data_4UY3
# 
_entry.id   4UY3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4UY3         
PDBE  EBI-61620    
WWPDB D_1290061620 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          4UXV 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        'CYTOPLASMIC DOMAIN OF BACTERIAL CELL DIVISION PROTEIN EZRA' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4UY3 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-08-28 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cleverley, R.M.' 1  
'Barrett, J.R.'   2  
'Basle, A.'       3  
'Khai-Bui, N.'    4  
'Hewitt, L.'      5  
'Solovyova, A.'   6  
'Xu, Z.'          7  
'Daniela, R.A.'   8  
'Dixon, N.E.'     9  
'Harry, E.J.'     10 
'Oakley, A.J.'    11 
'Vollmer, W.'     12 
'Lewis, R.J.'     13 
# 
_citation.id                        primary 
_citation.title                     'Structure and Function of a Spectrin-Like Regulator of Bacterial Cytokinesis.' 
_citation.journal_abbrev            Nat.Commun. 
_citation.journal_volume            5 
_citation.page_first                5421 
_citation.page_last                 ? 
_citation.year                      2014 
_citation.journal_id_ASTM           ? 
_citation.country                   UK 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_id_CSD            ? 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25403286 
_citation.pdbx_database_id_DOI      10.1038/NCOMMS6421 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Cleverley, R.M.' 1  
primary 'Barrett, J.R.'   2  
primary 'Basle, A.'       3  
primary 'Bui, N.K.'       4  
primary 'Hewitt, L.'      5  
primary 'Solovyova, A.'   6  
primary 'Xu, Z.'          7  
primary 'Daniel, R.A.'    8  
primary 'Dixon, N.E.'     9  
primary 'Harry, E.J.'     10 
primary 'Oakley, A.J.'    11 
primary 'Vollmer, W.'     12 
primary 'Lewis, R.J.'     13 
# 
_cell.entry_id           4UY3 
_cell.length_a           96.135 
_cell.length_b           96.135 
_cell.length_c           97.128 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4UY3 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'SEPTATION RING FORMATION REGULATOR EZRA' 
_entity.formula_weight             23119.725 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              'CYTOPLASMIC DOMAIN, N-TERMINAL SPECTRIN-LIKE, REPEATS 1-2, UNP RESIDUES 24-214' 
_entity.details                    ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        EZRA 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRSNKRQIIEKAIERKNEIETLPFDQNLAQLSKLNLKGETKTKYDAMKKDNVESTNKYLAPVEEKIHNAEALLDKFSFNA
SQSEIDDANELMDSYEQSYQQQLEDVNEIIALYKDNDELYDKCKVDYREMKRDVLANRHQFGEAASLLETEIEKFEPRLE
QYEVLKADGNYVQAHNHIAALNEQMKQLRSYMHGSSGN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRSNKRQIIEKAIERKNEIETLPFDQNLAQLSKLNLKGETKTKYDAMKKDNVESTNKYLAPVEEKIHNAEALLDKFSFNA
SQSEIDDANELMDSYEQSYQQQLEDVNEIIALYKDNDELYDKCKVDYREMKRDVLANRHQFGEAASLLETEIEKFEPRLE
QYEVLKADGNYVQAHNHIAALNEQMKQLRSYMHGSSGN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   SER n 
1 4   ASN n 
1 5   LYS n 
1 6   ARG n 
1 7   GLN n 
1 8   ILE n 
1 9   ILE n 
1 10  GLU n 
1 11  LYS n 
1 12  ALA n 
1 13  ILE n 
1 14  GLU n 
1 15  ARG n 
1 16  LYS n 
1 17  ASN n 
1 18  GLU n 
1 19  ILE n 
1 20  GLU n 
1 21  THR n 
1 22  LEU n 
1 23  PRO n 
1 24  PHE n 
1 25  ASP n 
1 26  GLN n 
1 27  ASN n 
1 28  LEU n 
1 29  ALA n 
1 30  GLN n 
1 31  LEU n 
1 32  SER n 
1 33  LYS n 
1 34  LEU n 
1 35  ASN n 
1 36  LEU n 
1 37  LYS n 
1 38  GLY n 
1 39  GLU n 
1 40  THR n 
1 41  LYS n 
1 42  THR n 
1 43  LYS n 
1 44  TYR n 
1 45  ASP n 
1 46  ALA n 
1 47  MET n 
1 48  LYS n 
1 49  LYS n 
1 50  ASP n 
1 51  ASN n 
1 52  VAL n 
1 53  GLU n 
1 54  SER n 
1 55  THR n 
1 56  ASN n 
1 57  LYS n 
1 58  TYR n 
1 59  LEU n 
1 60  ALA n 
1 61  PRO n 
1 62  VAL n 
1 63  GLU n 
1 64  GLU n 
1 65  LYS n 
1 66  ILE n 
1 67  HIS n 
1 68  ASN n 
1 69  ALA n 
1 70  GLU n 
1 71  ALA n 
1 72  LEU n 
1 73  LEU n 
1 74  ASP n 
1 75  LYS n 
1 76  PHE n 
1 77  SER n 
1 78  PHE n 
1 79  ASN n 
1 80  ALA n 
1 81  SER n 
1 82  GLN n 
1 83  SER n 
1 84  GLU n 
1 85  ILE n 
1 86  ASP n 
1 87  ASP n 
1 88  ALA n 
1 89  ASN n 
1 90  GLU n 
1 91  LEU n 
1 92  MET n 
1 93  ASP n 
1 94  SER n 
1 95  TYR n 
1 96  GLU n 
1 97  GLN n 
1 98  SER n 
1 99  TYR n 
1 100 GLN n 
1 101 GLN n 
1 102 GLN n 
1 103 LEU n 
1 104 GLU n 
1 105 ASP n 
1 106 VAL n 
1 107 ASN n 
1 108 GLU n 
1 109 ILE n 
1 110 ILE n 
1 111 ALA n 
1 112 LEU n 
1 113 TYR n 
1 114 LYS n 
1 115 ASP n 
1 116 ASN n 
1 117 ASP n 
1 118 GLU n 
1 119 LEU n 
1 120 TYR n 
1 121 ASP n 
1 122 LYS n 
1 123 CYS n 
1 124 LYS n 
1 125 VAL n 
1 126 ASP n 
1 127 TYR n 
1 128 ARG n 
1 129 GLU n 
1 130 MET n 
1 131 LYS n 
1 132 ARG n 
1 133 ASP n 
1 134 VAL n 
1 135 LEU n 
1 136 ALA n 
1 137 ASN n 
1 138 ARG n 
1 139 HIS n 
1 140 GLN n 
1 141 PHE n 
1 142 GLY n 
1 143 GLU n 
1 144 ALA n 
1 145 ALA n 
1 146 SER n 
1 147 LEU n 
1 148 LEU n 
1 149 GLU n 
1 150 THR n 
1 151 GLU n 
1 152 ILE n 
1 153 GLU n 
1 154 LYS n 
1 155 PHE n 
1 156 GLU n 
1 157 PRO n 
1 158 ARG n 
1 159 LEU n 
1 160 GLU n 
1 161 GLN n 
1 162 TYR n 
1 163 GLU n 
1 164 VAL n 
1 165 LEU n 
1 166 LYS n 
1 167 ALA n 
1 168 ASP n 
1 169 GLY n 
1 170 ASN n 
1 171 TYR n 
1 172 VAL n 
1 173 GLN n 
1 174 ALA n 
1 175 HIS n 
1 176 ASN n 
1 177 HIS n 
1 178 ILE n 
1 179 ALA n 
1 180 ALA n 
1 181 LEU n 
1 182 ASN n 
1 183 GLU n 
1 184 GLN n 
1 185 MET n 
1 186 LYS n 
1 187 GLN n 
1 188 LEU n 
1 189 ARG n 
1 190 SER n 
1 191 TYR n 
1 192 MET n 
1 193 HIS n 
1 194 GLY n 
1 195 SER n 
1 196 SER n 
1 197 GLY n 
1 198 ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'STAPHYLOCOCCUS AUREUS' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1280 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'ESCHERICHIA COLI' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              'ROSETTA PLYSS' 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               PETMSCI 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    EZRA_STAA1 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_db_accession          A7X3E7 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              4UY3 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 192 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             A7X3E7 
_struct_ref_seq.db_align_beg                  24 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  214 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       24 
_struct_ref_seq.pdbx_auth_seq_align_end       214 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4UY3 MET A 1   ? UNP A7X3E7 ? ? 'expression tag' 23  1 
1 4UY3 HIS A 193 ? UNP A7X3E7 ? ? 'expression tag' 215 2 
1 4UY3 GLY A 194 ? UNP A7X3E7 ? ? 'expression tag' 216 3 
1 4UY3 SER A 195 ? UNP A7X3E7 ? ? 'expression tag' 217 4 
1 4UY3 SER A 196 ? UNP A7X3E7 ? ? 'expression tag' 218 5 
1 4UY3 GLY A 197 ? UNP A7X3E7 ? ? 'expression tag' 219 6 
1 4UY3 ASN A 198 ? UNP A7X3E7 ? ? 'expression tag' 220 7 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          4UY3 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.86 
_exptl_crystal.density_percent_sol   74.71 
_exptl_crystal.description           NONE 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    '0.1M TRIS PH 7.5, 34% MPD' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               PIXEL 
_diffrn_detector.type                   'DECTRIS PILATUS 6M' 
_diffrn_detector.pdbx_collection_date   2014-07-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97950 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.pdbx_synchrotron_site       Diamond 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_wavelength             0.97950 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     4UY3 
_reflns.observed_criterion_sigma_I   -2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.56 
_reflns.d_resolution_high            2.60 
_reflns.number_obs                   14588 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         100.0 
_reflns.pdbx_Rmerge_I_obs            0.08 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        15.30 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              14.4 
# 
_reflns_shell.pdbx_diffrn_id         1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.d_res_high             2.60 
_reflns_shell.d_res_low              2.72 
_reflns_shell.percent_possible_all   100.0 
_reflns_shell.Rmerge_I_obs           0.97 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.80 
_reflns_shell.pdbx_redundancy        14.8 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 4UY3 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     13770 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          . 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.56 
_refine.ls_d_res_high                            2.60 
_refine.ls_percent_reflns_obs                    99.84 
_refine.ls_R_factor_obs                          0.21112 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.20930 
_refine.ls_R_factor_R_free                       0.24894 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  753 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.958 
_refine.correlation_coeff_Fo_to_Fc_free          0.949 
_refine.B_iso_mean                               87.020 
_refine.aniso_B[1][1]                            0.14 
_refine.aniso_B[2][2]                            0.14 
_refine.aniso_B[3][3]                            -0.29 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS. U VALUES WITH TLS ADDED' 
_refine.pdbx_starting_model                      'TO BE DEPOSITED' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.256 
_refine.pdbx_overall_ESU_R_Free                  0.224 
_refine.overall_SU_ML                            0.205 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             23.391 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1586 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               1586 
_refine_hist.d_res_high                       2.60 
_refine_hist.d_res_low                        48.56 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.010  0.019  ? 1608 'X-RAY DIFFRACTION' ? 
r_bond_other_d               0.001  0.020  ? 1523 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.317  1.960  ? 2159 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            0.784  3.000  ? 3512 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       5.156  5.000  ? 193  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       38.887 26.087 ? 92   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       18.715 15.000 ? 316  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       17.256 15.000 ? 8    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.071  0.200  ? 231  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.004  0.020  ? 1851 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           0.001  0.020  ? 363  'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  3.667  6.454  ? 775  'X-RAY DIFFRACTION' ? 
r_mcbond_other               3.659  6.453  ? 774  'X-RAY DIFFRACTION' ? 
r_mcangle_it                 5.326  9.692  ? 967  'X-RAY DIFFRACTION' ? 
r_mcangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scbond_it                  5.628  7.149  ? 833  'X-RAY DIFFRACTION' ? 
r_scbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_scangle_it                 8.806  10.447 ? 1193 'X-RAY DIFFRACTION' ? 
r_scangle_other              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_long_range_B_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.600 
_refine_ls_shell.d_res_low                        2.668 
_refine_ls_shell.number_reflns_R_work             982 
_refine_ls_shell.R_factor_R_work                  0.430 
_refine_ls_shell.percent_reflns_obs               99.71 
_refine_ls_shell.R_factor_R_free                  0.478 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             64 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  4UY3 
_struct.title                     'Cytoplasmic domain of bacterial cell division protein ezra' 
_struct.pdbx_descriptor           'SEPTATION RING FORMATION REGULATOR EZRA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4UY3 
_struct_keywords.pdbx_keywords   'STRUCTURAL PROTEIN' 
_struct_keywords.text            'STRUCTURAL PROTEIN, DIVISOME, FTSZ, CELL WALL, TUBULIN, SPECTRIN, Z-RING' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 MET A 1   ? GLU A 20  ? MET A 23  GLU A 42  1 ? 20 
HELX_P HELX_P2 2 PRO A 23  ? LYS A 33  ? PRO A 45  LYS A 55  1 ? 11 
HELX_P HELX_P3 3 LYS A 37  ? LEU A 59  ? LYS A 59  LEU A 81  1 ? 23 
HELX_P HELX_P4 4 PRO A 61  ? LYS A 75  ? PRO A 83  LYS A 97  1 ? 15 
HELX_P HELX_P5 5 SER A 77  ? ASN A 137 ? SER A 99  ASN A 159 1 ? 61 
HELX_P HELX_P6 6 ARG A 138 ? GLU A 143 ? ARG A 160 GLU A 165 5 ? 6  
HELX_P HELX_P7 7 ALA A 144 ? LYS A 154 ? ALA A 166 LYS A 176 1 ? 11 
HELX_P HELX_P8 8 LYS A 154 ? ASP A 168 ? LYS A 176 ASP A 190 1 ? 15 
HELX_P HELX_P9 9 ASN A 170 ? MET A 192 ? ASN A 192 MET A 214 1 ? 23 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          4UY3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4UY3 
_atom_sites.fract_transf_matrix[1][1]   0.010402 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010402 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010296 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N   . MET A 1 1   ? 34.029 -60.952 -7.089  1.00 99.33  ? 23  MET A N   1 
ATOM 2    C CA  . MET A 1 1   ? 34.249 -59.537 -7.533  1.00 99.65  ? 23  MET A CA  1 
ATOM 3    C C   . MET A 1 1   ? 32.942 -58.875 -8.017  1.00 98.05  ? 23  MET A C   1 
ATOM 4    O O   . MET A 1 1   ? 32.678 -57.701 -7.709  1.00 95.65  ? 23  MET A O   1 
ATOM 5    C CB  . MET A 1 1   ? 35.347 -59.456 -8.609  1.00 96.69  ? 23  MET A CB  1 
ATOM 6    C CG  . MET A 1 1   ? 35.616 -58.042 -9.169  1.00 96.96  ? 23  MET A CG  1 
ATOM 7    S SD  . MET A 1 1   ? 36.605 -56.879 -8.172  1.00 97.72  ? 23  MET A SD  1 
ATOM 8    C CE  . MET A 1 1   ? 35.355 -55.792 -7.558  1.00 92.80  ? 23  MET A CE  1 
ATOM 9    N N   . ARG A 1 2   ? 32.119 -59.623 -8.752  1.00 91.75  ? 24  ARG A N   1 
ATOM 10   C CA  . ARG A 1 2   ? 30.785 -59.136 -9.101  1.00 88.66  ? 24  ARG A CA  1 
ATOM 11   C C   . ARG A 1 2   ? 29.967 -58.743 -7.869  1.00 92.95  ? 24  ARG A C   1 
ATOM 12   O O   . ARG A 1 2   ? 29.296 -57.722 -7.892  1.00 101.85 ? 24  ARG A O   1 
ATOM 13   C CB  . ARG A 1 2   ? 29.972 -60.163 -9.886  1.00 89.35  ? 24  ARG A CB  1 
ATOM 14   C CG  . ARG A 1 2   ? 30.631 -60.762 -11.116 1.00 88.59  ? 24  ARG A CG  1 
ATOM 15   C CD  . ARG A 1 2   ? 30.564 -62.272 -10.998 1.00 97.95  ? 24  ARG A CD  1 
ATOM 16   N NE  . ARG A 1 2   ? 29.495 -62.844 -11.801 1.00 96.51  ? 24  ARG A NE  1 
ATOM 17   C CZ  . ARG A 1 2   ? 29.155 -64.127 -11.782 1.00 98.28  ? 24  ARG A CZ  1 
ATOM 18   N NH1 . ARG A 1 2   ? 29.782 -64.989 -10.988 1.00 98.08  ? 24  ARG A NH1 1 
ATOM 19   N NH2 . ARG A 1 2   ? 28.176 -64.545 -12.565 1.00 105.14 ? 24  ARG A NH2 1 
ATOM 20   N N   . SER A 1 3   ? 29.998 -59.533 -6.797  1.00 102.90 ? 25  SER A N   1 
ATOM 21   C CA  . SER A 1 3   ? 29.134 -59.222 -5.656  1.00 109.63 ? 25  SER A CA  1 
ATOM 22   C C   . SER A 1 3   ? 29.425 -57.815 -5.111  1.00 111.77 ? 25  SER A C   1 
ATOM 23   O O   . SER A 1 3   ? 28.491 -57.126 -4.676  1.00 124.63 ? 25  SER A O   1 
ATOM 24   C CB  . SER A 1 3   ? 29.199 -60.284 -4.556  1.00 110.98 ? 25  SER A CB  1 
ATOM 25   O OG  . SER A 1 3   ? 30.334 -60.098 -3.751  1.00 116.38 ? 25  SER A OG  1 
ATOM 26   N N   . ASN A 1 4   ? 30.675 -57.347 -5.175  1.00 104.41 ? 26  ASN A N   1 
ATOM 27   C CA  . ASN A 1 4   ? 30.957 -56.001 -4.659  1.00 111.27 ? 26  ASN A CA  1 
ATOM 28   C C   . ASN A 1 4   ? 30.895 -54.854 -5.718  1.00 102.92 ? 26  ASN A C   1 
ATOM 29   O O   . ASN A 1 4   ? 30.816 -53.662 -5.370  1.00 105.31 ? 26  ASN A O   1 
ATOM 30   C CB  . ASN A 1 4   ? 32.209 -56.005 -3.755  1.00 115.86 ? 26  ASN A CB  1 
ATOM 31   C CG  . ASN A 1 4   ? 33.482 -55.716 -4.499  1.00 115.08 ? 26  ASN A CG  1 
ATOM 32   O OD1 . ASN A 1 4   ? 33.513 -54.879 -5.399  1.00 105.63 ? 26  ASN A OD1 1 
ATOM 33   N ND2 . ASN A 1 4   ? 34.557 -56.382 -4.096  1.00 115.61 ? 26  ASN A ND2 1 
ATOM 34   N N   . LYS A 1 5   ? 30.880 -55.220 -6.996  1.00 93.36  ? 27  LYS A N   1 
ATOM 35   C CA  . LYS A 1 5   ? 30.377 -54.320 -8.059  1.00 87.34  ? 27  LYS A CA  1 
ATOM 36   C C   . LYS A 1 5   ? 28.866 -54.163 -8.035  1.00 85.74  ? 27  LYS A C   1 
ATOM 37   O O   . LYS A 1 5   ? 28.339 -53.151 -8.502  1.00 86.58  ? 27  LYS A O   1 
ATOM 38   C CB  . LYS A 1 5   ? 30.746 -54.842 -9.445  1.00 89.13  ? 27  LYS A CB  1 
ATOM 39   C CG  . LYS A 1 5   ? 32.223 -54.716 -9.794  1.00 88.53  ? 27  LYS A CG  1 
ATOM 40   C CD  . LYS A 1 5   ? 32.483 -53.489 -10.647 1.00 92.56  ? 27  LYS A CD  1 
ATOM 41   C CE  . LYS A 1 5   ? 33.963 -53.342 -10.931 1.00 92.56  ? 27  LYS A CE  1 
ATOM 42   N NZ  . LYS A 1 5   ? 34.714 -52.985 -9.704  1.00 90.02  ? 27  LYS A NZ  1 
ATOM 43   N N   . ARG A 1 6   ? 28.157 -55.160 -7.509  1.00 87.97  ? 28  ARG A N   1 
ATOM 44   C CA  . ARG A 1 6   ? 26.719 -55.049 -7.396  1.00 87.83  ? 28  ARG A CA  1 
ATOM 45   C C   . ARG A 1 6   ? 26.340 -53.906 -6.486  1.00 82.64  ? 28  ARG A C   1 
ATOM 46   O O   . ARG A 1 6   ? 25.257 -53.396 -6.613  1.00 90.23  ? 28  ARG A O   1 
ATOM 47   C CB  . ARG A 1 6   ? 26.057 -56.336 -6.909  1.00 94.46  ? 28  ARG A CB  1 
ATOM 48   C CG  . ARG A 1 6   ? 24.679 -56.589 -7.543  1.00 103.31 ? 28  ARG A CG  1 
ATOM 49   C CD  . ARG A 1 6   ? 24.766 -57.698 -8.588  1.00 105.20 ? 28  ARG A CD  1 
ATOM 50   N NE  . ARG A 1 6   ? 25.155 -58.931 -7.905  1.00 117.70 ? 28  ARG A NE  1 
ATOM 51   C CZ  . ARG A 1 6   ? 25.880 -59.933 -8.414  1.00 125.35 ? 28  ARG A CZ  1 
ATOM 52   N NH1 . ARG A 1 6   ? 26.323 -59.916 -9.677  1.00 114.99 ? 28  ARG A NH1 1 
ATOM 53   N NH2 . ARG A 1 6   ? 26.162 -60.981 -7.634  1.00 125.67 ? 28  ARG A NH2 1 
ATOM 54   N N   . GLN A 1 7   ? 27.211 -53.507 -5.572  1.00 87.12  ? 29  GLN A N   1 
ATOM 55   C CA  . GLN A 1 7   ? 26.918 -52.371 -4.698  1.00 93.78  ? 29  GLN A CA  1 
ATOM 56   C C   . GLN A 1 7   ? 26.808 -51.072 -5.491  1.00 91.57  ? 29  GLN A C   1 
ATOM 57   O O   . GLN A 1 7   ? 25.969 -50.216 -5.179  1.00 87.44  ? 29  GLN A O   1 
ATOM 58   C CB  . GLN A 1 7   ? 27.981 -52.219 -3.609  1.00 102.83 ? 29  GLN A CB  1 
ATOM 59   C CG  . GLN A 1 7   ? 27.816 -53.196 -2.449  1.00 115.07 ? 29  GLN A CG  1 
ATOM 60   C CD  . GLN A 1 7   ? 29.145 -53.727 -1.916  1.00 129.20 ? 29  GLN A CD  1 
ATOM 61   O OE1 . GLN A 1 7   ? 30.219 -53.191 -2.212  1.00 130.60 ? 29  GLN A OE1 1 
ATOM 62   N NE2 . GLN A 1 7   ? 29.077 -54.798 -1.132  1.00 138.92 ? 29  GLN A NE2 1 
ATOM 63   N N   . ILE A 1 8   ? 27.643 -50.922 -6.516  1.00 87.24  ? 30  ILE A N   1 
ATOM 64   C CA  . ILE A 1 8   ? 27.630 -49.689 -7.314  1.00 87.38  ? 30  ILE A CA  1 
ATOM 65   C C   . ILE A 1 8   ? 26.236 -49.611 -7.944  1.00 85.23  ? 30  ILE A C   1 
ATOM 66   O O   . ILE A 1 8   ? 25.563 -48.570 -7.905  1.00 82.45  ? 30  ILE A O   1 
ATOM 67   C CB  . ILE A 1 8   ? 28.721 -49.658 -8.428  1.00 93.17  ? 30  ILE A CB  1 
ATOM 68   C CG1 . ILE A 1 8   ? 30.099 -50.204 -7.969  1.00 106.96 ? 30  ILE A CG1 1 
ATOM 69   C CG2 . ILE A 1 8   ? 28.921 -48.261 -8.954  1.00 88.49  ? 30  ILE A CG2 1 
ATOM 70   C CD1 . ILE A 1 8   ? 30.561 -49.819 -6.574  1.00 111.51 ? 30  ILE A CD1 1 
ATOM 71   N N   . ILE A 1 9   ? 25.790 -50.745 -8.480  1.00 82.25  ? 31  ILE A N   1 
ATOM 72   C CA  . ILE A 1 9   ? 24.488 -50.840 -9.137  1.00 76.21  ? 31  ILE A CA  1 
ATOM 73   C C   . ILE A 1 9   ? 23.329 -50.586 -8.185  1.00 81.07  ? 31  ILE A C   1 
ATOM 74   O O   . ILE A 1 9   ? 22.383 -49.879 -8.543  1.00 81.76  ? 31  ILE A O   1 
ATOM 75   C CB  . ILE A 1 9   ? 24.295 -52.208 -9.806  1.00 72.62  ? 31  ILE A CB  1 
ATOM 76   C CG1 . ILE A 1 9   ? 25.346 -52.371 -10.909 1.00 72.48  ? 31  ILE A CG1 1 
ATOM 77   C CG2 . ILE A 1 9   ? 22.893 -52.318 -10.388 1.00 71.11  ? 31  ILE A CG2 1 
ATOM 78   C CD1 . ILE A 1 9   ? 25.273 -53.673 -11.682 1.00 75.76  ? 31  ILE A CD1 1 
ATOM 79   N N   . GLU A 1 10  ? 23.403 -51.155 -6.982  1.00 83.95  ? 32  GLU A N   1 
ATOM 80   C CA  . GLU A 1 10  ? 22.367 -50.943 -5.975  1.00 88.43  ? 32  GLU A CA  1 
ATOM 81   C C   . GLU A 1 10  ? 22.280 -49.480 -5.562  1.00 86.04  ? 32  GLU A C   1 
ATOM 82   O O   . GLU A 1 10  ? 21.187 -48.966 -5.377  1.00 86.02  ? 32  GLU A O   1 
ATOM 83   C CB  . GLU A 1 10  ? 22.556 -51.866 -4.761  1.00 96.94  ? 32  GLU A CB  1 
ATOM 84   C CG  . GLU A 1 10  ? 22.126 -53.301 -5.059  1.00 105.70 ? 32  GLU A CG  1 
ATOM 85   C CD  . GLU A 1 10  ? 22.368 -54.252 -3.905  1.00 119.31 ? 32  GLU A CD  1 
ATOM 86   O OE1 . GLU A 1 10  ? 21.990 -53.904 -2.755  1.00 122.98 ? 32  GLU A OE1 1 
ATOM 87   O OE2 . GLU A 1 10  ? 22.920 -55.353 -4.161  1.00 119.20 ? 32  GLU A OE2 1 
ATOM 88   N N   . LYS A 1 11  ? 23.417 -48.797 -5.469  1.00 85.31  ? 33  LYS A N   1 
ATOM 89   C CA  . LYS A 1 11  ? 23.412 -47.385 -5.122  1.00 84.38  ? 33  LYS A CA  1 
ATOM 90   C C   . LYS A 1 11  ? 22.663 -46.582 -6.194  1.00 81.11  ? 33  LYS A C   1 
ATOM 91   O O   . LYS A 1 11  ? 21.925 -45.610 -5.889  1.00 77.81  ? 33  LYS A O   1 
ATOM 92   C CB  . LYS A 1 11  ? 24.829 -46.857 -4.908  1.00 91.79  ? 33  LYS A CB  1 
ATOM 93   C CG  . LYS A 1 11  ? 24.853 -45.690 -3.941  1.00 112.17 ? 33  LYS A CG  1 
ATOM 94   C CD  . LYS A 1 11  ? 26.205 -45.008 -3.834  1.00 124.75 ? 33  LYS A CD  1 
ATOM 95   C CE  . LYS A 1 11  ? 26.021 -43.552 -3.415  1.00 129.17 ? 33  LYS A CE  1 
ATOM 96   N NZ  . LYS A 1 11  ? 27.333 -42.870 -3.289  1.00 132.25 ? 33  LYS A NZ  1 
ATOM 97   N N   . ALA A 1 12  ? 22.800 -47.017 -7.441  1.00 74.37  ? 34  ALA A N   1 
ATOM 98   C CA  . ALA A 1 12  ? 22.071 -46.373 -8.533  1.00 74.28  ? 34  ALA A CA  1 
ATOM 99   C C   . ALA A 1 12  ? 20.559 -46.614 -8.438  1.00 76.72  ? 34  ALA A C   1 
ATOM 100  O O   . ALA A 1 12  ? 19.776 -45.688 -8.692  1.00 76.49  ? 34  ALA A O   1 
ATOM 101  C CB  . ALA A 1 12  ? 22.602 -46.830 -9.877  1.00 72.40  ? 34  ALA A CB  1 
ATOM 102  N N   . ILE A 1 13  ? 20.152 -47.832 -8.059  1.00 76.18  ? 35  ILE A N   1 
ATOM 103  C CA  . ILE A 1 13  ? 18.730 -48.151 -7.902  1.00 76.54  ? 35  ILE A CA  1 
ATOM 104  C C   . ILE A 1 13  ? 18.119 -47.315 -6.762  1.00 83.13  ? 35  ILE A C   1 
ATOM 105  O O   . ILE A 1 13  ? 16.992 -46.820 -6.886  1.00 80.63  ? 35  ILE A O   1 
ATOM 106  C CB  . ILE A 1 13  ? 18.493 -49.671 -7.709  1.00 82.33  ? 35  ILE A CB  1 
ATOM 107  C CG1 . ILE A 1 13  ? 18.871 -50.443 -8.984  1.00 83.96  ? 35  ILE A CG1 1 
ATOM 108  C CG2 . ILE A 1 13  ? 17.029 -49.966 -7.400  1.00 84.02  ? 35  ILE A CG2 1 
ATOM 109  C CD1 . ILE A 1 13  ? 19.058 -51.947 -8.823  1.00 84.45  ? 35  ILE A CD1 1 
ATOM 110  N N   . GLU A 1 14  ? 18.878 -47.127 -5.677  1.00 88.27  ? 36  GLU A N   1 
ATOM 111  C CA  . GLU A 1 14  ? 18.427 -46.312 -4.537  1.00 90.22  ? 36  GLU A CA  1 
ATOM 112  C C   . GLU A 1 14  ? 18.275 -44.876 -4.974  1.00 86.89  ? 36  GLU A C   1 
ATOM 113  O O   . GLU A 1 14  ? 17.330 -44.187 -4.580  1.00 93.15  ? 36  GLU A O   1 
ATOM 114  C CB  . GLU A 1 14  ? 19.391 -46.418 -3.335  1.00 96.73  ? 36  GLU A CB  1 
ATOM 115  C CG  . GLU A 1 14  ? 19.013 -47.527 -2.347  1.00 110.55 ? 36  GLU A CG  1 
ATOM 116  C CD  . GLU A 1 14  ? 20.204 -48.319 -1.810  1.00 120.60 ? 36  GLU A CD  1 
ATOM 117  O OE1 . GLU A 1 14  ? 21.162 -47.687 -1.315  1.00 129.14 ? 36  GLU A OE1 1 
ATOM 118  O OE2 . GLU A 1 14  ? 20.178 -49.577 -1.877  1.00 116.07 ? 36  GLU A OE2 1 
ATOM 119  N N   . ARG A 1 15  ? 19.208 -44.427 -5.803  1.00 83.78  ? 37  ARG A N   1 
ATOM 120  C CA  . ARG A 1 15  ? 19.173 -43.056 -6.299  1.00 77.35  ? 37  ARG A CA  1 
ATOM 121  C C   . ARG A 1 15  ? 17.983 -42.816 -7.237  1.00 79.28  ? 37  ARG A C   1 
ATOM 122  O O   . ARG A 1 15  ? 17.363 -41.754 -7.192  1.00 79.33  ? 37  ARG A O   1 
ATOM 123  C CB  . ARG A 1 15  ? 20.474 -42.708 -7.002  1.00 69.62  ? 37  ARG A CB  1 
ATOM 124  C CG  . ARG A 1 15  ? 20.634 -41.232 -7.243  1.00 69.71  ? 37  ARG A CG  1 
ATOM 125  C CD  . ARG A 1 15  ? 21.787 -40.888 -8.167  1.00 67.77  ? 37  ARG A CD  1 
ATOM 126  N NE  . ARG A 1 15  ? 21.769 -39.457 -8.483  1.00 71.17  ? 37  ARG A NE  1 
ATOM 127  C CZ  . ARG A 1 15  ? 22.423 -38.901 -9.500  1.00 72.02  ? 37  ARG A CZ  1 
ATOM 128  N NH1 . ARG A 1 15  ? 23.166 -39.640 -10.315 1.00 74.83  ? 37  ARG A NH1 1 
ATOM 129  N NH2 . ARG A 1 15  ? 22.310 -37.605 -9.731  1.00 69.31  ? 37  ARG A NH2 1 
ATOM 130  N N   . LYS A 1 16  ? 17.662 -43.787 -8.086  1.00 79.52  ? 38  LYS A N   1 
ATOM 131  C CA  . LYS A 1 16  ? 16.523 -43.625 -8.981  1.00 80.33  ? 38  LYS A CA  1 
ATOM 132  C C   . LYS A 1 16  ? 15.249 -43.521 -8.138  1.00 84.09  ? 38  LYS A C   1 
ATOM 133  O O   . LYS A 1 16  ? 14.456 -42.603 -8.303  1.00 92.98  ? 38  LYS A O   1 
ATOM 134  C CB  . LYS A 1 16  ? 16.432 -44.793 -9.964  1.00 80.41  ? 38  LYS A CB  1 
ATOM 135  C CG  . LYS A 1 16  ? 15.203 -44.774 -10.866 1.00 86.38  ? 38  LYS A CG  1 
ATOM 136  C CD  . LYS A 1 16  ? 14.919 -46.140 -11.486 1.00 92.12  ? 38  LYS A CD  1 
ATOM 137  C CE  . LYS A 1 16  ? 13.415 -46.382 -11.587 1.00 104.55 ? 38  LYS A CE  1 
ATOM 138  N NZ  . LYS A 1 16  ? 13.055 -47.724 -12.133 1.00 112.43 ? 38  LYS A NZ  1 
ATOM 139  N N   . ASN A 1 17  ? 15.075 -44.453 -7.216  1.00 84.24  ? 39  ASN A N   1 
ATOM 140  C CA  . ASN A 1 17  ? 13.850 -44.529 -6.455  1.00 85.42  ? 39  ASN A CA  1 
ATOM 141  C C   . ASN A 1 17  ? 13.637 -43.306 -5.603  1.00 89.18  ? 39  ASN A C   1 
ATOM 142  O O   . ASN A 1 17  ? 12.487 -42.979 -5.292  1.00 99.59  ? 39  ASN A O   1 
ATOM 143  C CB  . ASN A 1 17  ? 13.827 -45.791 -5.589  1.00 87.48  ? 39  ASN A CB  1 
ATOM 144  C CG  . ASN A 1 17  ? 13.669 -47.047 -6.418  1.00 89.73  ? 39  ASN A CG  1 
ATOM 145  O OD1 . ASN A 1 17  ? 13.075 -47.041 -7.499  1.00 98.84  ? 39  ASN A OD1 1 
ATOM 146  N ND2 . ASN A 1 17  ? 14.220 -48.120 -5.933  1.00 92.06  ? 39  ASN A ND2 1 
ATOM 147  N N   . GLU A 1 18  ? 14.708 -42.610 -5.235  1.00 82.72  ? 40  GLU A N   1 
ATOM 148  C CA  . GLU A 1 18  ? 14.513 -41.434 -4.419  1.00 91.87  ? 40  GLU A CA  1 
ATOM 149  C C   . GLU A 1 18  ? 14.258 -40.189 -5.263  1.00 90.04  ? 40  GLU A C   1 
ATOM 150  O O   . GLU A 1 18  ? 13.435 -39.355 -4.893  1.00 92.80  ? 40  GLU A O   1 
ATOM 151  C CB  . GLU A 1 18  ? 15.638 -41.262 -3.415  1.00 100.51 ? 40  GLU A CB  1 
ATOM 152  C CG  . GLU A 1 18  ? 16.749 -40.322 -3.795  1.00 112.49 ? 40  GLU A CG  1 
ATOM 153  C CD  . GLU A 1 18  ? 17.746 -40.257 -2.670  1.00 130.60 ? 40  GLU A CD  1 
ATOM 154  O OE1 . GLU A 1 18  ? 17.450 -39.560 -1.676  1.00 141.16 ? 40  GLU A OE1 1 
ATOM 155  O OE2 . GLU A 1 18  ? 18.787 -40.944 -2.753  1.00 144.06 ? 40  GLU A OE2 1 
ATOM 156  N N   . ILE A 1 19  ? 14.909 -40.069 -6.411  1.00 84.35  ? 41  ILE A N   1 
ATOM 157  C CA  . ILE A 1 19  ? 14.624 -38.931 -7.269  1.00 87.03  ? 41  ILE A CA  1 
ATOM 158  C C   . ILE A 1 19  ? 13.240 -39.005 -7.946  1.00 88.50  ? 41  ILE A C   1 
ATOM 159  O O   . ILE A 1 19  ? 12.708 -37.980 -8.385  1.00 89.23  ? 41  ILE A O   1 
ATOM 160  C CB  . ILE A 1 19  ? 15.712 -38.692 -8.327  1.00 88.90  ? 41  ILE A CB  1 
ATOM 161  C CG1 . ILE A 1 19  ? 15.690 -39.800 -9.361  1.00 93.04  ? 41  ILE A CG1 1 
ATOM 162  C CG2 . ILE A 1 19  ? 17.089 -38.537 -7.684  1.00 86.41  ? 41  ILE A CG2 1 
ATOM 163  C CD1 . ILE A 1 19  ? 16.562 -39.478 -10.545 1.00 102.13 ? 41  ILE A CD1 1 
ATOM 164  N N   . GLU A 1 20  ? 12.647 -40.194 -8.025  1.00 86.46  ? 42  GLU A N   1 
ATOM 165  C CA  . GLU A 1 20  ? 11.238 -40.304 -8.417  1.00 90.74  ? 42  GLU A CA  1 
ATOM 166  C C   . GLU A 1 20  ? 10.301 -39.572 -7.441  1.00 92.90  ? 42  GLU A C   1 
ATOM 167  O O   . GLU A 1 20  ? 9.135  -39.378 -7.745  1.00 97.57  ? 42  GLU A O   1 
ATOM 168  C CB  . GLU A 1 20  ? 10.797 -41.762 -8.475  1.00 96.65  ? 42  GLU A CB  1 
ATOM 169  C CG  . GLU A 1 20  ? 10.931 -42.469 -9.811  1.00 100.45 ? 42  GLU A CG  1 
ATOM 170  C CD  . GLU A 1 20  ? 10.892 -43.992 -9.638  1.00 121.24 ? 42  GLU A CD  1 
ATOM 171  O OE1 . GLU A 1 20  ? 10.211 -44.499 -8.703  1.00 123.62 ? 42  GLU A OE1 1 
ATOM 172  O OE2 . GLU A 1 20  ? 11.560 -44.698 -10.422 1.00 127.77 ? 42  GLU A OE2 1 
ATOM 173  N N   . THR A 1 21  ? 10.798 -39.195 -6.264  1.00 93.18  ? 43  THR A N   1 
ATOM 174  C CA  . THR A 1 21  ? 9.983  -38.537 -5.243  1.00 90.55  ? 43  THR A CA  1 
ATOM 175  C C   . THR A 1 21  ? 10.293 -37.050 -5.070  1.00 86.92  ? 43  THR A C   1 
ATOM 176  O O   . THR A 1 21  ? 9.889  -36.454 -4.074  1.00 88.64  ? 43  THR A O   1 
ATOM 177  C CB  . THR A 1 21  ? 10.216 -39.187 -3.871  1.00 91.60  ? 43  THR A CB  1 
ATOM 178  O OG1 . THR A 1 21  ? 11.499 -38.784 -3.372  1.00 87.57  ? 43  THR A OG1 1 
ATOM 179  C CG2 . THR A 1 21  ? 10.136 -40.704 -3.966  1.00 90.86  ? 43  THR A CG2 1 
ATOM 180  N N   . LEU A 1 22  ? 11.022 -36.459 -6.010  1.00 80.69  ? 44  LEU A N   1 
ATOM 181  C CA  . LEU A 1 22  ? 11.268 -35.028 -5.958  1.00 79.92  ? 44  LEU A CA  1 
ATOM 182  C C   . LEU A 1 22  ? 9.952  -34.311 -6.196  1.00 82.63  ? 44  LEU A C   1 
ATOM 183  O O   . LEU A 1 22  ? 9.243  -34.609 -7.162  1.00 80.65  ? 44  LEU A O   1 
ATOM 184  C CB  . LEU A 1 22  ? 12.275 -34.598 -7.015  1.00 81.12  ? 44  LEU A CB  1 
ATOM 185  C CG  . LEU A 1 22  ? 13.729 -35.008 -6.744  1.00 82.74  ? 44  LEU A CG  1 
ATOM 186  C CD1 . LEU A 1 22  ? 14.541 -34.901 -8.026  1.00 77.76  ? 44  LEU A CD1 1 
ATOM 187  C CD2 . LEU A 1 22  ? 14.356 -34.177 -5.627  1.00 80.52  ? 44  LEU A CD2 1 
ATOM 188  N N   . PRO A 1 23  ? 9.623  -33.353 -5.327  1.00 86.28  ? 45  PRO A N   1 
ATOM 189  C CA  . PRO A 1 23  ? 8.306  -32.729 -5.336  1.00 86.56  ? 45  PRO A CA  1 
ATOM 190  C C   . PRO A 1 23  ? 8.158  -31.640 -6.418  1.00 79.72  ? 45  PRO A C   1 
ATOM 191  O O   . PRO A 1 23  ? 7.932  -30.470 -6.112  1.00 74.61  ? 45  PRO A O   1 
ATOM 192  C CB  . PRO A 1 23  ? 8.232  -32.137 -3.935  1.00 92.10  ? 45  PRO A CB  1 
ATOM 193  C CG  . PRO A 1 23  ? 9.648  -31.693 -3.677  1.00 90.05  ? 45  PRO A CG  1 
ATOM 194  C CD  . PRO A 1 23  ? 10.516 -32.731 -4.329  1.00 87.30  ? 45  PRO A CD  1 
ATOM 195  N N   . PHE A 1 24  ? 8.273  -32.040 -7.678  1.00 77.25  ? 46  PHE A N   1 
ATOM 196  C CA  . PHE A 1 24  ? 8.016  -31.150 -8.812  1.00 78.39  ? 46  PHE A CA  1 
ATOM 197  C C   . PHE A 1 24  ? 6.665  -30.452 -8.735  1.00 80.72  ? 46  PHE A C   1 
ATOM 198  O O   . PHE A 1 24  ? 6.541  -29.286 -9.095  1.00 88.50  ? 46  PHE A O   1 
ATOM 199  C CB  . PHE A 1 24  ? 8.027  -31.939 -10.118 1.00 77.62  ? 46  PHE A CB  1 
ATOM 200  C CG  . PHE A 1 24  ? 9.398  -32.284 -10.632 1.00 73.96  ? 46  PHE A CG  1 
ATOM 201  C CD1 . PHE A 1 24  ? 10.086 -31.403 -11.454 1.00 77.40  ? 46  PHE A CD1 1 
ATOM 202  C CD2 . PHE A 1 24  ? 9.974  -33.499 -10.345 1.00 76.55  ? 46  PHE A CD2 1 
ATOM 203  C CE1 . PHE A 1 24  ? 11.331 -31.720 -11.965 1.00 75.94  ? 46  PHE A CE1 1 
ATOM 204  C CE2 . PHE A 1 24  ? 11.225 -33.827 -10.851 1.00 78.93  ? 46  PHE A CE2 1 
ATOM 205  C CZ  . PHE A 1 24  ? 11.905 -32.934 -11.664 1.00 77.60  ? 46  PHE A CZ  1 
ATOM 206  N N   . ASP A 1 25  ? 5.655  -31.181 -8.285  1.00 88.17  ? 47  ASP A N   1 
ATOM 207  C CA  . ASP A 1 25  ? 4.284  -30.675 -8.269  1.00 89.42  ? 47  ASP A CA  1 
ATOM 208  C C   . ASP A 1 25  ? 3.992  -29.781 -7.091  1.00 85.99  ? 47  ASP A C   1 
ATOM 209  O O   . ASP A 1 25  ? 3.352  -28.765 -7.272  1.00 89.24  ? 47  ASP A O   1 
ATOM 210  C CB  . ASP A 1 25  ? 3.300  -31.829 -8.282  1.00 96.75  ? 47  ASP A CB  1 
ATOM 211  C CG  . ASP A 1 25  ? 3.506  -32.738 -9.471  1.00 105.15 ? 47  ASP A CG  1 
ATOM 212  O OD1 . ASP A 1 25  ? 3.317  -32.265 -10.612 1.00 96.20  ? 47  ASP A OD1 1 
ATOM 213  O OD2 . ASP A 1 25  ? 3.890  -33.910 -9.260  1.00 117.70 ? 47  ASP A OD2 1 
ATOM 214  N N   . GLN A 1 26  ? 4.438  -30.154 -5.892  1.00 86.02  ? 48  GLN A N   1 
ATOM 215  C CA  . GLN A 1 26  ? 4.376  -29.246 -4.734  1.00 86.39  ? 48  GLN A CA  1 
ATOM 216  C C   . GLN A 1 26  ? 5.025  -27.907 -5.095  1.00 84.51  ? 48  GLN A C   1 
ATOM 217  O O   . GLN A 1 26  ? 4.503  -26.854 -4.762  1.00 84.46  ? 48  GLN A O   1 
ATOM 218  C CB  . GLN A 1 26  ? 5.070  -29.829 -3.496  1.00 91.66  ? 48  GLN A CB  1 
ATOM 219  C CG  . GLN A 1 26  ? 4.390  -31.053 -2.897  1.00 101.84 ? 48  GLN A CG  1 
ATOM 220  C CD  . GLN A 1 26  ? 4.903  -32.385 -3.459  1.00 111.29 ? 48  GLN A CD  1 
ATOM 221  O OE1 . GLN A 1 26  ? 5.145  -32.549 -4.678  1.00 107.15 ? 48  GLN A OE1 1 
ATOM 222  N NE2 . GLN A 1 26  ? 5.067  -33.354 -2.561  1.00 113.08 ? 48  GLN A NE2 1 
ATOM 223  N N   . ASN A 1 27  ? 6.156  -27.959 -5.797  1.00 83.85  ? 49  ASN A N   1 
ATOM 224  C CA  . ASN A 1 27  ? 6.848  -26.747 -6.246  1.00 81.37  ? 49  ASN A CA  1 
ATOM 225  C C   . ASN A 1 27  ? 5.915  -25.894 -7.100  1.00 78.45  ? 49  ASN A C   1 
ATOM 226  O O   . ASN A 1 27  ? 5.623  -24.746 -6.781  1.00 77.96  ? 49  ASN A O   1 
ATOM 227  C CB  . ASN A 1 27  ? 8.132  -27.099 -7.037  1.00 76.62  ? 49  ASN A CB  1 
ATOM 228  C CG  . ASN A 1 27  ? 8.838  -25.871 -7.579  1.00 76.07  ? 49  ASN A CG  1 
ATOM 229  O OD1 . ASN A 1 27  ? 9.323  -25.845 -8.721  1.00 76.33  ? 49  ASN A OD1 1 
ATOM 230  N ND2 . ASN A 1 27  ? 8.887  -24.835 -6.766  1.00 75.98  ? 49  ASN A ND2 1 
ATOM 231  N N   . LEU A 1 28  ? 5.432  -26.486 -8.179  1.00 76.89  ? 50  LEU A N   1 
ATOM 232  C CA  . LEU A 1 28  ? 4.543  -25.803 -9.104  1.00 75.86  ? 50  LEU A CA  1 
ATOM 233  C C   . LEU A 1 28  ? 3.211  -25.379 -8.491  1.00 73.93  ? 50  LEU A C   1 
ATOM 234  O O   . LEU A 1 28  ? 2.643  -24.384 -8.903  1.00 74.17  ? 50  LEU A O   1 
ATOM 235  C CB  . LEU A 1 28  ? 4.270  -26.690 -10.317 1.00 78.84  ? 50  LEU A CB  1 
ATOM 236  C CG  . LEU A 1 28  ? 5.434  -26.859 -11.291 1.00 79.92  ? 50  LEU A CG  1 
ATOM 237  C CD1 . LEU A 1 28  ? 5.044  -27.764 -12.455 1.00 83.44  ? 50  LEU A CD1 1 
ATOM 238  C CD2 . LEU A 1 28  ? 5.892  -25.501 -11.810 1.00 78.59  ? 50  LEU A CD2 1 
ATOM 239  N N   . ALA A 1 29  ? 2.710  -26.120 -7.512  1.00 76.17  ? 51  ALA A N   1 
ATOM 240  C CA  . ALA A 1 29  ? 1.466  -25.736 -6.825  1.00 77.83  ? 51  ALA A CA  1 
ATOM 241  C C   . ALA A 1 29  ? 1.562  -24.367 -6.142  1.00 81.08  ? 51  ALA A C   1 
ATOM 242  O O   . ALA A 1 29  ? 0.537  -23.746 -5.862  1.00 85.92  ? 51  ALA A O   1 
ATOM 243  C CB  . ALA A 1 29  ? 1.069  -26.794 -5.813  1.00 77.52  ? 51  ALA A CB  1 
ATOM 244  N N   . GLN A 1 30  ? 2.781  -23.896 -5.863  1.00 81.30  ? 52  GLN A N   1 
ATOM 245  C CA  . GLN A 1 30  ? 2.951  -22.564 -5.312  1.00 76.13  ? 52  GLN A CA  1 
ATOM 246  C C   . GLN A 1 30  ? 2.407  -21.508 -6.273  1.00 76.96  ? 52  GLN A C   1 
ATOM 247  O O   . GLN A 1 30  ? 1.831  -20.516 -5.832  1.00 80.74  ? 52  GLN A O   1 
ATOM 248  C CB  . GLN A 1 30  ? 4.402  -22.284 -5.037  1.00 73.30  ? 52  GLN A CB  1 
ATOM 249  C CG  . GLN A 1 30  ? 4.994  -23.030 -3.867  1.00 77.02  ? 52  GLN A CG  1 
ATOM 250  C CD  . GLN A 1 30  ? 6.495  -22.787 -3.810  1.00 80.81  ? 52  GLN A CD  1 
ATOM 251  O OE1 . GLN A 1 30  ? 7.235  -23.181 -4.720  1.00 81.95  ? 52  GLN A OE1 1 
ATOM 252  N NE2 . GLN A 1 30  ? 6.947  -22.101 -2.776  1.00 77.62  ? 52  GLN A NE2 1 
ATOM 253  N N   . LEU A 1 31  ? 2.573  -21.714 -7.578  1.00 73.50  ? 53  LEU A N   1 
ATOM 254  C CA  . LEU A 1 31  ? 2.007  -20.790 -8.573  1.00 78.45  ? 53  LEU A CA  1 
ATOM 255  C C   . LEU A 1 31  ? 0.478  -20.674 -8.507  1.00 87.03  ? 53  LEU A C   1 
ATOM 256  O O   . LEU A 1 31  ? -0.084 -19.600 -8.764  1.00 89.42  ? 53  LEU A O   1 
ATOM 257  C CB  . LEU A 1 31  ? 2.408  -21.185 -9.988  1.00 75.91  ? 53  LEU A CB  1 
ATOM 258  C CG  . LEU A 1 31  ? 3.893  -21.131 -10.327 1.00 76.28  ? 53  LEU A CG  1 
ATOM 259  C CD1 . LEU A 1 31  ? 4.116  -21.509 -11.780 1.00 76.64  ? 53  LEU A CD1 1 
ATOM 260  C CD2 . LEU A 1 31  ? 4.489  -19.758 -10.063 1.00 79.01  ? 53  LEU A CD2 1 
ATOM 261  N N   . SER A 1 32  ? -0.190 -21.771 -8.157  1.00 93.29  ? 54  SER A N   1 
ATOM 262  C CA  . SER A 1 32  ? -1.645 -21.747 -7.949  1.00 95.92  ? 54  SER A CA  1 
ATOM 263  C C   . SER A 1 32  ? -2.102 -20.845 -6.783  1.00 89.16  ? 54  SER A C   1 
ATOM 264  O O   . SER A 1 32  ? -3.214 -20.377 -6.799  1.00 94.37  ? 54  SER A O   1 
ATOM 265  C CB  . SER A 1 32  ? -2.189 -23.178 -7.783  1.00 98.13  ? 54  SER A CB  1 
ATOM 266  O OG  . SER A 1 32  ? -1.973 -23.665 -6.472  1.00 100.01 ? 54  SER A OG  1 
ATOM 267  N N   . LYS A 1 33  ? -1.254 -20.600 -5.789  1.00 89.07  ? 55  LYS A N   1 
ATOM 268  C CA  . LYS A 1 33  ? -1.584 -19.681 -4.688  1.00 90.62  ? 55  LYS A CA  1 
ATOM 269  C C   . LYS A 1 33  ? -1.451 -18.205 -5.079  1.00 88.38  ? 55  LYS A C   1 
ATOM 270  O O   . LYS A 1 33  ? -1.657 -17.316 -4.250  1.00 88.39  ? 55  LYS A O   1 
ATOM 271  C CB  . LYS A 1 33  ? -0.693 -19.963 -3.474  1.00 97.96  ? 55  LYS A CB  1 
ATOM 272  C CG  . LYS A 1 33  ? -0.940 -21.318 -2.833  1.00 106.30 ? 55  LYS A CG  1 
ATOM 273  C CD  . LYS A 1 33  ? -2.094 -21.242 -1.842  1.00 121.18 ? 55  LYS A CD  1 
ATOM 274  C CE  . LYS A 1 33  ? -2.820 -22.573 -1.715  1.00 128.53 ? 55  LYS A CE  1 
ATOM 275  N NZ  . LYS A 1 33  ? -1.849 -23.695 -1.593  1.00 127.01 ? 55  LYS A NZ  1 
ATOM 276  N N   . LEU A 1 34  ? -1.080 -17.944 -6.327  1.00 84.56  ? 56  LEU A N   1 
ATOM 277  C CA  . LEU A 1 34  ? -1.087 -16.591 -6.881  1.00 84.86  ? 56  LEU A CA  1 
ATOM 278  C C   . LEU A 1 34  ? -2.227 -16.576 -7.898  1.00 89.77  ? 56  LEU A C   1 
ATOM 279  O O   . LEU A 1 34  ? -3.077 -17.445 -7.854  1.00 110.76 ? 56  LEU A O   1 
ATOM 280  C CB  . LEU A 1 34  ? 0.269  -16.287 -7.543  1.00 80.52  ? 56  LEU A CB  1 
ATOM 281  C CG  . LEU A 1 34  ? 1.515  -16.670 -6.714  1.00 78.51  ? 56  LEU A CG  1 
ATOM 282  C CD1 . LEU A 1 34  ? 2.801  -16.622 -7.517  1.00 73.34  ? 56  LEU A CD1 1 
ATOM 283  C CD2 . LEU A 1 34  ? 1.640  -15.776 -5.490  1.00 79.61  ? 56  LEU A CD2 1 
ATOM 284  N N   . ASN A 1 35  ? -2.260 -15.627 -8.819  1.00 89.40  ? 57  ASN A N   1 
ATOM 285  C CA  . ASN A 1 35  ? -3.276 -15.652 -9.866  1.00 96.28  ? 57  ASN A CA  1 
ATOM 286  C C   . ASN A 1 35  ? -2.902 -16.613 -10.971 1.00 100.61 ? 57  ASN A C   1 
ATOM 287  O O   . ASN A 1 35  ? -2.182 -16.229 -11.887 1.00 109.20 ? 57  ASN A O   1 
ATOM 288  C CB  . ASN A 1 35  ? -3.499 -14.248 -10.446 1.00 97.72  ? 57  ASN A CB  1 
ATOM 289  C CG  . ASN A 1 35  ? -3.939 -13.254 -9.383  1.00 98.40  ? 57  ASN A CG  1 
ATOM 290  O OD1 . ASN A 1 35  ? -4.791 -13.572 -8.558  1.00 103.61 ? 57  ASN A OD1 1 
ATOM 291  N ND2 . ASN A 1 35  ? -3.352 -12.062 -9.381  1.00 94.13  ? 57  ASN A ND2 1 
ATOM 292  N N   . LEU A 1 36  ? -3.398 -17.850 -10.901 1.00 99.28  ? 58  LEU A N   1 
ATOM 293  C CA  . LEU A 1 36  ? -3.243 -18.794 -12.010 1.00 101.26 ? 58  LEU A CA  1 
ATOM 294  C C   . LEU A 1 36  ? -4.111 -18.449 -13.254 1.00 98.68  ? 58  LEU A C   1 
ATOM 295  O O   . LEU A 1 36  ? -5.085 -19.145 -13.557 1.00 91.87  ? 58  LEU A O   1 
ATOM 296  C CB  . LEU A 1 36  ? -3.493 -20.244 -11.548 1.00 114.58 ? 58  LEU A CB  1 
ATOM 297  C CG  . LEU A 1 36  ? -2.254 -21.159 -11.460 1.00 117.52 ? 58  LEU A CG  1 
ATOM 298  C CD1 . LEU A 1 36  ? -2.664 -22.589 -11.104 1.00 117.74 ? 58  LEU A CD1 1 
ATOM 299  C CD2 . LEU A 1 36  ? -1.431 -21.148 -12.747 1.00 114.03 ? 58  LEU A CD2 1 
ATOM 300  N N   . LYS A 1 37  ? -3.720 -17.378 -13.957 1.00 92.50  ? 59  LYS A N   1 
ATOM 301  C CA  . LYS A 1 37  ? -4.181 -17.050 -15.300 1.00 89.89  ? 59  LYS A CA  1 
ATOM 302  C C   . LYS A 1 37  ? -3.068 -16.329 -16.080 1.00 87.16  ? 59  LYS A C   1 
ATOM 303  O O   . LYS A 1 37  ? -2.020 -16.005 -15.537 1.00 84.22  ? 59  LYS A O   1 
ATOM 304  C CB  . LYS A 1 37  ? -5.416 -16.152 -15.235 1.00 95.82  ? 59  LYS A CB  1 
ATOM 305  C CG  . LYS A 1 37  ? -6.707 -16.903 -14.934 1.00 107.33 ? 59  LYS A CG  1 
ATOM 306  C CD  . LYS A 1 37  ? -7.982 -16.204 -15.419 1.00 116.71 ? 59  LYS A CD  1 
ATOM 307  C CE  . LYS A 1 37  ? -8.142 -14.784 -14.870 1.00 115.19 ? 59  LYS A CE  1 
ATOM 308  N NZ  . LYS A 1 37  ? -7.817 -14.679 -13.419 1.00 107.97 ? 59  LYS A NZ  1 
ATOM 309  N N   . GLY A 1 38  ? -3.294 -16.086 -17.363 1.00 87.15  ? 60  GLY A N   1 
ATOM 310  C CA  . GLY A 1 38  ? -2.402 -15.250 -18.159 1.00 82.10  ? 60  GLY A CA  1 
ATOM 311  C C   . GLY A 1 38  ? -0.996 -15.814 -18.265 1.00 83.61  ? 60  GLY A C   1 
ATOM 312  O O   . GLY A 1 38  ? -0.804 -17.004 -18.496 1.00 81.62  ? 60  GLY A O   1 
ATOM 313  N N   . GLU A 1 39  ? -0.004 -14.948 -18.086 1.00 84.76  ? 61  GLU A N   1 
ATOM 314  C CA  . GLU A 1 39  ? 1.393  -15.332 -18.239 1.00 79.58  ? 61  GLU A CA  1 
ATOM 315  C C   . GLU A 1 39  ? 1.788  -16.327 -17.154 1.00 78.25  ? 61  GLU A C   1 
ATOM 316  O O   . GLU A 1 39  ? 2.608  -17.210 -17.400 1.00 81.25  ? 61  GLU A O   1 
ATOM 317  C CB  . GLU A 1 39  ? 2.298  -14.097 -18.211 1.00 78.27  ? 61  GLU A CB  1 
ATOM 318  C CG  . GLU A 1 39  ? 2.144  -13.211 -19.443 1.00 85.07  ? 61  GLU A CG  1 
ATOM 319  C CD  . GLU A 1 39  ? 2.821  -11.848 -19.338 1.00 89.16  ? 61  GLU A CD  1 
ATOM 320  O OE1 . GLU A 1 39  ? 2.820  -11.219 -18.250 1.00 86.60  ? 61  GLU A OE1 1 
ATOM 321  O OE2 . GLU A 1 39  ? 3.332  -11.385 -20.378 1.00 93.09  ? 61  GLU A OE2 1 
ATOM 322  N N   . THR A 1 40  ? 1.188  -16.191 -15.968 1.00 70.89  ? 62  THR A N   1 
ATOM 323  C CA  . THR A 1 40  ? 1.428  -17.108 -14.868 1.00 66.65  ? 62  THR A CA  1 
ATOM 324  C C   . THR A 1 40  ? 1.017  -18.536 -15.261 1.00 75.20  ? 62  THR A C   1 
ATOM 325  O O   . THR A 1 40  ? 1.793  -19.477 -15.113 1.00 77.90  ? 62  THR A O   1 
ATOM 326  C CB  . THR A 1 40  ? 0.629  -16.701 -13.611 1.00 67.37  ? 62  THR A CB  1 
ATOM 327  O OG1 . THR A 1 40  ? 0.851  -15.319 -13.282 1.00 64.98  ? 62  THR A OG1 1 
ATOM 328  C CG2 . THR A 1 40  ? 1.023  -17.553 -12.423 1.00 66.03  ? 62  THR A CG2 1 
ATOM 329  N N   . LYS A 1 41  ? -0.200 -18.687 -15.777 1.00 79.40  ? 63  LYS A N   1 
ATOM 330  C CA  . LYS A 1 41  ? -0.695 -19.984 -16.184 1.00 79.61  ? 63  LYS A CA  1 
ATOM 331  C C   . LYS A 1 41  ? 0.080  -20.502 -17.372 1.00 80.19  ? 63  LYS A C   1 
ATOM 332  O O   . LYS A 1 41  ? 0.347  -21.698 -17.472 1.00 80.49  ? 63  LYS A O   1 
ATOM 333  C CB  . LYS A 1 41  ? -2.172 -19.918 -16.534 1.00 91.25  ? 63  LYS A CB  1 
ATOM 334  C CG  . LYS A 1 41  ? -2.756 -21.280 -16.873 1.00 99.53  ? 63  LYS A CG  1 
ATOM 335  C CD  . LYS A 1 41  ? -4.273 -21.327 -16.683 1.00 113.50 ? 63  LYS A CD  1 
ATOM 336  C CE  . LYS A 1 41  ? -4.884 -22.575 -17.315 1.00 113.67 ? 63  LYS A CE  1 
ATOM 337  N NZ  . LYS A 1 41  ? -4.035 -23.787 -17.097 1.00 113.65 ? 63  LYS A NZ  1 
ATOM 338  N N   . THR A 1 42  ? 0.454  -19.614 -18.280 1.00 80.55  ? 64  THR A N   1 
ATOM 339  C CA  . THR A 1 42  ? 1.271  -20.039 -19.417 1.00 81.82  ? 64  THR A CA  1 
ATOM 340  C C   . THR A 1 42  ? 2.558  -20.712 -18.930 1.00 81.95  ? 64  THR A C   1 
ATOM 341  O O   . THR A 1 42  ? 2.901  -21.792 -19.426 1.00 85.16  ? 64  THR A O   1 
ATOM 342  C CB  . THR A 1 42  ? 1.615  -18.860 -20.345 1.00 80.90  ? 64  THR A CB  1 
ATOM 343  O OG1 . THR A 1 42  ? 0.405  -18.276 -20.830 1.00 85.94  ? 64  THR A OG1 1 
ATOM 344  C CG2 . THR A 1 42  ? 2.489  -19.289 -21.523 1.00 77.02  ? 64  THR A CG2 1 
ATOM 345  N N   . LYS A 1 43  ? 3.233  -20.092 -17.948 1.00 79.83  ? 65  LYS A N   1 
ATOM 346  C CA  . LYS A 1 43  ? 4.527  -20.579 -17.456 1.00 74.06  ? 65  LYS A CA  1 
ATOM 347  C C   . LYS A 1 43  ? 4.269  -21.875 -16.701 1.00 72.61  ? 65  LYS A C   1 
ATOM 348  O O   . LYS A 1 43  ? 5.050  -22.805 -16.799 1.00 78.02  ? 65  LYS A O   1 
ATOM 349  C CB  . LYS A 1 43  ? 5.286  -19.513 -16.610 1.00 76.25  ? 65  LYS A CB  1 
ATOM 350  C CG  . LYS A 1 43  ? 6.795  -19.338 -16.943 1.00 74.95  ? 65  LYS A CG  1 
ATOM 351  N N   . TYR A 1 44  ? 3.151  -21.964 -15.990 1.00 70.44  ? 66  TYR A N   1 
ATOM 352  C CA  . TYR A 1 44  ? 2.780  -23.198 -15.269 1.00 70.73  ? 66  TYR A CA  1 
ATOM 353  C C   . TYR A 1 44  ? 2.569  -24.353 -16.234 1.00 74.23  ? 66  TYR A C   1 
ATOM 354  O O   . TYR A 1 44  ? 3.101  -25.439 -16.051 1.00 74.15  ? 66  TYR A O   1 
ATOM 355  C CB  . TYR A 1 44  ? 1.493  -22.942 -14.504 1.00 73.86  ? 66  TYR A CB  1 
ATOM 356  C CG  . TYR A 1 44  ? 0.890  -24.111 -13.779 1.00 77.52  ? 66  TYR A CG  1 
ATOM 357  C CD1 . TYR A 1 44  ? -0.039 -24.936 -14.392 1.00 83.03  ? 66  TYR A CD1 1 
ATOM 358  C CD2 . TYR A 1 44  ? 1.189  -24.342 -12.440 1.00 79.58  ? 66  TYR A CD2 1 
ATOM 359  C CE1 . TYR A 1 44  ? -0.623 -25.984 -13.698 1.00 86.49  ? 66  TYR A CE1 1 
ATOM 360  C CE2 . TYR A 1 44  ? 0.617  -25.384 -11.736 1.00 79.05  ? 66  TYR A CE2 1 
ATOM 361  C CZ  . TYR A 1 44  ? -0.290 -26.198 -12.365 1.00 85.73  ? 66  TYR A CZ  1 
ATOM 362  O OH  . TYR A 1 44  ? -0.854 -27.226 -11.656 1.00 84.79  ? 66  TYR A OH  1 
ATOM 363  N N   . ASP A 1 45  ? 1.783  -24.108 -17.275 1.00 77.38  ? 67  ASP A N   1 
ATOM 364  C CA  . ASP A 1 45  ? 1.554  -25.111 -18.305 1.00 76.44  ? 67  ASP A CA  1 
ATOM 365  C C   . ASP A 1 45  ? 2.868  -25.543 -18.939 1.00 76.04  ? 67  ASP A C   1 
ATOM 366  O O   . ASP A 1 45  ? 3.102  -26.726 -19.156 1.00 79.23  ? 67  ASP A O   1 
ATOM 367  C CB  . ASP A 1 45  ? 0.617  -24.577 -19.386 1.00 77.58  ? 67  ASP A CB  1 
ATOM 368  C CG  . ASP A 1 45  ? -0.840 -24.525 -18.934 1.00 86.23  ? 67  ASP A CG  1 
ATOM 369  O OD1 . ASP A 1 45  ? -1.196 -25.167 -17.914 1.00 86.47  ? 67  ASP A OD1 1 
ATOM 370  O OD2 . ASP A 1 45  ? -1.645 -23.842 -19.621 1.00 91.91  ? 67  ASP A OD2 1 
ATOM 371  N N   . ALA A 1 46  ? 3.733  -24.583 -19.237 1.00 76.90  ? 68  ALA A N   1 
ATOM 372  C CA  . ALA A 1 46  ? 4.949  -24.897 -19.983 1.00 76.38  ? 68  ALA A CA  1 
ATOM 373  C C   . ALA A 1 46  ? 5.851  -25.771 -19.140 1.00 74.03  ? 68  ALA A C   1 
ATOM 374  O O   . ALA A 1 46  ? 6.506  -26.665 -19.654 1.00 80.79  ? 68  ALA A O   1 
ATOM 375  C CB  . ALA A 1 46  ? 5.670  -23.626 -20.429 1.00 70.80  ? 68  ALA A CB  1 
ATOM 376  N N   . MET A 1 47  ? 5.844  -25.539 -17.835 1.00 75.19  ? 69  MET A N   1 
ATOM 377  C CA  . MET A 1 47  ? 6.681  -26.305 -16.926 1.00 75.93  ? 69  MET A CA  1 
ATOM 378  C C   . MET A 1 47  ? 6.161  -27.723 -16.685 1.00 72.67  ? 69  MET A C   1 
ATOM 379  O O   . MET A 1 47  ? 6.955  -28.608 -16.465 1.00 74.72  ? 69  MET A O   1 
ATOM 380  C CB  . MET A 1 47  ? 6.889  -25.529 -15.610 1.00 78.58  ? 69  MET A CB  1 
ATOM 381  C CG  . MET A 1 47  ? 7.755  -24.270 -15.765 1.00 78.78  ? 69  MET A CG  1 
ATOM 382  S SD  . MET A 1 47  ? 7.880  -23.171 -14.316 1.00 83.56  ? 69  MET A SD  1 
ATOM 383  C CE  . MET A 1 47  ? 8.902  -24.255 -13.329 1.00 86.28  ? 69  MET A CE  1 
ATOM 384  N N   . LYS A 1 48  ? 4.851  -27.948 -16.747 1.00 76.43  ? 70  LYS A N   1 
ATOM 385  C CA  . LYS A 1 48  ? 4.296  -29.319 -16.710 1.00 78.94  ? 70  LYS A CA  1 
ATOM 386  C C   . LYS A 1 48  ? 4.735  -30.140 -17.903 1.00 78.25  ? 70  LYS A C   1 
ATOM 387  O O   . LYS A 1 48  ? 5.136  -31.287 -17.763 1.00 79.06  ? 70  LYS A O   1 
ATOM 388  C CB  . LYS A 1 48  ? 2.777  -29.282 -16.751 1.00 86.65  ? 70  LYS A CB  1 
ATOM 389  C CG  . LYS A 1 48  ? 2.120  -28.660 -15.540 1.00 90.80  ? 70  LYS A CG  1 
ATOM 390  C CD  . LYS A 1 48  ? 2.166  -29.594 -14.353 1.00 92.68  ? 70  LYS A CD  1 
ATOM 391  C CE  . LYS A 1 48  ? 1.034  -29.284 -13.394 1.00 100.13 ? 70  LYS A CE  1 
ATOM 392  N NZ  . LYS A 1 48  ? 1.269  -29.985 -12.102 1.00 102.90 ? 70  LYS A NZ  1 
ATOM 393  N N   . LYS A 1 49  ? 4.598  -29.541 -19.086 1.00 86.40  ? 71  LYS A N   1 
ATOM 394  C CA  . LYS A 1 49  ? 5.098  -30.104 -20.352 1.00 94.07  ? 71  LYS A CA  1 
ATOM 395  C C   . LYS A 1 49  ? 6.583  -30.493 -20.308 1.00 88.91  ? 71  LYS A C   1 
ATOM 396  O O   . LYS A 1 49  ? 6.931  -31.595 -20.726 1.00 88.19  ? 71  LYS A O   1 
ATOM 397  C CB  . LYS A 1 49  ? 4.906  -29.110 -21.509 1.00 97.74  ? 71  LYS A CB  1 
ATOM 398  C CG  . LYS A 1 49  ? 3.570  -29.178 -22.213 1.00 106.03 ? 71  LYS A CG  1 
ATOM 399  C CD  . LYS A 1 49  ? 3.529  -28.220 -23.405 1.00 116.50 ? 71  LYS A CD  1 
ATOM 400  C CE  . LYS A 1 49  ? 3.857  -28.885 -24.746 1.00 116.19 ? 71  LYS A CE  1 
ATOM 401  N NZ  . LYS A 1 49  ? 5.163  -29.587 -24.802 1.00 109.43 ? 71  LYS A NZ  1 
ATOM 402  N N   . ASP A 1 50  ? 7.438  -29.568 -19.850 1.00 85.01  ? 72  ASP A N   1 
ATOM 403  C CA  . ASP A 1 50  ? 8.873  -29.833 -19.649 1.00 85.22  ? 72  ASP A CA  1 
ATOM 404  C C   . ASP A 1 50  ? 9.096  -31.059 -18.797 1.00 85.70  ? 72  ASP A C   1 
ATOM 405  O O   . ASP A 1 50  ? 9.978  -31.840 -19.110 1.00 99.11  ? 72  ASP A O   1 
ATOM 406  C CB  . ASP A 1 50  ? 9.584  -28.677 -18.948 1.00 89.65  ? 72  ASP A CB  1 
ATOM 407  C CG  . ASP A 1 50  ? 9.837  -27.499 -19.853 1.00 99.65  ? 72  ASP A CG  1 
ATOM 408  O OD1 . ASP A 1 50  ? 9.688  -27.622 -21.082 1.00 114.26 ? 72  ASP A OD1 1 
ATOM 409  O OD2 . ASP A 1 50  ? 10.185 -26.425 -19.322 1.00 106.65 ? 72  ASP A OD2 1 
ATOM 410  N N   . ASN A 1 51  ? 8.311  -31.227 -17.727 1.00 80.25  ? 73  ASN A N   1 
ATOM 411  C CA  . ASN A 1 51  ? 8.451  -32.381 -16.833 1.00 77.85  ? 73  ASN A CA  1 
ATOM 412  C C   . ASN A 1 51  ? 8.125  -33.704 -17.492 1.00 81.81  ? 73  ASN A C   1 
ATOM 413  O O   . ASN A 1 51  ? 8.764  -34.706 -17.192 1.00 88.44  ? 73  ASN A O   1 
ATOM 414  C CB  . ASN A 1 51  ? 7.623  -32.198 -15.563 1.00 79.14  ? 73  ASN A CB  1 
ATOM 415  C CG  . ASN A 1 51  ? 8.143  -31.064 -14.699 1.00 82.39  ? 73  ASN A CG  1 
ATOM 416  O OD1 . ASN A 1 51  ? 9.312  -30.685 -14.781 1.00 84.83  ? 73  ASN A OD1 1 
ATOM 417  N ND2 . ASN A 1 51  ? 7.282  -30.519 -13.862 1.00 86.56  ? 73  ASN A ND2 1 
ATOM 418  N N   . VAL A 1 52  ? 7.146  -33.716 -18.387 1.00 84.71  ? 74  VAL A N   1 
ATOM 419  C CA  . VAL A 1 52  ? 6.927  -34.883 -19.237 1.00 88.42  ? 74  VAL A CA  1 
ATOM 420  C C   . VAL A 1 52  ? 8.157  -35.098 -20.151 1.00 86.34  ? 74  VAL A C   1 
ATOM 421  O O   . VAL A 1 52  ? 8.742  -36.190 -20.147 1.00 87.67  ? 74  VAL A O   1 
ATOM 422  C CB  . VAL A 1 52  ? 5.626  -34.726 -20.052 1.00 94.14  ? 74  VAL A CB  1 
ATOM 423  C CG1 . VAL A 1 52  ? 5.458  -35.864 -21.049 1.00 94.02  ? 74  VAL A CG1 1 
ATOM 424  C CG2 . VAL A 1 52  ? 4.434  -34.651 -19.108 1.00 96.59  ? 74  VAL A CG2 1 
ATOM 425  N N   . GLU A 1 53  ? 8.572  -34.055 -20.891 1.00 86.43  ? 75  GLU A N   1 
ATOM 426  C CA  . GLU A 1 53  ? 9.773  -34.115 -21.770 1.00 90.23  ? 75  GLU A CA  1 
ATOM 427  C C   . GLU A 1 53  ? 11.012 -34.580 -20.960 1.00 94.93  ? 75  GLU A C   1 
ATOM 428  O O   . GLU A 1 53  ? 11.802 -35.390 -21.445 1.00 100.27 ? 75  GLU A O   1 
ATOM 429  C CB  . GLU A 1 53  ? 10.080 -32.766 -22.495 1.00 89.50  ? 75  GLU A CB  1 
ATOM 430  C CG  . GLU A 1 53  ? 9.040  -32.237 -23.505 1.00 92.58  ? 75  GLU A CG  1 
ATOM 431  N N   . SER A 1 54  ? 11.169 -34.083 -19.728 1.00 90.45  ? 76  SER A N   1 
ATOM 432  C CA  . SER A 1 54  ? 12.306 -34.460 -18.867 1.00 87.83  ? 76  SER A CA  1 
ATOM 433  C C   . SER A 1 54  ? 12.183 -35.896 -18.374 1.00 90.55  ? 76  SER A C   1 
ATOM 434  O O   . SER A 1 54  ? 13.167 -36.644 -18.363 1.00 94.48  ? 76  SER A O   1 
ATOM 435  C CB  . SER A 1 54  ? 12.429 -33.541 -17.638 1.00 85.99  ? 76  SER A CB  1 
ATOM 436  O OG  . SER A 1 54  ? 12.901 -32.254 -17.980 1.00 84.45  ? 76  SER A OG  1 
ATOM 437  N N   . THR A 1 55  ? 10.977 -36.274 -17.957 1.00 84.19  ? 77  THR A N   1 
ATOM 438  C CA  . THR A 1 55  ? 10.756 -37.604 -17.456 1.00 81.30  ? 77  THR A CA  1 
ATOM 439  C C   . THR A 1 55  ? 11.070 -38.636 -18.506 1.00 86.11  ? 77  THR A C   1 
ATOM 440  O O   . THR A 1 55  ? 11.654 -39.658 -18.207 1.00 92.11  ? 77  THR A O   1 
ATOM 441  C CB  . THR A 1 55  ? 9.333  -37.764 -16.974 1.00 80.01  ? 77  THR A CB  1 
ATOM 442  O OG1 . THR A 1 55  ? 9.144  -36.858 -15.890 1.00 83.94  ? 77  THR A OG1 1 
ATOM 443  C CG2 . THR A 1 55  ? 9.083  -39.183 -16.499 1.00 78.04  ? 77  THR A CG2 1 
ATOM 444  N N   . ASN A 1 56  ? 10.713 -38.365 -19.746 1.00 93.29  ? 78  ASN A N   1 
ATOM 445  C CA  . ASN A 1 56  ? 10.940 -39.352 -20.791 1.00 97.18  ? 78  ASN A CA  1 
ATOM 446  C C   . ASN A 1 56  ? 12.345 -39.339 -21.346 1.00 92.49  ? 78  ASN A C   1 
ATOM 447  O O   . ASN A 1 56  ? 12.860 -40.380 -21.736 1.00 92.89  ? 78  ASN A O   1 
ATOM 448  C CB  . ASN A 1 56  ? 9.881  -39.187 -21.858 1.00 98.05  ? 78  ASN A CB  1 
ATOM 449  C CG  . ASN A 1 56  ? 8.510  -39.443 -21.287 1.00 105.27 ? 78  ASN A CG  1 
ATOM 450  O OD1 . ASN A 1 56  ? 8.337  -40.381 -20.487 1.00 110.53 ? 78  ASN A OD1 1 
ATOM 451  N ND2 . ASN A 1 56  ? 7.545  -38.597 -21.628 1.00 102.55 ? 78  ASN A ND2 1 
ATOM 452  N N   . LYS A 1 57  ? 12.975 -38.172 -21.320 1.00 87.88  ? 79  LYS A N   1 
ATOM 453  C CA  . LYS A 1 57  ? 14.320 -38.001 -21.841 1.00 89.56  ? 79  LYS A CA  1 
ATOM 454  C C   . LYS A 1 57  ? 15.329 -38.476 -20.823 1.00 84.16  ? 79  LYS A C   1 
ATOM 455  O O   . LYS A 1 57  ? 16.345 -39.047 -21.193 1.00 85.06  ? 79  LYS A O   1 
ATOM 456  C CB  . LYS A 1 57  ? 14.570 -36.521 -22.174 1.00 96.68  ? 79  LYS A CB  1 
ATOM 457  C CG  . LYS A 1 57  ? 15.642 -36.227 -23.219 1.00 103.11 ? 79  LYS A CG  1 
ATOM 458  C CD  . LYS A 1 57  ? 15.252 -35.003 -24.066 1.00 119.82 ? 79  LYS A CD  1 
ATOM 459  C CE  . LYS A 1 57  ? 15.782 -33.679 -23.520 1.00 125.44 ? 79  LYS A CE  1 
ATOM 460  N NZ  . LYS A 1 57  ? 17.178 -33.466 -23.998 1.00 127.51 ? 79  LYS A NZ  1 
ATOM 461  N N   . TYR A 1 58  ? 15.061 -38.235 -19.541 1.00 80.02  ? 80  TYR A N   1 
ATOM 462  C CA  . TYR A 1 58  ? 16.089 -38.435 -18.514 1.00 79.25  ? 80  TYR A CA  1 
ATOM 463  C C   . TYR A 1 58  ? 15.790 -39.507 -17.492 1.00 82.35  ? 80  TYR A C   1 
ATOM 464  O O   . TYR A 1 58  ? 16.715 -39.998 -16.861 1.00 89.44  ? 80  TYR A O   1 
ATOM 465  C CB  . TYR A 1 58  ? 16.393 -37.145 -17.740 1.00 71.91  ? 80  TYR A CB  1 
ATOM 466  C CG  . TYR A 1 58  ? 16.870 -35.998 -18.589 1.00 72.86  ? 80  TYR A CG  1 
ATOM 467  C CD1 . TYR A 1 58  ? 17.950 -36.140 -19.463 1.00 73.82  ? 80  TYR A CD1 1 
ATOM 468  C CD2 . TYR A 1 58  ? 16.251 -34.750 -18.503 1.00 72.85  ? 80  TYR A CD2 1 
ATOM 469  C CE1 . TYR A 1 58  ? 18.386 -35.079 -20.238 1.00 74.33  ? 80  TYR A CE1 1 
ATOM 470  C CE2 . TYR A 1 58  ? 16.679 -33.680 -19.261 1.00 74.55  ? 80  TYR A CE2 1 
ATOM 471  C CZ  . TYR A 1 58  ? 17.741 -33.835 -20.136 1.00 80.86  ? 80  TYR A CZ  1 
ATOM 472  O OH  . TYR A 1 58  ? 18.138 -32.732 -20.890 1.00 80.81  ? 80  TYR A OH  1 
ATOM 473  N N   . LEU A 1 59  ? 14.535 -39.860 -17.272 1.00 82.35  ? 81  LEU A N   1 
ATOM 474  C CA  . LEU A 1 59  ? 14.254 -40.811 -16.203 1.00 82.91  ? 81  LEU A CA  1 
ATOM 475  C C   . LEU A 1 59  ? 13.854 -42.169 -16.739 1.00 81.19  ? 81  LEU A C   1 
ATOM 476  O O   . LEU A 1 59  ? 14.325 -43.184 -16.249 1.00 92.08  ? 81  LEU A O   1 
ATOM 477  C CB  . LEU A 1 59  ? 13.203 -40.247 -15.247 1.00 90.51  ? 81  LEU A CB  1 
ATOM 478  C CG  . LEU A 1 59  ? 12.714 -41.172 -14.131 1.00 95.86  ? 81  LEU A CG  1 
ATOM 479  C CD1 . LEU A 1 59  ? 13.880 -41.587 -13.250 1.00 97.36  ? 81  LEU A CD1 1 
ATOM 480  C CD2 . LEU A 1 59  ? 11.641 -40.477 -13.309 1.00 99.51  ? 81  LEU A CD2 1 
ATOM 481  N N   . ALA A 1 60  ? 12.993 -42.214 -17.747 1.00 85.46  ? 82  ALA A N   1 
ATOM 482  C CA  . ALA A 1 60  ? 12.563 -43.503 -18.306 1.00 86.20  ? 82  ALA A CA  1 
ATOM 483  C C   . ALA A 1 60  ? 13.743 -44.413 -18.715 1.00 78.31  ? 82  ALA A C   1 
ATOM 484  O O   . ALA A 1 60  ? 13.781 -45.555 -18.306 1.00 88.96  ? 82  ALA A O   1 
ATOM 485  C CB  . ALA A 1 60  ? 11.605 -43.290 -19.460 1.00 88.35  ? 82  ALA A CB  1 
ATOM 486  N N   . PRO A 1 61  ? 14.737 -43.889 -19.462 1.00 77.09  ? 83  PRO A N   1 
ATOM 487  C CA  . PRO A 1 61  ? 15.877 -44.673 -19.958 1.00 73.29  ? 83  PRO A CA  1 
ATOM 488  C C   . PRO A 1 61  ? 16.792 -45.268 -18.890 1.00 76.78  ? 83  PRO A C   1 
ATOM 489  O O   . PRO A 1 61  ? 17.538 -46.218 -19.174 1.00 80.63  ? 83  PRO A O   1 
ATOM 490  C CB  . PRO A 1 61  ? 16.699 -43.653 -20.742 1.00 70.47  ? 83  PRO A CB  1 
ATOM 491  C CG  . PRO A 1 61  ? 15.787 -42.516 -21.005 1.00 74.78  ? 83  PRO A CG  1 
ATOM 492  C CD  . PRO A 1 61  ? 14.917 -42.460 -19.790 1.00 80.08  ? 83  PRO A CD  1 
ATOM 493  N N   . VAL A 1 62  ? 16.738 -44.727 -17.679 1.00 70.32  ? 84  VAL A N   1 
ATOM 494  C CA  . VAL A 1 62  ? 17.610 -45.186 -16.615 1.00 68.18  ? 84  VAL A CA  1 
ATOM 495  C C   . VAL A 1 62  ? 17.398 -46.654 -16.322 1.00 72.49  ? 84  VAL A C   1 
ATOM 496  O O   . VAL A 1 62  ? 18.348 -47.435 -16.256 1.00 79.31  ? 84  VAL A O   1 
ATOM 497  C CB  . VAL A 1 62  ? 17.368 -44.409 -15.325 1.00 67.86  ? 84  VAL A CB  1 
ATOM 498  C CG1 . VAL A 1 62  ? 18.185 -44.997 -14.199 1.00 71.48  ? 84  VAL A CG1 1 
ATOM 499  C CG2 . VAL A 1 62  ? 17.743 -42.949 -15.512 1.00 66.74  ? 84  VAL A CG2 1 
ATOM 500  N N   . GLU A 1 63  ? 16.149 -47.038 -16.139 1.00 80.69  ? 85  GLU A N   1 
ATOM 501  C CA  . GLU A 1 63  ? 15.843 -48.397 -15.757 1.00 82.14  ? 85  GLU A CA  1 
ATOM 502  C C   . GLU A 1 63  ? 16.580 -49.391 -16.669 1.00 80.70  ? 85  GLU A C   1 
ATOM 503  O O   . GLU A 1 63  ? 17.137 -50.375 -16.194 1.00 76.47  ? 85  GLU A O   1 
ATOM 504  C CB  . GLU A 1 63  ? 14.340 -48.617 -15.799 1.00 92.23  ? 85  GLU A CB  1 
ATOM 505  C CG  . GLU A 1 63  ? 13.904 -49.980 -15.280 1.00 105.59 ? 85  GLU A CG  1 
ATOM 506  C CD  . GLU A 1 63  ? 12.418 -50.213 -15.468 1.00 118.22 ? 85  GLU A CD  1 
ATOM 507  O OE1 . GLU A 1 63  ? 11.627 -49.281 -15.180 1.00 128.37 ? 85  GLU A OE1 1 
ATOM 508  O OE2 . GLU A 1 63  ? 12.048 -51.322 -15.907 1.00 115.25 ? 85  GLU A OE2 1 
ATOM 509  N N   . GLU A 1 64  ? 16.604 -49.129 -17.973 1.00 79.95  ? 86  GLU A N   1 
ATOM 510  C CA  . GLU A 1 64  ? 17.264 -50.047 -18.886 1.00 81.61  ? 86  GLU A CA  1 
ATOM 511  C C   . GLU A 1 64  ? 18.795 -50.016 -18.733 1.00 81.06  ? 86  GLU A C   1 
ATOM 512  O O   . GLU A 1 64  ? 19.427 -51.063 -18.662 1.00 82.07  ? 86  GLU A O   1 
ATOM 513  C CB  . GLU A 1 64  ? 16.869 -49.767 -20.325 1.00 87.07  ? 86  GLU A CB  1 
ATOM 514  C CG  . GLU A 1 64  ? 17.593 -50.670 -21.302 1.00 96.27  ? 86  GLU A CG  1 
ATOM 515  C CD  . GLU A 1 64  ? 16.845 -50.824 -22.599 1.00 108.78 ? 86  GLU A CD  1 
ATOM 516  O OE1 . GLU A 1 64  ? 16.250 -49.825 -23.045 1.00 120.54 ? 86  GLU A OE1 1 
ATOM 517  O OE2 . GLU A 1 64  ? 16.855 -51.937 -23.173 1.00 119.05 ? 86  GLU A OE2 1 
ATOM 518  N N   . LYS A 1 65  ? 19.389 -48.826 -18.666 1.00 76.91  ? 87  LYS A N   1 
ATOM 519  C CA  . LYS A 1 65  ? 20.821 -48.714 -18.377 1.00 71.98  ? 87  LYS A CA  1 
ATOM 520  C C   . LYS A 1 65  ? 21.211 -49.595 -17.169 1.00 70.81  ? 87  LYS A C   1 
ATOM 521  O O   . LYS A 1 65  ? 22.227 -50.290 -17.185 1.00 71.94  ? 87  LYS A O   1 
ATOM 522  C CB  . LYS A 1 65  ? 21.218 -47.254 -18.126 1.00 69.32  ? 87  LYS A CB  1 
ATOM 523  C CG  . LYS A 1 65  ? 21.174 -46.350 -19.345 1.00 69.49  ? 87  LYS A CG  1 
ATOM 524  C CD  . LYS A 1 65  ? 22.204 -46.743 -20.386 1.00 77.68  ? 87  LYS A CD  1 
ATOM 525  C CE  . LYS A 1 65  ? 22.446 -45.659 -21.436 1.00 81.03  ? 87  LYS A CE  1 
ATOM 526  N NZ  . LYS A 1 65  ? 23.585 -46.040 -22.332 1.00 83.91  ? 87  LYS A NZ  1 
ATOM 527  N N   . ILE A 1 66  ? 20.393 -49.590 -16.132 1.00 69.49  ? 88  ILE A N   1 
ATOM 528  C CA  . ILE A 1 66  ? 20.666 -50.430 -14.966 1.00 71.00  ? 88  ILE A CA  1 
ATOM 529  C C   . ILE A 1 66  ? 20.483 -51.902 -15.272 1.00 72.04  ? 88  ILE A C   1 
ATOM 530  O O   . ILE A 1 66  ? 21.304 -52.719 -14.851 1.00 73.03  ? 88  ILE A O   1 
ATOM 531  C CB  . ILE A 1 66  ? 19.786 -50.027 -13.784 1.00 71.98  ? 88  ILE A CB  1 
ATOM 532  C CG1 . ILE A 1 66  ? 20.250 -48.655 -13.292 1.00 74.41  ? 88  ILE A CG1 1 
ATOM 533  C CG2 . ILE A 1 66  ? 19.885 -51.039 -12.664 1.00 72.16  ? 88  ILE A CG2 1 
ATOM 534  C CD1 . ILE A 1 66  ? 19.213 -47.897 -12.495 1.00 75.84  ? 88  ILE A CD1 1 
ATOM 535  N N   . HIS A 1 67  ? 19.435 -52.261 -16.005 1.00 74.06  ? 89  HIS A N   1 
ATOM 536  C CA  . HIS A 1 67  ? 19.284 -53.668 -16.376 1.00 82.55  ? 89  HIS A CA  1 
ATOM 537  C C   . HIS A 1 67  ? 20.488 -54.131 -17.247 1.00 77.55  ? 89  HIS A C   1 
ATOM 538  O O   . HIS A 1 67  ? 20.981 -55.242 -17.048 1.00 81.13  ? 89  HIS A O   1 
ATOM 539  C CB  . HIS A 1 67  ? 17.901 -53.990 -17.006 1.00 87.82  ? 89  HIS A CB  1 
ATOM 540  C CG  . HIS A 1 67  ? 17.818 -55.371 -17.589 1.00 105.09 ? 89  HIS A CG  1 
ATOM 541  N ND1 . HIS A 1 67  ? 17.427 -55.613 -18.891 1.00 109.80 ? 89  HIS A ND1 1 
ATOM 542  C CD2 . HIS A 1 67  ? 18.151 -56.579 -17.070 1.00 116.50 ? 89  HIS A CD2 1 
ATOM 543  C CE1 . HIS A 1 67  ? 17.488 -56.909 -19.140 1.00 114.31 ? 89  HIS A CE1 1 
ATOM 544  N NE2 . HIS A 1 67  ? 17.934 -57.517 -18.054 1.00 124.30 ? 89  HIS A NE2 1 
ATOM 545  N N   . ASN A 1 68  ? 20.988 -53.287 -18.159 1.00 73.59  ? 90  ASN A N   1 
ATOM 546  C CA  . ASN A 1 68  ? 22.131 -53.675 -19.008 1.00 75.24  ? 90  ASN A CA  1 
ATOM 547  C C   . ASN A 1 68  ? 23.392 -53.817 -18.177 1.00 74.99  ? 90  ASN A C   1 
ATOM 548  O O   . ASN A 1 68  ? 24.219 -54.706 -18.422 1.00 75.46  ? 90  ASN A O   1 
ATOM 549  C CB  . ASN A 1 68  ? 22.397 -52.683 -20.137 1.00 76.77  ? 90  ASN A CB  1 
ATOM 550  C CG  . ASN A 1 68  ? 21.228 -52.550 -21.092 1.00 89.28  ? 90  ASN A CG  1 
ATOM 551  O OD1 . ASN A 1 68  ? 20.354 -53.423 -21.169 1.00 99.34  ? 90  ASN A OD1 1 
ATOM 552  N ND2 . ASN A 1 68  ? 21.199 -51.448 -21.831 1.00 91.67  ? 90  ASN A ND2 1 
ATOM 553  N N   . ALA A 1 69  ? 23.533 -52.939 -17.190 1.00 66.45  ? 91  ALA A N   1 
ATOM 554  C CA  . ALA A 1 69  ? 24.637 -53.034 -16.262 1.00 67.03  ? 91  ALA A CA  1 
ATOM 555  C C   . ALA A 1 69  ? 24.660 -54.374 -15.512 1.00 71.35  ? 91  ALA A C   1 
ATOM 556  O O   . ALA A 1 69  ? 25.736 -54.903 -15.253 1.00 72.72  ? 91  ALA A O   1 
ATOM 557  C CB  . ALA A 1 69  ? 24.594 -51.879 -15.284 1.00 66.73  ? 91  ALA A CB  1 
ATOM 558  N N   . GLU A 1 70  ? 23.491 -54.916 -15.161 1.00 75.18  ? 92  GLU A N   1 
ATOM 559  C CA  . GLU A 1 70  ? 23.422 -56.179 -14.426 1.00 75.80  ? 92  GLU A CA  1 
ATOM 560  C C   . GLU A 1 70  ? 23.818 -57.323 -15.333 1.00 72.60  ? 92  GLU A C   1 
ATOM 561  O O   . GLU A 1 70  ? 24.599 -58.197 -14.956 1.00 72.98  ? 92  GLU A O   1 
ATOM 562  C CB  . GLU A 1 70  ? 22.026 -56.404 -13.841 1.00 87.63  ? 92  GLU A CB  1 
ATOM 563  C CG  . GLU A 1 70  ? 21.881 -55.919 -12.396 1.00 100.11 ? 92  GLU A CG  1 
ATOM 564  C CD  . GLU A 1 70  ? 20.459 -55.510 -11.995 1.00 110.95 ? 92  GLU A CD  1 
ATOM 565  O OE1 . GLU A 1 70  ? 19.609 -55.240 -12.879 1.00 112.86 ? 92  GLU A OE1 1 
ATOM 566  O OE2 . GLU A 1 70  ? 20.192 -55.437 -10.771 1.00 120.04 ? 92  GLU A OE2 1 
ATOM 567  N N   . ALA A 1 71  ? 23.296 -57.291 -16.547 1.00 69.68  ? 93  ALA A N   1 
ATOM 568  C CA  . ALA A 1 71  ? 23.524 -58.350 -17.506 1.00 70.62  ? 93  ALA A CA  1 
ATOM 569  C C   . ALA A 1 71  ? 24.995 -58.411 -17.897 1.00 71.88  ? 93  ALA A C   1 
ATOM 570  O O   . ALA A 1 71  ? 25.571 -59.488 -17.985 1.00 71.56  ? 93  ALA A O   1 
ATOM 571  C CB  . ALA A 1 71  ? 22.656 -58.130 -18.742 1.00 70.51  ? 93  ALA A CB  1 
ATOM 572  N N   . LEU A 1 72  ? 25.580 -57.243 -18.158 1.00 73.91  ? 94  LEU A N   1 
ATOM 573  C CA  . LEU A 1 72  ? 26.988 -57.142 -18.551 1.00 70.39  ? 94  LEU A CA  1 
ATOM 574  C C   . LEU A 1 72  ? 27.900 -57.583 -17.420 1.00 69.42  ? 94  LEU A C   1 
ATOM 575  O O   . LEU A 1 72  ? 28.873 -58.298 -17.639 1.00 70.94  ? 94  LEU A O   1 
ATOM 576  C CB  . LEU A 1 72  ? 27.329 -55.717 -18.936 1.00 66.61  ? 94  LEU A CB  1 
ATOM 577  C CG  . LEU A 1 72  ? 26.824 -55.265 -20.309 1.00 64.81  ? 94  LEU A CG  1 
ATOM 578  C CD1 . LEU A 1 72  ? 26.833 -53.753 -20.385 1.00 62.38  ? 94  LEU A CD1 1 
ATOM 579  C CD2 . LEU A 1 72  ? 27.688 -55.805 -21.428 1.00 65.12  ? 94  LEU A CD2 1 
ATOM 580  N N   . LEU A 1 73  ? 27.571 -57.178 -16.200 1.00 67.43  ? 95  LEU A N   1 
ATOM 581  C CA  . LEU A 1 73  ? 28.394 -57.552 -15.053 1.00 68.54  ? 95  LEU A CA  1 
ATOM 582  C C   . LEU A 1 73  ? 28.444 -59.040 -14.931 1.00 71.07  ? 95  LEU A C   1 
ATOM 583  O O   . LEU A 1 73  ? 29.497 -59.621 -14.833 1.00 76.92  ? 95  LEU A O   1 
ATOM 584  C CB  . LEU A 1 73  ? 27.849 -56.945 -13.758 1.00 69.46  ? 95  LEU A CB  1 
ATOM 585  C CG  . LEU A 1 73  ? 28.558 -57.353 -12.463 1.00 71.35  ? 95  LEU A CG  1 
ATOM 586  C CD1 . LEU A 1 73  ? 30.058 -57.126 -12.572 1.00 72.52  ? 95  LEU A CD1 1 
ATOM 587  C CD2 . LEU A 1 73  ? 27.999 -56.597 -11.267 1.00 72.33  ? 95  LEU A CD2 1 
ATOM 588  N N   . ASP A 1 74  ? 27.275 -59.647 -14.985 1.00 79.42  ? 96  ASP A N   1 
ATOM 589  C CA  . ASP A 1 74  ? 27.118 -61.090 -14.905 1.00 85.61  ? 96  ASP A CA  1 
ATOM 590  C C   . ASP A 1 74  ? 28.004 -61.885 -15.909 1.00 80.53  ? 96  ASP A C   1 
ATOM 591  O O   . ASP A 1 74  ? 28.498 -62.945 -15.564 1.00 84.96  ? 96  ASP A O   1 
ATOM 592  C CB  . ASP A 1 74  ? 25.623 -61.393 -15.097 1.00 93.31  ? 96  ASP A CB  1 
ATOM 593  C CG  . ASP A 1 74  ? 25.288 -62.810 -14.819 1.00 101.17 ? 96  ASP A CG  1 
ATOM 594  O OD1 . ASP A 1 74  ? 25.382 -63.204 -13.638 1.00 104.96 ? 96  ASP A OD1 1 
ATOM 595  O OD2 . ASP A 1 74  ? 24.938 -63.522 -15.788 1.00 106.90 ? 96  ASP A OD2 1 
ATOM 596  N N   . LYS A 1 75  ? 28.201 -61.354 -17.122 1.00 77.13  ? 97  LYS A N   1 
ATOM 597  C CA  . LYS A 1 75  ? 29.086 -61.922 -18.141 1.00 79.44  ? 97  LYS A CA  1 
ATOM 598  C C   . LYS A 1 75  ? 30.545 -61.455 -17.967 1.00 77.44  ? 97  LYS A C   1 
ATOM 599  O O   . LYS A 1 75  ? 31.391 -61.703 -18.839 1.00 75.95  ? 97  LYS A O   1 
ATOM 600  C CB  . LYS A 1 75  ? 28.615 -61.526 -19.558 1.00 86.67  ? 97  LYS A CB  1 
ATOM 601  C CG  . LYS A 1 75  ? 27.222 -62.007 -19.965 1.00 103.15 ? 97  LYS A CG  1 
ATOM 602  C CD  . LYS A 1 75  ? 27.087 -63.537 -20.088 1.00 122.50 ? 97  LYS A CD  1 
ATOM 603  C CE  . LYS A 1 75  ? 27.898 -64.153 -21.240 1.00 134.58 ? 97  LYS A CE  1 
ATOM 604  N NZ  . LYS A 1 75  ? 27.714 -63.436 -22.538 1.00 140.50 ? 97  LYS A NZ  1 
ATOM 605  N N   . PHE A 1 76  ? 30.845 -60.774 -16.861 1.00 70.62  ? 98  PHE A N   1 
ATOM 606  C CA  . PHE A 1 76  ? 32.203 -60.294 -16.578 1.00 67.89  ? 98  PHE A CA  1 
ATOM 607  C C   . PHE A 1 76  ? 32.684 -59.173 -17.521 1.00 68.45  ? 98  PHE A C   1 
ATOM 608  O O   . PHE A 1 76  ? 33.893 -59.021 -17.762 1.00 69.01  ? 98  PHE A O   1 
ATOM 609  C CB  . PHE A 1 76  ? 33.202 -61.456 -16.636 1.00 69.53  ? 98  PHE A CB  1 
ATOM 610  C CG  . PHE A 1 76  ? 32.822 -62.648 -15.800 1.00 67.43  ? 98  PHE A CG  1 
ATOM 611  C CD1 . PHE A 1 76  ? 32.474 -62.506 -14.462 1.00 68.54  ? 98  PHE A CD1 1 
ATOM 612  C CD2 . PHE A 1 76  ? 32.886 -63.911 -16.324 1.00 67.41  ? 98  PHE A CD2 1 
ATOM 613  C CE1 . PHE A 1 76  ? 32.153 -63.604 -13.685 1.00 64.03  ? 98  PHE A CE1 1 
ATOM 614  C CE2 . PHE A 1 76  ? 32.583 -65.015 -15.543 1.00 67.90  ? 98  PHE A CE2 1 
ATOM 615  C CZ  . PHE A 1 76  ? 32.194 -64.848 -14.230 1.00 66.32  ? 98  PHE A CZ  1 
ATOM 616  N N   . SER A 1 77  ? 31.744 -58.391 -18.054 1.00 66.74  ? 99  SER A N   1 
ATOM 617  C CA  . SER A 1 77  ? 32.065 -57.176 -18.797 1.00 64.26  ? 99  SER A CA  1 
ATOM 618  C C   . SER A 1 77  ? 32.076 -56.000 -17.855 1.00 64.27  ? 99  SER A C   1 
ATOM 619  O O   . SER A 1 77  ? 31.208 -55.138 -17.873 1.00 67.12  ? 99  SER A O   1 
ATOM 620  C CB  . SER A 1 77  ? 31.089 -56.952 -19.930 1.00 64.86  ? 99  SER A CB  1 
ATOM 621  O OG  . SER A 1 77  ? 31.353 -57.908 -20.925 1.00 70.79  ? 99  SER A OG  1 
ATOM 622  N N   . PHE A 1 78  ? 33.122 -55.969 -17.046 1.00 66.48  ? 100 PHE A N   1 
ATOM 623  C CA  . PHE A 1 78  ? 33.214 -55.077 -15.909 1.00 63.37  ? 100 PHE A CA  1 
ATOM 624  C C   . PHE A 1 78  ? 33.223 -53.615 -16.273 1.00 63.62  ? 100 PHE A C   1 
ATOM 625  O O   . PHE A 1 78  ? 32.543 -52.839 -15.616 1.00 71.11  ? 100 PHE A O   1 
ATOM 626  C CB  . PHE A 1 78  ? 34.474 -55.390 -15.124 1.00 64.55  ? 100 PHE A CB  1 
ATOM 627  C CG  . PHE A 1 78  ? 34.434 -56.698 -14.395 1.00 62.74  ? 100 PHE A CG  1 
ATOM 628  C CD1 . PHE A 1 78  ? 33.630 -56.856 -13.281 1.00 61.81  ? 100 PHE A CD1 1 
ATOM 629  C CD2 . PHE A 1 78  ? 35.206 -57.752 -14.808 1.00 64.27  ? 100 PHE A CD2 1 
ATOM 630  C CE1 . PHE A 1 78  ? 33.598 -58.045 -12.590 1.00 63.84  ? 100 PHE A CE1 1 
ATOM 631  C CE2 . PHE A 1 78  ? 35.184 -58.955 -14.124 1.00 66.82  ? 100 PHE A CE2 1 
ATOM 632  C CZ  . PHE A 1 78  ? 34.392 -59.103 -13.004 1.00 66.29  ? 100 PHE A CZ  1 
ATOM 633  N N   . ASN A 1 79  ? 34.003 -53.228 -17.286 1.00 63.60  ? 101 ASN A N   1 
ATOM 634  C CA  . ASN A 1 79  ? 34.051 -51.812 -17.712 1.00 62.14  ? 101 ASN A CA  1 
ATOM 635  C C   . ASN A 1 79  ? 32.768 -51.394 -18.394 1.00 58.98  ? 101 ASN A C   1 
ATOM 636  O O   . ASN A 1 79  ? 32.236 -50.324 -18.116 1.00 65.53  ? 101 ASN A O   1 
ATOM 637  C CB  . ASN A 1 79  ? 35.241 -51.531 -18.647 1.00 61.08  ? 101 ASN A CB  1 
ATOM 638  C CG  . ASN A 1 79  ? 36.571 -51.772 -17.969 1.00 63.47  ? 101 ASN A CG  1 
ATOM 639  O OD1 . ASN A 1 79  ? 36.646 -51.775 -16.740 1.00 69.54  ? 101 ASN A OD1 1 
ATOM 640  N ND2 . ASN A 1 79  ? 37.611 -52.017 -18.751 1.00 61.90  ? 101 ASN A ND2 1 
ATOM 641  N N   . ALA A 1 80  ? 32.274 -52.254 -19.274 1.00 58.06  ? 102 ALA A N   1 
ATOM 642  C CA  . ALA A 1 80  ? 31.048 -52.009 -19.986 1.00 56.74  ? 102 ALA A CA  1 
ATOM 643  C C   . ALA A 1 80  ? 29.912 -51.771 -18.994 1.00 62.23  ? 102 ALA A C   1 
ATOM 644  O O   . ALA A 1 80  ? 29.133 -50.807 -19.120 1.00 63.75  ? 102 ALA A O   1 
ATOM 645  C CB  . ALA A 1 80  ? 30.733 -53.173 -20.873 1.00 56.49  ? 102 ALA A CB  1 
ATOM 646  N N   . SER A 1 81  ? 29.840 -52.621 -17.980 1.00 61.71  ? 103 SER A N   1 
ATOM 647  C CA  . SER A 1 81  ? 28.826 -52.443 -16.939 1.00 62.72  ? 103 SER A CA  1 
ATOM 648  C C   . SER A 1 81  ? 28.995 -51.089 -16.224 1.00 64.43  ? 103 SER A C   1 
ATOM 649  O O   . SER A 1 81  ? 28.040 -50.372 -15.983 1.00 69.79  ? 103 SER A O   1 
ATOM 650  C CB  . SER A 1 81  ? 28.880 -53.620 -15.950 1.00 60.86  ? 103 SER A CB  1 
ATOM 651  O OG  . SER A 1 81  ? 28.102 -53.360 -14.803 1.00 59.79  ? 103 SER A OG  1 
ATOM 652  N N   . GLN A 1 82  ? 30.222 -50.730 -15.892 1.00 66.41  ? 104 GLN A N   1 
ATOM 653  C CA  . GLN A 1 82  ? 30.468 -49.449 -15.246 1.00 66.43  ? 104 GLN A CA  1 
ATOM 654  C C   . GLN A 1 82  ? 30.027 -48.283 -16.153 1.00 66.20  ? 104 GLN A C   1 
ATOM 655  O O   . GLN A 1 82  ? 29.530 -47.260 -15.679 1.00 60.44  ? 104 GLN A O   1 
ATOM 656  C CB  . GLN A 1 82  ? 31.950 -49.324 -14.921 1.00 67.33  ? 104 GLN A CB  1 
ATOM 657  C CG  . GLN A 1 82  ? 32.327 -48.023 -14.266 1.00 70.16  ? 104 GLN A CG  1 
ATOM 658  C CD  . GLN A 1 82  ? 31.765 -47.931 -12.872 1.00 76.13  ? 104 GLN A CD  1 
ATOM 659  O OE1 . GLN A 1 82  ? 32.167 -48.679 -12.003 1.00 84.46  ? 104 GLN A OE1 1 
ATOM 660  N NE2 . GLN A 1 82  ? 30.837 -47.018 -12.655 1.00 76.58  ? 104 GLN A NE2 1 
ATOM 661  N N   . SER A 1 83  ? 30.215 -48.433 -17.456 1.00 62.38  ? 105 SER A N   1 
ATOM 662  C CA  . SER A 1 83  ? 29.813 -47.377 -18.334 1.00 65.50  ? 105 SER A CA  1 
ATOM 663  C C   . SER A 1 83  ? 28.321 -47.154 -18.258 1.00 64.43  ? 105 SER A C   1 
ATOM 664  O O   . SER A 1 83  ? 27.869 -46.003 -18.273 1.00 64.10  ? 105 SER A O   1 
ATOM 665  C CB  . SER A 1 83  ? 30.185 -47.670 -19.765 1.00 67.08  ? 105 SER A CB  1 
ATOM 666  O OG  . SER A 1 83  ? 31.508 -47.318 -19.992 1.00 76.55  ? 105 SER A OG  1 
ATOM 667  N N   . GLU A 1 84  ? 27.558 -48.242 -18.195 1.00 64.53  ? 106 GLU A N   1 
ATOM 668  C CA  . GLU A 1 84  ? 26.093 -48.126 -18.222 1.00 64.99  ? 106 GLU A CA  1 
ATOM 669  C C   . GLU A 1 84  ? 25.665 -47.448 -16.938 1.00 60.11  ? 106 GLU A C   1 
ATOM 670  O O   . GLU A 1 84  ? 24.741 -46.671 -16.928 1.00 62.26  ? 106 GLU A O   1 
ATOM 671  C CB  . GLU A 1 84  ? 25.396 -49.479 -18.404 1.00 68.80  ? 106 GLU A CB  1 
ATOM 672  C CG  . GLU A 1 84  ? 25.560 -50.122 -19.788 1.00 76.41  ? 106 GLU A CG  1 
ATOM 673  C CD  . GLU A 1 84  ? 24.839 -49.354 -20.891 1.00 86.25  ? 106 GLU A CD  1 
ATOM 674  O OE1 . GLU A 1 84  ? 23.639 -49.607 -21.133 1.00 87.80  ? 106 GLU A OE1 1 
ATOM 675  O OE2 . GLU A 1 84  ? 25.480 -48.486 -21.530 1.00 105.99 ? 106 GLU A OE2 1 
ATOM 676  N N   . ILE A 1 85  ? 26.385 -47.671 -15.861 1.00 58.96  ? 107 ILE A N   1 
ATOM 677  C CA  . ILE A 1 85  ? 26.042 -46.984 -14.631 1.00 63.52  ? 107 ILE A CA  1 
ATOM 678  C C   . ILE A 1 85  ? 26.437 -45.529 -14.673 1.00 64.71  ? 107 ILE A C   1 
ATOM 679  O O   . ILE A 1 85  ? 25.721 -44.698 -14.141 1.00 70.46  ? 107 ILE A O   1 
ATOM 680  C CB  . ILE A 1 85  ? 26.685 -47.655 -13.411 1.00 66.63  ? 107 ILE A CB  1 
ATOM 681  C CG1 . ILE A 1 85  ? 26.086 -49.049 -13.252 1.00 67.70  ? 107 ILE A CG1 1 
ATOM 682  C CG2 . ILE A 1 85  ? 26.444 -46.839 -12.151 1.00 66.63  ? 107 ILE A CG2 1 
ATOM 683  C CD1 . ILE A 1 85  ? 24.579 -49.022 -13.138 1.00 69.56  ? 107 ILE A CD1 1 
ATOM 684  N N   . ASP A 1 86  ? 27.583 -45.218 -15.265 1.00 66.07  ? 108 ASP A N   1 
ATOM 685  C CA  . ASP A 1 86  ? 27.986 -43.828 -15.415 1.00 64.66  ? 108 ASP A CA  1 
ATOM 686  C C   . ASP A 1 86  ? 26.924 -43.062 -16.182 1.00 65.32  ? 108 ASP A C   1 
ATOM 687  O O   . ASP A 1 86  ? 26.545 -41.958 -15.792 1.00 64.17  ? 108 ASP A O   1 
ATOM 688  C CB  . ASP A 1 86  ? 29.315 -43.722 -16.148 1.00 65.55  ? 108 ASP A CB  1 
ATOM 689  C CG  . ASP A 1 86  ? 30.505 -44.111 -15.271 1.00 72.67  ? 108 ASP A CG  1 
ATOM 690  O OD1 . ASP A 1 86  ? 30.330 -44.126 -14.034 1.00 74.02  ? 108 ASP A OD1 1 
ATOM 691  O OD2 . ASP A 1 86  ? 31.614 -44.387 -15.818 1.00 79.82  ? 108 ASP A OD2 1 
ATOM 692  N N   . ASP A 1 87  ? 26.439 -43.677 -17.258 1.00 65.66  ? 109 ASP A N   1 
ATOM 693  C CA  . ASP A 1 87  ? 25.402 -43.091 -18.092 1.00 67.36  ? 109 ASP A CA  1 
ATOM 694  C C   . ASP A 1 87  ? 24.151 -42.884 -17.271 1.00 64.83  ? 109 ASP A C   1 
ATOM 695  O O   . ASP A 1 87  ? 23.547 -41.827 -17.310 1.00 62.17  ? 109 ASP A O   1 
ATOM 696  C CB  . ASP A 1 87  ? 25.077 -44.000 -19.298 1.00 70.87  ? 109 ASP A CB  1 
ATOM 697  C CG  . ASP A 1 87  ? 26.136 -43.936 -20.414 1.00 74.15  ? 109 ASP A CG  1 
ATOM 698  O OD1 . ASP A 1 87  ? 27.181 -43.260 -20.249 1.00 84.63  ? 109 ASP A OD1 1 
ATOM 699  O OD2 . ASP A 1 87  ? 25.909 -44.567 -21.476 1.00 79.08  ? 109 ASP A OD2 1 
ATOM 700  N N   . ALA A 1 88  ? 23.759 -43.898 -16.510 1.00 64.20  ? 110 ALA A N   1 
ATOM 701  C CA  . ALA A 1 88  ? 22.578 -43.764 -15.659 1.00 62.49  ? 110 ALA A CA  1 
ATOM 702  C C   . ALA A 1 88  ? 22.699 -42.565 -14.730 1.00 60.76  ? 110 ALA A C   1 
ATOM 703  O O   . ALA A 1 88  ? 21.798 -41.741 -14.648 1.00 62.42  ? 110 ALA A O   1 
ATOM 704  C CB  . ALA A 1 88  ? 22.354 -45.026 -14.864 1.00 62.99  ? 110 ALA A CB  1 
ATOM 705  N N   . ASN A 1 89  ? 23.835 -42.449 -14.059 1.00 64.66  ? 111 ASN A N   1 
ATOM 706  C CA  . ASN A 1 89  ? 24.075 -41.315 -13.171 1.00 64.24  ? 111 ASN A CA  1 
ATOM 707  C C   . ASN A 1 89  ? 24.098 -39.965 -13.871 1.00 64.24  ? 111 ASN A C   1 
ATOM 708  O O   . ASN A 1 89  ? 23.636 -38.971 -13.310 1.00 61.98  ? 111 ASN A O   1 
ATOM 709  C CB  . ASN A 1 89  ? 25.339 -41.545 -12.352 1.00 59.87  ? 111 ASN A CB  1 
ATOM 710  C CG  . ASN A 1 89  ? 25.088 -42.508 -11.211 1.00 65.18  ? 111 ASN A CG  1 
ATOM 711  O OD1 . ASN A 1 89  ? 24.174 -42.318 -10.413 1.00 73.31  ? 111 ASN A OD1 1 
ATOM 712  N ND2 . ASN A 1 89  ? 25.831 -43.581 -11.174 1.00 69.03  ? 111 ASN A ND2 1 
ATOM 713  N N   . GLU A 1 90  ? 24.613 -39.931 -15.094 1.00 64.37  ? 112 GLU A N   1 
ATOM 714  C CA  . GLU A 1 90  ? 24.609 -38.706 -15.879 1.00 67.36  ? 112 GLU A CA  1 
ATOM 715  C C   . GLU A 1 90  ? 23.160 -38.297 -16.148 1.00 64.76  ? 112 GLU A C   1 
ATOM 716  O O   . GLU A 1 90  ? 22.794 -37.143 -16.036 1.00 64.33  ? 112 GLU A O   1 
ATOM 717  C CB  . GLU A 1 90  ? 25.357 -38.941 -17.178 1.00 76.98  ? 112 GLU A CB  1 
ATOM 718  C CG  . GLU A 1 90  ? 25.762 -37.688 -17.919 1.00 92.72  ? 112 GLU A CG  1 
ATOM 719  C CD  . GLU A 1 90  ? 26.434 -38.004 -19.244 1.00 107.29 ? 112 GLU A CD  1 
ATOM 720  O OE1 . GLU A 1 90  ? 27.320 -38.893 -19.266 1.00 116.54 ? 112 GLU A OE1 1 
ATOM 721  O OE2 . GLU A 1 90  ? 26.073 -37.368 -20.265 1.00 116.02 ? 112 GLU A OE2 1 
ATOM 722  N N   . LEU A 1 91  ? 22.322 -39.271 -16.455 1.00 64.61  ? 113 LEU A N   1 
ATOM 723  C CA  . LEU A 1 91  ? 20.942 -38.992 -16.775 1.00 65.90  ? 113 LEU A CA  1 
ATOM 724  C C   . LEU A 1 91  ? 20.221 -38.485 -15.542 1.00 70.96  ? 113 LEU A C   1 
ATOM 725  O O   . LEU A 1 91  ? 19.466 -37.514 -15.594 1.00 76.05  ? 113 LEU A O   1 
ATOM 726  C CB  . LEU A 1 91  ? 20.262 -40.239 -17.304 1.00 62.90  ? 113 LEU A CB  1 
ATOM 727  C CG  . LEU A 1 91  ? 20.619 -40.653 -18.730 1.00 64.66  ? 113 LEU A CG  1 
ATOM 728  C CD1 . LEU A 1 91  ? 20.116 -42.061 -19.010 1.00 68.55  ? 113 LEU A CD1 1 
ATOM 729  C CD2 . LEU A 1 91  ? 20.026 -39.703 -19.753 1.00 65.09  ? 113 LEU A CD2 1 
ATOM 730  N N   . MET A 1 92  ? 20.460 -39.135 -14.422 1.00 70.95  ? 114 MET A N   1 
ATOM 731  C CA  . MET A 1 92  ? 19.848 -38.675 -13.194 1.00 72.62  ? 114 MET A CA  1 
ATOM 732  C C   . MET A 1 92  ? 20.382 -37.300 -12.801 1.00 66.78  ? 114 MET A C   1 
ATOM 733  O O   . MET A 1 92  ? 19.616 -36.515 -12.286 1.00 68.76  ? 114 MET A O   1 
ATOM 734  C CB  . MET A 1 92  ? 20.043 -39.693 -12.071 1.00 73.54  ? 114 MET A CB  1 
ATOM 735  C CG  . MET A 1 92  ? 19.258 -40.969 -12.303 1.00 74.04  ? 114 MET A CG  1 
ATOM 736  S SD  . MET A 1 92  ? 19.318 -42.174 -10.957 1.00 77.63  ? 114 MET A SD  1 
ATOM 737  C CE  . MET A 1 92  ? 20.715 -43.167 -11.460 1.00 82.67  ? 114 MET A CE  1 
ATOM 738  N N   . ASP A 1 93  ? 21.662 -36.996 -13.061 1.00 64.60  ? 115 ASP A N   1 
ATOM 739  C CA  . ASP A 1 93  ? 22.187 -35.636 -12.791 1.00 65.18  ? 115 ASP A CA  1 
ATOM 740  C C   . ASP A 1 93  ? 21.332 -34.596 -13.525 1.00 64.17  ? 115 ASP A C   1 
ATOM 741  O O   . ASP A 1 93  ? 20.966 -33.594 -12.950 1.00 64.25  ? 115 ASP A O   1 
ATOM 742  C CB  . ASP A 1 93  ? 23.646 -35.453 -13.206 1.00 64.04  ? 115 ASP A CB  1 
ATOM 743  C CG  . ASP A 1 93  ? 24.615 -36.225 -12.352 1.00 72.11  ? 115 ASP A CG  1 
ATOM 744  O OD1 . ASP A 1 93  ? 24.318 -36.554 -11.196 1.00 78.37  ? 115 ASP A OD1 1 
ATOM 745  O OD2 . ASP A 1 93  ? 25.714 -36.519 -12.846 1.00 88.17  ? 115 ASP A OD2 1 
ATOM 746  N N   . SER A 1 94  ? 20.990 -34.869 -14.779 1.00 61.31  ? 116 SER A N   1 
ATOM 747  C CA  . SER A 1 94  ? 20.138 -33.981 -15.548 1.00 62.55  ? 116 SER A CA  1 
ATOM 748  C C   . SER A 1 94  ? 18.733 -33.866 -14.964 1.00 67.75  ? 116 SER A C   1 
ATOM 749  O O   . SER A 1 94  ? 18.230 -32.761 -14.778 1.00 72.35  ? 116 SER A O   1 
ATOM 750  C CB  . SER A 1 94  ? 20.049 -34.460 -16.997 1.00 65.72  ? 116 SER A CB  1 
ATOM 751  O OG  . SER A 1 94  ? 21.324 -34.403 -17.611 1.00 67.55  ? 116 SER A OG  1 
ATOM 752  N N   . TYR A 1 95  ? 18.087 -34.992 -14.680 1.00 66.17  ? 117 TYR A N   1 
ATOM 753  C CA  . TYR A 1 95  ? 16.788 -34.939 -14.028 1.00 65.29  ? 117 TYR A CA  1 
ATOM 754  C C   . TYR A 1 95  ? 16.851 -34.060 -12.765 1.00 67.68  ? 117 TYR A C   1 
ATOM 755  O O   . TYR A 1 95  ? 16.012 -33.189 -12.597 1.00 64.58  ? 117 TYR A O   1 
ATOM 756  C CB  . TYR A 1 95  ? 16.306 -36.331 -13.659 1.00 65.44  ? 117 TYR A CB  1 
ATOM 757  C CG  . TYR A 1 95  ? 14.819 -36.428 -13.368 1.00 71.86  ? 117 TYR A CG  1 
ATOM 758  C CD1 . TYR A 1 95  ? 13.866 -36.212 -14.372 1.00 77.74  ? 117 TYR A CD1 1 
ATOM 759  C CD2 . TYR A 1 95  ? 14.359 -36.783 -12.116 1.00 72.56  ? 117 TYR A CD2 1 
ATOM 760  C CE1 . TYR A 1 95  ? 12.495 -36.313 -14.111 1.00 76.52  ? 117 TYR A CE1 1 
ATOM 761  C CE2 . TYR A 1 95  ? 12.997 -36.903 -11.860 1.00 79.71  ? 117 TYR A CE2 1 
ATOM 762  C CZ  . TYR A 1 95  ? 12.073 -36.657 -12.853 1.00 78.22  ? 117 TYR A CZ  1 
ATOM 763  O OH  . TYR A 1 95  ? 10.734 -36.768 -12.566 1.00 87.60  ? 117 TYR A OH  1 
ATOM 764  N N   . GLU A 1 96  ? 17.843 -34.283 -11.894 1.00 69.01  ? 118 GLU A N   1 
ATOM 765  C CA  . GLU A 1 96  ? 18.015 -33.463 -10.687 1.00 70.02  ? 118 GLU A CA  1 
ATOM 766  C C   . GLU A 1 96  ? 18.165 -31.987 -11.062 1.00 68.54  ? 118 GLU A C   1 
ATOM 767  O O   . GLU A 1 96  ? 17.525 -31.118 -10.490 1.00 62.99  ? 118 GLU A O   1 
ATOM 768  C CB  . GLU A 1 96  ? 19.235 -33.900 -9.881  1.00 75.66  ? 118 GLU A CB  1 
ATOM 769  C CG  . GLU A 1 96  ? 18.931 -34.750 -8.658  1.00 85.86  ? 118 GLU A CG  1 
ATOM 770  C CD  . GLU A 1 96  ? 20.192 -35.179 -7.905  1.00 97.63  ? 118 GLU A CD  1 
ATOM 771  O OE1 . GLU A 1 96  ? 21.201 -34.426 -7.904  1.00 104.09 ? 118 GLU A OE1 1 
ATOM 772  O OE2 . GLU A 1 96  ? 20.190 -36.290 -7.318  1.00 109.25 ? 118 GLU A OE2 1 
ATOM 773  N N   . GLN A 1 97  ? 19.005 -31.713 -12.044 1.00 66.65  ? 119 GLN A N   1 
ATOM 774  C CA  . GLN A 1 97  ? 19.230 -30.356 -12.463 1.00 69.65  ? 119 GLN A CA  1 
ATOM 775  C C   . GLN A 1 97  ? 17.920 -29.738 -12.987 1.00 69.98  ? 119 GLN A C   1 
ATOM 776  O O   . GLN A 1 97  ? 17.670 -28.554 -12.784 1.00 72.18  ? 119 GLN A O   1 
ATOM 777  C CB  . GLN A 1 97  ? 20.361 -30.291 -13.502 1.00 77.13  ? 119 GLN A CB  1 
ATOM 778  C CG  . GLN A 1 97  ? 20.727 -28.882 -13.968 1.00 97.26  ? 119 GLN A CG  1 
ATOM 779  C CD  . GLN A 1 97  ? 21.042 -27.918 -12.811 1.00 113.23 ? 119 GLN A CD  1 
ATOM 780  O OE1 . GLN A 1 97  ? 21.582 -28.320 -11.765 1.00 117.02 ? 119 GLN A OE1 1 
ATOM 781  N NE2 . GLN A 1 97  ? 20.698 -26.636 -12.995 1.00 110.35 ? 119 GLN A NE2 1 
ATOM 782  N N   . SER A 1 98  ? 17.064 -30.527 -13.630 1.00 68.96  ? 120 SER A N   1 
ATOM 783  C CA  . SER A 1 98  ? 15.823 -29.973 -14.188 1.00 65.50  ? 120 SER A CA  1 
ATOM 784  C C   . SER A 1 98  ? 14.847 -29.600 -13.069 1.00 61.78  ? 120 SER A C   1 
ATOM 785  O O   . SER A 1 98  ? 14.094 -28.652 -13.196 1.00 68.05  ? 120 SER A O   1 
ATOM 786  C CB  . SER A 1 98  ? 15.189 -30.919 -15.202 1.00 62.13  ? 120 SER A CB  1 
ATOM 787  O OG  . SER A 1 98  ? 14.402 -31.894 -14.543 1.00 76.68  ? 120 SER A OG  1 
ATOM 788  N N   . TYR A 1 99  ? 14.899 -30.321 -11.963 1.00 63.33  ? 121 TYR A N   1 
ATOM 789  C CA  . TYR A 1 99  ? 14.208 -29.914 -10.746 1.00 67.72  ? 121 TYR A CA  1 
ATOM 790  C C   . TYR A 1 99  ? 14.728 -28.577 -10.219 1.00 66.06  ? 121 TYR A C   1 
ATOM 791  O O   . TYR A 1 99  ? 13.944 -27.676 -9.952  1.00 73.37  ? 121 TYR A O   1 
ATOM 792  C CB  . TYR A 1 99  ? 14.375 -30.982 -9.660  1.00 67.00  ? 121 TYR A CB  1 
ATOM 793  C CG  . TYR A 1 99  ? 13.713 -30.628 -8.354  1.00 69.92  ? 121 TYR A CG  1 
ATOM 794  C CD1 . TYR A 1 99  ? 12.340 -30.434 -8.286  1.00 71.52  ? 121 TYR A CD1 1 
ATOM 795  C CD2 . TYR A 1 99  ? 14.459 -30.479 -7.186  1.00 72.91  ? 121 TYR A CD2 1 
ATOM 796  C CE1 . TYR A 1 99  ? 11.720 -30.101 -7.086  1.00 79.32  ? 121 TYR A CE1 1 
ATOM 797  C CE2 . TYR A 1 99  ? 13.855 -30.149 -5.978  1.00 77.48  ? 121 TYR A CE2 1 
ATOM 798  C CZ  . TYR A 1 99  ? 12.482 -29.958 -5.933  1.00 83.69  ? 121 TYR A CZ  1 
ATOM 799  O OH  . TYR A 1 99  ? 11.862 -29.640 -4.746  1.00 87.72  ? 121 TYR A OH  1 
ATOM 800  N N   . GLN A 1 100 ? 16.043 -28.473 -10.056 1.00 66.16  ? 122 GLN A N   1 
ATOM 801  C CA  . GLN A 1 100 ? 16.675 -27.271 -9.507  1.00 70.77  ? 122 GLN A CA  1 
ATOM 802  C C   . GLN A 1 100 ? 16.318 -26.060 -10.334 1.00 65.86  ? 122 GLN A C   1 
ATOM 803  O O   . GLN A 1 100 ? 16.071 -24.991 -9.800  1.00 65.18  ? 122 GLN A O   1 
ATOM 804  C CB  . GLN A 1 100 ? 18.208 -27.405 -9.432  1.00 74.10  ? 122 GLN A CB  1 
ATOM 805  C CG  . GLN A 1 100 ? 18.730 -28.384 -8.376  1.00 82.46  ? 122 GLN A CG  1 
ATOM 806  C CD  . GLN A 1 100 ? 18.396 -27.961 -6.950  1.00 98.52  ? 122 GLN A CD  1 
ATOM 807  O OE1 . GLN A 1 100 ? 18.207 -26.764 -6.653  1.00 100.90 ? 122 GLN A OE1 1 
ATOM 808  N NE2 . GLN A 1 100 ? 18.318 -28.944 -6.054  1.00 103.87 ? 122 GLN A NE2 1 
ATOM 809  N N   . GLN A 1 101 ? 16.272 -26.245 -11.641 1.00 64.32  ? 123 GLN A N   1 
ATOM 810  C CA  . GLN A 1 101 ? 15.878 -25.182 -12.546 1.00 66.59  ? 123 GLN A CA  1 
ATOM 811  C C   . GLN A 1 101 ? 14.416 -24.760 -12.335 1.00 66.94  ? 123 GLN A C   1 
ATOM 812  O O   . GLN A 1 101 ? 14.041 -23.640 -12.623 1.00 67.62  ? 123 GLN A O   1 
ATOM 813  C CB  . GLN A 1 101 ? 16.093 -25.634 -13.992 1.00 68.55  ? 123 GLN A CB  1 
ATOM 814  C CG  . GLN A 1 101 ? 15.970 -24.552 -15.041 1.00 73.22  ? 123 GLN A CG  1 
ATOM 815  C CD  . GLN A 1 101 ? 16.742 -23.289 -14.693 1.00 81.06  ? 123 GLN A CD  1 
ATOM 816  O OE1 . GLN A 1 101 ? 16.155 -22.216 -14.556 1.00 84.07  ? 123 GLN A OE1 1 
ATOM 817  N NE2 . GLN A 1 101 ? 18.049 -23.411 -14.525 1.00 79.81  ? 123 GLN A NE2 1 
ATOM 818  N N   . GLN A 1 102 ? 13.580 -25.643 -11.826 1.00 67.53  ? 124 GLN A N   1 
ATOM 819  C CA  . GLN A 1 102 ? 12.213 -25.242 -11.569 1.00 69.32  ? 124 GLN A CA  1 
ATOM 820  C C   . GLN A 1 102 ? 12.009 -24.607 -10.217 1.00 71.71  ? 124 GLN A C   1 
ATOM 821  O O   . GLN A 1 102 ? 11.126 -23.760 -10.111 1.00 73.38  ? 124 GLN A O   1 
ATOM 822  C CB  . GLN A 1 102 ? 11.277 -26.409 -11.699 1.00 73.34  ? 124 GLN A CB  1 
ATOM 823  C CG  . GLN A 1 102 ? 11.169 -26.914 -13.115 1.00 71.48  ? 124 GLN A CG  1 
ATOM 824  C CD  . GLN A 1 102 ? 9.858  -27.604 -13.376 1.00 77.19  ? 124 GLN A CD  1 
ATOM 825  O OE1 . GLN A 1 102 ? 9.122  -28.037 -12.441 1.00 79.94  ? 124 GLN A OE1 1 
ATOM 826  N NE2 . GLN A 1 102 ? 9.537  -27.708 -14.658 1.00 78.75  ? 124 GLN A NE2 1 
ATOM 827  N N   . LEU A 1 103 ? 12.778 -25.001 -9.189  1.00 65.46  ? 125 LEU A N   1 
ATOM 828  C CA  . LEU A 1 103 ? 12.735 -24.261 -7.916  1.00 67.50  ? 125 LEU A CA  1 
ATOM 829  C C   . LEU A 1 103 ? 13.085 -22.805 -8.202  1.00 70.13  ? 125 LEU A C   1 
ATOM 830  O O   . LEU A 1 103 ? 12.540 -21.875 -7.592  1.00 65.04  ? 125 LEU A O   1 
ATOM 831  C CB  . LEU A 1 103 ? 13.731 -24.777 -6.891  1.00 66.41  ? 125 LEU A CB  1 
ATOM 832  C CG  . LEU A 1 103 ? 13.483 -26.168 -6.334  1.00 78.92  ? 125 LEU A CG  1 
ATOM 833  C CD1 . LEU A 1 103 ? 14.503 -26.447 -5.245  1.00 80.07  ? 125 LEU A CD1 1 
ATOM 834  C CD2 . LEU A 1 103 ? 12.063 -26.337 -5.796  1.00 82.94  ? 125 LEU A CD2 1 
ATOM 835  N N   . GLU A 1 104 ? 13.995 -22.627 -9.151  1.00 68.29  ? 126 GLU A N   1 
ATOM 836  C CA  . GLU A 1 104 ? 14.542 -21.335 -9.423  1.00 71.30  ? 126 GLU A CA  1 
ATOM 837  C C   . GLU A 1 104 ? 13.563 -20.542 -10.277 1.00 69.82  ? 126 GLU A C   1 
ATOM 838  O O   . GLU A 1 104 ? 13.265 -19.401 -9.973  1.00 70.58  ? 126 GLU A O   1 
ATOM 839  C CB  . GLU A 1 104 ? 15.890 -21.503 -10.091 1.00 74.42  ? 126 GLU A CB  1 
ATOM 840  C CG  . GLU A 1 104 ? 16.581 -20.196 -10.364 1.00 87.06  ? 126 GLU A CG  1 
ATOM 841  C CD  . GLU A 1 104 ? 18.075 -20.353 -10.555 1.00 97.49  ? 126 GLU A CD  1 
ATOM 842  O OE1 . GLU A 1 104 ? 18.701 -20.956 -9.651  1.00 95.71  ? 126 GLU A OE1 1 
ATOM 843  O OE2 . GLU A 1 104 ? 18.607 -19.868 -11.594 1.00 94.81  ? 126 GLU A OE2 1 
ATOM 844  N N   . ASP A 1 105 ? 13.045 -21.162 -11.329 1.00 71.01  ? 127 ASP A N   1 
ATOM 845  C CA  . ASP A 1 105 ? 12.045 -20.531 -12.191 1.00 67.85  ? 127 ASP A CA  1 
ATOM 846  C C   . ASP A 1 105 ? 10.806 -20.041 -11.423 1.00 71.47  ? 127 ASP A C   1 
ATOM 847  O O   . ASP A 1 105 ? 10.215 -19.013 -11.757 1.00 78.21  ? 127 ASP A O   1 
ATOM 848  C CB  . ASP A 1 105 ? 11.579 -21.519 -13.257 1.00 70.61  ? 127 ASP A CB  1 
ATOM 849  C CG  . ASP A 1 105 ? 12.549 -21.658 -14.423 1.00 76.66  ? 127 ASP A CG  1 
ATOM 850  O OD1 . ASP A 1 105 ? 13.475 -20.845 -14.541 1.00 78.42  ? 127 ASP A OD1 1 
ATOM 851  O OD2 . ASP A 1 105 ? 12.375 -22.594 -15.243 1.00 91.25  ? 127 ASP A OD2 1 
ATOM 852  N N   . VAL A 1 106 ? 10.401 -20.799 -10.418 1.00 66.53  ? 128 VAL A N   1 
ATOM 853  C CA  . VAL A 1 106 ? 9.234  -20.453 -9.622  1.00 66.50  ? 128 VAL A CA  1 
ATOM 854  C C   . VAL A 1 106 ? 9.543  -19.391 -8.575  1.00 68.87  ? 128 VAL A C   1 
ATOM 855  O O   . VAL A 1 106 ? 8.753  -18.478 -8.358  1.00 69.91  ? 128 VAL A O   1 
ATOM 856  C CB  . VAL A 1 106 ? 8.681  -21.706 -8.912  1.00 62.31  ? 128 VAL A CB  1 
ATOM 857  C CG1 . VAL A 1 106 ? 7.620  -21.350 -7.886  1.00 61.36  ? 128 VAL A CG1 1 
ATOM 858  C CG2 . VAL A 1 106 ? 8.092  -22.644 -9.945  1.00 66.62  ? 128 VAL A CG2 1 
ATOM 859  N N   . ASN A 1 107 ? 10.664 -19.549 -7.883  1.00 68.60  ? 129 ASN A N   1 
ATOM 860  C CA  . ASN A 1 107 ? 11.155 -18.500 -7.004  1.00 64.94  ? 129 ASN A CA  1 
ATOM 861  C C   . ASN A 1 107 ? 11.211 -17.138 -7.718  1.00 64.92  ? 129 ASN A C   1 
ATOM 862  O O   . ASN A 1 107 ? 10.849 -16.097 -7.138  1.00 61.84  ? 129 ASN A O   1 
ATOM 863  C CB  . ASN A 1 107 ? 12.523 -18.866 -6.465  1.00 61.90  ? 129 ASN A CB  1 
ATOM 864  C CG  . ASN A 1 107 ? 12.461 -19.975 -5.432  1.00 62.37  ? 129 ASN A CG  1 
ATOM 865  O OD1 . ASN A 1 107 ? 11.435 -20.209 -4.812  1.00 62.23  ? 129 ASN A OD1 1 
ATOM 866  N ND2 . ASN A 1 107 ? 13.570 -20.667 -5.250  1.00 65.90  ? 129 ASN A ND2 1 
ATOM 867  N N   . GLU A 1 108 ? 11.618 -17.150 -8.981  1.00 56.48  ? 130 GLU A N   1 
ATOM 868  C CA  . GLU A 1 108 ? 11.693 -15.917 -9.729  1.00 64.27  ? 130 GLU A CA  1 
ATOM 869  C C   . GLU A 1 108 ? 10.304 -15.271 -9.794  1.00 65.18  ? 130 GLU A C   1 
ATOM 870  O O   . GLU A 1 108 ? 10.136 -14.083 -9.532  1.00 66.95  ? 130 GLU A O   1 
ATOM 871  C CB  . GLU A 1 108 ? 12.231 -16.178 -11.128 1.00 63.00  ? 130 GLU A CB  1 
ATOM 872  C CG  . GLU A 1 108 ? 12.341 -14.926 -11.961 1.00 70.22  ? 130 GLU A CG  1 
ATOM 873  C CD  . GLU A 1 108 ? 13.066 -15.164 -13.273 1.00 79.62  ? 130 GLU A CD  1 
ATOM 874  O OE1 . GLU A 1 108 ? 12.986 -16.313 -13.766 1.00 79.90  ? 130 GLU A OE1 1 
ATOM 875  O OE2 . GLU A 1 108 ? 13.704 -14.210 -13.809 1.00 85.62  ? 130 GLU A OE2 1 
ATOM 876  N N   . ILE A 1 109 ? 9.314  -16.083 -10.119 1.00 64.60  ? 131 ILE A N   1 
ATOM 877  C CA  . ILE A 1 109 ? 7.934  -15.626 -10.219 1.00 61.85  ? 131 ILE A CA  1 
ATOM 878  C C   . ILE A 1 109 ? 7.383  -15.135 -8.885  1.00 58.76  ? 131 ILE A C   1 
ATOM 879  O O   . ILE A 1 109 ? 6.743  -14.085 -8.803  1.00 59.02  ? 131 ILE A O   1 
ATOM 880  C CB  . ILE A 1 109 ? 7.047  -16.726 -10.802 1.00 66.95  ? 131 ILE A CB  1 
ATOM 881  C CG1 . ILE A 1 109 ? 7.430  -16.952 -12.269 1.00 67.37  ? 131 ILE A CG1 1 
ATOM 882  C CG2 . ILE A 1 109 ? 5.583  -16.338 -10.700 1.00 72.59  ? 131 ILE A CG2 1 
ATOM 883  C CD1 . ILE A 1 109 ? 6.965  -18.263 -12.846 1.00 71.22  ? 131 ILE A CD1 1 
ATOM 884  N N   . ILE A 1 110 ? 7.680  -15.847 -7.820  1.00 57.85  ? 132 ILE A N   1 
ATOM 885  C CA  . ILE A 1 110 ? 7.267  -15.377 -6.505  1.00 58.28  ? 132 ILE A CA  1 
ATOM 886  C C   . ILE A 1 110 ? 7.864  -14.006 -6.225  1.00 60.43  ? 132 ILE A C   1 
ATOM 887  O O   . ILE A 1 110 ? 7.189  -13.113 -5.708  1.00 65.82  ? 132 ILE A O   1 
ATOM 888  C CB  . ILE A 1 110 ? 7.667  -16.388 -5.440  1.00 59.11  ? 132 ILE A CB  1 
ATOM 889  C CG1 . ILE A 1 110 ? 6.873  -17.679 -5.689  1.00 65.26  ? 132 ILE A CG1 1 
ATOM 890  C CG2 . ILE A 1 110 ? 7.352  -15.867 -4.059  1.00 57.05  ? 132 ILE A CG2 1 
ATOM 891  C CD1 . ILE A 1 110 ? 7.296  -18.853 -4.845  1.00 69.97  ? 132 ILE A CD1 1 
ATOM 892  N N   . ALA A 1 111 ? 9.119  -13.844 -6.627  1.00 63.58  ? 133 ALA A N   1 
ATOM 893  C CA  . ALA A 1 111 ? 9.884  -12.635 -6.363  1.00 63.58  ? 133 ALA A CA  1 
ATOM 894  C C   . ALA A 1 111 ? 9.329  -11.458 -7.143  1.00 65.89  ? 133 ALA A C   1 
ATOM 895  O O   . ALA A 1 111 ? 9.283  -10.328 -6.633  1.00 68.01  ? 133 ALA A O   1 
ATOM 896  C CB  . ALA A 1 111 ? 11.359 -12.847 -6.701  1.00 59.93  ? 133 ALA A CB  1 
ATOM 897  N N   . LEU A 1 112 ? 8.899  -11.723 -8.368  1.00 62.63  ? 134 LEU A N   1 
ATOM 898  C CA  . LEU A 1 112 ? 8.256  -10.697 -9.162  1.00 64.11  ? 134 LEU A CA  1 
ATOM 899  C C   . LEU A 1 112 ? 6.876  -10.258 -8.648  1.00 69.89  ? 134 LEU A C   1 
ATOM 900  O O   . LEU A 1 112 ? 6.519  -9.094  -8.782  1.00 67.31  ? 134 LEU A O   1 
ATOM 901  C CB  . LEU A 1 112 ? 8.122  -11.178 -10.584 1.00 62.98  ? 134 LEU A CB  1 
ATOM 902  C CG  . LEU A 1 112 ? 9.447  -11.083 -11.304 1.00 64.92  ? 134 LEU A CG  1 
ATOM 903  C CD1 . LEU A 1 112 ? 9.388  -11.814 -12.617 1.00 67.27  ? 134 LEU A CD1 1 
ATOM 904  C CD2 . LEU A 1 112 ? 9.829  -9.633  -11.562 1.00 70.37  ? 134 LEU A CD2 1 
ATOM 905  N N   . TYR A 1 113 ? 6.093  -11.176 -8.085  1.00 68.29  ? 135 TYR A N   1 
ATOM 906  C CA  . TYR A 1 113 ? 4.805  -10.788 -7.526  1.00 65.06  ? 135 TYR A CA  1 
ATOM 907  C C   . TYR A 1 113 ? 5.040  -9.897  -6.328  1.00 66.60  ? 135 TYR A C   1 
ATOM 908  O O   . TYR A 1 113 ? 4.361  -8.897  -6.137  1.00 76.03  ? 135 TYR A O   1 
ATOM 909  C CB  . TYR A 1 113 ? 3.983  -12.000 -7.108  1.00 67.27  ? 135 TYR A CB  1 
ATOM 910  C CG  . TYR A 1 113 ? 3.014  -12.497 -8.163  1.00 70.59  ? 135 TYR A CG  1 
ATOM 911  C CD1 . TYR A 1 113 ? 3.461  -13.199 -9.285  1.00 69.98  ? 135 TYR A CD1 1 
ATOM 912  C CD2 . TYR A 1 113 ? 1.638  -12.286 -8.030  1.00 74.09  ? 135 TYR A CD2 1 
ATOM 913  C CE1 . TYR A 1 113 ? 2.571  -13.666 -10.252 1.00 71.70  ? 135 TYR A CE1 1 
ATOM 914  C CE2 . TYR A 1 113 ? 0.741  -12.758 -8.988  1.00 79.90  ? 135 TYR A CE2 1 
ATOM 915  C CZ  . TYR A 1 113 ? 1.209  -13.450 -10.091 1.00 77.18  ? 135 TYR A CZ  1 
ATOM 916  O OH  . TYR A 1 113 ? 0.319  -13.908 -11.026 1.00 77.25  ? 135 TYR A OH  1 
ATOM 917  N N   . LYS A 1 114 ? 6.016  -10.267 -5.521  1.00 66.22  ? 136 LYS A N   1 
ATOM 918  C CA  . LYS A 1 114 ? 6.359  -9.499  -4.325  1.00 67.82  ? 136 LYS A CA  1 
ATOM 919  C C   . LYS A 1 114 ? 6.927  -8.109  -4.678  1.00 70.84  ? 136 LYS A C   1 
ATOM 920  O O   . LYS A 1 114 ? 6.582  -7.094  -4.057  1.00 72.69  ? 136 LYS A O   1 
ATOM 921  C CB  . LYS A 1 114 ? 7.370  -10.310 -3.548  1.00 64.93  ? 136 LYS A CB  1 
ATOM 922  C CG  . LYS A 1 114 ? 7.943  -9.702  -2.300  1.00 69.16  ? 136 LYS A CG  1 
ATOM 923  C CD  . LYS A 1 114 ? 9.171  -10.505 -1.867  1.00 76.83  ? 136 LYS A CD  1 
ATOM 924  C CE  . LYS A 1 114 ? 10.219 -9.644  -1.195  1.00 86.20  ? 136 LYS A CE  1 
ATOM 925  N NZ  . LYS A 1 114 ? 9.628  -9.107  0.058   1.00 97.74  ? 136 LYS A NZ  1 
ATOM 926  N N   . ASP A 1 115 ? 7.784  -8.072  -5.690  1.00 66.33  ? 137 ASP A N   1 
ATOM 927  C CA  . ASP A 1 115 ? 8.496  -6.857  -6.018  1.00 67.77  ? 137 ASP A CA  1 
ATOM 928  C C   . ASP A 1 115 ? 7.590  -5.915  -6.834  1.00 68.96  ? 137 ASP A C   1 
ATOM 929  O O   . ASP A 1 115 ? 7.651  -4.690  -6.656  1.00 68.71  ? 137 ASP A O   1 
ATOM 930  C CB  . ASP A 1 115 ? 9.849  -7.173  -6.701  1.00 68.75  ? 137 ASP A CB  1 
ATOM 931  C CG  . ASP A 1 115 ? 11.010 -7.388  -5.685  1.00 73.96  ? 137 ASP A CG  1 
ATOM 932  O OD1 . ASP A 1 115 ? 10.805 -7.872  -4.545  1.00 87.42  ? 137 ASP A OD1 1 
ATOM 933  O OD2 . ASP A 1 115 ? 12.155 -7.047  -6.027  1.00 80.29  ? 137 ASP A OD2 1 
ATOM 934  N N   . ASN A 1 116 ? 6.753  -6.492  -7.701  1.00 65.89  ? 138 ASN A N   1 
ATOM 935  C CA  . ASN A 1 116 ? 5.622  -5.789  -8.318  1.00 60.96  ? 138 ASN A CA  1 
ATOM 936  C C   . ASN A 1 116 ? 4.734  -5.093  -7.284  1.00 63.01  ? 138 ASN A C   1 
ATOM 937  O O   . ASN A 1 116 ? 4.392  -3.943  -7.425  1.00 67.05  ? 138 ASN A O   1 
ATOM 938  C CB  . ASN A 1 116 ? 4.753  -6.765  -9.107  1.00 62.32  ? 138 ASN A CB  1 
ATOM 939  C CG  . ASN A 1 116 ? 5.371  -7.170  -10.448 1.00 66.71  ? 138 ASN A CG  1 
ATOM 940  O OD1 . ASN A 1 116 ? 6.454  -6.733  -10.799 1.00 67.88  ? 138 ASN A OD1 1 
ATOM 941  N ND2 . ASN A 1 116 ? 4.669  -8.013  -11.202 1.00 67.85  ? 138 ASN A ND2 1 
ATOM 942  N N   . ASP A 1 117 ? 4.367  -5.768  -6.217  1.00 64.99  ? 139 ASP A N   1 
ATOM 943  C CA  . ASP A 1 117 ? 3.569  -5.089  -5.222  1.00 64.97  ? 139 ASP A CA  1 
ATOM 944  C C   . ASP A 1 117 ? 4.365  -4.045  -4.457  1.00 67.85  ? 139 ASP A C   1 
ATOM 945  O O   . ASP A 1 117 ? 3.777  -3.079  -3.992  1.00 75.08  ? 139 ASP A O   1 
ATOM 946  C CB  . ASP A 1 117 ? 2.920  -6.080  -4.264  1.00 71.14  ? 139 ASP A CB  1 
ATOM 947  C CG  . ASP A 1 117 ? 1.664  -6.741  -4.863  1.00 82.46  ? 139 ASP A CG  1 
ATOM 948  O OD1 . ASP A 1 117 ? 1.190  -6.299  -5.950  1.00 74.44  ? 139 ASP A OD1 1 
ATOM 949  O OD2 . ASP A 1 117 ? 1.156  -7.710  -4.236  1.00 88.82  ? 139 ASP A OD2 1 
ATOM 950  N N   . GLU A 1 118 ? 5.680  -4.223  -4.299  1.00 67.34  ? 140 GLU A N   1 
ATOM 951  C CA  . GLU A 1 118 ? 6.458  -3.221  -3.586  1.00 62.94  ? 140 GLU A CA  1 
ATOM 952  C C   . GLU A 1 118 ? 6.454  -1.944  -4.394  1.00 62.66  ? 140 GLU A C   1 
ATOM 953  O O   . GLU A 1 118 ? 6.287  -0.857  -3.857  1.00 65.86  ? 140 GLU A O   1 
ATOM 954  C CB  . GLU A 1 118 ? 7.869  -3.680  -3.272  1.00 68.76  ? 140 GLU A CB  1 
ATOM 955  C CG  . GLU A 1 118 ? 7.967  -4.416  -1.940  1.00 81.29  ? 140 GLU A CG  1 
ATOM 956  C CD  . GLU A 1 118 ? 9.313  -5.107  -1.703  1.00 94.62  ? 140 GLU A CD  1 
ATOM 957  O OE1 . GLU A 1 118 ? 10.310 -4.792  -2.418  1.00 92.65  ? 140 GLU A OE1 1 
ATOM 958  O OE2 . GLU A 1 118 ? 9.352  -5.977  -0.788  1.00 90.35  ? 140 GLU A OE2 1 
ATOM 959  N N   . LEU A 1 119 ? 6.573  -2.071  -5.699  1.00 63.69  ? 141 LEU A N   1 
ATOM 960  C CA  . LEU A 1 119 ? 6.630  -0.891  -6.547  1.00 62.93  ? 141 LEU A CA  1 
ATOM 961  C C   . LEU A 1 119 ? 5.296  -0.224  -6.600  1.00 65.00  ? 141 LEU A C   1 
ATOM 962  O O   . LEU A 1 119 ? 5.209  0.998   -6.623  1.00 68.11  ? 141 LEU A O   1 
ATOM 963  C CB  . LEU A 1 119 ? 7.047  -1.265  -7.955  1.00 62.63  ? 141 LEU A CB  1 
ATOM 964  C CG  . LEU A 1 119 ? 8.556  -1.442  -8.132  1.00 65.05  ? 141 LEU A CG  1 
ATOM 965  C CD1 . LEU A 1 119 ? 8.820  -2.222  -9.399  1.00 71.31  ? 141 LEU A CD1 1 
ATOM 966  C CD2 . LEU A 1 119 ? 9.280  -0.104  -8.195  1.00 66.25  ? 141 LEU A CD2 1 
ATOM 967  N N   . TYR A 1 120 ? 4.243  -1.022  -6.623  1.00 63.21  ? 142 TYR A N   1 
ATOM 968  C CA  . TYR A 1 120 ? 2.912  -0.448  -6.695  1.00 64.37  ? 142 TYR A CA  1 
ATOM 969  C C   . TYR A 1 120 ? 2.642  0.367   -5.458  1.00 62.48  ? 142 TYR A C   1 
ATOM 970  O O   . TYR A 1 120 ? 2.164  1.477   -5.558  1.00 60.60  ? 142 TYR A O   1 
ATOM 971  C CB  . TYR A 1 120 ? 1.872  -1.530  -6.824  1.00 65.94  ? 142 TYR A CB  1 
ATOM 972  C CG  . TYR A 1 120 ? 0.447  -1.060  -6.657  1.00 70.90  ? 142 TYR A CG  1 
ATOM 973  C CD1 . TYR A 1 120 ? -0.189 -0.303  -7.641  1.00 72.98  ? 142 TYR A CD1 1 
ATOM 974  C CD2 . TYR A 1 120 ? -0.283 -1.432  -5.551  1.00 72.58  ? 142 TYR A CD2 1 
ATOM 975  C CE1 . TYR A 1 120 ? -1.511 0.084   -7.503  1.00 77.04  ? 142 TYR A CE1 1 
ATOM 976  C CE2 . TYR A 1 120 ? -1.602 -1.065  -5.407  1.00 78.70  ? 142 TYR A CE2 1 
ATOM 977  C CZ  . TYR A 1 120 ? -2.219 -0.299  -6.373  1.00 81.65  ? 142 TYR A CZ  1 
ATOM 978  O OH  . TYR A 1 120 ? -3.542 0.075   -6.184  1.00 84.15  ? 142 TYR A OH  1 
ATOM 979  N N   . ASP A 1 121 ? 2.991  -0.169  -4.294  1.00 61.06  ? 143 ASP A N   1 
ATOM 980  C CA  . ASP A 1 121 ? 2.757  0.555   -3.055  1.00 64.81  ? 143 ASP A CA  1 
ATOM 981  C C   . ASP A 1 121 ? 3.494  1.869   -3.068  1.00 64.19  ? 143 ASP A C   1 
ATOM 982  O O   . ASP A 1 121 ? 2.989  2.851   -2.597  1.00 70.16  ? 143 ASP A O   1 
ATOM 983  C CB  . ASP A 1 121 ? 3.149  -0.282  -1.839  1.00 68.56  ? 143 ASP A CB  1 
ATOM 984  C CG  . ASP A 1 121 ? 2.252  -1.502  -1.647  1.00 73.43  ? 143 ASP A CG  1 
ATOM 985  O OD1 . ASP A 1 121 ? 1.127  -1.545  -2.184  1.00 89.52  ? 143 ASP A OD1 1 
ATOM 986  O OD2 . ASP A 1 121 ? 2.658  -2.429  -0.940  1.00 82.29  ? 143 ASP A OD2 1 
ATOM 987  N N   . LYS A 1 122 ? 4.673  1.888   -3.663  1.00 67.57  ? 144 LYS A N   1 
ATOM 988  C CA  . LYS A 1 122 ? 5.493  3.082   -3.702  1.00 67.87  ? 144 LYS A CA  1 
ATOM 989  C C   . LYS A 1 122 ? 4.863  4.096   -4.640  1.00 67.04  ? 144 LYS A C   1 
ATOM 990  O O   . LYS A 1 122 ? 4.860  5.303   -4.351  1.00 69.01  ? 144 LYS A O   1 
ATOM 991  C CB  . LYS A 1 122 ? 6.916  2.728   -4.144  1.00 70.59  ? 144 LYS A CB  1 
ATOM 992  C CG  . LYS A 1 122 ? 7.790  3.898   -4.583  1.00 79.34  ? 144 LYS A CG  1 
ATOM 993  C CD  . LYS A 1 122 ? 9.056  4.082   -3.757  1.00 86.34  ? 144 LYS A CD  1 
ATOM 994  C CE  . LYS A 1 122 ? 9.678  5.446   -4.045  1.00 94.10  ? 144 LYS A CE  1 
ATOM 995  N NZ  . LYS A 1 122 ? 9.860  5.666   -5.516  1.00 97.34  ? 144 LYS A NZ  1 
ATOM 996  N N   . CYS A 1 123 ? 4.324  3.622   -5.755  1.00 65.62  ? 145 CYS A N   1 
ATOM 997  C CA  . CYS A 1 123 ? 3.692  4.533   -6.719  1.00 68.34  ? 145 CYS A CA  1 
ATOM 998  C C   . CYS A 1 123 ? 2.383  5.126   -6.164  1.00 66.83  ? 145 CYS A C   1 
ATOM 999  O O   . CYS A 1 123 ? 2.113  6.281   -6.385  1.00 74.58  ? 145 CYS A O   1 
ATOM 1000 C CB  . CYS A 1 123 ? 3.446  3.843   -8.060  1.00 67.86  ? 145 CYS A CB  1 
ATOM 1001 S SG  . CYS A 1 123 ? 4.954  3.353   -8.941  1.00 77.23  ? 145 CYS A SG  1 
ATOM 1002 N N   . LYS A 1 124 ? 1.577  4.355   -5.444  1.00 64.55  ? 146 LYS A N   1 
ATOM 1003 C CA  . LYS A 1 124 ? 0.383  4.909   -4.813  1.00 65.34  ? 146 LYS A CA  1 
ATOM 1004 C C   . LYS A 1 124 ? 0.758  6.076   -3.926  1.00 68.80  ? 146 LYS A C   1 
ATOM 1005 O O   . LYS A 1 124 ? 0.138  7.134   -3.969  1.00 72.98  ? 146 LYS A O   1 
ATOM 1006 C CB  . LYS A 1 124 ? -0.309 3.874   -3.937  1.00 72.46  ? 146 LYS A CB  1 
ATOM 1007 C CG  . LYS A 1 124 ? -1.514 3.186   -4.554  1.00 79.73  ? 146 LYS A CG  1 
ATOM 1008 C CD  . LYS A 1 124 ? -2.347 2.474   -3.488  1.00 88.99  ? 146 LYS A CD  1 
ATOM 1009 C CE  . LYS A 1 124 ? -1.773 1.125   -3.081  1.00 94.42  ? 146 LYS A CE  1 
ATOM 1010 N NZ  . LYS A 1 124 ? -1.717 0.951   -1.605  1.00 103.48 ? 146 LYS A NZ  1 
ATOM 1011 N N   . VAL A 1 125 ? 1.772  5.867   -3.096  1.00 68.16  ? 147 VAL A N   1 
ATOM 1012 C CA  . VAL A 1 125 ? 2.174  6.861   -2.105  1.00 64.28  ? 147 VAL A CA  1 
ATOM 1013 C C   . VAL A 1 125 ? 2.736  8.123   -2.739  1.00 68.39  ? 147 VAL A C   1 
ATOM 1014 O O   . VAL A 1 125 ? 2.399  9.220   -2.328  1.00 71.11  ? 147 VAL A O   1 
ATOM 1015 C CB  . VAL A 1 125 ? 3.231  6.272   -1.186  1.00 59.80  ? 147 VAL A CB  1 
ATOM 1016 C CG1 . VAL A 1 125 ? 3.811  7.342   -0.289  1.00 61.11  ? 147 VAL A CG1 1 
ATOM 1017 C CG2 . VAL A 1 125 ? 2.609  5.177   -0.339  1.00 59.63  ? 147 VAL A CG2 1 
ATOM 1018 N N   . ASP A 1 126 ? 3.611  7.950   -3.725  1.00 72.66  ? 148 ASP A N   1 
ATOM 1019 C CA  . ASP A 1 126 ? 4.190  9.075   -4.456  1.00 76.25  ? 148 ASP A CA  1 
ATOM 1020 C C   . ASP A 1 126 ? 3.139  9.885   -5.195  1.00 74.28  ? 148 ASP A C   1 
ATOM 1021 O O   . ASP A 1 126 ? 3.246  11.092  -5.258  1.00 77.20  ? 148 ASP A O   1 
ATOM 1022 C CB  . ASP A 1 126 ? 5.180  8.576   -5.505  1.00 80.77  ? 148 ASP A CB  1 
ATOM 1023 C CG  . ASP A 1 126 ? 6.430  7.973   -4.910  1.00 83.75  ? 148 ASP A CG  1 
ATOM 1024 O OD1 . ASP A 1 126 ? 6.785  8.312   -3.757  1.00 85.05  ? 148 ASP A OD1 1 
ATOM 1025 O OD2 . ASP A 1 126 ? 7.066  7.166   -5.640  1.00 99.05  ? 148 ASP A OD2 1 
ATOM 1026 N N   . TYR A 1 127 ? 2.166  9.197   -5.794  1.00 73.67  ? 149 TYR A N   1 
ATOM 1027 C CA  . TYR A 1 127 ? 1.051  9.823   -6.520  1.00 72.60  ? 149 TYR A CA  1 
ATOM 1028 C C   . TYR A 1 127 ? 0.324  10.750  -5.561  1.00 74.98  ? 149 TYR A C   1 
ATOM 1029 O O   . TYR A 1 127 ? 0.137  11.929  -5.831  1.00 73.16  ? 149 TYR A O   1 
ATOM 1030 C CB  . TYR A 1 127 ? 0.063  8.760   -7.083  1.00 71.04  ? 149 TYR A CB  1 
ATOM 1031 C CG  . TYR A 1 127 ? -1.280 9.332   -7.486  1.00 74.67  ? 149 TYR A CG  1 
ATOM 1032 C CD1 . TYR A 1 127 ? -1.396 10.154  -8.593  1.00 78.48  ? 149 TYR A CD1 1 
ATOM 1033 C CD2 . TYR A 1 127 ? -2.423 9.085   -6.735  1.00 79.51  ? 149 TYR A CD2 1 
ATOM 1034 C CE1 . TYR A 1 127 ? -2.609 10.713  -8.954  1.00 81.90  ? 149 TYR A CE1 1 
ATOM 1035 C CE2 . TYR A 1 127 ? -3.645 9.643   -7.080  1.00 81.62  ? 149 TYR A CE2 1 
ATOM 1036 C CZ  . TYR A 1 127 ? -3.732 10.463  -8.192  1.00 84.24  ? 149 TYR A CZ  1 
ATOM 1037 O OH  . TYR A 1 127 ? -4.940 11.018  -8.568  1.00 88.24  ? 149 TYR A OH  1 
ATOM 1038 N N   . ARG A 1 128 ? -0.078 10.182  -4.432  1.00 73.65  ? 150 ARG A N   1 
ATOM 1039 C CA  . ARG A 1 128 ? -0.754 10.913  -3.396  1.00 70.65  ? 150 ARG A CA  1 
ATOM 1040 C C   . ARG A 1 128 ? 0.039  12.162  -3.023  1.00 72.99  ? 150 ARG A C   1 
ATOM 1041 O O   . ARG A 1 128 ? -0.534 13.240  -2.967  1.00 81.29  ? 150 ARG A O   1 
ATOM 1042 C CB  . ARG A 1 128 ? -0.949 10.019  -2.173  1.00 71.09  ? 150 ARG A CB  1 
ATOM 1043 C CG  . ARG A 1 128 ? -2.367 9.589   -1.911  1.00 72.27  ? 150 ARG A CG  1 
ATOM 1044 C CD  . ARG A 1 128 ? -2.710 8.171   -2.299  1.00 70.28  ? 150 ARG A CD  1 
ATOM 1045 N NE  . ARG A 1 128 ? -2.409 7.241   -1.227  1.00 69.94  ? 150 ARG A NE  1 
ATOM 1046 C CZ  . ARG A 1 128 ? -2.984 6.052   -1.018  1.00 72.27  ? 150 ARG A CZ  1 
ATOM 1047 N NH1 . ARG A 1 128 ? -3.966 5.601   -1.756  1.00 73.85  ? 150 ARG A NH1 1 
ATOM 1048 N NH2 . ARG A 1 128 ? -2.570 5.295   -0.021  1.00 79.85  ? 150 ARG A NH2 1 
ATOM 1049 N N   . GLU A 1 129 ? 1.346  12.025  -2.797  1.00 73.74  ? 151 GLU A N   1 
ATOM 1050 C CA  . GLU A 1 129 ? 2.180  13.165  -2.353  1.00 78.01  ? 151 GLU A CA  1 
ATOM 1051 C C   . GLU A 1 129 ? 2.315  14.239  -3.408  1.00 77.06  ? 151 GLU A C   1 
ATOM 1052 O O   . GLU A 1 129 ? 2.240  15.414  -3.100  1.00 82.22  ? 151 GLU A O   1 
ATOM 1053 C CB  . GLU A 1 129 ? 3.572  12.724  -1.879  1.00 81.10  ? 151 GLU A CB  1 
ATOM 1054 C CG  . GLU A 1 129 ? 3.640  12.498  -0.373  1.00 89.68  ? 151 GLU A CG  1 
ATOM 1055 C CD  . GLU A 1 129 ? 4.797  11.617  0.071   1.00 105.67 ? 151 GLU A CD  1 
ATOM 1056 O OE1 . GLU A 1 129 ? 5.519  11.030  -0.770  1.00 120.82 ? 151 GLU A OE1 1 
ATOM 1057 O OE2 . GLU A 1 129 ? 4.977  11.487  1.293   1.00 122.06 ? 151 GLU A OE2 1 
ATOM 1058 N N   . MET A 1 130 ? 2.498  13.835  -4.653  1.00 79.58  ? 152 MET A N   1 
ATOM 1059 C CA  . MET A 1 130 ? 2.617  14.780  -5.759  1.00 84.13  ? 152 MET A CA  1 
ATOM 1060 C C   . MET A 1 130 ? 1.307  15.558  -5.997  1.00 81.65  ? 152 MET A C   1 
ATOM 1061 O O   . MET A 1 130 ? 1.323  16.759  -6.151  1.00 82.34  ? 152 MET A O   1 
ATOM 1062 C CB  . MET A 1 130 ? 3.065  14.033  -7.027  1.00 86.10  ? 152 MET A CB  1 
ATOM 1063 C CG  . MET A 1 130 ? 4.533  13.630  -6.984  1.00 90.80  ? 152 MET A CG  1 
ATOM 1064 S SD  . MET A 1 130 ? 5.002  12.344  -8.170  1.00 101.22 ? 152 MET A SD  1 
ATOM 1065 C CE  . MET A 1 130 ? 4.433  13.137  -9.657  1.00 102.75 ? 152 MET A CE  1 
ATOM 1066 N N   . LYS A 1 131 ? 0.188  14.847  -6.020  1.00 82.47  ? 153 LYS A N   1 
ATOM 1067 C CA  . LYS A 1 131 ? -1.156 15.412  -6.181  1.00 84.66  ? 153 LYS A CA  1 
ATOM 1068 C C   . LYS A 1 131 ? -1.431 16.466  -5.116  1.00 89.17  ? 153 LYS A C   1 
ATOM 1069 O O   . LYS A 1 131 ? -2.014 17.508  -5.403  1.00 96.23  ? 153 LYS A O   1 
ATOM 1070 C CB  . LYS A 1 131 ? -2.161 14.262  -6.087  1.00 91.85  ? 153 LYS A CB  1 
ATOM 1071 C CG  . LYS A 1 131 ? -3.648 14.564  -6.066  1.00 104.60 ? 153 LYS A CG  1 
ATOM 1072 C CD  . LYS A 1 131 ? -4.426 13.284  -5.693  1.00 114.24 ? 153 LYS A CD  1 
ATOM 1073 C CE  . LYS A 1 131 ? -5.873 13.558  -5.293  1.00 121.45 ? 153 LYS A CE  1 
ATOM 1074 N NZ  . LYS A 1 131 ? -6.565 14.464  -6.258  1.00 124.89 ? 153 LYS A NZ  1 
ATOM 1075 N N   . ARG A 1 132 ? -0.988 16.192  -3.893  1.00 89.08  ? 154 ARG A N   1 
ATOM 1076 C CA  . ARG A 1 132 ? -1.116 17.130  -2.780  1.00 88.29  ? 154 ARG A CA  1 
ATOM 1077 C C   . ARG A 1 132 ? -0.167 18.336  -2.876  1.00 86.11  ? 154 ARG A C   1 
ATOM 1078 O O   . ARG A 1 132 ? -0.549 19.436  -2.511  1.00 81.87  ? 154 ARG A O   1 
ATOM 1079 C CB  . ARG A 1 132 ? -0.861 16.414  -1.448  1.00 86.34  ? 154 ARG A CB  1 
ATOM 1080 C CG  . ARG A 1 132 ? -1.280 17.223  -0.234  1.00 89.82  ? 154 ARG A CG  1 
ATOM 1081 C CD  . ARG A 1 132 ? -0.280 17.153  0.906   1.00 98.29  ? 154 ARG A CD  1 
ATOM 1082 N NE  . ARG A 1 132 ? 0.822  18.142  0.833   1.00 106.67 ? 154 ARG A NE  1 
ATOM 1083 C CZ  . ARG A 1 132 ? 0.864  19.346  1.438   1.00 108.29 ? 154 ARG A CZ  1 
ATOM 1084 N NH1 . ARG A 1 132 ? -0.162 19.818  2.165   1.00 112.77 ? 154 ARG A NH1 1 
ATOM 1085 N NH2 . ARG A 1 132 ? 1.952  20.105  1.305   1.00 102.43 ? 154 ARG A NH2 1 
ATOM 1086 N N   . ASP A 1 133 ? 1.071  18.109  -3.319  1.00 87.76  ? 155 ASP A N   1 
ATOM 1087 C CA  . ASP A 1 133 ? 2.086  19.169  -3.445  1.00 90.66  ? 155 ASP A CA  1 
ATOM 1088 C C   . ASP A 1 133 ? 1.604  20.239  -4.418  1.00 92.87  ? 155 ASP A C   1 
ATOM 1089 O O   . ASP A 1 133 ? 1.696  21.435  -4.141  1.00 92.99  ? 155 ASP A O   1 
ATOM 1090 C CB  . ASP A 1 133 ? 3.408  18.571  -3.932  1.00 97.38  ? 155 ASP A CB  1 
ATOM 1091 C CG  . ASP A 1 133 ? 4.626  19.383  -3.521  1.00 106.86 ? 155 ASP A CG  1 
ATOM 1092 O OD1 . ASP A 1 133 ? 4.478  20.545  -3.084  1.00 115.51 ? 155 ASP A OD1 1 
ATOM 1093 O OD2 . ASP A 1 133 ? 5.749  18.845  -3.644  1.00 110.58 ? 155 ASP A OD2 1 
ATOM 1094 N N   . VAL A 1 134 ? 1.052  19.797  -5.541  1.00 92.45  ? 156 VAL A N   1 
ATOM 1095 C CA  . VAL A 1 134 ? 0.388  20.697  -6.475  1.00 100.41 ? 156 VAL A CA  1 
ATOM 1096 C C   . VAL A 1 134 ? -0.846 21.389  -5.896  1.00 98.75  ? 156 VAL A C   1 
ATOM 1097 O O   . VAL A 1 134 ? -0.973 22.586  -6.027  1.00 104.27 ? 156 VAL A O   1 
ATOM 1098 C CB  . VAL A 1 134 ? -0.005 19.964  -7.776  1.00 101.40 ? 156 VAL A CB  1 
ATOM 1099 C CG1 . VAL A 1 134 ? -1.043 20.750  -8.571  1.00 108.92 ? 156 VAL A CG1 1 
ATOM 1100 C CG2 . VAL A 1 134 ? 1.232  19.753  -8.618  1.00 99.74  ? 156 VAL A CG2 1 
ATOM 1101 N N   . LEU A 1 135 ? -1.767 20.646  -5.293  1.00 102.21 ? 157 LEU A N   1 
ATOM 1102 C CA  . LEU A 1 135 ? -3.030 21.245  -4.850  1.00 105.45 ? 157 LEU A CA  1 
ATOM 1103 C C   . LEU A 1 135 ? -2.785 22.229  -3.721  1.00 105.35 ? 157 LEU A C   1 
ATOM 1104 O O   . LEU A 1 135 ? -3.559 23.145  -3.541  1.00 110.91 ? 157 LEU A O   1 
ATOM 1105 C CB  . LEU A 1 135 ? -4.084 20.190  -4.445  1.00 109.92 ? 157 LEU A CB  1 
ATOM 1106 C CG  . LEU A 1 135 ? -4.662 19.361  -5.626  1.00 131.58 ? 157 LEU A CG  1 
ATOM 1107 C CD1 . LEU A 1 135 ? -5.295 18.030  -5.200  1.00 127.99 ? 157 LEU A CD1 1 
ATOM 1108 C CD2 . LEU A 1 135 ? -5.650 20.179  -6.463  1.00 136.36 ? 157 LEU A CD2 1 
ATOM 1109 N N   . ALA A 1 136 ? -1.702 22.067  -2.970  1.00 102.34 ? 158 ALA A N   1 
ATOM 1110 C CA  . ALA A 1 136 ? -1.452 22.946  -1.831  1.00 100.03 ? 158 ALA A CA  1 
ATOM 1111 C C   . ALA A 1 136 ? -0.359 23.983  -2.087  1.00 102.87 ? 158 ALA A C   1 
ATOM 1112 O O   . ALA A 1 136 ? -0.285 24.967  -1.363  1.00 100.67 ? 158 ALA A O   1 
ATOM 1113 C CB  . ALA A 1 136 ? -1.117 22.127  -0.601  1.00 95.64  ? 158 ALA A CB  1 
ATOM 1114 N N   . ASN A 1 137 ? 0.494  23.761  -3.085  1.00 103.49 ? 159 ASN A N   1 
ATOM 1115 C CA  . ASN A 1 137 ? 1.510  24.746  -3.464  1.00 103.65 ? 159 ASN A CA  1 
ATOM 1116 C C   . ASN A 1 137 ? 1.464  25.061  -4.956  1.00 107.71 ? 159 ASN A C   1 
ATOM 1117 O O   . ASN A 1 137 ? 2.495  25.066  -5.648  1.00 103.06 ? 159 ASN A O   1 
ATOM 1118 C CB  . ASN A 1 137 ? 2.888  24.255  -3.057  1.00 101.45 ? 159 ASN A CB  1 
ATOM 1119 C CG  . ASN A 1 137 ? 2.959  23.905  -1.591  1.00 98.07  ? 159 ASN A CG  1 
ATOM 1120 O OD1 . ASN A 1 137 ? 3.004  24.778  -0.727  1.00 103.78 ? 159 ASN A OD1 1 
ATOM 1121 N ND2 . ASN A 1 137 ? 2.983  22.628  -1.304  1.00 94.22  ? 159 ASN A ND2 1 
ATOM 1122 N N   . ARG A 1 138 ? 0.242  25.310  -5.425  1.00 111.77 ? 160 ARG A N   1 
ATOM 1123 C CA  . ARG A 1 138 ? -0.040 25.735  -6.792  1.00 118.47 ? 160 ARG A CA  1 
ATOM 1124 C C   . ARG A 1 138 ? 0.887  26.902  -7.123  1.00 127.39 ? 160 ARG A C   1 
ATOM 1125 O O   . ARG A 1 138 ? 1.841  26.727  -7.889  1.00 125.91 ? 160 ARG A O   1 
ATOM 1126 C CB  . ARG A 1 138 ? -1.545 26.065  -6.911  1.00 123.82 ? 160 ARG A CB  1 
ATOM 1127 C CG  . ARG A 1 138 ? -1.985 27.194  -7.843  1.00 141.39 ? 160 ARG A CG  1 
ATOM 1128 C CD  . ARG A 1 138 ? -1.973 26.832  -9.319  1.00 145.55 ? 160 ARG A CD  1 
ATOM 1129 N NE  . ARG A 1 138 ? -2.635 25.562  -9.610  1.00 142.97 ? 160 ARG A NE  1 
ATOM 1130 C CZ  . ARG A 1 138 ? -2.874 25.114  -10.841 1.00 154.17 ? 160 ARG A CZ  1 
ATOM 1131 N NH1 . ARG A 1 138 ? -2.538 25.841  -11.905 1.00 150.10 ? 160 ARG A NH1 1 
ATOM 1132 N NH2 . ARG A 1 138 ? -3.464 23.932  -11.015 1.00 158.18 ? 160 ARG A NH2 1 
ATOM 1133 N N   . HIS A 1 139 ? 0.645  28.052  -6.487  1.00 135.29 ? 161 HIS A N   1 
ATOM 1134 C CA  . HIS A 1 139 ? 1.463  29.265  -6.655  1.00 146.30 ? 161 HIS A CA  1 
ATOM 1135 C C   . HIS A 1 139 ? 2.973  28.986  -6.807  1.00 147.36 ? 161 HIS A C   1 
ATOM 1136 O O   . HIS A 1 139 ? 3.620  29.533  -7.696  1.00 152.69 ? 161 HIS A O   1 
ATOM 1137 C CB  . HIS A 1 139 ? 1.236  30.222  -5.470  1.00 151.56 ? 161 HIS A CB  1 
ATOM 1138 C CG  . HIS A 1 139 ? 1.580  29.621  -4.139  1.00 159.82 ? 161 HIS A CG  1 
ATOM 1139 N ND1 . HIS A 1 139 ? 2.864  29.615  -3.632  1.00 163.64 ? 161 HIS A ND1 1 
ATOM 1140 C CD2 . HIS A 1 139 ? 0.814  28.974  -3.227  1.00 159.30 ? 161 HIS A CD2 1 
ATOM 1141 C CE1 . HIS A 1 139 ? 2.872  28.999  -2.464  1.00 161.87 ? 161 HIS A CE1 1 
ATOM 1142 N NE2 . HIS A 1 139 ? 1.640  28.603  -2.194  1.00 159.73 ? 161 HIS A NE2 1 
ATOM 1143 N N   . GLN A 1 140 ? 3.514  28.109  -5.964  1.00 140.36 ? 162 GLN A N   1 
ATOM 1144 C CA  . GLN A 1 140 ? 4.957  27.893  -5.868  1.00 137.03 ? 162 GLN A CA  1 
ATOM 1145 C C   . GLN A 1 140 ? 5.554  27.261  -7.134  1.00 132.72 ? 162 GLN A C   1 
ATOM 1146 O O   . GLN A 1 140 ? 6.771  27.197  -7.267  1.00 137.04 ? 162 GLN A O   1 
ATOM 1147 C CB  . GLN A 1 140 ? 5.262  27.049  -4.609  1.00 141.39 ? 162 GLN A CB  1 
ATOM 1148 C CG  . GLN A 1 140 ? 6.732  26.749  -4.313  1.00 142.90 ? 162 GLN A CG  1 
ATOM 1149 C CD  . GLN A 1 140 ? 7.159  25.339  -4.726  1.00 149.81 ? 162 GLN A CD  1 
ATOM 1150 O OE1 . GLN A 1 140 ? 6.634  24.347  -4.214  1.00 146.45 ? 162 GLN A OE1 1 
ATOM 1151 N NE2 . GLN A 1 140 ? 8.122  25.245  -5.647  1.00 153.84 ? 162 GLN A NE2 1 
ATOM 1152 N N   . PHE A 1 141 ? 4.716  26.796  -8.061  1.00 128.04 ? 163 PHE A N   1 
ATOM 1153 C CA  . PHE A 1 141 ? 5.206  26.243  -9.342  1.00 129.90 ? 163 PHE A CA  1 
ATOM 1154 C C   . PHE A 1 141 ? 5.046  27.193  -10.530 1.00 136.06 ? 163 PHE A C   1 
ATOM 1155 O O   . PHE A 1 141 ? 5.534  26.914  -11.632 1.00 134.49 ? 163 PHE A O   1 
ATOM 1156 C CB  . PHE A 1 141 ? 4.516  24.906  -9.646  1.00 124.94 ? 163 PHE A CB  1 
ATOM 1157 C CG  . PHE A 1 141 ? 4.953  23.801  -8.733  1.00 118.01 ? 163 PHE A CG  1 
ATOM 1158 C CD1 . PHE A 1 141 ? 6.252  23.314  -8.802  1.00 116.34 ? 163 PHE A CD1 1 
ATOM 1159 C CD2 . PHE A 1 141 ? 4.090  23.284  -7.779  1.00 109.23 ? 163 PHE A CD2 1 
ATOM 1160 C CE1 . PHE A 1 141 ? 6.679  22.315  -7.950  1.00 116.48 ? 163 PHE A CE1 1 
ATOM 1161 C CE2 . PHE A 1 141 ? 4.512  22.291  -6.919  1.00 109.00 ? 163 PHE A CE2 1 
ATOM 1162 C CZ  . PHE A 1 141 ? 5.806  21.800  -7.006  1.00 113.72 ? 163 PHE A CZ  1 
ATOM 1163 N N   . GLY A 1 142 ? 4.361  28.309  -10.305 1.00 136.78 ? 164 GLY A N   1 
ATOM 1164 C CA  . GLY A 1 142 ? 4.151  29.291  -11.348 1.00 142.01 ? 164 GLY A CA  1 
ATOM 1165 C C   . GLY A 1 142 ? 3.265  28.762  -12.454 1.00 140.02 ? 164 GLY A C   1 
ATOM 1166 O O   . GLY A 1 142 ? 2.223  28.162  -12.195 1.00 130.17 ? 164 GLY A O   1 
ATOM 1167 N N   . GLU A 1 143 ? 3.707  28.972  -13.688 1.00 145.69 ? 165 GLU A N   1 
ATOM 1168 C CA  . GLU A 1 143 ? 2.894  28.703  -14.871 1.00 144.41 ? 165 GLU A CA  1 
ATOM 1169 C C   . GLU A 1 143 ? 2.890  27.230  -15.271 1.00 138.73 ? 165 GLU A C   1 
ATOM 1170 O O   . GLU A 1 143 ? 1.929  26.757  -15.873 1.00 134.61 ? 165 GLU A O   1 
ATOM 1171 C CB  . GLU A 1 143 ? 3.375  29.570  -16.035 1.00 146.24 ? 165 GLU A CB  1 
ATOM 1172 C CG  . GLU A 1 143 ? 3.289  31.065  -15.745 1.00 146.05 ? 165 GLU A CG  1 
ATOM 1173 C CD  . GLU A 1 143 ? 3.755  31.913  -16.914 1.00 150.64 ? 165 GLU A CD  1 
ATOM 1174 O OE1 . GLU A 1 143 ? 4.339  31.348  -17.865 1.00 150.48 ? 165 GLU A OE1 1 
ATOM 1175 O OE2 . GLU A 1 143 ? 3.538  33.145  -16.884 1.00 143.86 ? 165 GLU A OE2 1 
ATOM 1176 N N   . ALA A 1 144 ? 3.940  26.496  -14.912 1.00 138.32 ? 166 ALA A N   1 
ATOM 1177 C CA  . ALA A 1 144 ? 3.997  25.049  -15.177 1.00 136.55 ? 166 ALA A CA  1 
ATOM 1178 C C   . ALA A 1 144 ? 3.046  24.223  -14.296 1.00 128.23 ? 166 ALA A C   1 
ATOM 1179 O O   . ALA A 1 144 ? 3.210  23.021  -14.191 1.00 125.64 ? 166 ALA A O   1 
ATOM 1180 C CB  . ALA A 1 144 ? 5.428  24.539  -15.011 1.00 133.57 ? 166 ALA A CB  1 
ATOM 1181 N N   . ALA A 1 145 ? 2.047  24.851  -13.685 1.00 126.91 ? 167 ALA A N   1 
ATOM 1182 C CA  . ALA A 1 145 ? 1.209  24.170  -12.710 1.00 123.90 ? 167 ALA A CA  1 
ATOM 1183 C C   . ALA A 1 145 ? 0.038  23.392  -13.331 1.00 126.60 ? 167 ALA A C   1 
ATOM 1184 O O   . ALA A 1 145 ? -0.286 22.301  -12.865 1.00 134.82 ? 167 ALA A O   1 
ATOM 1185 C CB  . ALA A 1 145 ? 0.709  25.161  -11.670 1.00 120.14 ? 167 ALA A CB  1 
ATOM 1186 N N   . SER A 1 146 ? -0.601 23.926  -14.365 1.00 130.18 ? 168 SER A N   1 
ATOM 1187 C CA  . SER A 1 146 ? -1.735 23.218  -14.980 1.00 130.92 ? 168 SER A CA  1 
ATOM 1188 C C   . SER A 1 146 ? -1.288 22.021  -15.792 1.00 132.28 ? 168 SER A C   1 
ATOM 1189 O O   . SER A 1 146 ? -2.038 21.055  -15.943 1.00 134.74 ? 168 SER A O   1 
ATOM 1190 C CB  . SER A 1 146 ? -2.568 24.137  -15.867 1.00 134.86 ? 168 SER A CB  1 
ATOM 1191 O OG  . SER A 1 146 ? -3.676 24.631  -15.140 1.00 137.73 ? 168 SER A OG  1 
ATOM 1192 N N   . LEU A 1 147 ? -0.070 22.090  -16.318 1.00 132.90 ? 169 LEU A N   1 
ATOM 1193 C CA  . LEU A 1 147 ? 0.501  20.966  -17.050 1.00 133.99 ? 169 LEU A CA  1 
ATOM 1194 C C   . LEU A 1 147 ? 0.773  19.839  -16.041 1.00 130.06 ? 169 LEU A C   1 
ATOM 1195 O O   . LEU A 1 147 ? 0.543  18.660  -16.321 1.00 127.41 ? 169 LEU A O   1 
ATOM 1196 C CB  . LEU A 1 147 ? 1.768  21.395  -17.812 1.00 137.55 ? 169 LEU A CB  1 
ATOM 1197 C CG  . LEU A 1 147 ? 1.611  22.631  -18.736 1.00 149.38 ? 169 LEU A CG  1 
ATOM 1198 C CD1 . LEU A 1 147 ? 2.963  23.200  -19.157 1.00 152.50 ? 169 LEU A CD1 1 
ATOM 1199 C CD2 . LEU A 1 147 ? 0.749  22.354  -19.967 1.00 145.77 ? 169 LEU A CD2 1 
ATOM 1200 N N   . LEU A 1 148 ? 1.217  20.224  -14.848 1.00 125.53 ? 170 LEU A N   1 
ATOM 1201 C CA  . LEU A 1 148 ? 1.493  19.271  -13.781 1.00 118.72 ? 170 LEU A CA  1 
ATOM 1202 C C   . LEU A 1 148 ? 0.244  18.614  -13.248 1.00 111.96 ? 170 LEU A C   1 
ATOM 1203 O O   . LEU A 1 148 ? 0.241  17.406  -13.050 1.00 104.93 ? 170 LEU A O   1 
ATOM 1204 C CB  . LEU A 1 148 ? 2.251  19.933  -12.628 1.00 119.44 ? 170 LEU A CB  1 
ATOM 1205 C CG  . LEU A 1 148 ? 3.746  19.610  -12.548 1.00 123.62 ? 170 LEU A CG  1 
ATOM 1206 C CD1 . LEU A 1 148 ? 4.451  19.805  -13.883 1.00 131.70 ? 170 LEU A CD1 1 
ATOM 1207 C CD2 . LEU A 1 148 ? 4.405  20.468  -11.478 1.00 123.98 ? 170 LEU A CD2 1 
ATOM 1208 N N   . GLU A 1 149 ? -0.805 19.395  -13.007 1.00 110.62 ? 171 GLU A N   1 
ATOM 1209 C CA  . GLU A 1 149 ? -2.036 18.843  -12.424 1.00 118.61 ? 171 GLU A CA  1 
ATOM 1210 C C   . GLU A 1 149 ? -2.666 17.776  -13.328 1.00 122.91 ? 171 GLU A C   1 
ATOM 1211 O O   . GLU A 1 149 ? -3.199 16.762  -12.847 1.00 126.43 ? 171 GLU A O   1 
ATOM 1212 C CB  . GLU A 1 149 ? -3.052 19.947  -12.108 1.00 122.95 ? 171 GLU A CB  1 
ATOM 1213 C CG  . GLU A 1 149 ? -4.261 19.469  -11.302 1.00 125.19 ? 171 GLU A CG  1 
ATOM 1214 C CD  . GLU A 1 149 ? -5.044 20.613  -10.668 1.00 133.18 ? 171 GLU A CD  1 
ATOM 1215 O OE1 . GLU A 1 149 ? -4.982 21.748  -11.199 1.00 130.83 ? 171 GLU A OE1 1 
ATOM 1216 O OE2 . GLU A 1 149 ? -5.722 20.376  -9.638  1.00 130.91 ? 171 GLU A OE2 1 
ATOM 1217 N N   . THR A 1 150 ? -2.599 17.995  -14.636 1.00 122.11 ? 172 THR A N   1 
ATOM 1218 C CA  . THR A 1 150 ? -3.123 17.019  -15.574 1.00 119.74 ? 172 THR A CA  1 
ATOM 1219 C C   . THR A 1 150 ? -2.144 15.845  -15.739 1.00 112.83 ? 172 THR A C   1 
ATOM 1220 O O   . THR A 1 150 ? -2.592 14.706  -15.824 1.00 115.42 ? 172 THR A O   1 
ATOM 1221 C CB  . THR A 1 150 ? -3.499 17.655  -16.933 1.00 120.95 ? 172 THR A CB  1 
ATOM 1222 O OG1 . THR A 1 150 ? -2.359 18.313  -17.491 1.00 121.01 ? 172 THR A OG1 1 
ATOM 1223 C CG2 . THR A 1 150 ? -4.634 18.673  -16.753 1.00 122.73 ? 172 THR A CG2 1 
ATOM 1224 N N   . GLU A 1 151 ? -0.830 16.108  -15.748 1.00 104.91 ? 173 GLU A N   1 
ATOM 1225 C CA  . GLU A 1 151 ? 0.186  15.032  -15.900 1.00 101.01 ? 173 GLU A CA  1 
ATOM 1226 C C   . GLU A 1 151 ? 0.253  14.047  -14.723 1.00 95.07  ? 173 GLU A C   1 
ATOM 1227 O O   . GLU A 1 151 ? 0.521  12.849  -14.892 1.00 92.24  ? 173 GLU A O   1 
ATOM 1228 C CB  . GLU A 1 151 ? 1.578  15.614  -16.166 1.00 101.72 ? 173 GLU A CB  1 
ATOM 1229 C CG  . GLU A 1 151 ? 1.775  16.004  -17.626 1.00 116.02 ? 173 GLU A CG  1 
ATOM 1230 C CD  . GLU A 1 151 ? 2.031  14.806  -18.537 1.00 123.33 ? 173 GLU A CD  1 
ATOM 1231 O OE1 . GLU A 1 151 ? 3.166  14.297  -18.518 1.00 126.04 ? 173 GLU A OE1 1 
ATOM 1232 O OE2 . GLU A 1 151 ? 1.116  14.364  -19.278 1.00 127.99 ? 173 GLU A OE2 1 
ATOM 1233 N N   . ILE A 1 152 ? 0.003  14.568  -13.536 1.00 92.74  ? 174 ILE A N   1 
ATOM 1234 C CA  . ILE A 1 152 ? -0.088 13.762  -12.347 1.00 89.23  ? 174 ILE A CA  1 
ATOM 1235 C C   . ILE A 1 152 ? -1.421 12.997  -12.337 1.00 91.08  ? 174 ILE A C   1 
ATOM 1236 O O   . ILE A 1 152 ? -1.466 11.825  -11.933 1.00 92.99  ? 174 ILE A O   1 
ATOM 1237 C CB  . ILE A 1 152 ? 0.075  14.641  -11.092 1.00 89.28  ? 174 ILE A CB  1 
ATOM 1238 C CG1 . ILE A 1 152 ? 1.493  15.243  -11.038 1.00 89.97  ? 174 ILE A CG1 1 
ATOM 1239 C CG2 . ILE A 1 152 ? -0.196 13.832  -9.831  1.00 90.11  ? 174 ILE A CG2 1 
ATOM 1240 C CD1 . ILE A 1 152 ? 1.631  16.395  -10.052 1.00 90.89  ? 174 ILE A CD1 1 
ATOM 1241 N N   . GLU A 1 153 ? -2.497 13.640  -12.795 1.00 90.89  ? 175 GLU A N   1 
ATOM 1242 C CA  . GLU A 1 153 ? -3.779 12.946  -12.961 1.00 91.99  ? 175 GLU A CA  1 
ATOM 1243 C C   . GLU A 1 153 ? -3.601 11.708  -13.886 1.00 87.96  ? 175 GLU A C   1 
ATOM 1244 O O   . GLU A 1 153 ? -4.212 10.679  -13.654 1.00 87.01  ? 175 GLU A O   1 
ATOM 1245 C CB  . GLU A 1 153 ? -4.878 13.911  -13.463 1.00 89.35  ? 175 GLU A CB  1 
ATOM 1246 N N   . LYS A 1 154 ? -2.726 11.797  -14.890 1.00 91.41  ? 176 LYS A N   1 
ATOM 1247 C CA  . LYS A 1 154 ? -2.444 10.672  -15.821 1.00 94.85  ? 176 LYS A CA  1 
ATOM 1248 C C   . LYS A 1 154 ? -1.785 9.453   -15.179 1.00 94.01  ? 176 LYS A C   1 
ATOM 1249 O O   . LYS A 1 154 ? -1.690 8.408   -15.810 1.00 96.43  ? 176 LYS A O   1 
ATOM 1250 C CB  . LYS A 1 154 ? -1.583 11.125  -17.015 1.00 95.81  ? 176 LYS A CB  1 
ATOM 1251 C CG  . LYS A 1 154 ? -2.397 11.906  -18.028 1.00 101.17 ? 176 LYS A CG  1 
ATOM 1252 C CD  . LYS A 1 154 ? -1.583 12.599  -19.110 1.00 103.37 ? 176 LYS A CD  1 
ATOM 1253 C CE  . LYS A 1 154 ? -2.444 12.708  -20.363 1.00 114.02 ? 176 LYS A CE  1 
ATOM 1254 N NZ  . LYS A 1 154 ? -2.309 13.984  -21.117 1.00 121.61 ? 176 LYS A NZ  1 
ATOM 1255 N N   . PHE A 1 155 ? -1.325 9.579   -13.941 1.00 91.17  ? 177 PHE A N   1 
ATOM 1256 C CA  . PHE A 1 155 ? -0.826 8.423   -13.215 1.00 90.17  ? 177 PHE A CA  1 
ATOM 1257 C C   . PHE A 1 155 ? -1.931 7.595   -12.589 1.00 89.86  ? 177 PHE A C   1 
ATOM 1258 O O   . PHE A 1 155 ? -1.724 6.414   -12.341 1.00 94.46  ? 177 PHE A O   1 
ATOM 1259 C CB  . PHE A 1 155 ? 0.171  8.834   -12.123 1.00 89.13  ? 177 PHE A CB  1 
ATOM 1260 C CG  . PHE A 1 155 ? 1.395  9.537   -12.644 1.00 87.73  ? 177 PHE A CG  1 
ATOM 1261 C CD1 . PHE A 1 155 ? 1.979  9.174   -13.848 1.00 89.09  ? 177 PHE A CD1 1 
ATOM 1262 C CD2 . PHE A 1 155 ? 1.975  10.552  -11.919 1.00 88.74  ? 177 PHE A CD2 1 
ATOM 1263 C CE1 . PHE A 1 155 ? 3.106  9.822   -14.326 1.00 91.05  ? 177 PHE A CE1 1 
ATOM 1264 C CE2 . PHE A 1 155 ? 3.100  11.202  -12.391 1.00 91.20  ? 177 PHE A CE2 1 
ATOM 1265 C CZ  . PHE A 1 155 ? 3.672  10.835  -13.596 1.00 91.25  ? 177 PHE A CZ  1 
ATOM 1266 N N   . GLU A 1 156 ? -3.089 8.189   -12.318 1.00 90.62  ? 178 GLU A N   1 
ATOM 1267 C CA  . GLU A 1 156 ? -4.152 7.434   -11.673 1.00 93.31  ? 178 GLU A CA  1 
ATOM 1268 C C   . GLU A 1 156 ? -4.683 6.279   -12.532 1.00 93.10  ? 178 GLU A C   1 
ATOM 1269 O O   . GLU A 1 156 ? -4.718 5.151   -12.069 1.00 90.98  ? 178 GLU A O   1 
ATOM 1270 C CB  . GLU A 1 156 ? -5.300 8.327   -11.224 1.00 101.50 ? 178 GLU A CB  1 
ATOM 1271 C CG  . GLU A 1 156 ? -6.424 7.525   -10.580 1.00 110.02 ? 178 GLU A CG  1 
ATOM 1272 C CD  . GLU A 1 156 ? -7.124 8.286   -9.475  1.00 121.73 ? 178 GLU A CD  1 
ATOM 1273 O OE1 . GLU A 1 156 ? -7.791 9.301   -9.790  1.00 131.31 ? 178 GLU A OE1 1 
ATOM 1274 O OE2 . GLU A 1 156 ? -7.007 7.865   -8.297  1.00 115.79 ? 178 GLU A OE2 1 
ATOM 1275 N N   . PRO A 1 157 ? -5.104 6.542   -13.778 1.00 93.50  ? 179 PRO A N   1 
ATOM 1276 C CA  . PRO A 1 157 ? -5.480 5.381   -14.589 1.00 89.04  ? 179 PRO A CA  1 
ATOM 1277 C C   . PRO A 1 157 ? -4.390 4.318   -14.664 1.00 87.55  ? 179 PRO A C   1 
ATOM 1278 O O   . PRO A 1 157 ? -4.711 3.126   -14.695 1.00 94.16  ? 179 PRO A O   1 
ATOM 1279 C CB  . PRO A 1 157 ? -5.726 5.974   -15.983 1.00 91.36  ? 179 PRO A CB  1 
ATOM 1280 C CG  . PRO A 1 157 ? -5.172 7.353   -15.941 1.00 95.40  ? 179 PRO A CG  1 
ATOM 1281 C CD  . PRO A 1 157 ? -5.288 7.800   -14.514 1.00 94.09  ? 179 PRO A CD  1 
ATOM 1282 N N   . ARG A 1 158 ? -3.121 4.735   -14.691 1.00 84.66  ? 180 ARG A N   1 
ATOM 1283 C CA  . ARG A 1 158 ? -1.988 3.793   -14.798 1.00 77.41  ? 180 ARG A CA  1 
ATOM 1284 C C   . ARG A 1 158 ? -1.811 2.944   -13.550 1.00 74.17  ? 180 ARG A C   1 
ATOM 1285 O O   . ARG A 1 158 ? -1.329 1.805   -13.627 1.00 74.62  ? 180 ARG A O   1 
ATOM 1286 C CB  . ARG A 1 158 ? -0.692 4.522   -15.166 1.00 79.60  ? 180 ARG A CB  1 
ATOM 1287 C CG  . ARG A 1 158 ? -0.739 5.083   -16.594 1.00 85.87  ? 180 ARG A CG  1 
ATOM 1288 C CD  . ARG A 1 158 ? 0.433  5.973   -16.958 1.00 83.63  ? 180 ARG A CD  1 
ATOM 1289 N NE  . ARG A 1 158 ? 1.625  5.180   -17.242 1.00 87.60  ? 180 ARG A NE  1 
ATOM 1290 C CZ  . ARG A 1 158 ? 2.871  5.657   -17.262 1.00 92.55  ? 180 ARG A CZ  1 
ATOM 1291 N NH1 . ARG A 1 158 ? 3.110  6.944   -17.009 1.00 97.99  ? 180 ARG A NH1 1 
ATOM 1292 N NH2 . ARG A 1 158 ? 3.893  4.843   -17.529 1.00 93.45  ? 180 ARG A NH2 1 
ATOM 1293 N N   . LEU A 1 159 ? -2.215 3.452   -12.394 1.00 73.48  ? 181 LEU A N   1 
ATOM 1294 C CA  . LEU A 1 159 ? -2.300 2.580   -11.213 1.00 74.76  ? 181 LEU A CA  1 
ATOM 1295 C C   . LEU A 1 159 ? -3.367 1.502   -11.400 1.00 74.74  ? 181 LEU A C   1 
ATOM 1296 O O   . LEU A 1 159 ? -3.068 0.329   -11.264 1.00 73.83  ? 181 LEU A O   1 
ATOM 1297 C CB  . LEU A 1 159 ? -2.572 3.382   -9.945  1.00 76.11  ? 181 LEU A CB  1 
ATOM 1298 C CG  . LEU A 1 159 ? -1.400 4.269   -9.526  1.00 78.97  ? 181 LEU A CG  1 
ATOM 1299 C CD1 . LEU A 1 159 ? -1.827 5.310   -8.505  1.00 83.19  ? 181 LEU A CD1 1 
ATOM 1300 C CD2 . LEU A 1 159 ? -0.280 3.425   -8.966  1.00 80.80  ? 181 LEU A CD2 1 
ATOM 1301 N N   . GLU A 1 160 ? -4.592 1.907   -11.744 1.00 81.37  ? 182 GLU A N   1 
ATOM 1302 C CA  . GLU A 1 160 ? -5.712 0.971   -11.924 1.00 85.40  ? 182 GLU A CA  1 
ATOM 1303 C C   . GLU A 1 160 ? -5.304 -0.094  -12.949 1.00 82.22  ? 182 GLU A C   1 
ATOM 1304 O O   . GLU A 1 160 ? -5.540 -1.285  -12.723 1.00 79.65  ? 182 GLU A O   1 
ATOM 1305 C CB  . GLU A 1 160 ? -7.016 1.686   -12.356 1.00 94.04  ? 182 GLU A CB  1 
ATOM 1306 C CG  . GLU A 1 160 ? -7.458 2.870   -11.476 1.00 102.01 ? 182 GLU A CG  1 
ATOM 1307 C CD  . GLU A 1 160 ? -8.720 3.596   -11.983 1.00 110.50 ? 182 GLU A CD  1 
ATOM 1308 O OE1 . GLU A 1 160 ? -9.790 2.953   -11.983 1.00 116.02 ? 182 GLU A OE1 1 
ATOM 1309 O OE2 . GLU A 1 160 ? -8.662 4.805   -12.357 1.00 102.59 ? 182 GLU A OE2 1 
ATOM 1310 N N   . GLN A 1 161 ? -4.666 0.328   -14.049 1.00 77.64  ? 183 GLN A N   1 
ATOM 1311 C CA  . GLN A 1 161 ? -4.147 -0.618  -15.062 1.00 80.72  ? 183 GLN A CA  1 
ATOM 1312 C C   . GLN A 1 161 ? -3.294 -1.718  -14.449 1.00 79.42  ? 183 GLN A C   1 
ATOM 1313 O O   . GLN A 1 161 ? -3.416 -2.869  -14.834 1.00 84.79  ? 183 GLN A O   1 
ATOM 1314 C CB  . GLN A 1 161 ? -3.333 0.089   -16.147 1.00 81.90  ? 183 GLN A CB  1 
ATOM 1315 C CG  . GLN A 1 161 ? -4.187 0.783   -17.193 1.00 88.20  ? 183 GLN A CG  1 
ATOM 1316 C CD  . GLN A 1 161 ? -3.536 2.021   -17.802 1.00 89.06  ? 183 GLN A CD  1 
ATOM 1317 O OE1 . GLN A 1 161 ? -2.414 1.994   -18.320 1.00 82.52  ? 183 GLN A OE1 1 
ATOM 1318 N NE2 . GLN A 1 161 ? -4.262 3.121   -17.755 1.00 101.03 ? 183 GLN A NE2 1 
ATOM 1319 N N   . TYR A 1 162 ? -2.435 -1.376  -13.493 1.00 78.10  ? 184 TYR A N   1 
ATOM 1320 C CA  . TYR A 1 162 ? -1.631 -2.390  -12.833 1.00 74.07  ? 184 TYR A CA  1 
ATOM 1321 C C   . TYR A 1 162 ? -2.506 -3.413  -12.117 1.00 75.88  ? 184 TYR A C   1 
ATOM 1322 O O   . TYR A 1 162 ? -2.265 -4.618  -12.242 1.00 75.95  ? 184 TYR A O   1 
ATOM 1323 C CB  . TYR A 1 162 ? -0.599 -1.789  -11.870 1.00 71.26  ? 184 TYR A CB  1 
ATOM 1324 C CG  . TYR A 1 162 ? 0.036  -2.829  -10.945 1.00 69.13  ? 184 TYR A CG  1 
ATOM 1325 C CD1 . TYR A 1 162 ? 1.121  -3.608  -11.354 1.00 65.39  ? 184 TYR A CD1 1 
ATOM 1326 C CD2 . TYR A 1 162 ? -0.458 -3.033  -9.657  1.00 67.81  ? 184 TYR A CD2 1 
ATOM 1327 C CE1 . TYR A 1 162 ? 1.683  -4.558  -10.503 1.00 62.46  ? 184 TYR A CE1 1 
ATOM 1328 C CE2 . TYR A 1 162 ? 0.104  -3.970  -8.806  1.00 64.39  ? 184 TYR A CE2 1 
ATOM 1329 C CZ  . TYR A 1 162 ? 1.168  -4.734  -9.231  1.00 62.19  ? 184 TYR A CZ  1 
ATOM 1330 O OH  . TYR A 1 162 ? 1.706  -5.657  -8.355  1.00 62.87  ? 184 TYR A OH  1 
ATOM 1331 N N   . GLU A 1 163 ? -3.524 -2.961  -11.393 1.00 77.33  ? 185 GLU A N   1 
ATOM 1332 C CA  . GLU A 1 163 ? -4.383 -3.909  -10.680 1.00 79.86  ? 185 GLU A CA  1 
ATOM 1333 C C   . GLU A 1 163 ? -4.977 -4.936  -11.631 1.00 78.87  ? 185 GLU A C   1 
ATOM 1334 O O   . GLU A 1 163 ? -5.049 -6.116  -11.292 1.00 84.46  ? 185 GLU A O   1 
ATOM 1335 C CB  . GLU A 1 163 ? -5.487 -3.199  -9.927  1.00 87.31  ? 185 GLU A CB  1 
ATOM 1336 C CG  . GLU A 1 163 ? -4.971 -2.093  -9.025  1.00 97.64  ? 185 GLU A CG  1 
ATOM 1337 C CD  . GLU A 1 163 ? -5.592 -2.122  -7.640  1.00 109.55 ? 185 GLU A CD  1 
ATOM 1338 O OE1 . GLU A 1 163 ? -5.266 -3.055  -6.863  1.00 110.44 ? 185 GLU A OE1 1 
ATOM 1339 O OE2 . GLU A 1 163 ? -6.388 -1.205  -7.326  1.00 110.41 ? 185 GLU A OE2 1 
ATOM 1340 N N   . VAL A 1 164 ? -5.350 -4.489  -12.827 1.00 75.45  ? 186 VAL A N   1 
ATOM 1341 C CA  . VAL A 1 164 ? -5.968 -5.350  -13.859 1.00 81.44  ? 186 VAL A CA  1 
ATOM 1342 C C   . VAL A 1 164 ? -5.003 -6.402  -14.380 1.00 79.79  ? 186 VAL A C   1 
ATOM 1343 O O   . VAL A 1 164 ? -5.348 -7.582  -14.468 1.00 89.08  ? 186 VAL A O   1 
ATOM 1344 C CB  . VAL A 1 164 ? -6.539 -4.498  -15.054 1.00 81.96  ? 186 VAL A CB  1 
ATOM 1345 C CG1 . VAL A 1 164 ? -6.795 -5.320  -16.324 1.00 79.11  ? 186 VAL A CG1 1 
ATOM 1346 C CG2 . VAL A 1 164 ? -7.802 -3.789  -14.607 1.00 77.91  ? 186 VAL A CG2 1 
ATOM 1347 N N   . LEU A 1 165 ? -3.802 -5.961  -14.733 1.00 78.39  ? 187 LEU A N   1 
ATOM 1348 C CA  . LEU A 1 165 ? -2.746 -6.839  -15.242 1.00 72.57  ? 187 LEU A CA  1 
ATOM 1349 C C   . LEU A 1 165 ? -2.338 -7.896  -14.218 1.00 74.14  ? 187 LEU A C   1 
ATOM 1350 O O   . LEU A 1 165 ? -2.103 -9.064  -14.559 1.00 79.51  ? 187 LEU A O   1 
ATOM 1351 C CB  . LEU A 1 165 ? -1.511 -6.012  -15.566 1.00 69.44  ? 187 LEU A CB  1 
ATOM 1352 C CG  . LEU A 1 165 ? -1.559 -5.080  -16.763 1.00 70.75  ? 187 LEU A CG  1 
ATOM 1353 C CD1 . LEU A 1 165 ? -0.347 -4.169  -16.704 1.00 72.31  ? 187 LEU A CD1 1 
ATOM 1354 C CD2 . LEU A 1 165 ? -1.580 -5.862  -18.062 1.00 70.99  ? 187 LEU A CD2 1 
ATOM 1355 N N   . LYS A 1 166 ? -2.200 -7.471  -12.968 1.00 71.10  ? 188 LYS A N   1 
ATOM 1356 C CA  . LYS A 1 166 ? -1.848 -8.393  -11.906 1.00 71.33  ? 188 LYS A CA  1 
ATOM 1357 C C   . LYS A 1 166 ? -2.962 -9.417  -11.722 1.00 73.46  ? 188 LYS A C   1 
ATOM 1358 O O   . LYS A 1 166 ? -2.714 -10.608 -11.758 1.00 78.87  ? 188 LYS A O   1 
ATOM 1359 C CB  . LYS A 1 166 ? -1.617 -7.635  -10.614 1.00 69.69  ? 188 LYS A CB  1 
ATOM 1360 C CG  . LYS A 1 166 ? -1.468 -8.546  -9.421  1.00 72.39  ? 188 LYS A CG  1 
ATOM 1361 C CD  . LYS A 1 166 ? -1.572 -7.784  -8.123  1.00 72.06  ? 188 LYS A CD  1 
ATOM 1362 C CE  . LYS A 1 166 ? -1.273 -8.740  -6.990  1.00 76.79  ? 188 LYS A CE  1 
ATOM 1363 N NZ  . LYS A 1 166 ? -1.594 -8.036  -5.735  1.00 84.76  ? 188 LYS A NZ  1 
ATOM 1364 N N   . ALA A 1 167 ? -4.185 -8.925  -11.548 1.00 79.00  ? 189 ALA A N   1 
ATOM 1365 C CA  . ALA A 1 167 ? -5.396 -9.755  -11.452 1.00 78.86  ? 189 ALA A CA  1 
ATOM 1366 C C   . ALA A 1 167 ? -5.563 -10.777 -12.587 1.00 80.16  ? 189 ALA A C   1 
ATOM 1367 O O   . ALA A 1 167 ? -6.083 -11.871 -12.362 1.00 80.37  ? 189 ALA A O   1 
ATOM 1368 C CB  . ALA A 1 167 ? -6.616 -8.860  -11.382 1.00 76.24  ? 189 ALA A CB  1 
ATOM 1369 N N   . ASP A 1 168 ? -5.109 -10.427 -13.791 1.00 79.90  ? 190 ASP A N   1 
ATOM 1370 C CA  . ASP A 1 168 ? -5.069 -11.378 -14.923 1.00 82.72  ? 190 ASP A CA  1 
ATOM 1371 C C   . ASP A 1 168 ? -3.850 -12.343 -14.934 1.00 81.87  ? 190 ASP A C   1 
ATOM 1372 O O   . ASP A 1 168 ? -3.689 -13.153 -15.867 1.00 82.21  ? 190 ASP A O   1 
ATOM 1373 C CB  . ASP A 1 168 ? -5.133 -10.598 -16.239 1.00 84.02  ? 190 ASP A CB  1 
ATOM 1374 C CG  . ASP A 1 168 ? -6.439 -9.773  -16.389 1.00 88.86  ? 190 ASP A CG  1 
ATOM 1375 O OD1 . ASP A 1 168 ? -7.442 -10.025 -15.675 1.00 88.80  ? 190 ASP A OD1 1 
ATOM 1376 O OD2 . ASP A 1 168 ? -6.455 -8.866  -17.243 1.00 86.58  ? 190 ASP A OD2 1 
ATOM 1377 N N   . GLY A 1 169 ? -3.013 -12.267 -13.895 1.00 78.08  ? 191 GLY A N   1 
ATOM 1378 C CA  . GLY A 1 169 ? -1.813 -13.098 -13.786 1.00 75.75  ? 191 GLY A CA  1 
ATOM 1379 C C   . GLY A 1 169 ? -0.739 -12.761 -14.804 1.00 71.75  ? 191 GLY A C   1 
ATOM 1380 O O   . GLY A 1 169 ? 0.113  -13.579 -15.119 1.00 67.49  ? 191 GLY A O   1 
ATOM 1381 N N   . ASN A 1 170 ? -0.773 -11.554 -15.336 1.00 72.79  ? 192 ASN A N   1 
ATOM 1382 C CA  . ASN A 1 170 ? 0.268  -11.131 -16.255 1.00 74.99  ? 192 ASN A CA  1 
ATOM 1383 C C   . ASN A 1 170 ? 1.383  -10.424 -15.504 1.00 72.77  ? 192 ASN A C   1 
ATOM 1384 O O   . ASN A 1 170 ? 1.541  -9.207  -15.573 1.00 67.38  ? 192 ASN A O   1 
ATOM 1385 C CB  . ASN A 1 170 ? -0.337 -10.297 -17.366 1.00 75.40  ? 192 ASN A CB  1 
ATOM 1386 C CG  . ASN A 1 170 ? -1.264 -11.124 -18.223 1.00 78.13  ? 192 ASN A CG  1 
ATOM 1387 O OD1 . ASN A 1 170 ? -1.006 -12.297 -18.490 1.00 80.98  ? 192 ASN A OD1 1 
ATOM 1388 N ND2 . ASN A 1 170 ? -2.358 -10.543 -18.618 1.00 79.53  ? 192 ASN A ND2 1 
ATOM 1389 N N   . TYR A 1 171 ? 2.145  -11.237 -14.774 1.00 73.19  ? 193 TYR A N   1 
ATOM 1390 C CA  . TYR A 1 171 ? 3.181  -10.752 -13.863 1.00 70.28  ? 193 TYR A CA  1 
ATOM 1391 C C   . TYR A 1 171 ? 4.303  -10.034 -14.598 1.00 70.13  ? 193 TYR A C   1 
ATOM 1392 O O   . TYR A 1 171 ? 4.926  -9.133  -14.043 1.00 75.58  ? 193 TYR A O   1 
ATOM 1393 C CB  . TYR A 1 171 ? 3.730  -11.889 -12.998 1.00 66.33  ? 193 TYR A CB  1 
ATOM 1394 C CG  . TYR A 1 171 ? 4.542  -12.945 -13.728 1.00 73.26  ? 193 TYR A CG  1 
ATOM 1395 C CD1 . TYR A 1 171 ? 3.929  -14.042 -14.343 1.00 74.56  ? 193 TYR A CD1 1 
ATOM 1396 C CD2 . TYR A 1 171 ? 5.937  -12.879 -13.772 1.00 72.80  ? 193 TYR A CD2 1 
ATOM 1397 C CE1 . TYR A 1 171 ? 4.674  -15.012 -14.995 1.00 69.80  ? 193 TYR A CE1 1 
ATOM 1398 C CE2 . TYR A 1 171 ? 6.682  -13.851 -14.421 1.00 69.81  ? 193 TYR A CE2 1 
ATOM 1399 C CZ  . TYR A 1 171 ? 6.048  -14.911 -15.028 1.00 70.47  ? 193 TYR A CZ  1 
ATOM 1400 O OH  . TYR A 1 171 ? 6.806  -15.872 -15.661 1.00 76.09  ? 193 TYR A OH  1 
ATOM 1401 N N   . VAL A 1 172 ? 4.540  -10.375 -15.855 1.00 68.05  ? 194 VAL A N   1 
ATOM 1402 C CA  . VAL A 1 172 ? 5.649  -9.751  -16.565 1.00 69.73  ? 194 VAL A CA  1 
ATOM 1403 C C   . VAL A 1 172 ? 5.253  -8.375  -17.071 1.00 71.43  ? 194 VAL A C   1 
ATOM 1404 O O   . VAL A 1 172 ? 6.026  -7.411  -16.960 1.00 76.12  ? 194 VAL A O   1 
ATOM 1405 C CB  . VAL A 1 172 ? 6.184  -10.642 -17.716 1.00 74.79  ? 194 VAL A CB  1 
ATOM 1406 C CG1 . VAL A 1 172 ? 7.306  -9.937  -18.469 1.00 75.57  ? 194 VAL A CG1 1 
ATOM 1407 C CG2 . VAL A 1 172 ? 6.678  -11.980 -17.164 1.00 74.12  ? 194 VAL A CG2 1 
ATOM 1408 N N   . GLN A 1 173 ? 4.045  -8.273  -17.611 1.00 73.26  ? 195 GLN A N   1 
ATOM 1409 C CA  . GLN A 1 173 ? 3.586  -6.999  -18.136 1.00 76.30  ? 195 GLN A CA  1 
ATOM 1410 C C   . GLN A 1 173 ? 3.342  -6.085  -16.962 1.00 74.05  ? 195 GLN A C   1 
ATOM 1411 O O   . GLN A 1 173 ? 3.673  -4.896  -16.993 1.00 74.41  ? 195 GLN A O   1 
ATOM 1412 C CB  . GLN A 1 173 ? 2.336  -7.175  -18.962 1.00 81.60  ? 195 GLN A CB  1 
ATOM 1413 C CG  . GLN A 1 173 ? 2.563  -7.993  -20.226 1.00 87.26  ? 195 GLN A CG  1 
ATOM 1414 C CD  . GLN A 1 173 ? 1.251  -8.385  -20.881 1.00 93.72  ? 195 GLN A CD  1 
ATOM 1415 O OE1 . GLN A 1 173 ? 1.054  -9.539  -21.260 1.00 100.46 ? 195 GLN A OE1 1 
ATOM 1416 N NE2 . GLN A 1 173 ? 0.334  -7.427  -20.990 1.00 94.28  ? 195 GLN A NE2 1 
ATOM 1417 N N   . ALA A 1 174 ? 2.803  -6.664  -15.903 1.00 71.19  ? 196 ALA A N   1 
ATOM 1418 C CA  . ALA A 1 174 ? 2.627  -5.938  -14.659 1.00 72.56  ? 196 ALA A CA  1 
ATOM 1419 C C   . ALA A 1 174 ? 3.938  -5.292  -14.192 1.00 72.90  ? 196 ALA A C   1 
ATOM 1420 O O   . ALA A 1 174 ? 3.973  -4.095  -13.878 1.00 65.95  ? 196 ALA A O   1 
ATOM 1421 C CB  . ALA A 1 174 ? 2.081  -6.866  -13.589 1.00 71.18  ? 196 ALA A CB  1 
ATOM 1422 N N   . HIS A 1 175 ? 5.010  -6.084  -14.149 1.00 75.47  ? 197 HIS A N   1 
ATOM 1423 C CA  . HIS A 1 175 ? 6.299  -5.571  -13.747 1.00 69.21  ? 197 HIS A CA  1 
ATOM 1424 C C   . HIS A 1 175 ? 6.783  -4.489  -14.704 1.00 70.77  ? 197 HIS A C   1 
ATOM 1425 O O   . HIS A 1 175 ? 7.142  -3.404  -14.276 1.00 70.36  ? 197 HIS A O   1 
ATOM 1426 C CB  . HIS A 1 175 ? 7.330  -6.661  -13.724 1.00 73.69  ? 197 HIS A CB  1 
ATOM 1427 C CG  . HIS A 1 175 ? 8.650  -6.172  -13.241 1.00 78.93  ? 197 HIS A CG  1 
ATOM 1428 N ND1 . HIS A 1 175 ? 8.926  -6.007  -11.903 1.00 81.91  ? 197 HIS A ND1 1 
ATOM 1429 C CD2 . HIS A 1 175 ? 9.739  -5.728  -13.911 1.00 79.55  ? 197 HIS A CD2 1 
ATOM 1430 C CE1 . HIS A 1 175 ? 10.139 -5.510  -11.764 1.00 82.13  ? 197 HIS A CE1 1 
ATOM 1431 N NE2 . HIS A 1 175 ? 10.655 -5.335  -12.967 1.00 82.18  ? 197 HIS A NE2 1 
ATOM 1432 N N   . ASN A 1 176 ? 6.789  -4.751  -16.006 1.00 67.22  ? 198 ASN A N   1 
ATOM 1433 C CA  . ASN A 1 176 ? 7.255  -3.712  -16.912 1.00 69.49  ? 198 ASN A CA  1 
ATOM 1434 C C   . ASN A 1 176 ? 6.416  -2.444  -16.824 1.00 74.55  ? 198 ASN A C   1 
ATOM 1435 O O   . ASN A 1 176 ? 6.909  -1.352  -17.071 1.00 79.66  ? 198 ASN A O   1 
ATOM 1436 C CB  . ASN A 1 176 ? 7.280  -4.207  -18.341 1.00 72.30  ? 198 ASN A CB  1 
ATOM 1437 C CG  . ASN A 1 176 ? 8.266  -5.352  -18.552 1.00 75.36  ? 198 ASN A CG  1 
ATOM 1438 O OD1 . ASN A 1 176 ? 9.409  -5.329  -18.092 1.00 75.49  ? 198 ASN A OD1 1 
ATOM 1439 N ND2 . ASN A 1 176 ? 7.813  -6.369  -19.243 1.00 80.08  ? 198 ASN A ND2 1 
ATOM 1440 N N   . HIS A 1 177 ? 5.145  -2.590  -16.463 1.00 74.79  ? 199 HIS A N   1 
ATOM 1441 C CA  . HIS A 1 177 ? 4.222  -1.469  -16.422 1.00 69.71  ? 199 HIS A CA  1 
ATOM 1442 C C   . HIS A 1 177 ? 4.494  -0.581  -15.232 1.00 69.51  ? 199 HIS A C   1 
ATOM 1443 O O   . HIS A 1 177 ? 4.535  0.667   -15.340 1.00 71.53  ? 199 HIS A O   1 
ATOM 1444 C CB  . HIS A 1 177 ? 2.789  -1.986  -16.347 1.00 70.76  ? 199 HIS A CB  1 
ATOM 1445 C CG  . HIS A 1 177 ? 1.755  -0.904  -16.286 1.00 78.39  ? 199 HIS A CG  1 
ATOM 1446 N ND1 . HIS A 1 177 ? 1.272  -0.270  -17.414 1.00 84.91  ? 199 HIS A ND1 1 
ATOM 1447 C CD2 . HIS A 1 177 ? 1.118  -0.340  -15.233 1.00 79.53  ? 199 HIS A CD2 1 
ATOM 1448 C CE1 . HIS A 1 177 ? 0.384  0.639   -17.055 1.00 88.14  ? 199 HIS A CE1 1 
ATOM 1449 N NE2 . HIS A 1 177 ? 0.266  0.609   -15.738 1.00 85.42  ? 199 HIS A NE2 1 
ATOM 1450 N N   . ILE A 1 178 ? 4.653  -1.231  -14.085 1.00 68.88  ? 200 ILE A N   1 
ATOM 1451 C CA  . ILE A 1 178 ? 4.858  -0.522  -12.826 1.00 70.18  ? 200 ILE A CA  1 
ATOM 1452 C C   . ILE A 1 178 ? 6.290  0.030   -12.670 1.00 73.58  ? 200 ILE A C   1 
ATOM 1453 O O   . ILE A 1 178 ? 6.491  1.093   -12.084 1.00 78.74  ? 200 ILE A O   1 
ATOM 1454 C CB  . ILE A 1 178 ? 4.457  -1.400  -11.642 1.00 68.30  ? 200 ILE A CB  1 
ATOM 1455 C CG1 . ILE A 1 178 ? 4.146  -0.535  -10.421 1.00 72.53  ? 200 ILE A CG1 1 
ATOM 1456 C CG2 . ILE A 1 178 ? 5.516  -2.428  -11.332 1.00 69.34  ? 200 ILE A CG2 1 
ATOM 1457 C CD1 . ILE A 1 178 ? 2.833  0.197   -10.558 1.00 73.76  ? 200 ILE A CD1 1 
ATOM 1458 N N   . ALA A 1 179 ? 7.275  -0.654  -13.240 1.00 70.18  ? 201 ALA A N   1 
ATOM 1459 C CA  . ALA A 1 179 ? 8.621  -0.113  -13.291 1.00 69.59  ? 201 ALA A CA  1 
ATOM 1460 C C   . ALA A 1 179 ? 8.668  1.169   -14.093 1.00 70.94  ? 201 ALA A C   1 
ATOM 1461 O O   . ALA A 1 179 ? 9.270  2.145   -13.666 1.00 74.95  ? 201 ALA A O   1 
ATOM 1462 C CB  . ALA A 1 179 ? 9.572  -1.126  -13.881 1.00 67.34  ? 201 ALA A CB  1 
ATOM 1463 N N   . ALA A 1 180 ? 8.029  1.153   -15.262 1.00 75.44  ? 202 ALA A N   1 
ATOM 1464 C CA  . ALA A 1 180 ? 7.970  2.334   -16.144 1.00 74.34  ? 202 ALA A CA  1 
ATOM 1465 C C   . ALA A 1 180 ? 7.258  3.460   -15.426 1.00 74.30  ? 202 ALA A C   1 
ATOM 1466 O O   . ALA A 1 180 ? 7.704  4.591   -15.471 1.00 84.23  ? 202 ALA A O   1 
ATOM 1467 C CB  . ALA A 1 180 ? 7.260  2.015   -17.455 1.00 68.87  ? 202 ALA A CB  1 
ATOM 1468 N N   . LEU A 1 181 ? 6.165  3.140   -14.744 1.00 70.31  ? 203 LEU A N   1 
ATOM 1469 C CA  . LEU A 1 181 ? 5.423  4.149   -14.033 1.00 68.48  ? 203 LEU A CA  1 
ATOM 1470 C C   . LEU A 1 181 ? 6.296  4.786   -12.959 1.00 72.77  ? 203 LEU A C   1 
ATOM 1471 O O   . LEU A 1 181 ? 6.303  6.001   -12.767 1.00 76.17  ? 203 LEU A O   1 
ATOM 1472 C CB  . LEU A 1 181 ? 4.205  3.517   -13.382 1.00 68.46  ? 203 LEU A CB  1 
ATOM 1473 C CG  . LEU A 1 181 ? 3.350  4.513   -12.597 1.00 71.66  ? 203 LEU A CG  1 
ATOM 1474 C CD1 . LEU A 1 181 ? 2.848  5.574   -13.560 1.00 75.74  ? 203 LEU A CD1 1 
ATOM 1475 C CD2 . LEU A 1 181 ? 2.194  3.862   -11.840 1.00 70.52  ? 203 LEU A CD2 1 
ATOM 1476 N N   . ASN A 1 182 ? 7.034  3.959   -12.237 1.00 77.36  ? 204 ASN A N   1 
ATOM 1477 C CA  . ASN A 1 182 ? 7.869  4.466   -11.174 1.00 77.39  ? 204 ASN A CA  1 
ATOM 1478 C C   . ASN A 1 182 ? 8.935  5.406   -11.720 1.00 79.03  ? 204 ASN A C   1 
ATOM 1479 O O   . ASN A 1 182 ? 9.141  6.504   -11.202 1.00 82.60  ? 204 ASN A O   1 
ATOM 1480 C CB  . ASN A 1 182 ? 8.517  3.317   -10.445 1.00 77.21  ? 204 ASN A CB  1 
ATOM 1481 C CG  . ASN A 1 182 ? 9.147  3.743   -9.149  1.00 82.47  ? 204 ASN A CG  1 
ATOM 1482 O OD1 . ASN A 1 182 ? 8.610  4.566   -8.396  1.00 102.95 ? 204 ASN A OD1 1 
ATOM 1483 N ND2 . ASN A 1 182 ? 10.285 3.183   -8.874  1.00 84.97  ? 204 ASN A ND2 1 
ATOM 1484 N N   . GLU A 1 183 ? 9.573  4.979   -12.799 1.00 78.72  ? 205 GLU A N   1 
ATOM 1485 C CA  . GLU A 1 183 ? 10.551 5.797   -13.467 1.00 87.17  ? 205 GLU A CA  1 
ATOM 1486 C C   . GLU A 1 183 ? 10.026 7.184   -13.778 1.00 87.06  ? 205 GLU A C   1 
ATOM 1487 O O   . GLU A 1 183 ? 10.702 8.169   -13.530 1.00 94.33  ? 205 GLU A O   1 
ATOM 1488 C CB  . GLU A 1 183 ? 11.008 5.153   -14.778 1.00 99.16  ? 205 GLU A CB  1 
ATOM 1489 C CG  . GLU A 1 183 ? 12.280 5.787   -15.295 1.00 107.23 ? 205 GLU A CG  1 
ATOM 1490 C CD  . GLU A 1 183 ? 13.281 5.915   -14.162 1.00 116.76 ? 205 GLU A CD  1 
ATOM 1491 O OE1 . GLU A 1 183 ? 13.610 4.859   -13.572 1.00 117.02 ? 205 GLU A OE1 1 
ATOM 1492 O OE2 . GLU A 1 183 ? 13.684 7.051   -13.819 1.00 114.05 ? 205 GLU A OE2 1 
ATOM 1493 N N   . GLN A 1 184 ? 8.821  7.264   -14.315 1.00 83.01  ? 206 GLN A N   1 
ATOM 1494 C CA  . GLN A 1 184 ? 8.321  8.527   -14.807 1.00 87.14  ? 206 GLN A CA  1 
ATOM 1495 C C   . GLN A 1 184 ? 7.864  9.406   -13.678 1.00 88.37  ? 206 GLN A C   1 
ATOM 1496 O O   . GLN A 1 184 ? 8.031  10.624  -13.724 1.00 93.25  ? 206 GLN A O   1 
ATOM 1497 C CB  . GLN A 1 184 ? 7.181  8.289   -15.753 1.00 93.35  ? 206 GLN A CB  1 
ATOM 1498 C CG  . GLN A 1 184 ? 7.547  7.292   -16.815 1.00 103.53 ? 206 GLN A CG  1 
ATOM 1499 C CD  . GLN A 1 184 ? 6.739  7.504   -18.049 1.00 113.40 ? 206 GLN A CD  1 
ATOM 1500 O OE1 . GLN A 1 184 ? 5.576  7.108   -18.115 1.00 115.63 ? 206 GLN A OE1 1 
ATOM 1501 N NE2 . GLN A 1 184 ? 7.340  8.153   -19.039 1.00 118.56 ? 206 GLN A NE2 1 
ATOM 1502 N N   . MET A 1 185 ? 7.274  8.792   -12.663 1.00 87.05  ? 207 MET A N   1 
ATOM 1503 C CA  . MET A 1 185 ? 6.969  9.517   -11.448 1.00 88.92  ? 207 MET A CA  1 
ATOM 1504 C C   . MET A 1 185 ? 8.288  10.070  -10.882 1.00 88.59  ? 207 MET A C   1 
ATOM 1505 O O   . MET A 1 185 ? 8.383  11.250  -10.560 1.00 88.82  ? 207 MET A O   1 
ATOM 1506 C CB  . MET A 1 185 ? 6.231  8.614   -10.450 1.00 89.30  ? 207 MET A CB  1 
ATOM 1507 C CG  . MET A 1 185 ? 4.824  8.216   -10.905 1.00 86.24  ? 207 MET A CG  1 
ATOM 1508 S SD  . MET A 1 185 ? 3.921  7.216   -9.696  1.00 86.74  ? 207 MET A SD  1 
ATOM 1509 C CE  . MET A 1 185 ? 3.193  8.445   -8.647  1.00 88.48  ? 207 MET A CE  1 
ATOM 1510 N N   . LYS A 1 186 ? 9.325  9.240   -10.837 1.00 85.06  ? 208 LYS A N   1 
ATOM 1511 C CA  . LYS A 1 186 ? 10.612 9.688   -10.325 1.00 90.40  ? 208 LYS A CA  1 
ATOM 1512 C C   . LYS A 1 186 ? 11.133 10.946  -11.016 1.00 93.24  ? 208 LYS A C   1 
ATOM 1513 O O   . LYS A 1 186 ? 11.513 11.913  -10.359 1.00 100.59 ? 208 LYS A O   1 
ATOM 1514 C CB  . LYS A 1 186 ? 11.647 8.582   -10.444 1.00 93.84  ? 208 LYS A CB  1 
ATOM 1515 C CG  . LYS A 1 186 ? 12.926 8.854   -9.674  1.00 101.08 ? 208 LYS A CG  1 
ATOM 1516 C CD  . LYS A 1 186 ? 13.679 7.566   -9.393  1.00 107.99 ? 208 LYS A CD  1 
ATOM 1517 C CE  . LYS A 1 186 ? 13.003 6.748   -8.292  1.00 115.42 ? 208 LYS A CE  1 
ATOM 1518 N NZ  . LYS A 1 186 ? 13.259 5.277   -8.424  1.00 117.80 ? 208 LYS A NZ  1 
ATOM 1519 N N   . GLN A 1 187 ? 11.146 10.944  -12.336 1.00 94.45  ? 209 GLN A N   1 
ATOM 1520 C CA  . GLN A 1 187 ? 11.701 12.074  -13.068 1.00 98.12  ? 209 GLN A CA  1 
ATOM 1521 C C   . GLN A 1 187 ? 10.815 13.279  -12.954 1.00 96.13  ? 209 GLN A C   1 
ATOM 1522 O O   . GLN A 1 187 ? 11.299 14.410  -12.972 1.00 105.46 ? 209 GLN A O   1 
ATOM 1523 C CB  . GLN A 1 187 ? 11.920 11.727  -14.528 1.00 101.87 ? 209 GLN A CB  1 
ATOM 1524 C CG  . GLN A 1 187 ? 13.001 10.683  -14.712 1.00 106.00 ? 209 GLN A CG  1 
ATOM 1525 C CD  . GLN A 1 187 ? 13.021 10.142  -16.118 1.00 112.16 ? 209 GLN A CD  1 
ATOM 1526 O OE1 . GLN A 1 187 ? 12.805 10.877  -17.069 1.00 121.67 ? 209 GLN A OE1 1 
ATOM 1527 N NE2 . GLN A 1 187 ? 13.278 8.850   -16.258 1.00 117.63 ? 209 GLN A NE2 1 
ATOM 1528 N N   . LEU A 1 188 ? 9.516  13.061  -12.818 1.00 89.68  ? 210 LEU A N   1 
ATOM 1529 C CA  . LEU A 1 188 ? 8.629  14.193  -12.568 1.00 89.27  ? 210 LEU A CA  1 
ATOM 1530 C C   . LEU A 1 188 ? 8.879  14.796  -11.184 1.00 91.87  ? 210 LEU A C   1 
ATOM 1531 O O   . LEU A 1 188 ? 8.667  15.976  -10.967 1.00 93.91  ? 210 LEU A O   1 
ATOM 1532 C CB  . LEU A 1 188 ? 7.170  13.773  -12.705 1.00 84.15  ? 210 LEU A CB  1 
ATOM 1533 C CG  . LEU A 1 188 ? 6.173  14.921  -12.736 1.00 86.65  ? 210 LEU A CG  1 
ATOM 1534 C CD1 . LEU A 1 188 ? 6.552  15.924  -13.814 1.00 92.76  ? 210 LEU A CD1 1 
ATOM 1535 C CD2 . LEU A 1 188 ? 4.749  14.442  -12.967 1.00 88.15  ? 210 LEU A CD2 1 
ATOM 1536 N N   . ARG A 1 189 ? 9.328  13.982  -10.239 1.00 99.09  ? 211 ARG A N   1 
ATOM 1537 C CA  . ARG A 1 189 ? 9.581  14.489  -8.905  1.00 106.97 ? 211 ARG A CA  1 
ATOM 1538 C C   . ARG A 1 189 ? 10.874 15.305  -8.861  1.00 107.10 ? 211 ARG A C   1 
ATOM 1539 O O   . ARG A 1 189 ? 10.902 16.322  -8.166  1.00 117.98 ? 211 ARG A O   1 
ATOM 1540 C CB  . ARG A 1 189 ? 9.554  13.362  -7.860  1.00 111.00 ? 211 ARG A CB  1 
ATOM 1541 C CG  . ARG A 1 189 ? 9.058  13.803  -6.474  1.00 122.51 ? 211 ARG A CG  1 
ATOM 1542 C CD  . ARG A 1 189 ? 8.332  12.703  -5.691  1.00 125.82 ? 211 ARG A CD  1 
ATOM 1543 N NE  . ARG A 1 189 ? 9.048  11.424  -5.747  1.00 129.57 ? 211 ARG A NE  1 
ATOM 1544 C CZ  . ARG A 1 189 ? 8.795  10.430  -6.601  1.00 134.62 ? 211 ARG A CZ  1 
ATOM 1545 N NH1 . ARG A 1 189 ? 7.814  10.522  -7.495  1.00 145.33 ? 211 ARG A NH1 1 
ATOM 1546 N NH2 . ARG A 1 189 ? 9.530  9.321   -6.565  1.00 134.73 ? 211 ARG A NH2 1 
ATOM 1547 N N   . SER A 1 190 ? 11.913 14.896  -9.606  1.00 102.65 ? 212 SER A N   1 
ATOM 1548 C CA  . SER A 1 190 ? 13.140 15.709  -9.738  1.00 108.78 ? 212 SER A CA  1 
ATOM 1549 C C   . SER A 1 190 ? 12.780 17.077  -10.283 1.00 117.91 ? 212 SER A C   1 
ATOM 1550 O O   . SER A 1 190 ? 13.112 18.124  -9.692  1.00 126.26 ? 212 SER A O   1 
ATOM 1551 C CB  . SER A 1 190 ? 14.155 15.079  -10.681 1.00 109.56 ? 212 SER A CB  1 
ATOM 1552 O OG  . SER A 1 190 ? 14.517 13.792  -10.237 1.00 117.29 ? 212 SER A OG  1 
ATOM 1553 N N   . TYR A 1 191 ? 12.071 17.062  -11.404 1.00 114.83 ? 213 TYR A N   1 
ATOM 1554 C CA  . TYR A 1 191 ? 11.592 18.289  -11.995 1.00 116.50 ? 213 TYR A CA  1 
ATOM 1555 C C   . TYR A 1 191 ? 10.851 19.166  -10.977 1.00 114.82 ? 213 TYR A C   1 
ATOM 1556 O O   . TYR A 1 191 ? 11.058 20.371  -10.947 1.00 126.06 ? 213 TYR A O   1 
ATOM 1557 C CB  . TYR A 1 191 ? 10.705 17.996  -13.201 1.00 114.79 ? 213 TYR A CB  1 
ATOM 1558 C CG  . TYR A 1 191 ? 10.081 19.244  -13.750 1.00 120.76 ? 213 TYR A CG  1 
ATOM 1559 C CD1 . TYR A 1 191 ? 10.849 20.191  -14.436 1.00 125.22 ? 213 TYR A CD1 1 
ATOM 1560 C CD2 . TYR A 1 191 ? 8.736  19.513  -13.544 1.00 122.59 ? 213 TYR A CD2 1 
ATOM 1561 C CE1 . TYR A 1 191 ? 10.282 21.356  -14.919 1.00 125.02 ? 213 TYR A CE1 1 
ATOM 1562 C CE2 . TYR A 1 191 ? 8.158  20.677  -14.025 1.00 124.75 ? 213 TYR A CE2 1 
ATOM 1563 C CZ  . TYR A 1 191 ? 8.929  21.591  -14.709 1.00 127.94 ? 213 TYR A CZ  1 
ATOM 1564 O OH  . TYR A 1 191 ? 8.323  22.736  -15.168 1.00 135.97 ? 213 TYR A OH  1 
ATOM 1565 N N   . MET A 1 192 ? 10.024 18.574  -10.123 1.00 114.55 ? 214 MET A N   1 
ATOM 1566 C CA  . MET A 1 192 ? 9.241  19.363  -9.159  1.00 121.83 ? 214 MET A CA  1 
ATOM 1567 C C   . MET A 1 192 ? 10.055 20.107  -8.073  1.00 129.61 ? 214 MET A C   1 
ATOM 1568 O O   . MET A 1 192 ? 9.461  20.726  -7.201  1.00 131.88 ? 214 MET A O   1 
ATOM 1569 C CB  . MET A 1 192 ? 8.124  18.507  -8.524  1.00 118.83 ? 214 MET A CB  1 
ATOM 1570 C CG  . MET A 1 192 ? 6.830  18.479  -9.337  1.00 116.59 ? 214 MET A CG  1 
ATOM 1571 S SD  . MET A 1 192 ? 5.580  17.272  -8.806  1.00 110.05 ? 214 MET A SD  1 
ATOM 1572 C CE  . MET A 1 192 ? 4.779  18.147  -7.479  1.00 115.38 ? 214 MET A CE  1 
ATOM 1573 N N   . HIS A 1 193 ? 11.389 20.064  -8.119  1.00 138.95 ? 215 HIS A N   1 
ATOM 1574 C CA  . HIS A 1 193 ? 12.225 20.995  -7.327  1.00 146.36 ? 215 HIS A CA  1 
ATOM 1575 C C   . HIS A 1 193 ? 12.505 22.294  -8.103  1.00 145.85 ? 215 HIS A C   1 
ATOM 1576 O O   . HIS A 1 193 ? 13.609 22.493  -8.602  1.00 151.09 ? 215 HIS A O   1 
ATOM 1577 C CB  . HIS A 1 193 ? 13.546 20.327  -6.937  1.00 146.78 ? 215 HIS A CB  1 
ATOM 1578 C CG  . HIS A 1 193 ? 13.394 19.294  -5.873  1.00 150.38 ? 215 HIS A CG  1 
ATOM 1579 N ND1 . HIS A 1 193 ? 12.317 18.432  -5.818  1.00 147.41 ? 215 HIS A ND1 1 
ATOM 1580 C CD2 . HIS A 1 193 ? 14.182 18.982  -4.819  1.00 151.47 ? 215 HIS A CD2 1 
ATOM 1581 C CE1 . HIS A 1 193 ? 12.450 17.631  -4.777  1.00 145.86 ? 215 HIS A CE1 1 
ATOM 1582 N NE2 . HIS A 1 193 ? 13.573 17.944  -4.155  1.00 154.24 ? 215 HIS A NE2 1 
ATOM 1583 N N   . GLY A 1 194 ? 11.511 23.173  -8.202  1.00 138.68 ? 216 GLY A N   1 
ATOM 1584 C CA  . GLY A 1 194 ? 11.610 24.350  -9.064  1.00 133.58 ? 216 GLY A CA  1 
ATOM 1585 C C   . GLY A 1 194 ? 10.281 24.661  -9.720  1.00 128.58 ? 216 GLY A C   1 
ATOM 1586 O O   . GLY A 1 194 ? 9.339  25.086  -9.044  1.00 120.74 ? 216 GLY A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 1   ? 1.3955 1.1051 1.2733 0.3329  0.0115  0.0228  23  MET A N   
2    C CA  . MET A 1   ? 1.3721 1.1278 1.2864 0.3123  -0.0056 0.0045  23  MET A CA  
3    C C   . MET A 1   ? 1.3431 1.1058 1.2764 0.2809  0.0164  0.0197  23  MET A C   
4    O O   . MET A 1   ? 1.3093 1.0847 1.2401 0.2781  0.0103  0.0167  23  MET A O   
5    C CB  . MET A 1   ? 1.3015 1.1012 1.2710 0.2941  -0.0229 -0.0210 23  MET A CB  
6    C CG  . MET A 1   ? 1.2764 1.1196 1.2881 0.2717  -0.0342 -0.0388 23  MET A CG  
7    S SD  . MET A 1   ? 1.2802 1.1411 1.2913 0.2980  -0.0691 -0.0651 23  MET A SD  
8    C CE  . MET A 1   ? 1.2324 1.0811 1.2122 0.2942  -0.0591 -0.0481 23  MET A CE  
9    N N   . ARG A 2   ? 1.2594 1.0130 1.2137 0.2589  0.0398  0.0342  24  ARG A N   
10   C CA  . ARG A 2   ? 1.2137 0.9679 1.1870 0.2340  0.0594  0.0481  24  ARG A CA  
11   C C   . ARG A 2   ? 1.2920 1.0147 1.2250 0.2533  0.0747  0.0668  24  ARG A C   
12   O O   . ARG A 2   ? 1.3969 1.1327 1.3399 0.2398  0.0774  0.0689  24  ARG A O   
13   C CB  . ARG A 2   ? 1.2167 0.9580 1.2198 0.2143  0.0802  0.0592  24  ARG A CB  
14   C CG  . ARG A 2   ? 1.1898 0.9513 1.2249 0.1982  0.0696  0.0438  24  ARG A CG  
15   C CD  . ARG A 2   ? 1.3208 1.0498 1.3510 0.2087  0.0840  0.0543  24  ARG A CD  
16   N NE  . ARG A 2   ? 1.2923 1.0134 1.3611 0.1853  0.0996  0.0610  24  ARG A NE  
17   C CZ  . ARG A 2   ? 1.3217 1.0131 1.3991 0.1890  0.1164  0.0711  24  ARG A CZ  
18   N NH1 . ARG A 2   ? 1.3402 1.0036 1.3827 0.2160  0.1225  0.0786  24  ARG A NH1 
19   N NH2 . ARG A 2   ? 1.3947 1.0827 1.5174 0.1668  0.1257  0.0721  24  ARG A NH2 
20   N N   . SER A 3   ? 1.4497 1.1267 1.3332 0.2865  0.0870  0.0813  25  SER A N   
21   C CA  . SER A 3   ? 1.5625 1.2005 1.4022 0.3068  0.1091  0.1024  25  SER A CA  
22   C C   . SER A 3   ? 1.5912 1.2468 1.4085 0.3169  0.0864  0.0903  25  SER A C   
23   O O   . SER A 3   ? 1.7611 1.4057 1.5686 0.3150  0.1030  0.1034  25  SER A O   
24   C CB  . SER A 3   ? 1.6210 1.1972 1.3982 0.3470  0.1283  0.1209  25  SER A CB  
25   O OG  . SER A 3   ? 1.7111 1.2775 1.4329 0.3852  0.0983  0.1067  25  SER A OG  
26   N N   . ASN A 4   ? 1.4882 1.1728 1.3060 0.3257  0.0494  0.0641  26  ASN A N   
27   C CA  . ASN A 4   ? 1.5740 1.2755 1.3783 0.3350  0.0265  0.0499  26  ASN A CA  
28   C C   . ASN A 4   ? 1.4295 1.1855 1.2954 0.2952  0.0164  0.0349  26  ASN A C   
29   O O   . ASN A 4   ? 1.4569 1.2258 1.3185 0.2962  0.0050  0.0277  26  ASN A O   
30   C CB  . ASN A 4   ? 1.6499 1.3401 1.4120 0.3773  -0.0075 0.0301  26  ASN A CB  
31   C CG  . ASN A 4   ? 1.6054 1.3455 1.4213 0.3651  -0.0407 -0.0021 26  ASN A CG  
32   O OD1 . ASN A 4   ? 1.4523 1.2367 1.3243 0.3311  -0.0445 -0.0137 26  ASN A OD1 
33   N ND2 . ASN A 4   ? 1.6213 1.3512 1.4200 0.3953  -0.0639 -0.0174 26  ASN A ND2 
34   N N   . LYS A 5   ? 1.2825 1.0647 1.1999 0.2624  0.0221  0.0314  27  LYS A N   
35   C CA  . LYS A 5   ? 1.1792 0.9960 1.1431 0.2252  0.0248  0.0270  27  LYS A CA  
36   C C   . LYS A 5   ? 1.1638 0.9647 1.1289 0.2114  0.0505  0.0487  27  LYS A C   
37   O O   . LYS A 5   ? 1.1601 0.9821 1.1473 0.1905  0.0498  0.0462  27  LYS A O   
38   C CB  . LYS A 5   ? 1.1799 1.0191 1.1874 0.1996  0.0243  0.0175  27  LYS A CB  
39   C CG  . LYS A 5   ? 1.1569 1.0227 1.1840 0.2034  0.0021  -0.0072 27  LYS A CG  
40   C CD  . LYS A 5   ? 1.1840 1.0848 1.2477 0.1795  -0.0042 -0.0223 27  LYS A CD  
41   C CE  . LYS A 5   ? 1.1657 1.0916 1.2592 0.1838  -0.0211 -0.0473 27  LYS A CE  
42   N NZ  . LYS A 5   ? 1.1379 1.0642 1.2180 0.2137  -0.0443 -0.0610 27  LYS A NZ  
43   N N   . ARG A 6   ? 1.2114 0.9740 1.1570 0.2233  0.0748  0.0697  28  ARG A N   
44   C CA  . ARG A 6   ? 1.2114 0.9575 1.1681 0.2119  0.1021  0.0894  28  ARG A CA  
45   C C   . ARG A 6   ? 1.1577 0.8978 1.0841 0.2246  0.1029  0.0942  28  ARG A C   
46   O O   . ARG A 6   ? 1.2462 0.9881 1.1938 0.2088  0.1184  0.1038  28  ARG A O   
47   C CB  . ARG A 6   ? 1.3134 1.0150 1.2605 0.2241  0.1340  0.1117  28  ARG A CB  
48   C CG  . ARG A 6   ? 1.4075 1.1079 1.4097 0.1966  0.1585  0.1228  28  ARG A CG  
49   C CD  . ARG A 6   ? 1.4154 1.1218 1.4599 0.1792  0.1573  0.1166  28  ARG A CD  
50   N NE  . ARG A 6   ? 1.5968 1.2644 1.6106 0.2040  0.1734  0.1286  28  ARG A NE  
51   C CZ  . ARG A 6   ? 1.6918 1.3593 1.7114 0.2046  0.1649  0.1210  28  ARG A CZ  
52   N NH1 . ARG A 6   ? 1.5368 1.2401 1.5921 0.1815  0.1415  0.1011  28  ARG A NH1 
53   N NH2 . ARG A 6   ? 1.7215 1.3474 1.7056 0.2311  0.1821  0.1344  28  ARG A NH2 
54   N N   . GLN A 7   ? 1.2330 0.9652 1.1119 0.2546  0.0844  0.0859  29  GLN A N   
55   C CA  . GLN A 7   ? 1.3306 1.0557 1.1768 0.2692  0.0813  0.0877  29  GLN A CA  
56   C C   . GLN A 7   ? 1.2732 1.0439 1.1619 0.2391  0.0660  0.0731  29  GLN A C   
57   O O   . GLN A 7   ? 1.2232 0.9914 1.1078 0.2352  0.0757  0.0812  29  GLN A O   
58   C CB  . GLN A 7   ? 1.4707 1.1778 1.2584 0.3107  0.0565  0.0757  29  GLN A CB  
59   C CG  . GLN A 7   ? 1.6697 1.3140 1.3883 0.3517  0.0765  0.0958  29  GLN A CG  
60   C CD  . GLN A 7   ? 1.8667 1.4973 1.5448 0.3877  0.0467  0.0790  29  GLN A CD  
61   O OE1 . GLN A 7   ? 1.8636 1.5325 1.5658 0.3858  0.0084  0.0499  29  GLN A OE1 
62   N NE2 . GLN A 7   ? 2.0282 1.6021 1.6479 0.4218  0.0655  0.0968  29  GLN A NE2 
63   N N   . ILE A 8   ? 1.1928 1.0014 1.1205 0.2191  0.0451  0.0526  30  ILE A N   
64   C CA  . ILE A 8   ? 1.1701 1.0163 1.1337 0.1928  0.0335  0.0392  30  ILE A CA  
65   C C   . ILE A 8   ? 1.1345 0.9797 1.1240 0.1674  0.0552  0.0546  30  ILE A C   
66   O O   . ILE A 8   ? 1.0950 0.9481 1.0894 0.1582  0.0572  0.0568  30  ILE A O   
67   C CB  . ILE A 8   ? 1.2194 1.0991 1.2213 0.1755  0.0163  0.0175  30  ILE A CB  
68   C CG1 . ILE A 8   ? 1.3975 1.2773 1.3889 0.1996  -0.0029 0.0017  30  ILE A CG1 
69   C CG2 . ILE A 8   ? 1.1417 1.0515 1.1689 0.1578  0.0055  0.0032  30  ILE A CG2 
70   C CD1 . ILE A 8   ? 1.4742 1.3382 1.4244 0.2352  -0.0204 -0.0047 30  ILE A CD1 
71   N N   . ILE A 9   ? 1.0943 0.9280 1.1026 0.1582  0.0701  0.0638  31  ILE A N   
72   C CA  . ILE A 9   ? 1.0065 0.8389 1.0502 0.1356  0.0866  0.0739  31  ILE A CA  
73   C C   . ILE A 9   ? 1.0796 0.8881 1.1126 0.1447  0.1098  0.0931  31  ILE A C   
74   O O   . ILE A 9   ? 1.0759 0.8947 1.1358 0.1277  0.1140  0.0949  31  ILE A O   
75   C CB  . ILE A 9   ? 0.9558 0.7778 1.0256 0.1274  0.0959  0.0772  31  ILE A CB  
76   C CG1 . ILE A 9   ? 0.9423 0.7875 1.0241 0.1164  0.0752  0.0581  31  ILE A CG1 
77   C CG2 . ILE A 9   ? 0.9227 0.7419 1.0371 0.1072  0.1094  0.0840  31  ILE A CG2 
78   C CD1 . ILE A 9   ? 0.9790 0.8152 1.0842 0.1087  0.0797  0.0578  31  ILE A CD1 
79   N N   . GLU A 10  ? 1.1417 0.9149 1.1331 0.1734  0.1258  0.1073  32  GLU A N   
80   C CA  . GLU A 10  ? 1.2148 0.9571 1.1880 0.1870  0.1542  0.1278  32  GLU A CA  
81   C C   . GLU A 10  ? 1.1865 0.9420 1.1403 0.1899  0.1425  0.1226  32  GLU A C   
82   O O   . GLU A 10  ? 1.1832 0.9332 1.1520 0.1830  0.1608  0.1335  32  GLU A O   
83   C CB  . GLU A 10  ? 1.3577 1.0494 1.2761 0.2230  0.1762  0.1451  32  GLU A CB  
84   C CG  . GLU A 10  ? 1.4661 1.1357 1.4143 0.2175  0.2023  0.1577  32  GLU A CG  
85   C CD  . GLU A 10  ? 1.6770 1.2907 1.5654 0.2552  0.2266  0.1761  32  GLU A CD  
86   O OE1 . GLU A 10  ? 1.7537 1.3288 1.5901 0.2826  0.2478  0.1922  32  GLU A OE1 
87   O OE2 . GLU A 10  ? 1.6784 1.2828 1.5679 0.2590  0.2256  0.1749  32  GLU A OE2 
88   N N   . LYS A 11  ? 1.1792 0.9538 1.1080 0.1987  0.1117  0.1042  33  LYS A N   
89   C CA  . LYS A 11  ? 1.1674 0.9560 1.0825 0.2007  0.0980  0.0964  33  LYS A CA  
90   C C   . LYS A 11  ? 1.0982 0.9185 1.0650 0.1657  0.0967  0.0920  33  LYS A C   
91   O O   . LYS A 11  ? 1.0566 0.8779 1.0220 0.1632  0.1022  0.0967  33  LYS A O   
92   C CB  . LYS A 11  ? 1.2627 1.0682 1.1566 0.2149  0.0638  0.0733  33  LYS A CB  
93   C CG  . LYS A 11  ? 1.5352 1.3339 1.3926 0.2347  0.0531  0.0689  33  LYS A CG  
94   C CD  . LYS A 11  ? 1.6875 1.5092 1.5430 0.2446  0.0159  0.0407  33  LYS A CD  
95   C CE  . LYS A 11  ? 1.7428 1.5737 1.5912 0.2466  0.0042  0.0324  33  LYS A CE  
96   N NZ  . LYS A 11  ? 1.7708 1.6244 1.6295 0.2560  -0.0322 0.0020  33  LYS A NZ  
97   N N   . ALA A 12  ? 0.9919 0.8335 1.0002 0.1414  0.0897  0.0835  34  ALA A N   
98   C CA  . ALA A 12  ? 0.9692 0.8334 1.0193 0.1127  0.0864  0.0786  34  ALA A CA  
99   C C   . ALA A 12  ? 0.9960 0.8451 1.0737 0.1056  0.1104  0.0946  34  ALA A C   
100  O O   . ALA A 12  ? 0.9833 0.8434 1.0795 0.0934  0.1095  0.0938  34  ALA A O   
101  C CB  . ALA A 12  ? 0.9304 0.8125 1.0077 0.0942  0.0730  0.0651  34  ALA A CB  
102  N N   . ILE A 13  ? 0.9955 0.8187 1.0803 0.1138  0.1330  0.1084  35  ILE A N   
103  C CA  . ILE A 13  ? 0.9924 0.7994 1.1162 0.1077  0.1607  0.1230  35  ILE A CA  
104  C C   . ILE A 13  ? 1.0901 0.8806 1.1878 0.1229  0.1795  0.1368  35  ILE A C   
105  O O   . ILE A 13  ? 1.0444 0.8389 1.1801 0.1110  0.1907  0.1408  35  ILE A O   
106  C CB  . ILE A 13  ? 1.0692 0.8483 1.2105 0.1138  0.1854  0.1352  35  ILE A CB  
107  C CG1 . ILE A 13  ? 1.0723 0.8689 1.2487 0.0957  0.1659  0.1199  35  ILE A CG1 
108  C CG2 . ILE A 13  ? 1.0806 0.8404 1.2713 0.1090  0.2199  0.1504  35  ILE A CG2 
109  C CD1 . ILE A 13  ? 1.0848 0.8563 1.2673 0.1039  0.1830  0.1281  35  ILE A CD1 
110  N N   . GLU A 14  ? 1.1835 0.9545 1.2158 0.1509  0.1800  0.1418  36  GLU A N   
111  C CA  . GLU A 14  ? 1.2282 0.9779 1.2218 0.1708  0.1955  0.1536  36  GLU A CA  
112  C C   . GLU A 14  ? 1.1707 0.9534 1.1772 0.1548  0.1735  0.1405  36  GLU A C   
113  O O   . GLU A 14  ? 1.2498 1.0263 1.2632 0.1547  0.1893  0.1494  36  GLU A O   
114  C CB  . GLU A 14  ? 1.3478 1.0666 1.2608 0.2092  0.1922  0.1568  36  GLU A CB  
115  C CG  . GLU A 14  ? 1.5526 1.2157 1.4318 0.2369  0.2320  0.1812  36  GLU A CG  
116  C CD  . GLU A 14  ? 1.7080 1.3465 1.5278 0.2669  0.2203  0.1785  36  GLU A CD  
117  O OE1 . GLU A 14  ? 1.8323 1.4733 1.6007 0.2882  0.1897  0.1641  36  GLU A OE1 
118  O OE2 . GLU A 14  ? 1.6555 1.2715 1.4831 0.2701  0.2403  0.1892  36  GLU A OE2 
119  N N   . ARG A 15  ? 1.1187 0.9344 1.1299 0.1417  0.1396  0.1197  37  ARG A N   
120  C CA  . ARG A 15  ? 1.0241 0.8685 1.0460 0.1265  0.1196  0.1068  37  ARG A CA  
121  C C   . ARG A 15  ? 1.0253 0.8840 1.1029 0.1005  0.1247  0.1074  37  ARG A C   
122  O O   . ARG A 15  ? 1.0213 0.8879 1.1049 0.0950  0.1236  0.1071  37  ARG A O   
123  C CB  . ARG A 15  ? 0.9186 0.7896 0.9369 0.1191  0.0889  0.0856  37  ARG A CB  
124  C CG  . ARG A 15  ? 0.9124 0.8052 0.9310 0.1102  0.0718  0.0733  37  ARG A CG  
125  C CD  . ARG A 15  ? 0.8755 0.7934 0.9058 0.0977  0.0493  0.0533  37  ARG A CD  
126  N NE  . ARG A 15  ? 0.9110 0.8456 0.9472 0.0869  0.0390  0.0439  37  ARG A NE  
127  C CZ  . ARG A 15  ? 0.9099 0.8629 0.9635 0.0709  0.0276  0.0296  37  ARG A CZ  
128  N NH1 . ARG A 15  ? 0.9395 0.8979 1.0056 0.0640  0.0244  0.0223  37  ARG A NH1 
129  N NH2 . ARG A 15  ? 0.8711 0.8338 0.9284 0.0624  0.0225  0.0235  37  ARG A NH2 
130  N N   . LYS A 16  ? 1.0138 0.8747 1.1327 0.0861  0.1275  0.1063  38  LYS A N   
131  C CA  . LYS A 16  ? 1.0019 0.8739 1.1763 0.0653  0.1266  0.1028  38  LYS A CA  
132  C C   . LYS A 16  ? 1.0478 0.9027 1.2443 0.0710  0.1561  0.1190  38  LYS A C   
133  O O   . LYS A 16  ? 1.1500 1.0151 1.3677 0.0627  0.1535  0.1166  38  LYS A O   
134  C CB  . LYS A 16  ? 0.9891 0.8623 1.2035 0.0531  0.1219  0.0962  38  LYS A CB  
135  C CG  . LYS A 16  ? 1.0413 0.9221 1.3183 0.0357  0.1166  0.0888  38  LYS A CG  
136  C CD  . LYS A 16  ? 1.1012 0.9747 1.4241 0.0291  0.1183  0.0846  38  LYS A CD  
137  C CE  . LYS A 16  ? 1.2346 1.1044 1.6332 0.0207  0.1301  0.0848  38  LYS A CE  
138  N NZ  . LYS A 16  ? 1.3183 1.1801 1.7732 0.0144  0.1320  0.0786  38  LYS A NZ  
139  N N   . ASN A 17  ? 1.0619 0.8872 1.2514 0.0870  0.1869  0.1361  39  ASN A N   
140  C CA  . ASN A 17  ? 1.0751 0.8782 1.2923 0.0928  0.2237  0.1535  39  ASN A CA  
141  C C   . ASN A 17  ? 1.1372 0.9352 1.3160 0.1054  0.2297  0.1600  39  ASN A C   
142  O O   . ASN A 17  ? 1.2596 1.0505 1.4738 0.1033  0.2532  0.1690  39  ASN A O   
143  C CB  . ASN A 17  ? 1.1179 0.8815 1.3243 0.1113  0.2611  0.1730  39  ASN A CB  
144  C CG  . ASN A 17  ? 1.1260 0.8924 1.3908 0.0962  0.2620  0.1678  39  ASN A CG  
145  O OD1 . ASN A 17  ? 1.2109 1.0022 1.5423 0.0728  0.2448  0.1527  39  ASN A OD1 
146  N ND2 . ASN A 17  ? 1.1739 0.9128 1.4110 0.1116  0.2792  0.1785  39  ASN A ND2 
147  N N   . GLU A 18  ? 1.0760 0.8780 1.1890 0.1184  0.2083  0.1538  40  GLU A N   
148  C CA  . GLU A 18  ? 1.2063 1.0020 1.2822 0.1317  0.2115  0.1580  40  GLU A CA  
149  C C   . GLU A 18  ? 1.1626 0.9935 1.2649 0.1102  0.1850  0.1424  40  GLU A C   
150  O O   . GLU A 18  ? 1.1959 1.0248 1.3052 0.1112  0.1957  0.1477  40  GLU A O   
151  C CB  . GLU A 18  ? 1.3493 1.1253 1.3440 0.1615  0.2034  0.1583  40  GLU A CB  
152  C CG  . GLU A 18  ? 1.4989 1.3043 1.4707 0.1573  0.1623  0.1364  40  GLU A CG  
153  C CD  . GLU A 18  ? 1.7603 1.5419 1.6599 0.1913  0.1538  0.1347  40  GLU A CD  
154  O OE1 . GLU A 18  ? 1.9152 1.6747 1.7732 0.2129  0.1622  0.1412  40  GLU A OE1 
155  O OE2 . GLU A 18  ? 1.9361 1.7179 1.8196 0.1989  0.1385  0.1262  40  GLU A OE2 
156  N N   . ILE A 19  ? 1.0764 0.9357 1.1926 0.0920  0.1535  0.1242  41  ILE A N   
157  C CA  . ILE A 19  ? 1.0950 0.9801 1.2315 0.0739  0.1317  0.1111  41  ILE A CA  
158  C C   . ILE A 19  ? 1.0898 0.9808 1.2918 0.0574  0.1379  0.1111  41  ILE A C   
159  O O   . ILE A 19  ? 1.0898 0.9944 1.3058 0.0481  0.1256  0.1039  41  ILE A O   
160  C CB  . ILE A 19  ? 1.1147 1.0211 1.2418 0.0619  0.1008  0.0927  41  ILE A CB  
161  C CG1 . ILE A 19  ? 1.1546 1.0643 1.3159 0.0493  0.0957  0.0874  41  ILE A CG1 
162  C CG2 . ILE A 19  ? 1.1003 1.0051 1.1775 0.0774  0.0915  0.0880  41  ILE A CG2 
163  C CD1 . ILE A 19  ? 1.2671 1.1928 1.4204 0.0374  0.0701  0.0705  41  ILE A CD1 
164  N N   . GLU A 20  ? 1.0530 0.9332 1.2988 0.0548  0.1558  0.1174  42  GLU A N   
165  C CA  . GLU A 20  ? 1.0815 0.9650 1.4009 0.0430  0.1649  0.1165  42  GLU A CA  
166  C C   . GLU A 20  ? 1.1100 0.9830 1.4364 0.0517  0.1915  0.1298  42  GLU A C   
167  O O   . GLU A 20  ? 1.1457 1.0256 1.5358 0.0420  0.1960  0.1264  42  GLU A O   
168  C CB  . GLU A 20  ? 1.1434 1.0136 1.5150 0.0408  0.1851  0.1215  42  GLU A CB  
169  C CG  . GLU A 20  ? 1.1747 1.0585 1.5833 0.0256  0.1571  0.1029  42  GLU A CG  
170  C CD  . GLU A 20  ? 1.4329 1.2993 1.8741 0.0276  0.1790  0.1100  42  GLU A CD  
171  O OE1 . GLU A 20  ? 1.4609 1.3056 1.9304 0.0353  0.2194  0.1274  42  GLU A OE1 
172  O OE2 . GLU A 20  ? 1.5156 1.3865 1.9523 0.0225  0.1589  0.0991  42  GLU A OE2 
173  N N   . THR A 21  ? 1.1411 0.9955 1.4036 0.0719  0.2082  0.1435  43  THR A N   
174  C CA  . THR A 21  ? 1.1151 0.9528 1.3724 0.0845  0.2369  0.1578  43  THR A CA  
175  C C   . THR A 21  ? 1.0804 0.9300 1.2918 0.0880  0.2161  0.1512  43  THR A C   
176  O O   . THR A 21  ? 1.1169 0.9483 1.3025 0.1039  0.2376  0.1631  43  THR A O   
177  C CB  . THR A 21  ? 1.1590 0.9548 1.3663 0.1123  0.2755  0.1800  43  THR A CB  
178  O OG1 . THR A 21  ? 1.1384 0.9284 1.2601 0.1301  0.2554  0.1767  43  THR A OG1 
179  C CG2 . THR A 21  ? 1.1440 0.9231 1.3851 0.1114  0.2977  0.1879  43  THR A CG2 
180  N N   . LEU A 22  ? 0.9969 0.8727 1.1962 0.0749  0.1772  0.1328  44  LEU A N   
181  C CA  . LEU A 22  ? 0.9941 0.8815 1.1607 0.0755  0.1584  0.1252  44  LEU A CA  
182  C C   . LEU A 22  ? 1.0101 0.9053 1.2242 0.0662  0.1635  0.1250  44  LEU A C   
183  O O   . LEU A 22  ? 0.9607 0.8690 1.2346 0.0500  0.1546  0.1166  44  LEU A O   
184  C CB  . LEU A 22  ? 1.0069 0.9166 1.1586 0.0624  0.1222  0.1066  44  LEU A CB  
185  C CG  . LEU A 22  ? 1.0439 0.9504 1.1492 0.0723  0.1127  0.1027  44  LEU A CG  
186  C CD1 . LEU A 22  ? 0.9723 0.8987 1.0834 0.0556  0.0855  0.0858  44  LEU A CD1 
187  C CD2 . LEU A 22  ? 1.0371 0.9343 1.0880 0.0922  0.1112  0.1033  44  LEU A CD2 
188  N N   . PRO A 23  ? 1.0679 0.9543 1.2561 0.0782  0.1750  0.1322  45  PRO A N   
189  C CA  . PRO A 23  ? 1.0546 0.9447 1.2894 0.0729  0.1862  0.1345  45  PRO A CA  
190  C C   . PRO A 23  ? 0.9546 0.8701 1.2040 0.0566  0.1516  0.1168  45  PRO A C   
191  O O   . PRO A 23  ? 0.8956 0.8129 1.1261 0.0602  0.1483  0.1162  45  PRO A O   
192  C CB  . PRO A 23  ? 1.1496 1.0154 1.3343 0.0961  0.2114  0.1493  45  PRO A CB  
193  C CG  . PRO A 23  ? 1.1484 1.0139 1.2591 0.1062  0.1873  0.1418  45  PRO A CG  
194  C CD  . PRO A 23  ? 1.1102 0.9830 1.2238 0.0985  0.1735  0.1352  45  PRO A CD  
195  N N   . PHE A 24  ? 0.9087 0.8390 1.1872 0.0410  0.1267  0.1027  46  PHE A N   
196  C CA  . PHE A 24  ? 0.9141 0.8597 1.2044 0.0289  0.0957  0.0865  46  PHE A CA  
197  C C   . PHE A 24  ? 0.9273 0.8765 1.2632 0.0280  0.1005  0.0860  46  PHE A C   
198  O O   . PHE A 24  ? 1.0292 0.9841 1.3490 0.0260  0.0827  0.0785  46  PHE A O   
199  C CB  . PHE A 24  ? 0.8919 0.8437 1.2136 0.0176  0.0732  0.0725  46  PHE A CB  
200  C CG  . PHE A 24  ? 0.8612 0.8126 1.1361 0.0155  0.0589  0.0674  46  PHE A CG  
201  C CD1 . PHE A 24  ? 0.9169 0.8711 1.1528 0.0114  0.0356  0.0567  46  PHE A CD1 
202  C CD2 . PHE A 24  ? 0.8962 0.8423 1.1697 0.0181  0.0708  0.0732  46  PHE A CD2 
203  C CE1 . PHE A 24  ? 0.9105 0.8634 1.1114 0.0092  0.0267  0.0517  46  PHE A CE1 
204  C CE2 . PHE A 24  ? 0.9384 0.8854 1.1750 0.0162  0.0578  0.0672  46  PHE A CE2 
205  C CZ  . PHE A 24  ? 0.9315 0.8826 1.1344 0.0114  0.0366  0.0563  46  PHE A CZ  
206  N N   . ASP A 25  ? 1.0028 0.9474 1.3998 0.0296  0.1261  0.0934  47  ASP A N   
207  C CA  . ASP A 25  ? 0.9961 0.9460 1.4553 0.0279  0.1320  0.0905  47  ASP A CA  
208  C C   . ASP A 25  ? 0.9648 0.9050 1.3972 0.0399  0.1584  0.1052  47  ASP A C   
209  O O   . ASP A 25  ? 0.9989 0.9470 1.4449 0.0385  0.1478  0.0989  47  ASP A O   
210  C CB  . ASP A 25  ? 1.0589 1.0080 1.6091 0.0239  0.1520  0.0907  47  ASP A CB  
211  C CG  . ASP A 25  ? 1.1523 1.1096 1.7330 0.0136  0.1228  0.0734  47  ASP A CG  
212  O OD1 . ASP A 25  ? 1.0323 1.0005 1.6223 0.0080  0.0828  0.0530  47  ASP A OD1 
213  O OD2 . ASP A 25  ? 1.3118 1.2605 1.8998 0.0136  0.1395  0.0804  47  ASP A OD2 
214  N N   . GLN A 26  ? 0.9861 0.9056 1.3767 0.0543  0.1916  0.1240  48  GLN A N   
215  C CA  . GLN A 26  ? 1.0118 0.9156 1.3547 0.0707  0.2128  0.1370  48  GLN A CA  
216  C C   . GLN A 26  ? 1.0017 0.9177 1.2914 0.0683  0.1782  0.1252  48  GLN A C   
217  O O   . GLN A 26  ? 1.0028 0.9186 1.2876 0.0727  0.1806  0.1260  48  GLN A O   
218  C CB  . GLN A 26  ? 1.1094 0.9828 1.3903 0.0920  0.2432  0.1554  48  GLN A CB  
219  C CG  . GLN A 26  ? 1.2318 1.0822 1.5554 0.0992  0.2892  0.1724  48  GLN A CG  
220  C CD  . GLN A 26  ? 1.3440 1.1969 1.6874 0.0908  0.2840  0.1695  48  GLN A CD  
221  O OE1 . GLN A 26  ? 1.2727 1.1523 1.6460 0.0715  0.2473  0.1512  48  GLN A OE1 
222  N NE2 . GLN A 26  ? 1.3849 1.2049 1.7065 0.1076  0.3220  0.1882  48  GLN A NE2 
223  N N   . ASN A 27  ? 1.0022 0.9275 1.2561 0.0612  0.1487  0.1143  49  ASN A N   
224  C CA  . ASN A 27  ? 0.9820 0.9166 1.1927 0.0572  0.1193  0.1026  49  ASN A CA  
225  C C   . ASN A 27  ? 0.9284 0.8752 1.1768 0.0470  0.1019  0.0923  49  ASN A C   
226  O O   . ASN A 27  ? 0.9278 0.8738 1.1604 0.0511  0.1006  0.0923  49  ASN A O   
227  C CB  . ASN A 27  ? 0.9292 0.8706 1.1114 0.0493  0.0954  0.0922  49  ASN A CB  
228  C CG  . ASN A 27  ? 0.9318 0.8797 1.0786 0.0440  0.0709  0.0805  49  ASN A CG  
229  O OD1 . ASN A 27  ? 0.9337 0.8874 1.0788 0.0328  0.0504  0.0695  49  ASN A OD1 
230  N ND2 . ASN A 27  ? 0.9420 0.8851 1.0595 0.0533  0.0751  0.0829  49  ASN A ND2 
231  N N   . LEU A 28  ? 0.8894 0.8451 1.1868 0.0358  0.0867  0.0822  50  LEU A N   
232  C CA  . LEU A 28  ? 0.8620 0.8258 1.1945 0.0297  0.0641  0.0690  50  LEU A CA  
233  C C   . LEU A 28  ? 0.8203 0.7857 1.2031 0.0344  0.0820  0.0736  50  LEU A C   
234  O O   . LEU A 28  ? 0.8194 0.7890 1.2097 0.0340  0.0652  0.0651  50  LEU A O   
235  C CB  . LEU A 28  ? 0.8837 0.8523 1.2594 0.0216  0.0419  0.0548  50  LEU A CB  
236  C CG  . LEU A 28  ? 0.9152 0.8799 1.2415 0.0170  0.0180  0.0463  50  LEU A CG  
237  C CD1 . LEU A 28  ? 0.9461 0.9108 1.3132 0.0130  -0.0046 0.0312  50  LEU A CD1 
238  C CD2 . LEU A 28  ? 0.9181 0.8773 1.1905 0.0176  -0.0005 0.0405  50  LEU A CD2 
239  N N   . ALA A 29  ? 0.8393 0.7985 1.2562 0.0403  0.1183  0.0875  51  ALA A N   
240  C CA  . ALA A 29  ? 0.8441 0.8016 1.3112 0.0461  0.1437  0.0940  51  ALA A CA  
241  C C   . ALA A 29  ? 0.9054 0.8568 1.3182 0.0555  0.1475  0.1000  51  ALA A C   
242  O O   . ALA A 29  ? 0.9536 0.9066 1.4042 0.0588  0.1582  0.1006  51  ALA A O   
243  C CB  . ALA A 29  ? 0.8337 0.7767 1.3349 0.0534  0.1909  0.1116  51  ALA A CB  
244  N N   . GLN A 30  ? 0.9381 0.8824 1.2682 0.0601  0.1386  0.1026  52  GLN A N   
245  C CA  . GLN A 30  ? 0.8910 0.8299 1.1716 0.0684  0.1365  0.1044  52  GLN A CA  
246  C C   . GLN A 30  ? 0.8909 0.8424 1.1908 0.0598  0.1074  0.0899  52  GLN A C   
247  O O   . GLN A 30  ? 0.9403 0.8893 1.2380 0.0660  0.1131  0.0918  52  GLN A O   
248  C CB  . GLN A 30  ? 0.8830 0.8153 1.0864 0.0730  0.1250  0.1036  52  GLN A CB  
249  C CG  . GLN A 30  ? 0.9493 0.8626 1.1145 0.0892  0.1505  0.1170  52  GLN A CG  
250  C CD  . GLN A 30  ? 1.0186 0.9308 1.1210 0.0921  0.1295  0.1094  52  GLN A CD  
251  O OE1 . GLN A 30  ? 1.0282 0.9522 1.1333 0.0792  0.1090  0.0998  52  GLN A OE1 
252  N NE2 . GLN A 30  ? 1.0010 0.8980 1.0500 0.1099  0.1334  0.1115  52  GLN A NE2 
253  N N   . LEU A 31  ? 0.8395 0.8001 1.1531 0.0482  0.0766  0.0755  53  LEU A N   
254  C CA  . LEU A 31  ? 0.8963 0.8616 1.2227 0.0443  0.0474  0.0612  53  LEU A CA  
255  C C   . LEU A 31  ? 0.9774 0.9499 1.3793 0.0470  0.0529  0.0576  53  LEU A C   
256  O O   . LEU A 31  ? 1.0069 0.9800 1.4103 0.0497  0.0388  0.0507  53  LEU A O   
257  C CB  . LEU A 31  ? 0.8655 0.8309 1.1877 0.0368  0.0152  0.0466  53  LEU A CB  
258  C CG  . LEU A 31  ? 0.8955 0.8534 1.1494 0.0331  0.0070  0.0468  53  LEU A CG  
259  C CD1 . LEU A 31  ? 0.9035 0.8553 1.1530 0.0288  -0.0213 0.0331  53  LEU A CD1 
260  C CD2 . LEU A 31  ? 0.9508 0.9015 1.1495 0.0354  0.0054  0.0485  53  LEU A CD2 
261  N N   . SER A 32  ? 1.0328 1.0100 1.5016 0.0464  0.0748  0.0616  54  SER A N   
262  C CA  . SER A 32  ? 1.0346 1.0194 1.5905 0.0487  0.0874  0.0583  54  SER A CA  
263  C C   . SER A 32  ? 0.9552 0.9330 1.4993 0.0588  0.1182  0.0723  54  SER A C   
264  O O   . SER A 32  ? 0.9991 0.9840 1.6022 0.0609  0.1197  0.0662  54  SER A O   
265  C CB  . SER A 32  ? 1.0341 1.0229 1.6713 0.0451  0.1105  0.0603  54  SER A CB  
266  O OG  . SER A 32  ? 1.0685 1.0426 1.6887 0.0522  0.1598  0.0838  54  SER A OG  
267  N N   . LYS A 33  ? 0.9842 0.9469 1.4531 0.0669  0.1405  0.0890  55  LYS A N   
268  C CA  . LYS A 33  ? 1.0165 0.9673 1.4592 0.0799  0.1664  0.1011  55  LYS A CA  
269  C C   . LYS A 33  ? 1.0009 0.9548 1.4022 0.0799  0.1367  0.0914  55  LYS A C   
270  O O   . LYS A 33  ? 1.0135 0.9576 1.3872 0.0907  0.1523  0.0989  55  LYS A O   
271  C CB  . LYS A 33  ? 1.1411 1.0692 1.5114 0.0935  0.1958  0.1194  55  LYS A CB  
272  C CG  . LYS A 33  ? 1.2403 1.1553 1.6432 0.0990  0.2361  0.1341  55  LYS A CG  
273  C CD  . LYS A 33  ? 1.4203 1.3197 1.8642 0.1120  0.2838  0.1486  55  LYS A CD  
274  C CE  . LYS A 33  ? 1.4874 1.3823 2.0138 0.1095  0.3208  0.1567  55  LYS A CE  
275  N NZ  . LYS A 33  ? 1.4856 1.3678 1.9723 0.1110  0.3264  0.1643  55  LYS A NZ  
276  N N   . LEU A 34  ? 0.9527 0.9157 1.3442 0.0698  0.0959  0.0753  56  LEU A N   
277  C CA  . LEU A 34  ? 0.9672 0.9293 1.3277 0.0699  0.0684  0.0654  56  LEU A CA  
278  C C   . LEU A 34  ? 1.0023 0.9752 1.4330 0.0671  0.0440  0.0489  56  LEU A C   
279  O O   . LEU A 34  ? 1.2390 1.2215 1.7476 0.0660  0.0552  0.0467  56  LEU A O   
280  C CB  . LEU A 34  ? 0.9382 0.8940 1.2272 0.0641  0.0440  0.0603  56  LEU A CB  
281  C CG  . LEU A 34  ? 0.9331 0.8818 1.1677 0.0662  0.0609  0.0709  56  LEU A CG  
282  C CD1 . LEU A 34  ? 0.8845 0.8303 1.0717 0.0580  0.0387  0.0635  56  LEU A CD1 
283  C CD2 . LEU A 34  ? 0.9637 0.9021 1.1589 0.0782  0.0790  0.0796  56  LEU A CD2 
284  N N   . ASN A 35  ? 1.0072 0.9760 1.4136 0.0677  0.0105  0.0361  57  ASN A N   
285  C CA  . ASN A 35  ? 1.0728 1.0473 1.5380 0.0696  -0.0203 0.0167  57  ASN A CA  
286  C C   . ASN A 35  ? 1.1267 1.0997 1.5963 0.0652  -0.0467 0.0045  57  ASN A C   
287  O O   . ASN A 35  ? 1.2617 1.2190 1.6683 0.0662  -0.0726 -0.0016 57  ASN A O   
288  C CB  . ASN A 35  ? 1.1069 1.0701 1.5358 0.0767  -0.0469 0.0077  57  ASN A CB  
289  C CG  . ASN A 35  ? 1.1157 1.0801 1.5427 0.0820  -0.0229 0.0181  57  ASN A CG  
290  O OD1 . ASN A 35  ? 1.1567 1.1328 1.6472 0.0843  0.0036  0.0235  57  ASN A OD1 
291  N ND2 . ASN A 35  ? 1.0902 1.0402 1.4460 0.0846  -0.0291 0.0213  57  ASN A ND2 
292  N N   . LEU A 36  ? 1.0808 1.0666 1.6246 0.0615  -0.0382 0.0011  58  LEU A N   
293  C CA  . LEU A 36  ? 1.1009 1.0853 1.6608 0.0594  -0.0677 -0.0145 58  LEU A CA  
294  C C   . LEU A 36  ? 1.0595 1.0392 1.6504 0.0696  -0.1160 -0.0415 58  LEU A C   
295  O O   . LEU A 36  ? 0.9384 0.9304 1.6216 0.0716  -0.1298 -0.0589 58  LEU A O   
296  C CB  . LEU A 36  ? 1.2407 1.2386 1.8742 0.0524  -0.0436 -0.0109 58  LEU A CB  
297  C CG  . LEU A 36  ? 1.2963 1.2885 1.8801 0.0452  -0.0310 0.0005  58  LEU A CG  
298  C CD1 . LEU A 36  ? 1.2689 1.2714 1.9332 0.0398  -0.0090 0.0020  58  LEU A CD1 
299  C CD2 . LEU A 36  ? 1.2776 1.2559 1.7990 0.0459  -0.0695 -0.0118 58  LEU A CD2 
300  N N   . LYS A 37  ? 1.0143 0.9729 1.5270 0.0777  -0.1413 -0.0457 59  LYS A N   
301  C CA  . LYS A 37  ? 0.9907 0.9308 1.4938 0.0926  -0.1910 -0.0699 59  LYS A CA  
302  C C   . LYS A 37  ? 1.0066 0.9128 1.3920 0.0980  -0.2037 -0.0651 59  LYS A C   
303  O O   . LYS A 37  ? 0.9904 0.8931 1.3164 0.0884  -0.1750 -0.0453 59  LYS A O   
304  C CB  . LYS A 37  ? 1.0479 0.9933 1.5995 0.1035  -0.2057 -0.0820 59  LYS A CB  
305  C CG  . LYS A 37  ? 1.1402 1.1135 1.8240 0.1029  -0.2065 -0.0971 59  LYS A CG  
306  C CD  . LYS A 37  ? 1.2401 1.2144 1.9799 0.1192  -0.2426 -0.1219 59  LYS A CD  
307  C CE  . LYS A 37  ? 1.2356 1.2050 1.9359 0.1232  -0.2288 -0.1097 59  LYS A CE  
308  N NZ  . LYS A 37  ? 1.1392 1.1239 1.8393 0.1084  -0.1705 -0.0805 59  LYS A NZ  
309  N N   . GLY A 38  ? 1.0270 0.9047 1.3795 0.1156  -0.2462 -0.0844 60  GLY A N   
310  C CA  . GLY A 38  ? 1.0137 0.8507 1.2548 0.1249  -0.2544 -0.0795 60  GLY A CA  
311  C C   . GLY A 38  ? 1.0555 0.8828 1.2381 0.1138  -0.2332 -0.0655 60  GLY A C   
312  O O   . GLY A 38  ? 1.0194 0.8544 1.2274 0.1097  -0.2375 -0.0707 60  GLY A O   
313  N N   . GLU A 39  ? 1.1000 0.9108 1.2096 0.1087  -0.2100 -0.0488 61  GLU A N   
314  C CA  . GLU A 39  ? 1.0563 0.8557 1.1115 0.0993  -0.1896 -0.0371 61  GLU A CA  
315  C C   . GLU A 39  ? 1.0098 0.8477 1.1155 0.0802  -0.1623 -0.0267 61  GLU A C   
316  O O   . GLU A 39  ? 1.0531 0.8894 1.1444 0.0744  -0.1562 -0.0243 61  GLU A O   
317  C CB  . GLU A 39  ? 1.0719 0.8471 1.0547 0.0976  -0.1692 -0.0241 61  GLU A CB  
318  C CG  . GLU A 39  ? 1.1983 0.9222 1.1116 0.1190  -0.1907 -0.0314 61  GLU A CG  
319  C CD  . GLU A 39  ? 1.2777 0.9772 1.1328 0.1175  -0.1679 -0.0189 61  GLU A CD  
320  O OE1 . GLU A 39  ? 1.2277 0.9532 1.1094 0.1053  -0.1485 -0.0103 61  GLU A OE1 
321  O OE2 . GLU A 39  ? 1.3689 1.0183 1.1495 0.1308  -0.1688 -0.0180 61  GLU A OE2 
322  N N   . THR A 40  ? 0.8881 0.7563 1.0489 0.0732  -0.1451 -0.0202 62  THR A N   
323  C CA  . THR A 40  ? 0.8103 0.7080 1.0142 0.0603  -0.1175 -0.0094 62  THR A CA  
324  C C   . THR A 40  ? 0.8968 0.8047 1.1557 0.0596  -0.1294 -0.0194 62  THR A C   
325  O O   . THR A 40  ? 0.9308 0.8440 1.1848 0.0516  -0.1165 -0.0133 62  THR A O   
326  C CB  . THR A 40  ? 0.7960 0.7156 1.0479 0.0587  -0.0969 -0.0016 62  THR A CB  
327  O OG1 . THR A 40  ? 0.7842 0.6939 0.9908 0.0611  -0.0904 0.0045  62  THR A OG1 
328  C CG2 . THR A 40  ? 0.7649 0.7036 1.0401 0.0500  -0.0637 0.0126  62  THR A CG2 
329  N N   . LYS A 41  ? 0.9306 0.8406 1.2453 0.0688  -0.1560 -0.0368 63  LYS A N   
330  C CA  . LYS A 41  ? 0.9089 0.8283 1.2873 0.0690  -0.1710 -0.0505 63  LYS A CA  
331  C C   . LYS A 41  ? 0.9433 0.8375 1.2660 0.0745  -0.1941 -0.0592 63  LYS A C   
332  O O   . LYS A 41  ? 0.9362 0.8376 1.2844 0.0689  -0.1923 -0.0615 63  LYS A O   
333  C CB  . LYS A 41  ? 1.0279 0.9543 1.4848 0.0797  -0.1997 -0.0723 63  LYS A CB  
334  C CG  . LYS A 41  ? 1.1005 1.0395 1.6415 0.0791  -0.2150 -0.0896 63  LYS A CG  
335  C CD  . LYS A 41  ? 1.2327 1.1919 1.8878 0.0836  -0.2270 -0.1076 63  LYS A CD  
336  C CE  . LYS A 41  ? 1.2037 1.1703 1.9448 0.0865  -0.2544 -0.1330 63  LYS A CE  
337  N NZ  . LYS A 41  ? 1.2040 1.1745 1.9393 0.0733  -0.2310 -0.1209 63  LYS A NZ  
338  N N   . THR A 42  ? 0.9856 0.8461 1.2289 0.0869  -0.2131 -0.0633 64  THR A N   
339  C CA  . THR A 42  ? 1.0342 0.8627 1.2118 0.0949  -0.2291 -0.0690 64  THR A CA  
340  C C   . THR A 42  ? 1.0399 0.8784 1.1953 0.0782  -0.1960 -0.0517 64  THR A C   
341  O O   . THR A 42  ? 1.0808 0.9154 1.2392 0.0781  -0.2036 -0.0576 64  THR A O   
342  C CB  . THR A 42  ? 1.0690 0.8521 1.1528 0.1115  -0.2422 -0.0701 64  THR A CB  
343  O OG1 . THR A 42  ? 1.1308 0.9019 1.2324 0.1305  -0.2774 -0.0882 64  THR A OG1 
344  C CG2 . THR A 42  ? 1.0583 0.8007 1.0670 0.1225  -0.2521 -0.0737 64  THR A CG2 
345  N N   . LYS A 43  ? 1.0151 0.8662 1.1516 0.0658  -0.1623 -0.0326 65  LYS A N   
346  C CA  . LYS A 43  ? 0.9475 0.8065 1.0600 0.0526  -0.1340 -0.0184 65  LYS A CA  
347  C C   . LYS A 43  ? 0.8967 0.7856 1.0766 0.0436  -0.1229 -0.0161 65  LYS A C   
348  O O   . LYS A 43  ? 0.9674 0.8575 1.1392 0.0382  -0.1156 -0.0134 65  LYS A O   
349  C CB  . LYS A 43  ? 0.9853 0.8480 1.0638 0.0451  -0.1070 -0.0035 65  LYS A CB  
350  C CG  . LYS A 43  ? 0.9945 0.8400 1.0130 0.0403  -0.0920 0.0028  65  LYS A CG  
351  N N   . TYR A 44  ? 0.8393 0.7493 1.0875 0.0430  -0.1198 -0.0172 66  TYR A N   
352  C CA  . TYR A 44  ? 0.8121 0.7450 1.1301 0.0359  -0.1039 -0.0140 66  TYR A CA  
353  C C   . TYR A 44  ? 0.8483 0.7761 1.1958 0.0386  -0.1282 -0.0301 66  TYR A C   
354  O O   . TYR A 44  ? 0.8418 0.7756 1.2000 0.0319  -0.1158 -0.0254 66  TYR A O   
355  C CB  . TYR A 44  ? 0.8223 0.7722 1.2117 0.0371  -0.0950 -0.0140 66  TYR A CB  
356  C CG  . TYR A 44  ? 0.8351 0.8034 1.3067 0.0317  -0.0736 -0.0106 66  TYR A CG  
357  C CD1 . TYR A 44  ? 0.8769 0.8508 1.4268 0.0334  -0.0940 -0.0292 66  TYR A CD1 
358  C CD2 . TYR A 44  ? 0.8581 0.8344 1.3311 0.0273  -0.0321 0.0104  66  TYR A CD2 
359  C CE1 . TYR A 44  ? 0.8878 0.8763 1.5219 0.0276  -0.0686 -0.0253 66  TYR A CE1 
360  C CE2 . TYR A 44  ? 0.8246 0.8102 1.3685 0.0245  -0.0054 0.0165  66  TYR A CE2 
361  C CZ  . TYR A 44  ? 0.8789 0.8714 1.5071 0.0231  -0.0212 -0.0006 66  TYR A CZ  
362  O OH  . TYR A 44  ? 0.8389 0.8384 1.5443 0.0195  0.0105  0.0061  66  TYR A OH  
363  N N   . ASP A 45  ? 0.8892 0.8032 1.2476 0.0507  -0.1655 -0.0508 67  ASP A N   
364  C CA  . ASP A 45  ? 0.8734 0.7772 1.2538 0.0577  -0.1966 -0.0709 67  ASP A CA  
365  C C   . ASP A 45  ? 0.9005 0.7836 1.2049 0.0575  -0.1953 -0.0662 67  ASP A C   
366  O O   . ASP A 45  ? 0.9324 0.8185 1.2595 0.0543  -0.1976 -0.0709 67  ASP A O   
367  C CB  . ASP A 45  ? 0.8934 0.7772 1.2771 0.0771  -0.2429 -0.0962 67  ASP A CB  
368  C CG  . ASP A 45  ? 0.9601 0.8679 1.4482 0.0781  -0.2514 -0.1089 67  ASP A CG  
369  O OD1 . ASP A 45  ? 0.9270 0.8641 1.4941 0.0641  -0.2209 -0.0999 67  ASP A OD1 
370  O OD2 . ASP A 45  ? 1.0356 0.9295 1.5271 0.0949  -0.2879 -0.1287 67  ASP A OD2 
371  N N   . ALA A 46  ? 0.9474 0.8085 1.1656 0.0608  -0.1893 -0.0571 68  ALA A N   
372  C CA  . ALA A 46  ? 0.9729 0.8092 1.1200 0.0628  -0.1872 -0.0543 68  ALA A CA  
373  C C   . ALA A 46  ? 0.9304 0.7898 1.0925 0.0463  -0.1557 -0.0393 68  ALA A C   
374  O O   . ALA A 46  ? 1.0245 0.8749 1.1700 0.0463  -0.1578 -0.0420 68  ALA A O   
375  C CB  . ALA A 46  ? 0.9409 0.7469 1.0020 0.0691  -0.1805 -0.0468 68  ALA A CB  
376  N N   . MET A 47  ? 0.9262 0.8126 1.1180 0.0351  -0.1279 -0.0246 69  MET A N   
377  C CA  . MET A 47  ? 0.9268 0.8312 1.1267 0.0238  -0.0992 -0.0106 69  MET A CA  
378  C C   . MET A 47  ? 0.8584 0.7775 1.1249 0.0203  -0.0981 -0.0140 69  MET A C   
379  O O   . MET A 47  ? 0.8852 0.8081 1.1457 0.0151  -0.0846 -0.0078 69  MET A O   
380  C CB  . MET A 47  ? 0.9563 0.8764 1.1527 0.0184  -0.0720 0.0050  69  MET A CB  
381  C CG  . MET A 47  ? 0.9849 0.8914 1.1170 0.0190  -0.0680 0.0090  69  MET A CG  
382  S SD  . MET A 47  ? 1.0423 0.9632 1.1692 0.0165  -0.0447 0.0218  69  MET A SD  
383  C CE  . MET A 47  ? 1.0708 1.0062 1.2012 0.0119  -0.0227 0.0315  69  MET A CE  
384  N N   . LYS A 48  ? 0.8810 0.8076 1.2154 0.0235  -0.1118 -0.0251 70  LYS A N   
385  C CA  . LYS A 48  ? 0.8848 0.8217 1.2926 0.0204  -0.1128 -0.0323 70  LYS A CA  
386  C C   . LYS A 48  ? 0.8886 0.8086 1.2758 0.0251  -0.1391 -0.0472 70  LYS A C   
387  O O   . LYS A 48  ? 0.8909 0.8157 1.2972 0.0196  -0.1288 -0.0444 70  LYS A O   
388  C CB  . LYS A 48  ? 0.9509 0.8972 1.4442 0.0240  -0.1278 -0.0471 70  LYS A CB  
389  C CG  . LYS A 48  ? 0.9854 0.9480 1.5166 0.0204  -0.0984 -0.0333 70  LYS A CG  
390  C CD  . LYS A 48  ? 0.9908 0.9655 1.5650 0.0123  -0.0562 -0.0155 70  LYS A CD  
391  C CE  . LYS A 48  ? 1.0580 1.0443 1.7019 0.0122  -0.0309 -0.0091 70  LYS A CE  
392  N NZ  . LYS A 48  ? 1.0889 1.0760 1.7448 0.0091  0.0181  0.0143  70  LYS A NZ  
393  N N   . LYS A 49  ? 1.0135 0.9097 1.3592 0.0380  -0.1736 -0.0635 71  LYS A N   
394  C CA  . LYS A 49  ? 1.1345 1.0035 1.4361 0.0482  -0.2001 -0.0777 71  LYS A CA  
395  C C   . LYS A 49  ? 1.0915 0.9542 1.3324 0.0415  -0.1763 -0.0626 71  LYS A C   
396  O O   . LYS A 49  ? 1.0819 0.9398 1.3288 0.0417  -0.1820 -0.0686 71  LYS A O   
397  C CB  . LYS A 49  ? 1.2140 1.0478 1.4516 0.0676  -0.2327 -0.0916 71  LYS A CB  
398  C CG  . LYS A 49  ? 1.3055 1.1311 1.5920 0.0837  -0.2772 -0.1195 71  LYS A CG  
399  C CD  . LYS A 49  ? 1.4813 1.2616 1.6833 0.1084  -0.3095 -0.1320 71  LYS A CD  
400  C CE  . LYS A 49  ? 1.5094 1.2482 1.6567 0.1292  -0.3416 -0.1503 71  LYS A CE  
401  N NZ  . LYS A 49  ? 1.4411 1.1738 1.5428 0.1199  -0.3142 -0.1354 71  LYS A NZ  
402  N N   . ASP A 50  ? 1.0602 0.9224 1.2472 0.0365  -0.1519 -0.0456 72  ASP A N   
403  C CA  . ASP A 50  ? 1.0781 0.9395 1.2203 0.0291  -0.1273 -0.0323 72  ASP A CA  
404  C C   . ASP A 50  ? 1.0603 0.9458 1.2499 0.0188  -0.1090 -0.0248 72  ASP A C   
405  O O   . ASP A 50  ? 1.2390 1.1186 1.4078 0.0174  -0.1045 -0.0241 72  ASP A O   
406  C CB  . ASP A 50  ? 1.1446 1.0112 1.2505 0.0233  -0.1030 -0.0173 72  ASP A CB  
407  C CG  . ASP A 50  ? 1.3030 1.1384 1.3449 0.0326  -0.1110 -0.0206 72  ASP A CG  
408  O OD1 . ASP A 50  ? 1.5098 1.3134 1.5180 0.0460  -0.1329 -0.0326 72  ASP A OD1 
409  O OD2 . ASP A 50  ? 1.3969 1.2358 1.4193 0.0285  -0.0948 -0.0113 72  ASP A OD2 
410  N N   . ASN A 51  ? 0.9633 0.8720 1.2136 0.0132  -0.0958 -0.0183 73  ASN A N   
411  C CA  . ASN A 51  ? 0.9136 0.8386 1.2056 0.0062  -0.0735 -0.0087 73  ASN A CA  
412  C C   . ASN A 51  ? 0.9516 0.8723 1.2845 0.0069  -0.0886 -0.0215 73  ASN A C   
413  O O   . ASN A 51  ? 1.0333 0.9572 1.3695 0.0030  -0.0740 -0.0150 73  ASN A O   
414  C CB  . ASN A 51  ? 0.9077 0.8495 1.2495 0.0035  -0.0506 0.0026  73  ASN A CB  
415  C CG  . ASN A 51  ? 0.9624 0.9081 1.2597 0.0038  -0.0325 0.0166  73  ASN A CG  
416  O OD1 . ASN A 51  ? 1.0140 0.9549 1.2540 0.0034  -0.0300 0.0201  73  ASN A OD1 
417  N ND2 . ASN A 51  ? 1.0026 0.9561 1.3302 0.0051  -0.0193 0.0232  73  ASN A ND2 
418  N N   . VAL A 52  ? 0.9804 0.8928 1.3452 0.0136  -0.1200 -0.0415 74  VAL A N   
419  C CA  . VAL A 52  ? 1.0202 0.9236 1.4156 0.0173  -0.1430 -0.0592 74  VAL A CA  
420  C C   . VAL A 52  ? 1.0280 0.9088 1.3436 0.0227  -0.1514 -0.0612 74  VAL A C   
421  O O   . VAL A 52  ? 1.0427 0.9243 1.3638 0.0189  -0.1433 -0.0592 74  VAL A O   
422  C CB  . VAL A 52  ? 1.0790 0.9753 1.5224 0.0276  -0.1822 -0.0852 74  VAL A CB  
423  C CG1 . VAL A 52  ? 1.0740 0.9564 1.5416 0.0351  -0.2133 -0.1081 74  VAL A CG1 
424  C CG2 . VAL A 52  ? 1.0709 0.9913 1.6075 0.0208  -0.1681 -0.0832 74  VAL A CG2 
425  N N   . GLU A 53  ? 1.0610 0.9195 1.3031 0.0319  -0.1631 -0.0635 75  GLU A N   
426  C CA  . GLU A 53  ? 1.1445 0.9761 1.3074 0.0384  -0.1636 -0.0633 75  GLU A CA  
427  C C   . GLU A 53  ? 1.2021 1.0506 1.3542 0.0256  -0.1288 -0.0448 75  GLU A C   
428  O O   . GLU A 53  ? 1.2807 1.1185 1.4104 0.0270  -0.1274 -0.0467 75  GLU A O   
429  C CB  . GLU A 53  ? 1.1711 0.9731 1.2563 0.0496  -0.1691 -0.0632 75  GLU A CB  
430  C CG  . GLU A 53  ? 1.2244 0.9977 1.2955 0.0693  -0.2078 -0.0831 75  GLU A CG  
431  N N   . SER A 54  ? 1.1322 1.0048 1.2994 0.0155  -0.1029 -0.0285 76  SER A N   
432  C CA  . SER A 54  ? 1.0974 0.9849 1.2547 0.0074  -0.0747 -0.0138 76  SER A CA  
433  C C   . SER A 54  ? 1.1118 1.0113 1.3171 0.0035  -0.0676 -0.0117 76  SER A C   
434  O O   . SER A 54  ? 1.1674 1.0663 1.3560 0.0020  -0.0580 -0.0083 76  SER A O   
435  C CB  . SER A 54  ? 1.0681 0.9735 1.2254 0.0026  -0.0536 0.0001  76  SER A CB  
436  O OG  . SER A 54  ? 1.0678 0.9628 1.1779 0.0042  -0.0535 0.0003  76  SER A OG  
437  N N   . THR A 55  ? 1.0071 0.9162 1.2756 0.0021  -0.0700 -0.0139 77  THR A N   
438  C CA  . THR A 55  ? 0.9507 0.8674 1.2709 -0.0013 -0.0584 -0.0108 77  THR A CA  
439  C C   . THR A 55  ? 1.0171 0.9202 1.3345 0.0012  -0.0772 -0.0245 77  THR A C   
440  O O   . THR A 55  ? 1.0903 0.9954 1.4138 -0.0012 -0.0638 -0.0187 77  THR A O   
441  C CB  . THR A 55  ? 0.9054 0.8311 1.3032 -0.0032 -0.0558 -0.0129 77  THR A CB  
442  O OG1 . THR A 55  ? 0.9535 0.8892 1.3466 -0.0041 -0.0334 0.0024  77  THR A OG1 
443  C CG2 . THR A 55  ? 0.8600 0.7887 1.3165 -0.0069 -0.0392 -0.0093 77  THR A CG2 
444  N N   . ASN A 56  ? 1.1190 1.0044 1.4208 0.0090  -0.1091 -0.0432 78  ASN A N   
445  C CA  . ASN A 56  ? 1.1765 1.0440 1.4718 0.0151  -0.1301 -0.0586 78  ASN A CA  
446  C C   . ASN A 56  ? 1.1479 0.9995 1.3666 0.0186  -0.1238 -0.0543 78  ASN A C   
447  O O   . ASN A 56  ? 1.1566 1.0006 1.3722 0.0200  -0.1257 -0.0586 78  ASN A O   
448  C CB  . ASN A 56  ? 1.1876 1.0378 1.5000 0.0269  -0.1704 -0.0834 78  ASN A CB  
449  C CG  . ASN A 56  ? 1.2402 1.1096 1.6500 0.0219  -0.1745 -0.0903 78  ASN A CG  
450  O OD1 . ASN A 56  ? 1.2806 1.1664 1.7525 0.0118  -0.1526 -0.0826 78  ASN A OD1 
451  N ND2 . ASN A 56  ? 1.2015 1.0676 1.6273 0.0292  -0.1984 -0.1036 78  ASN A ND2 
452  N N   . LYS A 57  ? 1.1092 0.9566 1.2729 0.0193  -0.1131 -0.0455 79  LYS A N   
453  C CA  . LYS A 57  ? 1.1576 0.9891 1.2559 0.0221  -0.1019 -0.0415 79  LYS A CA  
454  C C   . LYS A 57  ? 1.0785 0.9328 1.1863 0.0121  -0.0736 -0.0269 79  LYS A C   
455  O O   . LYS A 57  ? 1.1009 0.9474 1.1836 0.0133  -0.0664 -0.0270 79  LYS A O   
456  C CB  . LYS A 57  ? 1.2703 1.0870 1.3159 0.0263  -0.0983 -0.0384 79  LYS A CB  
457  C CG  . LYS A 57  ? 1.3862 1.1700 1.3613 0.0350  -0.0916 -0.0398 79  LYS A CG  
458  C CD  . LYS A 57  ? 1.6262 1.3765 1.5496 0.0479  -0.1022 -0.0444 79  LYS A CD  
459  C CE  . LYS A 57  ? 1.7008 1.4585 1.6069 0.0405  -0.0776 -0.0318 79  LYS A CE  
460  N NZ  . LYS A 57  ? 1.7488 1.4865 1.6093 0.0412  -0.0509 -0.0261 79  LYS A NZ  
461  N N   . TYR A 58  ? 1.0067 0.8859 1.1475 0.0049  -0.0581 -0.0151 80  TYR A N   
462  C CA  . TYR A 58  ? 0.9928 0.8888 1.1295 0.0006  -0.0344 -0.0025 80  TYR A CA  
463  C C   . TYR A 58  ? 1.0133 0.9226 1.1930 -0.0010 -0.0225 0.0056  80  TYR A C   
464  O O   . TYR A 58  ? 1.1039 1.0198 1.2744 -0.0001 -0.0083 0.0126  80  TYR A O   
465  C CB  . TYR A 58  ? 0.9018 0.8089 1.0213 -0.0011 -0.0223 0.0054  80  TYR A CB  
466  C CG  . TYR A 58  ? 0.9331 0.8255 1.0096 0.0000  -0.0255 0.0004  80  TYR A CG  
467  C CD1 . TYR A 58  ? 0.9617 0.8384 1.0044 0.0018  -0.0215 -0.0042 80  TYR A CD1 
468  C CD2 . TYR A 58  ? 0.9358 0.8267 1.0052 0.0002  -0.0287 0.0014  80  TYR A CD2 
469  C CE1 . TYR A 58  ? 0.9882 0.8449 0.9908 0.0042  -0.0173 -0.0066 80  TYR A CE1 
470  C CE2 . TYR A 58  ? 0.9772 0.8497 1.0056 0.0023  -0.0277 -0.0016 80  TYR A CE2 
471  C CZ  . TYR A 58  ? 1.0748 0.9283 1.0692 0.0046  -0.0203 -0.0050 80  TYR A CZ  
472  O OH  . TYR A 58  ? 1.0962 0.9249 1.0490 0.0080  -0.0128 -0.0060 80  TYR A OH  
473  N N   . LEU A 59  ? 0.9965 0.9077 1.2247 -0.0020 -0.0261 0.0049  81  LEU A N   
474  C CA  . LEU A 59  ? 0.9883 0.9062 1.2556 -0.0023 -0.0062 0.0161  81  LEU A CA  
475  C C   . LEU A 59  ? 0.9554 0.8657 1.2637 -0.0035 -0.0133 0.0080  81  LEU A C   
476  O O   . LEU A 59  ? 1.0915 1.0005 1.4065 -0.0024 0.0017  0.0155  81  LEU A O   
477  C CB  . LEU A 59  ? 1.0713 0.9962 1.3712 -0.0024 0.0071  0.0254  81  LEU A CB  
478  C CG  . LEU A 59  ? 1.1260 1.0492 1.4670 -0.0002 0.0346  0.0393  81  LEU A CG  
479  C CD1 . LEU A 59  ? 1.1601 1.0801 1.4587 0.0073  0.0531  0.0524  81  LEU A CD1 
480  C CD2 . LEU A 59  ? 1.1613 1.0874 1.5320 0.0008  0.0501  0.0480  81  LEU A CD2 
481  N N   . ALA A 60  ? 1.0025 0.9058 1.3387 -0.0039 -0.0383 -0.0089 82  ALA A N   
482  C CA  . ALA A 60  ? 0.9990 0.8945 1.3815 -0.0043 -0.0497 -0.0209 82  ALA A CA  
483  C C   . ALA A 60  ? 0.9139 0.8009 1.2607 -0.0021 -0.0490 -0.0215 82  ALA A C   
484  O O   . ALA A 60  ? 1.0381 0.9247 1.4172 -0.0037 -0.0361 -0.0170 82  ALA A O   
485  C CB  . ALA A 60  ? 1.0213 0.9073 1.4281 -0.0005 -0.0856 -0.0445 82  ALA A CB  
486  N N   . PRO A 61  ? 0.9231 0.8018 1.2040 0.0018  -0.0585 -0.0256 83  PRO A N   
487  C CA  . PRO A 61  ? 0.8893 0.7587 1.1365 0.0047  -0.0575 -0.0277 83  PRO A CA  
488  C C   . PRO A 61  ? 0.9306 0.8116 1.1747 0.0029  -0.0307 -0.0117 83  PRO A C   
489  O O   . PRO A 61  ? 0.9846 0.8595 1.2193 0.0049  -0.0293 -0.0138 83  PRO A O   
490  C CB  . PRO A 61  ? 0.8794 0.7377 1.0602 0.0092  -0.0630 -0.0312 83  PRO A CB  
491  C CG  . PRO A 61  ? 0.9357 0.7904 1.1150 0.0109  -0.0766 -0.0362 83  PRO A CG  
492  C CD  . PRO A 61  ? 0.9775 0.8535 1.2116 0.0041  -0.0645 -0.0262 83  PRO A CD  
493  N N   . VAL A 62  ? 0.8431 0.7375 1.0913 0.0017  -0.0115 0.0030  84  VAL A N   
494  C CA  . VAL A 62  ? 0.8182 0.7185 1.0538 0.0055  0.0098  0.0166  84  VAL A CA  
495  C C   . VAL A 62  ? 0.8638 0.7565 1.1337 0.0069  0.0194  0.0204  84  VAL A C   
496  O O   . VAL A 62  ? 0.9572 0.8468 1.2094 0.0111  0.0244  0.0221  84  VAL A O   
497  C CB  . VAL A 62  ? 0.8122 0.7210 1.0450 0.0086  0.0266  0.0306  84  VAL A CB  
498  C CG1 . VAL A 62  ? 0.8644 0.7719 1.0796 0.0183  0.0450  0.0427  84  VAL A CG1 
499  C CG2 . VAL A 62  ? 0.8067 0.7235 1.0054 0.0072  0.0189  0.0270  84  VAL A CG2 
500  N N   . GLU A 63  ? 0.9509 0.8398 1.2750 0.0037  0.0235  0.0214  85  GLU A N   
501  C CA  . GLU A 63  ? 0.9588 0.8377 1.3240 0.0046  0.0387  0.0267  85  GLU A CA  
502  C C   . GLU A 63  ? 0.9464 0.8180 1.3016 0.0050  0.0244  0.0152  85  GLU A C   
503  O O   . GLU A 63  ? 0.8962 0.7607 1.2485 0.0095  0.0396  0.0235  85  GLU A O   
504  C CB  . GLU A 63  ? 1.0626 0.9390 1.5026 -0.0013 0.0402  0.0223  85  GLU A CB  
505  C CG  . GLU A 63  ? 1.2180 1.0814 1.7125 -0.0013 0.0637  0.0298  85  GLU A CG  
506  C CD  . GLU A 63  ? 1.3479 1.2106 1.9333 -0.0088 0.0635  0.0204  85  GLU A CD  
507  O OE1 . GLU A 63  ? 1.4671 1.3378 2.0726 -0.0109 0.0662  0.0218  85  GLU A OE1 
508  O OE2 . GLU A 63  ? 1.2941 1.1488 1.9358 -0.0124 0.0598  0.0099  85  GLU A OE2 
509  N N   . GLU A 64  ? 0.9416 0.8109 1.2852 0.0028  -0.0039 -0.0034 86  GLU A N   
510  C CA  . GLU A 64  ? 0.9708 0.8292 1.3006 0.0053  -0.0171 -0.0149 86  GLU A CA  
511  C C   . GLU A 64  ? 0.9818 0.8433 1.2545 0.0100  -0.0075 -0.0082 86  GLU A C   
512  O O   . GLU A 64  ? 0.9968 0.8529 1.2684 0.0131  -0.0010 -0.0065 86  GLU A O   
513  C CB  . GLU A 64  ? 1.0463 0.8930 1.3687 0.0070  -0.0498 -0.0370 86  GLU A CB  
514  C CG  . GLU A 64  ? 1.1763 1.0067 1.4748 0.0125  -0.0627 -0.0490 86  GLU A CG  
515  C CD  . GLU A 64  ? 1.3382 1.1490 1.6459 0.0185  -0.0974 -0.0734 86  GLU A CD  
516  O OE1 . GLU A 64  ? 1.4922 1.2992 1.7885 0.0215  -0.1144 -0.0815 86  GLU A OE1 
517  O OE2 . GLU A 64  ? 1.4673 1.2644 1.7914 0.0222  -0.1098 -0.0858 86  GLU A OE2 
518  N N   . LYS A 65  ? 0.9402 0.8104 1.1716 0.0107  -0.0065 -0.0055 87  LYS A N   
519  C CA  . LYS A 65  ? 0.8886 0.7653 1.0810 0.0150  0.0035  -0.0011 87  LYS A CA  
520  C C   . LYS A 65  ? 0.8694 0.7491 1.0717 0.0210  0.0215  0.0117  87  LYS A C   
521  O O   . LYS A 65  ? 0.8891 0.7675 1.0766 0.0261  0.0245  0.0106  87  LYS A O   
522  C CB  . LYS A 65  ? 0.8604 0.7486 1.0248 0.0142  0.0061  0.0011  87  LYS A CB  
523  C CG  . LYS A 65  ? 0.8741 0.7529 1.0131 0.0119  -0.0067 -0.0098 87  LYS A CG  
524  C CD  . LYS A 65  ? 0.9920 0.8577 1.1018 0.0154  -0.0082 -0.0188 87  LYS A CD  
525  C CE  . LYS A 65  ? 1.0526 0.9029 1.1231 0.0169  -0.0112 -0.0257 87  LYS A CE  
526  N NZ  . LYS A 65  ? 1.1042 0.9388 1.1450 0.0220  -0.0041 -0.0318 87  LYS A NZ  
527  N N   . ILE A 66  ? 0.8453 0.7249 1.0701 0.0225  0.0348  0.0241  88  ILE A N   
528  C CA  . ILE A 66  ? 0.8669 0.7391 1.0916 0.0329  0.0546  0.0382  88  ILE A CA  
529  C C   . ILE A 66  ? 0.8755 0.7331 1.1284 0.0326  0.0585  0.0374  88  ILE A C   
530  O O   . ILE A 66  ? 0.8960 0.7466 1.1320 0.0421  0.0666  0.0423  88  ILE A O   
531  C CB  . ILE A 66  ? 0.8773 0.7449 1.1128 0.0375  0.0735  0.0537  88  ILE A CB  
532  C CG1 . ILE A 66  ? 0.9158 0.7964 1.1148 0.0416  0.0696  0.0546  88  ILE A CG1 
533  C CG2 . ILE A 66  ? 0.8875 0.7353 1.1190 0.0517  0.0978  0.0698  88  ILE A CG2 
534  C CD1 . ILE A 66  ? 0.9313 0.8096 1.1404 0.0430  0.0823  0.0654  88  ILE A CD1 
535  N N   . HIS A 67  ? 0.8879 0.7400 1.1858 0.0233  0.0507  0.0292  89  HIS A N   
536  C CA  . HIS A 67  ? 0.9894 0.8274 1.3197 0.0225  0.0518  0.0251  89  HIS A CA  
537  C C   . HIS A 67  ? 0.9378 0.7754 1.2333 0.0253  0.0367  0.0137  89  HIS A C   
538  O O   . HIS A 67  ? 0.9860 0.8136 1.2829 0.0307  0.0452  0.0172  89  HIS A O   
539  C CB  . HIS A 67  ? 1.0358 0.8683 1.4324 0.0130  0.0421  0.0137  89  HIS A CB  
540  C CG  . HIS A 67  ? 1.2475 1.0661 1.6793 0.0119  0.0367  0.0039  89  HIS A CG  
541  N ND1 . HIS A 67  ? 1.3011 1.1156 1.7550 0.0079  0.0059  -0.0197 89  HIS A ND1 
542  C CD2 . HIS A 67  ? 1.3930 1.1980 1.8354 0.0165  0.0565  0.0137  89  HIS A CD2 
543  C CE1 . HIS A 67  ? 1.3531 1.1544 1.8356 0.0086  0.0065  -0.0251 89  HIS A CE1 
544  N NE2 . HIS A 67  ? 1.4833 1.2792 1.9603 0.0128  0.0383  -0.0042 89  HIS A NE2 
545  N N   . ASN A 68  ? 0.8960 0.7412 1.1587 0.0231  0.0183  0.0015  90  ASN A N   
546  C CA  . ASN A 68  ? 0.9289 0.7704 1.1591 0.0267  0.0095  -0.0084 90  ASN A CA  
547  C C   . ASN A 68  ? 0.9321 0.7817 1.1354 0.0348  0.0237  0.0007  90  ASN A C   
548  O O   . ASN A 68  ? 0.9425 0.7869 1.1374 0.0398  0.0244  -0.0027 90  ASN A O   
549  C CB  . ASN A 68  ? 0.9598 0.8003 1.1567 0.0250  -0.0061 -0.0210 90  ASN A CB  
550  C CG  . ASN A 68  ? 1.1168 0.9441 1.3310 0.0224  -0.0273 -0.0344 90  ASN A CG  
551  O OD1 . ASN A 68  ? 1.2322 1.0515 1.4906 0.0207  -0.0345 -0.0396 90  ASN A OD1 
552  N ND2 . ASN A 68  ? 1.1596 0.9823 1.3412 0.0234  -0.0382 -0.0415 90  ASN A ND2 
553  N N   . ALA A 69  ? 0.8240 0.6857 1.0150 0.0378  0.0327  0.0103  91  ALA A N   
554  C CA  . ALA A 69  ? 0.8367 0.7048 1.0054 0.0495  0.0412  0.0162  91  ALA A CA  
555  C C   . ALA A 69  ? 0.8940 0.7465 1.0702 0.0599  0.0535  0.0263  91  ALA A C   
556  O O   . ALA A 69  ? 0.9171 0.7697 1.0759 0.0705  0.0539  0.0247  91  ALA A O   
557  C CB  . ALA A 69  ? 0.8338 0.7127 0.9887 0.0537  0.0454  0.0232  91  ALA A CB  
558  N N   . GLU A 70  ? 0.9378 0.7755 1.1430 0.0578  0.0650  0.0362  92  GLU A N   
559  C CA  . GLU A 70  ? 0.9502 0.7666 1.1632 0.0684  0.0828  0.0482  92  GLU A CA  
560  C C   . GLU A 70  ? 0.9077 0.7173 1.1333 0.0653  0.0750  0.0381  92  GLU A C   
561  O O   . GLU A 70  ? 0.9211 0.7208 1.1308 0.0772  0.0812  0.0419  92  GLU A O   
562  C CB  . GLU A 70  ? 1.0931 0.8931 1.3431 0.0657  0.1033  0.0617  92  GLU A CB  
563  C CG  . GLU A 70  ? 1.2640 1.0529 1.4867 0.0811  0.1247  0.0805  92  GLU A CG  
564  C CD  . GLU A 70  ? 1.3915 1.1731 1.6510 0.0746  0.1431  0.0907  92  GLU A CD  
565  O OE1 . GLU A 70  ? 1.3958 1.1897 1.7024 0.0566  0.1316  0.0794  92  GLU A OE1 
566  O OE2 . GLU A 70  ? 1.5202 1.2810 1.7595 0.0901  0.1690  0.1095  92  GLU A OE2 
567  N N   . ALA A 71  ? 0.8614 0.6742 1.1118 0.0516  0.0593  0.0238  93  ALA A N   
568  C CA  . ALA A 71  ? 0.8724 0.6753 1.1352 0.0495  0.0494  0.0120  93  ALA A CA  
569  C C   . ALA A 71  ? 0.8993 0.7094 1.1222 0.0563  0.0424  0.0047  93  ALA A C   
570  O O   . ALA A 71  ? 0.8990 0.6992 1.1206 0.0624  0.0448  0.0035  93  ALA A O   
571  C CB  . ALA A 71  ? 0.8632 0.6644 1.1515 0.0382  0.0286  -0.0048 93  ALA A CB  
572  N N   . LEU A 72  ? 0.9286 0.7553 1.1242 0.0548  0.0352  -0.0006 94  LEU A N   
573  C CA  . LEU A 72  ? 0.8904 0.7257 1.0583 0.0601  0.0321  -0.0089 94  LEU A CA  
574  C C   . LEU A 72  ? 0.8800 0.7195 1.0378 0.0741  0.0411  -0.0013 94  LEU A C   
575  O O   . LEU A 72  ? 0.9020 0.7402 1.0532 0.0811  0.0403  -0.0071 94  LEU A O   
576  C CB  . LEU A 72  ? 0.8436 0.6937 0.9935 0.0553  0.0279  -0.0150 94  LEU A CB  
577  C CG  . LEU A 72  ? 0.8268 0.6665 0.9690 0.0473  0.0172  -0.0259 94  LEU A CG  
578  C CD1 . LEU A 72  ? 0.7975 0.6480 0.9245 0.0428  0.0176  -0.0266 94  LEU A CD1 
579  C CD2 . LEU A 72  ? 0.8410 0.6685 0.9645 0.0510  0.0153  -0.0374 94  LEU A CD2 
580  N N   . LEU A 73  ? 0.8559 0.6968 1.0094 0.0811  0.0487  0.0109  95  LEU A N   
581  C CA  . LEU A 73  ? 0.8772 0.7154 1.0116 0.1004  0.0535  0.0169  95  LEU A CA  
582  C C   . LEU A 73  ? 0.9151 0.7317 1.0535 0.1087  0.0611  0.0224  95  LEU A C   
583  O O   . LEU A 73  ? 0.9931 0.8098 1.1196 0.1206  0.0573  0.0171  95  LEU A O   
584  C CB  . LEU A 73  ? 0.8953 0.7281 1.0156 0.1105  0.0617  0.0306  95  LEU A CB  
585  C CG  . LEU A 73  ? 0.9341 0.7536 1.0231 0.1374  0.0648  0.0373  95  LEU A CG  
586  C CD1 . LEU A 73  ? 0.9450 0.7847 1.0257 0.1463  0.0471  0.0198  95  LEU A CD1 
587  C CD2 . LEU A 73  ? 0.9575 0.7672 1.0234 0.1498  0.0723  0.0497  95  LEU A CD2 
588  N N   . ASP A 74  ? 1.0194 0.8174 1.1808 0.1019  0.0719  0.0316  96  ASP A N   
589  C CA  . ASP A 74  ? 1.1017 0.8752 1.2756 0.1074  0.0828  0.0378  96  ASP A CA  
590  C C   . ASP A 74  ? 1.0361 0.8123 1.2110 0.1059  0.0709  0.0232  96  ASP A C   
591  O O   . ASP A 74  ? 1.0998 0.8603 1.2678 0.1184  0.0772  0.0272  96  ASP A O   
592  C CB  . ASP A 74  ? 1.1896 0.9488 1.4067 0.0942  0.0936  0.0438  96  ASP A CB  
593  C CG  . ASP A 74  ? 1.2917 1.0221 1.5302 0.0997  0.1111  0.0528  96  ASP A CG  
594  O OD1 . ASP A 74  ? 1.3543 1.0624 1.5711 0.1174  0.1325  0.0707  96  ASP A OD1 
595  O OD2 . ASP A 74  ? 1.3538 1.0800 1.6278 0.0882  0.1032  0.0415  96  ASP A OD2 
596  N N   . LYS A 75  ? 0.9866 0.7784 1.1654 0.0931  0.0557  0.0072  97  LYS A N   
597  C CA  . LYS A 75  ? 1.0175 0.8100 1.1907 0.0931  0.0467  -0.0068 97  LYS A CA  
598  C C   . LYS A 75  ? 0.9932 0.8044 1.1444 0.1026  0.0437  -0.0136 97  LYS A C   
599  O O   . LYS A 75  ? 0.9746 0.7890 1.1219 0.1025  0.0397  -0.0259 97  LYS A O   
600  C CB  . LYS A 75  ? 1.1073 0.8993 1.2862 0.0794  0.0341  -0.0207 97  LYS A CB  
601  C CG  . LYS A 75  ? 1.3111 1.0862 1.5220 0.0706  0.0292  -0.0221 97  LYS A CG  
602  C CD  . LYS A 75  ? 1.5556 1.3099 1.7889 0.0739  0.0316  -0.0232 97  LYS A CD  
603  C CE  . LYS A 75  ? 1.7170 1.4634 1.9328 0.0775  0.0203  -0.0388 97  LYS A CE  
604  N NZ  . LYS A 75  ? 1.7987 1.5423 1.9973 0.0729  0.0030  -0.0549 97  LYS A NZ  
605  N N   . PHE A 76  ? 0.9070 0.7293 1.0469 0.1121  0.0456  -0.0074 98  PHE A N   
606  C CA  . PHE A 76  ? 0.8688 0.7107 1.0000 0.1225  0.0395  -0.0175 98  PHE A CA  
607  C C   . PHE A 76  ? 0.8669 0.7293 1.0044 0.1099  0.0361  -0.0310 98  PHE A C   
608  O O   . PHE A 76  ? 0.8669 0.7437 1.0115 0.1144  0.0347  -0.0436 98  PHE A O   
609  C CB  . PHE A 76  ? 0.8917 0.7276 1.0224 0.1353  0.0382  -0.0233 98  PHE A CB  
610  C CG  . PHE A 76  ? 0.8772 0.6867 0.9980 0.1495  0.0447  -0.0096 98  PHE A CG  
611  C CD1 . PHE A 76  ? 0.9019 0.6993 1.0030 0.1651  0.0491  0.0038  98  PHE A CD1 
612  C CD2 . PHE A 76  ? 0.8805 0.6731 1.0075 0.1500  0.0482  -0.0102 98  PHE A CD2 
613  C CE1 . PHE A 76  ? 0.8604 0.6257 0.9466 0.1811  0.0608  0.0186  98  PHE A CE1 
614  C CE2 . PHE A 76  ? 0.8990 0.6635 1.0173 0.1640  0.0578  0.0032  98  PHE A CE2 
615  C CZ  . PHE A 76  ? 0.8911 0.6404 0.9883 0.1795  0.0660  0.0186  98  PHE A CZ  
616  N N   . SER A 77  ? 0.8456 0.7070 0.9830 0.0954  0.0368  -0.0286 99  SER A N   
617  C CA  . SER A 77  ? 0.8102 0.6847 0.9467 0.0857  0.0374  -0.0378 99  SER A CA  
618  C C   . SER A 77  ? 0.8038 0.6961 0.9420 0.0873  0.0354  -0.0354 99  SER A C   
619  O O   . SER A 77  ? 0.8409 0.7338 0.9754 0.0785  0.0352  -0.0304 99  SER A O   
620  C CB  . SER A 77  ? 0.8255 0.6846 0.9540 0.0733  0.0361  -0.0384 99  SER A CB  
621  O OG  . SER A 77  ? 0.9082 0.7503 1.0311 0.0747  0.0360  -0.0454 99  SER A OG  
622  N N   . PHE A 78  ? 0.8246 0.7313 0.9699 0.1004  0.0316  -0.0415 100 PHE A N   
623  C CA  . PHE A 78  ? 0.7811 0.7010 0.9257 0.1086  0.0249  -0.0412 100 PHE A CA  
624  C C   . PHE A 78  ? 0.7758 0.7114 0.9299 0.0963  0.0265  -0.0475 100 PHE A C   
625  O O   . PHE A 78  ? 0.8727 0.8105 1.0187 0.0959  0.0235  -0.0408 100 PHE A O   
626  C CB  . PHE A 78  ? 0.7893 0.7201 0.9428 0.1282  0.0147  -0.0528 100 PHE A CB  
627  C CG  . PHE A 78  ? 0.7794 0.6903 0.9140 0.1468  0.0119  -0.0444 100 PHE A CG  
628  C CD1 . PHE A 78  ? 0.7834 0.6751 0.8897 0.1600  0.0121  -0.0290 100 PHE A CD1 
629  C CD2 . PHE A 78  ? 0.7972 0.7048 0.9398 0.1526  0.0119  -0.0511 100 PHE A CD2 
630  C CE1 . PHE A 78  ? 0.8250 0.6915 0.9092 0.1795  0.0142  -0.0193 100 PHE A CE1 
631  C CE2 . PHE A 78  ? 0.8434 0.7293 0.9662 0.1711  0.0104  -0.0428 100 PHE A CE2 
632  C CZ  . PHE A 78  ? 0.8542 0.7180 0.9464 0.1852  0.0123  -0.0265 100 PHE A CZ  
633  N N   . ASN A 79  ? 0.7674 0.7110 0.9380 0.0875  0.0342  -0.0594 101 ASN A N   
634  C CA  . ASN A 79  ? 0.7425 0.6960 0.9222 0.0759  0.0408  -0.0646 101 ASN A CA  
635  C C   . ASN A 79  ? 0.7163 0.6531 0.8716 0.0634  0.0450  -0.0535 101 ASN A C   
636  O O   . ASN A 79  ? 0.7984 0.7405 0.9509 0.0580  0.0437  -0.0504 101 ASN A O   
637  C CB  . ASN A 79  ? 0.7190 0.6786 0.9232 0.0714  0.0553  -0.0786 101 ASN A CB  
638  C CG  . ASN A 79  ? 0.7293 0.7104 0.9718 0.0836  0.0487  -0.0944 101 ASN A CG  
639  O OD1 . ASN A 79  ? 0.8008 0.7934 1.0477 0.0966  0.0302  -0.0970 101 ASN A OD1 
640  N ND2 . ASN A 79  ? 0.7000 0.6834 0.9685 0.0823  0.0630  -0.1057 101 ASN A ND2 
641  N N   . ALA A 80  ? 0.7170 0.6329 0.8561 0.0604  0.0474  -0.0496 102 ALA A N   
642  C CA  . ALA A 80  ? 0.7130 0.6106 0.8320 0.0519  0.0456  -0.0433 102 ALA A CA  
643  C C   . ALA A 80  ? 0.7806 0.6823 0.9015 0.0512  0.0373  -0.0323 102 ALA A C   
644  O O   . ALA A 80  ? 0.8021 0.7029 0.9169 0.0442  0.0358  -0.0293 102 ALA A O   
645  C CB  . ALA A 80  ? 0.7214 0.5963 0.8286 0.0532  0.0432  -0.0442 102 ALA A CB  
646  N N   . SER A 81  ? 0.7710 0.6745 0.8989 0.0602  0.0343  -0.0258 103 SER A N   
647  C CA  . SER A 81  ? 0.7842 0.6865 0.9122 0.0625  0.0329  -0.0135 103 SER A CA  
648  C C   . SER A 81  ? 0.8013 0.7200 0.9268 0.0636  0.0314  -0.0143 103 SER A C   
649  O O   . SER A 81  ? 0.8702 0.7881 0.9934 0.0585  0.0315  -0.0074 103 SER A O   
650  C CB  . SER A 81  ? 0.7639 0.6570 0.8914 0.0766  0.0354  -0.0050 103 SER A CB  
651  O OG  . SER A 81  ? 0.7540 0.6419 0.8757 0.0833  0.0396  0.0078  103 SER A OG  
652  N N   . GLN A 82  ? 0.8193 0.7535 0.9503 0.0707  0.0288  -0.0246 104 GLN A N   
653  C CA  . GLN A 82  ? 0.8132 0.7631 0.9476 0.0724  0.0247  -0.0292 104 GLN A CA  
654  C C   . GLN A 82  ? 0.8095 0.7610 0.9447 0.0559  0.0301  -0.0308 104 GLN A C   
655  O O   . GLN A 82  ? 0.7357 0.6927 0.8680 0.0538  0.0280  -0.0279 104 GLN A O   
656  C CB  . GLN A 82  ? 0.8125 0.7796 0.9661 0.0822  0.0188  -0.0457 104 GLN A CB  
657  C CG  . GLN A 82  ? 0.8384 0.8227 1.0045 0.0849  0.0115  -0.0552 104 GLN A CG  
658  C CD  . GLN A 82  ? 0.9238 0.9021 1.0665 0.1016  0.0007  -0.0473 104 GLN A CD  
659  O OE1 . GLN A 82  ? 1.0352 1.0072 1.1663 0.1222  -0.0086 -0.0485 104 GLN A OE1 
660  N NE2 . GLN A 82  ? 0.9340 0.9103 1.0654 0.0952  0.0031  -0.0389 104 GLN A NE2 
661  N N   . SER A 83  ? 0.7647 0.7070 0.8984 0.0469  0.0375  -0.0352 105 SER A N   
662  C CA  . SER A 83  ? 0.8097 0.7451 0.9339 0.0360  0.0435  -0.0359 105 SER A CA  
663  C C   . SER A 83  ? 0.8036 0.7293 0.9149 0.0317  0.0368  -0.0254 105 SER A C   
664  O O   . SER A 83  ? 0.8006 0.7281 0.9069 0.0263  0.0372  -0.0241 105 SER A O   
665  C CB  . SER A 83  ? 0.8400 0.7567 0.9517 0.0325  0.0535  -0.0411 105 SER A CB  
666  O OG  . SER A 83  ? 0.9513 0.8765 1.0806 0.0329  0.0666  -0.0512 105 SER A OG  
667  N N   . GLU A 84  ? 0.8085 0.7235 0.9198 0.0339  0.0317  -0.0190 106 GLU A N   
668  C CA  . GLU A 84  ? 0.8172 0.7229 0.9293 0.0292  0.0259  -0.0118 106 GLU A CA  
669  C C   . GLU A 84  ? 0.7494 0.6674 0.8671 0.0319  0.0273  -0.0032 106 GLU A C   
670  O O   . GLU A 84  ? 0.7767 0.6938 0.8949 0.0268  0.0252  0.0002  106 GLU A O   
671  C CB  . GLU A 84  ? 0.8660 0.7577 0.9901 0.0305  0.0220  -0.0090 106 GLU A CB  
672  C CG  . GLU A 84  ? 0.9718 0.8455 1.0859 0.0295  0.0163  -0.0191 106 GLU A CG  
673  C CD  . GLU A 84  ? 1.1072 0.9654 1.2045 0.0257  0.0067  -0.0257 106 GLU A CD  
674  O OE1 . GLU A 84  ? 1.1252 0.9737 1.2370 0.0241  -0.0059 -0.0274 106 GLU A OE1 
675  O OE2 . GLU A 84  ? 1.3676 1.2208 1.4384 0.0259  0.0122  -0.0301 106 GLU A OE2 
676  N N   . ILE A 85  ? 0.7315 0.6590 0.8497 0.0425  0.0297  -0.0014 107 ILE A N   
677  C CA  . ILE A 85  ? 0.7887 0.7222 0.9026 0.0495  0.0303  0.0056  107 ILE A CA  
678  C C   . ILE A 85  ? 0.7999 0.7472 0.9116 0.0450  0.0272  -0.0020 107 ILE A C   
679  O O   . ILE A 85  ? 0.8735 0.8223 0.9811 0.0446  0.0270  0.0035  107 ILE A O   
680  C CB  . ILE A 85  ? 0.8314 0.7634 0.9365 0.0683  0.0304  0.0085  107 ILE A CB  
681  C CG1 . ILE A 85  ? 0.8507 0.7636 0.9577 0.0730  0.0387  0.0199  107 ILE A CG1 
682  C CG2 . ILE A 85  ? 0.8361 0.7691 0.9263 0.0803  0.0293  0.0136  107 ILE A CG2 
683  C CD1 . ILE A 85  ? 0.8745 0.7758 0.9925 0.0665  0.0479  0.0327  107 ILE A CD1 
684  N N   . ASP A 86  ? 0.8120 0.7681 0.9300 0.0422  0.0271  -0.0148 108 ASP A N   
685  C CA  . ASP A 86  ? 0.7888 0.7556 0.9121 0.0363  0.0282  -0.0227 108 ASP A CA  
686  C C   . ASP A 86  ? 0.8046 0.7607 0.9165 0.0248  0.0311  -0.0171 108 ASP A C   
687  O O   . ASP A 86  ? 0.7888 0.7501 0.8990 0.0227  0.0299  -0.0158 108 ASP A O   
688  C CB  . ASP A 86  ? 0.7926 0.7654 0.9324 0.0332  0.0349  -0.0366 108 ASP A CB  
689  C CG  . ASP A 86  ? 0.8702 0.8593 1.0314 0.0459  0.0275  -0.0479 108 ASP A CG  
690  O OD1 . ASP A 86  ? 0.8879 0.8817 1.0428 0.0591  0.0155  -0.0460 108 ASP A OD1 
691  O OD2 . ASP A 86  ? 0.9518 0.9463 1.1347 0.0451  0.0336  -0.0595 108 ASP A OD2 
692  N N   . ASP A 87  ? 0.8176 0.7568 0.9201 0.0198  0.0323  -0.0153 109 ASP A N   
693  C CA  . ASP A 87  ? 0.8488 0.7730 0.9372 0.0131  0.0298  -0.0128 109 ASP A CA  
694  C C   . ASP A 87  ? 0.8130 0.7411 0.9088 0.0133  0.0236  -0.0036 109 ASP A C   
695  O O   . ASP A 87  ? 0.7813 0.7089 0.8718 0.0095  0.0219  -0.0022 109 ASP A O   
696  C CB  . ASP A 87  ? 0.9047 0.8068 0.9811 0.0130  0.0258  -0.0156 109 ASP A CB  
697  C CG  . ASP A 87  ? 0.9572 0.8451 1.0150 0.0138  0.0363  -0.0236 109 ASP A CG  
698  O OD1 . ASP A 87  ? 1.0843 0.9823 1.1489 0.0124  0.0492  -0.0273 109 ASP A OD1 
699  O OD2 . ASP A 87  ? 1.0341 0.8981 1.0721 0.0170  0.0325  -0.0272 109 ASP A OD2 
700  N N   . ALA A 88  ? 0.8004 0.7297 0.9090 0.0186  0.0233  0.0032  110 ALA A N   
701  C CA  . ALA A 88  ? 0.7751 0.7046 0.8947 0.0200  0.0243  0.0136  110 ALA A CA  
702  C C   . ALA A 88  ? 0.7522 0.6930 0.8634 0.0234  0.0264  0.0161  110 ALA A C   
703  O O   . ALA A 88  ? 0.7726 0.7131 0.8857 0.0196  0.0256  0.0197  110 ALA A O   
704  C CB  . ALA A 88  ? 0.7792 0.7032 0.9110 0.0279  0.0312  0.0225  110 ALA A CB  
705  N N   . ASN A 89  ? 0.8009 0.7512 0.9047 0.0316  0.0269  0.0118  111 ASN A N   
706  C CA  . ASN A 89  ? 0.7946 0.7547 0.8915 0.0372  0.0248  0.0101  111 ASN A CA  
707  C C   . ASN A 89  ? 0.7928 0.7580 0.8900 0.0259  0.0234  0.0033  111 ASN A C   
708  O O   . ASN A 89  ? 0.7643 0.7329 0.8575 0.0269  0.0222  0.0056  111 ASN A O   
709  C CB  . ASN A 89  ? 0.7374 0.7056 0.8315 0.0512  0.0197  0.0019  111 ASN A CB  
710  C CG  . ASN A 89  ? 0.8138 0.7697 0.8930 0.0694  0.0221  0.0123  111 ASN A CG  
711  O OD1 . ASN A 89  ? 0.9243 0.8698 0.9910 0.0767  0.0281  0.0242  111 ASN A OD1 
712  N ND2 . ASN A 89  ? 0.8635 0.8164 0.9425 0.0776  0.0206  0.0093  111 ASN A ND2 
713  N N   . GLU A 90  ? 0.7954 0.7567 0.8937 0.0170  0.0258  -0.0041 112 GLU A N   
714  C CA  . GLU A 90  ? 0.8367 0.7938 0.9289 0.0083  0.0292  -0.0085 112 GLU A CA  
715  C C   . GLU A 90  ? 0.8104 0.7570 0.8931 0.0045  0.0248  -0.0007 112 GLU A C   
716  O O   . GLU A 90  ? 0.8062 0.7536 0.8842 0.0018  0.0248  -0.0001 112 GLU A O   
717  C CB  . GLU A 90  ? 0.9645 0.9092 1.0509 0.0036  0.0374  -0.0152 112 GLU A CB  
718  C CG  . GLU A 90  ? 1.1694 1.1050 1.2485 -0.0022 0.0487  -0.0200 112 GLU A CG  
719  C CD  . GLU A 90  ? 1.3659 1.2798 1.4308 -0.0032 0.0624  -0.0240 112 GLU A CD  
720  O OE1 . GLU A 90  ? 1.4763 1.3961 1.5553 -0.0009 0.0666  -0.0289 112 GLU A OE1 
721  O OE2 . GLU A 90  ? 1.4951 1.3823 1.5306 -0.0040 0.0697  -0.0221 112 GLU A OE2 
722  N N   . LEU A 91  ? 0.8106 0.7480 0.8963 0.0050  0.0201  0.0038  113 LEU A N   
723  C CA  . LEU A 91  ? 0.8291 0.7576 0.9171 0.0023  0.0129  0.0074  113 LEU A CA  
724  C C   . LEU A 91  ? 0.8857 0.8251 0.9853 0.0048  0.0154  0.0159  113 LEU A C   
725  O O   . LEU A 91  ? 0.9511 0.8892 1.0491 0.0023  0.0123  0.0170  113 LEU A O   
726  C CB  . LEU A 91  ? 0.7901 0.7081 0.8918 0.0028  0.0059  0.0068  113 LEU A CB  
727  C CG  . LEU A 91  ? 0.8252 0.7239 0.9076 0.0030  -0.0006 -0.0026 113 LEU A CG  
728  C CD1 . LEU A 91  ? 0.8700 0.7616 0.9730 0.0048  -0.0086 -0.0049 113 LEU A CD1 
729  C CD2 . LEU A 91  ? 0.8448 0.7244 0.9035 0.0037  -0.0103 -0.0083 113 LEU A CD2 
730  N N   . MET A 92  ? 0.8809 0.8271 0.9875 0.0124  0.0220  0.0222  114 MET A N   
731  C CA  . MET A 92  ? 0.9005 0.8501 1.0086 0.0191  0.0278  0.0314  114 MET A CA  
732  C C   . MET A 92  ? 0.8287 0.7870 0.9214 0.0203  0.0253  0.0265  114 MET A C   
733  O O   . MET A 92  ? 0.8540 0.8125 0.9458 0.0217  0.0269  0.0316  114 MET A O   
734  C CB  . MET A 92  ? 0.9140 0.8595 1.0207 0.0322  0.0373  0.0400  114 MET A CB  
735  C CG  . MET A 92  ? 0.9158 0.8506 1.0464 0.0304  0.0444  0.0469  114 MET A CG  
736  S SD  . MET A 92  ? 0.9684 0.8881 1.0928 0.0483  0.0629  0.0613  114 MET A SD  
737  C CE  . MET A 92  ? 1.0348 0.9569 1.1493 0.0504  0.0544  0.0519  114 MET A CE  
738  N N   . ASP A 93  ? 0.8009 0.7661 0.8875 0.0195  0.0222  0.0158  115 ASP A N   
739  C CA  . ASP A 93  ? 0.8068 0.7801 0.8895 0.0189  0.0199  0.0082  115 ASP A CA  
740  C C   . ASP A 93  ? 0.7976 0.7644 0.8761 0.0091  0.0201  0.0100  115 ASP A C   
741  O O   . ASP A 93  ? 0.7986 0.7686 0.8738 0.0107  0.0191  0.0112  115 ASP A O   
742  C CB  . ASP A 93  ? 0.7871 0.7677 0.8785 0.0164  0.0200  -0.0056 115 ASP A CB  
743  C CG  . ASP A 93  ? 0.8843 0.8736 0.9820 0.0290  0.0148  -0.0117 115 ASP A CG  
744  O OD1 . ASP A 93  ? 0.9680 0.9556 1.0540 0.0436  0.0103  -0.0063 115 ASP A OD1 
745  O OD2 . ASP A 93  ? 1.0808 1.0755 1.1935 0.0266  0.0160  -0.0224 115 ASP A OD2 
746  N N   . SER A 94  ? 0.7667 0.7212 0.8416 0.0016  0.0197  0.0095  116 SER A N   
747  C CA  . SER A 94  ? 0.7898 0.7323 0.8545 -0.0033 0.0166  0.0100  116 SER A CA  
748  C C   . SER A 94  ? 0.8512 0.7958 0.9269 -0.0012 0.0121  0.0179  116 SER A C   
749  O O   . SER A 94  ? 0.9110 0.8556 0.9821 -0.0020 0.0110  0.0190  116 SER A O   
750  C CB  . SER A 94  ? 0.8412 0.7635 0.8921 -0.0055 0.0132  0.0061  116 SER A CB  
751  O OG  . SER A 94  ? 0.8703 0.7863 0.9099 -0.0071 0.0233  0.0000  116 SER A OG  
752  N N   . TYR A 95  ? 0.8250 0.7699 0.9192 0.0013  0.0117  0.0232  117 TYR A N   
753  C CA  . TYR A 95  ? 0.8064 0.7530 0.9213 0.0035  0.0135  0.0310  117 TYR A CA  
754  C C   . TYR A 95  ? 0.8372 0.7914 0.9427 0.0097  0.0215  0.0370  117 TYR A C   
755  O O   . TYR A 95  ? 0.7967 0.7509 0.9061 0.0091  0.0209  0.0394  117 TYR A O   
756  C CB  . TYR A 95  ? 0.7998 0.7447 0.9416 0.0064  0.0199  0.0372  117 TYR A CB  
757  C CG  . TYR A 95  ? 0.8695 0.8125 1.0480 0.0061  0.0238  0.0427  117 TYR A CG  
758  C CD1 . TYR A 95  ? 0.9379 0.8770 1.1386 0.0007  0.0082  0.0337  117 TYR A CD1 
759  C CD2 . TYR A 95  ? 0.8741 0.8160 1.0668 0.0135  0.0436  0.0558  117 TYR A CD2 
760  C CE1 . TYR A 95  ? 0.9064 0.8464 1.1545 0.0002  0.0109  0.0356  117 TYR A CE1 
761  C CE2 . TYR A 95  ? 0.9509 0.8903 1.1873 0.0126  0.0527  0.0609  117 TYR A CE2 
762  C CZ  . TYR A 95  ? 0.9202 0.8617 1.1901 0.0047  0.0356  0.0498  117 TYR A CZ  
763  O OH  . TYR A 95  ? 1.0205 0.9621 1.3457 0.0039  0.0443  0.0523  117 TYR A OH  
764  N N   . GLU A 96  ? 0.8570 0.8159 0.9490 0.0179  0.0265  0.0376  118 GLU A N   
765  C CA  . GLU A 96  ? 0.8740 0.8359 0.9506 0.0283  0.0295  0.0398  118 GLU A CA  
766  C C   . GLU A 96  ? 0.8560 0.8224 0.9255 0.0216  0.0227  0.0320  118 GLU A C   
767  O O   . GLU A 96  ? 0.7873 0.7532 0.8526 0.0250  0.0241  0.0357  118 GLU A O   
768  C CB  . GLU A 96  ? 0.9497 0.9139 1.0111 0.0409  0.0280  0.0355  118 GLU A CB  
769  C CG  . GLU A 96  ? 1.0873 1.0390 1.1359 0.0592  0.0385  0.0472  118 GLU A CG  
770  C CD  . GLU A 96  ? 1.2439 1.1941 1.2715 0.0761  0.0313  0.0399  118 GLU A CD  
771  O OE1 . GLU A 96  ? 1.3223 1.2840 1.3484 0.0768  0.0170  0.0242  118 GLU A OE1 
772  O OE2 . GLU A 96  ? 1.3997 1.3357 1.4154 0.0899  0.0398  0.0486  118 GLU A OE2 
773  N N   . GLN A 97  ? 0.8322 0.7999 0.9003 0.0126  0.0183  0.0220  119 GLN A N   
774  C CA  . GLN A 97  ? 0.8723 0.8393 0.9345 0.0065  0.0166  0.0154  119 GLN A CA  
775  C C   . GLN A 97  ? 0.8803 0.8383 0.9401 0.0021  0.0146  0.0209  119 GLN A C   
776  O O   . GLN A 97  ? 0.9104 0.8678 0.9642 0.0016  0.0140  0.0200  119 GLN A O   
777  C CB  . GLN A 97  ? 0.9683 0.9317 1.0304 -0.0011 0.0197  0.0058  119 GLN A CB  
778  C CG  . GLN A 97  ? 1.2265 1.1839 1.2847 -0.0073 0.0244  -0.0004 119 GLN A CG  
779  C CD  . GLN A 97  ? 1.4215 1.3916 1.4889 -0.0026 0.0211  -0.0061 119 GLN A CD  
780  O OE1 . GLN A 97  ? 1.4625 1.4452 1.5384 0.0067  0.0148  -0.0109 119 GLN A OE1 
781  N NE2 . GLN A 97  ? 1.3890 1.3523 1.4513 -0.0067 0.0234  -0.0067 119 GLN A NE2 
782  N N   . SER A 98  ? 0.8672 0.8180 0.9350 0.0002  0.0113  0.0246  120 SER A N   
783  C CA  . SER A 98  ? 0.8252 0.7673 0.8962 -0.0016 0.0042  0.0257  120 SER A CA  
784  C C   . SER A 98  ? 0.7702 0.7203 0.8566 0.0031  0.0085  0.0335  120 SER A C   
785  O O   . SER A 98  ? 0.8508 0.7977 0.9368 0.0026  0.0045  0.0334  120 SER A O   
786  C CB  . SER A 98  ? 0.7822 0.7141 0.8642 -0.0026 -0.0055 0.0226  120 SER A CB  
787  O OG  . SER A 98  ? 0.9525 0.8923 1.0686 -0.0005 -0.0024 0.0284  120 SER A OG  
788  N N   . TYR A 99  ? 0.7848 0.7413 0.8801 0.0099  0.0187  0.0408  121 TYR A N   
789  C CA  . TYR A 99  ? 0.8388 0.7968 0.9374 0.0184  0.0287  0.0497  121 TYR A CA  
790  C C   . TYR A 99  ? 0.8251 0.7855 0.8991 0.0218  0.0263  0.0459  121 TYR A C   
791  O O   . TYR A 99  ? 0.9177 0.8769 0.9929 0.0231  0.0272  0.0485  121 TYR A O   
792  C CB  . TYR A 99  ? 0.8307 0.7856 0.9291 0.0299  0.0429  0.0591  121 TYR A CB  
793  C CG  . TYR A 99  ? 0.8725 0.8202 0.9640 0.0434  0.0582  0.0701  121 TYR A CG  
794  C CD1 . TYR A 99  ? 0.8840 0.8290 1.0044 0.0417  0.0680  0.0772  121 TYR A CD1 
795  C CD2 . TYR A 99  ? 0.9247 0.8654 0.9802 0.0604  0.0621  0.0719  121 TYR A CD2 
796  C CE1 . TYR A 99  ? 0.9891 0.9235 1.1013 0.0556  0.0870  0.0888  121 TYR A CE1 
797  C CE2 . TYR A 99  ? 0.9930 0.9196 1.0312 0.0772  0.0774  0.0825  121 TYR A CE2 
798  C CZ  . TYR A 99  ? 1.0637 0.9865 1.1294 0.0742  0.0926  0.0923  121 TYR A CZ  
799  O OH  . TYR A 99  ? 1.1267 1.0318 1.1744 0.0920  0.1127  0.1043  121 TYR A OH  
800  N N   . GLN A 100 ? 0.8306 0.7948 0.8883 0.0237  0.0225  0.0381  122 GLN A N   
801  C CA  . GLN A 100 ? 0.8928 0.8601 0.9360 0.0276  0.0182  0.0305  122 GLN A CA  
802  C C   . GLN A 100 ? 0.8315 0.7958 0.8749 0.0171  0.0147  0.0268  122 GLN A C   
803  O O   . GLN A 100 ? 0.8252 0.7892 0.8619 0.0206  0.0137  0.0258  122 GLN A O   
804  C CB  . GLN A 100 ? 0.9334 0.9072 0.9747 0.0291  0.0124  0.0179  122 GLN A CB  
805  C CG  . GLN A 100 ? 1.0424 1.0160 1.0745 0.0456  0.0116  0.0186  122 GLN A CG  
806  C CD  . GLN A 100 ? 1.2561 1.2219 1.2653 0.0656  0.0112  0.0219  122 GLN A CD  
807  O OE1 . GLN A 100 ? 1.2878 1.2539 1.2918 0.0668  0.0070  0.0175  122 GLN A OE1 
808  N NE2 . GLN A 100 ? 1.3339 1.2881 1.3245 0.0836  0.0170  0.0301  122 GLN A NE2 
809  N N   . GLN A 101 ? 0.8131 0.7711 0.8595 0.0068  0.0127  0.0249  123 GLN A N   
810  C CA  . GLN A 101 ? 0.8486 0.7953 0.8861 0.0006  0.0100  0.0225  123 GLN A CA  
811  C C   . GLN A 101 ? 0.8517 0.7964 0.8953 0.0036  0.0066  0.0290  123 GLN A C   
812  O O   . GLN A 101 ? 0.8660 0.8031 0.9001 0.0024  0.0040  0.0275  123 GLN A O   
813  C CB  . GLN A 101 ? 0.8813 0.8132 0.9100 -0.0050 0.0081  0.0194  123 GLN A CB  
814  C CG  . GLN A 101 ? 0.9552 0.8654 0.9612 -0.0074 0.0079  0.0167  123 GLN A CG  
815  C CD  . GLN A 101 ? 1.0559 0.9659 1.0579 -0.0103 0.0171  0.0128  123 GLN A CD  
816  O OE1 . GLN A 101 ? 1.0982 1.0027 1.0933 -0.0092 0.0156  0.0141  123 GLN A OE1 
817  N NE2 . GLN A 101 ? 1.0344 0.9511 1.0468 -0.0139 0.0260  0.0064  123 GLN A NE2 
818  N N   . GLN A 102 ? 0.8507 0.8009 0.9140 0.0080  0.0088  0.0360  124 GLN A N   
819  C CA  . GLN A 102 ? 0.8679 0.8178 0.9478 0.0109  0.0086  0.0409  124 GLN A CA  
820  C C   . GLN A 102 ? 0.8985 0.8526 0.9733 0.0195  0.0185  0.0470  124 GLN A C   
821  O O   . GLN A 102 ? 0.9184 0.8708 0.9987 0.0209  0.0178  0.0486  124 GLN A O   
822  C CB  . GLN A 102 ? 0.9066 0.8582 1.0215 0.0113  0.0097  0.0446  124 GLN A CB  
823  C CG  . GLN A 102 ? 0.8840 0.8276 1.0043 0.0061  -0.0059 0.0359  124 GLN A CG  
824  C CD  . GLN A 102 ? 0.9402 0.8851 1.1072 0.0068  -0.0121 0.0340  124 GLN A CD  
825  O OE1 . GLN A 102 ? 0.9601 0.9131 1.1639 0.0093  0.0026  0.0420  124 GLN A OE1 
826  N NE2 . GLN A 102 ? 0.9636 0.8971 1.1311 0.0066  -0.0333 0.0224  124 GLN A NE2 
827  N N   . LEU A 103 ? 0.8229 0.7796 0.8844 0.0279  0.0263  0.0495  125 LEU A N   
828  C CA  . LEU A 103 ? 0.8556 0.8098 0.8992 0.0407  0.0323  0.0525  125 LEU A CA  
829  C C   . LEU A 103 ? 0.8930 0.8477 0.9239 0.0359  0.0224  0.0431  125 LEU A C   
830  O O   . LEU A 103 ? 0.8319 0.7835 0.8556 0.0421  0.0243  0.0449  125 LEU A O   
831  C CB  . LEU A 103 ? 0.8501 0.8018 0.8711 0.0547  0.0346  0.0514  125 LEU A CB  
832  C CG  . LEU A 103 ? 1.0102 0.9545 1.0335 0.0646  0.0487  0.0627  125 LEU A CG  
833  C CD1 . LEU A 103 ? 1.0391 0.9751 1.0280 0.0841  0.0466  0.0595  125 LEU A CD1 
834  C CD2 . LEU A 103 ? 1.0595 0.9942 1.0976 0.0710  0.0689  0.0776  125 LEU A CD2 
835  N N   . GLU A 104 ? 0.8698 0.8258 0.8990 0.0252  0.0147  0.0335  126 GLU A N   
836  C CA  . GLU A 104 ? 0.9116 0.8649 0.9323 0.0204  0.0100  0.0244  126 GLU A CA  
837  C C   . GLU A 104 ? 0.8962 0.8401 0.9163 0.0143  0.0082  0.0272  126 GLU A C   
838  O O   . GLU A 104 ? 0.9092 0.8496 0.9227 0.0163  0.0074  0.0260  126 GLU A O   
839  C CB  . GLU A 104 ? 0.9500 0.9041 0.9735 0.0125  0.0090  0.0143  126 GLU A CB  
840  C CG  . GLU A 104 ? 1.1116 1.0609 1.1354 0.0067  0.0096  0.0042  126 GLU A CG  
841  C CD  . GLU A 104 ? 1.2368 1.1909 1.2762 0.0021  0.0117  -0.0083 126 GLU A CD  
842  O OE1 . GLU A 104 ? 1.2075 1.1739 1.2548 0.0108  0.0049  -0.0146 126 GLU A OE1 
843  O OE2 . GLU A 104 ? 1.2055 1.1479 1.2488 -0.0082 0.0212  -0.0119 126 GLU A OE2 
844  N N   . ASP A 105 ? 0.9116 0.8493 0.9371 0.0093  0.0051  0.0297  127 ASP A N   
845  C CA  . ASP A 105 ? 0.8767 0.8019 0.8992 0.0081  -0.0019 0.0301  127 ASP A CA  
846  C C   . ASP A 105 ? 0.9160 0.8466 0.9527 0.0144  -0.0017 0.0353  127 ASP A C   
847  O O   . ASP A 105 ? 1.0067 0.9284 1.0364 0.0153  -0.0070 0.0339  127 ASP A O   
848  C CB  . ASP A 105 ? 0.9116 0.8296 0.9416 0.0068  -0.0104 0.0291  127 ASP A CB  
849  C CG  . ASP A 105 ? 1.0024 0.9033 1.0071 0.0029  -0.0109 0.0239  127 ASP A CG  
850  O OD1 . ASP A 105 ? 1.0335 0.9263 1.0197 -0.0002 -0.0023 0.0214  127 ASP A OD1 
851  O OD2 . ASP A 105 ? 1.1893 1.0826 1.1949 0.0039  -0.0186 0.0217  127 ASP A OD2 
852  N N   . VAL A 106 ? 0.8434 0.7852 0.8992 0.0201  0.0066  0.0421  128 VAL A N   
853  C CA  . VAL A 106 ? 0.8363 0.7810 0.9091 0.0273  0.0133  0.0487  128 VAL A CA  
854  C C   . VAL A 106 ? 0.8746 0.8180 0.9242 0.0346  0.0189  0.0494  128 VAL A C   
855  O O   . VAL A 106 ? 0.8880 0.8286 0.9397 0.0380  0.0192  0.0507  128 VAL A O   
856  C CB  . VAL A 106 ? 0.7721 0.7223 0.8729 0.0327  0.0275  0.0577  128 VAL A CB  
857  C CG1 . VAL A 106 ? 0.7554 0.7044 0.8715 0.0424  0.0432  0.0666  128 VAL A CG1 
858  C CG2 . VAL A 106 ? 0.8145 0.7665 0.9502 0.0259  0.0192  0.0544  128 VAL A CG2 
859  N N   . ASN A 107 ? 0.8774 0.8221 0.9068 0.0392  0.0214  0.0469  129 ASN A N   
860  C CA  . ASN A 107 ? 0.8396 0.7814 0.8464 0.0473  0.0201  0.0420  129 ASN A CA  
861  C C   . ASN A 107 ? 0.8424 0.7795 0.8445 0.0387  0.0118  0.0345  129 ASN A C   
862  O O   . ASN A 107 ? 0.8077 0.7409 0.8010 0.0448  0.0118  0.0337  129 ASN A O   
863  C CB  . ASN A 107 ? 0.8050 0.7491 0.7975 0.0526  0.0159  0.0338  129 ASN A CB  
864  C CG  . ASN A 107 ? 0.8154 0.7560 0.7982 0.0685  0.0252  0.0419  129 ASN A CG  
865  O OD1 . ASN A 107 ? 0.8163 0.7495 0.7986 0.0783  0.0391  0.0543  129 ASN A OD1 
866  N ND2 . ASN A 107 ? 0.8618 0.8048 0.8373 0.0723  0.0196  0.0352  129 ASN A ND2 
867  N N   . GLU A 108 ? 0.7360 0.6693 0.7404 0.0264  0.0068  0.0300  130 GLU A N   
868  C CA  . GLU A 108 ? 0.8421 0.7633 0.8364 0.0203  0.0035  0.0250  130 GLU A CA  
869  C C   . GLU A 108 ? 0.8547 0.7706 0.8511 0.0244  0.0008  0.0304  130 GLU A C   
870  O O   . GLU A 108 ? 0.8823 0.7920 0.8694 0.0266  0.0004  0.0283  130 GLU A O   
871  C CB  . GLU A 108 ? 0.8322 0.7412 0.8201 0.0109  0.0030  0.0222  130 GLU A CB  
872  C CG  . GLU A 108 ? 0.9369 0.8242 0.9069 0.0072  0.0048  0.0192  130 GLU A CG  
873  C CD  . GLU A 108 ? 1.0678 0.9348 1.0224 0.0015  0.0106  0.0175  130 GLU A CD  
874  O OE1 . GLU A 108 ? 1.0705 0.9391 1.0261 0.0017  0.0067  0.0195  130 GLU A OE1 
875  O OE2 . GLU A 108 ? 1.1551 1.0015 1.0964 -0.0021 0.0212  0.0146  130 GLU A OE2 
876  N N   . ILE A 109 ? 0.8403 0.7594 0.8545 0.0259  -0.0015 0.0358  131 ILE A N   
877  C CA  . ILE A 109 ? 0.8014 0.7183 0.8300 0.0304  -0.0058 0.0384  131 ILE A CA  
878  C C   . ILE A 109 ? 0.7582 0.6817 0.7927 0.0394  0.0043  0.0437  131 ILE A C   
879  O O   . ILE A 109 ? 0.7641 0.6823 0.7959 0.0428  0.0020  0.0432  131 ILE A O   
880  C CB  . ILE A 109 ? 0.8540 0.7752 0.9144 0.0304  -0.0119 0.0393  131 ILE A CB  
881  C CG1 . ILE A 109 ? 0.8702 0.7761 0.9135 0.0262  -0.0261 0.0323  131 ILE A CG1 
882  C CG2 . ILE A 109 ? 0.9145 0.8380 1.0052 0.0363  -0.0157 0.0398  131 ILE A CG2 
883  C CD1 . ILE A 109 ? 0.9081 0.8182 0.9797 0.0260  -0.0347 0.0297  131 ILE A CD1 
884  N N   . ILE A 110 ? 0.7438 0.6746 0.7796 0.0456  0.0164  0.0489  132 ILE A N   
885  C CA  . ILE A 110 ? 0.7523 0.6813 0.7807 0.0587  0.0282  0.0544  132 ILE A CA  
886  C C   . ILE A 110 ? 0.7911 0.7135 0.7912 0.0606  0.0212  0.0465  132 ILE A C   
887  O O   . ILE A 110 ? 0.8624 0.7800 0.8584 0.0679  0.0242  0.0483  132 ILE A O   
888  C CB  . ILE A 110 ? 0.7658 0.6944 0.7855 0.0697  0.0420  0.0609  132 ILE A CB  
889  C CG1 . ILE A 110 ? 0.8298 0.7631 0.8866 0.0674  0.0534  0.0697  132 ILE A CG1 
890  C CG2 . ILE A 110 ? 0.7508 0.6686 0.7479 0.0884  0.0548  0.0663  132 ILE A CG2 
891  C CD1 . ILE A 110 ? 0.8942 0.8226 0.9415 0.0776  0.0690  0.0776  132 ILE A CD1 
892  N N   . ALA A 111 ? 0.8358 0.7575 0.8224 0.0533  0.0127  0.0370  133 ALA A N   
893  C CA  . ALA A 111 ? 0.8432 0.7591 0.8133 0.0537  0.0065  0.0265  133 ALA A CA  
894  C C   . ALA A 111 ? 0.8760 0.7821 0.8453 0.0473  0.0031  0.0255  133 ALA A C   
895  O O   . ALA A 111 ? 0.9081 0.8082 0.8678 0.0520  0.0016  0.0211  133 ALA A O   
896  C CB  . ALA A 111 ? 0.7960 0.7144 0.7665 0.0459  0.0015  0.0155  133 ALA A CB  
897  N N   . LEU A 112 ? 0.8341 0.7354 0.8101 0.0390  0.0003  0.0285  134 LEU A N   
898  C CA  . LEU A 112 ? 0.8603 0.7467 0.8288 0.0374  -0.0045 0.0282  134 LEU A CA  
899  C C   . LEU A 112 ? 0.9291 0.8181 0.9083 0.0466  -0.0050 0.0332  134 LEU A C   
900  O O   . LEU A 112 ? 0.9036 0.7813 0.8723 0.0486  -0.0080 0.0313  134 LEU A O   
901  C CB  . LEU A 112 ? 0.8511 0.7258 0.8161 0.0322  -0.0108 0.0285  134 LEU A CB  
902  C CG  . LEU A 112 ? 0.8859 0.7473 0.8335 0.0237  -0.0057 0.0238  134 LEU A CG  
903  C CD1 . LEU A 112 ? 0.9241 0.7708 0.8608 0.0224  -0.0105 0.0248  134 LEU A CD1 
904  C CD2 . LEU A 112 ? 0.9680 0.8084 0.8972 0.0220  -0.0005 0.0202  134 LEU A CD2 
905  N N   . TYR A 113 ? 0.8964 0.7986 0.8996 0.0522  0.0003  0.0398  135 TYR A N   
906  C CA  . TYR A 113 ? 0.8485 0.7533 0.8699 0.0612  0.0049  0.0445  135 TYR A CA  
907  C C   . TYR A 113 ? 0.8765 0.7776 0.8764 0.0703  0.0129  0.0448  135 TYR A C   
908  O O   . TYR A 113 ? 0.9983 0.8937 0.9966 0.0754  0.0124  0.0446  135 TYR A O   
909  C CB  . TYR A 113 ? 0.8601 0.7770 0.9189 0.0653  0.0161  0.0521  135 TYR A CB  
910  C CG  . TYR A 113 ? 0.8878 0.8085 0.9858 0.0615  0.0046  0.0489  135 TYR A CG  
911  C CD1 . TYR A 113 ? 0.8811 0.7997 0.9781 0.0538  -0.0094 0.0433  135 TYR A CD1 
912  C CD2 . TYR A 113 ? 0.9167 0.8422 1.0560 0.0675  0.0064  0.0494  135 TYR A CD2 
913  C CE1 . TYR A 113 ? 0.8912 0.8104 1.0225 0.0540  -0.0256 0.0366  135 TYR A CE1 
914  C CE2 . TYR A 113 ? 0.9741 0.9039 1.1576 0.0662  -0.0095 0.0417  135 TYR A CE2 
915  C CZ  . TYR A 113 ? 0.9431 0.8689 1.1205 0.0604  -0.0275 0.0345  135 TYR A CZ  
916  O OH  . TYR A 113 ? 0.9296 0.8568 1.1487 0.0626  -0.0484 0.0234  135 TYR A OH  
917  N N   . LYS A 114 ? 0.8772 0.7797 0.8590 0.0742  0.0178  0.0435  136 LYS A N   
918  C CA  . LYS A 114 ? 0.9084 0.8038 0.8646 0.0871  0.0207  0.0402  136 LYS A CA  
919  C C   . LYS A 114 ? 0.9540 0.8410 0.8966 0.0812  0.0090  0.0288  136 LYS A C   
920  O O   . LYS A 114 ? 0.9839 0.8632 0.9147 0.0901  0.0091  0.0266  136 LYS A O   
921  C CB  . LYS A 114 ? 0.8770 0.7733 0.8165 0.0948  0.0222  0.0376  136 LYS A CB  
922  C CG  . LYS A 114 ? 0.9448 0.8304 0.8524 0.1125  0.0186  0.0296  136 LYS A CG  
923  C CD  . LYS A 114 ? 1.0460 0.9326 0.9403 0.1185  0.0115  0.0216  136 LYS A CD  
924  C CE  . LYS A 114 ? 1.1730 1.0530 1.0489 0.1282  -0.0062 0.0021  136 LYS A CE  
925  N NZ  . LYS A 114 ? 1.3369 1.1986 1.1782 0.1536  -0.0025 0.0041  136 LYS A NZ  
926  N N   . ASP A 115 ? 0.8963 0.7821 0.8416 0.0669  0.0019  0.0222  137 ASP A N   
927  C CA  . ASP A 115 ? 0.9208 0.7955 0.8584 0.0606  -0.0033 0.0117  137 ASP A CA  
928  C C   . ASP A 115 ? 0.9414 0.8027 0.8758 0.0577  -0.0041 0.0157  137 ASP A C   
929  O O   . ASP A 115 ? 0.9449 0.7949 0.8709 0.0592  -0.0053 0.0102  137 ASP A O   
930  C CB  . ASP A 115 ? 0.9313 0.8056 0.8753 0.0481  -0.0042 0.0034  137 ASP A CB  
931  C CG  . ASP A 115 ? 0.9928 0.8760 0.9410 0.0538  -0.0095 -0.0095 137 ASP A CG  
932  O OD1 . ASP A 115 ? 1.1650 1.0540 1.1025 0.0694  -0.0121 -0.0085 137 ASP A OD1 
933  O OD2 . ASP A 115 ? 1.0690 0.9500 1.0315 0.0447  -0.0109 -0.0220 137 ASP A OD2 
934  N N   . ASN A 116 ? 0.9002 0.7612 0.8420 0.0556  -0.0057 0.0234  138 ASN A N   
935  C CA  . ASN A 116 ? 0.8420 0.6916 0.7826 0.0591  -0.0109 0.0264  138 ASN A CA  
936  C C   . ASN A 116 ? 0.8650 0.7187 0.8103 0.0702  -0.0081 0.0284  138 ASN A C   
937  O O   . ASN A 116 ? 0.9240 0.7645 0.8588 0.0728  -0.0111 0.0264  138 ASN A O   
938  C CB  . ASN A 116 ? 0.8517 0.7059 0.8102 0.0597  -0.0177 0.0306  138 ASN A CB  
939  C CG  . ASN A 116 ? 0.9176 0.7566 0.8602 0.0527  -0.0236 0.0283  138 ASN A CG  
940  O OD1 . ASN A 116 ? 0.9445 0.7691 0.8654 0.0463  -0.0178 0.0254  138 ASN A OD1 
941  N ND2 . ASN A 116 ? 0.9273 0.7673 0.8834 0.0553  -0.0343 0.0285  138 ASN A ND2 
942  N N   . ASP A 117 ? 0.8810 0.7492 0.8390 0.0784  0.0003  0.0333  139 ASP A N   
943  C CA  . ASP A 117 ? 0.8813 0.7483 0.8387 0.0911  0.0071  0.0360  139 ASP A CA  
944  C C   . ASP A 117 ? 0.9304 0.7873 0.8601 0.0959  0.0054  0.0279  139 ASP A C   
945  O O   . ASP A 117 ? 1.0268 0.8762 0.9497 0.1043  0.0066  0.0275  139 ASP A O   
946  C CB  . ASP A 117 ? 0.9505 0.8276 0.9246 0.1019  0.0230  0.0454  139 ASP A CB  
947  C CG  . ASP A 117 ? 1.0759 0.9627 1.0943 0.1000  0.0257  0.0512  139 ASP A CG  
948  O OD1 . ASP A 117 ? 0.9712 0.8555 1.0016 0.0942  0.0104  0.0464  139 ASP A OD1 
949  O OD2 . ASP A 117 ? 1.1461 1.0402 1.1884 0.1062  0.0430  0.0596  139 ASP A OD2 
950  N N   . GLU A 118 ? 0.9276 0.7847 0.8461 0.0916  0.0014  0.0195  140 GLU A N   
951  C CA  . GLU A 118 ? 0.8803 0.7285 0.7824 0.0968  -0.0044 0.0071  140 GLU A CA  
952  C C   . GLU A 118 ? 0.8813 0.7158 0.7836 0.0875  -0.0083 0.0023  140 GLU A C   
953  O O   . GLU A 118 ? 0.9281 0.7529 0.8211 0.0946  -0.0106 -0.0030 140 GLU A O   
954  C CB  . GLU A 118 ? 0.9529 0.8055 0.8541 0.0949  -0.0109 -0.0047 140 GLU A CB  
955  C CG  . GLU A 118 ? 1.1169 0.9716 1.0000 0.1149  -0.0103 -0.0048 140 GLU A CG  
956  C CD  . GLU A 118 ? 1.2833 1.1438 1.1679 0.1151  -0.0200 -0.0172 140 GLU A CD  
957  O OE1 . GLU A 118 ? 1.2501 1.1140 1.1559 0.0993  -0.0272 -0.0293 140 GLU A OE1 
958  O OE2 . GLU A 118 ? 1.2363 1.0952 1.1011 0.1326  -0.0184 -0.0142 140 GLU A OE2 
959  N N   . LEU A 119 ? 0.8942 0.7232 0.8023 0.0740  -0.0079 0.0053  141 LEU A N   
960  C CA  . LEU A 119 ? 0.8943 0.7018 0.7948 0.0675  -0.0078 0.0026  141 LEU A CA  
961  C C   . LEU A 119 ? 0.9250 0.7253 0.8192 0.0763  -0.0100 0.0091  141 LEU A C   
962  O O   . LEU A 119 ? 0.9733 0.7569 0.8576 0.0780  -0.0102 0.0055  141 LEU A O   
963  C CB  . LEU A 119 ? 0.8959 0.6907 0.7928 0.0561  -0.0046 0.0059  141 LEU A CB  
964  C CG  . LEU A 119 ? 0.9238 0.7171 0.8303 0.0448  0.0017  -0.0028 141 LEU A CG  
965  C CD1 . LEU A 119 ? 1.0088 0.7922 0.9084 0.0372  0.0071  0.0033  141 LEU A CD1 
966  C CD2 . LEU A 119 ? 0.9447 0.7178 0.8545 0.0395  0.0085  -0.0124 141 LEU A CD2 
967  N N   . TYR A 120 ? 0.8944 0.7071 0.7998 0.0821  -0.0112 0.0177  142 TYR A N   
968  C CA  . TYR A 120 ? 0.9091 0.7176 0.8189 0.0912  -0.0143 0.0219  142 TYR A CA  
969  C C   . TYR A 120 ? 0.8866 0.6958 0.7915 0.1018  -0.0095 0.0199  142 TYR A C   
970  O O   . TYR A 120 ? 0.8701 0.6657 0.7668 0.1060  -0.0123 0.0183  142 TYR A O   
971  C CB  . TYR A 120 ? 0.9139 0.7391 0.8521 0.0952  -0.0152 0.0284  142 TYR A CB  
972  C CG  . TYR A 120 ? 0.9697 0.7966 0.9275 0.1060  -0.0169 0.0307  142 TYR A CG  
973  C CD1 . TYR A 120 ? 1.0030 0.8136 0.9560 0.1090  -0.0308 0.0276  142 TYR A CD1 
974  C CD2 . TYR A 120 ? 0.9780 0.8199 0.9595 0.1153  -0.0035 0.0360  142 TYR A CD2 
975  C CE1 . TYR A 120 ? 1.0448 0.8592 1.0232 0.1197  -0.0347 0.0275  142 TYR A CE1 
976  C CE2 . TYR A 120 ? 1.0452 0.8903 1.0548 0.1248  -0.0020 0.0376  142 TYR A CE2 
977  C CZ  . TYR A 120 ? 1.0854 0.9195 1.0972 0.1264  -0.0194 0.0322  142 TYR A CZ  
978  O OH  . TYR A 120 ? 1.1038 0.9431 1.1502 0.1369  -0.0193 0.0316  142 TYR A OH  
979  N N   . ASP A 121 ? 0.8651 0.6856 0.7690 0.1085  -0.0028 0.0194  143 ASP A N   
980  C CA  . ASP A 121 ? 0.9189 0.7344 0.8089 0.1233  0.0012  0.0168  143 ASP A CA  
981  C C   . ASP A 121 ? 0.9216 0.7211 0.7958 0.1203  -0.0068 0.0047  143 ASP A C   
982  O O   . ASP A 121 ? 1.0036 0.7933 0.8687 0.1295  -0.0069 0.0027  143 ASP A O   
983  C CB  . ASP A 121 ? 0.9683 0.7896 0.8471 0.1357  0.0084  0.0174  143 ASP A CB  
984  C CG  . ASP A 121 ? 1.0198 0.8525 0.9174 0.1412  0.0236  0.0315  143 ASP A CG  
985  O OD1 . ASP A 121 ? 1.2126 1.0508 1.1381 0.1390  0.0280  0.0387  143 ASP A OD1 
986  O OD2 . ASP A 121 ? 1.1349 0.9694 1.0224 0.1492  0.0313  0.0343  143 ASP A OD2 
987  N N   . LYS A 122 ? 0.9651 0.7609 0.8410 0.1069  -0.0117 -0.0034 144 LYS A N   
988  C CA  . LYS A 122 ? 0.9753 0.7554 0.8480 0.1020  -0.0161 -0.0165 144 LYS A CA  
989  C C   . LYS A 122 ? 0.9730 0.7337 0.8404 0.0976  -0.0139 -0.0117 144 LYS A C   
990  O O   . LYS A 122 ? 1.0048 0.7506 0.8663 0.1011  -0.0153 -0.0186 144 LYS A O   
991  C CB  . LYS A 122 ? 1.0046 0.7860 0.8913 0.0881  -0.0170 -0.0263 144 LYS A CB  
992  C CG  . LYS A 122 ? 1.1181 0.8804 1.0158 0.0776  -0.0151 -0.0385 144 LYS A CG  
993  C CD  . LYS A 122 ? 1.1979 0.9657 1.1169 0.0779  -0.0240 -0.0603 144 LYS A CD  
994  C CE  . LYS A 122 ? 1.2964 1.0436 1.2353 0.0692  -0.0202 -0.0734 144 LYS A CE  
995  N NZ  . LYS A 122 ? 1.3430 1.0697 1.2856 0.0526  -0.0005 -0.0629 144 LYS A NZ  
996  N N   . CYS A 123 ? 0.9561 0.7137 0.8231 0.0925  -0.0123 -0.0012 145 CYS A N   
997  C CA  . CYS A 123 ? 1.0034 0.7364 0.8566 0.0932  -0.0130 0.0030  145 CYS A CA  
998  C C   . CYS A 123 ? 0.9837 0.7189 0.8365 0.1072  -0.0170 0.0061  145 CYS A C   
999  O O   . CYS A 123 ? 1.0931 0.8073 0.9332 0.1105  -0.0179 0.0046  145 CYS A O   
1000 C CB  . CYS A 123 ? 1.0026 0.7268 0.8489 0.0895  -0.0152 0.0106  145 CYS A CB  
1001 S SG  . CYS A 123 ? 1.1273 0.8387 0.9682 0.0741  -0.0052 0.0086  145 CYS A SG  
1002 N N   . LYS A 124 ? 0.9419 0.6999 0.8105 0.1160  -0.0166 0.0109  146 LYS A N   
1003 C CA  . LYS A 124 ? 0.9495 0.7096 0.8235 0.1298  -0.0157 0.0136  146 LYS A CA  
1004 C C   . LYS A 124 ? 1.0031 0.7511 0.8598 0.1356  -0.0141 0.0059  146 LYS A C   
1005 O O   . LYS A 124 ? 1.0628 0.7970 0.9128 0.1420  -0.0161 0.0051  146 LYS A O   
1006 C CB  . LYS A 124 ? 1.0247 0.8078 0.9204 0.1387  -0.0068 0.0201  146 LYS A CB  
1007 C CG  . LYS A 124 ? 1.1015 0.8966 1.0310 0.1408  -0.0086 0.0265  146 LYS A CG  
1008 C CD  . LYS A 124 ? 1.2040 1.0161 1.1610 0.1520  0.0085  0.0336  146 LYS A CD  
1009 C CE  . LYS A 124 ? 1.2667 1.0917 1.2289 0.1487  0.0189  0.0382  146 LYS A CE  
1010 N NZ  . LYS A 124 ? 1.3876 1.2102 1.3339 0.1635  0.0386  0.0430  146 LYS A NZ  
1011 N N   . VAL A 125 ? 0.9956 0.7481 0.8458 0.1354  -0.0128 -0.0017 147 VAL A N   
1012 C CA  . VAL A 125 ? 0.9550 0.6965 0.7906 0.1443  -0.0155 -0.0131 147 VAL A CA  
1013 C C   . VAL A 125 ? 1.0152 0.7348 0.8482 0.1347  -0.0196 -0.0219 147 VAL A C   
1014 O O   . VAL A 125 ? 1.0572 0.7632 0.8813 0.1427  -0.0214 -0.0266 147 VAL A O   
1015 C CB  . VAL A 125 ? 0.8975 0.6464 0.7280 0.1484  -0.0192 -0.0233 147 VAL A CB  
1016 C CG1 . VAL A 125 ? 0.9229 0.6577 0.7410 0.1581  -0.0286 -0.0406 147 VAL A CG1 
1017 C CG2 . VAL A 125 ? 0.8935 0.6550 0.7170 0.1635  -0.0105 -0.0132 147 VAL A CG2 
1018 N N   . ASP A 126 ? 1.0688 0.7821 0.9096 0.1183  -0.0180 -0.0235 148 ASP A N   
1019 C CA  . ASP A 126 ? 1.1235 0.8098 0.9637 0.1084  -0.0143 -0.0293 148 ASP A CA  
1020 C C   . ASP A 126 ? 1.1114 0.7763 0.9343 0.1134  -0.0124 -0.0196 148 ASP A C   
1021 O O   . ASP A 126 ? 1.1582 0.7997 0.9752 0.1136  -0.0098 -0.0246 148 ASP A O   
1022 C CB  . ASP A 126 ? 1.1802 0.8595 1.0291 0.0919  -0.0062 -0.0285 148 ASP A CB  
1023 C CG  . ASP A 126 ? 1.2043 0.9008 1.0770 0.0853  -0.0087 -0.0419 148 ASP A CG  
1024 O OD1 . ASP A 126 ? 1.2153 0.9196 1.0965 0.0931  -0.0185 -0.0567 148 ASP A OD1 
1025 O OD2 . ASP A 126 ? 1.3943 1.0938 1.2754 0.0741  -0.0023 -0.0387 148 ASP A OD2 
1026 N N   . TYR A 127 ? 1.1031 0.7747 0.9210 0.1179  -0.0152 -0.0074 149 TYR A N   
1027 C CA  . TYR A 127 ? 1.1008 0.7535 0.9038 0.1268  -0.0192 -0.0002 149 TYR A CA  
1028 C C   . TYR A 127 ? 1.1305 0.7842 0.9339 0.1390  -0.0215 -0.0036 149 TYR A C   
1029 O O   . TYR A 127 ? 1.1211 0.7487 0.9097 0.1426  -0.0212 -0.0051 149 TYR A O   
1030 C CB  . TYR A 127 ? 1.0731 0.7412 0.8847 0.1324  -0.0275 0.0081  149 TYR A CB  
1031 C CG  . TYR A 127 ? 1.1238 0.7812 0.9319 0.1465  -0.0376 0.0109  149 TYR A CG  
1032 C CD1 . TYR A 127 ? 1.1951 0.8143 0.9722 0.1511  -0.0422 0.0123  149 TYR A CD1 
1033 C CD2 . TYR A 127 ? 1.1675 0.8498 1.0034 0.1573  -0.0408 0.0119  149 TYR A CD2 
1034 C CE1 . TYR A 127 ? 1.2437 0.8513 1.0165 0.1669  -0.0552 0.0126  149 TYR A CE1 
1035 C CE2 . TYR A 127 ? 1.1950 0.8695 1.0365 0.1707  -0.0513 0.0119  149 TYR A CE2 
1036 C CZ  . TYR A 127 ? 1.2510 0.8891 1.0604 0.1759  -0.0612 0.0112  149 TYR A CZ  
1037 O OH  . TYR A 127 ? 1.3035 0.9320 1.1170 0.1920  -0.0758 0.0091  149 TYR A OH  
1038 N N   . ARG A 128 ? 1.1001 0.7806 0.9175 0.1470  -0.0215 -0.0040 150 ARG A N   
1039 C CA  . ARG A 128 ? 1.0628 0.7438 0.8776 0.1613  -0.0207 -0.0066 150 ARG A CA  
1040 C C   . ARG A 128 ? 1.1041 0.7636 0.9055 0.1598  -0.0216 -0.0186 150 ARG A C   
1041 O O   . ARG A 128 ? 1.2177 0.8607 1.0102 0.1674  -0.0227 -0.0197 150 ARG A O   
1042 C CB  . ARG A 128 ? 1.0579 0.7625 0.8804 0.1712  -0.0147 -0.0051 150 ARG A CB  
1043 C CG  . ARG A 128 ? 1.0622 0.7806 0.9029 0.1837  -0.0079 0.0048  150 ARG A CG  
1044 C CD  . ARG A 128 ? 1.0209 0.7610 0.8883 0.1792  -0.0041 0.0132  150 ARG A CD  
1045 N NE  . ARG A 128 ? 1.0130 0.7655 0.8789 0.1855  0.0083  0.0159  150 ARG A NE  
1046 C CZ  . ARG A 128 ? 1.0282 0.7981 0.9196 0.1887  0.0205  0.0251  150 ARG A CZ  
1047 N NH1 . ARG A 128 ? 1.0310 0.8131 0.9617 0.1859  0.0200  0.0302  150 ARG A NH1 
1048 N NH2 . ARG A 128 ? 1.1276 0.9003 1.0059 0.1969  0.0333  0.0280  150 ARG A NH2 
1049 N N   . GLU A 129 ? 1.1122 0.7718 0.9178 0.1501  -0.0220 -0.0291 151 GLU A N   
1050 C CA  . GLU A 129 ? 1.1721 0.8136 0.9782 0.1484  -0.0248 -0.0451 151 GLU A CA  
1051 C C   . GLU A 129 ? 1.1715 0.7816 0.9745 0.1391  -0.0184 -0.0439 151 GLU A C   
1052 O O   . GLU A 129 ? 1.2443 0.8358 1.0435 0.1437  -0.0192 -0.0512 151 GLU A O   
1053 C CB  . GLU A 129 ? 1.2026 0.8533 1.0255 0.1410  -0.0295 -0.0607 151 GLU A CB  
1054 C CG  . GLU A 129 ? 1.3103 0.9729 1.1240 0.1594  -0.0405 -0.0721 151 GLU A CG  
1055 C CD  . GLU A 129 ? 1.5040 1.1808 1.3301 0.1571  -0.0488 -0.0848 151 GLU A CD  
1056 O OE1 . GLU A 129 ? 1.6867 1.3701 1.5337 0.1393  -0.0442 -0.0832 151 GLU A OE1 
1057 O OE2 . GLU A 129 ? 1.7158 1.3948 1.5269 0.1760  -0.0606 -0.0968 151 GLU A OE2 
1058 N N   . MET A 130 ? 1.2079 0.8078 1.0080 0.1282  -0.0108 -0.0340 152 MET A N   
1059 C CA  . MET A 130 ? 1.2833 0.8437 1.0693 0.1229  -0.0001 -0.0296 152 MET A CA  
1060 C C   . MET A 130 ? 1.2657 0.8092 1.0274 0.1378  -0.0048 -0.0214 152 MET A C   
1061 O O   . MET A 130 ? 1.2877 0.8009 1.0395 0.1397  0.0005  -0.0239 152 MET A O   
1062 C CB  . MET A 130 ? 1.3150 0.8634 1.0927 0.1131  0.0095  -0.0197 152 MET A CB  
1063 C CG  . MET A 130 ? 1.3635 0.9173 1.1690 0.0965  0.0195  -0.0292 152 MET A CG  
1064 S SD  . MET A 130 ? 1.4986 1.0510 1.2962 0.0874  0.0287  -0.0180 152 MET A SD  
1065 C CE  . MET A 130 ? 1.5533 1.0487 1.3020 0.0955  0.0413  -0.0029 152 MET A CE  
1066 N N   . LYS A 131 ? 1.2706 0.8341 1.0286 0.1484  -0.0147 -0.0128 153 LYS A N   
1067 C CA  . LYS A 131 ? 1.3054 0.8603 1.0510 0.1642  -0.0226 -0.0074 153 LYS A CA  
1068 C C   . LYS A 131 ? 1.3622 0.9155 1.1101 0.1725  -0.0230 -0.0151 153 LYS A C   
1069 O O   . LYS A 131 ? 1.4652 0.9933 1.1975 0.1812  -0.0244 -0.0138 153 LYS A O   
1070 C CB  . LYS A 131 ? 1.3798 0.9674 1.1427 0.1719  -0.0319 -0.0015 153 LYS A CB  
1071 C CG  . LYS A 131 ? 1.5378 1.1291 1.3072 0.1889  -0.0416 0.0012  153 LYS A CG  
1072 C CD  . LYS A 131 ? 1.6352 1.2652 1.4402 0.1928  -0.0447 0.0043  153 LYS A CD  
1073 C CE  . LYS A 131 ? 1.7144 1.3560 1.5439 0.2092  -0.0490 0.0046  153 LYS A CE  
1074 N NZ  . LYS A 131 ? 1.7727 1.3859 1.5863 0.2199  -0.0636 0.0031  153 LYS A NZ  
1075 N N   . ARG A 132 ? 1.3484 0.9250 1.1113 0.1722  -0.0229 -0.0238 154 ARG A N   
1076 C CA  . ARG A 132 ? 1.3405 0.9131 1.1009 0.1825  -0.0248 -0.0337 154 ARG A CA  
1077 C C   . ARG A 132 ? 1.3233 0.8659 1.0824 0.1745  -0.0218 -0.0457 154 ARG A C   
1078 O O   . ARG A 132 ? 1.2780 0.8035 1.0290 0.1833  -0.0234 -0.0505 154 ARG A O   
1079 C CB  . ARG A 132 ? 1.3049 0.9038 1.0719 0.1896  -0.0272 -0.0407 154 ARG A CB  
1080 C CG  . ARG A 132 ? 1.3547 0.9480 1.1100 0.2076  -0.0299 -0.0490 154 ARG A CG  
1081 C CD  . ARG A 132 ? 1.4624 1.0582 1.2138 0.2129  -0.0373 -0.0664 154 ARG A CD  
1082 N NE  . ARG A 132 ? 1.5717 1.1475 1.3336 0.2032  -0.0447 -0.0852 154 ARG A NE  
1083 C CZ  . ARG A 132 ? 1.6007 1.1568 1.3569 0.2125  -0.0515 -0.0994 154 ARG A CZ  
1084 N NH1 . ARG A 132 ? 1.6670 1.2179 1.3998 0.2331  -0.0514 -0.0962 154 ARG A NH1 
1085 N NH2 . ARG A 132 ? 1.5243 1.0645 1.3030 0.2010  -0.0570 -0.1180 154 ARG A NH2 
1086 N N   . ASP A 133 ? 1.3416 0.8783 1.1144 0.1579  -0.0162 -0.0514 155 ASP A N   
1087 C CA  . ASP A 133 ? 1.3831 0.8917 1.1696 0.1475  -0.0091 -0.0643 155 ASP A CA  
1088 C C   . ASP A 133 ? 1.4318 0.8996 1.1969 0.1490  0.0017  -0.0544 155 ASP A C   
1089 O O   . ASP A 133 ? 1.4402 0.8849 1.2081 0.1512  0.0041  -0.0631 155 ASP A O   
1090 C CB  . ASP A 133 ? 1.4592 0.9694 1.2713 0.1289  -0.0003 -0.0695 155 ASP A CB  
1091 C CG  . ASP A 133 ? 1.5709 1.0686 1.4206 0.1190  0.0023  -0.0916 155 ASP A CG  
1092 O OD1 . ASP A 133 ? 1.6856 1.1652 1.5378 0.1248  -0.0002 -0.1014 155 ASP A OD1 
1093 O OD2 . ASP A 133 ? 1.6043 1.1106 1.4867 0.1054  0.0065  -0.1009 155 ASP A OD2 
1094 N N   . VAL A 134 ? 1.4385 0.8948 1.1792 0.1506  0.0064  -0.0372 156 VAL A N   
1095 C CA  . VAL A 134 ? 1.5643 0.9786 1.2720 0.1592  0.0125  -0.0265 156 VAL A CA  
1096 C C   . VAL A 134 ? 1.5460 0.9634 1.2426 0.1772  -0.0002 -0.0267 156 VAL A C   
1097 O O   . VAL A 134 ? 1.6314 1.0153 1.3148 0.1819  0.0050  -0.0280 156 VAL A O   
1098 C CB  . VAL A 134 ? 1.5915 0.9916 1.2694 0.1630  0.0136  -0.0107 156 VAL A CB  
1099 C CG1 . VAL A 134 ? 1.7132 1.0749 1.3502 0.1813  0.0095  -0.0013 156 VAL A CG1 
1100 C CG2 . VAL A 134 ? 1.5795 0.9536 1.2563 0.1479  0.0350  -0.0080 156 VAL A CG2 
1101 N N   . LEU A 135 ? 1.5750 1.0298 1.2787 0.1875  -0.0141 -0.0247 157 LEU A N   
1102 C CA  . LEU A 135 ? 1.6175 1.0744 1.3145 0.2055  -0.0233 -0.0236 157 LEU A CA  
1103 C C   . LEU A 135 ? 1.6153 1.0686 1.3188 0.2087  -0.0223 -0.0364 157 LEU A C   
1104 O O   . LEU A 135 ? 1.6941 1.1330 1.3868 0.2215  -0.0253 -0.0365 157 LEU A O   
1105 C CB  . LEU A 135 ? 1.6553 1.1521 1.3687 0.2157  -0.0327 -0.0186 157 LEU A CB  
1106 C CG  . LEU A 135 ? 1.9303 1.4283 1.6405 0.2180  -0.0404 -0.0087 157 LEU A CG  
1107 C CD1 . LEU A 135 ? 1.8596 1.4017 1.6016 0.2207  -0.0452 -0.0061 157 LEU A CD1 
1108 C CD2 . LEU A 135 ? 2.0082 1.4757 1.6970 0.2340  -0.0501 -0.0051 157 LEU A CD2 
1109 N N   . ALA A 136 ? 1.5674 1.0320 1.2886 0.1989  -0.0207 -0.0491 158 ALA A N   
1110 C CA  . ALA A 136 ? 1.5378 0.9984 1.2645 0.2054  -0.0251 -0.0653 158 ALA A CA  
1111 C C   . ALA A 136 ? 1.5803 1.0085 1.3195 0.1927  -0.0182 -0.0779 158 ALA A C   
1112 O O   . ALA A 136 ? 1.5555 0.9712 1.2984 0.1992  -0.0230 -0.0917 158 ALA A O   
1113 C CB  . ALA A 136 ? 1.4683 0.9608 1.2046 0.2107  -0.0334 -0.0755 158 ALA A CB  
1114 N N   . ASN A 137 ? 1.5901 1.0031 1.3390 0.1754  -0.0052 -0.0739 159 ASN A N   
1115 C CA  . ASN A 137 ? 1.5972 0.9747 1.3661 0.1622  0.0090  -0.0838 159 ASN A CA  
1116 C C   . ASN A 137 ? 1.6709 1.0055 1.4159 0.1570  0.0309  -0.0654 159 ASN A C   
1117 O O   . ASN A 137 ? 1.6138 0.9262 1.3758 0.1413  0.0512  -0.0655 159 ASN A O   
1118 C CB  . ASN A 137 ? 1.5487 0.9435 1.3623 0.1468  0.0084  -0.1018 159 ASN A CB  
1119 C CG  . ASN A 137 ? 1.4903 0.9199 1.3157 0.1577  -0.0158 -0.1209 159 ASN A CG  
1120 O OD1 . ASN A 137 ? 1.5624 0.9846 1.3958 0.1665  -0.0270 -0.1387 159 ASN A OD1 
1121 N ND2 . ASN A 137 ? 1.4314 0.8944 1.2538 0.1593  -0.0239 -0.1175 159 ASN A ND2 
1122 N N   . ARG A 138 ? 1.7407 1.0612 1.4448 0.1730  0.0267  -0.0504 160 ARG A N   
1123 C CA  . ARG A 138 ? 1.8553 1.1262 1.5197 0.1776  0.0422  -0.0332 160 ARG A CA  
1124 C C   . ARG A 138 ? 1.9811 1.2028 1.6563 0.1673  0.0680  -0.0379 160 ARG A C   
1125 O O   . ARG A 138 ? 1.9684 1.1650 1.6504 0.1540  0.0921  -0.0335 160 ARG A O   
1126 C CB  . ARG A 138 ? 1.9366 1.2028 1.5650 0.2005  0.0261  -0.0242 160 ARG A CB  
1127 C CG  . ARG A 138 ? 2.1939 1.3992 1.7789 0.2133  0.0365  -0.0139 160 ARG A CG  
1128 C CD  . ARG A 138 ? 2.2759 1.4396 1.8147 0.2194  0.0468  0.0026  160 ARG A CD  
1129 N NE  . ARG A 138 ? 2.2343 1.4318 1.7659 0.2269  0.0259  0.0077  160 ARG A NE  
1130 C CZ  . ARG A 138 ? 2.4016 1.5674 1.8884 0.2386  0.0248  0.0196  160 ARG A CZ  
1131 N NH1 . ARG A 138 ? 2.3908 1.4858 1.8265 0.2468  0.0459  0.0302  160 ARG A NH1 
1132 N NH2 . ARG A 138 ? 2.4393 1.6404 1.9303 0.2445  0.0030  0.0206  160 ARG A NH2 
1133 N N   . HIS A 139 ? 2.0828 1.2920 1.7654 0.1730  0.0648  -0.0477 161 HIS A N   
1134 C CA  . HIS A 139 ? 2.2309 1.3941 1.9338 0.1634  0.0891  -0.0550 161 HIS A CA  
1135 C C   . HIS A 139 ? 2.2275 1.3885 1.9827 0.1398  0.1107  -0.0651 161 HIS A C   
1136 O O   . HIS A 139 ? 2.3117 1.4214 2.0682 0.1315  0.1448  -0.0577 161 HIS A O   
1137 C CB  . HIS A 139 ? 2.2862 1.4596 2.0125 0.1689  0.0734  -0.0742 161 HIS A CB  
1138 C CG  . HIS A 139 ? 2.3590 1.5877 2.1255 0.1658  0.0487  -0.0960 161 HIS A CG  
1139 N ND1 . HIS A 139 ? 2.3846 1.6234 2.2095 0.1495  0.0504  -0.1186 161 HIS A ND1 
1140 C CD2 . HIS A 139 ? 2.3418 1.6145 2.0964 0.1794  0.0226  -0.0988 161 HIS A CD2 
1141 C CE1 . HIS A 139 ? 2.3423 1.6267 2.1812 0.1557  0.0228  -0.1349 161 HIS A CE1 
1142 N NE2 . HIS A 139 ? 2.3236 1.6271 2.1180 0.1738  0.0087  -0.1216 161 HIS A NE2 
1143 N N   . GLN A 140 ? 2.1075 1.3209 1.9045 0.1307  0.0927  -0.0813 162 GLN A N   
1144 C CA  . GLN A 140 ? 2.0420 1.2615 1.9030 0.1095  0.1061  -0.0980 162 GLN A CA  
1145 C C   . GLN A 140 ? 1.9985 1.1936 1.8507 0.0983  0.1372  -0.0802 162 GLN A C   
1146 O O   . GLN A 140 ? 2.0361 1.2264 1.9443 0.0799  0.1572  -0.0913 162 GLN A O   
1147 C CB  . GLN A 140 ? 2.0650 1.3455 1.9615 0.1089  0.0733  -0.1200 162 GLN A CB  
1148 C CG  . GLN A 140 ? 2.0544 1.3502 2.0246 0.0901  0.0768  -0.1436 162 GLN A CG  
1149 C CD  . GLN A 140 ? 2.1327 1.4553 2.1041 0.0819  0.0792  -0.1351 162 GLN A CD  
1150 O OE1 . GLN A 140 ? 2.0854 1.4475 2.0313 0.0917  0.0549  -0.1319 162 GLN A OE1 
1151 N NE2 . GLN A 140 ? 2.1812 1.4800 2.1838 0.0641  0.1114  -0.1312 162 GLN A NE2 
1152 N N   . PHE A 141 ? 1.9673 1.1453 1.7521 0.1109  0.1407  -0.0545 163 PHE A N   
1153 C CA  . PHE A 141 ? 2.0098 1.1544 1.7714 0.1055  0.1707  -0.0361 163 PHE A CA  
1154 C C   . PHE A 141 ? 2.1313 1.1964 1.8419 0.1149  0.2058  -0.0163 163 PHE A C   
1155 O O   . PHE A 141 ? 2.1341 1.1567 1.8189 0.1133  0.2378  -0.0004 163 PHE A O   
1156 C CB  . PHE A 141 ? 1.9503 1.1264 1.6704 0.1151  0.1492  -0.0233 163 PHE A CB  
1157 C CG  . PHE A 141 ? 1.8248 1.0670 1.5919 0.1042  0.1269  -0.0386 163 PHE A CG  
1158 C CD1 . PHE A 141 ? 1.7842 1.0348 1.6012 0.0848  0.1436  -0.0478 163 PHE A CD1 
1159 C CD2 . PHE A 141 ? 1.6982 0.9906 1.4613 0.1146  0.0917  -0.0442 163 PHE A CD2 
1160 C CE1 . PHE A 141 ? 1.7537 1.0615 1.6104 0.0774  0.1214  -0.0628 163 PHE A CE1 
1161 C CE2 . PHE A 141 ? 1.6658 1.0112 1.4645 0.1078  0.0738  -0.0571 163 PHE A CE2 
1162 C CZ  . PHE A 141 ? 1.7082 1.0613 1.5513 0.0898  0.0864  -0.0669 163 PHE A CZ  
1163 N N   . GLY A 142 ? 2.1552 1.1958 1.8459 0.1269  0.2012  -0.0165 164 GLY A N   
1164 C CA  . GLY A 142 ? 2.2662 1.2267 1.9027 0.1395  0.2333  0.0020  164 GLY A CA  
1165 C C   . GLY A 142 ? 2.2816 1.2111 1.8274 0.1634  0.2283  0.0259  164 GLY A C   
1166 O O   . GLY A 142 ? 2.1522 1.1211 1.6725 0.1775  0.1893  0.0262  164 GLY A O   
1167 N N   . GLU A 143 ? 2.3934 1.2493 1.8927 0.1695  0.2690  0.0447  165 GLU A N   
1168 C CA  . GLU A 143 ? 2.4271 1.2329 1.8266 0.1991  0.2659  0.0666  165 GLU A CA  
1169 C C   . GLU A 143 ? 2.3498 1.1876 1.7334 0.2002  0.2493  0.0706  165 GLU A C   
1170 O O   . GLU A 143 ? 2.3231 1.1509 1.6405 0.2254  0.2231  0.0795  165 GLU A O   
1171 C CB  . GLU A 143 ? 2.5037 1.2057 1.8469 0.2104  0.3196  0.0864  165 GLU A CB  
1172 C CG  . GLU A 143 ? 2.5118 1.1736 1.8636 0.2123  0.3375  0.0844  165 GLU A CG  
1173 C CD  . GLU A 143 ? 2.6266 1.1781 1.9188 0.2255  0.3964  0.1065  165 GLU A CD  
1174 O OE1 . GLU A 143 ? 2.6514 1.1595 1.9065 0.2293  0.4291  0.1219  165 GLU A OE1 
1175 O OE2 . GLU A 143 ? 2.5608 1.0648 1.8401 0.2336  0.4127  0.1093  165 GLU A OE2 
1176 N N   . ALA A 144 ? 2.3097 1.1876 1.7582 0.1738  0.2612  0.0616  166 ALA A N   
1177 C CA  . ALA A 144 ? 2.2771 1.1917 1.7194 0.1722  0.2449  0.0636  166 ALA A CA  
1178 C C   . ALA A 144 ? 2.1380 1.1334 1.6005 0.1748  0.1908  0.0519  166 ALA A C   
1179 O O   . ALA A 144 ? 2.0842 1.1243 1.5652 0.1672  0.1764  0.0489  166 ALA A O   
1180 C CB  . ALA A 144 ? 2.2102 1.1440 1.7207 0.1435  0.2740  0.0563  166 ALA A CB  
1181 N N   . ALA A 145 ? 2.1172 1.1281 1.5764 0.1864  0.1640  0.0462  167 ALA A N   
1182 C CA  . ALA A 145 ? 2.0441 1.1296 1.5336 0.1874  0.1213  0.0348  167 ALA A CA  
1183 C C   . ALA A 145 ? 2.0928 1.1833 1.5339 0.2107  0.0907  0.0426  167 ALA A C   
1184 O O   . ALA A 145 ? 2.1677 1.3171 1.6377 0.2065  0.0663  0.0367  167 ALA A O   
1185 C CB  . ALA A 145 ? 1.9817 1.0848 1.4980 0.1887  0.1086  0.0235  167 ALA A CB  
1186 N N   . SER A 146 ? 2.1826 1.2108 1.5527 0.2367  0.0907  0.0541  168 SER A N   
1187 C CA  . SER A 146 ? 2.2044 1.2358 1.5342 0.2619  0.0557  0.0566  168 SER A CA  
1188 C C   . SER A 146 ? 2.2301 1.2568 1.5389 0.2616  0.0578  0.0623  168 SER A C   
1189 O O   . SER A 146 ? 2.2504 1.3092 1.5599 0.2722  0.0248  0.0580  168 SER A O   
1190 C CB  . SER A 146 ? 2.3026 1.2644 1.5571 0.2952  0.0490  0.0644  168 SER A CB  
1191 O OG  . SER A 146 ? 2.3206 1.3141 1.5982 0.3048  0.0200  0.0550  168 SER A OG  
1192 N N   . LEU A 147 ? 2.2562 1.2421 1.5510 0.2497  0.0979  0.0710  169 LEU A N   
1193 C CA  . LEU A 147 ? 2.2780 1.2580 1.5549 0.2475  0.1052  0.0766  169 LEU A CA  
1194 C C   . LEU A 147 ? 2.1720 1.2411 1.5286 0.2216  0.0891  0.0644  169 LEU A C   
1195 O O   . LEU A 147 ? 2.1303 1.2256 1.4849 0.2249  0.0692  0.0633  169 LEU A O   
1196 C CB  . LEU A 147 ? 2.3554 1.2669 1.6038 0.2408  0.1589  0.0895  169 LEU A CB  
1197 C CG  . LEU A 147 ? 2.5652 1.3784 1.7322 0.2667  0.1848  0.1040  169 LEU A CG  
1198 C CD1 . LEU A 147 ? 2.6240 1.3787 1.7914 0.2525  0.2477  0.1152  169 LEU A CD1 
1199 C CD2 . LEU A 147 ? 2.5732 1.3275 1.6377 0.3079  0.1630  0.1132  169 LEU A CD2 
1200 N N   . LEU A 148 ? 2.0777 1.1904 1.5015 0.1987  0.0958  0.0541  170 LEU A N   
1201 C CA  . LEU A 148 ? 1.9425 1.1329 1.4351 0.1780  0.0814  0.0422  170 LEU A CA  
1202 C C   . LEU A 148 ? 1.8350 1.0775 1.3413 0.1888  0.0417  0.0366  170 LEU A C   
1203 O O   . LEU A 148 ? 1.7232 1.0095 1.2541 0.1823  0.0285  0.0338  170 LEU A O   
1204 C CB  . LEU A 148 ? 1.9229 1.1388 1.4762 0.1569  0.0945  0.0299  170 LEU A CB  
1205 C CG  . LEU A 148 ? 1.9601 1.1809 1.5558 0.1329  0.1219  0.0249  170 LEU A CG  
1206 C CD1 . LEU A 148 ? 2.0993 1.2510 1.6536 0.1349  0.1594  0.0392  170 LEU A CD1 
1207 C CD2 . LEU A 148 ? 1.9397 1.1764 1.5943 0.1174  0.1296  0.0086  170 LEU A CD2 
1208 N N   . GLU A 149 ? 1.8236 1.0608 1.3186 0.2049  0.0250  0.0348  171 GLU A N   
1209 C CA  . GLU A 149 ? 1.8996 1.1870 1.4200 0.2148  -0.0083 0.0285  171 GLU A CA  
1210 C C   . GLU A 149 ? 1.9609 1.2488 1.4601 0.2294  -0.0304 0.0310  171 GLU A C   
1211 O O   . GLU A 149 ? 1.9739 1.3152 1.5144 0.2269  -0.0496 0.0254  171 GLU A O   
1212 C CB  . GLU A 149 ? 1.9610 1.2370 1.4733 0.2313  -0.0203 0.0258  171 GLU A CB  
1213 C CG  . GLU A 149 ? 1.9571 1.2885 1.5111 0.2389  -0.0475 0.0183  171 GLU A CG  
1214 C CD  . GLU A 149 ? 2.0576 1.3859 1.6167 0.2499  -0.0529 0.0142  171 GLU A CD  
1215 O OE1 . GLU A 149 ? 2.0595 1.3345 1.5769 0.2594  -0.0447 0.0180  171 GLU A OE1 
1216 O OE2 . GLU A 149 ? 1.9982 1.3742 1.6014 0.2501  -0.0626 0.0080  171 GLU A OE2 
1217 N N   . THR A 150 ? 1.9935 1.2183 1.4275 0.2463  -0.0269 0.0389  172 THR A N   
1218 C CA  . THR A 150 ? 1.9748 1.1923 1.3822 0.2636  -0.0509 0.0387  172 THR A CA  
1219 C C   . THR A 150 ? 1.8766 1.1126 1.2976 0.2453  -0.0379 0.0412  172 THR A C   
1220 O O   . THR A 150 ? 1.8906 1.1614 1.3332 0.2478  -0.0611 0.0359  172 THR A O   
1221 C CB  . THR A 150 ? 2.0465 1.1823 1.3665 0.2960  -0.0569 0.0448  172 THR A CB  
1222 O OG1 . THR A 150 ? 2.0844 1.1577 1.3556 0.2912  -0.0155 0.0577  172 THR A OG1 
1223 C CG2 . THR A 150 ? 2.0755 1.1999 1.3877 0.3169  -0.0776 0.0398  172 THR A CG2 
1224 N N   . GLU A 151 ? 1.7847 1.0001 1.2013 0.2267  -0.0010 0.0478  173 GLU A N   
1225 C CA  . GLU A 151 ? 1.7244 0.9564 1.1569 0.2090  0.0136  0.0497  173 GLU A CA  
1226 C C   . GLU A 151 ? 1.5974 0.9101 1.1044 0.1882  0.0020  0.0405  173 GLU A C   
1227 O O   . GLU A 151 ? 1.5490 0.8862 1.0693 0.1818  -0.0031 0.0399  173 GLU A O   
1228 C CB  . GLU A 151 ? 1.7508 0.9415 1.1723 0.1941  0.0580  0.0570  173 GLU A CB  
1229 C CG  . GLU A 151 ? 1.9896 1.0927 1.3259 0.2156  0.0779  0.0705  173 GLU A CG  
1230 C CD  . GLU A 151 ? 2.0972 1.1878 1.4008 0.2227  0.0748  0.0747  173 GLU A CD  
1231 O OE1 . GLU A 151 ? 2.1204 1.2193 1.4490 0.2023  0.1022  0.0770  173 GLU A OE1 
1232 O OE2 . GLU A 151 ? 2.1785 1.2505 1.4340 0.2497  0.0436  0.0740  173 GLU A OE2 
1233 N N   . ILE A 152 ? 1.5415 0.8904 1.0917 0.1801  -0.0010 0.0338  174 ILE A N   
1234 C CA  . ILE A 152 ? 1.4547 0.8710 1.0643 0.1672  -0.0114 0.0261  174 ILE A CA  
1235 C C   . ILE A 152 ? 1.4634 0.9101 1.0871 0.1815  -0.0414 0.0236  174 ILE A C   
1236 O O   . ILE A 152 ? 1.4612 0.9514 1.1205 0.1741  -0.0485 0.0212  174 ILE A O   
1237 C CB  . ILE A 152 ? 1.4385 0.8740 1.0798 0.1589  -0.0044 0.0191  174 ILE A CB  
1238 C CG1 . ILE A 152 ? 1.4528 0.8658 1.0996 0.1421  0.0231  0.0168  174 ILE A CG1 
1239 C CG2 . ILE A 152 ? 1.4125 0.9092 1.1019 0.1531  -0.0156 0.0124  174 ILE A CG2 
1240 C CD1 . ILE A 152 ? 1.4567 0.8716 1.1251 0.1387  0.0278  0.0078  174 ILE A CD1 
1241 N N   . GLU A 153 ? 1.4768 0.8996 1.0770 0.2026  -0.0584 0.0232  175 GLU A N   
1242 C CA  . GLU A 153 ? 1.4755 0.9225 1.0969 0.2181  -0.0886 0.0176  175 GLU A CA  
1243 C C   . GLU A 153 ? 1.4290 0.8733 1.0396 0.2203  -0.0994 0.0177  175 GLU A C   
1244 O O   . GLU A 153 ? 1.3884 0.8739 1.0435 0.2203  -0.1162 0.0119  175 GLU A O   
1245 C CB  . GLU A 153 ? 1.4622 0.8762 1.0566 0.2434  -0.1080 0.0147  175 GLU A CB  
1246 N N   . LYS A 154 ? 1.5081 0.9028 1.0621 0.2218  -0.0863 0.0244  176 LYS A N   
1247 C CA  . LYS A 154 ? 1.5618 0.9462 1.0956 0.2255  -0.0943 0.0248  176 LYS A CA  
1248 C C   . LYS A 154 ? 1.5170 0.9536 1.1010 0.2020  -0.0852 0.0243  176 LYS A C   
1249 O O   . LYS A 154 ? 1.5491 0.9869 1.1277 0.2044  -0.0951 0.0230  176 LYS A O   
1250 C CB  . LYS A 154 ? 1.6249 0.9358 1.0797 0.2344  -0.0744 0.0345  176 LYS A CB  
1251 C CG  . LYS A 154 ? 1.7360 0.9844 1.1235 0.2681  -0.0930 0.0342  176 LYS A CG  
1252 C CD  . LYS A 154 ? 1.8213 0.9849 1.1214 0.2805  -0.0648 0.0470  176 LYS A CD  
1253 C CE  . LYS A 154 ? 2.0026 1.1043 1.2252 0.3218  -0.0954 0.0439  176 LYS A CE  
1254 N NZ  . LYS A 154 ? 2.1566 1.1712 1.2927 0.3448  -0.0760 0.0548  176 LYS A NZ  
1255 N N   . PHE A 155 ? 1.4532 0.9292 1.0815 0.1818  -0.0682 0.0243  177 PHE A N   
1256 C CA  . PHE A 155 ? 1.4086 0.9341 1.0832 0.1637  -0.0628 0.0229  177 PHE A CA  
1257 C C   . PHE A 155 ? 1.3711 0.9450 1.0981 0.1677  -0.0824 0.0175  177 PHE A C   
1258 O O   . PHE A 155 ? 1.4085 1.0145 1.1658 0.1585  -0.0823 0.0169  177 PHE A O   
1259 C CB  . PHE A 155 ? 1.3819 0.9256 1.0788 0.1447  -0.0394 0.0228  177 PHE A CB  
1260 C CG  . PHE A 155 ? 1.3885 0.8905 1.0541 0.1364  -0.0151 0.0262  177 PHE A CG  
1261 C CD1 . PHE A 155 ? 1.4309 0.8955 1.0586 0.1382  -0.0061 0.0320  177 PHE A CD1 
1262 C CD2 . PHE A 155 ? 1.3987 0.8968 1.0761 0.1277  0.0005  0.0228  177 PHE A CD2 
1263 C CE1 . PHE A 155 ? 1.4770 0.9001 1.0821 0.1306  0.0232  0.0362  177 PHE A CE1 
1264 C CE2 . PHE A 155 ? 1.4477 0.9077 1.1096 0.1188  0.0262  0.0246  177 PHE A CE2 
1265 C CZ  . PHE A 155 ? 1.4725 0.8946 1.1000 0.1197  0.0403  0.0322  177 PHE A CZ  
1266 N N   . GLU A 156 ? 1.3741 0.9527 1.1161 0.1812  -0.0962 0.0135  178 GLU A N   
1267 C CA  . GLU A 156 ? 1.3730 0.9967 1.1756 0.1844  -0.1084 0.0084  178 GLU A CA  
1268 C C   . GLU A 156 ? 1.3621 0.9925 1.1824 0.1919  -0.1311 0.0023  178 GLU A C   
1269 O O   . GLU A 156 ? 1.3078 0.9753 1.1737 0.1827  -0.1280 0.0018  178 GLU A O   
1270 C CB  . GLU A 156 ? 1.4690 1.0962 1.2910 0.1979  -0.1168 0.0044  178 GLU A CB  
1271 C CG  . GLU A 156 ? 1.5381 1.2100 1.4322 0.2014  -0.1237 -0.0006 178 GLU A CG  
1272 C CD  . GLU A 156 ? 1.6718 1.3595 1.5937 0.2059  -0.1130 -0.0002 178 GLU A CD  
1273 O OE1 . GLU A 156 ? 1.8045 1.4711 1.7136 0.2202  -0.1256 -0.0044 178 GLU A OE1 
1274 O OE2 . GLU A 156 ? 1.5767 1.2941 1.5285 0.1976  -0.0917 0.0045  178 GLU A OE2 
1275 N N   . PRO A 157 ? 1.3928 0.9841 1.1754 0.2110  -0.1551 -0.0033 179 PRO A N   
1276 C CA  . PRO A 157 ? 1.3297 0.9256 1.1278 0.2188  -0.1795 -0.0119 179 PRO A CA  
1277 C C   . PRO A 157 ? 1.3091 0.9150 1.1020 0.2015  -0.1643 -0.0059 179 PRO A C   
1278 O O   . PRO A 157 ? 1.3683 1.0032 1.2058 0.1991  -0.1756 -0.0120 179 PRO A O   
1279 C CB  . PRO A 157 ? 1.4019 0.9376 1.1316 0.2450  -0.2044 -0.0174 179 PRO A CB  
1280 C CG  . PRO A 157 ? 1.4854 0.9817 1.1574 0.2455  -0.1833 -0.0070 179 PRO A CG  
1281 C CD  . PRO A 157 ? 1.4376 0.9763 1.1609 0.2291  -0.1634 -0.0033 179 PRO A CD  
1282 N N   . ARG A 158 ? 1.2962 0.8787 1.0415 0.1896  -0.1384 0.0045  180 ARG A N   
1283 C CA  . ARG A 158 ? 1.2040 0.7934 0.9436 0.1735  -0.1228 0.0096  180 ARG A CA  
1284 C C   . ARG A 158 ? 1.1238 0.7692 0.9248 0.1549  -0.1096 0.0111  180 ARG A C   
1285 O O   . ARG A 158 ? 1.1191 0.7815 0.9345 0.1458  -0.1070 0.0116  180 ARG A O   
1286 C CB  . ARG A 158 ? 1.2643 0.8128 0.9473 0.1663  -0.0967 0.0185  180 ARG A CB  
1287 C CG  . ARG A 158 ? 1.3907 0.8722 0.9995 0.1880  -0.1047 0.0198  180 ARG A CG  
1288 C CD  . ARG A 158 ? 1.3955 0.8294 0.9525 0.1825  -0.0719 0.0301  180 ARG A CD  
1289 N NE  . ARG A 158 ? 1.4482 0.8803 0.9997 0.1682  -0.0513 0.0347  180 ARG A NE  
1290 C CZ  . ARG A 158 ? 1.5230 0.9327 1.0606 0.1545  -0.0163 0.0419  180 ARG A CZ  
1291 N NH1 . ARG A 158 ? 1.6032 0.9890 1.1308 0.1526  0.0025  0.0451  180 ARG A NH1 
1292 N NH2 . ARG A 158 ? 1.5331 0.9445 1.0731 0.1425  0.0006  0.0445  180 ARG A NH2 
1293 N N   . LEU A 159 ? 1.0959 0.7667 0.9293 0.1517  -0.1007 0.0120  181 LEU A N   
1294 C CA  . LEU A 159 ? 1.0787 0.7962 0.9657 0.1414  -0.0894 0.0137  181 LEU A CA  
1295 C C   . LEU A 159 ? 1.0526 0.7948 0.9921 0.1477  -0.1058 0.0079  181 LEU A C   
1296 O O   . LEU A 159 ? 1.0259 0.7893 0.9898 0.1392  -0.1011 0.0091  181 LEU A O   
1297 C CB  . LEU A 159 ? 1.0859 0.8176 0.9881 0.1416  -0.0756 0.0159  181 LEU A CB  
1298 C CG  . LEU A 159 ? 1.1399 0.8551 1.0055 0.1331  -0.0592 0.0185  181 LEU A CG  
1299 C CD1 . LEU A 159 ? 1.1906 0.9089 1.0611 0.1389  -0.0524 0.0179  181 LEU A CD1 
1300 C CD2 . LEU A 159 ? 1.1550 0.8884 1.0265 0.1195  -0.0456 0.0202  181 LEU A CD2 
1301 N N   . GLU A 160 ? 1.1307 0.8692 1.0915 0.1631  -0.1259 0.0000  182 GLU A N   
1302 C CA  . GLU A 160 ? 1.1516 0.9147 1.1783 0.1701  -0.1437 -0.0098 182 GLU A CA  
1303 C C   . GLU A 160 ? 1.1175 0.8724 1.1338 0.1692  -0.1600 -0.0150 182 GLU A C   
1304 O O   . GLU A 160 ? 1.0572 0.8413 1.1277 0.1631  -0.1588 -0.0176 182 GLU A O   
1305 C CB  . GLU A 160 ? 1.2568 1.0109 1.3053 0.1897  -0.1697 -0.0221 182 GLU A CB  
1306 C CG  . GLU A 160 ? 1.3559 1.1121 1.4079 0.1932  -0.1558 -0.0177 182 GLU A CG  
1307 C CD  . GLU A 160 ? 1.4600 1.2056 1.5327 0.2142  -0.1840 -0.0312 182 GLU A CD  
1308 O OE1 . GLU A 160 ? 1.4954 1.2671 1.6454 0.2207  -0.1982 -0.0432 182 GLU A OE1 
1309 O OE2 . GLU A 160 ? 1.3897 1.1009 1.4072 0.2247  -0.1916 -0.0307 182 GLU A OE2 
1310 N N   . GLN A 161 ? 1.0978 0.8095 1.0424 0.1762  -0.1715 -0.0155 183 GLN A N   
1311 C CA  . GLN A 161 ? 1.1502 0.8460 1.0704 0.1775  -0.1844 -0.0193 183 GLN A CA  
1312 C C   . GLN A 161 ? 1.1160 0.8419 1.0593 0.1567  -0.1615 -0.0113 183 GLN A C   
1313 O O   . GLN A 161 ? 1.1709 0.9089 1.1417 0.1562  -0.1733 -0.0175 183 GLN A O   
1314 C CB  . GLN A 161 ? 1.2150 0.8533 1.0432 0.1869  -0.1857 -0.0154 183 GLN A CB  
1315 C CG  . GLN A 161 ? 1.3214 0.9170 1.1125 0.2156  -0.2185 -0.0265 183 GLN A CG  
1316 C CD  . GLN A 161 ? 1.3821 0.9183 1.0835 0.2251  -0.2062 -0.0173 183 GLN A CD  
1317 O OE1 . GLN A 161 ? 1.3290 0.8325 0.9736 0.2204  -0.1863 -0.0077 183 GLN A OE1 
1318 N NE2 . GLN A 161 ? 1.5424 1.0623 1.2338 0.2393  -0.2159 -0.0201 183 GLN A NE2 
1319 N N   . TYR A 162 ? 1.0992 0.8360 1.0322 0.1414  -0.1312 0.0006  184 TYR A N   
1320 C CA  . TYR A 162 ? 1.0326 0.7963 0.9854 0.1248  -0.1115 0.0070  184 TYR A CA  
1321 C C   . TYR A 162 ? 1.0175 0.8210 1.0444 0.1232  -0.1105 0.0048  184 TYR A C   
1322 O O   . TYR A 162 ? 1.0064 0.8241 1.0553 0.1169  -0.1101 0.0043  184 TYR A O   
1323 C CB  . TYR A 162 ? 1.0030 0.7700 0.9343 0.1128  -0.0845 0.0161  184 TYR A CB  
1324 C CG  . TYR A 162 ? 0.9574 0.7548 0.9145 0.1006  -0.0670 0.0211  184 TYR A CG  
1325 C CD1 . TYR A 162 ? 0.9165 0.7112 0.8566 0.0910  -0.0624 0.0224  184 TYR A CD1 
1326 C CD2 . TYR A 162 ? 0.9190 0.7437 0.9136 0.1012  -0.0535 0.0249  184 TYR A CD2 
1327 C CE1 . TYR A 162 ? 0.8639 0.6842 0.8251 0.0825  -0.0485 0.0262  184 TYR A CE1 
1328 C CE2 . TYR A 162 ? 0.8645 0.7093 0.8728 0.0946  -0.0374 0.0300  184 TYR A CE2 
1329 C CZ  . TYR A 162 ? 0.8423 0.6858 0.8346 0.0853  -0.0367 0.0301  184 TYR A CZ  
1330 O OH  . TYR A 162 ? 0.8412 0.7027 0.8448 0.0814  -0.0223 0.0346  184 TYR A OH  
1331 N N   . GLU A 163 ? 1.0171 0.8362 1.0848 0.1292  -0.1075 0.0038  185 GLU A N   
1332 C CA  . GLU A 163 ? 1.0124 0.8652 1.1565 0.1281  -0.0988 0.0032  185 GLU A CA  
1333 C C   . GLU A 163 ? 0.9838 0.8420 1.1708 0.1321  -0.1239 -0.0096 185 GLU A C   
1334 O O   . GLU A 163 ? 1.0311 0.9119 1.2660 0.1250  -0.1134 -0.0082 185 GLU A O   
1335 C CB  . GLU A 163 ? 1.0898 0.9533 1.2740 0.1365  -0.0916 0.0027  185 GLU A CB  
1336 C CG  . GLU A 163 ? 1.2387 1.0931 1.3777 0.1357  -0.0713 0.0127  185 GLU A CG  
1337 C CD  . GLU A 163 ? 1.3698 1.2435 1.5491 0.1388  -0.0429 0.0204  185 GLU A CD  
1338 O OE1 . GLU A 163 ? 1.3716 1.2589 1.5654 0.1337  -0.0197 0.0289  185 GLU A OE1 
1339 O OE2 . GLU A 163 ? 1.3773 1.2486 1.5689 0.1482  -0.0422 0.0186  185 GLU A OE2 
1340 N N   . VAL A 164 ? 0.9560 0.7895 1.1210 0.1454  -0.1576 -0.0227 186 VAL A N   
1341 C CA  . VAL A 164 ? 1.0205 0.8528 1.2208 0.1549  -0.1910 -0.0403 186 VAL A CA  
1342 C C   . VAL A 164 ? 1.0104 0.8373 1.1840 0.1465  -0.1909 -0.0381 186 VAL A C   
1343 O O   . VAL A 164 ? 1.1018 0.9490 1.3335 0.1436  -0.1975 -0.0458 186 VAL A O   
1344 C CB  . VAL A 164 ? 1.0513 0.8474 1.2152 0.1779  -0.2313 -0.0561 186 VAL A CB  
1345 C CG1 . VAL A 164 ? 1.0200 0.7997 1.1861 0.1921  -0.2711 -0.0754 186 VAL A CG1 
1346 C CG2 . VAL A 164 ? 0.9763 0.7868 1.1971 0.1880  -0.2388 -0.0644 186 VAL A CG2 
1347 N N   . LEU A 165 ? 1.0298 0.8284 1.1200 0.1428  -0.1819 -0.0283 187 LEU A N   
1348 C CA  . LEU A 165 ? 0.9702 0.7598 1.0270 0.1350  -0.1781 -0.0248 187 LEU A CA  
1349 C C   . LEU A 165 ? 0.9626 0.7894 1.0649 0.1169  -0.1510 -0.0155 187 LEU A C   
1350 O O   . LEU A 165 ? 1.0223 0.8566 1.1422 0.1127  -0.1557 -0.0189 187 LEU A O   
1351 C CB  . LEU A 165 ? 0.9705 0.7258 0.9417 0.1320  -0.1633 -0.0141 187 LEU A CB  
1352 C CG  . LEU A 165 ? 1.0275 0.7310 0.9294 0.1512  -0.1829 -0.0193 187 LEU A CG  
1353 C CD1 . LEU A 165 ? 1.0775 0.7543 0.9155 0.1432  -0.1547 -0.0056 187 LEU A CD1 
1354 C CD2 . LEU A 165 ? 1.0489 0.7245 0.9237 0.1658  -0.2101 -0.0305 187 LEU A CD2 
1355 N N   . LYS A 166 ? 0.9143 0.7594 1.0276 0.1085  -0.1227 -0.0036 188 LYS A N   
1356 C CA  . LYS A 166 ? 0.8970 0.7700 1.0432 0.0966  -0.0959 0.0061  188 LYS A CA  
1357 C C   . LYS A 166 ? 0.8877 0.7853 1.1180 0.0984  -0.0985 -0.0001 188 LYS A C   
1358 O O   . LYS A 166 ? 0.9443 0.8532 1.1992 0.0920  -0.0941 0.0002  188 LYS A O   
1359 C CB  . LYS A 166 ? 0.8777 0.7577 1.0122 0.0941  -0.0691 0.0176  188 LYS A CB  
1360 C CG  . LYS A 166 ? 0.8945 0.7966 1.0592 0.0888  -0.0413 0.0276  188 LYS A CG  
1361 C CD  . LYS A 166 ? 0.8925 0.7969 1.0486 0.0935  -0.0184 0.0365  188 LYS A CD  
1362 C CE  . LYS A 166 ? 0.9446 0.8604 1.1126 0.0930  0.0095  0.0473  188 LYS A CE  
1363 N NZ  . LYS A 166 ? 1.0495 0.9621 1.2086 0.1031  0.0313  0.0551  188 LYS A NZ  
1364 N N   . ALA A 167 ? 0.9392 0.8443 1.2179 0.1073  -0.1049 -0.0069 189 ALA A N   
1365 C CA  . ALA A 167 ? 0.8977 0.8256 1.2729 0.1100  -0.1081 -0.0166 189 ALA A CA  
1366 C C   . ALA A 167 ? 0.9049 0.8317 1.3088 0.1120  -0.1393 -0.0335 189 ALA A C   
1367 O O   . ALA A 167 ? 0.8747 0.8226 1.3561 0.1077  -0.1323 -0.0378 189 ALA A O   
1368 C CB  . ALA A 167 ? 0.8497 0.7806 1.2665 0.1214  -0.1185 -0.0258 189 ALA A CB  
1369 N N   . ASP A 168 ? 0.9324 0.8308 1.2723 0.1201  -0.1715 -0.0428 190 ASP A N   
1370 C CA  . ASP A 168 ? 0.9693 0.8584 1.3153 0.1252  -0.2026 -0.0587 190 ASP A CA  
1371 C C   . ASP A 168 ? 0.9703 0.8588 1.2814 0.1121  -0.1859 -0.0478 190 ASP A C   
1372 O O   . ASP A 168 ? 0.9795 0.8575 1.2866 0.1163  -0.2095 -0.0596 190 ASP A O   
1373 C CB  . ASP A 168 ? 1.0204 0.8699 1.3020 0.1451  -0.2431 -0.0731 190 ASP A CB  
1374 C CG  . ASP A 168 ? 1.0682 0.9171 1.3907 0.1620  -0.2689 -0.0892 190 ASP A CG  
1375 O OD1 . ASP A 168 ? 1.0239 0.9062 1.4438 0.1587  -0.2615 -0.0947 190 ASP A OD1 
1376 O OD2 . ASP A 168 ? 1.0739 0.8856 1.3301 0.1802  -0.2952 -0.0963 190 ASP A OD2 
1377 N N   . GLY A 169 ? 0.9272 0.8257 1.2136 0.0984  -0.1477 -0.0271 191 GLY A N   
1378 C CA  . GLY A 169 ? 0.9081 0.8073 1.1626 0.0868  -0.1309 -0.0169 191 GLY A CA  
1379 C C   . GLY A 169 ? 0.8966 0.7636 1.0660 0.0892  -0.1436 -0.0175 191 GLY A C   
1380 O O   . GLY A 169 ? 0.8504 0.7140 0.9995 0.0830  -0.1400 -0.0152 191 GLY A O   
1381 N N   . ASN A 170 ? 0.9354 0.7754 1.0546 0.0991  -0.1558 -0.0200 192 ASN A N   
1382 C CA  . ASN A 170 ? 1.0034 0.8061 1.0396 0.1025  -0.1590 -0.0177 192 ASN A CA  
1383 C C   . ASN A 170 ? 0.9880 0.7906 0.9861 0.0900  -0.1272 -0.0023 192 ASN A C   
1384 O O   . ASN A 170 ? 0.9400 0.7215 0.8983 0.0940  -0.1232 0.0008  192 ASN A O   
1385 C CB  . ASN A 170 ? 1.0345 0.7989 1.0311 0.1236  -0.1890 -0.0293 192 ASN A CB  
1386 C CG  . ASN A 170 ? 1.0588 0.8198 1.0898 0.1387  -0.2270 -0.0494 192 ASN A CG  
1387 O OD1 . ASN A 170 ? 1.0860 0.8551 1.1356 0.1345  -0.2314 -0.0537 192 ASN A OD1 
1388 N ND2 . ASN A 170 ? 1.0752 0.8257 1.1207 0.1567  -0.2561 -0.0637 192 ASN A ND2 
1389 N N   . TYR A 171 ? 0.9800 0.8058 0.9948 0.0761  -0.1062 0.0055  193 TYR A N   
1390 C CA  . TYR A 171 ? 0.9478 0.7804 0.9420 0.0653  -0.0797 0.0161  193 TYR A CA  
1391 C C   . TYR A 171 ? 0.9771 0.7772 0.9102 0.0638  -0.0738 0.0176  193 TYR A C   
1392 O O   . TYR A 171 ? 1.0526 0.8500 0.9690 0.0587  -0.0581 0.0219  193 TYR A O   
1393 C CB  . TYR A 171 ? 0.8791 0.7392 0.9016 0.0552  -0.0633 0.0217  193 TYR A CB  
1394 C CG  . TYR A 171 ? 0.9729 0.8276 0.9830 0.0504  -0.0657 0.0200  193 TYR A CG  
1395 C CD1 . TYR A 171 ? 0.9783 0.8369 1.0176 0.0537  -0.0815 0.0134  193 TYR A CD1 
1396 C CD2 . TYR A 171 ? 0.9812 0.8279 0.9570 0.0426  -0.0520 0.0232  193 TYR A CD2 
1397 C CE1 . TYR A 171 ? 0.9246 0.7769 0.9503 0.0503  -0.0836 0.0116  193 TYR A CE1 
1398 C CE2 . TYR A 171 ? 0.9482 0.7899 0.9142 0.0387  -0.0522 0.0218  193 TYR A CE2 
1399 C CZ  . TYR A 171 ? 0.9490 0.7927 0.9359 0.0429  -0.0679 0.0168  193 TYR A CZ  
1400 O OH  . TYR A 171 ? 1.0264 0.8636 1.0009 0.0399  -0.0679 0.0153  193 TYR A OH  
1401 N N   . VAL A 172 ? 0.9712 0.7430 0.8713 0.0700  -0.0850 0.0135  194 VAL A N   
1402 C CA  . VAL A 172 ? 1.0233 0.7592 0.8667 0.0692  -0.0712 0.0170  194 VAL A CA  
1403 C C   . VAL A 172 ? 1.0703 0.7700 0.8734 0.0811  -0.0748 0.0171  194 VAL A C   
1404 O O   . VAL A 172 ? 1.1439 0.8264 0.9219 0.0760  -0.0540 0.0224  194 VAL A O   
1405 C CB  . VAL A 172 ? 1.1059 0.8171 0.9185 0.0736  -0.0755 0.0147  194 VAL A CB  
1406 C CG1 . VAL A 172 ? 1.1496 0.8175 0.9043 0.0743  -0.0538 0.0202  194 VAL A CG1 
1407 C CG2 . VAL A 172 ? 1.0723 0.8192 0.9246 0.0609  -0.0696 0.0153  194 VAL A CG2 
1408 N N   . GLN A 173 ? 1.0981 0.7859 0.8996 0.0977  -0.1017 0.0097  195 GLN A N   
1409 C CA  . GLN A 173 ? 1.1634 0.8131 0.9223 0.1127  -0.1083 0.0091  195 GLN A CA  
1410 C C   . GLN A 173 ? 1.1165 0.7915 0.9055 0.1041  -0.0966 0.0131  195 GLN A C   
1411 O O   . GLN A 173 ? 1.1406 0.7902 0.8961 0.1054  -0.0834 0.0178  195 GLN A O   
1412 C CB  . GLN A 173 ? 1.2377 0.8702 0.9923 0.1354  -0.1456 -0.0034 195 GLN A CB  
1413 C CG  . GLN A 173 ? 1.3352 0.9328 1.0474 0.1497  -0.1614 -0.0097 195 GLN A CG  
1414 C CD  . GLN A 173 ? 1.4144 1.0050 1.1414 0.1726  -0.2062 -0.0280 195 GLN A CD  
1415 O OE1 . GLN A 173 ? 1.4888 1.0888 1.2391 0.1760  -0.2257 -0.0384 195 GLN A OE1 
1416 N NE2 . GLN A 173 ? 1.4289 1.0044 1.1489 0.1888  -0.2247 -0.0342 195 GLN A NE2 
1417 N N   . ALA A 174 ? 1.0437 0.7659 0.8950 0.0959  -0.0986 0.0118  196 ALA A N   
1418 C CA  . ALA A 174 ? 1.0442 0.7905 0.9220 0.0892  -0.0853 0.0160  196 ALA A CA  
1419 C C   . ALA A 174 ? 1.0585 0.7987 0.9127 0.0771  -0.0598 0.0221  196 ALA A C   
1420 O O   . ALA A 174 ? 0.9790 0.7074 0.8191 0.0781  -0.0525 0.0235  196 ALA A O   
1421 C CB  . ALA A 174 ? 0.9911 0.7820 0.9312 0.0833  -0.0830 0.0164  196 ALA A CB  
1422 N N   . HIS A 175 ? 1.0877 0.8363 0.9434 0.0661  -0.0477 0.0239  197 HIS A N   
1423 C CA  . HIS A 175 ? 1.0127 0.7579 0.8588 0.0549  -0.0264 0.0255  197 HIS A CA  
1424 C C   . HIS A 175 ? 1.0631 0.7618 0.8638 0.0581  -0.0162 0.0270  197 HIS A C   
1425 O O   . HIS A 175 ? 1.0613 0.7523 0.8598 0.0545  -0.0042 0.0267  197 HIS A O   
1426 C CB  . HIS A 175 ? 1.0613 0.8203 0.9182 0.0447  -0.0177 0.0252  197 HIS A CB  
1427 C CG  . HIS A 175 ? 1.1260 0.8860 0.9871 0.0338  0.0009  0.0228  197 HIS A CG  
1428 N ND1 . HIS A 175 ? 1.1450 0.9331 1.0338 0.0301  0.0031  0.0188  197 HIS A ND1 
1429 C CD2 . HIS A 175 ? 1.1484 0.8816 0.9925 0.0278  0.0184  0.0220  197 HIS A CD2 
1430 C CE1 . HIS A 175 ? 1.1479 0.9303 1.0422 0.0218  0.0161  0.0128  197 HIS A CE1 
1431 N NE2 . HIS A 175 ? 1.1663 0.9170 1.0388 0.0187  0.0281  0.0151  197 HIS A NE2 
1432 N N   . ASN A 176 ? 1.0433 0.7059 0.8046 0.0670  -0.0196 0.0285  198 ASN A N   
1433 C CA  . ASN A 176 ? 1.1068 0.7161 0.8172 0.0732  -0.0036 0.0326  198 ASN A CA  
1434 C C   . ASN A 176 ? 1.1822 0.7735 0.8766 0.0837  -0.0103 0.0330  198 ASN A C   
1435 O O   . ASN A 176 ? 1.2672 0.8240 0.9353 0.0839  0.0094  0.0367  198 ASN A O   
1436 C CB  . ASN A 176 ? 1.1749 0.7395 0.8324 0.0876  -0.0073 0.0346  198 ASN A CB  
1437 C CG  . ASN A 176 ? 1.2071 0.7818 0.8741 0.0774  0.0043  0.0351  198 ASN A CG  
1438 O OD1 . ASN A 176 ? 1.1964 0.7842 0.8877 0.0609  0.0288  0.0362  198 ASN A OD1 
1439 N ND2 . ASN A 176 ? 1.2736 0.8430 0.9259 0.0882  -0.0156 0.0321  198 ASN A ND2 
1440 N N   . HIS A 177 ? 1.1708 0.7849 0.8860 0.0924  -0.0362 0.0288  199 HIS A N   
1441 C CA  . HIS A 177 ? 1.1161 0.7142 0.8182 0.1046  -0.0462 0.0280  199 HIS A CA  
1442 C C   . HIS A 177 ? 1.0971 0.7168 0.8270 0.0929  -0.0313 0.0288  199 HIS A C   
1443 O O   . HIS A 177 ? 1.1407 0.7310 0.8459 0.0969  -0.0221 0.0308  199 HIS A O   
1444 C CB  . HIS A 177 ? 1.1124 0.7332 0.8429 0.1167  -0.0777 0.0210  199 HIS A CB  
1445 C CG  . HIS A 177 ? 1.2153 0.8235 0.9395 0.1306  -0.0908 0.0184  199 HIS A CG  
1446 N ND1 . HIS A 177 ? 1.3332 0.8902 1.0026 0.1527  -0.1058 0.0162  199 HIS A ND1 
1447 C CD2 . HIS A 177 ? 1.2076 0.8446 0.9696 0.1278  -0.0910 0.0175  199 HIS A CD2 
1448 C CE1 . HIS A 177 ? 1.3707 0.9287 1.0492 0.1614  -0.1159 0.0134  199 HIS A CE1 
1449 N NE2 . HIS A 177 ? 1.3007 0.9079 1.0368 0.1459  -0.1063 0.0143  199 HIS A NE2 
1450 N N   . ILE A 178 ? 1.0569 0.7247 0.8354 0.0808  -0.0298 0.0266  200 ILE A N   
1451 C CA  . ILE A 178 ? 1.0578 0.7474 0.8614 0.0736  -0.0205 0.0249  200 ILE A CA  
1452 C C   . ILE A 178 ? 1.1056 0.7837 0.9064 0.0610  0.0015  0.0229  200 ILE A C   
1453 O O   . ILE A 178 ? 1.1708 0.8445 0.9764 0.0590  0.0086  0.0196  200 ILE A O   
1454 C CB  . ILE A 178 ? 1.0039 0.7401 0.8508 0.0710  -0.0261 0.0235  200 ILE A CB  
1455 C CG1 . ILE A 178 ? 1.0484 0.7981 0.9093 0.0735  -0.0230 0.0216  200 ILE A CG1 
1456 C CG2 . ILE A 178 ? 1.0056 0.7613 0.8676 0.0599  -0.0176 0.0226  200 ILE A CG2 
1457 C CD1 . ILE A 178 ? 1.0680 0.8086 0.9260 0.0860  -0.0339 0.0226  200 ILE A CD1 
1458 N N   . ALA A 179 ? 1.0661 0.7372 0.8630 0.0530  0.0125  0.0234  201 ALA A N   
1459 C CA  . ALA A 179 ? 1.0620 0.7178 0.8643 0.0414  0.0356  0.0201  201 ALA A CA  
1460 C C   . ALA A 179 ? 1.1075 0.7127 0.8752 0.0463  0.0512  0.0243  201 ALA A C   
1461 O O   . ALA A 179 ? 1.1548 0.7530 0.9396 0.0392  0.0656  0.0193  201 ALA A O   
1462 C CB  . ALA A 179 ? 1.0330 0.6876 0.8377 0.0338  0.0463  0.0208  201 ALA A CB  
1463 N N   . ALA A 180 ? 1.1937 0.7606 0.9118 0.0605  0.0473  0.0324  202 ALA A N   
1464 C CA  . ALA A 180 ? 1.2155 0.7233 0.8857 0.0709  0.0628  0.0387  202 ALA A CA  
1465 C C   . ALA A 180 ? 1.2104 0.7234 0.8891 0.0746  0.0544  0.0360  202 ALA A C   
1466 O O   . ALA A 180 ? 1.3481 0.8317 1.0206 0.0721  0.0749  0.0368  202 ALA A O   
1467 C CB  . ALA A 180 ? 1.1817 0.6460 0.7889 0.0923  0.0516  0.0455  202 ALA A CB  
1468 N N   . LEU A 181 ? 1.1413 0.6914 0.8386 0.0805  0.0268  0.0325  203 LEU A N   
1469 C CA  . LEU A 181 ? 1.1133 0.6696 0.8189 0.0855  0.0187  0.0300  203 LEU A CA  
1470 C C   . LEU A 181 ? 1.1490 0.7237 0.8921 0.0708  0.0333  0.0228  203 LEU A C   
1471 O O   . LEU A 181 ? 1.2002 0.7548 0.9387 0.0719  0.0414  0.0213  203 LEU A O   
1472 C CB  . LEU A 181 ? 1.0910 0.6882 0.8219 0.0926  -0.0078 0.0272  203 LEU A CB  
1473 C CG  . LEU A 181 ? 1.1255 0.7305 0.8667 0.0994  -0.0153 0.0248  203 LEU A CG  
1474 C CD1 . LEU A 181 ? 1.2097 0.7639 0.9040 0.1143  -0.0169 0.0284  203 LEU A CD1 
1475 C CD2 . LEU A 181 ? 1.0857 0.7319 0.8618 0.1056  -0.0340 0.0227  203 LEU A CD2 
1476 N N   . ASN A 182 ? 1.1821 0.7942 0.9630 0.0586  0.0341  0.0167  204 ASN A N   
1477 C CA  . ASN A 182 ? 1.1639 0.7944 0.9822 0.0484  0.0408  0.0054  204 ASN A CA  
1478 C C   . ASN A 182 ? 1.1961 0.7897 1.0170 0.0394  0.0668  0.0026  204 ASN A C   
1479 O O   . ASN A 182 ? 1.2385 0.8245 1.0753 0.0372  0.0719  -0.0049 204 ASN A O   
1480 C CB  . ASN A 182 ? 1.1371 0.8077 0.9886 0.0408  0.0350  -0.0014 204 ASN A CB  
1481 C CG  . ASN A 182 ? 1.1846 0.8775 1.0712 0.0375  0.0309  -0.0166 204 ASN A CG  
1482 O OD1 . ASN A 182 ? 1.4436 1.1383 1.3295 0.0449  0.0230  -0.0207 204 ASN A OD1 
1483 N ND2 . ASN A 182 ? 1.2011 0.9095 1.1178 0.0284  0.0340  -0.0267 204 ASN A ND2 
1484 N N   . GLU A 183 ? 1.2061 0.7732 1.0114 0.0352  0.0853  0.0091  205 GLU A N   
1485 C CA  . GLU A 183 ? 1.3267 0.8513 1.1340 0.0278  0.1181  0.0096  205 GLU A CA  
1486 C C   . GLU A 183 ? 1.3494 0.8313 1.1270 0.0364  0.1276  0.0148  205 GLU A C   
1487 O O   . GLU A 183 ? 1.4366 0.9037 1.2435 0.0278  0.1467  0.0077  205 GLU A O   
1488 C CB  . GLU A 183 ? 1.5015 0.9905 1.2753 0.0291  0.1393  0.0210  205 GLU A CB  
1489 C CG  . GLU A 183 ? 1.6095 1.0611 1.4035 0.0179  0.1809  0.0201  205 GLU A CG  
1490 C CD  . GLU A 183 ? 1.6885 1.1824 1.5655 -0.0001 0.1807  -0.0001 205 GLU A CD  
1491 O OE1 . GLU A 183 ? 1.6657 1.2060 1.5743 -0.0059 0.1628  -0.0089 205 GLU A OE1 
1492 O OE2 . GLU A 183 ? 1.6473 1.1284 1.5574 -0.0064 0.1946  -0.0088 205 GLU A OE2 
1493 N N   . GLN A 184 ? 1.3227 0.7847 1.0464 0.0541  0.1129  0.0256  206 GLN A N   
1494 C CA  . GLN A 184 ? 1.4046 0.8172 1.0890 0.0657  0.1227  0.0324  206 GLN A CA  
1495 C C   . GLN A 184 ? 1.4022 0.8394 1.1159 0.0645  0.1087  0.0229  206 GLN A C   
1496 O O   . GLN A 184 ? 1.4760 0.8803 1.1868 0.0645  0.1256  0.0226  206 GLN A O   
1497 C CB  . GLN A 184 ? 1.5151 0.8980 1.1334 0.0885  0.1060  0.0435  206 GLN A CB  
1498 C CG  . GLN A 184 ? 1.6630 1.0232 1.2475 0.0932  0.1138  0.0509  206 GLN A CG  
1499 C CD  . GLN A 184 ? 1.8349 1.1352 1.3385 0.1204  0.1076  0.0612  206 GLN A CD  
1500 O OE1 . GLN A 184 ? 1.8638 1.1782 1.3512 0.1360  0.0719  0.0587  206 GLN A OE1 
1501 N NE2 . GLN A 184 ? 1.9409 1.1700 1.3938 0.1285  0.1429  0.0720  206 GLN A NE2 
1502 N N   . MET A 185 ? 1.3588 0.8501 1.0985 0.0649  0.0800  0.0159  207 MET A N   
1503 C CA  . MET A 185 ? 1.3646 0.8810 1.1330 0.0646  0.0679  0.0055  207 MET A CA  
1504 C C   . MET A 185 ? 1.3435 0.8626 1.1599 0.0488  0.0847  -0.0086 207 MET A C   
1505 O O   . MET A 185 ? 1.3485 0.8505 1.1755 0.0481  0.0914  -0.0149 207 MET A O   
1506 C CB  . MET A 185 ? 1.3460 0.9150 1.1319 0.0693  0.0410  0.0019  207 MET A CB  
1507 C CG  . MET A 185 ? 1.3171 0.8863 1.0732 0.0849  0.0234  0.0119  207 MET A CG  
1508 S SD  . MET A 185 ? 1.2945 0.9205 1.0805 0.0902  0.0015  0.0091  207 MET A SD  
1509 C CE  . MET A 185 ? 1.3140 0.9428 1.1050 0.0996  -0.0038 0.0041  207 MET A CE  
1510 N N   . LYS A 186 ? 1.2817 0.8195 1.1305 0.0364  0.0915  -0.0149 208 LYS A N   
1511 C CA  . LYS A 186 ? 1.3286 0.8715 1.2346 0.0221  0.1040  -0.0326 208 LYS A CA  
1512 C C   . LYS A 186 ? 1.3800 0.8718 1.2909 0.0164  0.1363  -0.0313 208 LYS A C   
1513 O O   . LYS A 186 ? 1.4602 0.9513 1.4102 0.0116  0.1376  -0.0464 208 LYS A O   
1514 C CB  . LYS A 186 ? 1.3546 0.9182 1.2926 0.0108  0.1097  -0.0380 208 LYS A CB  
1515 C CG  . LYS A 186 ? 1.4159 0.9980 1.4264 -0.0017 0.1118  -0.0625 208 LYS A CG  
1516 C CD  . LYS A 186 ? 1.4816 1.0995 1.5220 -0.0074 0.1025  -0.0709 208 LYS A CD  
1517 C CE  . LYS A 186 ? 1.5663 1.2270 1.5921 0.0048  0.0668  -0.0744 208 LYS A CE  
1518 N NZ  . LYS A 186 ? 1.5889 1.2741 1.6127 0.0033  0.0614  -0.0700 208 LYS A NZ  
1519 N N   . GLN A 187 ? 1.4249 0.8695 1.2939 0.0189  0.1632  -0.0135 209 GLN A N   
1520 C CA  . GLN A 187 ? 1.4905 0.8778 1.3598 0.0149  0.2022  -0.0091 209 GLN A CA  
1521 C C   . GLN A 187 ? 1.4842 0.8453 1.3227 0.0264  0.1976  -0.0051 209 GLN A C   
1522 O O   . GLN A 187 ? 1.6046 0.9342 1.4680 0.0205  0.2220  -0.0099 209 GLN A O   
1523 C CB  . GLN A 187 ? 1.5727 0.9068 1.3909 0.0201  0.2348  0.0109  209 GLN A CB  
1524 C CG  . GLN A 187 ? 1.6059 0.9590 1.4625 0.0066  0.2482  0.0063  209 GLN A CG  
1525 C CD  . GLN A 187 ? 1.7225 1.0251 1.5138 0.0168  0.2737  0.0271  209 GLN A CD  
1526 O OE1 . GLN A 187 ? 1.8843 1.1196 1.6189 0.0293  0.3017  0.0429  209 GLN A OE1 
1527 N NE2 . GLN A 187 ? 1.7817 1.1122 1.5753 0.0140  0.2640  0.0272  209 GLN A NE2 
1528 N N   . LEU A 188 ? 1.4141 0.7882 1.2048 0.0427  0.1672  0.0024  210 LEU A N   
1529 C CA  . LEU A 188 ? 1.4229 0.7786 1.1901 0.0543  0.1587  0.0039  210 LEU A CA  
1530 C C   . LEU A 188 ? 1.4238 0.8163 1.2504 0.0460  0.1439  -0.0172 210 LEU A C   
1531 O O   . LEU A 188 ? 1.4568 0.8268 1.2845 0.0491  0.1488  -0.0205 210 LEU A O   
1532 C CB  . LEU A 188 ? 1.3726 0.7379 1.0868 0.0739  0.1283  0.0141  210 LEU A CB  
1533 C CG  . LEU A 188 ? 1.4254 0.7618 1.1049 0.0895  0.1219  0.0186  210 LEU A CG  
1534 C CD1 . LEU A 188 ? 1.5404 0.8020 1.1818 0.0942  0.1576  0.0298  210 LEU A CD1 
1535 C CD2 . LEU A 188 ? 1.4553 0.8014 1.0925 0.1095  0.0914  0.0262  210 LEU A CD2 
1536 N N   . ARG A 189 ? 1.4823 0.9282 1.3541 0.0381  0.1244  -0.0323 211 ARG A N   
1537 C CA  . ARG A 189 ? 1.5562 1.0324 1.4756 0.0356  0.1061  -0.0546 211 ARG A CA  
1538 C C   . ARG A 189 ? 1.5430 1.0013 1.5249 0.0200  0.1287  -0.0720 211 ARG A C   
1539 O O   . ARG A 189 ? 1.6732 1.1283 1.6809 0.0210  0.1221  -0.0870 211 ARG A O   
1540 C CB  . ARG A 189 ? 1.5830 1.1152 1.5192 0.0384  0.0758  -0.0650 211 ARG A CB  
1541 C CG  . ARG A 189 ? 1.7182 1.2752 1.6615 0.0500  0.0483  -0.0797 211 ARG A CG  
1542 C CD  . ARG A 189 ? 1.7538 1.3502 1.6764 0.0625  0.0238  -0.0763 211 ARG A CD  
1543 N NE  . ARG A 189 ? 1.7874 1.4082 1.7274 0.0553  0.0221  -0.0782 211 ARG A NE  
1544 C CZ  . ARG A 189 ? 1.8578 1.4809 1.7763 0.0524  0.0294  -0.0610 211 ARG A CZ  
1545 N NH1 . ARG A 189 ? 2.0139 1.6160 1.8917 0.0578  0.0359  -0.0417 211 ARG A NH1 
1546 N NH2 . ARG A 189 ? 1.8452 1.4906 1.7833 0.0458  0.0276  -0.0649 211 ARG A NH2 
1547 N N   . SER A 190 ? 1.4818 0.9265 1.4915 0.0063  0.1562  -0.0708 212 SER A N   
1548 C CA  . SER A 190 ? 1.5443 0.9657 1.6231 -0.0095 0.1860  -0.0862 212 SER A CA  
1549 C C   . SER A 190 ? 1.6861 1.0518 1.7421 -0.0062 0.2123  -0.0760 212 SER A C   
1550 O O   . SER A 190 ? 1.7772 1.1375 1.8825 -0.0110 0.2131  -0.0945 212 SER A O   
1551 C CB  . SER A 190 ? 1.5519 0.9568 1.6540 -0.0226 0.2209  -0.0801 212 SER A CB  
1552 O OG  . SER A 190 ? 1.6266 1.0808 1.7489 -0.0255 0.1977  -0.0889 212 SER A OG  
1553 N N   . TYR A 191 ? 1.6876 1.0094 1.6657 0.0046  0.2314  -0.0476 213 TYR A N   
1554 C CA  . TYR A 191 ? 1.7416 1.0044 1.6805 0.0131  0.2550  -0.0345 213 TYR A CA  
1555 C C   . TYR A 191 ? 1.7128 0.9931 1.6564 0.0206  0.2251  -0.0468 213 TYR A C   
1556 O O   . TYR A 191 ? 1.8591 1.1061 1.8245 0.0176  0.2439  -0.0521 213 TYR A O   
1557 C CB  . TYR A 191 ? 1.7676 0.9861 1.6077 0.0318  0.2642  -0.0049 213 TYR A CB  
1558 C CG  . TYR A 191 ? 1.8811 1.0373 1.6698 0.0458  0.2823  0.0084  213 TYR A CG  
1559 C CD1 . TYR A 191 ? 1.9553 1.0469 1.7553 0.0401  0.3340  0.0144  213 TYR A CD1 
1560 C CD2 . TYR A 191 ? 1.9212 1.0816 1.6551 0.0651  0.2499  0.0143  213 TYR A CD2 
1561 C CE1 . TYR A 191 ? 1.9905 1.0203 1.7394 0.0548  0.3519  0.0274  213 TYR A CE1 
1562 C CE2 . TYR A 191 ? 1.9838 1.0864 1.6697 0.0798  0.2642  0.0255  213 TYR A CE2 
1563 C CZ  . TYR A 191 ? 2.0451 1.0813 1.7346 0.0752  0.3145  0.0325  213 TYR A CZ  
1564 O OH  . TYR A 191 ? 2.1848 1.1603 1.8210 0.0919  0.3286  0.0445  213 TYR A OH  
1565 N N   . MET A 192 ? 1.6985 1.0289 1.6250 0.0304  0.1816  -0.0515 214 MET A N   
1566 C CA  . MET A 192 ? 1.7871 1.1314 1.7104 0.0406  0.1550  -0.0614 214 MET A CA  
1567 C C   . MET A 192 ? 1.8545 1.2159 1.8541 0.0308  0.1471  -0.0917 214 MET A C   
1568 O O   . MET A 192 ? 1.8806 1.2535 1.8764 0.0408  0.1235  -0.1018 214 MET A O   
1569 C CB  . MET A 192 ? 1.7464 1.1355 1.6330 0.0553  0.1165  -0.0573 214 MET A CB  
1570 C CG  . MET A 192 ? 1.7507 1.1155 1.5635 0.0724  0.1142  -0.0334 214 MET A CG  
1571 S SD  . MET A 192 ? 1.6598 1.0761 1.4452 0.0868  0.0771  -0.0275 214 MET A SD  
1572 C CE  . MET A 192 ? 1.7182 1.1538 1.5117 0.0984  0.0546  -0.0396 214 MET A CE  
1573 N N   . HIS A 193 ? 1.9489 1.3109 2.0196 0.0131  0.1652  -0.1080 215 HIS A N   
1574 C CA  . HIS A 193 ? 2.0147 1.3797 2.1663 0.0039  0.1624  -0.1391 215 HIS A CA  
1575 C C   . HIS A 193 ? 2.0235 1.3272 2.1907 -0.0036 0.2058  -0.1329 215 HIS A C   
1576 O O   . HIS A 193 ? 2.0762 1.3582 2.3063 -0.0205 0.2411  -0.1397 215 HIS A O   
1577 C CB  . HIS A 193 ? 1.9813 1.3793 2.2163 -0.0105 0.1576  -0.1648 215 HIS A CB  
1578 C CG  . HIS A 193 ? 2.0098 1.4646 2.2392 -0.0003 0.1111  -0.1787 215 HIS A CG  
1579 N ND1 . HIS A 193 ? 1.9915 1.4653 2.1438 0.0141  0.0927  -0.1574 215 HIS A ND1 
1580 C CD2 . HIS A 193 ? 1.9906 1.4832 2.2812 -0.0002 0.0800  -0.2122 215 HIS A CD2 
1581 C CE1 . HIS A 193 ? 1.9536 1.4717 2.1165 0.0221  0.0571  -0.1744 215 HIS A CE1 
1582 N NE2 . HIS A 193 ? 2.0301 1.5592 2.2710 0.0153  0.0468  -0.2078 215 HIS A NE2 
1583 N N   . GLY A 194 ? 1.9609 1.2349 2.0734 0.0094  0.2056  -0.1198 216 GLY A N   
1584 C CA  . GLY A 194 ? 1.9205 1.1274 2.0274 0.0065  0.2499  -0.1074 216 GLY A CA  
1585 C C   . GLY A 194 ? 1.9036 1.0739 1.9076 0.0269  0.2517  -0.0776 216 GLY A C   
1586 O O   . GLY A 194 ? 1.8089 0.9939 1.7847 0.0405  0.2209  -0.0810 216 GLY A O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   23  23  MET MET A . n 
A 1 2   ARG 2   24  24  ARG ARG A . n 
A 1 3   SER 3   25  25  SER SER A . n 
A 1 4   ASN 4   26  26  ASN ASN A . n 
A 1 5   LYS 5   27  27  LYS LYS A . n 
A 1 6   ARG 6   28  28  ARG ARG A . n 
A 1 7   GLN 7   29  29  GLN GLN A . n 
A 1 8   ILE 8   30  30  ILE ILE A . n 
A 1 9   ILE 9   31  31  ILE ILE A . n 
A 1 10  GLU 10  32  32  GLU GLU A . n 
A 1 11  LYS 11  33  33  LYS LYS A . n 
A 1 12  ALA 12  34  34  ALA ALA A . n 
A 1 13  ILE 13  35  35  ILE ILE A . n 
A 1 14  GLU 14  36  36  GLU GLU A . n 
A 1 15  ARG 15  37  37  ARG ARG A . n 
A 1 16  LYS 16  38  38  LYS LYS A . n 
A 1 17  ASN 17  39  39  ASN ASN A . n 
A 1 18  GLU 18  40  40  GLU GLU A . n 
A 1 19  ILE 19  41  41  ILE ILE A . n 
A 1 20  GLU 20  42  42  GLU GLU A . n 
A 1 21  THR 21  43  43  THR THR A . n 
A 1 22  LEU 22  44  44  LEU LEU A . n 
A 1 23  PRO 23  45  45  PRO PRO A . n 
A 1 24  PHE 24  46  46  PHE PHE A . n 
A 1 25  ASP 25  47  47  ASP ASP A . n 
A 1 26  GLN 26  48  48  GLN GLN A . n 
A 1 27  ASN 27  49  49  ASN ASN A . n 
A 1 28  LEU 28  50  50  LEU LEU A . n 
A 1 29  ALA 29  51  51  ALA ALA A . n 
A 1 30  GLN 30  52  52  GLN GLN A . n 
A 1 31  LEU 31  53  53  LEU LEU A . n 
A 1 32  SER 32  54  54  SER SER A . n 
A 1 33  LYS 33  55  55  LYS LYS A . n 
A 1 34  LEU 34  56  56  LEU LEU A . n 
A 1 35  ASN 35  57  57  ASN ASN A . n 
A 1 36  LEU 36  58  58  LEU LEU A . n 
A 1 37  LYS 37  59  59  LYS LYS A . n 
A 1 38  GLY 38  60  60  GLY GLY A . n 
A 1 39  GLU 39  61  61  GLU GLU A . n 
A 1 40  THR 40  62  62  THR THR A . n 
A 1 41  LYS 41  63  63  LYS LYS A . n 
A 1 42  THR 42  64  64  THR THR A . n 
A 1 43  LYS 43  65  65  LYS LYS A . n 
A 1 44  TYR 44  66  66  TYR TYR A . n 
A 1 45  ASP 45  67  67  ASP ASP A . n 
A 1 46  ALA 46  68  68  ALA ALA A . n 
A 1 47  MET 47  69  69  MET MET A . n 
A 1 48  LYS 48  70  70  LYS LYS A . n 
A 1 49  LYS 49  71  71  LYS LYS A . n 
A 1 50  ASP 50  72  72  ASP ASP A . n 
A 1 51  ASN 51  73  73  ASN ASN A . n 
A 1 52  VAL 52  74  74  VAL VAL A . n 
A 1 53  GLU 53  75  75  GLU GLU A . n 
A 1 54  SER 54  76  76  SER SER A . n 
A 1 55  THR 55  77  77  THR THR A . n 
A 1 56  ASN 56  78  78  ASN ASN A . n 
A 1 57  LYS 57  79  79  LYS LYS A . n 
A 1 58  TYR 58  80  80  TYR TYR A . n 
A 1 59  LEU 59  81  81  LEU LEU A . n 
A 1 60  ALA 60  82  82  ALA ALA A . n 
A 1 61  PRO 61  83  83  PRO PRO A . n 
A 1 62  VAL 62  84  84  VAL VAL A . n 
A 1 63  GLU 63  85  85  GLU GLU A . n 
A 1 64  GLU 64  86  86  GLU GLU A . n 
A 1 65  LYS 65  87  87  LYS LYS A . n 
A 1 66  ILE 66  88  88  ILE ILE A . n 
A 1 67  HIS 67  89  89  HIS HIS A . n 
A 1 68  ASN 68  90  90  ASN ASN A . n 
A 1 69  ALA 69  91  91  ALA ALA A . n 
A 1 70  GLU 70  92  92  GLU GLU A . n 
A 1 71  ALA 71  93  93  ALA ALA A . n 
A 1 72  LEU 72  94  94  LEU LEU A . n 
A 1 73  LEU 73  95  95  LEU LEU A . n 
A 1 74  ASP 74  96  96  ASP ASP A . n 
A 1 75  LYS 75  97  97  LYS LYS A . n 
A 1 76  PHE 76  98  98  PHE PHE A . n 
A 1 77  SER 77  99  99  SER SER A . n 
A 1 78  PHE 78  100 100 PHE PHE A . n 
A 1 79  ASN 79  101 101 ASN ASN A . n 
A 1 80  ALA 80  102 102 ALA ALA A . n 
A 1 81  SER 81  103 103 SER SER A . n 
A 1 82  GLN 82  104 104 GLN GLN A . n 
A 1 83  SER 83  105 105 SER SER A . n 
A 1 84  GLU 84  106 106 GLU GLU A . n 
A 1 85  ILE 85  107 107 ILE ILE A . n 
A 1 86  ASP 86  108 108 ASP ASP A . n 
A 1 87  ASP 87  109 109 ASP ASP A . n 
A 1 88  ALA 88  110 110 ALA ALA A . n 
A 1 89  ASN 89  111 111 ASN ASN A . n 
A 1 90  GLU 90  112 112 GLU GLU A . n 
A 1 91  LEU 91  113 113 LEU LEU A . n 
A 1 92  MET 92  114 114 MET MET A . n 
A 1 93  ASP 93  115 115 ASP ASP A . n 
A 1 94  SER 94  116 116 SER SER A . n 
A 1 95  TYR 95  117 117 TYR TYR A . n 
A 1 96  GLU 96  118 118 GLU GLU A . n 
A 1 97  GLN 97  119 119 GLN GLN A . n 
A 1 98  SER 98  120 120 SER SER A . n 
A 1 99  TYR 99  121 121 TYR TYR A . n 
A 1 100 GLN 100 122 122 GLN GLN A . n 
A 1 101 GLN 101 123 123 GLN GLN A . n 
A 1 102 GLN 102 124 124 GLN GLN A . n 
A 1 103 LEU 103 125 125 LEU LEU A . n 
A 1 104 GLU 104 126 126 GLU GLU A . n 
A 1 105 ASP 105 127 127 ASP ASP A . n 
A 1 106 VAL 106 128 128 VAL VAL A . n 
A 1 107 ASN 107 129 129 ASN ASN A . n 
A 1 108 GLU 108 130 130 GLU GLU A . n 
A 1 109 ILE 109 131 131 ILE ILE A . n 
A 1 110 ILE 110 132 132 ILE ILE A . n 
A 1 111 ALA 111 133 133 ALA ALA A . n 
A 1 112 LEU 112 134 134 LEU LEU A . n 
A 1 113 TYR 113 135 135 TYR TYR A . n 
A 1 114 LYS 114 136 136 LYS LYS A . n 
A 1 115 ASP 115 137 137 ASP ASP A . n 
A 1 116 ASN 116 138 138 ASN ASN A . n 
A 1 117 ASP 117 139 139 ASP ASP A . n 
A 1 118 GLU 118 140 140 GLU GLU A . n 
A 1 119 LEU 119 141 141 LEU LEU A . n 
A 1 120 TYR 120 142 142 TYR TYR A . n 
A 1 121 ASP 121 143 143 ASP ASP A . n 
A 1 122 LYS 122 144 144 LYS LYS A . n 
A 1 123 CYS 123 145 145 CYS CYS A . n 
A 1 124 LYS 124 146 146 LYS LYS A . n 
A 1 125 VAL 125 147 147 VAL VAL A . n 
A 1 126 ASP 126 148 148 ASP ASP A . n 
A 1 127 TYR 127 149 149 TYR TYR A . n 
A 1 128 ARG 128 150 150 ARG ARG A . n 
A 1 129 GLU 129 151 151 GLU GLU A . n 
A 1 130 MET 130 152 152 MET MET A . n 
A 1 131 LYS 131 153 153 LYS LYS A . n 
A 1 132 ARG 132 154 154 ARG ARG A . n 
A 1 133 ASP 133 155 155 ASP ASP A . n 
A 1 134 VAL 134 156 156 VAL VAL A . n 
A 1 135 LEU 135 157 157 LEU LEU A . n 
A 1 136 ALA 136 158 158 ALA ALA A . n 
A 1 137 ASN 137 159 159 ASN ASN A . n 
A 1 138 ARG 138 160 160 ARG ARG A . n 
A 1 139 HIS 139 161 161 HIS HIS A . n 
A 1 140 GLN 140 162 162 GLN GLN A . n 
A 1 141 PHE 141 163 163 PHE PHE A . n 
A 1 142 GLY 142 164 164 GLY GLY A . n 
A 1 143 GLU 143 165 165 GLU GLU A . n 
A 1 144 ALA 144 166 166 ALA ALA A . n 
A 1 145 ALA 145 167 167 ALA ALA A . n 
A 1 146 SER 146 168 168 SER SER A . n 
A 1 147 LEU 147 169 169 LEU LEU A . n 
A 1 148 LEU 148 170 170 LEU LEU A . n 
A 1 149 GLU 149 171 171 GLU GLU A . n 
A 1 150 THR 150 172 172 THR THR A . n 
A 1 151 GLU 151 173 173 GLU GLU A . n 
A 1 152 ILE 152 174 174 ILE ILE A . n 
A 1 153 GLU 153 175 175 GLU GLU A . n 
A 1 154 LYS 154 176 176 LYS LYS A . n 
A 1 155 PHE 155 177 177 PHE PHE A . n 
A 1 156 GLU 156 178 178 GLU GLU A . n 
A 1 157 PRO 157 179 179 PRO PRO A . n 
A 1 158 ARG 158 180 180 ARG ARG A . n 
A 1 159 LEU 159 181 181 LEU LEU A . n 
A 1 160 GLU 160 182 182 GLU GLU A . n 
A 1 161 GLN 161 183 183 GLN GLN A . n 
A 1 162 TYR 162 184 184 TYR TYR A . n 
A 1 163 GLU 163 185 185 GLU GLU A . n 
A 1 164 VAL 164 186 186 VAL VAL A . n 
A 1 165 LEU 165 187 187 LEU LEU A . n 
A 1 166 LYS 166 188 188 LYS LYS A . n 
A 1 167 ALA 167 189 189 ALA ALA A . n 
A 1 168 ASP 168 190 190 ASP ASP A . n 
A 1 169 GLY 169 191 191 GLY GLY A . n 
A 1 170 ASN 170 192 192 ASN ASN A . n 
A 1 171 TYR 171 193 193 TYR TYR A . n 
A 1 172 VAL 172 194 194 VAL VAL A . n 
A 1 173 GLN 173 195 195 GLN GLN A . n 
A 1 174 ALA 174 196 196 ALA ALA A . n 
A 1 175 HIS 175 197 197 HIS HIS A . n 
A 1 176 ASN 176 198 198 ASN ASN A . n 
A 1 177 HIS 177 199 199 HIS HIS A . n 
A 1 178 ILE 178 200 200 ILE ILE A . n 
A 1 179 ALA 179 201 201 ALA ALA A . n 
A 1 180 ALA 180 202 202 ALA ALA A . n 
A 1 181 LEU 181 203 203 LEU LEU A . n 
A 1 182 ASN 182 204 204 ASN ASN A . n 
A 1 183 GLU 183 205 205 GLU GLU A . n 
A 1 184 GLN 184 206 206 GLN GLN A . n 
A 1 185 MET 185 207 207 MET MET A . n 
A 1 186 LYS 186 208 208 LYS LYS A . n 
A 1 187 GLN 187 209 209 GLN GLN A . n 
A 1 188 LEU 188 210 210 LEU LEU A . n 
A 1 189 ARG 189 211 211 ARG ARG A . n 
A 1 190 SER 190 212 212 SER SER A . n 
A 1 191 TYR 191 213 213 TYR TYR A . n 
A 1 192 MET 192 214 214 MET MET A . n 
A 1 193 HIS 193 215 215 HIS HIS A . n 
A 1 194 GLY 194 216 216 GLY GLY A . n 
A 1 195 SER 195 217 ?   ?   ?   A . n 
A 1 196 SER 196 218 ?   ?   ?   A . n 
A 1 197 GLY 197 219 ?   ?   ?   A . n 
A 1 198 ASN 198 220 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-10-22 
2 'Structure model' 1 1 2014-12-03 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         10.1167 
_pdbx_refine_tls.origin_y         -18.3450 
_pdbx_refine_tls.origin_z         -11.6054 
_pdbx_refine_tls.T[1][1]          0.0949 
_pdbx_refine_tls.T[2][2]          0.0140 
_pdbx_refine_tls.T[3][3]          0.1184 
_pdbx_refine_tls.T[1][2]          0.0164 
_pdbx_refine_tls.T[1][3]          -0.0068 
_pdbx_refine_tls.T[2][3]          0.0336 
_pdbx_refine_tls.L[1][1]          1.7834 
_pdbx_refine_tls.L[2][2]          6.2690 
_pdbx_refine_tls.L[3][3]          0.9750 
_pdbx_refine_tls.L[1][2]          -2.8155 
_pdbx_refine_tls.L[1][3]          -0.6032 
_pdbx_refine_tls.L[2][3]          1.3615 
_pdbx_refine_tls.S[1][1]          -0.0707 
_pdbx_refine_tls.S[1][2]          -0.0950 
_pdbx_refine_tls.S[1][3]          -0.1846 
_pdbx_refine_tls.S[2][1]          -0.2165 
_pdbx_refine_tls.S[2][2]          0.1047 
_pdbx_refine_tls.S[2][3]          0.3917 
_pdbx_refine_tls.S[3][1]          -0.1881 
_pdbx_refine_tls.S[3][2]          -0.0255 
_pdbx_refine_tls.S[3][3]          -0.0340 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     1 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     194 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC  refinement       5.8.0073 ? 1 
XDS     'data reduction' .        ? 2 
Aimless 'data scaling'   .        ? 3 
PHASER  phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 56  ? ? -109.90 -161.64 
2 1 MET A 214 ? ? -65.87  4.13    
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 65  ? CD  ? A LYS 43  CD  
2  1 Y 1 A LYS 65  ? CE  ? A LYS 43  CE  
3  1 Y 1 A LYS 65  ? NZ  ? A LYS 43  NZ  
4  1 Y 1 A GLU 75  ? CD  ? A GLU 53  CD  
5  1 Y 1 A GLU 75  ? OE1 ? A GLU 53  OE1 
6  1 Y 1 A GLU 75  ? OE2 ? A GLU 53  OE2 
7  1 Y 1 A GLU 175 ? CG  ? A GLU 153 CG  
8  1 Y 1 A GLU 175 ? CD  ? A GLU 153 CD  
9  1 Y 1 A GLU 175 ? OE1 ? A GLU 153 OE1 
10 1 Y 1 A GLU 175 ? OE2 ? A GLU 153 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A SER 217 ? A SER 195 
2 1 Y 1 A SER 218 ? A SER 196 
3 1 Y 1 A GLY 219 ? A GLY 197 
4 1 Y 1 A ASN 220 ? A ASN 198 
#