data_4UU5
# 
_entry.id   4UU5 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4UU5         
PDBE  EBI-61305    
WWPDB D_1290061305 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4UU6 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'LIGAND-FREE PDZ DOMAIN' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4UU5 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-07-24 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ivanova, M.E.'  1 
'Purkiss, A.G.'  2 
'McDonald, N.Q.' 3 
# 
_citation.id                        primary 
_citation.title                     
'Structures of the human Pals1 PDZ domain with and without ligand suggest gated access of Crb to the PDZ peptide-binding groove.' 
_citation.journal_abbrev            'Acta Crystallogr. D Biol. Crystallogr.' 
_citation.journal_volume            71 
_citation.page_first                555 
_citation.page_last                 564 
_citation.year                      2015 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   US 
_citation.journal_id_ISSN           1399-0047 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25760605 
_citation.pdbx_database_id_DOI      10.1107/S139900471402776X 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ivanova, M.E.'  1 
primary 'Fletcher, G.C.' 2 
primary 
;O'Reilly, N.
;
3 
primary 'Purkiss, A.G.'  4 
primary 'Thompson, B.J.' 5 
primary 'McDonald, N.Q.' 6 
# 
_cell.entry_id           4UU5 
_cell.length_a           74.730 
_cell.length_b           74.730 
_cell.length_c           42.710 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4UU5 
_symmetry.space_group_name_H-M             'P 41 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                91 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'MAGUK P55 SUBFAMILY MEMBER 5'  9650.056 1   ? ? 'PDZ DOMAIN, RESIDUES 251-335' ? 
2 polymer     man 'PROTEIN CRUMBS HOMOLOG 1'      2101.557 1   ? ? 'RESIDUES 1390-1406'           ? 
3 non-polymer syn 'CHLORIDE ION'                  35.453   8   ? ? ?                              ? 
4 non-polymer syn 'SODIUM ION'                    22.990   1   ? ? ?                              ? 
5 non-polymer syn 2,2,4,4,6,6,8-heptamethylnonane 226.441  1   ? ? ?                              ? 
6 water       nat water                           18.015   120 ? ? ?                              ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        PALS1 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no  
;GPLGSGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMH
GTLTFVLIPS
;
;GPLGSGETVKIVRIEKARDIPLGATVRNEMDSVIISRIVKGGAAEKSGLLHEGDEVLEINGIEIRGKDVNEVFDLLSDMH
GTLTFVLIPS
;
A ? 
2 'polypeptide(L)' no yes 'RVEMWNLMPPPA(SME)ERLI'                                                                       
RVEMWNLMPPPAMERLI                                                                             B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  LEU n 
1 4  GLY n 
1 5  SER n 
1 6  GLY n 
1 7  GLU n 
1 8  THR n 
1 9  VAL n 
1 10 LYS n 
1 11 ILE n 
1 12 VAL n 
1 13 ARG n 
1 14 ILE n 
1 15 GLU n 
1 16 LYS n 
1 17 ALA n 
1 18 ARG n 
1 19 ASP n 
1 20 ILE n 
1 21 PRO n 
1 22 LEU n 
1 23 GLY n 
1 24 ALA n 
1 25 THR n 
1 26 VAL n 
1 27 ARG n 
1 28 ASN n 
1 29 GLU n 
1 30 MET n 
1 31 ASP n 
1 32 SER n 
1 33 VAL n 
1 34 ILE n 
1 35 ILE n 
1 36 SER n 
1 37 ARG n 
1 38 ILE n 
1 39 VAL n 
1 40 LYS n 
1 41 GLY n 
1 42 GLY n 
1 43 ALA n 
1 44 ALA n 
1 45 GLU n 
1 46 LYS n 
1 47 SER n 
1 48 GLY n 
1 49 LEU n 
1 50 LEU n 
1 51 HIS n 
1 52 GLU n 
1 53 GLY n 
1 54 ASP n 
1 55 GLU n 
1 56 VAL n 
1 57 LEU n 
1 58 GLU n 
1 59 ILE n 
1 60 ASN n 
1 61 GLY n 
1 62 ILE n 
1 63 GLU n 
1 64 ILE n 
1 65 ARG n 
1 66 GLY n 
1 67 LYS n 
1 68 ASP n 
1 69 VAL n 
1 70 ASN n 
1 71 GLU n 
1 72 VAL n 
1 73 PHE n 
1 74 ASP n 
1 75 LEU n 
1 76 LEU n 
1 77 SER n 
1 78 ASP n 
1 79 MET n 
1 80 HIS n 
1 81 GLY n 
1 82 THR n 
1 83 LEU n 
1 84 THR n 
1 85 PHE n 
1 86 VAL n 
1 87 LEU n 
1 88 ILE n 
1 89 PRO n 
1 90 SER n 
2 1  ARG n 
2 2  VAL n 
2 3  GLU n 
2 4  MET n 
2 5  TRP n 
2 6  ASN n 
2 7  LEU n 
2 8  MET n 
2 9  PRO n 
2 10 PRO n 
2 11 PRO n 
2 12 ALA n 
2 13 SME n 
2 14 GLU n 
2 15 ARG n 
2 16 LEU n 
2 17 ILE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 511693 ? ? ? ? ? ? BL21 ? ? ? ? ? ? 
? PLASMID PGEX-6P-2 ? ? ? ? ? 
2 1 sample ? ? ? HUMAN ? ? ? ? ? ? ? ? 'HOMO SAPIENS' 9606 ? ? ? ? ? ? ? ? 'ESCHERICHIA COLI' 511693 ? ? ? ? ? ? BL21 ? ? ? ? ? ? 
? PLASMID PGEX-6P-2 ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1 UNP MPP5_HUMAN  1 ? ? Q8N3R9 ? 
2 UNP CRUM1_HUMAN 2 ? ? P82279 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4UU5 A 6 ? 90 ? Q8N3R9 251  ? 335  ? 251  335  
2 2 4UU5 B 1 ? 17 ? P82279 1390 ? 1406 ? 1390 1406 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4UU5 GLY A 1 ? UNP Q8N3R9 ? ? 'expression tag' 246 1 
1 4UU5 PRO A 2 ? UNP Q8N3R9 ? ? 'expression tag' 247 2 
1 4UU5 LEU A 3 ? UNP Q8N3R9 ? ? 'expression tag' 248 3 
1 4UU5 GLY A 4 ? UNP Q8N3R9 ? ? 'expression tag' 249 4 
1 4UU5 SER A 5 ? UNP Q8N3R9 ? ? 'expression tag' 250 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                 ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'                  ? 'Cl -1'          35.453  
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                 ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'                    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE                   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                         ? 'C5 H9 N O2'     115.130 
PUN non-polymer         . 2,2,4,4,6,6,8-heptamethylnonane ? 'C16 H34'        226.441 
SER 'L-peptide linking' y SERINE                          ? 'C3 H7 N O3'     105.093 
SME 'L-peptide linking' n 'METHIONINE SULFOXIDE'          ? 'C5 H11 N O3 S'  165.211 
THR 'L-peptide linking' y THREONINE                       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                      ? 'C11 H12 N2 O2'  204.225 
VAL 'L-peptide linking' y VALINE                          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4UU5 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.64 
_exptl_crystal.density_percent_sol   53.37 
_exptl_crystal.description           'MODEL WAS GENERATED BY PHYRE SERVER BASED ON 1VA8' 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M HEPES (PH 7.29), 2.68M NA CHLORIDE' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2013-10-25 
_diffrn_detector.details                MIRRORS 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04-1' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04-1 
_diffrn_source.pdbx_wavelength             0.92 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4UU5 
_reflns.observed_criterion_sigma_I   1.9 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             52.84 
_reflns.d_resolution_high            1.23 
_reflns.number_obs                   35567 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.04 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        17.70 
_reflns.B_iso_Wilson_estimate        14.90 
_reflns.pdbx_redundancy              6.2 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             1.23 
_reflns_shell.d_res_low              1.26 
_reflns_shell.percent_possible_all   98.7 
_reflns_shell.Rmerge_I_obs           0.99 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.90 
_reflns_shell.pdbx_redundancy        5.3 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4UU5 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     35566 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             52.842 
_refine.ls_d_res_high                            1.230 
_refine.ls_percent_reflns_obs                    99.62 
_refine.ls_R_factor_obs                          0.1688 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1680 
_refine.ls_R_factor_R_free                       0.1832 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  1808 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1VA8' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.11 
_refine.pdbx_overall_phase_error                 16.77 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        787 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         25 
_refine_hist.number_atoms_solvent             120 
_refine_hist.number_atoms_total               932 
_refine_hist.d_res_high                       1.230 
_refine_hist.d_res_low                        52.842 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.015  ? ? 955  'X-RAY DIFFRACTION' ? 
f_angle_d          1.936  ? ? 1320 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 12.923 ? ? 387  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.124  ? ? 159  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.007  ? ? 172  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
'X-RAY DIFFRACTION' . 1.2300 1.2633  2532 0.2358 99.00  0.2604 . . 124 . . 
'X-RAY DIFFRACTION' . 1.2633 1.3005  2524 0.2033 100.00 0.2236 . . 148 . . 
'X-RAY DIFFRACTION' . 1.3005 1.3424  2575 0.1820 100.00 0.1977 . . 127 . . 
'X-RAY DIFFRACTION' . 1.3424 1.3904  2578 0.1646 100.00 0.2007 . . 136 . . 
'X-RAY DIFFRACTION' . 1.3904 1.4461  2555 0.1555 100.00 0.1575 . . 138 . . 
'X-RAY DIFFRACTION' . 1.4461 1.5119  2581 0.1496 100.00 0.1903 . . 141 . . 
'X-RAY DIFFRACTION' . 1.5119 1.5916  2565 0.1350 100.00 0.1495 . . 155 . . 
'X-RAY DIFFRACTION' . 1.5916 1.6914  2581 0.1387 100.00 0.1490 . . 139 . . 
'X-RAY DIFFRACTION' . 1.6914 1.8220  2587 0.1448 100.00 0.1733 . . 152 . . 
'X-RAY DIFFRACTION' . 1.8220 2.0053  2617 0.1570 100.00 0.1783 . . 128 . . 
'X-RAY DIFFRACTION' . 2.0053 2.2955  2601 0.1521 100.00 0.1577 . . 155 . . 
'X-RAY DIFFRACTION' . 2.2955 2.8921  2672 0.1873 99.00  0.1689 . . 126 . . 
'X-RAY DIFFRACTION' . 2.8921 52.8909 2790 0.1756 99.00  0.2096 . . 139 . . 
# 
_struct.entry_id                  4UU5 
_struct.title                     'CRYSTAL STRUCTURE OF THE PDZ DOMAIN OF PALS1 IN COMPLEX WITH THE CRB PEPTIDE' 
_struct.pdbx_descriptor           'MAGUK P55 SUBFAMILY MEMBER 5, PROTEIN CRUMBS HOMOLOG 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4UU5 
_struct_keywords.pdbx_keywords   'CELL ADHESION' 
_struct_keywords.text            'CELL ADHESION' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
J N N 4 ? 
K N N 5 ? 
L N N 3 ? 
M N N 6 ? 
N N N 6 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLY A 42 ? GLY A 48 ? GLY A 287 GLY A 293 1 ? 7  
HELX_P HELX_P2 2 ASP A 68 ? ASP A 78 ? ASP A 313 ASP A 323 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? J NA  .  NA ? ? ? 1_555 M HOH .  O   ? ? A NA  1342 A HOH 2074 1_555 ? ? ? ? ? ? ? 2.463 ? 
metalc2 metalc ? ? J NA  .  NA ? ? ? 1_555 M HOH .  O   ? ? A NA  1342 A HOH 2059 5_655 ? ? ? ? ? ? ? 2.347 ? 
metalc3 metalc ? ? J NA  .  NA ? ? ? 1_555 M HOH .  O   ? ? A NA  1342 A HOH 2022 1_555 ? ? ? ? ? ? ? 2.534 ? 
metalc4 metalc ? ? J NA  .  NA ? ? ? 1_555 M HOH .  O   ? ? A NA  1342 A HOH 2082 1_555 ? ? ? ? ? ? ? 3.126 ? 
metalc5 metalc ? ? J NA  .  NA ? ? ? 1_555 A SER 77 O   ? ? A NA  1342 A SER 322  1_555 ? ? ? ? ? ? ? 2.783 ? 
metalc6 metalc ? ? J NA  .  NA ? ? ? 1_555 A ASP 78 OD1 ? ? A NA  1342 A ASP 323  1_555 ? ? ? ? ? ? ? 2.381 ? 
covale1 covale ? ? B ALA 12 C  ? ? ? 1_555 B SME 13 N   ? ? B ALA 1401 B SME 1402 1_555 ? ? ? ? ? ? ? 1.318 ? 
covale2 covale ? ? B SME 13 C  ? ? ? 1_555 B GLU 14 O   ? ? B SME 1402 B GLU 1403 1_555 ? ? ? ? ? ? ? 3.901 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           1 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            246 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    2 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     247 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       6.22 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 4 ? 
AB ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AA 3 4 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LYS A 10 ? LYS A 16 ? LYS A 255  LYS A 261  
AA 2 GLY A 81 ? ILE A 88 ? GLY A 326  ILE A 333  
AA 3 GLU A 55 ? ILE A 59 ? GLU A 300  ILE A 304  
AA 4 ILE A 62 ? GLU A 63 ? ILE A 307  GLU A 308  
AB 1 SER A 32 ? ILE A 38 ? SER A 277  ILE A 283  
AB 2 ALA A 24 ? GLU A 29 ? ALA A 269  GLU A 274  
AB 3 GLU B 14 ? ILE B 17 ? GLU B 1403 ILE B 1406 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N LYS A 16 ? N LYS A 261 O GLY A 81 ? O GLY A 326  
AA 2 3 N ILE A 88 ? N ILE A 333 O GLU A 55 ? O GLU A 300  
AA 3 4 N ILE A 59 ? N ILE A 304 O ILE A 62 ? O ILE A 307  
AB 1 2 N SER A 36 ? N SER A 281 O THR A 25 ? O THR A 270  
AB 2 3 N VAL A 26 ? N VAL A 271 O ARG B 15 ? O ARG B 1404 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CL B 2407'  
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 1338'  
AC3 Software ? ? ? ? 1 'BINDING SITE FOR RESIDUE CL A 1339'  
AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 1340'  
AC5 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE CL A 1341'  
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NA A 1342'  
AC7 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE PUN A 1343' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 PHE A 73 ? PHE A 318  . ? 8_555 ? 
2  AC1 4 ARG B 15 ? ARG B 1404 . ? 1_555 ? 
3  AC1 4 LEU B 16 ? LEU B 1405 . ? 1_555 ? 
4  AC1 4 HOH N .  ? HOH B 2011 . ? 1_555 ? 
5  AC2 3 ARG A 18 ? ARG A 263  . ? 1_555 ? 
6  AC2 3 CL  H .  ? CL  A 1340 . ? 1_555 ? 
7  AC2 3 PRO B 11 ? PRO B 1400 . ? 8_555 ? 
8  AC3 1 GLU A 7  ? GLU A 252  . ? 1_555 ? 
9  AC4 3 ALA A 17 ? ALA A 262  . ? 1_555 ? 
10 AC4 3 ARG A 18 ? ARG A 263  . ? 1_555 ? 
11 AC4 3 CL  F .  ? CL  A 1338 . ? 1_555 ? 
12 AC5 2 LYS A 10 ? LYS A 255  . ? 1_555 ? 
13 AC5 2 LYS A 10 ? LYS A 255  . ? 6_554 ? 
14 AC6 5 SER A 77 ? SER A 322  . ? 1_555 ? 
15 AC6 5 ASP A 78 ? ASP A 323  . ? 1_555 ? 
16 AC6 5 HOH M .  ? HOH A 2022 . ? 1_555 ? 
17 AC6 5 HOH M .  ? HOH A 2059 . ? 5_655 ? 
18 AC6 5 HOH M .  ? HOH A 2074 . ? 1_555 ? 
19 AC7 5 ARG A 18 ? ARG A 263  . ? 1_555 ? 
20 AC7 5 GLU A 63 ? GLU A 308  . ? 5_655 ? 
21 AC7 5 HIS A 80 ? HIS A 325  . ? 1_555 ? 
22 AC7 5 ASN B 6  ? ASN B 1395 . ? 4_655 ? 
23 AC7 5 LEU B 7  ? LEU B 1396 . ? 4_655 ? 
# 
_database_PDB_matrix.entry_id          4UU5 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4UU5 
_atom_sites.fract_transf_matrix[1][1]   0.013382 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013382 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.023414 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
H  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N    A GLY A 1 1  ? 17.417 -8.590  -25.864 0.42 28.98 ? 246  GLY A N    1 
ATOM   2    N  N    B GLY A 1 1  ? 20.243 -7.970  -25.548 0.58 34.99 ? 246  GLY A N    1 
ATOM   3    C  CA   A GLY A 1 1  ? 18.803 -9.015  -25.915 0.42 28.11 ? 246  GLY A CA   1 
ATOM   4    C  CA   B GLY A 1 1  ? 19.040 -8.670  -25.127 0.58 33.61 ? 246  GLY A CA   1 
ATOM   5    C  C    A GLY A 1 1  ? 19.031 -10.253 -25.075 0.42 27.10 ? 246  GLY A C    1 
ATOM   6    C  C    B GLY A 1 1  ? 18.204 -9.122  -26.308 0.58 32.21 ? 246  GLY A C    1 
ATOM   7    O  O    A GLY A 1 1  ? 19.745 -10.197 -24.079 0.42 29.04 ? 246  GLY A O    1 
ATOM   8    O  O    B GLY A 1 1  ? 17.966 -8.345  -27.247 0.58 33.77 ? 246  GLY A O    1 
ATOM   9    N  N    A PRO A 1 2  ? 18.425 -11.385 -25.480 0.42 24.12 ? 247  PRO A N    1 
ATOM   10   N  N    B PRO A 1 2  ? 17.728 -10.377 -26.265 0.58 28.74 ? 247  PRO A N    1 
ATOM   11   C  CA   A PRO A 1 2  ? 18.437 -12.596 -24.648 0.42 22.68 ? 247  PRO A CA   1 
ATOM   12   C  CA   B PRO A 1 2  ? 17.841 -11.294 -25.121 0.58 27.29 ? 247  PRO A CA   1 
ATOM   13   C  C    A PRO A 1 2  ? 19.752 -13.367 -24.642 0.42 21.78 ? 247  PRO A C    1 
ATOM   14   C  C    B PRO A 1 2  ? 19.241 -11.890 -24.898 0.58 25.02 ? 247  PRO A C    1 
ATOM   15   O  O    A PRO A 1 2  ? 19.916 -14.261 -23.821 0.42 21.98 ? 247  PRO A O    1 
ATOM   16   O  O    B PRO A 1 2  ? 19.571 -12.345 -23.796 0.58 26.72 ? 247  PRO A O    1 
ATOM   17   C  CB   A PRO A 1 2  ? 17.310 -13.452 -25.250 0.42 23.01 ? 247  PRO A CB   1 
ATOM   18   C  CB   B PRO A 1 2  ? 16.825 -12.382 -25.460 0.58 27.03 ? 247  PRO A CB   1 
ATOM   19   C  CG   A PRO A 1 2  ? 17.243 -13.033 -26.676 0.42 22.99 ? 247  PRO A CG   1 
ATOM   20   C  CG   B PRO A 1 2  ? 16.860 -12.442 -26.977 0.58 26.94 ? 247  PRO A CG   1 
ATOM   21   C  CD   A PRO A 1 2  ? 17.590 -11.547 -26.685 0.42 24.07 ? 247  PRO A CD   1 
ATOM   22   C  CD   B PRO A 1 2  ? 17.017 -10.995 -27.402 0.58 27.99 ? 247  PRO A CD   1 
ATOM   23   N  N    A LEU A 1 3  ? 20.677 -13.045 -25.538 0.42 19.89 ? 248  LEU A N    1 
ATOM   24   N  N    B LEU A 1 3  ? 20.091 -11.850 -25.915 0.58 21.91 ? 248  LEU A N    1 
ATOM   25   C  CA   A LEU A 1 3  ? 21.939 -13.786 -25.596 0.42 19.21 ? 248  LEU A CA   1 
ATOM   26   C  CA   B LEU A 1 3  ? 21.389 -12.477 -25.801 0.58 20.87 ? 248  LEU A CA   1 
ATOM   27   C  C    A LEU A 1 3  ? 23.038 -13.178 -24.711 0.42 18.96 ? 248  LEU A C    1 
ATOM   28   C  C    B LEU A 1 3  ? 22.390 -11.532 -25.183 0.58 21.11 ? 248  LEU A C    1 
ATOM   29   O  O    A LEU A 1 3  ? 23.754 -13.912 -24.032 0.42 20.48 ? 248  LEU A O    1 
ATOM   30   O  O    B LEU A 1 3  ? 22.330 -10.312 -25.355 0.58 22.19 ? 248  LEU A O    1 
ATOM   31   C  CB   A LEU A 1 3  ? 22.417 -13.974 -27.052 0.42 18.49 ? 248  LEU A CB   1 
ATOM   32   C  CB   B LEU A 1 3  ? 21.880 -12.964 -27.170 0.58 19.41 ? 248  LEU A CB   1 
ATOM   33   C  CG   A LEU A 1 3  ? 21.440 -14.704 -27.999 0.42 18.81 ? 248  LEU A CG   1 
ATOM   34   C  CG   B LEU A 1 3  ? 21.013 -14.098 -27.754 0.58 20.46 ? 248  LEU A CG   1 
ATOM   35   C  CD1  A LEU A 1 3  ? 21.957 -14.717 -29.443 0.42 19.14 ? 248  LEU A CD1  1 
ATOM   36   C  CD1  B LEU A 1 3  ? 21.315 -14.259 -29.236 0.58 21.28 ? 248  LEU A CD1  1 
ATOM   37   C  CD2  A LEU A 1 3  ? 21.054 -16.130 -27.512 0.42 18.44 ? 248  LEU A CD2  1 
ATOM   38   C  CD2  B LEU A 1 3  ? 21.227 -15.432 -27.036 0.58 20.76 ? 248  LEU A CD2  1 
ATOM   39   N  N    A GLY A 1 4  ? 23.157 -11.850 -24.695 0.42 18.28 ? 249  GLY A N    1 
ATOM   40   N  N    B GLY A 1 4  ? 23.327 -12.114 -24.459 0.58 20.65 ? 249  GLY A N    1 
ATOM   41   C  CA   A GLY A 1 4  ? 24.221 -11.187 -23.940 0.42 18.17 ? 249  GLY A CA   1 
ATOM   42   C  CA   B GLY A 1 4  ? 24.367 -11.329 -23.841 0.58 19.68 ? 249  GLY A CA   1 
ATOM   43   C  C    A GLY A 1 4  ? 23.921 -10.935 -22.473 0.42 17.82 ? 249  GLY A C    1 
ATOM   44   C  C    B GLY A 1 4  ? 23.904 -10.775 -22.523 0.58 18.99 ? 249  GLY A C    1 
ATOM   45   O  O    A GLY A 1 4  ? 22.816 -11.206 -21.999 0.42 18.42 ? 249  GLY A O    1 
ATOM   46   O  O    B GLY A 1 4  ? 22.701 -10.651 -22.225 0.58 20.28 ? 249  GLY A O    1 
ATOM   47   N  N    . SER A 1 5  ? 24.904 -10.412 -21.740 1.00 16.79 ? 250  SER A N    1 
ATOM   48   C  CA   A SER A 1 5  ? 24.687 -10.108 -20.328 0.82 16.75 ? 250  SER A CA   1 
ATOM   49   C  CA   B SER A 1 5  ? 24.729 -10.081 -20.324 0.18 16.80 ? 250  SER A CA   1 
ATOM   50   C  C    . SER A 1 5  ? 24.425 -8.623  -20.036 1.00 16.11 ? 250  SER A C    1 
ATOM   51   O  O    . SER A 1 5  ? 24.255 -8.248  -18.867 1.00 17.94 ? 250  SER A O    1 
ATOM   52   C  CB   A SER A 1 5  ? 25.837 -10.648 -19.470 0.82 18.74 ? 250  SER A CB   1 
ATOM   53   C  CB   B SER A 1 5  ? 25.960 -10.485 -19.515 0.18 17.88 ? 250  SER A CB   1 
ATOM   54   O  OG   A SER A 1 5  ? 27.063 -10.092 -19.919 0.82 17.77 ? 250  SER A OG   1 
ATOM   55   O  OG   B SER A 1 5  ? 26.081 -11.885 -19.464 0.18 17.85 ? 250  SER A OG   1 
ATOM   56   N  N    . GLY A 1 6  ? 24.358 -7.818  -21.087 1.00 16.28 ? 251  GLY A N    1 
ATOM   57   C  CA   . GLY A 1 6  ? 23.909 -6.442  -20.985 1.00 16.34 ? 251  GLY A CA   1 
ATOM   58   C  C    . GLY A 1 6  ? 25.001 -5.422  -20.781 1.00 15.00 ? 251  GLY A C    1 
ATOM   59   O  O    . GLY A 1 6  ? 26.192 -5.708  -20.835 1.00 17.36 ? 251  GLY A O    1 
ATOM   60   N  N    . GLU A 1 7  ? 24.566 -4.202  -20.515 1.00 14.79 ? 252  GLU A N    1 
ATOM   61   C  CA   . GLU A 1 7  ? 25.439 -3.028  -20.537 1.00 15.03 ? 252  GLU A CA   1 
ATOM   62   C  C    . GLU A 1 7  ? 25.478 -2.313  -19.187 1.00 14.21 ? 252  GLU A C    1 
ATOM   63   O  O    . GLU A 1 7  ? 25.843 -1.142  -19.117 1.00 15.27 ? 252  GLU A O    1 
ATOM   64   C  CB   . GLU A 1 7  ? 24.995 -2.049  -21.669 1.00 17.81 ? 252  GLU A CB   1 
ATOM   65   C  CG   . GLU A 1 7  ? 24.983 -2.683  -23.091 1.00 21.49 ? 252  GLU A CG   1 
ATOM   66   C  CD   . GLU A 1 7  ? 26.295 -3.367  -23.475 0.75 25.46 ? 252  GLU A CD   1 
ATOM   67   O  OE1  . GLU A 1 7  ? 27.396 -2.918  -23.082 0.77 27.85 ? 252  GLU A OE1  1 
ATOM   68   O  OE2  . GLU A 1 7  ? 26.222 -4.403  -24.197 0.62 30.23 ? 252  GLU A OE2  1 
ATOM   69   N  N    . THR A 1 8  ? 25.120 -3.020  -18.103 1.00 13.30 ? 253  THR A N    1 
ATOM   70   C  CA   . THR A 1 8  ? 25.128 -2.381  -16.778 1.00 13.99 ? 253  THR A CA   1 
ATOM   71   C  C    . THR A 1 8  ? 25.536 -3.330  -15.672 1.00 12.58 ? 253  THR A C    1 
ATOM   72   O  O    . THR A 1 8  ? 25.236 -4.514  -15.678 1.00 13.18 ? 253  THR A O    1 
ATOM   73   C  CB   . THR A 1 8  ? 23.825 -1.743  -16.520 1.00 15.93 ? 253  THR A CB   1 
ATOM   74   O  OG1  . THR A 1 8  ? 23.873 -0.987  -15.314 1.00 17.23 ? 253  THR A OG1  1 
ATOM   75   C  CG2  . THR A 1 8  ? 22.699 -2.695  -16.424 1.00 17.02 ? 253  THR A CG2  1 
ATOM   76   N  N    . VAL A 1 9  ? 26.232 -2.721  -14.711 1.00 12.08 ? 254  VAL A N    1 
ATOM   77   C  CA   . VAL A 1 9  ? 26.377 -3.344  -13.388 1.00 12.96 ? 254  VAL A CA   1 
ATOM   78   C  C    . VAL A 1 9  ? 25.997 -2.362  -12.329 1.00 11.86 ? 254  VAL A C    1 
ATOM   79   O  O    . VAL A 1 9  ? 25.987 -1.155  -12.521 1.00 13.00 ? 254  VAL A O    1 
ATOM   80   C  CB   . VAL A 1 9  ? 27.792 -3.900  -13.104 1.00 15.27 ? 254  VAL A CB   1 
ATOM   81   C  CG1  . VAL A 1 9  ? 28.156 -5.014  -14.044 1.00 16.74 ? 254  VAL A CG1  1 
ATOM   82   C  CG2  . VAL A 1 9  ? 28.829 -2.832  -13.155 1.00 17.00 ? 254  VAL A CG2  1 
ATOM   83   N  N    . LYS A 1 10 ? 25.631 -2.923  -11.183 1.00 12.29 ? 255  LYS A N    1 
ATOM   84   C  CA   . LYS A 1 10 ? 25.268 -2.138  -9.994  1.00 13.28 ? 255  LYS A CA   1 
ATOM   85   C  C    . LYS A 1 10 ? 26.236 -2.505  -8.891  1.00 12.98 ? 255  LYS A C    1 
ATOM   86   O  O    . LYS A 1 10 ? 26.525 -3.691  -8.694  1.00 14.51 ? 255  LYS A O    1 
ATOM   87   C  CB   . LYS A 1 10 ? 23.860 -2.468  -9.570  1.00 16.15 ? 255  LYS A CB   1 
ATOM   88   C  CG   . LYS A 1 10 ? 23.266 -1.685  -8.430  1.00 18.13 ? 255  LYS A CG   1 
ATOM   89   C  CD   . LYS A 1 10 ? 21.839 -2.186  -8.152  1.00 19.87 ? 255  LYS A CD   1 
ATOM   90   C  CE   A LYS A 1 10 ? 21.195 -1.319  -7.068  0.41 21.42 ? 255  LYS A CE   1 
ATOM   91   C  CE   B LYS A 1 10 ? 21.099 -1.473  -7.043  0.59 21.14 ? 255  LYS A CE   1 
ATOM   92   N  NZ   A LYS A 1 10 ? 21.296 0.158   -7.339  0.41 22.51 ? 255  LYS A NZ   1 
ATOM   93   N  NZ   B LYS A 1 10 ? 19.714 -2.066  -6.890  0.59 22.03 ? 255  LYS A NZ   1 
ATOM   94   N  N    . ILE A 1 11 ? 26.786 -1.498  -8.247  1.00 12.61 ? 256  ILE A N    1 
ATOM   95   C  CA   . ILE A 1 11 ? 27.705 -1.738  -7.135  1.00 12.57 ? 256  ILE A CA   1 
ATOM   96   C  C    . ILE A 1 11 ? 26.997 -1.315  -5.855  1.00 11.55 ? 256  ILE A C    1 
ATOM   97   O  O    . ILE A 1 11 ? 26.466 -0.201  -5.792  1.00 12.83 ? 256  ILE A O    1 
ATOM   98   C  CB   . ILE A 1 11 ? 29.032 -0.937  -7.323  1.00 15.84 ? 256  ILE A CB   1 
ATOM   99   C  CG1  . ILE A 1 11 ? 29.582 -1.291  -8.739  1.00 20.13 ? 256  ILE A CG1  1 
ATOM   100  C  CG2  . ILE A 1 11 ? 30.029 -1.286  -6.231  1.00 17.25 ? 256  ILE A CG2  1 
ATOM   101  C  CD1  . ILE A 1 11 ? 31.010 -0.905  -9.069  1.00 24.87 ? 256  ILE A CD1  1 
ATOM   102  N  N    . VAL A 1 12 ? 26.977 -2.188  -4.853  1.00 11.60 ? 257  VAL A N    1 
ATOM   103  C  CA   A VAL A 1 12 ? 26.316 -1.841  -3.589  0.61 12.12 ? 257  VAL A CA   1 
ATOM   104  C  CA   B VAL A 1 12 ? 26.264 -1.958  -3.592  0.39 12.42 ? 257  VAL A CA   1 
ATOM   105  C  C    . VAL A 1 12 ? 27.239 -2.196  -2.441  1.00 12.10 ? 257  VAL A C    1 
ATOM   106  O  O    . VAL A 1 12 ? 27.990 -3.170  -2.472  1.00 13.61 ? 257  VAL A O    1 
ATOM   107  C  CB   A VAL A 1 12 ? 24.939 -2.507  -3.446  0.61 13.29 ? 257  VAL A CB   1 
ATOM   108  C  CB   B VAL A 1 12 ? 25.106 -2.976  -3.486  0.39 13.66 ? 257  VAL A CB   1 
ATOM   109  C  CG1  A VAL A 1 12 ? 24.024 -2.124  -4.615  0.61 15.09 ? 257  VAL A CG1  1 
ATOM   110  C  CG1  B VAL A 1 12 ? 24.518 -3.023  -2.069  0.39 15.79 ? 257  VAL A CG1  1 
ATOM   111  C  CG2  A VAL A 1 12 ? 25.069 -4.013  -3.356  0.61 13.79 ? 257  VAL A CG2  1 
ATOM   112  C  CG2  B VAL A 1 12 ? 24.013 -2.706  -4.551  0.39 13.72 ? 257  VAL A CG2  1 
ATOM   113  N  N    . ARG A 1 13 ? 27.156 -1.360  -1.394  1.00 12.83 ? 258  ARG A N    1 
ATOM   114  C  CA   . ARG A 1 13 ? 27.922 -1.584  -0.169  1.00 13.99 ? 258  ARG A CA   1 
ATOM   115  C  C    . ARG A 1 13 ? 26.945 -1.923  0.951   1.00 13.94 ? 258  ARG A C    1 
ATOM   116  O  O    . ARG A 1 13 ? 25.958 -1.205  1.172   1.00 15.94 ? 258  ARG A O    1 
ATOM   117  C  CB   . ARG A 1 13 ? 28.724 -0.330  0.187   1.00 17.38 ? 258  ARG A CB   1 
ATOM   118  C  CG   . ARG A 1 13 ? 29.861 0.006   -0.752  1.00 22.13 ? 258  ARG A CG   1 
ATOM   119  C  CD   . ARG A 1 13 ? 30.685 1.192   -0.201  1.00 26.82 ? 258  ARG A CD   1 
ATOM   120  N  NE   . ARG A 1 13 ? 29.839 2.332   0.177   0.77 29.96 ? 258  ARG A NE   1 
ATOM   121  C  CZ   . ARG A 1 13 ? 30.301 3.569   0.375   0.34 30.73 ? 258  ARG A CZ   1 
ATOM   122  N  NH1  . ARG A 1 13 ? 31.594 3.808   0.245   0.74 31.61 ? 258  ARG A NH1  1 
ATOM   123  N  NH2  . ARG A 1 13 ? 29.483 4.571   0.697   1.00 30.23 ? 258  ARG A NH2  1 
ATOM   124  N  N    . ILE A 1 14 ? 27.219 -3.018  1.645   1.00 14.96 ? 259  ILE A N    1 
ATOM   125  C  CA   A ILE A 1 14 ? 26.349 -3.489  2.729   0.71 15.87 ? 259  ILE A CA   1 
ATOM   126  C  CA   B ILE A 1 14 ? 26.375 -3.438  2.738   0.29 15.25 ? 259  ILE A CA   1 
ATOM   127  C  C    . ILE A 1 14 ? 27.245 -3.904  3.898   1.00 15.07 ? 259  ILE A C    1 
ATOM   128  O  O    . ILE A 1 14 ? 28.250 -4.573  3.701   1.00 15.34 ? 259  ILE A O    1 
ATOM   129  C  CB   A ILE A 1 14 ? 25.451 -4.690  2.289   0.71 18.61 ? 259  ILE A CB   1 
ATOM   130  C  CB   B ILE A 1 14 ? 25.479 -4.568  2.274   0.29 15.71 ? 259  ILE A CB   1 
ATOM   131  C  CG1  A ILE A 1 14 ? 24.576 -4.339  1.085   0.71 19.57 ? 259  ILE A CG1  1 
ATOM   132  C  CG1  B ILE A 1 14 ? 24.515 -4.977  3.381   0.29 17.36 ? 259  ILE A CG1  1 
ATOM   133  C  CG2  A ILE A 1 14 ? 24.478 -5.037  3.349   0.71 19.98 ? 259  ILE A CG2  1 
ATOM   134  C  CG2  B ILE A 1 14 ? 26.332 -5.716  1.784   0.29 13.92 ? 259  ILE A CG2  1 
ATOM   135  C  CD1  A ILE A 1 14 ? 23.763 -5.529  0.551   0.71 21.40 ? 259  ILE A CD1  1 
ATOM   136  C  CD1  B ILE A 1 14 ? 23.489 -5.967  2.927   0.29 17.64 ? 259  ILE A CD1  1 
ATOM   137  N  N    . GLU A 1 15 ? 26.861 -3.527  5.096   1.00 15.30 ? 260  GLU A N    1 
ATOM   138  C  CA   A GLU A 1 15 ? 27.634 -3.872  6.281   0.54 15.61 ? 260  GLU A CA   1 
ATOM   139  C  CA   B GLU A 1 15 ? 27.632 -3.878  6.281   0.46 15.50 ? 260  GLU A CA   1 
ATOM   140  C  C    . GLU A 1 15 ? 27.291 -5.271  6.787   1.00 15.01 ? 260  GLU A C    1 
ATOM   141  O  O    . GLU A 1 15 ? 26.110 -5.564  7.026   1.00 16.47 ? 260  GLU A O    1 
ATOM   142  C  CB   A GLU A 1 15 ? 27.348 -2.865  7.401   0.54 18.54 ? 260  GLU A CB   1 
ATOM   143  C  CB   B GLU A 1 15 ? 27.349 -2.877  7.402   0.46 18.03 ? 260  GLU A CB   1 
ATOM   144  C  CG   A GLU A 1 15 ? 27.812 -1.446  7.133   0.54 22.23 ? 260  GLU A CG   1 
ATOM   145  C  CG   B GLU A 1 15 ? 28.399 -2.897  8.502   0.46 21.50 ? 260  GLU A CG   1 
ATOM   146  C  CD   A GLU A 1 15 ? 29.304 -1.348  6.919   0.54 25.51 ? 260  GLU A CD   1 
ATOM   147  C  CD   B GLU A 1 15 ? 29.712 -2.336  7.984   0.46 23.91 ? 260  GLU A CD   1 
ATOM   148  O  OE1  A GLU A 1 15 ? 30.083 -1.981  7.682   0.54 25.88 ? 260  GLU A OE1  1 
ATOM   149  O  OE1  B GLU A 1 15 ? 29.705 -1.680  6.902   0.46 25.70 ? 260  GLU A OE1  1 
ATOM   150  O  OE2  A GLU A 1 15 ? 29.704 -0.652  5.973   0.54 27.93 ? 260  GLU A OE2  1 
ATOM   151  O  OE2  B GLU A 1 15 ? 30.749 -2.539  8.650   0.46 24.55 ? 260  GLU A OE2  1 
ATOM   152  N  N    . LYS A 1 16 ? 28.313 -6.108  6.970   1.00 14.37 ? 261  LYS A N    1 
ATOM   153  C  CA   . LYS A 1 16 ? 28.115 -7.458  7.527   1.00 13.64 ? 261  LYS A CA   1 
ATOM   154  C  C    . LYS A 1 16 ? 28.773 -7.567  8.896   1.00 13.95 ? 261  LYS A C    1 
ATOM   155  O  O    . LYS A 1 16 ? 29.920 -7.121  9.085   1.00 14.71 ? 261  LYS A O    1 
ATOM   156  C  CB   . LYS A 1 16 ? 28.743 -8.527  6.612   1.00 14.69 ? 261  LYS A CB   1 
ATOM   157  C  CG   . LYS A 1 16 ? 28.397 -9.930  7.091   1.00 14.30 ? 261  LYS A CG   1 
ATOM   158  C  CD   . LYS A 1 16 ? 28.900 -11.028 6.188   1.00 14.69 ? 261  LYS A CD   1 
ATOM   159  C  CE   . LYS A 1 16 ? 28.536 -12.408 6.761   1.00 13.19 ? 261  LYS A CE   1 
ATOM   160  N  NZ   . LYS A 1 16 ? 29.175 -12.635 8.122   1.00 13.98 ? 261  LYS A NZ   1 
ATOM   161  N  N    . ALA A 1 17 ? 28.069 -8.157  9.863   1.00 14.41 ? 262  ALA A N    1 
ATOM   162  C  CA   . ALA A 1 17 ? 28.648 -8.408  11.206  1.00 14.64 ? 262  ALA A CA   1 
ATOM   163  C  C    . ALA A 1 17 ? 29.368 -9.744  11.210  1.00 14.43 ? 262  ALA A C    1 
ATOM   164  O  O    . ALA A 1 17 ? 28.978 -10.713 10.537  1.00 14.98 ? 262  ALA A O    1 
ATOM   165  C  CB   . ALA A 1 17 ? 27.519 -8.426  12.241  1.00 16.82 ? 262  ALA A CB   1 
ATOM   166  N  N    . ARG A 1 18 ? 30.448 -9.804  11.981  1.00 15.63 ? 263  ARG A N    1 
ATOM   167  C  CA   . ARG A 1 18 ? 31.169 -11.041 12.139  1.00 16.13 ? 263  ARG A CA   1 
ATOM   168  C  C    . ARG A 1 18 ? 30.262 -12.138 12.647  1.00 14.75 ? 263  ARG A C    1 
ATOM   169  O  O    . ARG A 1 18 ? 29.528 -11.974 13.626  1.00 15.86 ? 263  ARG A O    1 
ATOM   170  C  CB   A ARG A 1 18 ? 32.339 -10.909 13.126  0.64 19.94 ? 263  ARG A CB   1 
ATOM   171  C  CB   B ARG A 1 18 ? 32.333 -10.819 13.101  0.36 19.94 ? 263  ARG A CB   1 
ATOM   172  C  CG   A ARG A 1 18 ? 32.923 -12.262 13.402  0.64 24.39 ? 263  ARG A CG   1 
ATOM   173  C  CG   B ARG A 1 18 ? 33.065 -9.550  12.755  0.36 24.39 ? 263  ARG A CG   1 
ATOM   174  N  N    . ASP A 1 19 ? 30.302 -13.274 11.970  1.00 15.98 ? 264  ASP A N    1 
ATOM   175  C  CA   . ASP A 1 19 ? 29.614 -14.492 12.366  1.00 16.32 ? 264  ASP A CA   1 
ATOM   176  C  C    . ASP A 1 19 ? 28.096 -14.351 12.399  1.00 15.50 ? 264  ASP A C    1 
ATOM   177  O  O    . ASP A 1 19 ? 27.423 -15.168 13.059  1.00 16.83 ? 264  ASP A O    1 
ATOM   178  C  CB   . ASP A 1 19 ? 30.183 -15.059 13.690  1.00 20.71 ? 264  ASP A CB   1 
ATOM   179  C  CG   . ASP A 1 19 ? 31.571 -15.653 13.494  1.00 24.94 ? 264  ASP A CG   1 
ATOM   180  O  OD1  . ASP A 1 19 ? 31.805 -16.265 12.427  0.92 28.89 ? 264  ASP A OD1  1 
ATOM   181  O  OD2  . ASP A 1 19 ? 32.401 -15.547 14.401  0.56 27.01 ? 264  ASP A OD2  1 
ATOM   182  N  N    . ILE A 1 20 ? 27.537 -13.383 11.674  1.00 14.60 ? 265  ILE A N    1 
ATOM   183  C  CA   . ILE A 1 20 ? 26.082 -13.272 11.492  1.00 14.20 ? 265  ILE A CA   1 
ATOM   184  C  C    . ILE A 1 20 ? 25.815 -13.140 9.991   1.00 13.36 ? 265  ILE A C    1 
ATOM   185  O  O    . ILE A 1 20 ? 26.330 -12.189 9.330   1.00 13.92 ? 265  ILE A O    1 
ATOM   186  C  CB   . ILE A 1 20 ? 25.513 -12.051 12.202  1.00 14.72 ? 265  ILE A CB   1 
ATOM   187  C  CG1  . ILE A 1 20 ? 25.764 -12.161 13.734  1.00 17.38 ? 265  ILE A CG1  1 
ATOM   188  C  CG2  . ILE A 1 20 ? 24.053 -11.896 11.905  1.00 16.36 ? 265  ILE A CG2  1 
ATOM   189  C  CD1  . ILE A 1 20 ? 25.368 -10.961 14.522  1.00 17.80 ? 265  ILE A CD1  1 
ATOM   190  N  N    . PRO A 1 21 ? 25.030 -14.051 9.414   1.00 12.74 ? 266  PRO A N    1 
ATOM   191  C  CA   . PRO A 1 21 ? 24.728 -13.909 7.986   1.00 13.23 ? 266  PRO A CA   1 
ATOM   192  C  C    . PRO A 1 21 ? 24.114 -12.574 7.629   1.00 13.05 ? 266  PRO A C    1 
ATOM   193  O  O    . PRO A 1 21 ? 23.326 -12.013 8.391   1.00 13.23 ? 266  PRO A O    1 
ATOM   194  C  CB   . PRO A 1 21 ? 23.733 -15.066 7.720   1.00 14.40 ? 266  PRO A CB   1 
ATOM   195  C  CG   . PRO A 1 21 ? 24.166 -16.144 8.735   1.00 14.76 ? 266  PRO A CG   1 
ATOM   196  C  CD   . PRO A 1 21 ? 24.483 -15.303 9.971   1.00 14.36 ? 266  PRO A CD   1 
ATOM   197  N  N    . LEU A 1 22 ? 24.411 -12.080 6.428   1.00 12.93 ? 267  LEU A N    1 
ATOM   198  C  CA   A LEU A 1 22 ? 23.855 -10.847 5.943   0.38 14.05 ? 267  LEU A CA   1 
ATOM   199  C  CA   B LEU A 1 22 ? 23.812 -10.870 5.896   0.62 14.37 ? 267  LEU A CA   1 
ATOM   200  C  C    . LEU A 1 22 ? 22.330 -10.951 5.759   1.00 14.56 ? 267  LEU A C    1 
ATOM   201  O  O    . LEU A 1 22 ? 21.618 -9.924  5.765   1.00 16.98 ? 267  LEU A O    1 
ATOM   202  C  CB   A LEU A 1 22 ? 24.558 -10.516 4.613   0.38 16.50 ? 267  LEU A CB   1 
ATOM   203  C  CB   B LEU A 1 22 ? 24.296 -10.646 4.460   0.62 18.04 ? 267  LEU A CB   1 
ATOM   204  C  CG   A LEU A 1 22 ? 24.378 -9.168  3.947   0.38 16.86 ? 267  LEU A CG   1 
ATOM   205  C  CG   B LEU A 1 22 ? 25.647 -9.972  4.387   0.62 19.50 ? 267  LEU A CG   1 
ATOM   206  C  CD1  A LEU A 1 22 ? 25.225 -8.119  4.655   0.38 17.56 ? 267  LEU A CD1  1 
ATOM   207  C  CD1  B LEU A 1 22 ? 26.116 -9.964  2.937   0.62 19.77 ? 267  LEU A CD1  1 
ATOM   208  C  CD2  A LEU A 1 22 ? 24.794 -9.271  2.474   0.38 16.39 ? 267  LEU A CD2  1 
ATOM   209  C  CD2  B LEU A 1 22 ? 25.687 -8.539  4.976   0.62 19.01 ? 267  LEU A CD2  1 
ATOM   210  N  N    . GLY A 1 23 ? 21.825 -12.174 5.588   1.00 13.28 ? 268  GLY A N    1 
ATOM   211  C  CA   . GLY A 1 23 ? 20.385 -12.345 5.471   1.00 14.12 ? 268  GLY A CA   1 
ATOM   212  C  C    . GLY A 1 23 ? 19.886 -12.325 4.038   1.00 13.01 ? 268  GLY A C    1 
ATOM   213  O  O    . GLY A 1 23 ? 18.811 -11.770 3.744   1.00 13.65 ? 268  GLY A O    1 
ATOM   214  N  N    . ALA A 1 24 ? 20.625 -12.973 3.132   1.00 13.85 ? 269  ALA A N    1 
ATOM   215  C  CA   . ALA A 1 24 ? 20.160 -13.203 1.761   1.00 13.96 ? 269  ALA A CA   1 
ATOM   216  C  C    . ALA A 1 24 ? 20.532 -14.617 1.412   1.00 13.95 ? 269  ALA A C    1 
ATOM   217  O  O    . ALA A 1 24 ? 21.526 -15.135 1.927   1.00 16.19 ? 269  ALA A O    1 
ATOM   218  C  CB   . ALA A 1 24 ? 20.801 -12.246 0.810   1.00 15.58 ? 269  ALA A CB   1 
ATOM   219  N  N    . THR A 1 25 ? 19.757 -15.253 0.551   1.00 13.33 ? 270  THR A N    1 
ATOM   220  C  CA   . THR A 1 25 ? 20.146 -16.562 0.053   1.00 12.59 ? 270  THR A CA   1 
ATOM   221  C  C    . THR A 1 25 ? 20.539 -16.478 -1.415  1.00 12.19 ? 270  THR A C    1 
ATOM   222  O  O    . THR A 1 25 ? 20.153 -15.540 -2.134  1.00 12.91 ? 270  THR A O    1 
ATOM   223  C  CB   . THR A 1 25 ? 19.021 -17.598 0.209   1.00 13.27 ? 270  THR A CB   1 
ATOM   224  O  OG1  . THR A 1 25 ? 17.939 -17.268 -0.654  1.00 13.84 ? 270  THR A OG1  1 
ATOM   225  C  CG2  . THR A 1 25 ? 18.525 -17.642 1.651   1.00 15.30 ? 270  THR A CG2  1 
ATOM   226  N  N    . VAL A 1 26 ? 21.311 -17.468 -1.867  1.00 12.26 ? 271  VAL A N    1 
ATOM   227  C  CA   . VAL A 1 26 ? 21.773 -17.525 -3.247  1.00 12.25 ? 271  VAL A CA   1 
ATOM   228  C  C    . VAL A 1 26 ? 21.536 -18.942 -3.792  1.00 12.37 ? 271  VAL A C    1 
ATOM   229  O  O    . VAL A 1 26 ? 21.521 -19.951 -3.041  1.00 13.85 ? 271  VAL A O    1 
ATOM   230  C  CB   . VAL A 1 26 ? 23.286 -17.170 -3.363  1.00 13.31 ? 271  VAL A CB   1 
ATOM   231  C  CG1  . VAL A 1 26 ? 23.509 -15.681 -3.223  1.00 14.24 ? 271  VAL A CG1  1 
ATOM   232  C  CG2  . VAL A 1 26 ? 24.138 -17.991 -2.414  1.00 14.38 ? 271  VAL A CG2  1 
ATOM   233  N  N    . ARG A 1 27 ? 21.376 -18.997 -5.125  1.00 12.77 ? 272  ARG A N    1 
ATOM   234  C  CA   . ARG A 1 27 ? 21.296 -20.243 -5.881  1.00 13.30 ? 272  ARG A CA   1 
ATOM   235  C  C    . ARG A 1 27 ? 22.230 -20.156 -7.088  1.00 13.56 ? 272  ARG A C    1 
ATOM   236  O  O    . ARG A 1 27 ? 22.572 -19.058 -7.500  1.00 13.74 ? 272  ARG A O    1 
ATOM   237  C  CB   . ARG A 1 27 ? 19.839 -20.488 -6.394  1.00 15.05 ? 272  ARG A CB   1 
ATOM   238  C  CG   . ARG A 1 27 ? 19.351 -19.486 -7.444  1.00 17.00 ? 272  ARG A CG   1 
ATOM   239  C  CD   . ARG A 1 27 ? 17.904 -19.740 -7.867  1.00 20.57 ? 272  ARG A CD   1 
ATOM   240  N  NE   . ARG A 1 27 ? 17.470 -18.935 -9.011  1.00 22.22 ? 272  ARG A NE   1 
ATOM   241  C  CZ   . ARG A 1 27 ? 16.903 -17.730 -8.956  1.00 22.79 ? 272  ARG A CZ   1 
ATOM   242  N  NH1  . ARG A 1 27 ? 16.728 -17.098 -7.804  1.00 24.23 ? 272  ARG A NH1  1 
ATOM   243  N  NH2  . ARG A 1 27 ? 16.530 -17.126 -10.092 1.00 23.72 ? 272  ARG A NH2  1 
ATOM   244  N  N    . ASN A 1 28 ? 22.577 -21.306 -7.677  1.00 14.30 ? 273  ASN A N    1 
ATOM   245  C  CA   . ASN A 1 28 ? 23.264 -21.275 -8.974  1.00 15.52 ? 273  ASN A CA   1 
ATOM   246  C  C    . ASN A 1 28 ? 22.309 -21.382 -10.152 1.00 17.78 ? 273  ASN A C    1 
ATOM   247  O  O    . ASN A 1 28 ? 21.321 -22.142 -10.121 1.00 19.26 ? 273  ASN A O    1 
ATOM   248  C  CB   . ASN A 1 28 ? 24.238 -22.443 -9.117  1.00 16.16 ? 273  ASN A CB   1 
ATOM   249  C  CG   . ASN A 1 28 ? 25.475 -22.292 -8.248  1.00 15.90 ? 273  ASN A CG   1 
ATOM   250  O  OD1  . ASN A 1 28 ? 25.754 -23.130 -7.393  1.00 16.10 ? 273  ASN A OD1  1 
ATOM   251  N  ND2  . ASN A 1 28 ? 26.251 -21.226 -8.489  1.00 15.94 ? 273  ASN A ND2  1 
ATOM   252  N  N    A GLU A 1 29 ? 22.606 -20.645 -11.206 0.50 19.97 ? 274  GLU A N    1 
ATOM   253  N  N    B GLU A 1 29 ? 22.640 -20.645 -11.205 0.50 19.87 ? 274  GLU A N    1 
ATOM   254  C  CA   A GLU A 1 29 ? 22.094 -20.998 -12.511 0.50 23.38 ? 274  GLU A CA   1 
ATOM   255  C  CA   B GLU A 1 29 ? 22.063 -20.824 -12.525 0.50 23.83 ? 274  GLU A CA   1 
ATOM   256  C  C    A GLU A 1 29 ? 23.354 -21.305 -13.339 0.50 24.70 ? 274  GLU A C    1 
ATOM   257  C  C    B GLU A 1 29 ? 23.191 -20.571 -13.504 0.50 26.74 ? 274  GLU A C    1 
ATOM   258  O  O    A GLU A 1 29 ? 23.939 -20.415 -13.958 0.50 24.75 ? 274  GLU A O    1 
ATOM   259  O  O    B GLU A 1 29 ? 23.750 -19.483 -13.519 0.50 26.66 ? 274  GLU A O    1 
ATOM   260  C  CB   A GLU A 1 29 ? 21.237 -19.850 -13.050 0.50 26.23 ? 274  GLU A CB   1 
ATOM   261  C  CB   B GLU A 1 29 ? 20.945 -19.815 -12.737 0.50 26.20 ? 274  GLU A CB   1 
ATOM   262  C  CG   A GLU A 1 29 ? 20.028 -19.525 -12.132 0.50 28.63 ? 274  GLU A CG   1 
ATOM   263  C  CG   B GLU A 1 29 ? 19.705 -20.102 -11.917 0.50 28.76 ? 274  GLU A CG   1 
ATOM   264  C  CD   A GLU A 1 29 ? 19.141 -18.393 -12.646 0.50 31.12 ? 274  GLU A CD   1 
ATOM   265  C  CD   B GLU A 1 29 ? 18.481 -19.400 -12.459 0.50 32.09 ? 274  GLU A CD   1 
ATOM   266  O  OE1  A GLU A 1 29 ? 19.637 -17.578 -13.453 0.50 32.80 ? 274  GLU A OE1  1 
ATOM   267  O  OE1  B GLU A 1 29 ? 18.622 -18.655 -13.450 0.50 32.78 ? 274  GLU A OE1  1 
ATOM   268  O  OE2  A GLU A 1 29 ? 17.949 -18.315 -12.232 0.50 31.88 ? 274  GLU A OE2  1 
ATOM   269  O  OE2  B GLU A 1 29 ? 17.390 -19.585 -11.883 0.50 32.98 ? 274  GLU A OE2  1 
ATOM   270  N  N    A MET A 1 30 ? 23.796 -22.565 -13.329 0.50 25.54 ? 275  MET A N    1 
ATOM   271  N  N    B MET A 1 30 ? 23.549 -21.580 -14.299 0.50 29.98 ? 275  MET A N    1 
ATOM   272  C  CA   A MET A 1 30 ? 25.096 -22.922 -13.926 0.50 27.42 ? 275  MET A CA   1 
ATOM   273  C  CA   B MET A 1 30 ? 24.491 -21.404 -15.420 0.50 31.43 ? 275  MET A CA   1 
ATOM   274  C  C    A MET A 1 30 ? 26.270 -22.230 -13.198 0.50 26.40 ? 275  MET A C    1 
ATOM   275  C  C    B MET A 1 30 ? 25.745 -20.552 -15.141 0.50 30.84 ? 275  MET A C    1 
ATOM   276  O  O    A MET A 1 30 ? 26.405 -22.374 -11.976 0.50 25.97 ? 275  MET A O    1 
ATOM   277  O  O    B MET A 1 30 ? 25.843 -19.423 -15.639 0.50 31.37 ? 275  MET A O    1 
ATOM   278  C  CB   A MET A 1 30 ? 25.100 -22.721 -15.448 0.50 30.44 ? 275  MET A CB   1 
ATOM   279  C  CB   B MET A 1 30 ? 23.734 -20.834 -16.629 0.50 32.54 ? 275  MET A CB   1 
ATOM   280  C  CG   A MET A 1 30 ? 24.109 -23.648 -16.169 0.50 33.69 ? 275  MET A CG   1 
ATOM   281  S  SD   A MET A 1 30 ? 24.328 -25.410 -15.774 0.50 37.02 ? 275  MET A SD   1 
ATOM   282  C  CE   A MET A 1 30 ? 25.965 -25.663 -16.437 0.50 37.13 ? 275  MET A CE   1 
ATOM   283  N  N    A ASP A 1 31 ? 27.122 -21.492 -13.906 0.50 26.79 ? 276  ASP A N    1 
ATOM   284  N  N    B ASP A 1 31 ? 26.689 -21.104 -14.365 0.50 29.10 ? 276  ASP A N    1 
ATOM   285  C  CA   A ASP A 1 31 ? 28.240 -20.833 -13.220 0.50 28.26 ? 276  ASP A CA   1 
ATOM   286  C  CA   B ASP A 1 31 ? 27.882 -20.401 -13.836 0.50 27.62 ? 276  ASP A CA   1 
ATOM   287  C  C    A ASP A 1 31 ? 27.752 -19.713 -12.294 0.50 27.06 ? 276  ASP A C    1 
ATOM   288  C  C    B ASP A 1 31 ? 27.514 -19.327 -12.794 0.50 22.82 ? 276  ASP A C    1 
ATOM   289  O  O    A ASP A 1 31 ? 28.352 -19.406 -11.227 0.50 29.46 ? 276  ASP A O    1 
ATOM   290  O  O    B ASP A 1 31 ? 28.307 -18.929 -11.880 0.50 20.95 ? 276  ASP A O    1 
ATOM   291  C  CB   A ASP A 1 31 ? 29.251 -20.291 -14.236 0.50 30.23 ? 276  ASP A CB   1 
ATOM   292  C  CB   B ASP A 1 31 ? 28.730 -19.822 -14.977 0.50 28.74 ? 276  ASP A CB   1 
ATOM   293  C  CG   A ASP A 1 31 ? 30.390 -21.234 -14.461 0.50 32.19 ? 276  ASP A CG   1 
ATOM   294  O  OD1  A ASP A 1 31 ? 30.233 -22.416 -14.098 0.50 32.89 ? 276  ASP A OD1  1 
ATOM   295  O  OD2  A ASP A 1 31 ? 31.437 -20.794 -14.983 0.50 33.82 ? 276  ASP A OD2  1 
ATOM   296  N  N    A SER A 1 32 ? 26.646 -19.091 -12.680 0.50 22.50 ? 277  SER A N    1 
ATOM   297  N  N    B SER A 1 32 ? 26.268 -18.897 -12.863 0.50 17.68 ? 277  SER A N    1 
ATOM   298  C  CA   A SER A 1 32 ? 26.285 -17.854 -12.007 0.50 18.65 ? 277  SER A CA   1 
ATOM   299  C  CA   B SER A 1 32 ? 25.894 -17.703 -12.123 0.50 16.97 ? 277  SER A CA   1 
ATOM   300  C  C    A SER A 1 32 ? 25.699 -18.090 -10.632 0.50 15.53 ? 277  SER A C    1 
ATOM   301  C  C    B SER A 1 32 ? 25.479 -18.003 -10.696 0.50 14.85 ? 277  SER A C    1 
ATOM   302  O  O    A SER A 1 32 ? 25.222 -19.197 -10.299 0.50 16.07 ? 277  SER A O    1 
ATOM   303  O  O    B SER A 1 32 ? 24.951 -19.085 -10.385 0.50 14.95 ? 277  SER A O    1 
ATOM   304  C  CB   A SER A 1 32 ? 25.321 -17.058 -12.870 0.50 19.66 ? 277  SER A CB   1 
ATOM   305  C  CB   B SER A 1 32 ? 24.791 -16.923 -12.865 0.50 19.14 ? 277  SER A CB   1 
ATOM   306  O  OG   A SER A 1 32 ? 24.084 -17.723 -12.962 0.50 21.93 ? 277  SER A OG   1 
ATOM   307  O  OG   B SER A 1 32 ? 24.938 -16.980 -14.277 0.50 21.42 ? 277  SER A OG   1 
ATOM   308  N  N    . VAL A 1 33 ? 25.731 -17.010 -9.860  1.00 13.42 ? 278  VAL A N    1 
ATOM   309  C  CA   . VAL A 1 33 ? 25.277 -17.001 -8.472  1.00 12.75 ? 278  VAL A CA   1 
ATOM   310  C  C    . VAL A 1 33 ? 24.196 -15.909 -8.391  1.00 12.04 ? 278  VAL A C    1 
ATOM   311  O  O    . VAL A 1 33 ? 24.470 -14.750 -8.702  1.00 12.83 ? 278  VAL A O    1 
ATOM   312  C  CB   . VAL A 1 33 ? 26.453 -16.711 -7.528  1.00 12.65 ? 278  VAL A CB   1 
ATOM   313  C  CG1  . VAL A 1 33 ? 25.954 -16.485 -6.069  1.00 12.92 ? 278  VAL A CG1  1 
ATOM   314  C  CG2  . VAL A 1 33 ? 27.461 -17.854 -7.590  1.00 14.17 ? 278  VAL A CG2  1 
ATOM   315  N  N    . ILE A 1 34 ? 22.960 -16.293 -8.050  1.00 11.94 ? 279  ILE A N    1 
ATOM   316  C  CA   . ILE A 1 34 ? 21.803 -15.399 -8.141  1.00 12.18 ? 279  ILE A CA   1 
ATOM   317  C  C    . ILE A 1 34 ? 21.156 -15.243 -6.770  1.00 12.24 ? 279  ILE A C    1 
ATOM   318  O  O    . ILE A 1 34 ? 20.876 -16.240 -6.084  1.00 13.73 ? 279  ILE A O    1 
ATOM   319  C  CB   . ILE A 1 34 ? 20.747 -15.990 -9.143  1.00 14.11 ? 279  ILE A CB   1 
ATOM   320  C  CG1  . ILE A 1 34 ? 21.375 -16.313 -10.510 1.00 15.98 ? 279  ILE A CG1  1 
ATOM   321  C  CG2  . ILE A 1 34 ? 19.566 -15.082 -9.295  1.00 16.23 ? 279  ILE A CG2  1 
ATOM   322  C  CD1  . ILE A 1 34 ? 21.908 -15.158 -11.227 1.00 18.03 ? 279  ILE A CD1  1 
ATOM   323  N  N    . ILE A 1 35 ? 20.892 -13.996 -6.359  1.00 11.82 ? 280  ILE A N    1 
ATOM   324  C  CA   . ILE A 1 35 ? 20.151 -13.745 -5.116  1.00 12.26 ? 280  ILE A CA   1 
ATOM   325  C  C    . ILE A 1 35 ? 18.758 -14.339 -5.232  1.00 13.31 ? 280  ILE A C    1 
ATOM   326  O  O    . ILE A 1 35 ? 18.075 -14.146 -6.249  1.00 14.00 ? 280  ILE A O    1 
ATOM   327  C  CB   . ILE A 1 35 ? 20.043 -12.219 -4.860  1.00 14.45 ? 280  ILE A CB   1 
ATOM   328  C  CG1  . ILE A 1 35 ? 21.417 -11.583 -4.678  1.00 14.86 ? 280  ILE A CG1  1 
ATOM   329  C  CG2  . ILE A 1 35 ? 19.160 -11.928 -3.634  1.00 15.84 ? 280  ILE A CG2  1 
ATOM   330  C  CD1  . ILE A 1 35 ? 22.215 -11.985 -3.449  1.00 15.64 ? 280  ILE A CD1  1 
ATOM   331  N  N    . SER A 1 36 ? 18.353 -15.063 -4.215  1.00 14.12 ? 281  SER A N    1 
ATOM   332  C  CA   A SER A 1 36 ? 17.078 -15.729 -4.287  0.63 14.31 ? 281  SER A CA   1 
ATOM   333  C  CA   B SER A 1 36 ? 17.125 -15.849 -4.216  0.37 14.89 ? 281  SER A CA   1 
ATOM   334  C  C    . SER A 1 36 ? 16.072 -15.194 -3.295  1.00 14.54 ? 281  SER A C    1 
ATOM   335  O  O    . SER A 1 36 ? 15.055 -14.644 -3.746  1.00 16.44 ? 281  SER A O    1 
ATOM   336  C  CB   A SER A 1 36 ? 17.271 -17.217 -4.167  0.63 14.61 ? 281  SER A CB   1 
ATOM   337  C  CB   B SER A 1 36 ? 17.504 -17.281 -3.756  0.37 16.00 ? 281  SER A CB   1 
ATOM   338  O  OG   A SER A 1 36 ? 18.057 -17.647 -5.245  0.63 14.44 ? 281  SER A OG   1 
ATOM   339  O  OG   B SER A 1 36 ? 16.431 -18.211 -3.675  0.37 16.05 ? 281  SER A OG   1 
ATOM   340  N  N    . ARG A 1 37 ? 16.326 -15.297 -1.991  1.00 12.24 ? 282  ARG A N    1 
ATOM   341  C  CA   . ARG A 1 37 ? 15.347 -14.813 -1.021  1.00 12.69 ? 282  ARG A CA   1 
ATOM   342  C  C    . ARG A 1 37 ? 16.049 -13.953 0.041   1.00 12.48 ? 282  ARG A C    1 
ATOM   343  O  O    . ARG A 1 37 ? 17.299 -13.956 0.151   1.00 13.37 ? 282  ARG A O    1 
ATOM   344  C  CB   . ARG A 1 37 ? 14.600 -16.007 -0.351  1.00 13.03 ? 282  ARG A CB   1 
ATOM   345  C  CG   . ARG A 1 37 ? 13.866 -16.830 -1.435  1.00 13.15 ? 282  ARG A CG   1 
ATOM   346  C  CD   . ARG A 1 37 ? 12.874 -17.804 -0.849  1.00 14.02 ? 282  ARG A CD   1 
ATOM   347  N  NE   . ARG A 1 37 ? 13.507 -18.929 -0.153  1.00 13.47 ? 282  ARG A NE   1 
ATOM   348  C  CZ   . ARG A 1 37 ? 12.804 -19.871 0.485   1.00 13.44 ? 282  ARG A CZ   1 
ATOM   349  N  NH1  . ARG A 1 37 ? 11.488 -19.803 0.490   1.00 15.51 ? 282  ARG A NH1  1 
ATOM   350  N  NH2  . ARG A 1 37 ? 13.441 -20.880 1.084   1.00 14.78 ? 282  ARG A NH2  1 
ATOM   351  N  N    . ILE A 1 38 ? 15.258 -13.193 0.788   1.00 12.76 ? 283  ILE A N    1 
ATOM   352  C  CA   . ILE A 1 38 ? 15.757 -12.199 1.724   1.00 13.58 ? 283  ILE A CA   1 
ATOM   353  C  C    . ILE A 1 38 ? 15.195 -12.489 3.136   1.00 12.27 ? 283  ILE A C    1 
ATOM   354  O  O    . ILE A 1 38 ? 13.980 -12.743 3.268   1.00 13.87 ? 283  ILE A O    1 
ATOM   355  C  CB   . ILE A 1 38 ? 15.332 -10.760 1.266   1.00 14.91 ? 283  ILE A CB   1 
ATOM   356  C  CG1  . ILE A 1 38 ? 15.865 -10.418 -0.155  1.00 15.91 ? 283  ILE A CG1  1 
ATOM   357  C  CG2  . ILE A 1 38 ? 15.743 -9.699  2.279   1.00 16.07 ? 283  ILE A CG2  1 
ATOM   358  C  CD1  . ILE A 1 38 ? 17.358 -10.409 -0.242  1.00 17.36 ? 283  ILE A CD1  1 
ATOM   359  N  N    . VAL A 1 39 ? 16.051 -12.426 4.157   1.00 12.31 ? 284  VAL A N    1 
ATOM   360  C  CA   . VAL A 1 39 ? 15.626 -12.631 5.540   1.00 12.48 ? 284  VAL A CA   1 
ATOM   361  C  C    . VAL A 1 39 ? 14.998 -11.355 6.117   1.00 13.25 ? 284  VAL A C    1 
ATOM   362  O  O    . VAL A 1 39 ? 15.580 -10.269 6.028   1.00 14.53 ? 284  VAL A O    1 
ATOM   363  C  CB   . VAL A 1 39 ? 16.825 -13.049 6.405   1.00 13.06 ? 284  VAL A CB   1 
ATOM   364  C  CG1  . VAL A 1 39 ? 16.431 -13.144 7.892   1.00 14.72 ? 284  VAL A CG1  1 
ATOM   365  C  CG2  . VAL A 1 39 ? 17.315 -14.397 5.906   1.00 14.76 ? 284  VAL A CG2  1 
ATOM   366  N  N    . LYS A 1 40 ? 13.810 -11.476 6.709   1.00 13.52 ? 285  LYS A N    1 
ATOM   367  C  CA   A LYS A 1 40 ? 13.166 -10.326 7.327   0.50 15.32 ? 285  LYS A CA   1 
ATOM   368  C  CA   B LYS A 1 40 ? 13.149 -10.339 7.325   0.50 15.97 ? 285  LYS A CA   1 
ATOM   369  C  C    . LYS A 1 40 ? 13.966 -9.764  8.475   1.00 15.76 ? 285  LYS A C    1 
ATOM   370  O  O    . LYS A 1 40 ? 14.380 -10.489 9.406   1.00 16.23 ? 285  LYS A O    1 
ATOM   371  C  CB   A LYS A 1 40 ? 11.773 -10.706 7.827   0.50 15.38 ? 285  LYS A CB   1 
ATOM   372  C  CB   B LYS A 1 40 ? 11.756 -10.768 7.814   0.50 17.45 ? 285  LYS A CB   1 
ATOM   373  C  CG   A LYS A 1 40 ? 10.893 -11.166 6.723   0.50 16.48 ? 285  LYS A CG   1 
ATOM   374  C  CG   B LYS A 1 40 ? 10.962 -9.677  8.494   0.50 19.80 ? 285  LYS A CG   1 
ATOM   375  C  CD   A LYS A 1 40 ? 9.549  -11.589 7.200   0.50 17.23 ? 285  LYS A CD   1 
ATOM   376  C  CD   B LYS A 1 40 ? 10.696 -8.519  7.545   0.50 21.15 ? 285  LYS A CD   1 
ATOM   377  N  N    . GLY A 1 41 ? 14.221 -8.443  8.399   1.00 16.95 ? 286  GLY A N    1 
ATOM   378  C  CA   . GLY A 1 41 ? 14.951 -7.734  9.446   1.00 16.86 ? 286  GLY A CA   1 
ATOM   379  C  C    . GLY A 1 41 ? 16.471 -7.830  9.383   1.00 16.83 ? 286  GLY A C    1 
ATOM   380  O  O    . GLY A 1 41 ? 17.160 -7.278  10.233  1.00 18.48 ? 286  GLY A O    1 
ATOM   381  N  N    . GLY A 1 42 ? 17.010 -8.553  8.407   1.00 15.48 ? 287  GLY A N    1 
ATOM   382  C  CA   . GLY A 1 42 ? 18.450 -8.733  8.330   1.00 15.21 ? 287  GLY A CA   1 
ATOM   383  C  C    . GLY A 1 42 ? 19.119 -7.561  7.624   1.00 14.40 ? 287  GLY A C    1 
ATOM   384  O  O    . GLY A 1 42 ? 18.449 -6.616  7.112   1.00 15.19 ? 287  GLY A O    1 
ATOM   385  N  N    . ALA A 1 43 ? 20.444 -7.612  7.557   1.00 13.70 ? 288  ALA A N    1 
ATOM   386  C  CA   . ALA A 1 43 ? 21.185 -6.500  6.958   1.00 14.49 ? 288  ALA A CA   1 
ATOM   387  C  C    . ALA A 1 43 ? 20.824 -6.291  5.471   1.00 13.75 ? 288  ALA A C    1 
ATOM   388  O  O    . ALA A 1 43 ? 20.741 -5.152  4.994   1.00 15.32 ? 288  ALA A O    1 
ATOM   389  C  CB   . ALA A 1 43 ? 22.677 -6.750  7.083   1.00 15.48 ? 288  ALA A CB   1 
ATOM   390  N  N    . ALA A 1 44 ? 20.627 -7.391  4.731   1.00 14.27 ? 289  ALA A N    1 
ATOM   391  C  CA   . ALA A 1 44 ? 20.289 -7.266  3.314   1.00 14.77 ? 289  ALA A CA   1 
ATOM   392  C  C    . ALA A 1 44 ? 18.949 -6.580  3.152   1.00 15.32 ? 289  ALA A C    1 
ATOM   393  O  O    . ALA A 1 44 ? 18.807 -5.689  2.298   1.00 16.86 ? 289  ALA A O    1 
ATOM   394  C  CB   . ALA A 1 44 ? 20.312 -8.615  2.628   1.00 15.92 ? 289  ALA A CB   1 
ATOM   395  N  N    . GLU A 1 45 ? 17.934 -6.984  3.918   1.00 15.10 ? 290  GLU A N    1 
ATOM   396  C  CA   . GLU A 1 45 ? 16.639 -6.327  3.792   1.00 16.39 ? 290  GLU A CA   1 
ATOM   397  C  C    . GLU A 1 45 ? 16.756 -4.847  4.155   1.00 17.02 ? 290  GLU A C    1 
ATOM   398  O  O    . GLU A 1 45 ? 16.248 -3.960  3.432   1.00 19.26 ? 290  GLU A O    1 
ATOM   399  C  CB   . GLU A 1 45 ? 15.548 -6.976  4.661   1.00 17.83 ? 290  GLU A CB   1 
ATOM   400  C  CG   . GLU A 1 45 ? 14.131 -6.464  4.258   1.00 20.46 ? 290  GLU A CG   1 
ATOM   401  C  CD   . GLU A 1 45 ? 13.006 -6.550  5.300   0.91 24.43 ? 290  GLU A CD   1 
ATOM   402  O  OE1  . GLU A 1 45 ? 13.268 -6.819  6.458   0.83 25.02 ? 290  GLU A OE1  1 
ATOM   403  O  OE2  . GLU A 1 45 ? 11.844 -6.253  4.935   0.57 25.96 ? 290  GLU A OE2  1 
ATOM   404  N  N    . LYS A 1 46 ? 17.407 -4.547  5.278   1.00 16.38 ? 291  LYS A N    1 
ATOM   405  C  CA   . LYS A 1 46 ? 17.476 -3.161  5.749   1.00 18.95 ? 291  LYS A CA   1 
ATOM   406  C  C    . LYS A 1 46 ? 18.167 -2.273  4.718   1.00 18.73 ? 291  LYS A C    1 
ATOM   407  O  O    . LYS A 1 46 ? 17.855 -1.090  4.599   1.00 21.16 ? 291  LYS A O    1 
ATOM   408  C  CB   . LYS A 1 46 ? 18.181 -3.065  7.089   1.00 20.94 ? 291  LYS A CB   1 
ATOM   409  C  CG   . LYS A 1 46 ? 17.392 -3.613  8.290   1.00 24.11 ? 291  LYS A CG   1 
ATOM   410  C  CD   . LYS A 1 46 ? 18.267 -3.652  9.544   1.00 28.41 ? 291  LYS A CD   1 
ATOM   411  C  CE   . LYS A 1 46 ? 17.453 -3.967  10.787  1.00 31.53 ? 291  LYS A CE   1 
ATOM   412  N  NZ   . LYS A 1 46 ? 18.318 -3.827  11.986  1.00 34.00 ? 291  LYS A NZ   1 
ATOM   413  N  N    . SER A 1 47 ? 19.118 -2.814  3.970   1.00 17.87 ? 292  SER A N    1 
ATOM   414  C  CA   . SER A 1 47 ? 19.859 -2.009  2.995   1.00 18.62 ? 292  SER A CA   1 
ATOM   415  C  C    . SER A 1 47 ? 18.950 -1.626  1.839   1.00 19.28 ? 292  SER A C    1 
ATOM   416  O  O    . SER A 1 47 ? 19.182 -0.577  1.201   1.00 20.46 ? 292  SER A O    1 
ATOM   417  C  CB   . SER A 1 47 ? 21.049 -2.823  2.473   1.00 20.30 ? 292  SER A CB   1 
ATOM   418  O  OG   . SER A 1 47 ? 20.673 -3.797  1.522   1.00 20.88 ? 292  SER A OG   1 
ATOM   419  N  N    . GLY A 1 48 ? 17.999 -2.505  1.518   1.00 19.42 ? 293  GLY A N    1 
ATOM   420  C  CA   . GLY A 1 48 ? 17.175 -2.330  0.330   1.00 20.65 ? 293  GLY A CA   1 
ATOM   421  C  C    . GLY A 1 48 ? 17.930 -2.437  -0.982  1.00 21.16 ? 293  GLY A C    1 
ATOM   422  O  O    . GLY A 1 48 ? 17.437 -1.951  -2.000  1.00 24.02 ? 293  GLY A O    1 
ATOM   423  N  N    . LEU A 1 49 ? 19.128 -3.023  -0.969  1.00 19.18 ? 294  LEU A N    1 
ATOM   424  C  CA   . LEU A 1 49 ? 19.959 -2.999  -2.170  1.00 20.59 ? 294  LEU A CA   1 
ATOM   425  C  C    . LEU A 1 49 ? 20.224 -4.365  -2.822  1.00 19.49 ? 294  LEU A C    1 
ATOM   426  O  O    . LEU A 1 49 ? 20.917 -4.437  -3.848  1.00 20.86 ? 294  LEU A O    1 
ATOM   427  C  CB   . LEU A 1 49 ? 21.293 -2.318  -1.834  1.00 23.54 ? 294  LEU A CB   1 
ATOM   428  C  CG   . LEU A 1 49 ? 21.156 -0.796  -1.628  1.00 25.61 ? 294  LEU A CG   1 
ATOM   429  C  CD1  . LEU A 1 49 ? 22.482 -0.214  -1.183  1.00 25.39 ? 294  LEU A CD1  1 
ATOM   430  C  CD2  . LEU A 1 49 ? 20.657 -0.117  -2.917  1.00 27.42 ? 294  LEU A CD2  1 
ATOM   431  N  N    . LEU A 1 50 ? 19.703 -5.445  -2.238  1.00 17.05 ? 295  LEU A N    1 
ATOM   432  C  CA   . LEU A 1 50 ? 19.844 -6.786  -2.822  1.00 17.41 ? 295  LEU A CA   1 
ATOM   433  C  C    . LEU A 1 50 ? 18.462 -7.390  -3.066  1.00 17.06 ? 295  LEU A C    1 
ATOM   434  O  O    . LEU A 1 50 ? 17.626 -7.399  -2.143  1.00 19.42 ? 295  LEU A O    1 
ATOM   435  C  CB   . LEU A 1 50 ? 20.625 -7.731  -1.898  1.00 19.23 ? 295  LEU A CB   1 
ATOM   436  C  CG   . LEU A 1 50 ? 22.102 -7.518  -1.667  1.00 21.37 ? 295  LEU A CG   1 
ATOM   437  C  CD1  . LEU A 1 50 ? 22.604 -8.600  -0.694  1.00 21.97 ? 295  LEU A CD1  1 
ATOM   438  C  CD2  . LEU A 1 50 ? 22.806 -7.631  -2.970  1.00 20.62 ? 295  LEU A CD2  1 
ATOM   439  N  N    . HIS A 1 51 ? 18.215 -7.849  -4.302  1.00 18.16 ? 296  HIS A N    1 
ATOM   440  C  CA   . HIS A 1 51 ? 16.871 -8.309  -4.659  1.00 19.07 ? 296  HIS A CA   1 
ATOM   441  C  C    . HIS A 1 51 ? 16.905 -9.604  -5.454  1.00 18.46 ? 296  HIS A C    1 
ATOM   442  O  O    . HIS A 1 51 ? 17.883 -9.890  -6.143  1.00 17.25 ? 296  HIS A O    1 
ATOM   443  C  CB   . HIS A 1 51 ? 16.167 -7.255  -5.486  1.00 20.70 ? 296  HIS A CB   1 
ATOM   444  C  CG   . HIS A 1 51 ? 16.169 -5.915  -4.842  1.00 22.45 ? 296  HIS A CG   1 
ATOM   445  N  ND1  . HIS A 1 51 ? 15.324 -5.565  -3.803  1.00 24.87 ? 296  HIS A ND1  1 
ATOM   446  C  CD2  . HIS A 1 51 ? 16.966 -4.853  -5.059  1.00 23.19 ? 296  HIS A CD2  1 
ATOM   447  C  CE1  . HIS A 1 51 ? 15.580 -4.318  -3.447  1.00 24.82 ? 296  HIS A CE1  1 
ATOM   448  N  NE2  . HIS A 1 51 ? 16.562 -3.860  -4.203  1.00 25.45 ? 296  HIS A NE2  1 
ATOM   449  N  N    . GLU A 1 52 ? 15.803 -10.348 -5.383  1.00 18.70 ? 297  GLU A N    1 
ATOM   450  C  CA   A GLU A 1 52 ? 15.676 -11.585 -6.172  0.51 17.34 ? 297  GLU A CA   1 
ATOM   451  C  CA   B GLU A 1 52 ? 15.670 -11.585 -6.126  0.49 18.57 ? 297  GLU A CA   1 
ATOM   452  C  C    . GLU A 1 52 ? 16.055 -11.378 -7.614  1.00 17.80 ? 297  GLU A C    1 
ATOM   453  O  O    . GLU A 1 52 ? 15.589 -10.433 -8.254  1.00 19.18 ? 297  GLU A O    1 
ATOM   454  C  CB   A GLU A 1 52 ? 14.236 -12.120 -6.173  0.51 17.25 ? 297  GLU A CB   1 
ATOM   455  C  CB   B GLU A 1 52 ? 14.229 -12.139 -5.919  0.49 20.58 ? 297  GLU A CB   1 
ATOM   456  C  CG   A GLU A 1 52 ? 14.098 -13.591 -6.707  0.51 15.48 ? 297  GLU A CG   1 
ATOM   457  C  CG   B GLU A 1 52 ? 13.795 -12.213 -4.420  0.49 22.92 ? 297  GLU A CG   1 
ATOM   458  C  CD   A GLU A 1 52 ? 14.246 -13.815 -8.260  0.51 17.86 ? 297  GLU A CD   1 
ATOM   459  C  CD   B GLU A 1 52 ? 12.501 -13.006 -4.119  0.49 22.93 ? 297  GLU A CD   1 
ATOM   460  O  OE1  A GLU A 1 52 ? 13.716 -13.022 -9.035  0.51 19.52 ? 297  GLU A OE1  1 
ATOM   461  O  OE1  B GLU A 1 52 ? 11.552 -13.057 -4.964  0.49 25.23 ? 297  GLU A OE1  1 
ATOM   462  O  OE2  A GLU A 1 52 ? 14.886 -14.809 -8.717  0.51 18.75 ? 297  GLU A OE2  1 
ATOM   463  O  OE2  B GLU A 1 52 ? 12.451 -13.564 -2.992  0.49 19.72 ? 297  GLU A OE2  1 
ATOM   464  N  N    . GLY A 1 53 ? 16.924 -12.258 -8.132  1.00 16.50 ? 298  GLY A N    1 
ATOM   465  C  CA   . GLY A 1 53 ? 17.285 -12.247 -9.546  1.00 17.44 ? 298  GLY A CA   1 
ATOM   466  C  C    . GLY A 1 53 ? 18.598 -11.524 -9.824  1.00 15.42 ? 298  GLY A C    1 
ATOM   467  O  O    . GLY A 1 53 ? 19.176 -11.663 -10.905 1.00 17.59 ? 298  GLY A O    1 
ATOM   468  N  N    . ASP A 1 54 ? 19.071 -10.729 -8.844  1.00 14.99 ? 299  ASP A N    1 
ATOM   469  C  CA   . ASP A 1 54 ? 20.370 -10.058 -8.980  1.00 14.95 ? 299  ASP A CA   1 
ATOM   470  C  C    . ASP A 1 54 ? 21.481 -11.115 -9.092  1.00 13.15 ? 299  ASP A C    1 
ATOM   471  O  O    . ASP A 1 54 ? 21.514 -12.054 -8.302  1.00 13.59 ? 299  ASP A O    1 
ATOM   472  C  CB   . ASP A 1 54 ? 20.678 -9.151  -7.769  1.00 15.57 ? 299  ASP A CB   1 
ATOM   473  C  CG   . ASP A 1 54 ? 19.806 -7.892  -7.687  1.00 17.78 ? 299  ASP A CG   1 
ATOM   474  O  OD1  . ASP A 1 54 ? 19.122 -7.543  -8.685  1.00 20.58 ? 299  ASP A OD1  1 
ATOM   475  O  OD2  . ASP A 1 54 ? 19.844 -7.269  -6.595  1.00 18.56 ? 299  ASP A OD2  1 
ATOM   476  N  N    . GLU A 1 55 ? 22.361 -10.960 -10.078 1.00 12.48 ? 300  GLU A N    1 
ATOM   477  C  CA   . GLU A 1 55 ? 23.485 -11.876 -10.236 1.00 12.96 ? 300  GLU A CA   1 
ATOM   478  C  C    . GLU A 1 55 ? 24.719 -11.286 -9.542  1.00 12.56 ? 300  GLU A C    1 
ATOM   479  O  O    . GLU A 1 55 ? 25.076 -10.134 -9.770  1.00 13.36 ? 300  GLU A O    1 
ATOM   480  C  CB   . GLU A 1 55 ? 23.782 -12.112 -11.727 1.00 13.29 ? 300  GLU A CB   1 
ATOM   481  C  CG   . GLU A 1 55 ? 25.064 -12.903 -11.861 1.00 15.68 ? 300  GLU A CG   1 
ATOM   482  C  CD   . GLU A 1 55 ? 25.376 -13.433 -13.242 0.83 17.14 ? 300  GLU A CD   1 
ATOM   483  O  OE1  . GLU A 1 55 ? 24.603 -13.199 -14.195 0.76 17.72 ? 300  GLU A OE1  1 
ATOM   484  O  OE2  . GLU A 1 55 ? 26.419 -14.137 -13.361 0.80 17.24 ? 300  GLU A OE2  1 
ATOM   485  N  N    . VAL A 1 56 ? 25.354 -12.076 -8.673  1.00 11.79 ? 301  VAL A N    1 
ATOM   486  C  CA   . VAL A 1 56 ? 26.547 -11.616 -7.966  1.00 12.42 ? 301  VAL A CA   1 
ATOM   487  C  C    . VAL A 1 56 ? 27.787 -12.004 -8.773  1.00 11.93 ? 301  VAL A C    1 
ATOM   488  O  O    . VAL A 1 56 ? 28.128 -13.177 -8.925  1.00 13.19 ? 301  VAL A O    1 
ATOM   489  C  CB   . VAL A 1 56 ? 26.624 -12.267 -6.555  1.00 13.37 ? 301  VAL A CB   1 
ATOM   490  C  CG1  . VAL A 1 56 ? 27.834 -11.688 -5.812  1.00 13.77 ? 301  VAL A CG1  1 
ATOM   491  C  CG2  . VAL A 1 56 ? 25.335 -11.980 -5.769  1.00 14.19 ? 301  VAL A CG2  1 
ATOM   492  N  N    . LEU A 1 57 ? 28.480 -10.986 -9.269  1.00 11.53 ? 302  LEU A N    1 
ATOM   493  C  CA   . LEU A 1 57 ? 29.716 -11.214 -10.024 1.00 11.72 ? 302  LEU A CA   1 
ATOM   494  C  C    . LEU A 1 57 ? 30.951 -11.283 -9.127  1.00 11.76 ? 302  LEU A C    1 
ATOM   495  O  O    . LEU A 1 57 ? 31.841 -12.116 -9.332  1.00 12.70 ? 302  LEU A O    1 
ATOM   496  C  CB   . LEU A 1 57 ? 29.933 -10.116 -11.082 1.00 13.13 ? 302  LEU A CB   1 
ATOM   497  C  CG   . LEU A 1 57 ? 28.836 -10.026 -12.151 1.00 13.47 ? 302  LEU A CG   1 
ATOM   498  C  CD1  . LEU A 1 57 ? 29.189 -8.899  -13.129 1.00 15.07 ? 302  LEU A CD1  1 
ATOM   499  C  CD2  . LEU A 1 57 ? 28.645 -11.363 -12.875 1.00 15.38 ? 302  LEU A CD2  1 
ATOM   500  N  N    . GLU A 1 58 ? 31.007 -10.411 -8.123  1.00 11.70 ? 303  GLU A N    1 
ATOM   501  C  CA   . GLU A 1 58 ? 32.208 -10.246 -7.273  1.00 12.64 ? 303  GLU A CA   1 
ATOM   502  C  C    . GLU A 1 58 ? 31.773 -9.670  -5.944  1.00 11.78 ? 303  GLU A C    1 
ATOM   503  O  O    . GLU A 1 58 ? 30.805 -8.892  -5.871  1.00 12.50 ? 303  GLU A O    1 
ATOM   504  C  CB   . GLU A 1 58 ? 33.133 -9.195  -7.936  1.00 15.86 ? 303  GLU A CB   1 
ATOM   505  C  CG   . GLU A 1 58 ? 34.393 -8.853  -7.204  0.58 19.96 ? 303  GLU A CG   1 
ATOM   506  C  CD   . GLU A 1 58 ? 35.072 -7.661  -7.808  0.35 24.84 ? 303  GLU A CD   1 
ATOM   507  O  OE1  . GLU A 1 58 ? 35.530 -7.795  -8.943  1.00 26.52 ? 303  GLU A OE1  1 
ATOM   508  O  OE2  . GLU A 1 58 ? 35.143 -6.593  -7.171  1.00 28.51 ? 303  GLU A OE2  1 
ATOM   509  N  N    . ILE A 1 59 ? 32.505 -10.019 -4.885  1.00 12.15 ? 304  ILE A N    1 
ATOM   510  C  CA   . ILE A 1 59 ? 32.344 -9.403  -3.579  1.00 13.35 ? 304  ILE A CA   1 
ATOM   511  C  C    . ILE A 1 59 ? 33.750 -9.093  -3.069  1.00 14.23 ? 304  ILE A C    1 
ATOM   512  O  O    . ILE A 1 59 ? 34.566 -10.005 -2.958  1.00 15.78 ? 304  ILE A O    1 
ATOM   513  C  CB   . ILE A 1 59 ? 31.626 -10.299 -2.565  1.00 14.59 ? 304  ILE A CB   1 
ATOM   514  C  CG1  . ILE A 1 59 ? 30.212 -10.685 -3.053  1.00 15.07 ? 304  ILE A CG1  1 
ATOM   515  C  CG2  . ILE A 1 59 ? 31.590 -9.605  -1.189  1.00 17.71 ? 304  ILE A CG2  1 
ATOM   516  C  CD1  . ILE A 1 59 ? 29.633 -11.821 -2.265  1.00 16.07 ? 304  ILE A CD1  1 
ATOM   517  N  N    . ASN A 1 60 ? 34.034 -7.825  -2.761  1.00 15.47 ? 305  ASN A N    1 
ATOM   518  C  CA   . ASN A 1 60 ? 35.339 -7.466  -2.188  1.00 17.40 ? 305  ASN A CA   1 
ATOM   519  C  C    . ASN A 1 60 ? 36.527 -8.000  -2.991  1.00 17.83 ? 305  ASN A C    1 
ATOM   520  O  O    . ASN A 1 60 ? 37.537 -8.423  -2.415  1.00 19.19 ? 305  ASN A O    1 
ATOM   521  C  CB   . ASN A 1 60 ? 35.444 -7.863  -0.699  1.00 18.97 ? 305  ASN A CB   1 
ATOM   522  C  CG   . ASN A 1 60 ? 34.659 -6.915  0.195   1.00 19.45 ? 305  ASN A CG   1 
ATOM   523  O  OD1  . ASN A 1 60 ? 33.857 -6.123  -0.298  1.00 21.62 ? 305  ASN A OD1  1 
ATOM   524  N  ND2  . ASN A 1 60 ? 34.863 -7.001  1.502   1.00 18.98 ? 305  ASN A ND2  1 
ATOM   525  N  N    . GLY A 1 61 ? 36.413 -7.965  -4.308  1.00 17.03 ? 306  GLY A N    1 
ATOM   526  C  CA   . GLY A 1 61 ? 37.516 -8.381  -5.158  1.00 17.40 ? 306  GLY A CA   1 
ATOM   527  C  C    . GLY A 1 61 ? 37.602 -9.869  -5.389  1.00 15.57 ? 306  GLY A C    1 
ATOM   528  O  O    . GLY A 1 61 ? 38.470 -10.298 -6.127  1.00 17.25 ? 306  GLY A O    1 
ATOM   529  N  N    . ILE A 1 62 ? 36.713 -10.656 -4.778  1.00 15.51 ? 307  ILE A N    1 
ATOM   530  C  CA   . ILE A 1 62 ? 36.686 -12.105 -4.954  1.00 14.93 ? 307  ILE A CA   1 
ATOM   531  C  C    . ILE A 1 62 ? 35.729 -12.396 -6.096  1.00 13.35 ? 307  ILE A C    1 
ATOM   532  O  O    . ILE A 1 62 ? 34.578 -11.975 -6.072  1.00 13.92 ? 307  ILE A O    1 
ATOM   533  C  CB   . ILE A 1 62 ? 36.131 -12.832 -3.704  1.00 18.80 ? 307  ILE A CB   1 
ATOM   534  C  CG1  . ILE A 1 62 ? 36.886 -12.461 -2.417  1.00 22.58 ? 307  ILE A CG1  1 
ATOM   535  C  CG2  . ILE A 1 62 ? 36.154 -14.344 -3.944  1.00 20.22 ? 307  ILE A CG2  1 
ATOM   536  C  CD1  . ILE A 1 62 ? 36.045 -12.732 -1.197  1.00 25.69 ? 307  ILE A CD1  1 
ATOM   537  N  N    . GLU A 1 63 ? 36.195 -13.141 -7.088  1.00 13.94 ? 308  GLU A N    1 
ATOM   538  C  CA   . GLU A 1 63 ? 35.337 -13.555 -8.217  1.00 16.13 ? 308  GLU A CA   1 
ATOM   539  C  C    . GLU A 1 63 ? 34.353 -14.591 -7.747  1.00 16.73 ? 308  GLU A C    1 
ATOM   540  O  O    . GLU A 1 63 ? 34.774 -15.677 -7.369  1.00 21.46 ? 308  GLU A O    1 
ATOM   541  C  CB   . GLU A 1 63 ? 36.223 -14.132 -9.318  1.00 19.04 ? 308  GLU A CB   1 
ATOM   542  C  CG   . GLU A 1 63 ? 35.404 -14.590 -10.532 1.00 22.84 ? 308  GLU A CG   1 
ATOM   543  C  CD   . GLU A 1 63 ? 36.211 -15.314 -11.606 0.89 27.45 ? 308  GLU A CD   1 
ATOM   544  O  OE1  . GLU A 1 63 ? 36.757 -16.410 -11.330 0.50 28.93 ? 308  GLU A OE1  1 
ATOM   545  O  OE2  . GLU A 1 63 ? 36.283 -14.792 -12.731 0.70 29.95 ? 308  GLU A OE2  1 
ATOM   546  N  N    . ILE A 1 64 ? 33.046 -14.269 -7.788  1.00 14.72 ? 309  ILE A N    1 
ATOM   547  C  CA   . ILE A 1 64 ? 31.997 -15.136 -7.275  1.00 14.32 ? 309  ILE A CA   1 
ATOM   548  C  C    . ILE A 1 64 ? 31.348 -15.948 -8.415  1.00 14.48 ? 309  ILE A C    1 
ATOM   549  O  O    . ILE A 1 64 ? 31.056 -17.142 -8.265  1.00 14.85 ? 309  ILE A O    1 
ATOM   550  C  CB   . ILE A 1 64 ? 30.940 -14.283 -6.507  1.00 13.89 ? 309  ILE A CB   1 
ATOM   551  C  CG1  . ILE A 1 64 ? 31.558 -13.645 -5.258  1.00 15.24 ? 309  ILE A CG1  1 
ATOM   552  C  CG2  . ILE A 1 64 ? 29.711 -15.100 -6.177  1.00 15.44 ? 309  ILE A CG2  1 
ATOM   553  C  CD1  . ILE A 1 64 ? 31.993 -14.591 -4.217  1.00 16.78 ? 309  ILE A CD1  1 
ATOM   554  N  N    . ARG A 1 65 ? 31.177 -15.328 -9.575  1.00 15.39 ? 310  ARG A N    1 
ATOM   555  C  CA   A ARG A 1 65 ? 30.688 -16.050 -10.735 0.59 15.80 ? 310  ARG A CA   1 
ATOM   556  C  CA   B ARG A 1 65 ? 30.686 -16.055 -10.733 0.41 16.83 ? 310  ARG A CA   1 
ATOM   557  C  C    . ARG A 1 65 ? 31.565 -17.277 -10.989 1.00 16.91 ? 310  ARG A C    1 
ATOM   558  O  O    . ARG A 1 65 ? 32.808 -17.193 -10.954 1.00 18.76 ? 310  ARG A O    1 
ATOM   559  C  CB   A ARG A 1 65 ? 30.688 -15.160 -11.971 0.59 17.09 ? 310  ARG A CB   1 
ATOM   560  C  CB   B ARG A 1 65 ? 30.660 -15.161 -11.967 0.41 19.13 ? 310  ARG A CB   1 
ATOM   561  C  CG   A ARG A 1 65 ? 30.142 -15.892 -13.176 0.59 18.96 ? 310  ARG A CG   1 
ATOM   562  C  CG   B ARG A 1 65 ? 29.953 -15.805 -13.153 0.41 21.55 ? 310  ARG A CG   1 
ATOM   563  C  CD   A ARG A 1 65 ? 29.681 -14.983 -14.270 0.59 20.57 ? 310  ARG A CD   1 
ATOM   564  C  CD   B ARG A 1 65 ? 29.749 -14.812 -14.281 0.41 23.52 ? 310  ARG A CD   1 
ATOM   565  N  NE   A ARG A 1 65 ? 29.568 -15.822 -15.439 0.59 23.00 ? 310  ARG A NE   1 
ATOM   566  N  NE   B ARG A 1 65 ? 30.965 -14.615 -15.059 0.41 25.19 ? 310  ARG A NE   1 
ATOM   567  C  CZ   A ARG A 1 65 ? 28.456 -16.401 -15.843 0.59 24.07 ? 310  ARG A CZ   1 
ATOM   568  C  CZ   B ARG A 1 65 ? 31.285 -15.344 -16.124 0.41 26.34 ? 310  ARG A CZ   1 
ATOM   569  N  NH1  A ARG A 1 65 ? 27.305 -16.161 -15.240 0.59 23.52 ? 310  ARG A NH1  1 
ATOM   570  N  NH1  B ARG A 1 65 ? 30.476 -16.315 -16.531 0.41 27.44 ? 310  ARG A NH1  1 
ATOM   571  N  NH2  A ARG A 1 65 ? 28.505 -17.173 -16.910 0.59 24.98 ? 310  ARG A NH2  1 
ATOM   572  N  NH2  B ARG A 1 65 ? 32.409 -15.105 -16.776 0.41 26.30 ? 310  ARG A NH2  1 
ATOM   573  N  N    . GLY A 1 66 ? 30.915 -18.420 -11.227 1.00 17.26 ? 311  GLY A N    1 
ATOM   574  C  CA   . GLY A 1 66 ? 31.616 -19.669 -11.441 1.00 19.25 ? 311  GLY A CA   1 
ATOM   575  C  C    . GLY A 1 66 ? 31.720 -20.561 -10.223 1.00 19.61 ? 311  GLY A C    1 
ATOM   576  O  O    . GLY A 1 66 ? 32.077 -21.733 -10.329 1.00 21.89 ? 311  GLY A O    1 
ATOM   577  N  N    . LYS A 1 67 ? 31.428 -20.017 -9.032  1.00 17.36 ? 312  LYS A N    1 
ATOM   578  C  CA   . LYS A 1 67 ? 31.492 -20.794 -7.795  1.00 16.72 ? 312  LYS A CA   1 
ATOM   579  C  C    . LYS A 1 67 ? 30.183 -21.478 -7.501  1.00 15.73 ? 312  LYS A C    1 
ATOM   580  O  O    . LYS A 1 67 ? 29.127 -20.912 -7.760  1.00 16.02 ? 312  LYS A O    1 
ATOM   581  C  CB   . LYS A 1 67 ? 31.834 -19.886 -6.599  1.00 17.20 ? 312  LYS A CB   1 
ATOM   582  C  CG   . LYS A 1 67 ? 33.282 -19.393 -6.620  1.00 20.82 ? 312  LYS A CG   1 
ATOM   583  C  CD   . LYS A 1 67 ? 33.718 -18.732 -5.341  1.00 22.65 ? 312  LYS A CD   1 
ATOM   584  C  CE   . LYS A 1 67 ? 35.241 -18.363 -5.354  1.00 25.23 ? 312  LYS A CE   1 
ATOM   585  N  NZ   . LYS A 1 67 ? 36.063 -19.547 -5.727  1.00 26.59 ? 312  LYS A NZ   1 
ATOM   586  N  N    . ASP A 1 68 ? 30.263 -22.680 -6.935  1.00 15.99 ? 313  ASP A N    1 
ATOM   587  C  CA   . ASP A 1 68 ? 29.066 -23.319 -6.446  1.00 16.58 ? 313  ASP A CA   1 
ATOM   588  C  C    . ASP A 1 68 ? 28.584 -22.572 -5.204  1.00 15.37 ? 313  ASP A C    1 
ATOM   589  O  O    . ASP A 1 68 ? 29.407 -22.018 -4.430  1.00 16.03 ? 313  ASP A O    1 
ATOM   590  C  CB   . ASP A 1 68 ? 29.364 -24.773 -6.055  1.00 18.62 ? 313  ASP A CB   1 
ATOM   591  C  CG   . ASP A 1 68 ? 28.114 -25.573 -5.832  0.72 19.32 ? 313  ASP A CG   1 
ATOM   592  O  OD1  . ASP A 1 68 ? 27.608 -25.597 -4.689  0.65 19.75 ? 313  ASP A OD1  1 
ATOM   593  O  OD2  . ASP A 1 68 ? 27.645 -26.206 -6.788  0.42 19.20 ? 313  ASP A OD2  1 
ATOM   594  N  N    . VAL A 1 69 ? 27.273 -22.535 -4.988  1.00 15.11 ? 314  VAL A N    1 
ATOM   595  C  CA   . VAL A 1 69 ? 26.783 -21.838 -3.795  1.00 14.63 ? 314  VAL A CA   1 
ATOM   596  C  C    . VAL A 1 69 ? 27.296 -22.447 -2.472  1.00 14.84 ? 314  VAL A C    1 
ATOM   597  O  O    . VAL A 1 69 ? 27.343 -21.760 -1.445  1.00 14.81 ? 314  VAL A O    1 
ATOM   598  C  CB   . VAL A 1 69 ? 25.243 -21.673 -3.797  1.00 15.96 ? 314  VAL A CB   1 
ATOM   599  C  CG1  . VAL A 1 69 ? 24.814 -20.643 -4.878  1.00 16.53 ? 314  VAL A CG1  1 
ATOM   600  C  CG2  . VAL A 1 69 ? 24.540 -23.019 -3.926  1.00 17.62 ? 314  VAL A CG2  1 
ATOM   601  N  N    . ASN A 1 70 ? 27.692 -23.722 -2.456  1.00 15.39 ? 315  ASN A N    1 
ATOM   602  C  CA   A ASN A 1 70 ? 28.295 -24.262 -1.254  0.60 17.26 ? 315  ASN A CA   1 
ATOM   603  C  CA   B ASN A 1 70 ? 28.321 -24.261 -1.240  0.40 16.93 ? 315  ASN A CA   1 
ATOM   604  C  C    . ASN A 1 70 ? 29.616 -23.550 -0.928  1.00 17.17 ? 315  ASN A C    1 
ATOM   605  O  O    . ASN A 1 70 ? 29.913 -23.297 0.258   1.00 17.94 ? 315  ASN A O    1 
ATOM   606  C  CB   A ASN A 1 70 ? 28.514 -25.773 -1.426  0.60 20.85 ? 315  ASN A CB   1 
ATOM   607  C  CB   B ASN A 1 70 ? 28.594 -25.774 -1.332  0.40 19.37 ? 315  ASN A CB   1 
ATOM   608  C  CG   A ASN A 1 70 ? 27.193 -26.573 -1.604  0.60 22.27 ? 315  ASN A CG   1 
ATOM   609  C  CG   B ASN A 1 70 ? 29.310 -26.341 -0.074  0.40 19.83 ? 315  ASN A CG   1 
ATOM   610  O  OD1  A ASN A 1 70 ? 26.137 -26.205 -1.082  0.60 22.40 ? 315  ASN A OD1  1 
ATOM   611  O  OD1  B ASN A 1 70 ? 28.730 -26.401 1.017   0.40 20.46 ? 315  ASN A OD1  1 
ATOM   612  N  ND2  A ASN A 1 70 ? 27.274 -27.708 -2.307  0.60 22.83 ? 315  ASN A ND2  1 
ATOM   613  N  ND2  B ASN A 1 70 ? 30.558 -26.789 -0.239  0.40 20.51 ? 315  ASN A ND2  1 
ATOM   614  N  N    . GLU A 1 71 ? 30.393 -23.216 -1.953  1.00 17.26 ? 316  GLU A N    1 
ATOM   615  C  CA   A GLU A 1 71 ? 31.633 -22.449 -1.779  0.56 17.21 ? 316  GLU A CA   1 
ATOM   616  C  CA   B GLU A 1 71 ? 31.618 -22.470 -1.738  0.44 17.01 ? 316  GLU A CA   1 
ATOM   617  C  C    . GLU A 1 71 ? 31.341 -21.014 -1.321  1.00 15.16 ? 316  GLU A C    1 
ATOM   618  O  O    . GLU A 1 71 ? 32.008 -20.480 -0.430  1.00 16.34 ? 316  GLU A O    1 
ATOM   619  C  CB   A GLU A 1 71 ? 32.411 -22.365 -3.098  0.56 18.68 ? 316  GLU A CB   1 
ATOM   620  C  CB   B GLU A 1 71 ? 32.489 -22.508 -2.986  0.44 18.19 ? 316  GLU A CB   1 
ATOM   621  C  CG   A GLU A 1 71 ? 32.925 -23.676 -3.657  0.56 20.72 ? 316  GLU A CG   1 
ATOM   622  C  CG   B GLU A 1 71 ? 33.856 -22.029 -2.680  0.44 19.35 ? 316  GLU A CG   1 
ATOM   623  C  CD   A GLU A 1 71 ? 33.582 -23.490 -5.034  0.56 22.30 ? 316  GLU A CD   1 
ATOM   624  C  CD   B GLU A 1 71 ? 34.746 -21.907 -3.861  0.44 21.23 ? 316  GLU A CD   1 
ATOM   625  O  OE1  A GLU A 1 71 ? 34.792 -23.170 -5.047  0.56 25.54 ? 316  GLU A OE1  1 
ATOM   626  O  OE1  B GLU A 1 71 ? 34.380 -22.373 -4.967  0.44 22.66 ? 316  GLU A OE1  1 
ATOM   627  O  OE2  A GLU A 1 71 ? 32.916 -23.646 -6.099  0.56 21.85 ? 316  GLU A OE2  1 
ATOM   628  O  OE2  B GLU A 1 71 ? 35.823 -21.340 -3.641  0.44 21.95 ? 316  GLU A OE2  1 
ATOM   629  N  N    . VAL A 1 72 ? 30.341 -20.376 -1.937  1.00 14.13 ? 317  VAL A N    1 
ATOM   630  C  CA   . VAL A 1 72 ? 29.973 -19.011 -1.550  1.00 13.47 ? 317  VAL A CA   1 
ATOM   631  C  C    . VAL A 1 72 ? 29.517 -18.987 -0.084  1.00 12.71 ? 317  VAL A C    1 
ATOM   632  O  O    . VAL A 1 72 ? 29.895 -18.076 0.693   1.00 13.17 ? 317  VAL A O    1 
ATOM   633  C  CB   . VAL A 1 72 ? 28.861 -18.504 -2.495  1.00 13.68 ? 317  VAL A CB   1 
ATOM   634  C  CG1  . VAL A 1 72 ? 28.444 -17.086 -2.120  1.00 13.97 ? 317  VAL A CG1  1 
ATOM   635  C  CG2  . VAL A 1 72 ? 29.322 -18.546 -3.952  1.00 14.47 ? 317  VAL A CG2  1 
ATOM   636  N  N    . PHE A 1 73 ? 28.762 -20.001 0.305   1.00 13.33 ? 318  PHE A N    1 
ATOM   637  C  CA   . PHE A 1 73 ? 28.326 -20.091 1.683   1.00 13.53 ? 318  PHE A CA   1 
ATOM   638  C  C    . PHE A 1 73 ? 29.531 -20.058 2.654   1.00 14.05 ? 318  PHE A C    1 
ATOM   639  O  O    . PHE A 1 73 ? 29.541 -19.343 3.687   1.00 13.22 ? 318  PHE A O    1 
ATOM   640  C  CB   . PHE A 1 73 ? 27.575 -21.436 1.842   1.00 13.80 ? 318  PHE A CB   1 
ATOM   641  C  CG   . PHE A 1 73 ? 27.240 -21.750 3.283   1.00 13.87 ? 318  PHE A CG   1 
ATOM   642  C  CD1  . PHE A 1 73 ? 26.056 -21.273 3.837   1.00 14.59 ? 318  PHE A CD1  1 
ATOM   643  C  CD2  . PHE A 1 73 ? 28.076 -22.541 4.065   1.00 15.41 ? 318  PHE A CD2  1 
ATOM   644  C  CE1  . PHE A 1 73 ? 25.721 -21.542 5.141   1.00 14.68 ? 318  PHE A CE1  1 
ATOM   645  C  CE2  . PHE A 1 73 ? 27.756 -22.814 5.401   1.00 15.89 ? 318  PHE A CE2  1 
ATOM   646  C  CZ   . PHE A 1 73 ? 26.559 -22.315 5.918   1.00 15.76 ? 318  PHE A CZ   1 
ATOM   647  N  N    . ASP A 1 74 ? 30.542 -20.868 2.369   1.00 13.31 ? 319  ASP A N    1 
ATOM   648  C  CA   . ASP A 1 74 ? 31.704 -20.933 3.240   1.00 14.47 ? 319  ASP A CA   1 
ATOM   649  C  C    . ASP A 1 74 ? 32.472 -19.597 3.243   1.00 14.50 ? 319  ASP A C    1 
ATOM   650  O  O    . ASP A 1 74 ? 32.889 -19.119 4.302   1.00 15.49 ? 319  ASP A O    1 
ATOM   651  C  CB   . ASP A 1 74 ? 32.656 -22.056 2.817   1.00 16.88 ? 319  ASP A CB   1 
ATOM   652  C  CG   . ASP A 1 74 ? 32.173 -23.427 3.209   0.76 18.63 ? 319  ASP A CG   1 
ATOM   653  O  OD1  . ASP A 1 74 ? 31.343 -23.546 4.131   0.69 19.41 ? 319  ASP A OD1  1 
ATOM   654  O  OD2  . ASP A 1 74 ? 32.626 -24.396 2.577   0.64 20.67 ? 319  ASP A OD2  1 
ATOM   655  N  N    . LEU A 1 75 ? 32.678 -19.005 2.077   1.00 14.32 ? 320  LEU A N    1 
ATOM   656  C  CA   A LEU A 1 75 ? 33.412 -17.749 1.978   0.61 14.29 ? 320  LEU A CA   1 
ATOM   657  C  CA   B LEU A 1 75 ? 33.416 -17.741 1.991   0.39 14.60 ? 320  LEU A CA   1 
ATOM   658  C  C    . LEU A 1 75 ? 32.738 -16.655 2.826   1.00 13.67 ? 320  LEU A C    1 
ATOM   659  O  O    . LEU A 1 75 ? 33.385 -15.970 3.631   1.00 14.47 ? 320  LEU A O    1 
ATOM   660  C  CB   A LEU A 1 75 ? 33.452 -17.300 0.514   0.61 14.94 ? 320  LEU A CB   1 
ATOM   661  C  CB   B LEU A 1 75 ? 33.518 -17.262 0.539   0.39 15.83 ? 320  LEU A CB   1 
ATOM   662  C  CG   A LEU A 1 75 ? 34.056 -15.936 0.270   0.61 16.62 ? 320  LEU A CG   1 
ATOM   663  C  CG   B LEU A 1 75 ? 34.375 -18.113 -0.389  0.39 17.87 ? 320  LEU A CG   1 
ATOM   664  C  CD1  A LEU A 1 75 ? 35.518 -15.973 0.660   0.61 17.32 ? 320  LEU A CD1  1 
ATOM   665  C  CD1  B LEU A 1 75 ? 34.126 -17.739 -1.832  0.39 18.37 ? 320  LEU A CD1  1 
ATOM   666  C  CD2  A LEU A 1 75 ? 33.857 -15.552 -1.187  0.61 18.15 ? 320  LEU A CD2  1 
ATOM   667  C  CD2  B LEU A 1 75 ? 35.851 -17.941 -0.044  0.39 19.53 ? 320  LEU A CD2  1 
ATOM   668  N  N    . LEU A 1 76 ? 31.418 -16.480 2.644   1.00 12.91 ? 321  LEU A N    1 
ATOM   669  C  CA   . LEU A 1 76 ? 30.738 -15.374 3.326   1.00 13.59 ? 321  LEU A CA   1 
ATOM   670  C  C    . LEU A 1 76 ? 30.747 -15.569 4.839   1.00 13.32 ? 321  LEU A C    1 
ATOM   671  O  O    . LEU A 1 76 ? 30.794 -14.572 5.591   1.00 13.63 ? 321  LEU A O    1 
ATOM   672  C  CB   . LEU A 1 76 ? 29.312 -15.206 2.795   1.00 14.51 ? 321  LEU A CB   1 
ATOM   673  C  CG   . LEU A 1 76 ? 29.177 -14.236 1.585   1.00 14.62 ? 321  LEU A CG   1 
ATOM   674  C  CD1  . LEU A 1 76 ? 29.273 -12.799 2.007   1.00 16.27 ? 321  LEU A CD1  1 
ATOM   675  C  CD2  . LEU A 1 76 ? 30.215 -14.531 0.502   1.00 15.80 ? 321  LEU A CD2  1 
ATOM   676  N  N    . SER A 1 77 ? 30.747 -16.831 5.287   1.00 13.37 ? 322  SER A N    1 
ATOM   677  C  CA   A SER A 1 77 ? 30.785 -17.099 6.721   0.94 14.28 ? 322  SER A CA   1 
ATOM   678  C  CA   B SER A 1 77 ? 30.792 -17.136 6.706   0.06 14.57 ? 322  SER A CA   1 
ATOM   679  C  C    . SER A 1 77 ? 32.071 -16.622 7.367   1.00 14.87 ? 322  SER A C    1 
ATOM   680  O  O    . SER A 1 77 ? 32.126 -16.490 8.601   1.00 16.16 ? 322  SER A O    1 
ATOM   681  C  CB   A SER A 1 77 ? 30.567 -18.593 6.982   0.94 16.13 ? 322  SER A CB   1 
ATOM   682  C  CB   B SER A 1 77 ? 30.651 -18.644 6.922   0.06 15.47 ? 322  SER A CB   1 
ATOM   683  O  OG   A SER A 1 77 ? 31.737 -19.353 6.744   0.94 17.11 ? 322  SER A OG   1 
ATOM   684  O  OG   B SER A 1 77 ? 30.577 -18.955 8.300   0.06 16.12 ? 322  SER A OG   1 
ATOM   685  N  N    . ASP A 1 78 ? 33.101 -16.326 6.569   1.00 14.70 ? 323  ASP A N    1 
ATOM   686  C  CA   . ASP A 1 78 ? 34.386 -15.878 7.069   1.00 16.26 ? 323  ASP A CA   1 
ATOM   687  C  C    . ASP A 1 78 ? 34.599 -14.384 6.847   1.00 14.77 ? 323  ASP A C    1 
ATOM   688  O  O    . ASP A 1 78 ? 35.707 -13.920 7.037   1.00 17.23 ? 323  ASP A O    1 
ATOM   689  C  CB   . ASP A 1 78 ? 35.502 -16.636 6.314   1.00 22.23 ? 323  ASP A CB   1 
ATOM   690  C  CG   . ASP A 1 78 ? 35.597 -18.088 6.725   1.00 28.19 ? 323  ASP A CG   1 
ATOM   691  O  OD1  . ASP A 1 78 ? 35.181 -18.394 7.857   1.00 30.87 ? 323  ASP A OD1  1 
ATOM   692  O  OD2  . ASP A 1 78 ? 36.081 -18.926 5.924   1.00 31.51 ? 323  ASP A OD2  1 
ATOM   693  N  N    . MET A 1 79 ? 33.571 -13.653 6.419   1.00 14.02 ? 324  MET A N    1 
ATOM   694  C  CA   . MET A 1 79 ? 33.719 -12.239 6.091   1.00 13.88 ? 324  MET A CA   1 
ATOM   695  C  C    . MET A 1 79 ? 32.969 -11.327 7.038   1.00 13.94 ? 324  MET A C    1 
ATOM   696  O  O    . MET A 1 79 ? 31.953 -11.696 7.581   1.00 15.75 ? 324  MET A O    1 
ATOM   697  C  CB   . MET A 1 79 ? 33.244 -12.010 4.656   1.00 15.22 ? 324  MET A CB   1 
ATOM   698  C  CG   . MET A 1 79 ? 34.125 -12.702 3.625   1.00 16.81 ? 324  MET A CG   1 
ATOM   699  S  SD   . MET A 1 79 ? 33.687 -12.514 1.935   1.00 19.22 ? 324  MET A SD   1 
ATOM   700  C  CE   . MET A 1 79 ? 34.277 -10.820 1.655   1.00 19.37 ? 324  MET A CE   1 
ATOM   701  N  N    . HIS A 1 80 ? 33.461 -10.098 7.173   1.00 14.18 ? 325  HIS A N    1 
ATOM   702  C  CA   . HIS A 1 80 ? 32.738 -9.067  7.930   1.00 15.83 ? 325  HIS A CA   1 
ATOM   703  C  C    . HIS A 1 80 ? 33.199 -7.690  7.474   1.00 16.13 ? 325  HIS A C    1 
ATOM   704  O  O    . HIS A 1 80 ? 34.189 -7.549  6.765   1.00 16.94 ? 325  HIS A O    1 
ATOM   705  C  CB   . HIS A 1 80 ? 33.006 -9.203  9.451   1.00 20.28 ? 325  HIS A CB   1 
ATOM   706  C  CG   . HIS A 1 80 ? 34.386 -8.802  9.855   1.00 26.80 ? 325  HIS A CG   1 
ATOM   707  N  ND1  . HIS A 1 80 ? 35.477 -9.626  9.715   1.00 31.17 ? 325  HIS A ND1  1 
ATOM   708  C  CD2  . HIS A 1 80 ? 34.869 -7.609  10.261  1.00 31.08 ? 325  HIS A CD2  1 
ATOM   709  C  CE1  . HIS A 1 80 ? 36.570 -8.990  10.096  1.00 33.32 ? 325  HIS A CE1  1 
ATOM   710  N  NE2  . HIS A 1 80 ? 36.227 -7.765  10.451  1.00 33.37 ? 325  HIS A NE2  1 
ATOM   711  N  N    . GLY A 1 81 ? 32.499 -6.672  7.936   1.00 15.55 ? 326  GLY A N    1 
ATOM   712  C  CA   . GLY A 1 81 ? 32.825 -5.296  7.578   1.00 15.83 ? 326  GLY A CA   1 
ATOM   713  C  C    . GLY A 1 81 ? 31.993 -4.826  6.397   1.00 15.21 ? 326  GLY A C    1 
ATOM   714  O  O    . GLY A 1 81 ? 30.907 -5.356  6.089   1.00 15.54 ? 326  GLY A O    1 
ATOM   715  N  N    . THR A 1 82 ? 32.491 -3.809  5.696   1.00 15.94 ? 327  THR A N    1 
ATOM   716  C  CA   . THR A 1 82 ? 31.776 -3.341  4.530   1.00 16.54 ? 327  THR A CA   1 
ATOM   717  C  C    . THR A 1 82 ? 32.007 -4.285  3.370   1.00 16.15 ? 327  THR A C    1 
ATOM   718  O  O    . THR A 1 82 ? 33.162 -4.522  2.991   1.00 17.88 ? 327  THR A O    1 
ATOM   719  C  CB   . THR A 1 82 ? 32.299 -1.961  4.126   1.00 19.52 ? 327  THR A CB   1 
ATOM   720  O  OG1  . THR A 1 82 ? 32.204 -1.090  5.254   1.00 21.82 ? 327  THR A OG1  1 
ATOM   721  C  CG2  . THR A 1 82 ? 31.466 -1.392  2.975   1.00 21.41 ? 327  THR A CG2  1 
ATOM   722  N  N    . LEU A 1 83 ? 30.929 -4.839  2.838   1.00 14.87 ? 328  LEU A N    1 
ATOM   723  C  CA   . LEU A 1 83 ? 31.073 -5.686  1.642   1.00 14.72 ? 328  LEU A CA   1 
ATOM   724  C  C    . LEU A 1 83 ? 30.588 -4.947  0.417   1.00 14.40 ? 328  LEU A C    1 
ATOM   725  O  O    . LEU A 1 83 ? 29.478 -4.420  0.374   1.00 16.05 ? 328  LEU A O    1 
ATOM   726  C  CB   . LEU A 1 83 ? 30.217 -6.954  1.786   1.00 17.04 ? 328  LEU A CB   1 
ATOM   727  C  CG   . LEU A 1 83 ? 30.492 -7.841  2.995   1.00 20.90 ? 328  LEU A CG   1 
ATOM   728  C  CD1  . LEU A 1 83 ? 29.859 -9.201  2.788   1.00 20.99 ? 328  LEU A CD1  1 
ATOM   729  C  CD2  . LEU A 1 83 ? 31.932 -7.888  3.511   1.00 22.62 ? 328  LEU A CD2  1 
ATOM   730  N  N    . THR A 1 84 ? 31.422 -4.910  -0.605  1.00 13.81 ? 329  THR A N    1 
ATOM   731  C  CA   . THR A 1 84 ? 31.090 -4.237  -1.873  1.00 13.46 ? 329  THR A CA   1 
ATOM   732  C  C    . THR A 1 84 ? 30.754 -5.335  -2.891  1.00 13.44 ? 329  THR A C    1 
ATOM   733  O  O    . THR A 1 84 ? 31.633 -6.104  -3.301  1.00 15.41 ? 329  THR A O    1 
ATOM   734  C  CB   . THR A 1 84 ? 32.281 -3.378  -2.319  1.00 16.34 ? 329  THR A CB   1 
ATOM   735  O  OG1  . THR A 1 84 ? 32.506 -2.368  -1.332  1.00 18.31 ? 329  THR A OG1  1 
ATOM   736  C  CG2  . THR A 1 84 ? 31.989 -2.679  -3.622  1.00 18.84 ? 329  THR A CG2  1 
ATOM   737  N  N    . PHE A 1 85 ? 29.474 -5.419  -3.269  1.00 12.06 ? 330  PHE A N    1 
ATOM   738  C  CA   . PHE A 1 85 ? 29.008 -6.373  -4.249  1.00 12.35 ? 330  PHE A CA   1 
ATOM   739  C  C    . PHE A 1 85 ? 28.983 -5.739  -5.632  1.00 12.13 ? 330  PHE A C    1 
ATOM   740  O  O    . PHE A 1 85 ? 28.508 -4.605  -5.773  1.00 13.81 ? 330  PHE A O    1 
ATOM   741  C  CB   . PHE A 1 85 ? 27.547 -6.770  -3.975  1.00 13.09 ? 330  PHE A CB   1 
ATOM   742  C  CG   . PHE A 1 85 ? 27.320 -7.679  -2.791  1.00 13.77 ? 330  PHE A CG   1 
ATOM   743  C  CD1  . PHE A 1 85 ? 27.545 -7.260  -1.495  1.00 15.78 ? 330  PHE A CD1  1 
ATOM   744  C  CD2  . PHE A 1 85 ? 26.842 -8.959  -2.999  1.00 14.29 ? 330  PHE A CD2  1 
ATOM   745  C  CE1  . PHE A 1 85 ? 27.290 -8.178  -0.423  1.00 17.74 ? 330  PHE A CE1  1 
ATOM   746  C  CE2  . PHE A 1 85 ? 26.626 -9.853  -1.977  1.00 15.59 ? 330  PHE A CE2  1 
ATOM   747  C  CZ   . PHE A 1 85 ? 26.831 -9.478  -0.715  1.00 16.88 ? 330  PHE A CZ   1 
ATOM   748  N  N    . VAL A 1 86 ? 29.409 -6.486  -6.655  1.00 11.73 ? 331  VAL A N    1 
ATOM   749  C  CA   . VAL A 1 86 ? 29.201 -6.066  -8.050  1.00 11.83 ? 331  VAL A CA   1 
ATOM   750  C  C    . VAL A 1 86 ? 28.150 -7.015  -8.582  1.00 10.96 ? 331  VAL A C    1 
ATOM   751  O  O    . VAL A 1 86 ? 28.337 -8.240  -8.600  1.00 11.69 ? 331  VAL A O    1 
ATOM   752  C  CB   . VAL A 1 86 ? 30.494 -6.211  -8.882  1.00 13.99 ? 331  VAL A CB   1 
ATOM   753  C  CG1  . VAL A 1 86 ? 30.220 -5.766  -10.314 1.00 15.82 ? 331  VAL A CG1  1 
ATOM   754  C  CG2  . VAL A 1 86 ? 31.621 -5.392  -8.235  1.00 16.04 ? 331  VAL A CG2  1 
ATOM   755  N  N    . LEU A 1 87 ? 27.025 -6.438  -9.030  1.00 11.55 ? 332  LEU A N    1 
ATOM   756  C  CA   . LEU A 1 87 ? 25.818 -7.187  -9.423  1.00 12.39 ? 332  LEU A CA   1 
ATOM   757  C  C    . LEU A 1 87 ? 25.400 -6.876  -10.840 1.00 12.72 ? 332  LEU A C    1 
ATOM   758  O  O    . LEU A 1 87 ? 25.587 -5.765  -11.331 1.00 13.10 ? 332  LEU A O    1 
ATOM   759  C  CB   . LEU A 1 87 ? 24.612 -6.750  -8.541  1.00 14.09 ? 332  LEU A CB   1 
ATOM   760  C  CG   . LEU A 1 87 ? 24.781 -6.797  -7.026  1.00 14.91 ? 332  LEU A CG   1 
ATOM   761  C  CD1  . LEU A 1 87 ? 23.557 -6.090  -6.359  1.00 17.86 ? 332  LEU A CD1  1 
ATOM   762  C  CD2  . LEU A 1 87 ? 24.911 -8.174  -6.568  1.00 15.18 ? 332  LEU A CD2  1 
ATOM   763  N  N    . ILE A 1 88 ? 24.730 -7.836  -11.459 1.00 12.96 ? 333  ILE A N    1 
ATOM   764  C  CA   . ILE A 1 88 ? 23.894 -7.529  -12.622 1.00 14.60 ? 333  ILE A CA   1 
ATOM   765  C  C    . ILE A 1 88 ? 22.476 -7.530  -12.113 1.00 15.56 ? 333  ILE A C    1 
ATOM   766  O  O    . ILE A 1 88 ? 21.983 -8.567  -11.710 1.00 14.66 ? 333  ILE A O    1 
ATOM   767  C  CB   . ILE A 1 88 ? 24.035 -8.489  -13.785 1.00 15.92 ? 333  ILE A CB   1 
ATOM   768  C  CG1  . ILE A 1 88 ? 25.476 -8.488  -14.268 1.00 17.96 ? 333  ILE A CG1  1 
ATOM   769  C  CG2  . ILE A 1 88 ? 23.048 -8.079  -14.928 1.00 16.17 ? 333  ILE A CG2  1 
ATOM   770  C  CD1  . ILE A 1 88 ? 25.756 -9.568  -15.279 1.00 19.72 ? 333  ILE A CD1  1 
ATOM   771  N  N    . PRO A 1 89 ? 21.801 -6.363  -12.105 1.00 18.42 ? 334  PRO A N    1 
ATOM   772  C  CA   . PRO A 1 89 ? 20.469 -6.353  -11.503 1.00 21.95 ? 334  PRO A CA   1 
ATOM   773  C  C    . PRO A 1 89 ? 19.496 -7.217  -12.275 1.00 22.53 ? 334  PRO A C    1 
ATOM   774  O  O    . PRO A 1 89 ? 19.549 -7.359  -13.527 1.00 22.46 ? 334  PRO A O    1 
ATOM   775  C  CB   . PRO A 1 89 ? 20.026 -4.880  -11.594 1.00 25.68 ? 334  PRO A CB   1 
ATOM   776  C  CG   . PRO A 1 89 ? 21.234 -4.131  -11.713 1.00 26.35 ? 334  PRO A CG   1 
ATOM   777  C  CD   . PRO A 1 89 ? 22.246 -5.012  -12.466 1.00 23.13 ? 334  PRO A CD   1 
ATOM   778  N  N    . SER A 1 90 ? 18.555 -7.773  -11.529 1.00 24.53 ? 335  SER A N    1 
ATOM   779  C  CA   . SER A 1 90 ? 17.511 -8.611  -12.116 1.00 26.73 ? 335  SER A CA   1 
ATOM   780  C  C    . SER A 1 90 ? 16.841 -8.009  -13.354 1.00 28.91 ? 335  SER A C    1 
ATOM   781  O  O    . SER A 1 90 ? 16.566 -6.817  -13.405 0.76 28.77 ? 335  SER A O    1 
ATOM   782  C  CB   . SER A 1 90 ? 16.442 -8.856  -11.058 1.00 29.14 ? 335  SER A CB   1 
ATOM   783  O  OG   . SER A 1 90 ? 15.409 -9.688  -11.554 1.00 31.73 ? 335  SER A OG   1 
ATOM   784  O  OXT  . SER A 1 90 ? 16.572 -8.722  -14.316 0.48 28.41 ? 335  SER A OXT  1 
ATOM   785  N  N    . MET B 2 4  ? 3.206  -34.537 -14.457 1.00 44.12 ? 1393 MET B N    1 
ATOM   786  C  CA   . MET B 2 4  ? 3.983  -33.310 -14.301 1.00 44.53 ? 1393 MET B CA   1 
ATOM   787  C  C    . MET B 2 4  ? 5.152  -33.507 -13.342 1.00 45.21 ? 1393 MET B C    1 
ATOM   788  O  O    . MET B 2 4  ? 6.258  -33.059 -13.606 1.00 45.35 ? 1393 MET B O    1 
ATOM   789  C  CB   . MET B 2 4  ? 3.104  -32.119 -13.850 1.00 44.34 ? 1393 MET B CB   1 
ATOM   790  C  CG   . MET B 2 4  ? 2.292  -31.447 -14.965 1.00 43.98 ? 1393 MET B CG   1 
ATOM   791  S  SD   . MET B 2 4  ? 1.861  -29.686 -14.725 1.00 43.09 ? 1393 MET B SD   1 
ATOM   792  C  CE   . MET B 2 4  ? 3.254  -29.100 -13.757 1.00 42.71 ? 1393 MET B CE   1 
ATOM   793  N  N    A TRP B 2 5  ? 4.901  -34.208 -12.241 0.50 45.50 ? 1394 TRP B N    1 
ATOM   794  N  N    B TRP B 2 5  ? 4.908  -34.191 -12.228 0.50 45.97 ? 1394 TRP B N    1 
ATOM   795  C  CA   A TRP B 2 5  ? 5.903  -34.408 -11.184 0.50 45.44 ? 1394 TRP B CA   1 
ATOM   796  C  CA   B TRP B 2 5  ? 5.934  -34.337 -11.187 0.50 46.35 ? 1394 TRP B CA   1 
ATOM   797  C  C    A TRP B 2 5  ? 7.215  -35.043 -11.652 0.50 46.13 ? 1394 TRP B C    1 
ATOM   798  C  C    B TRP B 2 5  ? 7.214  -35.043 -11.650 0.50 46.60 ? 1394 TRP B C    1 
ATOM   799  O  O    A TRP B 2 5  ? 8.092  -35.347 -10.838 0.50 46.57 ? 1394 TRP B O    1 
ATOM   800  O  O    B TRP B 2 5  ? 8.069  -35.394 -10.832 0.50 47.03 ? 1394 TRP B O    1 
ATOM   801  C  CB   A TRP B 2 5  ? 5.308  -35.258 -10.058 0.50 44.44 ? 1394 TRP B CB   1 
ATOM   802  C  CB   B TRP B 2 5  ? 5.366  -35.038 -9.943  0.50 46.19 ? 1394 TRP B CB   1 
ATOM   803  C  CG   A TRP B 2 5  ? 4.526  -36.412 -10.581 0.50 43.49 ? 1394 TRP B CG   1 
ATOM   804  C  CG   B TRP B 2 5  ? 4.385  -34.200 -9.165  0.50 46.06 ? 1394 TRP B CG   1 
ATOM   805  C  CD1  A TRP B 2 5  ? 3.176  -36.468 -10.774 0.50 43.41 ? 1394 TRP B CD1  1 
ATOM   806  C  CD2  A TRP B 2 5  ? 5.047  -37.672 -11.013 0.50 42.56 ? 1394 TRP B CD2  1 
ATOM   807  N  NE1  A TRP B 2 5  ? 2.822  -37.692 -11.286 0.50 43.16 ? 1394 TRP B NE1  1 
ATOM   808  C  CE2  A TRP B 2 5  ? 3.953  -38.450 -11.444 0.50 42.67 ? 1394 TRP B CE2  1 
ATOM   809  C  CE3  A TRP B 2 5  ? 6.331  -38.222 -11.069 0.50 41.73 ? 1394 TRP B CE3  1 
ATOM   810  C  CZ2  A TRP B 2 5  ? 4.104  -39.748 -11.926 0.50 42.17 ? 1394 TRP B CZ2  1 
ATOM   811  C  CZ3  A TRP B 2 5  ? 6.479  -39.510 -11.548 0.50 41.56 ? 1394 TRP B CZ3  1 
ATOM   812  C  CH2  A TRP B 2 5  ? 5.374  -40.259 -11.972 0.50 41.76 ? 1394 TRP B CH2  1 
ATOM   813  N  N    . ASN B 2 6  ? 7.360  -35.228 -12.960 1.00 46.31 ? 1395 ASN B N    1 
ATOM   814  C  CA   . ASN B 2 6  ? 8.519  -35.924 -13.480 1.00 45.14 ? 1395 ASN B CA   1 
ATOM   815  C  C    . ASN B 2 6  ? 9.224  -35.246 -14.667 1.00 40.68 ? 1395 ASN B C    1 
ATOM   816  O  O    . ASN B 2 6  ? 10.426 -35.389 -14.841 1.00 40.98 ? 1395 ASN B O    1 
ATOM   817  C  CB   . ASN B 2 6  ? 8.126  -37.359 -13.765 1.00 48.01 ? 1395 ASN B CB   1 
ATOM   818  C  CG   . ASN B 2 6  ? 9.237  -38.343 -13.462 1.00 50.60 ? 1395 ASN B CG   1 
ATOM   819  O  OD1  . ASN B 2 6  ? 10.395 -37.963 -13.297 1.00 51.85 ? 1395 ASN B OD1  1 
ATOM   820  N  ND2  . ASN B 2 6  ? 8.886  -39.619 -13.393 1.00 51.26 ? 1395 ASN B ND2  1 
ATOM   821  N  N    . LEU B 2 7  ? 8.498  -34.460 -15.449 1.00 38.80 ? 1396 LEU B N    1 
ATOM   822  C  CA   . LEU B 2 7  ? 9.162  -33.626 -16.453 1.00 37.03 ? 1396 LEU B CA   1 
ATOM   823  C  C    . LEU B 2 7  ? 9.727  -32.296 -15.910 1.00 33.77 ? 1396 LEU B C    1 
ATOM   824  O  O    . LEU B 2 7  ? 10.655 -31.737 -16.490 1.00 33.85 ? 1396 LEU B O    1 
ATOM   825  C  CB   . LEU B 2 7  ? 8.243  -33.347 -17.649 1.00 38.86 ? 1396 LEU B CB   1 
ATOM   826  C  CG   . LEU B 2 7  ? 6.971  -32.577 -17.310 1.00 40.25 ? 1396 LEU B CG   1 
ATOM   827  C  CD1  . LEU B 2 7  ? 6.189  -32.244 -18.559 1.00 40.79 ? 1396 LEU B CD1  1 
ATOM   828  C  CD2  . LEU B 2 7  ? 6.099  -33.397 -16.369 1.00 40.69 ? 1396 LEU B CD2  1 
ATOM   829  N  N    . MET B 2 8  ? 9.197  -31.810 -14.793 1.00 30.55 ? 1397 MET B N    1 
ATOM   830  C  CA   . MET B 2 8  ? 9.578  -30.503 -14.323 1.00 27.10 ? 1397 MET B CA   1 
ATOM   831  C  C    . MET B 2 8  ? 11.004 -30.524 -13.781 1.00 24.26 ? 1397 MET B C    1 
ATOM   832  O  O    . MET B 2 8  ? 11.423 -31.451 -13.076 1.00 25.66 ? 1397 MET B O    1 
ATOM   833  C  CB   . MET B 2 8  ? 8.629  -30.050 -13.210 1.00 26.70 ? 1397 MET B CB   1 
ATOM   834  C  CG   . MET B 2 8  ? 7.151  -29.986 -13.642 1.00 27.87 ? 1397 MET B CG   1 
ATOM   835  S  SD   . MET B 2 8  ? 6.884  -28.912 -15.044 1.00 28.02 ? 1397 MET B SD   1 
ATOM   836  C  CE   . MET B 2 8  ? 6.927  -27.315 -14.303 1.00 26.13 ? 1397 MET B CE   1 
ATOM   837  N  N    . PRO B 2 9  ? 11.759 -29.469 -14.079 1.00 23.32 ? 1398 PRO B N    1 
ATOM   838  C  CA   . PRO B 2 9  ? 13.107 -29.361 -13.507 1.00 22.39 ? 1398 PRO B CA   1 
ATOM   839  C  C    . PRO B 2 9  ? 13.054 -29.309 -11.960 1.00 20.74 ? 1398 PRO B C    1 
ATOM   840  O  O    . PRO B 2 9  ? 12.128 -28.760 -11.388 1.00 19.98 ? 1398 PRO B O    1 
ATOM   841  C  CB   . PRO B 2 9  ? 13.563 -28.013 -14.012 1.00 23.17 ? 1398 PRO B CB   1 
ATOM   842  C  CG   . PRO B 2 9  ? 12.811 -27.835 -15.311 1.00 23.74 ? 1398 PRO B CG   1 
ATOM   843  C  CD   . PRO B 2 9  ? 11.450 -28.383 -15.025 1.00 23.62 ? 1398 PRO B CD   1 
ATOM   844  N  N    . PRO B 2 10 ? 14.041 -29.878 -11.283 1.00 19.95 ? 1399 PRO B N    1 
ATOM   845  C  CA   . PRO B 2 10 ? 14.028 -29.829 -9.800  1.00 19.40 ? 1399 PRO B CA   1 
ATOM   846  C  C    . PRO B 2 10 ? 14.431 -28.450 -9.287  1.00 17.38 ? 1399 PRO B C    1 
ATOM   847  O  O    . PRO B 2 10 ? 14.959 -27.640 -10.049 1.00 18.31 ? 1399 PRO B O    1 
ATOM   848  C  CB   . PRO B 2 10 ? 15.095 -30.856 -9.411  1.00 23.33 ? 1399 PRO B CB   1 
ATOM   849  C  CG   . PRO B 2 10 ? 16.067 -30.778 -10.586 1.00 24.50 ? 1399 PRO B CG   1 
ATOM   850  C  CD   . PRO B 2 10 ? 15.182 -30.627 -11.825 1.00 23.37 ? 1399 PRO B CD   1 
ATOM   851  N  N    . PRO B 2 11 ? 14.220 -28.191 -7.996  1.00 16.74 ? 1400 PRO B N    1 
ATOM   852  C  CA   . PRO B 2 11 ? 14.575 -26.864 -7.488  1.00 17.25 ? 1400 PRO B CA   1 
ATOM   853  C  C    . PRO B 2 11 ? 16.087 -26.728 -7.435  1.00 17.37 ? 1400 PRO B C    1 
ATOM   854  O  O    . PRO B 2 11 ? 16.831 -27.668 -7.179  1.00 19.22 ? 1400 PRO B O    1 
ATOM   855  C  CB   . PRO B 2 11 ? 14.013 -26.858 -6.067  1.00 18.21 ? 1400 PRO B CB   1 
ATOM   856  C  CG   . PRO B 2 11 ? 12.994 -27.865 -6.078  1.00 20.12 ? 1400 PRO B CG   1 
ATOM   857  C  CD   . PRO B 2 11 ? 13.411 -28.959 -7.049  1.00 18.57 ? 1400 PRO B CD   1 
ATOM   858  N  N    . ALA B 2 12 ? 16.546 -25.506 -7.618  1.00 17.81 ? 1401 ALA B N    1 
ATOM   859  C  CA   . ALA B 2 12 ? 17.960 -25.193 -7.390  1.00 18.68 ? 1401 ALA B CA   1 
ATOM   860  C  C    . ALA B 2 12 ? 18.281 -25.161 -5.892  1.00 17.22 ? 1401 ALA B C    1 
ATOM   861  O  O    . ALA B 2 12 ? 17.499 -24.667 -5.102  1.00 17.79 ? 1401 ALA B O    1 
ATOM   862  C  CB   . ALA B 2 12 ? 18.270 -23.842 -7.978  1.00 20.71 ? 1401 ALA B CB   1 
HETATM 863  N  N    . SME B 2 13 ? 19.461 -25.625 -5.532  1.00 15.87 ? 1402 SME B N    1 
HETATM 864  C  CA   A SME B 2 13 ? 19.906 -25.558 -4.157  0.47 16.06 ? 1402 SME B CA   1 
HETATM 865  C  CA   B SME B 2 13 ? 19.923 -25.551 -4.153  0.53 16.62 ? 1402 SME B CA   1 
HETATM 866  C  CB   A SME B 2 13 ? 21.264 -26.268 -4.091  0.47 17.71 ? 1402 SME B CB   1 
HETATM 867  C  CB   B SME B 2 13 ? 21.339 -26.126 -4.009  0.53 19.73 ? 1402 SME B CB   1 
HETATM 868  C  CG   A SME B 2 13 ? 21.825 -26.459 -2.706  0.47 19.13 ? 1402 SME B CG   1 
HETATM 869  C  CG   B SME B 2 13 ? 21.919 -25.905 -2.628  0.53 23.05 ? 1402 SME B CG   1 
HETATM 870  S  S    A SME B 2 13 ? 21.106 -27.801 -1.788  0.47 21.78 ? 1402 SME B S    1 
HETATM 871  S  S    B SME B 2 13 ? 21.296 -27.126 -1.517  0.53 27.59 ? 1402 SME B S    1 
HETATM 872  O  OE   A SME B 2 13 ? 19.889 -28.392 -2.445  0.47 21.22 ? 1402 SME B OE   1 
HETATM 873  C  CE   A SME B 2 13 ? 20.825 -26.877 -0.334  0.47 22.41 ? 1402 SME B CE   1 
HETATM 874  C  CE   B SME B 2 13 ? 21.107 -26.201 -0.073  0.53 27.33 ? 1402 SME B CE   1 
HETATM 875  C  C    . SME B 2 13 ? 20.077 -24.077 -3.745  1.00 15.18 ? 1402 SME B C    1 
HETATM 876  O  O    . SME B 2 13 ? 20.620 -23.233 -4.471  1.00 16.11 ? 1402 SME B O    1 
ATOM   877  N  N    . GLU B 2 14 ? 19.628 -23.758 -2.531  1.00 13.41 ? 1403 GLU B N    1 
ATOM   878  C  CA   . GLU B 2 14 ? 19.661 -22.386 -1.972  1.00 13.69 ? 1403 GLU B CA   1 
ATOM   879  C  C    . GLU B 2 14 ? 20.573 -22.424 -0.748  1.00 12.90 ? 1403 GLU B C    1 
ATOM   880  O  O    . GLU B 2 14 ? 20.472 -23.370 0.071   1.00 14.77 ? 1403 GLU B O    1 
ATOM   881  C  CB   . GLU B 2 14 ? 18.240 -22.037 -1.507  1.00 16.35 ? 1403 GLU B CB   1 
ATOM   882  C  CG   . GLU B 2 14 ? 18.093 -20.677 -0.850  1.00 16.95 ? 1403 GLU B CG   1 
ATOM   883  C  CD   . GLU B 2 14 ? 16.708 -20.397 -0.366  1.00 16.14 ? 1403 GLU B CD   1 
ATOM   884  O  OE1  . GLU B 2 14 ? 16.108 -21.241 0.334   1.00 17.56 ? 1403 GLU B OE1  1 
ATOM   885  O  OE2  . GLU B 2 14 ? 16.247 -19.269 -0.604  1.00 16.71 ? 1403 GLU B OE2  1 
ATOM   886  N  N    . ARG B 2 15 ? 21.461 -21.452 -0.591  1.00 12.47 ? 1404 ARG B N    1 
ATOM   887  C  CA   . ARG B 2 15 ? 22.297 -21.370 0.610   1.00 12.31 ? 1404 ARG B CA   1 
ATOM   888  C  C    . ARG B 2 15 ? 22.227 -19.940 1.184   1.00 12.58 ? 1404 ARG B C    1 
ATOM   889  O  O    . ARG B 2 15 ? 22.148 -18.948 0.450   1.00 13.33 ? 1404 ARG B O    1 
ATOM   890  C  CB   . ARG B 2 15 ? 23.774 -21.705 0.322   1.00 13.35 ? 1404 ARG B CB   1 
ATOM   891  C  CG   . ARG B 2 15 ? 24.046 -23.103 -0.160  1.00 14.68 ? 1404 ARG B CG   1 
ATOM   892  C  CD   . ARG B 2 15 ? 23.558 -24.229 0.730   1.00 17.72 ? 1404 ARG B CD   1 
ATOM   893  N  NE   . ARG B 2 15 ? 24.143 -24.234 2.062   1.00 17.78 ? 1404 ARG B NE   1 
ATOM   894  C  CZ   . ARG B 2 15 ? 25.310 -24.815 2.364   1.00 17.61 ? 1404 ARG B CZ   1 
ATOM   895  N  NH1  . ARG B 2 15 ? 26.028 -25.460 1.447   1.00 20.55 ? 1404 ARG B NH1  1 
ATOM   896  N  NH2  . ARG B 2 15 ? 25.711 -24.769 3.608   1.00 19.41 ? 1404 ARG B NH2  1 
ATOM   897  N  N    . LEU B 2 16 ? 22.327 -19.860 2.516   1.00 12.47 ? 1405 LEU B N    1 
ATOM   898  C  CA   . LEU B 2 16 ? 22.245 -18.582 3.259   1.00 12.95 ? 1405 LEU B CA   1 
ATOM   899  C  C    . LEU B 2 16 ? 23.610 -17.927 3.354   1.00 13.95 ? 1405 LEU B C    1 
ATOM   900  O  O    . LEU B 2 16 ? 24.589 -18.567 3.781   1.00 15.02 ? 1405 LEU B O    1 
ATOM   901  C  CB   . LEU B 2 16 ? 21.717 -18.857 4.699   1.00 14.08 ? 1405 LEU B CB   1 
ATOM   902  C  CG   . LEU B 2 16 ? 21.637 -17.698 5.673   1.00 14.71 ? 1405 LEU B CG   1 
ATOM   903  C  CD1  . LEU B 2 16 ? 20.637 -16.685 5.137   1.00 16.56 ? 1405 LEU B CD1  1 
ATOM   904  C  CD2  . LEU B 2 16 ? 21.274 -18.226 7.032   1.00 17.14 ? 1405 LEU B CD2  1 
ATOM   905  N  N    . ILE B 2 17 ? 23.624 -16.626 3.065   1.00 14.35 ? 1406 ILE B N    1 
ATOM   906  C  CA   . ILE B 2 17 ? 24.795 -15.759 3.283   1.00 15.27 ? 1406 ILE B CA   1 
ATOM   907  C  C    . ILE B 2 17 ? 24.511 -14.550 4.193   1.00 15.06 ? 1406 ILE B C    1 
ATOM   908  O  O    . ILE B 2 17 ? 23.287 -14.222 4.332   1.00 15.06 ? 1406 ILE B O    1 
ATOM   909  C  CB   . ILE B 2 17 ? 25.441 -15.335 1.956   1.00 16.13 ? 1406 ILE B CB   1 
ATOM   910  C  CG1  . ILE B 2 17 ? 24.554 -14.386 1.126   1.00 18.91 ? 1406 ILE B CG1  1 
ATOM   911  C  CG2  . ILE B 2 17 ? 25.910 -16.535 1.157   1.00 17.40 ? 1406 ILE B CG2  1 
ATOM   912  C  CD1  . ILE B 2 17 ? 25.282 -13.744 -0.031  1.00 20.87 ? 1406 ILE B CD1  1 
ATOM   913  O  OXT  . ILE B 2 17 ? 25.520 -13.964 4.695   1.00 15.79 ? 1406 ILE B OXT  1 
HETATM 914  CL CL   . CL  C 3 .  ? 23.646 -7.976  10.965  1.00 22.77 ? 1335 CL  A CL   1 
HETATM 915  CL CL   B CL  D 3 .  ? 23.065 -15.100 -23.323 0.38 19.52 ? 1336 CL  A CL   1 
HETATM 916  CL CL   B CL  E 3 .  ? 25.087 -27.004 -1.335  0.50 26.14 ? 1337 CL  A CL   1 
HETATM 917  CL CL   . CL  F 3 .  ? 29.346 -9.941  15.483  0.72 30.52 ? 1338 CL  A CL   1 
HETATM 918  CL CL   . CL  G 3 .  ? 21.518 -3.464  -21.089 0.76 32.61 ? 1339 CL  A CL   1 
HETATM 919  CL CL   . CL  H 3 .  ? 31.112 -7.292  13.641  0.66 39.63 ? 1340 CL  A CL   1 
HETATM 920  CL CL   . CL  I 3 .  ? 21.113 0.001   -10.677 0.50 29.59 ? 1341 CL  A CL   1 
HETATM 921  NA NA   . NA  J 4 .  ? 34.001 -18.083 9.901   0.88 45.83 ? 1342 NA  A NA   1 
HETATM 922  C  C    . PUN K 5 .  ? 36.762 -3.043  13.772  0.72 66.71 ? 1343 PUN A C    1 
HETATM 923  C  C1   . PUN K 5 .  ? 35.881 -2.555  12.632  0.72 56.80 ? 1343 PUN A C1   1 
HETATM 924  C  C2   . PUN K 5 .  ? 36.543 -2.211  15.025  0.72 63.50 ? 1343 PUN A C2   1 
HETATM 925  C  C3   . PUN K 5 .  ? 36.490 -4.516  14.089  0.72 57.73 ? 1343 PUN A C3   1 
HETATM 926  C  C4   . PUN K 5 .  ? 37.549 -5.533  13.638  0.72 61.35 ? 1343 PUN A C4   1 
HETATM 927  C  C5   . PUN K 5 .  ? 37.432 -5.737  12.142  0.72 62.05 ? 1343 PUN A C5   1 
HETATM 928  C  C6   . PUN K 5 .  ? 38.980 -5.086  13.889  0.72 61.65 ? 1343 PUN A C6   1 
HETATM 929  C  C7   . PUN K 5 .  ? 37.444 -6.837  14.468  0.72 40.16 ? 1343 PUN A C7   1 
HETATM 930  C  C8   . PUN K 5 .  ? 36.277 -7.835  14.323  0.72 58.49 ? 1343 PUN A C8   1 
HETATM 931  C  C9   . PUN K 5 .  ? 35.971 -8.266  15.726  0.72 62.57 ? 1343 PUN A C9   1 
HETATM 932  C  C10  . PUN K 5 .  ? 34.943 -7.251  13.892  0.72 64.02 ? 1343 PUN A C10  1 
HETATM 933  C  C11  . PUN K 5 .  ? 36.725 -9.043  13.457  0.72 63.61 ? 1343 PUN A C11  1 
HETATM 934  C  C12  . PUN K 5 .  ? 36.632 -10.526 13.911  0.72 46.90 ? 1343 PUN A C12  1 
HETATM 935  C  C13  . PUN K 5 .  ? 35.237 -11.039 14.050  0.72 35.97 ? 1343 PUN A C13  1 
HETATM 936  C  C14  . PUN K 5 .  ? 37.387 -11.008 15.141  0.72 63.88 ? 1343 PUN A C14  1 
HETATM 937  C  C15  . PUN K 5 .  ? 37.129 -11.380 12.737  0.72 63.28 ? 1343 PUN A C15  1 
HETATM 938  H  H    . PUN K 5 .  ? 37.813 -2.941  13.467  0.72 80.06 ? 1343 PUN A H    1 
HETATM 939  H  H1   . PUN K 5 .  ? 36.077 -3.130  11.764  0.72 68.16 ? 1343 PUN A H1   1 
HETATM 940  H  H1A  . PUN K 5 .  ? 34.862 -2.661  12.902  0.72 68.16 ? 1343 PUN A H1A  1 
HETATM 941  H  H1B  . PUN K 5 .  ? 36.090 -1.536  12.435  0.72 68.16 ? 1343 PUN A H1B  1 
HETATM 942  H  H2   . PUN K 5 .  ? 35.543 -2.325  15.355  0.72 76.20 ? 1343 PUN A H2   1 
HETATM 943  H  H2A  . PUN K 5 .  ? 37.204 -2.538  15.786  0.72 76.20 ? 1343 PUN A H2A  1 
HETATM 944  H  H2B  . PUN K 5 .  ? 36.730 -1.191  14.810  0.72 76.20 ? 1343 PUN A H2B  1 
HETATM 945  H  H3   . PUN K 5 .  ? 36.363 -4.614  15.170  0.72 69.28 ? 1343 PUN A H3   1 
HETATM 946  H  H3A  . PUN K 5 .  ? 35.537 -4.792  13.634  0.72 69.28 ? 1343 PUN A H3A  1 
HETATM 947  H  H5   . PUN K 5 .  ? 38.208 -6.378  11.812  0.72 74.46 ? 1343 PUN A H5   1 
HETATM 948  H  H5A  . PUN K 5 .  ? 36.494 -6.174  11.917  0.72 74.46 ? 1343 PUN A H5A  1 
HETATM 949  H  H5B  . PUN K 5 .  ? 37.514 -4.803  11.651  0.72 74.46 ? 1343 PUN A H5B  1 
HETATM 950  H  H6   . PUN K 5 .  ? 39.649 -5.837  13.556  0.72 73.98 ? 1343 PUN A H6   1 
HETATM 951  H  H6A  . PUN K 5 .  ? 39.167 -4.187  13.361  0.72 73.98 ? 1343 PUN A H6A  1 
HETATM 952  H  H6B  . PUN K 5 .  ? 39.122 -4.922  14.926  0.72 73.98 ? 1343 PUN A H6B  1 
HETATM 953  H  H7   . PUN K 5 .  ? 38.363 -7.399  14.288  0.72 48.20 ? 1343 PUN A H7   1 
HETATM 954  H  H7A  . PUN K 5 .  ? 37.478 -6.544  15.520  0.72 48.20 ? 1343 PUN A H7A  1 
HETATM 955  H  H9   . PUN K 5 .  ? 35.192 -8.983  15.713  0.72 75.09 ? 1343 PUN A H9   1 
HETATM 956  H  H9A  . PUN K 5 .  ? 36.837 -8.693  16.161  0.72 75.09 ? 1343 PUN A H9A  1 
HETATM 957  H  H9B  . PUN K 5 .  ? 35.668 -7.425  16.295  0.72 75.09 ? 1343 PUN A H9B  1 
HETATM 958  H  H10  . PUN K 5 .  ? 34.192 -7.994  13.966  0.72 76.83 ? 1343 PUN A H10  1 
HETATM 959  H  H10A . PUN K 5 .  ? 34.696 -6.435  14.519  0.72 76.83 ? 1343 PUN A H10A 1 
HETATM 960  H  H10B . PUN K 5 .  ? 35.012 -6.917  12.889  0.72 76.83 ? 1343 PUN A H10B 1 
HETATM 961  H  H11  . PUN K 5 .  ? 37.771 -8.865  13.195  0.72 76.34 ? 1343 PUN A H11  1 
HETATM 962  H  H11A . PUN K 5 .  ? 36.173 -8.972  12.518  0.72 76.34 ? 1343 PUN A H11A 1 
HETATM 963  H  H13  . PUN K 5 .  ? 34.718 -10.461 14.770  0.72 43.17 ? 1343 PUN A H13  1 
HETATM 964  H  H13A . PUN K 5 .  ? 34.741 -10.969 13.117  0.72 43.17 ? 1343 PUN A H13A 1 
HETATM 965  H  H13B . PUN K 5 .  ? 35.263 -12.050 14.362  0.72 43.17 ? 1343 PUN A H13B 1 
HETATM 966  H  H14  . PUN K 5 .  ? 36.924 -10.622 16.013  0.72 76.66 ? 1343 PUN A H14  1 
HETATM 967  H  H14A . PUN K 5 .  ? 38.389 -10.670 15.095  0.72 76.66 ? 1343 PUN A H14A 1 
HETATM 968  H  H14B . PUN K 5 .  ? 37.372 -12.066 15.172  0.72 76.66 ? 1343 PUN A H14B 1 
HETATM 969  H  H15  . PUN K 5 .  ? 38.133 -11.125 12.515  0.72 75.94 ? 1343 PUN A H15  1 
HETATM 970  H  H15A . PUN K 5 .  ? 37.076 -12.405 12.999  0.72 75.94 ? 1343 PUN A H15A 1 
HETATM 971  H  H15B . PUN K 5 .  ? 36.522 -11.201 11.888  0.72 75.94 ? 1343 PUN A H15B 1 
HETATM 972  CL CL   . CL  L 3 .  ? 22.323 -22.658 3.853   0.66 12.92 ? 2407 CL  B CL   1 
HETATM 973  O  O    . HOH M 6 .  ? 20.227 -10.751 -28.579 1.00 25.74 ? 2001 HOH A O    1 
HETATM 974  O  O    . HOH M 6 .  ? 25.030 -13.951 -21.173 1.00 26.83 ? 2002 HOH A O    1 
HETATM 975  O  O    . HOH M 6 .  ? 22.641 -11.008 -17.577 1.00 34.93 ? 2003 HOH A O    1 
HETATM 976  O  O    . HOH M 6 .  ? 21.435 -9.118  -18.055 1.00 37.46 ? 2004 HOH A O    1 
HETATM 977  O  O    . HOH M 6 .  ? 23.874 -5.771  -17.650 1.00 14.98 ? 2005 HOH A O    1 
HETATM 978  O  O    . HOH M 6 .  ? 27.756 -7.843  -21.574 1.00 22.46 ? 2006 HOH A O    1 
HETATM 979  O  O    . HOH M 6 .  ? 23.863 -13.429 -18.798 1.00 35.00 ? 2007 HOH A O    1 
HETATM 980  O  O    . HOH M 6 .  ? 25.141 -7.629  -24.237 1.00 33.82 ? 2008 HOH A O    1 
HETATM 981  O  O    . HOH M 6 .  ? 27.132 -0.425  -25.176 1.00 35.28 ? 2009 HOH A O    1 
HETATM 982  O  O    . HOH M 6 .  ? 19.629 2.589   -7.052  1.00 37.85 ? 2010 HOH A O    1 
HETATM 983  O  O    . HOH M 6 .  ? 22.258 1.756   -8.232  1.00 29.58 ? 2011 HOH A O    1 
HETATM 984  O  O    . HOH M 6 .  ? 18.528 -1.583  -9.871  1.00 32.23 ? 2012 HOH A O    1 
HETATM 985  O  O    . HOH M 6 .  ? 20.192 -4.610  -6.368  1.00 24.09 ? 2013 HOH A O    1 
HETATM 986  O  O    . HOH M 6 .  ? 17.672 -1.007  -5.102  1.00 28.19 ? 2014 HOH A O    1 
HETATM 987  O  O    . HOH M 6 .  ? 23.911 -0.654  2.860   1.00 25.97 ? 2015 HOH A O    1 
HETATM 988  O  O    . HOH M 6 .  ? 24.377 -1.850  5.372   1.00 19.74 ? 2016 HOH A O    1 
HETATM 989  O  O    . HOH M 6 .  ? 25.224 -5.647  9.629   1.00 26.47 ? 2017 HOH A O    1 
HETATM 990  O  O    . HOH M 6 .  ? 30.306 -4.624  10.286  1.00 35.58 ? 2018 HOH A O    1 
HETATM 991  O  O    . HOH M 6 .  ? 28.180 -15.184 8.430   1.00 16.92 ? 2019 HOH A O    1 
HETATM 992  O  O    . HOH M 6 .  ? 31.915 -13.788 9.671   1.00 18.69 ? 2020 HOH A O    1 
HETATM 993  O  O    . HOH M 6 .  ? 25.640 -9.458  9.100   1.00 15.04 ? 2021 HOH A O    1 
HETATM 994  O  O    . HOH M 6 .  ? 33.497 -18.964 12.223  1.00 52.36 ? 2022 HOH A O    1 
HETATM 995  O  O    . HOH M 6 .  ? 30.284 -17.723 10.561  1.00 25.25 ? 2023 HOH A O    1 
HETATM 996  O  O    . HOH M 6 .  ? 21.851 -9.748  9.053   1.00 14.15 ? 2024 HOH A O    1 
HETATM 997  O  O    . HOH M 6 .  ? 18.073 -9.488  5.264   1.00 14.59 ? 2025 HOH A O    1 
HETATM 998  O  O    . HOH M 6 .  ? 16.290 -15.099 -12.030 1.00 45.85 ? 2026 HOH A O    1 
HETATM 999  O  O    . HOH M 6 .  ? 21.870 -23.846 -6.841  1.00 18.18 ? 2027 HOH A O    1 
HETATM 1000 O  O    . HOH M 6 .  ? 21.319 -25.099 -9.576  1.00 28.34 ? 2028 HOH A O    1 
HETATM 1001 O  O    . HOH M 6 .  ? 24.123 -25.392 -6.916  1.00 24.38 ? 2029 HOH A O    1 
HETATM 1002 O  O    . HOH M 6 .  ? 21.991 -24.858 -13.062 1.00 36.36 ? 2030 HOH A O    1 
HETATM 1003 O  O    . HOH M 6 .  ? 32.647 -18.888 -14.577 1.00 50.31 ? 2031 HOH A O    1 
HETATM 1004 O  O    . HOH M 6 .  ? 24.481 -14.859 -16.359 1.00 34.73 ? 2032 HOH A O    1 
HETATM 1005 O  O    . HOH M 6 .  ? 27.537 -15.031 -10.883 1.00 15.94 ? 2033 HOH A O    1 
HETATM 1006 O  O    . HOH M 6 .  ? 9.602  -18.405 -1.289  1.00 20.17 ? 2034 HOH A O    1 
HETATM 1007 O  O    . HOH M 6 .  ? 13.081 -12.522 10.839  1.00 16.87 ? 2035 HOH A O    1 
HETATM 1008 O  O    . HOH M 6 .  ? 15.728 -10.247 11.947  1.00 24.23 ? 2036 HOH A O    1 
HETATM 1009 O  O    . HOH M 6 .  ? 16.203 -6.674  12.862  1.00 40.65 ? 2037 HOH A O    1 
HETATM 1010 O  O    . HOH M 6 .  ? 19.929 -6.976  11.281  1.00 43.52 ? 2038 HOH A O    1 
HETATM 1011 O  O    . HOH M 6 .  ? 11.533 -7.666  11.197  1.00 48.93 ? 2039 HOH A O    1 
HETATM 1012 O  O    . HOH M 6 .  ? 22.031 -3.007  6.290   1.00 18.54 ? 2040 HOH A O    1 
HETATM 1013 O  O    . HOH M 6 .  ? 17.252 -5.606  -0.084  1.00 22.90 ? 2041 HOH A O    1 
HETATM 1014 O  O    . HOH M 6 .  ? 15.816 0.165   6.432   1.00 41.49 ? 2042 HOH A O    1 
HETATM 1015 O  O    . HOH M 6 .  ? 20.797 -0.357  6.238   1.00 28.15 ? 2043 HOH A O    1 
HETATM 1016 O  O    . HOH M 6 .  ? 21.735 1.050   2.135   1.00 29.22 ? 2044 HOH A O    1 
HETATM 1017 O  O    . HOH M 6 .  ? 14.630 -0.974  -2.121  1.00 39.67 ? 2045 HOH A O    1 
HETATM 1018 O  O    . HOH M 6 .  ? 13.520 -7.255  -2.360  1.00 34.74 ? 2046 HOH A O    1 
HETATM 1019 O  O    . HOH M 6 .  ? 13.653 -9.399  -3.382  1.00 27.63 ? 2047 HOH A O    1 
HETATM 1020 O  O    . HOH M 6 .  ? 13.565 -8.667  -7.920  1.00 25.01 ? 2048 HOH A O    1 
HETATM 1021 O  O    . HOH M 6 .  ? 13.665 -11.451 -10.781 1.00 39.38 ? 2049 HOH A O    1 
HETATM 1022 O  O    . HOH M 6 .  ? 18.308 -13.488 -12.857 1.00 31.54 ? 2050 HOH A O    1 
HETATM 1023 O  O    . HOH M 6 .  ? 20.655 -10.584 -13.113 1.00 21.02 ? 2051 HOH A O    1 
HETATM 1024 O  O    . HOH M 6 .  ? 17.170 -5.486  -8.791  1.00 30.48 ? 2052 HOH A O    1 
HETATM 1025 O  O    . HOH M 6 .  ? 22.301 -11.893 -14.925 1.00 25.52 ? 2053 HOH A O    1 
HETATM 1026 O  O    . HOH M 6 .  ? 34.050 -5.744  -5.116  1.00 34.57 ? 2054 HOH A O    1 
HETATM 1027 O  O    . HOH M 6 .  ? 34.166 -3.229  0.685   1.00 22.17 ? 2055 HOH A O    1 
HETATM 1028 O  O    . HOH M 6 .  ? 36.491 -4.357  -0.695  1.00 45.61 ? 2056 HOH A O    1 
HETATM 1029 O  O    . HOH M 6 .  ? 35.022 -5.798  4.500   1.00 24.24 ? 2057 HOH A O    1 
HETATM 1030 O  O    . HOH M 6 .  ? 34.981 -18.779 -10.326 1.00 34.04 ? 2058 HOH A O    1 
HETATM 1031 O  O    . HOH M 6 .  ? 38.739 -16.905 -10.303 1.00 49.84 ? 2059 HOH A O    1 
HETATM 1032 O  O    . HOH M 6 .  ? 30.291 -24.152 -10.152 1.00 38.65 ? 2060 HOH A O    1 
HETATM 1033 O  O    . HOH M 6 .  ? 34.524 -23.037 -9.224  1.00 46.31 ? 2061 HOH A O    1 
HETATM 1034 O  O    . HOH M 6 .  ? 36.083 -20.537 -8.863  1.00 38.49 ? 2062 HOH A O    1 
HETATM 1035 O  O    . HOH M 6 .  ? 24.941 -26.620 -4.622  1.00 31.89 ? 2063 HOH A O    1 
HETATM 1036 O  O    . HOH M 6 .  ? 27.965 -25.673 -9.243  1.00 38.20 ? 2064 HOH A O    1 
HETATM 1037 O  O    . HOH M 6 .  ? 26.286 -28.159 -7.252  1.00 47.82 ? 2065 HOH A O    1 
HETATM 1038 O  O    . HOH M 6 .  ? 27.919 -26.427 4.285   1.00 38.06 ? 2066 HOH A O    1 
HETATM 1039 O  O    . HOH M 6 .  ? 28.985 -27.665 2.718   1.00 40.47 ? 2067 HOH A O    1 
HETATM 1040 O  O    . HOH M 6 .  ? 31.524 -26.654 -3.746  1.00 34.82 ? 2068 HOH A O    1 
HETATM 1041 O  O    A HOH M 6 .  ? 34.728 -21.366 -0.213  0.69 29.23 ? 2069 HOH A O    1 
HETATM 1042 O  O    . HOH M 6 .  ? 27.194 -18.274 4.944   1.00 14.47 ? 2070 HOH A O    1 
HETATM 1043 O  O    . HOH M 6 .  ? 31.252 -22.465 6.710   1.00 25.39 ? 2071 HOH A O    1 
HETATM 1044 O  O    . HOH M 6 .  ? 34.058 -24.446 0.271   1.00 33.93 ? 2072 HOH A O    1 
HETATM 1045 O  O    . HOH M 6 .  ? 27.362 -15.619 5.829   1.00 16.21 ? 2073 HOH A O    1 
HETATM 1046 O  O    . HOH M 6 .  ? 32.940 -20.161 9.113   1.00 30.86 ? 2074 HOH A O    1 
HETATM 1047 O  O    . HOH M 6 .  ? 27.021 -19.357 7.651   1.00 16.66 ? 2075 HOH A O    1 
HETATM 1048 O  O    . HOH M 6 .  ? 27.626 -17.554 9.737   1.00 18.32 ? 2076 HOH A O    1 
HETATM 1049 O  O    . HOH M 6 .  ? 29.021 -21.451 8.162   1.00 21.83 ? 2077 HOH A O    1 
HETATM 1050 O  O    . HOH M 6 .  ? 30.515 -20.630 10.243  1.00 26.21 ? 2078 HOH A O    1 
HETATM 1051 O  O    . HOH M 6 .  ? 34.557 -12.988 9.815   1.00 29.92 ? 2079 HOH A O    1 
HETATM 1052 O  O    . HOH M 6 .  ? 36.097 -11.612 9.014   1.00 40.18 ? 2080 HOH A O    1 
HETATM 1053 O  O    . HOH M 6 .  ? 34.727 -21.598 6.522   1.00 43.06 ? 2081 HOH A O    1 
HETATM 1054 O  O    . HOH M 6 .  ? 36.174 -20.330 9.950   1.00 43.05 ? 2082 HOH A O    1 
HETATM 1055 O  O    . HOH M 6 .  ? 21.186 -5.950  -17.505 1.00 22.73 ? 2083 HOH A O    1 
HETATM 1056 O  O    . HOH M 6 .  ? 17.803 2.430   -8.890  1.00 40.81 ? 2084 HOH A O    1 
HETATM 1057 O  O    . HOH M 6 .  ? 36.490 -6.279  8.203   1.00 34.35 ? 2085 HOH A O    1 
HETATM 1058 O  O    . HOH M 6 .  ? 35.633 -4.381  9.802   1.00 30.00 ? 2086 HOH A O    1 
HETATM 1059 O  O    . HOH M 6 .  ? 24.867 0.064   7.501   1.00 39.11 ? 2087 HOH A O    1 
HETATM 1060 O  O    . HOH M 6 .  ? 22.503 -3.605  9.071   1.00 39.65 ? 2088 HOH A O    1 
HETATM 1061 O  O    . HOH M 6 .  ? 27.662 -4.787  11.263  1.00 33.79 ? 2089 HOH A O    1 
HETATM 1062 O  O    . HOH M 6 .  ? 34.917 -2.499  6.658   1.00 33.71 ? 2090 HOH A O    1 
HETATM 1063 O  O    . HOH M 6 .  ? 19.553 -26.565 -10.796 1.00 45.06 ? 2091 HOH A O    1 
HETATM 1064 O  O    . HOH M 6 .  ? 24.118 -26.485 -9.528  1.00 41.92 ? 2092 HOH A O    1 
HETATM 1065 O  O    . HOH M 6 .  ? 19.050 -10.283 -15.346 1.00 36.83 ? 2093 HOH A O    1 
HETATM 1066 O  O    . HOH M 6 .  ? 19.837 -5.284  -15.191 1.00 29.45 ? 2094 HOH A O    1 
HETATM 1067 O  O    . HOH M 6 .  ? 16.414 -4.857  -11.330 1.00 34.34 ? 2095 HOH A O    1 
HETATM 1068 O  O    . HOH M 6 .  ? 10.321 -11.907 11.273  1.00 25.47 ? 2096 HOH A O    1 
HETATM 1069 O  O    . HOH M 6 .  ? 13.669 -8.668  13.303  1.00 39.44 ? 2097 HOH A O    1 
HETATM 1070 O  O    . HOH M 6 .  ? 21.449 -5.425  10.685  1.00 38.72 ? 2098 HOH A O    1 
HETATM 1071 O  O    . HOH M 6 .  ? 14.690 -6.332  0.533   1.00 26.45 ? 2099 HOH A O    1 
HETATM 1072 O  O    . HOH M 6 .  ? 12.893 -7.853  0.512   1.00 28.40 ? 2100 HOH A O    1 
HETATM 1073 O  O    . HOH M 6 .  ? 11.968 -8.844  -5.618  1.00 37.82 ? 2101 HOH A O    1 
HETATM 1074 O  O    . HOH M 6 .  ? 11.728 -8.959  -9.661  1.00 34.56 ? 2102 HOH A O    1 
HETATM 1075 O  O    . HOH M 6 .  ? 14.321 -5.983  -8.235  1.00 33.17 ? 2103 HOH A O    1 
HETATM 1076 O  O    . HOH M 6 .  ? 36.957 -4.531  5.634   1.00 40.46 ? 2104 HOH A O    1 
HETATM 1077 O  O    . HOH M 6 .  ? 35.467 -20.614 -12.630 1.00 41.56 ? 2105 HOH A O    1 
HETATM 1078 O  O    . HOH M 6 .  ? 26.114 -28.740 3.507   1.00 30.78 ? 2106 HOH A O    1 
HETATM 1079 O  O    . HOH M 6 .  ? 34.521 -22.232 9.251   1.00 31.77 ? 2107 HOH A O    1 
HETATM 1080 O  O    . HOH M 6 .  ? 34.402 -24.542 6.653   1.00 49.76 ? 2108 HOH A O    1 
HETATM 1081 O  O    . HOH N 6 .  ? 8.382  -32.962 -13.283 1.00 45.12 ? 2001 HOH B O    1 
HETATM 1082 O  O    . HOH N 6 .  ? 10.696 -33.069 -11.592 1.00 44.46 ? 2002 HOH B O    1 
HETATM 1083 O  O    . HOH N 6 .  ? 11.174 -27.409 -9.086  1.00 23.13 ? 2003 HOH B O    1 
HETATM 1084 O  O    . HOH N 6 .  ? 19.004 -28.512 -8.911  1.00 33.34 ? 2004 HOH B O    1 
HETATM 1085 O  O    . HOH N 6 .  ? 16.945 -30.346 -6.293  1.00 27.78 ? 2005 HOH B O    1 
HETATM 1086 O  O    . HOH N 6 .  ? 16.187 -24.917 -2.758  1.00 18.66 ? 2006 HOH B O    1 
HETATM 1087 O  O    . HOH N 6 .  ? 21.225 -27.224 -7.484  1.00 27.46 ? 2007 HOH B O    1 
HETATM 1088 O  O    B HOH N 6 .  ? 17.920 -28.388 -2.832  0.84 30.56 ? 2008 HOH B O    1 
HETATM 1089 O  O    . HOH N 6 .  ? 18.034 -25.821 -1.163  1.00 18.84 ? 2009 HOH B O    1 
HETATM 1090 O  O    . HOH N 6 .  ? 18.922 -29.378 -4.439  1.00 43.77 ? 2010 HOH B O    1 
HETATM 1091 O  O    . HOH N 6 .  ? 20.166 -24.351 2.626   1.00 18.84 ? 2011 HOH B O    1 
HETATM 1092 O  O    . HOH N 6 .  ? 24.060 -28.318 1.631   1.00 30.66 ? 2012 HOH B O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1   N N   A GLY A 1  ? 0.3596 0.2901 0.4514 -0.0273 0.0425  0.0146  246  GLY A N   
2   N N   B GLY A 1  ? 0.4205 0.4746 0.4342 -0.0144 0.0078  -0.0478 246  GLY A N   
3   C CA  A GLY A 1  ? 0.3529 0.2836 0.4316 -0.0245 0.0373  0.0092  246  GLY A CA  
4   C CA  B GLY A 1  ? 0.4104 0.4705 0.3961 -0.0197 0.0152  -0.0552 246  GLY A CA  
5   C C   A GLY A 1  ? 0.3475 0.2824 0.3995 -0.0207 0.0384  -0.0020 246  GLY A C   
6   C C   B GLY A 1  ? 0.4029 0.4656 0.3554 -0.0280 0.0152  -0.0618 246  GLY A C   
7   O O   A GLY A 1  ? 0.3593 0.2976 0.4465 -0.0107 0.0392  -0.0108 246  GLY A O   
8   O O   B GLY A 1  ? 0.4191 0.4787 0.3852 -0.0234 0.0247  -0.0721 246  GLY A O   
9   N N   A PRO A 2  ? 0.3292 0.2661 0.3212 -0.0206 0.0481  -0.0216 247  PRO A N   
10  N N   B PRO A 2  ? 0.3765 0.4452 0.2703 -0.0479 0.0064  -0.0710 247  PRO A N   
11  C CA  A PRO A 2  ? 0.3244 0.2633 0.2740 -0.0317 0.0364  -0.0120 247  PRO A CA  
12  C CA  B PRO A 2  ? 0.3636 0.4283 0.2447 -0.0537 0.0042  -0.0707 247  PRO A CA  
13  C C   A PRO A 2  ? 0.3316 0.2689 0.2268 -0.0342 0.0215  -0.0051 247  PRO A C   
14  C C   B PRO A 2  ? 0.3471 0.4053 0.1983 -0.0422 0.0219  -0.0610 247  PRO A C   
15  O O   A PRO A 2  ? 0.3393 0.2820 0.2139 -0.0286 0.0177  0.0238  247  PRO A O   
16  O O   B PRO A 2  ? 0.3614 0.4282 0.2255 -0.0358 0.0344  -0.0227 247  PRO A O   
17  C CB  A PRO A 2  ? 0.3146 0.2575 0.3020 -0.0291 0.0513  -0.0006 247  PRO A CB  
18  C CB  B PRO A 2  ? 0.3630 0.4323 0.2315 -0.0620 0.0015  -0.0841 247  PRO A CB  
19  C CG  A PRO A 2  ? 0.3126 0.2604 0.3003 -0.0232 0.0657  -0.0087 247  PRO A CG  
20  C CG  B PRO A 2  ? 0.3612 0.4365 0.2258 -0.0639 -0.0083 -0.0847 247  PRO A CG  
21  C CD  A PRO A 2  ? 0.3238 0.2660 0.3248 -0.0137 0.0555  -0.0029 247  PRO A CD  
22  C CD  B PRO A 2  ? 0.3682 0.4451 0.2502 -0.0545 -0.0011 -0.0734 247  PRO A CD  
23  N N   A LEU A 3  ? 0.3227 0.2686 0.1643 -0.0314 0.0026  -0.0199 248  LEU A N   
24  N N   B LEU A 3  ? 0.3160 0.3575 0.1587 -0.0472 0.0265  -0.0819 248  LEU A N   
25  C CA  A LEU A 3  ? 0.3151 0.2679 0.1469 -0.0319 -0.0250 -0.0289 248  LEU A CA  
26  C CA  B LEU A 3  ? 0.3082 0.3286 0.1561 -0.0523 0.0100  -0.0595 248  LEU A CA  
27  C C   A LEU A 3  ? 0.3019 0.2548 0.1637 -0.0247 -0.0403 -0.0666 248  LEU A C   
28  C C   B LEU A 3  ? 0.3137 0.3068 0.1815 -0.0497 0.0005  -0.0708 248  LEU A C   
29  O O   A LEU A 3  ? 0.2956 0.2605 0.2218 -0.0233 -0.0618 -0.0758 248  LEU A O   
30  O O   B LEU A 3  ? 0.3219 0.3105 0.2106 -0.0471 -0.0071 -0.0701 248  LEU A O   
31  C CB  A LEU A 3  ? 0.3208 0.2726 0.1089 -0.0453 -0.0261 -0.0240 248  LEU A CB  
32  C CB  B LEU A 3  ? 0.2998 0.3265 0.1112 -0.0510 0.0107  -0.0345 248  LEU A CB  
33  C CG  A LEU A 3  ? 0.3287 0.2652 0.1208 -0.0528 -0.0651 -0.0042 248  LEU A CG  
34  C CG  B LEU A 3  ? 0.3050 0.3341 0.1381 -0.0420 0.0135  -0.0380 248  LEU A CG  
35  C CD1 A LEU A 3  ? 0.3408 0.2691 0.1171 -0.0433 -0.0714 0.0048  248  LEU A CD1 
36  C CD1 B LEU A 3  ? 0.3002 0.3399 0.1684 -0.0340 -0.0134 -0.0373 248  LEU A CD1 
37  C CD2 A LEU A 3  ? 0.3174 0.2608 0.1224 -0.0560 -0.0719 -0.0180 248  LEU A CD2 
38  C CD2 B LEU A 3  ? 0.3155 0.3397 0.1334 -0.0382 0.0157  -0.0454 248  LEU A CD2 
39  N N   A GLY A 4  ? 0.2996 0.2452 0.1495 -0.0237 -0.0444 -0.0839 249  GLY A N   
40  N N   B GLY A 4  ? 0.3097 0.2848 0.1901 -0.0475 -0.0147 -0.0843 249  GLY A N   
41  C CA  A GLY A 4  ? 0.3013 0.2346 0.1543 -0.0210 -0.0307 -0.0779 249  GLY A CA  
42  C CA  B GLY A 4  ? 0.3050 0.2654 0.1774 -0.0369 -0.0158 -0.0822 249  GLY A CA  
43  C C   A GLY A 4  ? 0.3003 0.2188 0.1579 -0.0176 -0.0182 -0.0475 249  GLY A C   
44  C C   B GLY A 4  ? 0.3011 0.2448 0.1757 -0.0244 -0.0134 -0.0516 249  GLY A C   
45  O O   A GLY A 4  ? 0.3073 0.2151 0.1773 -0.0289 -0.0081 -0.0503 249  GLY A O   
46  O O   B GLY A 4  ? 0.3072 0.2578 0.2055 -0.0364 -0.0132 -0.0465 249  GLY A O   
47  N N   . SER A 5  ? 0.3042 0.2129 0.1209 -0.0162 -0.0307 -0.0250 250  SER A N   
48  C CA  A SER A 5  ? 0.3116 0.2124 0.1123 -0.0107 -0.0278 -0.0011 250  SER A CA  
49  C CA  B SER A 5  ? 0.3149 0.2153 0.1081 -0.0147 -0.0183 -0.0050 250  SER A CA  
50  C C   . SER A 5  ? 0.3100 0.2136 0.0882 -0.0206 -0.0091 0.0029  250  SER A C   
51  O O   . SER A 5  ? 0.3454 0.2385 0.0978 0.0135  0.0019  -0.0120 250  SER A O   
52  C CB  A SER A 5  ? 0.3184 0.2284 0.1651 -0.0077 -0.0235 -0.0034 250  SER A CB  
53  C CB  B SER A 5  ? 0.3322 0.2255 0.1215 -0.0076 -0.0101 0.0014  250  SER A CB  
54  O OG  A SER A 5  ? 0.3141 0.2246 0.1365 -0.0249 -0.0362 -0.0201 250  SER A OG  
55  O OG  B SER A 5  ? 0.3472 0.2299 0.1010 -0.0039 -0.0022 0.0085  250  SER A OG  
56  N N   . GLY A 6  ? 0.3011 0.1938 0.1234 -0.0292 -0.0148 -0.0145 251  GLY A N   
57  C CA  . GLY A 6  ? 0.2974 0.1815 0.1418 -0.0327 -0.0199 -0.0267 251  GLY A CA  
58  C C   . GLY A 6  ? 0.2825 0.1940 0.0934 -0.0272 -0.0185 -0.0187 251  GLY A C   
59  O O   . GLY A 6  ? 0.2681 0.2045 0.1869 -0.0133 -0.0037 -0.0109 251  GLY A O   
60  N N   . GLU A 7  ? 0.2960 0.1846 0.0812 -0.0321 -0.0122 -0.0186 252  GLU A N   
61  C CA  . GLU A 7  ? 0.3070 0.1829 0.0810 -0.0293 -0.0179 -0.0053 252  GLU A CA  
62  C C   . GLU A 7  ? 0.2893 0.1735 0.0771 -0.0279 -0.0219 -0.0008 252  GLU A C   
63  O O   . GLU A 7  ? 0.3179 0.1775 0.0846 -0.0453 -0.0149 0.0076  252  GLU A O   
64  C CB  . GLU A 7  ? 0.3530 0.2281 0.0954 -0.0152 -0.0332 0.0137  252  GLU A CB  
65  C CG  . GLU A 7  ? 0.4114 0.2910 0.1139 -0.0076 -0.0372 0.0209  252  GLU A CG  
66  C CD  . GLU A 7  ? 0.4305 0.3383 0.1985 -0.0096 -0.0122 -0.0303 252  GLU A CD  
67  O OE1 . GLU A 7  ? 0.4336 0.3563 0.2683 -0.0132 0.0390  -0.0213 252  GLU A OE1 
68  O OE2 . GLU A 7  ? 0.4577 0.3668 0.3238 -0.0011 -0.0254 -0.0927 252  GLU A OE2 
69  N N   . THR A 8  ? 0.2623 0.1750 0.0681 -0.0181 -0.0086 0.0098  253  THR A N   
70  C CA  . THR A 8  ? 0.2676 0.1942 0.0695 -0.0009 -0.0177 -0.0060 253  THR A CA  
71  C C   . THR A 8  ? 0.2400 0.1747 0.0630 -0.0075 -0.0023 0.0098  253  THR A C   
72  O O   . THR A 8  ? 0.2483 0.1582 0.0943 -0.0228 -0.0184 0.0030  253  THR A O   
73  C CB  . THR A 8  ? 0.2993 0.2185 0.0872 -0.0056 -0.0248 -0.0133 253  THR A CB  
74  O OG1 . THR A 8  ? 0.3090 0.2244 0.1210 0.0003  -0.0091 -0.0003 253  THR A OG1 
75  C CG2 . THR A 8  ? 0.3059 0.2138 0.1270 -0.0126 -0.0051 -0.0095 253  THR A CG2 
76  N N   . VAL A 9  ? 0.2133 0.1905 0.0550 -0.0015 -0.0120 -0.0057 254  VAL A N   
77  C CA  . VAL A 9  ? 0.2400 0.1862 0.0662 0.0080  -0.0200 -0.0119 254  VAL A CA  
78  C C   . VAL A 9  ? 0.2275 0.1648 0.0583 0.0048  -0.0118 -0.0006 254  VAL A C   
79  O O   . VAL A 9  ? 0.2756 0.1487 0.0694 0.0012  -0.0033 0.0029  254  VAL A O   
80  C CB  . VAL A 9  ? 0.2542 0.2085 0.1173 0.0238  -0.0273 -0.0231 254  VAL A CB  
81  C CG1 . VAL A 9  ? 0.2761 0.2313 0.1286 0.0369  -0.0154 -0.0178 254  VAL A CG1 
82  C CG2 . VAL A 9  ? 0.2605 0.2382 0.1472 0.0012  0.0041  0.0000  254  VAL A CG2 
83  N N   . LYS A 10 ? 0.2289 0.1777 0.0603 0.0080  -0.0127 0.0034  255  LYS A N   
84  C CA  . LYS A 10 ? 0.2337 0.2052 0.0657 0.0262  -0.0082 0.0179  255  LYS A CA  
85  C C   . LYS A 10 ? 0.2485 0.1797 0.0649 0.0252  -0.0019 0.0060  255  LYS A C   
86  O O   . LYS A 10 ? 0.2920 0.1683 0.0910 0.0152  -0.0380 0.0147  255  LYS A O   
87  C CB  . LYS A 10 ? 0.2581 0.2648 0.0907 0.0306  0.0027  0.0174  255  LYS A CB  
88  C CG  . LYS A 10 ? 0.2620 0.3031 0.1238 0.0184  0.0145  0.0018  255  LYS A CG  
89  C CD  . LYS A 10 ? 0.2643 0.3272 0.1635 0.0062  0.0190  0.0045  255  LYS A CD  
90  C CE  A LYS A 10 ? 0.2648 0.3375 0.2114 0.0074  0.0275  0.0097  255  LYS A CE  
91  C CE  B LYS A 10 ? 0.2635 0.3334 0.2062 0.0077  0.0522  0.0266  255  LYS A CE  
92  N NZ  A LYS A 10 ? 0.2647 0.3416 0.2490 0.0116  0.0167  -0.0065 255  LYS A NZ  
93  N NZ  B LYS A 10 ? 0.2662 0.3297 0.2412 0.0168  0.0693  0.0253  255  LYS A NZ  
94  N N   . ILE A 11 ? 0.2298 0.1900 0.0592 0.0140  0.0070  -0.0004 256  ILE A N   
95  C CA  . ILE A 11 ? 0.2181 0.2033 0.0560 0.0007  0.0080  0.0096  256  ILE A CA  
96  C C   . ILE A 11 ? 0.2157 0.1686 0.0545 0.0024  0.0052  0.0021  256  ILE A C   
97  O O   . ILE A 11 ? 0.2519 0.1621 0.0733 0.0238  0.0092  0.0112  256  ILE A O   
98  C CB  . ILE A 11 ? 0.2421 0.2768 0.0827 0.0006  0.0101  0.0453  256  ILE A CB  
99  C CG1 . ILE A 11 ? 0.2644 0.3600 0.1404 -0.0061 0.0188  0.0556  256  ILE A CG1 
100 C CG2 . ILE A 11 ? 0.2457 0.3010 0.1086 0.0087  -0.0166 0.0482  256  ILE A CG2 
101 C CD1 . ILE A 11 ? 0.2860 0.3884 0.2704 0.0053  0.0265  0.0341  256  ILE A CD1 
102 N N   . VAL A 12 ? 0.2054 0.1827 0.0527 0.0016  0.0050  0.0103  257  VAL A N   
103 C CA  A VAL A 12 ? 0.2187 0.1852 0.0565 -0.0125 -0.0001 0.0011  257  VAL A CA  
104 C CA  B VAL A 12 ? 0.2243 0.1901 0.0572 0.0001  0.0080  0.0066  257  VAL A CA  
105 C C   . VAL A 12 ? 0.2217 0.1807 0.0573 0.0123  0.0084  0.0045  257  VAL A C   
106 O O   . VAL A 12 ? 0.2458 0.1911 0.0801 0.0431  0.0074  -0.0143 257  VAL A O   
107 C CB  A VAL A 12 ? 0.2174 0.1977 0.0899 -0.0263 -0.0104 0.0260  257  VAL A CB  
108 C CB  B VAL A 12 ? 0.2392 0.2079 0.0717 -0.0008 0.0186  0.0271  257  VAL A CB  
109 C CG1 A VAL A 12 ? 0.2278 0.2149 0.1306 -0.0123 -0.0378 0.0487  257  VAL A CG1 
110 C CG1 B VAL A 12 ? 0.2498 0.2307 0.1193 0.0065  0.0162  0.0159  257  VAL A CG1 
111 C CG2 A VAL A 12 ? 0.2033 0.1978 0.1229 -0.0329 -0.0073 0.0050  257  VAL A CG2 
112 C CG2 B VAL A 12 ? 0.2421 0.2026 0.0765 -0.0068 0.0191  0.0421  257  VAL A CG2 
113 N N   . ARG A 13 ? 0.2437 0.1811 0.0624 0.0169  0.0015  0.0036  258  ARG A N   
114 C CA  . ARG A 13 ? 0.2521 0.2131 0.0661 0.0198  -0.0059 -0.0082 258  ARG A CA  
115 C C   . ARG A 13 ? 0.2578 0.2012 0.0706 0.0302  -0.0137 -0.0047 258  ARG A C   
116 O O   . ARG A 13 ? 0.2770 0.2163 0.1124 0.0387  0.0198  0.0136  258  ARG A O   
117 C CB  . ARG A 13 ? 0.2822 0.2772 0.1010 -0.0107 -0.0196 -0.0048 258  ARG A CB  
118 C CG  . ARG A 13 ? 0.3242 0.3136 0.2030 -0.0235 -0.0002 0.0023  258  ARG A CG  
119 C CD  . ARG A 13 ? 0.3635 0.3417 0.3137 -0.0329 -0.0075 0.0000  258  ARG A CD  
120 N NE  . ARG A 13 ? 0.3974 0.3664 0.3743 -0.0449 -0.0250 -0.0271 258  ARG A NE  
121 C CZ  . ARG A 13 ? 0.4161 0.3898 0.3616 -0.0633 -0.0261 -0.0358 258  ARG A CZ  
122 N NH1 . ARG A 13 ? 0.4188 0.3911 0.3912 -0.0803 -0.0423 -0.0295 258  ARG A NH1 
123 N NH2 . ARG A 13 ? 0.4278 0.4078 0.3128 -0.0664 -0.0105 -0.0532 258  ARG A NH2 
124 N N   . ILE A 14 ? 0.2685 0.2257 0.0740 0.0209  -0.0214 0.0149  259  ILE A N   
125 C CA  A ILE A 14 ? 0.2774 0.2511 0.0742 0.0017  -0.0146 0.0242  259  ILE A CA  
126 C CA  B ILE A 14 ? 0.2663 0.2318 0.0813 0.0149  -0.0201 0.0136  259  ILE A CA  
127 C C   . ILE A 14 ? 0.2676 0.2327 0.0722 0.0159  -0.0160 0.0171  259  ILE A C   
128 O O   . ILE A 14 ? 0.2564 0.2439 0.0824 0.0235  -0.0115 0.0084  259  ILE A O   
129 C CB  A ILE A 14 ? 0.2987 0.2772 0.1309 -0.0127 -0.0194 0.0235  259  ILE A CB  
130 C CB  B ILE A 14 ? 0.2515 0.2276 0.1176 0.0121  -0.0208 -0.0018 259  ILE A CB  
131 C CG1 A ILE A 14 ? 0.3088 0.2775 0.1573 -0.0189 -0.0666 0.0078  259  ILE A CG1 
132 C CG1 B ILE A 14 ? 0.2469 0.2427 0.1698 0.0097  -0.0250 -0.0008 259  ILE A CG1 
133 C CG2 A ILE A 14 ? 0.2985 0.2939 0.1667 -0.0150 0.0157  0.0490  259  ILE A CG2 
134 C CG2 B ILE A 14 ? 0.2373 0.2038 0.0877 0.0112  -0.0270 -0.0038 259  ILE A CG2 
135 C CD1 A ILE A 14 ? 0.3313 0.2845 0.1972 -0.0201 -0.0594 -0.0034 259  ILE A CD1 
136 C CD1 B ILE A 14 ? 0.2425 0.2498 0.1777 0.0077  -0.0391 -0.0107 259  ILE A CD1 
137 N N   . GLU A 15 ? 0.2880 0.2185 0.0747 0.0131  -0.0137 0.0078  260  GLU A N   
138 C CA  A GLU A 15 ? 0.3089 0.2056 0.0786 0.0010  -0.0131 -0.0036 260  GLU A CA  
139 C CA  B GLU A 15 ? 0.3027 0.2097 0.0765 0.0072  -0.0071 0.0032  260  GLU A CA  
140 C C   . GLU A 15 ? 0.2845 0.2006 0.0850 -0.0033 -0.0031 0.0059  260  GLU A C   
141 O O   . GLU A 15 ? 0.2676 0.2236 0.1346 -0.0021 0.0057  0.0254  260  GLU A O   
142 C CB  A GLU A 15 ? 0.3726 0.2256 0.1062 -0.0018 -0.0025 -0.0206 260  GLU A CB  
143 C CB  B GLU A 15 ? 0.3484 0.2341 0.1024 0.0164  0.0122  -0.0018 260  GLU A CB  
144 C CG  A GLU A 15 ? 0.4174 0.2506 0.1764 -0.0103 -0.0228 -0.0321 260  GLU A CG  
145 C CG  B GLU A 15 ? 0.3799 0.2618 0.1752 0.0210  0.0024  -0.0011 260  GLU A CG  
146 C CD  A GLU A 15 ? 0.4609 0.2768 0.2314 -0.0216 -0.0428 -0.0211 260  GLU A CD  
147 C CD  B GLU A 15 ? 0.4004 0.2878 0.2203 0.0222  -0.0045 0.0139  260  GLU A CD  
148 O OE1 A GLU A 15 ? 0.4803 0.2890 0.2139 -0.0254 -0.0583 -0.0134 260  GLU A OE1 
149 O OE1 B GLU A 15 ? 0.4105 0.3000 0.2657 0.0211  -0.0255 0.0157  260  GLU A OE1 
150 O OE2 A GLU A 15 ? 0.4789 0.2914 0.2908 -0.0277 -0.0301 -0.0208 260  GLU A OE2 
151 O OE2 B GLU A 15 ? 0.4018 0.2960 0.2350 0.0261  0.0048  0.0221  260  GLU A OE2 
152 N N   . LYS A 16 ? 0.2760 0.1872 0.0825 -0.0048 -0.0149 0.0061  261  LYS A N   
153 C CA  . LYS A 16 ? 0.2582 0.1791 0.0810 -0.0112 -0.0239 0.0102  261  LYS A CA  
154 C C   . LYS A 16 ? 0.2513 0.1930 0.0858 -0.0228 0.0018  0.0179  261  LYS A C   
155 O O   . LYS A 16 ? 0.2486 0.2136 0.0966 -0.0334 -0.0096 0.0305  261  LYS A O   
156 C CB  . LYS A 16 ? 0.2566 0.1986 0.1028 0.0088  -0.0142 0.0055  261  LYS A CB  
157 C CG  . LYS A 16 ? 0.2488 0.1912 0.1033 -0.0063 -0.0137 0.0091  261  LYS A CG  
158 C CD  . LYS A 16 ? 0.2391 0.1920 0.1269 -0.0104 -0.0100 -0.0057 261  LYS A CD  
159 C CE  . LYS A 16 ? 0.2318 0.1953 0.0741 -0.0188 -0.0078 0.0026  261  LYS A CE  
160 N NZ  . LYS A 16 ? 0.2258 0.2059 0.0994 -0.0280 -0.0144 0.0220  261  LYS A NZ  
161 N N   . ALA A 17 ? 0.2676 0.2046 0.0752 -0.0230 0.0057  0.0176  262  ALA A N   
162 C CA  . ALA A 17 ? 0.2557 0.2263 0.0741 -0.0196 -0.0048 0.0331  262  ALA A CA  
163 C C   . ALA A 17 ? 0.2463 0.2332 0.0686 -0.0260 -0.0097 0.0128  262  ALA A C   
164 O O   . ALA A 17 ? 0.2572 0.2312 0.0805 -0.0328 -0.0355 0.0210  262  ALA A O   
165 C CB  . ALA A 17 ? 0.2905 0.2565 0.0919 -0.0166 0.0196  0.0413  262  ALA A CB  
166 N N   . ARG A 18 ? 0.2425 0.2507 0.1006 -0.0314 -0.0299 0.0358  263  ARG A N   
167 C CA  . ARG A 18 ? 0.2274 0.2642 0.1211 -0.0408 -0.0323 0.0235  263  ARG A CA  
168 C C   . ARG A 18 ? 0.2187 0.2507 0.0911 -0.0508 -0.0283 0.0430  263  ARG A C   
169 O O   . ARG A 18 ? 0.2437 0.2631 0.0956 -0.0434 -0.0186 0.0337  263  ARG A O   
170 C CB  A ARG A 18 ? 0.2689 0.2982 0.1905 -0.0390 -0.0529 0.0252  263  ARG A CB  
171 C CB  B ARG A 18 ? 0.2689 0.2982 0.1905 -0.0390 -0.0529 0.0252  263  ARG A CB  
172 C CG  A ARG A 18 ? 0.3098 0.3464 0.2703 -0.0214 -0.0849 -0.0066 263  ARG A CG  
173 C CG  B ARG A 18 ? 0.3098 0.3464 0.2703 -0.0214 -0.0849 -0.0066 263  ARG A CG  
174 N N   . ASP A 19 ? 0.2242 0.2482 0.1345 -0.0480 -0.0506 0.0320  264  ASP A N   
175 C CA  . ASP A 19 ? 0.2447 0.2692 0.1060 -0.0343 -0.0354 0.0548  264  ASP A CA  
176 C C   . ASP A 19 ? 0.2341 0.2426 0.1122 -0.0375 -0.0233 0.0345  264  ASP A C   
177 O O   . ASP A 19 ? 0.2561 0.2510 0.1323 -0.0338 -0.0051 0.0549  264  ASP A O   
178 C CB  . ASP A 19 ? 0.2848 0.3301 0.1718 -0.0157 -0.0532 0.0737  264  ASP A CB  
179 C CG  . ASP A 19 ? 0.3181 0.3813 0.2482 -0.0072 -0.0901 0.0591  264  ASP A CG  
180 O OD1 . ASP A 19 ? 0.3363 0.4058 0.3556 0.0174  -0.0746 0.0273  264  ASP A OD1 
181 O OD2 . ASP A 19 ? 0.3136 0.4002 0.3123 -0.0139 -0.1344 0.0593  264  ASP A OD2 
182 N N   . ILE A 20 ? 0.2199 0.2529 0.0819 -0.0269 -0.0239 0.0227  265  ILE A N   
183 C CA  . ILE A 20 ? 0.2104 0.2498 0.0791 -0.0338 -0.0081 0.0013  265  ILE A CA  
184 C C   . ILE A 20 ? 0.2011 0.2259 0.0805 -0.0357 -0.0139 0.0144  265  ILE A C   
185 O O   . ILE A 20 ? 0.2069 0.2366 0.0853 -0.0356 -0.0061 0.0247  265  ILE A O   
186 C CB  . ILE A 20 ? 0.2237 0.2648 0.0708 -0.0268 0.0120  0.0005  265  ILE A CB  
187 C CG1 . ILE A 20 ? 0.2751 0.2867 0.0983 -0.0195 0.0051  -0.0242 265  ILE A CG1 
188 C CG2 . ILE A 20 ? 0.2286 0.2827 0.1100 -0.0268 0.0058  0.0079  265  ILE A CG2 
189 C CD1 . ILE A 20 ? 0.2881 0.2983 0.0899 -0.0230 -0.0130 -0.0388 265  ILE A CD1 
190 N N   . PRO A 21 ? 0.1972 0.2089 0.0779 -0.0275 -0.0067 0.0190  266  PRO A N   
191 C CA  . PRO A 21 ? 0.2047 0.2052 0.0927 -0.0270 -0.0152 0.0132  266  PRO A CA  
192 C C   . PRO A 21 ? 0.1920 0.2047 0.0991 -0.0304 -0.0174 -0.0008 266  PRO A C   
193 O O   . PRO A 21 ? 0.1992 0.2003 0.1032 -0.0162 -0.0078 0.0051  266  PRO A O   
194 C CB  . PRO A 21 ? 0.2293 0.1842 0.1334 -0.0293 -0.0185 0.0191  266  PRO A CB  
195 C CG  . PRO A 21 ? 0.2272 0.1884 0.1450 -0.0261 -0.0253 0.0071  266  PRO A CG  
196 C CD  . PRO A 21 ? 0.2124 0.1904 0.1427 -0.0289 0.0010  0.0161  266  PRO A CD  
197 N N   . LEU A 22 ? 0.1960 0.2099 0.0853 -0.0215 -0.0155 0.0166  267  LEU A N   
198 C CA  A LEU A 22 ? 0.2212 0.2138 0.0989 -0.0107 -0.0007 0.0247  267  LEU A CA  
199 C CA  B LEU A 22 ? 0.2299 0.2165 0.0996 -0.0146 -0.0009 0.0287  267  LEU A CA  
200 C C   . LEU A 22 ? 0.2308 0.2099 0.1125 0.0003  -0.0207 0.0125  267  LEU A C   
201 O O   . LEU A 22 ? 0.2698 0.2099 0.1654 0.0142  -0.0286 -0.0036 267  LEU A O   
202 C CB  A LEU A 22 ? 0.2561 0.2380 0.1328 -0.0106 0.0097  0.0304  267  LEU A CB  
203 C CB  B LEU A 22 ? 0.2862 0.2589 0.1403 -0.0182 -0.0170 0.0245  267  LEU A CB  
204 C CG  A LEU A 22 ? 0.2733 0.2409 0.1262 -0.0212 0.0084  0.0179  267  LEU A CG  
205 C CG  B LEU A 22 ? 0.3076 0.2710 0.1621 -0.0407 -0.0327 0.0200  267  LEU A CG  
206 C CD1 A LEU A 22 ? 0.2741 0.2365 0.1566 -0.0257 0.0027  0.0021  267  LEU A CD1 
207 C CD1 B LEU A 22 ? 0.3151 0.2932 0.1426 -0.0483 -0.0083 0.0338  267  LEU A CD1 
208 C CD2 A LEU A 22 ? 0.2830 0.2481 0.0917 -0.0259 0.0158  0.0486  267  LEU A CD2 
209 C CD2 B LEU A 22 ? 0.3076 0.2568 0.1577 -0.0570 -0.0629 0.0203  267  LEU A CD2 
210 N N   . GLY A 23 ? 0.2085 0.2020 0.0941 -0.0200 -0.0166 0.0044  268  GLY A N   
211 C CA  . GLY A 23 ? 0.2026 0.2303 0.1036 -0.0175 -0.0072 -0.0142 268  GLY A CA  
212 C C   . GLY A 23 ? 0.1693 0.2064 0.1184 -0.0324 -0.0064 -0.0160 268  GLY A C   
213 O O   . GLY A 23 ? 0.1829 0.1967 0.1391 -0.0070 0.0044  0.0093  268  GLY A O   
214 N N   . ALA A 24 ? 0.1951 0.2095 0.1216 -0.0222 -0.0211 -0.0356 269  ALA A N   
215 C CA  . ALA A 24 ? 0.2088 0.2054 0.1162 -0.0135 -0.0281 -0.0160 269  ALA A CA  
216 C C   . ALA A 24 ? 0.2030 0.2077 0.1193 0.0003  -0.0298 -0.0150 269  ALA A C   
217 O O   . ALA A 24 ? 0.2234 0.2119 0.1798 0.0333  -0.0715 -0.0467 269  ALA A O   
218 C CB  . ALA A 24 ? 0.2303 0.2174 0.1443 -0.0135 -0.0327 0.0125  269  ALA A CB  
219 N N   . THR A 25 ? 0.2012 0.2077 0.0973 -0.0174 -0.0188 -0.0257 270  THR A N   
220 C CA  . THR A 25 ? 0.1903 0.1970 0.0911 -0.0240 -0.0143 -0.0185 270  THR A CA  
221 C C   . THR A 25 ? 0.1875 0.1837 0.0920 -0.0191 -0.0164 -0.0025 270  THR A C   
222 O O   . THR A 25 ? 0.1911 0.1892 0.1101 -0.0236 -0.0145 0.0005  270  THR A O   
223 C CB  . THR A 25 ? 0.1969 0.2203 0.0869 -0.0276 -0.0084 0.0115  270  THR A CB  
224 O OG1 . THR A 25 ? 0.1812 0.2091 0.1354 -0.0185 -0.0208 0.0183  270  THR A OG1 
225 C CG2 . THR A 25 ? 0.2165 0.2444 0.1202 -0.0467 -0.0090 0.0057  270  THR A CG2 
226 N N   . VAL A 26 ? 0.1957 0.1747 0.0952 -0.0322 0.0039  -0.0223 271  VAL A N   
227 C CA  . VAL A 26 ? 0.2093 0.1770 0.0790 -0.0381 0.0009  -0.0088 271  VAL A CA  
228 C C   . VAL A 26 ? 0.2132 0.1628 0.0940 -0.0333 0.0060  0.0036  271  VAL A C   
229 O O   . VAL A 26 ? 0.2429 0.1889 0.0942 -0.0402 -0.0009 0.0100  271  VAL A O   
230 C CB  . VAL A 26 ? 0.2124 0.1711 0.1222 -0.0302 0.0178  -0.0076 271  VAL A CB  
231 C CG1 . VAL A 26 ? 0.2118 0.1730 0.1561 -0.0309 0.0056  -0.0240 271  VAL A CG1 
232 C CG2 . VAL A 26 ? 0.2268 0.1966 0.1228 -0.0207 -0.0051 -0.0022 271  VAL A CG2 
233 N N   . ARG A 27 ? 0.2213 0.1679 0.0960 -0.0141 0.0181  -0.0116 272  ARG A N   
234 C CA  . ARG A 27 ? 0.2263 0.1701 0.1088 -0.0306 -0.0048 -0.0042 272  ARG A CA  
235 C C   . ARG A 27 ? 0.2363 0.1669 0.1118 -0.0228 -0.0085 -0.0073 272  ARG A C   
236 O O   . ARG A 27 ? 0.2519 0.1636 0.1066 -0.0185 0.0072  -0.0122 272  ARG A O   
237 C CB  . ARG A 27 ? 0.2311 0.2000 0.1407 -0.0328 -0.0178 -0.0146 272  ARG A CB  
238 C CG  . ARG A 27 ? 0.2185 0.2392 0.1882 -0.0317 -0.0057 0.0182  272  ARG A CG  
239 C CD  . ARG A 27 ? 0.2391 0.2957 0.2465 -0.0359 -0.0467 0.0339  272  ARG A CD  
240 N NE  . ARG A 27 ? 0.2602 0.3379 0.2462 -0.0347 -0.0537 0.0069  272  ARG A NE  
241 C CZ  . ARG A 27 ? 0.2833 0.3632 0.2192 -0.0370 -0.0644 0.0230  272  ARG A CZ  
242 N NH1 . ARG A 27 ? 0.3059 0.3833 0.2314 -0.0441 -0.0524 0.0095  272  ARG A NH1 
243 N NH2 . ARG A 27 ? 0.2768 0.3787 0.2455 -0.0207 -0.0662 0.0490  272  ARG A NH2 
244 N N   . ASN A 28 ? 0.2684 0.1754 0.0996 -0.0309 0.0001  -0.0140 273  ASN A N   
245 C CA  . ASN A 28 ? 0.2853 0.2087 0.0954 -0.0249 0.0179  -0.0200 273  ASN A CA  
246 C C   . ASN A 28 ? 0.3183 0.2635 0.0937 -0.0348 0.0069  -0.0188 273  ASN A C   
247 O O   . ASN A 28 ? 0.3089 0.2789 0.1440 -0.0530 0.0030  -0.0048 273  ASN A O   
248 C CB  . ASN A 28 ? 0.2754 0.2068 0.1315 -0.0036 0.0198  -0.0223 273  ASN A CB  
249 C CG  . ASN A 28 ? 0.2629 0.2023 0.1389 -0.0036 0.0182  -0.0239 273  ASN A CG  
250 O OD1 . ASN A 28 ? 0.2635 0.1988 0.1494 -0.0133 0.0074  -0.0241 273  ASN A OD1 
251 N ND2 . ASN A 28 ? 0.2530 0.2133 0.1393 -0.0121 0.0104  -0.0079 273  ASN A ND2 
252 N N   A GLU A 29 ? 0.3444 0.2876 0.1265 -0.0323 0.0245  -0.0486 274  GLU A N   
253 N N   B GLU A 29 ? 0.3468 0.3036 0.1043 -0.0508 -0.0414 -0.0065 274  GLU A N   
254 C CA  A GLU A 29 ? 0.3734 0.3325 0.1824 -0.0290 0.0505  -0.0746 274  GLU A CA  
255 C CA  B GLU A 29 ? 0.3836 0.3623 0.1594 -0.0641 -0.0660 -0.0272 274  GLU A CA  
256 C C   A GLU A 29 ? 0.3860 0.3335 0.2188 -0.0128 0.0810  -0.0690 274  GLU A C   
257 C C   B GLU A 29 ? 0.4124 0.3898 0.2136 -0.0602 -0.0490 -0.0360 274  GLU A C   
258 O O   A GLU A 29 ? 0.3876 0.3205 0.2322 -0.0148 0.0917  -0.0719 274  GLU A O   
259 O O   B GLU A 29 ? 0.4166 0.3940 0.2022 -0.0565 -0.0550 -0.0078 274  GLU A O   
260 C CB  A GLU A 29 ? 0.3849 0.3711 0.2405 -0.0299 0.0669  -0.0744 274  GLU A CB  
261 C CB  B GLU A 29 ? 0.3943 0.3942 0.2069 -0.0649 -0.0771 -0.0172 274  GLU A CB  
262 C CG  A GLU A 29 ? 0.3923 0.3962 0.2993 -0.0249 0.0705  -0.0771 274  GLU A CG  
263 C CG  B GLU A 29 ? 0.4032 0.4199 0.2695 -0.0556 -0.0790 -0.0058 274  GLU A CG  
264 C CD  A GLU A 29 ? 0.4038 0.4202 0.3584 -0.0190 0.0796  -0.0722 274  GLU A CD  
265 C CD  B GLU A 29 ? 0.4148 0.4380 0.3663 -0.0525 -0.0639 -0.0076 274  GLU A CD  
266 O OE1 A GLU A 29 ? 0.4156 0.4382 0.3922 -0.0173 0.0629  -0.0591 274  GLU A OE1 
267 O OE1 B GLU A 29 ? 0.4250 0.4414 0.3788 -0.0507 -0.0557 0.0032  274  GLU A OE1 
268 O OE2 A GLU A 29 ? 0.4109 0.4255 0.3747 -0.0072 0.0913  -0.0763 274  GLU A OE2 
269 O OE2 B GLU A 29 ? 0.4056 0.4462 0.4010 -0.0539 -0.0618 -0.0265 274  GLU A OE2 
270 N N   A MET A 30 ? 0.3951 0.3460 0.2292 0.0023  0.0946  -0.0767 275  MET A N   
271 N N   B MET A 30 ? 0.4338 0.4137 0.2915 -0.0518 -0.0096 -0.0532 275  MET A N   
272 C CA  A MET A 30 ? 0.4070 0.3582 0.2764 0.0186  0.0810  -0.0682 275  MET A CA  
273 C CA  B MET A 30 ? 0.4455 0.4234 0.3252 -0.0414 0.0217  -0.0756 275  MET A CA  
274 C C   A MET A 30 ? 0.3901 0.3419 0.2710 0.0312  0.1064  -0.0819 275  MET A C   
275 C C   B MET A 30 ? 0.4452 0.4124 0.3140 -0.0301 0.0371  -0.1059 275  MET A C   
276 O O   A MET A 30 ? 0.3867 0.3413 0.2588 0.0389  0.1083  -0.0444 275  MET A O   
277 O O   B MET A 30 ? 0.4573 0.4287 0.3058 -0.0347 0.0491  -0.1181 275  MET A O   
278 C CB  A MET A 30 ? 0.4358 0.3859 0.3346 0.0171  0.0511  -0.0700 275  MET A CB  
279 C CB  B MET A 30 ? 0.4538 0.4339 0.3484 -0.0429 0.0316  -0.0687 275  MET A CB  
280 C CG  A MET A 30 ? 0.4666 0.4161 0.3973 0.0117  0.0303  -0.0565 275  MET A CG  
281 S SD  A MET A 30 ? 0.4973 0.4420 0.4670 0.0041  0.0193  -0.0331 275  MET A SD  
282 C CE  A MET A 30 ? 0.4962 0.4405 0.4741 0.0081  0.0156  -0.0379 275  MET A CE  
283 N N   A ASP A 31 ? 0.3844 0.3366 0.2968 0.0304  0.0941  -0.1286 276  ASP A N   
284 N N   B ASP A 31 ? 0.4214 0.3905 0.2936 -0.0145 0.0379  -0.1112 276  ASP A N   
285 C CA  A ASP A 31 ? 0.3759 0.3408 0.3568 0.0199  0.0741  -0.0966 276  ASP A CA  
286 C CA  B ASP A 31 ? 0.3938 0.3741 0.2814 -0.0033 0.0446  -0.0638 276  ASP A CA  
287 C C   A ASP A 31 ? 0.3517 0.3080 0.3683 0.0084  0.0349  -0.0839 276  ASP A C   
288 C C   B ASP A 31 ? 0.3566 0.3316 0.1787 0.0147  0.0292  -0.0364 276  ASP A C   
289 O O   A ASP A 31 ? 0.3474 0.3206 0.4514 0.0082  0.0208  -0.0775 276  ASP A O   
290 O O   B ASP A 31 ? 0.3502 0.3382 0.1075 0.0212  0.0361  0.0044  276  ASP A O   
291 C CB  A ASP A 31 ? 0.3928 0.3682 0.3875 0.0184  0.0924  -0.0986 276  ASP A CB  
292 C CB  B ASP A 31 ? 0.3998 0.3836 0.3086 -0.0086 0.0452  -0.0656 276  ASP A CB  
293 C CG  A ASP A 31 ? 0.4134 0.3932 0.4163 0.0128  0.1027  -0.1056 276  ASP A CG  
294 O OD1 A ASP A 31 ? 0.4261 0.4029 0.4204 0.0257  0.1099  -0.1221 276  ASP A OD1 
295 O OD2 A ASP A 31 ? 0.4248 0.4064 0.4538 -0.0008 0.0891  -0.0906 276  ASP A OD2 
296 N N   A SER A 32 ? 0.3268 0.2604 0.2676 0.0025  0.0284  -0.0542 277  SER A N   
297 N N   B SER A 32 ? 0.2988 0.2798 0.0929 0.0140  0.0296  -0.0475 277  SER A N   
298 C CA  A SER A 32 ? 0.2996 0.2261 0.1829 -0.0050 0.0319  -0.0448 277  SER A CA  
299 C CA  B SER A 32 ? 0.2970 0.2597 0.0880 0.0185  0.0192  -0.0407 277  SER A CA  
300 C C   A SER A 32 ? 0.2531 0.1945 0.1424 -0.0229 0.0265  -0.0188 277  SER A C   
301 C C   B SER A 32 ? 0.2685 0.2199 0.0757 -0.0011 0.0188  -0.0157 277  SER A C   
302 O O   A SER A 32 ? 0.2447 0.1821 0.1837 -0.0326 0.0205  -0.0358 277  SER A O   
303 O O   B SER A 32 ? 0.2729 0.2108 0.0841 -0.0054 0.0014  -0.0400 277  SER A O   
304 C CB  A SER A 32 ? 0.3229 0.2507 0.1731 -0.0009 0.0396  -0.0177 277  SER A CB  
305 C CB  B SER A 32 ? 0.3387 0.2990 0.0894 0.0224  0.0178  0.0084  277  SER A CB  
306 O OG  A SER A 32 ? 0.3454 0.2772 0.2105 -0.0010 0.0145  -0.0428 277  SER A OG  
307 O OG  B SER A 32 ? 0.3770 0.3311 0.1058 0.0396  0.0356  0.0060  277  SER A OG  
308 N N   . VAL A 33 ? 0.2383 0.1860 0.0853 -0.0058 0.0111  -0.0236 278  VAL A N   
309 C CA  . VAL A 33 ? 0.2129 0.1817 0.0898 -0.0004 0.0021  -0.0180 278  VAL A CA  
310 C C   . VAL A 33 ? 0.2032 0.1623 0.0918 -0.0101 0.0002  0.0022  278  VAL A C   
311 O O   . VAL A 33 ? 0.2087 0.1574 0.1212 -0.0187 0.0069  0.0032  278  VAL A O   
312 C CB  . VAL A 33 ? 0.2040 0.1859 0.0906 -0.0018 -0.0041 -0.0098 278  VAL A CB  
313 C CG1 . VAL A 33 ? 0.2067 0.1903 0.0939 -0.0074 -0.0052 -0.0077 278  VAL A CG1 
314 C CG2 . VAL A 33 ? 0.2068 0.2088 0.1225 0.0073  -0.0097 -0.0125 278  VAL A CG2 
315 N N   . ILE A 34 ? 0.1932 0.1645 0.0959 -0.0119 0.0102  -0.0094 279  ILE A N   
316 C CA  . ILE A 34 ? 0.1989 0.1871 0.0767 -0.0157 -0.0020 -0.0020 279  ILE A CA  
317 C C   . ILE A 34 ? 0.1928 0.1748 0.0972 -0.0231 0.0035  0.0048  279  ILE A C   
318 O O   . ILE A 34 ? 0.2198 0.1879 0.1139 -0.0147 0.0149  0.0124  279  ILE A O   
319 C CB  . ILE A 34 ? 0.2358 0.2215 0.0786 -0.0084 0.0041  -0.0115 279  ILE A CB  
320 C CG1 . ILE A 34 ? 0.2615 0.2313 0.1144 -0.0260 -0.0045 -0.0114 279  ILE A CG1 
321 C CG2 . ILE A 34 ? 0.2402 0.2430 0.1333 0.0128  -0.0242 -0.0111 279  ILE A CG2 
322 C CD1 . ILE A 34 ? 0.2807 0.2332 0.1709 -0.0376 -0.0010 -0.0016 279  ILE A CD1 
323 N N   . ILE A 35 ? 0.1821 0.1845 0.0823 -0.0165 0.0093  -0.0011 280  ILE A N   
324 C CA  . ILE A 35 ? 0.1725 0.1945 0.0987 -0.0159 0.0079  -0.0149 280  ILE A CA  
325 C C   . ILE A 35 ? 0.1921 0.2227 0.0909 -0.0235 0.0122  0.0016  280  ILE A C   
326 O O   . ILE A 35 ? 0.2001 0.2275 0.1043 -0.0195 -0.0037 -0.0001 280  ILE A O   
327 C CB  . ILE A 35 ? 0.2018 0.2132 0.1340 -0.0086 0.0180  -0.0294 280  ILE A CB  
328 C CG1 . ILE A 35 ? 0.2181 0.2270 0.1194 -0.0136 0.0023  -0.0208 280  ILE A CG1 
329 C CG2 . ILE A 35 ? 0.2185 0.2389 0.1444 -0.0014 0.0279  -0.0289 280  ILE A CG2 
330 C CD1 . ILE A 35 ? 0.2252 0.2277 0.1413 -0.0009 -0.0068 -0.0035 280  ILE A CD1 
331 N N   . SER A 36 ? 0.1871 0.2464 0.1029 -0.0355 0.0139  0.0027  281  SER A N   
332 C CA  A SER A 36 ? 0.1854 0.2538 0.1044 -0.0351 0.0144  0.0038  281  SER A CA  
333 C CA  B SER A 36 ? 0.1898 0.2577 0.1181 -0.0420 -0.0001 -0.0044 281  SER A CA  
334 C C   . SER A 36 ? 0.1871 0.2637 0.1015 -0.0317 -0.0042 0.0188  281  SER A C   
335 O O   . SER A 36 ? 0.2012 0.3206 0.1027 -0.0075 -0.0011 0.0400  281  SER A O   
336 C CB  A SER A 36 ? 0.1939 0.2606 0.1005 -0.0354 0.0264  -0.0096 281  SER A CB  
337 C CB  B SER A 36 ? 0.1996 0.2665 0.1418 -0.0525 -0.0068 -0.0330 281  SER A CB  
338 O OG  A SER A 36 ? 0.2023 0.2620 0.0841 -0.0325 0.0203  -0.0224 281  SER A OG  
339 O OG  B SER A 36 ? 0.2037 0.2666 0.1393 -0.0544 0.0057  -0.0408 281  SER A OG  
340 N N   . ARG A 37 ? 0.1722 0.2097 0.0829 -0.0266 0.0123  0.0021  282  ARG A N   
341 C CA  . ARG A 37 ? 0.1817 0.2061 0.0943 -0.0221 0.0047  -0.0007 282  ARG A CA  
342 C C   . ARG A 37 ? 0.1830 0.1960 0.0949 -0.0143 -0.0195 0.0046  282  ARG A C   
343 O O   . ARG A 37 ? 0.1795 0.2081 0.1204 -0.0152 -0.0125 0.0066  282  ARG A O   
344 C CB  . ARG A 37 ? 0.1788 0.2013 0.1150 -0.0266 0.0044  0.0100  282  ARG A CB  
345 C CG  . ARG A 37 ? 0.1933 0.2074 0.0990 -0.0409 -0.0180 0.0007  282  ARG A CG  
346 C CD  . ARG A 37 ? 0.2096 0.2107 0.1123 -0.0437 0.0012  0.0228  282  ARG A CD  
347 N NE  . ARG A 37 ? 0.2066 0.2026 0.1023 -0.0352 0.0059  -0.0058 282  ARG A NE  
348 C CZ  . ARG A 37 ? 0.1897 0.2212 0.0996 -0.0285 0.0065  -0.0026 282  ARG A CZ  
349 N NH1 . ARG A 37 ? 0.1981 0.2484 0.1425 -0.0197 0.0137  0.0239  282  ARG A NH1 
350 N NH2 . ARG A 37 ? 0.2071 0.2252 0.1290 -0.0202 0.0066  0.0023  282  ARG A NH2 
351 N N   . ILE A 38 ? 0.2033 0.1956 0.0857 -0.0112 -0.0085 -0.0057 283  ILE A N   
352 C CA  . ILE A 38 ? 0.2301 0.1863 0.0994 -0.0141 -0.0047 -0.0002 283  ILE A CA  
353 C C   . ILE A 38 ? 0.2074 0.1803 0.0784 -0.0248 0.0016  -0.0025 283  ILE A C   
354 O O   . ILE A 38 ? 0.1977 0.2123 0.1169 -0.0317 -0.0023 0.0169  283  ILE A O   
355 C CB  . ILE A 38 ? 0.2569 0.1978 0.1117 -0.0069 -0.0194 0.0107  283  ILE A CB  
356 C CG1 . ILE A 38 ? 0.2573 0.2287 0.1183 -0.0050 -0.0121 0.0373  283  ILE A CG1 
357 C CG2 . ILE A 38 ? 0.2635 0.2094 0.1376 -0.0144 -0.0326 -0.0089 283  ILE A CG2 
358 C CD1 . ILE A 38 ? 0.2522 0.2450 0.1622 -0.0251 0.0217  0.0322  283  ILE A CD1 
359 N N   . VAL A 39 ? 0.2197 0.1743 0.0735 -0.0204 -0.0045 -0.0033 284  VAL A N   
360 C CA  . VAL A 39 ? 0.2132 0.1775 0.0835 -0.0259 0.0012  -0.0023 284  VAL A CA  
361 C C   . VAL A 39 ? 0.2236 0.1828 0.0969 -0.0217 0.0160  -0.0048 284  VAL A C   
362 O O   . VAL A 39 ? 0.2425 0.1732 0.1364 -0.0160 0.0134  -0.0067 284  VAL A O   
363 C CB  . VAL A 39 ? 0.2124 0.1994 0.0843 -0.0120 -0.0106 0.0061  284  VAL A CB  
364 C CG1 . VAL A 39 ? 0.2065 0.2427 0.1101 -0.0174 -0.0021 0.0188  284  VAL A CG1 
365 C CG2 . VAL A 39 ? 0.2316 0.1960 0.1331 -0.0037 -0.0107 0.0134  284  VAL A CG2 
366 N N   . LYS A 40 ? 0.2108 0.1988 0.1040 -0.0075 0.0120  0.0019  285  LYS A N   
367 C CA  A LYS A 40 ? 0.2124 0.2139 0.1557 -0.0104 0.0237  -0.0222 285  LYS A CA  
368 C CA  B LYS A 40 ? 0.2193 0.2131 0.1742 -0.0054 0.0257  -0.0216 285  LYS A CA  
369 C C   . LYS A 40 ? 0.2343 0.2088 0.1557 -0.0087 0.0235  -0.0135 285  LYS A C   
370 O O   . LYS A 40 ? 0.2396 0.2174 0.1595 -0.0225 0.0059  -0.0037 285  LYS A O   
371 C CB  A LYS A 40 ? 0.2081 0.2310 0.1452 -0.0049 0.0346  -0.0209 285  LYS A CB  
372 C CB  B LYS A 40 ? 0.2278 0.2280 0.2071 0.0082  0.0367  -0.0253 285  LYS A CB  
373 C CG  A LYS A 40 ? 0.2155 0.2493 0.1611 -0.0083 0.0268  -0.0147 285  LYS A CG  
374 C CG  B LYS A 40 ? 0.2479 0.2443 0.2599 0.0144  0.0237  -0.0087 285  LYS A CG  
375 C CD  A LYS A 40 ? 0.2297 0.2561 0.1688 -0.0040 0.0169  -0.0269 285  LYS A CD  
376 C CD  B LYS A 40 ? 0.2569 0.2549 0.2917 0.0281  0.0241  -0.0095 285  LYS A CD  
377 N N   . GLY A 41 ? 0.2460 0.2025 0.1954 -0.0239 0.0480  -0.0313 286  GLY A N   
378 C CA  . GLY A 41 ? 0.2480 0.2140 0.1785 -0.0293 0.0345  -0.0378 286  GLY A CA  
379 C C   . GLY A 41 ? 0.2523 0.2195 0.1674 -0.0322 0.0194  -0.0430 286  GLY A C   
380 O O   . GLY A 41 ? 0.2800 0.2373 0.1849 -0.0300 0.0117  -0.0491 286  GLY A O   
381 N N   . GLY A 42 ? 0.2345 0.2198 0.1339 -0.0332 0.0334  -0.0050 287  GLY A N   
382 C CA  . GLY A 42 ? 0.2300 0.2010 0.1466 -0.0374 0.0213  0.0175  287  GLY A CA  
383 C C   . GLY A 42 ? 0.2319 0.1736 0.1417 -0.0149 0.0195  -0.0016 287  GLY A C   
384 O O   . GLY A 42 ? 0.2391 0.1741 0.1638 -0.0170 0.0258  0.0106  287  GLY A O   
385 N N   . ALA A 43 ? 0.2180 0.1809 0.1215 -0.0294 0.0264  -0.0072 288  ALA A N   
386 C CA  . ALA A 43 ? 0.2226 0.1906 0.1374 -0.0332 0.0218  0.0053  288  ALA A CA  
387 C C   . ALA A 43 ? 0.2225 0.1781 0.1216 -0.0298 0.0107  0.0148  288  ALA A C   
388 O O   . ALA A 43 ? 0.2351 0.1781 0.1689 -0.0375 0.0064  0.0084  288  ALA A O   
389 C CB  . ALA A 43 ? 0.2169 0.1989 0.1724 -0.0404 0.0023  0.0017  288  ALA A CB  
390 N N   . ALA A 44 ? 0.2328 0.1877 0.1216 -0.0247 0.0041  0.0074  289  ALA A N   
391 C CA  . ALA A 44 ? 0.2428 0.1836 0.1347 -0.0124 0.0058  0.0048  289  ALA A CA  
392 C C   . ALA A 44 ? 0.2446 0.1900 0.1474 -0.0170 0.0076  0.0148  289  ALA A C   
393 O O   . ALA A 44 ? 0.2524 0.2022 0.1858 -0.0207 0.0109  0.0390  289  ALA A O   
394 C CB  . ALA A 44 ? 0.2657 0.2065 0.1325 -0.0262 0.0043  -0.0136 289  ALA A CB  
395 N N   . GLU A 45 ? 0.2316 0.2030 0.1390 -0.0174 -0.0089 0.0099  290  GLU A N   
396 C CA  . GLU A 45 ? 0.2301 0.2053 0.1872 -0.0125 0.0039  0.0083  290  GLU A CA  
397 C C   . GLU A 45 ? 0.2477 0.1994 0.1995 -0.0043 -0.0077 0.0016  290  GLU A C   
398 O O   . GLU A 45 ? 0.2633 0.2148 0.2535 0.0006  -0.0219 0.0228  290  GLU A O   
399 C CB  . GLU A 45 ? 0.2358 0.2390 0.2027 -0.0072 0.0226  0.0268  290  GLU A CB  
400 C CG  . GLU A 45 ? 0.2496 0.2836 0.2440 0.0134  0.0078  0.0224  290  GLU A CG  
401 C CD  . GLU A 45 ? 0.2922 0.3206 0.3152 0.0408  0.0000  0.0367  290  GLU A CD  
402 O OE1 . GLU A 45 ? 0.3167 0.3291 0.3046 0.0531  0.0301  0.0669  290  GLU A OE1 
403 O OE2 . GLU A 45 ? 0.2991 0.3302 0.3568 0.0509  0.0069  0.0192  290  GLU A OE2 
404 N N   . LYS A 46 ? 0.2618 0.1888 0.1718 -0.0218 0.0097  -0.0139 291  LYS A N   
405 C CA  . LYS A 46 ? 0.3159 0.2048 0.1991 -0.0172 0.0150  -0.0182 291  LYS A CA  
406 C C   . LYS A 46 ? 0.3327 0.1869 0.1919 -0.0139 0.0168  -0.0019 291  LYS A C   
407 O O   . LYS A 46 ? 0.3764 0.1736 0.2538 -0.0020 0.0421  -0.0129 291  LYS A O   
408 C CB  . LYS A 46 ? 0.3657 0.2409 0.1890 -0.0113 0.0236  -0.0100 291  LYS A CB  
409 C CG  . LYS A 46 ? 0.4073 0.2894 0.2192 -0.0179 0.0182  0.0057  291  LYS A CG  
410 C CD  . LYS A 46 ? 0.4533 0.3467 0.2795 -0.0257 0.0264  0.0022  291  LYS A CD  
411 C CE  . LYS A 46 ? 0.4826 0.3821 0.3331 -0.0252 0.0200  -0.0003 291  LYS A CE  
412 N NZ  . LYS A 46 ? 0.5045 0.4044 0.3829 -0.0210 0.0143  -0.0147 291  LYS A NZ  
413 N N   . SER A 47 ? 0.3123 0.1946 0.1721 -0.0271 0.0373  0.0116  292  SER A N   
414 C CA  . SER A 47 ? 0.3116 0.2038 0.1920 -0.0262 0.0392  0.0275  292  SER A CA  
415 C C   . SER A 47 ? 0.3277 0.2161 0.1887 0.0009  0.0469  0.0372  292  SER A C   
416 O O   . SER A 47 ? 0.3781 0.2055 0.1938 0.0244  0.0391  0.0309  292  SER A O   
417 C CB  . SER A 47 ? 0.2979 0.2193 0.2541 -0.0205 0.0458  0.0240  292  SER A CB  
418 O OG  . SER A 47 ? 0.2970 0.2171 0.2792 0.0014  0.0713  0.0453  292  SER A OG  
419 N N   . GLY A 48 ? 0.2924 0.2608 0.1844 0.0456  0.0375  0.0223  293  GLY A N   
420 C CA  . GLY A 48 ? 0.3039 0.2975 0.1829 0.0356  0.0578  -0.0028 293  GLY A CA  
421 C C   . GLY A 48 ? 0.3042 0.3013 0.1984 0.0248  0.0733  0.0098  293  GLY A C   
422 O O   . GLY A 48 ? 0.3217 0.3486 0.2421 0.0358  0.0570  0.0151  293  GLY A O   
423 N N   . LEU A 49 ? 0.2745 0.2378 0.2163 -0.0106 0.0866  -0.0059 294  LEU A N   
424 C CA  . LEU A 49 ? 0.2977 0.2377 0.2469 -0.0224 0.0964  -0.0318 294  LEU A CA  
425 C C   . LEU A 49 ? 0.2911 0.2266 0.2228 -0.0330 0.0924  -0.0072 294  LEU A C   
426 O O   . LEU A 49 ? 0.3317 0.2252 0.2355 -0.0622 0.1315  -0.0138 294  LEU A O   
427 C CB  . LEU A 49 ? 0.3268 0.2570 0.3106 -0.0394 0.1072  -0.0698 294  LEU A CB  
428 C CG  . LEU A 49 ? 0.3546 0.2758 0.3426 -0.0477 0.0994  -0.0853 294  LEU A CG  
429 C CD1 . LEU A 49 ? 0.3483 0.2805 0.3359 -0.0526 0.1228  -0.0702 294  LEU A CD1 
430 C CD2 . LEU A 49 ? 0.3736 0.2785 0.3896 -0.0466 0.0987  -0.0806 294  LEU A CD2 
431 N N   . LEU A 50 ? 0.2526 0.2194 0.1757 -0.0089 0.0472  0.0042  295  LEU A N   
432 C CA  . LEU A 50 ? 0.2384 0.2319 0.1909 -0.0034 0.0196  0.0208  295  LEU A CA  
433 C C   . LEU A 50 ? 0.2254 0.2161 0.2064 -0.0013 0.0282  0.0174  295  LEU A C   
434 O O   . LEU A 50 ? 0.2468 0.2432 0.2476 -0.0091 0.0370  0.0376  295  LEU A O   
435 C CB  . LEU A 50 ? 0.2528 0.2993 0.1783 0.0194  0.0365  0.0683  295  LEU A CB  
436 C CG  . LEU A 50 ? 0.2708 0.3493 0.1916 0.0271  0.0338  0.0646  295  LEU A CG  
437 C CD1 . LEU A 50 ? 0.2838 0.3790 0.1718 0.0369  0.0165  0.0660  295  LEU A CD1 
438 C CD2 . LEU A 50 ? 0.2531 0.3488 0.1815 0.0256  0.0815  0.0576  295  LEU A CD2 
439 N N   . HIS A 51 ? 0.2180 0.2096 0.2621 0.0159  0.0141  -0.0082 296  HIS A N   
440 C CA  . HIS A 51 ? 0.2200 0.2141 0.2903 0.0231  0.0099  -0.0023 296  HIS A CA  
441 C C   . HIS A 51 ? 0.1974 0.2259 0.2778 0.0075  -0.0134 -0.0102 296  HIS A C   
442 O O   . HIS A 51 ? 0.1883 0.2242 0.2428 -0.0021 -0.0143 0.0018  296  HIS A O   
443 C CB  . HIS A 51 ? 0.2509 0.2257 0.3098 0.0363  -0.0028 0.0038  296  HIS A CB  
444 C CG  . HIS A 51 ? 0.2728 0.2530 0.3272 0.0486  0.0260  -0.0112 296  HIS A CG  
445 N ND1 . HIS A 51 ? 0.2973 0.2708 0.3769 0.0465  0.0335  -0.0164 296  HIS A ND1 
446 C CD2 . HIS A 51 ? 0.2867 0.2511 0.3433 0.0382  0.0255  0.0017  296  HIS A CD2 
447 C CE1 . HIS A 51 ? 0.2981 0.2689 0.3759 0.0352  0.0487  -0.0343 296  HIS A CE1 
448 N NE2 . HIS A 51 ? 0.3007 0.2630 0.4032 0.0358  0.0446  -0.0235 296  HIS A NE2 
449 N N   . GLU A 52 ? 0.1985 0.2403 0.2715 -0.0161 -0.0137 0.0041  297  GLU A N   
450 C CA  A GLU A 52 ? 0.1821 0.2466 0.2302 -0.0229 -0.0147 0.0257  297  GLU A CA  
451 C CA  B GLU A 52 ? 0.2002 0.2562 0.2491 -0.0118 -0.0173 0.0257  297  GLU A CA  
452 C C   . GLU A 52 ? 0.1937 0.2447 0.2377 -0.0053 -0.0258 0.0434  297  GLU A C   
453 O O   . GLU A 52 ? 0.2169 0.2453 0.2664 0.0224  -0.0423 0.0412  297  GLU A O   
454 C CB  A GLU A 52 ? 0.1695 0.2684 0.2173 -0.0250 -0.0158 0.0210  297  GLU A CB  
455 C CB  B GLU A 52 ? 0.2218 0.2972 0.2629 0.0069  -0.0209 0.0273  297  GLU A CB  
456 C CG  A GLU A 52 ? 0.1806 0.2741 0.1334 -0.0322 -0.0132 -0.0013 297  GLU A CG  
457 C CG  B GLU A 52 ? 0.2651 0.3336 0.2720 0.0184  -0.0293 0.0097  297  GLU A CG  
458 C CD  A GLU A 52 ? 0.2071 0.2862 0.1852 -0.0282 -0.0134 0.0316  297  GLU A CD  
459 C CD  B GLU A 52 ? 0.2985 0.3559 0.2169 0.0350  -0.0176 0.0255  297  GLU A CD  
460 O OE1 A GLU A 52 ? 0.2211 0.3093 0.2111 -0.0372 -0.0219 0.0341  297  GLU A OE1 
461 O OE1 B GLU A 52 ? 0.3349 0.3677 0.2560 0.0100  -0.0210 0.0284  297  GLU A OE1 
462 O OE2 A GLU A 52 ? 0.2276 0.2775 0.2073 -0.0400 -0.0396 0.0335  297  GLU A OE2 
463 O OE2 B GLU A 52 ? 0.2833 0.3487 0.1173 0.0709  0.0058  0.0298  297  GLU A OE2 
464 N N   . GLY A 53 ? 0.1760 0.2338 0.2169 -0.0133 -0.0448 0.0393  298  GLY A N   
465 C CA  . GLY A 53 ? 0.2045 0.2399 0.2183 -0.0149 -0.0413 0.0243  298  GLY A CA  
466 C C   . GLY A 53 ? 0.2051 0.2290 0.1515 -0.0111 -0.0349 0.0218  298  GLY A C   
467 O O   . GLY A 53 ? 0.2438 0.2475 0.1768 -0.0169 -0.0294 0.0208  298  GLY A O   
468 N N   . ASP A 54 ? 0.1937 0.2016 0.1742 -0.0032 -0.0348 0.0048  299  ASP A N   
469 C CA  . ASP A 54 ? 0.1759 0.1975 0.1944 0.0015  -0.0192 0.0060  299  ASP A CA  
470 C C   . ASP A 54 ? 0.1668 0.1973 0.1356 -0.0096 -0.0216 0.0048  299  ASP A C   
471 O O   . ASP A 54 ? 0.1935 0.1960 0.1269 -0.0036 0.0163  0.0281  299  ASP A O   
472 C CB  . ASP A 54 ? 0.2002 0.1999 0.1914 -0.0015 -0.0153 -0.0017 299  ASP A CB  
473 C CG  . ASP A 54 ? 0.2399 0.2279 0.2078 0.0094  -0.0126 -0.0085 299  ASP A CG  
474 O OD1 . ASP A 54 ? 0.2742 0.2349 0.2729 0.0383  -0.0193 0.0076  299  ASP A OD1 
475 O OD2 . ASP A 54 ? 0.2503 0.2244 0.2303 0.0085  -0.0031 -0.0065 299  ASP A OD2 
476 N N   . GLU A 55 ? 0.1745 0.1864 0.1130 -0.0130 -0.0145 -0.0058 300  GLU A N   
477 C CA  . GLU A 55 ? 0.1863 0.1972 0.1087 -0.0128 -0.0086 -0.0028 300  GLU A CA  
478 C C   . GLU A 55 ? 0.1912 0.1803 0.1055 -0.0081 -0.0211 0.0213  300  GLU A C   
479 O O   . GLU A 55 ? 0.2203 0.1738 0.1135 -0.0178 -0.0386 0.0291  300  GLU A O   
480 C CB  . GLU A 55 ? 0.2117 0.2187 0.0743 -0.0146 -0.0029 0.0018  300  GLU A CB  
481 C CG  . GLU A 55 ? 0.2544 0.2503 0.0908 -0.0025 0.0080  -0.0095 300  GLU A CG  
482 C CD  . GLU A 55 ? 0.2780 0.2681 0.1050 -0.0186 0.0015  -0.0189 300  GLU A CD  
483 O OE1 . GLU A 55 ? 0.2941 0.2909 0.0882 -0.0267 -0.0112 -0.0370 300  GLU A OE1 
484 O OE2 . GLU A 55 ? 0.2844 0.2523 0.1181 -0.0143 0.0286  -0.0114 300  GLU A OE2 
485 N N   . VAL A 56 ? 0.1698 0.1876 0.0904 -0.0001 -0.0033 0.0058  301  VAL A N   
486 C CA  . VAL A 56 ? 0.1784 0.2034 0.0899 -0.0075 0.0041  0.0150  301  VAL A CA  
487 C C   . VAL A 56 ? 0.1910 0.1714 0.0909 -0.0028 0.0028  -0.0037 301  VAL A C   
488 O O   . VAL A 56 ? 0.2099 0.1683 0.1229 0.0011  0.0169  0.0023  301  VAL A O   
489 C CB  . VAL A 56 ? 0.1849 0.2287 0.0944 0.0037  0.0070  0.0308  301  VAL A CB  
490 C CG1 . VAL A 56 ? 0.1920 0.2292 0.1018 0.0119  -0.0044 0.0021  301  VAL A CG1 
491 C CG2 . VAL A 56 ? 0.1983 0.2477 0.0932 -0.0036 0.0171  0.0170  301  VAL A CG2 
492 N N   . LEU A 57 ? 0.1842 0.1852 0.0686 -0.0103 0.0055  0.0013  302  LEU A N   
493 C CA  . LEU A 57 ? 0.1813 0.1868 0.0769 0.0011  0.0044  0.0114  302  LEU A CA  
494 C C   . LEU A 57 ? 0.1851 0.1867 0.0748 0.0069  0.0097  -0.0097 302  LEU A C   
495 O O   . LEU A 57 ? 0.1947 0.1963 0.0916 0.0107  0.0103  -0.0106 302  LEU A O   
496 C CB  . LEU A 57 ? 0.2038 0.2053 0.0896 0.0091  -0.0073 0.0102  302  LEU A CB  
497 C CG  . LEU A 57 ? 0.2255 0.2157 0.0705 0.0018  -0.0033 -0.0005 302  LEU A CG  
498 C CD1 . LEU A 57 ? 0.2218 0.2415 0.1092 0.0010  -0.0047 0.0284  302  LEU A CD1 
499 C CD2 . LEU A 57 ? 0.2718 0.2140 0.0984 -0.0092 -0.0178 -0.0085 302  LEU A CD2 
500 N N   . GLU A 58 ? 0.1828 0.1948 0.0670 -0.0064 -0.0037 -0.0118 303  GLU A N   
501 C CA  . GLU A 58 ? 0.1860 0.2070 0.0871 -0.0031 0.0000  -0.0169 303  GLU A CA  
502 C C   . GLU A 58 ? 0.1769 0.1948 0.0757 0.0207  -0.0075 -0.0229 303  GLU A C   
503 O O   . GLU A 58 ? 0.1919 0.1920 0.0910 0.0353  -0.0095 -0.0067 303  GLU A O   
504 C CB  . GLU A 58 ? 0.2146 0.2541 0.1339 -0.0138 -0.0151 -0.0170 303  GLU A CB  
505 C CG  . GLU A 58 ? 0.2531 0.2837 0.2214 -0.0245 -0.0219 0.0171  303  GLU A CG  
506 C CD  . GLU A 58 ? 0.3065 0.3147 0.3225 -0.0391 -0.0032 0.0226  303  GLU A CD  
507 O OE1 . GLU A 58 ? 0.3495 0.3332 0.3248 -0.0543 -0.0273 0.0511  303  GLU A OE1 
508 O OE2 . GLU A 58 ? 0.3243 0.3281 0.4306 -0.0347 0.0406  0.0236  303  GLU A OE2 
509 N N   . ILE A 59 ? 0.1820 0.2155 0.0639 0.0335  -0.0153 -0.0199 304  ILE A N   
510 C CA  . ILE A 59 ? 0.1972 0.2402 0.0696 0.0352  -0.0216 -0.0116 304  ILE A CA  
511 C C   . ILE A 59 ? 0.2024 0.2494 0.0888 0.0581  -0.0367 -0.0366 304  ILE A C   
512 O O   . ILE A 59 ? 0.2001 0.2730 0.1265 0.0688  -0.0202 -0.0366 304  ILE A O   
513 C CB  . ILE A 59 ? 0.2151 0.2678 0.0713 0.0311  -0.0069 0.0024  304  ILE A CB  
514 C CG1 . ILE A 59 ? 0.2249 0.2614 0.0863 0.0206  -0.0146 0.0065  304  ILE A CG1 
515 C CG2 . ILE A 59 ? 0.2637 0.3205 0.0885 0.0338  -0.0095 -0.0080 304  ILE A CG2 
516 C CD1 . ILE A 59 ? 0.2362 0.2666 0.1076 0.0136  0.0133  0.0349  304  ILE A CD1 
517 N N   . ASN A 60 ? 0.2098 0.2712 0.1068 0.0579  -0.0306 -0.0503 305  ASN A N   
518 C CA  . ASN A 60 ? 0.2189 0.2938 0.1484 0.0560  -0.0560 -0.0835 305  ASN A CA  
519 C C   . ASN A 60 ? 0.2070 0.2736 0.1966 0.0450  -0.0575 -0.0959 305  ASN A C   
520 O O   . ASN A 60 ? 0.2099 0.2866 0.2325 0.0587  -0.0710 -0.0736 305  ASN A O   
521 C CB  . ASN A 60 ? 0.2420 0.3184 0.1603 0.0846  -0.0715 -0.0904 305  ASN A CB  
522 C CG  . ASN A 60 ? 0.2429 0.3337 0.1623 0.0789  -0.0826 -0.0790 305  ASN A CG  
523 O OD1 . ASN A 60 ? 0.2995 0.3593 0.1625 0.1236  -0.0788 -0.0783 305  ASN A OD1 
524 N ND2 . ASN A 60 ? 0.2399 0.3486 0.1325 0.0372  -0.0532 -0.0427 305  ASN A ND2 
525 N N   . GLY A 61 ? 0.1948 0.2483 0.2038 0.0256  -0.0144 -0.0900 306  GLY A N   
526 C CA  . GLY A 61 ? 0.1897 0.2441 0.2273 0.0231  0.0115  -0.0724 306  GLY A CA  
527 C C   . GLY A 61 ? 0.1698 0.2405 0.1810 0.0245  -0.0106 -0.0626 306  GLY A C   
528 O O   . GLY A 61 ? 0.1777 0.2589 0.2186 0.0344  0.0273  -0.0461 306  GLY A O   
529 N N   . ILE A 62 ? 0.1758 0.2300 0.1835 0.0126  -0.0112 -0.0682 307  ILE A N   
530 C CA  . ILE A 62 ? 0.1963 0.2345 0.1364 0.0175  0.0005  -0.0215 307  ILE A CA  
531 C C   . ILE A 62 ? 0.1791 0.1995 0.1285 0.0061  -0.0004 -0.0106 307  ILE A C   
532 O O   . ILE A 62 ? 0.1723 0.2049 0.1515 0.0231  0.0036  -0.0070 307  ILE A O   
533 C CB  . ILE A 62 ? 0.2559 0.2943 0.1640 0.0500  -0.0046 -0.0074 307  ILE A CB  
534 C CG1 . ILE A 62 ? 0.2942 0.3722 0.1916 0.0687  -0.0222 -0.0284 307  ILE A CG1 
535 C CG2 . ILE A 62 ? 0.2778 0.2882 0.2021 0.0596  0.0435  0.0167  307  ILE A CG2 
536 C CD1 . ILE A 62 ? 0.3269 0.4126 0.2366 0.0727  -0.0081 -0.0190 307  ILE A CD1 
537 N N   . GLU A 63 ? 0.1857 0.2128 0.1309 0.0022  0.0061  -0.0158 308  GLU A N   
538 C CA  . GLU A 63 ? 0.2146 0.2503 0.1479 -0.0077 0.0149  -0.0323 308  GLU A CA  
539 C C   . GLU A 63 ? 0.1984 0.2313 0.2058 -0.0132 -0.0193 0.0303  308  GLU A C   
540 O O   . GLU A 63 ? 0.2171 0.2557 0.3426 -0.0148 -0.0392 0.0629  308  GLU A O   
541 C CB  . GLU A 63 ? 0.2663 0.3116 0.1454 0.0034  0.0085  -0.0771 308  GLU A CB  
542 C CG  . GLU A 63 ? 0.3376 0.3682 0.1619 0.0020  0.0138  -0.0463 308  GLU A CG  
543 C CD  . GLU A 63 ? 0.3902 0.4059 0.2466 0.0088  0.0185  -0.0310 308  GLU A CD  
544 O OE1 . GLU A 63 ? 0.3942 0.4161 0.2886 0.0143  0.0113  -0.0187 308  GLU A OE1 
545 O OE2 . GLU A 63 ? 0.4153 0.4253 0.2972 0.0050  0.0442  -0.0078 308  GLU A OE2 
546 N N   . ILE A 64 ? 0.1846 0.2133 0.1614 -0.0159 0.0068  0.0033  309  ILE A N   
547 C CA  . ILE A 64 ? 0.1998 0.2108 0.1333 -0.0119 0.0052  0.0020  309  ILE A CA  
548 C C   . ILE A 64 ? 0.2126 0.2184 0.1190 0.0047  0.0008  0.0055  309  ILE A C   
549 O O   . ILE A 64 ? 0.2259 0.2140 0.1243 -0.0124 0.0057  0.0013  309  ILE A O   
550 C CB  . ILE A 64 ? 0.2048 0.1980 0.1249 -0.0024 0.0041  0.0035  309  ILE A CB  
551 C CG1 . ILE A 64 ? 0.2220 0.2359 0.1211 -0.0042 0.0062  0.0147  309  ILE A CG1 
552 C CG2 . ILE A 64 ? 0.2108 0.2054 0.1705 -0.0074 0.0133  0.0225  309  ILE A CG2 
553 C CD1 . ILE A 64 ? 0.2230 0.2594 0.1552 -0.0015 -0.0071 0.0225  309  ILE A CD1 
554 N N   . ARG A 65 ? 0.2362 0.2392 0.1092 0.0082  -0.0173 -0.0130 310  ARG A N   
555 C CA  A ARG A 65 ? 0.2677 0.2476 0.0848 0.0095  0.0005  -0.0186 310  ARG A CA  
556 C CA  B ARG A 65 ? 0.2563 0.2594 0.1236 0.0105  0.0019  -0.0048 310  ARG A CA  
557 C C   . ARG A 65 ? 0.2584 0.2463 0.1378 0.0078  0.0353  -0.0083 310  ARG A C   
558 O O   . ARG A 65 ? 0.2573 0.2622 0.1930 0.0050  0.0443  0.0211  310  ARG A O   
559 C CB  A ARG A 65 ? 0.3059 0.2650 0.0782 0.0019  -0.0128 -0.0097 310  ARG A CB  
560 C CB  B ARG A 65 ? 0.2772 0.2986 0.1508 0.0080  -0.0066 0.0160  310  ARG A CB  
561 C CG  A ARG A 65 ? 0.3423 0.2793 0.0986 0.0025  -0.0253 -0.0320 310  ARG A CG  
562 C CG  B ARG A 65 ? 0.2928 0.3345 0.1912 0.0107  -0.0138 0.0225  310  ARG A CG  
563 C CD  A ARG A 65 ? 0.3712 0.2946 0.1155 -0.0023 -0.0270 -0.0452 310  ARG A CD  
564 C CD  B ARG A 65 ? 0.3016 0.3646 0.2272 0.0106  -0.0179 0.0343  310  ARG A CD  
565 N NE  A ARG A 65 ? 0.3961 0.3111 0.1664 -0.0030 -0.0015 -0.0391 310  ARG A NE  
566 N NE  B ARG A 65 ? 0.3047 0.3913 0.2610 0.0066  -0.0195 0.0457  310  ARG A NE  
567 C CZ  A ARG A 65 ? 0.4164 0.3147 0.1833 -0.0049 0.0295  -0.0154 310  ARG A CZ  
568 C CZ  B ARG A 65 ? 0.3106 0.4132 0.2767 0.0125  -0.0077 0.0497  310  ARG A CZ  
569 N NH1 A ARG A 65 ? 0.4219 0.3187 0.1528 -0.0092 0.0769  -0.0202 310  ARG A NH1 
570 N NH1 B ARG A 65 ? 0.3242 0.4231 0.2953 0.0164  0.0026  0.0342  310  ARG A NH1 
571 N NH2 A ARG A 65 ? 0.4254 0.3080 0.2157 -0.0046 0.0179  -0.0345 310  ARG A NH2 
572 N NH2 B ARG A 65 ? 0.3025 0.4206 0.2761 0.0180  -0.0036 0.0584  310  ARG A NH2 
573 N N   . GLY A 66 ? 0.2905 0.2261 0.1392 0.0135  0.0268  -0.0295 311  GLY A N   
574 C CA  . GLY A 66 ? 0.3185 0.2430 0.1698 0.0309  0.0726  -0.0214 311  GLY A CA  
575 C C   . GLY A 66 ? 0.3235 0.2272 0.1941 0.0368  0.0767  -0.0168 311  GLY A C   
576 O O   . GLY A 66 ? 0.3883 0.2365 0.2067 0.0359  0.0736  -0.0328 311  GLY A O   
577 N N   . LYS A 67 ? 0.2683 0.2186 0.1725 0.0261  0.0599  -0.0109 312  LYS A N   
578 C CA  . LYS A 67 ? 0.2421 0.2248 0.1683 0.0226  0.0387  0.0000  312  LYS A CA  
579 C C   . LYS A 67 ? 0.2466 0.2057 0.1452 0.0230  0.0396  -0.0045 312  LYS A C   
580 O O   . LYS A 67 ? 0.2377 0.2118 0.1591 0.0100  0.0231  0.0056  312  LYS A O   
581 C CB  . LYS A 67 ? 0.2234 0.2557 0.1742 0.0189  0.0004  0.0325  312  LYS A CB  
582 C CG  . LYS A 67 ? 0.2216 0.2918 0.2775 0.0083  0.0049  0.0488  312  LYS A CG  
583 C CD  . LYS A 67 ? 0.2301 0.3190 0.3113 0.0011  -0.0226 0.0752  312  LYS A CD  
584 C CE  . LYS A 67 ? 0.2481 0.3447 0.3657 0.0176  -0.0330 0.0931  312  LYS A CE  
585 N NZ  . LYS A 67 ? 0.2569 0.3726 0.3806 0.0190  -0.0209 0.0625  312  LYS A NZ  
586 N N   . ASP A 68 ? 0.2710 0.1808 0.1558 0.0114  0.0360  -0.0102 313  ASP A N   
587 C CA  . ASP A 68 ? 0.2829 0.1777 0.1693 0.0044  0.0408  -0.0080 313  ASP A CA  
588 C C   . ASP A 68 ? 0.2645 0.1873 0.1320 -0.0003 0.0243  -0.0093 313  ASP A C   
589 O O   . ASP A 68 ? 0.2550 0.2000 0.1538 0.0160  0.0107  -0.0151 313  ASP A O   
590 C CB  . ASP A 68 ? 0.3065 0.1838 0.2169 0.0037  0.0427  -0.0091 313  ASP A CB  
591 C CG  . ASP A 68 ? 0.3364 0.1977 0.1997 -0.0020 0.0582  -0.0176 313  ASP A CG  
592 O OD1 . ASP A 68 ? 0.3705 0.2021 0.1777 0.0069  0.0399  -0.0370 313  ASP A OD1 
593 O OD2 . ASP A 68 ? 0.3345 0.2111 0.1839 -0.0372 0.0638  -0.0080 313  ASP A OD2 
594 N N   . VAL A 69 ? 0.2565 0.1755 0.1419 0.0027  0.0158  -0.0198 314  VAL A N   
595 C CA  . VAL A 69 ? 0.2481 0.1953 0.1124 -0.0125 0.0017  -0.0139 314  VAL A CA  
596 C C   . VAL A 69 ? 0.2519 0.1846 0.1273 -0.0199 0.0053  0.0095  314  VAL A C   
597 O O   . VAL A 69 ? 0.2256 0.2124 0.1245 0.0058  -0.0045 -0.0131 314  VAL A O   
598 C CB  . VAL A 69 ? 0.2448 0.2305 0.1308 -0.0144 0.0178  -0.0233 314  VAL A CB  
599 C CG1 . VAL A 69 ? 0.2482 0.2434 0.1364 0.0197  0.0069  -0.0050 314  VAL A CG1 
600 C CG2 . VAL A 69 ? 0.2606 0.2543 0.1545 -0.0368 -0.0013 -0.0490 314  VAL A CG2 
601 N N   . ASN A 70 ? 0.2641 0.1812 0.1393 0.0034  0.0080  0.0103  315  ASN A N   
602 C CA  A ASN A 70 ? 0.2830 0.2087 0.1638 0.0028  0.0101  0.0347  315  ASN A CA  
603 C CA  B ASN A 70 ? 0.2726 0.2084 0.1620 0.0070  0.0084  0.0304  315  ASN A CA  
604 C C   . ASN A 70 ? 0.2697 0.2216 0.1608 0.0245  0.0194  0.0383  315  ASN A C   
605 O O   . ASN A 70 ? 0.2676 0.2519 0.1620 0.0238  0.0096  0.0370  315  ASN A O   
606 C CB  A ASN A 70 ? 0.3116 0.2194 0.2612 -0.0018 0.0044  0.0305  315  ASN A CB  
607 C CB  B ASN A 70 ? 0.2806 0.2209 0.2344 0.0076  0.0026  0.0264  315  ASN A CB  
608 C CG  A ASN A 70 ? 0.3232 0.2295 0.2932 -0.0036 0.0218  0.0313  315  ASN A CG  
609 C CG  B ASN A 70 ? 0.2768 0.2327 0.2439 0.0132  0.0144  0.0212  315  ASN A CG  
610 O OD1 A ASN A 70 ? 0.3178 0.2346 0.2985 -0.0045 0.0600  0.0465  315  ASN A OD1 
611 O OD1 B ASN A 70 ? 0.2648 0.2390 0.2733 0.0138  0.0313  0.0310  315  ASN A OD1 
612 N ND2 A ASN A 70 ? 0.3292 0.2294 0.3086 -0.0179 0.0181  0.0304  315  ASN A ND2 
613 N ND2 B ASN A 70 ? 0.2903 0.2330 0.2560 0.0158  0.0103  0.0387  315  ASN A ND2 
614 N N   . GLU A 71 ? 0.2535 0.2009 0.2013 0.0178  0.0409  0.0228  316  GLU A N   
615 C CA  A GLU A 71 ? 0.2506 0.2172 0.1858 0.0272  0.0340  0.0151  316  GLU A CA  
616 C CA  B GLU A 71 ? 0.2476 0.2104 0.1882 0.0228  0.0469  0.0188  316  GLU A CA  
617 C C   . GLU A 71 ? 0.2320 0.2113 0.1325 0.0246  0.0150  0.0117  316  GLU A C   
618 O O   . GLU A 71 ? 0.2262 0.2506 0.1440 0.0328  -0.0133 -0.0050 316  GLU A O   
619 C CB  A GLU A 71 ? 0.2723 0.2380 0.1994 0.0366  0.0371  -0.0037 316  GLU A CB  
620 C CB  B GLU A 71 ? 0.2633 0.2178 0.2098 0.0265  0.0760  0.0149  316  GLU A CB  
621 C CG  A GLU A 71 ? 0.2873 0.2562 0.2436 0.0411  0.0199  0.0016  316  GLU A CG  
622 C CG  B GLU A 71 ? 0.2734 0.2182 0.2434 0.0223  0.1023  0.0297  316  GLU A CG  
623 C CD  A GLU A 71 ? 0.2938 0.2798 0.2737 0.0625  0.0303  0.0105  316  GLU A CD  
624 C CD  B GLU A 71 ? 0.2860 0.2211 0.2993 0.0187  0.1066  0.0237  316  GLU A CD  
625 O OE1 A GLU A 71 ? 0.3206 0.3145 0.3352 0.0529  0.0350  -0.0134 316  GLU A OE1 
626 O OE1 B GLU A 71 ? 0.3080 0.2302 0.3228 0.0276  0.0972  0.0121  316  GLU A OE1 
627 O OE2 A GLU A 71 ? 0.2904 0.2728 0.2670 0.0834  0.0342  0.0543  316  GLU A OE2 
628 O OE2 B GLU A 71 ? 0.2723 0.2113 0.3501 0.0007  0.1283  0.0521  316  GLU A OE2 
629 N N   . VAL A 72 ? 0.2167 0.1924 0.1277 0.0075  0.0123  0.0185  317  VAL A N   
630 C CA  . VAL A 72 ? 0.2113 0.1832 0.1171 -0.0103 -0.0016 0.0254  317  VAL A CA  
631 C C   . VAL A 72 ? 0.1881 0.1863 0.1084 -0.0159 0.0066  0.0341  317  VAL A C   
632 O O   . VAL A 72 ? 0.1837 0.1909 0.1257 -0.0197 -0.0044 0.0192  317  VAL A O   
633 C CB  . VAL A 72 ? 0.2227 0.1739 0.1229 -0.0066 0.0069  0.0161  317  VAL A CB  
634 C CG1 . VAL A 72 ? 0.2223 0.1763 0.1321 0.0006  0.0157  -0.0024 317  VAL A CG1 
635 C CG2 . VAL A 72 ? 0.2445 0.1862 0.1190 -0.0043 0.0081  0.0109  317  VAL A CG2 
636 N N   . PHE A 73 ? 0.1979 0.1987 0.1099 -0.0104 0.0278  0.0368  318  PHE A N   
637 C CA  . PHE A 73 ? 0.1829 0.2011 0.1300 -0.0130 0.0092  0.0328  318  PHE A CA  
638 C C   . PHE A 73 ? 0.1921 0.2010 0.1405 -0.0069 0.0220  0.0249  318  PHE A C   
639 O O   . PHE A 73 ? 0.1865 0.1927 0.1230 -0.0082 0.0194  0.0227  318  PHE A O   
640 C CB  . PHE A 73 ? 0.1927 0.2008 0.1307 -0.0247 0.0003  0.0331  318  PHE A CB  
641 C CG  . PHE A 73 ? 0.1931 0.2084 0.1252 -0.0255 -0.0065 0.0117  318  PHE A CG  
642 C CD1 . PHE A 73 ? 0.2042 0.2211 0.1291 -0.0347 0.0225  0.0118  318  PHE A CD1 
643 C CD2 . PHE A 73 ? 0.2090 0.2434 0.1329 -0.0300 -0.0189 0.0285  318  PHE A CD2 
644 C CE1 . PHE A 73 ? 0.2049 0.2498 0.1031 -0.0345 0.0047  0.0095  318  PHE A CE1 
645 C CE2 . PHE A 73 ? 0.2154 0.2667 0.1216 -0.0189 -0.0195 0.0210  318  PHE A CE2 
646 C CZ  . PHE A 73 ? 0.2067 0.2570 0.1351 -0.0371 -0.0010 0.0246  318  PHE A CZ  
647 N N   . ASP A 74 ? 0.1740 0.1963 0.1352 -0.0017 -0.0044 0.0282  319  ASP A N   
648 C CA  . ASP A 74 ? 0.1893 0.2007 0.1595 -0.0011 -0.0079 0.0276  319  ASP A CA  
649 C C   . ASP A 74 ? 0.1957 0.2216 0.1334 -0.0171 -0.0090 0.0188  319  ASP A C   
650 O O   . ASP A 74 ? 0.2118 0.2394 0.1374 -0.0210 -0.0122 0.0212  319  ASP A O   
651 C CB  . ASP A 74 ? 0.2335 0.2167 0.1910 0.0189  0.0029  0.0165  319  ASP A CB  
652 C CG  . ASP A 74 ? 0.2626 0.2206 0.2245 0.0312  0.0133  0.0250  319  ASP A CG  
653 O OD1 . ASP A 74 ? 0.2633 0.2179 0.2562 0.0293  0.0357  0.0520  319  ASP A OD1 
654 O OD2 . ASP A 74 ? 0.2775 0.2236 0.2843 0.0438  0.0243  0.0266  319  ASP A OD2 
655 N N   . LEU A 75 ? 0.1893 0.2246 0.1302 -0.0209 0.0165  0.0140  320  LEU A N   
656 C CA  A LEU A 75 ? 0.2007 0.2219 0.1204 -0.0230 0.0153  0.0170  320  LEU A CA  
657 C CA  B LEU A 75 ? 0.2013 0.2240 0.1295 -0.0270 0.0266  0.0133  320  LEU A CA  
658 C C   . LEU A 75 ? 0.1918 0.2180 0.1094 -0.0270 0.0101  0.0129  320  LEU A C   
659 O O   . LEU A 75 ? 0.1860 0.2261 0.1374 -0.0383 0.0052  0.0145  320  LEU A O   
660 C CB  A LEU A 75 ? 0.2124 0.2296 0.1256 -0.0267 0.0167  0.0213  320  LEU A CB  
661 C CB  B LEU A 75 ? 0.2172 0.2330 0.1511 -0.0364 0.0503  0.0091  320  LEU A CB  
662 C CG  A LEU A 75 ? 0.2213 0.2661 0.1440 -0.0223 0.0085  0.0321  320  LEU A CG  
663 C CG  B LEU A 75 ? 0.2357 0.2620 0.1810 -0.0330 0.0696  0.0087  320  LEU A CG  
664 C CD1 A LEU A 75 ? 0.2126 0.2857 0.1598 -0.0183 -0.0007 0.0388  320  LEU A CD1 
665 C CD1 B LEU A 75 ? 0.2453 0.2772 0.1753 -0.0243 0.0914  0.0107  320  LEU A CD1 
666 C CD2 A LEU A 75 ? 0.2355 0.2891 0.1649 -0.0276 0.0182  0.0552  320  LEU A CD2 
667 C CD2 B LEU A 75 ? 0.2452 0.2775 0.2191 -0.0181 0.0787  0.0076  320  LEU A CD2 
668 N N   . LEU A 76 ? 0.1715 0.1970 0.1220 -0.0245 0.0112  0.0220  321  LEU A N   
669 C CA  . LEU A 76 ? 0.1794 0.2085 0.1283 -0.0105 0.0035  0.0236  321  LEU A CA  
670 C C   . LEU A 76 ? 0.1740 0.1995 0.1325 -0.0128 0.0045  0.0162  321  LEU A C   
671 O O   . LEU A 76 ? 0.1759 0.2050 0.1368 -0.0131 -0.0055 0.0054  321  LEU A O   
672 C CB  . LEU A 76 ? 0.1941 0.2063 0.1509 -0.0216 -0.0101 0.0286  321  LEU A CB  
673 C CG  . LEU A 76 ? 0.2316 0.2022 0.1214 -0.0315 -0.0186 0.0343  321  LEU A CG  
674 C CD1 . LEU A 76 ? 0.2674 0.2010 0.1498 -0.0174 -0.0145 0.0301  321  LEU A CD1 
675 C CD2 . LEU A 76 ? 0.2560 0.2169 0.1274 -0.0244 0.0003  0.0292  321  LEU A CD2 
676 N N   . SER A 77 ? 0.1854 0.2118 0.1107 -0.0172 0.0097  0.0385  322  SER A N   
677 C CA  A SER A 77 ? 0.2019 0.2173 0.1234 -0.0155 0.0055  0.0246  322  SER A CA  
678 C CA  B SER A 77 ? 0.1939 0.2210 0.1386 -0.0129 0.0114  0.0361  322  SER A CA  
679 C C   . SER A 77 ? 0.1935 0.2325 0.1387 -0.0078 0.0074  0.0413  322  SER A C   
680 O O   . SER A 77 ? 0.2148 0.2736 0.1254 -0.0299 0.0088  0.0380  322  SER A O   
681 C CB  A SER A 77 ? 0.2288 0.2026 0.1815 -0.0105 0.0394  0.0307  322  SER A CB  
682 C CB  B SER A 77 ? 0.2034 0.2192 0.1649 -0.0131 0.0193  0.0288  322  SER A CB  
683 O OG  A SER A 77 ? 0.2517 0.2072 0.1911 -0.0119 0.0297  0.0245  322  SER A OG  
684 O OG  B SER A 77 ? 0.2098 0.2198 0.1828 -0.0154 0.0201  0.0186  322  SER A OG  
685 N N   . ASP A 78 ? 0.1802 0.2206 0.1576 -0.0203 0.0012  0.0307  323  ASP A N   
686 C CA  . ASP A 78 ? 0.1795 0.2348 0.2033 -0.0070 -0.0128 0.0506  323  ASP A CA  
687 C C   . ASP A 78 ? 0.1829 0.2273 0.1507 -0.0273 -0.0117 0.0503  323  ASP A C   
688 O O   . ASP A 78 ? 0.1863 0.2616 0.2066 -0.0366 -0.0163 0.0583  323  ASP A O   
689 C CB  . ASP A 78 ? 0.1943 0.2845 0.3657 0.0104  0.0230  0.0717  323  ASP A CB  
690 C CG  . ASP A 78 ? 0.2330 0.3285 0.5094 0.0294  0.0408  0.1000  323  ASP A CG  
691 O OD1 . ASP A 78 ? 0.2693 0.3402 0.5633 0.0338  0.0532  0.1672  323  ASP A OD1 
692 O OD2 . ASP A 78 ? 0.2502 0.3455 0.6014 0.0399  0.0289  0.0702  323  ASP A OD2 
693 N N   . MET A 79 ? 0.1964 0.2082 0.1280 -0.0214 0.0048  0.0366  324  MET A N   
694 C CA  . MET A 79 ? 0.2131 0.2059 0.1084 -0.0228 -0.0071 0.0350  324  MET A CA  
695 C C   . MET A 79 ? 0.2097 0.2130 0.1068 -0.0293 -0.0109 0.0197  324  MET A C   
696 O O   . MET A 79 ? 0.2020 0.2211 0.1751 -0.0313 0.0242  0.0254  324  MET A O   
697 C CB  . MET A 79 ? 0.2332 0.2292 0.1158 -0.0361 -0.0172 0.0165  324  MET A CB  
698 C CG  . MET A 79 ? 0.2475 0.2665 0.1245 -0.0378 -0.0164 0.0059  324  MET A CG  
699 S SD  . MET A 79 ? 0.2570 0.3108 0.1623 -0.0299 -0.0183 -0.0202 324  MET A SD  
700 C CE  . MET A 79 ? 0.2990 0.2840 0.1530 -0.0063 0.0158  0.0264  324  MET A CE  
701 N N   . HIS A 80 ? 0.2329 0.2062 0.0997 -0.0354 -0.0174 0.0153  325  HIS A N   
702 C CA  . HIS A 80 ? 0.2754 0.2176 0.1083 -0.0435 -0.0183 0.0330  325  HIS A CA  
703 C C   . HIS A 80 ? 0.2707 0.2117 0.1304 -0.0428 -0.0174 0.0363  325  HIS A C   
704 O O   . HIS A 80 ? 0.2751 0.2023 0.1661 -0.0457 0.0141  0.0194  325  HIS A O   
705 C CB  . HIS A 80 ? 0.3308 0.2853 0.1543 -0.0414 -0.0191 0.0448  325  HIS A CB  
706 C CG  . HIS A 80 ? 0.3910 0.3737 0.2533 -0.0384 -0.1242 0.0668  325  HIS A CG  
707 N ND1 . HIS A 80 ? 0.4101 0.4309 0.3433 -0.0474 -0.1601 0.0481  325  HIS A ND1 
708 C CD2 . HIS A 80 ? 0.4112 0.4149 0.3545 -0.0470 -0.1665 0.0584  325  HIS A CD2 
709 C CE1 . HIS A 80 ? 0.4171 0.4386 0.4102 -0.0483 -0.1694 0.0408  325  HIS A CE1 
710 N NE2 . HIS A 80 ? 0.4126 0.4295 0.4256 -0.0523 -0.1749 0.0475  325  HIS A NE2 
711 N N   . GLY A 81 ? 0.2888 0.2168 0.0851 -0.0383 -0.0339 0.0193  326  GLY A N   
712 C CA  . GLY A 81 ? 0.2942 0.1992 0.1078 -0.0302 -0.0445 0.0249  326  GLY A CA  
713 C C   . GLY A 81 ? 0.2841 0.2068 0.0868 -0.0334 -0.0273 0.0090  326  GLY A C   
714 O O   . GLY A 81 ? 0.2752 0.2322 0.0830 -0.0256 -0.0173 0.0132  326  GLY A O   
715 N N   . THR A 82 ? 0.3096 0.2091 0.0868 -0.0187 -0.0309 0.0102  327  THR A N   
716 C CA  . THR A 82 ? 0.3245 0.2168 0.0871 -0.0065 -0.0146 0.0248  327  THR A CA  
717 C C   . THR A 82 ? 0.2855 0.2477 0.0803 0.0139  -0.0143 -0.0083 327  THR A C   
718 O O   . THR A 82 ? 0.2802 0.2980 0.1012 0.0167  -0.0158 -0.0049 327  THR A O   
719 C CB  . THR A 82 ? 0.3896 0.2207 0.1311 -0.0114 -0.0289 0.0283  327  THR A CB  
720 O OG1 . THR A 82 ? 0.4203 0.2163 0.1925 -0.0258 0.0029  0.0166  327  THR A OG1 
721 C CG2 . THR A 82 ? 0.3996 0.2378 0.1758 0.0071  -0.0309 0.0408  327  THR A CG2 
722 N N   . LEU A 83 ? 0.2656 0.2276 0.0718 0.0151  -0.0245 -0.0003 328  LEU A N   
723 C CA  . LEU A 83 ? 0.2707 0.2135 0.0749 0.0307  -0.0198 0.0106  328  LEU A CA  
724 C C   . LEU A 83 ? 0.2546 0.2147 0.0776 0.0491  -0.0262 0.0054  328  LEU A C   
725 O O   . LEU A 83 ? 0.2781 0.2418 0.0897 0.0707  0.0087  0.0238  328  LEU A O   
726 C CB  . LEU A 83 ? 0.3191 0.2221 0.1061 0.0143  -0.0467 0.0104  328  LEU A CB  
727 C CG  . LEU A 83 ? 0.3702 0.2560 0.1679 -0.0145 -0.0403 0.0385  328  LEU A CG  
728 C CD1 . LEU A 83 ? 0.3861 0.2528 0.1585 -0.0369 -0.0451 0.0367  328  LEU A CD1 
729 C CD2 . LEU A 83 ? 0.3832 0.2676 0.2085 -0.0014 -0.0454 0.0612  328  LEU A CD2 
730 N N   . THR A 84 ? 0.2437 0.2084 0.0726 0.0273  -0.0202 -0.0101 329  THR A N   
731 C CA  . THR A 84 ? 0.2352 0.2126 0.0636 0.0074  -0.0232 0.0040  329  THR A CA  
732 C C   . THR A 84 ? 0.2160 0.2210 0.0734 0.0326  -0.0088 -0.0075 329  THR A C   
733 O O   . THR A 84 ? 0.2117 0.2470 0.1266 0.0337  -0.0333 -0.0255 329  THR A O   
734 C CB  . THR A 84 ? 0.2691 0.2551 0.0965 -0.0059 -0.0360 0.0118  329  THR A CB  
735 O OG1 . THR A 84 ? 0.2908 0.2484 0.1564 -0.0261 -0.0253 -0.0043 329  THR A OG1 
736 C CG2 . THR A 84 ? 0.2824 0.2817 0.1516 -0.0004 -0.0202 0.0559  329  THR A CG2 
737 N N   . PHE A 85 ? 0.2088 0.1911 0.0583 0.0130  -0.0106 -0.0005 330  PHE A N   
738 C CA  . PHE A 85 ? 0.2147 0.1894 0.0650 0.0187  -0.0114 -0.0060 330  PHE A CA  
739 C C   . PHE A 85 ? 0.2133 0.1840 0.0633 0.0322  -0.0126 -0.0002 330  PHE A C   
740 O O   . PHE A 85 ? 0.2549 0.1973 0.0725 0.0555  -0.0023 -0.0011 330  PHE A O   
741 C CB  . PHE A 85 ? 0.2031 0.2088 0.0853 0.0204  -0.0147 0.0056  330  PHE A CB  
742 C CG  . PHE A 85 ? 0.2146 0.2276 0.0808 0.0085  -0.0095 0.0027  330  PHE A CG  
743 C CD1 . PHE A 85 ? 0.2581 0.2665 0.0750 -0.0154 -0.0079 0.0085  330  PHE A CD1 
744 C CD2 . PHE A 85 ? 0.2139 0.2320 0.0968 0.0082  0.0133  0.0127  330  PHE A CD2 
745 C CE1 . PHE A 85 ? 0.2801 0.2788 0.1150 -0.0255 -0.0005 0.0106  330  PHE A CE1 
746 C CE2 . PHE A 85 ? 0.2298 0.2543 0.1080 -0.0020 0.0098  0.0025  330  PHE A CE2 
747 C CZ  . PHE A 85 ? 0.2597 0.2685 0.1132 -0.0198 -0.0084 0.0071  330  PHE A CZ  
748 N N   . VAL A 86 ? 0.2033 0.1780 0.0641 0.0062  -0.0059 -0.0146 331  VAL A N   
749 C CA  . VAL A 86 ? 0.2041 0.1870 0.0581 0.0002  0.0003  -0.0039 331  VAL A CA  
750 C C   . VAL A 86 ? 0.1977 0.1676 0.0509 -0.0031 0.0020  -0.0109 331  VAL A C   
751 O O   . VAL A 86 ? 0.2012 0.1591 0.0839 0.0106  -0.0053 -0.0135 331  VAL A O   
752 C CB  . VAL A 86 ? 0.2284 0.2127 0.0905 -0.0033 0.0090  -0.0051 331  VAL A CB  
753 C CG1 . VAL A 86 ? 0.2655 0.2351 0.1004 -0.0118 0.0447  -0.0136 331  VAL A CG1 
754 C CG2 . VAL A 86 ? 0.2147 0.2250 0.1697 -0.0034 0.0047  0.0029  331  VAL A CG2 
755 N N   . LEU A 87 ? 0.1875 0.1804 0.0708 0.0030  -0.0052 0.0143  332  LEU A N   
756 C CA  . LEU A 87 ? 0.1973 0.2087 0.0648 -0.0079 -0.0176 0.0167  332  LEU A CA  
757 C C   . LEU A 87 ? 0.2109 0.1898 0.0823 -0.0088 -0.0257 0.0221  332  LEU A C   
758 O O   . LEU A 87 ? 0.2484 0.1741 0.0750 -0.0156 -0.0240 0.0131  332  LEU A O   
759 C CB  . LEU A 87 ? 0.2168 0.2352 0.0832 -0.0102 -0.0235 0.0118  332  LEU A CB  
760 C CG  . LEU A 87 ? 0.2386 0.2282 0.0996 -0.0074 -0.0109 -0.0022 332  LEU A CG  
761 C CD1 . LEU A 87 ? 0.2748 0.2560 0.1475 -0.0160 0.0261  -0.0236 332  LEU A CD1 
762 C CD2 . LEU A 87 ? 0.2556 0.2099 0.1111 0.0098  -0.0065 0.0060  332  LEU A CD2 
763 N N   . ILE A 88 ? 0.2213 0.1878 0.0832 -0.0207 -0.0427 0.0090  333  ILE A N   
764 C CA  . ILE A 88 ? 0.2349 0.2327 0.0869 -0.0301 -0.0408 0.0140  333  ILE A CA  
765 C C   . ILE A 88 ? 0.2532 0.2230 0.1150 -0.0025 -0.0478 0.0318  333  ILE A C   
766 O O   . ILE A 88 ? 0.2469 0.2145 0.0955 -0.0025 -0.0115 0.0374  333  ILE A O   
767 C CB  . ILE A 88 ? 0.2383 0.2783 0.0880 -0.0423 -0.0348 0.0136  333  ILE A CB  
768 C CG1 . ILE A 88 ? 0.2386 0.3332 0.1105 -0.0336 -0.0129 -0.0241 333  ILE A CG1 
769 C CG2 . ILE A 88 ? 0.2430 0.2795 0.0916 -0.0459 -0.0398 0.0284  333  ILE A CG2 
770 C CD1 . ILE A 88 ? 0.2408 0.3709 0.1374 -0.0053 -0.0182 -0.0427 333  ILE A CD1 
771 N N   . PRO A 89 ? 0.2681 0.2268 0.2048 0.0118  -0.0791 0.0352  334  PRO A N   
772 C CA  . PRO A 89 ? 0.2817 0.2533 0.2989 0.0230  -0.0774 0.0207  334  PRO A CA  
773 C C   . PRO A 89 ? 0.2668 0.2887 0.3006 0.0219  -0.0901 0.0517  334  PRO A C   
774 O O   . PRO A 89 ? 0.2727 0.3173 0.2634 0.0064  -0.0968 0.0467  334  PRO A O   
775 C CB  . PRO A 89 ? 0.3051 0.2643 0.4062 0.0232  -0.0677 -0.0021 334  PRO A CB  
776 C CG  . PRO A 89 ? 0.2960 0.2575 0.4477 0.0224  -0.0844 0.0046  334  PRO A CG  
777 C CD  . PRO A 89 ? 0.2811 0.2214 0.3761 0.0278  -0.1018 0.0270  334  PRO A CD  
778 N N   . SER A 90 ? 0.2591 0.3242 0.3486 0.0128  -0.0915 0.0784  335  SER A N   
779 C CA  . SER A 90 ? 0.2681 0.3717 0.3756 -0.0123 -0.0993 0.0923  335  SER A CA  
780 C C   . SER A 90 ? 0.2821 0.4027 0.4134 -0.0120 -0.0777 0.0954  335  SER A C   
781 O O   . SER A 90 ? 0.2950 0.4000 0.3979 -0.0003 -0.0762 0.1290  335  SER A O   
782 C CB  . SER A 90 ? 0.2858 0.3918 0.4295 -0.0397 -0.0748 0.0989  335  SER A CB  
783 O OG  . SER A 90 ? 0.3106 0.4052 0.4895 -0.0493 -0.0643 0.1080  335  SER A OG  
784 O OXT . SER A 90 ? 0.2654 0.4141 0.4000 -0.0254 -0.1001 0.0826  335  SER A OXT 
785 N N   . MET B 4  ? 0.6052 0.5888 0.4824 -0.0003 -0.0382 0.0604  1393 MET B N   
786 C CA  . MET B 4  ? 0.6084 0.5908 0.4928 0.0038  -0.0387 0.0518  1393 MET B CA  
787 C C   . MET B 4  ? 0.6086 0.5727 0.5364 0.0042  -0.0258 0.0240  1393 MET B C   
788 O O   . MET B 4  ? 0.6092 0.5659 0.5477 -0.0079 -0.0075 0.0135  1393 MET B O   
789 C CB  . MET B 4  ? 0.6089 0.6108 0.4649 0.0123  -0.0565 0.0668  1393 MET B CB  
790 C CG  . MET B 4  ? 0.6134 0.6277 0.4300 0.0218  -0.0659 0.0911  1393 MET B CG  
791 S SD  . MET B 4  ? 0.6173 0.6435 0.3763 0.0254  -0.0741 0.1426  1393 MET B SD  
792 C CE  . MET B 4  ? 0.6099 0.6422 0.3707 0.0118  -0.0430 0.1010  1393 MET B CE  
793 N N   A TRP B 5  ? 0.6039 0.5661 0.5588 0.0116  -0.0319 0.0129  1394 TRP B N   
794 N N   B TRP B 5  ? 0.6164 0.5733 0.5568 0.0105  -0.0326 0.0118  1394 TRP B N   
795 C CA  A TRP B 5  ? 0.5978 0.5553 0.5733 0.0195  -0.0369 0.0031  1394 TRP B CA  
796 C CA  B TRP B 5  ? 0.6226 0.5694 0.5689 0.0170  -0.0389 0.0010  1394 TRP B CA  
797 C C   A TRP B 5  ? 0.6177 0.5542 0.5808 0.0260  -0.0520 -0.0071 1394 TRP B C   
798 C C   B TRP B 5  ? 0.6300 0.5607 0.5799 0.0241  -0.0524 -0.0075 1394 TRP B C   
799 O O   A TRP B 5  ? 0.6186 0.5558 0.5950 0.0277  -0.0600 -0.0067 1394 TRP B O   
800 O O   B TRP B 5  ? 0.6303 0.5611 0.5953 0.0245  -0.0601 -0.0052 1394 TRP B O   
801 C CB  A TRP B 5  ? 0.5724 0.5426 0.5735 0.0213  -0.0289 0.0042  1394 TRP B CB  
802 C CB  B TRP B 5  ? 0.6214 0.5708 0.5625 0.0163  -0.0341 -0.0006 1394 TRP B CB  
803 C CG  A TRP B 5  ? 0.5483 0.5316 0.5725 0.0234  -0.0203 0.0011  1394 TRP B CG  
804 C CG  B TRP B 5  ? 0.6210 0.5722 0.5568 0.0154  -0.0297 -0.0054 1394 TRP B CG  
805 C CD1 A TRP B 5  ? 0.5401 0.5285 0.5805 0.0245  -0.0165 -0.0020 1394 TRP B CD1 
806 C CD2 A TRP B 5  ? 0.5338 0.5254 0.5576 0.0251  -0.0169 0.0040  1394 TRP B CD2 
807 N NE1 A TRP B 5  ? 0.5344 0.5261 0.5791 0.0263  -0.0143 -0.0037 1394 TRP B NE1 
808 C CE2 A TRP B 5  ? 0.5298 0.5249 0.5665 0.0265  -0.0162 0.0014  1394 TRP B CE2 
809 C CE3 A TRP B 5  ? 0.5256 0.5224 0.5374 0.0242  -0.0174 0.0103  1394 TRP B CE3 
810 C CZ2 A TRP B 5  ? 0.5241 0.5241 0.5540 0.0263  -0.0184 0.0046  1394 TRP B CZ2 
811 C CZ3 A TRP B 5  ? 0.5221 0.5225 0.5342 0.0240  -0.0169 0.0143  1394 TRP B CZ3 
812 C CH2 A TRP B 5  ? 0.5223 0.5229 0.5413 0.0263  -0.0184 0.0088  1394 TRP B CH2 
813 N N   . ASN B 6  ? 0.6348 0.5502 0.5745 0.0295  -0.0571 -0.0186 1395 ASN B N   
814 C CA  . ASN B 6  ? 0.6517 0.5295 0.5338 0.0301  -0.0762 -0.0380 1395 ASN B CA  
815 C C   . ASN B 6  ? 0.6466 0.4774 0.4214 0.0216  -0.1029 -0.0651 1395 ASN B C   
816 O O   . ASN B 6  ? 0.6535 0.4849 0.4184 0.0201  -0.0984 -0.0598 1395 ASN B O   
817 C CB  . ASN B 6  ? 0.6695 0.5569 0.5975 0.0351  -0.0784 -0.0369 1395 ASN B CB  
818 C CG  . ASN B 6  ? 0.6843 0.5796 0.6585 0.0368  -0.0766 -0.0367 1395 ASN B CG  
819 O OD1 . ASN B 6  ? 0.6882 0.5908 0.6909 0.0334  -0.0750 -0.0300 1395 ASN B OD1 
820 N ND2 . ASN B 6  ? 0.6906 0.5844 0.6725 0.0390  -0.0740 -0.0428 1395 ASN B ND2 
821 N N   . LEU B 7  ? 0.6377 0.4534 0.3830 0.0174  -0.1152 -0.0687 1396 LEU B N   
822 C CA  . LEU B 7  ? 0.6260 0.4304 0.3505 0.0133  -0.1265 -0.0659 1396 LEU B CA  
823 C C   . LEU B 7  ? 0.5948 0.4013 0.2869 0.0162  -0.1317 -0.0567 1396 LEU B C   
824 O O   . LEU B 7  ? 0.5994 0.4019 0.2848 0.0147  -0.1257 -0.0585 1396 LEU B O   
825 C CB  . LEU B 7  ? 0.6427 0.4368 0.3968 0.0081  -0.1307 -0.0630 1396 LEU B CB  
826 C CG  . LEU B 7  ? 0.6549 0.4393 0.4351 0.0047  -0.1322 -0.0605 1396 LEU B CG  
827 C CD1 . LEU B 7  ? 0.6593 0.4414 0.4491 0.0031  -0.1324 -0.0590 1396 LEU B CD1 
828 C CD2 . LEU B 7  ? 0.6593 0.4384 0.4481 0.0037  -0.1326 -0.0584 1396 LEU B CD2 
829 N N   . MET B 8  ? 0.5574 0.3747 0.2284 0.0198  -0.1466 -0.0467 1397 MET B N   
830 C CA  . MET B 8  ? 0.4751 0.3580 0.1964 0.0269  -0.1389 -0.0384 1397 MET B CA  
831 C C   . MET B 8  ? 0.4247 0.3403 0.1568 0.0338  -0.1054 -0.0301 1397 MET B C   
832 O O   . MET B 8  ? 0.4512 0.3231 0.2005 0.0514  -0.1314 -0.0361 1397 MET B O   
833 C CB  . MET B 8  ? 0.4495 0.3716 0.1931 0.0289  -0.1384 -0.0363 1397 MET B CB  
834 C CG  . MET B 8  ? 0.4496 0.3915 0.2176 0.0521  -0.1465 -0.0386 1397 MET B CG  
835 S SD  . MET B 8  ? 0.4341 0.3953 0.2350 0.0574  -0.1520 -0.0618 1397 MET B SD  
836 C CE  . MET B 8  ? 0.4264 0.3794 0.1869 0.0642  -0.0963 -0.0754 1397 MET B CE  
837 N N   . PRO B 9  ? 0.3983 0.3620 0.1255 0.0360  -0.0613 -0.0352 1398 PRO B N   
838 C CA  . PRO B 9  ? 0.3684 0.3675 0.1146 0.0363  -0.0340 -0.0448 1398 PRO B CA  
839 C C   . PRO B 9  ? 0.3249 0.3433 0.1196 0.0533  -0.0276 -0.0637 1398 PRO B C   
840 O O   . PRO B 9  ? 0.3083 0.3359 0.1150 0.0560  -0.0370 -0.0553 1398 PRO B O   
841 C CB  . PRO B 9  ? 0.3845 0.3877 0.1079 0.0366  0.0202  -0.0075 1398 PRO B CB  
842 C CG  . PRO B 9  ? 0.3950 0.3951 0.1116 0.0228  0.0191  -0.0121 1398 PRO B CG  
843 C CD  . PRO B 9  ? 0.4018 0.3827 0.1129 0.0259  -0.0233 -0.0214 1398 PRO B CD  
844 N N   . PRO B 10 ? 0.3111 0.3254 0.1215 0.0516  -0.0390 -0.0515 1399 PRO B N   
845 C CA  . PRO B 10 ? 0.2877 0.3131 0.1360 0.0355  -0.0521 -0.0287 1399 PRO B CA  
846 C C   . PRO B 10 ? 0.2557 0.2919 0.1128 -0.0044 -0.0277 -0.0273 1399 PRO B C   
847 O O   . PRO B 10 ? 0.2842 0.3017 0.1097 -0.0079 0.0126  -0.0231 1399 PRO B O   
848 C CB  . PRO B 10 ? 0.3159 0.3421 0.2284 0.0541  -0.0410 -0.0008 1399 PRO B CB  
849 C CG  . PRO B 10 ? 0.3267 0.3589 0.2450 0.0616  -0.0276 -0.0097 1399 PRO B CG  
850 C CD  . PRO B 10 ? 0.3195 0.3514 0.2171 0.0622  -0.0409 -0.0472 1399 PRO B CD  
851 N N   . PRO B 11 ? 0.2463 0.2874 0.1023 -0.0225 -0.0151 -0.0324 1400 PRO B N   
852 C CA  . PRO B 11 ? 0.2629 0.2890 0.1035 -0.0379 -0.0048 -0.0231 1400 PRO B CA  
853 C C   . PRO B 11 ? 0.2844 0.2626 0.1127 -0.0460 0.0095  -0.0295 1400 PRO B C   
854 O O   . PRO B 11 ? 0.2746 0.2402 0.2153 -0.0440 -0.0013 -0.0141 1400 PRO B O   
855 C CB  . PRO B 11 ? 0.2733 0.3267 0.0919 -0.0454 0.0009  -0.0251 1400 PRO B CB  
856 C CG  . PRO B 11 ? 0.2961 0.3307 0.1376 -0.0617 0.0089  -0.0157 1400 PRO B CG  
857 C CD  . PRO B 11 ? 0.2786 0.3124 0.1146 -0.0526 -0.0181 -0.0085 1400 PRO B CD  
858 N N   . ALA B 12 ? 0.3143 0.2645 0.0977 -0.0689 0.0144  -0.0250 1401 ALA B N   
859 C CA  . ALA B 12 ? 0.3358 0.2569 0.1169 -0.0776 0.0198  -0.0249 1401 ALA B CA  
860 C C   . ALA B 12 ? 0.3098 0.2341 0.1102 -0.0564 0.0202  -0.0311 1401 ALA B C   
861 O O   . ALA B 12 ? 0.3097 0.2569 0.1092 -0.0538 0.0325  -0.0181 1401 ALA B O   
862 C CB  . ALA B 12 ? 0.3791 0.2682 0.1396 -0.0892 0.0268  -0.0111 1401 ALA B CB  
863 N N   . SME B 13 ? 0.2913 0.2084 0.1031 -0.0429 0.0263  -0.0141 1402 SME B N   
864 C CA  A SME B 13 ? 0.2900 0.1963 0.1239 -0.0291 0.0115  -0.0093 1402 SME B CA  
865 C CA  B SME B 13 ? 0.2850 0.2083 0.1380 -0.0288 0.0135  -0.0045 1402 SME B CA  
866 C CB  A SME B 13 ? 0.3277 0.2050 0.1399 -0.0280 -0.0019 -0.0093 1402 SME B CB  
867 C CB  B SME B 13 ? 0.3138 0.2453 0.1906 -0.0271 0.0048  0.0033  1402 SME B CB  
868 C CG  A SME B 13 ? 0.3639 0.2242 0.1388 -0.0352 -0.0031 0.0028  1402 SME B CG  
869 C CG  B SME B 13 ? 0.3408 0.2949 0.2399 -0.0329 0.0100  0.0244  1402 SME B CG  
870 S S   A SME B 13 ? 0.3950 0.2496 0.1828 -0.0435 -0.0152 -0.0278 1402 SME B S   
871 S S   B SME B 13 ? 0.3725 0.3397 0.3359 -0.0279 0.0078  0.0310  1402 SME B S   
872 O OE  A SME B 13 ? 0.3896 0.2303 0.1863 -0.0674 -0.0266 -0.0373 1402 SME B OE  
873 C CE  A SME B 13 ? 0.4021 0.2661 0.1831 -0.0444 0.0015  -0.0491 1402 SME B CE  
874 C CE  B SME B 13 ? 0.3722 0.3383 0.3279 -0.0360 -0.0112 0.0076  1402 SME B CE  
875 C C   . SME B 13 ? 0.2573 0.1920 0.1272 -0.0260 0.0098  -0.0078 1402 SME B C   
876 O O   . SME B 13 ? 0.2578 0.2000 0.1543 -0.0488 0.0312  -0.0111 1402 SME B O   
877 N N   . GLU B 14 ? 0.2236 0.1877 0.0982 -0.0516 -0.0081 -0.0099 1403 GLU B N   
878 C CA  . GLU B 14 ? 0.2187 0.1905 0.1110 -0.0202 -0.0234 -0.0202 1403 GLU B CA  
879 C C   . GLU B 14 ? 0.2206 0.1726 0.0969 -0.0358 -0.0097 -0.0080 1403 GLU B C   
880 O O   . GLU B 14 ? 0.2393 0.2063 0.1154 -0.0547 -0.0228 0.0049  1403 GLU B O   
881 C CB  . GLU B 14 ? 0.2246 0.2172 0.1793 -0.0164 -0.0190 -0.0288 1403 GLU B CB  
882 C CG  . GLU B 14 ? 0.2225 0.2280 0.1935 -0.0039 -0.0103 -0.0261 1403 GLU B CG  
883 C CD  . GLU B 14 ? 0.2045 0.2236 0.1851 -0.0326 -0.0198 -0.0096 1403 GLU B CD  
884 O OE1 . GLU B 14 ? 0.2155 0.2369 0.2148 -0.0144 0.0077  -0.0028 1403 GLU B OE1 
885 O OE2 . GLU B 14 ? 0.1882 0.2242 0.2225 -0.0398 -0.0128 0.0060  1403 GLU B OE2 
886 N N   . ARG B 15 ? 0.2015 0.1811 0.0909 -0.0335 -0.0234 -0.0145 1404 ARG B N   
887 C CA  . ARG B 15 ? 0.1966 0.1662 0.1048 -0.0164 -0.0172 -0.0165 1404 ARG B CA  
888 C C   . ARG B 15 ? 0.2034 0.1759 0.0987 -0.0202 -0.0151 -0.0060 1404 ARG B C   
889 O O   . ARG B 15 ? 0.2209 0.1780 0.1073 -0.0129 -0.0221 -0.0017 1404 ARG B O   
890 C CB  . ARG B 15 ? 0.2134 0.1715 0.1221 -0.0007 -0.0147 -0.0139 1404 ARG B CB  
891 C CG  . ARG B 15 ? 0.2327 0.1839 0.1412 0.0052  -0.0200 -0.0147 1404 ARG B CG  
892 C CD  . ARG B 15 ? 0.2610 0.2068 0.2054 0.0064  -0.0231 0.0146  1404 ARG B CD  
893 N NE  . ARG B 15 ? 0.2774 0.2000 0.1980 -0.0083 -0.0072 0.0283  1404 ARG B NE  
894 C CZ  . ARG B 15 ? 0.2906 0.2156 0.1629 -0.0222 0.0029  0.0181  1404 ARG B CZ  
895 N NH1 . ARG B 15 ? 0.2755 0.2445 0.2605 -0.0165 -0.0145 0.0188  1404 ARG B NH1 
896 N NH2 . ARG B 15 ? 0.3336 0.2143 0.1895 -0.0205 -0.0175 0.0078  1404 ARG B NH2 
897 N N   . LEU B 16 ? 0.2003 0.1789 0.0944 -0.0241 -0.0091 -0.0200 1405 LEU B N   
898 C CA  . LEU B 16 ? 0.1995 0.1996 0.0929 -0.0178 -0.0093 -0.0207 1405 LEU B CA  
899 C C   . LEU B 16 ? 0.1949 0.2033 0.1318 -0.0080 -0.0228 -0.0110 1405 LEU B C   
900 O O   . LEU B 16 ? 0.2069 0.2130 0.1508 -0.0175 -0.0204 -0.0049 1405 LEU B O   
901 C CB  . LEU B 16 ? 0.2233 0.2119 0.0996 -0.0122 0.0063  -0.0286 1405 LEU B CB  
902 C CG  . LEU B 16 ? 0.2445 0.2302 0.0840 -0.0086 0.0145  -0.0124 1405 LEU B CG  
903 C CD1 . LEU B 16 ? 0.2259 0.2343 0.1688 0.0034  -0.0134 -0.0038 1405 LEU B CD1 
904 C CD2 . LEU B 16 ? 0.2806 0.2507 0.1200 -0.0354 0.0147  -0.0417 1405 LEU B CD2 
905 N N   . ILE B 17 ? 0.1967 0.2050 0.1433 -0.0309 -0.0178 -0.0016 1406 ILE B N   
906 C CA  . ILE B 17 ? 0.2159 0.2340 0.1302 -0.0286 -0.0043 0.0013  1406 ILE B CA  
907 C C   . ILE B 17 ? 0.2119 0.2397 0.1206 -0.0377 -0.0052 -0.0057 1406 ILE B C   
908 O O   . ILE B 17 ? 0.2092 0.2325 0.1302 -0.0327 -0.0079 -0.0164 1406 ILE B O   
909 C CB  . ILE B 17 ? 0.2382 0.2686 0.1060 -0.0279 0.0026  0.0093  1406 ILE B CB  
910 C CG1 . ILE B 17 ? 0.2613 0.3057 0.1513 -0.0376 -0.0048 0.0604  1406 ILE B CG1 
911 C CG2 . ILE B 17 ? 0.2462 0.2679 0.1468 -0.0291 0.0319  -0.0403 1406 ILE B CG2 
912 C CD1 . ILE B 17 ? 0.2841 0.3200 0.1887 -0.0560 0.0005  0.0651  1406 ILE B CD1 
913 O OXT . ILE B 17 ? 0.2389 0.2346 0.1263 -0.0295 -0.0127 -0.0034 1406 ILE B OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  246  246  GLY GLY A . n 
A 1 2  PRO 2  247  247  PRO PRO A . n 
A 1 3  LEU 3  248  248  LEU LEU A . n 
A 1 4  GLY 4  249  249  GLY GLY A . n 
A 1 5  SER 5  250  250  SER SER A . n 
A 1 6  GLY 6  251  251  GLY GLY A . n 
A 1 7  GLU 7  252  252  GLU GLU A . n 
A 1 8  THR 8  253  253  THR THR A . n 
A 1 9  VAL 9  254  254  VAL VAL A . n 
A 1 10 LYS 10 255  255  LYS LYS A . n 
A 1 11 ILE 11 256  256  ILE ILE A . n 
A 1 12 VAL 12 257  257  VAL VAL A . n 
A 1 13 ARG 13 258  258  ARG ARG A . n 
A 1 14 ILE 14 259  259  ILE ILE A . n 
A 1 15 GLU 15 260  260  GLU GLU A . n 
A 1 16 LYS 16 261  261  LYS LYS A . n 
A 1 17 ALA 17 262  262  ALA ALA A . n 
A 1 18 ARG 18 263  263  ARG ARG A . n 
A 1 19 ASP 19 264  264  ASP ASP A . n 
A 1 20 ILE 20 265  265  ILE ILE A . n 
A 1 21 PRO 21 266  266  PRO PRO A . n 
A 1 22 LEU 22 267  267  LEU LEU A . n 
A 1 23 GLY 23 268  268  GLY GLY A . n 
A 1 24 ALA 24 269  269  ALA ALA A . n 
A 1 25 THR 25 270  270  THR THR A . n 
A 1 26 VAL 26 271  271  VAL VAL A . n 
A 1 27 ARG 27 272  272  ARG ARG A . n 
A 1 28 ASN 28 273  273  ASN ASN A . n 
A 1 29 GLU 29 274  274  GLU GLU A . n 
A 1 30 MET 30 275  275  MET MET A . n 
A 1 31 ASP 31 276  276  ASP ASP A . n 
A 1 32 SER 32 277  277  SER SER A . n 
A 1 33 VAL 33 278  278  VAL VAL A . n 
A 1 34 ILE 34 279  279  ILE ILE A . n 
A 1 35 ILE 35 280  280  ILE ILE A . n 
A 1 36 SER 36 281  281  SER SER A . n 
A 1 37 ARG 37 282  282  ARG ARG A . n 
A 1 38 ILE 38 283  283  ILE ILE A . n 
A 1 39 VAL 39 284  284  VAL VAL A . n 
A 1 40 LYS 40 285  285  LYS LYS A . n 
A 1 41 GLY 41 286  286  GLY GLY A . n 
A 1 42 GLY 42 287  287  GLY GLY A . n 
A 1 43 ALA 43 288  288  ALA ALA A . n 
A 1 44 ALA 44 289  289  ALA ALA A . n 
A 1 45 GLU 45 290  290  GLU GLU A . n 
A 1 46 LYS 46 291  291  LYS LYS A . n 
A 1 47 SER 47 292  292  SER SER A . n 
A 1 48 GLY 48 293  293  GLY GLY A . n 
A 1 49 LEU 49 294  294  LEU LEU A . n 
A 1 50 LEU 50 295  295  LEU LEU A . n 
A 1 51 HIS 51 296  296  HIS HIS A . n 
A 1 52 GLU 52 297  297  GLU GLU A . n 
A 1 53 GLY 53 298  298  GLY GLY A . n 
A 1 54 ASP 54 299  299  ASP ASP A . n 
A 1 55 GLU 55 300  300  GLU GLU A . n 
A 1 56 VAL 56 301  301  VAL VAL A . n 
A 1 57 LEU 57 302  302  LEU LEU A . n 
A 1 58 GLU 58 303  303  GLU GLU A . n 
A 1 59 ILE 59 304  304  ILE ILE A . n 
A 1 60 ASN 60 305  305  ASN ASN A . n 
A 1 61 GLY 61 306  306  GLY GLY A . n 
A 1 62 ILE 62 307  307  ILE ILE A . n 
A 1 63 GLU 63 308  308  GLU GLU A . n 
A 1 64 ILE 64 309  309  ILE ILE A . n 
A 1 65 ARG 65 310  310  ARG ARG A . n 
A 1 66 GLY 66 311  311  GLY GLY A . n 
A 1 67 LYS 67 312  312  LYS LYS A . n 
A 1 68 ASP 68 313  313  ASP ASP A . n 
A 1 69 VAL 69 314  314  VAL VAL A . n 
A 1 70 ASN 70 315  315  ASN ASN A . n 
A 1 71 GLU 71 316  316  GLU GLU A . n 
A 1 72 VAL 72 317  317  VAL VAL A . n 
A 1 73 PHE 73 318  318  PHE PHE A . n 
A 1 74 ASP 74 319  319  ASP ASP A . n 
A 1 75 LEU 75 320  320  LEU LEU A . n 
A 1 76 LEU 76 321  321  LEU LEU A . n 
A 1 77 SER 77 322  322  SER SER A . n 
A 1 78 ASP 78 323  323  ASP ASP A . n 
A 1 79 MET 79 324  324  MET MET A . n 
A 1 80 HIS 80 325  325  HIS HIS A . n 
A 1 81 GLY 81 326  326  GLY GLY A . n 
A 1 82 THR 82 327  327  THR THR A . n 
A 1 83 LEU 83 328  328  LEU LEU A . n 
A 1 84 THR 84 329  329  THR THR A . n 
A 1 85 PHE 85 330  330  PHE PHE A . n 
A 1 86 VAL 86 331  331  VAL VAL A . n 
A 1 87 LEU 87 332  332  LEU LEU A . n 
A 1 88 ILE 88 333  333  ILE ILE A . n 
A 1 89 PRO 89 334  334  PRO PRO A . n 
A 1 90 SER 90 335  335  SER SER A . n 
B 2 1  ARG 1  1390 ?    ?   ?   B . n 
B 2 2  VAL 2  1391 ?    ?   ?   B . n 
B 2 3  GLU 3  1392 ?    ?   ?   B . n 
B 2 4  MET 4  1393 1393 MET MET B . n 
B 2 5  TRP 5  1394 1394 TRP TRP B . n 
B 2 6  ASN 6  1395 1395 ASN ASN B . n 
B 2 7  LEU 7  1396 1396 LEU LEU B . n 
B 2 8  MET 8  1397 1397 MET MET B . n 
B 2 9  PRO 9  1398 1398 PRO PRO B . n 
B 2 10 PRO 10 1399 1399 PRO PRO B . n 
B 2 11 PRO 11 1400 1400 PRO PRO B . n 
B 2 12 ALA 12 1401 1401 ALA ALA B . n 
B 2 13 SME 13 1402 1402 SME SME B . n 
B 2 14 GLU 14 1403 1403 GLU GLU B . n 
B 2 15 ARG 15 1404 1404 ARG ARG B . n 
B 2 16 LEU 16 1405 1405 LEU LEU B . n 
B 2 17 ILE 17 1406 1406 ILE ILE B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3 CL  1   1335 1335 CL  CL  A . 
D 3 CL  1   1336 1336 CL  CL  A . 
E 3 CL  1   1337 1337 CL  CL  A . 
F 3 CL  1   1338 1338 CL  CL  A . 
G 3 CL  1   1339 1339 CL  CL  A . 
H 3 CL  1   1340 1340 CL  CL  A . 
I 3 CL  1   1341 1341 CL  CL  A . 
J 4 NA  1   1342 1342 NA  NA  A . 
K 5 PUN 1   1343 1343 PUN PUN A . 
L 3 CL  1   2407 2407 CL  CL  B . 
M 6 HOH 1   2001 2001 HOH HOH A . 
M 6 HOH 2   2002 2002 HOH HOH A . 
M 6 HOH 3   2003 2003 HOH HOH A . 
M 6 HOH 4   2004 2004 HOH HOH A . 
M 6 HOH 5   2005 2005 HOH HOH A . 
M 6 HOH 6   2006 2006 HOH HOH A . 
M 6 HOH 7   2007 2007 HOH HOH A . 
M 6 HOH 8   2008 2008 HOH HOH A . 
M 6 HOH 9   2009 2009 HOH HOH A . 
M 6 HOH 10  2010 2010 HOH HOH A . 
M 6 HOH 11  2011 2011 HOH HOH A . 
M 6 HOH 12  2012 2012 HOH HOH A . 
M 6 HOH 13  2013 2013 HOH HOH A . 
M 6 HOH 14  2014 2014 HOH HOH A . 
M 6 HOH 15  2015 2015 HOH HOH A . 
M 6 HOH 16  2016 2016 HOH HOH A . 
M 6 HOH 17  2017 2017 HOH HOH A . 
M 6 HOH 18  2018 2018 HOH HOH A . 
M 6 HOH 19  2019 2019 HOH HOH A . 
M 6 HOH 20  2020 2020 HOH HOH A . 
M 6 HOH 21  2021 2021 HOH HOH A . 
M 6 HOH 22  2022 2022 HOH HOH A . 
M 6 HOH 23  2023 2023 HOH HOH A . 
M 6 HOH 24  2024 2024 HOH HOH A . 
M 6 HOH 25  2025 2025 HOH HOH A . 
M 6 HOH 26  2026 2026 HOH HOH A . 
M 6 HOH 27  2027 2027 HOH HOH A . 
M 6 HOH 28  2028 2028 HOH HOH A . 
M 6 HOH 29  2029 2029 HOH HOH A . 
M 6 HOH 30  2030 2030 HOH HOH A . 
M 6 HOH 31  2031 2031 HOH HOH A . 
M 6 HOH 32  2032 2032 HOH HOH A . 
M 6 HOH 33  2033 2033 HOH HOH A . 
M 6 HOH 34  2034 2034 HOH HOH A . 
M 6 HOH 35  2035 2035 HOH HOH A . 
M 6 HOH 36  2036 2036 HOH HOH A . 
M 6 HOH 37  2037 2037 HOH HOH A . 
M 6 HOH 38  2038 2038 HOH HOH A . 
M 6 HOH 39  2039 2039 HOH HOH A . 
M 6 HOH 40  2040 2040 HOH HOH A . 
M 6 HOH 41  2041 2041 HOH HOH A . 
M 6 HOH 42  2042 2042 HOH HOH A . 
M 6 HOH 43  2043 2043 HOH HOH A . 
M 6 HOH 44  2044 2044 HOH HOH A . 
M 6 HOH 45  2045 2045 HOH HOH A . 
M 6 HOH 46  2046 2046 HOH HOH A . 
M 6 HOH 47  2047 2047 HOH HOH A . 
M 6 HOH 48  2048 2048 HOH HOH A . 
M 6 HOH 49  2049 2049 HOH HOH A . 
M 6 HOH 50  2050 2050 HOH HOH A . 
M 6 HOH 51  2051 2051 HOH HOH A . 
M 6 HOH 52  2052 2052 HOH HOH A . 
M 6 HOH 53  2053 2053 HOH HOH A . 
M 6 HOH 54  2054 2054 HOH HOH A . 
M 6 HOH 55  2055 2055 HOH HOH A . 
M 6 HOH 56  2056 2056 HOH HOH A . 
M 6 HOH 57  2057 2057 HOH HOH A . 
M 6 HOH 58  2058 2058 HOH HOH A . 
M 6 HOH 59  2059 2059 HOH HOH A . 
M 6 HOH 60  2060 2060 HOH HOH A . 
M 6 HOH 61  2061 2061 HOH HOH A . 
M 6 HOH 62  2062 2062 HOH HOH A . 
M 6 HOH 63  2063 2063 HOH HOH A . 
M 6 HOH 64  2064 2064 HOH HOH A . 
M 6 HOH 65  2065 2065 HOH HOH A . 
M 6 HOH 66  2066 2066 HOH HOH A . 
M 6 HOH 67  2067 2067 HOH HOH A . 
M 6 HOH 68  2068 2068 HOH HOH A . 
M 6 HOH 69  2069 2069 HOH HOH A . 
M 6 HOH 70  2070 2070 HOH HOH A . 
M 6 HOH 71  2071 2071 HOH HOH A . 
M 6 HOH 72  2072 2072 HOH HOH A . 
M 6 HOH 73  2073 2073 HOH HOH A . 
M 6 HOH 74  2074 2074 HOH HOH A . 
M 6 HOH 75  2075 2075 HOH HOH A . 
M 6 HOH 76  2076 2076 HOH HOH A . 
M 6 HOH 77  2077 2077 HOH HOH A . 
M 6 HOH 78  2078 2078 HOH HOH A . 
M 6 HOH 79  2079 2079 HOH HOH A . 
M 6 HOH 80  2080 2080 HOH HOH A . 
M 6 HOH 81  2081 2081 HOH HOH A . 
M 6 HOH 82  2082 2082 HOH HOH A . 
M 6 HOH 83  2083 2083 HOH HOH A . 
M 6 HOH 84  2084 2084 HOH HOH A . 
M 6 HOH 85  2085 2085 HOH HOH A . 
M 6 HOH 86  2086 2086 HOH HOH A . 
M 6 HOH 87  2087 2087 HOH HOH A . 
M 6 HOH 88  2088 2088 HOH HOH A . 
M 6 HOH 89  2089 2089 HOH HOH A . 
M 6 HOH 90  2090 2090 HOH HOH A . 
M 6 HOH 91  2091 2091 HOH HOH A . 
M 6 HOH 92  2092 2092 HOH HOH A . 
M 6 HOH 93  2093 2093 HOH HOH A . 
M 6 HOH 94  2094 2094 HOH HOH A . 
M 6 HOH 95  2095 2095 HOH HOH A . 
M 6 HOH 96  2096 2096 HOH HOH A . 
M 6 HOH 97  2097 2097 HOH HOH A . 
M 6 HOH 98  2098 2098 HOH HOH A . 
M 6 HOH 99  2099 2099 HOH HOH A . 
M 6 HOH 100 2100 2100 HOH HOH A . 
M 6 HOH 101 2101 2101 HOH HOH A . 
M 6 HOH 102 2102 2102 HOH HOH A . 
M 6 HOH 103 2103 2103 HOH HOH A . 
M 6 HOH 104 2104 2104 HOH HOH A . 
M 6 HOH 105 2105 2105 HOH HOH A . 
M 6 HOH 106 2106 2106 HOH HOH A . 
M 6 HOH 107 2107 2107 HOH HOH A . 
M 6 HOH 108 2108 2108 HOH HOH A . 
N 6 HOH 1   2001 2001 HOH HOH B . 
N 6 HOH 2   2002 2002 HOH HOH B . 
N 6 HOH 3   2003 2003 HOH HOH B . 
N 6 HOH 4   2004 2004 HOH HOH B . 
N 6 HOH 5   2005 2005 HOH HOH B . 
N 6 HOH 6   2006 2006 HOH HOH B . 
N 6 HOH 7   2007 2007 HOH HOH B . 
N 6 HOH 8   2008 2008 HOH HOH B . 
N 6 HOH 9   2009 2009 HOH HOH B . 
N 6 HOH 10  2010 2010 HOH HOH B . 
N 6 HOH 11  2011 2011 HOH HOH B . 
N 6 HOH 12  2012 2012 HOH HOH B . 
# 
_pdbx_struct_mod_residue.id               1 
_pdbx_struct_mod_residue.label_asym_id    B 
_pdbx_struct_mod_residue.label_comp_id    SME 
_pdbx_struct_mod_residue.label_seq_id     13 
_pdbx_struct_mod_residue.auth_asym_id     B 
_pdbx_struct_mod_residue.auth_comp_id     SME 
_pdbx_struct_mod_residue.auth_seq_id      1402 
_pdbx_struct_mod_residue.PDB_ins_code     ? 
_pdbx_struct_mod_residue.parent_comp_id   MET 
_pdbx_struct_mod_residue.details          'METHIONINE SULFOXIDE' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    CL 
_pdbx_struct_special_symmetry.auth_seq_id     1341 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   I 
_pdbx_struct_special_symmetry.label_comp_id   CL 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? M HOH .  ? A HOH 2074 ? 1_555 NA ? J NA . ? A NA 1342 ? 1_555 O   ? M HOH .  ? A HOH 2059 ? 5_655 147.5 ? 
2  O ? M HOH .  ? A HOH 2074 ? 1_555 NA ? J NA . ? A NA 1342 ? 1_555 O   ? M HOH .  ? A HOH 2022 ? 1_555 85.1  ? 
3  O ? M HOH .  ? A HOH 2059 ? 5_655 NA ? J NA . ? A NA 1342 ? 1_555 O   ? M HOH .  ? A HOH 2022 ? 1_555 100.7 ? 
4  O ? M HOH .  ? A HOH 2074 ? 1_555 NA ? J NA . ? A NA 1342 ? 1_555 O   ? M HOH .  ? A HOH 2082 ? 1_555 72.4  ? 
5  O ? M HOH .  ? A HOH 2059 ? 5_655 NA ? J NA . ? A NA 1342 ? 1_555 O   ? M HOH .  ? A HOH 2082 ? 1_555 76.6  ? 
6  O ? M HOH .  ? A HOH 2022 ? 1_555 NA ? J NA . ? A NA 1342 ? 1_555 O   ? M HOH .  ? A HOH 2082 ? 1_555 82.8  ? 
7  O ? M HOH .  ? A HOH 2074 ? 1_555 NA ? J NA . ? A NA 1342 ? 1_555 O   ? A SER 77 ? A SER 322  ? 1_555 92.5  ? 
8  O ? M HOH .  ? A HOH 2059 ? 5_655 NA ? J NA . ? A NA 1342 ? 1_555 O   ? A SER 77 ? A SER 322  ? 1_555 111.3 ? 
9  O ? M HOH .  ? A HOH 2022 ? 1_555 NA ? J NA . ? A NA 1342 ? 1_555 O   ? A SER 77 ? A SER 322  ? 1_555 119.5 ? 
10 O ? M HOH .  ? A HOH 2082 ? 1_555 NA ? J NA . ? A NA 1342 ? 1_555 O   ? A SER 77 ? A SER 322  ? 1_555 152.5 ? 
11 O ? M HOH .  ? A HOH 2074 ? 1_555 NA ? J NA . ? A NA 1342 ? 1_555 OD1 ? A ASP 78 ? A ASP 323  ? 1_555 80.1  ? 
12 O ? M HOH .  ? A HOH 2059 ? 5_655 NA ? J NA . ? A NA 1342 ? 1_555 OD1 ? A ASP 78 ? A ASP 323  ? 1_555 78.0  ? 
13 O ? M HOH .  ? A HOH 2022 ? 1_555 NA ? J NA . ? A NA 1342 ? 1_555 OD1 ? A ASP 78 ? A ASP 323  ? 1_555 147.1 ? 
14 O ? M HOH .  ? A HOH 2082 ? 1_555 NA ? J NA . ? A NA 1342 ? 1_555 OD1 ? A ASP 78 ? A ASP 323  ? 1_555 64.9  ? 
15 O ? A SER 77 ? A SER 322  ? 1_555 NA ? J NA . ? A NA 1342 ? 1_555 OD1 ? A ASP 78 ? A ASP 323  ? 1_555 90.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-01-14 
2 'Structure model' 1 1 2015-03-11 
3 'Structure model' 1 2 2015-03-25 
4 'Structure model' 2 0 2018-02-28 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
3 4 'Structure model' 'Atomic model'        
4 4 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' atom_site       
2 4 'Structure model' citation        
3 4 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_atom_site.B_iso_or_equiv' 
2  4 'Structure model' '_atom_site.Cartn_x'        
3  4 'Structure model' '_atom_site.Cartn_y'        
4  4 'Structure model' '_atom_site.Cartn_z'        
5  4 'Structure model' '_atom_site.auth_atom_id'   
6  4 'Structure model' '_atom_site.label_atom_id'  
7  4 'Structure model' '_citation.country'         
8  4 'Structure model' '_citation.journal_abbrev'  
9  4 'Structure model' '_citation.journal_id_CSD'  
10 4 'Structure model' '_citation.journal_id_ISSN' 
11 4 'Structure model' '_citation.page_last'       
12 4 'Structure model' '_citation.title'           
13 4 'Structure model' '_citation_author.name'     
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
PHENIX refinement       '(PHENIX.REFINE: DEV_1839)' ? 1 
XDS    'data reduction' .                           ? 2 
XSCALE 'data scaling'   .                           ? 3 
PHASER phasing          .                           ? 4 
# 
_pdbx_entry_details.entry_id             4UU5 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     
;RESIDUES 251-335 N-TERMINAL RESIDUES GPLGS ARE VECTOR-
DERIVED
;
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 N   B MET 1397 ? ? O B HOH 2001 ? ? 2.07 
2 1 NZ  A LYS 255  ? A O A HOH 2011 ? ? 2.07 
3 1 OD1 A ASN 315  ? B O A HOH 2067 ? ? 2.13 
4 1 O   B MET 1393 ? ? O B HOH 2001 ? ? 2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 MET A 275  ? A 63.12   -124.99 
2 1 MET A 275  ? B 43.62   72.44   
3 1 ASP A 276  ? B 67.98   -21.51  
4 1 SER A 281  ? ? -108.42 -71.88  
5 1 TRP B 1394 ? A -56.40  6.09    
6 1 TRP B 1394 ? B -60.50  11.55   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 A ARG 263 ? CD  ? A ARG 18 CD  
2 1 Y 1 A ARG 263 ? NE  ? A ARG 18 NE  
3 1 Y 1 A ARG 263 ? CZ  ? A ARG 18 CZ  
4 1 Y 1 A ARG 263 ? NH1 ? A ARG 18 NH1 
5 1 Y 1 A ARG 263 ? NH2 ? A ARG 18 NH2 
6 1 Y 1 A LYS 285 ? CE  ? A LYS 40 CE  
7 1 Y 1 A LYS 285 ? NZ  ? A LYS 40 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 B ARG 1390 ? B ARG 1 
2 1 Y 1 B VAL 1391 ? B VAL 2 
3 1 Y 1 B GLU 1392 ? B GLU 3 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'CHLORIDE ION'                  CL  
4 'SODIUM ION'                    NA  
5 2,2,4,4,6,6,8-heptamethylnonane PUN 
6 water                           HOH 
#