644 1.00 32.27 ? 134  TYR B CD2 1 
ATOM   3426 C  CE1 . TYR B 1 134 ? 48.467 -31.078 112.491 1.00 32.79 ? 134  TYR B CE1 1 
ATOM   3427 C  CE2 . TYR B 1 134 ? 46.609 -31.801 113.824 1.00 33.38 ? 134  TYR B CE2 1 
ATOM   3428 C  CZ  . TYR B 1 134 ? 47.347 -30.787 113.248 1.00 33.68 ? 134  TYR B CZ  1 
ATOM   3429 O  OH  . TYR B 1 134 ? 46.956 -29.483 113.433 1.00 36.53 ? 134  TYR B OH  1 
ATOM   3430 N  N   . GLY B 1 135 ? 48.171 -37.689 110.415 1.00 26.05 ? 135  GLY B N   1 
ATOM   3431 C  CA  . GLY B 1 135 ? 48.870 -38.786 109.746 1.00 25.22 ? 135  GLY B CA  1 
ATOM   3432 C  C   . GLY B 1 135 ? 48.463 -40.207 110.085 1.00 24.26 ? 135  GLY B C   1 
ATOM   3433 O  O   . GLY B 1 135 ? 48.642 -41.103 109.260 1.00 22.94 ? 135  GLY B O   1 
ATOM   3434 N  N   . PHE B 1 136 ? 47.934 -40.435 111.287 1.00 24.04 ? 136  PHE B N   1 
ATOM   3435 C  CA  . PHE B 1 136 ? 47.724 -41.815 111.756 1.00 24.29 ? 136  PHE B CA  1 
ATOM   3436 C  C   . PHE B 1 136 ? 46.591 -42.498 111.000 1.00 24.97 ? 136  PHE B C   1 
ATOM   3437 O  O   . PHE B 1 136 ? 46.702 -43.667 110.633 1.00 25.47 ? 136  PHE B O   1 
ATOM   3438 C  CB  . PHE B 1 136 ? 47.467 -41.855 113.268 1.00 24.04 ? 136  PHE B CB  1 
ATOM   3439 C  CG  . PHE B 1 136 ? 47.416 -43.249 113.846 1.00 23.75 ? 136  PHE B CG  1 
ATOM   3440 C  CD1 . PHE B 1 136 ? 48.393 -44.192 113.532 1.00 23.18 ? 136  PHE B CD1 1 
ATOM   3441 C  CD2 . PHE B 1 136 ? 46.402 -43.610 114.718 1.00 23.94 ? 136  PHE B CD2 1 
ATOM   3442 C  CE1 . PHE B 1 136 ? 48.354 -45.466 114.071 1.00 23.21 ? 136  PHE B CE1 1 
ATOM   3443 C  CE2 . PHE B 1 136 ? 46.348 -44.889 115.255 1.00 24.29 ? 136  PHE B CE2 1 
ATOM   3444 C  CZ  . PHE B 1 136 ? 47.326 -45.817 114.937 1.00 24.37 ? 136  PHE B CZ  1 
ATOM   3445 N  N   . TYR B 1 137 ? 45.501 -41.764 110.780 1.00 25.93 ? 137  TYR B N   1 
ATOM   3446 C  CA  . TYR B 1 137 ? 44.392 -42.236 109.950 1.00 26.72 ? 137  TYR B CA  1 
ATOM   3447 C  C   . TYR B 1 137 ? 44.885 -42.612 108.550 1.00 26.74 ? 137  TYR B C   1 
ATOM   3448 O  O   . TYR B 1 137 ? 44.556 -43.682 108.039 1.00 26.23 ? 137  TYR B O   1 
ATOM   3449 C  CB  . TYR B 1 137 ? 43.306 -41.161 109.874 1.00 27.09 ? 137  TYR B CB  1 
ATOM   3450 C  CG  . TYR B 1 137 ? 42.221 -41.385 108.841 1.00 28.18 ? 137  TYR B CG  1 
ATOM   3451 C  CD1 . TYR B 1 137 ? 42.401 -40.981 107.518 1.00 28.88 ? 137  TYR B CD1 1 
ATOM   3452 C  CD2 . TYR B 1 137 ? 41.008 -41.973 109.189 1.00 28.39 ? 137  TYR B CD2 1 
ATOM   3453 C  CE1 . TYR B 1 137 ? 41.412 -41.176 106.566 1.00 29.79 ? 137  TYR B CE1 1 
ATOM   3454 C  CE2 . TYR B 1 137 ? 40.007 -42.165 108.246 1.00 29.27 ? 137  TYR B CE2 1 
ATOM   3455 C  CZ  . TYR B 1 137 ? 40.218 -41.764 106.936 1.00 30.01 ? 137  TYR B CZ  1 
ATOM   3456 O  OH  . TYR B 1 137 ? 39.243 -41.953 105.988 1.00 31.46 ? 137  TYR B OH  1 
ATOM   3457 N  N   . ASP B 1 138 ? 45.676 -41.730 107.945 1.00 27.08 ? 138  ASP B N   1 
ATOM   3458 C  CA  . ASP B 1 138 ? 46.234 -41.975 106.615 1.00 28.46 ? 138  ASP B CA  1 
ATOM   3459 C  C   . ASP B 1 138 ? 47.146 -43.194 106.581 1.00 27.54 ? 138  ASP B C   1 
ATOM   3460 O  O   . ASP B 1 138 ? 47.153 -43.932 105.596 1.00 25.94 ? 138  ASP B O   1 
ATOM   3461 C  CB  . ASP B 1 138 ? 47.004 -40.751 106.106 1.00 29.63 ? 138  ASP B CB  1 
ATOM   3462 C  CG  . ASP B 1 138 ? 46.095 -39.582 105.772 1.00 30.78 ? 138  ASP B CG  1 
ATOM   3463 O  OD1 . ASP B 1 138 ? 44.937 -39.812 105.366 1.00 32.25 ? 138  ASP B OD1 1 
ATOM   3464 O  OD2 . ASP B 1 138 ? 46.542 -38.428 105.912 1.00 32.55 ? 138  ASP B OD2 1 
ATOM   3465 N  N   . GLU B 1 139 ? 47.926 -43.393 107.642 1.00 27.06 ? 139  GLU B N   1 
ATOM   3466 C  CA  . GLU B 1 139 ? 48.821 -44.543 107.719 1.00 26.54 ? 139  GLU B CA  1 
ATOM   3467 C  C   . GLU B 1 139 ? 48.027 -45.845 107.858 1.00 26.90 ? 139  GLU B C   1 
ATOM   3468 O  O   . GLU B 1 139 ? 48.312 -46.826 107.167 1.00 26.03 ? 139  GLU B O   1 
ATOM   3469 C  CB  . GLU B 1 139 ? 49.822 -44.392 108.871 1.00 26.07 ? 139  GLU B CB  1 
ATOM   3470 C  CG  . GLU B 1 139 ? 50.946 -45.415 108.815 1.00 26.42 ? 139  GLU B CG  1 
ATOM   3471 C  CD  . GLU B 1 139 ? 51.936 -45.291 109.961 1.00 26.52 ? 139  GLU B CD  1 
ATOM   3472 O  OE1 . GLU B 1 139 ? 52.219 -44.160 110.406 1.00 25.27 ? 139  GLU B OE1 1 
ATOM   3473 O  OE2 . GLU B 1 139 ? 52.450 -46.336 110.402 1.00 26.81 ? 139  GLU B OE2 1 
ATOM   3474 N  N   . CYS B 1 140 ? 47.031 -45.842 108.742 1.00 27.91 ? 140  CYS B N   1 
ATOM   3475 C  CA  . CYS B 1 140 ? 46.144 -46.991 108.916 1.00 28.83 ? 140  CYS B CA  1 
ATOM   3476 C  C   . CYS B 1 140 ? 45.411 -47.364 107.623 1.00 30.15 ? 140  CYS B C   1 
ATOM   3477 O  O   . CYS B 1 140 ? 45.232 -48.546 107.322 1.00 30.32 ? 140  CYS B O   1 
ATOM   3478 C  CB  . CYS B 1 140 ? 45.112 -46.718 110.012 1.00 28.36 ? 140  CYS B CB  1 
ATOM   3479 S  SG  . CYS B 1 140 ? 45.771 -46.792 111.690 1.00 28.32 ? 140  CYS B SG  1 
ATOM   3480 N  N   . LYS B 1 141 ? 44.976 -46.354 106.878 1.00 31.37 ? 141  LYS B N   1 
ATOM   3481 C  CA  . LYS B 1 141 ? 44.261 -46.571 105.621 1.00 33.41 ? 141  LYS B CA  1 
ATOM   3482 C  C   . LYS B 1 141 ? 45.182 -47.167 104.557 1.00 33.97 ? 141  LYS B C   1 
ATOM   3483 O  O   . LYS B 1 141 ? 44.824 -48.142 103.895 1.00 34.40 ? 141  LYS B O   1 
ATOM   3484 C  CB  . LYS B 1 141 ? 43.657 -45.257 105.121 1.00 34.32 ? 141  LYS B CB  1 
ATOM   3485 C  CG  . LYS B 1 141 ? 42.683 -45.423 103.967 1.00 35.08 ? 141  LYS B CG  1 
ATOM   3486 C  CD  . LYS B 1 141 ? 42.192 -44.081 103.460 1.00 35.78 ? 141  LYS B CD  1 
ATOM   3487 C  CE  . LYS B 1 141 ? 41.442 -44.244 102.148 1.00 36.32 ? 141  LYS B CE  1 
ATOM   3488 N  NZ  . LYS B 1 141 ? 40.949 -42.944 101.619 1.00 37.43 ? 141  LYS B NZ  1 
ATOM   3489 N  N   . ARG B 1 142 ? 46.368 -46.581 104.407 1.00 34.09 ? 142  ARG B N   1 
ATOM   3490 C  CA  . ARG B 1 142 ? 47.348 -47.045 103.426 1.00 34.77 ? 142  ARG B CA  1 
ATOM   3491 C  C   . ARG B 1 142 ? 47.791 -48.486 103.676 1.00 35.06 ? 142  ARG B C   1 
ATOM   3492 O  O   . ARG B 1 142 ? 47.905 -49.273 102.734 1.00 34.20 ? 142  ARG B O   1 
ATOM   3493 C  CB  . ARG B 1 142 ? 48.584 -46.134 103.422 1.00 36.25 ? 142  ARG B CB  1 
ATOM   3494 C  CG  . ARG B 1 142 ? 49.727 -46.645 102.554 1.00 36.88 ? 142  ARG B CG  1 
ATOM   3495 C  CD  . ARG B 1 142 ? 50.829 -45.618 102.358 1.00 38.19 ? 142  ARG B CD  1 
ATOM   3496 N  NE  . ARG B 1 142 ? 51.802 -45.652 103.454 1.00 40.54 ? 142  ARG B NE  1 
ATOM   3497 C  CZ  . ARG B 1 142 ? 51.777 -44.877 104.538 1.00 41.05 ? 142  ARG B CZ  1 
ATOM   3498 N  NH1 . ARG B 1 142 ? 50.824 -43.962 104.717 1.00 42.56 ? 142  ARG B NH1 1 
ATOM   3499 N  NH2 . ARG B 1 142 ? 52.726 -45.017 105.459 1.00 41.97 ? 142  ARG B NH2 1 
ATOM   3500 N  N   . ARG B 1 143 ? 48.047 -48.819 104.940 1.00 33.93 ? 143  ARG B N   1 
ATOM   3501 C  CA  . ARG B 1 143 ? 48.655 -50.100 105.287 1.00 33.62 ? 143  ARG B CA  1 
ATOM   3502 C  C   . ARG B 1 143 ? 47.657 -51.181 105.707 1.00 32.88 ? 143  ARG B C   1 
ATOM   3503 O  O   . ARG B 1 143 ? 47.952 -52.367 105.573 1.00 32.56 ? 143  ARG B O   1 
ATOM   3504 C  CB  . ARG B 1 143 ? 49.694 -49.905 106.387 1.00 34.31 ? 143  ARG B CB  1 
ATOM   3505 C  CG  . ARG B 1 143 ? 50.896 -49.075 105.955 1.00 34.88 ? 143  ARG B CG  1 
ATOM   3506 C  CD  . ARG B 1 143 ? 52.076 -49.311 106.878 1.00 35.73 ? 143  ARG B CD  1 
ATOM   3507 N  NE  . ARG B 1 143 ? 52.531 -50.703 106.821 1.00 37.08 ? 143  ARG B NE  1 
ATOM   3508 C  CZ  . ARG B 1 143 ? 53.275 -51.309 107.746 1.00 38.81 ? 143  ARG B CZ  1 
ATOM   3509 N  NH1 . ARG B 1 143 ? 53.684 -50.666 108.836 1.00 37.68 ? 143  ARG B NH1 1 
ATOM   3510 N  NH2 . ARG B 1 143 ? 53.618 -52.582 107.578 1.00 40.31 ? 143  ARG B NH2 1 
ATOM   3511 N  N   . TYR B 1 144 ? 46.491 -50.784 106.213 1.00 32.96 ? 144  TYR B N   1 
ATOM   3512 C  CA  . TYR B 1 144 ? 45.469 -51.746 106.643 1.00 33.96 ? 144  TYR B CA  1 
ATOM   3513 C  C   . TYR B 1 144 ? 44.069 -51.274 106.218 1.00 35.03 ? 144  TYR B C   1 
ATOM   3514 O  O   . TYR B 1 144 ? 43.736 -51.343 105.034 1.00 36.71 ? 144  TYR B O   1 
ATOM   3515 C  CB  . TYR B 1 144 ? 45.587 -52.000 108.154 1.00 34.00 ? 144  TYR B CB  1 
ATOM   3516 C  CG  . TYR B 1 144 ? 46.898 -52.646 108.532 1.00 33.54 ? 144  TYR B CG  1 
ATOM   3517 C  CD1 . TYR B 1 144 ? 48.016 -51.875 108.828 1.00 33.14 ? 144  TYR B CD1 1 
ATOM   3518 C  CD2 . TYR B 1 144 ? 47.028 -54.030 108.561 1.00 33.19 ? 144  TYR B CD2 1 
ATOM   3519 C  CE1 . TYR B 1 144 ? 49.227 -52.462 109.151 1.00 33.19 ? 144  TYR B CE1 1 
ATOM   3520 C  CE2 . TYR B 1 144 ? 48.231 -54.626 108.886 1.00 33.95 ? 144  TYR B CE2 1 
ATOM   3521 C  CZ  . TYR B 1 144 ? 49.327 -53.837 109.181 1.00 33.23 ? 144  TYR B CZ  1 
ATOM   3522 O  OH  . TYR B 1 144 ? 50.517 -54.425 109.505 1.00 33.17 ? 144  TYR B OH  1 
ATOM   3523 N  N   . ASN B 1 145 ? 43.255 -50.798 107.156 1.00 35.19 ? 145  ASN B N   1 
ATOM   3524 C  CA  . ASN B 1 145 ? 41.946 -50.240 106.828 1.00 36.31 ? 145  ASN B CA  1 
ATOM   3525 C  C   . ASN B 1 145 ? 41.458 -49.279 107.906 1.00 36.56 ? 145  ASN B C   1 
ATOM   3526 O  O   . ASN B 1 145 ? 42.064 -49.175 108.979 1.00 36.63 ? 145  ASN B O   1 
ATOM   3527 C  CB  . ASN B 1 145 ? 40.921 -51.360 106.591 1.00 37.71 ? 145  ASN B CB  1 
ATOM   3528 C  CG  . ASN B 1 145 ? 40.811 -52.322 107.765 1.00 38.04 ? 145  ASN B CG  1 
ATOM   3529 O  OD1 . ASN B 1 145 ? 40.543 -51.919 108.895 1.00 38.58 ? 145  ASN B OD1 1 
ATOM   3530 N  ND2 . ASN B 1 145 ? 41.001 -53.607 107.494 1.00 38.44 ? 145  ASN B ND2 1 
ATOM   3531 N  N   . ILE B 1 146 ? 40.351 -48.596 107.618 1.00 36.67 ? 146  ILE B N   1 
ATOM   3532 C  CA  . ILE B 1 146 ? 39.777 -47.599 108.526 1.00 37.57 ? 146  ILE B CA  1 
ATOM   3533 C  C   . ILE B 1 146 ? 39.205 -48.233 109.796 1.00 36.30 ? 146  ILE B C   1 
ATOM   3534 O  O   . ILE B 1 146 ? 39.226 -47.614 110.860 1.00 37.28 ? 146  ILE B O   1 
ATOM   3535 C  CB  . ILE B 1 146 ? 38.678 -46.758 107.827 1.00 38.48 ? 146  ILE B CB  1 
ATOM   3536 C  CG1 . ILE B 1 146 ? 39.222 -46.103 106.552 1.00 39.28 ? 146  ILE B CG1 1 
ATOM   3537 C  CG2 . ILE B 1 146 ? 38.123 -45.688 108.765 1.00 39.76 ? 146  ILE B CG2 1 
ATOM   3538 C  CD1 . ILE B 1 146 ? 40.525 -45.359 106.740 1.00 38.55 ? 146  ILE B CD1 1 
ATOM   3539 N  N   . LYS B 1 147 ? 38.698 -49.459 109.692 1.00 35.73 ? 147  LYS B N   1 
ATOM   3540 C  CA  . LYS B 1 147 ? 38.192 -50.181 110.863 1.00 34.75 ? 147  LYS B CA  1 
ATOM   3541 C  C   . LYS B 1 147 ? 39.274 -50.389 111.926 1.00 33.26 ? 147  LYS B C   1 
ATOM   3542 O  O   . LYS B 1 147 ? 38.992 -50.300 113.124 1.00 32.61 ? 147  LYS B O   1 
ATOM   3543 C  CB  . LYS B 1 147 ? 37.579 -51.529 110.465 1.00 36.50 ? 147  LYS B CB  1 
ATOM   3544 C  CG  . LYS B 1 147 ? 36.128 -51.422 110.028 1.00 38.82 ? 147  LYS B CG  1 
ATOM   3545 C  CD  . LYS B 1 147 ? 35.602 -52.730 109.460 1.00 39.61 ? 147  LYS B CD  1 
ATOM   3546 C  CE  . LYS B 1 147 ? 34.099 -52.646 109.243 1.00 40.58 ? 147  LYS B CE  1 
ATOM   3547 N  NZ  . LYS B 1 147 ? 33.535 -53.891 108.660 1.00 41.18 ? 147  LYS B NZ  1 
ATOM   3548 N  N   . LEU B 1 148 ? 40.501 -50.659 111.489 1.00 31.42 ? 148  LEU B N   1 
ATOM   3549 C  CA  . LEU B 1 148 ? 41.624 -50.840 112.411 1.00 31.22 ? 148  LEU B CA  1 
ATOM   3550 C  C   . LEU B 1 148 ? 41.926 -49.546 113.160 1.00 30.67 ? 148  LEU B C   1 
ATOM   3551 O  O   . LEU B 1 148 ? 42.188 -49.563 114.362 1.00 31.09 ? 148  LEU B O   1 
ATOM   3552 C  CB  . LEU B 1 148 ? 42.875 -51.297 111.662 1.00 31.63 ? 148  LEU B CB  1 
ATOM   3553 C  CG  . LEU B 1 148 ? 44.076 -51.659 112.546 1.00 31.52 ? 148  LEU B CG  1 
ATOM   3554 C  CD1 . LEU B 1 148 ? 43.757 -52.873 113.405 1.00 31.47 ? 148  LEU B CD1 1 
ATOM   3555 C  CD2 . LEU B 1 148 ? 45.309 -51.912 111.697 1.00 32.32 ? 148  LEU B CD2 1 
ATOM   3556 N  N   . TRP B 1 149 ? 41.903 -48.433 112.432 1.00 29.45 ? 149  TRP B N   1 
ATOM   3557 C  CA  . TRP B 1 149 ? 42.067 -47.112 113.028 1.00 28.42 ? 149  TRP B CA  1 
ATOM   3558 C  C   . TRP B 1 149 ? 41.015 -46.832 114.107 1.00 28.78 ? 149  TRP B C   1 
ATOM   3559 O  O   . TRP B 1 149 ? 41.334 -46.258 115.152 1.00 27.06 ? 149  TRP B O   1 
ATOM   3560 C  CB  . TRP B 1 149 ? 42.016 -46.039 111.934 1.00 27.96 ? 149  TRP B CB  1 
ATOM   3561 C  CG  . TRP B 1 149 ? 42.087 -44.646 112.453 1.00 27.29 ? 149  TRP B CG  1 
ATOM   3562 C  CD1 . TRP B 1 149 ? 43.182 -44.020 112.982 1.00 26.60 ? 149  TRP B CD1 1 
ATOM   3563 C  CD2 . TRP B 1 149 ? 41.016 -43.698 112.503 1.00 27.45 ? 149  TRP B CD2 1 
ATOM   3564 N  NE1 . TRP B 1 149 ? 42.859 -42.735 113.345 1.00 26.37 ? 149  TRP B NE1 1 
ATOM   3565 C  CE2 . TRP B 1 149 ? 41.534 -42.514 113.064 1.00 27.20 ? 149  TRP B CE2 1 
ATOM   3566 C  CE3 . TRP B 1 149 ? 39.664 -43.733 112.122 1.00 27.34 ? 149  TRP B CE3 1 
ATOM   3567 C  CZ2 . TRP B 1 149 ? 40.751 -41.375 113.260 1.00 26.92 ? 149  TRP B CZ2 1 
ATOM   3568 C  CZ3 . TRP B 1 149 ? 38.890 -42.603 112.316 1.00 26.89 ? 149  TRP B CZ3 1 
ATOM   3569 C  CH2 . TRP B 1 149 ? 39.437 -41.438 112.879 1.00 27.15 ? 149  TRP B CH2 1 
ATOM   3570 N  N   . LYS B 1 150 ? 39.767 -47.240 113.863 1.00 29.96 ? 150  LYS B N   1 
ATOM   3571 C  CA  . LYS B 1 150 ? 38.707 -47.081 114.866 1.00 30.89 ? 150  LYS B CA  1 
ATOM   3572 C  C   . LYS B 1 150 ? 38.974 -47.944 116.100 1.00 29.74 ? 150  LYS B C   1 
ATOM   3573 O  O   . LYS B 1 150 ? 38.658 -47.536 117.214 1.00 29.72 ? 150  LYS B O   1 
ATOM   3574 C  CB  . LYS B 1 150 ? 37.321 -47.390 114.282 1.00 33.86 ? 150  LYS B CB  1 
ATOM   3575 C  CG  . LYS B 1 150 ? 36.822 -46.338 113.302 1.00 36.60 ? 150  LYS B CG  1 
ATOM   3576 C  CD  . LYS B 1 150 ? 35.351 -46.529 112.952 1.00 39.44 ? 150  LYS B CD  1 
ATOM   3577 C  CE  . LYS B 1 150 ? 34.813 -45.340 112.172 1.00 41.56 ? 150  LYS B CE  1 
ATOM   3578 N  NZ  . LYS B 1 150 ? 33.340 -45.420 111.952 1.00 43.11 ? 150  LYS B NZ  1 
ATOM   3579 N  N   . THR B 1 151 ? 39.556 -49.127 115.905 1.00 28.29 ? 151  THR B N   1 
ATOM   3580 C  CA  . THR B 1 151 ? 39.939 -49.990 117.025 1.00 28.29 ? 151  THR B CA  1 
ATOM   3581 C  C   . THR B 1 151 ? 41.044 -49.357 117.889 1.00 28.17 ? 151  THR B C   1 
ATOM   3582 O  O   . THR B 1 151 ? 41.043 -49.519 119.114 1.00 27.94 ? 151  THR B O   1 
ATOM   3583 C  CB  . THR B 1 151 ? 40.379 -51.388 116.539 1.00 29.34 ? 151  THR B CB  1 
ATOM   3584 O  OG1 . THR B 1 151 ? 39.295 -52.021 115.850 1.00 29.14 ? 151  THR B OG1 1 
ATOM   3585 C  CG2 . THR B 1 151 ? 40.795 -52.262 117.707 1.00 29.90 ? 151  THR B CG2 1 
ATOM   3586 N  N   . PHE B 1 152 ? 41.973 -48.638 117.260 1.00 27.47 ? 152  PHE B N   1 
ATOM   3587 C  CA  . PHE B 1 152 ? 42.978 -47.872 118.008 1.00 28.12 ? 152  PHE B CA  1 
ATOM   3588 C  C   . PHE B 1 152 ? 42.326 -46.771 118.843 1.00 28.77 ? 152  PHE B C   1 
ATOM   3589 O  O   . PHE B 1 152 ? 42.694 -46.560 120.004 1.00 27.93 ? 152  PHE B O   1 
ATOM   3590 C  CB  . PHE B 1 152 ? 44.035 -47.267 117.077 1.00 27.32 ? 152  PHE B CB  1 
ATOM   3591 C  CG  . PHE B 1 152 ? 45.174 -48.193 116.767 1.00 26.57 ? 152  PHE B CG  1 
ATOM   3592 C  CD1 . PHE B 1 152 ? 46.106 -48.512 117.743 1.00 26.23 ? 152  PHE B CD1 1 
ATOM   3593 C  CD2 . PHE B 1 152 ? 45.324 -48.736 115.499 1.00 27.23 ? 152  PHE B CD2 1 
ATOM   3594 C  CE1 . PHE B 1 152 ? 47.159 -49.364 117.466 1.00 26.12 ? 152  PHE B CE1 1 
ATOM   3595 C  CE2 . PHE B 1 152 ? 46.380 -49.587 115.210 1.00 26.76 ? 152  PHE B CE2 1 
ATOM   3596 C  CZ  . PHE B 1 152 ? 47.301 -49.901 116.195 1.00 26.48 ? 152  PHE B CZ  1 
ATOM   3597 N  N   . THR B 1 153 ? 41.352 -46.083 118.251 1.00 29.47 ? 153  THR B N   1 
ATOM   3598 C  CA  . THR B 1 153 ? 40.590 -45.042 118.943 1.00 30.93 ? 153  THR B CA  1 
ATOM   3599 C  C   . THR B 1 153 ? 39.960 -45.537 120.247 1.00 29.74 ? 153  THR B C   1 
ATOM   3600 O  O   . THR B 1 153 ? 40.096 -44.879 121.282 1.00 29.56 ? 153  THR B O   1 
ATOM   3601 C  CB  . THR B 1 153 ? 39.486 -44.472 118.029 1.00 31.53 ? 153  THR B CB  1 
ATOM   3602 O  OG1 . THR B 1 153 ? 40.096 -43.864 116.885 1.00 33.19 ? 153  THR B OG1 1 
ATOM   3603 C  CG2 . THR B 1 153 ? 38.633 -43.442 118.765 1.00 32.55 ? 153  THR B CG2 1 
ATOM   3604 N  N   . ASP B 1 154 ? 39.262 -46.674 120.183 1.00 29.70 ? 154  ASP B N   1 
ATOM   3605 C  CA  A ASP B 1 154 ? 38.650 -47.273 121.374 0.50 28.99 ? 154  ASP B CA  1 
ATOM   3606 C  CA  B ASP B 1 154 ? 38.655 -47.308 121.361 0.50 29.36 ? 154  ASP B CA  1 
ATOM   3607 C  C   . ASP B 1 154 ? 39.697 -47.580 122.442 1.00 28.58 ? 154  ASP B C   1 
ATOM   3608 O  O   . ASP B 1 154 ? 39.425 -47.434 123.633 1.00 28.03 ? 154  ASP B O   1 
ATOM   3609 C  CB  A ASP B 1 154 ? 37.902 -48.565 121.030 0.50 29.65 ? 154  ASP B CB  1 
ATOM   3610 C  CB  B ASP B 1 154 ? 37.983 -48.637 120.984 0.50 30.49 ? 154  ASP B CB  1 
ATOM   3611 C  CG  A ASP B 1 154 ? 36.803 -48.902 122.031 0.50 29.91 ? 154  ASP B CG  1 
ATOM   3612 C  CG  B ASP B 1 154 ? 36.711 -48.451 120.173 0.50 31.56 ? 154  ASP B CG  1 
ATOM   3613 O  OD1 A ASP B 1 154 ? 36.673 -48.195 123.056 0.50 30.93 ? 154  ASP B OD1 1 
ATOM   3614 O  OD1 B ASP B 1 154 ? 35.999 -47.448 120.395 0.50 32.07 ? 154  ASP B OD1 1 
ATOM   3615 O  OD2 A ASP B 1 154 ? 36.062 -49.882 121.788 0.50 30.66 ? 154  ASP B OD2 1 
ATOM   3616 O  OD2 B ASP B 1 154 ? 36.420 -49.320 119.318 0.50 32.33 ? 154  ASP B OD2 1 
ATOM   3617 N  N   . CYS B 1 155 ? 40.877 -48.020 122.009 1.00 26.57 ? 155  CYS B N   1 
ATOM   3618 C  CA  . CYS B 1 155 ? 41.996 -48.278 122.908 1.00 26.22 ? 155  CYS B CA  1 
ATOM   3619 C  C   . CYS B 1 155 ? 42.499 -46.980 123.543 1.00 24.35 ? 155  CYS B C   1 
ATOM   3620 O  O   . CYS B 1 155 ? 42.589 -46.873 124.770 1.00 23.62 ? 155  CYS B O   1 
ATOM   3621 C  CB  . CYS B 1 155 ? 43.127 -48.958 122.136 1.00 27.21 ? 155  CYS B CB  1 
ATOM   3622 S  SG  . CYS B 1 155 ? 44.556 -49.418 123.134 1.00 28.70 ? 155  CYS B SG  1 
ATOM   3623 N  N   . PHE B 1 156 ? 42.802 -45.997 122.698 1.00 22.48 ? 156  PHE B N   1 
ATOM   3624 C  CA  . PHE B 1 156 ? 43.295 -44.686 123.148 1.00 22.66 ? 156  PHE B CA  1 
ATOM   3625 C  C   . PHE B 1 156 ? 42.363 -44.006 124.157 1.00 22.13 ? 156  PHE B C   1 
ATOM   3626 O  O   . PHE B 1 156 ? 42.831 -43.391 125.126 1.00 22.12 ? 156  PHE B O   1 
ATOM   3627 C  CB  . PHE B 1 156 ? 43.501 -43.742 121.951 1.00 22.55 ? 156  PHE B CB  1 
ATOM   3628 C  CG  . PHE B 1 156 ? 44.652 -44.115 121.041 1.00 22.74 ? 156  PHE B CG  1 
ATOM   3629 C  CD1 . PHE B 1 156 ? 45.602 -45.069 121.399 1.00 23.33 ? 156  PHE B CD1 1 
ATOM   3630 C  CD2 . PHE B 1 156 ? 44.799 -43.466 119.818 1.00 23.22 ? 156  PHE B CD2 1 
ATOM   3631 C  CE1 . PHE B 1 156 ? 46.658 -45.376 120.551 1.00 23.51 ? 156  PHE B CE1 1 
ATOM   3632 C  CE2 . PHE B 1 156 ? 45.844 -43.771 118.966 1.00 23.39 ? 156  PHE B CE2 1 
ATOM   3633 C  CZ  . PHE B 1 156 ? 46.779 -44.728 119.331 1.00 23.78 ? 156  PHE B CZ  1 
ATOM   3634 N  N   . ASN B 1 157 ? 41.053 -44.125 123.935 1.00 21.41 ? 157  ASN B N   1 
ATOM   3635 C  CA  . ASN B 1 157 ? 40.051 -43.558 124.847 1.00 22.26 ? 157  ASN B CA  1 
ATOM   3636 C  C   . ASN B 1 157 ? 40.078 -44.117 126.275 1.00 21.84 ? 157  ASN B C   1 
ATOM   3637 O  O   . ASN B 1 157 ? 39.408 -43.570 127.170 1.00 22.62 ? 157  ASN B O   1 
ATOM   3638 C  CB  . ASN B 1 157 ? 38.635 -43.728 124.269 1.00 23.21 ? 157  ASN B CB  1 
ATOM   3639 C  CG  . ASN B 1 157 ? 38.387 -42.869 123.038 1.00 24.37 ? 157  ASN B CG  1 
ATOM   3640 O  OD1 . ASN B 1 157 ? 39.162 -41.968 122.721 1.00 25.88 ? 157  ASN B OD1 1 
ATOM   3641 N  ND2 . ASN B 1 157 ? 37.294 -43.150 122.337 1.00 25.75 ? 157  ASN B ND2 1 
ATOM   3642 N  N   . CYS B 1 158 ? 40.819 -45.204 126.483 1.00 21.52 ? 158  CYS B N   1 
ATOM   3643 C  CA  . CYS B 1 158 ? 40.975 -45.820 127.803 1.00 21.67 ? 158  CYS B CA  1 
ATOM   3644 C  C   . CYS B 1 158 ? 42.348 -45.604 128.470 1.00 21.91 ? 158  CYS B C   1 
ATOM   3645 O  O   . CYS B 1 158 ? 42.539 -46.007 129.614 1.00 22.17 ? 158  CYS B O   1 
ATOM   3646 C  CB  . CYS B 1 158 ? 40.691 -47.319 127.691 1.00 22.35 ? 158  CYS B CB  1 
ATOM   3647 S  SG  . CYS B 1 158 ? 38.995 -47.677 127.165 1.00 23.05 ? 158  CYS B SG  1 
ATOM   3648 N  N   . LEU B 1 159 ? 43.290 -44.970 127.773 1.00 21.01 ? 159  LEU B N   1 
ATOM   3649 C  CA  . LEU B 1 159 ? 44.605 -44.655 128.354 1.00 20.83 ? 159  LEU B CA  1 
ATOM   3650 C  C   . LEU B 1 159 ? 44.511 -43.830 129.651 1.00 20.94 ? 159  LEU B C   1 
ATOM   3651 O  O   . LEU B 1 159 ? 43.650 -42.964 129.764 1.00 20.95 ? 159  LEU B O   1 
ATOM   3652 C  CB  . LEU B 1 159 ? 45.463 -43.884 127.341 1.00 20.26 ? 159  LEU B CB  1 
ATOM   3653 C  CG  . LEU B 1 159 ? 46.100 -44.701 126.214 1.00 19.74 ? 159  LEU B CG  1 
ATOM   3654 C  CD1 . LEU B 1 159 ? 46.617 -43.792 125.104 1.00 19.88 ? 159  LEU B CD1 1 
ATOM   3655 C  CD2 . LEU B 1 159 ? 47.226 -45.560 126.760 1.00 19.58 ? 159  LEU B CD2 1 
ATOM   3656 N  N   . PRO B 1 160 ? 45.403 -44.091 130.627 1.00 20.71 ? 160  PRO B N   1 
ATOM   3657 C  CA  . PRO B 1 160 ? 45.469 -43.222 131.803 1.00 20.72 ? 160  PRO B CA  1 
ATOM   3658 C  C   . PRO B 1 160 ? 45.964 -41.814 131.476 1.00 20.27 ? 160  PRO B C   1 
ATOM   3659 O  O   . PRO B 1 160 ? 46.560 -41.582 130.425 1.00 19.90 ? 160  PRO B O   1 
ATOM   3660 C  CB  . PRO B 1 160 ? 46.459 -43.940 132.724 1.00 20.93 ? 160  PRO B CB  1 
ATOM   3661 C  CG  . PRO B 1 160 ? 47.323 -44.727 131.807 1.00 20.53 ? 160  PRO B CG  1 
ATOM   3662 C  CD  . PRO B 1 160 ? 46.425 -45.159 130.684 1.00 21.25 ? 160  PRO B CD  1 
ATOM   3663 N  N   . ILE B 1 161 ? 45.709 -40.889 132.389 1.00 20.64 ? 161  ILE B N   1 
ATOM   3664 C  CA  . ILE B 1 161 ? 45.853 -39.460 132.117 1.00 21.22 ? 161  ILE B CA  1 
ATOM   3665 C  C   . ILE B 1 161 ? 47.022 -38.814 132.853 1.00 22.04 ? 161  ILE B C   1 
ATOM   3666 O  O   . ILE B 1 161 ? 47.527 -37.778 132.419 1.00 23.02 ? 161  ILE B O   1 
ATOM   3667 C  CB  . ILE B 1 161 ? 44.543 -38.727 132.484 1.00 21.70 ? 161  ILE B CB  1 
ATOM   3668 C  CG1 . ILE B 1 161 ? 43.376 -39.296 131.667 1.00 21.73 ? 161  ILE B CG1 1 
ATOM   3669 C  CG2 . ILE B 1 161 ? 44.655 -37.219 132.272 1.00 21.90 ? 161  ILE B CG2 1 
ATOM   3670 C  CD1 . ILE B 1 161 ? 43.593 -39.287 130.176 1.00 21.79 ? 161  ILE B CD1 1 
ATOM   3671 N  N   . ALA B 1 162 ? 47.427 -39.391 133.980 1.00 22.36 ? 162  ALA B N   1 
ATOM   3672 C  CA  . ALA B 1 162 ? 48.524 -38.830 134.753 1.00 21.86 ? 162  ALA B CA  1 
ATOM   3673 C  C   . ALA B 1 162 ? 49.136 -39.885 135.648 1.00 22.30 ? 162  ALA B C   1 
ATOM   3674 O  O   . ALA B 1 162 ? 48.534 -40.938 135.896 1.00 21.77 ? 162  ALA B O   1 
ATOM   3675 C  CB  . ALA B 1 162 ? 48.045 -37.643 135.570 1.00 22.58 ? 162  ALA B CB  1 
ATOM   3676 N  N   . ALA B 1 163 ? 50.345 -39.602 136.116 1.00 22.80 ? 163  ALA B N   1 
ATOM   3677 C  CA  . ALA B 1 163 ? 51.033 -40.467 137.057 1.00 22.81 ? 163  ALA B CA  1 
ATOM   3678 C  C   . ALA B 1 163 ? 51.699 -39.619 138.136 1.00 23.13 ? 163  ALA B C   1 
ATOM   3679 O  O   . ALA B 1 163 ? 52.090 -38.474 137.894 1.00 22.22 ? 163  ALA B O   1 
ATOM   3680 C  CB  . ALA B 1 163 ? 52.063 -41.314 136.336 1.00 22.78 ? 163  ALA B CB  1 
ATOM   3681 N  N   . ILE B 1 164 ? 51.792 -40.179 139.335 1.00 24.59 ? 164  ILE B N   1 
ATOM   3682 C  CA  . ILE B 1 164 ? 52.557 -39.574 140.416 1.00 25.50 ? 164  ILE B CA  1 
ATOM   3683 C  C   . ILE B 1 164 ? 53.627 -40.588 140.794 1.00 25.55 ? 164  ILE B C   1 
ATOM   3684 O  O   . ILE B 1 164 ? 53.318 -41.736 141.117 1.00 25.21 ? 164  ILE B O   1 
ATOM   3685 C  CB  . ILE B 1 164 ? 51.670 -39.188 141.622 1.00 26.14 ? 164  ILE B CB  1 
ATOM   3686 C  CG1 . ILE B 1 164 ? 50.674 -38.097 141.205 1.00 26.57 ? 164  ILE B CG1 1 
ATOM   3687 C  CG2 . ILE B 1 164 ? 52.523 -38.669 142.784 1.00 26.49 ? 164  ILE B CG2 1 
ATOM   3688 C  CD1 . ILE B 1 164 ? 49.637 -37.752 142.255 1.00 26.67 ? 164  ILE B CD1 1 
ATOM   3689 N  N   . VAL B 1 165 ? 54.885 -40.165 140.720 1.00 26.07 ? 165  VAL B N   1 
ATOM   3690 C  CA  . VAL B 1 165 ? 56.011 -41.042 140.993 1.00 27.17 ? 165  VAL B CA  1 
ATOM   3691 C  C   . VAL B 1 165 ? 56.560 -40.740 142.383 1.00 29.40 ? 165  VAL B C   1 
ATOM   3692 O  O   . VAL B 1 165 ? 56.989 -39.618 142.650 1.00 29.41 ? 165  VAL B O   1 
ATOM   3693 C  CB  . VAL B 1 165 ? 57.139 -40.860 139.956 1.00 26.27 ? 165  VAL B CB  1 
ATOM   3694 C  CG1 . VAL B 1 165 ? 58.202 -41.937 140.136 1.00 25.74 ? 165  VAL B CG1 1 
ATOM   3695 C  CG2 . VAL B 1 165 ? 56.569 -40.888 138.543 1.00 26.03 ? 165  VAL B CG2 1 
ATOM   3696 N  N   . ASP B 1 166 ? 56.534 -41.751 143.251 1.00 32.16 ? 166  ASP B N   1 
ATOM   3697 C  CA  . ASP B 1 166 ? 57.036 -41.660 144.631 1.00 34.31 ? 166  ASP B CA  1 
ATOM   3698 C  C   . ASP B 1 166 ? 56.495 -40.449 145.393 1.00 34.72 ? 166  ASP B C   1 
ATOM   3699 O  O   . ASP B 1 166 ? 57.226 -39.789 146.144 1.00 35.53 ? 166  ASP B O   1 
ATOM   3700 C  CB  . ASP B 1 166 ? 58.570 -41.682 144.647 1.00 35.60 ? 166  ASP B CB  1 
ATOM   3701 C  CG  . ASP B 1 166 ? 59.138 -43.015 144.195 1.00 36.73 ? 166  ASP B CG  1 
ATOM   3702 O  OD1 . ASP B 1 166 ? 58.797 -44.056 144.800 1.00 37.45 ? 166  ASP B OD1 1 
ATOM   3703 O  OD2 . ASP B 1 166 ? 59.929 -43.032 143.229 1.00 38.77 ? 166  ASP B OD2 1 
ATOM   3704 N  N   . GLU B 1 167 ? 55.205 -40.175 145.188 1.00 34.79 ? 167  GLU B N   1 
ATOM   3705 C  CA  . GLU B 1 167 ? 54.487 -39.098 145.871 1.00 34.08 ? 167  GLU B CA  1 
ATOM   3706 C  C   . GLU B 1 167 ? 55.096 -37.709 145.656 1.00 33.12 ? 167  GLU B C   1 
ATOM   3707 O  O   . GLU B 1 167 ? 54.776 -36.782 146.401 1.00 32.96 ? 167  GLU B O   1 
ATOM   3708 C  CB  . GLU B 1 167 ? 54.395 -39.396 147.379 1.00 35.29 ? 167  GLU B CB  1 
ATOM   3709 C  CG  . GLU B 1 167 ? 53.908 -40.801 147.713 1.00 36.13 ? 167  GLU B CG  1 
ATOM   3710 C  CD  . GLU B 1 167 ? 53.727 -41.033 149.207 1.00 36.99 ? 167  GLU B CD  1 
ATOM   3711 O  OE1 . GLU B 1 167 ? 54.263 -40.246 150.013 1.00 37.32 ? 167  GLU B OE1 1 
ATOM   3712 O  OE2 . GLU B 1 167 ? 53.038 -42.009 149.576 1.00 37.62 ? 167  GLU B OE2 1 
ATOM   3713 N  N   . LYS B 1 168 ? 55.950 -37.558 144.641 1.00 32.22 ? 168  LYS B N   1 
ATOM   3714 C  CA  . LYS B 1 168 ? 56.708 -36.309 144.453 1.00 31.96 ? 168  LYS B CA  1 
ATOM   3715 C  C   . LYS B 1 168 ? 56.773 -35.750 143.028 1.00 30.60 ? 168  LYS B C   1 
ATOM   3716 O  O   . LYS B 1 168 ? 56.953 -34.541 142.860 1.00 29.42 ? 168  LYS B O   1 
ATOM   3717 C  CB  . LYS B 1 168 ? 58.139 -36.472 144.994 1.00 32.49 ? 168  LYS B CB  1 
ATOM   3718 C  CG  . LYS B 1 168 ? 58.241 -36.531 146.516 1.00 33.08 ? 168  LYS B CG  1 
ATOM   3719 C  CD  . LYS B 1 168 ? 57.676 -35.286 147.183 1.00 34.03 ? 168  LYS B CD  1 
ATOM   3720 C  CE  . LYS B 1 168 ? 57.875 -35.318 148.690 1.00 34.48 ? 168  LYS B CE  1 
ATOM   3721 N  NZ  . LYS B 1 168 ? 57.058 -34.271 149.361 1.00 34.82 ? 168  LYS B NZ  1 
ATOM   3722 N  N   . ILE B 1 169 ? 56.652 -36.603 142.014 1.00 29.08 ? 169  ILE B N   1 
ATOM   3723 C  CA  . ILE B 1 169 ? 56.682 -36.143 140.630 1.00 27.75 ? 169  ILE B CA  1 
ATOM   3724 C  C   . ILE B 1 169 ? 55.302 -36.335 140.000 1.00 26.88 ? 169  ILE B C   1 
ATOM   3725 O  O   . ILE B 1 169 ? 54.822 -37.460 139.895 1.00 27.44 ? 169  ILE B O   1 
ATOM   3726 C  CB  . ILE B 1 169 ? 57.742 -36.898 139.795 1.00 27.47 ? 169  ILE B CB  1 
ATOM   3727 C  CG1 . ILE B 1 169 ? 59.086 -36.938 140.536 1.00 27.73 ? 169  ILE B CG1 1 
ATOM   3728 C  CG2 . ILE B 1 169 ? 57.904 -36.245 138.422 1.00 27.02 ? 169  ILE B CG2 1 
ATOM   3729 C  CD1 . ILE B 1 169 ? 60.171 -37.719 139.817 1.00 27.64 ? 169  ILE B CD1 1 
ATOM   3730 N  N   . PHE B 1 170 ? 54.674 -35.233 139.591 1.00 25.97 ? 170  PHE B N   1 
ATOM   3731 C  CA  . PHE B 1 170 ? 53.396 -35.277 138.868 1.00 25.54 ? 170  PHE B CA  1 
ATOM   3732 C  C   . PHE B 1 170 ? 53.683 -35.323 137.374 1.00 24.49 ? 170  PHE B C   1 
ATOM   3733 O  O   . PHE B 1 170 ? 54.330 -34.428 136.845 1.00 26.51 ? 170  PHE B O   1 
ATOM   3734 C  CB  . PHE B 1 170 ? 52.546 -34.043 139.180 1.00 24.72 ? 170  PHE B CB  1 
ATOM   3735 C  CG  . PHE B 1 170 ? 51.188 -34.052 138.521 1.00 24.05 ? 170  PHE B CG  1 
ATOM   3736 C  CD1 . PHE B 1 170 ? 50.145 -34.786 139.067 1.00 24.04 ? 170  PHE B CD1 1 
ATOM   3737 C  CD2 . PHE B 1 170 ? 50.950 -33.322 137.361 1.00 23.94 ? 170  PHE B CD2 1 
ATOM   3738 C  CE1 . PHE B 1 170 ? 48.894 -34.801 138.468 1.00 23.90 ? 170  PHE B CE1 1 
ATOM   3739 C  CE2 . PHE B 1 170 ? 49.695 -33.330 136.759 1.00 23.47 ? 170  PHE B CE2 1 
ATOM   3740 C  CZ  . PHE B 1 170 ? 48.668 -34.068 137.317 1.00 23.65 ? 170  PHE B CZ  1 
ATOM   3741 N  N   . CYS B 1 171 ? 53.179 -36.351 136.696 1.00 24.78 ? 171  CYS B N   1 
ATOM   3742 C  CA  . CYS B 1 171 ? 53.451 -36.556 135.269 1.00 24.17 ? 171  CYS B CA  1 
ATOM   3743 C  C   . CYS B 1 171 ? 52.175 -36.525 134.427 1.00 24.36 ? 171  CYS B C   1 
ATOM   3744 O  O   . CYS B 1 171 ? 51.225 -37.251 134.708 1.00 23.38 ? 171  CYS B O   1 
ATOM   3745 C  CB  . CYS B 1 171 ? 54.162 -37.894 135.063 1.00 24.25 ? 171  CYS B CB  1 
ATOM   3746 S  SG  . CYS B 1 171 ? 55.724 -38.045 135.962 1.00 25.35 ? 171  CYS B SG  1 
ATOM   3747 N  N   . CYS B 1 172 ? 52.165 -35.677 133.397 1.00 23.82 ? 172  CYS B N   1 
ATOM   3748 C  CA  . CYS B 1 172 ? 51.088 -35.657 132.407 1.00 24.89 ? 172  CYS B CA  1 
ATOM   3749 C  C   . CYS B 1 172 ? 51.623 -35.122 131.086 1.00 24.35 ? 172  CYS B C   1 
ATOM   3750 O  O   . CYS B 1 172 ? 52.724 -34.561 131.030 1.00 23.59 ? 172  CYS B O   1 
ATOM   3751 C  CB  . CYS B 1 172 ? 49.899 -34.820 132.893 1.00 25.37 ? 172  CYS B CB  1 
ATOM   3752 S  SG  . CYS B 1 172 ? 50.248 -33.053 133.054 1.00 28.58 ? 172  CYS B SG  1 
ATOM   3753 N  N   . HIS B 1 173 ? 50.867 -35.306 130.009 1.00 23.72 ? 173  HIS B N   1 
ATOM   3754 C  CA  . HIS B 1 173 ? 51.376 -34.914 128.703 1.00 22.94 ? 173  HIS B CA  1 
ATOM   3755 C  C   . HIS B 1 173 ? 51.574 -33.408 128.581 1.00 23.58 ? 173  HIS B C   1 
ATOM   3756 O  O   . HIS B 1 173 ? 52.674 -32.947 128.247 1.00 22.39 ? 173  HIS B O   1 
ATOM   3757 C  CB  . HIS B 1 173 ? 50.466 -35.365 127.573 1.00 21.84 ? 173  HIS B CB  1 
ATOM   3758 C  CG  . HIS B 1 173 ? 51.018 -35.038 126.226 1.00 21.24 ? 173  HIS B CG  1 
ATOM   3759 N  ND1 . HIS B 1 173 ? 52.175 -35.614 125.744 1.00 20.36 ? 173  HIS B ND1 1 
ATOM   3760 C  CD2 . HIS B 1 173 ? 50.611 -34.161 125.283 1.00 20.42 ? 173  HIS B CD2 1 
ATOM   3761 C  CE1 . HIS B 1 173 ? 52.436 -35.128 124.547 1.00 20.04 ? 173  HIS B CE1 1 
ATOM   3762 N  NE2 . HIS B 1 173 ? 51.505 -34.245 124.245 1.00 20.65 ? 173  HIS B NE2 1 
ATOM   3763 N  N   . GLY B 1 174 ? 50.501 -32.664 128.846 1.00 23.33 ? 174  GLY B N   1 
ATOM   3764 C  CA  . GLY B 1 174 ? 50.455 -31.225 128.595 1.00 25.06 ? 174  GLY B CA  1 
ATOM   3765 C  C   . GLY B 1 174 ? 50.864 -30.412 129.802 1.00 25.85 ? 174  GLY B C   1 
ATOM   3766 O  O   . GLY B 1 174 ? 52.003 -29.966 129.901 1.00 27.07 ? 174  GLY B O   1 
ATOM   3767 N  N   . GLY B 1 175 ? 49.932 -30.212 130.726 1.00 27.40 ? 175  GLY B N   1 
ATOM   3768 C  CA  . GLY B 1 175 ? 50.235 -29.462 131.938 1.00 27.45 ? 175  GLY B CA  1 
ATOM   3769 C  C   . GLY B 1 175 ? 49.079 -29.336 132.909 1.00 27.79 ? 175  GLY B C   1 
ATOM   3770 O  O   . GLY B 1 175 ? 48.185 -30.180 132.956 1.00 26.61 ? 175  GLY B O   1 
ATOM   3771 N  N   . LEU B 1 176 ? 49.101 -28.261 133.686 1.00 28.45 ? 176  LEU B N   1 
ATOM   3772 C  CA  . LEU B 1 176 ? 48.113 -28.047 134.731 1.00 28.67 ? 176  LEU B CA  1 
ATOM   3773 C  C   . LEU B 1 176 ? 46.810 -27.499 134.165 1.00 29.70 ? 176  LEU B C   1 
ATOM   3774 O  O   . LEU B 1 176 ? 46.745 -27.064 133.010 1.00 29.85 ? 176  LEU B O   1 
ATOM   3775 C  CB  . LEU B 1 176 ? 48.663 -27.078 135.775 1.00 28.43 ? 176  LEU B CB  1 
ATOM   3776 C  CG  . LEU B 1 176 ? 49.986 -27.479 136.431 1.00 28.15 ? 176  LEU B CG  1 
ATOM   3777 C  CD1 . LEU B 1 176 ? 50.477 -26.367 137.345 1.00 28.62 ? 176  LEU B CD1 1 
ATOM   3778 C  CD2 . LEU B 1 176 ? 49.840 -28.784 137.197 1.00 28.23 ? 176  LEU B CD2 1 
ATOM   3779 N  N   . SER B 1 177 ? 45.780 -27.512 135.004 1.00 30.71 ? 177  SER B N   1 
ATOM   3780 C  CA  . SER B 1 177 ? 44.462 -26.983 134.655 1.00 32.34 ? 177  SER B CA  1 
ATOM   3781 C  C   . SER B 1 177 ? 44.010 -25.988 135.722 1.00 32.65 ? 177  SER B C   1 
ATOM   3782 O  O   . SER B 1 177 ? 44.274 -26.200 136.904 1.00 33.18 ? 177  SER B O   1 
ATOM   3783 C  CB  . SER B 1 177 ? 43.444 -28.116 134.589 1.00 32.09 ? 177  SER B CB  1 
ATOM   3784 O  OG  . SER B 1 177 ? 42.172 -27.625 134.195 1.00 32.81 ? 177  SER B OG  1 
ATOM   3785 N  N   . PRO B 1 178 ? 43.318 -24.909 135.314 1.00 34.38 ? 178  PRO B N   1 
ATOM   3786 C  CA  . PRO B 1 178 ? 42.627 -24.041 136.276 1.00 35.31 ? 178  PRO B CA  1 
ATOM   3787 C  C   . PRO B 1 178 ? 41.550 -24.766 137.085 1.00 36.12 ? 178  PRO B C   1 
ATOM   3788 O  O   . PRO B 1 178 ? 41.193 -24.311 138.173 1.00 38.45 ? 178  PRO B O   1 
ATOM   3789 C  CB  . PRO B 1 178 ? 41.968 -22.974 135.394 1.00 35.12 ? 178  PRO B CB  1 
ATOM   3790 C  CG  . PRO B 1 178 ? 42.663 -23.039 134.089 1.00 35.44 ? 178  PRO B CG  1 
ATOM   3791 C  CD  . PRO B 1 178 ? 43.141 -24.444 133.926 1.00 34.64 ? 178  PRO B CD  1 
ATOM   3792 N  N   . ASP B 1 179 ? 41.024 -25.867 136.548 1.00 36.88 ? 179  ASP B N   1 
ATOM   3793 C  CA  . ASP B 1 179 ? 40.025 -26.677 137.247 1.00 38.21 ? 179  ASP B CA  1 
ATOM   3794 C  C   . ASP B 1 179 ? 40.631 -27.786 138.115 1.00 36.99 ? 179  ASP B C   1 
ATOM   3795 O  O   . ASP B 1 179 ? 39.888 -28.568 138.707 1.00 37.74 ? 179  ASP B O   1 
ATOM   3796 C  CB  . ASP B 1 179 ? 39.058 -27.307 136.240 1.00 39.49 ? 179  ASP B CB  1 
ATOM   3797 C  CG  . ASP B 1 179 ? 38.333 -26.277 135.393 1.00 41.12 ? 179  ASP B CG  1 
ATOM   3798 O  OD1 . ASP B 1 179 ? 38.248 -25.102 135.807 1.00 44.70 ? 179  ASP B OD1 1 
ATOM   3799 O  OD2 . ASP B 1 179 ? 37.837 -26.650 134.311 1.00 42.49 ? 179  ASP B OD2 1 
ATOM   3800 N  N   . LEU B 1 180 ? 41.960 -27.870 138.191 1.00 36.57 ? 180  LEU B N   1 
ATOM   3801 C  CA  . LEU B 1 180 ? 42.610 -28.896 139.002 1.00 36.15 ? 180  LEU B CA  1 
ATOM   3802 C  C   . LEU B 1 180 ? 42.866 -28.383 140.419 1.00 36.69 ? 180  LEU B C   1 
ATOM   3803 O  O   . LEU B 1 180 ? 43.877 -27.729 140.680 1.00 34.47 ? 180  LEU B O   1 
ATOM   3804 C  CB  . LEU B 1 180 ? 43.917 -29.368 138.351 1.00 35.41 ? 180  LEU B CB  1 
ATOM   3805 C  CG  . LEU B 1 180 ? 44.658 -30.512 139.054 1.00 34.68 ? 180  LEU B CG  1 
ATOM   3806 C  CD1 . LEU B 1 180 ? 43.739 -31.699 139.303 1.00 34.55 ? 180  LEU B CD1 1 
ATOM   3807 C  CD2 . LEU B 1 180 ? 45.876 -30.941 138.248 1.00 35.04 ? 180  LEU B CD2 1 
ATOM   3808 N  N   . GLN B 1 181 ? 41.927 -28.677 141.316 1.00 37.78 ? 181  GLN B N   1 
ATOM   3809 C  CA  . GLN B 1 181 ? 42.039 -28.337 142.741 1.00 38.26 ? 181  GLN B CA  1 
ATOM   3810 C  C   . GLN B 1 181 ? 42.427 -29.545 143.597 1.00 36.80 ? 181  GLN B C   1 
ATOM   3811 O  O   . GLN B 1 181 ? 43.085 -29.390 144.632 1.00 37.60 ? 181  GLN B O   1 
ATOM   3812 C  CB  . GLN B 1 181 ? 40.716 -27.749 143.256 1.00 40.31 ? 181  GLN B CB  1 
ATOM   3813 C  CG  . GLN B 1 181 ? 40.645 -26.230 143.194 1.00 42.34 ? 181  GLN B CG  1 
ATOM   3814 C  CD  . GLN B 1 181 ? 40.756 -25.693 141.782 1.00 44.44 ? 181  GLN B CD  1 
ATOM   3815 O  OE1 . GLN B 1 181 ? 39.943 -26.027 140.920 1.00 48.75 ? 181  GLN B OE1 1 
ATOM   3816 N  NE2 . GLN B 1 181 ? 41.763 -24.855 141.534 1.00 44.94 ? 181  GLN B NE2 1 
ATOM   3817 N  N   . SER B 1 182 ? 41.989 -30.732 143.181 1.00 34.16 ? 182  SER B N   1 
ATOM   3818 C  CA  . SER B 1 182 ? 42.257 -31.969 143.902 1.00 32.68 ? 182  SER B CA  1 
ATOM   3819 C  C   . SER B 1 182 ? 42.588 -33.105 142.932 1.00 31.83 ? 182  SER B C   1 
ATOM   3820 O  O   . SER B 1 182 ? 42.063 -33.151 141.819 1.00 33.02 ? 182  SER B O   1 
ATOM   3821 C  CB  . SER B 1 182 ? 41.038 -32.356 144.739 1.00 32.65 ? 182  SER B CB  1 
ATOM   3822 O  OG  . SER B 1 182 ? 41.167 -33.670 145.249 1.00 32.63 ? 182  SER B OG  1 
ATOM   3823 N  N   . MET B 1 183 ? 43.445 -34.024 143.372 1.00 30.50 ? 183  MET B N   1 
ATOM   3824 C  CA  . MET B 1 183 ? 43.806 -35.210 142.581 1.00 29.51 ? 183  MET B CA  1 
ATOM   3825 C  C   . MET B 1 183 ? 42.625 -36.161 142.401 1.00 29.38 ? 183  MET B C   1 
ATOM   3826 O  O   . MET B 1 183 ? 42.579 -36.933 141.436 1.00 28.07 ? 183  MET B O   1 
ATOM   3827 C  CB  . MET B 1 183 ? 44.964 -35.963 143.238 1.00 29.22 ? 183  MET B CB  1 
ATOM   3828 C  CG  . MET B 1 183 ? 46.260 -35.182 143.291 1.00 28.67 ? 183  MET B CG  1 
ATOM   3829 S  SD  . MET B 1 183 ? 46.862 -34.749 141.647 1.00 28.41 ? 183  MET B SD  1 
ATOM   3830 C  CE  . MET B 1 183 ? 48.422 -33.985 142.068 1.00 28.36 ? 183  MET B CE  1 
ATOM   3831 N  N   . GLU B 1 184 ? 41.669 -36.103 143.328 1.00 29.23 ? 184  GLU B N   1 
ATOM   3832 C  CA  . GLU B 1 184 ? 40.444 -36.887 143.216 1.00 28.95 ? 184  GLU B CA  1 
ATOM   3833 C  C   . GLU B 1 184 ? 39.678 -36.558 141.933 1.00 28.03 ? 184  GLU B C   1 
ATOM   3834 O  O   . GLU B 1 184 ? 39.031 -37.429 141.364 1.00 27.90 ? 184  GLU B O   1 
ATOM   3835 C  CB  . GLU B 1 184 ? 39.554 -36.667 144.446 1.00 30.64 ? 184  GLU B CB  1 
ATOM   3836 C  CG  . GLU B 1 184 ? 38.289 -37.515 144.496 1.00 32.29 ? 184  GLU B CG  1 
ATOM   3837 C  CD  . GLU B 1 184 ? 38.551 -39.011 144.570 1.00 33.19 ? 184  GLU B CD  1 
ATOM   3838 O  OE1 . GLU B 1 184 ? 39.685 -39.424 144.891 1.00 35.13 ? 184  GLU B OE1 1 
ATOM   3839 O  OE2 . GLU B 1 184 ? 37.610 -39.783 144.305 1.00 36.63 ? 184  GLU B OE2 1 
ATOM   3840 N  N   . GLN B 1 185 ? 39.769 -35.315 141.470 1.00 27.37 ? 185  GLN B N   1 
ATOM   3841 C  CA  . GLN B 1 185 ? 39.110 -34.913 140.231 1.00 27.31 ? 185  GLN B CA  1 
ATOM   3842 C  C   . GLN B 1 185 ? 39.640 -35.684 139.020 1.00 26.67 ? 185  GLN B C   1 
ATOM   3843 O  O   . GLN B 1 185 ? 38.874 -36.016 138.121 1.00 25.41 ? 185  GLN B O   1 
ATOM   3844 C  CB  . GLN B 1 185 ? 39.292 -33.420 139.977 1.00 29.56 ? 185  GLN B CB  1 
ATOM   3845 C  CG  . GLN B 1 185 ? 38.705 -32.509 141.041 1.00 30.09 ? 185  GLN B CG  1 
ATOM   3846 C  CD  . GLN B 1 185 ? 38.990 -31.058 140.740 1.00 30.62 ? 185  GLN B CD  1 
ATOM   3847 O  OE1 . GLN B 1 185 ? 39.828 -30.426 141.386 1.00 31.55 ? 185  GLN B OE1 1 
ATOM   3848 N  NE2 . GLN B 1 185 ? 38.318 -30.528 139.729 1.00 31.54 ? 185  GLN B NE2 1 
ATOM   3849 N  N   . ILE B 1 186 ? 40.945 -35.955 138.994 1.00 24.21 ? 186  ILE B N   1 
ATOM   3850 C  CA  . ILE B 1 186 ? 41.531 -36.767 137.932 1.00 24.92 ? 186  ILE B CA  1 
ATOM   3851 C  C   . ILE B 1 186 ? 41.035 -38.203 138.057 1.00 24.39 ? 186  ILE B C   1 
ATOM   3852 O  O   . ILE B 1 186 ? 40.659 -38.820 137.068 1.00 23.47 ? 186  ILE B O   1 
ATOM   3853 C  CB  . ILE B 1 186 ? 43.077 -36.762 137.968 1.00 24.32 ? 186  ILE B CB  1 
ATOM   3854 C  CG1 . ILE B 1 186 ? 43.613 -35.369 137.635 1.00 23.92 ? 186  ILE B CG1 1 
ATOM   3855 C  CG2 . ILE B 1 186 ? 43.640 -37.776 136.976 1.00 24.85 ? 186  ILE B CG2 1 
ATOM   3856 C  CD1 . ILE B 1 186 ? 45.085 -35.192 137.946 1.00 23.86 ? 186  ILE B CD1 1 
ATOM   3857 N  N   . ARG B 1 187 ? 41.011 -38.719 139.282 1.00 25.66 ? 187  ARG B N   1 
ATOM   3858 C  CA  . ARG B 1 187 ? 40.562 -40.091 139.520 1.00 27.12 ? 187  ARG B CA  1 
ATOM   3859 C  C   . ARG B 1 187 ? 39.093 -40.309 139.121 1.00 27.54 ? 187  ARG B C   1 
ATOM   3860 O  O   . ARG B 1 187 ? 38.708 -41.434 138.810 1.00 28.00 ? 187  ARG B O   1 
ATOM   3861 C  CB  . ARG B 1 187 ? 40.751 -40.483 140.988 1.00 28.63 ? 187  ARG B CB  1 
ATOM   3862 C  CG  . ARG B 1 187 ? 42.191 -40.457 141.468 1.00 29.48 ? 187  ARG B CG  1 
ATOM   3863 C  CD  . ARG B 1 187 ? 42.353 -41.188 142.791 1.00 30.83 ? 187  ARG B CD  1 
ATOM   3864 N  NE  . ARG B 1 187 ? 43.676 -40.943 143.362 1.00 32.32 ? 187  ARG B NE  1 
ATOM   3865 C  CZ  . ARG B 1 187 ? 43.981 -39.964 144.213 1.00 33.41 ? 187  ARG B CZ  1 
ATOM   3866 N  NH1 . ARG B 1 187 ? 43.057 -39.104 144.647 1.00 34.83 ? 187  ARG B NH1 1 
ATOM   3867 N  NH2 . ARG B 1 187 ? 45.230 -39.850 144.647 1.00 33.82 ? 187  ARG B NH2 1 
ATOM   3868 N  N   . ARG B 1 188 ? 38.288 -39.243 139.137 1.00 28.60 ? 188  ARG B N   1 
ATOM   3869 C  CA  . ARG B 1 188 ? 36.860 -39.319 138.786 1.00 29.88 ? 188  ARG B CA  1 
ATOM   3870 C  C   . ARG B 1 188 ? 36.571 -39.124 137.287 1.00 29.35 ? 188  ARG B C   1 
ATOM   3871 O  O   . ARG B 1 188 ? 35.411 -39.140 136.881 1.00 29.91 ? 188  ARG B O   1 
ATOM   3872 C  CB  . ARG B 1 188 ? 36.051 -38.298 139.603 1.00 31.54 ? 188  ARG B CB  1 
ATOM   3873 C  CG  . ARG B 1 188 ? 35.907 -38.650 141.082 1.00 33.08 ? 188  ARG B CG  1 
ATOM   3874 C  CD  . ARG B 1 188 ? 34.843 -37.800 141.766 1.00 34.93 ? 188  ARG B CD  1 
ATOM   3875 N  NE  . ARG B 1 188 ? 35.190 -36.370 141.792 1.00 36.47 ? 188  ARG B NE  1 
ATOM   3876 C  CZ  . ARG B 1 188 ? 35.444 -35.640 142.885 1.00 36.46 ? 188  ARG B CZ  1 
ATOM   3877 N  NH1 . ARG B 1 188 ? 35.387 -36.161 144.109 1.00 37.92 ? 188  ARG B NH1 1 
ATOM   3878 N  NH2 . ARG B 1 188 ? 35.746 -34.354 142.752 1.00 37.60 ? 188  ARG B NH2 1 
ATOM   3879 N  N   . ILE B 1 189 ? 37.603 -38.936 136.466 1.00 28.40 ? 189  ILE B N   1 
ATOM   3880 C  CA  . ILE B 1 189 ? 37.405 -38.854 135.018 1.00 27.99 ? 189  ILE B CA  1 
ATOM   3881 C  C   . ILE B 1 189 ? 37.009 -40.241 134.521 1.00 28.22 ? 189  ILE B C   1 
ATOM   3882 O  O   . ILE B 1 189 ? 37.667 -41.230 134.843 1.00 27.51 ? 189  ILE B O   1 
ATOM   3883 C  CB  . ILE B 1 189 ? 38.660 -38.366 134.268 1.00 27.43 ? 189  ILE B CB  1 
ATOM   3884 C  CG1 . ILE B 1 189 ? 38.946 -36.902 134.603 1.00 27.02 ? 189  ILE B CG1 1 
ATOM   3885 C  CG2 . ILE B 1 189 ? 38.470 -38.519 132.758 1.00 27.39 ? 189  ILE B CG2 1 
ATOM   3886 C  CD1 . ILE B 1 189 ? 40.325 -36.439 134.189 1.00 27.06 ? 189  ILE B CD1 1 
ATOM   3887 N  N   . MET B 1 190 ? 35.928 -40.304 133.748 1.00 27.81 ? 190  MET B N   1 
ATOM   3888 C  CA  . MET B 1 190 ? 35.356 -41.573 133.311 1.00 29.02 ? 190  MET B CA  1 
ATOM   3889 C  C   . MET B 1 190 ? 35.910 -42.008 131.949 1.00 28.80 ? 190  MET B C   1 
ATOM   3890 O  O   . MET B 1 190 ? 35.962 -41.216 131.014 1.00 29.79 ? 190  MET B O   1 
ATOM   3891 C  CB  . MET B 1 190 ? 33.826 -41.437 133.245 1.00 30.86 ? 190  MET B CB  1 
ATOM   3892 C  CG  . MET B 1 190 ? 33.083 -42.736 132.988 1.00 32.37 ? 190  MET B CG  1 
ATOM   3893 S  SD  . MET B 1 190 ? 33.367 -43.931 134.297 1.00 35.54 ? 190  MET B SD  1 
ATOM   3894 C  CE  . MET B 1 190 ? 33.079 -45.479 133.449 1.00 34.75 ? 190  MET B CE  1 
ATOM   3895 N  N   . ARG B 1 191 ? 36.305 -43.277 131.847 1.00 27.66 ? 191  ARG B N   1 
ATOM   3896 C  CA  . ARG B 1 191 ? 36.766 -43.871 130.592 1.00 27.32 ? 191  ARG B CA  1 
ATOM   3897 C  C   . ARG B 1 191 ? 35.849 -45.031 130.205 1.00 27.16 ? 191  ARG B C   1 
ATOM   3898 O  O   . ARG B 1 191 ? 35.300 -45.687 131.086 1.00 28.33 ? 191  ARG B O   1 
ATOM   3899 C  CB  . ARG B 1 191 ? 38.185 -44.398 130.746 1.00 27.00 ? 191  ARG B CB  1 
ATOM   3900 C  CG  . ARG B 1 191 ? 39.201 -43.335 131.111 1.00 26.80 ? 191  ARG B CG  1 
ATOM   3901 C  CD  . ARG B 1 191 ? 40.541 -43.977 131.404 1.00 26.79 ? 191  ARG B CD  1 
ATOM   3902 N  NE  . ARG B 1 191 ? 40.506 -44.832 132.592 1.00 26.54 ? 191  ARG B NE  1 
ATOM   3903 C  CZ  . ARG B 1 191 ? 41.523 -45.589 133.005 1.00 27.17 ? 191  ARG B CZ  1 
ATOM   3904 N  NH1 . ARG B 1 191 ? 42.675 -45.606 132.332 1.00 26.78 ? 191  ARG B NH1 1 
ATOM   3905 N  NH2 . ARG B 1 191 ? 41.396 -46.333 134.099 1.00 27.48 ? 191  ARG B NH2 1 
ATOM   3906 N  N   . PRO B 1 192 ? 35.669 -45.296 128.912 1.00 27.08 ? 192  PRO B N   1 
ATOM   3907 C  CA  . PRO B 1 192 ? 36.282 -44.538 127.819 1.00 25.88 ? 192  PRO B CA  1 
ATOM   3908 C  C   . PRO B 1 192 ? 35.638 -43.173 127.601 1.00 25.65 ? 192  PRO B C   1 
ATOM   3909 O  O   . PRO B 1 192 ? 34.453 -42.976 127.905 1.00 24.72 ? 192  PRO B O   1 
ATOM   3910 C  CB  . PRO B 1 192 ? 36.027 -45.425 126.604 1.00 26.36 ? 192  PRO B CB  1 
ATOM   3911 C  CG  . PRO B 1 192 ? 34.789 -46.174 126.953 1.00 27.14 ? 192  PRO B CG  1 
ATOM   3912 C  CD  . PRO B 1 192 ? 34.944 -46.476 128.415 1.00 26.85 ? 192  PRO B CD  1 
ATOM   3913 N  N   . THR B 1 193 ? 36.429 -42.241 127.085 1.00 24.81 ? 193  THR B N   1 
ATOM   3914 C  CA  . THR B 1 193 ? 35.934 -40.922 126.702 1.00 25.11 ? 193  THR B CA  1 
ATOM   3915 C  C   . THR B 1 193 ? 36.847 -40.331 125.637 1.00 26.84 ? 193  THR B C   1 
ATOM   3916 O  O   . THR B 1 193 ? 38.052 -40.596 125.615 1.00 26.58 ? 193  THR B O   1 
ATOM   3917 C  CB  . THR B 1 193 ? 35.849 -39.953 127.901 1.00 24.66 ? 193  THR B CB  1 
ATOM   3918 O  OG1 . THR B 1 193 ? 35.280 -38.704 127.487 1.00 24.29 ? 193  THR B OG1 1 
ATOM   3919 C  CG2 . THR B 1 193 ? 37.227 -39.699 128.515 1.00 24.74 ? 193  THR B CG2 1 
ATOM   3920 N  N   . ASP B 1 194 ? 36.261 -39.531 124.754 1.00 28.67 ? 194  ASP B N   1 
ATOM   3921 C  CA  . ASP B 1 194 ? 37.033 -38.704 123.845 1.00 29.36 ? 194  ASP B CA  1 
ATOM   3922 C  C   . ASP B 1 194 ? 37.497 -37.481 124.632 1.00 30.14 ? 194  ASP B C   1 
ATOM   3923 O  O   . ASP B 1 194 ? 36.933 -37.162 125.680 1.00 29.49 ? 194  ASP B O   1 
ATOM   3924 C  CB  . ASP B 1 194 ? 36.194 -38.287 122.632 1.00 30.25 ? 194  ASP B CB  1 
ATOM   3925 C  CG  . ASP B 1 194 ? 35.737 -39.471 121.795 1.00 30.41 ? 194  ASP B CG  1 
ATOM   3926 O  OD1 . ASP B 1 194 ? 36.271 -40.584 121.971 1.00 31.80 ? 194  ASP B OD1 1 
ATOM   3927 O  OD2 . ASP B 1 194 ? 34.831 -39.290 120.954 1.00 31.16 ? 194  ASP B OD2 1 
ATOM   3928 N  N   . VAL B 1 195 ? 38.541 -36.817 124.143 1.00 30.67 ? 195  VAL B N   1 
ATOM   3929 C  CA  . VAL B 1 195 ? 39.060 -35.620 124.800 1.00 31.18 ? 195  VAL B CA  1 
ATOM   3930 C  C   . VAL B 1 195 ? 38.162 -34.444 124.434 1.00 32.27 ? 195  VAL B C   1 
ATOM   3931 O  O   . VAL B 1 195 ? 37.949 -34.183 123.249 1.00 33.02 ? 195  VAL B O   1 
ATOM   3932 C  CB  . VAL B 1 195 ? 40.517 -35.314 124.380 1.00 30.85 ? 195  VAL B CB  1 
ATOM   3933 C  CG1 . VAL B 1 195 ? 41.002 -34.010 125.008 1.00 31.06 ? 195  VAL B CG1 1 
ATOM   3934 C  CG2 . VAL B 1 195 ? 41.435 -36.461 124.770 1.00 30.58 ? 195  VAL B CG2 1 
ATOM   3935 N  N   . PRO B 1 196 ? 37.612 -33.740 125.444 1.00 32.59 ? 196  PRO B N   1 
ATOM   3936 C  CA  . PRO B 1 196 ? 36.733 -32.611 125.142 1.00 32.38 ? 196  PRO B CA  1 
ATOM   3937 C  C   . PRO B 1 196 ? 37.513 -31.364 124.719 1.00 33.25 ? 196  PRO B C   1 
ATOM   3938 O  O   . PRO B 1 196 ? 38.739 -31.307 124.876 1.00 30.72 ? 196  PRO B O   1 
ATOM   3939 C  CB  . PRO B 1 196 ? 35.990 -32.378 126.458 1.00 32.72 ? 196  PRO B CB  1 
ATOM   3940 C  CG  . PRO B 1 196 ? 36.900 -32.896 127.508 1.00 32.84 ? 196  PRO B CG  1 
ATOM   3941 C  CD  . PRO B 1 196 ? 37.707 -34.001 126.892 1.00 33.04 ? 196  PRO B CD  1 
ATOM   3942 N  N   . ASP B 1 197 ? 36.802 -30.382 124.176 1.00 32.81 ? 197  ASP B N   1 
ATOM   3943 C  CA  . ASP B 1 197 ? 37.430 -29.142 123.708 1.00 33.94 ? 197  ASP B CA  1 
ATOM   3944 C  C   . ASP B 1 197 ? 37.729 -28.156 124.841 1.00 33.21 ? 197  ASP B C   1 
ATOM   3945 O  O   . ASP B 1 197 ? 38.457 -27.191 124.635 1.00 33.09 ? 197  ASP B O   1 
ATOM   3946 C  CB  . ASP B 1 197 ? 36.555 -28.467 122.644 1.00 34.29 ? 197  ASP B CB  1 
ATOM   3947 C  CG  . ASP B 1 197 ? 36.495 -29.256 121.349 1.00 36.10 ? 197  ASP B CG  1 
ATOM   3948 O  OD1 . ASP B 1 197 ? 37.508 -29.888 120.979 1.00 37.62 ? 197  ASP B OD1 1 
ATOM   3949 O  OD2 . ASP B 1 197 ? 35.430 -29.250 120.697 1.00 37.12 ? 197  ASP B OD2 1 
ATOM   3950 N  N   . GLN B 1 198 ? 37.160 -28.404 126.021 1.00 34.09 ? 198  GLN B N   1 
ATOM   3951 C  CA  . GLN B 1 198 ? 37.390 -27.592 127.221 1.00 34.33 ? 198  GLN B CA  1 
ATOM   3952 C  C   . GLN B 1 198 ? 37.352 -28.482 128.466 1.00 32.82 ? 198  GLN B C   1 
ATOM   3953 O  O   . GLN B 1 198 ? 36.827 -29.593 128.428 1.00 31.62 ? 198  GLN B O   1 
ATOM   3954 C  CB  . GLN B 1 198 ? 36.347 -26.457 127.356 1.00 36.26 ? 198  GLN B CB  1 
ATOM   3955 C  CG  . GLN B 1 198 ? 34.957 -26.746 126.764 1.00 38.20 ? 198  GLN B CG  1 
ATOM   3956 C  CD  . GLN B 1 198 ? 34.711 -26.042 125.435 1.00 40.40 ? 198  GLN B CD  1 
ATOM   3957 O  OE1 . GLN B 1 198 ? 33.967 -26.541 124.595 1.00 41.97 ? 198  GLN B OE1 1 
ATOM   3958 N  NE2 . GLN B 1 198 ? 35.332 -24.878 125.241 1.00 42.57 ? 198  GLN B NE2 1 
ATOM   3959 N  N   . GLY B 1 199 ? 37.925 -27.990 129.562 1.00 31.56 ? 199  GLY B N   1 
ATOM   3960 C  CA  . GLY B 1 199 ? 37.837 -28.665 130.861 1.00 30.84 ? 199  GLY B CA  1 
ATOM   3961 C  C   . GLY B 1 199 ? 39.109 -29.374 131.291 1.00 29.76 ? 199  GLY B C   1 
ATOM   3962 O  O   . GLY B 1 199 ? 40.140 -29.304 130.615 1.00 29.16 ? 199  GLY B O   1 
ATOM   3963 N  N   . LEU B 1 200 ? 39.017 -30.074 132.418 1.00 29.15 ? 200  LEU B N   1 
ATOM   3964 C  CA  . LEU B 1 200 ? 40.177 -30.681 133.078 1.00 29.35 ? 200  LEU B CA  1 
ATOM   3965 C  C   . LEU B 1 200 ? 40.986 -31.631 132.184 1.00 29.15 ? 200  LEU B C   1 
ATOM   3966 O  O   . LEU B 1 200 ? 42.211 -31.495 132.088 1.00 28.18 ? 200  LEU B O   1 
ATOM   3967 C  CB  . LEU B 1 200 ? 39.727 -31.405 134.352 1.00 30.07 ? 200  LEU B CB  1 
ATOM   3968 C  CG  . LEU B 1 200 ? 40.799 -32.105 135.194 1.00 29.80 ? 200  LEU B CG  1 
ATOM   3969 C  CD1 . LEU B 1 200 ? 41.865 -31.125 135.657 1.00 30.13 ? 200  LEU B CD1 1 
ATOM   3970 C  CD2 . LEU B 1 200 ? 40.151 -32.798 136.380 1.00 29.42 ? 200  LEU B CD2 1 
ATOM   3971 N  N   . LEU B 1 201 ? 40.311 -32.581 131.540 1.00 29.19 ? 201  LEU B N   1 
ATOM   3972 C  CA  . LEU B 1 201 ? 40.987 -33.561 130.680 1.00 29.61 ? 201  LEU B CA  1 
ATOM   3973 C  C   . LEU B 1 201 ? 41.705 -32.872 129.521 1.00 29.64 ? 201  LEU B C   1 
ATOM   3974 O  O   . LEU B 1 201 ? 42.855 -33.207 129.204 1.00 29.03 ? 201  LEU B O   1 
ATOM   3975 C  CB  . LEU B 1 201 ? 39.996 -34.608 130.154 1.00 29.49 ? 201  LEU B CB  1 
ATOM   3976 C  CG  . LEU B 1 201 ? 40.525 -35.640 129.148 1.00 30.12 ? 201  LEU B CG  1 
ATOM   3977 C  CD1 . LEU B 1 201 ? 41.754 -36.365 129.672 1.00 30.20 ? 201  LEU B CD1 1 
ATOM   3978 C  CD2 . LEU B 1 201 ? 39.440 -36.642 128.789 1.00 30.03 ? 201  LEU B CD2 1 
ATOM   3979 N  N   . CYS B 1 202 ? 41.030 -31.907 128.901 1.00 29.18 ? 202  CYS B N   1 
ATOM   3980 C  CA  . CYS B 1 202 ? 41.638 -31.083 127.855 1.00 28.95 ? 202  CYS B CA  1 
ATOM   3981 C  C   . CYS B 1 202 ? 42.931 -30.422 128.323 1.00 28.82 ? 202  CYS B C   1 
ATOM   3982 O  O   . CYS B 1 202 ? 43.975 -30.574 127.684 1.00 29.66 ? 202  CYS B O   1 
ATOM   3983 C  CB  . CYS B 1 202 ? 40.655 -30.011 127.378 1.00 29.18 ? 202  CYS B CB  1 
ATOM   3984 S  SG  . CYS B 1 202 ? 41.301 -28.932 126.078 1.00 30.00 ? 202  CYS B SG  1 
ATOM   3985 N  N   . ASP B 1 203 ? 42.866 -29.699 129.439 1.00 27.94 ? 203  ASP B N   1 
ATOM   3986 C  CA  . ASP B 1 203 ? 44.025 -28.952 129.947 1.00 27.92 ? 203  ASP B CA  1 
ATOM   3987 C  C   . ASP B 1 203 ? 45.213 -29.856 130.251 1.00 26.73 ? 203  ASP B C   1 
ATOM   3988 O  O   . ASP B 1 203 ? 46.361 -29.515 129.941 1.00 27.00 ? 203  ASP B O   1 
ATOM   3989 C  CB  . ASP B 1 203 ? 43.661 -28.179 131.216 1.00 28.08 ? 203  ASP B CB  1 
ATOM   3990 C  CG  . ASP B 1 203 ? 42.629 -27.099 130.974 1.00 28.73 ? 203  ASP B CG  1 
ATOM   3991 O  OD1 . ASP B 1 203 ? 42.555 -26.554 129.851 1.00 29.52 ? 203  ASP B OD1 1 
ATOM   3992 O  OD2 . ASP B 1 203 ? 41.882 -26.794 131.923 1.00 30.20 ? 203  ASP B OD2 1 
ATOM   3993 N  N   . LEU B 1 204 ? 44.933 -31.010 130.850 1.00 25.39 ? 204  LEU B N   1 
ATOM   3994 C  CA  . LEU B 1 204 ? 45.975 -31.975 131.182 1.00 25.02 ? 204  LEU B CA  1 
ATOM   3995 C  C   . LEU B 1 204 ? 46.758 -32.475 129.955 1.00 25.27 ? 204  LEU B C   1 
ATOM   3996 O  O   . LEU B 1 204 ? 47.921 -32.877 130.080 1.00 23.24 ? 204  LEU B O   1 
ATOM   3997 C  CB  . LEU B 1 204 ? 45.385 -33.158 131.952 1.00 24.71 ? 204  LEU B CB  1 
ATOM   3998 C  CG  . LEU B 1 204 ? 44.924 -32.879 133.389 1.00 24.12 ? 204  LEU B CG  1 
ATOM   3999 C  CD1 . LEU B 1 204 ? 44.176 -34.079 133.950 1.00 24.30 ? 204  LEU B CD1 1 
ATOM   4000 C  CD2 . LEU B 1 204 ? 46.094 -32.521 134.291 1.00 24.35 ? 204  LEU B CD2 1 
ATOM   4001 N  N   . LEU B 1 205 ? 46.125 -32.438 128.782 1.00 25.26 ? 205  LEU B N   1 
ATOM   4002 C  CA  . LEU B 1 205 ? 46.747 -32.905 127.534 1.00 25.70 ? 205  LEU B CA  1 
ATOM   4003 C  C   . LEU B 1 205 ? 47.196 -31.782 126.587 1.00 25.71 ? 205  LEU B C   1 
ATOM   4004 O  O   . LEU B 1 205 ? 47.889 -32.055 125.603 1.00 25.52 ? 205  LEU B O   1 
ATOM   4005 C  CB  . LEU B 1 205 ? 45.789 -33.857 126.796 1.00 25.89 ? 205  LEU B CB  1 
ATOM   4006 C  CG  . LEU B 1 205 ? 45.827 -35.342 127.187 1.00 25.96 ? 205  LEU B CG  1 
ATOM   4007 C  CD1 . LEU B 1 205 ? 45.683 -35.542 128.688 1.00 26.10 ? 205  LEU B CD1 1 
ATOM   4008 C  CD2 . LEU B 1 205 ? 44.737 -36.111 126.449 1.00 26.25 ? 205  LEU B CD2 1 
ATOM   4009 N  N   . TRP B 1 206 ? 46.830 -30.534 126.883 1.00 25.74 ? 206  TRP B N   1 
ATOM   4010 C  CA  . TRP B 1 206 ? 47.028 -29.420 125.945 1.00 25.53 ? 206  TRP B CA  1 
ATOM   4011 C  C   . TRP B 1 206 ? 47.782 -28.184 126.455 1.00 26.17 ? 206  TRP B C   1 
ATOM   4012 O  O   . TRP B 1 206 ? 48.348 -27.449 125.648 1.00 25.04 ? 206  TRP B O   1 
ATOM   4013 C  CB  . TRP B 1 206 ? 45.673 -28.955 125.404 1.00 24.99 ? 206  TRP B CB  1 
ATOM   4014 C  CG  . TRP B 1 206 ? 45.111 -29.820 124.331 1.00 24.46 ? 206  TRP B CG  1 
ATOM   4015 C  CD1 . TRP B 1 206 ? 44.265 -30.875 124.490 1.00 24.76 ? 206  TRP B CD1 1 
ATOM   4016 C  CD2 . TRP B 1 206 ? 45.358 -29.714 122.925 1.00 24.04 ? 206  TRP B CD2 1 
ATOM   4017 N  NE1 . TRP B 1 206 ? 43.962 -31.427 123.276 1.00 24.11 ? 206  TRP B NE1 1 
ATOM   4018 C  CE2 . TRP B 1 206 ? 44.617 -30.731 122.296 1.00 23.85 ? 206  TRP B CE2 1 
ATOM   4019 C  CE3 . TRP B 1 206 ? 46.132 -28.857 122.135 1.00 24.48 ? 206  TRP B CE3 1 
ATOM   4020 C  CZ2 . TRP B 1 206 ? 44.628 -30.920 120.917 1.00 23.29 ? 206  TRP B CZ2 1 
ATOM   4021 C  CZ3 . TRP B 1 206 ? 46.134 -29.040 120.757 1.00 23.68 ? 206  TRP B CZ3 1 
ATOM   4022 C  CH2 . TRP B 1 206 ? 45.389 -30.066 120.167 1.00 24.04 ? 206  TRP B CH2 1 
ATOM   4023 N  N   . SER B 1 207 ? 47.780 -27.925 127.759 1.00 26.87 ? 207  SER B N   1 
ATOM   4024 C  CA  . SER B 1 207 ? 48.335 -26.667 128.269 1.00 28.02 ? 207  SER B CA  1 
ATOM   4025 C  C   . SER B 1 207 ? 49.865 -26.617 128.186 1.00 29.41 ? 207  SER B C   1 
ATOM   4026 O  O   . SER B 1 207 ? 50.526 -27.650 128.102 1.00 29.21 ? 207  SER B O   1 
ATOM   4027 C  CB  . SER B 1 207 ? 47.860 -26.411 129.704 1.00 27.83 ? 207  SER B CB  1 
ATOM   4028 O  OG  . SER B 1 207 ? 48.447 -27.315 130.613 1.00 26.82 ? 207  SER B OG  1 
ATOM   4029 N  N   . ASP B 1 208 ? 50.411 -25.401 128.189 1.00 30.99 ? 208  ASP B N   1 
ATOM   4030 C  CA  . ASP B 1 208 ? 51.856 -25.182 128.147 1.00 31.79 ? 208  ASP B CA  1 
ATOM   4031 C  C   . ASP B 1 208 ? 52.289 -24.227 129.253 1.00 33.14 ? 208  ASP B C   1 
ATOM   4032 O  O   . ASP B 1 208 ? 51.520 -23.365 129.660 1.00 34.44 ? 208  ASP B O   1 
ATOM   4033 C  CB  . ASP B 1 208 ? 52.279 -24.571 126.809 1.00 31.26 ? 208  ASP B CB  1 
ATOM   4034 C  CG  . ASP B 1 208 ? 51.920 -25.438 125.620 1.00 31.43 ? 208  ASP B CG  1 
ATOM   4035 O  OD1 . ASP B 1 208 ? 52.419 -26.580 125.526 1.00 29.94 ? 208  ASP B OD1 1 
ATOM   4036 O  OD2 . ASP B 1 208 ? 51.144 -24.963 124.767 1.00 30.53 ? 208  ASP B OD2 1 
ATOM   4037 N  N   . PRO B 1 209 ? 53.533 -24.368 129.735 1.00 35.06 ? 209  PRO B N   1 
ATOM   4038 C  CA  . PRO B 1 209 ? 54.096 -23.329 130.585 1.00 36.59 ? 209  PRO B CA  1 
ATOM   4039 C  C   . PRO B 1 209 ? 54.502 -22.127 129.732 1.00 39.50 ? 209  PRO B C   1 
ATOM   4040 O  O   . PRO B 1 209 ? 54.758 -22.282 128.536 1.00 39.08 ? 209  PRO B O   1 
ATOM   4041 C  CB  . PRO B 1 209 ? 55.322 -24.001 131.189 1.00 35.96 ? 209  PRO B CB  1 
ATOM   4042 C  CG  . PRO B 1 209 ? 55.760 -24.965 130.140 1.00 35.64 ? 209  PRO B CG  1 
ATOM   4043 C  CD  . PRO B 1 209 ? 54.501 -25.448 129.474 1.00 35.36 ? 209  PRO B CD  1 
ATOM   4044 N  N   . ASP B 1 210 ? 54.542 -20.945 130.340 1.00 43.63 ? 210  ASP B N   1 
ATOM   4045 C  CA  . ASP B 1 210 ? 54.942 -19.721 129.646 1.00 45.95 ? 210  ASP B CA  1 
ATOM   4046 C  C   . ASP B 1 210 ? 55.625 -18.774 130.635 1.00 48.74 ? 210  ASP B C   1 
ATOM   4047 O  O   . ASP B 1 210 ? 55.081 -18.479 131.702 1.00 48.20 ? 210  ASP B O   1 
ATOM   4048 C  CB  . ASP B 1 210 ? 53.719 -19.052 129.002 1.00 47.61 ? 210  ASP B CB  1 
ATOM   4049 C  CG  . ASP B 1 210 ? 54.091 -18.017 127.941 1.00 49.30 ? 210  ASP B CG  1 
ATOM   4050 O  OD1 . ASP B 1 210 ? 55.177 -17.406 128.031 1.00 50.84 ? 210  ASP B OD1 1 
ATOM   4051 O  OD2 . ASP B 1 210 ? 53.281 -17.806 127.013 1.00 49.90 ? 210  ASP B OD2 1 
ATOM   4052 N  N   . LYS B 1 211 ? 56.820 -18.313 130.272 1.00 51.42 ? 211  LYS B N   1 
ATOM   4053 C  CA  . LYS B 1 211 ? 57.622 -17.442 131.132 1.00 54.46 ? 211  LYS B CA  1 
ATOM   4054 C  C   . LYS B 1 211 ? 57.075 -16.016 131.198 1.00 56.48 ? 211  LYS B C   1 
ATOM   4055 O  O   . LYS B 1 211 ? 57.221 -15.340 132.216 1.00 57.54 ? 211  LYS B O   1 
ATOM   4056 C  CB  . LYS B 1 211 ? 59.078 -17.423 130.654 1.00 55.30 ? 211  LYS B CB  1 
ATOM   4057 C  CG  . LYS B 1 211 ? 59.757 -18.777 130.773 1.00 57.53 ? 211  LYS B CG  1 
ATOM   4058 C  CD  . LYS B 1 211 ? 61.210 -18.761 130.334 1.00 59.35 ? 211  LYS B CD  1 
ATOM   4059 C  CE  . LYS B 1 211 ? 61.878 -20.085 130.674 1.00 61.03 ? 211  LYS B CE  1 
ATOM   4060 N  NZ  . LYS B 1 211 ? 63.310 -20.119 130.272 1.00 62.76 ? 211  LYS B NZ  1 
ATOM   4061 N  N   . ASP B 1 212 ? 56.439 -15.569 130.119 1.00 58.54 ? 212  ASP B N   1 
ATOM   4062 C  CA  . ASP B 1 212 ? 55.899 -14.208 130.043 1.00 59.87 ? 212  ASP B CA  1 
ATOM   4063 C  C   . ASP B 1 212 ? 54.534 -14.050 130.724 1.00 60.04 ? 212  ASP B C   1 
ATOM   4064 O  O   . ASP B 1 212 ? 54.097 -12.926 130.967 1.00 61.23 ? 212  ASP B O   1 
ATOM   4065 C  CB  . ASP B 1 212 ? 55.805 -13.759 128.582 1.00 60.89 ? 212  ASP B CB  1 
ATOM   4066 C  CG  . ASP B 1 212 ? 57.156 -13.739 127.886 1.00 62.07 ? 212  ASP B CG  1 
ATOM   4067 O  OD1 . ASP B 1 212 ? 58.196 -13.860 128.575 1.00 62.82 ? 212  ASP B OD1 1 
ATOM   4068 O  OD2 . ASP B 1 212 ? 57.174 -13.604 126.644 1.00 63.24 ? 212  ASP B OD2 1 
ATOM   4069 N  N   . VAL B 1 213 ? 53.864 -15.162 131.020 1.00 59.58 ? 213  VAL B N   1 
ATOM   4070 C  CA  . VAL B 1 213 ? 52.590 -15.133 131.740 1.00 59.25 ? 213  VAL B CA  1 
ATOM   4071 C  C   . VAL B 1 213 ? 52.851 -15.312 133.233 1.00 58.98 ? 213  VAL B C   1 
ATOM   4072 O  O   . VAL B 1 213 ? 53.735 -16.079 133.622 1.00 57.92 ? 213  VAL B O   1 
ATOM   4073 C  CB  . VAL B 1 213 ? 51.631 -16.239 131.247 1.00 59.53 ? 213  VAL B CB  1 
ATOM   4074 C  CG1 . VAL B 1 213 ? 50.283 -16.137 131.951 1.00 59.81 ? 213  VAL B CG1 1 
ATOM   4075 C  CG2 . VAL B 1 213 ? 51.445 -16.146 129.740 1.00 60.26 ? 213  VAL B CG2 1 
ATOM   4076 N  N   . LEU B 1 214 ? 52.080 -14.606 134.060 1.00 59.98 ? 214  LEU B N   1 
ATOM   4077 C  CA  . LEU B 1 214 ? 52.230 -14.691 135.526 1.00 60.48 ? 214  LEU B CA  1 
ATOM   4078 C  C   . LEU B 1 214 ? 51.248 -15.694 136.131 1.00 58.34 ? 214  LEU B C   1 
ATOM   4079 O  O   . LEU B 1 214 ? 51.655 -16.565 136.898 1.00 58.09 ? 214  LEU B O   1 
ATOM   4080 C  CB  . LEU B 1 214 ? 52.136 -13.313 136.217 1.00 62.01 ? 214  LEU B CB  1 
ATOM   4081 C  CG  . LEU B 1 214 ? 53.474 -12.573 136.408 1.00 63.26 ? 214  LEU B CG  1 
ATOM   4082 C  CD1 . LEU B 1 214 ? 53.294 -11.204 137.057 1.00 64.14 ? 214  LEU B CD1 1 
ATOM   4083 C  CD2 . LEU B 1 214 ? 54.438 -13.423 137.231 1.00 62.54 ? 214  LEU B CD2 1 
ATOM   4084 N  N   . GLY B 1 215 ? 49.970 -15.584 135.769 1.00 56.45 ? 215  GLY B N   1 
ATOM   4085 C  CA  . GLY B 1 215 ? 48.942 -16.526 136.221 1.00 54.69 ? 215  GLY B CA  1 
ATOM   4086 C  C   . GLY B 1 215 ? 48.546 -17.459 135.092 1.00 53.87 ? 215  GLY B C   1 
ATOM   4087 O  O   . GLY B 1 215 ? 49.366 -18.243 134.612 1.00 53.90 ? 215  GLY B O   1 
ATOM   4088 N  N   . TRP B 1 216 ? 47.284 -17.376 134.677 1.00 53.01 ? 216  TRP B N   1 
ATOM   4089 C  CA  . TRP B 1 216 ? 46.783 -18.112 133.519 1.00 52.81 ? 216  TRP B CA  1 
ATOM   4090 C  C   . TRP B 1 216 ? 46.573 -17.155 132.350 1.00 54.80 ? 216  TRP B C   1 
ATOM   4091 O  O   . TRP B 1 216 ? 46.162 -16.011 132.547 1.00 57.36 ? 216  TRP B O   1 
ATOM   4092 C  CB  . TRP B 1 216 ? 45.465 -18.808 133.859 1.00 50.52 ? 216  TRP B CB  1 
ATOM   4093 C  CG  . TRP B 1 216 ? 45.604 -19.858 134.912 1.00 48.64 ? 216  TRP B CG  1 
ATOM   4094 C  CD1 . TRP B 1 216 ? 45.417 -19.704 136.253 1.00 47.50 ? 216  TRP B CD1 1 
ATOM   4095 C  CD2 . TRP B 1 216 ? 45.966 -21.229 134.712 1.00 47.70 ? 216  TRP B CD2 1 
ATOM   4096 N  NE1 . TRP B 1 216 ? 45.637 -20.895 136.902 1.00 47.94 ? 216  TRP B NE1 1 
ATOM   4097 C  CE2 . TRP B 1 216 ? 45.976 -21.848 135.978 1.00 47.28 ? 216  TRP B CE2 1 
ATOM   4098 C  CE3 . TRP B 1 216 ? 46.282 -21.995 133.583 1.00 46.73 ? 216  TRP B CE3 1 
ATOM   4099 C  CZ2 . TRP B 1 216 ? 46.290 -23.197 136.149 1.00 46.51 ? 216  TRP B CZ2 1 
ATOM   4100 C  CZ3 . TRP B 1 216 ? 46.592 -23.336 133.755 1.00 46.12 ? 216  TRP B CZ3 1 
ATOM   4101 C  CH2 . TRP B 1 216 ? 46.597 -23.920 135.029 1.00 45.97 ? 216  TRP B CH2 1 
ATOM   4102 N  N   . GLY B 1 217 ? 46.858 -17.627 131.139 1.00 55.44 ? 217  GLY B N   1 
ATOM   4103 C  CA  . GLY B 1 217 ? 46.693 -16.823 129.926 1.00 55.25 ? 217  GLY B CA  1 
ATOM   4104 C  C   . GLY B 1 217 ? 46.198 -17.656 128.762 1.00 55.72 ? 217  GLY B C   1 
ATOM   4105 O  O   . GLY B 1 217 ? 46.040 -18.872 128.883 1.00 54.99 ? 217  GLY B O   1 
ATOM   4106 N  N   . GLU B 1 218 ? 45.949 -17.002 127.630 1.00 56.20 ? 218  GLU B N   1 
ATOM   4107 C  CA  . GLU B 1 218 ? 45.469 -17.694 126.434 1.00 56.72 ? 218  GLU B CA  1 
ATOM   4108 C  C   . GLU B 1 218 ? 46.604 -18.454 125.752 1.00 52.96 ? 218  GLU B C   1 
ATOM   4109 O  O   . GLU B 1 218 ? 47.748 -17.996 125.722 1.00 52.13 ? 218  GLU B O   1 
ATOM   4110 C  CB  . GLU B 1 218 ? 44.822 -16.718 125.441 1.00 60.27 ? 218  GLU B CB  1 
ATOM   4111 C  CG  . GLU B 1 218 ? 43.511 -16.103 125.918 1.00 63.29 ? 218  GLU B CG  1 
ATOM   4112 C  CD  . GLU B 1 218 ? 43.677 -14.691 126.452 1.00 65.97 ? 218  GLU B CD  1 
ATOM   4113 O  OE1 . GLU B 1 218 ? 43.928 -13.776 125.638 1.00 68.51 ? 218  GLU B OE1 1 
ATOM   4114 O  OE2 . GLU B 1 218 ? 43.545 -14.493 127.680 1.00 69.55 ? 218  GLU B OE2 1 
ATOM   4115 N  N   . ASN B 1 219 ? 46.271 -19.619 125.205 1.00 49.12 ? 219  ASN B N   1 
ATOM   4116 C  CA  . ASN B 1 219 ? 47.243 -20.477 124.542 1.00 46.26 ? 219  ASN B CA  1 
ATOM   4117 C  C   . ASN B 1 219 ? 47.167 -20.283 123.032 1.00 45.94 ? 219  ASN B C   1 
ATOM   4118 O  O   . ASN B 1 219 ? 46.086 -20.380 122.450 1.00 44.78 ? 219  ASN B O   1 
ATOM   4119 C  CB  . ASN B 1 219 ? 46.974 -21.940 124.906 1.00 44.40 ? 219  ASN B CB  1 
ATOM   4120 C  CG  . ASN B 1 219 ? 48.137 -22.856 124.564 1.00 42.47 ? 219  ASN B CG  1 
ATOM   4121 O  OD1 . ASN B 1 219 ? 48.517 -22.981 123.403 1.00 40.11 ? 219  ASN B OD1 1 
ATOM   4122 N  ND2 . ASN B 1 219 ? 48.700 -23.511 125.573 1.00 41.20 ? 219  ASN B ND2 1 
ATOM   4123 N  N   . ASP B 1 220 ? 48.317 -20.033 122.405 1.00 46.24 ? 220  ASP B N   1 
ATOM   4124 C  CA  . ASP B 1 220 ? 48.394 -19.809 120.955 1.00 47.44 ? 220  ASP B CA  1 
ATOM   4125 C  C   . ASP B 1 220 ? 47.878 -20.981 120.113 1.00 46.24 ? 220  ASP B C   1 
ATOM   4126 O  O   . ASP B 1 220 ? 47.590 -20.806 118.928 1.00 47.55 ? 220  ASP B O   1 
ATOM   4127 C  CB  . ASP B 1 220 ? 49.833 -19.475 120.529 1.00 49.17 ? 220  ASP B CB  1 
ATOM   4128 C  CG  . ASP B 1 220 ? 50.280 -18.097 120.990 1.00 51.27 ? 220  ASP B CG  1 
ATOM   4129 O  OD1 . ASP B 1 220 ? 49.473 -17.144 120.923 1.00 52.69 ? 220  ASP B OD1 1 
ATOM   4130 O  OD2 . ASP B 1 220 ? 51.447 -17.962 121.415 1.00 54.03 ? 220  ASP B OD2 1 
ATOM   4131 N  N   . ARG B 1 221 ? 47.760 -22.165 120.717 1.00 44.38 ? 221  ARG B N   1 
ATOM   4132 C  CA  . ARG B 1 221 ? 47.200 -23.335 120.034 1.00 42.35 ? 221  ARG B CA  1 
ATOM   4133 C  C   . ARG B 1 221 ? 45.711 -23.186 119.710 1.00 43.28 ? 221  ARG B C   1 
ATOM   4134 O  O   . ARG B 1 221 ? 45.191 -23.909 118.861 1.00 43.46 ? 221  ARG B O   1 
ATOM   4135 C  CB  . ARG B 1 221 ? 47.383 -24.597 120.882 1.00 41.26 ? 221  ARG B CB  1 
ATOM   4136 C  CG  . ARG B 1 221 ? 48.823 -25.035 121.106 1.00 39.67 ? 221  ARG B CG  1 
ATOM   4137 C  CD  . ARG B 1 221 ? 48.856 -26.184 122.104 1.00 38.42 ? 221  ARG B CD  1 
ATOM   4138 N  NE  . ARG B 1 221 ? 50.192 -26.485 122.622 1.00 37.52 ? 221  ARG B NE  1 
ATOM   4139 C  CZ  . ARG B 1 221 ? 51.066 -27.325 122.062 1.00 37.09 ? 221  ARG B CZ  1 
ATOM   4140 N  NH1 . ARG B 1 221 ? 50.779 -27.963 120.933 1.00 36.83 ? 221  ARG B NH1 1 
ATOM   4141 N  NH2 . ARG B 1 221 ? 52.244 -27.528 122.642 1.00 35.99 ? 221  ARG B NH2 1 
ATOM   4142 N  N   . GLY B 1 222 ? 45.030 -22.270 120.395 1.00 43.68 ? 222  GLY B N   1 
ATOM   4143 C  CA  . GLY B 1 222 ? 43.597 -22.061 120.200 1.00 44.53 ? 222  GLY B CA  1 
ATOM   4144 C  C   . GLY B 1 222 ? 42.772 -22.999 121.058 1.00 45.09 ? 222  GLY B C   1 
ATOM   4145 O  O   . GLY B 1 222 ? 41.586 -23.203 120.807 1.00 46.28 ? 222  GLY B O   1 
ATOM   4146 N  N   . VAL B 1 223 ? 43.406 -23.568 122.079 1.00 45.48 ? 223  VAL B N   1 
ATOM   4147 C  CA  . VAL B 1 223 ? 42.742 -24.484 122.998 1.00 45.18 ? 223  VAL B CA  1 
ATOM   4148 C  C   . VAL B 1 223 ? 43.520 -24.502 124.314 1.00 43.70 ? 223  VAL B C   1 
ATOM   4149 O  O   . VAL B 1 223 ? 44.741 -24.337 124.321 1.00 44.07 ? 223  VAL B O   1 
ATOM   4150 C  CB  . VAL B 1 223 ? 42.617 -25.901 122.386 1.00 45.93 ? 223  VAL B CB  1 
ATOM   4151 C  CG1 . VAL B 1 223 ? 43.973 -26.428 121.938 1.00 46.23 ? 223  VAL B CG1 1 
ATOM   4152 C  CG2 . VAL B 1 223 ? 41.952 -26.868 123.358 1.00 45.62 ? 223  VAL B CG2 1 
ATOM   4153 N  N   . SER B 1 224 ? 42.802 -24.670 125.422 1.00 42.60 ? 224  SER B N   1 
ATOM   4154 C  CA  . SER B 1 224 ? 43.402 -24.707 126.756 1.00 41.14 ? 224  SER B CA  1 
ATOM   4155 C  C   . SER B 1 224 ? 44.077 -23.372 127.109 1.00 40.72 ? 224  SER B C   1 
ATOM   4156 O  O   . SER B 1 224 ? 43.740 -22.335 126.533 1.00 40.45 ? 224  SER B O   1 
ATOM   4157 C  CB  . SER B 1 224 ? 44.390 -25.875 126.873 1.00 40.66 ? 224  SER B CB  1 
ATOM   4158 O  OG  . SER B 1 224 ? 44.771 -26.076 128.222 1.00 39.56 ? 224  SER B OG  1 
ATOM   4159 N  N   . PHE B 1 225 ? 45.018 -23.403 128.053 1.00 39.66 ? 225  PHE B N   1 
ATOM   4160 C  CA  . PHE B 1 225 ? 45.642 -22.189 128.583 1.00 38.84 ? 225  PHE B CA  1 
ATOM   4161 C  C   . PHE B 1 225 ? 47.162 -22.314 128.622 1.00 38.40 ? 225  PHE B C   1 
ATOM   4162 O  O   . PHE B 1 225 ? 47.712 -23.385 128.367 1.00 36.45 ? 225  PHE B O   1 
ATOM   4163 C  CB  . PHE B 1 225 ? 45.125 -21.914 129.999 1.00 39.59 ? 225  PHE B CB  1 
ATOM   4164 C  CG  . PHE B 1 225 ? 43.624 -21.927 130.113 1.00 38.96 ? 225  PHE B CG  1 
ATOM   4165 C  CD1 . PHE B 1 225 ? 42.947 -23.103 130.395 1.00 38.90 ? 225  PHE B CD1 1 
ATOM   4166 C  CD2 . PHE B 1 225 ? 42.891 -20.763 129.936 1.00 39.94 ? 225  PHE B CD2 1 
ATOM   4167 C  CE1 . PHE B 1 225 ? 41.564 -23.121 130.498 1.00 38.95 ? 225  PHE B CE1 1 
ATOM   4168 C  CE2 . PHE B 1 225 ? 41.509 -20.772 130.036 1.00 39.76 ? 225  PHE B CE2 1 
ATOM   4169 C  CZ  . PHE B 1 225 ? 40.844 -21.954 130.318 1.00 39.95 ? 225  PHE B CZ  1 
ATOM   4170 N  N   . THR B 1 226 ? 47.830 -21.197 128.902 1.00 38.66 ? 226  THR B N   1 
ATOM   4171 C  CA  . THR B 1 226 ? 49.233 -21.199 129.311 1.00 39.56 ? 226  THR B CA  1 
ATOM   4172 C  C   . THR B 1 226 ? 49.288 -20.937 130.813 1.00 39.50 ? 226  THR B C   1 
ATOM   4173 O  O   . THR B 1 226 ? 48.350 -20.360 131.371 1.00 40.03 ? 226  THR B O   1 
ATOM   4174 C  CB  . THR B 1 226 ? 50.053 -20.117 128.582 1.00 39.83 ? 226  THR B CB  1 
ATOM   4175 O  OG1 . THR B 1 226 ? 49.369 -18.861 128.650 1.00 40.52 ? 226  THR B OG1 1 
ATOM   4176 C  CG2 . THR B 1 226 ? 50.266 -20.494 127.126 1.00 40.73 ? 226  THR B CG2 1 
ATOM   4177 N  N   . PHE B 1 227 ? 50.363 -21.370 131.469 1.00 38.50 ? 227  PHE B N   1 
ATOM   4178 C  CA  . PHE B 1 227 ? 50.535 -21.107 132.901 1.00 38.80 ? 227  PHE B CA  1 
ATOM   4179 C  C   . PHE B 1 227 ? 51.946 -20.645 133.245 1.00 39.51 ? 227  PHE B C   1 
ATOM   4180 O  O   . PHE B 1 227 ? 52.923 -21.046 132.606 1.00 39.71 ? 227  PHE B O   1 
ATOM   4181 C  CB  . PHE B 1 227 ? 50.127 -22.318 133.759 1.00 38.49 ? 227  PHE B CB  1 
ATOM   4182 C  CG  . PHE B 1 227 ? 50.847 -23.598 133.423 1.00 37.34 ? 227  PHE B CG  1 
ATOM   4183 C  CD1 . PHE B 1 227 ? 50.388 -24.425 132.403 1.00 37.36 ? 227  PHE B CD1 1 
ATOM   4184 C  CD2 . PHE B 1 227 ? 51.953 -24.005 134.159 1.00 37.74 ? 227  PHE B CD2 1 
ATOM   4185 C  CE1 . PHE B 1 227 ? 51.037 -25.614 132.106 1.00 36.67 ? 227  PHE B CE1 1 
ATOM   4186 C  CE2 . PHE B 1 227 ? 52.605 -25.194 133.866 1.00 36.43 ? 227  PHE B CE2 1 
ATOM   4187 C  CZ  . PHE B 1 227 ? 52.147 -25.997 132.839 1.00 36.39 ? 227  PHE B CZ  1 
ATOM   4188 N  N   . GLY B 1 228 ? 52.034 -19.786 134.260 1.00 39.41 ? 228  GLY B N   1 
ATOM   4189 C  CA  . GLY B 1 228 ? 53.303 -19.195 134.686 1.00 40.14 ? 228  GLY B CA  1 
ATOM   4190 C  C   . GLY B 1 228 ? 53.963 -19.936 135.831 1.00 40.01 ? 228  GLY B C   1 
ATOM   4191 O  O   . GLY B 1 228 ? 53.411 -20.902 136.359 1.00 40.24 ? 228  GLY B O   1 
ATOM   4192 N  N   . ALA B 1 229 ? 55.143 -19.461 136.223 1.00 40.16 ? 229  ALA B N   1 
ATOM   4193 C  CA  . ALA B 1 229 ? 55.954 -20.119 137.251 1.00 40.77 ? 229  ALA B CA  1 
ATOM   4194 C  C   . ALA B 1 229 ? 55.323 -20.101 138.648 1.00 42.14 ? 229  ALA B C   1 
ATOM   4195 O  O   . ALA B 1 229 ? 55.544 -21.022 139.437 1.00 40.11 ? 229  ALA B O   1 
ATOM   4196 C  CB  . ALA B 1 229 ? 57.342 -19.497 137.300 1.00 41.45 ? 229  ALA B CB  1 
ATOM   4197 N  N   . GLU B 1 230 ? 54.556 -19.057 138.958 1.00 43.72 ? 230  GLU B N   1 
ATOM   4198 C  CA  . GLU B 1 230 ? 53.890 -18.962 140.258 1.00 45.14 ? 230  GLU B CA  1 
ATOM   4199 C  C   . GLU B 1 230 ? 52.783 -20.007 140.384 1.00 42.52 ? 230  GLU B C   1 
ATOM   4200 O  O   . GLU B 1 230 ? 52.579 -20.571 141.461 1.00 39.36 ? 230  GLU B O   1 
ATOM   4201 C  CB  . GLU B 1 230 ? 53.313 -17.563 140.486 1.00 48.75 ? 230  GLU B CB  1 
ATOM   4202 C  CG  . GLU B 1 230 ? 52.913 -17.299 141.933 1.00 52.15 ? 230  GLU B CG  1 
ATOM   4203 C  CD  . GLU B 1 230 ? 52.112 -16.023 142.111 1.00 55.91 ? 230  GLU B CD  1 
ATOM   4204 O  OE1 . GLU B 1 230 ? 51.868 -15.316 141.108 1.00 59.36 ? 230  GLU B OE1 1 
ATOM   4205 O  OE2 . GLU B 1 230 ? 51.714 -15.731 143.261 1.00 57.24 ? 230  GLU B OE2 1 
ATOM   4206 N  N   . VAL B 1 231 ? 52.072 -20.258 139.284 1.00 41.02 ? 231  VAL B N   1 
ATOM   4207 C  CA  . VAL B 1 231 ? 51.059 -21.314 139.247 1.00 40.47 ? 231  VAL B CA  1 
ATOM   4208 C  C   . VAL B 1 231 ? 51.700 -22.670 139.555 1.00 39.39 ? 231  VAL B C   1 
ATOM   4209 O  O   . VAL B 1 231 ? 51.137 -23.469 140.303 1.00 38.84 ? 231  VAL B O   1 
ATOM   4210 C  CB  . VAL B 1 231 ? 50.325 -21.360 137.887 1.00 40.52 ? 231  VAL B CB  1 
ATOM   4211 C  CG1 . VAL B 1 231 ? 49.451 -22.605 137.776 1.00 40.31 ? 231  VAL B CG1 1 
ATOM   4212 C  CG2 . VAL B 1 231 ? 49.485 -20.102 137.699 1.00 41.17 ? 231  VAL B CG2 1 
ATOM   4213 N  N   . VAL B 1 232 ? 52.881 -22.913 138.985 1.00 38.41 ? 232  VAL B N   1 
ATOM   4214 C  CA  . VAL B 1 232 ? 53.641 -24.137 139.257 1.00 37.24 ? 232  VAL B CA  1 
ATOM   4215 C  C   . VAL B 1 232 ? 54.020 -24.200 140.738 1.00 36.36 ? 232  VAL B C   1 
ATOM   4216 O  O   . VAL B 1 232 ? 53.805 -25.219 141.393 1.00 34.12 ? 232  VAL B O   1 
ATOM   4217 C  CB  . VAL B 1 232 ? 54.912 -24.236 138.372 1.00 37.34 ? 232  VAL B CB  1 
ATOM   4218 C  CG1 . VAL B 1 232 ? 55.797 -25.401 138.804 1.00 37.79 ? 232  VAL B CG1 1 
ATOM   4219 C  CG2 . VAL B 1 232 ? 54.533 -24.373 136.905 1.00 36.73 ? 232  VAL B CG2 1 
ATOM   4220 N  N   . ALA B 1 233 ? 54.575 -23.106 141.254 1.00 36.53 ? 233  ALA B N   1 
ATOM   4221 C  CA  . ALA B 1 233 ? 54.988 -23.025 142.656 1.00 37.09 ? 233  ALA B CA  1 
ATOM   4222 C  C   . ALA B 1 233 ? 53.840 -23.335 143.622 1.00 37.07 ? 233  ALA B C   1 
ATOM   4223 O  O   . ALA B 1 233 ? 54.011 -24.102 144.568 1.00 37.39 ? 233  ALA B O   1 
ATOM   4224 C  CB  . ALA B 1 233 ? 55.567 -21.651 142.956 1.00 36.99 ? 233  ALA B CB  1 
ATOM   4225 N  N   . LYS B 1 234 ? 52.672 -22.748 143.375 1.00 38.02 ? 234  LYS B N   1 
ATOM   4226 C  CA  . LYS B 1 234 ? 51.506 -22.958 144.247 1.00 38.59 ? 234  LYS B CA  1 
ATOM   4227 C  C   . LYS B 1 234 ? 50.969 -24.387 144.170 1.00 37.89 ? 234  LYS B C   1 
ATOM   4228 O  O   . LYS B 1 234 ? 50.552 -24.954 145.182 1.00 37.67 ? 234  LYS B O   1 
ATOM   4229 C  CB  . LYS B 1 234 ? 50.398 -21.957 143.911 1.00 39.47 ? 234  LYS B CB  1 
ATOM   4230 C  CG  . LYS B 1 234 ? 50.732 -20.540 144.339 1.00 41.10 ? 234  LYS B CG  1 
ATOM   4231 C  CD  . LYS B 1 234 ? 49.720 -19.528 143.828 1.00 41.97 ? 234  LYS B CD  1 
ATOM   4232 C  CE  . LYS B 1 234 ? 49.994 -18.153 144.416 1.00 42.27 ? 234  LYS B CE  1 
ATOM   4233 N  NZ  . LYS B 1 234 ? 49.200 -17.088 143.744 1.00 42.77 ? 234  LYS B NZ  1 
ATOM   4234 N  N   . PHE B 1 235 ? 50.990 -24.967 142.969 1.00 36.78 ? 235  PHE B N   1 
ATOM   4235 C  CA  . PHE B 1 235 ? 50.546 -26.343 142.770 1.00 36.43 ? 235  PHE B CA  1 
ATOM   4236 C  C   . PHE B 1 235 ? 51.416 -27.332 143.549 1.00 35.53 ? 235  PHE B C   1 
ATOM   4237 O  O   . PHE B 1 235 ? 50.894 -28.207 144.245 1.00 33.22 ? 235  PHE B O   1 
ATOM   4238 C  CB  . PHE B 1 235 ? 50.546 -26.690 141.272 1.00 37.30 ? 235  PHE B CB  1 
ATOM   4239 C  CG  . PHE B 1 235 ? 50.031 -28.068 140.968 1.00 38.61 ? 235  PHE B CG  1 
ATOM   4240 C  CD1 . PHE B 1 235 ? 48.667 -28.315 140.904 1.00 39.16 ? 235  PHE B CD1 1 
ATOM   4241 C  CD2 . PHE B 1 235 ? 50.911 -29.121 140.741 1.00 39.71 ? 235  PHE B CD2 1 
ATOM   4242 C  CE1 . PHE B 1 235 ? 48.189 -29.585 140.626 1.00 39.91 ? 235  PHE B CE1 1 
ATOM   4243 C  CE2 . PHE B 1 235 ? 50.439 -30.394 140.462 1.00 39.58 ? 235  PHE B CE2 1 
ATOM   4244 C  CZ  . PHE B 1 235 ? 49.075 -30.626 140.404 1.00 40.55 ? 235  PHE B CZ  1 
ATOM   4245 N  N   . LEU B 1 236 ? 52.737 -27.194 143.422 1.00 35.05 ? 236  LEU B N   1 
ATOM   4246 C  CA  . LEU B 1 236 ? 53.676 -28.072 144.124 1.00 35.97 ? 236  LEU B CA  1 
ATOM   4247 C  C   . LEU B 1 236 ? 53.524 -27.972 145.642 1.00 36.02 ? 236  LEU B C   1 
ATOM   4248 O  O   . LEU B 1 236 ? 53.512 -28.990 146.336 1.00 35.13 ? 236  LEU B O   1 
ATOM   4249 C  CB  . LEU B 1 236 ? 55.126 -27.746 143.738 1.00 36.96 ? 236  LEU B CB  1 
ATOM   4250 C  CG  . LEU B 1 236 ? 55.587 -28.041 142.307 1.00 37.75 ? 236  LEU B CG  1 
ATOM   4251 C  CD1 . LEU B 1 236 ? 57.080 -27.774 142.197 1.00 38.20 ? 236  LEU B CD1 1 
ATOM   4252 C  CD2 . LEU B 1 236 ? 55.273 -29.469 141.875 1.00 38.15 ? 236  LEU B CD2 1 
ATOM   4253 N  N   . HIS B 1 237 ? 53.402 -26.745 146.144 1.00 35.87 ? 237  HIS B N   1 
ATOM   4254 C  CA  . HIS B 1 237 ? 53.229 -26.507 147.579 1.00 37.88 ? 237  HIS B CA  1 
ATOM   4255 C  C   . HIS B 1 237 ? 51.905 -27.067 148.102 1.00 36.49 ? 237  HIS B C   1 
ATOM   4256 O  O   . HIS B 1 237 ? 51.873 -27.717 149.146 1.00 35.52 ? 237  HIS B O   1 
ATOM   4257 C  CB  . HIS B 1 237 ? 53.313 -25.010 147.892 1.00 39.38 ? 237  HIS B CB  1 
ATOM   4258 C  CG  . HIS B 1 237 ? 53.121 -24.690 149.343 1.00 41.27 ? 237  HIS B CG  1 
ATOM   4259 N  ND1 . HIS B 1 237 ? 54.071 -24.979 150.300 1.00 42.11 ? 237  HIS B ND1 1 
ATOM   4260 C  CD2 . HIS B 1 237 ? 52.085 -24.118 150.000 1.00 41.16 ? 237  HIS B CD2 1 
ATOM   4261 C  CE1 . HIS B 1 237 ? 53.630 -24.594 151.485 1.00 42.26 ? 237  HIS B CE1 1 
ATOM   4262 N  NE2 . HIS B 1 237 ? 52.427 -24.070 151.331 1.00 42.92 ? 237  HIS B NE2 1 
ATOM   4263 N  N   . LYS B 1 238 ? 50.823 -26.821 147.369 1.00 37.06 ? 238  LYS B N   1 
ATOM   4264 C  CA  . LYS B 1 238 ? 49.494 -27.295 147.764 1.00 36.68 ? 238  LYS B CA  1 
ATOM   4265 C  C   . LYS B 1 238 ? 49.423 -28.820 147.883 1.00 36.53 ? 238  LYS B C   1 
ATOM   4266 O  O   . LYS B 1 238 ? 48.846 -29.341 148.834 1.00 37.24 ? 238  LYS B O   1 
ATOM   4267 C  CB  . LYS B 1 238 ? 48.439 -26.806 146.767 1.00 36.28 ? 238  LYS B CB  1 
ATOM   4268 C  CG  . LYS B 1 238 ? 47.019 -27.243 147.096 1.00 35.76 ? 238  LYS B CG  1 
ATOM   4269 C  CD  . LYS B 1 238 ? 46.000 -26.534 146.225 1.00 35.40 ? 238  LYS B CD  1 
ATOM   4270 C  CE  . LYS B 1 238 ? 44.594 -27.040 146.504 1.00 35.54 ? 238  LYS B CE  1 
ATOM   4271 N  NZ  . LYS B 1 238 ? 43.593 -26.457 145.573 1.00 35.88 ? 238  LYS B NZ  1 
ATOM   4272 N  N   . HIS B 1 239 ? 50.009 -29.528 146.919 1.00 36.63 ? 239  HIS B N   1 
ATOM   4273 C  CA  . HIS B 1 239 ? 49.933 -30.992 146.870 1.00 36.26 ? 239  HIS B CA  1 
ATOM   4274 C  C   . HIS B 1 239 ? 51.197 -31.686 147.377 1.00 35.86 ? 239  HIS B C   1 
ATOM   4275 O  O   . HIS B 1 239 ? 51.294 -32.916 147.336 1.00 35.91 ? 239  HIS B O   1 
ATOM   4276 C  CB  . HIS B 1 239 ? 49.613 -31.446 145.445 1.00 36.46 ? 239  HIS B CB  1 
ATOM   4277 C  CG  . HIS B 1 239 ? 48.291 -30.953 144.954 1.00 36.56 ? 239  HIS B CG  1 
ATOM   4278 N  ND1 . HIS B 1 239 ? 48.138 -29.748 144.302 1.00 37.19 ? 239  HIS B ND1 1 
ATOM   4279 C  CD2 . HIS B 1 239 ? 47.052 -31.490 145.050 1.00 36.31 ? 239  HIS B CD2 1 
ATOM   4280 C  CE1 . HIS B 1 239 ? 46.864 -29.572 144.003 1.00 36.95 ? 239  HIS B CE1 1 
ATOM   4281 N  NE2 . HIS B 1 239 ? 46.184 -30.615 144.445 1.00 37.07 ? 239  HIS B NE2 1 
ATOM   4282 N  N   . ASP B 1 240 ? 52.154 -30.901 147.863 1.00 35.81 ? 240  ASP B N   1 
ATOM   4283 C  CA  . ASP B 1 240 ? 53.364 -31.439 148.476 1.00 36.35 ? 240  ASP B CA  1 
ATOM   4284 C  C   . ASP B 1 240 ? 54.154 -32.286 147.471 1.00 34.20 ? 240  ASP B C   1 
ATOM   4285 O  O   . ASP B 1 240 ? 54.521 -33.430 147.744 1.00 33.82 ? 240  ASP B O   1 
ATOM   4286 C  CB  . ASP B 1 240 ? 53.002 -32.248 149.731 1.00 37.59 ? 240  ASP B CB  1 
ATOM   4287 C  CG  . ASP B 1 240 ? 54.196 -32.500 150.636 1.00 39.45 ? 240  ASP B CG  1 
ATOM   4288 O  OD1 . ASP B 1 240 ? 55.117 -31.655 150.677 1.00 39.87 ? 240  ASP B OD1 1 
ATOM   4289 O  OD2 . ASP B 1 240 ? 54.208 -33.550 151.310 1.00 40.75 ? 240  ASP B OD2 1 
ATOM   4290 N  N   . LEU B 1 241 ? 54.388 -31.707 146.298 1.00 33.54 ? 241  LEU B N   1 
ATOM   4291 C  CA  . LEU B 1 241 ? 55.179 -32.340 145.244 1.00 32.59 ? 241  LEU B CA  1 
ATOM   4292 C  C   . LEU B 1 241 ? 56.466 -31.543 145.036 1.00 32.07 ? 241  LEU B C   1 
ATOM   4293 O  O   . LEU B 1 241 ? 56.559 -30.387 145.451 1.00 30.92 ? 241  LEU B O   1 
ATOM   4294 C  CB  . LEU B 1 241 ? 54.376 -32.385 143.940 1.00 31.98 ? 241  LEU B CB  1 
ATOM   4295 C  CG  . LEU B 1 241 ? 53.032 -33.126 143.969 1.00 31.86 ? 241  LEU B CG  1 
ATOM   4296 C  CD1 . LEU B 1 241 ? 52.148 -32.655 142.827 1.00 31.63 ? 241  LEU B CD1 1 
ATOM   4297 C  CD2 . LEU B 1 241 ? 53.220 -34.635 143.922 1.00 31.26 ? 241  LEU B CD2 1 
ATOM   4298 N  N   . ASP B 1 242 ? 57.447 -32.170 144.389 1.00 32.35 ? 242  ASP B N   1 
ATOM   4299 C  CA  . ASP B 1 242 ? 58.740 -31.545 144.091 1.00 32.73 ? 242  ASP B CA  1 
ATOM   4300 C  C   . ASP B 1 242 ? 58.901 -31.135 142.623 1.00 32.25 ? 242  ASP B C   1 
ATOM   4301 O  O   . ASP B 1 242 ? 59.638 -30.195 142.321 1.00 31.65 ? 242  ASP B O   1 
ATOM   4302 C  CB  . ASP B 1 242 ? 59.881 -32.507 144.457 1.00 34.10 ? 242  ASP B CB  1 
ATOM   4303 C  CG  . ASP B 1 242 ? 60.006 -32.735 145.954 1.00 35.21 ? 242  ASP B CG  1 
ATOM   4304 O  OD1 . ASP B 1 242 ? 59.480 -31.919 146.737 1.00 37.18 ? 242  ASP B OD1 1 
ATOM   4305 O  OD2 . ASP B 1 242 ? 60.635 -33.738 146.352 1.00 36.64 ? 242  ASP B OD2 1 
ATOM   4306 N  N   . LEU B 1 243 ? 58.213 -31.828 141.713 1.00 31.07 ? 243  LEU B N   1 
ATOM   4307 C  CA  . LEU B 1 243 ? 58.448 -31.647 140.285 1.00 29.79 ? 243  LEU B CA  1 
ATOM   4308 C  C   . LEU B 1 243 ? 57.210 -31.950 139.445 1.00 29.49 ? 243  LEU B C   1 
ATOM   4309 O  O   . LEU B 1 243 ? 56.475 -32.887 139.730 1.00 29.15 ? 243  LEU B O   1 
ATOM   4310 C  CB  . LEU B 1 243 ? 59.592 -32.572 139.853 1.00 28.84 ? 243  LEU B CB  1 
ATOM   4311 C  CG  . LEU B 1 243 ? 60.074 -32.526 138.402 1.00 28.26 ? 243  LEU B CG  1 
ATOM   4312 C  CD1 . LEU B 1 243 ? 60.671 -31.169 138.063 1.00 27.96 ? 243  LEU B CD1 1 
ATOM   4313 C  CD2 . LEU B 1 243 ? 61.084 -33.635 138.159 1.00 28.13 ? 243  LEU B CD2 1 
ATOM   4314 N  N   . ILE B 1 244 ? 56.988 -31.136 138.416 1.00 30.21 ? 244  ILE B N   1 
ATOM   4315 C  CA  . ILE B 1 244 ? 56.066 -31.476 137.332 1.00 29.61 ? 244  ILE B CA  1 
ATOM   4316 C  C   . ILE B 1 244 ? 56.908 -31.953 136.158 1.00 29.36 ? 244  ILE B C   1 
ATOM   4317 O  O   . ILE B 1 244 ? 57.832 -31.257 135.728 1.00 30.15 ? 244  ILE B O   1 
ATOM   4318 C  CB  . ILE B 1 244 ? 55.220 -30.271 136.876 1.00 29.65 ? 244  ILE B CB  1 
ATOM   4319 C  CG1 . ILE B 1 244 ? 54.269 -29.826 137.989 1.00 30.53 ? 244  ILE B CG1 1 
ATOM   4320 C  CG2 . ILE B 1 244 ? 54.431 -30.618 135.612 1.00 29.61 ? 244  ILE B CG2 1 
ATOM   4321 C  CD1 . ILE B 1 244 ? 53.653 -28.464 137.747 1.00 30.79 ? 244  ILE B CD1 1 
ATOM   4322 N  N   . CYS B 1 245 ? 56.599 -33.144 135.655 1.00 29.36 ? 245  CYS B N   1 
ATOM   4323 C  CA  . CYS B 1 245 ? 57.279 -33.697 134.489 1.00 28.31 ? 245  CYS B CA  1 
ATOM   4324 C  C   . CYS B 1 245 ? 56.280 -33.828 133.345 1.00 27.62 ? 245  CYS B C   1 
ATOM   4325 O  O   . CYS B 1 245 ? 55.310 -34.571 133.451 1.00 28.18 ? 245  CYS B O   1 
ATOM   4326 C  CB  . CYS B 1 245 ? 57.882 -35.060 134.825 1.00 28.05 ? 245  CYS B CB  1 
ATOM   4327 S  SG  . CYS B 1 245 ? 58.740 -35.850 133.446 1.00 29.31 ? 245  CYS B SG  1 
ATOM   4328 N  N   . ARG B 1 246 ? 56.515 -33.099 132.256 1.00 27.04 ? 246  ARG B N   1 
ATOM   4329 C  CA  . ARG B 1 246 ? 55.596 -33.091 131.122 1.00 26.26 ? 246  ARG B CA  1 
ATOM   4330 C  C   . ARG B 1 246 ? 56.340 -33.111 129.781 1.00 26.36 ? 246  ARG B C   1 
ATOM   4331 O  O   . ARG B 1 246 ? 57.579 -33.150 129.749 1.00 25.33 ? 246  ARG B O   1 
ATOM   4332 C  CB  . ARG B 1 246 ? 54.621 -31.906 131.232 1.00 26.61 ? 246  ARG B CB  1 
ATOM   4333 C  CG  . ARG B 1 246 ? 55.248 -30.539 131.481 1.00 26.27 ? 246  ARG B CG  1 
ATOM   4334 C  CD  . ARG B 1 246 ? 55.714 -29.844 130.210 1.00 26.50 ? 246  ARG B CD  1 
ATOM   4335 N  NE  . ARG B 1 246 ? 54.604 -29.393 129.371 1.00 26.63 ? 246  ARG B NE  1 
ATOM   4336 C  CZ  . ARG B 1 246 ? 54.719 -28.546 128.350 1.00 26.18 ? 246  ARG B CZ  1 
ATOM   4337 N  NH1 . ARG B 1 246 ? 55.900 -28.033 128.009 1.00 27.12 ? 246  ARG B NH1 1 
ATOM   4338 N  NH2 . ARG B 1 246 ? 53.644 -28.206 127.655 1.00 24.77 ? 246  ARG B NH2 1 
ATOM   4339 N  N   . ALA B 1 247 ? 55.586 -33.104 128.687 1.00 25.02 ? 247  ALA B N   1 
ATOM   4340 C  CA  . ALA B 1 247 ? 56.164 -33.185 127.342 1.00 24.99 ? 247  ALA B CA  1 
ATOM   4341 C  C   . ALA B 1 247 ? 55.524 -32.140 126.418 1.00 24.74 ? 247  ALA B C   1 
ATOM   4342 O  O   . ALA B 1 247 ? 55.578 -30.948 126.738 1.00 25.34 ? 247  ALA B O   1 
ATOM   4343 C  CB  . ALA B 1 247 ? 56.017 -34.599 126.806 1.00 25.00 ? 247  ALA B CB  1 
ATOM   4344 N  N   . HIS B 1 248 ? 54.978 -32.546 125.265 1.00 24.72 ? 248  HIS B N   1 
ATOM   4345 C  CA  . HIS B 1 248 ? 54.043 -31.708 124.491 1.00 25.47 ? 248  HIS B CA  1 
ATOM   4346 C  C   . HIS B 1 248 ? 54.693 -30.585 123.669 1.00 26.05 ? 248  HIS B C   1 
ATOM   4347 O  O   . HIS B 1 248 ? 54.041 -30.019 122.793 1.00 26.85 ? 248  HIS B O   1 
ATOM   4348 C  CB  . HIS B 1 248 ? 52.966 -31.149 125.443 1.00 25.24 ? 248  HIS B CB  1 
ATOM   4349 C  CG  . HIS B 1 248 ? 51.776 -30.536 124.771 1.00 25.02 ? 248  HIS B CG  1 
ATOM   4350 N  ND1 . HIS B 1 248 ? 51.171 -31.076 123.658 1.00 25.29 ? 248  HIS B ND1 1 
ATOM   4351 C  CD2 . HIS B 1 248 ? 51.040 -29.453 125.108 1.00 24.99 ? 248  HIS B CD2 1 
ATOM   4352 C  CE1 . HIS B 1 248 ? 50.125 -30.341 123.326 1.00 24.94 ? 248  HIS B CE1 1 
ATOM   4353 N  NE2 . HIS B 1 248 ? 50.025 -29.348 124.189 1.00 24.93 ? 248  HIS B NE2 1 
ATOM   4354 N  N   . GLN B 1 249 ? 55.972 -30.286 123.925 1.00 27.26 ? 249  GLN B N   1 
ATOM   4355 C  CA  . GLN B 1 249 ? 56.675 -29.186 123.261 1.00 28.08 ? 249  GLN B CA  1 
ATOM   4356 C  C   . GLN B 1 249 ? 58.104 -29.579 122.891 1.00 28.27 ? 249  GLN B C   1 
ATOM   4357 O  O   . GLN B 1 249 ? 58.831 -30.155 123.703 1.00 27.05 ? 249  GLN B O   1 
ATOM   4358 C  CB  . GLN B 1 249 ? 56.704 -27.945 124.159 1.00 29.27 ? 249  GLN B CB  1 
ATOM   4359 C  CG  . GLN B 1 249 ? 55.407 -27.148 124.156 1.00 29.44 ? 249  GLN B CG  1 
ATOM   4360 C  CD  . GLN B 1 249 ? 55.500 -25.858 124.955 1.00 29.62 ? 249  GLN B CD  1 
ATOM   4361 O  OE1 . GLN B 1 249 ? 55.780 -25.876 126.154 1.00 28.70 ? 249  GLN B OE1 1 
ATOM   4362 N  NE2 . GLN B 1 249 ? 55.250 -24.729 124.296 1.00 30.53 ? 249  GLN B NE2 1 
ATOM   4363 N  N   . VAL B 1 250 ? 58.502 -29.255 121.665 1.00 28.53 ? 250  VAL B N   1 
ATOM   4364 C  CA  . VAL B 1 250 ? 59.843 -29.591 121.191 1.00 29.37 ? 250  VAL B CA  1 
ATOM   4365 C  C   . VAL B 1 250 ? 60.828 -28.702 121.922 1.00 29.63 ? 250  VAL B C   1 
ATOM   4366 O  O   . VAL B 1 250 ? 60.648 -27.491 121.962 1.00 29.95 ? 250  VAL B O   1 
ATOM   4367 C  CB  . VAL B 1 250 ? 60.026 -29.356 119.675 1.00 29.79 ? 250  VAL B CB  1 
ATOM   4368 C  CG1 . VAL B 1 250 ? 61.366 -29.920 119.217 1.00 30.36 ? 250  VAL B CG1 1 
ATOM   4369 C  CG2 . VAL B 1 250 ? 58.907 -29.988 118.872 1.00 31.42 ? 250  VAL B CG2 1 
ATOM   4370 N  N   . VAL B 1 251 ? 61.857 -29.303 122.510 1.00 30.67 ? 251  VAL B N   1 
ATOM   4371 C  CA  . VAL B 1 251 ? 62.906 -28.541 123.191 1.00 31.13 ? 251  VAL B CA  1 
ATOM   4372 C  C   . VAL B 1 251 ? 64.255 -28.959 122.615 1.00 31.58 ? 251  VAL B C   1 
ATOM   4373 O  O   . VAL B 1 251 ? 64.492 -30.143 122.352 1.00 29.16 ? 251  VAL B O   1 
ATOM   4374 C  CB  . VAL B 1 251 ? 62.856 -28.701 124.728 1.00 30.72 ? 251  VAL B CB  1 
ATOM   4375 C  CG1 . VAL B 1 251 ? 61.732 -27.855 125.307 1.00 31.36 ? 251  VAL B CG1 1 
ATOM   4376 C  CG2 . VAL B 1 251 ? 62.679 -30.157 125.135 1.00 30.73 ? 251  VAL B CG2 1 
ATOM   4377 N  N   . GLU B 1 252 ? 65.120 -27.971 122.398 1.00 33.13 ? 252  GLU B N   1 
ATOM   4378 C  CA  . GLU B 1 252 ? 66.343 -28.161 121.615 1.00 34.78 ? 252  GLU B CA  1 
ATOM   4379 C  C   . GLU B 1 252 ? 67.291 -29.197 122.214 1.00 33.99 ? 252  GLU B C   1 
ATOM   4380 O  O   . GLU B 1 252 ? 67.880 -29.988 121.480 1.00 33.01 ? 252  GLU B O   1 
ATOM   4381 C  CB  . GLU B 1 252 ? 67.078 -26.828 121.443 1.00 36.86 ? 252  GLU B CB  1 
ATOM   4382 C  CG  . GLU B 1 252 ? 68.252 -26.895 120.474 1.00 38.81 ? 252  GLU B CG  1 
ATOM   4383 C  CD  . GLU B 1 252 ? 68.798 -25.526 120.118 1.00 40.00 ? 252  GLU B CD  1 
ATOM   4384 O  OE1 . GLU B 1 252 ? 68.822 -24.637 121.000 1.00 41.67 ? 252  GLU B OE1 1 
ATOM   4385 O  OE2 . GLU B 1 252 ? 69.201 -25.344 118.952 1.00 40.81 ? 252  GLU B OE2 1 
ATOM   4386 N  N   . ASP B 1 253 ? 67.421 -29.196 123.539 1.00 34.04 ? 253  ASP B N   1 
ATOM   4387 C  CA  . ASP B 1 253 ? 68.344 -30.097 124.234 1.00 34.11 ? 253  ASP B CA  1 
ATOM   4388 C  C   . ASP B 1 253 ? 67.706 -31.429 124.648 1.00 32.70 ? 253  ASP B C   1 
ATOM   4389 O  O   . ASP B 1 253 ? 68.333 -32.208 125.359 1.00 31.00 ? 253  ASP B O   1 
ATOM   4390 C  CB  . ASP B 1 253 ? 68.897 -29.410 125.485 1.00 36.18 ? 253  ASP B CB  1 
ATOM   4391 C  CG  . ASP B 1 253 ? 69.511 -28.052 125.191 1.00 38.20 ? 253  ASP B CG  1 
ATOM   4392 O  OD1 . ASP B 1 253 ? 69.928 -27.811 124.037 1.00 41.49 ? 253  ASP B OD1 1 
ATOM   4393 O  OD2 . ASP B 1 253 ? 69.575 -27.225 126.125 1.00 39.71 ? 253  ASP B OD2 1 
ATOM   4394 N  N   . GLY B 1 254 ? 66.464 -31.683 124.230 1.00 31.29 ? 254  GLY B N   1 
ATOM   4395 C  CA  . GLY B 1 254 ? 65.737 -32.888 124.643 1.00 30.84 ? 254  GLY B CA  1 
ATOM   4396 C  C   . GLY B 1 254 ? 64.981 -32.731 125.954 1.00 32.07 ? 254  GLY B C   1 
ATOM   4397 O  O   . GLY B 1 254 ? 63.912 -33.326 126.137 1.00 32.82 ? 254  GLY B O   1 
ATOM   4398 N  N   . TYR B 1 255 ? 65.538 -31.947 126.873 1.00 31.88 ? 255  TYR B N   1 
ATOM   4399 C  CA  . TYR B 1 255 ? 64.844 -31.566 128.092 1.00 32.23 ? 255  TYR B CA  1 
ATOM   4400 C  C   . TYR B 1 255 ? 65.105 -30.098 128.407 1.00 32.12 ? 255  TYR B C   1 
ATOM   4401 O  O   . TYR B 1 255 ? 66.082 -29.508 127.931 1.00 31.70 ? 255  TYR B O   1 
ATOM   4402 C  CB  . TYR B 1 255 ? 65.260 -32.465 129.261 1.00 31.49 ? 255  TYR B CB  1 
ATOM   4403 C  CG  . TYR B 1 255 ? 66.631 -32.164 129.840 1.00 32.39 ? 255  TYR B CG  1 
ATOM   4404 C  CD1 . TYR B 1 255 ? 67.791 -32.624 129.219 1.00 31.95 ? 255  TYR B CD1 1 
ATOM   4405 C  CD2 . TYR B 1 255 ? 66.762 -31.434 131.024 1.00 31.67 ? 255  TYR B CD2 1 
ATOM   4406 C  CE1 . TYR B 1 255 ? 69.046 -32.354 129.751 1.00 32.13 ? 255  TYR B CE1 1 
ATOM   4407 C  CE2 . TYR B 1 255 ? 68.008 -31.162 131.563 1.00 32.47 ? 255  TYR B CE2 1 
ATOM   4408 C  CZ  . TYR B 1 255 ? 69.145 -31.623 130.924 1.00 32.04 ? 255  TYR B CZ  1 
ATOM   4409 O  OH  . TYR B 1 255 ? 70.377 -31.355 131.467 1.00 33.91 ? 255  TYR B OH  1 
ATOM   4410 N  N   . GLU B 1 256 ? 64.216 -29.514 129.203 1.00 32.04 ? 256  GLU B N   1 
ATOM   4411 C  CA  . GLU B 1 256 ? 64.291 -28.102 129.540 1.00 32.47 ? 256  GLU B CA  1 
ATOM   4412 C  C   . GLU B 1 256 ? 63.544 -27.826 130.841 1.00 33.23 ? 256  GLU B C   1 
ATOM   4413 O  O   . GLU B 1 256 ? 62.369 -28.185 130.986 1.00 28.94 ? 256  GLU B O   1 
ATOM   4414 C  CB  . GLU B 1 256 ? 63.703 -27.263 128.408 1.00 34.52 ? 256  GLU B CB  1 
ATOM   4415 C  CG  . GLU B 1 256 ? 63.923 -25.765 128.544 1.00 36.15 ? 256  GLU B CG  1 
ATOM   4416 C  CD  . GLU B 1 256 ? 63.279 -24.989 127.415 1.00 37.52 ? 256  GLU B CD  1 
ATOM   4417 O  OE1 . GLU B 1 256 ? 63.745 -25.107 126.264 1.00 40.12 ? 256  GLU B OE1 1 
ATOM   4418 O  OE2 . GLU B 1 256 ? 62.305 -24.261 127.681 1.00 39.93 ? 256  GLU B OE2 1 
ATOM   4419 N  N   . PHE B 1 257 ? 64.237 -27.191 131.780 1.00 32.18 ? 257  PHE B N   1 
ATOM   4420 C  CA  . PHE B 1 257 ? 63.648 -26.848 133.065 1.00 33.24 ? 257  PHE B CA  1 
ATOM   4421 C  C   . PHE B 1 257 ? 62.922 -25.511 132.996 1.00 34.28 ? 257  PHE B C   1 
ATOM   4422 O  O   . PHE B 1 257 ? 63.237 -24.655 132.163 1.00 33.89 ? 257  PHE B O   1 
ATOM   4423 C  CB  . PHE B 1 257 ? 64.711 -26.821 134.163 1.00 32.92 ? 257  PHE B CB  1 
ATOM   4424 C  CG  . PHE B 1 257 ? 65.080 -28.182 134.687 1.00 32.33 ? 257  PHE B CG  1 
ATOM   4425 C  CD1 . PHE B 1 257 ? 64.187 -28.904 135.473 1.00 31.86 ? 257  PHE B CD1 1 
ATOM   4426 C  CD2 . PHE B 1 257 ? 66.326 -28.736 134.419 1.00 31.85 ? 257  PHE B CD2 1 
ATOM   4427 C  CE1 . PHE B 1 257 ? 64.524 -30.152 135.972 1.00 31.52 ? 257  PHE B CE1 1 
ATOM   4428 C  CE2 . PHE B 1 257 ? 66.666 -29.987 134.912 1.00 32.19 ? 257  PHE B CE2 1 
ATOM   4429 C  CZ  . PHE B 1 257 ? 65.766 -30.695 135.691 1.00 32.03 ? 257  PHE B CZ  1 
ATOM   4430 N  N   . PHE B 1 258 ? 61.937 -25.361 133.875 1.00 35.71 ? 258  PHE B N   1 
ATOM   4431 C  CA  . PHE B 1 258 ? 61.103 -24.167 133.949 1.00 36.50 ? 258  PHE B CA  1 
ATOM   4432 C  C   . PHE B 1 258 ? 60.846 -23.869 135.426 1.00 36.67 ? 258  PHE B C   1 
ATOM   4433 O  O   . PHE B 1 258 ? 60.804 -24.789 136.248 1.00 35.53 ? 258  PHE B O   1 
ATOM   4434 C  CB  . PHE B 1 258 ? 59.796 -24.420 133.191 1.00 37.40 ? 258  PHE B CB  1 
ATOM   4435 C  CG  . PHE B 1 258 ? 58.799 -23.295 133.266 1.00 38.36 ? 258  PHE B CG  1 
ATOM   4436 C  CD1 . PHE B 1 258 ? 58.831 -22.253 132.349 1.00 39.47 ? 258  PHE B CD1 1 
ATOM   4437 C  CD2 . PHE B 1 258 ? 57.798 -23.302 134.229 1.00 38.31 ? 258  PHE B CD2 1 
ATOM   4438 C  CE1 . PHE B 1 258 ? 57.901 -21.226 132.408 1.00 39.72 ? 258  PHE B CE1 1 
ATOM   4439 C  CE2 . PHE B 1 258 ? 56.865 -22.279 134.295 1.00 39.82 ? 258  PHE B CE2 1 
ATOM   4440 C  CZ  . PHE B 1 258 ? 56.914 -21.238 133.383 1.00 39.99 ? 258  PHE B CZ  1 
ATOM   4441 N  N   . ALA B 1 259 ? 60.705 -22.585 135.756 1.00 37.37 ? 259  ALA B N   1 
ATOM   4442 C  CA  . ALA B 1 259 ? 60.399 -22.143 137.121 1.00 38.54 ? 259  ALA B CA  1 
ATOM   4443 C  C   . ALA B 1 259 ? 61.399 -22.670 138.157 1.00 38.91 ? 259  ALA B C   1 
ATOM   4444 O  O   . ALA B 1 259 ? 61.016 -23.316 139.135 1.00 39.04 ? 259  ALA B O   1 
ATOM   4445 C  CB  . ALA B 1 259 ? 58.973 -22.533 137.498 1.00 38.61 ? 259  ALA B CB  1 
ATOM   4446 N  N   . LYS B 1 260 ? 62.678 -22.383 137.929 1.00 39.57 ? 260  LYS B N   1 
ATOM   4447 C  CA  . LYS B 1 260 ? 63.757 -22.780 138.840 1.00 41.47 ? 260  LYS B CA  1 
ATOM   4448 C  C   . LYS B 1 260 ? 63.740 -24.281 139.153 1.00 40.75 ? 260  LYS B C   1 
ATOM   4449 O  O   . LYS B 1 260 ? 63.748 -24.691 140.316 1.00 39.52 ? 260  LYS B O   1 
ATOM   4450 C  CB  . LYS B 1 260 ? 63.707 -21.941 140.125 1.00 42.71 ? 260  LYS B CB  1 
ATOM   4451 C  CG  . LYS B 1 260 ? 64.151 -20.499 139.921 1.00 44.26 ? 260  LYS B CG  1 
ATOM   4452 C  CD  . LYS B 1 260 ? 63.572 -19.554 140.965 1.00 45.80 ? 260  LYS B CD  1 
ATOM   4453 C  CE  . LYS B 1 260 ? 62.363 -18.793 140.437 1.00 47.56 ? 260  LYS B CE  1 
ATOM   4454 N  NZ  . LYS B 1 260 ? 61.253 -19.675 139.970 1.00 48.11 ? 260  LYS B NZ  1 
ATOM   4455 N  N   . ARG B 1 261 ? 63.714 -25.085 138.092 1.00 39.44 ? 261  ARG B N   1 
ATOM   4456 C  CA  . ARG B 1 261 ? 63.743 -26.555 138.177 1.00 39.84 ? 261  ARG B CA  1 
ATOM   4457 C  C   . ARG B 1 261 ? 62.519 -27.197 138.867 1.00 38.06 ? 261  ARG B C   1 
ATOM   4458 O  O   . ARG B 1 261 ? 62.589 -28.337 139.328 1.00 37.68 ? 261  ARG B O   1 
ATOM   4459 C  CB  . ARG B 1 261 ? 65.061 -27.042 138.810 1.00 41.58 ? 261  ARG B CB  1 
ATOM   4460 C  CG  . ARG B 1 261 ? 66.262 -26.898 137.888 1.00 43.72 ? 261  ARG B CG  1 
ATOM   4461 C  CD  . ARG B 1 261 ? 67.586 -27.009 138.625 1.00 46.10 ? 261  ARG B CD  1 
ATOM   4462 N  NE  . ARG B 1 261 ? 67.938 -25.754 139.291 1.00 48.74 ? 261  ARG B NE  1 
ATOM   4463 C  CZ  . ARG B 1 261 ? 69.126 -25.481 139.837 1.00 52.34 ? 261  ARG B CZ  1 
ATOM   4464 N  NH1 . ARG B 1 261 ? 70.115 -26.374 139.808 1.00 53.80 ? 261  ARG B NH1 1 
ATOM   4465 N  NH2 . ARG B 1 261 ? 69.331 -24.300 140.417 1.00 51.88 ? 261  ARG B NH2 1 
ATOM   4466 N  N   . GLN B 1 262 ? 61.397 -26.480 138.901 1.00 36.64 ? 262  GLN B N   1 
ATOM   4467 C  CA  . GLN B 1 262 ? 60.150 -27.008 139.469 1.00 35.31 ? 262  GLN B CA  1 
ATOM   4468 C  C   . GLN B 1 262 ? 59.272 -27.704 138.420 1.00 33.03 ? 262  GLN B C   1 
ATOM   4469 O  O   . GLN B 1 262 ? 58.366 -28.457 138.769 1.00 32.86 ? 262  GLN B O   1 
ATOM   4470 C  CB  . GLN B 1 262 ? 59.363 -25.892 140.165 1.00 35.79 ? 262  GLN B CB  1 
ATOM   4471 C  CG  . GLN B 1 262 ? 59.983 -25.440 141.482 1.00 36.02 ? 262  GLN B CG  1 
ATOM   4472 C  CD  . GLN B 1 262 ? 59.133 -24.413 142.207 1.00 35.67 ? 262  GLN B CD  1 
ATOM   4473 O  OE1 . GLN B 1 262 ? 58.555 -24.699 143.257 1.00 35.55 ? 262  GLN B OE1 1 
ATOM   4474 N  NE2 . GLN B 1 262 ? 59.038 -23.216 141.640 1.00 36.08 ? 262  GLN B NE2 1 
ATOM   4475 N  N   . LEU B 1 263 ? 59.531 -27.434 137.143 1.00 31.81 ? 263  LEU B N   1 
ATOM   4476 C  CA  . LEU B 1 263 ? 58.902 -28.165 136.042 1.00 29.78 ? 263  LEU B CA  1 
ATOM   4477 C  C   . LEU B 1 263 ? 59.949 -28.532 135.000 1.00 29.40 ? 263  LEU B C   1 
ATOM   4478 O  O   . LEU B 1 263 ? 60.851 -27.740 134.713 1.00 31.67 ? 263  LEU B O   1 
ATOM   4479 C  CB  . LEU B 1 263 ? 57.791 -27.323 135.401 1.00 29.29 ? 263  LEU B CB  1 
ATOM   4480 C  CG  . LEU B 1 263 ? 57.029 -27.905 134.198 1.00 28.98 ? 263  LEU B CG  1 
ATOM   4481 C  CD1 . LEU B 1 263 ? 55.604 -27.368 134.149 1.00 28.70 ? 263  LEU B CD1 1 
ATOM   4482 C  CD2 . LEU B 1 263 ? 57.727 -27.636 132.872 1.00 28.87 ? 263  LEU B CD2 1 
ATOM   4483 N  N   . VAL B 1 264 ? 59.818 -29.725 134.420 1.00 28.51 ? 264  VAL B N   1 
ATOM   4484 C  CA  . VAL B 1 264 ? 60.659 -30.131 133.285 1.00 27.02 ? 264  VAL B CA  1 
ATOM   4485 C  C   . VAL B 1 264 ? 59.801 -30.593 132.106 1.00 26.66 ? 264  VAL B C   1 
ATOM   4486 O  O   . VAL B 1 264 ? 58.800 -31.304 132.289 1.00 25.87 ? 264  VAL B O   1 
ATOM   4487 C  CB  . VAL B 1 264 ? 61.672 -31.228 133.687 1.00 26.64 ? 264  VAL B CB  1 
ATOM   4488 C  CG1 . VAL B 1 264 ? 60.989 -32.570 133.931 1.00 26.59 ? 264  VAL B CG1 1 
ATOM   4489 C  CG2 . VAL B 1 264 ? 62.761 -31.368 132.634 1.00 27.18 ? 264  VAL B CG2 1 
ATOM   4490 N  N   . THR B 1 265 ? 60.190 -30.161 130.908 1.00 25.48 ? 265  THR B N   1 
ATOM   4491 C  CA  . THR B 1 265 ? 59.616 -30.635 129.654 1.00 25.47 ? 265  THR B CA  1 
ATOM   4492 C  C   . THR B 1 265 ? 60.563 -31.673 129.042 1.00 25.50 ? 265  THR B C   1 
ATOM   4493 O  O   . THR B 1 265 ? 61.766 -31.403 128.891 1.00 25.17 ? 265  THR B O   1 
ATOM   4494 C  CB  . THR B 1 265 ? 59.430 -29.471 128.655 1.00 26.22 ? 265  THR B CB  1 
ATOM   4495 O  OG1 . THR B 1 265 ? 58.542 -28.487 129.207 1.00 26.31 ? 265  THR B OG1 1 
ATOM   4496 C  CG2 . THR B 1 265 ? 58.861 -29.959 127.329 1.00 26.59 ? 265  THR B CG2 1 
ATOM   4497 N  N   . LEU B 1 266 ? 60.033 -32.861 128.730 1.00 24.25 ? 266  LEU B N   1 
ATOM   4498 C  CA  . LEU B 1 266 ? 60.790 -33.917 128.038 1.00 24.04 ? 266  LEU B CA  1 
ATOM   4499 C  C   . LEU B 1 266 ? 60.262 -34.108 126.621 1.00 24.03 ? 266  LEU B C   1 
ATOM   4500 O  O   . LEU B 1 266 ? 59.061 -34.013 126.376 1.00 23.44 ? 266  LEU B O   1 
ATOM   4501 C  CB  . LEU B 1 266 ? 60.682 -35.256 128.772 1.00 24.50 ? 266  LEU B CB  1 
ATOM   4502 C  CG  . LEU B 1 266 ? 61.018 -35.302 130.260 1.00 25.22 ? 266  LEU B CG  1 
ATOM   4503 C  CD1 . LEU B 1 266 ? 60.790 -36.706 130.799 1.00 25.25 ? 266  LEU B CD1 1 
ATOM   4504 C  CD2 . LEU B 1 266 ? 62.453 -34.865 130.508 1.00 25.69 ? 266  LEU B CD2 1 
ATOM   4505 N  N   . PHE B 1 267 ? 61.174 -34.383 125.698 1.00 24.12 ? 267  PHE B N   1 
ATOM   4506 C  CA  . PHE B 1 267 ? 60.838 -34.657 124.312 1.00 23.87 ? 267  PHE B CA  1 
ATOM   4507 C  C   . PHE B 1 267 ? 61.813 -35.711 123.808 1.00 24.54 ? 267  PHE B C   1 
ATOM   4508 O  O   . PHE B 1 267 ? 63.028 -35.550 123.941 1.00 24.58 ? 267  PHE B O   1 
ATOM   4509 C  CB  . PHE B 1 267 ? 60.940 -33.375 123.485 1.00 23.41 ? 267  PHE B CB  1 
ATOM   4510 C  CG  . PHE B 1 267 ? 60.209 -33.439 122.182 1.00 22.72 ? 267  PHE B CG  1 
ATOM   4511 C  CD1 . PHE B 1 267 ? 58.858 -33.141 122.119 1.00 22.38 ? 267  PHE B CD1 1 
ATOM   4512 C  CD2 . PHE B 1 267 ? 60.867 -33.804 121.016 1.00 22.44 ? 267  PHE B CD2 1 
ATOM   4513 C  CE1 . PHE B 1 267 ? 58.178 -33.191 120.915 1.00 22.25 ? 267  PHE B CE1 1 
ATOM   4514 C  CE2 . PHE B 1 267 ? 60.192 -33.864 119.811 1.00 22.48 ? 267  PHE B CE2 1 
ATOM   4515 C  CZ  . PHE B 1 267 ? 58.844 -33.561 119.757 1.00 22.55 ? 267  PHE B CZ  1 
ATOM   4516 N  N   . SER B 1 268 ? 61.292 -36.791 123.237 1.00 24.50 ? 268  SER B N   1 
ATOM   4517 C  CA  . SER B 1 268 ? 62.117 -37.965 122.950 1.00 24.80 ? 268  SER B CA  1 
ATOM   4518 C  C   . SER B 1 268 ? 62.235 -38.322 121.467 1.00 25.19 ? 268  SER B C   1 
ATOM   4519 O  O   . SER B 1 268 ? 62.682 -39.417 121.131 1.00 27.17 ? 268  SER B O   1 
ATOM   4520 C  CB  . SER B 1 268 ? 61.588 -39.154 123.752 1.00 24.55 ? 268  SER B CB  1 
ATOM   4521 O  OG  . SER B 1 268 ? 61.659 -38.874 125.142 1.00 23.80 ? 268  SER B OG  1 
ATOM   4522 N  N   . ALA B 1 269 ? 61.856 -37.394 120.592 1.00 24.68 ? 269  ALA B N   1 
ATOM   4523 C  CA  . ALA B 1 269 ? 61.969 -37.571 119.146 1.00 24.72 ? 269  ALA B CA  1 
ATOM   4524 C  C   . ALA B 1 269 ? 63.058 -36.650 118.587 1.00 25.17 ? 269  ALA B C   1 
ATOM   4525 O  O   . ALA B 1 269 ? 62.798 -35.476 118.303 1.00 24.53 ? 269  ALA B O   1 
ATOM   4526 C  CB  . ALA B 1 269 ? 60.636 -37.285 118.469 1.00 24.79 ? 269  ALA B CB  1 
ATOM   4527 N  N   . PRO B 1 270 ? 64.286 -37.175 118.433 1.00 25.78 ? 270  PRO B N   1 
ATOM   4528 C  CA  . PRO B 1 270 ? 65.361 -36.353 117.864 1.00 26.75 ? 270  PRO B CA  1 
ATOM   4529 C  C   . PRO B 1 270 ? 65.082 -35.992 116.408 1.00 27.83 ? 270  PRO B C   1 
ATOM   4530 O  O   . PRO B 1 270 ? 64.455 -36.769 115.692 1.00 28.10 ? 270  PRO B O   1 
ATOM   4531 C  CB  . PRO B 1 270 ? 66.600 -37.253 117.956 1.00 25.98 ? 270  PRO B CB  1 
ATOM   4532 C  CG  . PRO B 1 270 ? 66.225 -38.396 118.838 1.00 26.03 ? 270  PRO B CG  1 
ATOM   4533 C  CD  . PRO B 1 270 ? 64.739 -38.542 118.740 1.00 25.21 ? 270  PRO B CD  1 
ATOM   4534 N  N   . ASN B 1 271 ? 65.548 -34.819 115.984 1.00 29.49 ? 271  ASN B N   1 
ATOM   4535 C  CA  . ASN B 1 271 ? 65.331 -34.337 114.618 1.00 30.97 ? 271  ASN B CA  1 
ATOM   4536 C  C   . ASN B 1 271 ? 63.843 -34.392 114.257 1.00 30.21 ? 271  ASN B C   1 
ATOM   4537 O  O   . ASN B 1 271 ? 63.459 -34.890 113.201 1.00 28.89 ? 271  ASN B O   1 
ATOM   4538 C  CB  . ASN B 1 271 ? 66.170 -35.149 113.614 1.00 31.51 ? 271  ASN B CB  1 
ATOM   4539 C  CG  . ASN B 1 271 ? 66.265 -34.493 112.242 1.00 32.83 ? 271  ASN B CG  1 
ATOM   4540 O  OD1 . ASN B 1 271 ? 66.512 -35.166 111.239 1.00 33.82 ? 271  ASN B OD1 1 
ATOM   4541 N  ND2 . ASN B 1 271 ? 66.071 -33.179 112.187 1.00 33.18 ? 271  ASN B ND2 1 
ATOM   4542 N  N   . TYR B 1 272 ? 63.021 -33.872 115.163 1.00 31.93 ? 272  TYR B N   1 
ATOM   4543 C  CA  . TYR B 1 272 ? 61.563 -33.939 115.060 1.00 32.48 ? 272  TYR B CA  1 
ATOM   4544 C  C   . TYR B 1 272 ? 61.061 -33.474 113.691 1.00 35.41 ? 272  TYR B C   1 
ATOM   4545 O  O   . TYR B 1 272 ? 61.407 -32.382 113.240 1.00 33.98 ? 272  TYR B O   1 
ATOM   4546 C  CB  . TYR B 1 272 ? 60.957 -33.079 116.170 1.00 32.43 ? 272  TYR B CB  1 
ATOM   4547 C  CG  . TYR B 1 272 ? 59.451 -33.031 116.218 1.00 31.61 ? 272  TYR B CG  1 
ATOM   4548 C  CD1 . TYR B 1 272 ? 58.691 -34.193 116.233 1.00 31.01 ? 272  TYR B CD1 1 
ATOM   4549 C  CD2 . TYR B 1 272 ? 58.782 -31.814 116.278 1.00 31.62 ? 272  TYR B CD2 1 
ATOM   4550 C  CE1 . TYR B 1 272 ? 57.309 -34.138 116.287 1.00 30.02 ? 272  TYR B CE1 1 
ATOM   4551 C  CE2 . TYR B 1 272 ? 57.403 -31.751 116.342 1.00 30.65 ? 272  TYR B CE2 1 
ATOM   4552 C  CZ  . TYR B 1 272 ? 56.670 -32.913 116.347 1.00 30.30 ? 272  TYR B CZ  1 
ATOM   4553 O  OH  . TYR B 1 272 ? 55.292 -32.845 116.401 1.00 28.92 ? 272  TYR B OH  1 
HETATM 4554 N  N   . CSO B 1 273 ? 60.267 -34.323 113.035 1.00 39.66 ? 273  CSO B N   1 
HETATM 4555 C  CA  . CSO B 1 273 ? 59.687 -34.046 111.703 1.00 43.94 ? 273  CSO B CA  1 
HETATM 4556 C  CB  . CSO B 1 273 ? 58.882 -32.737 111.670 1.00 46.49 ? 273  CSO B CB  1 
HETATM 4557 S  SG  . CSO B 1 273 ? 57.387 -32.907 112.580 1.00 51.42 ? 273  CSO B SG  1 
HETATM 4558 C  C   . CSO B 1 273 ? 60.714 -34.002 110.596 1.00 44.85 ? 273  CSO B C   1 
HETATM 4559 O  O   . CSO B 1 273 ? 60.363 -33.759 109.441 1.00 46.17 ? 273  CSO B O   1 
HETATM 4560 O  OD  . CSO B 1 273 ? 56.877 -31.271 112.869 1.00 49.70 ? 273  CSO B OD  1 
ATOM   4561 N  N   . GLY B 1 274 ? 61.982 -34.244 110.920 1.00 45.05 ? 274  GLY B N   1 
ATOM   4562 C  CA  . GLY B 1 274 ? 63.081 -33.981 109.993 1.00 46.27 ? 274  GLY B CA  1 
ATOM   4563 C  C   . GLY B 1 274 ? 63.313 -32.499 109.726 1.00 47.73 ? 274  GLY B C   1 
ATOM   4564 O  O   . GLY B 1 274 ? 64.020 -32.141 108.781 1.00 48.53 ? 274  GLY B O   1 
ATOM   4565 N  N   . GLU B 1 275 ? 62.735 -31.637 110.561 1.00 47.80 ? 275  GLU B N   1 
ATOM   4566 C  CA  . GLU B 1 275 ? 62.821 -30.189 110.372 1.00 49.72 ? 275  GLU B CA  1 
ATOM   4567 C  C   . GLU B 1 275 ? 63.673 -29.532 111.449 1.00 47.66 ? 275  GLU B C   1 
ATOM   4568 O  O   . GLU B 1 275 ? 64.571 -28.748 111.145 1.00 50.20 ? 275  GLU B O   1 
ATOM   4569 C  CB  . GLU B 1 275 ? 61.420 -29.570 110.357 1.00 51.70 ? 275  GLU B CB  1 
ATOM   4570 C  CG  . GLU B 1 275 ? 60.585 -29.997 109.156 1.00 54.19 ? 275  GLU B CG  1 
ATOM   4571 C  CD  . GLU B 1 275 ? 59.334 -29.157 108.961 1.00 56.85 ? 275  GLU B CD  1 
ATOM   4572 O  OE1 . GLU B 1 275 ? 59.348 -27.955 109.310 1.00 61.12 ? 275  GLU B OE1 1 
ATOM   4573 O  OE2 . GLU B 1 275 ? 58.332 -29.697 108.445 1.00 57.99 ? 275  GLU B OE2 1 
ATOM   4574 N  N   . PHE B 1 276 ? 63.396 -29.863 112.706 1.00 44.02 ? 276  PHE B N   1 
ATOM   4575 C  CA  . PHE B 1 276 ? 64.145 -29.320 113.830 1.00 42.14 ? 276  PHE B CA  1 
ATOM   4576 C  C   . PHE B 1 276 ? 65.446 -30.102 113.983 1.00 39.17 ? 276  PHE B C   1 
ATOM   4577 O  O   . PHE B 1 276 ? 65.547 -31.232 113.517 1.00 38.11 ? 276  PHE B O   1 
ATOM   4578 C  CB  . PHE B 1 276 ? 63.312 -29.398 115.114 1.00 41.82 ? 276  PHE B CB  1 
ATOM   4579 C  CG  . PHE B 1 276 ? 62.041 -28.588 115.068 1.00 42.82 ? 276  PHE B CG  1 
ATOM   4580 C  CD1 . PHE B 1 276 ? 60.885 -29.104 114.488 1.00 42.96 ? 276  PHE B CD1 1 
ATOM   4581 C  CD2 . PHE B 1 276 ? 61.996 -27.312 115.614 1.00 44.00 ? 276  PHE B CD2 1 
ATOM   4582 C  CE1 . PHE B 1 276 ? 59.716 -28.360 114.444 1.00 44.05 ? 276  PHE B CE1 1 
ATOM   4583 C  CE2 . PHE B 1 276 ? 60.827 -26.564 115.577 1.00 45.03 ? 276  PHE B CE2 1 
ATOM   4584 C  CZ  . PHE B 1 276 ? 59.685 -27.089 114.991 1.00 44.60 ? 276  PHE B CZ  1 
ATOM   4585 N  N   . ASP B 1 277 ? 66.445 -29.490 114.613 1.00 37.63 ? 277  ASP B N   1 
ATOM   4586 C  CA  . ASP B 1 277 ? 67.735 -30.147 114.860 1.00 36.31 ? 277  ASP B CA  1 
ATOM   4587 C  C   . ASP B 1 277 ? 67.874 -30.489 116.340 1.00 33.53 ? 277  ASP B C   1 
ATOM   4588 O  O   . ASP B 1 277 ? 68.963 -30.427 116.912 1.00 33.99 ? 277  ASP B O   1 
ATOM   4589 C  CB  . ASP B 1 277 ? 68.889 -29.244 114.410 1.00 37.67 ? 277  ASP B CB  1 
ATOM   4590 C  CG  . ASP B 1 277 ? 68.996 -29.135 112.902 1.00 39.43 ? 277  ASP B CG  1 
ATOM   4591 O  OD1 . ASP B 1 277 ? 68.756 -30.147 112.206 1.00 40.37 ? 277  ASP B OD1 1 
ATOM   4592 O  OD2 . ASP B 1 277 ? 69.337 -28.038 112.410 1.00 40.70 ? 277  ASP B OD2 1 
ATOM   4593 N  N   . ASN B 1 278 ? 66.761 -30.885 116.948 1.00 31.02 ? 278  ASN B N   1 
ATOM   4594 C  CA  . ASN B 1 278 ? 66.706 -31.099 118.384 1.00 29.09 ? 278  ASN B CA  1 
ATOM   4595 C  C   . ASN B 1 278 ? 67.207 -32.483 118.776 1.00 27.85 ? 278  ASN B C   1 
ATOM   4596 O  O   . ASN B 1 278 ? 67.105 -33.440 118.008 1.00 28.43 ? 278  ASN B O   1 
ATOM   4597 C  CB  . ASN B 1 278 ? 65.273 -30.922 118.884 1.00 28.85 ? 278  ASN B CB  1 
ATOM   4598 C  CG  . ASN B 1 278 ? 64.341 -31.991 118.348 1.00 28.11 ? 278  ASN B CG  1 
ATOM   4599 O  OD1 . ASN B 1 278 ? 63.972 -31.972 117.175 1.00 28.27 ? 278  ASN B OD1 1 
ATOM   4600 N  ND2 . ASN B 1 278 ? 63.977 -32.940 119.196 1.00 27.92 ? 278  ASN B ND2 1 
ATOM   4601 N  N   . ALA B 1 279 ? 67.763 -32.568 119.976 1.00 26.66 ? 279  ALA B N   1 
ATOM   4602 C  CA  . ALA B 1 279 ? 68.058 -33.845 120.599 1.00 26.07 ? 279  ALA B CA  1 
ATOM   4603 C  C   . ALA B 1 279 ? 66.789 -34.385 121.228 1.00 25.14 ? 279  ALA B C   1 
ATOM   4604 O  O   . ALA B 1 279 ? 65.863 -33.628 121.529 1.00 25.56 ? 279  ALA B O   1 
ATOM   4605 C  CB  . ALA B 1 279 ? 69.135 -33.675 121.661 1.00 26.25 ? 279  ALA B CB  1 
ATOM   4606 N  N   . GLY B 1 280 ? 66.750 -35.698 121.412 1.00 24.45 ? 280  GLY B N   1 
ATOM   4607 C  CA  . GLY B 1 280 ? 65.777 -36.327 122.290 1.00 24.23 ? 280  GLY B CA  1 
ATOM   4608 C  C   . GLY B 1 280 ? 66.417 -36.525 123.656 1.00 24.74 ? 280  GLY B C   1 
ATOM   4609 O  O   . GLY B 1 280 ? 67.650 -36.531 123.775 1.00 23.17 ? 280  GLY B O   1 
ATOM   4610 N  N   . ALA B 1 281 ? 65.590 -36.668 124.689 1.00 24.68 ? 281  ALA B N   1 
ATOM   4611 C  CA  . ALA B 1 281 ? 66.082 -37.006 126.022 1.00 25.84 ? 281  ALA B CA  1 
ATOM   4612 C  C   . ALA B 1 281 ? 65.143 -37.959 126.751 1.00 26.64 ? 281  ALA B C   1 
ATOM   4613 O  O   . ALA B 1 281 ? 63.975 -38.127 126.379 1.00 26.35 ? 281  ALA B O   1 
ATOM   4614 C  CB  . ALA B 1 281 ? 66.316 -35.753 126.851 1.00 26.14 ? 281  ALA B CB  1 
ATOM   4615 N  N   . MET B 1 282 ? 65.687 -38.585 127.785 1.00 27.50 ? 282  MET B N   1 
ATOM   4616 C  CA  . MET B 1 282 ? 64.975 -39.558 128.599 1.00 28.32 ? 282  MET B CA  1 
ATOM   4617 C  C   . MET B 1 282 ? 65.409 -39.371 130.048 1.00 29.44 ? 282  MET B C   1 
ATOM   4618 O  O   . MET B 1 282 ? 66.603 -39.475 130.356 1.00 30.43 ? 282  MET B O   1 
ATOM   4619 C  CB  . MET B 1 282 ? 65.314 -40.959 128.100 1.00 29.24 ? 282  MET B CB  1 
ATOM   4620 C  CG  . MET B 1 282 ? 64.926 -42.101 129.016 1.00 29.70 ? 282  MET B CG  1 
ATOM   4621 S  SD  . MET B 1 282 ? 65.053 -43.692 128.174 1.00 31.45 ? 282  MET B SD  1 
ATOM   4622 C  CE  . MET B 1 282 ? 66.722 -43.628 127.525 1.00 31.30 ? 282  MET B CE  1 
ATOM   4623 N  N   . MET B 1 283 ? 64.450 -39.080 130.930 1.00 29.35 ? 283  MET B N   1 
ATOM   4624 C  CA  . MET B 1 283 ? 64.754 -38.841 132.340 1.00 29.69 ? 283  MET B CA  1 
ATOM   4625 C  C   . MET B 1 283 ? 64.767 -40.152 133.112 1.00 30.24 ? 283  MET B C   1 
ATOM   4626 O  O   . MET B 1 283 ? 63.844 -40.962 133.003 1.00 31.07 ? 283  MET B O   1 
ATOM   4627 C  CB  . MET B 1 283 ? 63.746 -37.872 132.971 1.00 29.67 ? 283  MET B CB  1 
ATOM   4628 C  CG  . MET B 1 283 ? 64.085 -37.479 134.406 1.00 29.93 ? 283  MET B CG  1 
ATOM   4629 S  SD  . MET B 1 283 ? 63.214 -36.005 134.976 1.00 30.42 ? 283  MET B SD  1 
ATOM   4630 C  CE  . MET B 1 283 ? 61.616 -36.688 135.395 1.00 28.94 ? 283  MET B CE  1 
ATOM   4631 N  N   . SER B 1 284 ? 65.823 -40.346 133.893 1.00 29.86 ? 284  SER B N   1 
ATOM   4632 C  CA  . SER B 1 284 ? 65.966 -41.502 134.757 1.00 30.86 ? 284  SER B CA  1 
ATOM   4633 C  C   . SER B 1 284 ? 65.713 -41.044 136.200 1.00 31.18 ? 284  SER B C   1 
ATOM   4634 O  O   . SER B 1 284 ? 66.262 -40.041 136.635 1.00 29.51 ? 284  SER B O   1 
ATOM   4635 C  CB  . SER B 1 284 ? 67.376 -42.076 134.588 1.00 31.35 ? 284  SER B CB  1 
ATOM   4636 O  OG  . SER B 1 284 ? 67.484 -43.367 135.147 1.00 32.57 ? 284  SER B OG  1 
ATOM   4637 N  N   . VAL B 1 285 ? 64.848 -41.756 136.922 1.00 33.24 ? 285  VAL B N   1 
ATOM   4638 C  CA  . VAL B 1 285 ? 64.590 -41.480 138.339 1.00 35.03 ? 285  VAL B CA  1 
ATOM   4639 C  C   . VAL B 1 285 ? 65.031 -42.704 139.141 1.00 36.43 ? 285  VAL B C   1 
ATOM   4640 O  O   . VAL B 1 285 ? 64.612 -43.816 138.840 1.00 36.05 ? 285  VAL B O   1 
ATOM   4641 C  CB  . VAL B 1 285 ? 63.093 -41.206 138.609 1.00 35.35 ? 285  VAL B CB  1 
ATOM   4642 C  CG1 . VAL B 1 285 ? 62.882 -40.711 140.035 1.00 35.00 ? 285  VAL B CG1 1 
ATOM   4643 C  CG2 . VAL B 1 285 ? 62.539 -40.194 137.614 1.00 34.62 ? 285  VAL B CG2 1 
ATOM   4644 N  N   . ASP B 1 286 ? 65.877 -42.502 140.152 1.00 39.80 ? 286  ASP B N   1 
ATOM   4645 C  CA  . ASP B 1 286 ? 66.376 -43.622 140.970 1.00 41.28 ? 286  ASP B CA  1 
ATOM   4646 C  C   . ASP B 1 286 ? 65.704 -43.674 142.348 1.00 43.65 ? 286  ASP B C   1 
ATOM   4647 O  O   . ASP B 1 286 ? 64.893 -42.803 142.683 1.00 42.62 ? 286  ASP B O   1 
ATOM   4648 C  CB  . ASP B 1 286 ? 67.907 -43.570 141.093 1.00 41.37 ? 286  ASP B CB  1 
ATOM   4649 C  CG  . ASP B 1 286 ? 68.405 -42.410 141.951 1.00 41.65 ? 286  ASP B CG  1 
ATOM   4650 O  OD1 . ASP B 1 286 ? 67.599 -41.779 142.675 1.00 40.14 ? 286  ASP B OD1 1 
ATOM   4651 O  OD2 . ASP B 1 286 ? 69.624 -42.138 141.899 1.00 39.57 ? 286  ASP B OD2 1 
ATOM   4652 N  N   . GLU B 1 287 ? 66.048 -44.696 143.133 1.00 45.53 ? 287  GLU B N   1 
ATOM   4653 C  CA  . GLU B 1 287 ? 65.417 -44.946 144.438 1.00 48.37 ? 287  GLU B CA  1 
ATOM   4654 C  C   . GLU B 1 287 ? 65.506 -43.780 145.431 1.00 47.27 ? 287  GLU B C   1 
ATOM   4655 O  O   . GLU B 1 287 ? 64.605 -43.599 146.251 1.00 44.09 ? 287  GLU B O   1 
ATOM   4656 C  CB  . GLU B 1 287 ? 65.995 -46.218 145.072 1.00 51.98 ? 287  GLU B CB  1 
ATOM   4657 C  CG  . GLU B 1 287 ? 65.442 -47.508 144.476 1.00 55.23 ? 287  GLU B CG  1 
ATOM   4658 C  CD  . GLU B 1 287 ? 66.342 -48.712 144.716 1.00 58.80 ? 287  GLU B CD  1 
ATOM   4659 O  OE1 . GLU B 1 287 ? 67.002 -48.766 145.779 1.00 62.83 ? 287  GLU B OE1 1 
ATOM   4660 O  OE2 . GLU B 1 287 ? 66.385 -49.613 143.845 1.00 60.78 ? 287  GLU B OE2 1 
ATOM   4661 N  N   . THR B 1 288 ? 66.571 -42.985 145.348 1.00 46.31 ? 288  THR B N   1 
ATOM   4662 C  CA  . THR B 1 288 ? 66.727 -41.808 146.216 1.00 47.17 ? 288  THR B CA  1 
ATOM   4663 C  C   . THR B 1 288 ? 66.000 -40.568 145.674 1.00 46.01 ? 288  THR B C   1 
ATOM   4664 O  O   . THR B 1 288 ? 66.169 -39.467 146.202 1.00 45.08 ? 288  THR B O   1 
ATOM   4665 C  CB  . THR B 1 288 ? 68.219 -41.458 146.423 1.00 46.88 ? 288  THR B CB  1 
ATOM   4666 O  OG1 . THR B 1 288 ? 68.855 -41.289 145.151 1.00 47.54 ? 288  THR B OG1 1 
ATOM   4667 C  CG2 . THR B 1 288 ? 68.925 -42.558 147.198 1.00 47.58 ? 288  THR B CG2 1 
ATOM   4668 N  N   . LEU B 1 289 ? 65.189 -40.754 144.631 1.00 45.74 ? 289  LEU B N   1 
ATOM   4669 C  CA  . LEU B 1 289 ? 64.477 -39.662 143.976 1.00 44.27 ? 289  LEU B CA  1 
ATOM   4670 C  C   . LEU B 1 289 ? 65.451 -38.616 143.425 1.00 42.74 ? 289  LEU B C   1 
ATOM   4671 O  O   . LEU B 1 289 ? 65.239 -37.411 143.565 1.00 41.77 ? 289  LEU B O   1 
ATOM   4672 C  CB  . LEU B 1 289 ? 63.452 -39.040 144.936 1.00 45.94 ? 289  LEU B CB  1 
ATOM   4673 C  CG  . LEU B 1 289 ? 62.320 -38.192 144.345 1.00 46.20 ? 289  LEU B CG  1 
ATOM   4674 C  CD1 . LEU B 1 289 ? 61.580 -38.915 143.226 1.00 46.47 ? 289  LEU B CD1 1 
ATOM   4675 C  CD2 . LEU B 1 289 ? 61.355 -37.793 145.451 1.00 46.54 ? 289  LEU B CD2 1 
ATOM   4676 N  N   . MET B 1 290 ? 66.521 -39.098 142.794 1.00 41.31 ? 290  MET B N   1 
ATOM   4677 C  CA  . MET B 1 290 ? 67.443 -38.245 142.052 1.00 41.06 ? 290  MET B CA  1 
ATOM   4678 C  C   . MET B 1 290 ? 67.168 -38.412 140.560 1.00 37.41 ? 290  MET B C   1 
ATOM   4679 O  O   . MET B 1 290 ? 67.014 -39.530 140.073 1.00 35.38 ? 290  MET B O   1 
ATOM   4680 C  CB  . MET B 1 290 ? 68.896 -38.610 142.366 1.00 43.67 ? 290  MET B CB  1 
ATOM   4681 C  CG  . MET B 1 290 ? 69.323 -38.279 143.789 1.00 45.05 ? 290  MET B CG  1 
ATOM   4682 S  SD  . MET B 1 290 ? 69.258 -36.512 144.159 1.00 48.35 ? 290  MET B SD  1 
ATOM   4683 C  CE  . MET B 1 290 ? 70.515 -35.877 143.051 1.00 48.94 ? 290  MET B CE  1 
HETATM 4684 N  N   . CSO B 1 291 ? 67.106 -37.291 139.849 1.00 36.25 ? 291  CSO B N   1 
HETATM 4685 C  CA  . CSO B 1 291 ? 66.746 -37.276 138.431 1.00 35.51 ? 291  CSO B CA  1 
HETATM 4686 C  CB  . CSO B 1 291 ? 65.685 -36.194 138.212 1.00 35.23 ? 291  CSO B CB  1 
HETATM 4687 S  SG  . CSO B 1 291 ? 64.072 -36.732 138.719 1.00 37.04 ? 291  CSO B SG  1 
HETATM 4688 C  C   . CSO B 1 291 ? 67.973 -37.010 137.589 1.00 34.22 ? 291  CSO B C   1 
HETATM 4689 O  O   . CSO B 1 291 ? 68.725 -36.073 137.863 1.00 34.60 ? 291  CSO B O   1 
HETATM 4690 O  OD  . CSO B 1 291 ? 64.112 -36.859 140.461 1.00 32.69 ? 291  CSO B OD  1 
ATOM   4691 N  N   . SER B 1 292 ? 68.190 -37.837 136.565 1.00 32.54 ? 292  SER B N   1 
ATOM   4692 C  CA  . SER B 1 292 ? 69.273 -37.626 135.596 1.00 32.13 ? 292  SER B CA  1 
ATOM   4693 C  C   . SER B 1 292 ? 68.757 -37.840 134.176 1.00 31.11 ? 292  SER B C   1 
ATOM   4694 O  O   . SER B 1 292 ? 67.663 -38.372 133.983 1.00 30.41 ? 292  SER B O   1 
ATOM   4695 C  CB  . SER B 1 292 ? 70.444 -38.563 135.878 1.00 32.03 ? 292  SER B CB  1 
ATOM   4696 O  OG  . SER B 1 292 ? 70.039 -39.917 135.827 1.00 33.18 ? 292  SER B OG  1 
ATOM   4697 N  N   . PHE B 1 293 ? 69.549 -37.432 133.189 1.00 29.49 ? 293  PHE B N   1 
ATOM   4698 C  CA  . PHE B 1 293 ? 69.088 -37.393 131.800 1.00 28.83 ? 293  PHE B CA  1 
ATOM   4699 C  C   . PHE B 1 293 ? 70.059 -38.068 130.834 1.00 28.36 ? 293  PHE B C   1 
ATOM   4700 O  O   . PHE B 1 293 ? 71.270 -37.845 130.891 1.00 27.95 ? 293  PHE B O   1 
ATOM   4701 C  CB  . PHE B 1 293 ? 68.850 -35.940 131.384 1.00 28.77 ? 293  PHE B CB  1 
ATOM   4702 C  CG  . PHE B 1 293 ? 67.817 -35.233 132.223 1.00 28.34 ? 293  PHE B CG  1 
ATOM   4703 C  CD1 . PHE B 1 293 ? 66.472 -35.276 131.878 1.00 28.46 ? 293  PHE B CD1 1 
ATOM   4704 C  CD2 . PHE B 1 293 ? 68.187 -34.541 133.367 1.00 28.54 ? 293  PHE B CD2 1 
ATOM   4705 C  CE1 . PHE B 1 293 ? 65.520 -34.628 132.653 1.00 27.83 ? 293  PHE B CE1 1 
ATOM   4706 C  CE2 . PHE B 1 293 ? 67.241 -33.898 134.151 1.00 28.30 ? 293  PHE B CE2 1 
ATOM   4707 C  CZ  . PHE B 1 293 ? 65.905 -33.938 133.790 1.00 28.21 ? 293  PHE B CZ  1 
ATOM   4708 N  N   . GLN B 1 294 ? 69.518 -38.906 129.956 1.00 28.37 ? 294  GLN B N   1 
ATOM   4709 C  CA  . GLN B 1 294 ? 70.282 -39.480 128.857 1.00 28.26 ? 294  GLN B CA  1 
ATOM   4710 C  C   . GLN B 1 294 ? 69.880 -38.755 127.585 1.00 28.95 ? 294  GLN B C   1 
ATOM   4711 O  O   . GLN B 1 294 ? 68.684 -38.579 127.314 1.00 26.93 ? 294  GLN B O   1 
ATOM   4712 C  CB  . GLN B 1 294 ? 70.012 -40.978 128.735 1.00 28.57 ? 294  GLN B CB  1 
ATOM   4713 C  CG  . GLN B 1 294 ? 70.399 -41.757 129.984 1.00 28.57 ? 294  GLN B CG  1 
ATOM   4714 C  CD  . GLN B 1 294 ? 69.970 -43.206 129.937 1.00 29.22 ? 294  GLN B CD  1 
ATOM   4715 O  OE1 . GLN B 1 294 ? 68.948 -43.576 130.523 1.00 30.53 ? 294  GLN B OE1 1 
ATOM   4716 N  NE2 . GLN B 1 294 ? 70.739 -44.040 129.235 1.00 28.82 ? 294  GLN B NE2 1 
ATOM   4717 N  N   . ILE B 1 295 ? 70.878 -38.334 126.809 1.00 28.71 ? 295  ILE B N   1 
ATOM   4718 C  CA  . ILE B 1 295 ? 70.627 -37.502 125.637 1.00 30.40 ? 295  ILE B CA  1 
ATOM   4719 C  C   . ILE B 1 295 ? 70.905 -38.247 124.333 1.00 30.55 ? 295  ILE B C   1 
ATOM   4720 O  O   . ILE B 1 295 ? 71.944 -38.904 124.182 1.00 29.67 ? 295  ILE B O   1 
ATOM   4721 C  CB  . ILE B 1 295 ? 71.430 -36.181 125.695 1.00 31.59 ? 295  ILE B CB  1 
ATOM   4722 C  CG1 . ILE B 1 295 ? 70.902 -35.287 126.834 1.00 32.55 ? 295  ILE B CG1 1 
ATOM   4723 C  CG2 . ILE B 1 295 ? 71.348 -35.433 124.369 1.00 31.54 ? 295  ILE B CG2 1 
ATOM   4724 C  CD1 . ILE B 1 295 ? 71.889 -35.068 127.954 1.00 33.55 ? 295  ILE B CD1 1 
ATOM   4725 N  N   . LEU B 1 296 ? 69.953 -38.122 123.406 1.00 30.59 ? 296  LEU B N   1 
ATOM   4726 C  CA  . LEU B 1 296 ? 70.014 -38.726 122.079 1.00 31.61 ? 296  LEU B CA  1 
ATOM   4727 C  C   . LEU B 1 296 ? 70.136 -37.615 121.045 1.00 32.33 ? 296  LEU B C   1 
ATOM   4728 O  O   . LEU B 1 296 ? 69.135 -36.990 120.675 1.00 31.65 ? 296  LEU B O   1 
ATOM   4729 C  CB  . LEU B 1 296 ? 68.730 -39.513 121.788 1.00 31.43 ? 296  LEU B CB  1 
ATOM   4730 C  CG  . LEU B 1 296 ? 68.217 -40.678 122.649 1.00 31.77 ? 296  LEU B CG  1 
ATOM   4731 C  CD1 . LEU B 1 296 ? 68.350 -41.999 121.906 1.00 32.07 ? 296  LEU B CD1 1 
ATOM   4732 C  CD2 . LEU B 1 296 ? 68.831 -40.773 124.037 1.00 31.72 ? 296  LEU B CD2 1 
ATOM   4733 N  N   . LYS B 1 297 ? 71.355 -37.358 120.578 1.00 34.38 ? 297  LYS B N   1 
ATOM   4734 C  CA  . LYS B 1 297 ? 71.569 -36.375 119.519 1.00 36.08 ? 297  LYS B CA  1 
ATOM   4735 C  C   . LYS B 1 297 ? 71.007 -36.899 118.200 1.00 36.70 ? 297  LYS B C   1 
ATOM   4736 O  O   . LYS B 1 297 ? 70.962 -38.111 117.984 1.00 36.60 ? 297  LYS B O   1 
ATOM   4737 C  CB  . LYS B 1 297 ? 73.062 -36.067 119.357 1.00 36.98 ? 297  LYS B CB  1 
ATOM   4738 C  CG  . LYS B 1 297 ? 73.668 -35.297 120.518 1.00 38.29 ? 297  LYS B CG  1 
ATOM   4739 C  CD  . LYS B 1 297 ? 73.089 -33.895 120.623 1.00 39.75 ? 297  LYS B CD  1 
ATOM   4740 C  CE  . LYS B 1 297 ? 74.067 -32.936 121.280 1.00 41.24 ? 297  LYS B CE  1 
ATOM   4741 N  NZ  . LYS B 1 297 ? 75.290 -32.735 120.455 1.00 41.92 ? 297  LYS B NZ  1 
ATOM   4742 N  N   . PRO B 1 298 ? 70.563 -35.992 117.317 1.00 38.93 ? 298  PRO B N   1 
ATOM   4743 C  CA  . PRO B 1 298 ? 70.060 -36.433 116.016 1.00 40.74 ? 298  PRO B CA  1 
ATOM   4744 C  C   . PRO B 1 298 ? 71.177 -37.021 115.147 1.00 43.49 ? 298  PRO B C   1 
ATOM   4745 O  O   . PRO B 1 298 ? 72.311 -36.549 115.209 1.00 41.66 ? 298  PRO B O   1 
ATOM   4746 C  CB  . PRO B 1 298 ? 69.499 -35.146 115.404 1.00 40.59 ? 298  PRO B CB  1 
ATOM   4747 C  CG  . PRO B 1 298 ? 70.260 -34.047 116.056 1.00 39.49 ? 298  PRO B CG  1 
ATOM   4748 C  CD  . PRO B 1 298 ? 70.545 -34.522 117.451 1.00 39.09 ? 298  PRO B CD  1 
ATOM   4749 N  N   . ALA B 1 299 ? 70.851 -38.051 114.365 1.00 47.21 ? 299  ALA B N   1 
ATOM   4750 C  CA  . ALA B 1 299 ? 71.819 -38.724 113.489 1.00 50.01 ? 299  ALA B CA  1 
ATOM   4751 C  C   . ALA B 1 299 ? 71.511 -38.452 112.021 1.00 52.31 ? 299  ALA B C   1 
ATOM   4752 O  O   . ALA B 1 299 ? 72.027 -37.498 111.430 1.00 56.20 ? 299  ALA B O   1 
ATOM   4753 C  CB  . ALA B 1 299 ? 71.813 -40.222 113.754 1.00 50.64 ? 299  ALA B CB  1 
HETATM 4754 MN MN  . MN  C 2 .   ? 42.352 -6.867  107.404 1.00 25.51 ? 400  MN  A MN  1 
HETATM 4755 MN MN  . MN  D 2 .   ? 39.958 -7.889  105.336 1.00 19.98 ? 401  MN  A MN  1 
HETATM 4756 P  P   . PO4 E 3 .   ? 40.114 -9.341  108.253 1.00 36.40 ? 501  PO4 A P   1 
HETATM 4757 O  O1  . PO4 E 3 .   ? 39.098 -9.706  109.315 1.00 38.65 ? 501  PO4 A O1  1 
HETATM 4758 O  O2  . PO4 E 3 .   ? 40.998 -8.247  108.805 1.00 35.43 ? 501  PO4 A O2  1 
HETATM 4759 O  O3  . PO4 E 3 .   ? 39.362 -8.826  107.052 1.00 35.04 ? 501  PO4 A O3  1 
HETATM 4760 O  O4  . PO4 E 3 .   ? 40.918 -10.558 107.885 1.00 35.10 ? 501  PO4 A O4  1 
HETATM 4761 MN MN  . MN  F 2 .   ? 53.639 -33.673 120.334 1.00 21.51 ? 400  MN  B MN  1 
HETATM 4762 MN MN  . MN  G 2 .   ? 51.142 -32.983 122.494 1.00 20.76 ? 401  MN  B MN  1 
HETATM 4763 P  P   . PO4 H 3 .   ? 51.405 -31.267 119.364 1.00 37.30 ? 501  PO4 B P   1 
HETATM 4764 O  O1  . PO4 H 3 .   ? 50.467 -31.784 120.432 1.00 34.62 ? 501  PO4 B O1  1 
HETATM 4765 O  O2  . PO4 H 3 .   ? 52.212 -30.112 119.898 1.00 37.09 ? 501  PO4 B O2  1 
HETATM 4766 O  O3  . PO4 H 3 .   ? 50.589 -30.789 118.178 1.00 38.55 ? 501  PO4 B O3  1 
HETATM 4767 O  O4  . PO4 H 3 .   ? 52.305 -32.384 118.885 1.00 36.30 ? 501  PO4 B O4  1 
HETATM 4768 O  O   . HOH I 4 .   ? 31.917 23.832  104.408 1.00 39.49 ? 2001 HOH A O   1 
HETATM 4769 O  O   . HOH I 4 .   ? 35.187 25.022  102.742 1.00 44.45 ? 2002 HOH A O   1 
HETATM 4770 O  O   . HOH I 4 .   ? 44.488 26.874  105.476 1.00 51.07 ? 2003 HOH A O   1 
HETATM 4771 O  O   . HOH I 4 .   ? 29.351 24.292  105.453 1.00 50.22 ? 2004 HOH A O   1 
HETATM 4772 O  O   . HOH I 4 .   ? 47.884 20.831  103.056 1.00 32.05 ? 2005 HOH A O   1 
HETATM 4773 O  O   . HOH I 4 .   ? 44.879 26.027  99.665  1.00 44.17 ? 2006 HOH A O   1 
HETATM 4774 O  O   . HOH I 4 .   ? 55.677 22.737  110.737 1.00 43.37 ? 2007 HOH A O   1 
HETATM 4775 O  O   . HOH I 4 .   ? 48.566 17.851  116.625 1.00 35.01 ? 2008 HOH A O   1 
HETATM 4776 O  O   . HOH I 4 .   ? 53.771 23.747  115.195 1.00 44.73 ? 2009 HOH A O   1 
HETATM 4777 O  O   . HOH I 4 .   ? 57.790 15.931  112.180 1.00 49.25 ? 2010 HOH A O   1 
HETATM 4778 O  O   . HOH I 4 .   ? 60.249 11.520  105.113 1.00 50.83 ? 2011 HOH A O   1 
HETATM 4779 O  O   . HOH I 4 .   ? 26.548 13.831  97.823  1.00 22.26 ? 2012 HOH A O   1 
HETATM 4780 O  O   . HOH I 4 .   ? 56.985 9.105   111.786 1.00 40.39 ? 2013 HOH A O   1 
HETATM 4781 O  O   . HOH I 4 .   ? 36.021 10.488  88.747  1.00 50.28 ? 2014 HOH A O   1 
HETATM 4782 O  O   . HOH I 4 .   ? 37.876 8.637   89.656  1.00 36.92 ? 2015 HOH A O   1 
HETATM 4783 O  O   . HOH I 4 .   ? 42.464 9.558   87.902  1.00 37.21 ? 2016 HOH A O   1 
HETATM 4784 O  O   . HOH I 4 .   ? 43.432 6.278   123.290 1.00 32.98 ? 2017 HOH A O   1 
HETATM 4785 O  O   . HOH I 4 .   ? 44.854 18.755  117.629 1.00 49.32 ? 2018 HOH A O   1 
HETATM 4786 O  O   . HOH I 4 .   ? 36.489 23.650  114.625 1.00 40.12 ? 2019 HOH A O   1 
HETATM 4787 O  O   . HOH I 4 .   ? 27.749 15.800  118.366 1.00 38.98 ? 2020 HOH A O   1 
HETATM 4788 O  O   . HOH I 4 .   ? 29.753 17.797  114.934 1.00 38.31 ? 2021 HOH A O   1 
HETATM 4789 O  O   . HOH I 4 .   ? 27.777 14.410  102.469 1.00 28.27 ? 2022 HOH A O   1 
HETATM 4790 O  O   . HOH I 4 .   ? 27.107 12.663  100.496 1.00 37.86 ? 2023 HOH A O   1 
HETATM 4791 O  O   . HOH I 4 .   ? 28.292 13.815  95.527  1.00 32.37 ? 2024 HOH A O   1 
HETATM 4792 O  O   . HOH I 4 .   ? 33.986 6.671   94.292  1.00 21.69 ? 2025 HOH A O   1 
HETATM 4793 O  O   . HOH I 4 .   ? 29.219 7.296   90.655  1.00 40.28 ? 2026 HOH A O   1 
HETATM 4794 O  O   . HOH I 4 .   ? 36.288 7.625   95.219  1.00 21.22 ? 2027 HOH A O   1 
HETATM 4795 O  O   . HOH I 4 .   ? 36.516 12.924  90.120  1.00 30.56 ? 2028 HOH A O   1 
HETATM 4796 O  O   . HOH I 4 .   ? 30.656 7.882   88.119  1.00 35.67 ? 2029 HOH A O   1 
HETATM 4797 O  O   . HOH I 4 .   ? 29.699 4.564   90.051  1.00 27.41 ? 2030 HOH A O   1 
HETATM 4798 O  O   . HOH I 4 .   ? 37.783 6.546   87.819  1.00 31.50 ? 2031 HOH A O   1 
HETATM 4799 O  O   . HOH I 4 .   ? 42.245 1.705   84.231  1.00 18.41 ? 2032 HOH A O   1 
HETATM 4800 O  O   . HOH I 4 .   ? 44.900 8.409   88.467  1.00 33.51 ? 2033 HOH A O   1 
HETATM 4801 O  O   . HOH I 4 .   ? 47.620 8.383   89.690  1.00 44.08 ? 2034 HOH A O   1 
HETATM 4802 O  O   . HOH I 4 .   ? 52.954 8.333   92.203  1.00 16.50 ? 2035 HOH A O   1 
HETATM 4803 O  O   . HOH I 4 .   ? 54.722 5.014   91.895  1.00 28.93 ? 2036 HOH A O   1 
HETATM 4804 O  O   . HOH I 4 .   ? 59.137 6.564   96.653  1.00 54.71 ? 2037 HOH A O   1 
HETATM 4805 O  O   . HOH I 4 .   ? 44.413 0.133   102.812 1.00 21.23 ? 2038 HOH A O   1 
HETATM 4806 O  O   . HOH I 4 .   ? 43.681 -3.449  102.318 1.00 22.93 ? 2039 HOH A O   1 
HETATM 4807 O  O   . HOH I 4 .   ? 41.807 -8.339  106.136 1.00 26.74 ? 2040 HOH A O   1 
HETATM 4808 O  O   . HOH I 4 .   ? 43.833 -8.391  108.594 1.00 21.18 ? 2041 HOH A O   1 
HETATM 4809 O  O   . HOH I 4 .   ? 46.555 -3.760  114.209 1.00 20.03 ? 2042 HOH A O   1 
HETATM 4810 O  O   . HOH I 4 .   ? 48.059 0.301   116.885 1.00 29.37 ? 2043 HOH A O   1 
HETATM 4811 O  O   . HOH I 4 .   ? 53.894 -2.004  114.124 1.00 33.81 ? 2044 HOH A O   1 
HETATM 4812 O  O   . HOH I 4 .   ? 35.978 -15.256 84.174  1.00 36.54 ? 2045 HOH A O   1 
HETATM 4813 O  O   . HOH I 4 .   ? 50.844 2.328   115.035 1.00 33.07 ? 2046 HOH A O   1 
HETATM 4814 O  O   . HOH I 4 .   ? 57.040 -0.485  112.418 1.00 41.26 ? 2047 HOH A O   1 
HETATM 4815 O  O   . HOH I 4 .   ? 61.339 3.655   109.511 1.00 28.19 ? 2048 HOH A O   1 
HETATM 4816 O  O   . HOH I 4 .   ? 25.148 -5.181  96.574  1.00 43.63 ? 2049 HOH A O   1 
HETATM 4817 O  O   . HOH I 4 .   ? 58.665 10.735  102.168 1.00 34.91 ? 2050 HOH A O   1 
HETATM 4818 O  O   . HOH I 4 .   ? 61.041 9.161   100.753 1.00 31.21 ? 2051 HOH A O   1 
HETATM 4819 O  O   . HOH I 4 .   ? 60.590 5.686   107.945 1.00 40.51 ? 2052 HOH A O   1 
HETATM 4820 O  O   . HOH I 4 .   ? 58.458 6.487   111.473 1.00 38.32 ? 2053 HOH A O   1 
HETATM 4821 O  O   . HOH I 4 .   ? 59.903 8.767   98.454  1.00 39.90 ? 2054 HOH A O   1 
HETATM 4822 O  O   . HOH I 4 .   ? 57.805 12.945  100.981 1.00 33.57 ? 2055 HOH A O   1 
HETATM 4823 O  O   . HOH I 4 .   ? 29.980 -20.687 104.351 1.00 42.13 ? 2056 HOH A O   1 
HETATM 4824 O  O   . HOH I 4 .   ? 51.501 15.669  103.046 1.00 29.40 ? 2057 HOH A O   1 
HETATM 4825 O  O   . HOH I 4 .   ? 35.173 -13.721 110.701 1.00 41.93 ? 2058 HOH A O   1 
HETATM 4826 O  O   . HOH I 4 .   ? 56.769 13.575  92.426  1.00 35.24 ? 2059 HOH A O   1 
HETATM 4827 O  O   . HOH I 4 .   ? 48.355 11.705  96.681  1.00 29.22 ? 2060 HOH A O   1 
HETATM 4828 O  O   . HOH I 4 .   ? 50.355 12.037  88.417  1.00 36.61 ? 2061 HOH A O   1 
HETATM 4829 O  O   . HOH I 4 .   ? 40.543 0.426   116.648 1.00 38.15 ? 2062 HOH A O   1 
HETATM 4830 O  O   . HOH I 4 .   ? 56.949 6.175   88.476  1.00 43.32 ? 2063 HOH A O   1 
HETATM 4831 O  O   . HOH I 4 .   ? 59.783 7.228   88.383  1.00 37.22 ? 2064 HOH A O   1 
HETATM 4832 O  O   . HOH I 4 .   ? 38.459 6.720   96.826  1.00 25.50 ? 2065 HOH A O   1 
HETATM 4833 O  O   . HOH I 4 .   ? 43.516 15.944  93.186  1.00 23.40 ? 2066 HOH A O   1 
HETATM 4834 O  O   . HOH I 4 .   ? 49.272 21.208  98.682  1.00 40.97 ? 2067 HOH A O   1 
HETATM 4835 O  O   . HOH I 4 .   ? 44.877 11.356  88.178  1.00 54.39 ? 2068 HOH A O   1 
HETATM 4836 O  O   . HOH I 4 .   ? 38.590 13.182  86.076  1.00 41.89 ? 2069 HOH A O   1 
HETATM 4837 O  O   . HOH I 4 .   ? 37.727 -3.399  97.839  1.00 21.06 ? 2070 HOH A O   1 
HETATM 4838 O  O   . HOH I 4 .   ? 30.059 1.228   99.195  1.00 21.80 ? 2071 HOH A O   1 
HETATM 4839 O  O   . HOH I 4 .   ? 31.757 -6.060  105.577 1.00 25.38 ? 2072 HOH A O   1 
HETATM 4840 O  O   . HOH I 4 .   ? 28.003 -0.324  107.438 1.00 31.77 ? 2073 HOH A O   1 
HETATM 4841 O  O   . HOH I 4 .   ? 34.641 -1.935  118.791 1.00 31.39 ? 2074 HOH A O   1 
HETATM 4842 O  O   . HOH I 4 .   ? 31.946 -3.165  122.425 1.00 36.79 ? 2075 HOH A O   1 
HETATM 4843 O  O   . HOH I 4 .   ? 39.605 0.109   120.301 1.00 36.95 ? 2076 HOH A O   1 
HETATM 4844 O  O   . HOH I 4 .   ? 25.722 2.138   121.296 1.00 43.40 ? 2077 HOH A O   1 
HETATM 4845 O  O   . HOH I 4 .   ? 34.871 2.453   124.497 1.00 21.89 ? 2078 HOH A O   1 
HETATM 4846 O  O   . HOH I 4 .   ? 35.913 11.144  125.570 1.00 34.04 ? 2079 HOH A O   1 
HETATM 4847 O  O   . HOH I 4 .   ? 37.699 1.655   125.307 1.00 34.71 ? 2080 HOH A O   1 
HETATM 4848 O  O   . HOH I 4 .   ? 30.678 13.330  123.415 1.00 30.21 ? 2081 HOH A O   1 
HETATM 4849 O  O   . HOH I 4 .   ? 26.624 2.746   112.663 1.00 29.59 ? 2082 HOH A O   1 
HETATM 4850 O  O   . HOH I 4 .   ? 41.157 -4.705  80.260  1.00 42.02 ? 2083 HOH A O   1 
HETATM 4851 O  O   . HOH I 4 .   ? 45.598 -5.875  75.676  1.00 45.50 ? 2084 HOH A O   1 
HETATM 4852 O  O   . HOH I 4 .   ? 46.731 -8.475  78.687  1.00 36.01 ? 2085 HOH A O   1 
HETATM 4853 O  O   . HOH I 4 .   ? 27.306 -18.164 91.703  1.00 47.30 ? 2086 HOH A O   1 
HETATM 4854 O  O   . HOH I 4 .   ? 28.306 -15.170 95.397  1.00 21.47 ? 2087 HOH A O   1 
HETATM 4855 O  O   . HOH I 4 .   ? 34.427 -12.932 84.725  1.00 31.77 ? 2088 HOH A O   1 
HETATM 4856 O  O   . HOH I 4 .   ? 33.149 -6.494  81.561  1.00 29.68 ? 2089 HOH A O   1 
HETATM 4857 O  O   . HOH I 4 .   ? 31.706 -3.452  81.406  1.00 27.70 ? 2090 HOH A O   1 
HETATM 4858 O  O   . HOH I 4 .   ? 25.366 -5.385  90.473  1.00 25.33 ? 2091 HOH A O   1 
HETATM 4859 O  O   . HOH I 4 .   ? 25.485 -7.755  90.007  1.00 29.01 ? 2092 HOH A O   1 
HETATM 4860 O  O   . HOH I 4 .   ? 28.905 3.266   87.604  1.00 34.97 ? 2093 HOH A O   1 
HETATM 4861 O  O   . HOH I 4 .   ? 22.978 -3.951  91.068  1.00 45.19 ? 2094 HOH A O   1 
HETATM 4862 O  O   . HOH I 4 .   ? 22.713 0.747   90.194  1.00 42.87 ? 2095 HOH A O   1 
HETATM 4863 O  O   . HOH I 4 .   ? 23.619 -6.254  87.572  1.00 54.96 ? 2096 HOH A O   1 
HETATM 4864 O  O   . HOH I 4 .   ? 25.265 4.860   93.930  1.00 40.22 ? 2097 HOH A O   1 
HETATM 4865 O  O   . HOH I 4 .   ? 23.123 -12.156 102.093 1.00 47.45 ? 2098 HOH A O   1 
HETATM 4866 O  O   . HOH I 4 .   ? 22.675 -9.941  103.969 1.00 28.10 ? 2099 HOH A O   1 
HETATM 4867 O  O   . HOH I 4 .   ? 28.743 -15.418 101.873 1.00 25.64 ? 2100 HOH A O   1 
HETATM 4868 O  O   . HOH I 4 .   ? 21.291 -9.811  106.603 1.00 51.35 ? 2101 HOH A O   1 
HETATM 4869 O  O   . HOH I 4 .   ? 27.203 -8.916  98.015  1.00 33.85 ? 2102 HOH A O   1 
HETATM 4870 O  O   . HOH I 4 .   ? 24.297 -9.418  97.601  1.00 26.37 ? 2103 HOH A O   1 
HETATM 4871 O  O   . HOH I 4 .   ? 29.021 -14.822 98.943  1.00 27.54 ? 2104 HOH A O   1 
HETATM 4872 O  O   . HOH I 4 .   ? 26.086 -7.355  95.784  1.00 27.49 ? 2105 HOH A O   1 
HETATM 4873 O  O   . HOH I 4 .   ? 40.974 -18.442 103.210 1.00 39.83 ? 2106 HOH A O   1 
HETATM 4874 O  O   . HOH I 4 .   ? 39.003 -24.942 88.374  1.00 42.63 ? 2107 HOH A O   1 
HETATM 4875 O  O   . HOH I 4 .   ? 32.444 -25.411 94.117  1.00 30.57 ? 2108 HOH A O   1 
HETATM 4876 O  O   . HOH I 4 .   ? 32.469 -20.790 102.634 1.00 59.75 ? 2109 HOH A O   1 
HETATM 4877 O  O   . HOH I 4 .   ? 39.367 -20.830 103.756 1.00 34.06 ? 2110 HOH A O   1 
HETATM 4878 O  O   . HOH I 4 .   ? 37.508 -13.498 109.056 1.00 36.08 ? 2111 HOH A O   1 
HETATM 4879 O  O   . HOH I 4 .   ? 42.944 -15.924 106.417 1.00 39.55 ? 2112 HOH A O   1 
HETATM 4880 O  O   . HOH I 4 .   ? 29.992 -19.349 100.892 1.00 29.12 ? 2113 HOH A O   1 
HETATM 4881 O  O   . HOH I 4 .   ? 37.904 -22.579 87.089  1.00 46.42 ? 2114 HOH A O   1 
HETATM 4882 O  O   . HOH I 4 .   ? 45.955 -8.497  74.807  1.00 49.57 ? 2115 HOH A O   1 
HETATM 4883 O  O   . HOH I 4 .   ? 43.514 -10.946 107.457 1.00 23.45 ? 2116 HOH A O   1 
HETATM 4884 O  O   . HOH I 4 .   ? 45.336 -13.209 107.594 1.00 26.09 ? 2117 HOH A O   1 
HETATM 4885 O  O   . HOH I 4 .   ? 53.491 -15.555 104.555 1.00 31.20 ? 2118 HOH A O   1 
HETATM 4886 O  O   . HOH I 4 .   ? 54.846 -16.718 108.828 1.00 50.98 ? 2119 HOH A O   1 
HETATM 4887 O  O   . HOH I 4 .   ? 58.237 -15.862 103.615 1.00 57.64 ? 2120 HOH A O   1 
HETATM 4888 O  O   . HOH I 4 .   ? 59.878 -8.668  101.928 1.00 21.10 ? 2121 HOH A O   1 
HETATM 4889 O  O   . HOH I 4 .   ? 60.379 -9.881  99.346  1.00 45.42 ? 2122 HOH A O   1 
HETATM 4890 O  O   . HOH I 4 .   ? 49.102 -13.964 97.271  1.00 34.55 ? 2123 HOH A O   1 
HETATM 4891 O  O   . HOH I 4 .   ? 55.718 -13.934 96.370  1.00 30.96 ? 2124 HOH A O   1 
HETATM 4892 O  O   . HOH I 4 .   ? 52.066 -3.234  115.770 1.00 31.60 ? 2125 HOH A O   1 
HETATM 4893 O  O   . HOH I 4 .   ? 57.601 0.432   89.331  0.50 14.16 ? 2126 HOH A O   1 
HETATM 4894 O  O   . HOH I 4 .   ? 57.413 2.308   90.237  1.00 33.33 ? 2127 HOH A O   1 
HETATM 4895 O  O   . HOH I 4 .   ? 56.152 6.304   85.737  1.00 28.57 ? 2128 HOH A O   1 
HETATM 4896 O  O   . HOH I 4 .   ? 50.911 -5.949  85.734  1.00 49.78 ? 2129 HOH A O   1 
HETATM 4897 O  O   . HOH I 4 .   ? 59.153 -6.842  90.694  1.00 32.35 ? 2130 HOH A O   1 
HETATM 4898 O  O   . HOH I 4 .   ? 60.630 -4.929  93.872  1.00 26.38 ? 2131 HOH A O   1 
HETATM 4899 O  O   . HOH I 4 .   ? 37.142 -11.168 110.647 1.00 42.01 ? 2132 HOH A O   1 
HETATM 4900 O  O   . HOH I 4 .   ? 42.207 -13.638 110.089 1.00 48.93 ? 2133 HOH A O   1 
HETATM 4901 O  O   . HOH I 4 .   ? 52.955 23.062  108.401 1.00 41.36 ? 2134 HOH A O   1 
HETATM 4902 O  O   . HOH J 4 .   ? 38.965 -63.791 118.714 1.00 47.86 ? 2001 HOH B O   1 
HETATM 4903 O  O   . HOH J 4 .   ? 53.900 -65.138 123.663 1.00 36.48 ? 2002 HOH B O   1 
HETATM 4904 O  O   . HOH J 4 .   ? 59.745 -62.056 122.322 1.00 34.35 ? 2003 HOH B O   1 
HETATM 4905 O  O   . HOH J 4 .   ? 64.188 -59.739 116.936 1.00 38.49 ? 2004 HOH B O   1 
HETATM 4906 O  O   . HOH J 4 .   ? 58.910 -64.312 113.014 1.00 37.77 ? 2005 HOH B O   1 
HETATM 4907 O  O   . HOH J 4 .   ? 60.209 -58.299 111.312 1.00 37.33 ? 2006 HOH B O   1 
HETATM 4908 O  O   . HOH J 4 .   ? 65.619 -62.226 113.750 1.00 41.21 ? 2007 HOH B O   1 
HETATM 4909 O  O   A HOH J 4 .   ? 67.280 -47.509 115.508 0.50 20.83 ? 2008 HOH B O   1 
HETATM 4910 O  O   B HOH J 4 .   ? 67.955 -49.433 116.345 0.50 19.41 ? 2008 HOH B O   1 
HETATM 4911 O  O   . HOH J 4 .   ? 41.452 -47.774 140.104 1.00 40.96 ? 2010 HOH B O   1 
HETATM 4912 O  O   . HOH J 4 .   ? 40.659 -44.781 139.695 1.00 42.75 ? 2011 HOH B O   1 
HETATM 4913 O  O   . HOH J 4 .   ? 48.834 -50.355 138.678 1.00 42.40 ? 2012 HOH B O   1 
HETATM 4914 O  O   . HOH J 4 .   ? 59.540 -51.791 104.632 1.00 28.75 ? 2013 HOH B O   1 
HETATM 4915 O  O   . HOH J 4 .   ? 52.490 -53.250 111.428 1.00 49.77 ? 2014 HOH B O   1 
HETATM 4916 O  O   . HOH J 4 .   ? 59.172 -37.360 111.138 1.00 28.02 ? 2015 HOH B O   1 
HETATM 4917 O  O   . HOH J 4 .   ? 57.090 -58.086 108.716 1.00 33.74 ? 2016 HOH B O   1 
HETATM 4918 O  O   . HOH J 4 .   ? 39.578 -60.884 119.213 1.00 47.29 ? 2017 HOH B O   1 
HETATM 4919 O  O   . HOH J 4 .   ? 54.205 -32.817 110.051 1.00 40.44 ? 2018 HOH B O   1 
HETATM 4920 O  O   . HOH J 4 .   ? 38.957 -54.319 125.848 1.00 30.08 ? 2019 HOH B O   1 
HETATM 4921 O  O   . HOH J 4 .   ? 39.628 -54.490 132.369 1.00 26.51 ? 2020 HOH B O   1 
HETATM 4922 O  O   . HOH J 4 .   ? 41.006 -61.431 128.327 1.00 46.37 ? 2021 HOH B O   1 
HETATM 4923 O  O   . HOH J 4 .   ? 45.152 -47.114 133.623 1.00 21.32 ? 2022 HOH B O   1 
HETATM 4924 O  O   . HOH J 4 .   ? 37.827 -48.931 135.012 1.00 54.46 ? 2023 HOH B O   1 
HETATM 4925 O  O   . HOH J 4 .   ? 41.003 -48.961 137.379 1.00 42.46 ? 2024 HOH B O   1 
HETATM 4926 O  O   . HOH J 4 .   ? 47.578 -48.477 132.484 1.00 20.97 ? 2025 HOH B O   1 
HETATM 4927 O  O   . HOH J 4 .   ? 47.011 -52.414 138.909 1.00 39.17 ? 2026 HOH B O   1 
HETATM 4928 O  O   . HOH J 4 .   ? 42.872 -43.251 139.715 1.00 25.83 ? 2027 HOH B O   1 
HETATM 4929 O  O   . HOH J 4 .   ? 40.105 -45.296 136.955 1.00 33.67 ? 2028 HOH B O   1 
HETATM 4930 O  O   . HOH J 4 .   ? 45.128 -43.484 141.830 1.00 26.24 ? 2029 HOH B O   1 
HETATM 4931 O  O   . HOH J 4 .   ? 48.908 -47.107 140.185 1.00 36.96 ? 2030 HOH B O   1 
HETATM 4932 O  O   . HOH J 4 .   ? 51.179 -49.049 139.675 1.00 63.65 ? 2031 HOH B O   1 
HETATM 4933 O  O   . HOH J 4 .   ? 53.761 -49.545 141.400 1.00 44.15 ? 2032 HOH B O   1 
HETATM 4934 O  O   . HOH J 4 .   ? 56.030 -48.426 140.118 1.00 48.34 ? 2033 HOH B O   1 
HETATM 4935 O  O   . HOH J 4 .   ? 58.093 -48.325 138.068 1.00 43.72 ? 2034 HOH B O   1 
HETATM 4936 O  O   . HOH J 4 .   ? 58.143 -50.302 139.981 1.00 40.81 ? 2035 HOH B O   1 
HETATM 4937 O  O   . HOH J 4 .   ? 55.759 -40.772 124.756 1.00 17.83 ? 2036 HOH B O   1 
HETATM 4938 O  O   . HOH J 4 .   ? 54.840 -37.170 125.324 1.00 23.44 ? 2037 HOH B O   1 
HETATM 4939 O  O   . HOH J 4 .   ? 52.844 -32.340 121.573 1.00 23.89 ? 2038 HOH B O   1 
HETATM 4940 O  O   . HOH J 4 .   ? 55.231 -32.828 119.314 1.00 25.81 ? 2039 HOH B O   1 
HETATM 4941 O  O   . HOH J 4 .   ? 57.546 -36.945 113.659 1.00 29.16 ? 2040 HOH B O   1 
HETATM 4942 O  O   . HOH J 4 .   ? 59.119 -41.683 111.172 1.00 35.31 ? 2041 HOH B O   1 
HETATM 4943 O  O   . HOH J 4 .   ? 61.943 -43.756 112.848 1.00 28.15 ? 2042 HOH B O   1 
HETATM 4944 O  O   . HOH J 4 .   ? 66.314 -43.232 113.673 1.00 29.23 ? 2043 HOH B O   1 
HETATM 4945 O  O   . HOH J 4 .   ? 68.450 -53.957 126.986 1.00 29.80 ? 2044 HOH B O   1 
HETATM 4946 O  O   . HOH J 4 .   ? 63.036 -53.124 135.693 1.00 28.62 ? 2045 HOH B O   1 
HETATM 4947 O  O   . HOH J 4 .   ? 59.573 -52.490 131.376 1.00 27.77 ? 2046 HOH B O   1 
HETATM 4948 O  O   . HOH J 4 .   ? 52.188 -39.083 110.077 1.00 31.11 ? 2047 HOH B O   1 
HETATM 4949 O  O   . HOH J 4 .   ? 55.860 -34.943 109.287 1.00 45.45 ? 2048 HOH B O   1 
HETATM 4950 O  O   . HOH J 4 .   ? 51.656 -41.666 111.011 1.00 30.45 ? 2049 HOH B O   1 
HETATM 4951 O  O   . HOH J 4 .   ? 54.530 -46.535 107.174 1.00 35.39 ? 2050 HOH B O   1 
HETATM 4952 O  O   . HOH J 4 .   ? 60.764 -40.944 103.443 1.00 40.43 ? 2051 HOH B O   1 
HETATM 4953 O  O   . HOH J 4 .   ? 53.807 -48.261 109.047 1.00 25.90 ? 2052 HOH B O   1 
HETATM 4954 O  O   . HOH J 4 .   ? 49.522 -47.351 130.889 1.00 19.57 ? 2053 HOH B O   1 
HETATM 4955 O  O   . HOH J 4 .   ? 48.581 -57.389 136.012 1.00 44.30 ? 2054 HOH B O   1 
HETATM 4956 O  O   . HOH J 4 .   ? 48.617 -37.314 130.040 1.00 25.60 ? 2055 HOH B O   1 
HETATM 4957 O  O   . HOH J 4 .   ? 41.365 -41.835 128.634 1.00 16.89 ? 2056 HOH B O   1 
HETATM 4958 O  O   . HOH J 4 .   ? 43.105 -33.700 122.008 1.00 27.29 ? 2057 HOH B O   1 
HETATM 4959 O  O   . HOH J 4 .   ? 39.000 -39.972 120.463 1.00 23.18 ? 2058 HOH B O   1 
HETATM 4960 O  O   . HOH J 4 .   ? 42.347 -42.302 117.870 1.00 32.29 ? 2059 HOH B O   1 
HETATM 4961 O  O   . HOH J 4 .   ? 45.820 -38.945 108.970 1.00 19.51 ? 2060 HOH B O   1 
HETATM 4962 O  O   . HOH J 4 .   ? 42.243 -49.307 103.469 1.00 28.10 ? 2061 HOH B O   1 
HETATM 4963 O  O   . HOH J 4 .   ? 36.628 -51.048 114.397 1.00 25.50 ? 2062 HOH B O   1 
HETATM 4964 O  O   . HOH J 4 .   ? 40.150 -51.355 121.125 1.00 25.15 ? 2063 HOH B O   1 
HETATM 4965 O  O   . HOH J 4 .   ? 35.599 -45.603 122.728 1.00 30.31 ? 2064 HOH B O   1 
HETATM 4966 O  O   . HOH J 4 .   ? 53.582 -41.751 143.791 1.00 28.21 ? 2065 HOH B O   1 
HETATM 4967 O  O   . HOH J 4 .   ? 62.437 -42.041 144.087 1.00 41.37 ? 2066 HOH B O   1 
HETATM 4968 O  O   . HOH J 4 .   ? 39.283 -25.275 131.833 1.00 33.30 ? 2067 HOH B O   1 
HETATM 4969 O  O   . HOH J 4 .   ? 45.517 -26.909 142.677 1.00 35.49 ? 2068 HOH B O   1 
HETATM 4970 O  O   . HOH J 4 .   ? 43.316 -30.373 147.491 1.00 32.63 ? 2069 HOH B O   1 
HETATM 4971 O  O   . HOH J 4 .   ? 41.268 -28.382 147.146 1.00 38.25 ? 2070 HOH B O   1 
HETATM 4972 O  O   . HOH J 4 .   ? 42.704 -36.244 146.530 1.00 35.47 ? 2071 HOH B O   1 
HETATM 4973 O  O   . HOH J 4 .   ? 44.552 -33.874 146.101 1.00 17.95 ? 2072 HOH B O   1 
HETATM 4974 O  O   . HOH J 4 .   ? 39.544 -42.077 144.630 1.00 33.91 ? 2073 HOH B O   1 
HETATM 4975 O  O   . HOH J 4 .   ? 36.479 -34.589 137.189 1.00 30.32 ? 2074 HOH B O   1 
HETATM 4976 O  O   . HOH J 4 .   ? 38.004 -43.489 136.707 1.00 39.57 ? 2075 HOH B O   1 
HETATM 4977 O  O   . HOH J 4 .   ? 34.583 -36.598 136.738 1.00 23.11 ? 2076 HOH B O   1 
HETATM 4978 O  O   . HOH J 4 .   ? 36.120 -47.113 133.972 1.00 31.65 ? 2077 HOH B O   1 
HETATM 4979 O  O   . HOH J 4 .   ? 38.573 -46.120 134.364 1.00 40.41 ? 2078 HOH B O   1 
HETATM 4980 O  O   . HOH J 4 .   ? 36.562 -40.345 118.817 1.00 29.86 ? 2079 HOH B O   1 
HETATM 4981 O  O   . HOH J 4 .   ? 40.435 -29.639 121.157 1.00 47.49 ? 2080 HOH B O   1 
HETATM 4982 O  O   . HOH J 4 .   ? 34.497 -30.415 118.267 1.00 36.15 ? 2081 HOH B O   1 
HETATM 4983 O  O   . HOH J 4 .   ? 36.051 -25.105 122.635 1.00 47.62 ? 2082 HOH B O   1 
HETATM 4984 O  O   . HOH J 4 .   ? 40.089 -25.868 129.038 1.00 29.73 ? 2083 HOH B O   1 
HETATM 4985 O  O   . HOH J 4 .   ? 56.147 -17.461 134.357 1.00 33.34 ? 2084 HOH B O   1 
HETATM 4986 O  O   . HOH J 4 .   ? 54.355 -16.937 137.450 1.00 42.85 ? 2085 HOH B O   1 
HETATM 4987 O  O   . HOH J 4 .   ? 45.943 -26.686 117.753 1.00 34.81 ? 2086 HOH B O   1 
HETATM 4988 O  O   . HOH J 4 .   ? 48.649 -27.434 118.884 1.00 34.40 ? 2087 HOH B O   1 
HETATM 4989 O  O   . HOH J 4 .   ? 56.426 -23.674 145.492 1.00 33.07 ? 2088 HOH B O   1 
HETATM 4990 O  O   . HOH J 4 .   ? 63.020 -30.501 141.131 1.00 44.00 ? 2089 HOH B O   1 
HETATM 4991 O  O   . HOH J 4 .   ? 55.138 -30.318 119.777 1.00 39.80 ? 2090 HOH B O   1 
HETATM 4992 O  O   . HOH J 4 .   ? 56.450 -27.754 119.731 1.00 29.48 ? 2091 HOH B O   1 
HETATM 4993 O  O   . HOH J 4 .   ? 70.357 -29.895 119.989 1.00 36.16 ? 2092 HOH B O   1 
HETATM 4994 O  O   . HOH J 4 .   ? 60.024 -26.571 130.352 1.00 29.29 ? 2093 HOH B O   1 
HETATM 4995 O  O   . HOH J 4 .   ? 59.504 -25.267 127.029 1.00 48.70 ? 2094 HOH B O   1 
HETATM 4996 O  O   . HOH J 4 .   ? 64.332 -23.749 135.790 1.00 26.95 ? 2095 HOH B O   1 
HETATM 4997 O  O   . HOH J 4 .   ? 60.894 -19.883 134.422 1.00 24.96 ? 2096 HOH B O   1 
HETATM 4998 O  O   . HOH J 4 .   ? 70.879 -25.881 111.218 1.00 45.81 ? 2097 HOH B O   1 
HETATM 4999 O  O   . HOH J 4 .   ? 62.363 -35.487 141.857 1.00 43.46 ? 2098 HOH B O   1 
HETATM 5000 O  O   . HOH J 4 .   ? 71.875 -35.584 134.215 1.00 31.41 ? 2099 HOH B O   1 
HETATM 5001 O  O   . HOH J 4 .   ? 70.406 -35.155 111.982 1.00 44.83 ? 2100 HOH B O   1 
HETATM 5002 O  O   . HOH J 4 .   ? 48.623 -28.986 116.895 1.00 37.87 ? 2101 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   ALA 2   2   ?   ?   ?   A . n 
A 1 3   ASP 3   3   ?   ?   ?   A . n 
A 1 4   LEU 4   4   ?   ?   ?   A . n 
A 1 5   ASP 5   5   ?   ?   ?   A . n 
A 1 6   LYS 6   6   6   LYS LYS A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   ASN 8   8   8   ASN ASN A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  ASP 10  10  10  ASP ASP A . n 
A 1 11  SER 11  11  11  SER SER A . n 
A 1 12  ILE 12  12  12  ILE ILE A . n 
A 1 13  ILE 13  13  13  ILE ILE A . n 
A 1 14  GLN 14  14  14  GLN GLN A . n 
A 1 15  ARG 15  15  15  ARG ARG A . n 
A 1 16  LEU 16  16  16  LEU LEU A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  GLU 18  18  18  GLU GLU A . n 
A 1 19  VAL 19  19  19  VAL VAL A . n 
A 1 20  ARG 20  20  20  ARG ARG A . n 
A 1 21  GLY 21  21  21  GLY GLY A . n 
A 1 22  SER 22  22  22  SER SER A . n 
A 1 23  LYS 23  23  23  LYS LYS A . n 
A 1 24  PRO 24  24  24  PRO PRO A . n 
A 1 25  GLY 25  25  25  GLY GLY A . n 
A 1 26  LYS 26  26  26  LYS LYS A . n 
A 1 27  ASN 27  27  27  ASN ASN A . n 
A 1 28  VAL 28  28  28  VAL VAL A . n 
A 1 29  GLN 29  29  29  GLN GLN A . n 
A 1 30  LEU 30  30  30  LEU LEU A . n 
A 1 31  GLN 31  31  31  GLN GLN A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  ASN 33  33  33  ASN ASN A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  ILE 35  35  35  ILE ILE A . n 
A 1 36  ARG 36  36  36  ARG ARG A . n 
A 1 37  GLY 37  37  37  GLY GLY A . n 
A 1 38  LEU 38  38  38  LEU LEU A . n 
A 1 39  CYS 39  39  39  CYS CYS A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  SER 42  42  42  SER SER A . n 
A 1 43  ARG 43  43  43  ARG ARG A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  ILE 45  45  45  ILE ILE A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  LEU 47  47  47  LEU LEU A . n 
A 1 48  SER 48  48  48  SER SER A . n 
A 1 49  GLN 49  49  49  GLN GLN A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  ILE 51  51  51  ILE ILE A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  GLU 54  54  54  GLU GLU A . n 
A 1 55  LEU 55  55  55  LEU LEU A . n 
A 1 56  GLU 56  56  56  GLU GLU A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  LEU 59  59  59  LEU LEU A . n 
A 1 60  LYS 60  60  60  LYS LYS A . n 
A 1 61  ILE 61  61  61  ILE ILE A . n 
A 1 62  CYS 62  62  62  CYS CYS A . n 
A 1 63  GLY 63  63  63  GLY GLY A . n 
A 1 64  ASP 64  64  64  ASP ASP A . n 
A 1 65  ILE 65  65  65  ILE ILE A . n 
A 1 66  HIS 66  66  66  HIS HIS A . n 
A 1 67  GLY 67  67  67  GLY GLY A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  TYR 69  69  69  TYR TYR A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  ASP 71  71  71  ASP ASP A . n 
A 1 72  LEU 72  72  72  LEU LEU A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  ARG 74  74  74  ARG ARG A . n 
A 1 75  LEU 75  75  75  LEU LEU A . n 
A 1 76  PHE 76  76  76  PHE PHE A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  TYR 78  78  78  TYR TYR A . n 
A 1 79  GLY 79  79  79  GLY GLY A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  PRO 82  82  82  PRO PRO A . n 
A 1 83  PRO 83  83  83  PRO PRO A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  SER 85  85  85  SER SER A . n 
A 1 86  ASN 86  86  86  ASN ASN A . n 
A 1 87  TYR 87  87  87  TYR TYR A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  PHE 89  89  89  PHE PHE A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ASP 92  92  92  ASP ASP A . n 
A 1 93  TYR 93  93  93  TYR TYR A . n 
A 1 94  VAL 94  94  94  VAL VAL A . n 
A 1 95  ASP 95  95  95  ASP ASP A . n 
A 1 96  ARG 96  96  96  ARG ARG A . n 
A 1 97  GLY 97  97  97  GLY GLY A . n 
A 1 98  LYS 98  98  98  LYS LYS A . n 
A 1 99  GLN 99  99  99  GLN GLN A . n 
A 1 100 SER 100 100 100 SER SER A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 GLU 102 102 102 GLU GLU A . n 
A 1 103 THR 103 103 103 THR THR A . n 
A 1 104 ILE 104 104 104 ILE ILE A . n 
A 1 105 CYS 105 105 105 CYS CYS A . n 
A 1 106 LEU 106 106 106 LEU LEU A . n 
A 1 107 LEU 107 107 107 LEU LEU A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 TYR 110 110 110 TYR TYR A . n 
A 1 111 LYS 111 111 111 LYS LYS A . n 
A 1 112 ILE 112 112 112 ILE ILE A . n 
A 1 113 LYS 113 113 113 LYS LYS A . n 
A 1 114 TYR 114 114 114 TYR TYR A . n 
A 1 115 PRO 115 115 115 PRO PRO A . n 
A 1 116 GLU 116 116 116 GLU GLU A . n 
A 1 117 ASN 117 117 117 ASN ASN A . n 
A 1 118 PHE 118 118 118 PHE PHE A . n 
A 1 119 PHE 119 119 119 PHE PHE A . n 
A 1 120 LEU 120 120 120 LEU LEU A . n 
A 1 121 LEU 121 121 121 LEU LEU A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 ASN 124 124 124 ASN ASN A . n 
A 1 125 HIS 125 125 125 HIS HIS A . n 
A 1 126 GLU 126 126 126 GLU GLU A . n 
A 1 127 CSO 127 127 127 CSO CSO A . n 
A 1 128 ALA 128 128 128 ALA ALA A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 ILE 130 130 130 ILE ILE A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 ARG 132 132 132 ARG ARG A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 PHE 136 136 136 PHE PHE A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 ASP 138 138 138 ASP ASP A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 CYS 140 140 140 CYS CYS A . n 
A 1 141 LYS 141 141 141 LYS LYS A . n 
A 1 142 ARG 142 142 142 ARG ARG A . n 
A 1 143 ARG 143 143 143 ARG ARG A . n 
A 1 144 TYR 144 144 144 TYR TYR A . n 
A 1 145 ASN 145 145 145 ASN ASN A . n 
A 1 146 ILE 146 146 146 ILE ILE A . n 
A 1 147 LYS 147 147 147 LYS LYS A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 TRP 149 149 149 TRP TRP A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 THR 151 151 151 THR THR A . n 
A 1 152 PHE 152 152 152 PHE PHE A . n 
A 1 153 THR 153 153 153 THR THR A . n 
A 1 154 ASP 154 154 154 ASP ASP A . n 
A 1 155 CYS 155 155 155 CYS CYS A . n 
A 1 156 PHE 156 156 156 PHE PHE A . n 
A 1 157 ASN 157 157 157 ASN ASN A . n 
A 1 158 CYS 158 158 158 CYS CYS A . n 
A 1 159 LEU 159 159 159 LEU LEU A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 ILE 161 161 161 ILE ILE A . n 
A 1 162 ALA 162 162 162 ALA ALA A . n 
A 1 163 ALA 163 163 163 ALA ALA A . n 
A 1 164 ILE 164 164 164 ILE ILE A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 ASP 166 166 166 ASP ASP A . n 
A 1 167 GLU 167 167 167 GLU GLU A . n 
A 1 168 LYS 168 168 168 LYS LYS A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 PHE 170 170 170 PHE PHE A . n 
A 1 171 CYS 171 171 171 CYS CYS A . n 
A 1 172 CYS 172 172 172 CYS CYS A . n 
A 1 173 HIS 173 173 173 HIS HIS A . n 
A 1 174 GLY 174 174 174 GLY GLY A . n 
A 1 175 GLY 175 175 175 GLY GLY A . n 
A 1 176 LEU 176 176 176 LEU LEU A . n 
A 1 177 SER 177 177 177 SER SER A . n 
A 1 178 PRO 178 178 178 PRO PRO A . n 
A 1 179 ASP 179 179 179 ASP ASP A . n 
A 1 180 LEU 180 180 180 LEU LEU A . n 
A 1 181 GLN 181 181 181 GLN GLN A . n 
A 1 182 SER 182 182 182 SER SER A . n 
A 1 183 MET 183 183 183 MET MET A . n 
A 1 184 GLU 184 184 184 GLU GLU A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 ILE 186 186 186 ILE ILE A . n 
A 1 187 ARG 187 187 187 ARG ARG A . n 
A 1 188 ARG 188 188 188 ARG ARG A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 MET 190 190 190 MET MET A . n 
A 1 191 ARG 191 191 191 ARG ARG A . n 
A 1 192 PRO 192 192 192 PRO PRO A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 ASP 194 194 194 ASP ASP A . n 
A 1 195 VAL 195 195 195 VAL VAL A . n 
A 1 196 PRO 196 196 196 PRO PRO A . n 
A 1 197 ASP 197 197 197 ASP ASP A . n 
A 1 198 GLN 198 198 198 GLN GLN A . n 
A 1 199 GLY 199 199 199 GLY GLY A . n 
A 1 200 LEU 200 200 200 LEU LEU A . n 
A 1 201 LEU 201 201 201 LEU LEU A . n 
A 1 202 CYS 202 202 202 CYS CYS A . n 
A 1 203 ASP 203 203 203 ASP ASP A . n 
A 1 204 LEU 204 204 204 LEU LEU A . n 
A 1 205 LEU 205 205 205 LEU LEU A . n 
A 1 206 TRP 206 206 206 TRP TRP A . n 
A 1 207 SER 207 207 207 SER SER A . n 
A 1 208 ASP 208 208 208 ASP ASP A . n 
A 1 209 PRO 209 209 209 PRO PRO A . n 
A 1 210 ASP 210 210 210 ASP ASP A . n 
A 1 211 LYS 211 211 211 LYS LYS A . n 
A 1 212 ASP 212 212 212 ASP ASP A . n 
A 1 213 VAL 213 213 213 VAL VAL A . n 
A 1 214 LEU 214 214 214 LEU LEU A . n 
A 1 215 GLY 215 215 215 GLY GLY A . n 
A 1 216 TRP 216 216 216 TRP TRP A . n 
A 1 217 GLY 217 217 217 GLY GLY A . n 
A 1 218 GLU 218 218 218 GLU GLU A . n 
A 1 219 ASN 219 219 219 ASN ASN A . n 
A 1 220 ASP 220 220 220 ASP ASP A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 GLY 222 222 222 GLY GLY A . n 
A 1 223 VAL 223 223 223 VAL VAL A . n 
A 1 224 SER 224 224 224 SER SER A . n 
A 1 225 PHE 225 225 225 PHE PHE A . n 
A 1 226 THR 226 226 226 THR THR A . n 
A 1 227 PHE 227 227 227 PHE PHE A . n 
A 1 228 GLY 228 228 228 GLY GLY A . n 
A 1 229 ALA 229 229 229 ALA ALA A . n 
A 1 230 GLU 230 230 230 GLU GLU A . n 
A 1 231 VAL 231 231 231 VAL VAL A . n 
A 1 232 VAL 232 232 232 VAL VAL A . n 
A 1 233 ALA 233 233 233 ALA ALA A . n 
A 1 234 LYS 234 234 234 LYS LYS A . n 
A 1 235 PHE 235 235 235 PHE PHE A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 HIS 237 237 237 HIS HIS A . n 
A 1 238 LYS 238 238 238 LYS LYS A . n 
A 1 239 HIS 239 239 239 HIS HIS A . n 
A 1 240 ASP 240 240 240 ASP ASP A . n 
A 1 241 LEU 241 241 241 LEU LEU A . n 
A 1 242 ASP 242 242 242 ASP ASP A . n 
A 1 243 LEU 243 243 243 LEU LEU A . n 
A 1 244 ILE 244 244 244 ILE ILE A . n 
A 1 245 CYS 245 245 245 CYS CYS A . n 
A 1 246 ARG 246 246 246 ARG ARG A . n 
A 1 247 ALA 247 247 247 ALA ALA A . n 
A 1 248 HIS 248 248 248 HIS HIS A . n 
A 1 249 GLN 249 249 249 GLN GLN A . n 
A 1 250 VAL 250 250 250 VAL VAL A . n 
A 1 251 VAL 251 251 251 VAL VAL A . n 
A 1 252 GLU 252 252 252 GLU GLU A . n 
A 1 253 ASP 253 253 253 ASP ASP A . n 
A 1 254 GLY 254 254 254 GLY GLY A . n 
A 1 255 TYR 255 255 255 TYR TYR A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 PHE 257 257 257 PHE PHE A . n 
A 1 258 PHE 258 258 258 PHE PHE A . n 
A 1 259 ALA 259 259 259 ALA ALA A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 ARG 261 261 261 ARG ARG A . n 
A 1 262 GLN 262 262 262 GLN GLN A . n 
A 1 263 LEU 263 263 263 LEU LEU A . n 
A 1 264 VAL 264 264 264 VAL VAL A . n 
A 1 265 THR 265 265 265 THR THR A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 PHE 267 267 267 PHE PHE A . n 
A 1 268 SER 268 268 268 SER SER A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 PRO 270 270 270 PRO PRO A . n 
A 1 271 ASN 271 271 271 ASN ASN A . n 
A 1 272 TYR 272 272 272 TYR TYR A . n 
A 1 273 CSO 273 273 273 CSO CSO A . n 
A 1 274 GLY 274 274 274 GLY GLY A . n 
A 1 275 GLU 275 275 275 GLU GLU A . n 
A 1 276 PHE 276 276 276 PHE PHE A . n 
A 1 277 ASP 277 277 277 ASP ASP A . n 
A 1 278 ASN 278 278 278 ASN ASN A . n 
A 1 279 ALA 279 279 279 ALA ALA A . n 
A 1 280 GLY 280 280 280 GLY GLY A . n 
A 1 281 ALA 281 281 281 ALA ALA A . n 
A 1 282 MET 282 282 282 MET MET A . n 
A 1 283 MET 283 283 283 MET MET A . n 
A 1 284 SER 284 284 284 SER SER A . n 
A 1 285 VAL 285 285 285 VAL VAL A . n 
A 1 286 ASP 286 286 286 ASP ASP A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 THR 288 288 288 THR THR A . n 
A 1 289 LEU 289 289 289 LEU LEU A . n 
A 1 290 MET 290 290 290 MET MET A . n 
A 1 291 CSO 291 291 291 CSO CSO A . n 
A 1 292 SER 292 292 292 SER SER A . n 
A 1 293 PHE 293 293 293 PHE PHE A . n 
A 1 294 GLN 294 294 294 GLN GLN A . n 
A 1 295 ILE 295 295 295 ILE ILE A . n 
A 1 296 LEU 296 296 296 LEU LEU A . n 
A 1 297 LYS 297 297 297 LYS LYS A . n 
A 1 298 PRO 298 298 298 PRO PRO A . n 
A 1 299 ALA 299 299 299 ALA ALA A . n 
A 1 300 GLU 300 300 ?   ?   ?   A . n 
A 1 301 LYS 301 301 ?   ?   ?   A . n 
A 1 302 LYS 302 302 ?   ?   ?   A . n 
A 1 303 LYS 303 303 ?   ?   ?   A . n 
A 1 304 PRO 304 304 ?   ?   ?   A . n 
A 1 305 ASN 305 305 ?   ?   ?   A . n 
A 1 306 ALA 306 306 ?   ?   ?   A . n 
A 1 307 THR 307 307 ?   ?   ?   A . n 
A 1 308 ARG 308 308 ?   ?   ?   A . n 
A 1 309 PRO 309 309 ?   ?   ?   A . n 
A 1 310 VAL 310 310 ?   ?   ?   A . n 
A 1 311 THR 311 311 ?   ?   ?   A . n 
A 1 312 PRO 312 312 ?   ?   ?   A . n 
A 1 313 PRO 313 313 ?   ?   ?   A . n 
A 1 314 ARG 314 314 ?   ?   ?   A . n 
A 1 315 GLY 315 315 ?   ?   ?   A . n 
A 1 316 MET 316 316 ?   ?   ?   A . n 
A 1 317 ILE 317 317 ?   ?   ?   A . n 
A 1 318 THR 318 318 ?   ?   ?   A . n 
A 1 319 LYS 319 319 ?   ?   ?   A . n 
A 1 320 GLN 320 320 ?   ?   ?   A . n 
A 1 321 ALA 321 321 ?   ?   ?   A . n 
A 1 322 LYS 322 322 ?   ?   ?   A . n 
A 1 323 LYS 323 323 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   ALA 2   2   ?   ?   ?   B . n 
B 1 3   ASP 3   3   ?   ?   ?   B . n 
B 1 4   LEU 4   4   ?   ?   ?   B . n 
B 1 5   ASP 5   5   ?   ?   ?   B . n 
B 1 6   LYS 6   6   6   LYS LYS B . n 
B 1 7   LEU 7   7   7   LEU LEU B . n 
B 1 8   ASN 8   8   8   ASN ASN B . n 
B 1 9   ILE 9   9   9   ILE ILE B . n 
B 1 10  ASP 10  10  10  ASP ASP B . n 
B 1 11  SER 11  11  11  SER SER B . n 
B 1 12  ILE 12  12  12  ILE ILE B . n 
B 1 13  ILE 13  13  13  ILE ILE B . n 
B 1 14  GLN 14  14  14  GLN GLN B . n 
B 1 15  ARG 15  15  15  ARG ARG B . n 
B 1 16  LEU 16  16  16  LEU LEU B . n 
B 1 17  LEU 17  17  17  LEU LEU B . n 
B 1 18  GLU 18  18  18  GLU GLU B . n 
B 1 19  VAL 19  19  19  VAL VAL B . n 
B 1 20  ARG 20  20  20  ARG ARG B . n 
B 1 21  GLY 21  21  21  GLY GLY B . n 
B 1 22  SER 22  22  22  SER SER B . n 
B 1 23  LYS 23  23  23  LYS LYS B . n 
B 1 24  PRO 24  24  24  PRO PRO B . n 
B 1 25  GLY 25  25  25  GLY GLY B . n 
B 1 26  LYS 26  26  26  LYS LYS B . n 
B 1 27  ASN 27  27  27  ASN ASN B . n 
B 1 28  VAL 28  28  28  VAL VAL B . n 
B 1 29  GLN 29  29  29  GLN GLN B . n 
B 1 30  LEU 30  30  30  LEU LEU B . n 
B 1 31  GLN 31  31  31  GLN GLN B . n 
B 1 32  GLU 32  32  32  GLU GLU B . n 
B 1 33  ASN 33  33  33  ASN ASN B . n 
B 1 34  GLU 34  34  34  GLU GLU B . n 
B 1 35  ILE 35  35  35  ILE ILE B . n 
B 1 36  ARG 36  36  36  ARG ARG B . n 
B 1 37  GLY 37  37  37  GLY GLY B . n 
B 1 38  LEU 38  38  38  LEU LEU B . n 
B 1 39  CYS 39  39  39  CYS CYS B . n 
B 1 40  LEU 40  40  40  LEU LEU B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  SER 42  42  42  SER SER B . n 
B 1 43  ARG 43  43  43  ARG ARG B . n 
B 1 44  GLU 44  44  44  GLU GLU B . n 
B 1 45  ILE 45  45  45  ILE ILE B . n 
B 1 46  PHE 46  46  46  PHE PHE B . n 
B 1 47  LEU 47  47  47  LEU LEU B . n 
B 1 48  SER 48  48  48  SER SER B . n 
B 1 49  GLN 49  49  49  GLN GLN B . n 
B 1 50  PRO 50  50  50  PRO PRO B . n 
B 1 51  ILE 51  51  51  ILE ILE B . n 
B 1 52  LEU 52  52  52  LEU LEU B . n 
B 1 53  LEU 53  53  53  LEU LEU B . n 
B 1 54  GLU 54  54  54  GLU GLU B . n 
B 1 55  LEU 55  55  55  LEU LEU B . n 
B 1 56  GLU 56  56  56  GLU GLU B . n 
B 1 57  ALA 57  57  57  ALA ALA B . n 
B 1 58  PRO 58  58  58  PRO PRO B . n 
B 1 59  LEU 59  59  59  LEU LEU B . n 
B 1 60  LYS 60  60  60  LYS LYS B . n 
B 1 61  ILE 61  61  61  ILE ILE B . n 
B 1 62  CYS 62  62  62  CYS CYS B . n 
B 1 63  GLY 63  63  63  GLY GLY B . n 
B 1 64  ASP 64  64  64  ASP ASP B . n 
B 1 65  ILE 65  65  65  ILE ILE B . n 
B 1 66  HIS 66  66  66  HIS HIS B . n 
B 1 67  GLY 67  67  67  GLY GLY B . n 
B 1 68  GLN 68  68  68  GLN GLN B . n 
B 1 69  TYR 69  69  69  TYR TYR B . n 
B 1 70  TYR 70  70  70  TYR TYR B . n 
B 1 71  ASP 71  71  71  ASP ASP B . n 
B 1 72  LEU 72  72  72  LEU LEU B . n 
B 1 73  LEU 73  73  73  LEU LEU B . n 
B 1 74  ARG 74  74  74  ARG ARG B . n 
B 1 75  LEU 75  75  75  LEU LEU B . n 
B 1 76  PHE 76  76  76  PHE PHE B . n 
B 1 77  GLU 77  77  77  GLU GLU B . n 
B 1 78  TYR 78  78  78  TYR TYR B . n 
B 1 79  GLY 79  79  79  GLY GLY B . n 
B 1 80  GLY 80  80  80  GLY GLY B . n 
B 1 81  PHE 81  81  81  PHE PHE B . n 
B 1 82  PRO 82  82  82  PRO PRO B . n 
B 1 83  PRO 83  83  83  PRO PRO B . n 
B 1 84  GLU 84  84  84  GLU GLU B . n 
B 1 85  SER 85  85  85  SER SER B . n 
B 1 86  ASN 86  86  86  ASN ASN B . n 
B 1 87  TYR 87  87  87  TYR TYR B . n 
B 1 88  LEU 88  88  88  LEU LEU B . n 
B 1 89  PHE 89  89  89  PHE PHE B . n 
B 1 90  LEU 90  90  90  LEU LEU B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  ASP 92  92  92  ASP ASP B . n 
B 1 93  TYR 93  93  93  TYR TYR B . n 
B 1 94  VAL 94  94  94  VAL VAL B . n 
B 1 95  ASP 95  95  95  ASP ASP B . n 
B 1 96  ARG 96  96  96  ARG ARG B . n 
B 1 97  GLY 97  97  97  GLY GLY B . n 
B 1 98  LYS 98  98  98  LYS LYS B . n 
B 1 99  GLN 99  99  99  GLN GLN B . n 
B 1 100 SER 100 100 100 SER SER B . n 
B 1 101 LEU 101 101 101 LEU LEU B . n 
B 1 102 GLU 102 102 102 GLU GLU B . n 
B 1 103 THR 103 103 103 THR THR B . n 
B 1 104 ILE 104 104 104 ILE ILE B . n 
B 1 105 CYS 105 105 105 CYS CYS B . n 
B 1 106 LEU 106 106 106 LEU LEU B . n 
B 1 107 LEU 107 107 107 LEU LEU B . n 
B 1 108 LEU 108 108 108 LEU LEU B . n 
B 1 109 ALA 109 109 109 ALA ALA B . n 
B 1 110 TYR 110 110 110 TYR TYR B . n 
B 1 111 LYS 111 111 111 LYS LYS B . n 
B 1 112 ILE 112 112 112 ILE ILE B . n 
B 1 113 LYS 113 113 113 LYS LYS B . n 
B 1 114 TYR 114 114 114 TYR TYR B . n 
B 1 115 PRO 115 115 115 PRO PRO B . n 
B 1 116 GLU 116 116 116 GLU GLU B . n 
B 1 117 ASN 117 117 117 ASN ASN B . n 
B 1 118 PHE 118 118 118 PHE PHE B . n 
B 1 119 PHE 119 119 119 PHE PHE B . n 
B 1 120 LEU 120 120 120 LEU LEU B . n 
B 1 121 LEU 121 121 121 LEU LEU B . n 
B 1 122 ARG 122 122 122 ARG ARG B . n 
B 1 123 GLY 123 123 123 GLY GLY B . n 
B 1 124 ASN 124 124 124 ASN ASN B . n 
B 1 125 HIS 125 125 125 HIS HIS B . n 
B 1 126 GLU 126 126 126 GLU GLU B . n 
B 1 127 CSO 127 127 127 CSO CSO B . n 
B 1 128 ALA 128 128 128 ALA ALA B . n 
B 1 129 SER 129 129 129 SER SER B . n 
B 1 130 ILE 130 130 130 ILE ILE B . n 
B 1 131 ASN 131 131 131 ASN ASN B . n 
B 1 132 ARG 132 132 132 ARG ARG B . n 
B 1 133 ILE 133 133 133 ILE ILE B . n 
B 1 134 TYR 134 134 134 TYR TYR B . n 
B 1 135 GLY 135 135 135 GLY GLY B . n 
B 1 136 PHE 136 136 136 PHE PHE B . n 
B 1 137 TYR 137 137 137 TYR TYR B . n 
B 1 138 ASP 138 138 138 ASP ASP B . n 
B 1 139 GLU 139 139 139 GLU GLU B . n 
B 1 140 CYS 140 140 140 CYS CYS B . n 
B 1 141 LYS 141 141 141 LYS LYS B . n 
B 1 142 ARG 142 142 142 ARG ARG B . n 
B 1 143 ARG 143 143 143 ARG ARG B . n 
B 1 144 TYR 144 144 144 TYR TYR B . n 
B 1 145 ASN 145 145 145 ASN ASN B . n 
B 1 146 ILE 146 146 146 ILE ILE B . n 
B 1 147 LYS 147 147 147 LYS LYS B . n 
B 1 148 LEU 148 148 148 LEU LEU B . n 
B 1 149 TRP 149 149 149 TRP TRP B . n 
B 1 150 LYS 150 150 150 LYS LYS B . n 
B 1 151 THR 151 151 151 THR THR B . n 
B 1 152 PHE 152 152 152 PHE PHE B . n 
B 1 153 THR 153 153 153 THR THR B . n 
B 1 154 ASP 154 154 154 ASP ASP B . n 
B 1 155 CYS 155 155 155 CYS CYS B . n 
B 1 156 PHE 156 156 156 PHE PHE B . n 
B 1 157 ASN 157 157 157 ASN ASN B . n 
B 1 158 CYS 158 158 158 CYS CYS B . n 
B 1 159 LEU 159 159 159 LEU LEU B . n 
B 1 160 PRO 160 160 160 PRO PRO B . n 
B 1 161 ILE 161 161 161 ILE ILE B . n 
B 1 162 ALA 162 162 162 ALA ALA B . n 
B 1 163 ALA 163 163 163 ALA ALA B . n 
B 1 164 ILE 164 164 164 ILE ILE B . n 
B 1 165 VAL 165 165 165 VAL VAL B . n 
B 1 166 ASP 166 166 166 ASP ASP B . n 
B 1 167 GLU 167 167 167 GLU GLU B . n 
B 1 168 LYS 168 168 168 LYS LYS B . n 
B 1 169 ILE 169 169 169 ILE ILE B . n 
B 1 170 PHE 170 170 170 PHE PHE B . n 
B 1 171 CYS 171 171 171 CYS CYS B . n 
B 1 172 CYS 172 172 172 CYS CYS B . n 
B 1 173 HIS 173 173 173 HIS HIS B . n 
B 1 174 GLY 174 174 174 GLY GLY B . n 
B 1 175 GLY 175 175 175 GLY GLY B . n 
B 1 176 LEU 176 176 176 LEU LEU B . n 
B 1 177 SER 177 177 177 SER SER B . n 
B 1 178 PRO 178 178 178 PRO PRO B . n 
B 1 179 ASP 179 179 179 ASP ASP B . n 
B 1 180 LEU 180 180 180 LEU LEU B . n 
B 1 181 GLN 181 181 181 GLN GLN B . n 
B 1 182 SER 182 182 182 SER SER B . n 
B 1 183 MET 183 183 183 MET MET B . n 
B 1 184 GLU 184 184 184 GLU GLU B . n 
B 1 185 GLN 185 185 185 GLN GLN B . n 
B 1 186 ILE 186 186 186 ILE ILE B . n 
B 1 187 ARG 187 187 187 ARG ARG B . n 
B 1 188 ARG 188 188 188 ARG ARG B . n 
B 1 189 ILE 189 189 189 ILE ILE B . n 
B 1 190 MET 190 190 190 MET MET B . n 
B 1 191 ARG 191 191 191 ARG ARG B . n 
B 1 192 PRO 192 192 192 PRO PRO B . n 
B 1 193 THR 193 193 193 THR THR B . n 
B 1 194 ASP 194 194 194 ASP ASP B . n 
B 1 195 VAL 195 195 195 VAL VAL B . n 
B 1 196 PRO 196 196 196 PRO PRO B . n 
B 1 197 ASP 197 197 197 ASP ASP B . n 
B 1 198 GLN 198 198 198 GLN GLN B . n 
B 1 199 GLY 199 199 199 GLY GLY B . n 
B 1 200 LEU 200 200 200 LEU LEU B . n 
B 1 201 LEU 201 201 201 LEU LEU B . n 
B 1 202 CYS 202 202 202 CYS CYS B . n 
B 1 203 ASP 203 203 203 ASP ASP B . n 
B 1 204 LEU 204 204 204 LEU LEU B . n 
B 1 205 LEU 205 205 205 LEU LEU B . n 
B 1 206 TRP 206 206 206 TRP TRP B . n 
B 1 207 SER 207 207 207 SER SER B . n 
B 1 208 ASP 208 208 208 ASP ASP B . n 
B 1 209 PRO 209 209 209 PRO PRO B . n 
B 1 210 ASP 210 210 210 ASP ASP B . n 
B 1 211 LYS 211 211 211 LYS LYS B . n 
B 1 212 ASP 212 212 212 ASP ASP B . n 
B 1 213 VAL 213 213 213 VAL VAL B . n 
B 1 214 LEU 214 214 214 LEU LEU B . n 
B 1 215 GLY 215 215 215 GLY GLY B . n 
B 1 216 TRP 216 216 216 TRP TRP B . n 
B 1 217 GLY 217 217 217 GLY GLY B . n 
B 1 218 GLU 218 218 218 GLU GLU B . n 
B 1 219 ASN 219 219 219 ASN ASN B . n 
B 1 220 ASP 220 220 220 ASP ASP B . n 
B 1 221 ARG 221 221 221 ARG ARG B . n 
B 1 222 GLY 222 222 222 GLY GLY B . n 
B 1 223 VAL 223 223 223 VAL VAL B . n 
B 1 224 SER 224 224 224 SER SER B . n 
B 1 225 PHE 225 225 225 PHE PHE B . n 
B 1 226 THR 226 226 226 THR THR B . n 
B 1 227 PHE 227 227 227 PHE PHE B . n 
B 1 228 GLY 228 228 228 GLY GLY B . n 
B 1 229 ALA 229 229 229 ALA ALA B . n 
B 1 230 GLU 230 230 230 GLU GLU B . n 
B 1 231 VAL 231 231 231 VAL VAL B . n 
B 1 232 VAL 232 232 232 VAL VAL B . n 
B 1 233 ALA 233 233 233 ALA ALA B . n 
B 1 234 LYS 234 234 234 LYS LYS B . n 
B 1 235 PHE 235 235 235 PHE PHE B . n 
B 1 236 LEU 236 236 236 LEU LEU B . n 
B 1 237 HIS 237 237 237 HIS HIS B . n 
B 1 238 LYS 238 238 238 LYS LYS B . n 
B 1 239 HIS 239 239 239 HIS HIS B . n 
B 1 240 ASP 240 240 240 ASP ASP B . n 
B 1 241 LEU 241 241 241 LEU LEU B . n 
B 1 242 ASP 242 242 242 ASP ASP B . n 
B 1 243 LEU 243 243 243 LEU LEU B . n 
B 1 244 ILE 244 244 244 ILE ILE B . n 
B 1 245 CYS 245 245 245 CYS CYS B . n 
B 1 246 ARG 246 246 246 ARG ARG B . n 
B 1 247 ALA 247 247 247 ALA ALA B . n 
B 1 248 HIS 248 248 248 HIS HIS B . n 
B 1 249 GLN 249 249 249 GLN GLN B . n 
B 1 250 VAL 250 250 250 VAL VAL B . n 
B 1 251 VAL 251 251 251 VAL VAL B . n 
B 1 252 GLU 252 252 252 GLU GLU B . n 
B 1 253 ASP 253 253 253 ASP ASP B . n 
B 1 254 GLY 254 254 254 GLY GLY B . n 
B 1 255 TYR 255 255 255 TYR TYR B . n 
B 1 256 GLU 256 256 256 GLU GLU B . n 
B 1 257 PHE 257 257 257 PHE PHE B . n 
B 1 258 PHE 258 258 258 PHE PHE B . n 
B 1 259 ALA 259 259 259 ALA ALA B . n 
B 1 260 LYS 260 260 260 LYS LYS B . n 
B 1 261 ARG 261 261 261 ARG ARG B . n 
B 1 262 GLN 262 262 262 GLN GLN B . n 
B 1 263 LEU 263 263 263 LEU LEU B . n 
B 1 264 VAL 264 264 264 VAL VAL B . n 
B 1 265 THR 265 265 265 THR THR B . n 
B 1 266 LEU 266 266 266 LEU LEU B . n 
B 1 267 PHE 267 267 267 PHE PHE B . n 
B 1 268 SER 268 268 268 SER SER B . n 
B 1 269 ALA 269 269 269 ALA ALA B . n 
B 1 270 PRO 270 270 270 PRO PRO B . n 
B 1 271 ASN 271 271 271 ASN ASN B . n 
B 1 272 TYR 272 272 272 TYR TYR B . n 
B 1 273 CSO 273 273 273 CSO CSO B . n 
B 1 274 GLY 274 274 274 GLY GLY B . n 
B 1 275 GLU 275 275 275 GLU GLU B . n 
B 1 276 PHE 276 276 276 PHE PHE B . n 
B 1 277 ASP 277 277 277 ASP ASP B . n 
B 1 278 ASN 278 278 278 ASN ASN B . n 
B 1 279 ALA 279 279 279 ALA ALA B . n 
B 1 280 GLY 280 280 280 GLY GLY B . n 
B 1 281 ALA 281 281 281 ALA ALA B . n 
B 1 282 MET 282 282 282 MET MET B . n 
B 1 283 MET 283 283 283 MET MET B . n 
B 1 284 SER 284 284 284 SER SER B . n 
B 1 285 VAL 285 285 285 VAL VAL B . n 
B 1 286 ASP 286 286 286 ASP ASP B . n 
B 1 287 GLU 287 287 287 GLU GLU B . n 
B 1 288 THR 288 288 288 THR THR B . n 
B 1 289 LEU 289 289 289 LEU LEU B . n 
B 1 290 MET 290 290 290 MET MET B . n 
B 1 291 CSO 291 291 291 CSO CSO B . n 
B 1 292 SER 292 292 292 SER SER B . n 
B 1 293 PHE 293 293 293 PHE PHE B . n 
B 1 294 GLN 294 294 294 GLN GLN B . n 
B 1 295 ILE 295 295 295 ILE ILE B . n 
B 1 296 LEU 296 296 296 LEU LEU B . n 
B 1 297 LYS 297 297 297 LYS LYS B . n 
B 1 298 PRO 298 298 298 PRO PRO B . n 
B 1 299 ALA 299 299 299 ALA ALA B . n 
B 1 300 GLU 300 300 ?   ?   ?   B . n 
B 1 301 LYS 301 301 ?   ?   ?   B . n 
B 1 302 LYS 302 302 ?   ?   ?   B . n 
B 1 303 LYS 303 303 ?   ?   ?   B . n 
B 1 304 PRO 304 304 ?   ?   ?   B . n 
B 1 305 ASN 305 305 ?   ?   ?   B . n 
B 1 306 ALA 306 306 ?   ?   ?   B . n 
B 1 307 THR 307 307 ?   ?   ?   B . n 
B 1 308 ARG 308 308 ?   ?   ?   B . n 
B 1 309 PRO 309 309 ?   ?   ?   B . n 
B 1 310 VAL 310 310 ?   ?   ?   B . n 
B 1 311 THR 311 311 ?   ?   ?   B . n 
B 1 312 PRO 312 312 ?   ?   ?   B . n 
B 1 313 PRO 313 313 ?   ?   ?   B . n 
B 1 314 ARG 314 314 ?   ?   ?   B . n 
B 1 315 GLY 315 315 ?   ?   ?   B . n 
B 1 316 MET 316 316 ?   ?   ?   B . n 
B 1 317 ILE 317 317 ?   ?   ?   B . n 
B 1 318 THR 318 318 ?   ?   ?   B . n 
B 1 319 LYS 319 319 ?   ?   ?   B . n 
B 1 320 GLN 320 320 ?   ?   ?   B . n 
B 1 321 ALA 321 321 ?   ?   ?   B . n 
B 1 322 LYS 322 322 ?   ?   ?   B . n 
B 1 323 LYS 323 323 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MN  1   400  400  MN  MN  A . 
D 2 MN  1   401  401  MN  MN  A . 
E 3 PO4 1   501  501  PO4 PO4 A . 
F 2 MN  1   400  400  MN  MN  B . 
G 2 MN  1   401  401  MN  MN  B . 
H 3 PO4 1   501  501  PO4 PO4 B . 
I 4 HOH 1   2001 2001 HOH HOH A . 
I 4 HOH 2   2002 2002 HOH HOH A . 
I 4 HOH 3   2003 2003 HOH HOH A . 
I 4 HOH 4   2004 2004 HOH HOH A . 
I 4 HOH 5   2005 2005 HOH HOH A . 
I 4 HOH 6   2006 2006 HOH HOH A . 
I 4 HOH 7   2007 2007 HOH HOH A . 
I 4 HOH 8   2008 2008 HOH HOH A . 
I 4 HOH 9   2009 2009 HOH HOH A . 
I 4 HOH 10  2010 2010 HOH HOH A . 
I 4 HOH 11  2011 2011 HOH HOH A . 
I 4 HOH 12  2012 2012 HOH HOH A . 
I 4 HOH 13  2013 2013 HOH HOH A . 
I 4 HOH 14  2014 2014 HOH HOH A . 
I 4 HOH 15  2015 2015 HOH HOH A . 
I 4 HOH 16  2016 2016 HOH HOH A . 
I 4 HOH 17  2017 2017 HOH HOH A . 
I 4 HOH 18  2018 2018 HOH HOH A . 
I 4 HOH 19  2019 2019 HOH HOH A . 
I 4 HOH 20  2020 2020 HOH HOH A . 
I 4 HOH 21  2021 2021 HOH HOH A . 
I 4 HOH 22  2022 2022 HOH HOH A . 
I 4 HOH 23  2023 2023 HOH HOH A . 
I 4 HOH 24  2024 2024 HOH HOH A . 
I 4 HOH 25  2025 2025 HOH HOH A . 
I 4 HOH 26  2026 2026 HOH HOH A . 
I 4 HOH 27  2027 2027 HOH HOH A . 
I 4 HOH 28  2028 2028 HOH HOH A . 
I 4 HOH 29  2029 2029 HOH HOH A . 
I 4 HOH 30  2030 2030 HOH HOH A . 
I 4 HOH 31  2031 2031 HOH HOH A . 
I 4 HOH 32  2032 2032 HOH HOH A . 
I 4 HOH 33  2033 2033 HOH HOH A . 
I 4 HOH 34  2034 2034 HOH HOH A . 
I 4 HOH 35  2035 2035 HOH HOH A . 
I 4 HOH 36  2036 2036 HOH HOH A . 
I 4 HOH 37  2037 2037 HOH HOH A . 
I 4 HOH 38  2038 2038 HOH HOH A . 
I 4 HOH 39  2039 2039 HOH HOH A . 
I 4 HOH 40  2040 2040 HOH HOH A . 
I 4 HOH 41  2041 2041 HOH HOH A . 
I 4 HOH 42  2042 2042 HOH HOH A . 
I 4 HOH 43  2043 2043 HOH HOH A . 
I 4 HOH 44  2044 2044 HOH HOH A . 
I 4 HOH 45  2045 2045 HOH HOH A . 
I 4 HOH 46  2046 2046 HOH HOH A . 
I 4 HOH 47  2047 2047 HOH HOH A . 
I 4 HOH 48  2048 2048 HOH HOH A . 
I 4 HOH 49  2049 2049 HOH HOH A . 
I 4 HOH 50  2050 2050 HOH HOH A . 
I 4 HOH 51  2051 2051 HOH HOH A . 
I 4 HOH 52  2052 2052 HOH HOH A . 
I 4 HOH 53  2053 2053 HOH HOH A . 
I 4 HOH 54  2054 2054 HOH HOH A . 
I 4 HOH 55  2055 2055 HOH HOH A . 
I 4 HOH 56  2056 2056 HOH HOH A . 
I 4 HOH 57  2057 2057 HOH HOH A . 
I 4 HOH 58  2058 2058 HOH HOH A . 
I 4 HOH 59  2059 2059 HOH HOH A . 
I 4 HOH 60  2060 2060 HOH HOH A . 
I 4 HOH 61  2061 2061 HOH HOH A . 
I 4 HOH 62  2062 2062 HOH HOH A . 
I 4 HOH 63  2063 2063 HOH HOH A . 
I 4 HOH 64  2064 2064 HOH HOH A . 
I 4 HOH 65  2065 2065 HOH HOH A . 
I 4 HOH 66  2066 2066 HOH HOH A . 
I 4 HOH 67  2067 2067 HOH HOH A . 
I 4 HOH 68  2068 2068 HOH HOH A . 
I 4 HOH 69  2069 2069 HOH HOH A . 
I 4 HOH 70  2070 2070 HOH HOH A . 
I 4 HOH 71  2071 2071 HOH HOH A . 
I 4 HOH 72  2072 2072 HOH HOH A . 
I 4 HOH 73  2073 2073 HOH HOH A . 
I 4 HOH 74  2074 2074 HOH HOH A . 
I 4 HOH 75  2075 2075 HOH HOH A . 
I 4 HOH 76  2076 2076 HOH HOH A . 
I 4 HOH 77  2077 2077 HOH HOH A . 
I 4 HOH 78  2078 2078 HOH HOH A . 
I 4 HOH 79  2079 2079 HOH HOH A . 
I 4 HOH 80  2080 2080 HOH HOH A . 
I 4 HOH 81  2081 2081 HOH HOH A . 
I 4 HOH 82  2082 2082 HOH HOH A . 
I 4 HOH 83  2083 2083 HOH HOH A . 
I 4 HOH 84  2084 2084 HOH HOH A . 
I 4 HOH 85  2085 2085 HOH HOH A . 
I 4 HOH 86  2086 2086 HOH HOH A . 
I 4 HOH 87  2087 2087 HOH HOH A . 
I 4 HOH 88  2088 2088 HOH HOH A . 
I 4 HOH 89  2089 2089 HOH HOH A . 
I 4 HOH 90  2090 2090 HOH HOH A . 
I 4 HOH 91  2091 2091 HOH HOH A . 
I 4 HOH 92  2092 2092 HOH HOH A . 
I 4 HOH 93  2093 2093 HOH HOH A . 
I 4 HOH 94  2094 2094 HOH HOH A . 
I 4 HOH 95  2095 2095 HOH HOH A . 
I 4 HOH 96  2096 2096 HOH HOH A . 
I 4 HOH 97  2097 2097 HOH HOH A . 
I 4 HOH 98  2098 2098 HOH HOH A . 
I 4 HOH 99  2099 2099 HOH HOH A . 
I 4 HOH 100 2100 2100 HOH HOH A . 
I 4 HOH 101 2101 2101 HOH HOH A . 
I 4 HOH 102 2102 2102 HOH HOH A . 
I 4 HOH 103 2103 2103 HOH HOH A . 
I 4 HOH 104 2104 2104 HOH HOH A . 
I 4 HOH 105 2105 2105 HOH HOH A . 
I 4 HOH 106 2106 2106 HOH HOH A . 
I 4 HOH 107 2107 2107 HOH HOH A . 
I 4 HOH 108 2108 2108 HOH HOH A . 
I 4 HOH 109 2109 2109 HOH HOH A . 
I 4 HOH 110 2110 2110 HOH HOH A . 
I 4 HOH 111 2111 2111 HOH HOH A . 
I 4 HOH 112 2112 2112 HOH HOH A . 
I 4 HOH 113 2113 2113 HOH HOH A . 
I 4 HOH 114 2114 2114 HOH HOH A . 
I 4 HOH 115 2115 2115 HOH HOH A . 
I 4 HOH 116 2116 2116 HOH HOH A . 
I 4 HOH 117 2117 2117 HOH HOH A . 
I 4 HOH 118 2118 2118 HOH HOH A . 
I 4 HOH 119 2119 2119 HOH HOH A . 
I 4 HOH 120 2120 2120 HOH HOH A . 
I 4 HOH 121 2121 2121 HOH HOH A . 
I 4 HOH 122 2122 2122 HOH HOH A . 
I 4 HOH 123 2123 2123 HOH HOH A . 
I 4 HOH 124 2124 2124 HOH HOH A . 
I 4 HOH 125 2125 2125 HOH HOH A . 
I 4 HOH 126 2126 2126 HOH HOH A . 
I 4 HOH 127 2127 2127 HOH HOH A . 
I 4 HOH 128 2128 2128 HOH HOH A . 
I 4 HOH 129 2129 2129 HOH HOH A . 
I 4 HOH 130 2130 2130 HOH HOH A . 
I 4 HOH 131 2131 2131 HOH HOH A . 
I 4 HOH 132 2132 2132 HOH HOH A . 
I 4 HOH 133 2133 2133 HOH HOH A . 
I 4 HOH 134 2134 2134 HOH HOH A . 
J 4 HOH 1   2001 2001 HOH HOH B . 
J 4 HOH 2   2002 2002 HOH HOH B . 
J 4 HOH 3   2003 2003 HOH HOH B . 
J 4 HOH 4   2004 2004 HOH HOH B . 
J 4 HOH 5   2005 2005 HOH HOH B . 
J 4 HOH 6   2006 2006 HOH HOH B . 
J 4 HOH 7   2007 2007 HOH HOH B . 
J 4 HOH 8   2008 2008 HOH HOH B . 
J 4 HOH 9   2010 2010 HOH HOH B . 
J 4 HOH 10  2011 2011 HOH HOH B . 
J 4 HOH 11  2012 2012 HOH HOH B . 
J 4 HOH 12  2013 2013 HOH HOH B . 
J 4 HOH 13  2014 2014 HOH HOH B . 
J 4 HOH 14  2015 2015 HOH HOH B . 
J 4 HOH 15  2016 2016 HOH HOH B . 
J 4 HOH 16  2017 2017 HOH HOH B . 
J 4 HOH 17  2018 2018 HOH HOH B . 
J 4 HOH 18  2019 2019 HOH HOH B . 
J 4 HOH 19  2020 2020 HOH HOH B . 
J 4 HOH 20  2021 2021 HOH HOH B . 
J 4 HOH 21  2022 2022 HOH HOH B . 
J 4 HOH 22  2023 2023 HOH HOH B . 
J 4 HOH 23  2024 2024 HOH HOH B . 
J 4 HOH 24  2025 2025 HOH HOH B . 
J 4 HOH 25  2026 2026 HOH HOH B . 
J 4 HOH 26  2027 2027 HOH HOH B . 
J 4 HOH 27  2028 2028 HOH HOH B . 
J 4 HOH 28  2029 2029 HOH HOH B . 
J 4 HOH 29  2030 2030 HOH HOH B . 
J 4 HOH 30  2031 2031 HOH HOH B . 
J 4 HOH 31  2032 2032 HOH HOH B . 
J 4 HOH 32  2033 2033 HOH HOH B . 
J 4 HOH 33  2034 2034 HOH HOH B . 
J 4 HOH 34  2035 2035 HOH HOH B . 
J 4 HOH 35  2036 2036 HOH HOH B . 
J 4 HOH 36  2037 2037 HOH HOH B . 
J 4 HOH 37  2038 2038 HOH HOH B . 
J 4 HOH 38  2039 2039 HOH HOH B . 
J 4 HOH 39  2040 2040 HOH HOH B . 
J 4 HOH 40  2041 2041 HOH HOH B . 
J 4 HOH 41  2042 2042 HOH HOH B . 
J 4 HOH 42  2043 2043 HOH HOH B . 
J 4 HOH 43  2044 2044 HOH HOH B . 
J 4 HOH 44  2045 2045 HOH HOH B . 
J 4 HOH 45  2046 2046 HOH HOH B . 
J 4 HOH 46  2047 2047 HOH HOH B . 
J 4 HOH 47  2048 2048 HOH HOH B . 
J 4 HOH 48  2049 2049 HOH HOH B . 
J 4 HOH 49  2050 2050 HOH HOH B . 
J 4 HOH 50  2051 2051 HOH HOH B . 
J 4 HOH 51  2052 2052 HOH HOH B . 
J 4 HOH 52  2053 2053 HOH HOH B . 
J 4 HOH 53  2054 2054 HOH HOH B . 
J 4 HOH 54  2055 2055 HOH HOH B . 
J 4 HOH 55  2056 2056 HOH HOH B . 
J 4 HOH 56  2057 2057 HOH HOH B . 
J 4 HOH 57  2058 2058 HOH HOH B . 
J 4 HOH 58  2059 2059 HOH HOH B . 
J 4 HOH 59  2060 2060 HOH HOH B . 
J 4 HOH 60  2061 2061 HOH HOH B . 
J 4 HOH 61  2062 2062 HOH HOH B . 
J 4 HOH 62  2063 2063 HOH HOH B . 
J 4 HOH 63  2064 2064 HOH HOH B . 
J 4 HOH 64  2065 2065 HOH HOH B . 
J 4 HOH 65  2066 2066 HOH HOH B . 
J 4 HOH 66  2067 2067 HOH HOH B . 
J 4 HOH 67  2068 2068 HOH HOH B . 
J 4 HOH 68  2069 2069 HOH HOH B . 
J 4 HOH 69  2070 2070 HOH HOH B . 
J 4 HOH 70  2071 2071 HOH HOH B . 
J 4 HOH 71  2072 2072 HOH HOH B . 
J 4 HOH 72  2073 2073 HOH HOH B . 
J 4 HOH 73  2074 2074 HOH HOH B . 
J 4 HOH 74  2075 2075 HOH HOH B . 
J 4 HOH 75  2076 2076 HOH HOH B . 
J 4 HOH 76  2077 2077 HOH HOH B . 
J 4 HOH 77  2078 2078 HOH HOH B . 
J 4 HOH 78  2079 2079 HOH HOH B . 
J 4 HOH 79  2080 2080 HOH HOH B . 
J 4 HOH 80  2081 2081 HOH HOH B . 
J 4 HOH 81  2082 2082 HOH HOH B . 
J 4 HOH 82  2083 2083 HOH HOH B . 
J 4 HOH 83  2084 2084 HOH HOH B . 
J 4 HOH 84  2085 2085 HOH HOH B . 
J 4 HOH 85  2086 2086 HOH HOH B . 
J 4 HOH 86  2087 2087 HOH HOH B . 
J 4 HOH 87  2088 2088 HOH HOH B . 
J 4 HOH 88  2089 2089 HOH HOH B . 
J 4 HOH 89  2090 2090 HOH HOH B . 
J 4 HOH 90  2091 2091 HOH HOH B . 
J 4 HOH 91  2092 2092 HOH HOH B . 
J 4 HOH 92  2093 2093 HOH HOH B . 
J 4 HOH 93  2094 2094 HOH HOH B . 
J 4 HOH 94  2095 2095 HOH HOH B . 
J 4 HOH 95  2096 2096 HOH HOH B . 
J 4 HOH 96  2097 2097 HOH HOH B . 
J 4 HOH 97  2098 2098 HOH HOH B . 
J 4 HOH 98  2099 2099 HOH HOH B . 
J 4 HOH 99  2100 2100 HOH HOH B . 
J 4 HOH 100 2101 2101 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A CSO 127 A CSO 127 ? CYS S-HYDROXYCYSTEINE 
2 A CSO 273 A CSO 273 ? CYS S-HYDROXYCYSTEINE 
3 A CSO 291 A CSO 291 ? CYS S-HYDROXYCYSTEINE 
4 B CSO 127 B CSO 127 ? CYS S-HYDROXYCYSTEINE 
5 B CSO 273 B CSO 273 ? CYS S-HYDROXYCYSTEINE 
6 B CSO 291 B CSO 291 ? CYS S-HYDROXYCYSTEINE 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,I 
2 1 B,F,G,H,J 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? I HOH .   ? A HOH 2041 ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 O2  ? E PO4 .   ? A PO4 501  ? 1_555 72.3  ? 
2  O   ? I HOH .   ? A HOH 2041 ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 OD2 ? A ASP 92  ? A ASP 92   ? 1_555 165.1 ? 
3  O2  ? E PO4 .   ? A PO4 501  ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 OD2 ? A ASP 92  ? A ASP 92   ? 1_555 94.9  ? 
4  O   ? I HOH .   ? A HOH 2041 ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 O   ? I HOH .   ? A HOH 2040 ? 1_555 90.8  ? 
5  O2  ? E PO4 .   ? A PO4 501  ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 O   ? I HOH .   ? A HOH 2040 ? 1_555 78.1  ? 
6  OD2 ? A ASP 92  ? A ASP 92   ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 O   ? I HOH .   ? A HOH 2040 ? 1_555 78.7  ? 
7  O   ? I HOH .   ? A HOH 2041 ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 OD2 ? A ASP 64  ? A ASP 64   ? 1_555 93.3  ? 
8  O2  ? E PO4 .   ? A PO4 501  ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 OD2 ? A ASP 64  ? A ASP 64   ? 1_555 157.6 ? 
9  OD2 ? A ASP 92  ? A ASP 92   ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 OD2 ? A ASP 64  ? A ASP 64   ? 1_555 96.4  ? 
10 O   ? I HOH .   ? A HOH 2040 ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 OD2 ? A ASP 64  ? A ASP 64   ? 1_555 85.2  ? 
11 O   ? I HOH .   ? A HOH 2041 ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 NE2 ? A HIS 66  ? A HIS 66   ? 1_555 88.9  ? 
12 O2  ? E PO4 .   ? A PO4 501  ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 NE2 ? A HIS 66  ? A HIS 66   ? 1_555 88.9  ? 
13 OD2 ? A ASP 92  ? A ASP 92   ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 NE2 ? A HIS 66  ? A HIS 66   ? 1_555 98.7  ? 
14 O   ? I HOH .   ? A HOH 2040 ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 NE2 ? A HIS 66  ? A HIS 66   ? 1_555 166.5 ? 
15 OD2 ? A ASP 64  ? A ASP 64   ? 1_555 MN ? C MN . ? A MN 400 ? 1_555 NE2 ? A HIS 66  ? A HIS 66   ? 1_555 108.3 ? 
16 OD1 ? A ASN 124 ? A ASN 124  ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 NE2 ? A HIS 173 ? A HIS 173  ? 1_555 87.3  ? 
17 OD1 ? A ASN 124 ? A ASN 124  ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 ND1 ? A HIS 248 ? A HIS 248  ? 1_555 98.9  ? 
18 NE2 ? A HIS 173 ? A HIS 173  ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 ND1 ? A HIS 248 ? A HIS 248  ? 1_555 91.0  ? 
19 OD1 ? A ASN 124 ? A ASN 124  ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 OD2 ? A ASP 92  ? A ASP 92   ? 1_555 93.9  ? 
20 NE2 ? A HIS 173 ? A HIS 173  ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 OD2 ? A ASP 92  ? A ASP 92   ? 1_555 75.8  ? 
21 ND1 ? A HIS 248 ? A HIS 248  ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 OD2 ? A ASP 92  ? A ASP 92   ? 1_555 161.3 ? 
22 OD1 ? A ASN 124 ? A ASN 124  ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O3  ? E PO4 .   ? A PO4 501  ? 1_555 82.9  ? 
23 NE2 ? A HIS 173 ? A HIS 173  ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O3  ? E PO4 .   ? A PO4 501  ? 1_555 167.6 ? 
24 ND1 ? A HIS 248 ? A HIS 248  ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O3  ? E PO4 .   ? A PO4 501  ? 1_555 98.0  ? 
25 OD2 ? A ASP 92  ? A ASP 92   ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O3  ? E PO4 .   ? A PO4 501  ? 1_555 97.2  ? 
26 OD1 ? A ASN 124 ? A ASN 124  ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O   ? I HOH .   ? A HOH 2040 ? 1_555 160.7 ? 
27 NE2 ? A HIS 173 ? A HIS 173  ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O   ? I HOH .   ? A HOH 2040 ? 1_555 107.6 ? 
28 ND1 ? A HIS 248 ? A HIS 248  ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O   ? I HOH .   ? A HOH 2040 ? 1_555 93.3  ? 
29 OD2 ? A ASP 92  ? A ASP 92   ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O   ? I HOH .   ? A HOH 2040 ? 1_555 78.4  ? 
30 O3  ? E PO4 .   ? A PO4 501  ? 1_555 MN ? D MN . ? A MN 401 ? 1_555 O   ? I HOH .   ? A HOH 2040 ? 1_555 80.6  ? 
31 O   ? J HOH .   ? B HOH 2039 ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 O   ? J HOH .   ? B HOH 2038 ? 1_555 109.9 ? 
32 O   ? J HOH .   ? B HOH 2039 ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 O4  ? H PO4 .   ? B PO4 501  ? 1_555 84.8  ? 
33 O   ? J HOH .   ? B HOH 2038 ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 O4  ? H PO4 .   ? B PO4 501  ? 1_555 77.9  ? 
34 O   ? J HOH .   ? B HOH 2039 ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 OD2 ? B ASP 92  ? B ASP 92   ? 1_555 175.3 ? 
35 O   ? J HOH .   ? B HOH 2038 ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 OD2 ? B ASP 92  ? B ASP 92   ? 1_555 74.7  ? 
36 O4  ? H PO4 .   ? B PO4 501  ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 OD2 ? B ASP 92  ? B ASP 92   ? 1_555 96.0  ? 
37 O   ? J HOH .   ? B HOH 2039 ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 NE2 ? B HIS 66  ? B HIS 66   ? 1_555 84.2  ? 
38 O   ? J HOH .   ? B HOH 2038 ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 NE2 ? B HIS 66  ? B HIS 66   ? 1_555 158.8 ? 
39 O4  ? H PO4 .   ? B PO4 501  ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 NE2 ? B HIS 66  ? B HIS 66   ? 1_555 88.1  ? 
40 OD2 ? B ASP 92  ? B ASP 92   ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 NE2 ? B HIS 66  ? B HIS 66   ? 1_555 91.2  ? 
41 O   ? J HOH .   ? B HOH 2039 ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 OD2 ? B ASP 64  ? B ASP 64   ? 1_555 88.1  ? 
42 O   ? J HOH .   ? B HOH 2038 ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 OD2 ? B ASP 64  ? B ASP 64   ? 1_555 92.1  ? 
43 O4  ? H PO4 .   ? B PO4 501  ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 OD2 ? B ASP 64  ? B ASP 64   ? 1_555 164.9 ? 
44 OD2 ? B ASP 92  ? B ASP 92   ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 OD2 ? B ASP 64  ? B ASP 64   ? 1_555 92.2  ? 
45 NE2 ? B HIS 66  ? B HIS 66   ? 1_555 MN ? F MN . ? B MN 400 ? 1_555 OD2 ? B ASP 64  ? B ASP 64   ? 1_555 104.4 ? 
46 NE2 ? B HIS 173 ? B HIS 173  ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 O   ? J HOH .   ? B HOH 2038 ? 1_555 113.9 ? 
47 NE2 ? B HIS 173 ? B HIS 173  ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 OD2 ? B ASP 92  ? B ASP 92   ? 1_555 81.3  ? 
48 O   ? J HOH .   ? B HOH 2038 ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 OD2 ? B ASP 92  ? B ASP 92   ? 1_555 79.8  ? 
49 NE2 ? B HIS 173 ? B HIS 173  ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 ND1 ? B HIS 248 ? B HIS 248  ? 1_555 94.2  ? 
50 O   ? J HOH .   ? B HOH 2038 ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 ND1 ? B HIS 248 ? B HIS 248  ? 1_555 87.4  ? 
51 OD2 ? B ASP 92  ? B ASP 92   ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 ND1 ? B HIS 248 ? B HIS 248  ? 1_555 163.3 ? 
52 NE2 ? B HIS 173 ? B HIS 173  ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 O1  ? H PO4 .   ? B PO4 501  ? 1_555 171.7 ? 
53 O   ? J HOH .   ? B HOH 2038 ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 O1  ? H PO4 .   ? B PO4 501  ? 1_555 72.5  ? 
54 OD2 ? B ASP 92  ? B ASP 92   ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 O1  ? H PO4 .   ? B PO4 501  ? 1_555 95.0  ? 
55 ND1 ? B HIS 248 ? B HIS 248  ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 O1  ? H PO4 .   ? B PO4 501  ? 1_555 91.4  ? 
56 NE2 ? B HIS 173 ? B HIS 173  ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 OD1 ? B ASN 124 ? B ASN 124  ? 1_555 93.0  ? 
57 O   ? J HOH .   ? B HOH 2038 ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 OD1 ? B ASN 124 ? B ASN 124  ? 1_555 152.1 ? 
58 OD2 ? B ASP 92  ? B ASP 92   ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 OD1 ? B ASN 124 ? B ASN 124  ? 1_555 97.8  ? 
59 ND1 ? B HIS 248 ? B HIS 248  ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 OD1 ? B ASN 124 ? B ASN 124  ? 1_555 98.5  ? 
60 O1  ? H PO4 .   ? B PO4 501  ? 1_555 MN ? G MN . ? B MN 401 ? 1_555 OD1 ? B ASN 124 ? B ASN 124  ? 1_555 80.1  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-07-22 
2 'Structure model' 1 1 2017-01-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC  refinement       5.8.0073 ? 1 
XDS     'data reduction' .        ? 2 
Aimless 'data scaling'   .        ? 3 
MOLREP  phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 95  ? ? 77.64   150.66  
2  1 ARG A 96  ? ? 76.09   -52.51  
3  1 TYR A 144 ? ? -139.45 -106.95 
4  1 GLU A 167 ? ? 58.58   16.76   
5  1 SER A 224 ? ? 63.30   -157.74 
6  1 ALA A 247 ? ? -134.17 -125.43 
7  1 HIS A 248 ? ? 77.56   -13.29  
8  1 ASP B 95  ? ? 76.99   150.83  
9  1 ARG B 96  ? ? 76.32   -52.76  
10 1 TYR B 144 ? ? -138.78 -106.33 
11 1 GLU B 167 ? ? 58.13   17.03   
12 1 SER B 224 ? ? 63.08   -158.05 
13 1 ALA B 247 ? ? -133.86 -125.55 
14 1 HIS B 248 ? ? 77.59   -13.30  
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      A 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       2064 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.18 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A ALA 2   ? A ALA 2   
3  1 Y 1 A ASP 3   ? A ASP 3   
4  1 Y 1 A LEU 4   ? A LEU 4   
5  1 Y 1 A ASP 5   ? A ASP 5   
6  1 Y 1 A GLU 300 ? A GLU 300 
7  1 Y 1 A LYS 301 ? A LYS 301 
8  1 Y 1 A LYS 302 ? A LYS 302 
9  1 Y 1 A LYS 303 ? A LYS 303 
10 1 Y 1 A PRO 304 ? A PRO 304 
11 1 Y 1 A ASN 305 ? A ASN 305 
12 1 Y 1 A ALA 306 ? A ALA 306 
13 1 Y 1 A THR 307 ? A THR 307 
14 1 Y 1 A ARG 308 ? A ARG 308 
15 1 Y 1 A PRO 309 ? A PRO 309 
16 1 Y 1 A VAL 310 ? A VAL 310 
17 1 Y 1 A THR 311 ? A THR 311 
18 1 Y 1 A PRO 312 ? A PRO 312 
19 1 Y 1 A PRO 313 ? A PRO 313 
20 1 Y 1 A ARG 314 ? A ARG 314 
21 1 Y 1 A GLY 315 ? A GLY 315 
22 1 Y 1 A MET 316 ? A MET 316 
23 1 Y 1 A ILE 317 ? A ILE 317 
24 1 Y 1 A THR 318 ? A THR 318 
25 1 Y 1 A LYS 319 ? A LYS 319 
26 1 Y 1 A GLN 320 ? A GLN 320 
27 1 Y 1 A ALA 321 ? A ALA 321 
28 1 Y 1 A LYS 322 ? A LYS 322 
29 1 Y 1 A LYS 323 ? A LYS 323 
30 1 Y 1 B MET 1   ? B MET 1   
31 1 Y 1 B ALA 2   ? B ALA 2   
32 1 Y 1 B ASP 3   ? B ASP 3   
33 1 Y 1 B LEU 4   ? B LEU 4   
34 1 Y 1 B ASP 5   ? B ASP 5   
35 1 Y 1 B GLU 300 ? B GLU 300 
36 1 Y 1 B LYS 301 ? B LYS 301 
37 1 Y 1 B LYS 302 ? B LYS 302 
38 1 Y 1 B LYS 303 ? B LYS 303 
39 1 Y 1 B PRO 304 ? B PRO 304 
40 1 Y 1 B ASN 305 ? B ASN 305 
41 1 Y 1 B ALA 306 ? B ALA 306 
42 1 Y 1 B THR 307 ? B THR 307 
43 1 Y 1 B ARG 308 ? B ARG 308 
44 1 Y 1 B PRO 309 ? B PRO 309 
45 1 Y 1 B VAL 310 ? B VAL 310 
46 1 Y 1 B THR 311 ? B THR 311 
47 1 Y 1 B PRO 312 ? B PRO 312 
48 1 Y 1 B PRO 313 ? B PRO 313 
49 1 Y 1 B ARG 314 ? B ARG 314 
50 1 Y 1 B GLY 315 ? B GLY 315 
51 1 Y 1 B MET 316 ? B MET 316 
52 1 Y 1 B ILE 317 ? B ILE 317 
53 1 Y 1 B THR 318 ? B THR 318 
54 1 Y 1 B LYS 319 ? B LYS 319 
55 1 Y 1 B GLN 320 ? B GLN 320 
56 1 Y 1 B ALA 321 ? B ALA 321 
57 1 Y 1 B LYS 322 ? B LYS 322 
58 1 Y 1 B LYS 323 ? B LYS 323 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION' MN  
3 'PHOSPHATE ION'      PO4 
4 water                HOH 
#