data_4V1M
# 
_entry.id   4V1M 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.283 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4V1M         
PDBE  EBI-61814    
WWPDB D_1290061814 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
EMDB EMD-2784 'associated EM volume' .                                                                                      
PDB  4V1N     unspecified            'ARCHITECTURE OF THE RNA POLYMERASE II-MEDIATOR CORE TRANSCRIPTION INITIATION COMPLEX' 
PDB  4V1O     unspecified            'ARCHITECTURE OF THE RNA POLYMERASE II-MEDIATOR CORE TRANSCRIPTION INITIATION COMPLEX' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        4V1M 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.recvd_initial_deposition_date   2014-09-29 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Plaschka, C.'       1  
'Lariviere, L.'      2  
'Wenzeck, L.'        3  
'Hemann, M.'         4  
'Tegunov, D.'        5  
'Petrotchenko, E.V.' 6  
'Borchers, C.H.'     7  
'Baumeister, W.'     8  
'Herzog, F.'         9  
'Villa, E.'          10 
'Cramer, P.'         11 
# 
_citation.id                        primary 
_citation.title                     'Architecture of the RNA Polymerase II-Mediator Core Initiation Complex.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            518 
_citation.page_first                376 
_citation.page_last                 ? 
_citation.year                      2015 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25652824 
_citation.pdbx_database_id_DOI      10.1038/NATURE14229 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Plaschka, C.'       1  
primary 'Lariviere, L.'      2  
primary 'Wenzeck, L.'        3  
primary 'Seizl, M.'          4  
primary 'Hemann, M.'         5  
primary 'Tegunov, D.'        6  
primary 'Petrotchenko, E.V.' 7  
primary 'Borchers, C.H.'     8  
primary 'Baumeister, W.'     9  
primary 'Herzog, F.'         10 
primary 'Villa, E.'          11 
primary 'Cramer, P.'         12 
# 
_cell.entry_id           4V1M 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4V1M 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1'                             191821.578 1 2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB2'                             138937.297 1 2.7.7.6 ? ? ? 
3  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3'                             35330.457  1 ?       ? ? ? 
4  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 1'             25117.094  1 ?       ? ? ? 
5  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 2'             17931.834  1 ?       ? ? ? 
6  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 3'             16525.363  1 ?       ? ? ? 
7  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB9'                             14308.161  1 ?       ? ? ? 
8  polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 5'             8290.732   1 ?       ? ? ? 
9  polymer     nat 'DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB11'                            13633.493  1 ?       ? ? ? 
10 polymer     nat 'DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4'             7729.969   1 2.7.7.6 ? ? ? 
11 polymer     syn "5'-D(*AP*AP*GP*TP*AP*CP*TP*TP*GP*AP)-3'"                                 3068.042   1 ?       ? ? ? 
12 polymer     syn "5'-D(*CP*CP*AP*GP*GP*AP)-3'"                                             1914.229   1 ?       ? ? ? 
13 polymer     syn 
;5'-D(*TP*CP*AP*AP*GP*TP*AP*CP*TP*TP*TP*TP*TP*CP *CP*BRUP*GP*GP*TP*C)-3'
;
6130.794   1 ?       ? ? ? 
14 non-polymer syn 'ZINC ION'                                                                65.409     8 ?       ? ? ? 
15 non-polymer syn 'MAGNESIUM ION'                                                           24.305     1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;RNA POLYMERASE II SUBUNIT 1, RNA POLYMERASE II SUBUNIT B1, DNA-DIRECTED RNA POLYMERASE III LARGEST SUBUNIT, RNA POLYMERASE II SUBUNIT B220
;
2  'RNA POLYMERASE II SUBUNIT 2, B150, DNA-DIRECTED RNA POLYMERASE II 140 KDA POLYPEPTIDE' 
3  'RNA POLYMERASE II SUBUNIT 3, RNA POLYMERASE II SUBUNIT B3, B44.5, DNA-DIRECTED RNA POLYMERASE II 45 KDA POLYPEPTIDE' 
4  
;RNA POLYMERASES I\,II\,AND III SUBUNIT ABC1, ABC27, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 27 KDA POLYPEPTIDE, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III SUBUNIT RPABC 1
;
5  
;RNA POLYMERASES I\,II\,AND III SUBUNIT ABC2, ABC23, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 23 KDA POLYPEPTIDE, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III SUBUNIT RPABC 2
;
6  
;RNA POLYMERASES I, II, AND III SUBUNIT ABC3, ABC14.4, ABC14.5, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 14.5 KDA POLYPEPTIDE, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III SUBUNIT RPABC 3
;
7  
'RNA POLYMERASE II SUBUNIT B9, B12.6, DNA-DIRECTED POLYMERASE II 14.2 KDA POLYPEPTIDE, DNA-DIRECTED RNA POLYMERASE II SUBUNIT 9' 
8  
;RNA POLYMERASES I\,II\,AND III SUBUNIT ABC5, ABC10-BETA, ABC8, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III 8.3 KDA POLYPEPTIDE, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III SUBUNIT RPABC 5
;
9  'RNA POLYMERASE II SUBUNIT B11, B13.6, DNA-DIRECTED RNA POLYMERASE II 13.6 KDA POLYPEPTIDE' 
10 'RNA POLYMERASES I\,II\,AND III SUBUNIT ABC4, ABC10-ALPHA, DNA-DIRECTED RNA POLYMERASES I\,II\,AND III SUBUNIT RPABC 4' 
11 'NONTEMPLATE DNA' 
13 'TEMPLATE DNA' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no  
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
;MVGQQYSSAPLRTVKEVQFGLFSPEEVRAISVAKIRFPETMDETQTRAKIGGLNDPRLGSIDRNLKCQTCQEGMNECPGH
FGHIDLAKPVFHVGFIAKIKKVCECVCMHCGKLLLDEHNELMRQALAIKDSKKRFAAIWTLCKTKMVCETDVPSEDDPTQ
LVSRGGCGNTQPTIRKDGLKLVGSWKKDRATGDADEPELRVLSTEEILNIFKHISVKDFTSLGFNEVFSRPEWMILTCLP
VPPPPVRPSISFNESQRGEDDLTFKLADILKANISLETLEHNGAPHHAIEEAESLLQFHVATYMDNDIAGQPQALQKSGR
PVKSIRARLKGKEGRIRGNLMGKRVDFSARTVISGDPNLELDQVGVPKSIAKTLTYPEVVTPYNIDRLTQLVRNGPNEHP
GAKYVIRDSGDRIDLRYSKRAGDIQLQYGWKVERHIMDNDPVLFNRQPSLHKMSMMAHRVKVIPYSTFRLNLSVTSPYNA
DFDGDEMNLHVPQSEETRAELSQLCAVPLQIVSPQSNKPCMGIVQDTLCGIRKLTLRDTFIELDQVLNMLYWVPDWDGVI
PTPAIIKPKPLWSGKQILSVAIPNGIHLQRFDEGTTLLSPKDNGMLIIDGQIIFGVVEKKTVGSSNGGLIHVVTREKGPQ
VCAKLFGNIQKVVNFWLLHNGFSTGIGDTIADGPTMREITETIAEAKKKVLDVTKEAQANLLTAKHGMTLRESFEDNVVR
FLNEARDKAGRLAEVNLKDLNNVKQMVMAGSKGSFINIAQMSACVGQQSVEGKRIAFGFVDRTLPHFSKDDYSPESKGFV
ENSYLRGLTPQEFFFHAMGGREGLIDTAVKTAETGYIQRRLVKALEDIMVHYDNTTRNSLGNVIQFIYGEDGMDAAHIEK
QSLDTIGGSDAAFEKRYRVDLLNTDHTLDPSLLESGSEILGDLKLQVLLDEEYKQLVKDRKFLREVFVDGEANWPLPVNI
RRIIQNAQQTFHIDHTKPSDLTIKDIVLGVKDLQENLLVLRGKNEIIQNAQRDAVTLFCCLLRSRLATRRVLQEYRLTKQ
AFDWVLSNIEAQFLRSVVHPGEMVGVLAAQSIGEPATQMTLNTFHFAGVASKKVTSGVPRLKEILNVAKNMKTPSLTVYL
EPGHAADQEQAKLIRSAIEHTTLKSVTIASEIYYDPDPRSTVIPEDEEIIQLHFSLLDEEAEQSFDQQSPWLLRLELDRA
AMNDKDLTMGQVGERIKQTFKNDLFVIWSEDNDEKLIIRCRVVRPKSLDAETEAEEDHMLKKIENTMLENITLRGVENIE
RVVMMKYDRKVPSPTGEYVKEPEWVLETDGVNLSEVMTVPGIDPTRIYTNSFIDIMEVLGIEAGRAALYKEVYNVIASDG
SYVNYRHMALLVDVMTTQGGLTSVTRHGFNRSNTGALMRCSFEETVEILFEAGASAELDDCRGVSENVILGQMAPIGTGA
FDVMIDEESLVKYMPEQKITEIEDGQDGGVTPYSNESGLVNADLDVKDELMFSPLVDSGSNDAMAGGFTAYGGADYGEAT
SPFGAYGEAPTSPGFGVSSPGFSPTSPTYSPTSPAYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSP
TSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPSYSPTSPAYSPTSPSYSPTSPSYSPTSP
SYSPTSPSYSPTSPNYSPTSPSYSPTSPGYSPGSPAYSPKQDEQKHNENENSR
;
A ? 
2  'polypeptide(L)'        no no  
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
;MSDLANSEKYYDEDPYGFEDESAPITAEDSWAVISAFFREKGLVSQQLDSFNQFVDYTLQDIICEDSTLILEQLAQHTTE
SDNISRKYEISFGKIYVTKPMVNESDGVTHALYPQEARLRNLTYSSGLFVDVKKRTYEAIDVPGRELKYELIAEESEDDS
ESGKVFIGRLPIMLRSKNCYLSEATESDLYKLKECPFDMGGYFIINGSEKVLIAQERSAGNIVQVFKKAAPSPISHVAEI
RSALEKGSRFISTLQVKLYGREGSSARTIKATLPYIKQDIPIVIIFRALGIIPDGEILEHICYDVNDWQMLEMLKPCVED
GFVIQDRETALDFIGRRGTALGIKKEKRIQYAKDILQKEFLPHITQLEGFESRKAFFLGYMINRLLLCALDRKDQDDRDH
FGKKRLDLAGPLLAQLFKTLFKKLTKDIFRYMQRTVEEAHDFNMKLAINAKTITSGLKYALATGNWGEQKKAMSSRAGVS
QVLNRYTYSSTLSHLRRTNTPIGRDGKLAKPRQLHNTHWGLVCPAETPEGQACGLVKNLSLMSCISVGTDPMPIITFLSE
WGMEPLEDYVPHQSPDATRVFVNGVWHGVHRNPARLMETLRTLRRKGDINPEVSMIRDIREKELKIFTDAGRVYRPLFIV
EDDESLGHKELKVRKGHIAKLMATEYQDIEGGFEDVEEYTWSSLLNEGLVEYIDAEEEESILIAMQPEDLEPAEANEEND
LDVDPAKRIRVSHHATTFTHCEIHPSMILGVAASIIPFPDHNQSPRNTYQSAMGKQAMGVFLTNYNVRMDTMANILYYPQ
KPLGTTRAMEYLKFRELPAGQNAIVAIACYSGYNQEDSMIMNQSSIDRGLFRSLFFRSYMDQEKKYGMSITETFEKPQRT
NTLRMKHGTYDKLDDDGLIAPGVRVSGEDVIIGKTTPISPDEEELGQRTAYHSKRDASTPLRSTENGIVDQVLVTTNQDG
LKFVKVRVRTTKIPQIGDKFASRHGQKGTIGITYRREDMPFTAEGIVPDLIINPHAIPSRMTVAHLIECLLSKVAALSGN
EGDASPFTDITVEGISKLLREHGYQSRGFEVMYNGHTGKKLMAQIFFGPTYYQRLRHMVDDKIHARARGPMQVLTRQPVE
GRSRDGGLRFGEMERDCMIAHGAASFLKERLMEASDAFRVHICGICGLMTVIAKLNHNQFECKGCDNKIDIYQIHIPYAA
KLLFQELMAMNITPRLYTDRSRDF
;
B ? 
3  'polypeptide(L)'        no no  
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
;MSEEGPQVKIREASKDNVDFILSNVDLAMANSLRRVMIAEIPTLAIDSVEVETNTTVLADEFIAHRLGLIPLQSMDIEQL
EYSRDCFCEDHCDKCSVVLTLQAFGESESTTNVYSKDLVIVSNLMGRNIGHPIIQDKEGNGVLICKLRKGQELKLTCVAK
KGIAKEHAKWGPAAAIEFEYDPWNKLKHTDYWYEQDSAKEWPQSKNCEYEDPPNEGDPFDYKAQADTFYMNVESVGSIPV
DQVVVRGIDTLQKKVASILLALTQMDQDKVNFASGDNNTASNMLGSNEDVMMTGAEQDPYSNASQMGNTGSGGYDNAW
;
C ? 
4  'polypeptide(L)'        no no  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
5  'polypeptide(L)'        no no  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
6  'polypeptide(L)'        no no  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
7  'polypeptide(L)'        no no  
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
;MTTFRFCRDCNNMLYPREDKENNRLLFECRTCSYVEEAGSPLVYRHELITNIGETAGVVQDIGSDPTLPRSDRECPKCHS
RENVFFQSQQRRKDTSMVLFFVCLSCSHIFTSDQKNKRTQFS
;
I ? 
8  'polypeptide(L)'        no no  MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
9  'polypeptide(L)'        no no  
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
;MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEG
YDPKDALKNACNSIINKLGALKTNFETEWNLQTLAADDAF
;
K ? 
10 'polypeptide(L)'        no no  MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
11 polydeoxyribonucleotide no no  '(DA)(DA)(DG)(DT)(DA)(DC)(DT)(DT)(DG)(DA)' AAGTACTTGA N ? 
12 polyribonucleotide      no no  CCAGGA CCAGGA P ? 
13 polydeoxyribonucleotide no yes 
;(DT)(DC)(DA)(DA)(DG)(DT)(DA)(DC)(DT)(DT)(DT)(DT)(DT)(DC)(DC)(BRU)(DG)(DG)(DT)
(DC)
;
TCAAGTACTTTTTCCUGGTC T ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    VAL n 
1  3    GLY n 
1  4    GLN n 
1  5    GLN n 
1  6    TYR n 
1  7    SER n 
1  8    SER n 
1  9    ALA n 
1  10   PRO n 
1  11   LEU n 
1  12   ARG n 
1  13   THR n 
1  14   VAL n 
1  15   LYS n 
1  16   GLU n 
1  17   VAL n 
1  18   GLN n 
1  19   PHE n 
1  20   GLY n 
1  21   LEU n 
1  22   PHE n 
1  23   SER n 
1  24   PRO n 
1  25   GLU n 
1  26   GLU n 
1  27   VAL n 
1  28   ARG n 
1  29   ALA n 
1  30   ILE n 
1  31   SER n 
1  32   VAL n 
1  33   ALA n 
1  34   LYS n 
1  35   ILE n 
1  36   ARG n 
1  37   PHE n 
1  38   PRO n 
1  39   GLU n 
1  40   THR n 
1  41   MET n 
1  42   ASP n 
1  43   GLU n 
1  44   THR n 
1  45   GLN n 
1  46   THR n 
1  47   ARG n 
1  48   ALA n 
1  49   LYS n 
1  50   ILE n 
1  51   GLY n 
1  52   GLY n 
1  53   LEU n 
1  54   ASN n 
1  55   ASP n 
1  56   PRO n 
1  57   ARG n 
1  58   LEU n 
1  59   GLY n 
1  60   SER n 
1  61   ILE n 
1  62   ASP n 
1  63   ARG n 
1  64   ASN n 
1  65   LEU n 
1  66   LYS n 
1  67   CYS n 
1  68   GLN n 
1  69   THR n 
1  70   CYS n 
1  71   GLN n 
1  72   GLU n 
1  73   GLY n 
1  74   MET n 
1  75   ASN n 
1  76   GLU n 
1  77   CYS n 
1  78   PRO n 
1  79   GLY n 
1  80   HIS n 
1  81   PHE n 
1  82   GLY n 
1  83   HIS n 
1  84   ILE n 
1  85   ASP n 
1  86   LEU n 
1  87   ALA n 
1  88   LYS n 
1  89   PRO n 
1  90   VAL n 
1  91   PHE n 
1  92   HIS n 
1  93   VAL n 
1  94   GLY n 
1  95   PHE n 
1  96   ILE n 
1  97   ALA n 
1  98   LYS n 
1  99   ILE n 
1  100  LYS n 
1  101  LYS n 
1  102  VAL n 
1  103  CYS n 
1  104  GLU n 
1  105  CYS n 
1  106  VAL n 
1  107  CYS n 
1  108  MET n 
1  109  HIS n 
1  110  CYS n 
1  111  GLY n 
1  112  LYS n 
1  113  LEU n 
1  114  LEU n 
1  115  LEU n 
1  116  ASP n 
1  117  GLU n 
1  118  HIS n 
1  119  ASN n 
1  120  GLU n 
1  121  LEU n 
1  122  MET n 
1  123  ARG n 
1  124  GLN n 
1  125  ALA n 
1  126  LEU n 
1  127  ALA n 
1  128  ILE n 
1  129  LYS n 
1  130  ASP n 
1  131  SER n 
1  132  LYS n 
1  133  LYS n 
1  134  ARG n 
1  135  PHE n 
1  136  ALA n 
1  137  ALA n 
1  138  ILE n 
1  139  TRP n 
1  140  THR n 
1  141  LEU n 
1  142  CYS n 
1  143  LYS n 
1  144  THR n 
1  145  LYS n 
1  146  MET n 
1  147  VAL n 
1  148  CYS n 
1  149  GLU n 
1  150  THR n 
1  151  ASP n 
1  152  VAL n 
1  153  PRO n 
1  154  SER n 
1  155  GLU n 
1  156  ASP n 
1  157  ASP n 
1  158  PRO n 
1  159  THR n 
1  160  GLN n 
1  161  LEU n 
1  162  VAL n 
1  163  SER n 
1  164  ARG n 
1  165  GLY n 
1  166  GLY n 
1  167  CYS n 
1  168  GLY n 
1  169  ASN n 
1  170  THR n 
1  171  GLN n 
1  172  PRO n 
1  173  THR n 
1  174  ILE n 
1  175  ARG n 
1  176  LYS n 
1  177  ASP n 
1  178  GLY n 
1  179  LEU n 
1  180  LYS n 
1  181  LEU n 
1  182  VAL n 
1  183  GLY n 
1  184  SER n 
1  185  TRP n 
1  186  LYS n 
1  187  LYS n 
1  188  ASP n 
1  189  ARG n 
1  190  ALA n 
1  191  THR n 
1  192  GLY n 
1  193  ASP n 
1  194  ALA n 
1  195  ASP n 
1  196  GLU n 
1  197  PRO n 
1  198  GLU n 
1  199  LEU n 
1  200  ARG n 
1  201  VAL n 
1  202  LEU n 
1  203  SER n 
1  204  THR n 
1  205  GLU n 
1  206  GLU n 
1  207  ILE n 
1  208  LEU n 
1  209  ASN n 
1  210  ILE n 
1  211  PHE n 
1  212  LYS n 
1  213  HIS n 
1  214  ILE n 
1  215  SER n 
1  216  VAL n 
1  217  LYS n 
1  218  ASP n 
1  219  PHE n 
1  220  THR n 
1  221  SER n 
1  222  LEU n 
1  223  GLY n 
1  224  PHE n 
1  225  ASN n 
1  226  GLU n 
1  227  VAL n 
1  228  PHE n 
1  229  SER n 
1  230  ARG n 
1  231  PRO n 
1  232  GLU n 
1  233  TRP n 
1  234  MET n 
1  235  ILE n 
1  236  LEU n 
1  237  THR n 
1  238  CYS n 
1  239  LEU n 
1  240  PRO n 
1  241  VAL n 
1  242  PRO n 
1  243  PRO n 
1  244  PRO n 
1  245  PRO n 
1  246  VAL n 
1  247  ARG n 
1  248  PRO n 
1  249  SER n 
1  250  ILE n 
1  251  SER n 
1  252  PHE n 
1  253  ASN n 
1  254  GLU n 
1  255  SER n 
1  256  GLN n 
1  257  ARG n 
1  258  GLY n 
1  259  GLU n 
1  260  ASP n 
1  261  ASP n 
1  262  LEU n 
1  263  THR n 
1  264  PHE n 
1  265  LYS n 
1  266  LEU n 
1  267  ALA n 
1  268  ASP n 
1  269  ILE n 
1  270  LEU n 
1  271  LYS n 
1  272  ALA n 
1  273  ASN n 
1  274  ILE n 
1  275  SER n 
1  276  LEU n 
1  277  GLU n 
1  278  THR n 
1  279  LEU n 
1  280  GLU n 
1  281  HIS n 
1  282  ASN n 
1  283  GLY n 
1  284  ALA n 
1  285  PRO n 
1  286  HIS n 
1  287  HIS n 
1  288  ALA n 
1  289  ILE n 
1  290  GLU n 
1  291  GLU n 
1  292  ALA n 
1  293  GLU n 
1  294  SER n 
1  295  LEU n 
1  296  LEU n 
1  297  GLN n 
1  298  PHE n 
1  299  HIS n 
1  300  VAL n 
1  301  ALA n 
1  302  THR n 
1  303  TYR n 
1  304  MET n 
1  305  ASP n 
1  306  ASN n 
1  307  ASP n 
1  308  ILE n 
1  309  ALA n 
1  310  GLY n 
1  311  GLN n 
1  312  PRO n 
1  313  GLN n 
1  314  ALA n 
1  315  LEU n 
1  316  GLN n 
1  317  LYS n 
1  318  SER n 
1  319  GLY n 
1  320  ARG n 
1  321  PRO n 
1  322  VAL n 
1  323  LYS n 
1  324  SER n 
1  325  ILE n 
1  326  ARG n 
1  327  ALA n 
1  328  ARG n 
1  329  LEU n 
1  330  LYS n 
1  331  GLY n 
1  332  LYS n 
1  333  GLU n 
1  334  GLY n 
1  335  ARG n 
1  336  ILE n 
1  337  ARG n 
1  338  GLY n 
1  339  ASN n 
1  340  LEU n 
1  341  MET n 
1  342  GLY n 
1  343  LYS n 
1  344  ARG n 
1  345  VAL n 
1  346  ASP n 
1  347  PHE n 
1  348  SER n 
1  349  ALA n 
1  350  ARG n 
1  351  THR n 
1  352  VAL n 
1  353  ILE n 
1  354  SER n 
1  355  GLY n 
1  356  ASP n 
1  357  PRO n 
1  358  ASN n 
1  359  LEU n 
1  360  GLU n 
1  361  LEU n 
1  362  ASP n 
1  363  GLN n 
1  364  VAL n 
1  365  GLY n 
1  366  VAL n 
1  367  PRO n 
1  368  LYS n 
1  369  SER n 
1  370  ILE n 
1  371  ALA n 
1  372  LYS n 
1  373  THR n 
1  374  LEU n 
1  375  THR n 
1  376  TYR n 
1  377  PRO n 
1  378  GLU n 
1  379  VAL n 
1  380  VAL n 
1  381  THR n 
1  382  PRO n 
1  383  TYR n 
1  384  ASN n 
1  385  ILE n 
1  386  ASP n 
1  387  ARG n 
1  388  LEU n 
1  389  THR n 
1  390  GLN n 
1  391  LEU n 
1  392  VAL n 
1  393  ARG n 
1  394  ASN n 
1  395  GLY n 
1  396  PRO n 
1  397  ASN n 
1  398  GLU n 
1  399  HIS n 
1  400  PRO n 
1  401  GLY n 
1  402  ALA n 
1  403  LYS n 
1  404  TYR n 
1  405  VAL n 
1  406  ILE n 
1  407  ARG n 
1  408  ASP n 
1  409  SER n 
1  410  GLY n 
1  411  ASP n 
1  412  ARG n 
1  413  ILE n 
1  414  ASP n 
1  415  LEU n 
1  416  ARG n 
1  417  TYR n 
1  418  SER n 
1  419  LYS n 
1  420  ARG n 
1  421  ALA n 
1  422  GLY n 
1  423  ASP n 
1  424  ILE n 
1  425  GLN n 
1  426  LEU n 
1  427  GLN n 
1  428  TYR n 
1  429  GLY n 
1  430  TRP n 
1  431  LYS n 
1  432  VAL n 
1  433  GLU n 
1  434  ARG n 
1  435  HIS n 
1  436  ILE n 
1  437  MET n 
1  438  ASP n 
1  439  ASN n 
1  440  ASP n 
1  441  PRO n 
1  442  VAL n 
1  443  LEU n 
1  444  PHE n 
1  445  ASN n 
1  446  ARG n 
1  447  GLN n 
1  448  PRO n 
1  449  SER n 
1  450  LEU n 
1  451  HIS n 
1  452  LYS n 
1  453  MET n 
1  454  SER n 
1  455  MET n 
1  456  MET n 
1  457  ALA n 
1  458  HIS n 
1  459  ARG n 
1  460  VAL n 
1  461  LYS n 
1  462  VAL n 
1  463  ILE n 
1  464  PRO n 
1  465  TYR n 
1  466  SER n 
1  467  THR n 
1  468  PHE n 
1  469  ARG n 
1  470  LEU n 
1  471  ASN n 
1  472  LEU n 
1  473  SER n 
1  474  VAL n 
1  475  THR n 
1  476  SER n 
1  477  PRO n 
1  478  TYR n 
1  479  ASN n 
1  480  ALA n 
1  481  ASP n 
1  482  PHE n 
1  483  ASP n 
1  484  GLY n 
1  485  ASP n 
1  486  GLU n 
1  487  MET n 
1  488  ASN n 
1  489  LEU n 
1  490  HIS n 
1  491  VAL n 
1  492  PRO n 
1  493  GLN n 
1  494  SER n 
1  495  GLU n 
1  496  GLU n 
1  497  THR n 
1  498  ARG n 
1  499  ALA n 
1  500  GLU n 
1  501  LEU n 
1  502  SER n 
1  503  GLN n 
1  504  LEU n 
1  505  CYS n 
1  506  ALA n 
1  507  VAL n 
1  508  PRO n 
1  509  LEU n 
1  510  GLN n 
1  511  ILE n 
1  512  VAL n 
1  513  SER n 
1  514  PRO n 
1  515  GLN n 
1  516  SER n 
1  517  ASN n 
1  518  LYS n 
1  519  PRO n 
1  520  CYS n 
1  521  MET n 
1  522  GLY n 
1  523  ILE n 
1  524  VAL n 
1  525  GLN n 
1  526  ASP n 
1  527  THR n 
1  528  LEU n 
1  529  CYS n 
1  530  GLY n 
1  531  ILE n 
1  532  ARG n 
1  533  LYS n 
1  534  LEU n 
1  535  THR n 
1  536  LEU n 
1  537  ARG n 
1  538  ASP n 
1  539  THR n 
1  540  PHE n 
1  541  ILE n 
1  542  GLU n 
1  543  LEU n 
1  544  ASP n 
1  545  GLN n 
1  546  VAL n 
1  547  LEU n 
1  548  ASN n 
1  549  MET n 
1  550  LEU n 
1  551  TYR n 
1  552  TRP n 
1  553  VAL n 
1  554  PRO n 
1  555  ASP n 
1  556  TRP n 
1  557  ASP n 
1  558  GLY n 
1  559  VAL n 
1  560  ILE n 
1  561  PRO n 
1  562  THR n 
1  563  PRO n 
1  564  ALA n 
1  565  ILE n 
1  566  ILE n 
1  567  LYS n 
1  568  PRO n 
1  569  LYS n 
1  570  PRO n 
1  571  LEU n 
1  572  TRP n 
1  573  SER n 
1  574  GLY n 
1  575  LYS n 
1  576  GLN n 
1  577  ILE n 
1  578  LEU n 
1  579  SER n 
1  580  VAL n 
1  581  ALA n 
1  582  ILE n 
1  583  PRO n 
1  584  ASN n 
1  585  GLY n 
1  586  ILE n 
1  587  HIS n 
1  588  LEU n 
1  589  GLN n 
1  590  ARG n 
1  591  PHE n 
1  592  ASP n 
1  593  GLU n 
1  594  GLY n 
1  595  THR n 
1  596  THR n 
1  597  LEU n 
1  598  LEU n 
1  599  SER n 
1  600  PRO n 
1  601  LYS n 
1  602  ASP n 
1  603  ASN n 
1  604  GLY n 
1  605  MET n 
1  606  LEU n 
1  607  ILE n 
1  608  ILE n 
1  609  ASP n 
1  610  GLY n 
1  611  GLN n 
1  612  ILE n 
1  613  ILE n 
1  614  PHE n 
1  615  GLY n 
1  616  VAL n 
1  617  VAL n 
1  618  GLU n 
1  619  LYS n 
1  620  LYS n 
1  621  THR n 
1  622  VAL n 
1  623  GLY n 
1  624  SER n 
1  625  SER n 
1  626  ASN n 
1  627  GLY n 
1  628  GLY n 
1  629  LEU n 
1  630  ILE n 
1  631  HIS n 
1  632  VAL n 
1  633  VAL n 
1  634  THR n 
1  635  ARG n 
1  636  GLU n 
1  637  LYS n 
1  638  GLY n 
1  639  PRO n 
1  640  GLN n 
1  641  VAL n 
1  642  CYS n 
1  643  ALA n 
1  644  LYS n 
1  645  LEU n 
1  646  PHE n 
1  647  GLY n 
1  648  ASN n 
1  649  ILE n 
1  650  GLN n 
1  651  LYS n 
1  652  VAL n 
1  653  VAL n 
1  654  ASN n 
1  655  PHE n 
1  656  TRP n 
1  657  LEU n 
1  658  LEU n 
1  659  HIS n 
1  660  ASN n 
1  661  GLY n 
1  662  PHE n 
1  663  SER n 
1  664  THR n 
1  665  GLY n 
1  666  ILE n 
1  667  GLY n 
1  668  ASP n 
1  669  THR n 
1  670  ILE n 
1  671  ALA n 
1  672  ASP n 
1  673  GLY n 
1  674  PRO n 
1  675  THR n 
1  676  MET n 
1  677  ARG n 
1  678  GLU n 
1  679  ILE n 
1  680  THR n 
1  681  GLU n 
1  682  THR n 
1  683  ILE n 
1  684  ALA n 
1  685  GLU n 
1  686  ALA n 
1  687  LYS n 
1  688  LYS n 
1  689  LYS n 
1  690  VAL n 
1  691  LEU n 
1  692  ASP n 
1  693  VAL n 
1  694  THR n 
1  695  LYS n 
1  696  GLU n 
1  697  ALA n 
1  698  GLN n 
1  699  ALA n 
1  700  ASN n 
1  701  LEU n 
1  702  LEU n 
1  703  THR n 
1  704  ALA n 
1  705  LYS n 
1  706  HIS n 
1  707  GLY n 
1  708  MET n 
1  709  THR n 
1  710  LEU n 
1  711  ARG n 
1  712  GLU n 
1  713  SER n 
1  714  PHE n 
1  715  GLU n 
1  716  ASP n 
1  717  ASN n 
1  718  VAL n 
1  719  VAL n 
1  720  ARG n 
1  721  PHE n 
1  722  LEU n 
1  723  ASN n 
1  724  GLU n 
1  725  ALA n 
1  726  ARG n 
1  727  ASP n 
1  728  LYS n 
1  729  ALA n 
1  730  GLY n 
1  731  ARG n 
1  732  LEU n 
1  733  ALA n 
1  734  GLU n 
1  735  VAL n 
1  736  ASN n 
1  737  LEU n 
1  738  LYS n 
1  739  ASP n 
1  740  LEU n 
1  741  ASN n 
1  742  ASN n 
1  743  VAL n 
1  744  LYS n 
1  745  GLN n 
1  746  MET n 
1  747  VAL n 
1  748  MET n 
1  749  ALA n 
1  750  GLY n 
1  751  SER n 
1  752  LYS n 
1  753  GLY n 
1  754  SER n 
1  755  PHE n 
1  756  ILE n 
1  757  ASN n 
1  758  ILE n 
1  759  ALA n 
1  760  GLN n 
1  761  MET n 
1  762  SER n 
1  763  ALA n 
1  764  CYS n 
1  765  VAL n 
1  766  GLY n 
1  767  GLN n 
1  768  GLN n 
1  769  SER n 
1  770  VAL n 
1  771  GLU n 
1  772  GLY n 
1  773  LYS n 
1  774  ARG n 
1  775  ILE n 
1  776  ALA n 
1  777  PHE n 
1  778  GLY n 
1  779  PHE n 
1  780  VAL n 
1  781  ASP n 
1  782  ARG n 
1  783  THR n 
1  784  LEU n 
1  785  PRO n 
1  786  HIS n 
1  787  PHE n 
1  788  SER n 
1  789  LYS n 
1  790  ASP n 
1  791  ASP n 
1  792  TYR n 
1  793  SER n 
1  794  PRO n 
1  795  GLU n 
1  796  SER n 
1  797  LYS n 
1  798  GLY n 
1  799  PHE n 
1  800  VAL n 
1  801  GLU n 
1  802  ASN n 
1  803  SER n 
1  804  TYR n 
1  805  LEU n 
1  806  ARG n 
1  807  GLY n 
1  808  LEU n 
1  809  THR n 
1  810  PRO n 
1  811  GLN n 
1  812  GLU n 
1  813  PHE n 
1  814  PHE n 
1  815  PHE n 
1  816  HIS n 
1  817  ALA n 
1  818  MET n 
1  819  GLY n 
1  820  GLY n 
1  821  ARG n 
1  822  GLU n 
1  823  GLY n 
1  824  LEU n 
1  825  ILE n 
1  826  ASP n 
1  827  THR n 
1  828  ALA n 
1  829  VAL n 
1  830  LYS n 
1  831  THR n 
1  832  ALA n 
1  833  GLU n 
1  834  THR n 
1  835  GLY n 
1  836  TYR n 
1  837  ILE n 
1  838  GLN n 
1  839  ARG n 
1  840  ARG n 
1  841  LEU n 
1  842  VAL n 
1  843  LYS n 
1  844  ALA n 
1  845  LEU n 
1  846  GLU n 
1  847  ASP n 
1  848  ILE n 
1  849  MET n 
1  850  VAL n 
1  851  HIS n 
1  852  TYR n 
1  853  ASP n 
1  854  ASN n 
1  855  THR n 
1  856  THR n 
1  857  ARG n 
1  858  ASN n 
1  859  SER n 
1  860  LEU n 
1  861  GLY n 
1  862  ASN n 
1  863  VAL n 
1  864  ILE n 
1  865  GLN n 
1  866  PHE n 
1  867  ILE n 
1  868  TYR n 
1  869  GLY n 
1  870  GLU n 
1  871  ASP n 
1  872  GLY n 
1  873  MET n 
1  874  ASP n 
1  875  ALA n 
1  876  ALA n 
1  877  HIS n 
1  878  ILE n 
1  879  GLU n 
1  880  LYS n 
1  881  GLN n 
1  882  SER n 
1  883  LEU n 
1  884  ASP n 
1  885  THR n 
1  886  ILE n 
1  887  GLY n 
1  888  GLY n 
1  889  SER n 
1  890  ASP n 
1  891  ALA n 
1  892  ALA n 
1  893  PHE n 
1  894  GLU n 
1  895  LYS n 
1  896  ARG n 
1  897  TYR n 
1  898  ARG n 
1  899  VAL n 
1  900  ASP n 
1  901  LEU n 
1  902  LEU n 
1  903  ASN n 
1  904  THR n 
1  905  ASP n 
1  906  HIS n 
1  907  THR n 
1  908  LEU n 
1  909  ASP n 
1  910  PRO n 
1  911  SER n 
1  912  LEU n 
1  913  LEU n 
1  914  GLU n 
1  915  SER n 
1  916  GLY n 
1  917  SER n 
1  918  GLU n 
1  919  ILE n 
1  920  LEU n 
1  921  GLY n 
1  922  ASP n 
1  923  LEU n 
1  924  LYS n 
1  925  LEU n 
1  926  GLN n 
1  927  VAL n 
1  928  LEU n 
1  929  LEU n 
1  930  ASP n 
1  931  GLU n 
1  932  GLU n 
1  933  TYR n 
1  934  LYS n 
1  935  GLN n 
1  936  LEU n 
1  937  VAL n 
1  938  LYS n 
1  939  ASP n 
1  940  ARG n 
1  941  LYS n 
1  942  PHE n 
1  943  LEU n 
1  944  ARG n 
1  945  GLU n 
1  946  VAL n 
1  947  PHE n 
1  948  VAL n 
1  949  ASP n 
1  950  GLY n 
1  951  GLU n 
1  952  ALA n 
1  953  ASN n 
1  954  TRP n 
1  955  PRO n 
1  956  LEU n 
1  957  PRO n 
1  958  VAL n 
1  959  ASN n 
1  960  ILE n 
1  961  ARG n 
1  962  ARG n 
1  963  ILE n 
1  964  ILE n 
1  965  GLN n 
1  966  ASN n 
1  967  ALA n 
1  968  GLN n 
1  969  GLN n 
1  970  THR n 
1  971  PHE n 
1  972  HIS n 
1  973  ILE n 
1  974  ASP n 
1  975  HIS n 
1  976  THR n 
1  977  LYS n 
1  978  PRO n 
1  979  SER n 
1  980  ASP n 
1  981  LEU n 
1  982  THR n 
1  983  ILE n 
1  984  LYS n 
1  985  ASP n 
1  986  ILE n 
1  987  VAL n 
1  988  LEU n 
1  989  GLY n 
1  990  VAL n 
1  991  LYS n 
1  992  ASP n 
1  993  LEU n 
1  994  GLN n 
1  995  GLU n 
1  996  ASN n 
1  997  LEU n 
1  998  LEU n 
1  999  VAL n 
1  1000 LEU n 
1  1001 ARG n 
1  1002 GLY n 
1  1003 LYS n 
1  1004 ASN n 
1  1005 GLU n 
1  1006 ILE n 
1  1007 ILE n 
1  1008 GLN n 
1  1009 ASN n 
1  1010 ALA n 
1  1011 GLN n 
1  1012 ARG n 
1  1013 ASP n 
1  1014 ALA n 
1  1015 VAL n 
1  1016 THR n 
1  1017 LEU n 
1  1018 PHE n 
1  1019 CYS n 
1  1020 CYS n 
1  1021 LEU n 
1  1022 LEU n 
1  1023 ARG n 
1  1024 SER n 
1  1025 ARG n 
1  1026 LEU n 
1  1027 ALA n 
1  1028 THR n 
1  1029 ARG n 
1  1030 ARG n 
1  1031 VAL n 
1  1032 LEU n 
1  1033 GLN n 
1  1034 GLU n 
1  1035 TYR n 
1  1036 ARG n 
1  1037 LEU n 
1  1038 THR n 
1  1039 LYS n 
1  1040 GLN n 
1  1041 ALA n 
1  1042 PHE n 
1  1043 ASP n 
1  1044 TRP n 
1  1045 VAL n 
1  1046 LEU n 
1  1047 SER n 
1  1048 ASN n 
1  1049 ILE n 
1  1050 GLU n 
1  1051 ALA n 
1  1052 GLN n 
1  1053 PHE n 
1  1054 LEU n 
1  1055 ARG n 
1  1056 SER n 
1  1057 VAL n 
1  1058 VAL n 
1  1059 HIS n 
1  1060 PRO n 
1  1061 GLY n 
1  1062 GLU n 
1  1063 MET n 
1  1064 VAL n 
1  1065 GLY n 
1  1066 VAL n 
1  1067 LEU n 
1  1068 ALA n 
1  1069 ALA n 
1  1070 GLN n 
1  1071 SER n 
1  1072 ILE n 
1  1073 GLY n 
1  1074 GLU n 
1  1075 PRO n 
1  1076 ALA n 
1  1077 THR n 
1  1078 GLN n 
1  1079 MET n 
1  1080 THR n 
1  1081 LEU n 
1  1082 ASN n 
1  1083 THR n 
1  1084 PHE n 
1  1085 HIS n 
1  1086 PHE n 
1  1087 ALA n 
1  1088 GLY n 
1  1089 VAL n 
1  1090 ALA n 
1  1091 SER n 
1  1092 LYS n 
1  1093 LYS n 
1  1094 VAL n 
1  1095 THR n 
1  1096 SER n 
1  1097 GLY n 
1  1098 VAL n 
1  1099 PRO n 
1  1100 ARG n 
1  1101 LEU n 
1  1102 LYS n 
1  1103 GLU n 
1  1104 ILE n 
1  1105 LEU n 
1  1106 ASN n 
1  1107 VAL n 
1  1108 ALA n 
1  1109 LYS n 
1  1110 ASN n 
1  1111 MET n 
1  1112 LYS n 
1  1113 THR n 
1  1114 PRO n 
1  1115 SER n 
1  1116 LEU n 
1  1117 THR n 
1  1118 VAL n 
1  1119 TYR n 
1  1120 LEU n 
1  1121 GLU n 
1  1122 PRO n 
1  1123 GLY n 
1  1124 HIS n 
1  1125 ALA n 
1  1126 ALA n 
1  1127 ASP n 
1  1128 GLN n 
1  1129 GLU n 
1  1130 GLN n 
1  1131 ALA n 
1  1132 LYS n 
1  1133 LEU n 
1  1134 ILE n 
1  1135 ARG n 
1  1136 SER n 
1  1137 ALA n 
1  1138 ILE n 
1  1139 GLU n 
1  1140 HIS n 
1  1141 THR n 
1  1142 THR n 
1  1143 LEU n 
1  1144 LYS n 
1  1145 SER n 
1  1146 VAL n 
1  1147 THR n 
1  1148 ILE n 
1  1149 ALA n 
1  1150 SER n 
1  1151 GLU n 
1  1152 ILE n 
1  1153 TYR n 
1  1154 TYR n 
1  1155 ASP n 
1  1156 PRO n 
1  1157 ASP n 
1  1158 PRO n 
1  1159 ARG n 
1  1160 SER n 
1  1161 THR n 
1  1162 VAL n 
1  1163 ILE n 
1  1164 PRO n 
1  1165 GLU n 
1  1166 ASP n 
1  1167 GLU n 
1  1168 GLU n 
1  1169 ILE n 
1  1170 ILE n 
1  1171 GLN n 
1  1172 LEU n 
1  1173 HIS n 
1  1174 PHE n 
1  1175 SER n 
1  1176 LEU n 
1  1177 LEU n 
1  1178 ASP n 
1  1179 GLU n 
1  1180 GLU n 
1  1181 ALA n 
1  1182 GLU n 
1  1183 GLN n 
1  1184 SER n 
1  1185 PHE n 
1  1186 ASP n 
1  1187 GLN n 
1  1188 GLN n 
1  1189 SER n 
1  1190 PRO n 
1  1191 TRP n 
1  1192 LEU n 
1  1193 LEU n 
1  1194 ARG n 
1  1195 LEU n 
1  1196 GLU n 
1  1197 LEU n 
1  1198 ASP n 
1  1199 ARG n 
1  1200 ALA n 
1  1201 ALA n 
1  1202 MET n 
1  1203 ASN n 
1  1204 ASP n 
1  1205 LYS n 
1  1206 ASP n 
1  1207 LEU n 
1  1208 THR n 
1  1209 MET n 
1  1210 GLY n 
1  1211 GLN n 
1  1212 VAL n 
1  1213 GLY n 
1  1214 GLU n 
1  1215 ARG n 
1  1216 ILE n 
1  1217 LYS n 
1  1218 GLN n 
1  1219 THR n 
1  1220 PHE n 
1  1221 LYS n 
1  1222 ASN n 
1  1223 ASP n 
1  1224 LEU n 
1  1225 PHE n 
1  1226 VAL n 
1  1227 ILE n 
1  1228 TRP n 
1  1229 SER n 
1  1230 GLU n 
1  1231 ASP n 
1  1232 ASN n 
1  1233 ASP n 
1  1234 GLU n 
1  1235 LYS n 
1  1236 LEU n 
1  1237 ILE n 
1  1238 ILE n 
1  1239 ARG n 
1  1240 CYS n 
1  1241 ARG n 
1  1242 VAL n 
1  1243 VAL n 
1  1244 ARG n 
1  1245 PRO n 
1  1246 LYS n 
1  1247 SER n 
1  1248 LEU n 
1  1249 ASP n 
1  1250 ALA n 
1  1251 GLU n 
1  1252 THR n 
1  1253 GLU n 
1  1254 ALA n 
1  1255 GLU n 
1  1256 GLU n 
1  1257 ASP n 
1  1258 HIS n 
1  1259 MET n 
1  1260 LEU n 
1  1261 LYS n 
1  1262 LYS n 
1  1263 ILE n 
1  1264 GLU n 
1  1265 ASN n 
1  1266 THR n 
1  1267 MET n 
1  1268 LEU n 
1  1269 GLU n 
1  1270 ASN n 
1  1271 ILE n 
1  1272 THR n 
1  1273 LEU n 
1  1274 ARG n 
1  1275 GLY n 
1  1276 VAL n 
1  1277 GLU n 
1  1278 ASN n 
1  1279 ILE n 
1  1280 GLU n 
1  1281 ARG n 
1  1282 VAL n 
1  1283 VAL n 
1  1284 MET n 
1  1285 MET n 
1  1286 LYS n 
1  1287 TYR n 
1  1288 ASP n 
1  1289 ARG n 
1  1290 LYS n 
1  1291 VAL n 
1  1292 PRO n 
1  1293 SER n 
1  1294 PRO n 
1  1295 THR n 
1  1296 GLY n 
1  1297 GLU n 
1  1298 TYR n 
1  1299 VAL n 
1  1300 LYS n 
1  1301 GLU n 
1  1302 PRO n 
1  1303 GLU n 
1  1304 TRP n 
1  1305 VAL n 
1  1306 LEU n 
1  1307 GLU n 
1  1308 THR n 
1  1309 ASP n 
1  1310 GLY n 
1  1311 VAL n 
1  1312 ASN n 
1  1313 LEU n 
1  1314 SER n 
1  1315 GLU n 
1  1316 VAL n 
1  1317 MET n 
1  1318 THR n 
1  1319 VAL n 
1  1320 PRO n 
1  1321 GLY n 
1  1322 ILE n 
1  1323 ASP n 
1  1324 PRO n 
1  1325 THR n 
1  1326 ARG n 
1  1327 ILE n 
1  1328 TYR n 
1  1329 THR n 
1  1330 ASN n 
1  1331 SER n 
1  1332 PHE n 
1  1333 ILE n 
1  1334 ASP n 
1  1335 ILE n 
1  1336 MET n 
1  1337 GLU n 
1  1338 VAL n 
1  1339 LEU n 
1  1340 GLY n 
1  1341 ILE n 
1  1342 GLU n 
1  1343 ALA n 
1  1344 GLY n 
1  1345 ARG n 
1  1346 ALA n 
1  1347 ALA n 
1  1348 LEU n 
1  1349 TYR n 
1  1350 LYS n 
1  1351 GLU n 
1  1352 VAL n 
1  1353 TYR n 
1  1354 ASN n 
1  1355 VAL n 
1  1356 ILE n 
1  1357 ALA n 
1  1358 SER n 
1  1359 ASP n 
1  1360 GLY n 
1  1361 SER n 
1  1362 TYR n 
1  1363 VAL n 
1  1364 ASN n 
1  1365 TYR n 
1  1366 ARG n 
1  1367 HIS n 
1  1368 MET n 
1  1369 ALA n 
1  1370 LEU n 
1  1371 LEU n 
1  1372 VAL n 
1  1373 ASP n 
1  1374 VAL n 
1  1375 MET n 
1  1376 THR n 
1  1377 THR n 
1  1378 GLN n 
1  1379 GLY n 
1  1380 GLY n 
1  1381 LEU n 
1  1382 THR n 
1  1383 SER n 
1  1384 VAL n 
1  1385 THR n 
1  1386 ARG n 
1  1387 HIS n 
1  1388 GLY n 
1  1389 PHE n 
1  1390 ASN n 
1  1391 ARG n 
1  1392 SER n 
1  1393 ASN n 
1  1394 THR n 
1  1395 GLY n 
1  1396 ALA n 
1  1397 LEU n 
1  1398 MET n 
1  1399 ARG n 
1  1400 CYS n 
1  1401 SER n 
1  1402 PHE n 
1  1403 GLU n 
1  1404 GLU n 
1  1405 THR n 
1  1406 VAL n 
1  1407 GLU n 
1  1408 ILE n 
1  1409 LEU n 
1  1410 PHE n 
1  1411 GLU n 
1  1412 ALA n 
1  1413 GLY n 
1  1414 ALA n 
1  1415 SER n 
1  1416 ALA n 
1  1417 GLU n 
1  1418 LEU n 
1  1419 ASP n 
1  1420 ASP n 
1  1421 CYS n 
1  1422 ARG n 
1  1423 GLY n 
1  1424 VAL n 
1  1425 SER n 
1  1426 GLU n 
1  1427 ASN n 
1  1428 VAL n 
1  1429 ILE n 
1  1430 LEU n 
1  1431 GLY n 
1  1432 GLN n 
1  1433 MET n 
1  1434 ALA n 
1  1435 PRO n 
1  1436 ILE n 
1  1437 GLY n 
1  1438 THR n 
1  1439 GLY n 
1  1440 ALA n 
1  1441 PHE n 
1  1442 ASP n 
1  1443 VAL n 
1  1444 MET n 
1  1445 ILE n 
1  1446 ASP n 
1  1447 GLU n 
1  1448 GLU n 
1  1449 SER n 
1  1450 LEU n 
1  1451 VAL n 
1  1452 LYS n 
1  1453 TYR n 
1  1454 MET n 
1  1455 PRO n 
1  1456 GLU n 
1  1457 GLN n 
1  1458 LYS n 
1  1459 ILE n 
1  1460 THR n 
1  1461 GLU n 
1  1462 ILE n 
1  1463 GLU n 
1  1464 ASP n 
1  1465 GLY n 
1  1466 GLN n 
1  1467 ASP n 
1  1468 GLY n 
1  1469 GLY n 
1  1470 VAL n 
1  1471 THR n 
1  1472 PRO n 
1  1473 TYR n 
1  1474 SER n 
1  1475 ASN n 
1  1476 GLU n 
1  1477 SER n 
1  1478 GLY n 
1  1479 LEU n 
1  1480 VAL n 
1  1481 ASN n 
1  1482 ALA n 
1  1483 ASP n 
1  1484 LEU n 
1  1485 ASP n 
1  1486 VAL n 
1  1487 LYS n 
1  1488 ASP n 
1  1489 GLU n 
1  1490 LEU n 
1  1491 MET n 
1  1492 PHE n 
1  1493 SER n 
1  1494 PRO n 
1  1495 LEU n 
1  1496 VAL n 
1  1497 ASP n 
1  1498 SER n 
1  1499 GLY n 
1  1500 SER n 
1  1501 ASN n 
1  1502 ASP n 
1  1503 ALA n 
1  1504 MET n 
1  1505 ALA n 
1  1506 GLY n 
1  1507 GLY n 
1  1508 PHE n 
1  1509 THR n 
1  1510 ALA n 
1  1511 TYR n 
1  1512 GLY n 
1  1513 GLY n 
1  1514 ALA n 
1  1515 ASP n 
1  1516 TYR n 
1  1517 GLY n 
1  1518 GLU n 
1  1519 ALA n 
1  1520 THR n 
1  1521 SER n 
1  1522 PRO n 
1  1523 PHE n 
1  1524 GLY n 
1  1525 ALA n 
1  1526 TYR n 
1  1527 GLY n 
1  1528 GLU n 
1  1529 ALA n 
1  1530 PRO n 
1  1531 THR n 
1  1532 SER n 
1  1533 PRO n 
1  1534 GLY n 
1  1535 PHE n 
1  1536 GLY n 
1  1537 VAL n 
1  1538 SER n 
1  1539 SER n 
1  1540 PRO n 
1  1541 GLY n 
1  1542 PHE n 
1  1543 SER n 
1  1544 PRO n 
1  1545 THR n 
1  1546 SER n 
1  1547 PRO n 
1  1548 THR n 
1  1549 TYR n 
1  1550 SER n 
1  1551 PRO n 
1  1552 THR n 
1  1553 SER n 
1  1554 PRO n 
1  1555 ALA n 
1  1556 TYR n 
1  1557 SER n 
1  1558 PRO n 
1  1559 THR n 
1  1560 SER n 
1  1561 PRO n 
1  1562 SER n 
1  1563 TYR n 
1  1564 SER n 
1  1565 PRO n 
1  1566 THR n 
1  1567 SER n 
1  1568 PRO n 
1  1569 SER n 
1  1570 TYR n 
1  1571 SER n 
1  1572 PRO n 
1  1573 THR n 
1  1574 SER n 
1  1575 PRO n 
1  1576 SER n 
1  1577 TYR n 
1  1578 SER n 
1  1579 PRO n 
1  1580 THR n 
1  1581 SER n 
1  1582 PRO n 
1  1583 SER n 
1  1584 TYR n 
1  1585 SER n 
1  1586 PRO n 
1  1587 THR n 
1  1588 SER n 
1  1589 PRO n 
1  1590 SER n 
1  1591 TYR n 
1  1592 SER n 
1  1593 PRO n 
1  1594 THR n 
1  1595 SER n 
1  1596 PRO n 
1  1597 SER n 
1  1598 TYR n 
1  1599 SER n 
1  1600 PRO n 
1  1601 THR n 
1  1602 SER n 
1  1603 PRO n 
1  1604 SER n 
1  1605 TYR n 
1  1606 SER n 
1  1607 PRO n 
1  1608 THR n 
1  1609 SER n 
1  1610 PRO n 
1  1611 SER n 
1  1612 TYR n 
1  1613 SER n 
1  1614 PRO n 
1  1615 THR n 
1  1616 SER n 
1  1617 PRO n 
1  1618 SER n 
1  1619 TYR n 
1  1620 SER n 
1  1621 PRO n 
1  1622 THR n 
1  1623 SER n 
1  1624 PRO n 
1  1625 SER n 
1  1626 TYR n 
1  1627 SER n 
1  1628 PRO n 
1  1629 THR n 
1  1630 SER n 
1  1631 PRO n 
1  1632 SER n 
1  1633 TYR n 
1  1634 SER n 
1  1635 PRO n 
1  1636 THR n 
1  1637 SER n 
1  1638 PRO n 
1  1639 SER n 
1  1640 TYR n 
1  1641 SER n 
1  1642 PRO n 
1  1643 THR n 
1  1644 SER n 
1  1645 PRO n 
1  1646 SER n 
1  1647 TYR n 
1  1648 SER n 
1  1649 PRO n 
1  1650 THR n 
1  1651 SER n 
1  1652 PRO n 
1  1653 SER n 
1  1654 TYR n 
1  1655 SER n 
1  1656 PRO n 
1  1657 THR n 
1  1658 SER n 
1  1659 PRO n 
1  1660 ALA n 
1  1661 TYR n 
1  1662 SER n 
1  1663 PRO n 
1  1664 THR n 
1  1665 SER n 
1  1666 PRO n 
1  1667 SER n 
1  1668 TYR n 
1  1669 SER n 
1  1670 PRO n 
1  1671 THR n 
1  1672 SER n 
1  1673 PRO n 
1  1674 SER n 
1  1675 TYR n 
1  1676 SER n 
1  1677 PRO n 
1  1678 THR n 
1  1679 SER n 
1  1680 PRO n 
1  1681 SER n 
1  1682 TYR n 
1  1683 SER n 
1  1684 PRO n 
1  1685 THR n 
1  1686 SER n 
1  1687 PRO n 
1  1688 SER n 
1  1689 TYR n 
1  1690 SER n 
1  1691 PRO n 
1  1692 THR n 
1  1693 SER n 
1  1694 PRO n 
1  1695 ASN n 
1  1696 TYR n 
1  1697 SER n 
1  1698 PRO n 
1  1699 THR n 
1  1700 SER n 
1  1701 PRO n 
1  1702 SER n 
1  1703 TYR n 
1  1704 SER n 
1  1705 PRO n 
1  1706 THR n 
1  1707 SER n 
1  1708 PRO n 
1  1709 GLY n 
1  1710 TYR n 
1  1711 SER n 
1  1712 PRO n 
1  1713 GLY n 
1  1714 SER n 
1  1715 PRO n 
1  1716 ALA n 
1  1717 TYR n 
1  1718 SER n 
1  1719 PRO n 
1  1720 LYS n 
1  1721 GLN n 
1  1722 ASP n 
1  1723 GLU n 
1  1724 GLN n 
1  1725 LYS n 
1  1726 HIS n 
1  1727 ASN n 
1  1728 GLU n 
1  1729 ASN n 
1  1730 GLU n 
1  1731 ASN n 
1  1732 SER n 
1  1733 ARG n 
2  1    MET n 
2  2    SER n 
2  3    ASP n 
2  4    LEU n 
2  5    ALA n 
2  6    ASN n 
2  7    SER n 
2  8    GLU n 
2  9    LYS n 
2  10   TYR n 
2  11   TYR n 
2  12   ASP n 
2  13   GLU n 
2  14   ASP n 
2  15   PRO n 
2  16   TYR n 
2  17   GLY n 
2  18   PHE n 
2  19   GLU n 
2  20   ASP n 
2  21   GLU n 
2  22   SER n 
2  23   ALA n 
2  24   PRO n 
2  25   ILE n 
2  26   THR n 
2  27   ALA n 
2  28   GLU n 
2  29   ASP n 
2  30   SER n 
2  31   TRP n 
2  32   ALA n 
2  33   VAL n 
2  34   ILE n 
2  35   SER n 
2  36   ALA n 
2  37   PHE n 
2  38   PHE n 
2  39   ARG n 
2  40   GLU n 
2  41   LYS n 
2  42   GLY n 
2  43   LEU n 
2  44   VAL n 
2  45   SER n 
2  46   GLN n 
2  47   GLN n 
2  48   LEU n 
2  49   ASP n 
2  50   SER n 
2  51   PHE n 
2  52   ASN n 
2  53   GLN n 
2  54   PHE n 
2  55   VAL n 
2  56   ASP n 
2  57   TYR n 
2  58   THR n 
2  59   LEU n 
2  60   GLN n 
2  61   ASP n 
2  62   ILE n 
2  63   ILE n 
2  64   CYS n 
2  65   GLU n 
2  66   ASP n 
2  67   SER n 
2  68   THR n 
2  69   LEU n 
2  70   ILE n 
2  71   LEU n 
2  72   GLU n 
2  73   GLN n 
2  74   LEU n 
2  75   ALA n 
2  76   GLN n 
2  77   HIS n 
2  78   THR n 
2  79   THR n 
2  80   GLU n 
2  81   SER n 
2  82   ASP n 
2  83   ASN n 
2  84   ILE n 
2  85   SER n 
2  86   ARG n 
2  87   LYS n 
2  88   TYR n 
2  89   GLU n 
2  90   ILE n 
2  91   SER n 
2  92   PHE n 
2  93   GLY n 
2  94   LYS n 
2  95   ILE n 
2  96   TYR n 
2  97   VAL n 
2  98   THR n 
2  99   LYS n 
2  100  PRO n 
2  101  MET n 
2  102  VAL n 
2  103  ASN n 
2  104  GLU n 
2  105  SER n 
2  106  ASP n 
2  107  GLY n 
2  108  VAL n 
2  109  THR n 
2  110  HIS n 
2  111  ALA n 
2  112  LEU n 
2  113  TYR n 
2  114  PRO n 
2  115  GLN n 
2  116  GLU n 
2  117  ALA n 
2  118  ARG n 
2  119  LEU n 
2  120  ARG n 
2  121  ASN n 
2  122  LEU n 
2  123  THR n 
2  124  TYR n 
2  125  SER n 
2  126  SER n 
2  127  GLY n 
2  128  LEU n 
2  129  PHE n 
2  130  VAL n 
2  131  ASP n 
2  132  VAL n 
2  133  LYS n 
2  134  LYS n 
2  135  ARG n 
2  136  THR n 
2  137  TYR n 
2  138  GLU n 
2  139  ALA n 
2  140  ILE n 
2  141  ASP n 
2  142  VAL n 
2  143  PRO n 
2  144  GLY n 
2  145  ARG n 
2  146  GLU n 
2  147  LEU n 
2  148  LYS n 
2  149  TYR n 
2  150  GLU n 
2  151  LEU n 
2  152  ILE n 
2  153  ALA n 
2  154  GLU n 
2  155  GLU n 
2  156  SER n 
2  157  GLU n 
2  158  ASP n 
2  159  ASP n 
2  160  SER n 
2  161  GLU n 
2  162  SER n 
2  163  GLY n 
2  164  LYS n 
2  165  VAL n 
2  166  PHE n 
2  167  ILE n 
2  168  GLY n 
2  169  ARG n 
2  170  LEU n 
2  171  PRO n 
2  172  ILE n 
2  173  MET n 
2  174  LEU n 
2  175  ARG n 
2  176  SER n 
2  177  LYS n 
2  178  ASN n 
2  179  CYS n 
2  180  TYR n 
2  181  LEU n 
2  182  SER n 
2  183  GLU n 
2  184  ALA n 
2  185  THR n 
2  186  GLU n 
2  187  SER n 
2  188  ASP n 
2  189  LEU n 
2  190  TYR n 
2  191  LYS n 
2  192  LEU n 
2  193  LYS n 
2  194  GLU n 
2  195  CYS n 
2  196  PRO n 
2  197  PHE n 
2  198  ASP n 
2  199  MET n 
2  200  GLY n 
2  201  GLY n 
2  202  TYR n 
2  203  PHE n 
2  204  ILE n 
2  205  ILE n 
2  206  ASN n 
2  207  GLY n 
2  208  SER n 
2  209  GLU n 
2  210  LYS n 
2  211  VAL n 
2  212  LEU n 
2  213  ILE n 
2  214  ALA n 
2  215  GLN n 
2  216  GLU n 
2  217  ARG n 
2  218  SER n 
2  219  ALA n 
2  220  GLY n 
2  221  ASN n 
2  222  ILE n 
2  223  VAL n 
2  224  GLN n 
2  225  VAL n 
2  226  PHE n 
2  227  LYS n 
2  228  LYS n 
2  229  ALA n 
2  230  ALA n 
2  231  PRO n 
2  232  SER n 
2  233  PRO n 
2  234  ILE n 
2  235  SER n 
2  236  HIS n 
2  237  VAL n 
2  238  ALA n 
2  239  GLU n 
2  240  ILE n 
2  241  ARG n 
2  242  SER n 
2  243  ALA n 
2  244  LEU n 
2  245  GLU n 
2  246  LYS n 
2  247  GLY n 
2  248  SER n 
2  249  ARG n 
2  250  PHE n 
2  251  ILE n 
2  252  SER n 
2  253  THR n 
2  254  LEU n 
2  255  GLN n 
2  256  VAL n 
2  257  LYS n 
2  258  LEU n 
2  259  TYR n 
2  260  GLY n 
2  261  ARG n 
2  262  GLU n 
2  263  GLY n 
2  264  SER n 
2  265  SER n 
2  266  ALA n 
2  267  ARG n 
2  268  THR n 
2  269  ILE n 
2  270  LYS n 
2  271  ALA n 
2  272  THR n 
2  273  LEU n 
2  274  PRO n 
2  275  TYR n 
2  276  ILE n 
2  277  LYS n 
2  278  GLN n 
2  279  ASP n 
2  280  ILE n 
2  281  PRO n 
2  282  ILE n 
2  283  VAL n 
2  284  ILE n 
2  285  ILE n 
2  286  PHE n 
2  287  ARG n 
2  288  ALA n 
2  289  LEU n 
2  290  GLY n 
2  291  ILE n 
2  292  ILE n 
2  293  PRO n 
2  294  ASP n 
2  295  GLY n 
2  296  GLU n 
2  297  ILE n 
2  298  LEU n 
2  299  GLU n 
2  300  HIS n 
2  301  ILE n 
2  302  CYS n 
2  303  TYR n 
2  304  ASP n 
2  305  VAL n 
2  306  ASN n 
2  307  ASP n 
2  308  TRP n 
2  309  GLN n 
2  310  MET n 
2  311  LEU n 
2  312  GLU n 
2  313  MET n 
2  314  LEU n 
2  315  LYS n 
2  316  PRO n 
2  317  CYS n 
2  318  VAL n 
2  319  GLU n 
2  320  ASP n 
2  321  GLY n 
2  322  PHE n 
2  323  VAL n 
2  324  ILE n 
2  325  GLN n 
2  326  ASP n 
2  327  ARG n 
2  328  GLU n 
2  329  THR n 
2  330  ALA n 
2  331  LEU n 
2  332  ASP n 
2  333  PHE n 
2  334  ILE n 
2  335  GLY n 
2  336  ARG n 
2  337  ARG n 
2  338  GLY n 
2  339  THR n 
2  340  ALA n 
2  341  LEU n 
2  342  GLY n 
2  343  ILE n 
2  344  LYS n 
2  345  LYS n 
2  346  GLU n 
2  347  LYS n 
2  348  ARG n 
2  349  ILE n 
2  350  GLN n 
2  351  TYR n 
2  352  ALA n 
2  353  LYS n 
2  354  ASP n 
2  355  ILE n 
2  356  LEU n 
2  357  GLN n 
2  358  LYS n 
2  359  GLU n 
2  360  PHE n 
2  361  LEU n 
2  362  PRO n 
2  363  HIS n 
2  364  ILE n 
2  365  THR n 
2  366  GLN n 
2  367  LEU n 
2  368  GLU n 
2  369  GLY n 
2  370  PHE n 
2  371  GLU n 
2  372  SER n 
2  373  ARG n 
2  374  LYS n 
2  375  ALA n 
2  376  PHE n 
2  377  PHE n 
2  378  LEU n 
2  379  GLY n 
2  380  TYR n 
2  381  MET n 
2  382  ILE n 
2  383  ASN n 
2  384  ARG n 
2  385  LEU n 
2  386  LEU n 
2  387  LEU n 
2  388  CYS n 
2  389  ALA n 
2  390  LEU n 
2  391  ASP n 
2  392  ARG n 
2  393  LYS n 
2  394  ASP n 
2  395  GLN n 
2  396  ASP n 
2  397  ASP n 
2  398  ARG n 
2  399  ASP n 
2  400  HIS n 
2  401  PHE n 
2  402  GLY n 
2  403  LYS n 
2  404  LYS n 
2  405  ARG n 
2  406  LEU n 
2  407  ASP n 
2  408  LEU n 
2  409  ALA n 
2  410  GLY n 
2  411  PRO n 
2  412  LEU n 
2  413  LEU n 
2  414  ALA n 
2  415  GLN n 
2  416  LEU n 
2  417  PHE n 
2  418  LYS n 
2  419  THR n 
2  420  LEU n 
2  421  PHE n 
2  422  LYS n 
2  423  LYS n 
2  424  LEU n 
2  425  THR n 
2  426  LYS n 
2  427  ASP n 
2  428  ILE n 
2  429  PHE n 
2  430  ARG n 
2  431  TYR n 
2  432  MET n 
2  433  GLN n 
2  434  ARG n 
2  435  THR n 
2  436  VAL n 
2  437  GLU n 
2  438  GLU n 
2  439  ALA n 
2  440  HIS n 
2  441  ASP n 
2  442  PHE n 
2  443  ASN n 
2  444  MET n 
2  445  LYS n 
2  446  LEU n 
2  447  ALA n 
2  448  ILE n 
2  449  ASN n 
2  450  ALA n 
2  451  LYS n 
2  452  THR n 
2  453  ILE n 
2  454  THR n 
2  455  SER n 
2  456  GLY n 
2  457  LEU n 
2  458  LYS n 
2  459  TYR n 
2  460  ALA n 
2  461  LEU n 
2  462  ALA n 
2  463  THR n 
2  464  GLY n 
2  465  ASN n 
2  466  TRP n 
2  467  GLY n 
2  468  GLU n 
2  469  GLN n 
2  470  LYS n 
2  471  LYS n 
2  472  ALA n 
2  473  MET n 
2  474  SER n 
2  475  SER n 
2  476  ARG n 
2  477  ALA n 
2  478  GLY n 
2  479  VAL n 
2  480  SER n 
2  481  GLN n 
2  482  VAL n 
2  483  LEU n 
2  484  ASN n 
2  485  ARG n 
2  486  TYR n 
2  487  THR n 
2  488  TYR n 
2  489  SER n 
2  490  SER n 
2  491  THR n 
2  492  LEU n 
2  493  SER n 
2  494  HIS n 
2  495  LEU n 
2  496  ARG n 
2  497  ARG n 
2  498  THR n 
2  499  ASN n 
2  500  THR n 
2  501  PRO n 
2  502  ILE n 
2  503  GLY n 
2  504  ARG n 
2  505  ASP n 
2  506  GLY n 
2  507  LYS n 
2  508  LEU n 
2  509  ALA n 
2  510  LYS n 
2  511  PRO n 
2  512  ARG n 
2  513  GLN n 
2  514  LEU n 
2  515  HIS n 
2  516  ASN n 
2  517  THR n 
2  518  HIS n 
2  519  TRP n 
2  520  GLY n 
2  521  LEU n 
2  522  VAL n 
2  523  CYS n 
2  524  PRO n 
2  525  ALA n 
2  526  GLU n 
2  527  THR n 
2  528  PRO n 
2  529  GLU n 
2  530  GLY n 
2  531  GLN n 
2  532  ALA n 
2  533  CYS n 
2  534  GLY n 
2  535  LEU n 
2  536  VAL n 
2  537  LYS n 
2  538  ASN n 
2  539  LEU n 
2  540  SER n 
2  541  LEU n 
2  542  MET n 
2  543  SER n 
2  544  CYS n 
2  545  ILE n 
2  546  SER n 
2  547  VAL n 
2  548  GLY n 
2  549  THR n 
2  550  ASP n 
2  551  PRO n 
2  552  MET n 
2  553  PRO n 
2  554  ILE n 
2  555  ILE n 
2  556  THR n 
2  557  PHE n 
2  558  LEU n 
2  559  SER n 
2  560  GLU n 
2  561  TRP n 
2  562  GLY n 
2  563  MET n 
2  564  GLU n 
2  565  PRO n 
2  566  LEU n 
2  567  GLU n 
2  568  ASP n 
2  569  TYR n 
2  570  VAL n 
2  571  PRO n 
2  572  HIS n 
2  573  GLN n 
2  574  SER n 
2  575  PRO n 
2  576  ASP n 
2  577  ALA n 
2  578  THR n 
2  579  ARG n 
2  580  VAL n 
2  581  PHE n 
2  582  VAL n 
2  583  ASN n 
2  584  GLY n 
2  585  VAL n 
2  586  TRP n 
2  587  HIS n 
2  588  GLY n 
2  589  VAL n 
2  590  HIS n 
2  591  ARG n 
2  592  ASN n 
2  593  PRO n 
2  594  ALA n 
2  595  ARG n 
2  596  LEU n 
2  597  MET n 
2  598  GLU n 
2  599  THR n 
2  600  LEU n 
2  601  ARG n 
2  602  THR n 
2  603  LEU n 
2  604  ARG n 
2  605  ARG n 
2  606  LYS n 
2  607  GLY n 
2  608  ASP n 
2  609  ILE n 
2  610  ASN n 
2  611  PRO n 
2  612  GLU n 
2  613  VAL n 
2  614  SER n 
2  615  MET n 
2  616  ILE n 
2  617  ARG n 
2  618  ASP n 
2  619  ILE n 
2  620  ARG n 
2  621  GLU n 
2  622  LYS n 
2  623  GLU n 
2  624  LEU n 
2  625  LYS n 
2  626  ILE n 
2  627  PHE n 
2  628  THR n 
2  629  ASP n 
2  630  ALA n 
2  631  GLY n 
2  632  ARG n 
2  633  VAL n 
2  634  TYR n 
2  635  ARG n 
2  636  PRO n 
2  637  LEU n 
2  638  PHE n 
2  639  ILE n 
2  640  VAL n 
2  641  GLU n 
2  642  ASP n 
2  643  ASP n 
2  644  GLU n 
2  645  SER n 
2  646  LEU n 
2  647  GLY n 
2  648  HIS n 
2  649  LYS n 
2  650  GLU n 
2  651  LEU n 
2  652  LYS n 
2  653  VAL n 
2  654  ARG n 
2  655  LYS n 
2  656  GLY n 
2  657  HIS n 
2  658  ILE n 
2  659  ALA n 
2  660  LYS n 
2  661  LEU n 
2  662  MET n 
2  663  ALA n 
2  664  THR n 
2  665  GLU n 
2  666  TYR n 
2  667  GLN n 
2  668  ASP n 
2  669  ILE n 
2  670  GLU n 
2  671  GLY n 
2  672  GLY n 
2  673  PHE n 
2  674  GLU n 
2  675  ASP n 
2  676  VAL n 
2  677  GLU n 
2  678  GLU n 
2  679  TYR n 
2  680  THR n 
2  681  TRP n 
2  682  SER n 
2  683  SER n 
2  684  LEU n 
2  685  LEU n 
2  686  ASN n 
2  687  GLU n 
2  688  GLY n 
2  689  LEU n 
2  690  VAL n 
2  691  GLU n 
2  692  TYR n 
2  693  ILE n 
2  694  ASP n 
2  695  ALA n 
2  696  GLU n 
2  697  GLU n 
2  698  GLU n 
2  699  GLU n 
2  700  SER n 
2  701  ILE n 
2  702  LEU n 
2  703  ILE n 
2  704  ALA n 
2  705  MET n 
2  706  GLN n 
2  707  PRO n 
2  708  GLU n 
2  709  ASP n 
2  710  LEU n 
2  711  GLU n 
2  712  PRO n 
2  713  ALA n 
2  714  GLU n 
2  715  ALA n 
2  716  ASN n 
2  717  GLU n 
2  718  GLU n 
2  719  ASN n 
2  720  ASP n 
2  721  LEU n 
2  722  ASP n 
2  723  VAL n 
2  724  ASP n 
2  725  PRO n 
2  726  ALA n 
2  727  LYS n 
2  728  ARG n 
2  729  ILE n 
2  730  ARG n 
2  731  VAL n 
2  732  SER n 
2  733  HIS n 
2  734  HIS n 
2  735  ALA n 
2  736  THR n 
2  737  THR n 
2  738  PHE n 
2  739  THR n 
2  740  HIS n 
2  741  CYS n 
2  742  GLU n 
2  743  ILE n 
2  744  HIS n 
2  745  PRO n 
2  746  SER n 
2  747  MET n 
2  748  ILE n 
2  749  LEU n 
2  750  GLY n 
2  751  VAL n 
2  752  ALA n 
2  753  ALA n 
2  754  SER n 
2  755  ILE n 
2  756  ILE n 
2  757  PRO n 
2  758  PHE n 
2  759  PRO n 
2  760  ASP n 
2  761  HIS n 
2  762  ASN n 
2  763  GLN n 
2  764  SER n 
2  765  PRO n 
2  766  ARG n 
2  767  ASN n 
2  768  THR n 
2  769  TYR n 
2  770  GLN n 
2  771  SER n 
2  772  ALA n 
2  773  MET n 
2  774  GLY n 
2  775  LYS n 
2  776  GLN n 
2  777  ALA n 
2  778  MET n 
2  779  GLY n 
2  780  VAL n 
2  781  PHE n 
2  782  LEU n 
2  783  THR n 
2  784  ASN n 
2  785  TYR n 
2  786  ASN n 
2  787  VAL n 
2  788  ARG n 
2  789  MET n 
2  790  ASP n 
2  791  THR n 
2  792  MET n 
2  793  ALA n 
2  794  ASN n 
2  795  ILE n 
2  796  LEU n 
2  797  TYR n 
2  798  TYR n 
2  799  PRO n 
2  800  GLN n 
2  801  LYS n 
2  802  PRO n 
2  803  LEU n 
2  804  GLY n 
2  805  THR n 
2  806  THR n 
2  807  ARG n 
2  808  ALA n 
2  809  MET n 
2  810  GLU n 
2  811  TYR n 
2  812  LEU n 
2  813  LYS n 
2  814  PHE n 
2  815  ARG n 
2  816  GLU n 
2  817  LEU n 
2  818  PRO n 
2  819  ALA n 
2  820  GLY n 
2  821  GLN n 
2  822  ASN n 
2  823  ALA n 
2  824  ILE n 
2  825  VAL n 
2  826  ALA n 
2  827  ILE n 
2  828  ALA n 
2  829  CYS n 
2  830  TYR n 
2  831  SER n 
2  832  GLY n 
2  833  TYR n 
2  834  ASN n 
2  835  GLN n 
2  836  GLU n 
2  837  ASP n 
2  838  SER n 
2  839  MET n 
2  840  ILE n 
2  841  MET n 
2  842  ASN n 
2  843  GLN n 
2  844  SER n 
2  845  SER n 
2  846  ILE n 
2  847  ASP n 
2  848  ARG n 
2  849  GLY n 
2  850  LEU n 
2  851  PHE n 
2  852  ARG n 
2  853  SER n 
2  854  LEU n 
2  855  PHE n 
2  856  PHE n 
2  857  ARG n 
2  858  SER n 
2  859  TYR n 
2  860  MET n 
2  861  ASP n 
2  862  GLN n 
2  863  GLU n 
2  864  LYS n 
2  865  LYS n 
2  866  TYR n 
2  867  GLY n 
2  868  MET n 
2  869  SER n 
2  870  ILE n 
2  871  THR n 
2  872  GLU n 
2  873  THR n 
2  874  PHE n 
2  875  GLU n 
2  876  LYS n 
2  877  PRO n 
2  878  GLN n 
2  879  ARG n 
2  880  THR n 
2  881  ASN n 
2  882  THR n 
2  883  LEU n 
2  884  ARG n 
2  885  MET n 
2  886  LYS n 
2  887  HIS n 
2  888  GLY n 
2  889  THR n 
2  890  TYR n 
2  891  ASP n 
2  892  LYS n 
2  893  LEU n 
2  894  ASP n 
2  895  ASP n 
2  896  ASP n 
2  897  GLY n 
2  898  LEU n 
2  899  ILE n 
2  900  ALA n 
2  901  PRO n 
2  902  GLY n 
2  903  VAL n 
2  904  ARG n 
2  905  VAL n 
2  906  SER n 
2  907  GLY n 
2  908  GLU n 
2  909  ASP n 
2  910  VAL n 
2  911  ILE n 
2  912  ILE n 
2  913  GLY n 
2  914  LYS n 
2  915  THR n 
2  916  THR n 
2  917  PRO n 
2  918  ILE n 
2  919  SER n 
2  920  PRO n 
2  921  ASP n 
2  922  GLU n 
2  923  GLU n 
2  924  GLU n 
2  925  LEU n 
2  926  GLY n 
2  927  GLN n 
2  928  ARG n 
2  929  THR n 
2  930  ALA n 
2  931  TYR n 
2  932  HIS n 
2  933  SER n 
2  934  LYS n 
2  935  ARG n 
2  936  ASP n 
2  937  ALA n 
2  938  SER n 
2  939  THR n 
2  940  PRO n 
2  941  LEU n 
2  942  ARG n 
2  943  SER n 
2  944  THR n 
2  945  GLU n 
2  946  ASN n 
2  947  GLY n 
2  948  ILE n 
2  949  VAL n 
2  950  ASP n 
2  951  GLN n 
2  952  VAL n 
2  953  LEU n 
2  954  VAL n 
2  955  THR n 
2  956  THR n 
2  957  ASN n 
2  958  GLN n 
2  959  ASP n 
2  960  GLY n 
2  961  LEU n 
2  962  LYS n 
2  963  PHE n 
2  964  VAL n 
2  965  LYS n 
2  966  VAL n 
2  967  ARG n 
2  968  VAL n 
2  969  ARG n 
2  970  THR n 
2  971  THR n 
2  972  LYS n 
2  973  ILE n 
2  974  PRO n 
2  975  GLN n 
2  976  ILE n 
2  977  GLY n 
2  978  ASP n 
2  979  LYS n 
2  980  PHE n 
2  981  ALA n 
2  982  SER n 
2  983  ARG n 
2  984  HIS n 
2  985  GLY n 
2  986  GLN n 
2  987  LYS n 
2  988  GLY n 
2  989  THR n 
2  990  ILE n 
2  991  GLY n 
2  992  ILE n 
2  993  THR n 
2  994  TYR n 
2  995  ARG n 
2  996  ARG n 
2  997  GLU n 
2  998  ASP n 
2  999  MET n 
2  1000 PRO n 
2  1001 PHE n 
2  1002 THR n 
2  1003 ALA n 
2  1004 GLU n 
2  1005 GLY n 
2  1006 ILE n 
2  1007 VAL n 
2  1008 PRO n 
2  1009 ASP n 
2  1010 LEU n 
2  1011 ILE n 
2  1012 ILE n 
2  1013 ASN n 
2  1014 PRO n 
2  1015 HIS n 
2  1016 ALA n 
2  1017 ILE n 
2  1018 PRO n 
2  1019 SER n 
2  1020 ARG n 
2  1021 MET n 
2  1022 THR n 
2  1023 VAL n 
2  1024 ALA n 
2  1025 HIS n 
2  1026 LEU n 
2  1027 ILE n 
2  1028 GLU n 
2  1029 CYS n 
2  1030 LEU n 
2  1031 LEU n 
2  1032 SER n 
2  1033 LYS n 
2  1034 VAL n 
2  1035 ALA n 
2  1036 ALA n 
2  1037 LEU n 
2  1038 SER n 
2  1039 GLY n 
2  1040 ASN n 
2  1041 GLU n 
2  1042 GLY n 
2  1043 ASP n 
2  1044 ALA n 
2  1045 SER n 
2  1046 PRO n 
2  1047 PHE n 
2  1048 THR n 
2  1049 ASP n 
2  1050 ILE n 
2  1051 THR n 
2  1052 VAL n 
2  1053 GLU n 
2  1054 GLY n 
2  1055 ILE n 
2  1056 SER n 
2  1057 LYS n 
2  1058 LEU n 
2  1059 LEU n 
2  1060 ARG n 
2  1061 GLU n 
2  1062 HIS n 
2  1063 GLY n 
2  1064 TYR n 
2  1065 GLN n 
2  1066 SER n 
2  1067 ARG n 
2  1068 GLY n 
2  1069 PHE n 
2  1070 GLU n 
2  1071 VAL n 
2  1072 MET n 
2  1073 TYR n 
2  1074 ASN n 
2  1075 GLY n 
2  1076 HIS n 
2  1077 THR n 
2  1078 GLY n 
2  1079 LYS n 
2  1080 LYS n 
2  1081 LEU n 
2  1082 MET n 
2  1083 ALA n 
2  1084 GLN n 
2  1085 ILE n 
2  1086 PHE n 
2  1087 PHE n 
2  1088 GLY n 
2  1089 PRO n 
2  1090 THR n 
2  1091 TYR n 
2  1092 TYR n 
2  1093 GLN n 
2  1094 ARG n 
2  1095 LEU n 
2  1096 ARG n 
2  1097 HIS n 
2  1098 MET n 
2  1099 VAL n 
2  1100 ASP n 
2  1101 ASP n 
2  1102 LYS n 
2  1103 ILE n 
2  1104 HIS n 
2  1105 ALA n 
2  1106 ARG n 
2  1107 ALA n 
2  1108 ARG n 
2  1109 GLY n 
2  1110 PRO n 
2  1111 MET n 
2  1112 GLN n 
2  1113 VAL n 
2  1114 LEU n 
2  1115 THR n 
2  1116 ARG n 
2  1117 GLN n 
2  1118 PRO n 
2  1119 VAL n 
2  1120 GLU n 
2  1121 GLY n 
2  1122 ARG n 
2  1123 SER n 
2  1124 ARG n 
2  1125 ASP n 
2  1126 GLY n 
2  1127 GLY n 
2  1128 LEU n 
2  1129 ARG n 
2  1130 PHE n 
2  1131 GLY n 
2  1132 GLU n 
2  1133 MET n 
2  1134 GLU n 
2  1135 ARG n 
2  1136 ASP n 
2  1137 CYS n 
2  1138 MET n 
2  1139 ILE n 
2  1140 ALA n 
2  1141 HIS n 
2  1142 GLY n 
2  1143 ALA n 
2  1144 ALA n 
2  1145 SER n 
2  1146 PHE n 
2  1147 LEU n 
2  1148 LYS n 
2  1149 GLU n 
2  1150 ARG n 
2  1151 LEU n 
2  1152 MET n 
2  1153 GLU n 
2  1154 ALA n 
2  1155 SER n 
2  1156 ASP n 
2  1157 ALA n 
2  1158 PHE n 
2  1159 ARG n 
2  1160 VAL n 
2  1161 HIS n 
2  1162 ILE n 
2  1163 CYS n 
2  1164 GLY n 
2  1165 ILE n 
2  1166 CYS n 
2  1167 GLY n 
2  1168 LEU n 
2  1169 MET n 
2  1170 THR n 
2  1171 VAL n 
2  1172 ILE n 
2  1173 ALA n 
2  1174 LYS n 
2  1175 LEU n 
2  1176 ASN n 
2  1177 HIS n 
2  1178 ASN n 
2  1179 GLN n 
2  1180 PHE n 
2  1181 GLU n 
2  1182 CYS n 
2  1183 LYS n 
2  1184 GLY n 
2  1185 CYS n 
2  1186 ASP n 
2  1187 ASN n 
2  1188 LYS n 
2  1189 ILE n 
2  1190 ASP n 
2  1191 ILE n 
2  1192 TYR n 
2  1193 GLN n 
2  1194 ILE n 
2  1195 HIS n 
2  1196 ILE n 
2  1197 PRO n 
2  1198 TYR n 
2  1199 ALA n 
2  1200 ALA n 
2  1201 LYS n 
2  1202 LEU n 
2  1203 LEU n 
2  1204 PHE n 
2  1205 GLN n 
2  1206 GLU n 
2  1207 LEU n 
2  1208 MET n 
2  1209 ALA n 
2  1210 MET n 
2  1211 ASN n 
2  1212 ILE n 
2  1213 THR n 
2  1214 PRO n 
2  1215 ARG n 
2  1216 LEU n 
2  1217 TYR n 
2  1218 THR n 
2  1219 ASP n 
2  1220 ARG n 
2  1221 SER n 
2  1222 ARG n 
2  1223 ASP n 
2  1224 PHE n 
3  1    MET n 
3  2    SER n 
3  3    GLU n 
3  4    GLU n 
3  5    GLY n 
3  6    PRO n 
3  7    GLN n 
3  8    VAL n 
3  9    LYS n 
3  10   ILE n 
3  11   ARG n 
3  12   GLU n 
3  13   ALA n 
3  14   SER n 
3  15   LYS n 
3  16   ASP n 
3  17   ASN n 
3  18   VAL n 
3  19   ASP n 
3  20   PHE n 
3  21   ILE n 
3  22   LEU n 
3  23   SER n 
3  24   ASN n 
3  25   VAL n 
3  26   ASP n 
3  27   LEU n 
3  28   ALA n 
3  29   MET n 
3  30   ALA n 
3  31   ASN n 
3  32   SER n 
3  33   LEU n 
3  34   ARG n 
3  35   ARG n 
3  36   VAL n 
3  37   MET n 
3  38   ILE n 
3  39   ALA n 
3  40   GLU n 
3  41   ILE n 
3  42   PRO n 
3  43   THR n 
3  44   LEU n 
3  45   ALA n 
3  46   ILE n 
3  47   ASP n 
3  48   SER n 
3  49   VAL n 
3  50   GLU n 
3  51   VAL n 
3  52   GLU n 
3  53   THR n 
3  54   ASN n 
3  55   THR n 
3  56   THR n 
3  57   VAL n 
3  58   LEU n 
3  59   ALA n 
3  60   ASP n 
3  61   GLU n 
3  62   PHE n 
3  63   ILE n 
3  64   ALA n 
3  65   HIS n 
3  66   ARG n 
3  67   LEU n 
3  68   GLY n 
3  69   LEU n 
3  70   ILE n 
3  71   PRO n 
3  72   LEU n 
3  73   GLN n 
3  74   SER n 
3  75   MET n 
3  76   ASP n 
3  77   ILE n 
3  78   GLU n 
3  79   GLN n 
3  80   LEU n 
3  81   GLU n 
3  82   TYR n 
3  83   SER n 
3  84   ARG n 
3  85   ASP n 
3  86   CYS n 
3  87   PHE n 
3  88   CYS n 
3  89   GLU n 
3  90   ASP n 
3  91   HIS n 
3  92   CYS n 
3  93   ASP n 
3  94   LYS n 
3  95   CYS n 
3  96   SER n 
3  97   VAL n 
3  98   VAL n 
3  99   LEU n 
3  100  THR n 
3  101  LEU n 
3  102  GLN n 
3  103  ALA n 
3  104  PHE n 
3  105  GLY n 
3  106  GLU n 
3  107  SER n 
3  108  GLU n 
3  109  SER n 
3  110  THR n 
3  111  THR n 
3  112  ASN n 
3  113  VAL n 
3  114  TYR n 
3  115  SER n 
3  116  LYS n 
3  117  ASP n 
3  118  LEU n 
3  119  VAL n 
3  120  ILE n 
3  121  VAL n 
3  122  SER n 
3  123  ASN n 
3  124  LEU n 
3  125  MET n 
3  126  GLY n 
3  127  ARG n 
3  128  ASN n 
3  129  ILE n 
3  130  GLY n 
3  131  HIS n 
3  132  PRO n 
3  133  ILE n 
3  134  ILE n 
3  135  GLN n 
3  136  ASP n 
3  137  LYS n 
3  138  GLU n 
3  139  GLY n 
3  140  ASN n 
3  141  GLY n 
3  142  VAL n 
3  143  LEU n 
3  144  ILE n 
3  145  CYS n 
3  146  LYS n 
3  147  LEU n 
3  148  ARG n 
3  149  LYS n 
3  150  GLY n 
3  151  GLN n 
3  152  GLU n 
3  153  LEU n 
3  154  LYS n 
3  155  LEU n 
3  156  THR n 
3  157  CYS n 
3  158  VAL n 
3  159  ALA n 
3  160  LYS n 
3  161  LYS n 
3  162  GLY n 
3  163  ILE n 
3  164  ALA n 
3  165  LYS n 
3  166  GLU n 
3  167  HIS n 
3  168  ALA n 
3  169  LYS n 
3  170  TRP n 
3  171  GLY n 
3  172  PRO n 
3  173  ALA n 
3  174  ALA n 
3  175  ALA n 
3  176  ILE n 
3  177  GLU n 
3  178  PHE n 
3  179  GLU n 
3  180  TYR n 
3  181  ASP n 
3  182  PRO n 
3  183  TRP n 
3  184  ASN n 
3  185  LYS n 
3  186  LEU n 
3  187  LYS n 
3  188  HIS n 
3  189  THR n 
3  190  ASP n 
3  191  TYR n 
3  192  TRP n 
3  193  TYR n 
3  194  GLU n 
3  195  GLN n 
3  196  ASP n 
3  197  SER n 
3  198  ALA n 
3  199  LYS n 
3  200  GLU n 
3  201  TRP n 
3  202  PRO n 
3  203  GLN n 
3  204  SER n 
3  205  LYS n 
3  206  ASN n 
3  207  CYS n 
3  208  GLU n 
3  209  TYR n 
3  210  GLU n 
3  211  ASP n 
3  212  PRO n 
3  213  PRO n 
3  214  ASN n 
3  215  GLU n 
3  216  GLY n 
3  217  ASP n 
3  218  PRO n 
3  219  PHE n 
3  220  ASP n 
3  221  TYR n 
3  222  LYS n 
3  223  ALA n 
3  224  GLN n 
3  225  ALA n 
3  226  ASP n 
3  227  THR n 
3  228  PHE n 
3  229  TYR n 
3  230  MET n 
3  231  ASN n 
3  232  VAL n 
3  233  GLU n 
3  234  SER n 
3  235  VAL n 
3  236  GLY n 
3  237  SER n 
3  238  ILE n 
3  239  PRO n 
3  240  VAL n 
3  241  ASP n 
3  242  GLN n 
3  243  VAL n 
3  244  VAL n 
3  245  VAL n 
3  246  ARG n 
3  247  GLY n 
3  248  ILE n 
3  249  ASP n 
3  250  THR n 
3  251  LEU n 
3  252  GLN n 
3  253  LYS n 
3  254  LYS n 
3  255  VAL n 
3  256  ALA n 
3  257  SER n 
3  258  ILE n 
3  259  LEU n 
3  260  LEU n 
3  261  ALA n 
3  262  LEU n 
3  263  THR n 
3  264  GLN n 
3  265  MET n 
3  266  ASP n 
3  267  GLN n 
3  268  ASP n 
3  269  LYS n 
3  270  VAL n 
3  271  ASN n 
3  272  PHE n 
3  273  ALA n 
3  274  SER n 
3  275  GLY n 
3  276  ASP n 
3  277  ASN n 
3  278  ASN n 
3  279  THR n 
3  280  ALA n 
3  281  SER n 
3  282  ASN n 
3  283  MET n 
3  284  LEU n 
3  285  GLY n 
3  286  SER n 
3  287  ASN n 
3  288  GLU n 
3  289  ASP n 
3  290  VAL n 
3  291  MET n 
3  292  MET n 
3  293  THR n 
3  294  GLY n 
3  295  ALA n 
3  296  GLU n 
3  297  GLN n 
3  298  ASP n 
3  299  PRO n 
3  300  TYR n 
3  301  SER n 
3  302  ASN n 
3  303  ALA n 
3  304  SER n 
3  305  GLN n 
3  306  MET n 
3  307  GLY n 
3  308  ASN n 
3  309  THR n 
3  310  GLY n 
3  311  SER n 
3  312  GLY n 
3  313  GLY n 
3  314  TYR n 
3  315  ASP n 
3  316  ASN n 
3  317  ALA n 
3  318  TRP n 
4  1    MET n 
4  2    ASP n 
4  3    GLN n 
4  4    GLU n 
4  5    ASN n 
4  6    GLU n 
4  7    ARG n 
4  8    ASN n 
4  9    ILE n 
4  10   SER n 
4  11   ARG n 
4  12   LEU n 
4  13   TRP n 
4  14   ARG n 
4  15   ALA n 
4  16   PHE n 
4  17   ARG n 
4  18   THR n 
4  19   VAL n 
4  20   LYS n 
4  21   GLU n 
4  22   MET n 
4  23   VAL n 
4  24   LYS n 
4  25   ASP n 
4  26   ARG n 
4  27   GLY n 
4  28   TYR n 
4  29   PHE n 
4  30   ILE n 
4  31   THR n 
4  32   GLN n 
4  33   GLU n 
4  34   GLU n 
4  35   VAL n 
4  36   GLU n 
4  37   LEU n 
4  38   PRO n 
4  39   LEU n 
4  40   GLU n 
4  41   ASP n 
4  42   PHE n 
4  43   LYS n 
4  44   ALA n 
4  45   LYS n 
4  46   TYR n 
4  47   CYS n 
4  48   ASP n 
4  49   SER n 
4  50   MET n 
4  51   GLY n 
4  52   ARG n 
4  53   PRO n 
4  54   GLN n 
4  55   ARG n 
4  56   LYS n 
4  57   MET n 
4  58   MET n 
4  59   SER n 
4  60   PHE n 
4  61   GLN n 
4  62   ALA n 
4  63   ASN n 
4  64   PRO n 
4  65   THR n 
4  66   GLU n 
4  67   GLU n 
4  68   SER n 
4  69   ILE n 
4  70   SER n 
4  71   LYS n 
4  72   PHE n 
4  73   PRO n 
4  74   ASP n 
4  75   MET n 
4  76   GLY n 
4  77   SER n 
4  78   LEU n 
4  79   TRP n 
4  80   VAL n 
4  81   GLU n 
4  82   PHE n 
4  83   CYS n 
4  84   ASP n 
4  85   GLU n 
4  86   PRO n 
4  87   SER n 
4  88   VAL n 
4  89   GLY n 
4  90   VAL n 
4  91   LYS n 
4  92   THR n 
4  93   MET n 
4  94   LYS n 
4  95   THR n 
4  96   PHE n 
4  97   VAL n 
4  98   ILE n 
4  99   HIS n 
4  100  ILE n 
4  101  GLN n 
4  102  GLU n 
4  103  LYS n 
4  104  ASN n 
4  105  PHE n 
4  106  GLN n 
4  107  THR n 
4  108  GLY n 
4  109  ILE n 
4  110  PHE n 
4  111  VAL n 
4  112  TYR n 
4  113  GLN n 
4  114  ASN n 
4  115  ASN n 
4  116  ILE n 
4  117  THR n 
4  118  PRO n 
4  119  SER n 
4  120  ALA n 
4  121  MET n 
4  122  LYS n 
4  123  LEU n 
4  124  VAL n 
4  125  PRO n 
4  126  SER n 
4  127  ILE n 
4  128  PRO n 
4  129  PRO n 
4  130  ALA n 
4  131  THR n 
4  132  ILE n 
4  133  GLU n 
4  134  THR n 
4  135  PHE n 
4  136  ASN n 
4  137  GLU n 
4  138  ALA n 
4  139  ALA n 
4  140  LEU n 
4  141  VAL n 
4  142  VAL n 
4  143  ASN n 
4  144  ILE n 
4  145  THR n 
4  146  HIS n 
4  147  HIS n 
4  148  GLU n 
4  149  LEU n 
4  150  VAL n 
4  151  PRO n 
4  152  LYS n 
4  153  HIS n 
4  154  ILE n 
4  155  ARG n 
4  156  LEU n 
4  157  SER n 
4  158  SER n 
4  159  ASP n 
4  160  GLU n 
4  161  LYS n 
4  162  ARG n 
4  163  GLU n 
4  164  LEU n 
4  165  LEU n 
4  166  LYS n 
4  167  ARG n 
4  168  TYR n 
4  169  ARG n 
4  170  LEU n 
4  171  LYS n 
4  172  GLU n 
4  173  SER n 
4  174  GLN n 
4  175  LEU n 
4  176  PRO n 
4  177  ARG n 
4  178  ILE n 
4  179  GLN n 
4  180  ARG n 
4  181  ALA n 
4  182  ASP n 
4  183  PRO n 
4  184  VAL n 
4  185  ALA n 
4  186  LEU n 
4  187  TYR n 
4  188  LEU n 
4  189  GLY n 
4  190  LEU n 
4  191  LYS n 
4  192  ARG n 
4  193  GLY n 
4  194  GLU n 
4  195  VAL n 
4  196  VAL n 
4  197  LYS n 
4  198  ILE n 
4  199  ILE n 
4  200  ARG n 
4  201  LYS n 
4  202  SER n 
4  203  GLU n 
4  204  THR n 
4  205  SER n 
4  206  GLY n 
4  207  ARG n 
4  208  TYR n 
4  209  ALA n 
4  210  SER n 
4  211  TYR n 
4  212  ARG n 
4  213  ILE n 
4  214  CYS n 
4  215  MET n 
5  1    MET n 
5  2    SER n 
5  3    ASP n 
5  4    TYR n 
5  5    GLU n 
5  6    GLU n 
5  7    ALA n 
5  8    PHE n 
5  9    ASN n 
5  10   ASP n 
5  11   GLY n 
5  12   ASN n 
5  13   GLU n 
5  14   ASN n 
5  15   PHE n 
5  16   GLU n 
5  17   ASP n 
5  18   PHE n 
5  19   ASP n 
5  20   VAL n 
5  21   GLU n 
5  22   HIS n 
5  23   PHE n 
5  24   SER n 
5  25   ASP n 
5  26   GLU n 
5  27   GLU n 
5  28   THR n 
5  29   TYR n 
5  30   GLU n 
5  31   GLU n 
5  32   LYS n 
5  33   PRO n 
5  34   GLN n 
5  35   PHE n 
5  36   LYS n 
5  37   ASP n 
5  38   GLY n 
5  39   GLU n 
5  40   THR n 
5  41   THR n 
5  42   ASP n 
5  43   ALA n 
5  44   ASN n 
5  45   GLY n 
5  46   LYS n 
5  47   THR n 
5  48   ILE n 
5  49   VAL n 
5  50   THR n 
5  51   GLY n 
5  52   GLY n 
5  53   ASN n 
5  54   GLY n 
5  55   PRO n 
5  56   GLU n 
5  57   ASP n 
5  58   PHE n 
5  59   GLN n 
5  60   GLN n 
5  61   HIS n 
5  62   GLU n 
5  63   GLN n 
5  64   ILE n 
5  65   ARG n 
5  66   ARG n 
5  67   LYS n 
5  68   THR n 
5  69   LEU n 
5  70   LYS n 
5  71   GLU n 
5  72   LYS n 
5  73   ALA n 
5  74   ILE n 
5  75   PRO n 
5  76   LYS n 
5  77   ASP n 
5  78   GLN n 
5  79   ARG n 
5  80   ALA n 
5  81   THR n 
5  82   THR n 
5  83   PRO n 
5  84   TYR n 
5  85   MET n 
5  86   THR n 
5  87   LYS n 
5  88   TYR n 
5  89   GLU n 
5  90   ARG n 
5  91   ALA n 
5  92   ARG n 
5  93   ILE n 
5  94   LEU n 
5  95   GLY n 
5  96   THR n 
5  97   ARG n 
5  98   ALA n 
5  99   LEU n 
5  100  GLN n 
5  101  ILE n 
5  102  SER n 
5  103  MET n 
5  104  ASN n 
5  105  ALA n 
5  106  PRO n 
5  107  VAL n 
5  108  PHE n 
5  109  VAL n 
5  110  ASP n 
5  111  LEU n 
5  112  GLU n 
5  113  GLY n 
5  114  GLU n 
5  115  THR n 
5  116  ASP n 
5  117  PRO n 
5  118  LEU n 
5  119  ARG n 
5  120  ILE n 
5  121  ALA n 
5  122  MET n 
5  123  LYS n 
5  124  GLU n 
5  125  LEU n 
5  126  ALA n 
5  127  GLU n 
5  128  LYS n 
5  129  LYS n 
5  130  ILE n 
5  131  PRO n 
5  132  LEU n 
5  133  VAL n 
5  134  ILE n 
5  135  ARG n 
5  136  ARG n 
5  137  TYR n 
5  138  LEU n 
5  139  PRO n 
5  140  ASP n 
5  141  GLY n 
5  142  SER n 
5  143  PHE n 
5  144  GLU n 
5  145  ASP n 
5  146  TRP n 
5  147  SER n 
5  148  VAL n 
5  149  GLU n 
5  150  GLU n 
5  151  LEU n 
5  152  ILE n 
5  153  VAL n 
5  154  ASP n 
5  155  LEU n 
6  1    MET n 
6  2    SER n 
6  3    ASN n 
6  4    THR n 
6  5    LEU n 
6  6    PHE n 
6  7    ASP n 
6  8    ASP n 
6  9    ILE n 
6  10   PHE n 
6  11   GLN n 
6  12   VAL n 
6  13   SER n 
6  14   GLU n 
6  15   VAL n 
6  16   ASP n 
6  17   PRO n 
6  18   GLY n 
6  19   ARG n 
6  20   TYR n 
6  21   ASN n 
6  22   LYS n 
6  23   VAL n 
6  24   CYS n 
6  25   ARG n 
6  26   ILE n 
6  27   GLU n 
6  28   ALA n 
6  29   ALA n 
6  30   SER n 
6  31   THR n 
6  32   THR n 
6  33   GLN n 
6  34   ASP n 
6  35   GLN n 
6  36   CYS n 
6  37   LYS n 
6  38   LEU n 
6  39   THR n 
6  40   LEU n 
6  41   ASP n 
6  42   ILE n 
6  43   ASN n 
6  44   VAL n 
6  45   GLU n 
6  46   LEU n 
6  47   PHE n 
6  48   PRO n 
6  49   VAL n 
6  50   ALA n 
6  51   ALA n 
6  52   GLN n 
6  53   ASP n 
6  54   SER n 
6  55   LEU n 
6  56   THR n 
6  57   VAL n 
6  58   THR n 
6  59   ILE n 
6  60   ALA n 
6  61   SER n 
6  62   SER n 
6  63   LEU n 
6  64   ASN n 
6  65   LEU n 
6  66   GLU n 
6  67   ASP n 
6  68   THR n 
6  69   PRO n 
6  70   ALA n 
6  71   ASN n 
6  72   ASP n 
6  73   SER n 
6  74   SER n 
6  75   ALA n 
6  76   THR n 
6  77   ARG n 
6  78   SER n 
6  79   TRP n 
6  80   ARG n 
6  81   PRO n 
6  82   PRO n 
6  83   GLN n 
6  84   ALA n 
6  85   GLY n 
6  86   ASP n 
6  87   ARG n 
6  88   SER n 
6  89   LEU n 
6  90   ALA n 
6  91   ASP n 
6  92   ASP n 
6  93   TYR n 
6  94   ASP n 
6  95   TYR n 
6  96   VAL n 
6  97   MET n 
6  98   TYR n 
6  99   GLY n 
6  100  THR n 
6  101  ALA n 
6  102  TYR n 
6  103  LYS n 
6  104  PHE n 
6  105  GLU n 
6  106  GLU n 
6  107  VAL n 
6  108  SER n 
6  109  LYS n 
6  110  ASP n 
6  111  LEU n 
6  112  ILE n 
6  113  ALA n 
6  114  VAL n 
6  115  TYR n 
6  116  TYR n 
6  117  SER n 
6  118  PHE n 
6  119  GLY n 
6  120  GLY n 
6  121  LEU n 
6  122  LEU n 
6  123  MET n 
6  124  ARG n 
6  125  LEU n 
6  126  GLU n 
6  127  GLY n 
6  128  ASN n 
6  129  TYR n 
6  130  ARG n 
6  131  ASN n 
6  132  LEU n 
6  133  ASN n 
6  134  ASN n 
6  135  LEU n 
6  136  LYS n 
6  137  GLN n 
6  138  GLU n 
6  139  ASN n 
6  140  ALA n 
6  141  TYR n 
6  142  LEU n 
6  143  LEU n 
6  144  ILE n 
6  145  ARG n 
6  146  ARG n 
7  1    MET n 
7  2    THR n 
7  3    THR n 
7  4    PHE n 
7  5    ARG n 
7  6    PHE n 
7  7    CYS n 
7  8    ARG n 
7  9    ASP n 
7  10   CYS n 
7  11   ASN n 
7  12   ASN n 
7  13   MET n 
7  14   LEU n 
7  15   TYR n 
7  16   PRO n 
7  17   ARG n 
7  18   GLU n 
7  19   ASP n 
7  20   LYS n 
7  21   GLU n 
7  22   ASN n 
7  23   ASN n 
7  24   ARG n 
7  25   LEU n 
7  26   LEU n 
7  27   PHE n 
7  28   GLU n 
7  29   CYS n 
7  30   ARG n 
7  31   THR n 
7  32   CYS n 
7  33   SER n 
7  34   TYR n 
7  35   VAL n 
7  36   GLU n 
7  37   GLU n 
7  38   ALA n 
7  39   GLY n 
7  40   SER n 
7  41   PRO n 
7  42   LEU n 
7  43   VAL n 
7  44   TYR n 
7  45   ARG n 
7  46   HIS n 
7  47   GLU n 
7  48   LEU n 
7  49   ILE n 
7  50   THR n 
7  51   ASN n 
7  52   ILE n 
7  53   GLY n 
7  54   GLU n 
7  55   THR n 
7  56   ALA n 
7  57   GLY n 
7  58   VAL n 
7  59   VAL n 
7  60   GLN n 
7  61   ASP n 
7  62   ILE n 
7  63   GLY n 
7  64   SER n 
7  65   ASP n 
7  66   PRO n 
7  67   THR n 
7  68   LEU n 
7  69   PRO n 
7  70   ARG n 
7  71   SER n 
7  72   ASP n 
7  73   ARG n 
7  74   GLU n 
7  75   CYS n 
7  76   PRO n 
7  77   LYS n 
7  78   CYS n 
7  79   HIS n 
7  80   SER n 
7  81   ARG n 
7  82   GLU n 
7  83   ASN n 
7  84   VAL n 
7  85   PHE n 
7  86   PHE n 
7  87   GLN n 
7  88   SER n 
7  89   GLN n 
7  90   GLN n 
7  91   ARG n 
7  92   ARG n 
7  93   LYS n 
7  94   ASP n 
7  95   THR n 
7  96   SER n 
7  97   MET n 
7  98   VAL n 
7  99   LEU n 
7  100  PHE n 
7  101  PHE n 
7  102  VAL n 
7  103  CYS n 
7  104  LEU n 
7  105  SER n 
7  106  CYS n 
7  107  SER n 
7  108  HIS n 
7  109  ILE n 
7  110  PHE n 
7  111  THR n 
7  112  SER n 
7  113  ASP n 
7  114  GLN n 
7  115  LYS n 
7  116  ASN n 
7  117  LYS n 
7  118  ARG n 
7  119  THR n 
7  120  GLN n 
7  121  PHE n 
7  122  SER n 
8  1    MET n 
8  2    ILE n 
8  3    VAL n 
8  4    PRO n 
8  5    VAL n 
8  6    ARG n 
8  7    CYS n 
8  8    PHE n 
8  9    SER n 
8  10   CYS n 
8  11   GLY n 
8  12   LYS n 
8  13   VAL n 
8  14   VAL n 
8  15   GLY n 
8  16   ASP n 
8  17   LYS n 
8  18   TRP n 
8  19   GLU n 
8  20   SER n 
8  21   TYR n 
8  22   LEU n 
8  23   ASN n 
8  24   LEU n 
8  25   LEU n 
8  26   GLN n 
8  27   GLU n 
8  28   ASP n 
8  29   GLU n 
8  30   LEU n 
8  31   ASP n 
8  32   GLU n 
8  33   GLY n 
8  34   THR n 
8  35   ALA n 
8  36   LEU n 
8  37   SER n 
8  38   ARG n 
8  39   LEU n 
8  40   GLY n 
8  41   LEU n 
8  42   LYS n 
8  43   ARG n 
8  44   TYR n 
8  45   CYS n 
8  46   CYS n 
8  47   ARG n 
8  48   ARG n 
8  49   MET n 
8  50   ILE n 
8  51   LEU n 
8  52   THR n 
8  53   HIS n 
8  54   VAL n 
8  55   ASP n 
8  56   LEU n 
8  57   ILE n 
8  58   GLU n 
8  59   LYS n 
8  60   PHE n 
8  61   LEU n 
8  62   ARG n 
8  63   TYR n 
8  64   ASN n 
8  65   PRO n 
8  66   LEU n 
8  67   GLU n 
8  68   LYS n 
8  69   ARG n 
8  70   ASP n 
9  1    MET n 
9  2    ASN n 
9  3    ALA n 
9  4    PRO n 
9  5    ASP n 
9  6    ARG n 
9  7    PHE n 
9  8    GLU n 
9  9    LEU n 
9  10   PHE n 
9  11   LEU n 
9  12   LEU n 
9  13   GLY n 
9  14   GLU n 
9  15   GLY n 
9  16   GLU n 
9  17   SER n 
9  18   LYS n 
9  19   LEU n 
9  20   LYS n 
9  21   ILE n 
9  22   ASP n 
9  23   PRO n 
9  24   ASP n 
9  25   THR n 
9  26   LYS n 
9  27   ALA n 
9  28   PRO n 
9  29   ASN n 
9  30   ALA n 
9  31   VAL n 
9  32   VAL n 
9  33   ILE n 
9  34   THR n 
9  35   PHE n 
9  36   GLU n 
9  37   LYS n 
9  38   GLU n 
9  39   ASP n 
9  40   HIS n 
9  41   THR n 
9  42   LEU n 
9  43   GLY n 
9  44   ASN n 
9  45   LEU n 
9  46   ILE n 
9  47   ARG n 
9  48   ALA n 
9  49   GLU n 
9  50   LEU n 
9  51   LEU n 
9  52   ASN n 
9  53   ASP n 
9  54   ARG n 
9  55   LYS n 
9  56   VAL n 
9  57   LEU n 
9  58   PHE n 
9  59   ALA n 
9  60   ALA n 
9  61   TYR n 
9  62   LYS n 
9  63   VAL n 
9  64   GLU n 
9  65   HIS n 
9  66   PRO n 
9  67   PHE n 
9  68   PHE n 
9  69   ALA n 
9  70   ARG n 
9  71   PHE n 
9  72   LYS n 
9  73   LEU n 
9  74   ARG n 
9  75   ILE n 
9  76   GLN n 
9  77   THR n 
9  78   THR n 
9  79   GLU n 
9  80   GLY n 
9  81   TYR n 
9  82   ASP n 
9  83   PRO n 
9  84   LYS n 
9  85   ASP n 
9  86   ALA n 
9  87   LEU n 
9  88   LYS n 
9  89   ASN n 
9  90   ALA n 
9  91   CYS n 
9  92   ASN n 
9  93   SER n 
9  94   ILE n 
9  95   ILE n 
9  96   ASN n 
9  97   LYS n 
9  98   LEU n 
9  99   GLY n 
9  100  ALA n 
9  101  LEU n 
9  102  LYS n 
9  103  THR n 
9  104  ASN n 
9  105  PHE n 
9  106  GLU n 
9  107  THR n 
9  108  GLU n 
9  109  TRP n 
9  110  ASN n 
9  111  LEU n 
9  112  GLN n 
9  113  THR n 
9  114  LEU n 
9  115  ALA n 
9  116  ALA n 
9  117  ASP n 
9  118  ASP n 
9  119  ALA n 
9  120  PHE n 
10 1    MET n 
10 2    SER n 
10 3    ARG n 
10 4    GLU n 
10 5    GLY n 
10 6    PHE n 
10 7    GLN n 
10 8    ILE n 
10 9    PRO n 
10 10   THR n 
10 11   ASN n 
10 12   LEU n 
10 13   ASP n 
10 14   ALA n 
10 15   ALA n 
10 16   ALA n 
10 17   ALA n 
10 18   GLY n 
10 19   THR n 
10 20   SER n 
10 21   GLN n 
10 22   ALA n 
10 23   ARG n 
10 24   THR n 
10 25   ALA n 
10 26   THR n 
10 27   LEU n 
10 28   LYS n 
10 29   TYR n 
10 30   ILE n 
10 31   CYS n 
10 32   ALA n 
10 33   GLU n 
10 34   CYS n 
10 35   SER n 
10 36   SER n 
10 37   LYS n 
10 38   LEU n 
10 39   SER n 
10 40   LEU n 
10 41   SER n 
10 42   ARG n 
10 43   THR n 
10 44   ASP n 
10 45   ALA n 
10 46   VAL n 
10 47   ARG n 
10 48   CYS n 
10 49   LYS n 
10 50   ASP n 
10 51   CYS n 
10 52   GLY n 
10 53   HIS n 
10 54   ARG n 
10 55   ILE n 
10 56   LEU n 
10 57   LEU n 
10 58   LYS n 
10 59   ALA n 
10 60   ARG n 
10 61   THR n 
10 62   LYS n 
10 63   ARG n 
10 64   LEU n 
10 65   VAL n 
10 66   GLN n 
10 67   PHE n 
10 68   GLU n 
10 69   ALA n 
10 70   ARG n 
11 1    DA  n 
11 2    DA  n 
11 3    DG  n 
11 4    DT  n 
11 5    DA  n 
11 6    DC  n 
11 7    DT  n 
11 8    DT  n 
11 9    DG  n 
11 10   DA  n 
12 1    C   n 
12 2    C   n 
12 3    A   n 
12 4    G   n 
12 5    G   n 
12 6    A   n 
13 1    DT  n 
13 2    DC  n 
13 3    DA  n 
13 4    DA  n 
13 5    DG  n 
13 6    DT  n 
13 7    DA  n 
13 8    DC  n 
13 9    DT  n 
13 10   DT  n 
13 11   DT  n 
13 12   DT  n 
13 13   DT  n 
13 14   DC  n 
13 15   DC  n 
13 16   BRU n 
13 17   DG  n 
13 18   DG  n 
13 19   DT  n 
13 20   DC  n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? 'BJ5464 RPB3 HIS-BIO' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? 'BJ5464 RPB3 HIS-BIO' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? 'BJ5464 RPB3 HIS-BIO' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? 'BJ5464 RPB3 HIS-BIO' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? 'BJ5464 RPB3 HIS-BIO' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? 'BJ5464 RPB3 HIS-BIO' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? 'BJ5464 RPB3 HIS-BIO' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? 'BJ5464 RPB3 HIS-BIO' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? 'BJ5464 RPB3 HIS-BIO' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? 
;BAKER'S YEAST
;
'SACCHAROMYCES CEREVISIAE' 4932 ? ? 'BJ5464 RPB3 HIS-BIO' ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
11 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
12 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
13 1 sample ? ? 'SYNTHETIC CONSTRUCT' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
1  UNP RPB1_YEAST  1  ? ? P04050 ? 
2  UNP RPB2_YEAST  2  ? ? P08518 ? 
3  UNP RPB3_YEAST  3  ? ? P16370 ? 
4  UNP RPAB1_YEAST 4  ? ? P20434 ? 
5  UNP RPAB2_YEAST 5  ? ? P20435 ? 
6  UNP RPAB3_YEAST 6  ? ? P20436 ? 
7  UNP RPB9_YEAST  7  ? ? P27999 ? 
8  UNP RPAB5_YEAST 8  ? ? P22139 ? 
9  UNP RPB11_YEAST 9  ? ? P38902 ? 
10 UNP RPAB4_YEAST 10 ? ? P40422 ? 
11 PDB 4V1M        13 ? ? 4V1M   ? 
12 PDB 4V1M        11 ? ? 4V1M   ? 
13 PDB 4V1M        12 ? ? 4V1M   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  4V1M A 1 ? 1733 ? P04050 1 ? 1733 ? 1 1733 
2  2  4V1M B 1 ? 1224 ? P08518 1 ? 1224 ? 1 1224 
3  3  4V1M C 1 ? 318  ? P16370 1 ? 318  ? 1 318  
4  4  4V1M E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
5  5  4V1M F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
6  6  4V1M H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
7  7  4V1M I 1 ? 122  ? P27999 1 ? 122  ? 1 122  
8  8  4V1M J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
9  9  4V1M K 1 ? 120  ? P38902 1 ? 120  ? 1 120  
10 10 4V1M L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
11 11 4V1M T 1 ? 20   ? 4V1M   7 ? 26   ? 7 26   
12 12 4V1M N 1 ? 10   ? 4V1M   2 ? 11   ? 2 11   
13 13 4V1M P 1 ? 6    ? 4V1M   5 ? 10   ? 5 10   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"               ? 'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                                    ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                   ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                 ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                            ? 'C4 H7 N O4'        133.103 
BRU 'DNA linking'       n "5-BROMO-2'-DEOXYURIDINE-5'-MONOPHOSPHATE" ? 'C9 H12 Br N2 O8 P' 387.078 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"                ? 'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                                   ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"        ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"       ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"               ? 'C10 H15 N2 O8 P'   322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"               ? 'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                                  ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                            ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                    ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                  ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                 ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                    ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                     ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                 ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                            ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                              ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                    ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                     ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                  ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                 ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                   ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                     ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                 ? 'Zn 2'              65.409  
# 
_exptl.entry_id          4V1M 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.entry_id                                 4V1M 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            6.60 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        28697 
_refine_hist.pdbx_number_atoms_nucleic_acid   741 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               29447 
_refine_hist.d_res_high                       6.60 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  4V1M 
_struct.title                     'Architecture of the RNA polymerase II-Mediator core transcription initiation complex' 
_struct.pdbx_descriptor           
;DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1 (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB2 (E.C.2.7.7.6), DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB3, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 1, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 2, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 3, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB9, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 5, DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB11, DNA-DIRECTED RNA POLYMERASES I, II, AND III SUBUNIT RPABC 4 (E.C.2.7.7.6)
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        4V1M 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
_struct_keywords.text            'TRANSCRIPTION, TRANSCRIPTION INITIATION, RNA POLYMERASE II, GENERAL TRANSCRIPTION FACTORS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 14 ? 
P N N 15 ? 
Q N N 14 ? 
R N N 14 ? 
S N N 14 ? 
T N N 14 ? 
U N N 14 ? 
V N N 14 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A 23   ? SER A 31   ? SER A 23   SER A 31   1 ? 9  
HELX_P HELX_P2   2   PHE A 95   ? VAL A 106  ? PHE A 95   VAL A 106  1 ? 12 
HELX_P HELX_P3   3   ASN A 119  ? ILE A 128  ? ASN A 119  ILE A 128  1 ? 10 
HELX_P HELX_P4   4   ASP A 130  ? LYS A 143  ? ASP A 130  LYS A 143  1 ? 14 
HELX_P HELX_P5   5   SER A 203  ? ILE A 214  ? SER A 203  ILE A 214  1 ? 12 
HELX_P HELX_P6   6   SER A 215  ? LEU A 222  ? SER A 215  LEU A 222  1 ? 8  
HELX_P HELX_P7   7   ARG A 230  ? TRP A 233  ? ARG A 230  TRP A 233  5 ? 4  
HELX_P HELX_P8   8   PRO A 243  ? ARG A 247  ? PRO A 243  ARG A 247  5 ? 5  
HELX_P HELX_P9   9   ASP A 260  ? ASN A 282  ? ASP A 260  ASN A 282  1 ? 23 
HELX_P HELX_P10  10  HIS A 286  ? ASP A 305  ? HIS A 286  ASP A 305  1 ? 20 
HELX_P HELX_P11  11  SER A 324  ? LYS A 330  ? SER A 324  LYS A 330  1 ? 7  
HELX_P HELX_P12  12  GLY A 334  ? LEU A 340  ? GLY A 334  LEU A 340  1 ? 7  
HELX_P HELX_P13  13  LYS A 368  ? LEU A 374  ? LYS A 368  LEU A 374  1 ? 7  
HELX_P HELX_P14  14  ASN A 384  ? GLY A 395  ? ASN A 384  GLY A 395  1 ? 12 
HELX_P HELX_P15  15  HIS A 451  ? MET A 453  ? HIS A 451  MET A 453  5 ? 3  
HELX_P HELX_P16  16  VAL A 474  ? ASN A 479  ? VAL A 474  ASN A 479  1 ? 6  
HELX_P HELX_P17  17  SER A 494  ? CYS A 505  ? SER A 494  CYS A 505  1 ? 12 
HELX_P HELX_P18  18  ALA A 506  ? ILE A 511  ? ALA A 506  ILE A 511  1 ? 6  
HELX_P HELX_P19  19  VAL A 524  ? THR A 535  ? VAL A 524  THR A 535  1 ? 12 
HELX_P HELX_P20  20  LEU A 543  ? TRP A 552  ? LEU A 543  TRP A 552  1 ? 10 
HELX_P HELX_P21  21  GLY A 574  ? SER A 579  ? GLY A 574  SER A 579  1 ? 6  
HELX_P HELX_P22  22  GLU A 618  ? GLY A 623  ? GLU A 618  GLY A 623  1 ? 6  
HELX_P HELX_P23  23  GLY A 628  ? GLY A 638  ? GLY A 628  GLY A 638  1 ? 11 
HELX_P HELX_P24  24  GLY A 638  ? GLY A 661  ? GLY A 638  GLY A 661  1 ? 24 
HELX_P HELX_P25  25  GLY A 665  ? THR A 669  ? GLY A 665  THR A 669  5 ? 5  
HELX_P HELX_P26  26  ASP A 672  ? ALA A 699  ? ASP A 672  ALA A 699  1 ? 28 
HELX_P HELX_P27  27  THR A 709  ? LEU A 737  ? THR A 709  LEU A 737  1 ? 29 
HELX_P HELX_P28  28  ASN A 741  ? GLY A 750  ? ASN A 741  GLY A 750  1 ? 10 
HELX_P HELX_P29  29  SER A 754  ? ALA A 763  ? SER A 754  ALA A 763  1 ? 10 
HELX_P HELX_P30  30  THR A 809  ? GLU A 846  ? THR A 809  GLU A 846  1 ? 38 
HELX_P HELX_P31  31  ILE A 867  ? ASP A 871  ? ILE A 867  ASP A 871  5 ? 5  
HELX_P HELX_P32  32  ASP A 874  ? ALA A 876  ? ASP A 874  ALA A 876  5 ? 3  
HELX_P HELX_P33  33  SER A 889  ? ARG A 898  ? SER A 889  ARG A 898  1 ? 10 
HELX_P HELX_P34  34  SER A 915  ? LEU A 920  ? SER A 915  LEU A 920  1 ? 6  
HELX_P HELX_P35  35  ASP A 922  ? PHE A 947  ? ASP A 922  PHE A 947  1 ? 26 
HELX_P HELX_P36  36  ASN A 959  ? HIS A 972  ? ASN A 959  HIS A 972  1 ? 14 
HELX_P HELX_P37  37  THR A 982  ? ASN A 996  ? THR A 982  ASN A 996  1 ? 15 
HELX_P HELX_P38  38  ASN A 1004 ? LEU A 1026 ? ASN A 1004 LEU A 1026 1 ? 23 
HELX_P HELX_P39  39  ALA A 1027 ? GLU A 1034 ? ALA A 1027 GLU A 1034 1 ? 8  
HELX_P HELX_P40  40  THR A 1038 ? VAL A 1057 ? THR A 1038 VAL A 1057 1 ? 20 
HELX_P HELX_P41  41  MET A 1063 ? GLN A 1078 ? MET A 1063 GLN A 1078 1 ? 16 
HELX_P HELX_P42  42  GLY A 1097 ? ASN A 1106 ? GLY A 1097 ASN A 1106 1 ? 10 
HELX_P HELX_P43  43  ASP A 1127 ? GLU A 1139 ? ASP A 1127 GLU A 1139 1 ? 13 
HELX_P HELX_P44  44  THR A 1142 ? VAL A 1146 ? THR A 1142 VAL A 1146 1 ? 5  
HELX_P HELX_P45  45  ASP A 1166 ? HIS A 1173 ? ASP A 1166 HIS A 1173 1 ? 8  
HELX_P HELX_P46  46  ASP A 1198 ? LYS A 1205 ? ASP A 1198 LYS A 1205 1 ? 8  
HELX_P HELX_P47  47  THR A 1208 ? LYS A 1221 ? THR A 1208 LYS A 1221 1 ? 14 
HELX_P HELX_P48  48  GLU A 1256 ? ILE A 1271 ? GLU A 1256 ILE A 1271 1 ? 16 
HELX_P HELX_P49  49  ASN A 1312 ? THR A 1318 ? ASN A 1312 THR A 1318 1 ? 7  
HELX_P HELX_P50  50  SER A 1331 ? GLY A 1340 ? SER A 1331 GLY A 1340 1 ? 10 
HELX_P HELX_P51  51  GLY A 1340 ? ASP A 1359 ? GLY A 1340 ASP A 1359 1 ? 20 
HELX_P HELX_P52  52  ASN A 1364 ? THR A 1377 ? ASN A 1364 THR A 1377 1 ? 14 
HELX_P HELX_P53  53  GLY A 1388 ? SER A 1392 ? GLY A 1388 SER A 1392 5 ? 5  
HELX_P HELX_P54  54  GLY A 1395 ? SER A 1401 ? GLY A 1395 SER A 1401 1 ? 7  
HELX_P HELX_P55  55  GLU A 1404 ? SER A 1415 ? GLU A 1404 SER A 1415 1 ? 12 
HELX_P HELX_P56  56  GLY A 1423 ? GLY A 1431 ? GLY A 1423 GLY A 1431 1 ? 9  
HELX_P HELX_P57  57  ILE A 1436 ? ALA A 1440 ? ILE A 1436 ALA A 1440 5 ? 5  
HELX_P HELX_P58  58  ASP A 1446 ? TYR A 1453 ? ASP A 1446 TYR A 1453 1 ? 8  
HELX_P HELX_P59  59  ASP B 29   ? GLY B 42   ? ASP B 29   GLY B 42   1 ? 14 
HELX_P HELX_P60  60  VAL B 44   ? TYR B 57   ? VAL B 44   TYR B 57   1 ? 14 
HELX_P HELX_P61  61  TYR B 57   ? GLU B 65   ? TYR B 57   GLU B 65   1 ? 9  
HELX_P HELX_P62  62  TYR B 113  ? ARG B 120  ? TYR B 113  ARG B 120  1 ? 8  
HELX_P HELX_P63  63  CYS B 179  ? ALA B 184  ? CYS B 179  ALA B 184  5 ? 6  
HELX_P HELX_P64  64  THR B 185  ? LEU B 192  ? THR B 185  LEU B 192  1 ? 8  
HELX_P HELX_P65  65  ILE B 282  ? GLY B 290  ? ILE B 282  GLY B 290  1 ? 9  
HELX_P HELX_P66  66  GLY B 295  ? CYS B 302  ? GLY B 295  CYS B 302  1 ? 8  
HELX_P HELX_P67  67  ASP B 307  ? MET B 313  ? ASP B 307  MET B 313  1 ? 7  
HELX_P HELX_P68  68  LEU B 314  ? GLY B 321  ? LEU B 314  GLY B 321  1 ? 8  
HELX_P HELX_P69  69  ASP B 326  ? ARG B 337  ? ASP B 326  ARG B 337  1 ? 12 
HELX_P HELX_P70  70  LYS B 344  ? TYR B 351  ? LYS B 344  TYR B 351  1 ? 8  
HELX_P HELX_P71  71  ALA B 352  ? GLU B 359  ? ALA B 352  GLU B 359  1 ? 8  
HELX_P HELX_P72  72  PHE B 370  ? LEU B 390  ? PHE B 370  LEU B 390  1 ? 21 
HELX_P HELX_P73  73  HIS B 400  ? GLY B 402  ? HIS B 400  GLY B 402  5 ? 3  
HELX_P HELX_P74  74  LEU B 408  ? GLU B 438  ? LEU B 408  GLU B 438  1 ? 31 
HELX_P HELX_P75  75  ASN B 443  ? ILE B 448  ? ASN B 443  ILE B 448  1 ? 6  
HELX_P HELX_P76  76  ALA B 450  ? GLY B 464  ? ALA B 450  GLY B 464  1 ? 15 
HELX_P HELX_P77  77  THR B 487  ? LEU B 495  ? THR B 487  LEU B 495  1 ? 9  
HELX_P HELX_P78  78  HIS B 515  ? TRP B 519  ? HIS B 515  TRP B 519  5 ? 5  
HELX_P HELX_P79  79  PRO B 551  ? GLU B 560  ? PRO B 551  GLU B 560  1 ? 10 
HELX_P HELX_P80  80  GLU B 567  ? TYR B 569  ? GLU B 567  TYR B 569  5 ? 3  
HELX_P HELX_P81  81  ASN B 592  ? GLY B 607  ? ASN B 592  GLY B 607  1 ? 16 
HELX_P HELX_P82  82  ARG B 654  ? GLN B 667  ? ARG B 654  GLN B 667  1 ? 14 
HELX_P HELX_P83  83  THR B 680  ? GLU B 687  ? THR B 680  GLU B 687  1 ? 8  
HELX_P HELX_P84  84  ALA B 695  ? GLU B 699  ? ALA B 695  GLU B 699  1 ? 5  
HELX_P HELX_P85  85  PRO B 707  ? GLU B 711  ? PRO B 707  GLU B 711  5 ? 5  
HELX_P HELX_P86  86  HIS B 744  ? LEU B 749  ? HIS B 744  LEU B 749  5 ? 6  
HELX_P HELX_P87  87  ALA B 752  ? ILE B 756  ? ALA B 752  ILE B 756  5 ? 5  
HELX_P HELX_P88  88  PHE B 758  ? HIS B 761  ? PHE B 758  HIS B 761  5 ? 4  
HELX_P HELX_P89  89  GLN B 763  ? GLY B 774  ? GLN B 763  GLY B 774  1 ? 12 
HELX_P HELX_P90  90  ASN B 784  ? ARG B 788  ? ASN B 784  ARG B 788  5 ? 5  
HELX_P HELX_P91  91  THR B 806  ? TYR B 811  ? THR B 806  TYR B 811  5 ? 6  
HELX_P HELX_P92  92  GLN B 843  ? ARG B 848  ? GLN B 843  ARG B 848  1 ? 6  
HELX_P HELX_P93  93  ALA B 1016 ? MET B 1021 ? ALA B 1016 MET B 1021 1 ? 6  
HELX_P HELX_P94  94  THR B 1022 ? GLY B 1039 ? THR B 1022 GLY B 1039 1 ? 18 
HELX_P HELX_P95  95  THR B 1051 ? HIS B 1062 ? THR B 1051 HIS B 1062 1 ? 12 
HELX_P HELX_P96  96  MET B 1098 ? LYS B 1102 ? MET B 1098 LYS B 1102 5 ? 5  
HELX_P HELX_P97  97  GLY B 1121 ? ASP B 1125 ? GLY B 1121 ASP B 1125 5 ? 5  
HELX_P HELX_P98  98  GLY B 1131 ? GLY B 1142 ? GLY B 1131 GLY B 1142 1 ? 12 
HELX_P HELX_P99  99  ALA B 1143 ? MET B 1152 ? ALA B 1143 MET B 1152 1 ? 10 
HELX_P HELX_P100 100 TYR B 1198 ? MET B 1210 ? TYR B 1198 MET B 1210 1 ? 13 
HELX_P HELX_P101 101 ASP C 26   ? GLU C 40   ? ASP C 26   GLU C 40   1 ? 15 
HELX_P HELX_P102 102 ALA C 59   ? ILE C 70   ? ALA C 59   ILE C 70   1 ? 12 
HELX_P HELX_P103 103 ASP C 76   ? LEU C 80   ? ASP C 76   LEU C 80   5 ? 5  
HELX_P HELX_P104 104 LYS C 116  ? LEU C 118  ? LYS C 116  LEU C 118  5 ? 3  
HELX_P HELX_P105 105 HIS C 167  ? GLY C 171  ? HIS C 167  GLY C 171  5 ? 5  
HELX_P HELX_P106 106 ASP C 196  ? TRP C 201  ? ASP C 196  TRP C 201  1 ? 6  
HELX_P HELX_P107 107 SER C 204  ? GLU C 210  ? SER C 204  GLU C 210  5 ? 7  
HELX_P HELX_P108 108 PRO C 239  ? ASP C 266  ? PRO C 239  ASP C 266  1 ? 28 
HELX_P HELX_P109 109 ASP D 2    ? GLU D 4    ? ASP E 2    GLU E 4    5 ? 3  
HELX_P HELX_P110 110 ASN D 5    ? TYR D 28   ? ASN E 5    TYR E 28   1 ? 24 
HELX_P HELX_P111 111 THR D 31   ? GLU D 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P112 112 PRO D 38   ? CYS D 47   ? PRO E 38   CYS E 47   1 ? 10 
HELX_P HELX_P113 113 GLN D 54   ? SER D 59   ? GLN E 54   SER E 59   1 ? 6  
HELX_P HELX_P114 114 THR D 65   ? PHE D 72   ? THR E 65   PHE E 72   1 ? 8  
HELX_P HELX_P115 115 GLY D 89   ? LYS D 103  ? GLY E 89   LYS E 103  1 ? 15 
HELX_P HELX_P116 116 THR D 117  ? LYS D 122  ? THR E 117  LYS E 122  1 ? 6  
HELX_P HELX_P117 117 GLU D 137  ? VAL D 141  ? GLU E 137  VAL E 141  1 ? 5  
HELX_P HELX_P118 118 ASN D 143  ? HIS D 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P119 119 SER D 157  ? ARG D 169  ? SER E 157  ARG E 169  1 ? 13 
HELX_P HELX_P120 120 LYS D 171  ? LEU D 175  ? LYS E 171  LEU E 175  5 ? 5  
HELX_P HELX_P121 121 ASP D 182  ? LEU D 188  ? ASP E 182  LEU E 188  1 ? 7  
HELX_P HELX_P122 122 PRO E 75   ? ARG E 79   ? PRO F 75   ARG F 79   5 ? 5  
HELX_P HELX_P123 123 THR E 86   ? MET E 103  ? THR F 86   MET F 103  1 ? 18 
HELX_P HELX_P124 124 ASP E 116  ? GLU E 127  ? ASP F 116  GLU F 127  1 ? 12 
HELX_P HELX_P125 125 TYR F 129  ? ASN F 133  ? TYR H 129  ASN H 133  5 ? 5  
HELX_P HELX_P126 126 VAL G 59   ? ASP G 65   ? VAL I 59   ASP I 65   5 ? 7  
HELX_P HELX_P127 127 ASP H 16   ? GLU H 27   ? ASP J 16   GLU J 27   1 ? 12 
HELX_P HELX_P128 128 ASP H 31   ? LEU H 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P129 129 ARG H 43   ? THR H 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P130 130 LEU H 56   ? LEU H 61   ? LEU J 56   LEU J 61   1 ? 6  
HELX_P HELX_P131 131 ASP I 5    ? PHE I 10   ? ASP K 5    PHE K 10   5 ? 6  
HELX_P HELX_P132 132 ASP I 39   ? ASP I 53   ? ASP K 39   ASP K 53   1 ? 15 
HELX_P HELX_P133 133 ASP I 82   ? GLN I 112  ? ASP K 82   GLN K 112  1 ? 31 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? N ZN  .  ZN    ? ? ? 1_555 A CYS 110  SG    ? ? A ZN  2456 A CYS 110  1_555 ? ? ? ? ? ? ?            2.318 ? 
metalc2  metalc ? ? N ZN  .  ZN    ? ? ? 1_555 A CYS 107  SG    ? ? A ZN  2456 A CYS 107  1_555 ? ? ? ? ? ? ?            2.378 ? 
metalc3  metalc ? ? N ZN  .  ZN    ? ? ? 1_555 A CYS 167  SG    ? ? A ZN  2456 A CYS 167  1_555 ? ? ? ? ? ? ?            2.377 ? 
metalc4  metalc ? ? N ZN  .  ZN    ? ? ? 1_555 A CYS 148  SG    ? ? A ZN  2456 A CYS 148  1_555 ? ? ? ? ? ? ?            2.307 ? 
metalc5  metalc ? ? O ZN  .  ZN    ? ? ? 1_555 A CYS 67   SG    ? ? A ZN  2457 A CYS 67   1_555 ? ? ? ? ? ? ?            2.360 ? 
metalc6  metalc ? ? O ZN  .  ZN    ? ? ? 1_555 A CYS 70   SG    ? ? A ZN  2457 A CYS 70   1_555 ? ? ? ? ? ? ?            2.512 ? 
metalc7  metalc ? ? O ZN  .  ZN    ? ? ? 1_555 A CYS 77   SG    ? ? A ZN  2457 A CYS 77   1_555 ? ? ? ? ? ? ?            2.405 ? 
metalc8  metalc ? ? O ZN  .  ZN    ? ? ? 1_555 A HIS 80   NE2   ? ? A ZN  2457 A HIS 80   1_555 ? ? ? ? ? ? ?            2.056 ? 
metalc9  metalc ? ? P MG  .  MG    ? ? ? 1_555 L A   6    "O3'" ? ? A MG  2458 P A   10   1_555 ? ? ? ? ? ? ?            1.935 ? 
metalc10 metalc ? ? P MG  .  MG    ? ? ? 1_555 A ASP 485  OD1   ? ? A MG  2458 A ASP 485  1_555 ? ? ? ? ? ? ?            2.300 ? 
metalc11 metalc ? ? P MG  .  MG    ? ? ? 1_555 A ASP 481  OD1   ? ? A MG  2458 A ASP 481  1_555 ? ? ? ? ? ? ?            1.924 ? 
metalc12 metalc ? ? P MG  .  MG    ? ? ? 1_555 A ASP 483  OD2   ? ? A MG  2458 A ASP 483  1_555 ? ? ? ? ? ? ?            2.376 ? 
metalc13 metalc ? ? P MG  .  MG    ? ? ? 1_555 A ASP 483  OD1   ? ? A MG  2458 A ASP 483  1_555 ? ? ? ? ? ? ?            2.267 ? 
metalc14 metalc ? ? P MG  .  MG    ? ? ? 1_555 A ASP 481  OD2   ? ? A MG  2458 A ASP 481  1_555 ? ? ? ? ? ? ?            2.349 ? 
metalc15 metalc ? ? Q ZN  .  ZN    ? ? ? 1_555 B CYS 1163 SG    ? ? B ZN  2225 B CYS 1163 1_555 ? ? ? ? ? ? ?            2.433 ? 
metalc16 metalc ? ? Q ZN  .  ZN    ? ? ? 1_555 B CYS 1182 SG    ? ? B ZN  2225 B CYS 1182 1_555 ? ? ? ? ? ? ?            2.362 ? 
metalc17 metalc ? ? Q ZN  .  ZN    ? ? ? 1_555 B CYS 1166 SG    ? ? B ZN  2225 B CYS 1166 1_555 ? ? ? ? ? ? ?            2.195 ? 
metalc18 metalc ? ? Q ZN  .  ZN    ? ? ? 1_555 B CYS 1185 SG    ? ? B ZN  2225 B CYS 1185 1_555 ? ? ? ? ? ? ?            2.445 ? 
metalc19 metalc ? ? R ZN  .  ZN    ? ? ? 1_555 C CYS 88   SG    ? ? C ZN  1269 C CYS 88   1_555 ? ? ? ? ? ? ?            2.311 ? 
metalc20 metalc ? ? R ZN  .  ZN    ? ? ? 1_555 C CYS 92   SG    ? ? C ZN  1269 C CYS 92   1_555 ? ? ? ? ? ? ?            2.231 ? 
metalc21 metalc ? ? R ZN  .  ZN    ? ? ? 1_555 C CYS 95   SG    ? ? C ZN  1269 C CYS 95   1_555 ? ? ? ? ? ? ?            2.222 ? 
metalc22 metalc ? ? R ZN  .  ZN    ? ? ? 1_555 C CYS 86   SG    ? ? C ZN  1269 C CYS 86   1_555 ? ? ? ? ? ? ?            2.261 ? 
metalc23 metalc ? ? S ZN  .  ZN    ? ? ? 1_555 G CYS 32   SG    ? ? I ZN  1121 I CYS 32   1_555 ? ? ? ? ? ? ?            2.328 ? 
metalc24 metalc ? ? S ZN  .  ZN    ? ? ? 1_555 G CYS 29   SG    ? ? I ZN  1121 I CYS 29   1_555 ? ? ? ? ? ? ?            2.267 ? 
metalc25 metalc ? ? S ZN  .  ZN    ? ? ? 1_555 G CYS 7    SG    ? ? I ZN  1121 I CYS 7    1_555 ? ? ? ? ? ? ?            2.250 ? 
metalc26 metalc ? ? S ZN  .  ZN    ? ? ? 1_555 G CYS 10   SG    ? ? I ZN  1121 I CYS 10   1_555 ? ? ? ? ? ? ?            2.317 ? 
metalc27 metalc ? ? T ZN  .  ZN    ? ? ? 1_555 G CYS 75   SG    ? ? I ZN  1122 I CYS 75   1_555 ? ? ? ? ? ? ?            2.356 ? 
metalc28 metalc ? ? T ZN  .  ZN    ? ? ? 1_555 G CYS 106  SG    ? ? I ZN  1122 I CYS 106  1_555 ? ? ? ? ? ? ?            2.289 ? 
metalc29 metalc ? ? T ZN  .  ZN    ? ? ? 1_555 G CYS 103  SG    ? ? I ZN  1122 I CYS 103  1_555 ? ? ? ? ? ? ?            2.403 ? 
metalc30 metalc ? ? T ZN  .  ZN    ? ? ? 1_555 G CYS 78   SG    ? ? I ZN  1122 I CYS 78   1_555 ? ? ? ? ? ? ?            2.342 ? 
metalc31 metalc ? ? U ZN  .  ZN    ? ? ? 1_555 H CYS 45   SG    ? ? J ZN  1066 J CYS 45   1_555 ? ? ? ? ? ? ?            2.369 ? 
metalc32 metalc ? ? U ZN  .  ZN    ? ? ? 1_555 H CYS 10   SG    ? ? J ZN  1066 J CYS 10   1_555 ? ? ? ? ? ? ?            2.485 ? 
metalc33 metalc ? ? U ZN  .  ZN    ? ? ? 1_555 H CYS 46   SG    ? ? J ZN  1066 J CYS 46   1_555 ? ? ? ? ? ? ?            2.281 ? 
metalc34 metalc ? ? U ZN  .  ZN    ? ? ? 1_555 H CYS 7    SG    ? ? J ZN  1066 J CYS 7    1_555 ? ? ? ? ? ? ?            2.226 ? 
metalc35 metalc ? ? V ZN  .  ZN    ? ? ? 1_555 J CYS 31   SG    ? ? L ZN  1071 L CYS 31   1_555 ? ? ? ? ? ? ?            2.537 ? 
metalc36 metalc ? ? V ZN  .  ZN    ? ? ? 1_555 J CYS 51   SG    ? ? L ZN  1071 L CYS 51   1_555 ? ? ? ? ? ? ?            2.364 ? 
metalc37 metalc ? ? V ZN  .  ZN    ? ? ? 1_555 J CYS 48   SG    ? ? L ZN  1071 L CYS 48   1_555 ? ? ? ? ? ? ?            2.298 ? 
metalc38 metalc ? ? V ZN  .  ZN    ? ? ? 1_555 J CYS 34   SG    ? ? L ZN  1071 L CYS 34   1_555 ? ? ? ? ? ? ?            2.342 ? 
covale1  covale ? ? M DC  15 "O3'" ? ? ? 1_555 M BRU 16   P     ? ? T DC  21   T BRU 22   1_555 ? ? ? ? ? ? ?            1.585 ? 
covale2  covale ? ? M BRU 16 "O3'" ? ? ? 1_555 M DG  17   P     ? ? T BRU 22   T DG  23   1_555 ? ? ? ? ? ? ?            1.588 ? 
hydrog1  hydrog ? ? K DA  1  N1    ? ? ? 1_555 M DT  10   N3    ? ? N DA  2    T DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? K DA  1  N6    ? ? ? 1_555 M DT  10   O4    ? ? N DA  2    T DT  16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? K DA  2  N1    ? ? ? 1_555 M DT  9    N3    ? ? N DA  3    T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? K DA  2  N6    ? ? ? 1_555 M DT  9    O4    ? ? N DA  3    T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? K DG  3  N1    ? ? ? 1_555 M DC  8    N3    ? ? N DG  4    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? K DG  3  N2    ? ? ? 1_555 M DC  8    O2    ? ? N DG  4    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? K DG  3  O6    ? ? ? 1_555 M DC  8    N4    ? ? N DG  4    T DC  14   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? K DT  4  N3    ? ? ? 1_555 M DA  7    N1    ? ? N DT  5    T DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? K DT  4  O4    ? ? ? 1_555 M DA  7    N6    ? ? N DT  5    T DA  13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? K DA  5  N1    ? ? ? 1_555 M DT  6    N3    ? ? N DA  6    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? K DA  5  N6    ? ? ? 1_555 M DT  6    O4    ? ? N DA  6    T DT  12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? K DC  6  N3    ? ? ? 1_555 M DG  5    N1    ? ? N DC  7    T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? K DC  6  N4    ? ? ? 1_555 M DG  5    O6    ? ? N DC  7    T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? K DC  6  O2    ? ? ? 1_555 M DG  5    N2    ? ? N DC  7    T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? K DT  7  N3    ? ? ? 1_555 M DA  4    N1    ? ? N DT  8    T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? K DT  7  O4    ? ? ? 1_555 M DA  4    N6    ? ? N DT  8    T DA  10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? K DT  8  N3    ? ? ? 1_555 M DA  3    N1    ? ? N DT  9    T DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? K DT  8  O4    ? ? ? 1_555 M DA  3    N6    ? ? N DT  9    T DA  9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? K DG  9  N1    ? ? ? 1_555 M DC  2    N3    ? ? N DG  10   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? K DG  9  N2    ? ? ? 1_555 M DC  2    O2    ? ? N DG  10   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? K DG  9  O6    ? ? ? 1_555 M DC  2    N4    ? ? N DG  10   T DC  8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? K DA  10 N1    ? ? ? 1_555 M DT  1    N3    ? ? N DA  11   T DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? K DA  10 N6    ? ? ? 1_555 M DT  1    O4    ? ? N DA  11   T DT  7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? L C   1  N3    ? ? ? 1_555 M DG  18   N1    ? ? P C   5    T DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? L C   1  N4    ? ? ? 1_555 M DG  18   O6    ? ? P C   5    T DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? L C   1  O2    ? ? ? 1_555 M DG  18   N2    ? ? P C   5    T DG  24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? L C   2  N3    ? ? ? 1_555 M DG  17   N1    ? ? P C   6    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? L C   2  N4    ? ? ? 1_555 M DG  17   O6    ? ? P C   6    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? L C   2  O2    ? ? ? 1_555 M DG  17   N2    ? ? P C   6    T DG  23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? L A   3  N1    ? ? ? 1_555 M BRU 16   N3    ? ? P A   7    T BRU 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? L A   3  N6    ? ? ? 1_555 M BRU 16   O4    ? ? P A   7    T BRU 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? L G   4  N1    ? ? ? 1_555 M DC  15   N3    ? ? P G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? L G   4  N2    ? ? ? 1_555 M DC  15   O2    ? ? P G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? L G   4  O6    ? ? ? 1_555 M DC  15   N4    ? ? P G   8    T DC  21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? L G   5  N1    ? ? ? 1_555 M DC  14   N3    ? ? P G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? L G   5  N2    ? ? ? 1_555 M DC  14   O2    ? ? P G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? L G   5  O6    ? ? ? 1_555 M DC  14   N4    ? ? P G   9    T DC  20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? L A   6  N1    ? ? ? 1_555 M DT  13   N3    ? ? P A   10   T DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? L A   6  N6    ? ? ? 1_555 M DT  13   O4    ? ? P A   10   T DT  19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ASP 193 A . ? ASP 193 A ALA 194 A ? ALA 194 A 1 3.36  
2 ALA 194 A . ? ALA 194 A ASP 195 A ? ASP 195 A 1 -2.08 
3 GLN 447 A . ? GLN 447 A PRO 448 A ? PRO 448 A 1 18.21 
4 LYS 567 A . ? LYS 567 A PRO 568 A ? PRO 568 A 1 -0.13 
5 GLU 80  B . ? GLU 80  B SER 81  B ? SER 81  B 1 12.82 
6 GLY 338 B . ? GLY 338 B THR 339 B ? THR 339 B 1 2.23  
7 GLU 468 B . ? GLU 468 B GLN 469 B ? GLN 469 B 1 -6.28 
8 MET 473 B . ? MET 473 B SER 474 B ? SER 474 B 1 -1.31 
9 PRO 128 D . ? PRO 128 E PRO 129 D ? PRO 129 E 1 2.52  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA ? 3  ? 
AB ? 2  ? 
AC ? 2  ? 
AD ? 3  ? 
AE ? 2  ? 
AF ? 14 ? 
AG ? 4  ? 
AH ? 2  ? 
AI ? 2  ? 
AJ ? 3  ? 
AK ? 2  ? 
AL ? 2  ? 
AM ? 3  ? 
AN ? 2  ? 
AO ? 4  ? 
AP ? 5  ? 
AQ ? 2  ? 
AR ? 3  ? 
BA ? 2  ? 
BB ? 2  ? 
BC ? 2  ? 
BD ? 4  ? 
BE ? 4  ? 
BF ? 3  ? 
BG ? 4  ? 
BH ? 5  ? 
BI ? 2  ? 
BJ ? 2  ? 
BK ? 2  ? 
BL ? 4  ? 
BM ? 4  ? 
BN ? 5  ? 
BO ? 5  ? 
BP ? 2  ? 
BQ ? 16 ? 
BR ? 2  ? 
BS ? 2  ? 
CA ? 4  ? 
CB ? 5  ? 
CC ? 2  ? 
CD ? 2  ? 
EA ? 4  ? 
EB ? 2  ? 
EC ? 4  ? 
HA ? 9  ? 
IA ? 3  ? 
IB ? 4  ? 
KA ? 4  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA 1 2 ? anti-parallel 
AA 2 3 ? anti-parallel 
AB 1 2 ? anti-parallel 
AC 1 2 ? anti-parallel 
AD 1 2 ? anti-parallel 
AD 2 3 ? anti-parallel 
AE 1 2 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 3 4 ? parallel      
AF 4 5 ? anti-parallel 
AF 5 6 ? anti-parallel 
AF 6 7 ? anti-parallel 
AF 7 8 ? anti-parallel 
AG 1 2 ? anti-parallel 
AG 2 3 ? anti-parallel 
AG 3 4 ? anti-parallel 
AH 1 2 ? anti-parallel 
AI 1 2 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AJ 2 3 ? anti-parallel 
AK 1 2 ? anti-parallel 
AL 1 2 ? anti-parallel 
AM 1 2 ? anti-parallel 
AM 2 3 ? anti-parallel 
AN 1 2 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? anti-parallel 
AP 1 2 ? anti-parallel 
AP 2 3 ? anti-parallel 
AP 3 4 ? anti-parallel 
AP 4 5 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
BA 1 2 ? anti-parallel 
BB 1 2 ? parallel      
BC 1 2 ? parallel      
BD 1 2 ? anti-parallel 
BD 2 3 ? anti-parallel 
BD 3 4 ? parallel      
BE 1 2 ? anti-parallel 
BE 2 3 ? anti-parallel 
BE 3 4 ? parallel      
BF 1 2 ? anti-parallel 
BF 2 3 ? anti-parallel 
BG 1 2 ? anti-parallel 
BG 2 3 ? parallel      
BG 3 4 ? anti-parallel 
BH 1 2 ? anti-parallel 
BH 2 3 ? anti-parallel 
BH 3 4 ? anti-parallel 
BH 4 5 ? anti-parallel 
BI 1 2 ? anti-parallel 
BJ 1 2 ? parallel      
BK 1 2 ? anti-parallel 
BL 1 2 ? parallel      
BL 2 3 ? anti-parallel 
BL 3 4 ? parallel      
BM 1 2 ? parallel      
BM 2 3 ? anti-parallel 
BM 3 4 ? anti-parallel 
BN 1 2 ? anti-parallel 
BN 2 3 ? anti-parallel 
BN 3 4 ? parallel      
BN 4 5 ? anti-parallel 
BO 1 2 ? anti-parallel 
BO 2 3 ? anti-parallel 
BO 3 4 ? anti-parallel 
BO 4 5 ? anti-parallel 
BP 1 2 ? parallel      
BQ 1 2 ? anti-parallel 
BQ 3 4 ? parallel      
BQ 4 5 ? anti-parallel 
BQ 6 7 ? anti-parallel 
BQ 8 9 ? anti-parallel 
BR 1 2 ? anti-parallel 
BS 1 2 ? anti-parallel 
CA 1 2 ? anti-parallel 
CA 2 3 ? anti-parallel 
CA 3 4 ? anti-parallel 
CB 1 2 ? anti-parallel 
CB 2 3 ? anti-parallel 
CB 3 4 ? anti-parallel 
CB 4 5 ? anti-parallel 
CC 1 2 ? anti-parallel 
CD 1 2 ? anti-parallel 
EA 1 2 ? anti-parallel 
EA 2 3 ? parallel      
EA 3 4 ? parallel      
EB 1 2 ? parallel      
EC 1 2 ? anti-parallel 
EC 2 3 ? anti-parallel 
EC 3 4 ? parallel      
HA 1 2 ? anti-parallel 
HA 2 3 ? anti-parallel 
HA 3 4 ? anti-parallel 
HA 4 5 ? anti-parallel 
HA 5 6 ? anti-parallel 
HA 6 7 ? anti-parallel 
HA 7 8 ? anti-parallel 
HA 8 9 ? anti-parallel 
IA 1 2 ? anti-parallel 
IA 2 3 ? anti-parallel 
IB 1 2 ? anti-parallel 
IB 2 3 ? anti-parallel 
IB 3 4 ? anti-parallel 
KA 1 2 ? anti-parallel 
KA 2 3 ? anti-parallel 
KA 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA 1 LEU A 1418 ? ASP A 1419 ? LEU A 1418 ASP A 1419 
AA 2 GLU A 16   ? GLN A 18   ? GLU A 16   GLN A 18   
AA 3 ARG B 1215 ? TYR B 1217 ? ARG B 1215 TYR B 1217 
AB 1 GLY A 82   ? PHE A 91   ? GLY A 82   PHE A 91   
AB 2 ILE A 235  ? VAL A 241  ? ILE A 235  VAL A 241  
AC 1 ASP A 151  ? PRO A 153  ? ASP A 151  PRO A 153  
AC 2 LEU A 161  ? SER A 163  ? LEU A 161  SER A 163  
AD 1 PRO A 172  ? LYS A 176  ? PRO A 172  LYS A 176  
AD 2 LEU A 181  ? TRP A 185  ? LEU A 181  TRP A 185  
AD 3 GLU A 198  ? LEU A 202  ? GLU A 198  LEU A 202  
AE 1 LYS A 343  ? VAL A 345  ? LYS A 343  VAL A 345  
AE 2 LEU B 1128 ? PHE B 1130 ? LEU B 1128 PHE B 1130 
AF 1 SER A 348  ? ASP A 356  ? SER A 348  ASP A 356  
AF 2 HIS B 1104 ? ARG B 1106 ? HIS B 1104 ARG B 1106 
AF 3 GLN A 363  ? PRO A 367  ? GLN A 363  PRO A 367  
AF 4 MET A 455  ? ILE A 463  ? MET A 455  ILE A 463  
AF 5 PRO A 441  ? ASN A 445  ? PRO A 441  ASN A 445  
AF 6 PHE A 468  ? ASN A 471  ? PHE A 468  ASN A 471  
AF 7 GLU A 486  ? HIS A 490  ? GLU A 486  HIS A 490  
AF 8 SER A 348  ? ASP A 356  ? SER A 348  ASP A 356  
AG 1 THR A 375  ? VAL A 379  ? THR A 375  VAL A 379  
AG 2 LYS A 431  ? HIS A 435  ? LYS A 431  HIS A 435  
AG 3 ALA A 402  ? ILE A 406  ? ALA A 402  ILE A 406  
AG 4 ARG A 412  ? ASP A 414  ? ARG A 412  ASP A 414  
AH 1 VAL A 512  ? SER A 513  ? VAL A 512  SER A 513  
AH 2 LYS A 518  ? PRO A 519  ? LYS A 518  PRO A 519  
AI 1 PHE A 540  ? GLU A 542  ? PHE A 540  GLU A 542  
AI 2 LEU A 571  ? SER A 573  ? LEU A 571  SER A 573  
AJ 1 LEU A 588  ? ARG A 590  ? LEU A 588  ARG A 590  
AJ 2 MET A 605  ? ILE A 607  ? MET A 605  ILE A 607  
AJ 3 ILE A 612  ? PHE A 614  ? ILE A 612  PHE A 614  
AK 1 GLY A 766  ? GLN A 767  ? GLY A 766  GLN A 767  
AK 2 PHE A 799  ? VAL A 800  ? PHE A 799  VAL A 800  
AL 1 SER A 769  ? VAL A 770  ? SER A 769  VAL A 770  
AL 2 LYS A 773  ? ARG A 774  ? LYS A 773  ARG A 774  
AM 1 MET A 849  ? VAL A 850  ? MET A 849  VAL A 850  
AM 2 THR A 856  ? ARG A 857  ? THR A 856  ARG A 857  
AM 3 VAL A 863  ? GLN A 865  ? VAL A 863  GLN A 865  
AN 1 ILE A 878  ? SER A 882  ? ILE A 878  SER A 882  
AN 2 ASN A 953  ? PRO A 957  ? ASN A 953  PRO A 957  
AO 1 GLU A 1280 ? TYR A 1287 ? GLU A 1280 TYR A 1287 
AO 2 GLU A 1303 ? ASP A 1309 ? GLU A 1303 ASP A 1309 
AO 3 LEU A 1116 ? TYR A 1119 ? LEU A 1116 TYR A 1119 
AO 4 TYR A 1328 ? THR A 1329 ? TYR A 1328 THR A 1329 
AP 1 LEU A 1224 ? TRP A 1228 ? LEU A 1224 TRP A 1228 
AP 2 LEU A 1236 ? VAL A 1242 ? LEU A 1236 VAL A 1242 
AP 3 TRP A 1191 ? LEU A 1197 ? TRP A 1191 LEU A 1197 
AP 4 THR A 1147 ? TYR A 1154 ? THR A 1147 TYR A 1154 
AP 5 LEU G 42   ? ARG G 45   ? LEU I 42   ARG I 45   
AQ 1 LYS A 1290 ? PRO A 1292 ? LYS A 1290 PRO A 1292 
AQ 2 TYR A 1298 ? LYS A 1300 ? TYR A 1298 LYS A 1300 
AR 1 ASP A 1442 ? ILE A 1445 ? ASP A 1442 ILE A 1445 
AR 2 LEU E 132  ? TYR E 137  ? LEU F 132  TYR F 137  
AR 3 PHE E 143  ? SER E 147  ? PHE F 143  SER F 147  
BA 1 LEU B 69   ? LEU B 74   ? LEU B 69   LEU B 74   
BA 2 SER B 85   ? ASN B 103  ? SER B 85   ASN B 103  
BB 1 THR B 109  ? ALA B 111  ? THR B 109  ALA B 111  
BB 2 SER B 85   ? ASN B 103  ? SER B 85   ASN B 103  
BC 1 THR B 136  ? ALA B 139  ? THR B 136  ALA B 139  
BC 2 SER B 85   ? ASN B 103  ? SER B 85   ASN B 103  
BD 1 LYS B 164  ? PRO B 171  ? LYS B 164  PRO B 171  
BD 2 SER B 125  ? LYS B 133  ? SER B 125  LYS B 133  
BD 3 SER B 85   ? ASN B 103  ? SER B 85   ASN B 103  
BD 4 THR B 109  ? ALA B 111  ? THR B 109  ALA B 111  
BE 1 LYS B 164  ? PRO B 171  ? LYS B 164  PRO B 171  
BE 2 SER B 125  ? LYS B 133  ? SER B 125  LYS B 133  
BE 3 SER B 85   ? ASN B 103  ? SER B 85   ASN B 103  
BE 4 THR B 136  ? ALA B 139  ? THR B 136  ALA B 139  
BF 1 PHE B 203  ? ILE B 205  ? PHE B 203  ILE B 205  
BF 2 SER B 208  ? LEU B 212  ? SER B 208  LEU B 212  
BF 3 SER B 480  ? VAL B 482  ? SER B 480  VAL B 482  
BG 1 LYS B 404  ? ASP B 407  ? LYS B 404  ASP B 407  
BG 2 ALA B 214  ? SER B 218  ? ALA B 214  SER B 218  
BG 3 ARG B 497  ? ASN B 499  ? ARG B 497  ASN B 499  
BG 4 VAL B 536  ? ASN B 538  ? VAL B 536  ASN B 538  
BH 1 VAL B 223  ? LYS B 227  ? VAL B 223  LYS B 227  
BH 2 ILE B 234  ? ARG B 241  ? ILE B 234  ARG B 241  
BH 3 THR B 253  ? TYR B 259  ? THR B 253  TYR B 259  
BH 4 ILE B 269  ? THR B 272  ? ILE B 269  THR B 272  
BH 5 ASP B 279  ? PRO B 281  ? ASP B 279  PRO B 281  
BI 1 CYS B 544  ? ILE B 545  ? CYS B 544  ILE B 545  
BI 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BJ 1 GLU B 650  ? LEU B 651  ? GLU B 650  LEU B 651  
BJ 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BK 1 VAL B 690  ? ASP B 694  ? VAL B 690  ASP B 694  
BK 2 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BL 1 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
BL 2 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
BL 3 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BL 4 GLU B 650  ? LEU B 651  ? GLU B 650  LEU B 651  
BM 1 ILE B 703  ? ALA B 704  ? ILE B 703  ALA B 704  
BM 2 HIS B 740  ? CYS B 741  ? HIS B 740  CYS B 741  
BM 3 VAL B 633  ? GLU B 641  ? VAL B 633  GLU B 641  
BM 4 VAL B 690  ? ASP B 694  ? VAL B 690  ASP B 694  
BN 1 MET B 563  ? PRO B 565  ? MET B 563  PRO B 565  
BN 2 TRP B 586  ? HIS B 590  ? TRP B 586  HIS B 590  
BN 3 THR B 578  ? VAL B 582  ? THR B 578  VAL B 582  
BN 4 GLU B 623  ? PHE B 627  ? GLU B 623  PHE B 627  
BN 5 SER B 614  ? ASP B 618  ? SER B 614  ASP B 618  
BO 1 ALA B 793  ? LEU B 796  ? ALA B 793  LEU B 796  
BO 2 SER B 853  ? GLN B 862  ? SER B 853  GLN B 862  
BO 3 LYS B 962  ? LYS B 972  ? LYS B 962  LYS B 972  
BO 4 GLY B 947  ? THR B 956  ? GLY B 947  THR B 956  
BO 5 ARG B 904  ? VAL B 905  ? ARG B 904  VAL B 905  
BP 1 GLY B 804  ? THR B 805  ? GLY B 804  THR B 805  
BP 2 GLY B 1042 ? ASP B 1043 ? GLY B 1042 ASP B 1043 
BQ 1 GLY B 820  ? ILE B 827  ? GLY B 820  ILE B 827  
BQ 2 LYS B 1080 ? ARG B 1094 ? LYS B 1080 ARG B 1094 
BQ 3 SER B 838  ? ASN B 842  ? SER B 838  ASN B 842  
BQ 4 LYS B 987  ? TYR B 994  ? LYS B 987  TYR B 994  
BQ 5 LYS B 979  ? ALA B 981  ? LYS B 979  ALA B 981  
BQ 6 PHE B 1001 ? THR B 1002 ? PHE B 1001 THR B 1002 
BQ 7 PHE B 1069 ? TYR B 1073 ? PHE B 1069 TYR B 1073 
BQ 8 LEU B 1010 ? ILE B 1012 ? LEU B 1010 ILE B 1012 
BQ 9 GLY B 820  ? ILE B 827  ? GLY B 820  ILE B 827  
BR 1 VAL B 910  ? ILE B 912  ? VAL B 910  ILE B 912  
BR 2 THR B 939  ? PRO B 940  ? THR B 939  PRO B 940  
BS 1 ALA B 1157 ? CYS B 1163 ? ALA B 1157 CYS B 1163 
BS 2 ILE B 1191 ? PRO B 1197 ? ILE B 1191 PRO B 1197 
CA 1 GLN C 7    ? ALA C 13   ? GLN C 7    ALA C 13   
CA 2 ASN C 17   ? SER C 23   ? ASN C 17   SER C 23   
CA 3 PHE C 228  ? SER C 234  ? PHE C 228  SER C 234  
CA 4 ALA C 173  ? GLU C 179  ? ALA C 173  GLU C 179  
CB 1 VAL C 119  ? ILE C 120  ? VAL C 119  ILE C 120  
CB 2 SER C 96   ? PHE C 104  ? SER C 96   PHE C 104  
CB 3 GLU C 152  ? GLY C 162  ? GLU C 152  GLY C 162  
CB 4 THR C 43   ? ASN C 54   ? THR C 43   ASN C 54   
CB 5 VAL J 65   ? GLU J 68   ? VAL L 65   GLU L 68   
CC 1 LEU C 72   ? SER C 74   ? LEU C 72   SER C 74   
CC 2 ILE C 129  ? PRO C 132  ? ILE C 129  PRO C 132  
CD 1 THR C 111  ? TYR C 114  ? THR C 111  TYR C 114  
CD 2 LEU C 143  ? LEU C 147  ? LEU C 143  LEU C 147  
EA 1 PHE D 60   ? ALA D 62   ? PHE E 60   ALA E 62   
EA 2 LEU D 78   ? PHE D 82   ? LEU E 78   PHE E 82   
EA 3 THR D 107  ? TYR D 112  ? THR E 107  TYR E 112  
EA 4 THR D 131  ? ASN D 136  ? THR E 131  ASN E 136  
EB 1 SER D 87   ? VAL D 88   ? SER E 87   VAL E 88   
EB 2 ASN D 115  ? ILE D 116  ? ASN E 115  ILE E 116  
EC 1 LYS D 152  ? ARG D 155  ? LYS E 152  ARG E 155  
EC 2 VAL D 195  ? SER D 202  ? VAL E 195  SER E 202  
EC 3 GLY D 206  ? CYS D 214  ? GLY E 206  CYS E 214  
EC 4 ARG D 177  ? ILE D 178  ? ARG E 177  ILE E 178  
HA 1 TYR F 95   ? TYR F 98   ? TYR H 95   TYR H 98   
HA 2 TYR F 141  ? ARG F 145  ? TYR H 141  ARG H 145  
HA 3 SER F 54   ? THR F 58   ? SER H 54   THR H 58   
HA 4 ASP F 7    ? ASP F 16   ? ASP H 7    ASP H 16   
HA 5 CYS F 24   ? SER F 30   ? CYS H 24   SER H 30   
HA 6 LYS F 37   ? ILE F 42   ? LYS H 37   ILE H 42   
HA 7 LEU F 121  ? GLY F 127  ? LEU H 121  GLY H 127  
HA 8 ILE F 112  ? PHE F 118  ? ILE H 112  PHE H 118  
HA 9 THR F 100  ? GLU F 105  ? THR H 100  GLU H 105  
IA 1 TYR G 15   ? ASP G 19   ? TYR I 15   ASP I 19   
IA 2 ARG G 24   ? GLU G 28   ? ARG I 24   GLU I 28   
IA 3 VAL G 35   ? GLU G 37   ? VAL I 35   GLU I 37   
IB 1 ARG G 70   ? SER G 71   ? ARG I 70   SER I 71   
IB 2 ASN G 83   ? GLN G 87   ? ASN I 83   GLN I 87   
IB 3 LEU G 99   ? CYS G 103  ? LEU I 99   CYS I 103  
IB 4 ILE G 109  ? THR G 111  ? ILE I 109  THR I 111  
KA 1 LEU I 19   ? PRO I 23   ? LEU K 19   PRO K 23   
KA 2 ALA I 30   ? GLU I 36   ? ALA K 30   GLU K 36   
KA 3 ARG I 70   ? THR I 77   ? ARG K 70   THR K 77   
KA 4 VAL I 56   ? LYS I 62   ? VAL K 56   LYS K 62   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA 1 2 N ASP A 1419 ? N ASP A 1419 O VAL A 17   ? O VAL A 17   
AA 2 3 N GLN A 18   ? N GLN A 18   O ARG B 1215 ? O ARG B 1215 
AB 1 2 N VAL A 90   ? N VAL A 90   O LEU A 236  ? O LEU A 236  
AC 1 2 N VAL A 152  ? N VAL A 152  O VAL A 162  ? O VAL A 162  
AD 1 2 N ARG A 175  ? N ARG A 175  O VAL A 182  ? O VAL A 182  
AD 2 3 N TRP A 185  ? N TRP A 185  O GLU A 198  ? O GLU A 198  
AE 1 2 N VAL A 345  ? N VAL A 345  O LEU B 1128 ? O LEU B 1128 
AF 1 2 N ARG A 350  ? N ARG A 350  O HIS B 1104 ? O HIS B 1104 
AF 3 4 N VAL A 364  ? N VAL A 364  O ARG A 459  ? O ARG A 459  
AF 4 5 N HIS A 458  ? N HIS A 458  O VAL A 442  ? O VAL A 442  
AF 5 6 N GLY A 365  ? N GLY A 365  O ARG A 469  ? O ARG A 469  
AF 6 7 N THR A 351  ? N THR A 351  O MET A 487  ? O MET A 487  
AF 7 8 N ARG B 1106 ? N ARG B 1106 O SER A 348  ? O SER A 348  
AG 1 2 N GLU A 378  ? N GLU A 378  O VAL A 432  ? O VAL A 432  
AG 2 3 O GLU A 433  ? O GLU A 433  N LYS A 403  ? N LYS A 403  
AG 3 4 N VAL A 405  ? N VAL A 405  O ILE A 413  ? O ILE A 413  
AH 1 2 N SER A 513  ? N SER A 513  O LYS A 518  ? O LYS A 518  
AI 1 2 N ILE A 541  ? N ILE A 541  O TRP A 572  ? O TRP A 572  
AJ 1 2 N ARG A 590  ? N ARG A 590  O MET A 605  ? O MET A 605  
AJ 2 3 O LEU A 606  ? O LEU A 606  N ILE A 613  ? N ILE A 613  
AK 1 2 N GLY A 766  ? N GLY A 766  O VAL A 800  ? O VAL A 800  
AL 1 2 N VAL A 770  ? N VAL A 770  O LYS A 773  ? O LYS A 773  
AM 1 2 N MET A 849  ? N MET A 849  O ARG A 857  ? O ARG A 857  
AM 2 3 O THR A 856  ? O THR A 856  N ILE A 864  ? N ILE A 864  
AN 1 2 N GLN A 881  ? N GLN A 881  O TRP A 954  ? O TRP A 954  
AO 1 2 N TYR A 1287 ? N TYR A 1287 O GLU A 1303 ? O GLU A 1303 
AO 2 3 N THR A 1308 ? N THR A 1308 O LEU A 1116 ? O LEU A 1116 
AO 3 4 N THR A 1117 ? N THR A 1117 O TYR A 1328 ? O TYR A 1328 
AP 1 2 N ILE A 1227 ? N ILE A 1227 O ARG A 1239 ? O ARG A 1239 
AP 2 3 N CYS A 1240 ? N CYS A 1240 O LEU A 1193 ? O LEU A 1193 
AP 3 4 O GLU A 1196 ? O GLU A 1196 N ILE A 1148 ? N ILE A 1148 
AP 4 5 O ILE A 1152 ? O ILE A 1152 N VAL G 43   ? N VAL I 43   
AQ 1 2 N VAL A 1291 ? N VAL A 1291 O VAL A 1299 ? O VAL A 1299 
AR 1 2 N MET A 1444 ? N MET A 1444 O VAL E 133  ? O VAL F 133  
AR 2 3 N ARG E 136  ? N ARG F 136  O GLU E 144  ? O GLU F 144  
BA 1 2 N GLN B 73   ? N GLN B 73   O ARG B 86   ? O ARG B 86   
BB 1 2 N HIS B 110  ? N HIS B 110  O VAL B 102  ? O VAL B 102  
BC 1 2 N ALA B 139  ? N ALA B 139  O SER B 85   ? O SER B 85   
BD 1 2 N LEU B 170  ? N LEU B 170  O SER B 126  ? O SER B 126  
BD 2 3 N LYS B 133  ? N LYS B 133  O SER B 91   ? O SER B 91   
BD 3 4 N VAL B 102  ? N VAL B 102  O HIS B 110  ? O HIS B 110  
BE 1 2 N LEU B 170  ? N LEU B 170  O SER B 126  ? O SER B 126  
BE 2 3 N LYS B 133  ? N LYS B 133  O SER B 91   ? O SER B 91   
BE 3 4 N LYS B 87   ? N LYS B 87   O TYR B 137  ? O TYR B 137  
BF 1 2 N ILE B 205  ? N ILE B 205  O SER B 208  ? O SER B 208  
BF 2 3 N VAL B 211  ? N VAL B 211  O GLN B 481  ? O GLN B 481  
BG 1 2 N ASP B 407  ? N ASP B 407  O GLN B 215  ? O GLN B 215  
BG 2 3 N ALA B 214  ? N ALA B 214  O ARG B 497  ? O ARG B 497  
BG 3 4 N THR B 498  ? N THR B 498  O LYS B 537  ? O LYS B 537  
BH 1 2 N PHE B 226  ? N PHE B 226  O VAL B 237  ? O VAL B 237  
BH 2 3 N ILE B 240  ? N ILE B 240  O LEU B 254  ? O LEU B 254  
BH 3 4 N LYS B 257  ? N LYS B 257  O LYS B 270  ? O LYS B 270  
BH 4 5 N ALA B 271  ? N ALA B 271  O ILE B 280  ? O ILE B 280  
BI 1 2 N CYS B 544  ? N CYS B 544  O TYR B 634  ? O TYR B 634  
BJ 1 2 N GLU B 650  ? N GLU B 650  O GLU B 641  ? O GLU B 641  
BK 1 2 N ILE B 693  ? N ILE B 693  O ARG B 635  ? O ARG B 635  
BL 1 2 N ALA B 704  ? N ALA B 704  O HIS B 740  ? O HIS B 740  
BL 2 3 N CYS B 741  ? N CYS B 741  O PHE B 638  ? O PHE B 638  
BL 3 4 N GLU B 641  ? N GLU B 641  O GLU B 650  ? O GLU B 650  
BM 1 2 N ALA B 704  ? N ALA B 704  O HIS B 740  ? O HIS B 740  
BM 2 3 N CYS B 741  ? N CYS B 741  O PHE B 638  ? O PHE B 638  
BM 3 4 N LEU B 637  ? N LEU B 637  O GLU B 691  ? O GLU B 691  
BN 1 2 N GLU B 564  ? N GLU B 564  O VAL B 589  ? O VAL B 589  
BN 2 3 N HIS B 590  ? N HIS B 590  O THR B 578  ? O THR B 578  
BN 3 4 N PHE B 581  ? N PHE B 581  O LEU B 624  ? O LEU B 624  
BN 4 5 N PHE B 627  ? N PHE B 627  O SER B 614  ? O SER B 614  
BO 1 2 N ILE B 795  ? N ILE B 795  O LEU B 854  ? O LEU B 854  
BO 2 3 N ASP B 861  ? N ASP B 861  O VAL B 964  ? O VAL B 964  
BO 3 4 N ARG B 969  ? N ARG B 969  O ILE B 948  ? O ILE B 948  
BO 4 5 N GLY B 947  ? N GLY B 947  O VAL B 905  ? O VAL B 905  
BP 1 2 N THR B 805  ? N THR B 805  O GLY B 1042 ? O GLY B 1042 
BQ 1 2 N ILE B 827  ? N ILE B 827  O PHE B 1086 ? O PHE B 1086 
BQ 3 4 N MET B 839  ? N MET B 839  O THR B 989  ? O THR B 989  
BQ 4 5 N GLY B 988  ? N GLY B 988  O PHE B 980  ? O PHE B 980  
BQ 6 7 N PHE B 1001 ? N PHE B 1001 O TYR B 1073 ? O TYR B 1073 
BQ 8 9 N TYR B 1092 ? N TYR B 1092 O GLN B 821  ? O GLN B 821  
BR 1 2 N ILE B 911  ? N ILE B 911  O THR B 939  ? O THR B 939  
BS 1 2 N ILE B 1162 ? N ILE B 1162 O TYR B 1192 ? O TYR B 1192 
CA 1 2 N ARG C 11   ? N ARG C 11   O ASP C 19   ? O ASP C 19   
CA 2 3 N LEU C 22   ? N LEU C 22   O PHE C 228  ? O PHE C 228  
CA 3 4 O GLU C 233  ? O GLU C 233  N ALA C 174  ? N ALA C 174  
CB 1 2 N VAL C 119  ? N VAL C 119  O THR C 100  ? O THR C 100  
CB 2 3 N ALA C 103  ? N ALA C 103  O LEU C 153  ? O LEU C 153  
CB 3 4 N GLY C 162  ? N GLY C 162  O THR C 43   ? O THR C 43   
CB 4 5 N VAL C 51   ? N VAL C 51   O VAL J 65   ? O VAL L 65   
CC 1 2 O GLN C 73   ? O GLN C 73   N GLY C 130  ? N GLY C 130  
CD 1 2 O VAL C 113  ? O VAL C 113  N ILE C 144  ? N ILE C 144  
EA 1 2 N ALA D 62   ? N ALA E 62   O LEU D 78   ? O LEU E 78   
EA 2 3 N TRP D 79   ? N TRP E 79   O THR D 107  ? O THR E 107  
EA 3 4 N GLY D 108  ? N GLY E 108  O THR D 131  ? O THR E 131  
EB 1 2 N VAL D 88   ? N VAL E 88   O ASN D 115  ? O ASN E 115  
EC 1 2 N ILE D 154  ? N ILE E 154  O LYS D 197  ? O LYS E 197  
EC 2 3 N SER D 202  ? N SER E 202  O GLY D 206  ? O GLY E 206  
EC 3 4 O ILE D 213  ? O ILE E 213  N ILE D 178  ? N ILE E 178  
HA 1 2 N MET F 97   ? N MET H 97   O LEU F 142  ? O LEU H 142  
HA 2 3 N ARG F 145  ? N ARG H 145  O THR F 56   ? O THR H 56   
HA 3 4 N VAL F 57   ? N VAL H 57   O ASP F 8    ? O ASP H 8    
HA 4 5 N ASP F 16   ? N ASP H 16   O ARG F 25   ? O ARG H 25   
HA 5 6 N ALA F 28   ? N ALA H 28   O LEU F 38   ? O LEU H 38   
HA 6 7 N ASP F 41   ? N ASP H 41   O LEU F 122  ? O LEU H 122  
HA 7 8 N GLY F 127  ? N GLY H 127  O ILE F 112  ? O ILE H 112  
HA 8 9 N SER F 117  ? N SER H 117  O THR F 100  ? O THR H 100  
IA 1 2 N ASP G 19   ? N ASP I 19   O ARG G 24   ? O ARG I 24   
IA 2 3 N PHE G 27   ? N PHE I 27   O GLU G 36   ? O GLU I 36   
IB 1 2 N SER G 71   ? N SER I 71   O ASN G 83   ? O ASN I 83   
IB 2 3 N PHE G 86   ? N PHE I 86   O PHE G 100  ? O PHE I 100  
IB 3 4 N PHE G 101  ? N PHE I 101  O PHE G 110  ? O PHE I 110  
KA 1 2 N ASP I 22   ? N ASP K 22   O VAL I 32   ? O VAL K 32   
KA 2 3 N PHE I 35   ? N PHE K 35   O PHE I 71   ? O PHE K 71   
KA 3 4 O GLN I 76   ? O GLN K 76   N LEU I 57   ? N LEU K 57   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2456' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 2457' 
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 2458' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 2225' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN C 1269' 
AC6 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 1121' 
AC7 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN I 1122' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN J 1066' 
AC9 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN L 1071' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 107  ? CYS A 107  . ? 1_555 ? 
2  AC1 4 CYS A 110  ? CYS A 110  . ? 1_555 ? 
3  AC1 4 CYS A 148  ? CYS A 148  . ? 1_555 ? 
4  AC1 4 CYS A 167  ? CYS A 167  . ? 1_555 ? 
5  AC2 4 CYS A 67   ? CYS A 67   . ? 1_555 ? 
6  AC2 4 CYS A 70   ? CYS A 70   . ? 1_555 ? 
7  AC2 4 CYS A 77   ? CYS A 77   . ? 1_555 ? 
8  AC2 4 HIS A 80   ? HIS A 80   . ? 1_555 ? 
9  AC3 4 ASP A 481  ? ASP A 481  . ? 1_555 ? 
10 AC3 4 ASP A 483  ? ASP A 483  . ? 1_555 ? 
11 AC3 4 ASP A 485  ? ASP A 485  . ? 1_555 ? 
12 AC3 4 A   L 6    ? A   P 10   . ? 1_555 ? 
13 AC4 4 CYS B 1163 ? CYS B 1163 . ? 1_555 ? 
14 AC4 4 CYS B 1166 ? CYS B 1166 . ? 1_555 ? 
15 AC4 4 CYS B 1182 ? CYS B 1182 . ? 1_555 ? 
16 AC4 4 CYS B 1185 ? CYS B 1185 . ? 1_555 ? 
17 AC5 4 CYS C 86   ? CYS C 86   . ? 1_555 ? 
18 AC5 4 CYS C 88   ? CYS C 88   . ? 1_555 ? 
19 AC5 4 CYS C 92   ? CYS C 92   . ? 1_555 ? 
20 AC5 4 CYS C 95   ? CYS C 95   . ? 1_555 ? 
21 AC6 4 CYS G 7    ? CYS I 7    . ? 1_555 ? 
22 AC6 4 CYS G 10   ? CYS I 10   . ? 1_555 ? 
23 AC6 4 CYS G 29   ? CYS I 29   . ? 1_555 ? 
24 AC6 4 CYS G 32   ? CYS I 32   . ? 1_555 ? 
25 AC7 4 CYS G 75   ? CYS I 75   . ? 1_555 ? 
26 AC7 4 CYS G 78   ? CYS I 78   . ? 1_555 ? 
27 AC7 4 CYS G 103  ? CYS I 103  . ? 1_555 ? 
28 AC7 4 CYS G 106  ? CYS I 106  . ? 1_555 ? 
29 AC8 4 CYS H 7    ? CYS J 7    . ? 1_555 ? 
30 AC8 4 CYS H 10   ? CYS J 10   . ? 1_555 ? 
31 AC8 4 CYS H 45   ? CYS J 45   . ? 1_555 ? 
32 AC8 4 CYS H 46   ? CYS J 46   . ? 1_555 ? 
33 AC9 4 CYS J 31   ? CYS L 31   . ? 1_555 ? 
34 AC9 4 CYS J 34   ? CYS L 34   . ? 1_555 ? 
35 AC9 4 CYS J 48   ? CYS L 48   . ? 1_555 ? 
36 AC9 4 CYS J 51   ? CYS L 51   . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          4V1M 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    4V1M 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
BR 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . GLY A 1  3    ? 153.934 179.632 200.328 1.00 96.24  ?  3    GLY A N     1 
ATOM   2     C  CA    . GLY A 1  3    ? 154.553 180.693 201.125 1.00 95.48  ?  3    GLY A CA    1 
ATOM   3     C  C     . GLY A 1  3    ? 154.802 180.325 202.576 1.00 96.50  ?  3    GLY A C     1 
ATOM   4     O  O     . GLY A 1  3    ? 154.962 179.140 202.896 1.00 97.32  ?  3    GLY A O     1 
ATOM   5     N  N     . GLN A 1  4    ? 154.865 181.342 203.461 1.00 88.85  ?  4    GLN A N     1 
ATOM   6     C  CA    . GLN A 1  4    ? 155.034 181.128 204.905 1.00 87.38  ?  4    GLN A CA    1 
ATOM   7     C  C     . GLN A 1  4    ? 153.795 181.605 205.628 1.00 89.76  ?  4    GLN A C     1 
ATOM   8     O  O     . GLN A 1  4    ? 153.215 182.599 205.208 1.00 89.23  ?  4    GLN A O     1 
ATOM   9     C  CB    . GLN A 1  4    ? 156.306 181.774 205.451 1.00 87.88  ?  4    GLN A CB    1 
ATOM   10    C  CG    . GLN A 1  4    ? 157.401 180.744 205.711 1.00 84.37  ?  4    GLN A CG    1 
ATOM   11    C  CD    . GLN A 1  4    ? 158.685 181.371 206.178 1.00 84.83  ?  4    GLN A CD    1 
ATOM   12    O  OE1   . GLN A 1  4    ? 159.460 181.946 205.401 1.00 86.27  ?  4    GLN A OE1   1 
ATOM   13    N  NE2   . GLN A 1  4    ? 158.943 181.270 207.457 1.00 56.06  ?  4    GLN A NE2   1 
ATOM   14    N  N     . GLN A 1  5    ? 153.353 180.891 206.677 1.00 85.89  ?  5    GLN A N     1 
ATOM   15    C  CA    . GLN A 1  5    ? 152.088 181.201 207.361 1.00 85.78  ?  5    GLN A CA    1 
ATOM   16    C  C     . GLN A 1  5    ? 151.999 182.406 208.293 1.00 85.56  ?  5    GLN A C     1 
ATOM   17    O  O     . GLN A 1  5    ? 153.029 182.845 208.787 1.00 86.14  ?  5    GLN A O     1 
ATOM   18    C  CB    . GLN A 1  5    ? 151.428 179.939 207.937 1.00 88.48  ?  5    GLN A CB    1 
ATOM   19    C  CG    . GLN A 1  5    ? 150.847 179.034 206.825 1.00 115.16 ?  5    GLN A CG    1 
ATOM   20    C  CD    . GLN A 1  5    ? 150.165 179.774 205.666 1.00 133.94 ?  5    GLN A CD    1 
ATOM   21    O  OE1   . GLN A 1  5    ? 150.463 179.530 204.483 1.00 127.51 ?  5    GLN A OE1   1 
ATOM   22    N  NE2   . GLN A 1  5    ? 149.238 180.696 205.976 1.00 123.31 ?  5    GLN A NE2   1 
ATOM   23    N  N     . TYR A 1  6    ? 150.774 182.975 208.498 1.00 77.69  ?  6    TYR A N     1 
ATOM   24    C  CA    . TYR A 1  6    ? 150.587 184.149 209.370 1.00 75.45  ?  6    TYR A CA    1 
ATOM   25    C  C     . TYR A 1  6    ? 150.995 183.829 210.790 1.00 75.79  ?  6    TYR A C     1 
ATOM   26    O  O     . TYR A 1  6    ? 150.593 182.789 211.318 1.00 75.59  ?  6    TYR A O     1 
ATOM   27    C  CB    . TYR A 1  6    ? 149.123 184.665 209.367 1.00 76.16  ?  6    TYR A CB    1 
ATOM   28    C  CG    . TYR A 1  6    ? 148.818 185.637 210.497 1.00 77.79  ?  6    TYR A CG    1 
ATOM   29    C  CD1   . TYR A 1  6    ? 149.100 186.993 210.372 1.00 79.96  ?  6    TYR A CD1   1 
ATOM   30    C  CD2   . TYR A 1  6    ? 148.306 185.191 211.712 1.00 79.32  ?  6    TYR A CD2   1 
ATOM   31    C  CE1   . TYR A 1  6    ? 148.887 187.883 211.432 1.00 81.73  ?  6    TYR A CE1   1 
ATOM   32    C  CE2   . TYR A 1  6    ? 148.083 186.071 212.777 1.00 80.80  ?  6    TYR A CE2   1 
ATOM   33    C  CZ    . TYR A 1  6    ? 148.376 187.416 212.633 1.00 86.16  ?  6    TYR A CZ    1 
ATOM   34    O  OH    . TYR A 1  6    ? 148.163 188.286 213.677 1.00 83.64  ?  6    TYR A OH    1 
ATOM   35    N  N     . SER A 1  7    ? 151.753 184.736 211.417 1.00 69.25  ?  7    SER A N     1 
ATOM   36    C  CA    . SER A 1  7    ? 152.135 184.579 212.810 1.00 68.83  ?  7    SER A CA    1 
ATOM   37    C  C     . SER A 1  7    ? 151.730 185.804 213.570 1.00 74.47  ?  7    SER A C     1 
ATOM   38    O  O     . SER A 1  7    ? 152.041 186.930 213.156 1.00 74.56  ?  7    SER A O     1 
ATOM   39    C  CB    . SER A 1  7    ? 153.634 184.358 212.947 1.00 70.41  ?  7    SER A CB    1 
ATOM   40    O  OG    . SER A 1  7    ? 153.992 184.183 214.307 1.00 75.07  ?  7    SER A OG    1 
ATOM   41    N  N     . SER A 1  8    ? 151.054 185.599 214.694 1.00 72.31  ?  8    SER A N     1 
ATOM   42    C  CA    . SER A 1  8    ? 150.617 186.708 215.542 1.00 73.96  ?  8    SER A CA    1 
ATOM   43    C  C     . SER A 1  8    ? 151.764 187.557 216.133 1.00 78.38  ?  8    SER A C     1 
ATOM   44    O  O     . SER A 1  8    ? 151.520 188.697 216.540 1.00 78.65  ?  8    SER A O     1 
ATOM   45    C  CB    . SER A 1  8    ? 149.740 186.188 216.671 1.00 81.05  ?  8    SER A CB    1 
ATOM   46    O  OG    . SER A 1  8    ? 150.403 185.141 217.355 1.00 96.68  ?  8    SER A OG    1 
ATOM   47    N  N     . ALA A 1  9    ? 152.999 186.992 216.190 1.00 74.41  ?  9    ALA A N     1 
ATOM   48    C  CA    . ALA A 1  9    ? 154.204 187.645 216.720 1.00 74.13  ?  9    ALA A CA    1 
ATOM   49    C  C     . ALA A 1  9    ? 154.503 188.990 216.049 1.00 75.54  ?  9    ALA A C     1 
ATOM   50    O  O     . ALA A 1  9    ? 154.586 189.053 214.826 1.00 75.94  ?  9    ALA A O     1 
ATOM   51    C  CB    . ALA A 1  9    ? 155.405 186.728 216.593 1.00 74.72  ?  9    ALA A CB    1 
ATOM   52    N  N     . PRO A 1  10   ? 154.639 190.074 216.833 1.00 69.03  ?  10   PRO A N     1 
ATOM   53    C  CA    . PRO A 1  10   ? 154.913 191.388 216.252 1.00 67.64  ?  10   PRO A CA    1 
ATOM   54    C  C     . PRO A 1  10   ? 156.147 191.413 215.377 1.00 68.77  ?  10   PRO A C     1 
ATOM   55    O  O     . PRO A 1  10   ? 157.214 190.961 215.811 1.00 69.86  ?  10   PRO A O     1 
ATOM   56    C  CB    . PRO A 1  10   ? 155.126 192.272 217.486 1.00 70.45  ?  10   PRO A CB    1 
ATOM   57    C  CG    . PRO A 1  10   ? 155.443 191.332 218.585 1.00 75.91  ?  10   PRO A CG    1 
ATOM   58    C  CD    . PRO A 1  10   ? 154.572 190.164 218.299 1.00 71.65  ?  10   PRO A CD    1 
ATOM   59    N  N     . LEU A 1  11   ? 156.010 191.940 214.153 1.00 61.15  ?  11   LEU A N     1 
ATOM   60    C  CA    . LEU A 1  11   ? 157.154 192.003 213.251 1.00 59.07  ?  11   LEU A CA    1 
ATOM   61    C  C     . LEU A 1  11   ? 158.018 193.253 213.458 1.00 65.48  ?  11   LEU A C     1 
ATOM   62    O  O     . LEU A 1  11   ? 157.519 194.381 213.345 1.00 67.59  ?  11   LEU A O     1 
ATOM   63    C  CB    . LEU A 1  11   ? 156.725 191.813 211.780 1.00 57.37  ?  11   LEU A CB    1 
ATOM   64    C  CG    . LEU A 1  11   ? 157.672 192.280 210.681 1.00 59.96  ?  11   LEU A CG    1 
ATOM   65    C  CD1   . LEU A 1  11   ? 158.856 191.390 210.554 1.00 60.67  ?  11   LEU A CD1   1 
ATOM   66    C  CD2   . LEU A 1  11   ? 156.988 192.327 209.397 1.00 59.25  ?  11   LEU A CD2   1 
ATOM   67    N  N     . ARG A 1  12   ? 159.321 193.035 213.716 1.00 60.80  ?  12   ARG A N     1 
ATOM   68    C  CA    . ARG A 1  12   ? 160.331 194.082 213.876 1.00 60.72  ?  12   ARG A CA    1 
ATOM   69    C  C     . ARG A 1  12   ? 161.581 193.854 212.959 1.00 64.58  ?  12   ARG A C     1 
ATOM   70    O  O     . ARG A 1  12   ? 161.676 192.840 212.231 1.00 62.90  ?  12   ARG A O     1 
ATOM   71    C  CB    . ARG A 1  12   ? 160.744 194.206 215.352 1.00 62.08  ?  12   ARG A CB    1 
ATOM   72    C  CG    . ARG A 1  12   ? 160.139 195.363 216.107 1.00 76.54  ?  12   ARG A CG    1 
ATOM   73    C  CD    . ARG A 1  12   ? 159.152 194.816 217.110 1.00 91.73  ?  12   ARG A CD    1 
ATOM   74    N  NE    . ARG A 1  12   ? 158.864 195.716 218.236 1.00 103.57 ?  12   ARG A NE    1 
ATOM   75    C  CZ    . ARG A 1  12   ? 159.651 195.889 219.298 1.00 116.17 ?  12   ARG A CZ    1 
ATOM   76    N  NH1   . ARG A 1  12   ? 160.834 195.292 219.361 1.00 108.40 1  12   ARG A NH1   1 
ATOM   77    N  NH2   . ARG A 1  12   ? 159.273 196.680 220.292 1.00 95.82  ?  12   ARG A NH2   1 
ATOM   78    N  N     . THR A 1  13   ? 162.505 194.852 212.966 1.00 62.11  ?  13   THR A N     1 
ATOM   79    C  CA    . THR A 1  13   ? 163.778 194.858 212.220 1.00 61.57  ?  13   THR A CA    1 
ATOM   80    C  C     . THR A 1  13   ? 164.895 194.696 213.225 1.00 66.39  ?  13   THR A C     1 
ATOM   81    O  O     . THR A 1  13   ? 164.767 195.164 214.361 1.00 67.65  ?  13   THR A O     1 
ATOM   82    C  CB    . THR A 1  13   ? 164.021 196.176 211.413 1.00 68.84  ?  13   THR A CB    1 
ATOM   83    O  OG1   . THR A 1  13   ? 163.173 197.235 211.852 1.00 73.92  ?  13   THR A OG1   1 
ATOM   84    C  CG2   . THR A 1  13   ? 163.856 195.994 209.930 1.00 65.66  ?  13   THR A CG2   1 
ATOM   85    N  N     . VAL A 1  14   ? 165.997 194.045 212.824 1.00 61.31  ?  14   VAL A N     1 
ATOM   86    C  CA    . VAL A 1  14   ? 167.144 193.900 213.713 1.00 60.13  ?  14   VAL A CA    1 
ATOM   87    C  C     . VAL A 1  14   ? 167.852 195.254 213.758 1.00 65.79  ?  14   VAL A C     1 
ATOM   88    O  O     . VAL A 1  14   ? 168.202 195.823 212.709 1.00 64.67  ?  14   VAL A O     1 
ATOM   89    C  CB    . VAL A 1  14   ? 168.058 192.698 213.383 1.00 61.34  ?  14   VAL A CB    1 
ATOM   90    C  CG1   . VAL A 1  14   ? 169.306 192.703 214.262 1.00 61.34  ?  14   VAL A CG1   1 
ATOM   91    C  CG2   . VAL A 1  14   ? 167.294 191.384 213.549 1.00 60.36  ?  14   VAL A CG2   1 
ATOM   92    N  N     . LYS A 1  15   ? 167.902 195.824 214.976 1.00 63.54  ?  15   LYS A N     1 
ATOM   93    C  CA    . LYS A 1  15   ? 168.510 197.126 215.236 1.00 63.17  ?  15   LYS A CA    1 
ATOM   94    C  C     . LYS A 1  15   ? 169.913 196.960 215.742 1.00 68.81  ?  15   LYS A C     1 
ATOM   95    O  O     . LYS A 1  15   ? 170.728 197.857 215.537 1.00 69.73  ?  15   LYS A O     1 
ATOM   96    C  CB    . LYS A 1  15   ? 167.679 197.950 216.225 1.00 64.49  ?  15   LYS A CB    1 
ATOM   97    C  CG    . LYS A 1  15   ? 166.996 199.123 215.547 1.00 75.98  ?  15   LYS A CG    1 
ATOM   98    C  CD    . LYS A 1  15   ? 165.474 199.015 215.558 1.00 83.68  ?  15   LYS A CD    1 
ATOM   99    C  CE    . LYS A 1  15   ? 164.905 198.404 214.305 1.00 86.98  ?  15   LYS A CE    1 
ATOM   100   N  NZ    . LYS A 1  15   ? 163.558 197.794 214.547 1.00 92.37  1  15   LYS A NZ    1 
ATOM   101   N  N     . GLU A 1  16   ? 170.208 195.816 216.398 1.00 65.15  ?  16   GLU A N     1 
ATOM   102   C  CA    . GLU A 1  16   ? 171.520 195.559 216.987 1.00 65.35  ?  16   GLU A CA    1 
ATOM   103   C  C     . GLU A 1  16   ? 171.884 194.088 216.973 1.00 67.71  ?  16   GLU A C     1 
ATOM   104   O  O     . GLU A 1  16   ? 171.014 193.224 217.158 1.00 67.01  ?  16   GLU A O     1 
ATOM   105   C  CB    . GLU A 1  16   ? 171.540 196.017 218.458 1.00 68.00  ?  16   GLU A CB    1 
ATOM   106   C  CG    . GLU A 1  16   ? 171.676 197.504 218.751 1.00 79.08  ?  16   GLU A CG    1 
ATOM   107   C  CD    . GLU A 1  16   ? 171.486 197.831 220.223 1.00 100.18 ?  16   GLU A CD    1 
ATOM   108   O  OE1   . GLU A 1  16   ? 171.033 196.945 220.994 1.00 84.03  ?  16   GLU A OE1   1 
ATOM   109   O  OE2   . GLU A 1  16   ? 171.780 198.991 220.601 1.00 91.28  -1 16   GLU A OE2   1 
ATOM   110   N  N     . VAL A 1  17   ? 173.187 193.801 216.820 1.00 63.71  ?  17   VAL A N     1 
ATOM   111   C  CA    . VAL A 1  17   ? 173.666 192.429 216.918 1.00 63.73  ?  17   VAL A CA    1 
ATOM   112   C  C     . VAL A 1  17   ? 174.608 192.395 218.104 1.00 68.24  ?  17   VAL A C     1 
ATOM   113   O  O     . VAL A 1  17   ? 175.645 193.062 218.106 1.00 67.40  ?  17   VAL A O     1 
ATOM   114   C  CB    . VAL A 1  17   ? 174.262 191.760 215.651 1.00 67.31  ?  17   VAL A CB    1 
ATOM   115   C  CG1   . VAL A 1  17   ? 174.285 190.245 215.820 1.00 67.20  ?  17   VAL A CG1   1 
ATOM   116   C  CG2   . VAL A 1  17   ? 173.478 192.125 214.401 1.00 66.55  ?  17   VAL A CG2   1 
ATOM   117   N  N     . GLN A 1  18   ? 174.188 191.682 219.148 1.00 65.59  ?  18   GLN A N     1 
ATOM   118   C  CA    . GLN A 1  18   ? 174.953 191.557 220.366 1.00 66.45  ?  18   GLN A CA    1 
ATOM   119   C  C     . GLN A 1  18   ? 175.707 190.248 220.349 1.00 73.17  ?  18   GLN A C     1 
ATOM   120   O  O     . GLN A 1  18   ? 175.151 189.189 220.680 1.00 73.90  ?  18   GLN A O     1 
ATOM   121   C  CB    . GLN A 1  18   ? 174.050 191.703 221.608 1.00 68.28  ?  18   GLN A CB    1 
ATOM   122   C  CG    . GLN A 1  18   ? 174.794 191.739 222.957 1.00 75.36  ?  18   GLN A CG    1 
ATOM   123   C  CD    . GLN A 1  18   ? 175.994 192.653 222.988 1.00 81.33  ?  18   GLN A CD    1 
ATOM   124   O  OE1   . GLN A 1  18   ? 177.129 192.244 222.725 1.00 75.67  ?  18   GLN A OE1   1 
ATOM   125   N  NE2   . GLN A 1  18   ? 175.769 193.906 223.320 1.00 70.06  ?  18   GLN A NE2   1 
ATOM   126   N  N     . PHE A 1  19   ? 176.989 190.334 219.944 1.00 69.80  ?  19   PHE A N     1 
ATOM   127   C  CA    . PHE A 1  19   ? 177.907 189.203 219.890 1.00 69.05  ?  19   PHE A CA    1 
ATOM   128   C  C     . PHE A 1  19   ? 178.271 188.752 221.290 1.00 76.57  ?  19   PHE A C     1 
ATOM   129   O  O     . PHE A 1  19   ? 178.169 189.524 222.247 1.00 76.41  ?  19   PHE A O     1 
ATOM   130   C  CB    . PHE A 1  19   ? 179.148 189.532 219.053 1.00 69.36  ?  19   PHE A CB    1 
ATOM   131   C  CG    . PHE A 1  19   ? 178.797 189.629 217.596 1.00 69.07  ?  19   PHE A CG    1 
ATOM   132   C  CD1   . PHE A 1  19   ? 178.795 188.504 216.791 1.00 70.81  ?  19   PHE A CD1   1 
ATOM   133   C  CD2   . PHE A 1  19   ? 178.365 190.829 217.047 1.00 71.01  ?  19   PHE A CD2   1 
ATOM   134   C  CE1   . PHE A 1  19   ? 178.404 188.581 215.451 1.00 70.72  ?  19   PHE A CE1   1 
ATOM   135   C  CE2   . PHE A 1  19   ? 177.965 190.903 215.708 1.00 72.60  ?  19   PHE A CE2   1 
ATOM   136   C  CZ    . PHE A 1  19   ? 178.001 189.780 214.917 1.00 69.76  ?  19   PHE A CZ    1 
ATOM   137   N  N     . GLY A 1  20   ? 178.625 187.484 221.398 1.00 75.63  ?  20   GLY A N     1 
ATOM   138   C  CA    . GLY A 1  20   ? 179.006 186.867 222.658 1.00 77.17  ?  20   GLY A CA    1 
ATOM   139   C  C     . GLY A 1  20   ? 179.431 185.426 222.492 1.00 82.85  ?  20   GLY A C     1 
ATOM   140   O  O     . GLY A 1  20   ? 179.616 184.941 221.368 1.00 82.85  ?  20   GLY A O     1 
ATOM   141   N  N     . LEU A 1  21   ? 179.576 184.731 223.625 1.00 79.62  ?  21   LEU A N     1 
ATOM   142   C  CA    . LEU A 1  21   ? 179.947 183.319 223.711 1.00 78.35  ?  21   LEU A CA    1 
ATOM   143   C  C     . LEU A 1  21   ? 178.874 182.551 224.490 1.00 81.92  ?  21   LEU A C     1 
ATOM   144   O  O     . LEU A 1  21   ? 178.152 183.120 225.328 1.00 81.38  ?  21   LEU A O     1 
ATOM   145   C  CB    . LEU A 1  21   ? 181.335 183.157 224.364 1.00 78.61  ?  21   LEU A CB    1 
ATOM   146   C  CG    . LEU A 1  21   ? 182.491 183.947 223.732 1.00 82.05  ?  21   LEU A CG    1 
ATOM   147   C  CD1   . LEU A 1  21   ? 183.746 183.794 224.533 1.00 82.58  ?  21   LEU A CD1   1 
ATOM   148   C  CD2   . LEU A 1  21   ? 182.721 183.556 222.280 1.00 82.56  ?  21   LEU A CD2   1 
ATOM   149   N  N     . PHE A 1  22   ? 178.745 181.266 224.181 1.00 78.28  ?  22   PHE A N     1 
ATOM   150   C  CA    . PHE A 1  22   ? 177.761 180.439 224.849 1.00 78.74  ?  22   PHE A CA    1 
ATOM   151   C  C     . PHE A 1  22   ? 178.257 179.903 226.195 1.00 84.69  ?  22   PHE A C     1 
ATOM   152   O  O     . PHE A 1  22   ? 179.325 179.280 226.271 1.00 84.56  ?  22   PHE A O     1 
ATOM   153   C  CB    . PHE A 1  22   ? 177.366 179.271 223.945 1.00 80.03  ?  22   PHE A CB    1 
ATOM   154   C  CG    . PHE A 1  22   ? 176.120 179.437 223.105 1.00 80.92  ?  22   PHE A CG    1 
ATOM   155   C  CD1   . PHE A 1  22   ? 174.861 179.476 223.696 1.00 82.99  ?  22   PHE A CD1   1 
ATOM   156   C  CD2   . PHE A 1  22   ? 176.191 179.415 221.714 1.00 82.31  ?  22   PHE A CD2   1 
ATOM   157   C  CE1   . PHE A 1  22   ? 173.710 179.561 222.917 1.00 82.49  ?  22   PHE A CE1   1 
ATOM   158   C  CE2   . PHE A 1  22   ? 175.031 179.510 220.935 1.00 83.51  ?  22   PHE A CE2   1 
ATOM   159   C  CZ    . PHE A 1  22   ? 173.802 179.579 221.544 1.00 80.95  ?  22   PHE A CZ    1 
ATOM   160   N  N     . SER A 1  23   ? 177.481 180.152 227.262 1.00 82.70  ?  23   SER A N     1 
ATOM   161   C  CA    . SER A 1  23   ? 177.745 179.578 228.577 1.00 83.92  ?  23   SER A CA    1 
ATOM   162   C  C     . SER A 1  23   ? 177.250 178.132 228.427 1.00 89.06  ?  23   SER A C     1 
ATOM   163   O  O     . SER A 1  23   ? 176.254 177.918 227.717 1.00 88.92  ?  23   SER A O     1 
ATOM   164   C  CB    . SER A 1  23   ? 176.929 180.287 229.655 1.00 87.98  ?  23   SER A CB    1 
ATOM   165   O  OG    . SER A 1  23   ? 175.536 180.308 229.387 1.00 94.67  ?  23   SER A OG    1 
ATOM   166   N  N     . PRO A 1  24   ? 177.905 177.112 229.017 1.00 85.98  ?  24   PRO A N     1 
ATOM   167   C  CA    . PRO A 1  24   ? 177.434 175.728 228.805 1.00 85.72  ?  24   PRO A CA    1 
ATOM   168   C  C     . PRO A 1  24   ? 175.980 175.558 229.192 1.00 89.93  ?  24   PRO A C     1 
ATOM   169   O  O     . PRO A 1  24   ? 175.224 174.892 228.487 1.00 88.47  ?  24   PRO A O     1 
ATOM   170   C  CB    . PRO A 1  24   ? 178.354 174.896 229.688 1.00 88.87  ?  24   PRO A CB    1 
ATOM   171   C  CG    . PRO A 1  24   ? 179.585 175.714 229.804 1.00 94.21  ?  24   PRO A CG    1 
ATOM   172   C  CD    . PRO A 1  24   ? 179.119 177.143 229.848 1.00 88.99  ?  24   PRO A CD    1 
ATOM   173   N  N     . GLU A 1  25   ? 175.584 176.258 230.271 1.00 87.89  ?  25   GLU A N     1 
ATOM   174   C  CA    . GLU A 1  25   ? 174.237 176.314 230.856 1.00 87.61  ?  25   GLU A CA    1 
ATOM   175   C  C     . GLU A 1  25   ? 173.185 176.721 229.796 1.00 87.90  ?  25   GLU A C     1 
ATOM   176   O  O     . GLU A 1  25   ? 172.121 176.086 229.713 1.00 87.33  ?  25   GLU A O     1 
ATOM   177   C  CB    . GLU A 1  25   ? 174.229 177.282 232.062 1.00 89.83  ?  25   GLU A CB    1 
ATOM   178   C  CG    . GLU A 1  25   ? 175.210 176.924 233.179 1.00 102.45 ?  25   GLU A CG    1 
ATOM   179   C  CD    . GLU A 1  25   ? 176.658 177.384 233.052 1.00 123.68 ?  25   GLU A CD    1 
ATOM   180   O  OE1   . GLU A 1  25   ? 177.044 177.868 231.963 1.00 110.83 ?  25   GLU A OE1   1 
ATOM   181   O  OE2   . GLU A 1  25   ? 177.411 177.246 234.046 1.00 118.75 -1 25   GLU A OE2   1 
ATOM   182   N  N     . GLU A 1  26   ? 173.524 177.746 228.960 1.00 80.76  ?  26   GLU A N     1 
ATOM   183   C  CA    . GLU A 1  26   ? 172.675 178.250 227.884 1.00 78.09  ?  26   GLU A CA    1 
ATOM   184   C  C     . GLU A 1  26   ? 172.480 177.167 226.845 1.00 78.83  ?  26   GLU A C     1 
ATOM   185   O  O     . GLU A 1  26   ? 171.342 176.918 226.433 1.00 76.27  ?  26   GLU A O     1 
ATOM   186   C  CB    . GLU A 1  26   ? 173.260 179.522 227.242 1.00 78.66  ?  26   GLU A CB    1 
ATOM   187   C  CG    . GLU A 1  26   ? 172.275 180.201 226.295 1.00 90.43  ?  26   GLU A CG    1 
ATOM   188   C  CD    . GLU A 1  26   ? 172.543 181.622 225.822 1.00 109.65 ?  26   GLU A CD    1 
ATOM   189   O  OE1   . GLU A 1  26   ? 173.705 182.088 225.918 1.00 115.12 ?  26   GLU A OE1   1 
ATOM   190   O  OE2   . GLU A 1  26   ? 171.583 182.254 225.317 1.00 82.61  -1 26   GLU A OE2   1 
ATOM   191   N  N     . VAL A 1  27   ? 173.602 176.503 226.449 1.00 75.20  ?  27   VAL A N     1 
ATOM   192   C  CA    . VAL A 1  27   ? 173.643 175.410 225.459 1.00 73.64  ?  27   VAL A CA    1 
ATOM   193   C  C     . VAL A 1  27   ? 172.639 174.307 225.870 1.00 79.18  ?  27   VAL A C     1 
ATOM   194   O  O     . VAL A 1  27   ? 171.816 173.897 225.037 1.00 77.82  ?  27   VAL A O     1 
ATOM   195   C  CB    . VAL A 1  27   ? 175.081 174.861 225.238 1.00 75.38  ?  27   VAL A CB    1 
ATOM   196   C  CG1   . VAL A 1  27   ? 175.107 173.774 224.170 1.00 73.93  ?  27   VAL A CG1   1 
ATOM   197   C  CG2   . VAL A 1  27   ? 176.069 175.981 224.917 1.00 74.07  ?  27   VAL A CG2   1 
ATOM   198   N  N     . ARG A 1  28   ? 172.673 173.905 227.179 1.00 76.85  ?  28   ARG A N     1 
ATOM   199   C  CA    . ARG A 1  28   ? 171.788 172.907 227.788 1.00 77.51  ?  28   ARG A CA    1 
ATOM   200   C  C     . ARG A 1  28   ? 170.345 173.426 227.812 1.00 82.82  ?  28   ARG A C     1 
ATOM   201   O  O     . ARG A 1  28   ? 169.410 172.648 227.562 1.00 82.81  ?  28   ARG A O     1 
ATOM   202   C  CB    . ARG A 1  28   ? 172.256 172.554 229.214 1.00 78.74  ?  28   ARG A CB    1 
ATOM   203   C  CG    . ARG A 1  28   ? 172.624 171.073 229.426 1.00 87.88  ?  28   ARG A CG    1 
ATOM   204   C  CD    . ARG A 1  28   ? 172.164 170.482 230.769 1.00 103.48 ?  28   ARG A CD    1 
ATOM   205   N  NE    . ARG A 1  28   ? 170.749 170.766 231.106 1.00 117.79 ?  28   ARG A NE    1 
ATOM   206   C  CZ    . ARG A 1  28   ? 169.965 169.997 231.873 1.00 125.83 ?  28   ARG A CZ    1 
ATOM   207   N  NH1   . ARG A 1  28   ? 170.422 168.850 232.365 1.00 116.34 1  28   ARG A NH1   1 
ATOM   208   N  NH2   . ARG A 1  28   ? 168.713 170.366 232.137 1.00 97.08  ?  28   ARG A NH2   1 
ATOM   209   N  N     . ALA A 1  29   ? 170.176 174.753 228.075 1.00 79.40  ?  29   ALA A N     1 
ATOM   210   C  CA    . ALA A 1  29   ? 168.872 175.421 228.149 1.00 78.53  ?  29   ALA A CA    1 
ATOM   211   C  C     . ALA A 1  29   ? 168.161 175.545 226.800 1.00 81.30  ?  29   ALA A C     1 
ATOM   212   O  O     . ALA A 1  29   ? 166.975 175.188 226.698 1.00 79.93  ?  29   ALA A O     1 
ATOM   213   C  CB    . ALA A 1  29   ? 169.014 176.773 228.807 1.00 79.23  ?  29   ALA A CB    1 
ATOM   214   N  N     . ILE A 1  30   ? 168.889 176.010 225.759 1.00 78.19  ?  30   ILE A N     1 
ATOM   215   C  CA    . ILE A 1  30   ? 168.330 176.154 224.405 1.00 77.53  ?  30   ILE A CA    1 
ATOM   216   C  C     . ILE A 1  30   ? 168.100 174.780 223.735 1.00 82.79  ?  30   ILE A C     1 
ATOM   217   O  O     . ILE A 1  30   ? 167.236 174.663 222.848 1.00 82.14  ?  30   ILE A O     1 
ATOM   218   C  CB    . ILE A 1  30   ? 169.093 177.163 223.478 1.00 79.29  ?  30   ILE A CB    1 
ATOM   219   C  CG1   . ILE A 1  30   ? 170.513 176.699 223.131 1.00 79.80  ?  30   ILE A CG1   1 
ATOM   220   C  CG2   . ILE A 1  30   ? 169.076 178.596 224.010 1.00 79.56  ?  30   ILE A CG2   1 
ATOM   221   C  CD1   . ILE A 1  30   ? 170.956 177.126 221.733 1.00 88.48  ?  30   ILE A CD1   1 
ATOM   222   N  N     . SER A 1  31   ? 168.873 173.749 224.180 1.00 79.93  ?  31   SER A N     1 
ATOM   223   C  CA    . SER A 1  31   ? 168.833 172.366 223.678 1.00 80.01  ?  31   SER A CA    1 
ATOM   224   C  C     . SER A 1  31   ? 167.456 171.713 223.777 1.00 83.09  ?  31   SER A C     1 
ATOM   225   O  O     . SER A 1  31   ? 166.794 171.848 224.819 1.00 85.54  ?  31   SER A O     1 
ATOM   226   C  CB    . SER A 1  31   ? 169.860 171.500 224.403 1.00 84.75  ?  31   SER A CB    1 
ATOM   227   O  OG    . SER A 1  31   ? 169.959 170.188 223.867 1.00 90.57  ?  31   SER A OG    1 
ATOM   228   N  N     . VAL A 1  32   ? 167.044 171.001 222.690 1.00 75.71  ?  32   VAL A N     1 
ATOM   229   C  CA    . VAL A 1  32   ? 165.775 170.259 222.588 1.00 74.81  ?  32   VAL A CA    1 
ATOM   230   C  C     . VAL A 1  32   ? 166.014 168.767 222.686 1.00 79.82  ?  32   VAL A C     1 
ATOM   231   O  O     . VAL A 1  32   ? 165.058 167.984 222.682 1.00 80.64  ?  32   VAL A O     1 
ATOM   232   C  CB    . VAL A 1  32   ? 164.856 170.615 221.385 1.00 76.95  ?  32   VAL A CB    1 
ATOM   233   C  CG1   . VAL A 1  32   ? 164.588 172.114 221.316 1.00 76.94  ?  32   VAL A CG1   1 
ATOM   234   C  CG2   . VAL A 1  32   ? 165.385 170.067 220.063 1.00 75.27  ?  32   VAL A CG2   1 
ATOM   235   N  N     . ALA A 1  33   ? 167.297 168.374 222.744 1.00 75.47  ?  33   ALA A N     1 
ATOM   236   C  CA    . ALA A 1  33   ? 167.724 166.988 222.842 1.00 75.17  ?  33   ALA A CA    1 
ATOM   237   C  C     . ALA A 1  33   ? 169.227 166.905 223.057 1.00 81.69  ?  33   ALA A C     1 
ATOM   238   O  O     . ALA A 1  33   ? 169.964 167.823 222.687 1.00 81.33  ?  33   ALA A O     1 
ATOM   239   C  CB    . ALA A 1  33   ? 167.348 166.237 221.573 1.00 74.41  ?  33   ALA A CB    1 
ATOM   240   N  N     . LYS A 1  34   ? 169.652 165.830 223.735 1.00 79.79  ?  34   LYS A N     1 
ATOM   241   C  CA    . LYS A 1  34   ? 171.012 165.335 223.917 1.00 80.53  ?  34   LYS A CA    1 
ATOM   242   C  C     . LYS A 1  34   ? 170.768 163.910 223.536 1.00 88.65  ?  34   LYS A C     1 
ATOM   243   O  O     . LYS A 1  34   ? 169.812 163.347 224.083 1.00 89.86  ?  34   LYS A O     1 
ATOM   244   C  CB    . LYS A 1  34   ? 171.596 165.510 225.358 1.00 83.41  ?  34   LYS A CB    1 
ATOM   245   C  CG    . LYS A 1  34   ? 171.126 164.636 226.564 1.00 80.47  ?  34   LYS A CG    1 
ATOM   246   C  CD    . LYS A 1  34   ? 172.164 163.559 227.081 1.00 75.22  ?  34   LYS A CD    1 
ATOM   247   C  CE    . LYS A 1  34   ? 173.422 164.025 227.816 1.00 67.74  ?  34   LYS A CE    1 
ATOM   248   N  NZ    . LYS A 1  34   ? 174.696 163.781 227.028 1.00 60.32  1  34   LYS A NZ    1 
ATOM   249   N  N     . ILE A 1  35   ? 171.265 163.427 222.394 1.00 86.42  ?  35   ILE A N     1 
ATOM   250   C  CA    . ILE A 1  35   ? 172.458 163.552 221.553 1.00 85.06  ?  35   ILE A CA    1 
ATOM   251   C  C     . ILE A 1  35   ? 173.512 162.804 222.281 1.00 88.81  ?  35   ILE A C     1 
ATOM   252   O  O     . ILE A 1  35   ? 174.236 163.345 223.121 1.00 87.64  ?  35   ILE A O     1 
ATOM   253   C  CB    . ILE A 1  35   ? 172.799 164.790 220.699 1.00 86.26  ?  35   ILE A CB    1 
ATOM   254   C  CG1   . ILE A 1  35   ? 171.595 165.115 219.822 1.00 85.69  ?  35   ILE A CG1   1 
ATOM   255   C  CG2   . ILE A 1  35   ? 173.931 164.438 219.747 1.00 85.62  ?  35   ILE A CG2   1 
ATOM   256   C  CD1   . ILE A 1  35   ? 170.950 166.308 220.103 1.00 97.29  ?  35   ILE A CD1   1 
ATOM   257   N  N     . ARG A 1  36   ? 173.360 161.475 222.110 1.00 86.51  ?  36   ARG A N     1 
ATOM   258   C  CA    . ARG A 1  36   ? 174.010 160.399 222.815 1.00 88.51  ?  36   ARG A CA    1 
ATOM   259   C  C     . ARG A 1  36   ? 174.516 159.278 221.908 1.00 94.08  ?  36   ARG A C     1 
ATOM   260   O  O     . ARG A 1  36   ? 175.407 158.513 222.326 1.00 93.70  ?  36   ARG A O     1 
ATOM   261   C  CB    . ARG A 1  36   ? 172.956 159.804 223.756 1.00 90.19  ?  36   ARG A CB    1 
ATOM   262   C  CG    . ARG A 1  36   ? 173.125 160.175 225.220 1.00 102.56 ?  36   ARG A CG    1 
ATOM   263   C  CD    . ARG A 1  36   ? 171.906 159.741 226.023 1.00 110.85 ?  36   ARG A CD    1 
ATOM   264   N  NE    . ARG A 1  36   ? 170.792 160.690 225.914 1.00 106.32 ?  36   ARG A NE    1 
ATOM   265   C  CZ    . ARG A 1  36   ? 169.508 160.355 225.944 1.00 115.32 ?  36   ARG A CZ    1 
ATOM   266   N  NH1   . ARG A 1  36   ? 169.146 159.081 226.065 1.00 112.73 1  36   ARG A NH1   1 
ATOM   267   N  NH2   . ARG A 1  36   ? 168.573 161.287 225.834 1.00 91.75  ?  36   ARG A NH2   1 
ATOM   268   N  N     . PHE A 1  37   ? 173.917 159.131 220.700 1.00 90.60  ?  37   PHE A N     1 
ATOM   269   C  CA    . PHE A 1  37   ? 174.287 158.036 219.800 1.00 90.55  ?  37   PHE A CA    1 
ATOM   270   C  C     . PHE A 1  37   ? 174.841 158.485 218.447 1.00 94.93  ?  37   PHE A C     1 
ATOM   271   O  O     . PHE A 1  37   ? 174.116 159.156 217.724 1.00 94.25  ?  37   PHE A O     1 
ATOM   272   C  CB    . PHE A 1  37   ? 173.112 157.060 219.608 1.00 92.25  ?  37   PHE A CB    1 
ATOM   273   C  CG    . PHE A 1  37   ? 172.289 156.790 220.844 1.00 94.65  ?  37   PHE A CG    1 
ATOM   274   C  CD1   . PHE A 1  37   ? 172.885 156.342 222.016 1.00 97.53  ?  37   PHE A CD1   1 
ATOM   275   C  CD2   . PHE A 1  37   ? 170.911 156.948 220.825 1.00 98.28  ?  37   PHE A CD2   1 
ATOM   276   C  CE1   . PHE A 1  37   ? 172.121 156.114 223.163 1.00 101.54 ?  37   PHE A CE1   1 
ATOM   277   C  CE2   . PHE A 1  37   ? 170.146 156.726 221.975 1.00 100.08 ?  37   PHE A CE2   1 
ATOM   278   C  CZ    . PHE A 1  37   ? 170.756 156.304 223.135 1.00 99.71  ?  37   PHE A CZ    1 
ATOM   279   N  N     . PRO A 1  38   ? 176.068 158.055 218.037 1.00 92.41  ?  38   PRO A N     1 
ATOM   280   C  CA    . PRO A 1  38   ? 176.604 158.466 216.722 1.00 92.45  ?  38   PRO A CA    1 
ATOM   281   C  C     . PRO A 1  38   ? 175.784 158.062 215.495 1.00 101.29 ?  38   PRO A C     1 
ATOM   282   O  O     . PRO A 1  38   ? 175.929 158.665 214.426 1.00 100.67 ?  38   PRO A O     1 
ATOM   283   C  CB    . PRO A 1  38   ? 177.999 157.839 216.685 1.00 94.14  ?  38   PRO A CB    1 
ATOM   284   C  CG    . PRO A 1  38   ? 177.988 156.814 217.719 1.00 99.31  ?  38   PRO A CG    1 
ATOM   285   C  CD    . PRO A 1  38   ? 177.056 157.256 218.780 1.00 94.89  ?  38   PRO A CD    1 
ATOM   286   N  N     . GLU A 1  39   ? 174.921 157.055 215.654 1.00 101.84 ?  39   GLU A N     1 
ATOM   287   C  CA    . GLU A 1  39   ? 174.046 156.539 214.609 1.00 102.76 ?  39   GLU A CA    1 
ATOM   288   C  C     . GLU A 1  39   ? 173.030 157.610 214.231 1.00 110.08 ?  39   GLU A C     1 
ATOM   289   O  O     . GLU A 1  39   ? 172.385 158.183 215.107 1.00 108.67 ?  39   GLU A O     1 
ATOM   290   C  CB    . GLU A 1  39   ? 173.396 155.227 215.066 1.00 105.04 ?  39   GLU A CB    1 
ATOM   291   C  CG    . GLU A 1  39   ? 174.415 154.119 215.339 1.00 118.03 ?  39   GLU A CG    1 
ATOM   292   C  CD    . GLU A 1  39   ? 175.114 154.064 216.692 1.00 144.70 ?  39   GLU A CD    1 
ATOM   293   O  OE1   . GLU A 1  39   ? 174.961 155.013 217.495 1.00 131.53 ?  39   GLU A OE1   1 
ATOM   294   O  OE2   . GLU A 1  39   ? 175.814 153.059 216.953 1.00 148.00 -1 39   GLU A OE2   1 
ATOM   295   N  N     . THR A 1  40   ? 172.992 157.959 212.934 1.00 111.59 ?  40   THR A N     1 
ATOM   296   C  CA    . THR A 1  40   ? 172.150 159.015 212.357 1.00 113.16 ?  40   THR A CA    1 
ATOM   297   C  C     . THR A 1  40   ? 170.712 158.718 212.627 1.00 123.01 ?  40   THR A C     1 
ATOM   298   O  O     . THR A 1  40   ? 170.020 159.466 213.326 1.00 122.94 ?  40   THR A O     1 
ATOM   299   C  CB    . THR A 1  40   ? 172.354 159.104 210.829 1.00 121.82 ?  40   THR A CB    1 
ATOM   300   O  OG1   . THR A 1  40   ? 173.748 159.175 210.519 1.00 129.01 ?  40   THR A OG1   1 
ATOM   301   C  CG2   . THR A 1  40   ? 171.601 160.255 210.205 1.00 115.08 ?  40   THR A CG2   1 
ATOM   302   N  N     . MET A 1  41   ? 170.263 157.615 212.057 1.00 123.99 ?  41   MET A N     1 
ATOM   303   C  CA    . MET A 1  41   ? 168.886 157.206 212.178 1.00 126.11 ?  41   MET A CA    1 
ATOM   304   C  C     . MET A 1  41   ? 168.809 155.697 212.136 1.00 133.71 ?  41   MET A C     1 
ATOM   305   O  O     . MET A 1  41   ? 169.709 155.048 212.678 1.00 133.12 ?  41   MET A O     1 
ATOM   306   C  CB    . MET A 1  41   ? 168.024 157.910 211.111 1.00 127.69 ?  41   MET A CB    1 
ATOM   307   C  CG    . MET A 1  41   ? 168.632 157.935 209.745 1.00 130.48 ?  41   MET A CG    1 
ATOM   308   S  SD    . MET A 1  41   ? 167.471 157.120 208.672 1.00 134.88 ?  41   MET A SD    1 
ATOM   309   C  CE    . MET A 1  41   ? 168.322 157.293 207.110 1.00 131.64 ?  41   MET A CE    1 
ATOM   310   N  N     . ASP A 1  42   ? 167.755 155.142 211.487 1.00 133.86 ?  42   ASP A N     1 
ATOM   311   C  CA    . ASP A 1  42   ? 167.454 153.711 211.352 1.00 136.00 ?  42   ASP A CA    1 
ATOM   312   C  C     . ASP A 1  42   ? 167.321 153.155 212.776 1.00 141.78 ?  42   ASP A C     1 
ATOM   313   O  O     . ASP A 1  42   ? 168.317 152.865 213.448 1.00 141.06 ?  42   ASP A O     1 
ATOM   314   C  CB    . ASP A 1  42   ? 168.504 152.935 210.467 1.00 138.39 ?  42   ASP A CB    1 
ATOM   315   C  CG    . ASP A 1  42   ? 168.161 152.512 209.010 1.00 143.01 ?  42   ASP A CG    1 
ATOM   316   O  OD1   . ASP A 1  42   ? 167.009 152.748 208.562 1.00 140.71 ?  42   ASP A OD1   1 
ATOM   317   O  OD2   . ASP A 1  42   ? 169.023 151.872 208.355 1.00 146.40 -1 42   ASP A OD2   1 
ATOM   318   N  N     . GLU A 1  43   ? 166.077 153.113 213.258 1.00 140.66 ?  43   GLU A N     1 
ATOM   319   C  CA    . GLU A 1  43   ? 165.707 152.612 214.581 1.00 142.96 ?  43   GLU A CA    1 
ATOM   320   C  C     . GLU A 1  43   ? 166.026 151.094 214.594 1.00 150.42 ?  43   GLU A C     1 
ATOM   321   O  O     . GLU A 1  43   ? 165.117 150.253 214.518 1.00 151.30 ?  43   GLU A O     1 
ATOM   322   C  CB    . GLU A 1  43   ? 164.206 152.870 214.832 1.00 144.48 ?  43   GLU A CB    1 
ATOM   323   C  CG    . GLU A 1  43   ? 163.667 154.177 214.279 1.00 153.94 ?  43   GLU A CG    1 
ATOM   324   C  CD    . GLU A 1  43   ? 162.161 154.265 214.379 1.00 177.29 ?  43   GLU A CD    1 
ATOM   325   O  OE1   . GLU A 1  43   ? 161.476 153.715 213.486 1.00 176.72 ?  43   GLU A OE1   1 
ATOM   326   O  OE2   . GLU A 1  43   ? 161.664 154.857 215.363 1.00 170.84 -1 43   GLU A OE2   1 
ATOM   327   N  N     . THR A 1  44   ? 167.343 150.765 214.652 1.00 147.81 ?  44   THR A N     1 
ATOM   328   C  CA    . THR A 1  44   ? 167.915 149.418 214.518 1.00 148.50 ?  44   THR A CA    1 
ATOM   329   C  C     . THR A 1  44   ? 167.557 148.950 213.078 1.00 151.20 ?  44   THR A C     1 
ATOM   330   O  O     . THR A 1  44   ? 166.725 148.057 212.891 1.00 151.88 ?  44   THR A O     1 
ATOM   331   C  CB    . THR A 1  44   ? 167.545 148.483 215.711 1.00 157.63 ?  44   THR A CB    1 
ATOM   332   O  OG1   . THR A 1  44   ? 167.716 149.194 216.939 1.00 157.75 ?  44   THR A OG1   1 
ATOM   333   C  CG2   . THR A 1  44   ? 168.380 147.205 215.745 1.00 156.32 ?  44   THR A CG2   1 
ATOM   334   N  N     . GLN A 1  45   ? 168.121 149.669 212.066 1.00 145.13 ?  45   GLN A N     1 
ATOM   335   C  CA    . GLN A 1  45   ? 167.928 149.490 210.613 1.00 143.70 ?  45   GLN A CA    1 
ATOM   336   C  C     . GLN A 1  45   ? 166.522 149.824 210.046 1.00 142.51 ?  45   GLN A C     1 
ATOM   337   O  O     . GLN A 1  45   ? 166.338 149.873 208.824 1.00 141.45 ?  45   GLN A O     1 
ATOM   338   C  CB    . GLN A 1  45   ? 168.531 148.178 210.058 1.00 146.55 ?  45   GLN A CB    1 
ATOM   339   C  CG    . GLN A 1  45   ? 169.361 148.381 208.774 1.00 169.33 ?  45   GLN A CG    1 
ATOM   340   C  CD    . GLN A 1  45   ? 169.486 147.138 207.913 1.00 190.10 ?  45   GLN A CD    1 
ATOM   341   O  OE1   . GLN A 1  45   ? 168.489 146.543 207.475 1.00 185.97 ?  45   GLN A OE1   1 
ATOM   342   N  NE2   . GLN A 1  45   ? 170.718 146.762 207.589 1.00 181.14 ?  45   GLN A NE2   1 
ATOM   343   N  N     . THR A 1  46   ? 165.560 150.111 210.932 1.00 135.88 ?  46   THR A N     1 
ATOM   344   C  CA    . THR A 1  46   ? 164.196 150.464 210.556 1.00 133.98 ?  46   THR A CA    1 
ATOM   345   C  C     . THR A 1  46   ? 164.128 151.965 210.236 1.00 133.86 ?  46   THR A C     1 
ATOM   346   O  O     . THR A 1  46   ? 164.006 152.790 211.151 1.00 133.47 ?  46   THR A O     1 
ATOM   347   C  CB    . THR A 1  46   ? 163.230 149.993 211.647 1.00 141.61 ?  46   THR A CB    1 
ATOM   348   O  OG1   . THR A 1  46   ? 163.482 148.613 211.916 1.00 139.34 ?  46   THR A OG1   1 
ATOM   349   C  CG2   . THR A 1  46   ? 161.770 150.202 211.272 1.00 141.23 ?  46   THR A CG2   1 
ATOM   350   N  N     . ARG A 1  47   ? 164.231 152.299 208.927 1.00 127.07 ?  47   ARG A N     1 
ATOM   351   C  CA    . ARG A 1  47   ? 164.240 153.649 208.350 1.00 124.75 ?  47   ARG A CA    1 
ATOM   352   C  C     . ARG A 1  47   ? 163.237 154.690 208.936 1.00 124.90 ?  47   ARG A C     1 
ATOM   353   O  O     . ARG A 1  47   ? 162.058 154.732 208.557 1.00 124.70 ?  47   ARG A O     1 
ATOM   354   C  CB    . ARG A 1  47   ? 164.234 153.586 206.812 1.00 125.51 ?  47   ARG A CB    1 
ATOM   355   C  CG    . ARG A 1  47   ? 164.975 154.734 206.133 1.00 140.04 ?  47   ARG A CG    1 
ATOM   356   C  CD    . ARG A 1  47   ? 164.253 155.216 204.875 1.00 155.57 ?  47   ARG A CD    1 
ATOM   357   N  NE    . ARG A 1  47   ? 164.080 156.674 204.862 1.00 165.10 ?  47   ARG A NE    1 
ATOM   358   C  CZ    . ARG A 1  47   ? 162.956 157.302 204.520 1.00 175.24 ?  47   ARG A CZ    1 
ATOM   359   N  NH1   . ARG A 1  47   ? 161.886 156.610 204.141 1.00 159.06 1  47   ARG A NH1   1 
ATOM   360   N  NH2   . ARG A 1  47   ? 162.895 158.628 204.552 1.00 158.19 ?  47   ARG A NH2   1 
ATOM   361   N  N     . ALA A 1  48   ? 163.758 155.508 209.891 1.00 117.20 ?  48   ALA A N     1 
ATOM   362   C  CA    . ALA A 1  48   ? 163.160 156.608 210.662 1.00 114.55 ?  48   ALA A CA    1 
ATOM   363   C  C     . ALA A 1  48   ? 164.253 157.109 211.596 1.00 115.90 ?  48   ALA A C     1 
ATOM   364   O  O     . ALA A 1  48   ? 165.109 156.318 211.987 1.00 116.50 ?  48   ALA A O     1 
ATOM   365   C  CB    . ALA A 1  48   ? 161.971 156.126 211.475 1.00 115.66 ?  48   ALA A CB    1 
ATOM   366   N  N     . LYS A 1  49   ? 164.244 158.410 211.932 1.00 110.09 ?  49   LYS A N     1 
ATOM   367   C  CA    . LYS A 1  49   ? 165.247 159.082 212.786 1.00 109.31 ?  49   LYS A CA    1 
ATOM   368   C  C     . LYS A 1  49   ? 165.422 158.435 214.155 1.00 109.40 ?  49   LYS A C     1 
ATOM   369   O  O     . LYS A 1  49   ? 164.410 158.039 214.740 1.00 109.99 ?  49   LYS A O     1 
ATOM   370   C  CB    . LYS A 1  49   ? 164.890 160.568 212.963 1.00 113.19 ?  49   LYS A CB    1 
ATOM   371   C  CG    . LYS A 1  49   ? 164.986 161.399 211.680 1.00 136.61 ?  49   LYS A CG    1 
ATOM   372   C  CD    . LYS A 1  49   ? 164.316 162.773 211.810 1.00 146.43 ?  49   LYS A CD    1 
ATOM   373   C  CE    . LYS A 1  49   ? 163.045 162.871 211.001 1.00 153.29 ?  49   LYS A CE    1 
ATOM   374   N  NZ    . LYS A 1  49   ? 162.146 163.938 211.508 1.00 157.50 1  49   LYS A NZ    1 
ATOM   375   N  N     . ILE A 1  50   ? 166.684 158.341 214.678 1.00 102.11 ?  50   ILE A N     1 
ATOM   376   C  CA    . ILE A 1  50   ? 166.956 157.740 216.005 1.00 101.90 ?  50   ILE A CA    1 
ATOM   377   C  C     . ILE A 1  50   ? 166.850 158.780 217.148 1.00 100.94 ?  50   ILE A C     1 
ATOM   378   O  O     . ILE A 1  50   ? 167.387 159.874 216.980 1.00 100.70 ?  50   ILE A O     1 
ATOM   379   C  CB    . ILE A 1  50   ? 168.293 156.891 216.037 1.00 106.19 ?  50   ILE A CB    1 
ATOM   380   C  CG1   . ILE A 1  50   ? 168.010 155.355 216.158 1.00 107.81 ?  50   ILE A CG1   1 
ATOM   381   C  CG2   . ILE A 1  50   ? 169.315 157.361 217.110 1.00 107.70 ?  50   ILE A CG2   1 
ATOM   382   C  CD1   . ILE A 1  50   ? 169.288 154.361 216.344 1.00 113.76 ?  50   ILE A CD1   1 
ATOM   383   N  N     . GLY A 1  51   ? 166.180 158.436 218.275 1.00 93.00  ?  51   GLY A N     1 
ATOM   384   C  CA    . GLY A 1  51   ? 166.085 159.283 219.465 1.00 90.78  ?  51   GLY A CA    1 
ATOM   385   C  C     . GLY A 1  51   ? 167.427 159.261 220.192 1.00 92.17  ?  51   GLY A C     1 
ATOM   386   O  O     . GLY A 1  51   ? 167.533 158.700 221.279 1.00 92.77  ?  51   GLY A O     1 
ATOM   387   N  N     . GLY A 1  52   ? 168.460 159.817 219.540 1.00 85.96  ?  52   GLY A N     1 
ATOM   388   C  CA    . GLY A 1  52   ? 169.872 159.836 219.922 1.00 85.13  ?  52   GLY A CA    1 
ATOM   389   C  C     . GLY A 1  52   ? 170.680 160.798 219.069 1.00 88.02  ?  52   GLY A C     1 
ATOM   390   O  O     . GLY A 1  52   ? 171.199 161.728 219.662 1.00 89.31  ?  52   GLY A O     1 
ATOM   391   N  N     . LEU A 1  53   ? 170.825 160.622 217.670 1.00 81.79  ?  53   LEU A N     1 
ATOM   392   C  CA    . LEU A 1  53   ? 171.420 161.650 216.717 1.00 78.98  ?  53   LEU A CA    1 
ATOM   393   C  C     . LEU A 1  53   ? 170.314 162.259 215.837 1.00 80.98  ?  53   LEU A C     1 
ATOM   394   O  O     . LEU A 1  53   ? 169.158 161.853 215.971 1.00 81.45  ?  53   LEU A O     1 
ATOM   395   C  CB    . LEU A 1  53   ? 172.722 161.330 215.889 1.00 77.97  ?  53   LEU A CB    1 
ATOM   396   C  CG    . LEU A 1  53   ? 173.687 162.578 215.564 1.00 80.09  ?  53   LEU A CG    1 
ATOM   397   C  CD1   . LEU A 1  53   ? 175.206 162.201 215.458 1.00 78.71  ?  53   LEU A CD1   1 
ATOM   398   C  CD2   . LEU A 1  53   ? 173.274 163.325 214.306 1.00 79.73  ?  53   LEU A CD2   1 
ATOM   399   N  N     . ASN A 1  54   ? 170.640 163.229 214.972 1.00 75.13  ?  54   ASN A N     1 
ATOM   400   C  CA    . ASN A 1  54   ? 169.657 163.951 214.168 1.00 74.85  ?  54   ASN A CA    1 
ATOM   401   C  C     . ASN A 1  54   ? 168.104 163.547 214.299 1.00 80.59  ?  54   ASN A C     1 
ATOM   402   O  O     . ASN A 1  54   ? 167.576 162.651 213.636 1.00 79.65  ?  54   ASN A O     1 
ATOM   403   C  CB    . ASN A 1  54   ? 170.188 164.358 212.783 1.00 72.35  ?  54   ASN A CB    1 
ATOM   404   C  CG    . ASN A 1  54   ? 169.932 163.508 211.575 1.00 86.17  ?  54   ASN A CG    1 
ATOM   405   O  OD1   . ASN A 1  54   ? 169.446 162.380 211.644 1.00 88.67  ?  54   ASN A OD1   1 
ATOM   406   N  ND2   . ASN A 1  54   ? 170.298 164.048 210.415 1.00 68.66  ?  54   ASN A ND2   1 
ATOM   407   N  N     . ASP A 1  55   ? 167.456 164.244 215.262 1.00 78.28  ?  55   ASP A N     1 
ATOM   408   C  CA    . ASP A 1  55   ? 166.097 164.266 215.788 1.00 79.05  ?  55   ASP A CA    1 
ATOM   409   C  C     . ASP A 1  55   ? 165.756 163.329 216.883 1.00 90.19  ?  55   ASP A C     1 
ATOM   410   O  O     . ASP A 1  55   ? 164.776 162.577 216.797 1.00 90.13  ?  55   ASP A O     1 
ATOM   411   C  CB    . ASP A 1  55   ? 164.929 164.532 214.822 1.00 79.69  ?  55   ASP A CB    1 
ATOM   412   C  CG    . ASP A 1  55   ? 163.537 164.570 215.506 1.00 78.83  ?  55   ASP A CG    1 
ATOM   413   O  OD1   . ASP A 1  55   ? 163.099 165.696 215.962 1.00 71.21  ?  55   ASP A OD1   1 
ATOM   414   O  OD2   . ASP A 1  55   ? 162.894 163.476 215.608 1.00 82.10  -1 55   ASP A OD2   1 
ATOM   415   N  N     . PRO A 1  56   ? 166.428 163.564 218.027 1.00 93.50  ?  56   PRO A N     1 
ATOM   416   C  CA    . PRO A 1  56   ? 166.016 162.938 219.307 1.00 96.47  ?  56   PRO A CA    1 
ATOM   417   C  C     . PRO A 1  56   ? 165.051 163.946 220.046 1.00 102.49 ?  56   PRO A C     1 
ATOM   418   O  O     . PRO A 1  56   ? 164.935 163.982 221.307 1.00 101.49 ?  56   PRO A O     1 
ATOM   419   C  CB    . PRO A 1  56   ? 167.359 162.767 220.046 1.00 99.12  ?  56   PRO A CB    1 
ATOM   420   C  CG    . PRO A 1  56   ? 168.411 163.581 219.173 1.00 102.68 ?  56   PRO A CG    1 
ATOM   421   C  CD    . PRO A 1  56   ? 167.594 164.433 218.251 1.00 96.37  ?  56   PRO A CD    1 
ATOM   422   N  N     . ARG A 1  57   ? 164.369 164.801 219.165 1.00 99.27  ?  57   ARG A N     1 
ATOM   423   C  CA    . ARG A 1  57   ? 163.398 165.917 219.278 1.00 97.95  ?  57   ARG A CA    1 
ATOM   424   C  C     . ARG A 1  57   ? 163.737 167.138 218.292 1.00 97.59  ?  57   ARG A C     1 
ATOM   425   O  O     . ARG A 1  57   ? 162.858 167.966 218.115 1.00 95.78  ?  57   ARG A O     1 
ATOM   426   C  CB    . ARG A 1  57   ? 163.143 166.375 220.761 1.00 99.65  ?  57   ARG A CB    1 
ATOM   427   C  CG    . ARG A 1  57   ? 162.356 165.402 221.683 1.00 111.30 ?  57   ARG A CG    1 
ATOM   428   C  CD    . ARG A 1  57   ? 162.203 165.896 223.136 1.00 133.35 ?  57   ARG A CD    1 
ATOM   429   N  NE    . ARG A 1  57   ? 161.118 165.208 223.875 1.00 148.92 ?  57   ARG A NE    1 
ATOM   430   C  CZ    . ARG A 1  57   ? 160.617 165.569 225.067 1.00 151.84 ?  57   ARG A CZ    1 
ATOM   431   N  NH1   . ARG A 1  57   ? 161.090 166.635 225.705 1.00 132.07 1  57   ARG A NH1   1 
ATOM   432   N  NH2   . ARG A 1  57   ? 159.636 164.867 225.624 1.00 129.42 ?  57   ARG A NH2   1 
ATOM   433   N  N     . LEU A 1  58   ? 164.969 167.187 217.613 1.00 92.88  ?  58   LEU A N     1 
ATOM   434   C  CA    . LEU A 1  58   ? 165.608 168.254 216.750 1.00 90.71  ?  58   LEU A CA    1 
ATOM   435   C  C     . LEU A 1  58   ? 164.756 168.867 215.689 1.00 97.39  ?  58   LEU A C     1 
ATOM   436   O  O     . LEU A 1  58   ? 163.565 169.018 215.890 1.00 98.69  ?  58   LEU A O     1 
ATOM   437   C  CB    . LEU A 1  58   ? 166.886 167.761 216.034 1.00 89.08  ?  58   LEU A CB    1 
ATOM   438   C  CG    . LEU A 1  58   ? 168.192 167.550 216.770 1.00 92.63  ?  58   LEU A CG    1 
ATOM   439   C  CD1   . LEU A 1  58   ? 169.326 167.681 215.828 1.00 91.69  ?  58   LEU A CD1   1 
ATOM   440   C  CD2   . LEU A 1  58   ? 168.401 168.512 217.927 1.00 94.15  ?  58   LEU A CD2   1 
ATOM   441   N  N     . GLY A 1  59   ? 165.360 169.184 214.542 1.00 94.87  ?  59   GLY A N     1 
ATOM   442   C  CA    . GLY A 1  59   ? 164.616 169.595 213.351 1.00 95.56  ?  59   GLY A CA    1 
ATOM   443   C  C     . GLY A 1  59   ? 163.937 168.378 212.698 1.00 102.50 ?  59   GLY A C     1 
ATOM   444   O  O     . GLY A 1  59   ? 163.672 167.379 213.380 1.00 102.58 ?  59   GLY A O     1 
ATOM   445   N  N     . SER A 1  60   ? 163.657 168.412 211.367 1.00 100.92 ?  60   SER A N     1 
ATOM   446   C  CA    . SER A 1  60   ? 163.035 167.242 210.700 1.00 101.77 ?  60   SER A CA    1 
ATOM   447   C  C     . SER A 1  60   ? 163.455 166.905 209.251 1.00 105.82 ?  60   SER A C     1 
ATOM   448   O  O     . SER A 1  60   ? 163.890 167.773 208.491 1.00 104.82 ?  60   SER A O     1 
ATOM   449   C  CB    . SER A 1  60   ? 161.511 167.277 210.808 1.00 105.85 ?  60   SER A CB    1 
ATOM   450   O  OG    . SER A 1  60   ? 160.938 166.047 210.385 1.00 113.82 ?  60   SER A OG    1 
ATOM   451   N  N     . ILE A 1  61   ? 163.298 165.615 208.892 1.00 102.96 ?  61   ILE A N     1 
ATOM   452   C  CA    . ILE A 1  61   ? 163.552 165.063 207.558 1.00 102.19 ?  61   ILE A CA    1 
ATOM   453   C  C     . ILE A 1  61   ? 162.183 164.616 206.933 1.00 112.70 ?  61   ILE A C     1 
ATOM   454   O  O     . ILE A 1  61   ? 161.112 165.138 207.296 1.00 113.05 ?  61   ILE A O     1 
ATOM   455   C  CB    . ILE A 1  61   ? 164.614 163.922 207.565 1.00 103.13 ?  61   ILE A CB    1 
ATOM   456   C  CG1   . ILE A 1  61   ? 165.686 164.141 208.616 1.00 101.53 ?  61   ILE A CG1   1 
ATOM   457   C  CG2   . ILE A 1  61   ? 165.231 163.752 206.175 1.00 103.05 ?  61   ILE A CG2   1 
ATOM   458   C  CD1   . ILE A 1  61   ? 166.479 162.998 208.838 1.00 101.93 ?  61   ILE A CD1   1 
ATOM   459   N  N     . ASP A 1  62   ? 162.237 163.668 205.981 1.00 112.43 ?  62   ASP A N     1 
ATOM   460   C  CA    . ASP A 1  62   ? 161.102 163.100 205.263 1.00 113.90 ?  62   ASP A CA    1 
ATOM   461   C  C     . ASP A 1  62   ? 160.270 164.070 204.411 1.00 118.70 ?  62   ASP A C     1 
ATOM   462   O  O     . ASP A 1  62   ? 159.456 163.585 203.618 1.00 120.49 ?  62   ASP A O     1 
ATOM   463   C  CB    . ASP A 1  62   ? 160.226 162.199 206.164 1.00 117.14 ?  62   ASP A CB    1 
ATOM   464   C  CG    . ASP A 1  62   ? 160.145 160.760 205.687 1.00 134.45 ?  62   ASP A CG    1 
ATOM   465   O  OD1   . ASP A 1  62   ? 159.515 160.517 204.619 1.00 135.60 ?  62   ASP A OD1   1 
ATOM   466   O  OD2   . ASP A 1  62   ? 160.714 159.872 206.374 1.00 142.51 -1 62   ASP A OD2   1 
ATOM   467   N  N     . ARG A 1  63   ? 160.490 165.414 204.527 1.00 112.68 ?  63   ARG A N     1 
ATOM   468   C  CA    . ARG A 1  63   ? 159.756 166.499 203.842 1.00 111.20 ?  63   ARG A CA    1 
ATOM   469   C  C     . ARG A 1  63   ? 158.315 166.478 204.313 1.00 114.37 ?  63   ARG A C     1 
ATOM   470   O  O     . ARG A 1  63   ? 157.857 167.453 204.909 1.00 115.37 ?  63   ARG A O     1 
ATOM   471   C  CB    . ARG A 1  63   ? 159.932 166.535 202.309 1.00 111.23 ?  63   ARG A CB    1 
ATOM   472   C  CG    . ARG A 1  63   ? 159.515 167.872 201.702 1.00 122.75 ?  63   ARG A CG    1 
ATOM   473   C  CD    . ARG A 1  63   ? 160.457 168.367 200.609 1.00 138.24 ?  63   ARG A CD    1 
ATOM   474   N  NE    . ARG A 1  63   ? 161.329 169.472 201.042 1.00 150.53 ?  63   ARG A NE    1 
ATOM   475   C  CZ    . ARG A 1  63   ? 160.957 170.750 201.163 1.00 161.76 ?  63   ARG A CZ    1 
ATOM   476   N  NH1   . ARG A 1  63   ? 159.701 171.111 200.921 1.00 149.00 1  63   ARG A NH1   1 
ATOM   477   N  NH2   . ARG A 1  63   ? 161.835 171.670 201.543 1.00 141.09 ?  63   ARG A NH2   1 
ATOM   478   N  N     . ASN A 1  64   ? 157.632 165.324 204.139 1.00 109.28 ?  64   ASN A N     1 
ATOM   479   C  CA    . ASN A 1  64   ? 156.345 165.013 204.750 1.00 108.79 ?  64   ASN A CA    1 
ATOM   480   C  C     . ASN A 1  64   ? 156.766 164.583 206.182 1.00 109.36 ?  64   ASN A C     1 
ATOM   481   O  O     . ASN A 1  64   ? 157.986 164.481 206.431 1.00 109.25 ?  64   ASN A O     1 
ATOM   482   C  CB    . ASN A 1  64   ? 155.571 163.905 203.988 1.00 111.81 ?  64   ASN A CB    1 
ATOM   483   C  CG    . ASN A 1  64   ? 156.309 162.614 203.737 1.00 135.70 ?  64   ASN A CG    1 
ATOM   484   O  OD1   . ASN A 1  64   ? 156.872 162.397 202.659 1.00 130.48 ?  64   ASN A OD1   1 
ATOM   485   N  ND2   . ASN A 1  64   ? 156.241 161.691 204.689 1.00 127.72 ?  64   ASN A ND2   1 
ATOM   486   N  N     . LEU A 1  65   ? 155.814 164.398 207.132 1.00 101.97 ?  65   LEU A N     1 
ATOM   487   C  CA    . LEU A 1  65   ? 156.184 164.070 208.520 1.00 100.18 ?  65   LEU A CA    1 
ATOM   488   C  C     . LEU A 1  65   ? 156.814 165.358 209.198 1.00 98.37  ?  65   LEU A C     1 
ATOM   489   O  O     . LEU A 1  65   ? 157.955 165.748 208.908 1.00 96.43  ?  65   LEU A O     1 
ATOM   490   C  CB    . LEU A 1  65   ? 157.087 162.801 208.532 1.00 100.51 ?  65   LEU A CB    1 
ATOM   491   C  CG    . LEU A 1  65   ? 157.876 162.454 209.758 1.00 106.44 ?  65   LEU A CG    1 
ATOM   492   C  CD1   . LEU A 1  65   ? 157.851 160.975 209.987 1.00 110.57 ?  65   LEU A CD1   1 
ATOM   493   C  CD2   . LEU A 1  65   ? 159.319 162.895 209.609 1.00 106.91 ?  65   LEU A CD2   1 
ATOM   494   N  N     . LYS A 1  66   ? 155.988 166.046 210.032 1.00 91.87  ?  66   LYS A N     1 
ATOM   495   C  CA    . LYS A 1  66   ? 156.240 167.323 210.727 1.00 89.90  ?  66   LYS A CA    1 
ATOM   496   C  C     . LYS A 1  66   ? 157.342 167.285 211.782 1.00 90.17  ?  66   LYS A C     1 
ATOM   497   O  O     . LYS A 1  66   ? 157.706 166.197 212.221 1.00 90.33  ?  66   LYS A O     1 
ATOM   498   C  CB    . LYS A 1  66   ? 154.948 167.793 211.396 1.00 93.27  ?  66   LYS A CB    1 
ATOM   499   C  CG    . LYS A 1  66   ? 153.835 168.255 210.455 1.00 112.29 ?  66   LYS A CG    1 
ATOM   500   C  CD    . LYS A 1  66   ? 152.624 168.826 211.244 1.00 127.60 ?  66   LYS A CD    1 
ATOM   501   C  CE    . LYS A 1  66   ? 151.809 167.811 212.036 1.00 137.07 ?  66   LYS A CE    1 
ATOM   502   N  NZ    . LYS A 1  66   ? 150.747 168.455 212.860 1.00 141.29 1  66   LYS A NZ    1 
ATOM   503   N  N     . CYS A 1  67   ? 157.846 168.472 212.225 1.00 84.08  ?  67   CYS A N     1 
ATOM   504   C  CA    . CYS A 1  67   ? 158.890 168.548 213.274 1.00 83.63  ?  67   CYS A CA    1 
ATOM   505   C  C     . CYS A 1  67   ? 158.334 168.136 214.640 1.00 88.29  ?  67   CYS A C     1 
ATOM   506   O  O     . CYS A 1  67   ? 157.219 168.528 214.981 1.00 88.64  ?  67   CYS A O     1 
ATOM   507   C  CB    . CYS A 1  67   ? 159.545 169.928 213.334 1.00 82.82  ?  67   CYS A CB    1 
ATOM   508   S  SG    . CYS A 1  67   ? 160.188 170.379 214.975 1.00 86.81  ?  67   CYS A SG    1 
ATOM   509   N  N     . GLN A 1  68   ? 159.107 167.375 215.427 1.00 84.32  ?  68   GLN A N     1 
ATOM   510   C  CA    . GLN A 1  68   ? 158.609 166.933 216.724 1.00 84.10  ?  68   GLN A CA    1 
ATOM   511   C  C     . GLN A 1  68   ? 158.550 168.007 217.829 1.00 86.23  ?  68   GLN A C     1 
ATOM   512   O  O     . GLN A 1  68   ? 157.671 167.896 218.679 1.00 87.15  ?  68   GLN A O     1 
ATOM   513   C  CB    . GLN A 1  68   ? 159.214 165.581 217.172 1.00 85.93  ?  68   GLN A CB    1 
ATOM   514   N  N     . THR A 1  69   ? 159.423 169.048 217.824 1.00 80.63  ?  69   THR A N     1 
ATOM   515   C  CA    . THR A 1  69   ? 159.348 170.045 218.902 1.00 81.10  ?  69   THR A CA    1 
ATOM   516   C  C     . THR A 1  69   ? 158.366 171.168 218.643 1.00 86.52  ?  69   THR A C     1 
ATOM   517   O  O     . THR A 1  69   ? 157.422 171.316 219.434 1.00 87.36  ?  69   THR A O     1 
ATOM   518   C  CB    . THR A 1  69   ? 160.671 170.409 219.558 1.00 86.08  ?  69   THR A CB    1 
ATOM   519   O  OG1   . THR A 1  69   ? 161.675 170.525 218.566 1.00 85.26  ?  69   THR A OG1   1 
ATOM   520   C  CG2   . THR A 1  69   ? 161.074 169.398 220.646 1.00 83.81  ?  69   THR A CG2   1 
ATOM   521   N  N     . CYS A 1  70   ? 158.528 171.916 217.517 1.00 82.32  ?  70   CYS A N     1 
ATOM   522   C  CA    . CYS A 1  70   ? 157.545 172.922 217.061 1.00 81.54  ?  70   CYS A CA    1 
ATOM   523   C  C     . CYS A 1  70   ? 156.523 172.047 216.346 1.00 88.32  ?  70   CYS A C     1 
ATOM   524   O  O     . CYS A 1  70   ? 156.491 170.855 216.628 1.00 89.68  ?  70   CYS A O     1 
ATOM   525   C  CB    . CYS A 1  70   ? 158.190 173.941 216.114 1.00 80.06  ?  70   CYS A CB    1 
ATOM   526   S  SG    . CYS A 1  70   ? 158.435 173.360 214.412 1.00 82.36  ?  70   CYS A SG    1 
ATOM   527   N  N     . GLN A 1  71   ? 155.745 172.536 215.412 1.00 85.66  ?  71   GLN A N     1 
ATOM   528   C  CA    . GLN A 1  71   ? 154.953 171.523 214.734 1.00 87.03  ?  71   GLN A CA    1 
ATOM   529   C  C     . GLN A 1  71   ? 155.072 171.591 213.244 1.00 93.23  ?  71   GLN A C     1 
ATOM   530   O  O     . GLN A 1  71   ? 155.085 170.580 212.555 1.00 92.44  ?  71   GLN A O     1 
ATOM   531   C  CB    . GLN A 1  71   ? 153.515 171.463 215.214 1.00 89.47  ?  71   GLN A CB    1 
ATOM   532   C  CG    . GLN A 1  71   ? 153.313 170.484 216.384 1.00 107.68 ?  71   GLN A CG    1 
ATOM   533   C  CD    . GLN A 1  71   ? 154.015 169.136 216.256 1.00 121.60 ?  71   GLN A CD    1 
ATOM   534   O  OE1   . GLN A 1  71   ? 154.659 168.679 217.204 1.00 116.47 ?  71   GLN A OE1   1 
ATOM   535   N  NE2   . GLN A 1  71   ? 153.910 168.458 215.102 1.00 110.79 ?  71   GLN A NE2   1 
ATOM   536   N  N     . GLU A 1  72   ? 155.287 172.803 212.788 1.00 91.97  ?  72   GLU A N     1 
ATOM   537   C  CA    . GLU A 1  72   ? 155.356 173.304 211.428 1.00 91.70  ?  72   GLU A CA    1 
ATOM   538   C  C     . GLU A 1  72   ? 155.910 172.420 210.284 1.00 94.29  ?  72   GLU A C     1 
ATOM   539   O  O     . GLU A 1  72   ? 155.179 172.197 209.317 1.00 94.89  ?  72   GLU A O     1 
ATOM   540   C  CB    . GLU A 1  72   ? 155.900 174.750 211.410 1.00 92.77  ?  72   GLU A CB    1 
ATOM   541   C  CG    . GLU A 1  72   ? 155.304 175.692 212.460 1.00 100.92 ?  72   GLU A CG    1 
ATOM   542   C  CD    . GLU A 1  72   ? 153.791 175.773 212.496 1.00 116.58 ?  72   GLU A CD    1 
ATOM   543   O  OE1   . GLU A 1  72   ? 153.185 175.970 211.418 1.00 107.74 ?  72   GLU A OE1   1 
ATOM   544   O  OE2   . GLU A 1  72   ? 153.212 175.599 213.595 1.00 111.11 -1 72   GLU A OE2   1 
ATOM   545   N  N     . GLY A 1  73   ? 157.156 171.975 210.350 1.00 88.44  ?  73   GLY A N     1 
ATOM   546   C  CA    . GLY A 1  73   ? 157.689 171.191 209.242 1.00 88.11  ?  73   GLY A CA    1 
ATOM   547   C  C     . GLY A 1  73   ? 158.196 171.954 208.011 1.00 91.96  ?  73   GLY A C     1 
ATOM   548   O  O     . GLY A 1  73   ? 157.520 172.816 207.428 1.00 90.21  ?  73   GLY A O     1 
ATOM   549   N  N     . MET A 1  74   ? 159.418 171.571 207.604 1.00 89.36  ?  74   MET A N     1 
ATOM   550   C  CA    . MET A 1  74   ? 160.252 172.019 206.494 1.00 88.33  ?  74   MET A CA    1 
ATOM   551   C  C     . MET A 1  74   ? 160.284 173.511 206.174 1.00 94.52  ?  74   MET A C     1 
ATOM   552   O  O     . MET A 1  74   ? 161.020 174.241 206.841 1.00 94.24  ?  74   MET A O     1 
ATOM   553   C  CB    . MET A 1  74   ? 160.100 171.117 205.267 1.00 90.05  ?  74   MET A CB    1 
ATOM   554   C  CG    . MET A 1  74   ? 160.458 169.640 205.523 1.00 93.40  ?  74   MET A CG    1 
ATOM   555   S  SD    . MET A 1  74   ? 162.206 169.096 205.676 1.00 96.27  ?  74   MET A SD    1 
ATOM   556   C  CE    . MET A 1  74   ? 162.917 169.751 204.172 1.00 91.93  ?  74   MET A CE    1 
ATOM   557   N  N     . ASN A 1  75   ? 159.545 173.977 205.146 1.00 93.38  ?  75   ASN A N     1 
ATOM   558   C  CA    . ASN A 1  75   ? 159.594 175.404 204.810 1.00 93.76  ?  75   ASN A CA    1 
ATOM   559   C  C     . ASN A 1  75   ? 158.759 176.158 205.816 1.00 95.99  ?  75   ASN A C     1 
ATOM   560   O  O     . ASN A 1  75   ? 157.564 176.401 205.575 1.00 97.26  ?  75   ASN A O     1 
ATOM   561   C  CB    . ASN A 1  75   ? 159.196 175.722 203.335 1.00 98.57  ?  75   ASN A CB    1 
ATOM   562   C  CG    . ASN A 1  75   ? 159.370 177.204 202.965 1.00 129.47 ?  75   ASN A CG    1 
ATOM   563   O  OD1   . ASN A 1  75   ? 160.498 177.742 202.919 1.00 129.32 ?  75   ASN A OD1   1 
ATOM   564   N  ND2   . ASN A 1  75   ? 158.255 177.905 202.707 1.00 114.10 ?  75   ASN A ND2   1 
ATOM   565   N  N     . GLU A 1  76   ? 159.384 176.441 206.985 1.00 88.06  ?  76   GLU A N     1 
ATOM   566   C  CA    . GLU A 1  76   ? 158.812 177.132 208.144 1.00 86.60  ?  76   GLU A CA    1 
ATOM   567   C  C     . GLU A 1  76   ? 159.634 176.854 209.372 1.00 87.78  ?  76   GLU A C     1 
ATOM   568   O  O     . GLU A 1  76   ? 160.008 177.801 210.082 1.00 89.98  ?  76   GLU A O     1 
ATOM   569   C  CB    . GLU A 1  76   ? 157.342 176.751 208.419 1.00 88.16  ?  76   GLU A CB    1 
ATOM   570   C  CG    . GLU A 1  76   ? 156.694 177.508 209.563 1.00 97.02  ?  76   GLU A CG    1 
ATOM   571   C  CD    . GLU A 1  76   ? 156.736 179.019 209.525 1.00 111.65 ?  76   GLU A CD    1 
ATOM   572   O  OE1   . GLU A 1  76   ? 156.099 179.602 208.614 1.00 86.72  ?  76   GLU A OE1   1 
ATOM   573   O  OE2   . GLU A 1  76   ? 157.350 179.618 210.445 1.00 103.15 -1 76   GLU A OE2   1 
ATOM   574   N  N     . CYS A 1  77   ? 159.877 175.569 209.660 1.00 78.72  ?  77   CYS A N     1 
ATOM   575   C  CA    . CYS A 1  77   ? 160.647 175.185 210.828 1.00 76.90  ?  77   CYS A CA    1 
ATOM   576   C  C     . CYS A 1  77   ? 162.142 175.439 210.658 1.00 81.48  ?  77   CYS A C     1 
ATOM   577   O  O     . CYS A 1  77   ? 162.803 174.721 209.890 1.00 81.66  ?  77   CYS A O     1 
ATOM   578   C  CB    . CYS A 1  77   ? 160.352 173.738 211.218 1.00 76.81  ?  77   CYS A CB    1 
ATOM   579   S  SG    . CYS A 1  77   ? 161.523 173.011 212.397 1.00 80.89  ?  77   CYS A SG    1 
ATOM   580   N  N     . PRO A 1  78   ? 162.731 176.439 211.370 1.00 78.95  ?  78   PRO A N     1 
ATOM   581   C  CA    . PRO A 1  78   ? 164.204 176.541 211.366 1.00 79.50  ?  78   PRO A CA    1 
ATOM   582   C  C     . PRO A 1  78   ? 164.601 175.375 212.248 1.00 88.06  ?  78   PRO A C     1 
ATOM   583   O  O     . PRO A 1  78   ? 163.803 174.996 213.111 1.00 90.82  ?  78   PRO A O     1 
ATOM   584   C  CB    . PRO A 1  78   ? 164.489 177.854 212.092 1.00 80.50  ?  78   PRO A CB    1 
ATOM   585   C  CG    . PRO A 1  78   ? 163.342 178.055 212.967 1.00 85.18  ?  78   PRO A CG    1 
ATOM   586   C  CD    . PRO A 1  78   ? 162.138 177.363 212.358 1.00 80.50  ?  78   PRO A CD    1 
ATOM   587   N  N     . GLY A 1  79   ? 165.743 174.763 212.049 1.00 83.76  ?  79   GLY A N     1 
ATOM   588   C  CA    . GLY A 1  79   ? 166.018 173.628 212.926 1.00 83.82  ?  79   GLY A CA    1 
ATOM   589   C  C     . GLY A 1  79   ? 166.046 173.980 214.407 1.00 86.60  ?  79   GLY A C     1 
ATOM   590   O  O     . GLY A 1  79   ? 166.046 175.166 214.776 1.00 86.64  ?  79   GLY A O     1 
ATOM   591   N  N     . HIS A 1  80   ? 166.057 172.961 215.269 1.00 81.17  ?  80   HIS A N     1 
ATOM   592   C  CA    . HIS A 1  80   ? 166.169 173.230 216.700 1.00 80.08  ?  80   HIS A CA    1 
ATOM   593   C  C     . HIS A 1  80   ? 167.487 172.689 217.200 1.00 84.02  ?  80   HIS A C     1 
ATOM   594   O  O     . HIS A 1  80   ? 167.879 171.595 216.800 1.00 85.91  ?  80   HIS A O     1 
ATOM   595   C  CB    . HIS A 1  80   ? 164.999 172.659 217.463 1.00 80.54  ?  80   HIS A CB    1 
ATOM   596   C  CG    . HIS A 1  80   ? 163.709 173.239 217.021 1.00 82.82  ?  80   HIS A CG    1 
ATOM   597   N  ND1   . HIS A 1  80   ? 163.455 174.581 217.150 1.00 84.18  ?  80   HIS A ND1   1 
ATOM   598   C  CD2   . HIS A 1  80   ? 162.647 172.637 216.443 1.00 83.96  ?  80   HIS A CD2   1 
ATOM   599   C  CE1   . HIS A 1  80   ? 162.235 174.755 216.670 1.00 83.41  ?  80   HIS A CE1   1 
ATOM   600   N  NE2   . HIS A 1  80   ? 161.709 173.610 216.243 1.00 83.53  ?  80   HIS A NE2   1 
ATOM   601   N  N     . PHE A 1  81   ? 168.201 173.463 218.016 1.00 78.14  ?  81   PHE A N     1 
ATOM   602   C  CA    . PHE A 1  81   ? 169.504 173.048 218.512 1.00 77.40  ?  81   PHE A CA    1 
ATOM   603   C  C     . PHE A 1  81   ? 169.415 171.943 219.566 1.00 82.01  ?  81   PHE A C     1 
ATOM   604   O  O     . PHE A 1  81   ? 168.424 171.833 220.289 1.00 82.91  ?  81   PHE A O     1 
ATOM   605   C  CB    . PHE A 1  81   ? 170.275 174.262 219.055 1.00 78.60  ?  81   PHE A CB    1 
ATOM   606   C  CG    . PHE A 1  81   ? 171.295 174.799 218.089 1.00 78.57  ?  81   PHE A CG    1 
ATOM   607   C  CD1   . PHE A 1  81   ? 170.932 175.701 217.100 1.00 79.89  ?  81   PHE A CD1   1 
ATOM   608   C  CD2   . PHE A 1  81   ? 172.622 174.403 218.163 1.00 80.49  ?  81   PHE A CD2   1 
ATOM   609   C  CE1   . PHE A 1  81   ? 171.875 176.178 216.181 1.00 79.61  ?  81   PHE A CE1   1 
ATOM   610   C  CE2   . PHE A 1  81   ? 173.569 174.904 217.263 1.00 81.93  ?  81   PHE A CE2   1 
ATOM   611   C  CZ    . PHE A 1  81   ? 173.184 175.777 216.270 1.00 78.53  ?  81   PHE A CZ    1 
ATOM   612   N  N     . GLY A 1  82   ? 170.443 171.122 219.616 1.00 77.14  ?  82   GLY A N     1 
ATOM   613   C  CA    . GLY A 1  82   ? 170.593 170.083 220.620 1.00 77.12  ?  82   GLY A CA    1 
ATOM   614   C  C     . GLY A 1  82   ? 171.876 170.343 221.387 1.00 80.47  ?  82   GLY A C     1 
ATOM   615   O  O     . GLY A 1  82   ? 172.467 171.429 221.267 1.00 81.25  ?  82   GLY A O     1 
ATOM   616   N  N     . HIS A 1  83   ? 172.337 169.349 222.165 1.00 74.38  ?  83   HIS A N     1 
ATOM   617   C  CA    . HIS A 1  83   ? 173.588 169.458 222.909 1.00 72.95  ?  83   HIS A CA    1 
ATOM   618   C  C     . HIS A 1  83   ? 174.256 168.108 223.136 1.00 79.08  ?  83   HIS A C     1 
ATOM   619   O  O     . HIS A 1  83   ? 173.612 167.063 223.018 1.00 77.84  ?  83   HIS A O     1 
ATOM   620   C  CB    . HIS A 1  83   ? 173.362 170.192 224.243 1.00 73.12  ?  83   HIS A CB    1 
ATOM   621   C  CG    . HIS A 1  83   ? 172.937 169.322 225.392 1.00 76.32  ?  83   HIS A CG    1 
ATOM   622   N  ND1   . HIS A 1  83   ? 171.611 169.174 225.726 1.00 77.32  ?  83   HIS A ND1   1 
ATOM   623   C  CD2   . HIS A 1  83   ? 173.691 168.633 226.285 1.00 78.16  ?  83   HIS A CD2   1 
ATOM   624   C  CE1   . HIS A 1  83   ? 171.594 168.397 226.795 1.00 77.59  ?  83   HIS A CE1   1 
ATOM   625   N  NE2   . HIS A 1  83   ? 172.824 168.042 227.166 1.00 78.46  ?  83   HIS A NE2   1 
ATOM   626   N  N     . ILE A 1  84   ? 175.550 168.138 223.485 1.00 79.38  ?  84   ILE A N     1 
ATOM   627   C  CA    . ILE A 1  84   ? 176.345 166.961 223.862 1.00 81.74  ?  84   ILE A CA    1 
ATOM   628   C  C     . ILE A 1  84   ? 177.232 167.310 225.043 1.00 85.65  ?  84   ILE A C     1 
ATOM   629   O  O     . ILE A 1  84   ? 178.059 168.225 224.955 1.00 84.02  ?  84   ILE A O     1 
ATOM   630   C  CB    . ILE A 1  84   ? 177.113 166.196 222.725 1.00 85.57  ?  84   ILE A CB    1 
ATOM   631   C  CG1   . ILE A 1  84   ? 178.081 167.053 221.943 1.00 86.22  ?  84   ILE A CG1   1 
ATOM   632   C  CG2   . ILE A 1  84   ? 176.218 165.475 221.785 1.00 86.38  ?  84   ILE A CG2   1 
ATOM   633   C  CD1   . ILE A 1  84   ? 179.408 166.524 222.070 1.00 102.81 ?  84   ILE A CD1   1 
ATOM   634   N  N     . ASP A 1  85   ? 177.035 166.619 226.161 1.00 84.22  ?  85   ASP A N     1 
ATOM   635   C  CA    . ASP A 1  85   ? 177.855 166.890 227.334 1.00 85.75  ?  85   ASP A CA    1 
ATOM   636   C  C     . ASP A 1  85   ? 179.230 166.226 227.131 1.00 89.74  ?  85   ASP A C     1 
ATOM   637   O  O     . ASP A 1  85   ? 179.316 164.992 227.084 1.00 90.45  ?  85   ASP A O     1 
ATOM   638   C  CB    . ASP A 1  85   ? 177.140 166.448 228.640 1.00 89.01  ?  85   ASP A CB    1 
ATOM   639   C  CG    . ASP A 1  85   ? 175.936 167.303 229.025 1.00 99.31  ?  85   ASP A CG    1 
ATOM   640   O  OD1   . ASP A 1  85   ? 176.120 168.528 229.240 1.00 102.22 ?  85   ASP A OD1   1 
ATOM   641   O  OD2   . ASP A 1  85   ? 174.816 166.740 229.159 1.00 98.89  -1 85   ASP A OD2   1 
ATOM   642   N  N     . LEU A 1  86   ? 180.279 167.045 226.905 1.00 84.85  ?  86   LEU A N     1 
ATOM   643   C  CA    . LEU A 1  86   ? 181.634 166.530 226.700 1.00 84.87  ?  86   LEU A CA    1 
ATOM   644   C  C     . LEU A 1  86   ? 182.167 165.939 227.991 1.00 92.63  ?  86   LEU A C     1 
ATOM   645   O  O     . LEU A 1  86   ? 182.074 166.592 229.040 1.00 92.40  ?  86   LEU A O     1 
ATOM   646   C  CB    . LEU A 1  86   ? 182.615 167.603 226.213 1.00 83.71  ?  86   LEU A CB    1 
ATOM   647   C  CG    . LEU A 1  86   ? 182.356 168.241 224.874 1.00 85.80  ?  86   LEU A CG    1 
ATOM   648   C  CD1   . LEU A 1  86   ? 183.247 169.454 224.697 1.00 85.41  ?  86   LEU A CD1   1 
ATOM   649   C  CD2   . LEU A 1  86   ? 182.579 167.264 223.760 1.00 86.07  ?  86   LEU A CD2   1 
ATOM   650   N  N     . ALA A 1  87   ? 182.743 164.704 227.905 1.00 91.29  ?  87   ALA A N     1 
ATOM   651   C  CA    . ALA A 1  87   ? 183.328 163.950 229.028 1.00 92.80  ?  87   ALA A CA    1 
ATOM   652   C  C     . ALA A 1  87   ? 184.471 164.716 229.754 1.00 98.11  ?  87   ALA A C     1 
ATOM   653   O  O     . ALA A 1  87   ? 184.620 164.591 230.979 1.00 99.04  ?  87   ALA A O     1 
ATOM   654   C  CB    . ALA A 1  87   ? 183.804 162.590 228.554 1.00 93.72  ?  87   ALA A CB    1 
ATOM   655   N  N     . LYS A 1  88   ? 185.236 165.538 228.990 1.00 92.97  ?  88   LYS A N     1 
ATOM   656   C  CA    . LYS A 1  88   ? 186.309 166.407 229.482 1.00 92.07  ?  88   LYS A CA    1 
ATOM   657   C  C     . LYS A 1  88   ? 186.240 167.786 228.808 1.00 94.17  ?  88   LYS A C     1 
ATOM   658   O  O     . LYS A 1  88   ? 185.724 167.859 227.687 1.00 93.46  ?  88   LYS A O     1 
ATOM   659   C  CB    . LYS A 1  88   ? 187.679 165.765 229.245 1.00 93.94  ?  88   LYS A CB    1 
ATOM   660   C  CG    . LYS A 1  88   ? 188.017 164.764 230.336 1.00 112.60 ?  88   LYS A CG    1 
ATOM   661   C  CD    . LYS A 1  88   ? 189.503 164.721 230.613 1.00 124.81 ?  88   LYS A CD    1 
ATOM   662   C  CE    . LYS A 1  88   ? 189.867 164.160 231.964 1.00 128.71 ?  88   LYS A CE    1 
ATOM   663   N  NZ    . LYS A 1  88   ? 191.231 164.601 232.368 1.00 134.32 1  88   LYS A NZ    1 
ATOM   664   N  N     . PRO A 1  89   ? 186.718 168.898 229.432 1.00 89.50  ?  89   PRO A N     1 
ATOM   665   C  CA    . PRO A 1  89   ? 186.697 170.185 228.718 1.00 88.07  ?  89   PRO A CA    1 
ATOM   666   C  C     . PRO A 1  89   ? 187.743 170.212 227.597 1.00 92.11  ?  89   PRO A C     1 
ATOM   667   O  O     . PRO A 1  89   ? 188.759 169.503 227.636 1.00 92.14  ?  89   PRO A O     1 
ATOM   668   C  CB    . PRO A 1  89   ? 186.965 171.216 229.810 1.00 90.20  ?  89   PRO A CB    1 
ATOM   669   C  CG    . PRO A 1  89   ? 187.705 170.505 230.832 1.00 95.98  ?  89   PRO A CG    1 
ATOM   670   C  CD    . PRO A 1  89   ? 187.341 169.043 230.761 1.00 92.02  ?  89   PRO A CD    1 
ATOM   671   N  N     . VAL A 1  90   ? 187.455 171.005 226.571 1.00 87.95  ?  90   VAL A N     1 
ATOM   672   C  CA    . VAL A 1  90   ? 188.260 171.104 225.365 1.00 87.21  ?  90   VAL A CA    1 
ATOM   673   C  C     . VAL A 1  90   ? 188.371 172.568 224.936 1.00 88.43  ?  90   VAL A C     1 
ATOM   674   O  O     . VAL A 1  90   ? 187.468 173.346 225.222 1.00 87.02  ?  90   VAL A O     1 
ATOM   675   C  CB    . VAL A 1  90   ? 187.550 170.207 224.318 1.00 91.65  ?  90   VAL A CB    1 
ATOM   676   C  CG1   . VAL A 1  90   ? 187.745 170.692 222.893 1.00 90.72  ?  90   VAL A CG1   1 
ATOM   677   C  CG2   . VAL A 1  90   ? 187.973 168.747 224.465 1.00 92.56  ?  90   VAL A CG2   1 
ATOM   678   N  N     . PHE A 1  91   ? 189.471 172.950 224.278 1.00 85.14  ?  91   PHE A N     1 
ATOM   679   C  CA    . PHE A 1  91   ? 189.621 174.321 223.799 1.00 85.52  ?  91   PHE A CA    1 
ATOM   680   C  C     . PHE A 1  91   ? 188.780 174.559 222.536 1.00 90.61  ?  91   PHE A C     1 
ATOM   681   O  O     . PHE A 1  91   ? 188.611 173.645 221.727 1.00 92.37  ?  91   PHE A O     1 
ATOM   682   C  CB    . PHE A 1  91   ? 191.074 174.612 223.413 1.00 87.78  ?  91   PHE A CB    1 
ATOM   683   C  CG    . PHE A 1  91   ? 192.117 174.536 224.489 1.00 91.54  ?  91   PHE A CG    1 
ATOM   684   C  CD1   . PHE A 1  91   ? 192.012 175.307 225.640 1.00 95.74  ?  91   PHE A CD1   1 
ATOM   685   C  CD2   . PHE A 1  91   ? 193.262 173.771 224.312 1.00 96.16  ?  91   PHE A CD2   1 
ATOM   686   C  CE1   . PHE A 1  91   ? 193.003 175.265 226.627 1.00 98.39  ?  91   PHE A CE1   1 
ATOM   687   C  CE2   . PHE A 1  91   ? 194.254 173.725 225.299 1.00 100.82 ?  91   PHE A CE2   1 
ATOM   688   C  CZ    . PHE A 1  91   ? 194.121 174.482 226.447 1.00 99.17  ?  91   PHE A CZ    1 
ATOM   689   N  N     . HIS A 1  92   ? 188.302 175.792 222.326 1.00 84.25  ?  92   HIS A N     1 
ATOM   690   C  CA    . HIS A 1  92   ? 187.631 176.127 221.077 1.00 81.83  ?  92   HIS A CA    1 
ATOM   691   C  C     . HIS A 1  92   ? 188.817 176.508 220.190 1.00 84.86  ?  92   HIS A C     1 
ATOM   692   O  O     . HIS A 1  92   ? 189.585 177.392 220.593 1.00 85.15  ?  92   HIS A O     1 
ATOM   693   C  CB    . HIS A 1  92   ? 186.693 177.336 221.286 1.00 81.68  ?  92   HIS A CB    1 
ATOM   694   C  CG    . HIS A 1  92   ? 185.978 177.832 220.057 1.00 83.29  ?  92   HIS A CG    1 
ATOM   695   N  ND1   . HIS A 1  92   ? 186.657 178.142 218.883 1.00 84.01  ?  92   HIS A ND1   1 
ATOM   696   C  CD2   . HIS A 1  92   ? 184.673 178.156 219.897 1.00 83.68  ?  92   HIS A CD2   1 
ATOM   697   C  CE1   . HIS A 1  92   ? 185.739 178.576 218.039 1.00 82.04  ?  92   HIS A CE1   1 
ATOM   698   N  NE2   . HIS A 1  92   ? 184.534 178.608 218.607 1.00 82.32  ?  92   HIS A NE2   1 
ATOM   699   N  N     . VAL A 1  93   ? 189.004 175.828 219.027 1.00 79.96  ?  93   VAL A N     1 
ATOM   700   C  CA    . VAL A 1  93   ? 190.118 176.118 218.097 1.00 79.68  ?  93   VAL A CA    1 
ATOM   701   C  C     . VAL A 1  93   ? 190.380 177.607 217.951 1.00 84.66  ?  93   VAL A C     1 
ATOM   702   O  O     . VAL A 1  93   ? 191.510 178.051 218.175 1.00 85.80  ?  93   VAL A O     1 
ATOM   703   C  CB    . VAL A 1  93   ? 189.968 175.516 216.689 1.00 82.79  ?  93   VAL A CB    1 
ATOM   704   C  CG1   . VAL A 1  93   ? 191.056 174.494 216.406 1.00 82.94  ?  93   VAL A CG1   1 
ATOM   705   C  CG2   . VAL A 1  93   ? 188.572 174.968 216.443 1.00 82.21  ?  93   VAL A CG2   1 
ATOM   706   N  N     . GLY A 1  94   ? 189.327 178.357 217.606 1.00 79.77  ?  94   GLY A N     1 
ATOM   707   C  CA    . GLY A 1  94   ? 189.375 179.799 217.404 1.00 79.06  ?  94   GLY A CA    1 
ATOM   708   C  C     . GLY A 1  94   ? 189.953 180.613 218.547 1.00 83.46  ?  94   GLY A C     1 
ATOM   709   O  O     . GLY A 1  94   ? 190.554 181.669 218.306 1.00 82.58  ?  94   GLY A O     1 
ATOM   710   N  N     . PHE A 1  95   ? 189.786 180.129 219.797 1.00 81.12  ?  95   PHE A N     1 
ATOM   711   C  CA    . PHE A 1  95   ? 190.263 180.840 220.981 1.00 82.00  ?  95   PHE A CA    1 
ATOM   712   C  C     . PHE A 1  95   ? 191.602 180.398 221.563 1.00 88.14  ?  95   PHE A C     1 
ATOM   713   O  O     . PHE A 1  95   ? 192.091 181.073 222.467 1.00 88.72  ?  95   PHE A O     1 
ATOM   714   C  CB    . PHE A 1  95   ? 189.161 180.970 222.042 1.00 83.61  ?  95   PHE A CB    1 
ATOM   715   C  CG    . PHE A 1  95   ? 187.954 181.645 221.463 1.00 84.20  ?  95   PHE A CG    1 
ATOM   716   C  CD1   . PHE A 1  95   ? 188.004 182.975 221.066 1.00 86.77  ?  95   PHE A CD1   1 
ATOM   717   C  CD2   . PHE A 1  95   ? 186.792 180.930 221.213 1.00 87.07  ?  95   PHE A CD2   1 
ATOM   718   C  CE1   . PHE A 1  95   ? 186.903 183.585 220.450 1.00 87.37  ?  95   PHE A CE1   1 
ATOM   719   C  CE2   . PHE A 1  95   ? 185.684 181.541 220.599 1.00 89.21  ?  95   PHE A CE2   1 
ATOM   720   C  CZ    . PHE A 1  95   ? 185.747 182.866 220.223 1.00 86.54  ?  95   PHE A CZ    1 
ATOM   721   N  N     . ILE A 1  96   ? 192.228 179.329 221.018 1.00 85.00  ?  96   ILE A N     1 
ATOM   722   C  CA    . ILE A 1  96   ? 193.517 178.828 221.504 1.00 86.71  ?  96   ILE A CA    1 
ATOM   723   C  C     . ILE A 1  96   ? 194.557 179.915 221.834 1.00 90.88  ?  96   ILE A C     1 
ATOM   724   O  O     . ILE A 1  96   ? 195.153 179.864 222.908 1.00 91.27  ?  96   ILE A O     1 
ATOM   725   C  CB    . ILE A 1  96   ? 194.068 177.580 220.722 1.00 90.52  ?  96   ILE A CB    1 
ATOM   726   C  CG1   . ILE A 1  96   ? 193.498 176.266 221.317 1.00 91.52  ?  96   ILE A CG1   1 
ATOM   727   C  CG2   . ILE A 1  96   ? 195.614 177.508 220.715 1.00 92.40  ?  96   ILE A CG2   1 
ATOM   728   C  CD1   . ILE A 1  96   ? 193.326 175.106 220.330 1.00 94.78  ?  96   ILE A CD1   1 
ATOM   729   N  N     . ALA A 1  97   ? 194.739 180.912 220.962 1.00 87.20  ?  97   ALA A N     1 
ATOM   730   C  CA    . ALA A 1  97   ? 195.713 181.967 221.253 1.00 87.80  ?  97   ALA A CA    1 
ATOM   731   C  C     . ALA A 1  97   ? 195.231 182.976 222.294 1.00 91.51  ?  97   ALA A C     1 
ATOM   732   O  O     . ALA A 1  97   ? 196.037 183.336 223.161 1.00 91.72  ?  97   ALA A O     1 
ATOM   733   C  CB    . ALA A 1  97   ? 196.159 182.660 219.984 1.00 88.10  ?  97   ALA A CB    1 
ATOM   734   N  N     . LYS A 1  98   ? 193.923 183.415 222.239 1.00 87.32  ?  98   LYS A N     1 
ATOM   735   C  CA    . LYS A 1  98   ? 193.355 184.335 223.253 1.00 86.91  ?  98   LYS A CA    1 
ATOM   736   C  C     . LYS A 1  98   ? 193.401 183.666 224.647 1.00 91.19  ?  98   LYS A C     1 
ATOM   737   O  O     . LYS A 1  98   ? 193.775 184.332 225.609 1.00 92.76  ?  98   LYS A O     1 
ATOM   738   C  CB    . LYS A 1  98   ? 191.949 184.891 222.898 1.00 87.11  ?  98   LYS A CB    1 
ATOM   739   C  CG    . LYS A 1  98   ? 191.575 186.152 223.711 1.00 86.49  ?  98   LYS A CG    1 
ATOM   740   C  CD    . LYS A 1  98   ? 190.620 187.153 223.008 1.00 97.15  ?  98   LYS A CD    1 
ATOM   741   C  CE    . LYS A 1  98   ? 190.505 188.491 223.749 1.00 113.36 ?  98   LYS A CE    1 
ATOM   742   N  NZ    . LYS A 1  98   ? 189.266 189.286 223.426 1.00 115.55 1  98   LYS A NZ    1 
ATOM   743   N  N     . ILE A 1  99   ? 193.128 182.336 224.729 1.00 85.20  ?  99   ILE A N     1 
ATOM   744   C  CA    . ILE A 1  99   ? 193.239 181.535 225.952 1.00 84.63  ?  99   ILE A CA    1 
ATOM   745   C  C     . ILE A 1  99   ? 194.685 181.660 226.449 1.00 90.03  ?  99   ILE A C     1 
ATOM   746   O  O     . ILE A 1  99   ? 194.882 182.117 227.577 1.00 91.11  ?  99   ILE A O     1 
ATOM   747   C  CB    . ILE A 1  99   ? 192.821 180.050 225.720 1.00 86.67  ?  99   ILE A CB    1 
ATOM   748   C  CG1   . ILE A 1  99   ? 191.298 179.919 225.551 1.00 85.81  ?  99   ILE A CG1   1 
ATOM   749   C  CG2   . ILE A 1  99   ? 193.300 179.163 226.863 1.00 88.34  ?  99   ILE A CG2   1 
ATOM   750   C  CD1   . ILE A 1  99   ? 190.809 178.646 224.944 1.00 87.97  ?  99   ILE A CD1   1 
ATOM   751   N  N     . LYS A 1  100  ? 195.683 181.324 225.577 1.00 86.59  ?  100  LYS A N     1 
ATOM   752   C  CA    . LYS A 1  100  ? 197.126 181.395 225.858 1.00 87.36  ?  100  LYS A CA    1 
ATOM   753   C  C     . LYS A 1  100  ? 197.449 182.751 226.423 1.00 93.17  ?  100  LYS A C     1 
ATOM   754   O  O     . LYS A 1  100  ? 197.966 182.807 227.536 1.00 95.41  ?  100  LYS A O     1 
ATOM   755   C  CB    . LYS A 1  100  ? 197.985 181.140 224.602 1.00 88.84  ?  100  LYS A CB    1 
ATOM   756   C  CG    . LYS A 1  100  ? 199.471 180.963 224.902 1.00 97.44  ?  100  LYS A CG    1 
ATOM   757   C  CD    . LYS A 1  100  ? 200.363 181.456 223.767 1.00 107.08 ?  100  LYS A CD    1 
ATOM   758   C  CE    . LYS A 1  100  ? 201.715 180.762 223.769 1.00 115.09 ?  100  LYS A CE    1 
ATOM   759   N  NZ    . LYS A 1  100  ? 202.842 181.686 223.444 1.00 119.29 1  100  LYS A NZ    1 
ATOM   760   N  N     . LYS A 1  101  ? 197.090 183.841 225.702 1.00 88.23  ?  101  LYS A N     1 
ATOM   761   C  CA    . LYS A 1  101  ? 197.332 185.217 226.153 1.00 88.30  ?  101  LYS A CA    1 
ATOM   762   C  C     . LYS A 1  101  ? 196.723 185.536 227.509 1.00 93.57  ?  101  LYS A C     1 
ATOM   763   O  O     . LYS A 1  101  ? 197.366 186.233 228.301 1.00 93.66  ?  101  LYS A O     1 
ATOM   764   C  CB    . LYS A 1  101  ? 196.921 186.254 225.107 1.00 89.29  ?  101  LYS A CB    1 
ATOM   765   C  CG    . LYS A 1  101  ? 197.927 186.350 223.973 1.00 100.48 ?  101  LYS A CG    1 
ATOM   766   C  CD    . LYS A 1  101  ? 197.731 187.615 223.173 1.00 104.93 ?  101  LYS A CD    1 
ATOM   767   C  CE    . LYS A 1  101  ? 198.522 187.566 221.900 1.00 108.36 ?  101  LYS A CE    1 
ATOM   768   N  NZ    . LYS A 1  101  ? 198.414 188.834 221.140 1.00 115.25 1  101  LYS A NZ    1 
ATOM   769   N  N     . VAL A 1  102  ? 195.516 184.993 227.799 1.00 90.69  ?  102  VAL A N     1 
ATOM   770   C  CA    . VAL A 1  102  ? 194.846 185.215 229.082 1.00 91.69  ?  102  VAL A CA    1 
ATOM   771   C  C     . VAL A 1  102  ? 195.633 184.572 230.219 1.00 99.77  ?  102  VAL A C     1 
ATOM   772   O  O     . VAL A 1  102  ? 195.880 185.236 231.232 1.00 100.53 ?  102  VAL A O     1 
ATOM   773   C  CB    . VAL A 1  102  ? 193.320 184.948 229.074 1.00 94.39  ?  102  VAL A CB    1 
ATOM   774   C  CG1   . VAL A 1  102  ? 192.732 185.028 230.477 1.00 95.38  ?  102  VAL A CG1   1 
ATOM   775   C  CG2   . VAL A 1  102  ? 192.612 185.952 228.168 1.00 92.69  ?  102  VAL A CG2   1 
ATOM   776   N  N     . CYS A 1  103  ? 196.148 183.345 229.994 1.00 98.66  ?  103  CYS A N     1 
ATOM   777   C  CA    . CYS A 1  103  ? 197.014 182.632 230.952 1.00 100.67 ?  103  CYS A CA    1 
ATOM   778   C  C     . CYS A 1  103  ? 198.283 183.436 231.198 1.00 105.16 ?  103  CYS A C     1 
ATOM   779   O  O     . CYS A 1  103  ? 198.713 183.571 232.346 1.00 106.34 ?  103  CYS A O     1 
ATOM   780   C  CB    . CYS A 1  103  ? 197.342 181.233 230.447 1.00 101.42 ?  103  CYS A CB    1 
ATOM   781   S  SG    . CYS A 1  103  ? 195.892 180.231 230.055 1.00 104.91 ?  103  CYS A SG    1 
ATOM   782   N  N     . GLU A 1  104  ? 198.846 184.006 230.109 1.00 100.57 ?  104  GLU A N     1 
ATOM   783   C  CA    . GLU A 1  104  ? 200.038 184.852 230.103 1.00 100.99 ?  104  GLU A CA    1 
ATOM   784   C  C     . GLU A 1  104  ? 199.857 186.151 230.948 1.00 107.70 ?  104  GLU A C     1 
ATOM   785   O  O     . GLU A 1  104  ? 200.835 186.673 231.492 1.00 107.84 ?  104  GLU A O     1 
ATOM   786   C  CB    . GLU A 1  104  ? 200.492 185.150 228.648 1.00 100.73 ?  104  GLU A CB    1 
ATOM   787   C  CG    . GLU A 1  104  ? 200.995 183.921 227.895 1.00 105.76 ?  104  GLU A CG    1 
ATOM   788   C  CD    . GLU A 1  104  ? 201.348 184.027 226.418 1.00 124.62 ?  104  GLU A CD    1 
ATOM   789   O  OE1   . GLU A 1  104  ? 200.713 184.824 225.687 1.00 122.94 ?  104  GLU A OE1   1 
ATOM   790   O  OE2   . GLU A 1  104  ? 202.224 183.249 225.975 1.00 117.11 -1 104  GLU A OE2   1 
ATOM   791   N  N     . CYS A 1  105  ? 198.599 186.612 231.104 1.00 106.12 ?  105  CYS A N     1 
ATOM   792   C  CA    . CYS A 1  105  ? 198.218 187.829 231.836 1.00 108.01 ?  105  CYS A CA    1 
ATOM   793   C  C     . CYS A 1  105  ? 197.869 187.619 233.305 1.00 114.08 ?  105  CYS A C     1 
ATOM   794   O  O     . CYS A 1  105  ? 197.948 188.552 234.110 1.00 113.82 ?  105  CYS A O     1 
ATOM   795   C  CB    . CYS A 1  105  ? 197.066 188.524 231.115 1.00 107.83 ?  105  CYS A CB    1 
ATOM   796   S  SG    . CYS A 1  105  ? 197.528 189.334 229.564 1.00 110.99 ?  105  CYS A SG    1 
ATOM   797   N  N     . VAL A 1  106  ? 197.377 186.432 233.624 1.00 112.23 ?  106  VAL A N     1 
ATOM   798   C  CA    . VAL A 1  106  ? 196.857 186.120 234.942 1.00 113.52 ?  106  VAL A CA    1 
ATOM   799   C  C     . VAL A 1  106  ? 197.725 185.104 235.716 1.00 118.14 ?  106  VAL A C     1 
ATOM   800   O  O     . VAL A 1  106  ? 198.639 184.502 235.142 1.00 116.86 ?  106  VAL A O     1 
ATOM   801   C  CB    . VAL A 1  106  ? 195.358 185.718 234.746 1.00 117.00 ?  106  VAL A CB    1 
ATOM   802   C  CG1   . VAL A 1  106  ? 195.172 184.226 234.502 1.00 116.57 ?  106  VAL A CG1   1 
ATOM   803   C  CG2   . VAL A 1  106  ? 194.469 186.222 235.871 1.00 117.73 ?  106  VAL A CG2   1 
ATOM   804   N  N     . CYS A 1  107  ? 197.462 184.948 237.020 1.00 116.94 ?  107  CYS A N     1 
ATOM   805   C  CA    . CYS A 1  107  ? 198.204 183.988 237.826 1.00 118.93 ?  107  CYS A CA    1 
ATOM   806   C  C     . CYS A 1  107  ? 197.627 182.600 237.627 1.00 123.96 ?  107  CYS A C     1 
ATOM   807   O  O     . CYS A 1  107  ? 196.439 182.401 237.891 1.00 123.60 ?  107  CYS A O     1 
ATOM   808   C  CB    . CYS A 1  107  ? 198.224 184.382 239.299 1.00 120.82 ?  107  CYS A CB    1 
ATOM   809   S  SG    . CYS A 1  107  ? 198.874 183.093 240.399 1.00 126.30 ?  107  CYS A SG    1 
ATOM   810   N  N     . MET A 1  108  ? 198.475 181.632 237.203 1.00 120.98 ?  108  MET A N     1 
ATOM   811   C  CA    . MET A 1  108  ? 198.089 180.228 236.970 1.00 120.46 ?  108  MET A CA    1 
ATOM   812   C  C     . MET A 1  108  ? 197.835 179.400 238.254 1.00 125.22 ?  108  MET A C     1 
ATOM   813   O  O     . MET A 1  108  ? 197.888 178.164 238.223 1.00 125.19 ?  108  MET A O     1 
ATOM   814   C  CB    . MET A 1  108  ? 199.066 179.525 236.007 1.00 122.42 ?  108  MET A CB    1 
ATOM   815   C  CG    . MET A 1  108  ? 199.038 180.082 234.605 1.00 124.84 ?  108  MET A CG    1 
ATOM   816   S  SD    . MET A 1  108  ? 197.364 180.330 233.936 1.00 128.02 ?  108  MET A SD    1 
ATOM   817   C  CE    . MET A 1  108  ? 196.826 178.620 233.710 1.00 124.62 ?  108  MET A CE    1 
ATOM   818   N  N     . HIS A 1  109  ? 197.522 180.091 239.366 1.00 121.78 ?  109  HIS A N     1 
ATOM   819   C  CA    . HIS A 1  109  ? 197.227 179.484 240.655 1.00 122.44 ?  109  HIS A CA    1 
ATOM   820   C  C     . HIS A 1  109  ? 196.098 180.211 241.399 1.00 124.84 ?  109  HIS A C     1 
ATOM   821   O  O     . HIS A 1  109  ? 195.210 179.535 241.930 1.00 124.58 ?  109  HIS A O     1 
ATOM   822   C  CB    . HIS A 1  109  ? 198.488 179.388 241.523 1.00 124.87 ?  109  HIS A CB    1 
ATOM   823   C  CG    . HIS A 1  109  ? 198.205 178.873 242.896 1.00 129.80 ?  109  HIS A CG    1 
ATOM   824   N  ND1   . HIS A 1  109  ? 198.025 177.519 243.135 1.00 132.00 ?  109  HIS A ND1   1 
ATOM   825   C  CD2   . HIS A 1  109  ? 198.012 179.552 244.052 1.00 132.63 ?  109  HIS A CD2   1 
ATOM   826   C  CE1   . HIS A 1  109  ? 197.765 177.417 244.427 1.00 132.92 ?  109  HIS A CE1   1 
ATOM   827   N  NE2   . HIS A 1  109  ? 197.745 178.615 245.021 1.00 133.73 ?  109  HIS A NE2   1 
ATOM   828   N  N     . CYS A 1  110  ? 196.152 181.567 241.478 1.00 119.90 ?  110  CYS A N     1 
ATOM   829   C  CA    . CYS A 1  110  ? 195.130 182.349 242.185 1.00 119.51 ?  110  CYS A CA    1 
ATOM   830   C  C     . CYS A 1  110  ? 194.087 183.049 241.297 1.00 121.35 ?  110  CYS A C     1 
ATOM   831   O  O     . CYS A 1  110  ? 192.989 183.369 241.777 1.00 120.29 ?  110  CYS A O     1 
ATOM   832   C  CB    . CYS A 1  110  ? 195.746 183.293 243.218 1.00 121.15 ?  110  CYS A CB    1 
ATOM   833   S  SG    . CYS A 1  110  ? 196.429 184.825 242.535 1.00 124.31 ?  110  CYS A SG    1 
ATOM   834   N  N     . GLY A 1  111  ? 194.428 183.235 240.017 1.00 116.89 ?  111  GLY A N     1 
ATOM   835   C  CA    . GLY A 1  111  ? 193.562 183.858 239.020 1.00 115.09 ?  111  GLY A CA    1 
ATOM   836   C  C     . GLY A 1  111  ? 193.475 185.356 239.195 1.00 119.03 ?  111  GLY A C     1 
ATOM   837   O  O     . GLY A 1  111  ? 192.381 185.934 239.190 1.00 117.89 ?  111  GLY A O     1 
ATOM   838   N  N     . LYS A 1  112  ? 194.635 185.987 239.375 1.00 116.98 ?  112  LYS A N     1 
ATOM   839   C  CA    . LYS A 1  112  ? 194.705 187.427 239.563 1.00 117.97 ?  112  LYS A CA    1 
ATOM   840   C  C     . LYS A 1  112  ? 195.710 188.030 238.621 1.00 121.60 ?  112  LYS A C     1 
ATOM   841   O  O     . LYS A 1  112  ? 196.772 187.430 238.401 1.00 121.78 ?  112  LYS A O     1 
ATOM   842   C  CB    . LYS A 1  112  ? 195.024 187.807 241.030 1.00 123.66 ?  112  LYS A CB    1 
ATOM   843   C  CG    . LYS A 1  112  ? 193.872 187.587 242.039 1.00 151.39 ?  112  LYS A CG    1 
ATOM   844   C  CD    . LYS A 1  112  ? 192.519 188.255 241.652 1.00 166.29 ?  112  LYS A CD    1 
ATOM   845   C  CE    . LYS A 1  112  ? 192.431 189.717 242.033 1.00 180.97 ?  112  LYS A CE    1 
ATOM   846   N  NZ    . LYS A 1  112  ? 191.248 190.376 241.418 1.00 187.12 1  112  LYS A NZ    1 
ATOM   847   N  N     . LEU A 1  113  ? 195.355 189.209 238.036 1.00 116.73 ?  113  LEU A N     1 
ATOM   848   C  CA    . LEU A 1  113  ? 196.189 189.973 237.100 1.00 115.43 ?  113  LEU A CA    1 
ATOM   849   C  C     . LEU A 1  113  ? 197.608 190.184 237.668 1.00 121.22 ?  113  LEU A C     1 
ATOM   850   O  O     . LEU A 1  113  ? 197.770 190.698 238.785 1.00 121.90 ?  113  LEU A O     1 
ATOM   851   C  CB    . LEU A 1  113  ? 195.533 191.324 236.755 1.00 114.20 ?  113  LEU A CB    1 
ATOM   852   C  CG    . LEU A 1  113  ? 194.610 191.376 235.540 1.00 115.98 ?  113  LEU A CG    1 
ATOM   853   C  CD1   . LEU A 1  113  ? 193.744 192.610 235.592 1.00 115.60 ?  113  LEU A CD1   1 
ATOM   854   C  CD2   . LEU A 1  113  ? 195.394 191.367 234.235 1.00 115.63 ?  113  LEU A CD2   1 
ATOM   855   N  N     . LEU A 1  114  ? 198.622 189.734 236.905 1.00 117.50 ?  114  LEU A N     1 
ATOM   856   C  CA    . LEU A 1  114  ? 200.034 189.805 237.289 1.00 118.39 ?  114  LEU A CA    1 
ATOM   857   C  C     . LEU A 1  114  ? 200.520 191.215 237.618 1.00 122.51 ?  114  LEU A C     1 
ATOM   858   O  O     . LEU A 1  114  ? 201.435 191.372 238.430 1.00 123.97 ?  114  LEU A O     1 
ATOM   859   C  CB    . LEU A 1  114  ? 200.934 189.098 236.261 1.00 117.97 ?  114  LEU A CB    1 
ATOM   860   C  CG    . LEU A 1  114  ? 200.570 187.637 235.947 1.00 122.45 ?  114  LEU A CG    1 
ATOM   861   C  CD1   . LEU A 1  114  ? 201.460 187.070 234.872 1.00 122.35 ?  114  LEU A CD1   1 
ATOM   862   C  CD2   . LEU A 1  114  ? 200.629 186.766 237.180 1.00 126.34 ?  114  LEU A CD2   1 
ATOM   863   N  N     . LEU A 1  115  ? 199.870 192.233 237.023 1.00 116.99 ?  115  LEU A N     1 
ATOM   864   C  CA    . LEU A 1  115  ? 200.128 193.654 237.268 1.00 116.84 ?  115  LEU A CA    1 
ATOM   865   C  C     . LEU A 1  115  ? 198.798 194.323 237.598 1.00 120.98 ?  115  LEU A C     1 
ATOM   866   O  O     . LEU A 1  115  ? 197.748 193.769 237.276 1.00 118.84 ?  115  LEU A O     1 
ATOM   867   C  CB    . LEU A 1  115  ? 200.811 194.325 236.062 1.00 115.71 ?  115  LEU A CB    1 
ATOM   868   C  CG    . LEU A 1  115  ? 202.212 193.820 235.723 1.00 120.43 ?  115  LEU A CG    1 
ATOM   869   C  CD1   . LEU A 1  115  ? 202.550 194.069 234.290 1.00 118.88 ?  115  LEU A CD1   1 
ATOM   870   C  CD2   . LEU A 1  115  ? 203.250 194.463 236.600 1.00 125.63 ?  115  LEU A CD2   1 
ATOM   871   N  N     . ASP A 1  116  ? 198.830 195.472 238.289 1.00 120.10 ?  116  ASP A N     1 
ATOM   872   C  CA    . ASP A 1  116  ? 197.600 196.167 238.681 1.00 120.57 ?  116  ASP A CA    1 
ATOM   873   C  C     . ASP A 1  116  ? 197.773 197.684 238.806 1.00 128.74 ?  116  ASP A C     1 
ATOM   874   O  O     . ASP A 1  116  ? 198.713 198.244 238.238 1.00 128.70 ?  116  ASP A O     1 
ATOM   875   C  CB    . ASP A 1  116  ? 196.993 195.552 239.967 1.00 122.63 ?  116  ASP A CB    1 
ATOM   876   C  CG    . ASP A 1  116  ? 197.932 195.434 241.154 1.00 126.76 ?  116  ASP A CG    1 
ATOM   877   O  OD1   . ASP A 1  116  ? 198.925 196.199 241.211 1.00 125.83 ?  116  ASP A OD1   1 
ATOM   878   O  OD2   . ASP A 1  116  ? 197.673 194.581 242.030 1.00 131.52 -1 116  ASP A OD2   1 
ATOM   879   N  N     . GLU A 1  117  ? 196.868 198.334 239.577 1.00 128.12 ?  117  GLU A N     1 
ATOM   880   C  CA    . GLU A 1  117  ? 196.800 199.777 239.860 1.00 129.27 ?  117  GLU A CA    1 
ATOM   881   C  C     . GLU A 1  117  ? 198.103 200.319 240.463 1.00 135.14 ?  117  GLU A C     1 
ATOM   882   O  O     . GLU A 1  117  ? 198.381 201.517 240.340 1.00 134.74 ?  117  GLU A O     1 
ATOM   883   C  CB    . GLU A 1  117  ? 195.610 200.107 240.787 1.00 131.38 ?  117  GLU A CB    1 
ATOM   884   C  CG    . GLU A 1  117  ? 194.248 199.630 240.292 1.00 142.18 ?  117  GLU A CG    1 
ATOM   885   C  CD    . GLU A 1  117  ? 193.929 198.177 240.596 1.00 164.99 ?  117  GLU A CD    1 
ATOM   886   O  OE1   . GLU A 1  117  ? 194.066 197.769 241.774 1.00 160.19 ?  117  GLU A OE1   1 
ATOM   887   O  OE2   . GLU A 1  117  ? 193.591 197.436 239.644 1.00 153.75 -1 117  GLU A OE2   1 
ATOM   888   N  N     . HIS A 1  118  ? 198.897 199.430 241.098 1.00 133.09 ?  118  HIS A N     1 
ATOM   889   C  CA    . HIS A 1  118  ? 200.183 199.774 241.694 1.00 134.46 ?  118  HIS A CA    1 
ATOM   890   C  C     . HIS A 1  118  ? 201.249 200.078 240.635 1.00 137.90 ?  118  HIS A C     1 
ATOM   891   O  O     . HIS A 1  118  ? 202.012 201.022 240.832 1.00 139.23 ?  118  HIS A O     1 
ATOM   892   C  CB    . HIS A 1  118  ? 200.633 198.734 242.733 1.00 136.44 ?  118  HIS A CB    1 
ATOM   893   C  CG    . HIS A 1  118  ? 199.644 198.536 243.846 1.00 140.60 ?  118  HIS A CG    1 
ATOM   894   N  ND1   . HIS A 1  118  ? 199.273 199.579 244.681 1.00 143.31 ?  118  HIS A ND1   1 
ATOM   895   C  CD2   . HIS A 1  118  ? 198.973 197.420 244.220 1.00 142.30 ?  118  HIS A CD2   1 
ATOM   896   C  CE1   . HIS A 1  118  ? 198.394 199.064 245.528 1.00 143.20 ?  118  HIS A CE1   1 
ATOM   897   N  NE2   . HIS A 1  118  ? 198.186 197.767 245.295 1.00 142.91 ?  118  HIS A NE2   1 
ATOM   898   N  N     . ASN A 1  119  ? 201.285 199.335 239.502 1.00 132.16 ?  119  ASN A N     1 
ATOM   899   C  CA    . ASN A 1  119  ? 202.237 199.658 238.435 1.00 131.15 ?  119  ASN A CA    1 
ATOM   900   C  C     . ASN A 1  119  ? 201.689 200.838 237.612 1.00 135.31 ?  119  ASN A C     1 
ATOM   901   O  O     . ASN A 1  119  ? 200.506 200.841 237.238 1.00 134.44 ?  119  ASN A O     1 
ATOM   902   C  CB    . ASN A 1  119  ? 202.563 198.453 237.536 1.00 126.83 ?  119  ASN A CB    1 
ATOM   903   C  CG    . ASN A 1  119  ? 203.681 198.713 236.527 1.00 136.14 ?  119  ASN A CG    1 
ATOM   904   O  OD1   . ASN A 1  119  ? 203.731 199.733 235.821 1.00 125.53 ?  119  ASN A OD1   1 
ATOM   905   N  ND2   . ASN A 1  119  ? 204.609 197.783 236.420 1.00 126.73 ?  119  ASN A ND2   1 
ATOM   906   N  N     . GLU A 1  120  ? 202.570 201.826 237.321 1.00 131.99 ?  120  GLU A N     1 
ATOM   907   C  CA    . GLU A 1  120  ? 202.238 203.035 236.562 1.00 130.85 ?  120  GLU A CA    1 
ATOM   908   C  C     . GLU A 1  120  ? 201.895 202.746 235.090 1.00 130.93 ?  120  GLU A C     1 
ATOM   909   O  O     . GLU A 1  120  ? 200.862 203.225 234.598 1.00 129.05 ?  120  GLU A O     1 
ATOM   910   C  CB    . GLU A 1  120  ? 203.346 204.093 236.686 1.00 133.44 ?  120  GLU A CB    1 
ATOM   911   C  CG    . GLU A 1  120  ? 202.886 205.478 236.245 1.00 146.78 ?  120  GLU A CG    1 
ATOM   912   C  CD    . GLU A 1  120  ? 203.901 206.604 236.275 1.00 170.77 ?  120  GLU A CD    1 
ATOM   913   O  OE1   . GLU A 1  120  ? 204.987 206.435 236.878 1.00 162.58 ?  120  GLU A OE1   1 
ATOM   914   O  OE2   . GLU A 1  120  ? 203.595 207.670 235.692 1.00 168.73 -1 120  GLU A OE2   1 
ATOM   915   N  N     . LEU A 1  121  ? 202.762 201.964 234.398 1.00 125.57 ?  121  LEU A N     1 
ATOM   916   C  CA    . LEU A 1  121  ? 202.584 201.568 232.991 1.00 122.88 ?  121  LEU A CA    1 
ATOM   917   C  C     . LEU A 1  121  ? 201.261 200.828 232.827 1.00 124.89 ?  121  LEU A C     1 
ATOM   918   O  O     . LEU A 1  121  ? 200.556 201.008 231.825 1.00 122.44 ?  121  LEU A O     1 
ATOM   919   C  CB    . LEU A 1  121  ? 203.738 200.671 232.528 1.00 122.42 ?  121  LEU A CB    1 
ATOM   920   C  CG    . LEU A 1  121  ? 205.091 201.333 232.402 1.00 126.99 ?  121  LEU A CG    1 
ATOM   921   C  CD1   . LEU A 1  121  ? 206.001 200.940 233.559 1.00 128.38 ?  121  LEU A CD1   1 
ATOM   922   C  CD2   . LEU A 1  121  ? 205.719 200.994 231.078 1.00 127.98 ?  121  LEU A CD2   1 
ATOM   923   N  N     . MET A 1  122  ? 200.921 200.027 233.857 1.00 121.85 ?  122  MET A N     1 
ATOM   924   C  CA    . MET A 1  122  ? 199.702 199.255 233.945 1.00 120.80 ?  122  MET A CA    1 
ATOM   925   C  C     . MET A 1  122  ? 198.503 200.181 234.053 1.00 123.88 ?  122  MET A C     1 
ATOM   926   O  O     . MET A 1  122  ? 197.696 200.189 233.125 1.00 121.73 ?  122  MET A O     1 
ATOM   927   C  CB    . MET A 1  122  ? 199.772 198.244 235.104 1.00 124.03 ?  122  MET A CB    1 
ATOM   928   C  CG    . MET A 1  122  ? 198.616 197.255 235.136 1.00 126.79 ?  122  MET A CG    1 
ATOM   929   S  SD    . MET A 1  122  ? 198.473 196.188 233.684 1.00 129.14 ?  122  MET A SD    1 
ATOM   930   C  CE    . MET A 1  122  ? 197.053 195.229 234.153 1.00 125.43 ?  122  MET A CE    1 
ATOM   931   N  N     . ARG A 1  123  ? 198.413 201.010 235.129 1.00 121.46 ?  123  ARG A N     1 
ATOM   932   C  CA    . ARG A 1  123  ? 197.278 201.934 235.319 1.00 121.11 ?  123  ARG A CA    1 
ATOM   933   C  C     . ARG A 1  123  ? 196.973 202.816 234.088 1.00 123.34 ?  123  ARG A C     1 
ATOM   934   O  O     . ARG A 1  123  ? 195.819 203.192 233.850 1.00 120.50 ?  123  ARG A O     1 
ATOM   935   C  CB    . ARG A 1  123  ? 197.383 202.730 236.633 1.00 122.35 ?  123  ARG A CB    1 
ATOM   936   C  CG    . ARG A 1  123  ? 198.550 203.695 236.713 1.00 133.04 ?  123  ARG A CG    1 
ATOM   937   C  CD    . ARG A 1  123  ? 198.417 204.628 237.899 1.00 144.86 ?  123  ARG A CD    1 
ATOM   938   N  NE    . ARG A 1  123  ? 199.016 204.085 239.121 1.00 151.88 ?  123  ARG A NE    1 
ATOM   939   C  CZ    . ARG A 1  123  ? 200.204 204.444 239.596 1.00 165.46 ?  123  ARG A CZ    1 
ATOM   940   N  NH1   . ARG A 1  123  ? 200.941 205.341 238.955 1.00 144.66 1  123  ARG A NH1   1 
ATOM   941   N  NH2   . ARG A 1  123  ? 200.663 203.913 240.722 1.00 161.89 ?  123  ARG A NH2   1 
ATOM   942   N  N     . GLN A 1  124  ? 198.030 203.054 233.281 1.00 121.05 ?  124  GLN A N     1 
ATOM   943   C  CA    . GLN A 1  124  ? 198.073 203.796 232.020 1.00 120.38 ?  124  GLN A CA    1 
ATOM   944   C  C     . GLN A 1  124  ? 197.406 202.971 230.891 1.00 120.98 ?  124  GLN A C     1 
ATOM   945   O  O     . GLN A 1  124  ? 196.551 203.485 230.148 1.00 118.27 ?  124  GLN A O     1 
ATOM   946   C  CB    . GLN A 1  124  ? 199.557 204.118 231.696 1.00 122.76 ?  124  GLN A CB    1 
ATOM   947   C  CG    . GLN A 1  124  ? 199.852 204.629 230.278 1.00 146.28 ?  124  GLN A CG    1 
ATOM   948   C  CD    . GLN A 1  124  ? 201.315 204.522 229.892 1.00 165.92 ?  124  GLN A CD    1 
ATOM   949   O  OE1   . GLN A 1  124  ? 202.075 203.698 230.417 1.00 161.72 ?  124  GLN A OE1   1 
ATOM   950   N  NE2   . GLN A 1  124  ? 201.729 205.320 228.914 1.00 156.31 ?  124  GLN A NE2   1 
ATOM   951   N  N     . ALA A 1  125  ? 197.838 201.696 230.758 1.00 116.81 ?  125  ALA A N     1 
ATOM   952   C  CA    . ALA A 1  125  ? 197.307 200.761 229.769 1.00 114.57 ?  125  ALA A CA    1 
ATOM   953   C  C     . ALA A 1  125  ? 195.884 200.380 230.163 1.00 116.10 ?  125  ALA A C     1 
ATOM   954   O  O     . ALA A 1  125  ? 195.026 200.251 229.292 1.00 114.62 ?  125  ALA A O     1 
ATOM   955   C  CB    . ALA A 1  125  ? 198.186 199.525 229.682 1.00 115.28 ?  125  ALA A CB    1 
ATOM   956   N  N     . LEU A 1  126  ? 195.624 200.258 231.486 1.00 111.89 ?  126  LEU A N     1 
ATOM   957   C  CA    . LEU A 1  126  ? 194.315 199.945 232.045 1.00 110.72 ?  126  LEU A CA    1 
ATOM   958   C  C     . LEU A 1  126  ? 193.338 201.031 231.668 1.00 114.17 ?  126  LEU A C     1 
ATOM   959   O  O     . LEU A 1  126  ? 192.177 200.732 231.412 1.00 113.15 ?  126  LEU A O     1 
ATOM   960   C  CB    . LEU A 1  126  ? 194.384 199.812 233.577 1.00 111.95 ?  126  LEU A CB    1 
ATOM   961   C  CG    . LEU A 1  126  ? 194.884 198.474 234.141 1.00 117.15 ?  126  LEU A CG    1 
ATOM   962   C  CD1   . LEU A 1  126  ? 195.167 198.582 235.614 1.00 118.97 ?  126  LEU A CD1   1 
ATOM   963   C  CD2   . LEU A 1  126  ? 193.867 197.365 233.947 1.00 119.19 ?  126  LEU A CD2   1 
ATOM   964   N  N     . ALA A 1  127  ? 193.825 202.285 231.587 1.00 111.48 ?  127  ALA A N     1 
ATOM   965   C  CA    . ALA A 1  127  ? 193.056 203.474 231.238 1.00 111.05 ?  127  ALA A CA    1 
ATOM   966   C  C     . ALA A 1  127  ? 192.453 203.443 229.831 1.00 113.89 ?  127  ALA A C     1 
ATOM   967   O  O     . ALA A 1  127  ? 191.353 203.979 229.644 1.00 112.56 ?  127  ALA A O     1 
ATOM   968   C  CB    . ALA A 1  127  ? 193.921 204.702 231.398 1.00 112.69 ?  127  ALA A CB    1 
ATOM   969   N  N     . ILE A 1  128  ? 193.175 202.824 228.847 1.00 110.41 ?  128  ILE A N     1 
ATOM   970   C  CA    . ILE A 1  128  ? 192.774 202.681 227.427 1.00 108.51 ?  128  ILE A CA    1 
ATOM   971   C  C     . ILE A 1  128  ? 191.301 202.305 227.286 1.00 110.91 ?  128  ILE A C     1 
ATOM   972   O  O     . ILE A 1  128  ? 190.853 201.295 227.841 1.00 109.81 ?  128  ILE A O     1 
ATOM   973   C  CB    . ILE A 1  128  ? 193.736 201.778 226.589 1.00 110.78 ?  128  ILE A CB    1 
ATOM   974   C  CG1   . ILE A 1  128  ? 195.161 202.355 226.600 1.00 112.21 ?  128  ILE A CG1   1 
ATOM   975   C  CG2   . ILE A 1  128  ? 193.235 201.565 225.144 1.00 109.21 ?  128  ILE A CG2   1 
ATOM   976   C  CD1   . ILE A 1  128  ? 196.244 201.371 226.375 1.00 120.58 ?  128  ILE A CD1   1 
ATOM   977   N  N     . LYS A 1  129  ? 190.551 203.179 226.594 1.00 106.87 ?  129  LYS A N     1 
ATOM   978   C  CA    . LYS A 1  129  ? 189.111 203.053 226.380 1.00 105.58 ?  129  LYS A CA    1 
ATOM   979   C  C     . LYS A 1  129  ? 188.782 201.879 225.480 1.00 106.75 ?  129  LYS A C     1 
ATOM   980   O  O     . LYS A 1  129  ? 187.870 201.110 225.813 1.00 104.92 ?  129  LYS A O     1 
ATOM   981   C  CB    . LYS A 1  129  ? 188.510 204.364 225.835 1.00 107.91 ?  129  LYS A CB    1 
ATOM   982   C  CG    . LYS A 1  129  ? 188.950 205.638 226.575 1.00 127.06 ?  129  LYS A CG    1 
ATOM   983   C  CD    . LYS A 1  129  ? 188.322 205.799 227.968 1.00 138.74 ?  129  LYS A CD    1 
ATOM   984   C  CE    . LYS A 1  129  ? 189.027 206.853 228.792 1.00 152.83 ?  129  LYS A CE    1 
ATOM   985   N  NZ    . LYS A 1  129  ? 188.749 208.228 228.298 1.00 162.34 1  129  LYS A NZ    1 
ATOM   986   N  N     . ASP A 1  130  ? 189.549 201.715 224.366 1.00 102.59 ?  130  ASP A N     1 
ATOM   987   C  CA    . ASP A 1  130  ? 189.320 200.623 223.428 1.00 101.42 ?  130  ASP A CA    1 
ATOM   988   C  C     . ASP A 1  130  ? 189.542 199.266 224.033 1.00 104.14 ?  130  ASP A C     1 
ATOM   989   O  O     . ASP A 1  130  ? 190.668 198.896 224.371 1.00 104.57 ?  130  ASP A O     1 
ATOM   990   C  CB    . ASP A 1  130  ? 190.073 200.763 222.089 1.00 103.49 ?  130  ASP A CB    1 
ATOM   991   C  CG    . ASP A 1  130  ? 189.713 199.654 221.081 1.00 122.89 ?  130  ASP A CG    1 
ATOM   992   O  OD1   . ASP A 1  130  ? 188.494 199.406 220.864 1.00 131.10 ?  130  ASP A OD1   1 
ATOM   993   O  OD2   . ASP A 1  130  ? 190.641 199.001 220.556 1.00 125.05 -1 130  ASP A OD2   1 
ATOM   994   N  N     . SER A 1  131  ? 188.443 198.514 224.114 1.00 99.40  ?  131  SER A N     1 
ATOM   995   C  CA    . SER A 1  131  ? 188.340 197.145 224.603 1.00 98.90  ?  131  SER A CA    1 
ATOM   996   C  C     . SER A 1  131  ? 189.472 196.240 224.066 1.00 100.74 ?  131  SER A C     1 
ATOM   997   O  O     . SER A 1  131  ? 190.015 195.457 224.834 1.00 102.17 ?  131  SER A O     1 
ATOM   998   C  CB    . SER A 1  131  ? 186.971 196.556 224.244 1.00 102.48 ?  131  SER A CB    1 
ATOM   999   O  OG    . SER A 1  131  ? 185.945 197.526 224.062 1.00 109.45 ?  131  SER A OG    1 
ATOM   1000  N  N     . LYS A 1  132  ? 189.855 196.372 222.781 1.00 94.13  ?  132  LYS A N     1 
ATOM   1001  C  CA    . LYS A 1  132  ? 190.905 195.544 222.184 1.00 92.95  ?  132  LYS A CA    1 
ATOM   1002  C  C     . LYS A 1  132  ? 192.298 196.075 222.416 1.00 95.95  ?  132  LYS A C     1 
ATOM   1003  O  O     . LYS A 1  132  ? 193.217 195.291 222.651 1.00 95.83  ?  132  LYS A O     1 
ATOM   1004  C  CB    . LYS A 1  132  ? 190.669 195.348 220.688 1.00 94.02  ?  132  LYS A CB    1 
ATOM   1005  C  CG    . LYS A 1  132  ? 189.584 194.339 220.362 1.00 101.13 ?  132  LYS A CG    1 
ATOM   1006  C  CD    . LYS A 1  132  ? 188.591 194.937 219.383 1.00 102.62 ?  132  LYS A CD    1 
ATOM   1007  C  CE    . LYS A 1  132  ? 187.773 193.895 218.674 1.00 106.76 ?  132  LYS A CE    1 
ATOM   1008  N  NZ    . LYS A 1  132  ? 186.689 193.371 219.538 1.00 118.04 1  132  LYS A NZ    1 
ATOM   1009  N  N     . LYS A 1  133  ? 192.463 197.392 222.307 1.00 91.97  ?  133  LYS A N     1 
ATOM   1010  C  CA    . LYS A 1  133  ? 193.747 198.054 222.473 1.00 92.75  ?  133  LYS A CA    1 
ATOM   1011  C  C     . LYS A 1  133  ? 194.253 197.948 223.905 1.00 98.85  ?  133  LYS A C     1 
ATOM   1012  O  O     . LYS A 1  133  ? 195.455 197.707 224.110 1.00 99.01  ?  133  LYS A O     1 
ATOM   1013  C  CB    . LYS A 1  133  ? 193.695 199.496 221.945 1.00 95.04  ?  133  LYS A CB    1 
ATOM   1014  C  CG    . LYS A 1  133  ? 193.970 199.548 220.433 1.00 106.92 ?  133  LYS A CG    1 
ATOM   1015  C  CD    . LYS A 1  133  ? 193.446 200.808 219.732 1.00 112.08 ?  133  LYS A CD    1 
ATOM   1016  C  CE    . LYS A 1  133  ? 193.828 200.789 218.267 1.00 117.81 ?  133  LYS A CE    1 
ATOM   1017  N  NZ    . LYS A 1  133  ? 193.218 201.910 217.501 1.00 123.17 1  133  LYS A NZ    1 
ATOM   1018  N  N     . ARG A 1  134  ? 193.321 198.050 224.891 1.00 95.85  ?  134  ARG A N     1 
ATOM   1019  C  CA    . ARG A 1  134  ? 193.639 197.893 226.311 1.00 96.61  ?  134  ARG A CA    1 
ATOM   1020  C  C     . ARG A 1  134  ? 194.085 196.456 226.578 1.00 103.98 ?  134  ARG A C     1 
ATOM   1021  O  O     . ARG A 1  134  ? 195.178 196.299 227.116 1.00 105.23 ?  134  ARG A O     1 
ATOM   1022  C  CB    . ARG A 1  134  ? 192.525 198.420 227.240 1.00 92.75  ?  134  ARG A CB    1 
ATOM   1023  C  CG    . ARG A 1  134  ? 191.899 197.441 228.219 1.00 91.70  ?  134  ARG A CG    1 
ATOM   1024  C  CD    . ARG A 1  134  ? 190.907 198.105 229.162 1.00 98.12  ?  134  ARG A CD    1 
ATOM   1025  N  NE    . ARG A 1  134  ? 189.726 198.671 228.496 1.00 110.20 ?  134  ARG A NE    1 
ATOM   1026  C  CZ    . ARG A 1  134  ? 188.618 197.992 228.188 1.00 125.44 ?  134  ARG A CZ    1 
ATOM   1027  N  NH1   . ARG A 1  134  ? 188.530 196.694 228.453 1.00 110.81 1  134  ARG A NH1   1 
ATOM   1028  N  NH2   . ARG A 1  134  ? 187.592 198.607 227.607 1.00 110.72 ?  134  ARG A NH2   1 
ATOM   1029  N  N     . PHE A 1  135  ? 193.336 195.417 226.077 1.00 100.97 ?  135  PHE A N     1 
ATOM   1030  C  CA    . PHE A 1  135  ? 193.757 194.012 226.228 1.00 101.60 ?  135  PHE A CA    1 
ATOM   1031  C  C     . PHE A 1  135  ? 195.145 193.787 225.611 1.00 106.52 ?  135  PHE A C     1 
ATOM   1032  O  O     . PHE A 1  135  ? 195.968 193.080 226.199 1.00 106.96 ?  135  PHE A O     1 
ATOM   1033  C  CB    . PHE A 1  135  ? 192.730 193.004 225.661 1.00 102.63 ?  135  PHE A CB    1 
ATOM   1034  C  CG    . PHE A 1  135  ? 193.244 191.573 225.610 1.00 104.65 ?  135  PHE A CG    1 
ATOM   1035  C  CD1   . PHE A 1  135  ? 193.193 190.757 226.733 1.00 108.77 ?  135  PHE A CD1   1 
ATOM   1036  C  CD2   . PHE A 1  135  ? 193.827 191.064 224.454 1.00 106.11 ?  135  PHE A CD2   1 
ATOM   1037  C  CE1   . PHE A 1  135  ? 193.715 189.456 226.700 1.00 109.61 ?  135  PHE A CE1   1 
ATOM   1038  C  CE2   . PHE A 1  135  ? 194.339 189.762 224.421 1.00 108.96 ?  135  PHE A CE2   1 
ATOM   1039  C  CZ    . PHE A 1  135  ? 194.281 188.968 225.545 1.00 107.70 ?  135  PHE A CZ    1 
ATOM   1040  N  N     . ALA A 1  136  ? 195.399 194.406 224.445 1.00 103.05 ?  136  ALA A N     1 
ATOM   1041  C  CA    . ALA A 1  136  ? 196.664 194.324 223.718 1.00 103.49 ?  136  ALA A CA    1 
ATOM   1042  C  C     . ALA A 1  136  ? 197.816 194.857 224.550 1.00 109.16 ?  136  ALA A C     1 
ATOM   1043  O  O     . ALA A 1  136  ? 198.868 194.210 224.643 1.00 108.56 ?  136  ALA A O     1 
ATOM   1044  C  CB    . ALA A 1  136  ? 196.562 195.113 222.425 1.00 103.52 ?  136  ALA A CB    1 
ATOM   1045  N  N     . ALA A 1  137  ? 197.603 196.039 225.160 1.00 107.35 ?  137  ALA A N     1 
ATOM   1046  C  CA    . ALA A 1  137  ? 198.591 196.712 226.000 1.00 108.94 ?  137  ALA A CA    1 
ATOM   1047  C  C     . ALA A 1  137  ? 198.816 195.959 227.308 1.00 112.89 ?  137  ALA A C     1 
ATOM   1048  O  O     . ALA A 1  137  ? 199.975 195.765 227.700 1.00 113.41 ?  137  ALA A O     1 
ATOM   1049  C  CB    . ALA A 1  137  ? 198.155 198.136 226.278 1.00 110.10 ?  137  ALA A CB    1 
ATOM   1050  N  N     . ILE A 1  138  ? 197.707 195.507 227.960 1.00 107.69 ?  138  ILE A N     1 
ATOM   1051  C  CA    . ILE A 1  138  ? 197.727 194.746 229.210 1.00 107.55 ?  138  ILE A CA    1 
ATOM   1052  C  C     . ILE A 1  138  ? 198.603 193.519 229.045 1.00 111.39 ?  138  ILE A C     1 
ATOM   1053  O  O     . ILE A 1  138  ? 199.401 193.227 229.931 1.00 112.64 ?  138  ILE A O     1 
ATOM   1054  C  CB    . ILE A 1  138  ? 196.299 194.402 229.739 1.00 109.80 ?  138  ILE A CB    1 
ATOM   1055  C  CG1   . ILE A 1  138  ? 195.580 195.677 230.245 1.00 109.80 ?  138  ILE A CG1   1 
ATOM   1056  C  CG2   . ILE A 1  138  ? 196.357 193.338 230.855 1.00 111.64 ?  138  ILE A CG2   1 
ATOM   1057  C  CD1   . ILE A 1  138  ? 194.080 195.551 230.550 1.00 112.62 ?  138  ILE A CD1   1 
ATOM   1058  N  N     . TRP A 1  139  ? 198.503 192.851 227.891 1.00 106.61 ?  139  TRP A N     1 
ATOM   1059  C  CA    . TRP A 1  139  ? 199.278 191.657 227.613 1.00 107.03 ?  139  TRP A CA    1 
ATOM   1060  C  C     . TRP A 1  139  ? 200.773 191.861 227.487 1.00 112.95 ?  139  TRP A C     1 
ATOM   1061  O  O     . TRP A 1  139  ? 201.527 191.193 228.203 1.00 113.60 ?  139  TRP A O     1 
ATOM   1062  C  CB    . TRP A 1  139  ? 198.719 190.893 226.422 1.00 104.58 ?  139  TRP A CB    1 
ATOM   1063  C  CG    . TRP A 1  139  ? 199.487 189.647 226.103 1.00 105.61 ?  139  TRP A CG    1 
ATOM   1064  C  CD1   . TRP A 1  139  ? 199.473 188.471 226.794 1.00 109.14 ?  139  TRP A CD1   1 
ATOM   1065  C  CD2   . TRP A 1  139  ? 200.382 189.459 225.004 1.00 104.97 ?  139  TRP A CD2   1 
ATOM   1066  N  NE1   . TRP A 1  139  ? 200.299 187.557 226.187 1.00 108.74 ?  139  TRP A NE1   1 
ATOM   1067  C  CE2   . TRP A 1  139  ? 200.859 188.131 225.075 1.00 109.37 ?  139  TRP A CE2   1 
ATOM   1068  C  CE3   . TRP A 1  139  ? 200.817 190.280 223.951 1.00 105.50 ?  139  TRP A CE3   1 
ATOM   1069  C  CZ2   . TRP A 1  139  ? 201.743 187.603 224.132 1.00 108.34 ?  139  TRP A CZ2   1 
ATOM   1070  C  CZ3   . TRP A 1  139  ? 201.686 189.755 223.015 1.00 106.80 ?  139  TRP A CZ3   1 
ATOM   1071  C  CH2   . TRP A 1  139  ? 202.148 188.435 223.115 1.00 107.88 ?  139  TRP A CH2   1 
ATOM   1072  N  N     . THR A 1  140  ? 201.211 192.769 226.596 1.00 109.75 ?  140  THR A N     1 
ATOM   1073  C  CA    . THR A 1  140  ? 202.642 193.041 226.394 1.00 110.46 ?  140  THR A CA    1 
ATOM   1074  C  C     . THR A 1  140  ? 203.366 193.352 227.708 1.00 114.07 ?  140  THR A C     1 
ATOM   1075  O  O     . THR A 1  140  ? 204.557 193.052 227.846 1.00 114.09 ?  140  THR A O     1 
ATOM   1076  C  CB    . THR A 1  140  ? 202.861 194.091 225.317 1.00 121.90 ?  140  THR A CB    1 
ATOM   1077  O  OG1   . THR A 1  140  ? 202.005 195.197 225.596 1.00 125.24 ?  140  THR A OG1   1 
ATOM   1078  C  CG2   . THR A 1  140  ? 202.597 193.548 223.913 1.00 118.66 ?  140  THR A CG2   1 
ATOM   1079  N  N     . LEU A 1  141  ? 202.611 193.894 228.684 1.00 109.56 ?  141  LEU A N     1 
ATOM   1080  C  CA    . LEU A 1  141  ? 203.071 194.206 230.028 1.00 110.13 ?  141  LEU A CA    1 
ATOM   1081  C  C     . LEU A 1  141  ? 203.106 192.957 230.892 1.00 114.71 ?  141  LEU A C     1 
ATOM   1082  O  O     . LEU A 1  141  ? 204.140 192.661 231.484 1.00 116.90 ?  141  LEU A O     1 
ATOM   1083  C  CB    . LEU A 1  141  ? 202.133 195.219 230.705 1.00 110.07 ?  141  LEU A CB    1 
ATOM   1084  C  CG    . LEU A 1  141  ? 202.255 196.682 230.350 1.00 114.38 ?  141  LEU A CG    1 
ATOM   1085  C  CD1   . LEU A 1  141  ? 201.119 197.447 230.958 1.00 114.60 ?  141  LEU A CD1   1 
ATOM   1086  C  CD2   . LEU A 1  141  ? 203.559 197.270 230.848 1.00 117.43 ?  141  LEU A CD2   1 
ATOM   1087  N  N     . CYS A 1  142  ? 201.969 192.261 231.021 1.00 109.29 ?  142  CYS A N     1 
ATOM   1088  C  CA    . CYS A 1  142  ? 201.830 191.113 231.910 1.00 109.48 ?  142  CYS A CA    1 
ATOM   1089  C  C     . CYS A 1  142  ? 202.509 189.833 231.479 1.00 113.30 ?  142  CYS A C     1 
ATOM   1090  O  O     . CYS A 1  142  ? 202.789 188.995 232.345 1.00 114.42 ?  142  CYS A O     1 
ATOM   1091  C  CB    . CYS A 1  142  ? 200.375 190.887 232.301 1.00 109.41 ?  142  CYS A CB    1 
ATOM   1092  S  SG    . CYS A 1  142  ? 199.619 192.276 233.186 1.00 113.80 ?  142  CYS A SG    1 
ATOM   1093  N  N     . LYS A 1  143  ? 202.789 189.668 230.163 1.00 108.19 ?  143  LYS A N     1 
ATOM   1094  C  CA    . LYS A 1  143  ? 203.456 188.459 229.651 1.00 107.48 ?  143  LYS A CA    1 
ATOM   1095  C  C     . LYS A 1  143  ? 204.796 188.207 230.354 1.00 113.98 ?  143  LYS A C     1 
ATOM   1096  O  O     . LYS A 1  143  ? 205.008 187.115 230.892 1.00 113.17 ?  143  LYS A O     1 
ATOM   1097  C  CB    . LYS A 1  143  ? 203.579 188.454 228.108 1.00 107.04 ?  143  LYS A CB    1 
ATOM   1098  C  CG    . LYS A 1  143  ? 204.259 189.660 227.470 1.00 103.42 ?  143  LYS A CG    1 
ATOM   1099  C  CD    . LYS A 1  143  ? 204.563 189.393 226.013 1.00 104.63 ?  143  LYS A CD    1 
ATOM   1100  C  CE    . LYS A 1  143  ? 205.047 190.628 225.304 1.00 108.28 ?  143  LYS A CE    1 
ATOM   1101  N  NZ    . LYS A 1  143  ? 205.359 190.355 223.881 1.00 113.41 1  143  LYS A NZ    1 
ATOM   1102  N  N     . THR A 1  144  ? 205.629 189.282 230.433 1.00 113.16 ?  144  THR A N     1 
ATOM   1103  C  CA    . THR A 1  144  ? 206.964 189.414 231.032 1.00 115.07 ?  144  THR A CA    1 
ATOM   1104  C  C     . THR A 1  144  ? 206.964 189.051 232.518 1.00 122.21 ?  144  THR A C     1 
ATOM   1105  O  O     . THR A 1  144  ? 207.916 188.410 232.966 1.00 123.53 ?  144  THR A O     1 
ATOM   1106  C  CB    . THR A 1  144  ? 207.481 190.869 230.871 1.00 125.05 ?  144  THR A CB    1 
ATOM   1107  O  OG1   . THR A 1  144  ? 207.047 191.438 229.632 1.00 123.25 ?  144  THR A OG1   1 
ATOM   1108  C  CG2   . THR A 1  144  ? 208.993 190.979 230.993 1.00 127.27 ?  144  THR A CG2   1 
ATOM   1109  N  N     . LYS A 1  145  ? 205.935 189.509 233.289 1.00 119.12 ?  145  LYS A N     1 
ATOM   1110  C  CA    . LYS A 1  145  ? 205.800 189.240 234.728 1.00 120.15 ?  145  LYS A CA    1 
ATOM   1111  C  C     . LYS A 1  145  ? 205.667 187.734 234.954 1.00 124.27 ?  145  LYS A C     1 
ATOM   1112  O  O     . LYS A 1  145  ? 204.717 187.121 234.453 1.00 122.56 ?  145  LYS A O     1 
ATOM   1113  C  CB    . LYS A 1  145  ? 204.602 190.002 235.332 1.00 122.08 ?  145  LYS A CB    1 
ATOM   1114  C  CG    . LYS A 1  145  ? 205.003 191.072 236.345 1.00 132.68 ?  145  LYS A CG    1 
ATOM   1115  C  CD    . LYS A 1  145  ? 204.838 190.626 237.801 1.00 140.77 ?  145  LYS A CD    1 
ATOM   1116  C  CE    . LYS A 1  145  ? 205.351 191.671 238.772 1.00 148.25 ?  145  LYS A CE    1 
ATOM   1117  N  NZ    . LYS A 1  145  ? 204.983 191.358 240.180 1.00 154.86 1  145  LYS A NZ    1 
ATOM   1118  N  N     . MET A 1  146  ? 206.666 187.132 235.630 1.00 122.06 ?  146  MET A N     1 
ATOM   1119  C  CA    . MET A 1  146  ? 206.685 185.697 235.895 1.00 122.20 ?  146  MET A CA    1 
ATOM   1120  C  C     . MET A 1  146  ? 206.460 185.331 237.358 1.00 129.21 ?  146  MET A C     1 
ATOM   1121  O  O     . MET A 1  146  ? 206.744 184.200 237.759 1.00 129.66 ?  146  MET A O     1 
ATOM   1122  C  CB    . MET A 1  146  ? 207.943 185.040 235.323 1.00 124.58 ?  146  MET A CB    1 
ATOM   1123  C  CG    . MET A 1  146  ? 207.670 184.217 234.091 1.00 126.51 ?  146  MET A CG    1 
ATOM   1124  S  SD    . MET A 1  146  ? 207.554 185.216 232.596 1.00 128.85 ?  146  MET A SD    1 
ATOM   1125  C  CE    . MET A 1  146  ? 209.281 185.478 232.226 1.00 126.62 ?  146  MET A CE    1 
ATOM   1126  N  N     . VAL A 1  147  ? 205.919 186.275 238.148 1.00 127.58 ?  147  VAL A N     1 
ATOM   1127  C  CA    . VAL A 1  147  ? 205.580 186.063 239.555 1.00 129.51 ?  147  VAL A CA    1 
ATOM   1128  C  C     . VAL A 1  147  ? 204.358 186.808 240.041 1.00 136.33 ?  147  VAL A C     1 
ATOM   1129  O  O     . VAL A 1  147  ? 204.188 188.011 239.793 1.00 134.94 ?  147  VAL A O     1 
ATOM   1130  C  CB    . VAL A 1  147  ? 206.731 186.194 240.567 1.00 134.82 ?  147  VAL A CB    1 
ATOM   1131  C  CG1   . VAL A 1  147  ? 207.394 184.849 240.818 1.00 135.52 ?  147  VAL A CG1   1 
ATOM   1132  C  CG2   . VAL A 1  147  ? 207.735 187.273 240.165 1.00 134.63 ?  147  VAL A CG2   1 
ATOM   1133  N  N     . CYS A 1  148  ? 203.521 186.079 240.779 1.00 135.95 ?  148  CYS A N     1 
ATOM   1134  C  CA    . CYS A 1  148  ? 202.347 186.645 241.409 1.00 136.81 ?  148  CYS A CA    1 
ATOM   1135  C  C     . CYS A 1  148  ? 202.909 187.305 242.654 1.00 145.88 ?  148  CYS A C     1 
ATOM   1136  O  O     . CYS A 1  148  ? 203.494 186.614 243.488 1.00 146.95 ?  148  CYS A O     1 
ATOM   1137  C  CB    . CYS A 1  148  ? 201.344 185.549 241.753 1.00 136.70 ?  148  CYS A CB    1 
ATOM   1138  S  SG    . CYS A 1  148  ? 199.743 186.171 242.318 1.00 140.07 ?  148  CYS A SG    1 
ATOM   1139  N  N     . GLU A 1  149  ? 202.859 188.639 242.722 1.00 145.07 ?  149  GLU A N     1 
ATOM   1140  C  CA    . GLU A 1  149  ? 203.419 189.353 243.868 1.00 147.87 ?  149  GLU A CA    1 
ATOM   1141  C  C     . GLU A 1  149  ? 202.433 189.495 245.031 1.00 155.83 ?  149  GLU A C     1 
ATOM   1142  O  O     . GLU A 1  149  ? 201.236 189.693 244.813 1.00 155.06 ?  149  GLU A O     1 
ATOM   1143  C  CB    . GLU A 1  149  ? 204.005 190.706 243.449 1.00 149.09 ?  149  GLU A CB    1 
ATOM   1144  C  CG    . GLU A 1  149  ? 205.390 190.974 244.012 1.00 161.66 ?  149  GLU A CG    1 
ATOM   1145  C  CD    . GLU A 1  149  ? 206.513 190.109 243.473 1.00 182.66 ?  149  GLU A CD    1 
ATOM   1146  O  OE1   . GLU A 1  149  ? 206.573 189.899 242.238 1.00 166.45 ?  149  GLU A OE1   1 
ATOM   1147  O  OE2   . GLU A 1  149  ? 207.355 189.666 244.290 1.00 180.93 -1 149  GLU A OE2   1 
ATOM   1148  N  N     . THR A 1  150  ? 202.942 189.364 246.266 1.00 155.82 ?  150  THR A N     1 
ATOM   1149  C  CA    . THR A 1  150  ? 202.158 189.476 247.501 1.00 157.39 ?  150  THR A CA    1 
ATOM   1150  C  C     . THR A 1  150  ? 202.175 190.913 248.007 1.00 164.36 ?  150  THR A C     1 
ATOM   1151  O  O     . THR A 1  150  ? 201.144 191.430 248.440 1.00 163.37 ?  150  THR A O     1 
ATOM   1152  C  CB    . THR A 1  150  ? 202.683 188.503 248.557 1.00 164.67 ?  150  THR A CB    1 
ATOM   1153  O  OG1   . THR A 1  150  ? 204.115 188.566 248.594 1.00 163.20 ?  150  THR A OG1   1 
ATOM   1154  C  CG2   . THR A 1  150  ? 202.221 187.083 248.306 1.00 162.68 ?  150  THR A CG2   1 
ATOM   1155  N  N     . ASP A 1  151  ? 203.369 191.537 247.956 1.00 164.08 ?  151  ASP A N     1 
ATOM   1156  C  CA    . ASP A 1  151  ? 203.659 192.907 248.366 1.00 165.69 ?  151  ASP A CA    1 
ATOM   1157  C  C     . ASP A 1  151  ? 204.434 193.605 247.238 1.00 169.77 ?  151  ASP A C     1 
ATOM   1158  O  O     . ASP A 1  151  ? 205.360 193.025 246.663 1.00 168.93 ?  151  ASP A O     1 
ATOM   1159  C  CB    . ASP A 1  151  ? 204.493 192.919 249.666 1.00 170.32 ?  151  ASP A CB    1 
ATOM   1160  C  CG    . ASP A 1  151  ? 203.860 192.258 250.884 1.00 184.43 ?  151  ASP A CG    1 
ATOM   1161  O  OD1   . ASP A 1  151  ? 203.654 191.022 250.852 1.00 185.11 ?  151  ASP A OD1   1 
ATOM   1162  O  OD2   . ASP A 1  151  ? 203.682 192.953 251.913 1.00 191.95 -1 151  ASP A OD2   1 
ATOM   1163  N  N     . VAL A 1  152  ? 204.050 194.848 246.932 1.00 167.27 ?  152  VAL A N     1 
ATOM   1164  C  CA    . VAL A 1  152  ? 204.645 195.686 245.884 1.00 167.23 ?  152  VAL A CA    1 
ATOM   1165  C  C     . VAL A 1  152  ? 204.922 197.095 246.480 1.00 174.83 ?  152  VAL A C     1 
ATOM   1166  O  O     . VAL A 1  152  ? 204.205 197.480 247.406 1.00 174.81 ?  152  VAL A O     1 
ATOM   1167  C  CB    . VAL A 1  152  ? 203.710 195.670 244.630 1.00 169.09 ?  152  VAL A CB    1 
ATOM   1168  C  CG1   . VAL A 1  152  ? 203.713 196.983 243.843 1.00 168.01 ?  152  VAL A CG1   1 
ATOM   1169  C  CG2   . VAL A 1  152  ? 204.044 194.498 243.721 1.00 167.92 ?  152  VAL A CG2   1 
ATOM   1170  N  N     . PRO A 1  153  ? 205.965 197.853 246.036 1.00 174.15 ?  153  PRO A N     1 
ATOM   1171  C  CA    . PRO A 1  153  ? 206.216 199.185 246.631 1.00 176.10 ?  153  PRO A CA    1 
ATOM   1172  C  C     . PRO A 1  153  ? 204.999 200.108 246.613 1.00 182.22 ?  153  PRO A C     1 
ATOM   1173  O  O     . PRO A 1  153  ? 204.308 200.178 245.594 1.00 180.16 ?  153  PRO A O     1 
ATOM   1174  C  CB    . PRO A 1  153  ? 207.352 199.747 245.768 1.00 177.57 ?  153  PRO A CB    1 
ATOM   1175  C  CG    . PRO A 1  153  ? 207.319 198.932 244.500 1.00 179.94 ?  153  PRO A CG    1 
ATOM   1176  C  CD    . PRO A 1  153  ? 206.945 197.567 244.968 1.00 175.25 ?  153  PRO A CD    1 
ATOM   1177  N  N     . SER A 1  154  ? 204.728 200.795 247.751 1.00 182.43 ?  154  SER A N     1 
ATOM   1178  C  CA    . SER A 1  154  ? 203.597 201.726 247.931 1.00 183.03 ?  154  SER A CA    1 
ATOM   1179  C  C     . SER A 1  154  ? 203.576 202.862 246.901 1.00 187.46 ?  154  SER A C     1 
ATOM   1180  O  O     . SER A 1  154  ? 204.624 203.185 246.331 1.00 186.84 ?  154  SER A O     1 
ATOM   1181  C  CB    . SER A 1  154  ? 203.555 202.283 249.357 1.00 189.37 ?  154  SER A CB    1 
ATOM   1182  O  OG    . SER A 1  154  ? 204.812 202.705 249.864 1.00 201.50 ?  154  SER A OG    1 
ATOM   1183  N  N     . GLU A 1  155  ? 202.385 203.466 246.664 1.00 184.76 ?  155  GLU A N     1 
ATOM   1184  C  CA    . GLU A 1  155  ? 202.195 204.562 245.697 1.00 184.24 ?  155  GLU A CA    1 
ATOM   1185  C  C     . GLU A 1  155  ? 202.840 205.893 246.151 1.00 191.67 ?  155  GLU A C     1 
ATOM   1186  O  O     . GLU A 1  155  ? 202.278 206.973 245.932 1.00 191.00 ?  155  GLU A O     1 
ATOM   1187  C  CB    . GLU A 1  155  ? 200.709 204.742 245.350 1.00 184.24 ?  155  GLU A CB    1 
ATOM   1188  C  CG    . GLU A 1  155  ? 200.097 203.589 244.581 1.00 191.25 ?  155  GLU A CG    1 
ATOM   1189  C  CD    . GLU A 1  155  ? 198.583 203.649 244.505 1.00 211.78 ?  155  GLU A CD    1 
ATOM   1190  O  OE1   . GLU A 1  155  ? 197.942 203.969 245.533 1.00 209.68 ?  155  GLU A OE1   1 
ATOM   1191  O  OE2   . GLU A 1  155  ? 198.035 203.364 243.416 1.00 202.32 -1 155  GLU A OE2   1 
ATOM   1192  N  N     . ASP A 1  156  ? 204.044 205.795 246.765 1.00 191.45 ?  156  ASP A N     1 
ATOM   1193  C  CA    . ASP A 1  156  ? 204.880 206.886 247.280 1.00 193.31 ?  156  ASP A CA    1 
ATOM   1194  C  C     . ASP A 1  156  ? 206.338 206.421 247.537 1.00 198.72 ?  156  ASP A C     1 
ATOM   1195  O  O     . ASP A 1  156  ? 207.261 206.864 246.844 1.00 197.99 ?  156  ASP A O     1 
ATOM   1196  C  CB    . ASP A 1  156  ? 204.255 207.558 248.541 1.00 196.55 ?  156  ASP A CB    1 
ATOM   1197  C  CG    . ASP A 1  156  ? 203.773 206.602 249.625 1.00 205.78 ?  156  ASP A CG    1 
ATOM   1198  O  OD1   . ASP A 1  156  ? 204.619 206.135 250.431 1.00 212.45 ?  156  ASP A OD1   1 
ATOM   1199  O  OD2   . ASP A 1  156  ? 202.553 206.325 249.673 1.00 204.90 -1 156  ASP A OD2   1 
ATOM   1200  N  N     . ASP A 1  157  ? 206.522 205.496 248.499 1.00 196.81 ?  157  ASP A N     1 
ATOM   1201  C  CA    . ASP A 1  157  ? 207.818 204.995 248.934 1.00 198.09 ?  157  ASP A CA    1 
ATOM   1202  C  C     . ASP A 1  157  ? 208.156 203.555 248.518 1.00 203.01 ?  157  ASP A C     1 
ATOM   1203  O  O     . ASP A 1  157  ? 207.337 202.654 248.732 1.00 202.22 ?  157  ASP A O     1 
ATOM   1204  C  CB    . ASP A 1  157  ? 207.918 205.124 250.451 1.00 201.57 ?  157  ASP A CB    1 
ATOM   1205  C  CG    . ASP A 1  157  ? 209.167 205.828 250.895 1.00 208.54 ?  157  ASP A CG    1 
ATOM   1206  O  OD1   . ASP A 1  157  ? 210.235 205.180 250.914 1.00 208.61 ?  157  ASP A OD1   1 
ATOM   1207  O  OD2   . ASP A 1  157  ? 209.082 207.024 251.225 1.00 214.28 -1 157  ASP A OD2   1 
ATOM   1208  N  N     . PRO A 1  158  ? 209.393 203.302 248.012 1.00 200.64 ?  158  PRO A N     1 
ATOM   1209  C  CA    . PRO A 1  158  ? 209.783 201.921 247.665 1.00 199.93 ?  158  PRO A CA    1 
ATOM   1210  C  C     . PRO A 1  158  ? 210.395 201.138 248.848 1.00 203.62 ?  158  PRO A C     1 
ATOM   1211  O  O     . PRO A 1  158  ? 210.768 199.968 248.684 1.00 202.84 ?  158  PRO A O     1 
ATOM   1212  C  CB    . PRO A 1  158  ? 210.777 202.114 246.506 1.00 201.16 ?  158  PRO A CB    1 
ATOM   1213  C  CG    . PRO A 1  158  ? 211.173 203.594 246.537 1.00 206.39 ?  158  PRO A CG    1 
ATOM   1214  C  CD    . PRO A 1  158  ? 210.491 204.244 247.709 1.00 202.83 ?  158  PRO A CD    1 
ATOM   1215  N  N     . THR A 1  159  ? 210.477 201.784 250.044 1.00 199.96 ?  159  THR A N     1 
ATOM   1216  C  CA    . THR A 1  159  ? 211.012 201.226 251.296 1.00 200.39 ?  159  THR A CA    1 
ATOM   1217  C  C     . THR A 1  159  ? 209.938 200.380 252.019 1.00 200.95 ?  159  THR A C     1 
ATOM   1218  O  O     . THR A 1  159  ? 210.199 199.216 252.345 1.00 200.86 ?  159  THR A O     1 
ATOM   1219  C  CB    . THR A 1  159  ? 211.600 202.348 252.182 1.00 209.99 ?  159  THR A CB    1 
ATOM   1220  O  OG1   . THR A 1  159  ? 212.190 203.357 251.356 1.00 209.25 ?  159  THR A OG1   1 
ATOM   1221  C  CG2   . THR A 1  159  ? 212.621 201.827 253.195 1.00 209.51 ?  159  THR A CG2   1 
ATOM   1222  N  N     . GLN A 1  160  ? 208.737 200.971 252.260 1.00 194.23 ?  160  GLN A N     1 
ATOM   1223  C  CA    . GLN A 1  160  ? 207.591 200.296 252.891 1.00 192.53 ?  160  GLN A CA    1 
ATOM   1224  C  C     . GLN A 1  160  ? 206.630 199.807 251.787 1.00 190.63 ?  160  GLN A C     1 
ATOM   1225  O  O     . GLN A 1  160  ? 205.827 200.579 251.246 1.00 188.88 ?  160  GLN A O     1 
ATOM   1226  C  CB    . GLN A 1  160  ? 206.854 201.166 253.942 1.00 194.78 ?  160  GLN A CB    1 
ATOM   1227  C  CG    . GLN A 1  160  ? 207.656 202.299 254.577 1.00 202.71 ?  160  GLN A CG    1 
ATOM   1228  C  CD    . GLN A 1  160  ? 207.614 203.561 253.747 1.00 212.88 ?  160  GLN A CD    1 
ATOM   1229  O  OE1   . GLN A 1  160  ? 206.595 203.914 253.127 1.00 208.18 ?  160  GLN A OE1   1 
ATOM   1230  N  NE2   . GLN A 1  160  ? 208.728 204.272 253.730 1.00 205.55 ?  160  GLN A NE2   1 
ATOM   1231  N  N     . LEU A 1  161  ? 206.768 198.514 251.439 1.00 183.81 ?  161  LEU A N     1 
ATOM   1232  C  CA    . LEU A 1  161  ? 206.012 197.802 250.411 1.00 179.79 ?  161  LEU A CA    1 
ATOM   1233  C  C     . LEU A 1  161  ? 204.607 197.434 250.918 1.00 180.88 ?  161  LEU A C     1 
ATOM   1234  O  O     . LEU A 1  161  ? 204.474 196.786 251.961 1.00 181.35 ?  161  LEU A O     1 
ATOM   1235  C  CB    . LEU A 1  161  ? 206.793 196.533 249.980 1.00 179.01 ?  161  LEU A CB    1 
ATOM   1236  C  CG    . LEU A 1  161  ? 207.965 196.710 248.995 1.00 182.37 ?  161  LEU A CG    1 
ATOM   1237  C  CD1   . LEU A 1  161  ? 209.238 197.141 249.700 1.00 184.21 ?  161  LEU A CD1   1 
ATOM   1238  C  CD2   . LEU A 1  161  ? 208.255 195.414 248.275 1.00 182.98 ?  161  LEU A CD2   1 
ATOM   1239  N  N     . VAL A 1  162  ? 203.565 197.871 250.174 1.00 174.30 ?  162  VAL A N     1 
ATOM   1240  C  CA    . VAL A 1  162  ? 202.144 197.611 250.465 1.00 172.51 ?  162  VAL A CA    1 
ATOM   1241  C  C     . VAL A 1  162  ? 201.707 196.269 249.840 1.00 172.03 ?  162  VAL A C     1 
ATOM   1242  O  O     . VAL A 1  162  ? 202.081 195.966 248.704 1.00 170.03 ?  162  VAL A O     1 
ATOM   1243  C  CB    . VAL A 1  162  ? 201.238 198.817 250.055 1.00 175.34 ?  162  VAL A CB    1 
ATOM   1244  C  CG1   . VAL A 1  162  ? 199.765 198.425 249.916 1.00 173.99 ?  162  VAL A CG1   1 
ATOM   1245  C  CG2   . VAL A 1  162  ? 201.388 199.967 251.043 1.00 176.69 ?  162  VAL A CG2   1 
ATOM   1246  N  N     . SER A 1  163  ? 200.941 195.462 250.597 1.00 166.74 ?  163  SER A N     1 
ATOM   1247  C  CA    . SER A 1  163  ? 200.468 194.174 250.112 1.00 164.36 ?  163  SER A CA    1 
ATOM   1248  C  C     . SER A 1  163  ? 199.216 194.316 249.272 1.00 164.57 ?  163  SER A C     1 
ATOM   1249  O  O     . SER A 1  163  ? 198.252 194.969 249.684 1.00 164.24 ?  163  SER A O     1 
ATOM   1250  C  CB    . SER A 1  163  ? 200.225 193.203 251.262 1.00 168.48 ?  163  SER A CB    1 
ATOM   1251  O  OG    . SER A 1  163  ? 199.110 193.597 252.042 1.00 176.26 ?  163  SER A OG    1 
ATOM   1252  N  N     . ARG A 1  164  ? 199.248 193.708 248.078 1.00 157.73 ?  164  ARG A N     1 
ATOM   1253  C  CA    . ARG A 1  164  ? 198.129 193.621 247.142 1.00 154.32 ?  164  ARG A CA    1 
ATOM   1254  C  C     . ARG A 1  164  ? 197.525 192.228 247.402 1.00 156.69 ?  164  ARG A C     1 
ATOM   1255  O  O     . ARG A 1  164  ? 197.459 191.814 248.562 1.00 158.12 ?  164  ARG A O     1 
ATOM   1256  C  CB    . ARG A 1  164  ? 198.600 193.831 245.682 1.00 149.82 ?  164  ARG A CB    1 
ATOM   1257  C  CG    . ARG A 1  164  ? 199.830 193.028 245.227 1.00 150.04 ?  164  ARG A CG    1 
ATOM   1258  C  CD    . ARG A 1  164  ? 200.183 193.439 243.817 1.00 149.58 ?  164  ARG A CD    1 
ATOM   1259  N  NE    . ARG A 1  164  ? 200.988 192.454 243.092 1.00 151.07 ?  164  ARG A NE    1 
ATOM   1260  C  CZ    . ARG A 1  164  ? 200.878 192.214 241.787 1.00 157.44 ?  164  ARG A CZ    1 
ATOM   1261  N  NH1   . ARG A 1  164  ? 199.973 192.856 241.060 1.00 140.75 1  164  ARG A NH1   1 
ATOM   1262  N  NH2   . ARG A 1  164  ? 201.662 191.318 241.201 1.00 141.71 ?  164  ARG A NH2   1 
ATOM   1263  N  N     . GLY A 1  165  ? 197.132 191.507 246.360 1.00 150.20 ?  165  GLY A N     1 
ATOM   1264  C  CA    . GLY A 1  165  ? 196.628 190.147 246.508 1.00 149.27 ?  165  GLY A CA    1 
ATOM   1265  C  C     . GLY A 1  165  ? 197.749 189.205 246.899 1.00 152.55 ?  165  GLY A C     1 
ATOM   1266  O  O     . GLY A 1  165  ? 198.922 189.501 246.651 1.00 152.00 ?  165  GLY A O     1 
ATOM   1267  N  N     . GLY A 1  166  ? 197.394 188.086 247.521 1.00 149.38 ?  166  GLY A N     1 
ATOM   1268  C  CA    . GLY A 1  166  ? 198.360 187.090 247.979 1.00 150.26 ?  166  GLY A CA    1 
ATOM   1269  C  C     . GLY A 1  166  ? 199.014 186.303 246.858 1.00 152.52 ?  166  GLY A C     1 
ATOM   1270  O  O     . GLY A 1  166  ? 199.207 186.837 245.758 1.00 150.55 ?  166  GLY A O     1 
ATOM   1271  N  N     . CYS A 1  167  ? 199.368 185.015 247.148 1.00 148.93 ?  167  CYS A N     1 
ATOM   1272  C  CA    . CYS A 1  167  ? 200.004 184.039 246.242 1.00 147.24 ?  167  CYS A CA    1 
ATOM   1273  C  C     . CYS A 1  167  ? 201.386 184.513 245.773 1.00 147.99 ?  167  CYS A C     1 
ATOM   1274  O  O     . CYS A 1  167  ? 201.516 185.599 245.212 1.00 146.92 ?  167  CYS A O     1 
ATOM   1275  C  CB    . CYS A 1  167  ? 199.078 183.692 245.070 1.00 145.95 ?  167  CYS A CB    1 
ATOM   1276  S  SG    . CYS A 1  167  ? 199.779 182.543 243.851 1.00 148.99 ?  167  CYS A SG    1 
ATOM   1277  N  N     . GLY A 1  168  ? 202.405 183.711 246.027 1.00 143.20 ?  168  GLY A N     1 
ATOM   1278  C  CA    . GLY A 1  168  ? 203.759 184.060 245.615 1.00 142.80 ?  168  GLY A CA    1 
ATOM   1279  C  C     . GLY A 1  168  ? 204.255 183.298 244.403 1.00 144.88 ?  168  GLY A C     1 
ATOM   1280  O  O     . GLY A 1  168  ? 205.318 183.613 243.860 1.00 144.64 ?  168  GLY A O     1 
ATOM   1281  N  N     . ASN A 1  169  ? 203.474 182.298 243.969 1.00 139.60 ?  169  ASN A N     1 
ATOM   1282  C  CA    . ASN A 1  169  ? 203.783 181.363 242.892 1.00 137.81 ?  169  ASN A CA    1 
ATOM   1283  C  C     . ASN A 1  169  ? 204.416 181.889 241.621 1.00 138.37 ?  169  ASN A C     1 
ATOM   1284  O  O     . ASN A 1  169  ? 204.098 182.992 241.165 1.00 136.33 ?  169  ASN A O     1 
ATOM   1285  C  CB    . ASN A 1  169  ? 202.625 180.409 242.624 1.00 137.91 ?  169  ASN A CB    1 
ATOM   1286  C  CG    . ASN A 1  169  ? 202.330 179.506 243.801 1.00 164.09 ?  169  ASN A CG    1 
ATOM   1287  O  OD1   . ASN A 1  169  ? 203.057 178.547 244.086 1.00 159.60 ?  169  ASN A OD1   1 
ATOM   1288  N  ND2   . ASN A 1  169  ? 201.276 179.820 244.540 1.00 156.90 ?  169  ASN A ND2   1 
ATOM   1289  N  N     . THR A 1  170  ? 205.356 181.087 241.088 1.00 134.39 ?  170  THR A N     1 
ATOM   1290  C  CA    . THR A 1  170  ? 206.073 181.354 239.847 1.00 133.14 ?  170  THR A CA    1 
ATOM   1291  C  C     . THR A 1  170  ? 205.153 181.009 238.670 1.00 135.26 ?  170  THR A C     1 
ATOM   1292  O  O     . THR A 1  170  ? 204.417 180.012 238.693 1.00 134.90 ?  170  THR A O     1 
ATOM   1293  C  CB    . THR A 1  170  ? 207.422 180.613 239.797 1.00 139.91 ?  170  THR A CB    1 
ATOM   1294  O  OG1   . THR A 1  170  ? 208.054 180.682 241.076 1.00 142.43 ?  170  THR A OG1   1 
ATOM   1295  C  CG2   . THR A 1  170  ? 208.362 181.172 238.726 1.00 135.28 ?  170  THR A CG2   1 
ATOM   1296  N  N     . GLN A 1  171  ? 205.192 181.864 237.651 1.00 129.45 ?  171  GLN A N     1 
ATOM   1297  C  CA    . GLN A 1  171  ? 204.369 181.740 236.467 1.00 126.55 ?  171  GLN A CA    1 
ATOM   1298  C  C     . GLN A 1  171  ? 205.099 181.025 235.325 1.00 128.89 ?  171  GLN A C     1 
ATOM   1299  O  O     . GLN A 1  171  ? 206.251 181.352 235.023 1.00 128.48 ?  171  GLN A O     1 
ATOM   1300  C  CB    . GLN A 1  171  ? 203.837 183.117 236.052 1.00 126.60 ?  171  GLN A CB    1 
ATOM   1301  C  CG    . GLN A 1  171  ? 203.027 183.829 237.150 1.00 128.31 ?  171  GLN A CG    1 
ATOM   1302  C  CD    . GLN A 1  171  ? 201.770 183.089 237.543 1.00 137.64 ?  171  GLN A CD    1 
ATOM   1303  O  OE1   . GLN A 1  171  ? 200.942 182.707 236.700 1.00 134.25 ?  171  GLN A OE1   1 
ATOM   1304  N  NE2   . GLN A 1  171  ? 201.606 182.875 238.837 1.00 121.47 ?  171  GLN A NE2   1 
ATOM   1305  N  N     . PRO A 1  172  ? 204.439 180.021 234.701 1.00 124.39 ?  172  PRO A N     1 
ATOM   1306  C  CA    . PRO A 1  172  ? 205.088 179.274 233.606 1.00 123.20 ?  172  PRO A CA    1 
ATOM   1307  C  C     . PRO A 1  172  ? 205.337 180.076 232.348 1.00 123.98 ?  172  PRO A C     1 
ATOM   1308  O  O     . PRO A 1  172  ? 204.635 181.042 232.072 1.00 123.16 ?  172  PRO A O     1 
ATOM   1309  C  CB    . PRO A 1  172  ? 204.069 178.177 233.277 1.00 124.21 ?  172  PRO A CB    1 
ATOM   1310  C  CG    . PRO A 1  172  ? 202.760 178.727 233.715 1.00 128.38 ?  172  PRO A CG    1 
ATOM   1311  C  CD    . PRO A 1  172  ? 203.073 179.514 234.955 1.00 125.43 ?  172  PRO A CD    1 
ATOM   1312  N  N     . THR A 1  173  ? 206.289 179.620 231.552 1.00 118.87 ?  173  THR A N     1 
ATOM   1313  C  CA    . THR A 1  173  ? 206.518 180.198 230.250 1.00 117.16 ?  173  THR A CA    1 
ATOM   1314  C  C     . THR A 1  173  ? 205.732 179.295 229.314 1.00 119.48 ?  173  THR A C     1 
ATOM   1315  O  O     . THR A 1  173  ? 206.106 178.133 229.107 1.00 119.85 ?  173  THR A O     1 
ATOM   1316  C  CB    . THR A 1  173  ? 208.010 180.466 230.004 1.00 125.07 ?  173  THR A CB    1 
ATOM   1317  O  OG1   . THR A 1  173  ? 208.261 181.812 230.417 1.00 125.49 ?  173  THR A OG1   1 
ATOM   1318  C  CG2   . THR A 1  173  ? 208.437 180.289 228.536 1.00 120.80 ?  173  THR A CG2   1 
ATOM   1319  N  N     . ILE A 1  174  ? 204.567 179.797 228.859 1.00 113.79 ?  174  ILE A N     1 
ATOM   1320  C  CA    . ILE A 1  174  ? 203.661 179.052 227.984 1.00 111.79 ?  174  ILE A CA    1 
ATOM   1321  C  C     . ILE A 1  174  ? 204.027 179.184 226.505 1.00 114.67 ?  174  ILE A C     1 
ATOM   1322  O  O     . ILE A 1  174  ? 204.334 180.274 226.004 1.00 113.70 ?  174  ILE A O     1 
ATOM   1323  C  CB    . ILE A 1  174  ? 202.154 179.328 228.234 1.00 113.45 ?  174  ILE A CB    1 
ATOM   1324  C  CG1   . ILE A 1  174  ? 201.856 179.704 229.689 1.00 114.39 ?  174  ILE A CG1   1 
ATOM   1325  C  CG2   . ILE A 1  174  ? 201.311 178.135 227.800 1.00 113.17 ?  174  ILE A CG2   1 
ATOM   1326  C  CD1   . ILE A 1  174  ? 200.862 180.773 229.803 1.00 118.71 ?  174  ILE A CD1   1 
ATOM   1327  N  N     . ARG A 1  175  ? 203.979 178.044 225.825 1.00 110.79 ?  175  ARG A N     1 
ATOM   1328  C  CA    . ARG A 1  175  ? 204.228 177.893 224.405 1.00 110.03 ?  175  ARG A CA    1 
ATOM   1329  C  C     . ARG A 1  175  ? 203.229 176.865 223.882 1.00 113.15 ?  175  ARG A C     1 
ATOM   1330  O  O     . ARG A 1  175  ? 202.809 175.980 224.637 1.00 112.91 ?  175  ARG A O     1 
ATOM   1331  C  CB    . ARG A 1  175  ? 205.686 177.469 224.136 1.00 112.62 ?  175  ARG A CB    1 
ATOM   1332  C  CG    . ARG A 1  175  ? 206.272 176.435 225.109 1.00 131.62 ?  175  ARG A CG    1 
ATOM   1333  C  CD    . ARG A 1  175  ? 207.258 175.487 224.433 1.00 153.01 ?  175  ARG A CD    1 
ATOM   1334  N  NE    . ARG A 1  175  ? 206.610 174.670 223.399 1.00 167.49 ?  175  ARG A NE    1 
ATOM   1335  C  CZ    . ARG A 1  175  ? 207.039 173.481 222.985 1.00 181.61 ?  175  ARG A CZ    1 
ATOM   1336  N  NH1   . ARG A 1  175  ? 208.132 172.940 223.514 1.00 171.21 1  175  ARG A NH1   1 
ATOM   1337  N  NH2   . ARG A 1  175  ? 206.376 172.821 222.044 1.00 163.97 ?  175  ARG A NH2   1 
ATOM   1338  N  N     . LYS A 1  176  ? 202.807 176.994 222.620 1.00 108.83 ?  176  LYS A N     1 
ATOM   1339  C  CA    . LYS A 1  176  ? 201.857 176.016 222.106 1.00 108.28 ?  176  LYS A CA    1 
ATOM   1340  C  C     . LYS A 1  176  ? 202.501 174.857 221.342 1.00 111.97 ?  176  LYS A C     1 
ATOM   1341  O  O     . LYS A 1  176  ? 203.469 175.054 220.603 1.00 111.50 ?  176  LYS A O     1 
ATOM   1342  C  CB    . LYS A 1  176  ? 200.644 176.663 221.385 1.00 109.88 ?  176  LYS A CB    1 
ATOM   1343  C  CG    . LYS A 1  176  ? 200.768 176.904 219.865 1.00 115.22 ?  176  LYS A CG    1 
ATOM   1344  C  CD    . LYS A 1  176  ? 199.429 177.295 219.226 1.00 114.96 ?  176  LYS A CD    1 
ATOM   1345  C  CE    . LYS A 1  176  ? 198.604 176.102 218.808 1.00 122.36 ?  176  LYS A CE    1 
ATOM   1346  N  NZ    . LYS A 1  176  ? 198.827 175.739 217.385 1.00 133.26 1  176  LYS A NZ    1 
ATOM   1347  N  N     . ASP A 1  177  ? 201.977 173.646 221.556 1.00 108.74 ?  177  ASP A N     1 
ATOM   1348  C  CA    . ASP A 1  177  ? 202.420 172.449 220.851 1.00 108.94 ?  177  ASP A CA    1 
ATOM   1349  C  C     . ASP A 1  177  ? 201.212 171.892 220.110 1.00 109.45 ?  177  ASP A C     1 
ATOM   1350  O  O     . ASP A 1  177  ? 200.815 170.753 220.360 1.00 109.57 ?  177  ASP A O     1 
ATOM   1351  C  CB    . ASP A 1  177  ? 203.039 171.412 221.814 1.00 113.29 ?  177  ASP A CB    1 
ATOM   1352  C  CG    . ASP A 1  177  ? 203.809 170.292 221.123 1.00 130.89 ?  177  ASP A CG    1 
ATOM   1353  O  OD1   . ASP A 1  177  ? 204.956 170.542 220.681 1.00 140.64 ?  177  ASP A OD1   1 
ATOM   1354  O  OD2   . ASP A 1  177  ? 203.275 169.162 221.043 1.00 131.64 -1 177  ASP A OD2   1 
ATOM   1355  N  N     . GLY A 1  178  ? 200.625 172.741 219.246 1.00 102.85 ?  178  GLY A N     1 
ATOM   1356  C  CA    . GLY A 1  178  ? 199.471 172.470 218.388 1.00 100.33 ?  178  GLY A CA    1 
ATOM   1357  C  C     . GLY A 1  178  ? 198.304 171.849 219.115 1.00 101.43 ?  178  GLY A C     1 
ATOM   1358  O  O     . GLY A 1  178  ? 198.274 170.629 219.309 1.00 102.28 ?  178  GLY A O     1 
ATOM   1359  N  N     . LEU A 1  179  ? 197.337 172.683 219.520 1.00 94.57  ?  179  LEU A N     1 
ATOM   1360  C  CA    . LEU A 1  179  ? 196.131 172.325 220.299 1.00 93.32  ?  179  LEU A CA    1 
ATOM   1361  C  C     . LEU A 1  179  ? 196.413 172.116 221.812 1.00 98.35  ?  179  LEU A C     1 
ATOM   1362  O  O     . LEU A 1  179  ? 195.463 171.979 222.609 1.00 97.80  ?  179  LEU A O     1 
ATOM   1363  C  CB    . LEU A 1  179  ? 195.310 171.129 219.736 1.00 92.17  ?  179  LEU A CB    1 
ATOM   1364  C  CG    . LEU A 1  179  ? 194.977 171.035 218.256 1.00 94.27  ?  179  LEU A CG    1 
ATOM   1365  C  CD1   . LEU A 1  179  ? 193.977 169.912 218.009 1.00 93.70  ?  179  LEU A CD1   1 
ATOM   1366  C  CD2   . LEU A 1  179  ? 194.415 172.309 217.743 1.00 95.60  ?  179  LEU A CD2   1 
ATOM   1367  N  N     . LYS A 1  180  ? 197.715 172.075 222.189 1.00 95.25  ?  180  LYS A N     1 
ATOM   1368  C  CA    . LYS A 1  180  ? 198.157 171.876 223.567 1.00 96.22  ?  180  LYS A CA    1 
ATOM   1369  C  C     . LYS A 1  180  ? 198.933 173.080 224.020 1.00 102.02 ?  180  LYS A C     1 
ATOM   1370  O  O     . LYS A 1  180  ? 199.627 173.703 223.216 1.00 100.94 ?  180  LYS A O     1 
ATOM   1371  C  CB    . LYS A 1  180  ? 199.026 170.611 223.708 1.00 98.88  ?  180  LYS A CB    1 
ATOM   1372  C  CG    . LYS A 1  180  ? 198.306 169.308 223.390 1.00 109.45 ?  180  LYS A CG    1 
ATOM   1373  C  CD    . LYS A 1  180  ? 198.177 168.394 224.593 1.00 120.27 ?  180  LYS A CD    1 
ATOM   1374  C  CE    . LYS A 1  180  ? 197.445 167.121 224.218 1.00 136.72 ?  180  LYS A CE    1 
ATOM   1375  N  NZ    . LYS A 1  180  ? 197.453 166.105 225.311 1.00 147.82 1  180  LYS A NZ    1 
ATOM   1376  N  N     . LEU A 1  181  ? 198.809 173.414 225.306 1.00 101.58 ?  181  LEU A N     1 
ATOM   1377  C  CA    . LEU A 1  181  ? 199.532 174.526 225.906 1.00 103.47 ?  181  LEU A CA    1 
ATOM   1378  C  C     . LEU A 1  181  ? 200.474 173.970 226.969 1.00 114.78 ?  181  LEU A C     1 
ATOM   1379  O  O     . LEU A 1  181  ? 200.010 173.359 227.933 1.00 116.93 ?  181  LEU A O     1 
ATOM   1380  C  CB    . LEU A 1  181  ? 198.562 175.545 226.522 1.00 102.79 ?  181  LEU A CB    1 
ATOM   1381  C  CG    . LEU A 1  181  ? 197.780 176.422 225.556 1.00 105.70 ?  181  LEU A CG    1 
ATOM   1382  C  CD1   . LEU A 1  181  ? 196.836 177.316 226.311 1.00 105.61 ?  181  LEU A CD1   1 
ATOM   1383  C  CD2   . LEU A 1  181  ? 198.703 177.261 224.670 1.00 107.35 ?  181  LEU A CD2   1 
ATOM   1384  N  N     . VAL A 1  182  ? 201.792 174.143 226.788 1.00 113.69 ?  182  VAL A N     1 
ATOM   1385  C  CA    . VAL A 1  182  ? 202.770 173.616 227.738 1.00 115.84 ?  182  VAL A CA    1 
ATOM   1386  C  C     . VAL A 1  182  ? 203.629 174.703 228.398 1.00 124.65 ?  182  VAL A C     1 
ATOM   1387  O  O     . VAL A 1  182  ? 204.195 175.554 227.710 1.00 124.01 ?  182  VAL A O     1 
ATOM   1388  C  CB    . VAL A 1  182  ? 203.575 172.434 227.146 1.00 119.61 ?  182  VAL A CB    1 
ATOM   1389  C  CG1   . VAL A 1  182  ? 203.956 172.681 225.689 1.00 118.10 ?  182  VAL A CG1   1 
ATOM   1390  C  CG2   . VAL A 1  182  ? 204.804 172.106 227.990 1.00 121.19 ?  182  VAL A CG2   1 
ATOM   1391  N  N     . GLY A 1  183  ? 203.700 174.654 229.727 1.00 125.43 ?  183  GLY A N     1 
ATOM   1392  C  CA    . GLY A 1  183  ? 204.450 175.611 230.529 1.00 127.72 ?  183  GLY A CA    1 
ATOM   1393  C  C     . GLY A 1  183  ? 205.834 175.162 230.951 1.00 137.08 ?  183  GLY A C     1 
ATOM   1394  O  O     . GLY A 1  183  ? 206.098 173.962 231.063 1.00 136.99 ?  183  GLY A O     1 
ATOM   1395  N  N     . SER A 1  184  ? 206.714 176.148 231.210 1.00 137.81 ?  184  SER A N     1 
ATOM   1396  C  CA    . SER A 1  184  ? 208.103 175.998 231.652 1.00 140.50 ?  184  SER A CA    1 
ATOM   1397  C  C     . SER A 1  184  ? 208.362 176.942 232.835 1.00 150.37 ?  184  SER A C     1 
ATOM   1398  O  O     . SER A 1  184  ? 208.773 178.093 232.642 1.00 149.50 ?  184  SER A O     1 
ATOM   1399  C  CB    . SER A 1  184  ? 209.063 176.308 230.506 1.00 142.74 ?  184  SER A CB    1 
ATOM   1400  O  OG    . SER A 1  184  ? 210.405 176.353 230.960 1.00 149.92 ?  184  SER A OG    1 
ATOM   1401  N  N     . TRP A 1  185  ? 208.103 176.453 234.056 1.00 152.62 ?  185  TRP A N     1 
ATOM   1402  C  CA    . TRP A 1  185  ? 208.272 177.221 235.293 1.00 156.08 ?  185  TRP A CA    1 
ATOM   1403  C  C     . TRP A 1  185  ? 209.746 177.525 235.620 1.00 167.10 ?  185  TRP A C     1 
ATOM   1404  O  O     . TRP A 1  185  ? 210.562 176.605 235.774 1.00 167.32 ?  185  TRP A O     1 
ATOM   1405  C  CB    . TRP A 1  185  ? 207.584 176.523 236.473 1.00 155.60 ?  185  TRP A CB    1 
ATOM   1406  C  CG    . TRP A 1  185  ? 206.088 176.593 236.462 1.00 155.40 ?  185  TRP A CG    1 
ATOM   1407  C  CD1   . TRP A 1  185  ? 205.296 177.348 237.278 1.00 158.43 ?  185  TRP A CD1   1 
ATOM   1408  C  CD2   . TRP A 1  185  ? 205.204 175.813 235.654 1.00 154.01 ?  185  TRP A CD2   1 
ATOM   1409  N  NE1   . TRP A 1  185  ? 203.970 177.098 237.016 1.00 156.81 ?  185  TRP A NE1   1 
ATOM   1410  C  CE2   . TRP A 1  185  ? 203.884 176.154 236.027 1.00 157.52 ?  185  TRP A CE2   1 
ATOM   1411  C  CE3   . TRP A 1  185  ? 205.396 174.877 234.624 1.00 154.55 ?  185  TRP A CE3   1 
ATOM   1412  C  CZ2   . TRP A 1  185  ? 202.764 175.589 235.407 1.00 155.76 ?  185  TRP A CZ2   1 
ATOM   1413  C  CZ3   . TRP A 1  185  ? 204.288 174.350 233.988 1.00 154.83 ?  185  TRP A CZ3   1 
ATOM   1414  C  CH2   . TRP A 1  185  ? 202.991 174.696 234.384 1.00 155.01 ?  185  TRP A CH2   1 
ATOM   1415  N  N     . LYS A 1  186  ? 210.061 178.835 235.748 1.00 167.95 ?  186  LYS A N     1 
ATOM   1416  C  CA    . LYS A 1  186  ? 211.385 179.393 236.033 1.00 170.64 ?  186  LYS A CA    1 
ATOM   1417  C  C     . LYS A 1  186  ? 212.195 178.632 237.071 1.00 180.74 ?  186  LYS A C     1 
ATOM   1418  O  O     . LYS A 1  186  ? 213.372 178.381 236.820 1.00 181.35 ?  186  LYS A O     1 
ATOM   1419  C  CB    . LYS A 1  186  ? 211.278 180.873 236.415 1.00 173.26 ?  186  LYS A CB    1 
ATOM   1420  N  N     . LYS A 1  187  ? 211.558 178.247 238.217 1.00 181.63 ?  187  LYS A N     1 
ATOM   1421  C  CA    . LYS A 1  187  ? 212.132 177.522 239.379 1.00 184.90 ?  187  LYS A CA    1 
ATOM   1422  C  C     . LYS A 1  187  ? 213.143 178.352 240.216 1.00 192.97 ?  187  LYS A C     1 
ATOM   1423  O  O     . LYS A 1  187  ? 213.414 179.509 239.871 1.00 192.67 ?  187  LYS A O     1 
ATOM   1424  C  CB    . LYS A 1  187  ? 212.677 176.119 239.007 1.00 187.91 ?  187  LYS A CB    1 
ATOM   1425  C  CG    . LYS A 1  187  ? 211.708 174.977 239.295 1.00 197.66 ?  187  LYS A CG    1 
ATOM   1426  C  CD    . LYS A 1  187  ? 212.244 173.646 238.793 1.00 202.91 ?  187  LYS A CD    1 
ATOM   1427  C  CE    . LYS A 1  187  ? 211.355 172.493 239.173 1.00 204.86 ?  187  LYS A CE    1 
ATOM   1428  N  NZ    . LYS A 1  187  ? 211.742 171.258 238.451 1.00 208.75 1  187  LYS A NZ    1 
ATOM   1429  N  N     . ASP A 1  188  ? 213.688 177.775 241.316 1.00 192.60 ?  188  ASP A N     1 
ATOM   1430  C  CA    . ASP A 1  188  ? 214.651 178.478 242.170 1.00 194.56 ?  188  ASP A CA    1 
ATOM   1431  C  C     . ASP A 1  188  ? 215.941 177.710 242.450 1.00 202.56 ?  188  ASP A C     1 
ATOM   1432  O  O     . ASP A 1  188  ? 217.004 178.249 242.154 1.00 202.52 ?  188  ASP A O     1 
ATOM   1433  C  CB    . ASP A 1  188  ? 214.007 179.026 243.461 1.00 196.90 ?  188  ASP A CB    1 
ATOM   1434  C  CG    . ASP A 1  188  ? 213.183 180.287 243.263 1.00 203.14 ?  188  ASP A CG    1 
ATOM   1435  O  OD1   . ASP A 1  188  ? 213.730 181.280 242.736 1.00 202.92 ?  188  ASP A OD1   1 
ATOM   1436  O  OD2   . ASP A 1  188  ? 212.004 180.296 243.671 1.00 207.79 -1 188  ASP A OD2   1 
ATOM   1437  N  N     . ARG A 1  189  ? 215.849 176.464 243.003 1.00 201.83 ?  189  ARG A N     1 
ATOM   1438  C  CA    . ARG A 1  189  ? 216.945 175.535 243.385 1.00 203.92 ?  189  ARG A CA    1 
ATOM   1439  C  C     . ARG A 1  189  ? 218.393 176.097 243.412 1.00 210.56 ?  189  ARG A C     1 
ATOM   1440  O  O     . ARG A 1  189  ? 219.047 176.170 242.364 1.00 209.86 ?  189  ARG A O     1 
ATOM   1441  C  CB    . ARG A 1  189  ? 216.860 174.194 242.625 1.00 203.64 ?  189  ARG A CB    1 
ATOM   1442  C  CG    . ARG A 1  189  ? 215.781 173.236 243.126 1.00 212.66 ?  189  ARG A CG    1 
ATOM   1443  C  CD    . ARG A 1  189  ? 215.943 171.842 242.543 1.00 219.91 ?  189  ARG A CD    1 
ATOM   1444  N  NE    . ARG A 1  189  ? 215.551 171.777 241.132 1.00 224.79 ?  189  ARG A NE    1 
ATOM   1445  C  CZ    . ARG A 1  189  ? 215.650 170.691 240.372 1.00 234.14 ?  189  ARG A CZ    1 
ATOM   1446  N  NH1   . ARG A 1  189  ? 216.132 169.560 240.874 1.00 221.05 1  189  ARG A NH1   1 
ATOM   1447  N  NH2   . ARG A 1  189  ? 215.267 170.727 239.101 1.00 220.53 ?  189  ARG A NH2   1 
ATOM   1448  N  N     . ALA A 1  190  ? 218.881 176.471 244.629 1.00 209.85 ?  190  ALA A N     1 
ATOM   1449  C  CA    . ALA A 1  190  ? 220.193 177.082 244.923 1.00 211.42 ?  190  ALA A CA    1 
ATOM   1450  C  C     . ALA A 1  190  ? 220.413 178.417 244.157 1.00 215.97 ?  190  ALA A C     1 
ATOM   1451  O  O     . ALA A 1  190  ? 221.524 178.699 243.693 1.00 216.10 ?  190  ALA A O     1 
ATOM   1452  C  CB    . ALA A 1  190  ? 221.331 176.090 244.682 1.00 213.08 ?  190  ALA A CB    1 
ATOM   1453  N  N     . THR A 1  191  ? 219.322 179.240 244.060 1.00 212.41 ?  191  THR A N     1 
ATOM   1454  C  CA    . THR A 1  191  ? 219.162 180.555 243.388 1.00 211.33 ?  191  THR A CA    1 
ATOM   1455  C  C     . THR A 1  191  ? 219.162 180.546 241.836 1.00 213.90 ?  191  THR A C     1 
ATOM   1456  O  O     . THR A 1  191  ? 218.454 181.354 241.222 1.00 211.44 ?  191  THR A O     1 
ATOM   1457  C  CB    . THR A 1  191  ? 219.955 181.718 244.042 1.00 219.23 ?  191  THR A CB    1 
ATOM   1458  O  OG1   . THR A 1  191  ? 221.352 181.432 244.070 1.00 220.63 ?  191  THR A OG1   1 
ATOM   1459  C  CG2   . THR A 1  191  ? 219.450 182.070 245.437 1.00 218.21 ?  191  THR A CG2   1 
ATOM   1460  N  N     . GLY A 1  192  ? 219.919 179.618 241.242 1.00 211.28 ?  192  GLY A N     1 
ATOM   1461  C  CA    . GLY A 1  192  ? 220.051 179.448 239.796 1.00 209.95 ?  192  GLY A CA    1 
ATOM   1462  C  C     . GLY A 1  192  ? 218.817 178.894 239.112 1.00 212.08 ?  192  GLY A C     1 
ATOM   1463  O  O     . GLY A 1  192  ? 217.948 179.672 238.706 1.00 209.87 ?  192  GLY A O     1 
ATOM   1464  N  N     . ASP A 1  193  ? 218.766 177.533 238.963 1.00 208.50 ?  193  ASP A N     1 
ATOM   1465  C  CA    . ASP A 1  193  ? 217.730 176.651 238.362 1.00 206.77 ?  193  ASP A CA    1 
ATOM   1466  C  C     . ASP A 1  193  ? 216.389 177.347 237.956 1.00 206.90 ?  193  ASP A C     1 
ATOM   1467  O  O     . ASP A 1  193  ? 215.744 177.910 238.838 1.00 206.77 ?  193  ASP A O     1 
ATOM   1468  C  CB    . ASP A 1  193  ? 217.475 175.455 239.314 1.00 210.02 ?  193  ASP A CB    1 
ATOM   1469  C  CG    . ASP A 1  193  ? 216.710 174.267 238.748 1.00 221.19 ?  193  ASP A CG    1 
ATOM   1470  O  OD1   . ASP A 1  193  ? 215.475 174.382 238.572 1.00 220.42 ?  193  ASP A OD1   1 
ATOM   1471  O  OD2   . ASP A 1  193  ? 217.322 173.187 238.599 1.00 228.49 -1 193  ASP A OD2   1 
ATOM   1472  N  N     . ALA A 1  194  ? 215.962 177.354 236.653 1.00 200.17 ?  194  ALA A N     1 
ATOM   1473  C  CA    . ALA A 1  194  ? 216.534 176.728 235.444 1.00 198.28 ?  194  ALA A CA    1 
ATOM   1474  C  C     . ALA A 1  194  ? 217.785 177.426 234.857 1.00 200.03 ?  194  ALA A C     1 
ATOM   1475  O  O     . ALA A 1  194  ? 217.793 178.659 234.832 1.00 199.13 ?  194  ALA A O     1 
ATOM   1476  C  CB    . ALA A 1  194  ? 215.464 176.628 234.371 1.00 196.99 ?  194  ALA A CB    1 
ATOM   1477  N  N     . ASP A 1  195  ? 218.835 176.701 234.337 1.00 195.23 ?  195  ASP A N     1 
ATOM   1478  C  CA    . ASP A 1  195  ? 219.167 175.255 234.189 1.00 194.42 ?  195  ASP A CA    1 
ATOM   1479  C  C     . ASP A 1  195  ? 218.136 174.144 234.554 1.00 195.04 ?  195  ASP A C     1 
ATOM   1480  O  O     . ASP A 1  195  ? 217.951 173.837 235.736 1.00 196.04 ?  195  ASP A O     1 
ATOM   1481  C  CB    . ASP A 1  195  ? 220.570 174.946 234.764 1.00 197.94 ?  195  ASP A CB    1 
ATOM   1482  C  CG    . ASP A 1  195  ? 221.702 175.694 234.080 1.00 205.93 ?  195  ASP A CG    1 
ATOM   1483  O  OD1   . ASP A 1  195  ? 222.261 175.158 233.098 1.00 210.34 ?  195  ASP A OD1   1 
ATOM   1484  O  OD2   . ASP A 1  195  ? 222.037 176.808 234.534 1.00 206.63 -1 195  ASP A OD2   1 
ATOM   1485  N  N     . GLU A 1  196  ? 217.536 173.501 233.517 1.00 187.14 ?  196  GLU A N     1 
ATOM   1486  C  CA    . GLU A 1  196  ? 216.503 172.446 233.589 1.00 184.92 ?  196  GLU A CA    1 
ATOM   1487  C  C     . GLU A 1  196  ? 215.246 172.767 234.443 1.00 184.36 ?  196  GLU A C     1 
ATOM   1488  O  O     . GLU A 1  196  ? 215.229 172.537 235.658 1.00 185.08 ?  196  GLU A O     1 
ATOM   1489  C  CB    . GLU A 1  196  ? 217.037 170.994 233.735 1.00 187.40 ?  196  GLU A CB    1 
ATOM   1490  C  CG    . GLU A 1  196  ? 218.151 170.734 234.745 1.00 199.31 ?  196  GLU A CG    1 
ATOM   1491  C  CD    . GLU A 1  196  ? 217.780 170.632 236.214 1.00 216.91 ?  196  GLU A CD    1 
ATOM   1492  O  OE1   . GLU A 1  196  ? 216.664 170.157 236.528 1.00 209.52 ?  196  GLU A OE1   1 
ATOM   1493  O  OE2   . GLU A 1  196  ? 218.636 170.986 237.056 1.00 209.39 -1 196  GLU A OE2   1 
ATOM   1494  N  N     . PRO A 1  197  ? 214.182 173.317 233.806 1.00 175.92 ?  197  PRO A N     1 
ATOM   1495  C  CA    . PRO A 1  197  ? 212.974 173.686 234.566 1.00 173.92 ?  197  PRO A CA    1 
ATOM   1496  C  C     . PRO A 1  197  ? 211.907 172.589 234.638 1.00 172.75 ?  197  PRO A C     1 
ATOM   1497  O  O     . PRO A 1  197  ? 212.109 171.489 234.115 1.00 172.63 ?  197  PRO A O     1 
ATOM   1498  C  CB    . PRO A 1  197  ? 212.453 174.904 233.796 1.00 174.31 ?  197  PRO A CB    1 
ATOM   1499  C  CG    . PRO A 1  197  ? 212.947 174.714 232.381 1.00 178.30 ?  197  PRO A CG    1 
ATOM   1500  C  CD    . PRO A 1  197  ? 214.037 173.674 232.378 1.00 175.38 ?  197  PRO A CD    1 
ATOM   1501  N  N     . GLU A 1  198  ? 210.757 172.909 235.278 1.00 164.67 ?  198  GLU A N     1 
ATOM   1502  C  CA    . GLU A 1  198  ? 209.582 172.039 235.391 1.00 161.90 ?  198  GLU A CA    1 
ATOM   1503  C  C     . GLU A 1  198  ? 208.809 172.134 234.048 1.00 158.11 ?  198  GLU A C     1 
ATOM   1504  O  O     . GLU A 1  198  ? 208.292 173.207 233.705 1.00 156.96 ?  198  GLU A O     1 
ATOM   1505  C  CB    . GLU A 1  198  ? 208.706 172.475 236.596 1.00 163.74 ?  198  GLU A CB    1 
ATOM   1506  C  CG    . GLU A 1  198  ? 207.439 171.657 236.832 1.00 173.20 ?  198  GLU A CG    1 
ATOM   1507  C  CD    . GLU A 1  198  ? 206.571 172.116 237.992 1.00 190.10 ?  198  GLU A CD    1 
ATOM   1508  O  OE1   . GLU A 1  198  ? 207.049 172.049 239.148 1.00 191.11 ?  198  GLU A OE1   1 
ATOM   1509  O  OE2   . GLU A 1  198  ? 205.413 172.533 237.752 1.00 164.55 -1 198  GLU A OE2   1 
ATOM   1510  N  N     . LEU A 1  199  ? 208.788 171.028 233.269 1.00 148.88 ?  199  LEU A N     1 
ATOM   1511  C  CA    . LEU A 1  199  ? 208.114 170.969 231.963 1.00 144.11 ?  199  LEU A CA    1 
ATOM   1512  C  C     . LEU A 1  199  ? 206.837 170.129 232.018 1.00 141.46 ?  199  LEU A C     1 
ATOM   1513  O  O     . LEU A 1  199  ? 206.899 168.893 232.056 1.00 141.04 ?  199  LEU A O     1 
ATOM   1514  C  CB    . LEU A 1  199  ? 209.061 170.450 230.857 1.00 143.60 ?  199  LEU A CB    1 
ATOM   1515  C  CG    . LEU A 1  199  ? 210.118 171.379 230.214 1.00 147.60 ?  199  LEU A CG    1 
ATOM   1516  C  CD1   . LEU A 1  199  ? 209.987 171.378 228.712 1.00 146.22 ?  199  LEU A CD1   1 
ATOM   1517  C  CD2   . LEU A 1  199  ? 210.090 172.805 230.747 1.00 149.36 ?  199  LEU A CD2   1 
ATOM   1518  N  N     . ARG A 1  200  ? 205.679 170.811 232.045 1.00 133.09 ?  200  ARG A N     1 
ATOM   1519  C  CA    . ARG A 1  200  ? 204.364 170.168 232.089 1.00 130.48 ?  200  ARG A CA    1 
ATOM   1520  C  C     . ARG A 1  200  ? 203.342 170.872 231.235 1.00 129.27 ?  200  ARG A C     1 
ATOM   1521  O  O     . ARG A 1  200  ? 203.350 172.103 231.106 1.00 128.61 ?  200  ARG A O     1 
ATOM   1522  C  CB    . ARG A 1  200  ? 203.835 169.973 233.522 1.00 130.34 ?  200  ARG A CB    1 
ATOM   1523  C  CG    . ARG A 1  200  ? 203.604 171.261 234.305 1.00 135.02 ?  200  ARG A CG    1 
ATOM   1524  C  CD    . ARG A 1  200  ? 203.010 171.055 235.682 1.00 138.01 ?  200  ARG A CD    1 
ATOM   1525  N  NE    . ARG A 1  200  ? 201.670 170.500 235.575 1.00 139.71 ?  200  ARG A NE    1 
ATOM   1526  C  CZ    . ARG A 1  200  ? 200.567 171.230 235.492 1.00 152.06 ?  200  ARG A CZ    1 
ATOM   1527  N  NH1   . ARG A 1  200  ? 200.634 172.555 235.549 1.00 133.78 1  200  ARG A NH1   1 
ATOM   1528  N  NH2   . ARG A 1  200  ? 199.386 170.642 235.369 1.00 141.92 ?  200  ARG A NH2   1 
ATOM   1529  N  N     . VAL A 1  201  ? 202.456 170.070 230.654 1.00 121.83 ?  201  VAL A N     1 
ATOM   1530  C  CA    . VAL A 1  201  ? 201.373 170.548 229.818 1.00 118.55 ?  201  VAL A CA    1 
ATOM   1531  C  C     . VAL A 1  201  ? 200.236 170.995 230.724 1.00 119.72 ?  201  VAL A C     1 
ATOM   1532  O  O     . VAL A 1  201  ? 199.898 170.305 231.689 1.00 120.61 ?  201  VAL A O     1 
ATOM   1533  C  CB    . VAL A 1  201  ? 200.948 169.486 228.773 1.00 121.44 ?  201  VAL A CB    1 
ATOM   1534  C  CG1   . VAL A 1  201  ? 200.632 168.138 229.418 1.00 122.07 ?  201  VAL A CG1   1 
ATOM   1535  C  CG2   . VAL A 1  201  ? 199.786 169.971 227.914 1.00 119.81 ?  201  VAL A CG2   1 
ATOM   1536  N  N     . LEU A 1  202  ? 199.687 172.169 230.447 1.00 113.20 ?  202  LEU A N     1 
ATOM   1537  C  CA    . LEU A 1  202  ? 198.575 172.695 231.218 1.00 112.18 ?  202  LEU A CA    1 
ATOM   1538  C  C     . LEU A 1  202  ? 197.287 172.085 230.687 1.00 113.03 ?  202  LEU A C     1 
ATOM   1539  O  O     . LEU A 1  202  ? 196.961 172.231 229.501 1.00 111.73 ?  202  LEU A O     1 
ATOM   1540  C  CB    . LEU A 1  202  ? 198.520 174.222 231.147 1.00 111.83 ?  202  LEU A CB    1 
ATOM   1541  C  CG    . LEU A 1  202  ? 199.775 174.934 231.582 1.00 117.78 ?  202  LEU A CG    1 
ATOM   1542  C  CD1   . LEU A 1  202  ? 200.394 175.659 230.423 1.00 117.20 ?  202  LEU A CD1   1 
ATOM   1543  C  CD2   . LEU A 1  202  ? 199.497 175.869 232.747 1.00 121.89 ?  202  LEU A CD2   1 
ATOM   1544  N  N     . SER A 1  203  ? 196.575 171.371 231.565 1.00 108.17 ?  203  SER A N     1 
ATOM   1545  C  CA    . SER A 1  203  ? 195.310 170.718 231.243 1.00 106.42 ?  203  SER A CA    1 
ATOM   1546  C  C     . SER A 1  203  ? 194.209 171.753 230.995 1.00 108.88 ?  203  SER A C     1 
ATOM   1547  O  O     . SER A 1  203  ? 194.241 172.844 231.585 1.00 109.08 ?  203  SER A O     1 
ATOM   1548  C  CB    . SER A 1  203  ? 194.900 169.797 232.387 1.00 109.45 ?  203  SER A CB    1 
ATOM   1549  O  OG    . SER A 1  203  ? 194.551 170.519 233.559 1.00 112.71 ?  203  SER A OG    1 
ATOM   1550  N  N     . THR A 1  204  ? 193.221 171.403 230.144 1.00 102.74 ?  204  THR A N     1 
ATOM   1551  C  CA    . THR A 1  204  ? 192.074 172.273 229.875 1.00 100.65 ?  204  THR A CA    1 
ATOM   1552  C  C     . THR A 1  204  ? 191.427 172.642 231.209 1.00 105.36 ?  204  THR A C     1 
ATOM   1553  O  O     . THR A 1  204  ? 191.370 173.818 231.561 1.00 105.17 ?  204  THR A O     1 
ATOM   1554  C  CB    . THR A 1  204  ? 191.069 171.584 228.977 1.00 101.51 ?  204  THR A CB    1 
ATOM   1555  O  OG1   . THR A 1  204  ? 191.689 170.487 228.318 1.00 102.43 ?  204  THR A OG1   1 
ATOM   1556  C  CG2   . THR A 1  204  ? 190.492 172.516 227.979 1.00 97.62  ?  204  THR A CG2   1 
ATOM   1557  N  N     . GLU A 1  205  ? 191.069 171.611 231.995 1.00 102.40 ?  205  GLU A N     1 
ATOM   1558  C  CA    . GLU A 1  205  ? 190.467 171.684 233.325 1.00 102.79 ?  205  GLU A CA    1 
ATOM   1559  C  C     . GLU A 1  205  ? 191.167 172.642 234.275 1.00 105.99 ?  205  GLU A C     1 
ATOM   1560  O  O     . GLU A 1  205  ? 190.472 173.382 234.971 1.00 105.58 ?  205  GLU A O     1 
ATOM   1561  C  CB    . GLU A 1  205  ? 190.275 170.287 233.954 1.00 105.31 ?  205  GLU A CB    1 
ATOM   1562  C  CG    . GLU A 1  205  ? 191.353 169.268 233.610 1.00 121.16 ?  205  GLU A CG    1 
ATOM   1563  C  CD    . GLU A 1  205  ? 191.115 168.439 232.356 1.00 153.29 ?  205  GLU A CD    1 
ATOM   1564  O  OE1   . GLU A 1  205  ? 191.488 168.890 231.246 1.00 147.59 ?  205  GLU A OE1   1 
ATOM   1565  O  OE2   . GLU A 1  205  ? 190.590 167.311 232.494 1.00 155.71 -1 205  GLU A OE2   1 
ATOM   1566  N  N     . GLU A 1  206  ? 192.521 172.672 234.287 1.00 102.55 ?  206  GLU A N     1 
ATOM   1567  C  CA    . GLU A 1  206  ? 193.231 173.599 235.179 1.00 103.37 ?  206  GLU A CA    1 
ATOM   1568  C  C     . GLU A 1  206  ? 193.124 175.046 234.706 1.00 105.30 ?  206  GLU A C     1 
ATOM   1569  O  O     . GLU A 1  206  ? 192.894 175.932 235.538 1.00 105.58 ?  206  GLU A O     1 
ATOM   1570  C  CB    . GLU A 1  206  ? 194.677 173.161 235.498 1.00 106.08 ?  206  GLU A CB    1 
ATOM   1571  C  CG    . GLU A 1  206  ? 195.738 173.547 234.478 1.00 118.22 ?  206  GLU A CG    1 
ATOM   1572  C  CD    . GLU A 1  206  ? 197.098 172.923 234.711 1.00 145.05 ?  206  GLU A CD    1 
ATOM   1573  O  OE1   . GLU A 1  206  ? 197.308 171.781 234.241 1.00 148.43 ?  206  GLU A OE1   1 
ATOM   1574  O  OE2   . GLU A 1  206  ? 197.960 173.575 235.347 1.00 137.40 -1 206  GLU A OE2   1 
ATOM   1575  N  N     . ILE A 1  207  ? 193.230 175.266 233.361 1.00 98.75  ?  207  ILE A N     1 
ATOM   1576  C  CA    . ILE A 1  207  ? 193.115 176.583 232.707 1.00 96.31  ?  207  ILE A CA    1 
ATOM   1577  C  C     . ILE A 1  207  ? 191.696 177.118 232.958 1.00 97.65  ?  207  ILE A C     1 
ATOM   1578  O  O     . ILE A 1  207  ? 191.533 178.263 233.380 1.00 97.07  ?  207  ILE A O     1 
ATOM   1579  C  CB    . ILE A 1  207  ? 193.502 176.526 231.193 1.00 97.39  ?  207  ILE A CB    1 
ATOM   1580  C  CG1   . ILE A 1  207  ? 195.005 176.175 231.009 1.00 97.65  ?  207  ILE A CG1   1 
ATOM   1581  C  CG2   . ILE A 1  207  ? 193.143 177.842 230.481 1.00 96.12  ?  207  ILE A CG2   1 
ATOM   1582  C  CD1   . ILE A 1  207  ? 195.419 175.643 229.639 1.00 98.53  ?  207  ILE A CD1   1 
ATOM   1583  N  N     . LEU A 1  208  ? 190.692 176.238 232.768 1.00 92.33  ?  208  LEU A N     1 
ATOM   1584  C  CA    . LEU A 1  208  ? 189.276 176.472 233.010 1.00 91.06  ?  208  LEU A CA    1 
ATOM   1585  C  C     . LEU A 1  208  ? 189.090 176.970 234.435 1.00 95.94  ?  208  LEU A C     1 
ATOM   1586  O  O     . LEU A 1  208  ? 188.413 177.977 234.627 1.00 96.25  ?  208  LEU A O     1 
ATOM   1587  C  CB    . LEU A 1  208  ? 188.511 175.146 232.851 1.00 90.76  ?  208  LEU A CB    1 
ATOM   1588  C  CG    . LEU A 1  208  ? 187.094 175.168 232.278 1.00 94.08  ?  208  LEU A CG    1 
ATOM   1589  C  CD1   . LEU A 1  208  ? 186.438 173.832 232.464 1.00 94.16  ?  208  LEU A CD1   1 
ATOM   1590  C  CD2   . LEU A 1  208  ? 186.211 176.212 232.933 1.00 96.79  ?  208  LEU A CD2   1 
ATOM   1591  N  N     . ASN A 1  209  ? 189.693 176.279 235.423 1.00 92.83  ?  209  ASN A N     1 
ATOM   1592  C  CA    . ASN A 1  209  ? 189.564 176.648 236.821 1.00 93.71  ?  209  ASN A CA    1 
ATOM   1593  C  C     . ASN A 1  209  ? 190.143 178.000 237.148 1.00 97.88  ?  209  ASN A C     1 
ATOM   1594  O  O     . ASN A 1  209  ? 189.528 178.724 237.925 1.00 97.87  ?  209  ASN A O     1 
ATOM   1595  C  CB    . ASN A 1  209  ? 190.109 175.588 237.760 1.00 95.92  ?  209  ASN A CB    1 
ATOM   1596  C  CG    . ASN A 1  209  ? 189.721 175.864 239.193 1.00 114.67 ?  209  ASN A CG    1 
ATOM   1597  O  OD1   . ASN A 1  209  ? 190.567 176.018 240.078 1.00 101.11 ?  209  ASN A OD1   1 
ATOM   1598  N  ND2   . ASN A 1  209  ? 188.429 176.050 239.430 1.00 110.15 ?  209  ASN A ND2   1 
ATOM   1599  N  N     . ILE A 1  210  ? 191.303 178.352 236.569 1.00 94.95  ?  210  ILE A N     1 
ATOM   1600  C  CA    . ILE A 1  210  ? 191.927 179.663 236.801 1.00 96.07  ?  210  ILE A CA    1 
ATOM   1601  C  C     . ILE A 1  210  ? 191.011 180.775 236.251 1.00 101.02 ?  210  ILE A C     1 
ATOM   1602  O  O     . ILE A 1  210  ? 190.748 181.775 236.935 1.00 100.94 ?  210  ILE A O     1 
ATOM   1603  C  CB    . ILE A 1  210  ? 193.351 179.718 236.188 1.00 99.34  ?  210  ILE A CB    1 
ATOM   1604  C  CG1   . ILE A 1  210  ? 194.269 178.599 236.727 1.00 101.93 ?  210  ILE A CG1   1 
ATOM   1605  C  CG2   . ILE A 1  210  ? 193.992 181.094 236.332 1.00 99.40  ?  210  ILE A CG2   1 
ATOM   1606  C  CD1   . ILE A 1  210  ? 194.402 178.443 238.291 1.00 115.78 ?  210  ILE A CD1   1 
ATOM   1607  N  N     . PHE A 1  211  ? 190.496 180.547 235.023 1.00 96.83  ?  211  PHE A N     1 
ATOM   1608  C  CA    . PHE A 1  211  ? 189.577 181.415 234.303 1.00 95.07  ?  211  PHE A CA    1 
ATOM   1609  C  C     . PHE A 1  211  ? 188.312 181.622 235.113 1.00 101.53 ?  211  PHE A C     1 
ATOM   1610  O  O     . PHE A 1  211  ? 187.866 182.761 235.245 1.00 102.88 ?  211  PHE A O     1 
ATOM   1611  C  CB    . PHE A 1  211  ? 189.283 180.854 232.901 1.00 94.79  ?  211  PHE A CB    1 
ATOM   1612  C  CG    . PHE A 1  211  ? 190.383 181.063 231.876 1.00 95.36  ?  211  PHE A CG    1 
ATOM   1613  C  CD1   . PHE A 1  211  ? 191.682 181.378 232.270 1.00 98.54  ?  211  PHE A CD1   1 
ATOM   1614  C  CD2   . PHE A 1  211  ? 190.120 180.943 230.517 1.00 96.15  ?  211  PHE A CD2   1 
ATOM   1615  C  CE1   . PHE A 1  211  ? 192.694 181.568 231.322 1.00 98.79  ?  211  PHE A CE1   1 
ATOM   1616  C  CE2   . PHE A 1  211  ? 191.139 181.132 229.569 1.00 98.20  ?  211  PHE A CE2   1 
ATOM   1617  C  CZ    . PHE A 1  211  ? 192.418 181.441 229.979 1.00 96.67  ?  211  PHE A CZ    1 
ATOM   1618  N  N     . LYS A 1  212  ? 187.795 180.553 235.745 1.00 98.42  ?  212  LYS A N     1 
ATOM   1619  C  CA    . LYS A 1  212  ? 186.615 180.630 236.604 1.00 99.01  ?  212  LYS A CA    1 
ATOM   1620  C  C     . LYS A 1  212  ? 186.839 181.565 237.798 1.00 106.85 ?  212  LYS A C     1 
ATOM   1621  O  O     . LYS A 1  212  ? 185.908 182.268 238.201 1.00 107.48 ?  212  LYS A O     1 
ATOM   1622  C  CB    . LYS A 1  212  ? 186.168 179.230 237.051 1.00 101.28 ?  212  LYS A CB    1 
ATOM   1623  C  CG    . LYS A 1  212  ? 185.334 178.508 235.983 1.00 106.74 ?  212  LYS A CG    1 
ATOM   1624  C  CD    . LYS A 1  212  ? 184.913 177.090 236.397 1.00 108.55 ?  212  LYS A CD    1 
ATOM   1625  C  CE    . LYS A 1  212  ? 183.646 176.636 235.702 1.00 101.70 ?  212  LYS A CE    1 
ATOM   1626  N  NZ    . LYS A 1  212  ? 183.228 175.265 236.106 1.00 104.66 1  212  LYS A NZ    1 
ATOM   1627  N  N     . HIS A 1  213  ? 188.097 181.633 238.291 1.00 105.33 ?  213  HIS A N     1 
ATOM   1628  C  CA    . HIS A 1  213  ? 188.530 182.454 239.423 1.00 107.11 ?  213  HIS A CA    1 
ATOM   1629  C  C     . HIS A 1  213  ? 188.968 183.876 239.068 1.00 111.43 ?  213  HIS A C     1 
ATOM   1630  O  O     . HIS A 1  213  ? 189.193 184.682 239.987 1.00 111.90 ?  213  HIS A O     1 
ATOM   1631  C  CB    . HIS A 1  213  ? 189.631 181.735 240.220 1.00 109.57 ?  213  HIS A CB    1 
ATOM   1632  C  CG    . HIS A 1  213  ? 189.156 180.538 240.988 1.00 113.95 ?  213  HIS A CG    1 
ATOM   1633  N  ND1   . HIS A 1  213  ? 187.854 180.070 240.881 1.00 115.26 ?  213  HIS A ND1   1 
ATOM   1634  C  CD2   . HIS A 1  213  ? 189.832 179.751 241.855 1.00 117.09 ?  213  HIS A CD2   1 
ATOM   1635  C  CE1   . HIS A 1  213  ? 187.788 179.015 241.674 1.00 115.82 ?  213  HIS A CE1   1 
ATOM   1636  N  NE2   . HIS A 1  213  ? 188.954 178.780 242.277 1.00 117.29 ?  213  HIS A NE2   1 
ATOM   1637  N  N     . ILE A 1  214  ? 189.094 184.198 237.754 1.00 107.38 ?  214  ILE A N     1 
ATOM   1638  C  CA    . ILE A 1  214  ? 189.457 185.559 237.329 1.00 107.21 ?  214  ILE A CA    1 
ATOM   1639  C  C     . ILE A 1  214  ? 188.305 186.508 237.712 1.00 113.14 ?  214  ILE A C     1 
ATOM   1640  O  O     . ILE A 1  214  ? 187.139 186.258 237.345 1.00 111.83 ?  214  ILE A O     1 
ATOM   1641  C  CB    . ILE A 1  214  ? 189.872 185.704 235.827 1.00 108.52 ?  214  ILE A CB    1 
ATOM   1642  C  CG1   . ILE A 1  214  ? 190.966 184.690 235.426 1.00 108.94 ?  214  ILE A CG1   1 
ATOM   1643  C  CG2   . ILE A 1  214  ? 190.336 187.137 235.530 1.00 108.52 ?  214  ILE A CG2   1 
ATOM   1644  C  CD1   . ILE A 1  214  ? 191.342 184.656 233.919 1.00 112.52 ?  214  ILE A CD1   1 
ATOM   1645  N  N     . SER A 1  215  ? 188.644 187.561 238.501 1.00 111.58 ?  215  SER A N     1 
ATOM   1646  C  CA    . SER A 1  215  ? 187.717 188.592 238.981 1.00 111.72 ?  215  SER A CA    1 
ATOM   1647  C  C     . SER A 1  215  ? 186.968 189.234 237.834 1.00 112.09 ?  215  SER A C     1 
ATOM   1648  O  O     . SER A 1  215  ? 187.542 189.416 236.760 1.00 109.61 ?  215  SER A O     1 
ATOM   1649  C  CB    . SER A 1  215  ? 188.468 189.669 239.762 1.00 118.19 ?  215  SER A CB    1 
ATOM   1650  O  OG    . SER A 1  215  ? 187.783 190.915 239.751 1.00 129.56 ?  215  SER A OG    1 
ATOM   1651  N  N     . VAL A 1  216  ? 185.697 189.603 238.070 1.00 108.97 ?  216  VAL A N     1 
ATOM   1652  C  CA    . VAL A 1  216  ? 184.864 190.245 237.043 1.00 107.76 ?  216  VAL A CA    1 
ATOM   1653  C  C     . VAL A 1  216  ? 185.529 191.543 236.598 1.00 111.76 ?  216  VAL A C     1 
ATOM   1654  O  O     . VAL A 1  216  ? 185.629 191.786 235.393 1.00 110.21 ?  216  VAL A O     1 
ATOM   1655  C  CB    . VAL A 1  216  ? 183.384 190.441 237.471 1.00 111.44 ?  216  VAL A CB    1 
ATOM   1656  C  CG1   . VAL A 1  216  ? 182.615 191.272 236.448 1.00 109.53 ?  216  VAL A CG1   1 
ATOM   1657  C  CG2   . VAL A 1  216  ? 182.691 189.098 237.706 1.00 111.37 ?  216  VAL A CG2   1 
ATOM   1658  N  N     . LYS A 1  217  ? 186.050 192.322 237.572 1.00 109.18 ?  217  LYS A N     1 
ATOM   1659  C  CA    . LYS A 1  217  ? 186.754 193.581 237.336 1.00 108.65 ?  217  LYS A CA    1 
ATOM   1660  C  C     . LYS A 1  217  ? 187.982 193.336 236.460 1.00 109.38 ?  217  LYS A C     1 
ATOM   1661  O  O     . LYS A 1  217  ? 188.152 194.017 235.443 1.00 106.68 ?  217  LYS A O     1 
ATOM   1662  C  CB    . LYS A 1  217  ? 187.129 194.249 238.674 1.00 113.72 ?  217  LYS A CB    1 
ATOM   1663  C  CG    . LYS A 1  217  ? 185.935 194.732 239.517 1.00 140.91 ?  217  LYS A CG    1 
ATOM   1664  C  CD    . LYS A 1  217  ? 185.163 195.918 238.883 1.00 156.71 ?  217  LYS A CD    1 
ATOM   1665  C  CE    . LYS A 1  217  ? 184.416 196.769 239.892 1.00 171.62 ?  217  LYS A CE    1 
ATOM   1666  N  NZ    . LYS A 1  217  ? 185.305 197.747 240.590 1.00 178.05 1  217  LYS A NZ    1 
ATOM   1667  N  N     . ASP A 1  218  ? 188.781 192.300 236.823 1.00 106.26 ?  218  ASP A N     1 
ATOM   1668  C  CA    . ASP A 1  218  ? 189.979 191.841 236.112 1.00 105.51 ?  218  ASP A CA    1 
ATOM   1669  C  C     . ASP A 1  218  ? 189.628 191.438 234.668 1.00 104.86 ?  218  ASP A C     1 
ATOM   1670  O  O     . ASP A 1  218  ? 190.102 192.083 233.731 1.00 103.52 ?  218  ASP A O     1 
ATOM   1671  C  CB    . ASP A 1  218  ? 190.629 190.632 236.835 1.00 108.90 ?  218  ASP A CB    1 
ATOM   1672  C  CG    . ASP A 1  218  ? 191.493 190.907 238.054 1.00 125.09 ?  218  ASP A CG    1 
ATOM   1673  O  OD1   . ASP A 1  218  ? 191.827 192.090 238.291 1.00 127.63 ?  218  ASP A OD1   1 
ATOM   1674  O  OD2   . ASP A 1  218  ? 191.881 189.925 238.741 1.00 130.56 -1 218  ASP A OD2   1 
ATOM   1675  N  N     . PHE A 1  219  ? 188.781 190.398 234.481 1.00 98.39  ?  219  PHE A N     1 
ATOM   1676  C  CA    . PHE A 1  219  ? 188.432 189.971 233.130 1.00 95.79  ?  219  PHE A CA    1 
ATOM   1677  C  C     . PHE A 1  219  ? 187.774 191.051 232.314 1.00 98.33  ?  219  PHE A C     1 
ATOM   1678  O  O     . PHE A 1  219  ? 187.912 191.038 231.095 1.00 97.52  ?  219  PHE A O     1 
ATOM   1679  C  CB    . PHE A 1  219  ? 187.708 188.609 233.057 1.00 96.81  ?  219  PHE A CB    1 
ATOM   1680  C  CG    . PHE A 1  219  ? 186.236 188.506 233.406 1.00 97.45  ?  219  PHE A CG    1 
ATOM   1681  C  CD1   . PHE A 1  219  ? 185.289 189.289 232.756 1.00 98.30  ?  219  PHE A CD1   1 
ATOM   1682  C  CD2   . PHE A 1  219  ? 185.782 187.523 234.279 1.00 100.13 ?  219  PHE A CD2   1 
ATOM   1683  C  CE1   . PHE A 1  219  ? 183.935 189.173 233.059 1.00 98.68  ?  219  PHE A CE1   1 
ATOM   1684  C  CE2   . PHE A 1  219  ? 184.419 187.397 234.569 1.00 102.19 ?  219  PHE A CE2   1 
ATOM   1685  C  CZ    . PHE A 1  219  ? 183.506 188.222 233.956 1.00 98.56  ?  219  PHE A CZ    1 
ATOM   1686  N  N     . THR A 1  220  ? 187.097 192.007 232.978 1.00 94.41  ?  220  THR A N     1 
ATOM   1687  C  CA    . THR A 1  220  ? 186.471 193.117 232.276 1.00 93.46  ?  220  THR A CA    1 
ATOM   1688  C  C     . THR A 1  220  ? 187.522 194.121 231.795 1.00 98.77  ?  220  THR A C     1 
ATOM   1689  O  O     . THR A 1  220  ? 187.287 194.791 230.787 1.00 97.87  ?  220  THR A O     1 
ATOM   1690  C  CB    . THR A 1  220  ? 185.250 193.652 233.018 1.00 97.60  ?  220  THR A CB    1 
ATOM   1691  O  OG1   . THR A 1  220  ? 184.093 193.545 232.179 1.00 87.72  ?  220  THR A OG1   1 
ATOM   1692  C  CG2   . THR A 1  220  ? 185.447 195.077 233.563 1.00 100.55 ?  220  THR A CG2   1 
ATOM   1693  N  N     . SER A 1  221  ? 188.696 194.181 232.483 1.00 96.62  ?  221  SER A N     1 
ATOM   1694  C  CA    . SER A 1  221  ? 189.839 195.017 232.084 1.00 96.38  ?  221  SER A CA    1 
ATOM   1695  C  C     . SER A 1  221  ? 190.449 194.380 230.838 1.00 98.67  ?  221  SER A C     1 
ATOM   1696  O  O     . SER A 1  221  ? 190.792 195.094 229.899 1.00 97.31  ?  221  SER A O     1 
ATOM   1697  C  CB    . SER A 1  221  ? 190.853 195.132 233.211 1.00 101.33 ?  221  SER A CB    1 
ATOM   1698  O  OG    . SER A 1  221  ? 190.182 195.572 234.380 1.00 112.47 ?  221  SER A OG    1 
ATOM   1699  N  N     . LEU A 1  222  ? 190.461 193.020 230.779 1.00 94.72  ?  222  LEU A N     1 
ATOM   1700  C  CA    . LEU A 1  222  ? 190.807 192.253 229.576 1.00 93.14  ?  222  LEU A CA    1 
ATOM   1701  C  C     . LEU A 1  222  ? 189.559 192.427 228.661 1.00 96.32  ?  222  LEU A C     1 
ATOM   1702  O  O     . LEU A 1  222  ? 188.564 192.991 229.119 1.00 95.60  ?  222  LEU A O     1 
ATOM   1703  C  CB    . LEU A 1  222  ? 191.004 190.762 229.931 1.00 93.05  ?  222  LEU A CB    1 
ATOM   1704  C  CG    . LEU A 1  222  ? 192.301 190.286 230.636 1.00 97.83  ?  222  LEU A CG    1 
ATOM   1705  C  CD1   . LEU A 1  222  ? 193.502 191.166 230.344 1.00 97.61  ?  222  LEU A CD1   1 
ATOM   1706  C  CD2   . LEU A 1  222  ? 192.095 190.082 232.097 1.00 100.34 ?  222  LEU A CD2   1 
ATOM   1707  N  N     . GLY A 1  223  ? 189.593 191.980 227.410 1.00 92.88  ?  223  GLY A N     1 
ATOM   1708  C  CA    . GLY A 1  223  ? 188.440 192.166 226.509 1.00 92.49  ?  223  GLY A CA    1 
ATOM   1709  C  C     . GLY A 1  223  ? 187.018 191.925 227.045 1.00 96.12  ?  223  GLY A C     1 
ATOM   1710  O  O     . GLY A 1  223  ? 186.117 192.763 226.903 1.00 94.71  ?  223  GLY A O     1 
ATOM   1711  N  N     . PHE A 1  224  ? 186.843 190.759 227.677 1.00 92.53  ?  224  PHE A N     1 
ATOM   1712  C  CA    . PHE A 1  224  ? 185.675 190.077 228.253 1.00 91.13  ?  224  PHE A CA    1 
ATOM   1713  C  C     . PHE A 1  224  ? 184.581 190.881 228.882 1.00 91.47  ?  224  PHE A C     1 
ATOM   1714  O  O     . PHE A 1  224  ? 184.841 191.948 229.415 1.00 92.59  ?  224  PHE A O     1 
ATOM   1715  C  CB    . PHE A 1  224  ? 186.146 188.908 229.136 1.00 93.83  ?  224  PHE A CB    1 
ATOM   1716  C  CG    . PHE A 1  224  ? 187.185 188.125 228.376 1.00 94.89  ?  224  PHE A CG    1 
ATOM   1717  C  CD1   . PHE A 1  224  ? 186.810 187.126 227.492 1.00 97.27  ?  224  PHE A CD1   1 
ATOM   1718  C  CD2   . PHE A 1  224  ? 188.525 188.487 228.430 1.00 97.44  ?  224  PHE A CD2   1 
ATOM   1719  C  CE1   . PHE A 1  224  ? 187.762 186.465 226.722 1.00 98.25  ?  224  PHE A CE1   1 
ATOM   1720  C  CE2   . PHE A 1  224  ? 189.468 187.847 227.638 1.00 100.30 ?  224  PHE A CE2   1 
ATOM   1721  C  CZ    . PHE A 1  224  ? 189.085 186.827 226.803 1.00 97.89  ?  224  PHE A CZ    1 
ATOM   1722  N  N     . ASN A 1  225  ? 183.354 190.350 228.817 1.00 84.67  ?  225  ASN A N     1 
ATOM   1723  C  CA    . ASN A 1  225  ? 182.114 190.952 229.306 1.00 83.95  ?  225  ASN A CA    1 
ATOM   1724  C  C     . ASN A 1  225  ? 181.403 189.961 230.230 1.00 88.14  ?  225  ASN A C     1 
ATOM   1725  O  O     . ASN A 1  225  ? 181.083 188.858 229.776 1.00 87.79  ?  225  ASN A O     1 
ATOM   1726  C  CB    . ASN A 1  225  ? 181.240 191.273 228.089 1.00 81.48  ?  225  ASN A CB    1 
ATOM   1727  C  CG    . ASN A 1  225  ? 179.833 191.679 228.397 1.00 98.18  ?  225  ASN A CG    1 
ATOM   1728  O  OD1   . ASN A 1  225  ? 178.956 190.851 228.646 1.00 83.58  ?  225  ASN A OD1   1 
ATOM   1729  N  ND2   . ASN A 1  225  ? 179.581 192.969 228.345 1.00 95.01  ?  225  ASN A ND2   1 
ATOM   1730  N  N     . GLU A 1  226  ? 181.099 190.356 231.494 1.00 84.81  ?  226  GLU A N     1 
ATOM   1731  C  CA    . GLU A 1  226  ? 180.449 189.462 232.472 1.00 85.24  ?  226  GLU A CA    1 
ATOM   1732  C  C     . GLU A 1  226  ? 179.137 188.794 232.076 1.00 88.12  ?  226  GLU A C     1 
ATOM   1733  O  O     . GLU A 1  226  ? 178.770 187.775 232.669 1.00 88.52  ?  226  GLU A O     1 
ATOM   1734  C  CB    . GLU A 1  226  ? 180.359 190.073 233.877 1.00 88.16  ?  226  GLU A CB    1 
ATOM   1735  C  CG    . GLU A 1  226  ? 179.360 191.207 234.058 1.00 101.66 ?  226  GLU A CG    1 
ATOM   1736  C  CD    . GLU A 1  226  ? 178.809 191.432 235.463 1.00 128.29 ?  226  GLU A CD    1 
ATOM   1737  O  OE1   . GLU A 1  226  ? 179.401 190.933 236.453 1.00 103.21 ?  226  GLU A OE1   1 
ATOM   1738  O  OE2   . GLU A 1  226  ? 177.755 192.105 235.561 1.00 142.96 -1 226  GLU A OE2   1 
ATOM   1739  N  N     . VAL A 1  227  ? 178.443 189.349 231.082 1.00 82.91  ?  227  VAL A N     1 
ATOM   1740  C  CA    . VAL A 1  227  ? 177.153 188.833 230.654 1.00 81.79  ?  227  VAL A CA    1 
ATOM   1741  C  C     . VAL A 1  227  ? 177.255 187.926 229.473 1.00 86.13  ?  227  VAL A C     1 
ATOM   1742  O  O     . VAL A 1  227  ? 176.787 186.795 229.546 1.00 85.03  ?  227  VAL A O     1 
ATOM   1743  C  CB    . VAL A 1  227  ? 176.158 189.966 230.347 1.00 84.69  ?  227  VAL A CB    1 
ATOM   1744  C  CG1   . VAL A 1  227  ? 174.729 189.505 230.601 1.00 84.33  ?  227  VAL A CG1   1 
ATOM   1745  C  CG2   . VAL A 1  227  ? 176.490 191.237 231.130 1.00 85.31  ?  227  VAL A CG2   1 
ATOM   1746  N  N     . PHE A 1  228  ? 177.802 188.459 228.357 1.00 84.16  ?  228  PHE A N     1 
ATOM   1747  C  CA    . PHE A 1  228  ? 177.906 187.831 227.034 1.00 83.44  ?  228  PHE A CA    1 
ATOM   1748  C  C     . PHE A 1  228  ? 179.179 187.092 226.707 1.00 86.92  ?  228  PHE A C     1 
ATOM   1749  O  O     . PHE A 1  228  ? 179.121 186.254 225.809 1.00 87.18  ?  228  PHE A O     1 
ATOM   1750  C  CB    . PHE A 1  228  ? 177.631 188.850 225.923 1.00 84.48  ?  228  PHE A CB    1 
ATOM   1751  C  CG    . PHE A 1  228  ? 176.419 189.706 226.155 1.00 85.96  ?  228  PHE A CG    1 
ATOM   1752  C  CD1   . PHE A 1  228  ? 175.142 189.159 226.111 1.00 89.29  ?  228  PHE A CD1   1 
ATOM   1753  C  CD2   . PHE A 1  228  ? 176.546 191.059 226.395 1.00 87.93  ?  228  PHE A CD2   1 
ATOM   1754  C  CE1   . PHE A 1  228  ? 174.019 189.951 226.322 1.00 89.86  ?  228  PHE A CE1   1 
ATOM   1755  C  CE2   . PHE A 1  228  ? 175.423 191.850 226.598 1.00 91.10  ?  228  PHE A CE2   1 
ATOM   1756  C  CZ    . PHE A 1  228  ? 174.167 191.289 226.565 1.00 89.06  ?  228  PHE A CZ    1 
ATOM   1757  N  N     . SER A 1  229  ? 180.325 187.405 227.362 1.00 81.80  ?  229  SER A N     1 
ATOM   1758  C  CA    . SER A 1  229  ? 181.569 186.692 227.084 1.00 81.01  ?  229  SER A CA    1 
ATOM   1759  C  C     . SER A 1  229  ? 182.628 186.635 228.203 1.00 84.53  ?  229  SER A C     1 
ATOM   1760  O  O     . SER A 1  229  ? 183.638 187.339 228.148 1.00 84.36  ?  229  SER A O     1 
ATOM   1761  C  CB    . SER A 1  229  ? 182.163 187.083 225.735 1.00 84.34  ?  229  SER A CB    1 
ATOM   1762  O  OG    . SER A 1  229  ? 182.752 188.369 225.797 1.00 98.60  ?  229  SER A OG    1 
ATOM   1763  N  N     . ARG A 1  230  ? 182.398 185.760 229.199 1.00 80.29  ?  230  ARG A N     1 
ATOM   1764  C  CA    . ARG A 1  230  ? 183.322 185.457 230.290 1.00 80.58  ?  230  ARG A CA    1 
ATOM   1765  C  C     . ARG A 1  230  ? 184.452 184.621 229.684 1.00 85.88  ?  230  ARG A C     1 
ATOM   1766  O  O     . ARG A 1  230  ? 184.160 183.808 228.807 1.00 85.77  ?  230  ARG A O     1 
ATOM   1767  C  CB    . ARG A 1  230  ? 182.601 184.649 231.371 1.00 79.82  ?  230  ARG A CB    1 
ATOM   1768  C  CG    . ARG A 1  230  ? 181.714 185.516 232.248 1.00 92.05  ?  230  ARG A CG    1 
ATOM   1769  C  CD    . ARG A 1  230  ? 180.933 184.728 233.276 1.00 103.39 ?  230  ARG A CD    1 
ATOM   1770  N  NE    . ARG A 1  230  ? 180.412 185.601 234.326 1.00 114.57 ?  230  ARG A NE    1 
ATOM   1771  C  CZ    . ARG A 1  230  ? 181.017 185.804 235.490 1.00 135.30 ?  230  ARG A CZ    1 
ATOM   1772  N  NH1   . ARG A 1  230  ? 182.154 185.177 235.775 1.00 127.07 1  230  ARG A NH1   1 
ATOM   1773  N  NH2   . ARG A 1  230  ? 180.483 186.622 236.388 1.00 126.02 ?  230  ARG A NH2   1 
ATOM   1774  N  N     . PRO A 1  231  ? 185.733 184.781 230.086 1.00 83.88  ?  231  PRO A N     1 
ATOM   1775  C  CA    . PRO A 1  231  ? 186.807 183.965 229.468 1.00 84.18  ?  231  PRO A CA    1 
ATOM   1776  C  C     . PRO A 1  231  ? 186.662 182.458 229.656 1.00 89.85  ?  231  PRO A C     1 
ATOM   1777  O  O     . PRO A 1  231  ? 187.122 181.697 228.800 1.00 87.75  ?  231  PRO A O     1 
ATOM   1778  C  CB    . PRO A 1  231  ? 188.095 184.485 230.105 1.00 86.88  ?  231  PRO A CB    1 
ATOM   1779  C  CG    . PRO A 1  231  ? 187.717 185.721 230.814 1.00 91.79  ?  231  PRO A CG    1 
ATOM   1780  C  CD    . PRO A 1  231  ? 186.266 185.682 231.120 1.00 86.72  ?  231  PRO A CD    1 
ATOM   1781  N  N     . GLU A 1  232  ? 185.979 182.029 230.750 1.00 89.56  ?  232  GLU A N     1 
ATOM   1782  C  CA    . GLU A 1  232  ? 185.699 180.615 231.033 1.00 90.38  ?  232  GLU A CA    1 
ATOM   1783  C  C     . GLU A 1  232  ? 184.951 179.940 229.881 1.00 95.15  ?  232  GLU A C     1 
ATOM   1784  O  O     . GLU A 1  232  ? 185.109 178.735 229.699 1.00 95.72  ?  232  GLU A O     1 
ATOM   1785  C  CB    . GLU A 1  232  ? 184.990 180.386 232.394 1.00 92.55  ?  232  GLU A CB    1 
ATOM   1786  C  CG    . GLU A 1  232  ? 183.839 181.327 232.720 1.00 102.89 ?  232  GLU A CG    1 
ATOM   1787  C  CD    . GLU A 1  232  ? 184.141 182.375 233.781 1.00 130.65 ?  232  GLU A CD    1 
ATOM   1788  O  OE1   . GLU A 1  232  ? 184.970 183.277 233.517 1.00 123.35 ?  232  GLU A OE1   1 
ATOM   1789  O  OE2   . GLU A 1  232  ? 183.523 182.313 234.869 1.00 128.63 -1 232  GLU A OE2   1 
ATOM   1790  N  N     . TRP A 1  233  ? 184.216 180.732 229.059 1.00 91.15  ?  233  TRP A N     1 
ATOM   1791  C  CA    . TRP A 1  233  ? 183.418 180.264 227.912 1.00 90.16  ?  233  TRP A CA    1 
ATOM   1792  C  C     . TRP A 1  233  ? 184.166 179.996 226.597 1.00 89.41  ?  233  TRP A C     1 
ATOM   1793  O  O     . TRP A 1  233  ? 183.542 179.566 225.610 1.00 87.36  ?  233  TRP A O     1 
ATOM   1794  C  CB    . TRP A 1  233  ? 182.218 181.178 227.678 1.00 89.20  ?  233  TRP A CB    1 
ATOM   1795  C  CG    . TRP A 1  233  ? 181.321 181.319 228.865 1.00 91.63  ?  233  TRP A CG    1 
ATOM   1796  C  CD1   . TRP A 1  233  ? 181.122 180.413 229.863 1.00 95.65  ?  233  TRP A CD1   1 
ATOM   1797  C  CD2   . TRP A 1  233  ? 180.429 182.397 229.119 1.00 91.75  ?  233  TRP A CD2   1 
ATOM   1798  N  NE1   . TRP A 1  233  ? 180.195 180.887 230.752 1.00 95.88  ?  233  TRP A NE1   1 
ATOM   1799  C  CE2   . TRP A 1  233  ? 179.759 182.112 230.326 1.00 96.98  ?  233  TRP A CE2   1 
ATOM   1800  C  CE3   . TRP A 1  233  ? 180.121 183.583 228.439 1.00 92.72  ?  233  TRP A CE3   1 
ATOM   1801  C  CZ2   . TRP A 1  233  ? 178.819 182.986 230.882 1.00 97.07  ?  233  TRP A CZ2   1 
ATOM   1802  C  CZ3   . TRP A 1  233  ? 179.206 184.460 229.002 1.00 94.80  ?  233  TRP A CZ3   1 
ATOM   1803  C  CH2   . TRP A 1  233  ? 178.562 184.158 230.206 1.00 96.52  ?  233  TRP A CH2   1 
ATOM   1804  N  N     . MET A 1  234  ? 185.497 180.235 226.589 1.00 83.62  ?  234  MET A N     1 
ATOM   1805  C  CA    . MET A 1  234  ? 186.344 179.965 225.426 1.00 81.73  ?  234  MET A CA    1 
ATOM   1806  C  C     . MET A 1  234  ? 186.671 178.463 225.427 1.00 86.85  ?  234  MET A C     1 
ATOM   1807  O  O     . MET A 1  234  ? 187.108 177.913 224.411 1.00 85.85  ?  234  MET A O     1 
ATOM   1808  C  CB    . MET A 1  234  ? 187.630 180.812 225.454 1.00 83.56  ?  234  MET A CB    1 
ATOM   1809  C  CG    . MET A 1  234  ? 187.381 182.295 225.514 1.00 85.96  ?  234  MET A CG    1 
ATOM   1810  S  SD    . MET A 1  234  ? 188.802 183.272 224.995 1.00 89.76  ?  234  MET A SD    1 
ATOM   1811  C  CE    . MET A 1  234  ? 189.775 183.262 226.440 1.00 88.22  ?  234  MET A CE    1 
ATOM   1812  N  N     . ILE A 1  235  ? 186.447 177.806 226.592 1.00 84.68  ?  235  ILE A N     1 
ATOM   1813  C  CA    . ILE A 1  235  ? 186.638 176.374 226.828 1.00 84.66  ?  235  ILE A CA    1 
ATOM   1814  C  C     . ILE A 1  235  ? 185.258 175.709 226.792 1.00 88.35  ?  235  ILE A C     1 
ATOM   1815  O  O     . ILE A 1  235  ? 184.327 176.152 227.469 1.00 88.21  ?  235  ILE A O     1 
ATOM   1816  C  CB    . ILE A 1  235  ? 187.437 176.102 228.134 1.00 88.59  ?  235  ILE A CB    1 
ATOM   1817  C  CG1   . ILE A 1  235  ? 188.894 176.623 228.001 1.00 88.69  ?  235  ILE A CG1   1 
ATOM   1818  C  CG2   . ILE A 1  235  ? 187.431 174.618 228.472 1.00 89.87  ?  235  ILE A CG2   1 
ATOM   1819  C  CD1   . ILE A 1  235  ? 189.545 177.100 229.292 1.00 91.80  ?  235  ILE A CD1   1 
ATOM   1820  N  N     . LEU A 1  236  ? 185.134 174.664 225.974 1.00 84.47  ?  236  LEU A N     1 
ATOM   1821  C  CA    . LEU A 1  236  ? 183.882 173.958 225.736 1.00 83.53  ?  236  LEU A CA    1 
ATOM   1822  C  C     . LEU A 1  236  ? 183.661 172.733 226.620 1.00 88.47  ?  236  LEU A C     1 
ATOM   1823  O  O     . LEU A 1  236  ? 184.516 171.849 226.711 1.00 88.71  ?  236  LEU A O     1 
ATOM   1824  C  CB    . LEU A 1  236  ? 183.757 173.618 224.247 1.00 82.20  ?  236  LEU A CB    1 
ATOM   1825  C  CG    . LEU A 1  236  ? 184.357 174.649 223.281 1.00 85.84  ?  236  LEU A CG    1 
ATOM   1826  C  CD1   . LEU A 1  236  ? 184.529 174.065 221.915 1.00 85.74  ?  236  LEU A CD1   1 
ATOM   1827  C  CD2   . LEU A 1  236  ? 183.545 175.945 223.236 1.00 86.38  ?  236  LEU A CD2   1 
ATOM   1828  N  N     . THR A 1  237  ? 182.498 172.717 227.285 1.00 84.80  ?  237  THR A N     1 
ATOM   1829  C  CA    . THR A 1  237  ? 182.039 171.662 228.183 1.00 85.17  ?  237  THR A CA    1 
ATOM   1830  C  C     . THR A 1  237  ? 180.802 171.030 227.550 1.00 88.68  ?  237  THR A C     1 
ATOM   1831  O  O     . THR A 1  237  ? 180.701 169.811 227.416 1.00 88.96  ?  237  THR A O     1 
ATOM   1832  C  CB    . THR A 1  237  ? 181.615 172.285 229.511 1.00 91.88  ?  237  THR A CB    1 
ATOM   1833  O  OG1   . THR A 1  237  ? 182.399 173.442 229.768 1.00 93.88  ?  237  THR A OG1   1 
ATOM   1834  C  CG2   . THR A 1  237  ? 181.659 171.304 230.666 1.00 91.02  ?  237  THR A CG2   1 
ATOM   1835  N  N     . CYS A 1  238  ? 179.846 171.875 227.193 1.00 83.94  ?  238  CYS A N     1 
ATOM   1836  C  CA    . CYS A 1  238  ? 178.605 171.432 226.616 1.00 83.08  ?  238  CYS A CA    1 
ATOM   1837  C  C     . CYS A 1  238  ? 178.600 171.947 225.189 1.00 84.29  ?  238  CYS A C     1 
ATOM   1838  O  O     . CYS A 1  238  ? 178.574 173.171 224.972 1.00 84.11  ?  238  CYS A O     1 
ATOM   1839  C  CB    . CYS A 1  238  ? 177.443 171.980 227.433 1.00 84.17  ?  238  CYS A CB    1 
ATOM   1840  S  SG    . CYS A 1  238  ? 175.825 171.380 226.912 1.00 87.85  ?  238  CYS A SG    1 
ATOM   1841  N  N     . LEU A 1  239  ? 178.736 171.014 224.219 1.00 77.53  ?  239  LEU A N     1 
ATOM   1842  C  CA    . LEU A 1  239  ? 178.820 171.348 222.805 1.00 74.59  ?  239  LEU A CA    1 
ATOM   1843  C  C     . LEU A 1  239  ? 177.459 171.435 222.115 1.00 78.63  ?  239  LEU A C     1 
ATOM   1844  O  O     . LEU A 1  239  ? 176.726 170.434 222.117 1.00 78.95  ?  239  LEU A O     1 
ATOM   1845  C  CB    . LEU A 1  239  ? 179.755 170.380 222.066 1.00 73.80  ?  239  LEU A CB    1 
ATOM   1846  C  CG    . LEU A 1  239  ? 179.899 170.602 220.564 1.00 77.23  ?  239  LEU A CG    1 
ATOM   1847  C  CD1   . LEU A 1  239  ? 180.763 171.803 220.268 1.00 77.47  ?  239  LEU A CD1   1 
ATOM   1848  C  CD2   . LEU A 1  239  ? 180.533 169.438 219.917 1.00 78.88  ?  239  LEU A CD2   1 
ATOM   1849  N  N     . PRO A 1  240  ? 177.108 172.597 221.478 1.00 73.65  ?  240  PRO A N     1 
ATOM   1850  C  CA    . PRO A 1  240  ? 175.827 172.660 220.744 1.00 71.81  ?  240  PRO A CA    1 
ATOM   1851  C  C     . PRO A 1  240  ? 175.835 171.786 219.491 1.00 72.94  ?  240  PRO A C     1 
ATOM   1852  O  O     . PRO A 1  240  ? 176.836 171.720 218.727 1.00 72.18  ?  240  PRO A O     1 
ATOM   1853  C  CB    . PRO A 1  240  ? 175.650 174.150 220.407 1.00 72.55  ?  240  PRO A CB    1 
ATOM   1854  C  CG    . PRO A 1  240  ? 177.022 174.699 220.403 1.00 77.62  ?  240  PRO A CG    1 
ATOM   1855  C  CD    . PRO A 1  240  ? 177.854 173.874 221.373 1.00 74.52  ?  240  PRO A CD    1 
ATOM   1856  N  N     . VAL A 1  241  ? 174.698 171.101 219.309 1.00 66.64  ?  241  VAL A N     1 
ATOM   1857  C  CA    . VAL A 1  241  ? 174.428 170.245 218.170 1.00 65.26  ?  241  VAL A CA    1 
ATOM   1858  C  C     . VAL A 1  241  ? 173.541 170.999 217.136 1.00 68.95  ?  241  VAL A C     1 
ATOM   1859  O  O     . VAL A 1  241  ? 172.333 171.183 217.374 1.00 69.03  ?  241  VAL A O     1 
ATOM   1860  C  CB    . VAL A 1  241  ? 173.819 168.887 218.599 1.00 69.21  ?  241  VAL A CB    1 
ATOM   1861  C  CG1   . VAL A 1  241  ? 173.435 168.050 217.387 1.00 68.09  ?  241  VAL A CG1   1 
ATOM   1862  C  CG2   . VAL A 1  241  ? 174.775 168.113 219.501 1.00 70.27  ?  241  VAL A CG2   1 
ATOM   1863  N  N     . PRO A 1  242  ? 174.118 171.446 215.988 1.00 63.90  ?  242  PRO A N     1 
ATOM   1864  C  CA    . PRO A 1  242  ? 173.297 172.121 214.975 1.00 62.52  ?  242  PRO A CA    1 
ATOM   1865  C  C     . PRO A 1  242  ? 172.240 171.203 214.363 1.00 67.65  ?  242  PRO A C     1 
ATOM   1866  O  O     . PRO A 1  242  ? 172.449 169.995 214.175 1.00 66.67  ?  242  PRO A O     1 
ATOM   1867  C  CB    . PRO A 1  242  ? 174.306 172.613 213.946 1.00 63.11  ?  242  PRO A CB    1 
ATOM   1868  C  CG    . PRO A 1  242  ? 175.463 171.805 214.149 1.00 68.39  ?  242  PRO A CG    1 
ATOM   1869  C  CD    . PRO A 1  242  ? 175.521 171.365 215.561 1.00 65.11  ?  242  PRO A CD    1 
ATOM   1870  N  N     . PRO A 1  243  ? 171.057 171.786 214.125 1.00 65.81  ?  243  PRO A N     1 
ATOM   1871  C  CA    . PRO A 1  243  ? 169.941 171.001 213.582 1.00 66.73  ?  243  PRO A CA    1 
ATOM   1872  C  C     . PRO A 1  243  ? 170.118 170.631 212.122 1.00 74.10  ?  243  PRO A C     1 
ATOM   1873  O  O     . PRO A 1  243  ? 170.816 171.351 211.407 1.00 75.44  ?  243  PRO A O     1 
ATOM   1874  C  CB    . PRO A 1  243  ? 168.769 171.955 213.706 1.00 67.74  ?  243  PRO A CB    1 
ATOM   1875  C  CG    . PRO A 1  243  ? 169.401 173.323 213.621 1.00 70.83  ?  243  PRO A CG    1 
ATOM   1876  C  CD    . PRO A 1  243  ? 170.674 173.195 214.349 1.00 66.70  ?  243  PRO A CD    1 
ATOM   1877  N  N     . PRO A 1  244  ? 169.395 169.603 211.636 1.00 70.93  ?  244  PRO A N     1 
ATOM   1878  C  CA    . PRO A 1  244  ? 169.493 169.225 210.219 1.00 70.16  ?  244  PRO A CA    1 
ATOM   1879  C  C     . PRO A 1  244  ? 169.533 170.348 209.175 1.00 72.46  ?  244  PRO A C     1 
ATOM   1880  O  O     . PRO A 1  244  ? 170.430 170.281 208.341 1.00 72.06  ?  244  PRO A O     1 
ATOM   1881  C  CB    . PRO A 1  244  ? 168.317 168.274 210.041 1.00 72.30  ?  244  PRO A CB    1 
ATOM   1882  C  CG    . PRO A 1  244  ? 168.252 167.577 211.351 1.00 77.72  ?  244  PRO A CG    1 
ATOM   1883  C  CD    . PRO A 1  244  ? 168.511 168.670 212.362 1.00 73.54  ?  244  PRO A CD    1 
ATOM   1884  N  N     . PRO A 1  245  ? 168.715 171.423 209.221 1.00 68.01  ?  245  PRO A N     1 
ATOM   1885  C  CA    . PRO A 1  245  ? 168.816 172.475 208.181 1.00 67.46  ?  245  PRO A CA    1 
ATOM   1886  C  C     . PRO A 1  245  ? 170.191 173.036 207.849 1.00 70.87  ?  245  PRO A C     1 
ATOM   1887  O  O     . PRO A 1  245  ? 170.369 173.610 206.761 1.00 70.35  ?  245  PRO A O     1 
ATOM   1888  C  CB    . PRO A 1  245  ? 167.898 173.565 208.703 1.00 69.81  ?  245  PRO A CB    1 
ATOM   1889  C  CG    . PRO A 1  245  ? 166.842 172.809 209.411 1.00 75.47  ?  245  PRO A CG    1 
ATOM   1890  C  CD    . PRO A 1  245  ? 167.564 171.675 210.102 1.00 70.78  ?  245  PRO A CD    1 
ATOM   1891  N  N     . VAL A 1  246  ? 171.142 172.857 208.787 1.00 67.52  ?  246  VAL A N     1 
ATOM   1892  C  CA    . VAL A 1  246  ? 172.546 173.272 208.736 1.00 67.39  ?  246  VAL A CA    1 
ATOM   1893  C  C     . VAL A 1  246  ? 173.403 172.180 208.082 1.00 73.40  ?  246  VAL A C     1 
ATOM   1894  O  O     . VAL A 1  246  ? 174.357 172.496 207.372 1.00 73.72  ?  246  VAL A O     1 
ATOM   1895  C  CB    . VAL A 1  246  ? 173.048 173.598 210.165 1.00 71.48  ?  246  VAL A CB    1 
ATOM   1896  C  CG1   . VAL A 1  246  ? 174.460 174.182 210.150 1.00 71.20  ?  246  VAL A CG1   1 
ATOM   1897  C  CG2   . VAL A 1  246  ? 172.091 174.549 210.868 1.00 71.43  ?  246  VAL A CG2   1 
ATOM   1898  N  N     . ARG A 1  247  ? 173.072 170.904 208.334 1.00 70.57  ?  247  ARG A N     1 
ATOM   1899  C  CA    . ARG A 1  247  ? 173.790 169.743 207.811 1.00 71.15  ?  247  ARG A CA    1 
ATOM   1900  C  C     . ARG A 1  247  ? 172.806 168.735 207.113 1.00 82.11  ?  247  ARG A C     1 
ATOM   1901  O  O     . ARG A 1  247  ? 172.704 167.550 207.521 1.00 84.07  ?  247  ARG A O     1 
ATOM   1902  C  CB    . ARG A 1  247  ? 174.597 169.092 208.948 1.00 66.96  ?  247  ARG A CB    1 
ATOM   1903  C  CG    . ARG A 1  247  ? 173.808 168.950 210.248 1.00 63.70  ?  247  ARG A CG    1 
ATOM   1904  C  CD    . ARG A 1  247  ? 174.567 168.207 211.329 1.00 59.03  ?  247  ARG A CD    1 
ATOM   1905  N  NE    . ARG A 1  247  ? 173.720 168.047 212.510 1.00 68.00  ?  247  ARG A NE    1 
ATOM   1906  C  CZ    . ARG A 1  247  ? 172.797 167.099 212.646 1.00 91.31  ?  247  ARG A CZ    1 
ATOM   1907  N  NH1   . ARG A 1  247  ? 172.594 166.213 211.677 1.00 82.51  1  247  ARG A NH1   1 
ATOM   1908  N  NH2   . ARG A 1  247  ? 172.078 167.020 213.758 1.00 82.93  ?  247  ARG A NH2   1 
ATOM   1909  N  N     . PRO A 1  248  ? 172.065 169.177 206.057 1.00 80.26  ?  248  PRO A N     1 
ATOM   1910  C  CA    . PRO A 1  248  ? 171.105 168.273 205.424 1.00 81.91  ?  248  PRO A CA    1 
ATOM   1911  C  C     . PRO A 1  248  ? 171.762 167.107 204.722 1.00 94.70  ?  248  PRO A C     1 
ATOM   1912  O  O     . PRO A 1  248  ? 172.926 167.202 204.323 1.00 94.46  ?  248  PRO A O     1 
ATOM   1913  C  CB    . PRO A 1  248  ? 170.391 169.177 204.421 1.00 81.98  ?  248  PRO A CB    1 
ATOM   1914  C  CG    . PRO A 1  248  ? 171.379 170.193 204.093 1.00 85.05  ?  248  PRO A CG    1 
ATOM   1915  C  CD    . PRO A 1  248  ? 172.036 170.492 205.395 1.00 80.74  ?  248  PRO A CD    1 
ATOM   1916  N  N     . SER A 1  249  ? 171.000 166.011 204.576 1.00 97.87  ?  249  SER A N     1 
ATOM   1917  C  CA    . SER A 1  249  ? 171.443 164.826 203.858 1.00 100.85 ?  249  SER A CA    1 
ATOM   1918  C  C     . SER A 1  249  ? 171.020 164.939 202.408 1.00 111.90 ?  249  SER A C     1 
ATOM   1919  O  O     . SER A 1  249  ? 169.921 165.425 202.120 1.00 111.02 ?  249  SER A O     1 
ATOM   1920  C  CB    . SER A 1  249  ? 170.855 163.560 204.473 1.00 105.05 ?  249  SER A CB    1 
ATOM   1921  O  OG    . SER A 1  249  ? 169.478 163.395 204.177 1.00 114.63 ?  249  SER A OG    1 
ATOM   1922  N  N     . ILE A 1  250  ? 171.891 164.502 201.496 1.00 115.23 ?  250  ILE A N     1 
ATOM   1923  C  CA    . ILE A 1  250  ? 171.567 164.461 200.072 1.00 118.02 ?  250  ILE A CA    1 
ATOM   1924  C  C     . ILE A 1  250  ? 170.938 163.056 199.818 1.00 134.36 ?  250  ILE A C     1 
ATOM   1925  O  O     . ILE A 1  250  ? 171.634 162.077 199.505 1.00 135.35 ?  250  ILE A O     1 
ATOM   1926  C  CB    . ILE A 1  250  ? 172.763 164.903 199.178 1.00 119.38 ?  250  ILE A CB    1 
ATOM   1927  C  CG1   . ILE A 1  250  ? 173.185 166.374 199.494 1.00 118.32 ?  250  ILE A CG1   1 
ATOM   1928  C  CG2   . ILE A 1  250  ? 172.489 164.691 197.680 1.00 118.87 ?  250  ILE A CG2   1 
ATOM   1929  C  CD1   . ILE A 1  250  ? 172.006 167.481 199.750 1.00 116.01 ?  250  ILE A CD1   1 
ATOM   1930  N  N     . SER A 1  251  ? 169.600 162.977 200.082 1.00 137.95 ?  251  SER A N     1 
ATOM   1931  C  CA    . SER A 1  251  ? 168.716 161.797 200.070 1.00 141.25 ?  251  SER A CA    1 
ATOM   1932  C  C     . SER A 1  251  ? 168.438 161.136 198.689 1.00 152.93 ?  251  SER A C     1 
ATOM   1933  O  O     . SER A 1  251  ? 167.263 160.941 198.330 1.00 152.73 ?  251  SER A O     1 
ATOM   1934  C  CB    . SER A 1  251  ? 167.407 162.107 200.802 1.00 144.46 ?  251  SER A CB    1 
ATOM   1935  O  OG    . SER A 1  251  ? 167.571 162.920 201.954 1.00 151.61 ?  251  SER A OG    1 
ATOM   1936  N  N     . PHE A 1  252  ? 169.522 160.743 197.947 1.00 154.86 ?  252  PHE A N     1 
ATOM   1937  C  CA    . PHE A 1  252  ? 169.441 160.077 196.626 1.00 156.71 ?  252  PHE A CA    1 
ATOM   1938  C  C     . PHE A 1  252  ? 168.567 158.817 196.659 1.00 166.90 ?  252  PHE A C     1 
ATOM   1939  O  O     . PHE A 1  252  ? 168.643 158.042 197.621 1.00 168.12 ?  252  PHE A O     1 
ATOM   1940  C  CB    . PHE A 1  252  ? 170.831 159.749 196.006 1.00 158.19 ?  252  PHE A CB    1 
ATOM   1941  C  CG    . PHE A 1  252  ? 172.023 159.718 196.932 1.00 159.31 ?  252  PHE A CG    1 
ATOM   1942  C  CD1   . PHE A 1  252  ? 172.173 158.701 197.867 1.00 162.10 ?  252  PHE A CD1   1 
ATOM   1943  C  CD2   . PHE A 1  252  ? 173.015 160.687 196.846 1.00 160.95 ?  252  PHE A CD2   1 
ATOM   1944  C  CE1   . PHE A 1  252  ? 173.269 158.680 198.731 1.00 163.07 ?  252  PHE A CE1   1 
ATOM   1945  C  CE2   . PHE A 1  252  ? 174.120 160.656 197.700 1.00 163.68 ?  252  PHE A CE2   1 
ATOM   1946  C  CZ    . PHE A 1  252  ? 174.243 159.647 198.629 1.00 162.04 ?  252  PHE A CZ    1 
ATOM   1947  N  N     . ASN A 1  253  ? 167.705 158.645 195.621 1.00 165.60 ?  253  ASN A N     1 
ATOM   1948  C  CA    . ASN A 1  253  ? 166.797 157.498 195.457 1.00 166.43 ?  253  ASN A CA    1 
ATOM   1949  C  C     . ASN A 1  253  ? 165.820 157.392 196.677 1.00 171.77 ?  253  ASN A C     1 
ATOM   1950  O  O     . ASN A 1  253  ? 165.428 158.438 197.218 1.00 170.76 ?  253  ASN A O     1 
ATOM   1951  C  CB    . ASN A 1  253  ? 167.628 156.207 195.174 1.00 165.57 ?  253  ASN A CB    1 
ATOM   1952  C  CG    . ASN A 1  253  ? 168.771 156.409 194.180 1.00 174.14 ?  253  ASN A CG    1 
ATOM   1953  O  OD1   . ASN A 1  253  ? 168.570 156.661 192.983 1.00 163.49 ?  253  ASN A OD1   1 
ATOM   1954  N  ND2   . ASN A 1  253  ? 170.002 156.358 194.667 1.00 163.31 ?  253  ASN A ND2   1 
ATOM   1955  N  N     . GLU A 1  254  ? 165.430 156.168 197.105 1.00 169.79 ?  254  GLU A N     1 
ATOM   1956  C  CA    . GLU A 1  254  ? 164.557 155.983 198.273 1.00 170.05 ?  254  GLU A CA    1 
ATOM   1957  C  C     . GLU A 1  254  ? 165.389 155.566 199.503 1.00 173.58 ?  254  GLU A C     1 
ATOM   1958  O  O     . GLU A 1  254  ? 165.607 156.404 200.390 1.00 172.59 ?  254  GLU A O     1 
ATOM   1959  C  CB    . GLU A 1  254  ? 163.352 155.043 197.973 1.00 171.98 ?  254  GLU A CB    1 
ATOM   1960  C  CG    . GLU A 1  254  ? 162.516 154.587 199.169 1.00 182.58 ?  254  GLU A CG    1 
ATOM   1961  C  CD    . GLU A 1  254  ? 162.138 155.622 200.216 1.00 201.98 ?  254  GLU A CD    1 
ATOM   1962  O  OE1   . GLU A 1  254  ? 161.624 156.699 199.836 1.00 194.85 ?  254  GLU A OE1   1 
ATOM   1963  O  OE2   . GLU A 1  254  ? 162.364 155.355 201.419 1.00 195.02 -1 254  GLU A OE2   1 
ATOM   1964  N  N     . SER A 1  255  ? 165.869 154.292 199.537 1.00 170.08 ?  255  SER A N     1 
ATOM   1965  C  CA    . SER A 1  255  ? 166.687 153.751 200.630 1.00 169.67 ?  255  SER A CA    1 
ATOM   1966  C  C     . SER A 1  255  ? 168.221 153.890 200.382 1.00 170.95 ?  255  SER A C     1 
ATOM   1967  O  O     . SER A 1  255  ? 168.919 152.929 200.017 1.00 171.46 ?  255  SER A O     1 
ATOM   1968  C  CB    . SER A 1  255  ? 166.228 152.348 201.049 1.00 173.83 ?  255  SER A CB    1 
ATOM   1969  O  OG    . SER A 1  255  ? 167.006 151.279 200.531 1.00 181.66 ?  255  SER A OG    1 
ATOM   1970  N  N     . GLN A 1  256  ? 168.708 155.145 200.562 1.00 163.45 ?  256  GLN A N     1 
ATOM   1971  C  CA    . GLN A 1  256  ? 170.097 155.606 200.434 1.00 161.16 ?  256  GLN A CA    1 
ATOM   1972  C  C     . GLN A 1  256  ? 170.228 156.943 201.211 1.00 158.81 ?  256  GLN A C     1 
ATOM   1973  O  O     . GLN A 1  256  ? 169.468 157.882 200.942 1.00 157.75 ?  256  GLN A O     1 
ATOM   1974  C  CB    . GLN A 1  256  ? 170.491 155.765 198.949 1.00 162.35 ?  256  GLN A CB    1 
ATOM   1975  C  CG    . GLN A 1  256  ? 171.487 154.726 198.430 1.00 180.71 ?  256  GLN A CG    1 
ATOM   1976  C  CD    . GLN A 1  256  ? 171.657 154.801 196.928 1.00 199.79 ?  256  GLN A CD    1 
ATOM   1977  O  OE1   . GLN A 1  256  ? 170.996 154.082 196.173 1.00 195.54 ?  256  GLN A OE1   1 
ATOM   1978  N  NE2   . GLN A 1  256  ? 172.532 155.685 196.452 1.00 190.46 ?  256  GLN A NE2   1 
ATOM   1979  N  N     . ARG A 1  257  ? 171.155 156.990 202.210 1.00 150.82 ?  257  ARG A N     1 
ATOM   1980  C  CA    . ARG A 1  257  ? 171.429 158.128 203.118 1.00 147.39 ?  257  ARG A CA    1 
ATOM   1981  C  C     . ARG A 1  257  ? 171.894 159.436 202.398 1.00 140.27 ?  257  ARG A C     1 
ATOM   1982  O  O     . ARG A 1  257  ? 171.057 160.162 201.856 1.00 139.24 ?  257  ARG A O     1 
ATOM   1983  C  CB    . ARG A 1  257  ? 172.406 157.704 204.258 1.00 150.47 ?  257  ARG A CB    1 
ATOM   1984  C  CG    . ARG A 1  257  ? 171.779 157.478 205.647 1.00 165.67 ?  257  ARG A CG    1 
ATOM   1985  C  CD    . ARG A 1  257  ? 172.734 156.734 206.588 1.00 181.61 ?  257  ARG A CD    1 
ATOM   1986  N  NE    . ARG A 1  257  ? 172.224 156.619 207.964 1.00 192.75 ?  257  ARG A NE    1 
ATOM   1987  C  CZ    . ARG A 1  257  ? 172.744 155.825 208.903 1.00 203.43 ?  257  ARG A CZ    1 
ATOM   1988  N  NH1   . ARG A 1  257  ? 173.788 155.052 208.629 1.00 189.29 1  257  ARG A NH1   1 
ATOM   1989  N  NH2   . ARG A 1  257  ? 172.211 155.788 210.119 1.00 185.89 ?  257  ARG A NH2   1 
ATOM   1990  N  N     . GLY A 1  258  ? 173.205 159.710 202.418 1.00 128.22 ?  258  GLY A N     1 
ATOM   1991  C  CA    . GLY A 1  258  ? 173.829 160.896 201.839 1.00 122.92 ?  258  GLY A CA    1 
ATOM   1992  C  C     . GLY A 1  258  ? 174.111 161.990 202.854 1.00 115.44 ?  258  GLY A C     1 
ATOM   1993  O  O     . GLY A 1  258  ? 174.045 163.173 202.512 1.00 114.05 ?  258  GLY A O     1 
ATOM   1994  N  N     . GLU A 1  259  ? 174.457 161.596 204.101 1.00 104.17 ?  259  GLU A N     1 
ATOM   1995  C  CA    . GLU A 1  259  ? 174.701 162.480 205.241 1.00 99.98  ?  259  GLU A CA    1 
ATOM   1996  C  C     . GLU A 1  259  ? 175.789 163.503 205.035 1.00 96.32  ?  259  GLU A C     1 
ATOM   1997  O  O     . GLU A 1  259  ? 176.781 163.194 204.385 1.00 94.85  ?  259  GLU A O     1 
ATOM   1998  C  CB    . GLU A 1  259  ? 174.932 161.681 206.528 1.00 101.82 ?  259  GLU A CB    1 
ATOM   1999  C  CG    . GLU A 1  259  ? 173.700 160.964 207.059 1.00 110.95 ?  259  GLU A CG    1 
ATOM   2000  C  CD    . GLU A 1  259  ? 172.430 161.773 207.251 1.00 134.97 ?  259  GLU A CD    1 
ATOM   2001  O  OE1   . GLU A 1  259  ? 172.509 162.937 207.713 1.00 134.15 ?  259  GLU A OE1   1 
ATOM   2002  O  OE2   . GLU A 1  259  ? 171.341 161.208 206.997 1.00 131.03 -1 259  GLU A OE2   1 
ATOM   2003  N  N     . ASP A 1  260  ? 175.598 164.726 205.584 1.00 88.96  ?  260  ASP A N     1 
ATOM   2004  C  CA    . ASP A 1  260  ? 176.552 165.830 205.467 1.00 87.37  ?  260  ASP A CA    1 
ATOM   2005  C  C     . ASP A 1  260  ? 177.865 165.536 206.184 1.00 89.67  ?  260  ASP A C     1 
ATOM   2006  O  O     . ASP A 1  260  ? 177.899 164.716 207.093 1.00 89.86  ?  260  ASP A O     1 
ATOM   2007  C  CB    . ASP A 1  260  ? 175.940 167.124 206.012 1.00 89.12  ?  260  ASP A CB    1 
ATOM   2008  C  CG    . ASP A 1  260  ? 176.650 168.408 205.580 1.00 103.41 ?  260  ASP A CG    1 
ATOM   2009  O  OD1   . ASP A 1  260  ? 177.782 168.663 206.071 1.00 109.44 ?  260  ASP A OD1   1 
ATOM   2010  O  OD2   . ASP A 1  260  ? 176.055 169.182 204.793 1.00 104.31 -1 260  ASP A OD2   1 
ATOM   2011  N  N     . ASP A 1  261  ? 178.946 166.222 205.791 1.00 85.04  ?  261  ASP A N     1 
ATOM   2012  C  CA    . ASP A 1  261  ? 180.252 166.080 206.430 1.00 85.12  ?  261  ASP A CA    1 
ATOM   2013  C  C     . ASP A 1  261  ? 180.137 166.395 207.916 1.00 85.72  ?  261  ASP A C     1 
ATOM   2014  O  O     . ASP A 1  261  ? 180.761 165.717 208.737 1.00 86.36  ?  261  ASP A O     1 
ATOM   2015  C  CB    . ASP A 1  261  ? 181.269 167.041 205.799 1.00 87.62  ?  261  ASP A CB    1 
ATOM   2016  C  CG    . ASP A 1  261  ? 181.910 166.552 204.522 1.00 105.65 ?  261  ASP A CG    1 
ATOM   2017  O  OD1   . ASP A 1  261  ? 181.158 166.212 203.569 1.00 113.63 ?  261  ASP A OD1   1 
ATOM   2018  O  OD2   . ASP A 1  261  ? 183.168 166.576 204.444 1.00 107.43 -1 261  ASP A OD2   1 
ATOM   2019  N  N     . LEU A 1  262  ? 179.327 167.424 208.256 1.00 78.39  ?  262  LEU A N     1 
ATOM   2020  C  CA    . LEU A 1  262  ? 179.110 167.846 209.633 1.00 76.73  ?  262  LEU A CA    1 
ATOM   2021  C  C     . LEU A 1  262  ? 178.435 166.795 210.452 1.00 78.62  ?  262  LEU A C     1 
ATOM   2022  O  O     . LEU A 1  262  ? 178.819 166.624 211.603 1.00 78.81  ?  262  LEU A O     1 
ATOM   2023  C  CB    . LEU A 1  262  ? 178.402 169.190 209.731 1.00 75.70  ?  262  LEU A CB    1 
ATOM   2024  C  CG    . LEU A 1  262  ? 179.226 170.430 209.343 1.00 79.23  ?  262  LEU A CG    1 
ATOM   2025  C  CD1   . LEU A 1  262  ? 178.620 171.661 209.962 1.00 79.19  ?  262  LEU A CD1   1 
ATOM   2026  C  CD2   . LEU A 1  262  ? 180.680 170.344 209.819 1.00 81.22  ?  262  LEU A CD2   1 
ATOM   2027  N  N     . THR A 1  263  ? 177.518 166.018 209.837 1.00 73.18  ?  263  THR A N     1 
ATOM   2028  C  CA    . THR A 1  263  ? 176.867 164.883 210.476 1.00 72.97  ?  263  THR A CA    1 
ATOM   2029  C  C     . THR A 1  263  ? 177.928 163.811 210.745 1.00 78.90  ?  263  THR A C     1 
ATOM   2030  O  O     . THR A 1  263  ? 177.937 163.253 211.836 1.00 80.55  ?  263  THR A O     1 
ATOM   2031  C  CB    . THR A 1  263  ? 175.692 164.356 209.654 1.00 77.70  ?  263  THR A CB    1 
ATOM   2032  O  OG1   . THR A 1  263  ? 174.818 165.423 209.264 1.00 76.37  ?  263  THR A OG1   1 
ATOM   2033  C  CG2   . THR A 1  263  ? 174.902 163.284 210.390 1.00 77.33  ?  263  THR A CG2   1 
ATOM   2034  N  N     . PHE A 1  264  ? 178.866 163.584 209.811 1.00 76.07  ?  264  PHE A N     1 
ATOM   2035  C  CA    . PHE A 1  264  ? 179.941 162.612 210.034 1.00 77.99  ?  264  PHE A CA    1 
ATOM   2036  C  C     . PHE A 1  264  ? 180.883 163.033 211.121 1.00 78.00  ?  264  PHE A C     1 
ATOM   2037  O  O     . PHE A 1  264  ? 181.024 162.304 212.100 1.00 76.43  ?  264  PHE A O     1 
ATOM   2038  C  CB    . PHE A 1  264  ? 180.694 162.258 208.743 1.00 81.90  ?  264  PHE A CB    1 
ATOM   2039  C  CG    . PHE A 1  264  ? 179.830 161.447 207.803 1.00 86.09  ?  264  PHE A CG    1 
ATOM   2040  C  CD1   . PHE A 1  264  ? 179.080 160.364 208.274 1.00 91.15  ?  264  PHE A CD1   1 
ATOM   2041  C  CD2   . PHE A 1  264  ? 179.741 161.778 206.453 1.00 89.72  ?  264  PHE A CD2   1 
ATOM   2042  C  CE1   . PHE A 1  264  ? 178.244 159.641 207.416 1.00 92.70  ?  264  PHE A CE1   1 
ATOM   2043  C  CE2   . PHE A 1  264  ? 178.914 161.044 205.591 1.00 93.47  ?  264  PHE A CE2   1 
ATOM   2044  C  CZ    . PHE A 1  264  ? 178.168 159.982 206.080 1.00 92.14  ?  264  PHE A CZ    1 
ATOM   2045  N  N     . LYS A 1  265  ? 181.463 164.249 210.988 1.00 73.55  ?  265  LYS A N     1 
ATOM   2046  C  CA    . LYS A 1  265  ? 182.360 164.859 211.969 1.00 73.03  ?  265  LYS A CA    1 
ATOM   2047  C  C     . LYS A 1  265  ? 181.746 164.880 213.356 1.00 77.56  ?  265  LYS A C     1 
ATOM   2048  O  O     . LYS A 1  265  ? 182.476 164.701 214.333 1.00 78.74  ?  265  LYS A O     1 
ATOM   2049  C  CB    . LYS A 1  265  ? 182.772 166.281 211.561 1.00 73.76  ?  265  LYS A CB    1 
ATOM   2050  C  CG    . LYS A 1  265  ? 184.001 166.826 212.324 1.00 80.91  ?  265  LYS A CG    1 
ATOM   2051  C  CD    . LYS A 1  265  ? 185.179 165.839 212.391 1.00 83.95  ?  265  LYS A CD    1 
ATOM   2052  C  CE    . LYS A 1  265  ? 186.478 166.484 212.757 1.00 77.39  ?  265  LYS A CE    1 
ATOM   2053  N  NZ    . LYS A 1  265  ? 187.569 165.477 212.802 1.00 76.66  1  265  LYS A NZ    1 
ATOM   2054  N  N     . LEU A 1  266  ? 180.412 165.076 213.452 1.00 72.26  ?  266  LEU A N     1 
ATOM   2055  C  CA    . LEU A 1  266  ? 179.759 165.062 214.751 1.00 71.49  ?  266  LEU A CA    1 
ATOM   2056  C  C     . LEU A 1  266  ? 179.823 163.670 215.357 1.00 76.99  ?  266  LEU A C     1 
ATOM   2057  O  O     . LEU A 1  266  ? 180.316 163.531 216.476 1.00 77.68  ?  266  LEU A O     1 
ATOM   2058  C  CB    . LEU A 1  266  ? 178.349 165.693 214.745 1.00 70.07  ?  266  LEU A CB    1 
ATOM   2059  C  CG    . LEU A 1  266  ? 178.358 167.244 214.772 1.00 72.90  ?  266  LEU A CG    1 
ATOM   2060  C  CD1   . LEU A 1  266  ? 176.993 167.817 214.594 1.00 72.23  ?  266  LEU A CD1   1 
ATOM   2061  C  CD2   . LEU A 1  266  ? 178.917 167.778 216.053 1.00 75.52  ?  266  LEU A CD2   1 
ATOM   2062  N  N     . ALA A 1  267  ? 179.489 162.634 214.574 1.00 73.08  ?  267  ALA A N     1 
ATOM   2063  C  CA    . ALA A 1  267  ? 179.583 161.262 215.058 1.00 73.66  ?  267  ALA A CA    1 
ATOM   2064  C  C     . ALA A 1  267  ? 180.993 160.946 215.540 1.00 78.89  ?  267  ALA A C     1 
ATOM   2065  O  O     . ALA A 1  267  ? 181.138 160.299 216.565 1.00 78.92  ?  267  ALA A O     1 
ATOM   2066  C  CB    . ALA A 1  267  ? 179.167 160.296 213.977 1.00 74.31  ?  267  ALA A CB    1 
ATOM   2067  N  N     . ASP A 1  268  ? 182.029 161.452 214.844 1.00 76.95  ?  268  ASP A N     1 
ATOM   2068  C  CA    . ASP A 1  268  ? 183.437 161.283 215.226 1.00 78.06  ?  268  ASP A CA    1 
ATOM   2069  C  C     . ASP A 1  268  ? 183.649 161.841 216.640 1.00 80.64  ?  268  ASP A C     1 
ATOM   2070  O  O     . ASP A 1  268  ? 184.283 161.175 217.458 1.00 82.12  ?  268  ASP A O     1 
ATOM   2071  C  CB    . ASP A 1  268  ? 184.378 162.007 214.229 1.00 80.42  ?  268  ASP A CB    1 
ATOM   2072  C  CG    . ASP A 1  268  ? 184.604 161.354 212.865 1.00 98.84  ?  268  ASP A CG    1 
ATOM   2073  O  OD1   . ASP A 1  268  ? 184.426 160.103 212.757 1.00 101.08 ?  268  ASP A OD1   1 
ATOM   2074  O  OD2   . ASP A 1  268  ? 185.056 162.076 211.923 1.00 104.99 -1 268  ASP A OD2   1 
ATOM   2075  N  N     . ILE A 1  269  ? 183.082 163.041 216.922 1.00 74.11  ?  269  ILE A N     1 
ATOM   2076  C  CA    . ILE A 1  269  ? 183.133 163.729 218.216 1.00 73.86  ?  269  ILE A CA    1 
ATOM   2077  C  C     . ILE A 1  269  ? 182.390 162.894 219.262 1.00 76.51  ?  269  ILE A C     1 
ATOM   2078  O  O     . ILE A 1  269  ? 182.880 162.725 220.377 1.00 76.19  ?  269  ILE A O     1 
ATOM   2079  C  CB    . ILE A 1  269  ? 182.537 165.173 218.112 1.00 76.51  ?  269  ILE A CB    1 
ATOM   2080  C  CG1   . ILE A 1  269  ? 183.372 166.081 217.188 1.00 76.28  ?  269  ILE A CG1   1 
ATOM   2081  C  CG2   . ILE A 1  269  ? 182.350 165.818 219.495 1.00 77.91  ?  269  ILE A CG2   1 
ATOM   2082  C  CD1   . ILE A 1  269  ? 182.616 167.264 216.626 1.00 80.63  ?  269  ILE A CD1   1 
ATOM   2083  N  N     . LEU A 1  270  ? 181.199 162.394 218.899 1.00 72.78  ?  270  LEU A N     1 
ATOM   2084  C  CA    . LEU A 1  270  ? 180.368 161.554 219.757 1.00 73.43  ?  270  LEU A CA    1 
ATOM   2085  C  C     . LEU A 1  270  ? 181.158 160.315 220.172 1.00 80.34  ?  270  LEU A C     1 
ATOM   2086  O  O     . LEU A 1  270  ? 181.364 160.088 221.364 1.00 80.34  ?  270  LEU A O     1 
ATOM   2087  C  CB    . LEU A 1  270  ? 179.112 161.115 218.983 1.00 72.52  ?  270  LEU A CB    1 
ATOM   2088  C  CG    . LEU A 1  270  ? 177.751 161.364 219.589 1.00 77.08  ?  270  LEU A CG    1 
ATOM   2089  C  CD1   . LEU A 1  270  ? 177.612 160.742 220.958 1.00 78.02  ?  270  LEU A CD1   1 
ATOM   2090  C  CD2   . LEU A 1  270  ? 177.424 162.823 219.576 1.00 81.45  ?  270  LEU A CD2   1 
ATOM   2091  N  N     . LYS A 1  271  ? 181.639 159.553 219.166 1.00 78.84  ?  271  LYS A N     1 
ATOM   2092  C  CA    . LYS A 1  271  ? 182.432 158.339 219.302 1.00 80.64  ?  271  LYS A CA    1 
ATOM   2093  C  C     . LYS A 1  271  ? 183.665 158.564 220.201 1.00 87.36  ?  271  LYS A C     1 
ATOM   2094  O  O     . LYS A 1  271  ? 183.864 157.796 221.154 1.00 88.48  ?  271  LYS A O     1 
ATOM   2095  C  CB    . LYS A 1  271  ? 182.814 157.789 217.910 1.00 83.06  ?  271  LYS A CB    1 
ATOM   2096  C  CG    . LYS A 1  271  ? 181.639 157.141 217.143 1.00 94.98  ?  271  LYS A CG    1 
ATOM   2097  C  CD    . LYS A 1  271  ? 182.038 156.443 215.807 1.00 102.04 ?  271  LYS A CD    1 
ATOM   2098  C  CE    . LYS A 1  271  ? 182.179 157.366 214.606 1.00 105.90 ?  271  LYS A CE    1 
ATOM   2099  N  NZ    . LYS A 1  271  ? 182.902 156.725 213.467 1.00 107.63 1  271  LYS A NZ    1 
ATOM   2100  N  N     . ALA A 1  272  ? 184.434 159.663 219.944 1.00 84.18  ?  272  ALA A N     1 
ATOM   2101  C  CA    . ALA A 1  272  ? 185.634 160.067 220.709 1.00 84.84  ?  272  ALA A CA    1 
ATOM   2102  C  C     . ALA A 1  272  ? 185.307 160.310 222.179 1.00 89.06  ?  272  ALA A C     1 
ATOM   2103  O  O     . ALA A 1  272  ? 186.088 159.944 223.064 1.00 88.25  ?  272  ALA A O     1 
ATOM   2104  C  CB    . ALA A 1  272  ? 186.255 161.326 220.099 1.00 84.68  ?  272  ALA A CB    1 
ATOM   2105  N  N     . ASN A 1  273  ? 184.127 160.933 222.410 1.00 86.46  ?  273  ASN A N     1 
ATOM   2106  C  CA    . ASN A 1  273  ? 183.575 161.281 223.711 1.00 86.95  ?  273  ASN A CA    1 
ATOM   2107  C  C     . ASN A 1  273  ? 183.164 160.031 224.469 1.00 93.78  ?  273  ASN A C     1 
ATOM   2108  O  O     . ASN A 1  273  ? 183.524 159.905 225.638 1.00 95.13  ?  273  ASN A O     1 
ATOM   2109  C  CB    . ASN A 1  273  ? 182.401 162.255 223.571 1.00 81.03  ?  273  ASN A CB    1 
ATOM   2110  C  CG    . ASN A 1  273  ? 182.094 162.979 224.847 1.00 92.66  ?  273  ASN A CG    1 
ATOM   2111  O  OD1   . ASN A 1  273  ? 182.775 163.941 225.213 1.00 79.99  ?  273  ASN A OD1   1 
ATOM   2112  N  ND2   . ASN A 1  273  ? 181.086 162.505 225.572 1.00 86.98  ?  273  ASN A ND2   1 
ATOM   2113  N  N     . ILE A 1  274  ? 182.450 159.094 223.812 1.00 90.36  ?  274  ILE A N     1 
ATOM   2114  C  CA    . ILE A 1  274  ? 182.040 157.871 224.490 1.00 91.41  ?  274  ILE A CA    1 
ATOM   2115  C  C     . ILE A 1  274  ? 183.243 157.072 224.936 1.00 100.26 ?  274  ILE A C     1 
ATOM   2116  O  O     . ILE A 1  274  ? 183.283 156.690 226.109 1.00 101.68 ?  274  ILE A O     1 
ATOM   2117  C  CB    . ILE A 1  274  ? 180.978 157.031 223.763 1.00 93.26  ?  274  ILE A CB    1 
ATOM   2118  C  CG1   . ILE A 1  274  ? 179.835 157.925 223.269 1.00 92.47  ?  274  ILE A CG1   1 
ATOM   2119  C  CG2   . ILE A 1  274  ? 180.428 155.969 224.713 1.00 94.61  ?  274  ILE A CG2   1 
ATOM   2120  C  CD1   . ILE A 1  274  ? 179.255 157.546 221.934 1.00 100.74 ?  274  ILE A CD1   1 
ATOM   2121  N  N     . SER A 1  275  ? 184.262 156.897 224.050 1.00 98.71  ?  275  SER A N     1 
ATOM   2122  C  CA    . SER A 1  275  ? 185.488 156.162 224.413 1.00 100.75 ?  275  SER A CA    1 
ATOM   2123  C  C     . SER A 1  275  ? 186.082 156.732 225.708 1.00 105.96 ?  275  SER A C     1 
ATOM   2124  O  O     . SER A 1  275  ? 186.210 156.001 226.687 1.00 106.28 ?  275  SER A O     1 
ATOM   2125  C  CB    . SER A 1  275  ? 186.511 156.139 223.269 1.00 104.77 ?  275  SER A CB    1 
ATOM   2126  O  OG    . SER A 1  275  ? 187.420 157.233 223.239 1.00 114.50 ?  275  SER A OG    1 
ATOM   2127  N  N     . LEU A 1  276  ? 186.310 158.055 225.735 1.00 102.85 ?  276  LEU A N     1 
ATOM   2128  C  CA    . LEU A 1  276  ? 186.866 158.786 226.868 1.00 103.92 ?  276  LEU A CA    1 
ATOM   2129  C  C     . LEU A 1  276  ? 186.013 158.663 228.112 1.00 111.17 ?  276  LEU A C     1 
ATOM   2130  O  O     . LEU A 1  276  ? 186.549 158.440 229.200 1.00 112.13 ?  276  LEU A O     1 
ATOM   2131  C  CB    . LEU A 1  276  ? 187.059 160.264 226.501 1.00 102.71 ?  276  LEU A CB    1 
ATOM   2132  C  CG    . LEU A 1  276  ? 187.633 161.166 227.588 1.00 107.87 ?  276  LEU A CG    1 
ATOM   2133  C  CD1   . LEU A 1  276  ? 189.128 160.935 227.777 1.00 108.55 ?  276  LEU A CD1   1 
ATOM   2134  C  CD2   . LEU A 1  276  ? 187.365 162.604 227.268 1.00 110.85 ?  276  LEU A CD2   1 
ATOM   2135  N  N     . GLU A 1  277  ? 184.692 158.824 227.953 1.00 109.20 ?  277  GLU A N     1 
ATOM   2136  C  CA    . GLU A 1  277  ? 183.722 158.757 229.046 1.00 110.44 ?  277  GLU A CA    1 
ATOM   2137  C  C     . GLU A 1  277  ? 183.820 157.394 229.760 1.00 116.46 ?  277  GLU A C     1 
ATOM   2138  O  O     . GLU A 1  277  ? 184.068 157.350 230.975 1.00 117.52 ?  277  GLU A O     1 
ATOM   2139  C  CB    . GLU A 1  277  ? 182.303 159.073 228.515 1.00 110.79 ?  277  GLU A CB    1 
ATOM   2140  C  CG    . GLU A 1  277  ? 181.193 159.055 229.551 1.00 123.18 ?  277  GLU A CG    1 
ATOM   2141  C  CD    . GLU A 1  277  ? 180.534 157.698 229.712 1.00 151.52 ?  277  GLU A CD    1 
ATOM   2142  O  OE1   . GLU A 1  277  ? 180.099 157.114 228.691 1.00 149.22 ?  277  GLU A OE1   1 
ATOM   2143  O  OE2   . GLU A 1  277  ? 180.485 157.205 230.863 1.00 147.84 -1 277  GLU A OE2   1 
ATOM   2144  N  N     . THR A 1  278  ? 183.686 156.293 228.984 1.00 112.29 ?  278  THR A N     1 
ATOM   2145  C  CA    . THR A 1  278  ? 183.753 154.925 229.496 1.00 112.55 ?  278  THR A CA    1 
ATOM   2146  C  C     . THR A 1  278  ? 185.125 154.672 230.135 1.00 117.11 ?  278  THR A C     1 
ATOM   2147  O  O     . THR A 1  278  ? 185.180 154.228 231.274 1.00 117.75 ?  278  THR A O     1 
ATOM   2148  C  CB    . THR A 1  278  ? 183.277 153.892 228.437 1.00 112.31 ?  278  THR A CB    1 
ATOM   2149  O  OG1   . THR A 1  278  ? 184.228 153.803 227.375 1.00 109.86 ?  278  THR A OG1   1 
ATOM   2150  C  CG2   . THR A 1  278  ? 181.865 154.200 227.880 1.00 104.18 ?  278  THR A CG2   1 
ATOM   2151  N  N     . LEU A 1  279  ? 186.208 155.079 229.449 1.00 113.61 ?  279  LEU A N     1 
ATOM   2152  C  CA    . LEU A 1  279  ? 187.605 154.954 229.877 1.00 114.61 ?  279  LEU A CA    1 
ATOM   2153  C  C     . LEU A 1  279  ? 187.849 155.442 231.287 1.00 122.95 ?  279  LEU A C     1 
ATOM   2154  O  O     . LEU A 1  279  ? 188.481 154.733 232.064 1.00 123.48 ?  279  LEU A O     1 
ATOM   2155  C  CB    . LEU A 1  279  ? 188.511 155.735 228.911 1.00 113.18 ?  279  LEU A CB    1 
ATOM   2156  C  CG    . LEU A 1  279  ? 189.339 154.974 227.887 1.00 117.11 ?  279  LEU A CG    1 
ATOM   2157  C  CD1   . LEU A 1  279  ? 190.668 154.595 228.446 1.00 118.55 ?  279  LEU A CD1   1 
ATOM   2158  C  CD2   . LEU A 1  279  ? 188.599 153.779 227.285 1.00 119.02 ?  279  LEU A CD2   1 
ATOM   2159  N  N     . GLU A 1  280  ? 187.367 156.656 231.613 1.00 122.91 ?  280  GLU A N     1 
ATOM   2160  C  CA    . GLU A 1  280  ? 187.556 157.261 232.933 1.00 125.68 ?  280  GLU A CA    1 
ATOM   2161  C  C     . GLU A 1  280  ? 186.630 156.736 234.013 1.00 135.06 ?  280  GLU A C     1 
ATOM   2162  O  O     . GLU A 1  280  ? 187.079 156.565 235.147 1.00 136.49 ?  280  GLU A O     1 
ATOM   2163  C  CB    . GLU A 1  280  ? 187.600 158.797 232.892 1.00 126.21 ?  280  GLU A CB    1 
ATOM   2164  C  CG    . GLU A 1  280  ? 186.342 159.474 232.384 1.00 136.01 ?  280  GLU A CG    1 
ATOM   2165  C  CD    . GLU A 1  280  ? 186.517 160.956 232.127 1.00 160.28 ?  280  GLU A CD    1 
ATOM   2166  O  OE1   . GLU A 1  280  ? 187.510 161.334 231.462 1.00 151.96 ?  280  GLU A OE1   1 
ATOM   2167  O  OE2   . GLU A 1  280  ? 185.659 161.742 232.587 1.00 163.71 -1 280  GLU A OE2   1 
ATOM   2168  N  N     . HIS A 1  281  ? 185.354 156.461 233.670 1.00 133.97 ?  281  HIS A N     1 
ATOM   2169  C  CA    . HIS A 1  281  ? 184.383 155.891 234.611 1.00 136.10 ?  281  HIS A CA    1 
ATOM   2170  C  C     . HIS A 1  281  ? 184.851 154.477 235.054 1.00 141.82 ?  281  HIS A C     1 
ATOM   2171  O  O     . HIS A 1  281  ? 184.650 154.088 236.207 1.00 142.59 ?  281  HIS A O     1 
ATOM   2172  C  CB    . HIS A 1  281  ? 182.975 155.844 233.982 1.00 136.49 ?  281  HIS A CB    1 
ATOM   2173  C  CG    . HIS A 1  281  ? 181.979 155.097 234.818 1.00 141.48 ?  281  HIS A CG    1 
ATOM   2174  N  ND1   . HIS A 1  281  ? 181.760 153.736 234.641 1.00 144.14 ?  281  HIS A ND1   1 
ATOM   2175  C  CD2   . HIS A 1  281  ? 181.229 155.530 235.858 1.00 144.18 ?  281  HIS A CD2   1 
ATOM   2176  C  CE1   . HIS A 1  281  ? 180.866 153.396 235.556 1.00 144.64 ?  281  HIS A CE1   1 
ATOM   2177  N  NE2   . HIS A 1  281  ? 180.513 154.442 236.310 1.00 145.01 ?  281  HIS A NE2   1 
ATOM   2178  N  N     . ASN A 1  282  ? 185.495 153.742 234.130 1.00 138.40 ?  282  ASN A N     1 
ATOM   2179  C  CA    . ASN A 1  282  ? 186.041 152.411 234.344 1.00 139.75 ?  282  ASN A CA    1 
ATOM   2180  C  C     . ASN A 1  282  ? 187.440 152.488 234.938 1.00 147.11 ?  282  ASN A C     1 
ATOM   2181  O  O     . ASN A 1  282  ? 187.845 153.520 235.490 1.00 145.98 ?  282  ASN A O     1 
ATOM   2182  C  CB    . ASN A 1  282  ? 186.107 151.664 233.007 1.00 137.70 ?  282  ASN A CB    1 
ATOM   2183  C  CG    . ASN A 1  282  ? 184.859 150.915 232.642 1.00 159.13 ?  282  ASN A CG    1 
ATOM   2184  O  OD1   . ASN A 1  282  ? 183.731 151.299 232.988 1.00 152.62 ?  282  ASN A OD1   1 
ATOM   2185  N  ND2   . ASN A 1  282  ? 185.039 149.835 231.901 1.00 151.38 ?  282  ASN A ND2   1 
ATOM   2186  N  N     . GLY A 1  283  ? 188.159 151.373 234.814 1.00 147.44 ?  283  GLY A N     1 
ATOM   2187  C  CA    . GLY A 1  283  ? 189.540 151.231 235.241 1.00 149.43 ?  283  GLY A CA    1 
ATOM   2188  C  C     . GLY A 1  283  ? 190.382 152.106 234.347 1.00 154.26 ?  283  GLY A C     1 
ATOM   2189  O  O     . GLY A 1  283  ? 190.711 151.721 233.218 1.00 153.36 ?  283  GLY A O     1 
ATOM   2190  N  N     . ALA A 1  284  ? 190.628 153.332 234.821 1.00 151.53 ?  284  ALA A N     1 
ATOM   2191  C  CA    . ALA A 1  284  ? 191.377 154.356 234.120 1.00 150.86 ?  284  ALA A CA    1 
ATOM   2192  C  C     . ALA A 1  284  ? 192.848 153.947 233.898 1.00 157.55 ?  284  ALA A C     1 
ATOM   2193  O  O     . ALA A 1  284  ? 193.615 153.941 234.864 1.00 159.30 ?  284  ALA A O     1 
ATOM   2194  C  CB    . ALA A 1  284  ? 191.298 155.661 234.900 1.00 151.48 ?  284  ALA A CB    1 
ATOM   2195  N  N     . PRO A 1  285  ? 193.293 153.606 232.660 1.00 153.90 ?  285  PRO A N     1 
ATOM   2196  C  CA    . PRO A 1  285  ? 194.715 153.271 232.468 1.00 154.54 ?  285  PRO A CA    1 
ATOM   2197  C  C     . PRO A 1  285  ? 195.587 154.537 232.360 1.00 159.24 ?  285  PRO A C     1 
ATOM   2198  O  O     . PRO A 1  285  ? 196.735 154.452 231.920 1.00 159.47 ?  285  PRO A O     1 
ATOM   2199  C  CB    . PRO A 1  285  ? 194.718 152.411 231.191 1.00 155.49 ?  285  PRO A CB    1 
ATOM   2200  C  CG    . PRO A 1  285  ? 193.265 152.363 230.720 1.00 158.99 ?  285  PRO A CG    1 
ATOM   2201  C  CD    . PRO A 1  285  ? 192.573 153.517 231.382 1.00 154.07 ?  285  PRO A CD    1 
ATOM   2202  N  N     . HIS A 1  286  ? 195.018 155.715 232.765 1.00 155.44 ?  286  HIS A N     1 
ATOM   2203  C  CA    . HIS A 1  286  ? 195.586 157.069 232.894 1.00 155.11 ?  286  HIS A CA    1 
ATOM   2204  C  C     . HIS A 1  286  ? 196.321 157.699 231.721 1.00 154.55 ?  286  HIS A C     1 
ATOM   2205  O  O     . HIS A 1  286  ? 196.359 158.923 231.649 1.00 152.66 ?  286  HIS A O     1 
ATOM   2206  C  CB    . HIS A 1  286  ? 196.357 157.264 234.216 1.00 158.79 ?  286  HIS A CB    1 
ATOM   2207  C  CG    . HIS A 1  286  ? 195.724 156.622 235.425 1.00 164.69 ?  286  HIS A CG    1 
ATOM   2208  N  ND1   . HIS A 1  286  ? 194.525 157.090 235.958 1.00 166.69 ?  286  HIS A ND1   1 
ATOM   2209  C  CD2   . HIS A 1  286  ? 196.166 155.588 236.190 1.00 168.69 ?  286  HIS A CD2   1 
ATOM   2210  C  CE1   . HIS A 1  286  ? 194.272 156.318 237.007 1.00 167.77 ?  286  HIS A CE1   1 
ATOM   2211  N  NE2   . HIS A 1  286  ? 195.232 155.400 237.189 1.00 169.26 ?  286  HIS A NE2   1 
ATOM   2212  N  N     . HIS A 1  287  ? 196.949 156.894 230.851 1.00 150.11 ?  287  HIS A N     1 
ATOM   2213  C  CA    . HIS A 1  287  ? 197.616 157.369 229.638 1.00 148.57 ?  287  HIS A CA    1 
ATOM   2214  C  C     . HIS A 1  287  ? 196.640 157.179 228.481 1.00 148.92 ?  287  HIS A C     1 
ATOM   2215  O  O     . HIS A 1  287  ? 196.526 158.060 227.631 1.00 147.31 ?  287  HIS A O     1 
ATOM   2216  C  CB    . HIS A 1  287  ? 198.942 156.635 229.348 1.00 150.56 ?  287  HIS A CB    1 
ATOM   2217  C  CG    . HIS A 1  287  ? 199.472 156.912 227.966 1.00 153.18 ?  287  HIS A CG    1 
ATOM   2218  N  ND1   . HIS A 1  287  ? 199.088 156.140 226.873 1.00 154.38 ?  287  HIS A ND1   1 
ATOM   2219  C  CD2   . HIS A 1  287  ? 200.273 157.912 227.530 1.00 154.49 ?  287  HIS A CD2   1 
ATOM   2220  C  CE1   . HIS A 1  287  ? 199.688 156.677 225.824 1.00 152.91 ?  287  HIS A CE1   1 
ATOM   2221  N  NE2   . HIS A 1  287  ? 200.412 157.743 226.167 1.00 153.31 ?  287  HIS A NE2   1 
ATOM   2222  N  N     . ALA A 1  288  ? 195.930 156.029 228.452 1.00 144.10 ?  288  ALA A N     1 
ATOM   2223  C  CA    . ALA A 1  288  ? 194.924 155.712 227.434 1.00 142.10 ?  288  ALA A CA    1 
ATOM   2224  C  C     . ALA A 1  288  ? 193.795 156.726 227.520 1.00 142.70 ?  288  ALA A C     1 
ATOM   2225  O  O     . ALA A 1  288  ? 193.001 156.856 226.583 1.00 141.32 ?  288  ALA A O     1 
ATOM   2226  C  CB    . ALA A 1  288  ? 194.381 154.315 227.656 1.00 143.74 ?  288  ALA A CB    1 
ATOM   2227  N  N     . ILE A 1  289  ? 193.766 157.468 228.647 1.00 137.44 ?  289  ILE A N     1 
ATOM   2228  C  CA    . ILE A 1  289  ? 192.834 158.539 228.953 1.00 135.23 ?  289  ILE A CA    1 
ATOM   2229  C  C     . ILE A 1  289  ? 193.270 159.859 228.303 1.00 134.75 ?  289  ILE A C     1 
ATOM   2230  O  O     . ILE A 1  289  ? 192.485 160.421 227.540 1.00 133.60 ?  289  ILE A O     1 
ATOM   2231  C  CB    . ILE A 1  289  ? 192.548 158.592 230.481 1.00 139.59 ?  289  ILE A CB    1 
ATOM   2232  C  CG1   . ILE A 1  289  ? 191.120 158.154 230.775 1.00 140.12 ?  289  ILE A CG1   1 
ATOM   2233  C  CG2   . ILE A 1  289  ? 192.876 159.925 231.157 1.00 140.24 ?  289  ILE A CG2   1 
ATOM   2234  C  CD1   . ILE A 1  289  ? 191.065 156.878 231.398 1.00 150.60 ?  289  ILE A CD1   1 
ATOM   2235  N  N     . GLU A 1  290  ? 194.529 160.314 228.538 1.00 129.03 ?  290  GLU A N     1 
ATOM   2236  C  CA    . GLU A 1  290  ? 195.067 161.558 227.960 1.00 126.99 ?  290  GLU A CA    1 
ATOM   2237  C  C     . GLU A 1  290  ? 195.177 161.446 226.438 1.00 125.51 ?  290  GLU A C     1 
ATOM   2238  O  O     . GLU A 1  290  ? 195.238 162.459 225.744 1.00 124.21 ?  290  GLU A O     1 
ATOM   2239  C  CB    . GLU A 1  290  ? 196.405 161.973 228.620 1.00 129.73 ?  290  GLU A CB    1 
ATOM   2240  C  CG    . GLU A 1  290  ? 197.588 161.051 228.339 1.00 144.66 ?  290  GLU A CG    1 
ATOM   2241  C  CD    . GLU A 1  290  ? 198.674 160.949 229.399 1.00 172.28 ?  290  GLU A CD    1 
ATOM   2242  O  OE1   . GLU A 1  290  ? 198.344 160.675 230.576 1.00 169.82 ?  290  GLU A OE1   1 
ATOM   2243  O  OE2   . GLU A 1  290  ? 199.866 161.056 229.030 1.00 167.47 -1 290  GLU A OE2   1 
ATOM   2244  N  N     . GLU A 1  291  ? 195.168 160.195 225.948 1.00 118.75 ?  291  GLU A N     1 
ATOM   2245  C  CA    . GLU A 1  291  ? 195.205 159.762 224.562 1.00 116.49 ?  291  GLU A CA    1 
ATOM   2246  C  C     . GLU A 1  291  ? 193.804 159.962 223.949 1.00 116.78 ?  291  GLU A C     1 
ATOM   2247  O  O     . GLU A 1  291  ? 193.678 160.616 222.908 1.00 114.81 ?  291  GLU A O     1 
ATOM   2248  C  CB    . GLU A 1  291  ? 195.586 158.270 224.540 1.00 118.96 ?  291  GLU A CB    1 
ATOM   2249  C  CG    . GLU A 1  291  ? 195.924 157.693 223.183 1.00 131.02 ?  291  GLU A CG    1 
ATOM   2250  C  CD    . GLU A 1  291  ? 197.338 157.999 222.745 1.00 161.18 ?  291  GLU A CD    1 
ATOM   2251  O  OE1   . GLU A 1  291  ? 197.562 159.105 222.203 1.00 154.55 ?  291  GLU A OE1   1 
ATOM   2252  O  OE2   . GLU A 1  291  ? 198.228 157.153 222.985 1.00 172.77 -1 291  GLU A OE2   1 
ATOM   2253  N  N     . ALA A 1  292  ? 192.756 159.385 224.600 1.00 112.36 ?  292  ALA A N     1 
ATOM   2254  C  CA    . ALA A 1  292  ? 191.348 159.462 224.171 1.00 110.38 ?  292  ALA A CA    1 
ATOM   2255  C  C     . ALA A 1  292  ? 190.836 160.883 224.274 1.00 110.84 ?  292  ALA A C     1 
ATOM   2256  O  O     . ALA A 1  292  ? 189.958 161.268 223.490 1.00 109.16 ?  292  ALA A O     1 
ATOM   2257  C  CB    . ALA A 1  292  ? 190.479 158.530 225.003 1.00 111.90 ?  292  ALA A CB    1 
ATOM   2258  N  N     . GLU A 1  293  ? 191.407 161.661 225.236 1.00 106.05 ?  293  GLU A N     1 
ATOM   2259  C  CA    . GLU A 1  293  ? 191.111 163.072 225.469 1.00 104.60 ?  293  GLU A CA    1 
ATOM   2260  C  C     . GLU A 1  293  ? 191.609 163.901 224.279 1.00 106.78 ?  293  GLU A C     1 
ATOM   2261  O  O     . GLU A 1  293  ? 190.802 164.552 223.608 1.00 105.23 ?  293  GLU A O     1 
ATOM   2262  C  CB    . GLU A 1  293  ? 191.729 163.579 226.793 1.00 106.85 ?  293  GLU A CB    1 
ATOM   2263  C  CG    . GLU A 1  293  ? 191.267 164.988 227.152 1.00 118.00 ?  293  GLU A CG    1 
ATOM   2264  C  CD    . GLU A 1  293  ? 191.835 165.661 228.388 1.00 141.77 ?  293  GLU A CD    1 
ATOM   2265  O  OE1   . GLU A 1  293  ? 192.672 165.038 229.085 1.00 143.61 ?  293  GLU A OE1   1 
ATOM   2266  O  OE2   . GLU A 1  293  ? 191.394 166.796 228.692 1.00 127.70 -1 293  GLU A OE2   1 
ATOM   2267  N  N     . SER A 1  294  ? 192.928 163.846 224.000 1.00 103.05 ?  294  SER A N     1 
ATOM   2268  C  CA    . SER A 1  294  ? 193.582 164.581 222.907 1.00 101.48 ?  294  SER A CA    1 
ATOM   2269  C  C     . SER A 1  294  ? 192.945 164.350 221.535 1.00 99.02  ?  294  SER A C     1 
ATOM   2270  O  O     . SER A 1  294  ? 192.932 165.267 220.706 1.00 96.80  ?  294  SER A O     1 
ATOM   2271  C  CB    . SER A 1  294  ? 195.087 164.324 222.892 1.00 108.50 ?  294  SER A CB    1 
ATOM   2272  O  OG    . SER A 1  294  ? 195.397 162.955 223.101 1.00 125.26 ?  294  SER A OG    1 
ATOM   2273  N  N     . LEU A 1  295  ? 192.368 163.153 221.330 1.00 93.18  ?  295  LEU A N     1 
ATOM   2274  C  CA    . LEU A 1  295  ? 191.646 162.802 220.113 1.00 91.27  ?  295  LEU A CA    1 
ATOM   2275  C  C     . LEU A 1  295  ? 190.316 163.576 220.045 1.00 91.83  ?  295  LEU A C     1 
ATOM   2276  O  O     . LEU A 1  295  ? 189.955 164.079 218.977 1.00 91.07  ?  295  LEU A O     1 
ATOM   2277  C  CB    . LEU A 1  295  ? 191.412 161.288 220.040 1.00 91.83  ?  295  LEU A CB    1 
ATOM   2278  C  CG    . LEU A 1  295  ? 190.225 160.816 219.197 1.00 95.28  ?  295  LEU A CG    1 
ATOM   2279  C  CD1   . LEU A 1  295  ? 190.577 160.730 217.721 1.00 93.88  ?  295  LEU A CD1   1 
ATOM   2280  C  CD2   . LEU A 1  295  ? 189.688 159.512 219.718 1.00 100.75 ?  295  LEU A CD2   1 
ATOM   2281  N  N     . LEU A 1  296  ? 189.589 163.668 221.177 1.00 85.45  ?  296  LEU A N     1 
ATOM   2282  C  CA    . LEU A 1  296  ? 188.334 164.421 221.234 1.00 82.57  ?  296  LEU A CA    1 
ATOM   2283  C  C     . LEU A 1  296  ? 188.631 165.894 220.982 1.00 83.21  ?  296  LEU A C     1 
ATOM   2284  O  O     . LEU A 1  296  ? 187.957 166.499 220.153 1.00 80.96  ?  296  LEU A O     1 
ATOM   2285  C  CB    . LEU A 1  296  ? 187.637 164.223 222.588 1.00 82.74  ?  296  LEU A CB    1 
ATOM   2286  C  CG    . LEU A 1  296  ? 186.410 165.067 222.887 1.00 85.10  ?  296  LEU A CG    1 
ATOM   2287  C  CD1   . LEU A 1  296  ? 185.209 164.601 222.089 1.00 83.38  ?  296  LEU A CD1   1 
ATOM   2288  C  CD2   . LEU A 1  296  ? 186.106 165.040 224.375 1.00 88.56  ?  296  LEU A CD2   1 
ATOM   2289  N  N     . GLN A 1  297  ? 189.684 166.444 221.641 1.00 79.40  ?  297  GLN A N     1 
ATOM   2290  C  CA    . GLN A 1  297  ? 190.122 167.827 221.460 1.00 78.51  ?  297  GLN A CA    1 
ATOM   2291  C  C     . GLN A 1  297  ? 190.299 168.086 219.984 1.00 82.77  ?  297  GLN A C     1 
ATOM   2292  O  O     . GLN A 1  297  ? 189.753 169.072 219.495 1.00 82.40  ?  297  GLN A O     1 
ATOM   2293  C  CB    . GLN A 1  297  ? 191.413 168.125 222.251 1.00 80.71  ?  297  GLN A CB    1 
ATOM   2294  C  CG    . GLN A 1  297  ? 192.119 169.476 221.962 1.00 90.40  ?  297  GLN A CG    1 
ATOM   2295  C  CD    . GLN A 1  297  ? 191.275 170.726 222.158 1.00 95.05  ?  297  GLN A CD    1 
ATOM   2296  O  OE1   . GLN A 1  297  ? 191.254 171.348 223.221 1.00 88.86  ?  297  GLN A OE1   1 
ATOM   2297  N  NE2   . GLN A 1  297  ? 190.629 171.175 221.103 1.00 78.18  ?  297  GLN A NE2   1 
ATOM   2298  N  N     . PHE A 1  298  ? 190.972 167.156 219.264 1.00 79.15  ?  298  PHE A N     1 
ATOM   2299  C  CA    . PHE A 1  298  ? 191.189 167.203 217.813 1.00 77.69  ?  298  PHE A CA    1 
ATOM   2300  C  C     . PHE A 1  298  ? 189.872 167.260 217.022 1.00 79.87  ?  298  PHE A C     1 
ATOM   2301  O  O     . PHE A 1  298  ? 189.749 168.074 216.109 1.00 77.02  ?  298  PHE A O     1 
ATOM   2302  C  CB    . PHE A 1  298  ? 192.028 165.990 217.359 1.00 79.90  ?  298  PHE A CB    1 
ATOM   2303  C  CG    . PHE A 1  298  ? 192.058 165.723 215.865 1.00 80.44  ?  298  PHE A CG    1 
ATOM   2304  C  CD1   . PHE A 1  298  ? 192.984 166.365 215.044 1.00 82.78  ?  298  PHE A CD1   1 
ATOM   2305  C  CD2   . PHE A 1  298  ? 191.172 164.822 215.283 1.00 81.85  ?  298  PHE A CD2   1 
ATOM   2306  C  CE1   . PHE A 1  298  ? 193.013 166.125 213.667 1.00 82.29  ?  298  PHE A CE1   1 
ATOM   2307  C  CE2   . PHE A 1  298  ? 191.184 164.601 213.902 1.00 83.66  ?  298  PHE A CE2   1 
ATOM   2308  C  CZ    . PHE A 1  298  ? 192.111 165.247 213.107 1.00 81.19  ?  298  PHE A CZ    1 
ATOM   2309  N  N     . HIS A 1  299  ? 188.924 166.361 217.331 1.00 78.50  ?  299  HIS A N     1 
ATOM   2310  C  CA    . HIS A 1  299  ? 187.658 166.312 216.613 1.00 79.00  ?  299  HIS A CA    1 
ATOM   2311  C  C     . HIS A 1  299  ? 186.842 167.578 216.764 1.00 85.10  ?  299  HIS A C     1 
ATOM   2312  O  O     . HIS A 1  299  ? 186.391 168.119 215.756 1.00 85.83  ?  299  HIS A O     1 
ATOM   2313  C  CB    . HIS A 1  299  ? 186.844 165.078 216.983 1.00 80.64  ?  299  HIS A CB    1 
ATOM   2314  C  CG    . HIS A 1  299  ? 187.284 163.853 216.260 1.00 84.80  ?  299  HIS A CG    1 
ATOM   2315  N  ND1   . HIS A 1  299  ? 187.575 163.879 214.904 1.00 86.00  ?  299  HIS A ND1   1 
ATOM   2316  C  CD2   . HIS A 1  299  ? 187.454 162.592 216.725 1.00 87.81  ?  299  HIS A CD2   1 
ATOM   2317  C  CE1   . HIS A 1  299  ? 187.939 162.647 214.596 1.00 86.18  ?  299  HIS A CE1   1 
ATOM   2318  N  NE2   . HIS A 1  299  ? 187.871 161.832 215.658 1.00 87.53  ?  299  HIS A NE2   1 
ATOM   2319  N  N     . VAL A 1  300  ? 186.705 168.087 218.005 1.00 80.95  ?  300  VAL A N     1 
ATOM   2320  C  CA    . VAL A 1  300  ? 185.985 169.323 218.322 1.00 79.13  ?  300  VAL A CA    1 
ATOM   2321  C  C     . VAL A 1  300  ? 186.732 170.525 217.708 1.00 81.05  ?  300  VAL A C     1 
ATOM   2322  O  O     . VAL A 1  300  ? 186.109 171.528 217.370 1.00 79.63  ?  300  VAL A O     1 
ATOM   2323  C  CB    . VAL A 1  300  ? 185.747 169.427 219.847 1.00 83.48  ?  300  VAL A CB    1 
ATOM   2324  C  CG1   . VAL A 1  300  ? 185.288 170.819 220.257 1.00 83.22  ?  300  VAL A CG1   1 
ATOM   2325  C  CG2   . VAL A 1  300  ? 184.739 168.380 220.304 1.00 83.34  ?  300  VAL A CG2   1 
ATOM   2326  N  N     . ALA A 1  301  ? 188.056 170.379 217.498 1.00 77.54  ?  301  ALA A N     1 
ATOM   2327  C  CA    . ALA A 1  301  ? 188.886 171.380 216.838 1.00 76.41  ?  301  ALA A CA    1 
ATOM   2328  C  C     . ALA A 1  301  ? 188.588 171.349 215.315 1.00 79.15  ?  301  ALA A C     1 
ATOM   2329  O  O     . ALA A 1  301  ? 187.985 172.281 214.773 1.00 76.98  ?  301  ALA A O     1 
ATOM   2330  C  CB    . ALA A 1  301  ? 190.371 171.110 217.110 1.00 77.47  ?  301  ALA A CB    1 
ATOM   2331  N  N     . THR A 1  302  ? 188.924 170.231 214.654 1.00 76.53  ?  302  THR A N     1 
ATOM   2332  C  CA    . THR A 1  302  ? 188.758 170.058 213.213 1.00 76.01  ?  302  THR A CA    1 
ATOM   2333  C  C     . THR A 1  302  ? 187.323 170.194 212.676 1.00 82.26  ?  302  THR A C     1 
ATOM   2334  O  O     . THR A 1  302  ? 187.134 170.337 211.465 1.00 82.63  ?  302  THR A O     1 
ATOM   2335  C  CB    . THR A 1  302  ? 189.586 168.876 212.690 1.00 77.97  ?  302  THR A CB    1 
ATOM   2336  O  OG1   . THR A 1  302  ? 189.312 167.713 213.476 1.00 73.40  ?  302  THR A OG1   1 
ATOM   2337  C  CG2   . THR A 1  302  ? 191.102 169.180 212.671 1.00 75.81  ?  302  THR A CG2   1 
ATOM   2338  N  N     . TYR A 1  303  ? 186.325 170.196 213.572 1.00 79.03  ?  303  TYR A N     1 
ATOM   2339  C  CA    . TYR A 1  303  ? 184.915 170.341 213.224 1.00 78.17  ?  303  TYR A CA    1 
ATOM   2340  C  C     . TYR A 1  303  ? 184.643 171.787 212.860 1.00 80.65  ?  303  TYR A C     1 
ATOM   2341  O  O     . TYR A 1  303  ? 184.023 172.057 211.828 1.00 79.54  ?  303  TYR A O     1 
ATOM   2342  C  CB    . TYR A 1  303  ? 184.060 169.841 214.403 1.00 80.13  ?  303  TYR A CB    1 
ATOM   2343  C  CG    . TYR A 1  303  ? 182.648 170.368 214.570 1.00 81.97  ?  303  TYR A CG    1 
ATOM   2344  C  CD1   . TYR A 1  303  ? 181.604 169.898 213.768 1.00 82.75  ?  303  TYR A CD1   1 
ATOM   2345  C  CD2   . TYR A 1  303  ? 182.314 171.167 215.657 1.00 83.81  ?  303  TYR A CD2   1 
ATOM   2346  C  CE1   . TYR A 1  303  ? 180.279 170.298 213.987 1.00 81.48  ?  303  TYR A CE1   1 
ATOM   2347  C  CE2   . TYR A 1  303  ? 180.997 171.572 215.887 1.00 84.91  ?  303  TYR A CE2   1 
ATOM   2348  C  CZ    . TYR A 1  303  ? 179.979 171.133 215.055 1.00 87.91  ?  303  TYR A CZ    1 
ATOM   2349  O  OH    . TYR A 1  303  ? 178.700 171.569 215.330 1.00 84.12  ?  303  TYR A OH    1 
ATOM   2350  N  N     . MET A 1  304  ? 185.184 172.708 213.668 1.00 76.99  ?  304  MET A N     1 
ATOM   2351  C  CA    . MET A 1  304  ? 185.026 174.144 213.488 1.00 76.17  ?  304  MET A CA    1 
ATOM   2352  C  C     . MET A 1  304  ? 186.003 174.651 212.448 1.00 82.53  ?  304  MET A C     1 
ATOM   2353  O  O     . MET A 1  304  ? 185.585 175.297 211.494 1.00 81.69  ?  304  MET A O     1 
ATOM   2354  C  CB    . MET A 1  304  ? 185.098 174.885 214.840 1.00 78.45  ?  304  MET A CB    1 
ATOM   2355  C  CG    . MET A 1  304  ? 183.990 174.428 215.799 1.00 81.79  ?  304  MET A CG    1 
ATOM   2356  S  SD    . MET A 1  304  ? 183.798 175.218 217.414 1.00 86.22  ?  304  MET A SD    1 
ATOM   2357  C  CE    . MET A 1  304  ? 185.333 174.727 218.198 1.00 84.49  ?  304  MET A CE    1 
ATOM   2358  N  N     . ASP A 1  305  ? 187.277 174.284 212.573 1.00 81.82  ?  305  ASP A N     1 
ATOM   2359  C  CA    . ASP A 1  305  ? 188.298 174.661 211.595 1.00 82.16  ?  305  ASP A CA    1 
ATOM   2360  C  C     . ASP A 1  305  ? 189.156 173.441 211.256 1.00 87.51  ?  305  ASP A C     1 
ATOM   2361  O  O     . ASP A 1  305  ? 189.774 172.880 212.150 1.00 88.11  ?  305  ASP A O     1 
ATOM   2362  C  CB    . ASP A 1  305  ? 189.148 175.836 212.113 1.00 84.12  ?  305  ASP A CB    1 
ATOM   2363  C  CG    . ASP A 1  305  ? 190.352 176.205 211.261 1.00 90.55  ?  305  ASP A CG    1 
ATOM   2364  O  OD1   . ASP A 1  305  ? 190.338 175.908 210.038 1.00 89.54  ?  305  ASP A OD1   1 
ATOM   2365  O  OD2   . ASP A 1  305  ? 191.275 176.861 211.797 1.00 95.53  -1 305  ASP A OD2   1 
ATOM   2366  N  N     . ASN A 1  306  ? 189.182 173.031 209.974 1.00 84.31  ?  306  ASN A N     1 
ATOM   2367  C  CA    . ASN A 1  306  ? 189.950 171.876 209.503 1.00 84.62  ?  306  ASN A CA    1 
ATOM   2368  C  C     . ASN A 1  306  ? 191.281 172.258 208.879 1.00 91.72  ?  306  ASN A C     1 
ATOM   2369  O  O     . ASN A 1  306  ? 192.148 171.393 208.725 1.00 93.33  ?  306  ASN A O     1 
ATOM   2370  C  CB    . ASN A 1  306  ? 189.158 171.034 208.517 1.00 79.23  ?  306  ASN A CB    1 
ATOM   2371  C  CG    . ASN A 1  306  ? 189.720 169.642 208.382 1.00 92.94  ?  306  ASN A CG    1 
ATOM   2372  O  OD1   . ASN A 1  306  ? 190.574 169.216 209.160 1.00 80.93  ?  306  ASN A OD1   1 
ATOM   2373  N  ND2   . ASN A 1  306  ? 189.254 168.890 207.405 1.00 89.75  ?  306  ASN A ND2   1 
ATOM   2374  N  N     . ASP A 1  307  ? 191.449 173.546 208.540 1.00 88.27  ?  307  ASP A N     1 
ATOM   2375  C  CA    . ASP A 1  307  ? 192.639 174.094 207.891 1.00 88.50  ?  307  ASP A CA    1 
ATOM   2376  C  C     . ASP A 1  307  ? 193.587 174.795 208.918 1.00 90.53  ?  307  ASP A C     1 
ATOM   2377  O  O     . ASP A 1  307  ? 193.872 175.991 208.808 1.00 90.11  ?  307  ASP A O     1 
ATOM   2378  C  CB    . ASP A 1  307  ? 192.219 174.978 206.694 1.00 90.91  ?  307  ASP A CB    1 
ATOM   2379  C  CG    . ASP A 1  307  ? 190.737 174.835 206.311 1.00 113.60 ?  307  ASP A CG    1 
ATOM   2380  O  OD1   . ASP A 1  307  ? 190.348 173.738 205.817 1.00 115.93 ?  307  ASP A OD1   1 
ATOM   2381  O  OD2   . ASP A 1  307  ? 189.953 175.790 206.575 1.00 121.08 -1 307  ASP A OD2   1 
ATOM   2382  N  N     . ILE A 1  308  ? 194.083 173.999 209.910 1.00 85.44  ?  308  ILE A N     1 
ATOM   2383  C  CA    . ILE A 1  308  ? 194.963 174.395 211.024 1.00 84.77  ?  308  ILE A CA    1 
ATOM   2384  C  C     . ILE A 1  308  ? 196.442 174.240 210.657 1.00 93.78  ?  308  ILE A C     1 
ATOM   2385  O  O     . ILE A 1  308  ? 196.767 173.294 209.928 1.00 95.29  ?  308  ILE A O     1 
ATOM   2386  C  CB    . ILE A 1  308  ? 194.627 173.543 212.283 1.00 86.64  ?  308  ILE A CB    1 
ATOM   2387  C  CG1   . ILE A 1  308  ? 193.111 173.436 212.532 1.00 85.88  ?  308  ILE A CG1   1 
ATOM   2388  C  CG2   . ILE A 1  308  ? 195.342 174.070 213.510 1.00 86.67  ?  308  ILE A CG2   1 
ATOM   2389  C  CD1   . ILE A 1  308  ? 192.692 172.511 213.642 1.00 91.96  ?  308  ILE A CD1   1 
ATOM   2390  N  N     . ALA A 1  309  ? 197.334 175.128 211.215 1.00 92.22  ?  309  ALA A N     1 
ATOM   2391  C  CA    . ALA A 1  309  ? 198.803 175.165 211.080 1.00 93.66  ?  309  ALA A CA    1 
ATOM   2392  C  C     . ALA A 1  309  ? 199.491 173.758 211.139 1.00 105.46 ?  309  ALA A C     1 
ATOM   2393  O  O     . ALA A 1  309  ? 200.053 173.314 210.125 1.00 104.73 ?  309  ALA A O     1 
ATOM   2394  C  CB    . ALA A 1  309  ? 199.382 176.084 212.139 1.00 94.44  ?  309  ALA A CB    1 
ATOM   2395  N  N     . GLY A 1  310  ? 199.415 173.081 212.306 1.00 108.15 ?  310  GLY A N     1 
ATOM   2396  C  CA    . GLY A 1  310  ? 199.903 171.717 212.541 1.00 110.78 ?  310  GLY A CA    1 
ATOM   2397  C  C     . GLY A 1  310  ? 199.063 170.731 211.746 1.00 119.68 ?  310  GLY A C     1 
ATOM   2398  O  O     . GLY A 1  310  ? 198.046 170.200 212.222 1.00 117.68 ?  310  GLY A O     1 
ATOM   2399  N  N     . GLN A 1  311  ? 199.512 170.542 210.494 1.00 121.87 ?  311  GLN A N     1 
ATOM   2400  C  CA    . GLN A 1  311  ? 199.012 169.815 209.313 1.00 123.73 ?  311  GLN A CA    1 
ATOM   2401  C  C     . GLN A 1  311  ? 197.951 168.655 209.323 1.00 129.66 ?  311  GLN A C     1 
ATOM   2402  O  O     . GLN A 1  311  ? 197.173 168.688 208.366 1.00 130.55 ?  311  GLN A O     1 
ATOM   2403  C  CB    . GLN A 1  311  ? 200.163 169.484 208.339 1.00 126.22 ?  311  GLN A CB    1 
ATOM   2404  C  CG    . GLN A 1  311  ? 200.161 170.363 207.078 1.00 147.15 ?  311  GLN A CG    1 
ATOM   2405  C  CD    . GLN A 1  311  ? 201.312 170.064 206.141 1.00 167.88 ?  311  GLN A CD    1 
ATOM   2406  O  OE1   . GLN A 1  311  ? 201.577 168.912 205.770 1.00 162.63 ?  311  GLN A OE1   1 
ATOM   2407  N  NE2   . GLN A 1  311  ? 202.001 171.111 205.704 1.00 161.11 ?  311  GLN A NE2   1 
ATOM   2408  N  N     . PRO A 1  312  ? 197.916 167.590 210.192 1.00 125.27 ?  312  PRO A N     1 
ATOM   2409  C  CA    . PRO A 1  312  ? 196.870 166.547 210.056 1.00 124.12 ?  312  PRO A CA    1 
ATOM   2410  C  C     . PRO A 1  312  ? 195.534 167.141 209.635 1.00 124.86 ?  312  PRO A C     1 
ATOM   2411  O  O     . PRO A 1  312  ? 194.966 167.966 210.364 1.00 125.33 ?  312  PRO A O     1 
ATOM   2412  C  CB    . PRO A 1  312  ? 196.809 165.921 211.456 1.00 126.89 ?  312  PRO A CB    1 
ATOM   2413  C  CG    . PRO A 1  312  ? 197.683 166.807 212.329 1.00 132.32 ?  312  PRO A CG    1 
ATOM   2414  C  CD    . PRO A 1  312  ? 198.723 167.319 211.387 1.00 127.93 ?  312  PRO A CD    1 
ATOM   2415  N  N     . GLN A 1  313  ? 195.112 166.842 208.399 1.00 117.08 ?  313  GLN A N     1 
ATOM   2416  C  CA    . GLN A 1  313  ? 193.942 167.509 207.871 1.00 114.09 ?  313  GLN A CA    1 
ATOM   2417  C  C     . GLN A 1  313  ? 192.609 166.845 208.044 1.00 116.71 ?  313  GLN A C     1 
ATOM   2418  O  O     . GLN A 1  313  ? 191.703 167.169 207.281 1.00 116.65 ?  313  GLN A O     1 
ATOM   2419  C  CB    . GLN A 1  313  ? 194.175 168.057 206.451 1.00 113.91 ?  313  GLN A CB    1 
ATOM   2420  C  CG    . GLN A 1  313  ? 194.128 169.584 206.390 1.00 102.50 ?  313  GLN A CG    1 
ATOM   2421  C  CD    . GLN A 1  313  ? 193.216 170.138 205.313 1.00 106.30 ?  313  GLN A CD    1 
ATOM   2422  O  OE1   . GLN A 1  313  ? 193.149 169.646 204.191 1.00 93.42  ?  313  GLN A OE1   1 
ATOM   2423  N  NE2   . GLN A 1  313  ? 192.538 171.230 205.608 1.00 103.89 ?  313  GLN A NE2   1 
ATOM   2424  N  N     . ALA A 1  314  ? 192.439 165.985 209.071 1.00 112.22 ?  314  ALA A N     1 
ATOM   2425  C  CA    . ALA A 1  314  ? 191.155 165.312 209.343 1.00 111.70 ?  314  ALA A CA    1 
ATOM   2426  C  C     . ALA A 1  314  ? 190.420 164.992 208.024 1.00 115.66 ?  314  ALA A C     1 
ATOM   2427  O  O     . ALA A 1  314  ? 189.358 165.539 207.690 1.00 114.03 ?  314  ALA A O     1 
ATOM   2428  C  CB    . ALA A 1  314  ? 190.290 166.162 210.260 1.00 111.87 ?  314  ALA A CB    1 
ATOM   2429  N  N     . LEU A 1  315  ? 191.084 164.155 207.245 1.00 113.17 ?  315  LEU A N     1 
ATOM   2430  C  CA    . LEU A 1  315  ? 190.722 163.719 205.911 1.00 112.40 ?  315  LEU A CA    1 
ATOM   2431  C  C     . LEU A 1  315  ? 189.644 162.666 205.980 1.00 117.45 ?  315  LEU A C     1 
ATOM   2432  O  O     . LEU A 1  315  ? 189.774 161.723 206.761 1.00 118.47 ?  315  LEU A O     1 
ATOM   2433  C  CB    . LEU A 1  315  ? 191.981 163.139 205.251 1.00 112.73 ?  315  LEU A CB    1 
ATOM   2434  C  CG    . LEU A 1  315  ? 193.275 163.893 205.553 1.00 117.69 ?  315  LEU A CG    1 
ATOM   2435  C  CD1   . LEU A 1  315  ? 194.047 163.254 206.711 1.00 118.68 ?  315  LEU A CD1   1 
ATOM   2436  C  CD2   . LEU A 1  315  ? 194.125 164.002 204.328 1.00 120.89 ?  315  LEU A CD2   1 
ATOM   2437  N  N     . GLN A 1  316  ? 188.577 162.821 205.173 1.00 113.42 ?  316  GLN A N     1 
ATOM   2438  C  CA    . GLN A 1  316  ? 187.474 161.862 205.051 1.00 113.53 ?  316  GLN A CA    1 
ATOM   2439  C  C     . GLN A 1  316  ? 188.042 160.556 204.443 1.00 119.82 ?  316  GLN A C     1 
ATOM   2440  O  O     . GLN A 1  316  ? 189.074 160.598 203.759 1.00 119.86 ?  316  GLN A O     1 
ATOM   2441  C  CB    . GLN A 1  316  ? 186.375 162.466 204.145 1.00 113.69 ?  316  GLN A CB    1 
ATOM   2442  C  CG    . GLN A 1  316  ? 185.243 161.538 203.704 1.00 132.43 ?  316  GLN A CG    1 
ATOM   2443  C  CD    . GLN A 1  316  ? 184.144 161.416 204.728 1.00 160.05 ?  316  GLN A CD    1 
ATOM   2444  O  OE1   . GLN A 1  316  ? 183.760 162.391 205.398 1.00 156.47 ?  316  GLN A OE1   1 
ATOM   2445  N  NE2   . GLN A 1  316  ? 183.581 160.216 204.838 1.00 153.70 ?  316  GLN A NE2   1 
ATOM   2446  N  N     . LYS A 1  317  ? 187.401 159.398 204.714 1.00 117.55 ?  317  LYS A N     1 
ATOM   2447  C  CA    . LYS A 1  317  ? 187.824 158.124 204.128 1.00 118.28 ?  317  LYS A CA    1 
ATOM   2448  C  C     . LYS A 1  317  ? 187.385 158.285 202.674 1.00 121.55 ?  317  LYS A C     1 
ATOM   2449  O  O     . LYS A 1  317  ? 186.195 158.152 202.373 1.00 120.94 ?  317  LYS A O     1 
ATOM   2450  C  CB    . LYS A 1  317  ? 187.111 156.946 204.820 1.00 121.68 ?  317  LYS A CB    1 
ATOM   2451  C  CG    . LYS A 1  317  ? 187.904 155.634 204.847 1.00 137.69 ?  317  LYS A CG    1 
ATOM   2452  C  CD    . LYS A 1  317  ? 187.108 154.520 205.574 1.00 145.59 ?  317  LYS A CD    1 
ATOM   2453  C  CE    . LYS A 1  317  ? 187.866 153.226 205.787 1.00 147.18 ?  317  LYS A CE    1 
ATOM   2454  N  NZ    . LYS A 1  317  ? 187.028 152.194 206.459 1.00 146.98 1  317  LYS A NZ    1 
ATOM   2455  N  N     . SER A 1  318  ? 188.333 158.781 201.838 1.00 117.17 ?  318  SER A N     1 
ATOM   2456  C  CA    . SER A 1  318  ? 188.258 159.155 200.411 1.00 116.00 ?  318  SER A CA    1 
ATOM   2457  C  C     . SER A 1  318  ? 189.378 160.173 200.122 1.00 120.37 ?  318  SER A C     1 
ATOM   2458  O  O     . SER A 1  318  ? 189.393 160.790 199.047 1.00 120.21 ?  318  SER A O     1 
ATOM   2459  C  CB    . SER A 1  318  ? 186.904 159.774 200.044 1.00 117.01 ?  318  SER A CB    1 
ATOM   2460  O  OG    . SER A 1  318  ? 186.725 161.079 200.572 1.00 121.87 ?  318  SER A OG    1 
ATOM   2461  N  N     . GLY A 1  319  ? 190.261 160.375 201.110 1.00 116.38 ?  319  GLY A N     1 
ATOM   2462  C  CA    . GLY A 1  319  ? 191.377 161.318 201.049 1.00 115.53 ?  319  GLY A CA    1 
ATOM   2463  C  C     . GLY A 1  319  ? 190.970 162.764 201.281 1.00 116.79 ?  319  GLY A C     1 
ATOM   2464  O  O     . GLY A 1  319  ? 191.645 163.494 202.019 1.00 116.32 ?  319  GLY A O     1 
ATOM   2465  N  N     . ARG A 1  320  ? 189.858 163.176 200.619 1.00 110.64 ?  320  ARG A N     1 
ATOM   2466  C  CA    . ARG A 1  320  ? 189.198 164.483 200.639 1.00 108.16 ?  320  ARG A CA    1 
ATOM   2467  C  C     . ARG A 1  320  ? 189.057 164.987 202.089 1.00 107.71 ?  320  ARG A C     1 
ATOM   2468  O  O     . ARG A 1  320  ? 188.480 164.272 202.901 1.00 107.52 ?  320  ARG A O     1 
ATOM   2469  C  CB    . ARG A 1  320  ? 187.817 164.326 199.969 1.00 109.23 ?  320  ARG A CB    1 
ATOM   2470  C  CG    . ARG A 1  320  ? 187.046 165.624 199.734 1.00 126.83 ?  320  ARG A CG    1 
ATOM   2471  C  CD    . ARG A 1  320  ? 185.917 165.860 200.737 1.00 144.32 ?  320  ARG A CD    1 
ATOM   2472  N  NE    . ARG A 1  320  ? 184.858 164.847 200.665 1.00 155.11 ?  320  ARG A NE    1 
ATOM   2473  C  CZ    . ARG A 1  320  ? 184.178 164.399 201.715 1.00 167.49 ?  320  ARG A CZ    1 
ATOM   2474  N  NH1   . ARG A 1  320  ? 184.435 164.866 202.930 1.00 152.96 1  320  ARG A NH1   1 
ATOM   2475  N  NH2   . ARG A 1  320  ? 183.243 163.472 201.560 1.00 154.44 ?  320  ARG A NH2   1 
ATOM   2476  N  N     . PRO A 1  321  ? 189.595 166.166 202.465 1.00 101.11 ?  321  PRO A N     1 
ATOM   2477  C  CA    . PRO A 1  321  ? 189.445 166.617 203.858 1.00 100.24 ?  321  PRO A CA    1 
ATOM   2478  C  C     . PRO A 1  321  ? 188.007 166.999 204.205 1.00 101.83 ?  321  PRO A C     1 
ATOM   2479  O  O     . PRO A 1  321  ? 187.235 167.387 203.320 1.00 99.66  ?  321  PRO A O     1 
ATOM   2480  C  CB    . PRO A 1  321  ? 190.389 167.814 203.947 1.00 101.74 ?  321  PRO A CB    1 
ATOM   2481  C  CG    . PRO A 1  321  ? 190.426 168.355 202.579 1.00 105.85 ?  321  PRO A CG    1 
ATOM   2482  C  CD    . PRO A 1  321  ? 190.326 167.161 201.660 1.00 101.99 ?  321  PRO A CD    1 
ATOM   2483  N  N     . VAL A 1  322  ? 187.646 166.860 205.492 1.00 98.09  ?  322  VAL A N     1 
ATOM   2484  C  CA    . VAL A 1  322  ? 186.309 167.190 205.966 1.00 97.17  ?  322  VAL A CA    1 
ATOM   2485  C  C     . VAL A 1  322  ? 186.090 168.697 205.941 1.00 99.62  ?  322  VAL A C     1 
ATOM   2486  O  O     . VAL A 1  322  ? 186.992 169.453 206.297 1.00 99.57  ?  322  VAL A O     1 
ATOM   2487  C  CB    . VAL A 1  322  ? 185.966 166.476 207.295 1.00 101.75 ?  322  VAL A CB    1 
ATOM   2488  C  CG1   . VAL A 1  322  ? 185.167 167.360 208.255 1.00 101.05 ?  322  VAL A CG1   1 
ATOM   2489  C  CG2   . VAL A 1  322  ? 185.231 165.164 207.012 1.00 102.08 ?  322  VAL A CG2   1 
ATOM   2490  N  N     . LYS A 1  323  ? 184.928 169.133 205.439 1.00 94.48  ?  323  LYS A N     1 
ATOM   2491  C  CA    . LYS A 1  323  ? 184.624 170.556 205.295 1.00 93.13  ?  323  LYS A CA    1 
ATOM   2492  C  C     . LYS A 1  323  ? 184.237 171.190 206.618 1.00 92.67  ?  323  LYS A C     1 
ATOM   2493  O  O     . LYS A 1  323  ? 183.116 171.000 207.084 1.00 92.79  ?  323  LYS A O     1 
ATOM   2494  C  CB    . LYS A 1  323  ? 183.546 170.782 204.216 1.00 96.88  ?  323  LYS A CB    1 
ATOM   2495  C  CG    . LYS A 1  323  ? 183.849 170.061 202.884 1.00 125.73 ?  323  LYS A CG    1 
ATOM   2496  C  CD    . LYS A 1  323  ? 182.693 169.185 202.382 1.00 136.89 ?  323  LYS A CD    1 
ATOM   2497  C  CE    . LYS A 1  323  ? 183.091 168.274 201.244 1.00 147.11 ?  323  LYS A CE    1 
ATOM   2498  N  NZ    . LYS A 1  323  ? 181.933 167.477 200.752 1.00 159.14 1  323  LYS A NZ    1 
ATOM   2499  N  N     . SER A 1  324  ? 185.175 171.936 207.230 1.00 85.54  ?  324  SER A N     1 
ATOM   2500  C  CA    . SER A 1  324  ? 184.993 172.659 208.499 1.00 83.34  ?  324  SER A CA    1 
ATOM   2501  C  C     . SER A 1  324  ? 183.838 173.685 208.428 1.00 83.19  ?  324  SER A C     1 
ATOM   2502  O  O     . SER A 1  324  ? 183.340 173.983 207.329 1.00 83.09  ?  324  SER A O     1 
ATOM   2503  C  CB    . SER A 1  324  ? 186.289 173.371 208.891 1.00 85.40  ?  324  SER A CB    1 
ATOM   2504  O  OG    . SER A 1  324  ? 187.084 173.862 207.818 1.00 87.16  ?  324  SER A OG    1 
ATOM   2505  N  N     . ILE A 1  325  ? 183.398 174.220 209.587 1.00 75.55  ?  325  ILE A N     1 
ATOM   2506  C  CA    . ILE A 1  325  ? 182.352 175.245 209.566 1.00 72.66  ?  325  ILE A CA    1 
ATOM   2507  C  C     . ILE A 1  325  ? 183.028 176.548 209.078 1.00 74.90  ?  325  ILE A C     1 
ATOM   2508  O  O     . ILE A 1  325  ? 182.435 177.285 208.285 1.00 73.23  ?  325  ILE A O     1 
ATOM   2509  C  CB    . ILE A 1  325  ? 181.590 175.421 210.921 1.00 75.06  ?  325  ILE A CB    1 
ATOM   2510  C  CG1   . ILE A 1  325  ? 181.047 174.101 211.487 1.00 74.13  ?  325  ILE A CG1   1 
ATOM   2511  C  CG2   . ILE A 1  325  ? 180.468 176.478 210.800 1.00 76.24  ?  325  ILE A CG2   1 
ATOM   2512  C  CD1   . ILE A 1  325  ? 180.375 174.247 212.829 1.00 73.02  ?  325  ILE A CD1   1 
ATOM   2513  N  N     . ARG A 1  326  ? 184.297 176.788 209.520 1.00 71.75  ?  326  ARG A N     1 
ATOM   2514  C  CA    . ARG A 1  326  ? 185.108 177.954 209.153 1.00 71.47  ?  326  ARG A CA    1 
ATOM   2515  C  C     . ARG A 1  326  ? 185.198 178.043 207.649 1.00 76.11  ?  326  ARG A C     1 
ATOM   2516  O  O     . ARG A 1  326  ? 185.026 179.122 207.090 1.00 75.40  ?  326  ARG A O     1 
ATOM   2517  C  CB    . ARG A 1  326  ? 186.524 177.893 209.764 1.00 72.21  ?  326  ARG A CB    1 
ATOM   2518  C  CG    . ARG A 1  326  ? 187.400 179.058 209.309 1.00 80.94  ?  326  ARG A CG    1 
ATOM   2519  C  CD    . ARG A 1  326  ? 188.787 179.070 209.895 1.00 89.88  ?  326  ARG A CD    1 
ATOM   2520  N  NE    . ARG A 1  326  ? 189.629 180.073 209.239 1.00 100.60 ?  326  ARG A NE    1 
ATOM   2521  C  CZ    . ARG A 1  326  ? 190.359 179.843 208.150 1.00 121.65 ?  326  ARG A CZ    1 
ATOM   2522  N  NH1   . ARG A 1  326  ? 190.359 178.641 207.581 1.00 115.51 1  326  ARG A NH1   1 
ATOM   2523  N  NH2   . ARG A 1  326  ? 191.102 180.810 207.626 1.00 106.48 ?  326  ARG A NH2   1 
ATOM   2524  N  N     . ALA A 1  327  ? 185.429 176.899 206.994 1.00 74.13  ?  327  ALA A N     1 
ATOM   2525  C  CA    . ALA A 1  327  ? 185.525 176.805 205.541 1.00 73.90  ?  327  ALA A CA    1 
ATOM   2526  C  C     . ALA A 1  327  ? 184.281 177.324 204.859 1.00 76.85  ?  327  ALA A C     1 
ATOM   2527  O  O     . ALA A 1  327  ? 184.400 177.984 203.821 1.00 76.90  ?  327  ALA A O     1 
ATOM   2528  C  CB    . ALA A 1  327  ? 185.768 175.371 205.133 1.00 75.18  ?  327  ALA A CB    1 
ATOM   2529  N  N     . ARG A 1  328  ? 183.096 177.051 205.461 1.00 72.58  ?  328  ARG A N     1 
ATOM   2530  C  CA    . ARG A 1  328  ? 181.778 177.423 204.940 1.00 71.65  ?  328  ARG A CA    1 
ATOM   2531  C  C     . ARG A 1  328  ? 181.575 178.918 204.855 1.00 75.37  ?  328  ARG A C     1 
ATOM   2532  O  O     . ARG A 1  328  ? 180.883 179.384 203.951 1.00 74.75  ?  328  ARG A O     1 
ATOM   2533  C  CB    . ARG A 1  328  ? 180.657 176.832 205.801 1.00 71.54  ?  328  ARG A CB    1 
ATOM   2534  C  CG    . ARG A 1  328  ? 180.505 175.318 205.775 1.00 80.50  ?  328  ARG A CG    1 
ATOM   2535  C  CD    . ARG A 1  328  ? 179.076 174.989 206.140 1.00 83.81  ?  328  ARG A CD    1 
ATOM   2536  N  NE    . ARG A 1  328  ? 178.821 173.557 206.262 1.00 90.26  ?  328  ARG A NE    1 
ATOM   2537  C  CZ    . ARG A 1  328  ? 177.655 173.047 206.647 1.00 99.77  ?  328  ARG A CZ    1 
ATOM   2538  N  NH1   . ARG A 1  328  ? 176.644 173.849 206.964 1.00 70.44  1  328  ARG A NH1   1 
ATOM   2539  N  NH2   . ARG A 1  328  ? 177.489 171.731 206.718 1.00 93.89  ?  328  ARG A NH2   1 
ATOM   2540  N  N     . LEU A 1  329  ? 182.143 179.667 205.806 1.00 71.58  ?  329  LEU A N     1 
ATOM   2541  C  CA    . LEU A 1  329  ? 181.950 181.111 205.856 1.00 70.85  ?  329  LEU A CA    1 
ATOM   2542  C  C     . LEU A 1  329  ? 183.037 181.890 205.122 1.00 78.01  ?  329  LEU A C     1 
ATOM   2543  O  O     . LEU A 1  329  ? 182.772 183.026 204.691 1.00 79.06  ?  329  LEU A O     1 
ATOM   2544  C  CB    . LEU A 1  329  ? 181.766 181.594 207.300 1.00 70.39  ?  329  LEU A CB    1 
ATOM   2545  C  CG    . LEU A 1  329  ? 181.067 180.636 208.266 1.00 74.96  ?  329  LEU A CG    1 
ATOM   2546  C  CD1   . LEU A 1  329  ? 181.035 181.200 209.631 1.00 75.97  ?  329  LEU A CD1   1 
ATOM   2547  C  CD2   . LEU A 1  329  ? 179.650 180.356 207.861 1.00 77.55  ?  329  LEU A CD2   1 
ATOM   2548  N  N     . LYS A 1  330  ? 184.238 181.259 204.948 1.00 74.74  ?  330  LYS A N     1 
ATOM   2549  C  CA    . LYS A 1  330  ? 185.443 181.779 204.287 1.00 74.84  ?  330  LYS A CA    1 
ATOM   2550  C  C     . LYS A 1  330  ? 185.134 182.270 202.894 1.00 79.92  ?  330  LYS A C     1 
ATOM   2551  O  O     . LYS A 1  330  ? 184.527 181.565 202.074 1.00 78.85  ?  330  LYS A O     1 
ATOM   2552  C  CB    . LYS A 1  330  ? 186.523 180.711 204.226 1.00 78.35  ?  330  LYS A CB    1 
ATOM   2553  C  CG    . LYS A 1  330  ? 187.825 181.038 204.944 1.00 93.58  ?  330  LYS A CG    1 
ATOM   2554  C  CD    . LYS A 1  330  ? 189.020 180.296 204.282 1.00 108.40 ?  330  LYS A CD    1 
ATOM   2555  C  CE    . LYS A 1  330  ? 189.017 178.773 204.424 1.00 122.02 ?  330  LYS A CE    1 
ATOM   2556  N  NZ    . LYS A 1  330  ? 189.208 178.058 203.126 1.00 125.00 1  330  LYS A NZ    1 
ATOM   2557  N  N     . GLY A 1  331  ? 185.580 183.495 202.677 1.00 78.69  ?  331  GLY A N     1 
ATOM   2558  C  CA    . GLY A 1  331  ? 185.345 184.376 201.534 1.00 79.01  ?  331  GLY A CA    1 
ATOM   2559  C  C     . GLY A 1  331  ? 185.256 183.914 200.091 1.00 80.79  ?  331  GLY A C     1 
ATOM   2560  O  O     . GLY A 1  331  ? 186.108 183.150 199.624 1.00 80.54  ?  331  GLY A O     1 
ATOM   2561  N  N     . LYS A 1  332  ? 184.301 184.562 199.352 1.00 74.97  ?  332  LYS A N     1 
ATOM   2562  C  CA    . LYS A 1  332  ? 183.898 184.425 197.947 1.00 74.13  ?  332  LYS A CA    1 
ATOM   2563  C  C     . LYS A 1  332  ? 183.600 183.015 197.744 1.00 84.10  ?  332  LYS A C     1 
ATOM   2564  O  O     . LYS A 1  332  ? 184.520 182.188 197.786 1.00 87.47  ?  332  LYS A O     1 
ATOM   2565  C  CB    . LYS A 1  332  ? 184.951 184.902 196.953 1.00 73.97  ?  332  LYS A CB    1 
ATOM   2566  C  CG    . LYS A 1  332  ? 184.379 185.010 195.547 1.00 65.99  ?  332  LYS A CG    1 
ATOM   2567  C  CD    . LYS A 1  332  ? 185.484 185.311 194.548 1.00 76.83  ?  332  LYS A CD    1 
ATOM   2568  C  CE    . LYS A 1  332  ? 184.936 185.668 193.190 1.00 91.60  ?  332  LYS A CE    1 
ATOM   2569  N  NZ    . LYS A 1  332  ? 185.971 185.601 192.124 1.00 100.92 1  332  LYS A NZ    1 
ATOM   2570  N  N     . GLU A 1  333  ? 182.319 182.703 197.521 1.00 80.49  ?  333  GLU A N     1 
ATOM   2571  C  CA    . GLU A 1  333  ? 181.778 181.331 197.470 1.00 79.79  ?  333  GLU A CA    1 
ATOM   2572  C  C     . GLU A 1  333  ? 181.744 180.985 198.952 1.00 84.23  ?  333  GLU A C     1 
ATOM   2573  O  O     . GLU A 1  333  ? 182.781 180.981 199.632 1.00 85.53  ?  333  GLU A O     1 
ATOM   2574  C  CB    . GLU A 1  333  ? 182.626 180.292 196.671 1.00 80.97  ?  333  GLU A CB    1 
ATOM   2575  C  CG    . GLU A 1  333  ? 183.252 180.788 195.378 1.00 91.06  ?  333  GLU A CG    1 
ATOM   2576  C  CD    . GLU A 1  333  ? 183.094 179.920 194.153 1.00 126.97 ?  333  GLU A CD    1 
ATOM   2577  O  OE1   . GLU A 1  333  ? 183.462 178.722 194.203 1.00 127.34 ?  333  GLU A OE1   1 
ATOM   2578  O  OE2   . GLU A 1  333  ? 182.654 180.468 193.116 1.00 133.71 -1 333  GLU A OE2   1 
ATOM   2579  N  N     . GLY A 1  334  ? 180.556 180.838 199.487 1.00 79.44  ?  334  GLY A N     1 
ATOM   2580  C  CA    . GLY A 1  334  ? 180.487 180.568 200.907 1.00 78.95  ?  334  GLY A CA    1 
ATOM   2581  C  C     . GLY A 1  334  ? 180.092 181.779 201.703 1.00 79.40  ?  334  GLY A C     1 
ATOM   2582  O  O     . GLY A 1  334  ? 180.793 182.801 201.754 1.00 78.85  ?  334  GLY A O     1 
ATOM   2583  N  N     . ARG A 1  335  ? 178.935 181.582 202.334 1.00 73.45  ?  335  ARG A N     1 
ATOM   2584  C  CA    . ARG A 1  335  ? 178.109 182.417 203.172 1.00 71.41  ?  335  ARG A CA    1 
ATOM   2585  C  C     . ARG A 1  335  ? 178.189 183.885 202.914 1.00 73.39  ?  335  ARG A C     1 
ATOM   2586  O  O     . ARG A 1  335  ? 177.647 184.335 201.914 1.00 71.53  ?  335  ARG A O     1 
ATOM   2587  C  CB    . ARG A 1  335  ? 178.138 182.000 204.651 1.00 68.24  ?  335  ARG A CB    1 
ATOM   2588  C  CG    . ARG A 1  335  ? 176.727 181.762 205.173 1.00 70.46  ?  335  ARG A CG    1 
ATOM   2589  C  CD    . ARG A 1  335  ? 176.288 180.302 205.195 1.00 69.42  ?  335  ARG A CD    1 
ATOM   2590  N  NE    . ARG A 1  335  ? 176.255 179.663 203.883 1.00 69.34  ?  335  ARG A NE    1 
ATOM   2591  C  CZ    . ARG A 1  335  ? 176.571 178.391 203.668 1.00 86.25  ?  335  ARG A CZ    1 
ATOM   2592  N  NH1   . ARG A 1  335  ? 176.906 177.604 204.683 1.00 77.25  1  335  ARG A NH1   1 
ATOM   2593  N  NH2   . ARG A 1  335  ? 176.556 177.894 202.436 1.00 72.62  ?  335  ARG A NH2   1 
ATOM   2594  N  N     . ILE A 1  336  ? 178.918 184.616 203.770 1.00 69.83  ?  336  ILE A N     1 
ATOM   2595  C  CA    . ILE A 1  336  ? 179.084 186.067 203.739 1.00 68.00  ?  336  ILE A CA    1 
ATOM   2596  C  C     . ILE A 1  336  ? 179.199 186.602 202.327 1.00 70.84  ?  336  ILE A C     1 
ATOM   2597  O  O     . ILE A 1  336  ? 178.266 187.232 201.806 1.00 69.60  ?  336  ILE A O     1 
ATOM   2598  C  CB    . ILE A 1  336  ? 180.268 186.485 204.648 1.00 70.31  ?  336  ILE A CB    1 
ATOM   2599  C  CG1   . ILE A 1  336  ? 180.193 185.768 206.003 1.00 70.78  ?  336  ILE A CG1   1 
ATOM   2600  C  CG2   . ILE A 1  336  ? 180.362 188.018 204.809 1.00 69.38  ?  336  ILE A CG2   1 
ATOM   2601  C  CD1   . ILE A 1  336  ? 179.152 186.253 206.951 1.00 74.51  ?  336  ILE A CD1   1 
ATOM   2602  N  N     . ARG A 1  337  ? 180.305 186.283 201.690 1.00 66.86  ?  337  ARG A N     1 
ATOM   2603  C  CA    . ARG A 1  337  ? 180.545 186.796 200.375 1.00 65.96  ?  337  ARG A CA    1 
ATOM   2604  C  C     . ARG A 1  337  ? 179.717 186.196 199.241 1.00 69.30  ?  337  ARG A C     1 
ATOM   2605  O  O     . ARG A 1  337  ? 179.235 186.948 198.390 1.00 68.95  ?  337  ARG A O     1 
ATOM   2606  C  CB    . ARG A 1  337  ? 182.025 186.747 200.114 1.00 65.92  ?  337  ARG A CB    1 
ATOM   2607  C  CG    . ARG A 1  337  ? 182.636 188.117 200.096 1.00 69.60  ?  337  ARG A CG    1 
ATOM   2608  C  CD    . ARG A 1  337  ? 183.540 188.215 198.900 1.00 64.04  ?  337  ARG A CD    1 
ATOM   2609  N  NE    . ARG A 1  337  ? 184.939 187.969 199.214 1.00 59.91  ?  337  ARG A NE    1 
ATOM   2610  C  CZ    . ARG A 1  337  ? 185.912 188.069 198.323 1.00 78.94  ?  337  ARG A CZ    1 
ATOM   2611  N  NH1   . ARG A 1  337  ? 185.637 188.396 197.061 1.00 48.29  1  337  ARG A NH1   1 
ATOM   2612  N  NH2   . ARG A 1  337  ? 187.173 187.859 198.686 1.00 89.05  ?  337  ARG A NH2   1 
ATOM   2613  N  N     . GLY A 1  338  ? 179.525 184.880 199.250 1.00 65.03  ?  338  GLY A N     1 
ATOM   2614  C  CA    . GLY A 1  338  ? 178.813 184.209 198.167 1.00 64.56  ?  338  GLY A CA    1 
ATOM   2615  C  C     . GLY A 1  338  ? 177.320 183.938 198.276 1.00 67.71  ?  338  GLY A C     1 
ATOM   2616  O  O     . GLY A 1  338  ? 176.674 183.571 197.281 1.00 68.05  ?  338  GLY A O     1 
ATOM   2617  N  N     . ASN A 1  339  ? 176.772 184.026 199.475 1.00 62.06  ?  339  ASN A N     1 
ATOM   2618  C  CA    . ASN A 1  339  ? 175.354 183.760 199.667 1.00 60.19  ?  339  ASN A CA    1 
ATOM   2619  C  C     . ASN A 1  339  ? 174.659 184.980 200.235 1.00 62.58  ?  339  ASN A C     1 
ATOM   2620  O  O     . ASN A 1  339  ? 173.434 185.034 200.196 1.00 62.54  ?  339  ASN A O     1 
ATOM   2621  C  CB    . ASN A 1  339  ? 175.169 182.579 200.614 1.00 56.57  ?  339  ASN A CB    1 
ATOM   2622  C  CG    . ASN A 1  339  ? 175.605 181.274 200.049 1.00 72.66  ?  339  ASN A CG    1 
ATOM   2623  O  OD1   . ASN A 1  339  ? 176.559 180.655 200.539 1.00 62.56  ?  339  ASN A OD1   1 
ATOM   2624  N  ND2   . ASN A 1  339  ? 174.883 180.805 199.031 1.00 69.27  ?  339  ASN A ND2   1 
ATOM   2625  N  N     . LEU A 1  340  ? 175.426 185.953 200.766 1.00 57.12  ?  340  LEU A N     1 
ATOM   2626  C  CA    . LEU A 1  340  ? 174.857 187.114 201.421 1.00 56.20  ?  340  LEU A CA    1 
ATOM   2627  C  C     . LEU A 1  340  ? 175.153 188.469 200.764 1.00 61.19  ?  340  LEU A C     1 
ATOM   2628  O  O     . LEU A 1  340  ? 174.209 189.233 200.512 1.00 60.14  ?  340  LEU A O     1 
ATOM   2629  C  CB    . LEU A 1  340  ? 175.134 187.072 202.945 1.00 56.03  ?  340  LEU A CB    1 
ATOM   2630  C  CG    . LEU A 1  340  ? 174.267 186.079 203.727 1.00 59.80  ?  340  LEU A CG    1 
ATOM   2631  C  CD1   . LEU A 1  340  ? 175.027 185.441 204.791 1.00 60.32  ?  340  LEU A CD1   1 
ATOM   2632  C  CD2   . LEU A 1  340  ? 173.071 186.745 204.329 1.00 62.46  ?  340  LEU A CD2   1 
ATOM   2633  N  N     . MET A 1  341  ? 176.435 188.767 200.470 1.00 59.39  ?  341  MET A N     1 
ATOM   2634  C  CA    . MET A 1  341  ? 176.789 190.022 199.786 1.00 60.64  ?  341  MET A CA    1 
ATOM   2635  C  C     . MET A 1  341  ? 176.326 189.957 198.303 1.00 63.52  ?  341  MET A C     1 
ATOM   2636  O  O     . MET A 1  341  ? 176.032 190.976 197.676 1.00 62.61  ?  341  MET A O     1 
ATOM   2637  C  CB    . MET A 1  341  ? 178.302 190.327 199.881 1.00 64.03  ?  341  MET A CB    1 
ATOM   2638  C  CG    . MET A 1  341  ? 178.792 190.650 201.264 1.00 69.33  ?  341  MET A CG    1 
ATOM   2639  S  SD    . MET A 1  341  ? 177.777 191.838 202.175 1.00 75.48  ?  341  MET A SD    1 
ATOM   2640  C  CE    . MET A 1  341  ? 178.487 193.356 201.620 1.00 72.88  ?  341  MET A CE    1 
ATOM   2641  N  N     . GLY A 1  342  ? 176.309 188.737 197.782 1.00 59.32  ?  342  GLY A N     1 
ATOM   2642  C  CA    . GLY A 1  342  ? 175.852 188.373 196.454 1.00 58.26  ?  342  GLY A CA    1 
ATOM   2643  C  C     . GLY A 1  342  ? 174.914 187.198 196.626 1.00 60.39  ?  342  GLY A C     1 
ATOM   2644  O  O     . GLY A 1  342  ? 175.026 186.445 197.600 1.00 60.13  ?  342  GLY A O     1 
ATOM   2645  N  N     . LYS A 1  343  ? 173.988 187.037 195.697 1.00 55.14  ?  343  LYS A N     1 
ATOM   2646  C  CA    . LYS A 1  343  ? 172.957 186.013 195.756 1.00 54.77  ?  343  LYS A CA    1 
ATOM   2647  C  C     . LYS A 1  343  ? 172.605 185.565 194.310 1.00 60.29  ?  343  LYS A C     1 
ATOM   2648  O  O     . LYS A 1  343  ? 172.617 186.394 193.388 1.00 60.07  ?  343  LYS A O     1 
ATOM   2649  C  CB    . LYS A 1  343  ? 171.693 186.692 196.401 1.00 56.19  ?  343  LYS A CB    1 
ATOM   2650  C  CG    . LYS A 1  343  ? 171.047 185.991 197.601 1.00 55.55  ?  343  LYS A CG    1 
ATOM   2651  C  CD    . LYS A 1  343  ? 170.269 186.927 198.535 1.00 54.93  ?  343  LYS A CD    1 
ATOM   2652  C  CE    . LYS A 1  343  ? 171.144 187.320 199.714 1.00 69.98  ?  343  LYS A CE    1 
ATOM   2653  N  NZ    . LYS A 1  343  ? 170.548 188.287 200.681 1.00 75.78  1  343  LYS A NZ    1 
ATOM   2654  N  N     . ARG A 1  344  ? 172.231 184.291 194.105 1.00 57.62  ?  344  ARG A N     1 
ATOM   2655  C  CA    . ARG A 1  344  ? 171.674 183.935 192.791 1.00 57.90  ?  344  ARG A CA    1 
ATOM   2656  C  C     . ARG A 1  344  ? 170.195 184.455 192.871 1.00 62.36  ?  344  ARG A C     1 
ATOM   2657  O  O     . ARG A 1  344  ? 169.668 184.515 193.978 1.00 63.34  ?  344  ARG A O     1 
ATOM   2658  C  CB    . ARG A 1  344  ? 171.838 182.440 192.454 1.00 58.25  ?  344  ARG A CB    1 
ATOM   2659  C  CG    . ARG A 1  344  ? 172.702 182.270 191.212 1.00 64.30  ?  344  ARG A CG    1 
ATOM   2660  C  CD    . ARG A 1  344  ? 173.601 181.037 191.122 1.00 78.37  ?  344  ARG A CD    1 
ATOM   2661  N  NE    . ARG A 1  344  ? 174.695 181.308 190.168 1.00 107.42 ?  344  ARG A NE    1 
ATOM   2662  C  CZ    . ARG A 1  344  ? 174.619 181.236 188.827 1.00 130.39 ?  344  ARG A CZ    1 
ATOM   2663  N  NH1   . ARG A 1  344  ? 173.502 180.820 188.235 1.00 120.61 1  344  ARG A NH1   1 
ATOM   2664  N  NH2   . ARG A 1  344  ? 175.676 181.536 188.076 1.00 112.78 ?  344  ARG A NH2   1 
ATOM   2665  N  N     . VAL A 1  345  ? 169.599 185.011 191.797 1.00 57.67  ?  345  VAL A N     1 
ATOM   2666  C  CA    . VAL A 1  345  ? 168.281 185.667 191.936 1.00 56.81  ?  345  VAL A CA    1 
ATOM   2667  C  C     . VAL A 1  345  ? 167.233 185.271 190.906 1.00 61.79  ?  345  VAL A C     1 
ATOM   2668  O  O     . VAL A 1  345  ? 167.592 184.961 189.776 1.00 62.39  ?  345  VAL A O     1 
ATOM   2669  C  CB    . VAL A 1  345  ? 168.409 187.227 192.052 1.00 59.89  ?  345  VAL A CB    1 
ATOM   2670  C  CG1   . VAL A 1  345  ? 169.260 187.642 193.248 1.00 59.39  ?  345  VAL A CG1   1 
ATOM   2671  C  CG2   . VAL A 1  345  ? 168.938 187.866 190.766 1.00 59.57  ?  345  VAL A CG2   1 
ATOM   2672  N  N     . ASP A 1  346  ? 165.939 185.328 191.270 1.00 59.03  ?  346  ASP A N     1 
ATOM   2673  C  CA    . ASP A 1  346  ? 164.817 185.052 190.344 1.00 59.72  ?  346  ASP A CA    1 
ATOM   2674  C  C     . ASP A 1  346  ? 164.548 186.340 189.543 1.00 62.95  ?  346  ASP A C     1 
ATOM   2675  O  O     . ASP A 1  346  ? 165.061 187.400 189.919 1.00 61.22  ?  346  ASP A O     1 
ATOM   2676  C  CB    . ASP A 1  346  ? 163.535 184.639 191.112 1.00 62.53  ?  346  ASP A CB    1 
ATOM   2677  C  CG    . ASP A 1  346  ? 163.587 183.343 191.928 1.00 77.87  ?  346  ASP A CG    1 
ATOM   2678  O  OD1   . ASP A 1  346  ? 164.297 182.389 191.494 1.00 77.84  ?  346  ASP A OD1   1 
ATOM   2679  O  OD2   . ASP A 1  346  ? 162.834 183.245 192.952 1.00 82.22  -1 346  ASP A OD2   1 
ATOM   2680  N  N     . PHE A 1  347  ? 163.746 186.262 188.455 1.00 61.01  ?  347  PHE A N     1 
ATOM   2681  C  CA    . PHE A 1  347  ? 163.433 187.435 187.600 1.00 62.00  ?  347  PHE A CA    1 
ATOM   2682  C  C     . PHE A 1  347  ? 164.684 188.049 186.950 1.00 67.57  ?  347  PHE A C     1 
ATOM   2683  O  O     . PHE A 1  347  ? 164.826 189.269 186.792 1.00 68.46  ?  347  PHE A O     1 
ATOM   2684  C  CB    . PHE A 1  347  ? 162.547 188.476 188.313 1.00 64.16  ?  347  PHE A CB    1 
ATOM   2685  C  CG    . PHE A 1  347  ? 161.341 187.811 188.905 1.00 66.82  ?  347  PHE A CG    1 
ATOM   2686  C  CD1   . PHE A 1  347  ? 160.212 187.575 188.136 1.00 70.11  ?  347  PHE A CD1   1 
ATOM   2687  C  CD2   . PHE A 1  347  ? 161.352 187.361 190.220 1.00 71.04  ?  347  PHE A CD2   1 
ATOM   2688  C  CE1   . PHE A 1  347  ? 159.120 186.890 188.663 1.00 71.51  ?  347  PHE A CE1   1 
ATOM   2689  C  CE2   . PHE A 1  347  ? 160.260 186.672 190.749 1.00 74.43  ?  347  PHE A CE2   1 
ATOM   2690  C  CZ    . PHE A 1  347  ? 159.153 186.435 189.961 1.00 72.18  ?  347  PHE A CZ    1 
ATOM   2691  N  N     . SER A 1  348  ? 165.596 187.161 186.600 1.00 62.92  ?  348  SER A N     1 
ATOM   2692  C  CA    . SER A 1  348  ? 166.851 187.454 185.949 1.00 62.29  ?  348  SER A CA    1 
ATOM   2693  C  C     . SER A 1  348  ? 166.738 186.754 184.592 1.00 63.12  ?  348  SER A C     1 
ATOM   2694  O  O     . SER A 1  348  ? 165.917 185.845 184.469 1.00 63.63  ?  348  SER A O     1 
ATOM   2695  C  CB    . SER A 1  348  ? 167.995 186.864 186.764 1.00 67.51  ?  348  SER A CB    1 
ATOM   2696  O  OG    . SER A 1  348  ? 167.796 185.470 186.970 1.00 79.52  ?  348  SER A OG    1 
ATOM   2697  N  N     . ALA A 1  349  ? 167.521 187.188 183.580 1.00 54.96  ?  349  ALA A N     1 
ATOM   2698  C  CA    . ALA A 1  349  ? 167.560 186.646 182.224 1.00 52.08  ?  349  ALA A CA    1 
ATOM   2699  C  C     . ALA A 1  349  ? 168.860 187.053 181.567 1.00 55.90  ?  349  ALA A C     1 
ATOM   2700  O  O     . ALA A 1  349  ? 169.368 188.164 181.798 1.00 57.04  ?  349  ALA A O     1 
ATOM   2701  C  CB    . ALA A 1  349  ? 166.399 187.183 181.422 1.00 52.20  ?  349  ALA A CB    1 
ATOM   2702  N  N     . ARG A 1  350  ? 169.422 186.168 180.747 1.00 50.92  ?  350  ARG A N     1 
ATOM   2703  C  CA    . ARG A 1  350  ? 170.675 186.493 180.061 1.00 50.32  ?  350  ARG A CA    1 
ATOM   2704  C  C     . ARG A 1  350  ? 170.776 185.921 178.638 1.00 54.40  ?  350  ARG A C     1 
ATOM   2705  O  O     . ARG A 1  350  ? 170.307 184.809 178.391 1.00 53.35  ?  350  ARG A O     1 
ATOM   2706  C  CB    . ARG A 1  350  ? 171.857 186.113 180.939 1.00 48.33  ?  350  ARG A CB    1 
ATOM   2707  C  CG    . ARG A 1  350  ? 173.178 186.173 180.269 1.00 56.69  ?  350  ARG A CG    1 
ATOM   2708  C  CD    . ARG A 1  350  ? 174.043 185.069 180.811 1.00 63.24  ?  350  ARG A CD    1 
ATOM   2709  N  NE    . ARG A 1  350  ? 175.414 185.224 180.338 1.00 67.66  ?  350  ARG A NE    1 
ATOM   2710  C  CZ    . ARG A 1  350  ? 176.294 186.074 180.852 1.00 74.33  ?  350  ARG A CZ    1 
ATOM   2711  N  NH1   . ARG A 1  350  ? 175.957 186.861 181.866 1.00 54.61  1  350  ARG A NH1   1 
ATOM   2712  N  NH2   . ARG A 1  350  ? 177.518 186.142 180.358 1.00 70.55  ?  350  ARG A NH2   1 
ATOM   2713  N  N     . THR A 1  351  ? 171.333 186.719 177.692 1.00 52.10  ?  351  THR A N     1 
ATOM   2714  C  CA    . THR A 1  351  ? 171.529 186.339 176.284 1.00 52.83  ?  351  THR A CA    1 
ATOM   2715  C  C     . THR A 1  351  ? 172.541 187.207 175.591 1.00 59.33  ?  351  THR A C     1 
ATOM   2716  O  O     . THR A 1  351  ? 172.964 188.214 176.157 1.00 60.19  ?  351  THR A O     1 
ATOM   2717  C  CB    . THR A 1  351  ? 170.216 186.246 175.475 1.00 58.77  ?  351  THR A CB    1 
ATOM   2718  O  OG1   . THR A 1  351  ? 170.511 185.480 174.318 1.00 59.54  ?  351  THR A OG1   1 
ATOM   2719  C  CG2   . THR A 1  351  ? 169.655 187.606 175.053 1.00 54.72  ?  351  THR A CG2   1 
ATOM   2720  N  N     . VAL A 1  352  ? 172.903 186.825 174.347 1.00 56.24  ?  352  VAL A N     1 
ATOM   2721  C  CA    . VAL A 1  352  ? 173.831 187.542 173.473 1.00 55.91  ?  352  VAL A CA    1 
ATOM   2722  C  C     . VAL A 1  352  ? 173.261 188.907 173.117 1.00 60.47  ?  352  VAL A C     1 
ATOM   2723  O  O     . VAL A 1  352  ? 172.097 189.000 172.737 1.00 61.38  ?  352  VAL A O     1 
ATOM   2724  C  CB    . VAL A 1  352  ? 174.091 186.730 172.196 1.00 59.73  ?  352  VAL A CB    1 
ATOM   2725  C  CG1   . VAL A 1  352  ? 174.994 187.488 171.244 1.00 60.10  ?  352  VAL A CG1   1 
ATOM   2726  C  CG2   . VAL A 1  352  ? 174.703 185.389 172.532 1.00 59.93  ?  352  VAL A CG2   1 
ATOM   2727  N  N     . ILE A 1  353  ? 174.059 189.959 173.253 1.00 56.31  ?  353  ILE A N     1 
ATOM   2728  C  CA    . ILE A 1  353  ? 173.610 191.286 172.857 1.00 56.43  ?  353  ILE A CA    1 
ATOM   2729  C  C     . ILE A 1  353  ? 174.009 191.575 171.435 1.00 63.22  ?  353  ILE A C     1 
ATOM   2730  O  O     . ILE A 1  353  ? 175.033 191.064 170.957 1.00 64.73  ?  353  ILE A O     1 
ATOM   2731  C  CB    . ILE A 1  353  ? 174.019 192.440 173.814 1.00 59.30  ?  353  ILE A CB    1 
ATOM   2732  C  CG1   . ILE A 1  353  ? 175.489 192.386 174.266 1.00 58.88  ?  353  ILE A CG1   1 
ATOM   2733  C  CG2   . ILE A 1  353  ? 173.115 192.478 174.994 1.00 61.16  ?  353  ILE A CG2   1 
ATOM   2734  C  CD1   . ILE A 1  353  ? 176.267 193.545 173.944 1.00 52.42  ?  353  ILE A CD1   1 
ATOM   2735  N  N     . SER A 1  354  ? 173.186 192.384 170.757 1.00 61.01  ?  354  SER A N     1 
ATOM   2736  C  CA    . SER A 1  354  ? 173.413 192.918 169.412 1.00 62.29  ?  354  SER A CA    1 
ATOM   2737  C  C     . SER A 1  354  ? 172.862 194.367 169.292 1.00 68.37  ?  354  SER A C     1 
ATOM   2738  O  O     . SER A 1  354  ? 172.003 194.767 170.076 1.00 68.17  ?  354  SER A O     1 
ATOM   2739  C  CB    . SER A 1  354  ? 173.021 191.947 168.293 1.00 65.62  ?  354  SER A CB    1 
ATOM   2740  O  OG    . SER A 1  354  ? 171.673 191.521 168.357 1.00 74.37  ?  354  SER A OG    1 
ATOM   2741  N  N     . GLY A 1  355  ? 173.475 195.179 168.442 1.00 66.65  ?  355  GLY A N     1 
ATOM   2742  C  CA    . GLY A 1  355  ? 173.107 196.588 168.311 1.00 66.83  ?  355  GLY A CA    1 
ATOM   2743  C  C     . GLY A 1  355  ? 171.909 196.850 167.438 1.00 69.82  ?  355  GLY A C     1 
ATOM   2744  O  O     . GLY A 1  355  ? 171.490 195.966 166.676 1.00 71.59  ?  355  GLY A O     1 
ATOM   2745  N  N     . ASP A 1  356  ? 171.351 198.065 167.547 1.00 62.43  ?  356  ASP A N     1 
ATOM   2746  C  CA    . ASP A 1  356  ? 170.195 198.433 166.756 1.00 61.66  ?  356  ASP A CA    1 
ATOM   2747  C  C     . ASP A 1  356  ? 170.128 199.932 166.523 1.00 69.17  ?  356  ASP A C     1 
ATOM   2748  O  O     . ASP A 1  356  ? 169.995 200.684 167.495 1.00 70.69  ?  356  ASP A O     1 
ATOM   2749  C  CB    . ASP A 1  356  ? 168.908 197.925 167.395 1.00 61.96  ?  356  ASP A CB    1 
ATOM   2750  C  CG    . ASP A 1  356  ? 167.768 197.780 166.422 1.00 75.00  ?  356  ASP A CG    1 
ATOM   2751  O  OD1   . ASP A 1  356  ? 167.588 198.678 165.580 1.00 77.56  ?  356  ASP A OD1   1 
ATOM   2752  O  OD2   . ASP A 1  356  ? 167.030 196.780 166.519 1.00 81.75  -1 356  ASP A OD2   1 
ATOM   2753  N  N     . PRO A 1  357  ? 170.187 200.399 165.243 1.00 65.53  ?  357  PRO A N     1 
ATOM   2754  C  CA    . PRO A 1  357  ? 170.093 201.848 164.977 1.00 65.72  ?  357  PRO A CA    1 
ATOM   2755  C  C     . PRO A 1  357  ? 168.662 202.380 165.142 1.00 68.98  ?  357  PRO A C     1 
ATOM   2756  O  O     . PRO A 1  357  ? 168.453 203.597 165.180 1.00 69.09  ?  357  PRO A O     1 
ATOM   2757  C  CB    . PRO A 1  357  ? 170.554 201.960 163.509 1.00 67.96  ?  357  PRO A CB    1 
ATOM   2758  C  CG    . PRO A 1  357  ? 171.129 200.611 163.143 1.00 70.98  ?  357  PRO A CG    1 
ATOM   2759  C  CD    . PRO A 1  357  ? 170.386 199.656 163.986 1.00 66.24  ?  357  PRO A CD    1 
ATOM   2760  N  N     . ASN A 1  358  ? 167.683 201.461 165.248 1.00 64.48  ?  358  ASN A N     1 
ATOM   2761  C  CA    . ASN A 1  358  ? 166.266 201.772 165.361 1.00 64.65  ?  358  ASN A CA    1 
ATOM   2762  C  C     . ASN A 1  358  ? 165.645 201.664 166.728 1.00 71.57  ?  358  ASN A C     1 
ATOM   2763  O  O     . ASN A 1  358  ? 164.428 201.839 166.876 1.00 71.98  ?  358  ASN A O     1 
ATOM   2764  C  CB    . ASN A 1  358  ? 165.480 201.032 164.328 1.00 61.85  ?  358  ASN A CB    1 
ATOM   2765  C  CG    . ASN A 1  358  ? 165.806 201.552 162.979 1.00 75.22  ?  358  ASN A CG    1 
ATOM   2766  O  OD1   . ASN A 1  358  ? 165.750 202.762 162.754 1.00 61.54  ?  358  ASN A OD1   1 
ATOM   2767  N  ND2   . ASN A 1  358  ? 166.224 200.659 162.081 1.00 69.36  ?  358  ASN A ND2   1 
ATOM   2768  N  N     . LEU A 1  359  ? 166.467 201.411 167.741 1.00 69.31  ?  359  LEU A N     1 
ATOM   2769  C  CA    . LEU A 1  359  ? 165.964 201.440 169.104 1.00 68.91  ?  359  LEU A CA    1 
ATOM   2770  C  C     . LEU A 1  359  ? 166.256 202.845 169.642 1.00 75.72  ?  359  LEU A C     1 
ATOM   2771  O  O     . LEU A 1  359  ? 167.153 203.546 169.132 1.00 76.59  ?  359  LEU A O     1 
ATOM   2772  C  CB    . LEU A 1  359  ? 166.580 200.359 170.008 1.00 67.51  ?  359  LEU A CB    1 
ATOM   2773  C  CG    . LEU A 1  359  ? 166.142 198.909 169.817 1.00 70.52  ?  359  LEU A CG    1 
ATOM   2774  C  CD1   . LEU A 1  359  ? 166.423 198.116 171.067 1.00 69.22  ?  359  LEU A CD1   1 
ATOM   2775  C  CD2   . LEU A 1  359  ? 164.665 198.787 169.426 1.00 72.18  ?  359  LEU A CD2   1 
ATOM   2776  N  N     . GLU A 1  360  ? 165.442 203.291 170.610 1.00 71.16  ?  360  GLU A N     1 
ATOM   2777  C  CA    . GLU A 1  360  ? 165.645 204.585 171.224 1.00 69.87  ?  360  GLU A CA    1 
ATOM   2778  C  C     . GLU A 1  360  ? 166.735 204.390 172.281 1.00 71.44  ?  360  GLU A C     1 
ATOM   2779  O  O     . GLU A 1  360  ? 166.945 203.242 172.688 1.00 70.21  ?  360  GLU A O     1 
ATOM   2780  C  CB    . GLU A 1  360  ? 164.317 205.166 171.725 1.00 70.91  ?  360  GLU A CB    1 
ATOM   2781  C  CG    . GLU A 1  360  ? 163.633 206.005 170.652 1.00 82.61  ?  360  GLU A CG    1 
ATOM   2782  C  CD    . GLU A 1  360  ? 164.323 207.309 170.248 1.00 122.22 ?  360  GLU A CD    1 
ATOM   2783  O  OE1   . GLU A 1  360  ? 165.208 207.787 171.006 1.00 132.40 ?  360  GLU A OE1   1 
ATOM   2784  O  OE2   . GLU A 1  360  ? 163.960 207.866 169.182 1.00 109.82 -1 360  GLU A OE2   1 
ATOM   2785  N  N     . LEU A 1  361  ? 167.512 205.450 172.628 1.00 66.67  ?  361  LEU A N     1 
ATOM   2786  C  CA    . LEU A 1  361  ? 168.643 205.312 173.569 1.00 65.36  ?  361  LEU A CA    1 
ATOM   2787  C  C     . LEU A 1  361  ? 168.329 204.453 174.810 1.00 69.15  ?  361  LEU A C     1 
ATOM   2788  O  O     . LEU A 1  361  ? 169.034 203.456 175.099 1.00 69.50  ?  361  LEU A O     1 
ATOM   2789  C  CB    . LEU A 1  361  ? 169.219 206.692 173.979 1.00 64.97  ?  361  LEU A CB    1 
ATOM   2790  C  CG    . LEU A 1  361  ? 170.539 206.716 174.795 1.00 67.17  ?  361  LEU A CG    1 
ATOM   2791  C  CD1   . LEU A 1  361  ? 171.757 206.726 173.886 1.00 66.98  ?  361  LEU A CD1   1 
ATOM   2792  C  CD2   . LEU A 1  361  ? 170.588 207.921 175.725 1.00 66.48  ?  361  LEU A CD2   1 
ATOM   2793  N  N     . ASP A 1  362  ? 167.220 204.814 175.479 1.00 63.89  ?  362  ASP A N     1 
ATOM   2794  C  CA    . ASP A 1  362  ? 166.785 204.208 176.716 1.00 63.27  ?  362  ASP A CA    1 
ATOM   2795  C  C     . ASP A 1  362  ? 166.028 202.904 176.630 1.00 65.10  ?  362  ASP A C     1 
ATOM   2796  O  O     . ASP A 1  362  ? 165.654 202.365 177.673 1.00 66.09  ?  362  ASP A O     1 
ATOM   2797  C  CB    . ASP A 1  362  ? 166.098 205.233 177.635 1.00 66.09  ?  362  ASP A CB    1 
ATOM   2798  C  CG    . ASP A 1  362  ? 164.651 205.580 177.332 1.00 79.39  ?  362  ASP A CG    1 
ATOM   2799  O  OD1   . ASP A 1  362  ? 164.241 205.468 176.145 1.00 77.92  ?  362  ASP A OD1   1 
ATOM   2800  O  OD2   . ASP A 1  362  ? 163.947 206.028 178.266 1.00 89.52  -1 362  ASP A OD2   1 
ATOM   2801  N  N     . GLN A 1  363  ? 165.807 202.374 175.433 1.00 57.96  ?  363  GLN A N     1 
ATOM   2802  C  CA    . GLN A 1  363  ? 165.128 201.086 175.382 1.00 55.67  ?  363  GLN A CA    1 
ATOM   2803  C  C     . GLN A 1  363  ? 166.075 199.909 175.194 1.00 58.52  ?  363  GLN A C     1 
ATOM   2804  O  O     . GLN A 1  363  ? 167.302 200.098 175.017 1.00 59.33  ?  363  GLN A O     1 
ATOM   2805  C  CB    . GLN A 1  363  ? 163.879 201.068 174.488 1.00 56.73  ?  363  GLN A CB    1 
ATOM   2806  C  CG    . GLN A 1  363  ? 164.061 201.608 173.065 1.00 66.78  ?  363  GLN A CG    1 
ATOM   2807  C  CD    . GLN A 1  363  ? 162.750 201.778 172.326 1.00 77.33  ?  363  GLN A CD    1 
ATOM   2808  O  OE1   . GLN A 1  363  ? 162.709 201.889 171.087 1.00 68.26  ?  363  GLN A OE1   1 
ATOM   2809  N  NE2   . GLN A 1  363  ? 161.637 201.746 173.065 1.00 70.38  ?  363  GLN A NE2   1 
ATOM   2810  N  N     . VAL A 1  364  ? 165.506 198.699 175.361 1.00 52.47  ?  364  VAL A N     1 
ATOM   2811  C  CA    . VAL A 1  364  ? 166.156 197.395 175.273 1.00 50.76  ?  364  VAL A CA    1 
ATOM   2812  C  C     . VAL A 1  364  ? 165.227 196.406 174.604 1.00 59.42  ?  364  VAL A C     1 
ATOM   2813  O  O     . VAL A 1  364  ? 164.082 196.167 175.052 1.00 59.57  ?  364  VAL A O     1 
ATOM   2814  C  CB    . VAL A 1  364  ? 166.729 196.833 176.611 1.00 50.61  ?  364  VAL A CB    1 
ATOM   2815  C  CG1   . VAL A 1  364  ? 165.663 196.691 177.699 1.00 48.57  ?  364  VAL A CG1   1 
ATOM   2816  C  CG2   . VAL A 1  364  ? 167.433 195.506 176.370 1.00 49.82  ?  364  VAL A CG2   1 
ATOM   2817  N  N     . GLY A 1  365  ? 165.753 195.842 173.527 1.00 57.24  ?  365  GLY A N     1 
ATOM   2818  C  CA    . GLY A 1  365  ? 165.078 194.821 172.745 1.00 56.70  ?  365  GLY A CA    1 
ATOM   2819  C  C     . GLY A 1  365  ? 165.043 193.545 173.549 1.00 58.09  ?  365  GLY A C     1 
ATOM   2820  O  O     . GLY A 1  365  ? 166.084 193.036 173.962 1.00 58.06  ?  365  GLY A O     1 
ATOM   2821  N  N     . VAL A 1  366  ? 163.860 193.063 173.833 1.00 52.39  ?  366  VAL A N     1 
ATOM   2822  C  CA    . VAL A 1  366  ? 163.741 191.862 174.622 1.00 51.26  ?  366  VAL A CA    1 
ATOM   2823  C  C     . VAL A 1  366  ? 163.145 190.753 173.766 1.00 53.67  ?  366  VAL A C     1 
ATOM   2824  O  O     . VAL A 1  366  ? 162.032 190.899 173.248 1.00 52.65  ?  366  VAL A O     1 
ATOM   2825  C  CB    . VAL A 1  366  ? 162.973 192.128 175.956 1.00 55.14  ?  366  VAL A CB    1 
ATOM   2826  C  CG1   . VAL A 1  366  ? 162.632 190.835 176.699 1.00 54.72  ?  366  VAL A CG1   1 
ATOM   2827  C  CG2   . VAL A 1  366  ? 163.755 193.074 176.862 1.00 54.63  ?  366  VAL A CG2   1 
ATOM   2828  N  N     . PRO A 1  367  ? 163.873 189.631 173.612 1.00 50.76  ?  367  PRO A N     1 
ATOM   2829  C  CA    . PRO A 1  367  ? 163.314 188.487 172.846 1.00 51.54  ?  367  PRO A CA    1 
ATOM   2830  C  C     . PRO A 1  367  ? 161.967 188.009 173.410 1.00 54.34  ?  367  PRO A C     1 
ATOM   2831  O  O     . PRO A 1  367  ? 161.853 187.884 174.638 1.00 52.34  ?  367  PRO A O     1 
ATOM   2832  C  CB    . PRO A 1  367  ? 164.392 187.398 172.974 1.00 53.11  ?  367  PRO A CB    1 
ATOM   2833  C  CG    . PRO A 1  367  ? 165.639 188.128 173.359 1.00 57.00  ?  367  PRO A CG    1 
ATOM   2834  C  CD    . PRO A 1  367  ? 165.219 189.337 174.138 1.00 51.73  ?  367  PRO A CD    1 
ATOM   2835  N  N     . LYS A 1  368  ? 160.944 187.781 172.523 1.00 51.35  ?  368  LYS A N     1 
ATOM   2836  C  CA    . LYS A 1  368  ? 159.582 187.310 172.893 1.00 51.14  ?  368  LYS A CA    1 
ATOM   2837  C  C     . LYS A 1  368  ? 159.596 186.215 173.972 1.00 56.30  ?  368  LYS A C     1 
ATOM   2838  O  O     . LYS A 1  368  ? 158.880 186.350 174.972 1.00 55.78  ?  368  LYS A O     1 
ATOM   2839  C  CB    . LYS A 1  368  ? 158.760 186.854 171.666 1.00 52.52  ?  368  LYS A CB    1 
ATOM   2840  C  CG    . LYS A 1  368  ? 157.237 186.932 171.828 1.00 57.68  ?  368  LYS A CG    1 
ATOM   2841  C  CD    . LYS A 1  368  ? 156.504 186.523 170.500 1.00 80.37  ?  368  LYS A CD    1 
ATOM   2842  C  CE    . LYS A 1  368  ? 154.960 186.377 170.489 1.00 97.13  ?  368  LYS A CE    1 
ATOM   2843  N  NZ    . LYS A 1  368  ? 154.426 184.974 170.716 1.00 93.70  1  368  LYS A NZ    1 
ATOM   2844  N  N     . SER A 1  369  ? 160.464 185.169 173.793 1.00 52.67  ?  369  SER A N     1 
ATOM   2845  C  CA    . SER A 1  369  ? 160.634 184.044 174.723 1.00 51.47  ?  369  SER A CA    1 
ATOM   2846  C  C     . SER A 1  369  ? 161.016 184.518 176.116 1.00 56.37  ?  369  SER A C     1 
ATOM   2847  O  O     . SER A 1  369  ? 160.484 184.004 177.100 1.00 55.65  ?  369  SER A O     1 
ATOM   2848  C  CB    . SER A 1  369  ? 161.682 183.067 174.211 1.00 52.36  ?  369  SER A CB    1 
ATOM   2849  O  OG    . SER A 1  369  ? 163.025 183.475 174.418 1.00 52.86  ?  369  SER A OG    1 
ATOM   2850  N  N     . ILE A 1  370  ? 161.943 185.505 176.191 1.00 53.42  ?  370  ILE A N     1 
ATOM   2851  C  CA    . ILE A 1  370  ? 162.395 186.059 177.463 1.00 52.09  ?  370  ILE A CA    1 
ATOM   2852  C  C     . ILE A 1  370  ? 161.258 186.809 178.118 1.00 58.05  ?  370  ILE A C     1 
ATOM   2853  O  O     . ILE A 1  370  ? 161.032 186.608 179.314 1.00 58.03  ?  370  ILE A O     1 
ATOM   2854  C  CB    . ILE A 1  370  ? 163.732 186.835 177.392 1.00 53.78  ?  370  ILE A CB    1 
ATOM   2855  C  CG1   . ILE A 1  370  ? 164.904 185.872 177.031 1.00 54.06  ?  370  ILE A CG1   1 
ATOM   2856  C  CG2   . ILE A 1  370  ? 163.999 187.529 178.711 1.00 52.36  ?  370  ILE A CG2   1 
ATOM   2857  C  CD1   . ILE A 1  370  ? 166.415 186.475 177.046 1.00 61.05  ?  370  ILE A CD1   1 
ATOM   2858  N  N     . ALA A 1  371  ? 160.476 187.588 177.319 1.00 55.67  ?  371  ALA A N     1 
ATOM   2859  C  CA    . ALA A 1  371  ? 159.317 188.348 177.811 1.00 55.07  ?  371  ALA A CA    1 
ATOM   2860  C  C     . ALA A 1  371  ? 158.232 187.420 178.317 1.00 58.19  ?  371  ALA A C     1 
ATOM   2861  O  O     . ALA A 1  371  ? 157.587 187.735 179.327 1.00 58.03  ?  371  ALA A O     1 
ATOM   2862  C  CB    . ALA A 1  371  ? 158.760 189.231 176.720 1.00 55.92  ?  371  ALA A CB    1 
ATOM   2863  N  N     . LYS A 1  372  ? 158.066 186.259 177.635 1.00 53.28  ?  372  LYS A N     1 
ATOM   2864  C  CA    . LYS A 1  372  ? 157.063 185.254 177.964 1.00 52.91  ?  372  LYS A CA    1 
ATOM   2865  C  C     . LYS A 1  372  ? 157.380 184.461 179.239 1.00 58.93  ?  372  LYS A C     1 
ATOM   2866  O  O     . LYS A 1  372  ? 156.502 183.783 179.768 1.00 58.89  ?  372  LYS A O     1 
ATOM   2867  C  CB    . LYS A 1  372  ? 156.791 184.327 176.775 1.00 55.10  ?  372  LYS A CB    1 
ATOM   2868  C  CG    . LYS A 1  372  ? 155.979 184.947 175.627 1.00 64.87  ?  372  LYS A CG    1 
ATOM   2869  C  CD    . LYS A 1  372  ? 155.122 183.915 174.848 1.00 77.26  ?  372  LYS A CD    1 
ATOM   2870  C  CE    . LYS A 1  372  ? 155.796 182.642 174.335 1.00 88.98  ?  372  LYS A CE    1 
ATOM   2871  N  NZ    . LYS A 1  372  ? 156.690 182.876 173.162 1.00 101.80 1  372  LYS A NZ    1 
ATOM   2872  N  N     . THR A 1  373  ? 158.621 184.558 179.739 1.00 57.33  ?  373  THR A N     1 
ATOM   2873  C  CA    . THR A 1  373  ? 159.107 183.869 180.941 1.00 57.18  ?  373  THR A CA    1 
ATOM   2874  C  C     . THR A 1  373  ? 159.081 184.828 182.136 1.00 64.16  ?  373  THR A C     1 
ATOM   2875  O  O     . THR A 1  373  ? 158.500 184.502 183.180 1.00 65.37  ?  373  THR A O     1 
ATOM   2876  C  CB    . THR A 1  373  ? 160.528 183.401 180.696 1.00 58.41  ?  373  THR A CB    1 
ATOM   2877  O  OG1   . THR A 1  373  ? 160.558 182.525 179.583 1.00 58.32  ?  373  THR A OG1   1 
ATOM   2878  C  CG2   . THR A 1  373  ? 161.127 182.747 181.889 1.00 57.79  ?  373  THR A CG2   1 
ATOM   2879  N  N     . LEU A 1  374  ? 159.747 185.994 181.990 1.00 60.11  ?  374  LEU A N     1 
ATOM   2880  C  CA    . LEU A 1  374  ? 159.804 187.002 183.038 1.00 59.78  ?  374  LEU A CA    1 
ATOM   2881  C  C     . LEU A 1  374  ? 158.424 187.609 183.299 1.00 64.06  ?  374  LEU A C     1 
ATOM   2882  O  O     . LEU A 1  374  ? 157.671 187.944 182.372 1.00 64.64  ?  374  LEU A O     1 
ATOM   2883  C  CB    . LEU A 1  374  ? 160.827 188.087 182.719 1.00 59.90  ?  374  LEU A CB    1 
ATOM   2884  C  CG    . LEU A 1  374  ? 162.245 187.652 182.483 1.00 65.03  ?  374  LEU A CG    1 
ATOM   2885  C  CD1   . LEU A 1  374  ? 162.981 188.711 181.742 1.00 65.47  ?  374  LEU A CD1   1 
ATOM   2886  C  CD2   . LEU A 1  374  ? 162.950 187.354 183.786 1.00 68.32  ?  374  LEU A CD2   1 
ATOM   2887  N  N     . THR A 1  375  ? 158.118 187.769 184.573 1.00 59.16  ?  375  THR A N     1 
ATOM   2888  C  CA    . THR A 1  375  ? 156.834 188.215 184.997 1.00 59.12  ?  375  THR A CA    1 
ATOM   2889  C  C     . THR A 1  375  ? 156.819 189.388 185.984 1.00 66.82  ?  375  THR A C     1 
ATOM   2890  O  O     . THR A 1  375  ? 157.735 189.545 186.791 1.00 67.70  ?  375  THR A O     1 
ATOM   2891  C  CB    . THR A 1  375  ? 156.141 186.958 185.459 1.00 66.19  ?  375  THR A CB    1 
ATOM   2892  O  OG1   . THR A 1  375  ? 154.879 186.897 184.820 1.00 74.45  ?  375  THR A OG1   1 
ATOM   2893  C  CG2   . THR A 1  375  ? 156.084 186.795 186.983 1.00 61.39  ?  375  THR A CG2   1 
ATOM   2894  N  N     . TYR A 1  376  ? 155.765 190.215 185.917 1.00 64.75  ?  376  TYR A N     1 
ATOM   2895  C  CA    . TYR A 1  376  ? 155.544 191.313 186.857 1.00 64.42  ?  376  TYR A CA    1 
ATOM   2896  C  C     . TYR A 1  376  ? 154.226 191.025 187.622 1.00 70.68  ?  376  TYR A C     1 
ATOM   2897  O  O     . TYR A 1  376  ? 153.193 190.773 186.976 1.00 70.54  ?  376  TYR A O     1 
ATOM   2898  C  CB    . TYR A 1  376  ? 155.524 192.704 186.180 1.00 64.76  ?  376  TYR A CB    1 
ATOM   2899  C  CG    . TYR A 1  376  ? 155.320 193.828 187.175 1.00 66.09  ?  376  TYR A CG    1 
ATOM   2900  C  CD1   . TYR A 1  376  ? 156.351 194.239 188.008 1.00 68.66  ?  376  TYR A CD1   1 
ATOM   2901  C  CD2   . TYR A 1  376  ? 154.078 194.438 187.327 1.00 66.61  ?  376  TYR A CD2   1 
ATOM   2902  C  CE1   . TYR A 1  376  ? 156.149 195.216 188.985 1.00 70.55  ?  376  TYR A CE1   1 
ATOM   2903  C  CE2   . TYR A 1  376  ? 153.865 195.422 188.297 1.00 67.36  ?  376  TYR A CE2   1 
ATOM   2904  C  CZ    . TYR A 1  376  ? 154.908 195.814 189.119 1.00 76.27  ?  376  TYR A CZ    1 
ATOM   2905  O  OH    . TYR A 1  376  ? 154.740 196.790 190.078 1.00 78.55  ?  376  TYR A OH    1 
ATOM   2906  N  N     . PRO A 1  377  ? 154.260 191.023 188.989 1.00 67.62  ?  377  PRO A N     1 
ATOM   2907  C  CA    . PRO A 1  377  ? 153.029 190.773 189.773 1.00 67.44  ?  377  PRO A CA    1 
ATOM   2908  C  C     . PRO A 1  377  ? 152.248 192.054 189.932 1.00 69.36  ?  377  PRO A C     1 
ATOM   2909  O  O     . PRO A 1  377  ? 152.695 192.964 190.637 1.00 68.80  ?  377  PRO A O     1 
ATOM   2910  C  CB    . PRO A 1  377  ? 153.554 190.309 191.128 1.00 69.68  ?  377  PRO A CB    1 
ATOM   2911  C  CG    . PRO A 1  377  ? 155.039 190.587 191.104 1.00 74.23  ?  377  PRO A CG    1 
ATOM   2912  C  CD    . PRO A 1  377  ? 155.398 191.309 189.872 1.00 69.11  ?  377  PRO A CD    1 
ATOM   2913  N  N     . GLU A 1  378  ? 151.122 192.147 189.223 1.00 64.73  ?  378  GLU A N     1 
ATOM   2914  C  CA    . GLU A 1  378  ? 150.307 193.354 189.186 1.00 64.39  ?  378  GLU A CA    1 
ATOM   2915  C  C     . GLU A 1  378  ? 149.080 193.166 190.025 1.00 69.30  ?  378  GLU A C     1 
ATOM   2916  O  O     . GLU A 1  378  ? 148.420 192.144 189.894 1.00 70.79  ?  378  GLU A O     1 
ATOM   2917  C  CB    . GLU A 1  378  ? 149.921 193.643 187.733 1.00 65.73  ?  378  GLU A CB    1 
ATOM   2918  C  CG    . GLU A 1  378  ? 149.233 194.977 187.530 1.00 75.75  ?  378  GLU A CG    1 
ATOM   2919  C  CD    . GLU A 1  378  ? 149.325 195.557 186.132 1.00 96.04  ?  378  GLU A CD    1 
ATOM   2920  O  OE1   . GLU A 1  378  ? 149.670 194.813 185.185 1.00 94.93  ?  378  GLU A OE1   1 
ATOM   2921  O  OE2   . GLU A 1  378  ? 149.053 196.770 185.987 1.00 89.62  -1 378  GLU A OE2   1 
ATOM   2922  N  N     . VAL A 1  379  ? 148.749 194.140 190.868 1.00 65.16  ?  379  VAL A N     1 
ATOM   2923  C  CA    . VAL A 1  379  ? 147.557 194.041 191.716 1.00 64.96  ?  379  VAL A CA    1 
ATOM   2924  C  C     . VAL A 1  379  ? 146.307 194.459 190.961 1.00 67.82  ?  379  VAL A C     1 
ATOM   2925  O  O     . VAL A 1  379  ? 146.265 195.570 190.411 1.00 67.80  ?  379  VAL A O     1 
ATOM   2926  C  CB    . VAL A 1  379  ? 147.701 194.821 193.047 1.00 69.15  ?  379  VAL A CB    1 
ATOM   2927  C  CG1   . VAL A 1  379  ? 146.376 194.914 193.792 1.00 69.43  ?  379  VAL A CG1   1 
ATOM   2928  C  CG2   . VAL A 1  379  ? 148.751 194.182 193.935 1.00 68.88  ?  379  VAL A CG2   1 
ATOM   2929  N  N     . VAL A 1  380  ? 145.275 193.575 190.990 1.00 62.64  ?  380  VAL A N     1 
ATOM   2930  C  CA    . VAL A 1  380  ? 143.950 193.793 190.416 1.00 62.14  ?  380  VAL A CA    1 
ATOM   2931  C  C     . VAL A 1  380  ? 143.320 195.005 191.101 1.00 69.57  ?  380  VAL A C     1 
ATOM   2932  O  O     . VAL A 1  380  ? 143.198 195.076 192.329 1.00 69.79  ?  380  VAL A O     1 
ATOM   2933  C  CB    . VAL A 1  380  ? 143.079 192.544 190.487 1.00 64.83  ?  380  VAL A CB    1 
ATOM   2934  C  CG1   . VAL A 1  380  ? 141.647 192.866 190.114 1.00 65.14  ?  380  VAL A CG1   1 
ATOM   2935  C  CG2   . VAL A 1  380  ? 143.638 191.466 189.579 1.00 64.13  ?  380  VAL A CG2   1 
ATOM   2936  N  N     . THR A 1  381  ? 143.007 195.991 190.281 1.00 67.87  ?  381  THR A N     1 
ATOM   2937  C  CA    . THR A 1  381  ? 142.562 197.303 190.678 1.00 68.26  ?  381  THR A CA    1 
ATOM   2938  C  C     . THR A 1  381  ? 141.520 197.787 189.667 1.00 73.93  ?  381  THR A C     1 
ATOM   2939  O  O     . THR A 1  381  ? 141.593 197.376 188.509 1.00 72.86  ?  381  THR A O     1 
ATOM   2940  C  CB    . THR A 1  381  ? 143.835 198.186 190.759 1.00 74.90  ?  381  THR A CB    1 
ATOM   2941  O  OG1   . THR A 1  381  ? 143.691 199.160 191.771 1.00 78.20  ?  381  THR A OG1   1 
ATOM   2942  C  CG2   . THR A 1  381  ? 144.232 198.832 189.433 1.00 72.65  ?  381  THR A CG2   1 
ATOM   2943  N  N     . PRO A 1  382  ? 140.569 198.679 190.044 1.00 73.25  ?  382  PRO A N     1 
ATOM   2944  C  CA    . PRO A 1  382  ? 139.584 199.156 189.058 1.00 74.53  ?  382  PRO A CA    1 
ATOM   2945  C  C     . PRO A 1  382  ? 140.192 199.614 187.739 1.00 82.11  ?  382  PRO A C     1 
ATOM   2946  O  O     . PRO A 1  382  ? 139.658 199.265 186.684 1.00 81.98  ?  382  PRO A O     1 
ATOM   2947  C  CB    . PRO A 1  382  ? 138.878 200.282 189.799 1.00 76.59  ?  382  PRO A CB    1 
ATOM   2948  C  CG    . PRO A 1  382  ? 138.980 199.893 191.229 1.00 80.18  ?  382  PRO A CG    1 
ATOM   2949  C  CD    . PRO A 1  382  ? 140.323 199.282 191.372 1.00 74.94  ?  382  PRO A CD    1 
ATOM   2950  N  N     . TYR A 1  383  ? 141.368 200.279 187.807 1.00 81.82  ?  383  TYR A N     1 
ATOM   2951  C  CA    . TYR A 1  383  ? 142.120 200.805 186.666 1.00 83.46  ?  383  TYR A CA    1 
ATOM   2952  C  C     . TYR A 1  383  ? 142.573 199.744 185.676 1.00 87.65  ?  383  TYR A C     1 
ATOM   2953  O  O     . TYR A 1  383  ? 142.438 199.952 184.470 1.00 88.49  ?  383  TYR A O     1 
ATOM   2954  C  CB    . TYR A 1  383  ? 143.325 201.673 187.099 1.00 85.97  ?  383  TYR A CB    1 
ATOM   2955  C  CG    . TYR A 1  383  ? 143.170 202.384 188.429 1.00 91.13  ?  383  TYR A CG    1 
ATOM   2956  C  CD1   . TYR A 1  383  ? 142.170 203.339 188.625 1.00 94.48  ?  383  TYR A CD1   1 
ATOM   2957  C  CD2   . TYR A 1  383  ? 144.050 202.141 189.477 1.00 92.46  ?  383  TYR A CD2   1 
ATOM   2958  C  CE1   . TYR A 1  383  ? 142.019 203.989 189.856 1.00 96.52  ?  383  TYR A CE1   1 
ATOM   2959  C  CE2   . TYR A 1  383  ? 143.909 202.780 190.710 1.00 94.27  ?  383  TYR A CE2   1 
ATOM   2960  C  CZ    . TYR A 1  383  ? 142.899 203.712 190.893 1.00 105.12 ?  383  TYR A CZ    1 
ATOM   2961  O  OH    . TYR A 1  383  ? 142.796 204.340 192.114 1.00 109.49 ?  383  TYR A OH    1 
ATOM   2962  N  N     . ASN A 1  384  ? 143.092 198.615 186.162 1.00 82.45  ?  384  ASN A N     1 
ATOM   2963  C  CA    . ASN A 1  384  ? 143.610 197.595 185.251 1.00 81.45  ?  384  ASN A CA    1 
ATOM   2964  C  C     . ASN A 1  384  ? 142.746 196.347 185.028 1.00 84.09  ?  384  ASN A C     1 
ATOM   2965  O  O     . ASN A 1  384  ? 143.000 195.576 184.092 1.00 83.40  ?  384  ASN A O     1 
ATOM   2966  C  CB    . ASN A 1  384  ? 145.024 197.193 185.688 1.00 79.41  ?  384  ASN A CB    1 
ATOM   2967  C  CG    . ASN A 1  384  ? 145.099 196.545 187.042 1.00 81.10  ?  384  ASN A CG    1 
ATOM   2968  O  OD1   . ASN A 1  384  ? 144.142 195.973 187.537 1.00 62.06  ?  384  ASN A OD1   1 
ATOM   2969  N  ND2   . ASN A 1  384  ? 146.251 196.616 187.680 1.00 78.10  ?  384  ASN A ND2   1 
ATOM   2970  N  N     . ILE A 1  385  ? 141.779 196.123 185.926 1.00 79.30  ?  385  ILE A N     1 
ATOM   2971  C  CA    . ILE A 1  385  ? 140.944 194.928 185.977 1.00 77.76  ?  385  ILE A CA    1 
ATOM   2972  C  C     . ILE A 1  385  ? 140.608 194.302 184.650 1.00 82.17  ?  385  ILE A C     1 
ATOM   2973  O  O     . ILE A 1  385  ? 140.970 193.150 184.455 1.00 81.53  ?  385  ILE A O     1 
ATOM   2974  C  CB    . ILE A 1  385  ? 139.777 195.049 186.973 1.00 80.14  ?  385  ILE A CB    1 
ATOM   2975  C  CG1   . ILE A 1  385  ? 139.371 193.721 187.671 1.00 78.92  ?  385  ILE A CG1   1 
ATOM   2976  C  CG2   . ILE A 1  385  ? 138.642 195.931 186.489 1.00 82.58  ?  385  ILE A CG2   1 
ATOM   2977  C  CD1   . ILE A 1  385  ? 138.751 192.593 186.906 1.00 78.88  ?  385  ILE A CD1   1 
ATOM   2978  N  N     . ASP A 1  386  ? 140.034 195.072 183.709 1.00 79.79  ?  386  ASP A N     1 
ATOM   2979  C  CA    . ASP A 1  386  ? 139.656 194.574 182.380 1.00 79.93  ?  386  ASP A CA    1 
ATOM   2980  C  C     . ASP A 1  386  ? 140.866 194.101 181.602 1.00 79.30  ?  386  ASP A C     1 
ATOM   2981  O  O     . ASP A 1  386  ? 140.862 192.953 181.156 1.00 78.21  ?  386  ASP A O     1 
ATOM   2982  C  CB    . ASP A 1  386  ? 138.856 195.614 181.562 1.00 83.77  ?  386  ASP A CB    1 
ATOM   2983  C  CG    . ASP A 1  386  ? 137.882 196.484 182.344 1.00 101.33 ?  386  ASP A CG    1 
ATOM   2984  O  OD1   . ASP A 1  386  ? 138.333 197.185 183.291 1.00 115.70 ?  386  ASP A OD1   1 
ATOM   2985  O  OD2   . ASP A 1  386  ? 136.694 196.537 181.960 1.00 100.65 -1 386  ASP A OD2   1 
ATOM   2986  N  N     . ARG A 1  387  ? 141.919 194.951 181.495 1.00 74.09  ?  387  ARG A N     1 
ATOM   2987  C  CA    . ARG A 1  387  ? 143.167 194.601 180.791 1.00 73.44  ?  387  ARG A CA    1 
ATOM   2988  C  C     . ARG A 1  387  ? 143.758 193.309 181.327 1.00 71.49  ?  387  ARG A C     1 
ATOM   2989  O  O     . ARG A 1  387  ? 143.956 192.357 180.565 1.00 70.08  ?  387  ARG A O     1 
ATOM   2990  C  CB    . ARG A 1  387  ? 144.220 195.732 180.872 1.00 77.13  ?  387  ARG A CB    1 
ATOM   2991  C  CG    . ARG A 1  387  ? 145.528 195.444 180.076 1.00 88.91  ?  387  ARG A CG    1 
ATOM   2992  C  CD    . ARG A 1  387  ? 146.563 196.558 180.188 1.00 96.11  ?  387  ARG A CD    1 
ATOM   2993  N  NE    . ARG A 1  387  ? 146.803 196.957 181.577 1.00 98.61  ?  387  ARG A NE    1 
ATOM   2994  C  CZ    . ARG A 1  387  ? 147.807 196.511 182.329 1.00 104.78 ?  387  ARG A CZ    1 
ATOM   2995  N  NH1   . ARG A 1  387  ? 148.707 195.674 181.822 1.00 83.01  1  387  ARG A NH1   1 
ATOM   2996  N  NH2   . ARG A 1  387  ? 147.924 196.906 183.590 1.00 86.60  ?  387  ARG A NH2   1 
ATOM   2997  N  N     . LEU A 1  388  ? 144.015 193.285 182.642 1.00 64.35  ?  388  LEU A N     1 
ATOM   2998  C  CA    . LEU A 1  388  ? 144.531 192.120 183.332 1.00 62.66  ?  388  LEU A CA    1 
ATOM   2999  C  C     . LEU A 1  388  ? 143.728 190.838 183.012 1.00 66.79  ?  388  LEU A C     1 
ATOM   3000  O  O     . LEU A 1  388  ? 144.337 189.831 182.666 1.00 64.95  ?  388  LEU A O     1 
ATOM   3001  C  CB    . LEU A 1  388  ? 144.571 192.388 184.838 1.00 61.90  ?  388  LEU A CB    1 
ATOM   3002  C  CG    . LEU A 1  388  ? 145.752 193.175 185.353 1.00 65.07  ?  388  LEU A CG    1 
ATOM   3003  C  CD1   . LEU A 1  388  ? 145.847 193.036 186.821 1.00 65.59  ?  388  LEU A CD1   1 
ATOM   3004  C  CD2   . LEU A 1  388  ? 147.035 192.631 184.841 1.00 65.37  ?  388  LEU A CD2   1 
ATOM   3005  N  N     . THR A 1  389  ? 142.362 190.910 183.038 1.00 64.92  ?  389  THR A N     1 
ATOM   3006  C  CA    . THR A 1  389  ? 141.474 189.771 182.750 1.00 64.92  ?  389  THR A CA    1 
ATOM   3007  C  C     . THR A 1  389  ? 141.724 189.229 181.377 1.00 69.62  ?  389  THR A C     1 
ATOM   3008  O  O     . THR A 1  389  ? 141.597 188.012 181.168 1.00 69.40  ?  389  THR A O     1 
ATOM   3009  C  CB    . THR A 1  389  ? 139.997 190.106 182.940 1.00 67.71  ?  389  THR A CB    1 
ATOM   3010  O  OG1   . THR A 1  389  ? 139.842 190.825 184.145 1.00 69.81  ?  389  THR A OG1   1 
ATOM   3011  C  CG2   . THR A 1  389  ? 139.156 188.870 183.085 1.00 66.36  ?  389  THR A CG2   1 
ATOM   3012  N  N     . GLN A 1  390  ? 142.104 190.133 180.449 1.00 66.11  ?  390  GLN A N     1 
ATOM   3013  C  CA    . GLN A 1  390  ? 142.383 189.770 179.073 1.00 65.98  ?  390  GLN A CA    1 
ATOM   3014  C  C     . GLN A 1  390  ? 143.702 189.018 178.949 1.00 70.25  ?  390  GLN A C     1 
ATOM   3015  O  O     . GLN A 1  390  ? 143.743 187.989 178.272 1.00 71.63  ?  390  GLN A O     1 
ATOM   3016  C  CB    . GLN A 1  390  ? 142.279 190.976 178.126 1.00 67.37  ?  390  GLN A CB    1 
ATOM   3017  C  CG    . GLN A 1  390  ? 142.285 190.601 176.638 1.00 90.38  ?  390  GLN A CG    1 
ATOM   3018  C  CD    . GLN A 1  390  ? 141.375 189.442 176.313 1.00 126.09 ?  390  GLN A CD    1 
ATOM   3019  O  OE1   . GLN A 1  390  ? 140.159 189.484 176.546 1.00 125.57 ?  390  GLN A OE1   1 
ATOM   3020  N  NE2   . GLN A 1  390  ? 141.960 188.361 175.805 1.00 124.45 ?  390  GLN A NE2   1 
ATOM   3021  N  N     . LEU A 1  391  ? 144.764 189.497 179.622 1.00 64.52  ?  391  LEU A N     1 
ATOM   3022  C  CA    . LEU A 1  391  ? 146.064 188.840 179.584 1.00 62.84  ?  391  LEU A CA    1 
ATOM   3023  C  C     . LEU A 1  391  ? 145.892 187.489 180.234 1.00 66.83  ?  391  LEU A C     1 
ATOM   3024  O  O     . LEU A 1  391  ? 146.474 186.522 179.761 1.00 67.93  ?  391  LEU A O     1 
ATOM   3025  C  CB    . LEU A 1  391  ? 147.116 189.636 180.355 1.00 62.46  ?  391  LEU A CB    1 
ATOM   3026  C  CG    . LEU A 1  391  ? 147.359 191.061 179.913 1.00 68.05  ?  391  LEU A CG    1 
ATOM   3027  C  CD1   . LEU A 1  391  ? 147.521 191.965 181.099 1.00 67.99  ?  391  LEU A CD1   1 
ATOM   3028  C  CD2   . LEU A 1  391  ? 148.614 191.159 179.120 1.00 74.10  ?  391  LEU A CD2   1 
ATOM   3029  N  N     . VAL A 1  392  ? 145.054 187.395 181.282 1.00 62.61  ?  392  VAL A N     1 
ATOM   3030  C  CA    . VAL A 1  392  ? 144.801 186.119 181.950 1.00 62.54  ?  392  VAL A CA    1 
ATOM   3031  C  C     . VAL A 1  392  ? 144.186 185.150 180.922 1.00 71.70  ?  392  VAL A C     1 
ATOM   3032  O  O     . VAL A 1  392  ? 144.695 184.028 180.735 1.00 70.86  ?  392  VAL A O     1 
ATOM   3033  C  CB    . VAL A 1  392  ? 143.958 186.264 183.237 1.00 64.73  ?  392  VAL A CB    1 
ATOM   3034  C  CG1   . VAL A 1  392  ? 143.894 184.947 183.972 1.00 63.88  ?  392  VAL A CG1   1 
ATOM   3035  C  CG2   . VAL A 1  392  ? 144.550 187.320 184.152 1.00 63.94  ?  392  VAL A CG2   1 
ATOM   3036  N  N     . ARG A 1  393  ? 143.144 185.642 180.196 1.00 71.78  ?  393  ARG A N     1 
ATOM   3037  C  CA    . ARG A 1  393  ? 142.455 184.926 179.122 1.00 72.64  ?  393  ARG A CA    1 
ATOM   3038  C  C     . ARG A 1  393  ? 143.482 184.524 178.060 1.00 76.55  ?  393  ARG A C     1 
ATOM   3039  O  O     . ARG A 1  393  ? 143.530 183.347 177.704 1.00 78.12  ?  393  ARG A O     1 
ATOM   3040  C  CB    . ARG A 1  393  ? 141.332 185.781 178.523 1.00 75.18  ?  393  ARG A CB    1 
ATOM   3041  C  CG    . ARG A 1  393  ? 139.998 185.048 178.422 1.00 97.15  ?  393  ARG A CG    1 
ATOM   3042  C  CD    . ARG A 1  393  ? 138.907 185.710 179.252 1.00 119.06 ?  393  ARG A CD    1 
ATOM   3043  N  NE    . ARG A 1  393  ? 138.976 185.316 180.663 1.00 137.46 ?  393  ARG A NE    1 
ATOM   3044  C  CZ    . ARG A 1  393  ? 138.011 185.536 181.554 1.00 152.33 ?  393  ARG A CZ    1 
ATOM   3045  N  NH1   . ARG A 1  393  ? 136.890 186.153 181.193 1.00 137.64 1  393  ARG A NH1   1 
ATOM   3046  N  NH2   . ARG A 1  393  ? 138.161 185.141 182.813 1.00 136.75 ?  393  ARG A NH2   1 
ATOM   3047  N  N     . ASN A 1  394  ? 144.371 185.458 177.649 1.00 71.00  ?  394  ASN A N     1 
ATOM   3048  C  CA    . ASN A 1  394  ? 145.456 185.216 176.693 1.00 70.42  ?  394  ASN A CA    1 
ATOM   3049  C  C     . ASN A 1  394  ? 146.351 184.035 177.123 1.00 74.92  ?  394  ASN A C     1 
ATOM   3050  O  O     . ASN A 1  394  ? 146.740 183.200 176.298 1.00 75.65  ?  394  ASN A O     1 
ATOM   3051  C  CB    . ASN A 1  394  ? 146.280 186.472 176.502 1.00 69.71  ?  394  ASN A CB    1 
ATOM   3052  C  CG    . ASN A 1  394  ? 145.842 187.307 175.344 1.00 100.90 ?  394  ASN A CG    1 
ATOM   3053  O  OD1   . ASN A 1  394  ? 144.876 188.075 175.427 1.00 94.53  ?  394  ASN A OD1   1 
ATOM   3054  N  ND2   . ASN A 1  394  ? 146.575 187.196 174.245 1.00 98.63  ?  394  ASN A ND2   1 
ATOM   3055  N  N     . GLY A 1  395  ? 146.634 183.954 178.414 1.00 70.34  ?  395  GLY A N     1 
ATOM   3056  C  CA    . GLY A 1  395  ? 147.393 182.841 178.951 1.00 69.76  ?  395  GLY A CA    1 
ATOM   3057  C  C     . GLY A 1  395  ? 148.892 182.877 178.781 1.00 72.71  ?  395  GLY A C     1 
ATOM   3058  O  O     . GLY A 1  395  ? 149.442 183.877 178.316 1.00 72.11  ?  395  GLY A O     1 
ATOM   3059  N  N     . PRO A 1  396  ? 149.559 181.760 179.183 1.00 69.06  ?  396  PRO A N     1 
ATOM   3060  C  CA    . PRO A 1  396  ? 151.024 181.708 179.204 1.00 69.35  ?  396  PRO A CA    1 
ATOM   3061  C  C     . PRO A 1  396  ? 151.758 181.593 177.880 1.00 77.61  ?  396  PRO A C     1 
ATOM   3062  O  O     . PRO A 1  396  ? 152.968 181.856 177.841 1.00 76.58  ?  396  PRO A O     1 
ATOM   3063  C  CB    . PRO A 1  396  ? 151.300 180.467 180.053 1.00 70.33  ?  396  PRO A CB    1 
ATOM   3064  C  CG    . PRO A 1  396  ? 150.055 180.188 180.779 1.00 73.78  ?  396  PRO A CG    1 
ATOM   3065  C  CD    . PRO A 1  396  ? 149.013 180.543 179.803 1.00 69.95  ?  396  PRO A CD    1 
ATOM   3066  N  N     . ASN A 1  397  ? 151.051 181.182 176.819 1.00 77.94  ?  397  ASN A N     1 
ATOM   3067  C  CA    . ASN A 1  397  ? 151.658 180.964 175.507 1.00 79.35  ?  397  ASN A CA    1 
ATOM   3068  C  C     . ASN A 1  397  ? 151.592 182.132 174.530 1.00 85.84  ?  397  ASN A C     1 
ATOM   3069  O  O     . ASN A 1  397  ? 152.511 182.299 173.728 1.00 86.28  ?  397  ASN A O     1 
ATOM   3070  C  CB    . ASN A 1  397  ? 151.112 179.697 174.893 1.00 81.35  ?  397  ASN A CB    1 
ATOM   3071  C  CG    . ASN A 1  397  ? 151.426 178.502 175.735 1.00 113.37 ?  397  ASN A CG    1 
ATOM   3072  O  OD1   . ASN A 1  397  ? 150.785 178.247 176.760 1.00 106.74 ?  397  ASN A OD1   1 
ATOM   3073  N  ND2   . ASN A 1  397  ? 152.477 177.793 175.365 1.00 111.25 ?  397  ASN A ND2   1 
ATOM   3074  N  N     . GLU A 1  398  ? 150.502 182.918 174.572 1.00 83.36  ?  398  GLU A N     1 
ATOM   3075  C  CA    . GLU A 1  398  ? 150.290 184.086 173.703 1.00 83.87  ?  398  GLU A CA    1 
ATOM   3076  C  C     . GLU A 1  398  ? 151.234 185.172 174.178 1.00 82.35  ?  398  GLU A C     1 
ATOM   3077  O  O     . GLU A 1  398  ? 151.428 185.195 175.397 1.00 80.66  ?  398  GLU A O     1 
ATOM   3078  C  CB    . GLU A 1  398  ? 148.838 184.601 173.905 1.00 86.51  ?  398  GLU A CB    1 
ATOM   3079  C  CG    . GLU A 1  398  ? 147.881 184.319 172.756 1.00 106.52 ?  398  GLU A CG    1 
ATOM   3080  C  CD    . GLU A 1  398  ? 147.460 182.866 172.632 1.00 150.75 ?  398  GLU A CD    1 
ATOM   3081  O  OE1   . GLU A 1  398  ? 146.480 182.472 173.310 1.00 156.46 ?  398  GLU A OE1   1 
ATOM   3082  O  OE2   . GLU A 1  398  ? 148.117 182.120 171.868 1.00 154.09 -1 398  GLU A OE2   1 
ATOM   3083  N  N     . HIS A 1  399  ? 151.787 186.101 173.291 1.00 75.38  ?  399  HIS A N     1 
ATOM   3084  C  CA    . HIS A 1  399  ? 152.585 187.117 173.940 1.00 73.22  ?  399  HIS A CA    1 
ATOM   3085  C  C     . HIS A 1  399  ? 151.892 187.905 174.985 1.00 80.14  ?  399  HIS A C     1 
ATOM   3086  O  O     . HIS A 1  399  ? 152.142 187.533 176.130 1.00 84.72  ?  399  HIS A O     1 
ATOM   3087  C  CB    . HIS A 1  399  ? 153.597 187.988 173.211 1.00 72.90  ?  399  HIS A CB    1 
ATOM   3088  C  CG    . HIS A 1  399  ? 154.324 188.849 174.242 1.00 74.65  ?  399  HIS A CG    1 
ATOM   3089  N  ND1   . HIS A 1  399  ? 154.105 190.221 174.330 1.00 75.69  ?  399  HIS A ND1   1 
ATOM   3090  C  CD2   . HIS A 1  399  ? 155.055 188.468 175.325 1.00 74.34  ?  399  HIS A CD2   1 
ATOM   3091  C  CE1   . HIS A 1  399  ? 154.778 190.627 175.395 1.00 73.75  ?  399  HIS A CE1   1 
ATOM   3092  N  NE2   . HIS A 1  399  ? 155.343 189.608 176.040 1.00 73.46  ?  399  HIS A NE2   1 
ATOM   3093  N  N     . PRO A 1  400  ? 151.184 189.041 174.778 1.00 71.41  ?  400  PRO A N     1 
ATOM   3094  C  CA    . PRO A 1  400  ? 150.703 189.769 175.971 1.00 69.17  ?  400  PRO A CA    1 
ATOM   3095  C  C     . PRO A 1  400  ? 149.685 188.896 176.709 1.00 73.41  ?  400  PRO A C     1 
ATOM   3096  O  O     . PRO A 1  400  ? 148.498 188.877 176.377 1.00 76.50  ?  400  PRO A O     1 
ATOM   3097  C  CB    . PRO A 1  400  ? 150.220 191.105 175.425 1.00 70.50  ?  400  PRO A CB    1 
ATOM   3098  C  CG    . PRO A 1  400  ? 150.721 191.126 173.990 1.00 75.53  ?  400  PRO A CG    1 
ATOM   3099  C  CD    . PRO A 1  400  ? 150.794 189.719 173.534 1.00 71.50  ?  400  PRO A CD    1 
ATOM   3100  N  N     . GLY A 1  401  ? 150.221 188.065 177.610 1.00 65.67  ?  401  GLY A N     1 
ATOM   3101  C  CA    . GLY A 1  401  ? 149.493 187.084 178.401 1.00 63.92  ?  401  GLY A CA    1 
ATOM   3102  C  C     . GLY A 1  401  ? 149.947 187.106 179.834 1.00 64.09  ?  401  GLY A C     1 
ATOM   3103  O  O     . GLY A 1  401  ? 150.584 188.067 180.249 1.00 62.46  ?  401  GLY A O     1 
ATOM   3104  N  N     . ALA A 1  402  ? 149.634 186.062 180.594 1.00 61.21  ?  402  ALA A N     1 
ATOM   3105  C  CA    . ALA A 1  402  ? 150.029 185.950 182.005 1.00 61.33  ?  402  ALA A CA    1 
ATOM   3106  C  C     . ALA A 1  402  ? 150.324 184.470 182.412 1.00 66.80  ?  402  ALA A C     1 
ATOM   3107  O  O     . ALA A 1  402  ? 149.892 183.538 181.728 1.00 66.80  ?  402  ALA A O     1 
ATOM   3108  C  CB    . ALA A 1  402  ? 148.967 186.579 182.901 1.00 61.97  ?  402  ALA A CB    1 
ATOM   3109  N  N     . LYS A 1  403  ? 151.068 184.263 183.511 1.00 63.18  ?  403  LYS A N     1 
ATOM   3110  C  CA    . LYS A 1  403  ? 151.445 182.914 183.956 1.00 62.97  ?  403  LYS A CA    1 
ATOM   3111  C  C     . LYS A 1  403  ? 150.690 182.378 185.197 1.00 65.29  ?  403  LYS A C     1 
ATOM   3112  O  O     . LYS A 1  403  ? 150.433 181.158 185.270 1.00 65.23  ?  403  LYS A O     1 
ATOM   3113  C  CB    . LYS A 1  403  ? 152.967 182.835 184.197 1.00 65.42  ?  403  LYS A CB    1 
ATOM   3114  C  CG    . LYS A 1  403  ? 153.833 182.976 182.941 1.00 74.17  ?  403  LYS A CG    1 
ATOM   3115  C  CD    . LYS A 1  403  ? 155.325 183.109 183.273 1.00 74.63  ?  403  LYS A CD    1 
ATOM   3116  C  CE    . LYS A 1  403  ? 156.005 181.772 183.437 1.00 82.92  ?  403  LYS A CE    1 
ATOM   3117  N  NZ    . LYS A 1  403  ? 157.484 181.902 183.400 1.00 92.55  1  403  LYS A NZ    1 
ATOM   3118  N  N     . TYR A 1  404  ? 150.414 183.273 186.189 1.00 59.23  ?  404  TYR A N     1 
ATOM   3119  C  CA    . TYR A 1  404  ? 149.782 182.949 187.468 1.00 58.72  ?  404  TYR A CA    1 
ATOM   3120  C  C     . TYR A 1  404  ? 148.793 183.974 187.926 1.00 61.31  ?  404  TYR A C     1 
ATOM   3121  O  O     . TYR A 1  404  ? 148.885 185.141 187.536 1.00 60.47  ?  404  TYR A O     1 
ATOM   3122  C  CB    . TYR A 1  404  ? 150.840 182.839 188.574 1.00 60.71  ?  404  TYR A CB    1 
ATOM   3123  C  CG    . TYR A 1  404  ? 151.767 181.662 188.414 1.00 65.38  ?  404  TYR A CG    1 
ATOM   3124  C  CD1   . TYR A 1  404  ? 151.436 180.413 188.926 1.00 67.65  ?  404  TYR A CD1   1 
ATOM   3125  C  CD2   . TYR A 1  404  ? 152.974 181.790 187.741 1.00 68.06  ?  404  TYR A CD2   1 
ATOM   3126  C  CE1   . TYR A 1  404  ? 152.286 179.313 188.768 1.00 69.29  ?  404  TYR A CE1   1 
ATOM   3127  C  CE2   . TYR A 1  404  ? 153.828 180.699 187.566 1.00 71.34  ?  404  TYR A CE2   1 
ATOM   3128  C  CZ    . TYR A 1  404  ? 153.487 179.464 188.089 1.00 79.09  ?  404  TYR A CZ    1 
ATOM   3129  O  OH    . TYR A 1  404  ? 154.351 178.400 187.943 1.00 82.43  ?  404  TYR A OH    1 
ATOM   3130  N  N     . VAL A 1  405  ? 147.864 183.546 188.806 1.00 58.14  ?  405  VAL A N     1 
ATOM   3131  C  CA    . VAL A 1  405  ? 146.882 184.417 189.466 1.00 58.51  ?  405  VAL A CA    1 
ATOM   3132  C  C     . VAL A 1  405  ? 147.063 184.171 190.953 1.00 67.96  ?  405  VAL A C     1 
ATOM   3133  O  O     . VAL A 1  405  ? 147.062 183.021 191.377 1.00 67.98  ?  405  VAL A O     1 
ATOM   3134  C  CB    . VAL A 1  405  ? 145.399 184.263 189.008 1.00 60.70  ?  405  VAL A CB    1 
ATOM   3135  C  CG1   . VAL A 1  405  ? 144.502 185.264 189.712 1.00 60.00  ?  405  VAL A CG1   1 
ATOM   3136  C  CG2   . VAL A 1  405  ? 145.262 184.456 187.517 1.00 60.49  ?  405  VAL A CG2   1 
ATOM   3137  N  N     . ILE A 1  406  ? 147.297 185.224 191.732 1.00 69.60  ?  406  ILE A N     1 
ATOM   3138  C  CA    . ILE A 1  406  ? 147.487 185.072 193.169 1.00 72.39  ?  406  ILE A CA    1 
ATOM   3139  C  C     . ILE A 1  406  ? 146.289 185.614 193.929 1.00 85.11  ?  406  ILE A C     1 
ATOM   3140  O  O     . ILE A 1  406  ? 146.056 186.828 193.991 1.00 85.32  ?  406  ILE A O     1 
ATOM   3141  C  CB    . ILE A 1  406  ? 148.862 185.561 193.707 1.00 74.56  ?  406  ILE A CB    1 
ATOM   3142  C  CG1   . ILE A 1  406  ? 150.026 184.844 193.018 1.00 74.16  ?  406  ILE A CG1   1 
ATOM   3143  C  CG2   . ILE A 1  406  ? 148.953 185.349 195.209 1.00 75.52  ?  406  ILE A CG2   1 
ATOM   3144  C  CD1   . ILE A 1  406  ? 150.788 185.704 192.127 1.00 79.60  ?  406  ILE A CD1   1 
ATOM   3145  N  N     . ARG A 1  407  ? 145.540 184.690 194.520 1.00 87.67  ?  407  ARG A N     1 
ATOM   3146  C  CA    . ARG A 1  407  ? 144.355 185.017 195.286 1.00 90.91  ?  407  ARG A CA    1 
ATOM   3147  C  C     . ARG A 1  407  ? 144.742 185.611 196.627 1.00 103.19 ?  407  ARG A C     1 
ATOM   3148  O  O     . ARG A 1  407  ? 145.907 185.501 197.038 1.00 102.90 ?  407  ARG A O     1 
ATOM   3149  C  CB    . ARG A 1  407  ? 143.506 183.761 195.459 1.00 91.48  ?  407  ARG A CB    1 
ATOM   3150  C  CG    . ARG A 1  407  ? 142.733 183.407 194.197 1.00 100.89 ?  407  ARG A CG    1 
ATOM   3151  C  CD    . ARG A 1  407  ? 142.293 181.958 194.099 1.00 107.57 ?  407  ARG A CD    1 
ATOM   3152  N  NE    . ARG A 1  407  ? 141.605 181.477 195.290 1.00 114.51 ?  407  ARG A NE    1 
ATOM   3153  C  CZ    . ARG A 1  407  ? 142.097 180.545 196.093 1.00 141.23 ?  407  ARG A CZ    1 
ATOM   3154  N  NH1   . ARG A 1  407  ? 143.274 179.981 195.826 1.00 133.13 1  407  ARG A NH1   1 
ATOM   3155  N  NH2   . ARG A 1  407  ? 141.424 180.169 197.171 1.00 137.59 ?  407  ARG A NH2   1 
ATOM   3156  N  N     . ASP A 1  408  ? 143.764 186.275 197.299 1.00 106.08 ?  408  ASP A N     1 
ATOM   3157  C  CA    . ASP A 1  408  ? 143.915 186.875 198.640 1.00 108.30 ?  408  ASP A CA    1 
ATOM   3158  C  C     . ASP A 1  408  ? 144.382 185.774 199.596 1.00 115.81 ?  408  ASP A C     1 
ATOM   3159  O  O     . ASP A 1  408  ? 145.393 185.950 200.286 1.00 114.78 ?  408  ASP A O     1 
ATOM   3160  C  CB    . ASP A 1  408  ? 142.599 187.555 199.138 1.00 111.21 ?  408  ASP A CB    1 
ATOM   3161  C  CG    . ASP A 1  408  ? 141.267 187.007 198.605 1.00 129.27 ?  408  ASP A CG    1 
ATOM   3162  O  OD1   . ASP A 1  408  ? 141.133 185.758 198.476 1.00 131.59 ?  408  ASP A OD1   1 
ATOM   3163  O  OD2   . ASP A 1  408  ? 140.341 187.822 198.362 1.00 136.78 -1 408  ASP A OD2   1 
ATOM   3164  N  N     . SER A 1  409  ? 143.710 184.581 199.494 1.00 115.71 ?  409  SER A N     1 
ATOM   3165  C  CA    . SER A 1  409  ? 143.904 183.305 200.207 1.00 116.65 ?  409  SER A CA    1 
ATOM   3166  C  C     . SER A 1  409  ? 145.372 182.857 200.294 1.00 121.07 ?  409  SER A C     1 
ATOM   3167  O  O     . SER A 1  409  ? 145.713 181.999 201.118 1.00 121.78 ?  409  SER A O     1 
ATOM   3168  C  CB    . SER A 1  409  ? 143.084 182.200 199.537 1.00 120.99 ?  409  SER A CB    1 
ATOM   3169  O  OG    . SER A 1  409  ? 143.879 181.448 198.628 1.00 131.29 ?  409  SER A OG    1 
ATOM   3170  N  N     . GLY A 1  410  ? 146.201 183.400 199.412 1.00 116.29 ?  410  GLY A N     1 
ATOM   3171  C  CA    . GLY A 1  410  ? 147.610 183.066 199.362 1.00 115.04 ?  410  GLY A CA    1 
ATOM   3172  C  C     . GLY A 1  410  ? 147.933 182.028 198.310 1.00 116.30 ?  410  GLY A C     1 
ATOM   3173  O  O     . GLY A 1  410  ? 149.056 182.059 197.786 1.00 116.33 ?  410  GLY A O     1 
ATOM   3174  N  N     . ASP A 1  411  ? 146.977 181.085 197.981 1.00 108.86 ?  411  ASP A N     1 
ATOM   3175  C  CA    . ASP A 1  411  ? 147.336 180.094 196.965 1.00 106.29 ?  411  ASP A CA    1 
ATOM   3176  C  C     . ASP A 1  411  ? 147.353 180.580 195.511 1.00 102.58 ?  411  ASP A C     1 
ATOM   3177  O  O     . ASP A 1  411  ? 146.466 181.342 195.087 1.00 103.58 ?  411  ASP A O     1 
ATOM   3178  C  CB    . ASP A 1  411  ? 146.781 178.674 197.160 1.00 108.76 ?  411  ASP A CB    1 
ATOM   3179  C  CG    . ASP A 1  411  ? 147.875 177.600 196.987 1.00 121.19 ?  411  ASP A CG    1 
ATOM   3180  O  OD1   . ASP A 1  411  ? 148.811 177.808 196.156 1.00 119.62 ?  411  ASP A OD1   1 
ATOM   3181  O  OD2   . ASP A 1  411  ? 147.805 176.561 197.682 1.00 130.49 -1 411  ASP A OD2   1 
ATOM   3182  N  N     . ARG A 1  412  ? 148.449 180.176 194.796 1.00 89.48  ?  412  ARG A N     1 
ATOM   3183  C  CA    . ARG A 1  412  ? 148.850 180.481 193.423 1.00 84.04  ?  412  ARG A CA    1 
ATOM   3184  C  C     . ARG A 1  412  ? 148.098 179.626 192.441 1.00 79.31  ?  412  ARG A C     1 
ATOM   3185  O  O     . ARG A 1  412  ? 148.098 178.408 192.597 1.00 79.70  ?  412  ARG A O     1 
ATOM   3186  C  CB    . ARG A 1  412  ? 150.334 180.147 193.283 1.00 81.07  ?  412  ARG A CB    1 
ATOM   3187  C  CG    . ARG A 1  412  ? 151.139 181.208 192.589 1.00 83.25  ?  412  ARG A CG    1 
ATOM   3188  C  CD    . ARG A 1  412  ? 152.601 181.091 192.971 1.00 81.07  ?  412  ARG A CD    1 
ATOM   3189  N  NE    . ARG A 1  412  ? 153.122 182.399 193.358 1.00 84.67  ?  412  ARG A NE    1 
ATOM   3190  C  CZ    . ARG A 1  412  ? 154.316 182.608 193.895 1.00 103.26 ?  412  ARG A CZ    1 
ATOM   3191  N  NH1   . ARG A 1  412  ? 155.136 181.590 194.126 1.00 85.39  1  412  ARG A NH1   1 
ATOM   3192  N  NH2   . ARG A 1  412  ? 154.699 183.839 194.214 1.00 100.84 ?  412  ARG A NH2   1 
ATOM   3193  N  N     . ILE A 1  413  ? 147.478 180.248 191.419 1.00 68.69  ?  413  ILE A N     1 
ATOM   3194  C  CA    . ILE A 1  413  ? 146.737 179.571 190.347 1.00 65.33  ?  413  ILE A CA    1 
ATOM   3195  C  C     . ILE A 1  413  ? 147.673 179.483 189.150 1.00 66.92  ?  413  ILE A C     1 
ATOM   3196  O  O     . ILE A 1  413  ? 148.094 180.522 188.645 1.00 65.52  ?  413  ILE A O     1 
ATOM   3197  C  CB    . ILE A 1  413  ? 145.428 180.320 189.957 1.00 66.76  ?  413  ILE A CB    1 
ATOM   3198  C  CG1   . ILE A 1  413  ? 144.478 180.469 191.117 1.00 66.29  ?  413  ILE A CG1   1 
ATOM   3199  C  CG2   . ILE A 1  413  ? 144.729 179.660 188.794 1.00 66.62  ?  413  ILE A CG2   1 
ATOM   3200  C  CD1   . ILE A 1  413  ? 143.564 181.613 190.921 1.00 72.28  ?  413  ILE A CD1   1 
ATOM   3201  N  N     . ASP A 1  414  ? 147.977 178.268 188.684 1.00 63.55  ?  414  ASP A N     1 
ATOM   3202  C  CA    . ASP A 1  414  ? 148.830 178.113 187.509 1.00 64.05  ?  414  ASP A CA    1 
ATOM   3203  C  C     . ASP A 1  414  ? 147.969 178.088 186.254 1.00 71.03  ?  414  ASP A C     1 
ATOM   3204  O  O     . ASP A 1  414  ? 147.341 177.062 185.963 1.00 72.55  ?  414  ASP A O     1 
ATOM   3205  C  CB    . ASP A 1  414  ? 149.707 176.849 187.591 1.00 65.81  ?  414  ASP A CB    1 
ATOM   3206  C  CG    . ASP A 1  414  ? 150.678 176.654 186.433 1.00 72.50  ?  414  ASP A CG    1 
ATOM   3207  O  OD1   . ASP A 1  414  ? 150.634 177.473 185.460 1.00 73.69  ?  414  ASP A OD1   1 
ATOM   3208  O  OD2   . ASP A 1  414  ? 151.522 175.721 186.517 1.00 72.49  -1 414  ASP A OD2   1 
ATOM   3209  N  N     . LEU A 1  415  ? 147.985 179.197 185.480 1.00 66.64  ?  415  LEU A N     1 
ATOM   3210  C  CA    . LEU A 1  415  ? 147.198 179.341 184.249 1.00 65.98  ?  415  LEU A CA    1 
ATOM   3211  C  C     . LEU A 1  415  ? 147.543 178.297 183.197 1.00 71.49  ?  415  LEU A C     1 
ATOM   3212  O  O     . LEU A 1  415  ? 146.785 178.097 182.259 1.00 72.63  ?  415  LEU A O     1 
ATOM   3213  C  CB    . LEU A 1  415  ? 147.379 180.735 183.647 1.00 65.24  ?  415  LEU A CB    1 
ATOM   3214  C  CG    . LEU A 1  415  ? 146.993 181.903 184.496 1.00 68.87  ?  415  LEU A CG    1 
ATOM   3215  C  CD1   . LEU A 1  415  ? 147.280 183.178 183.771 1.00 68.10  ?  415  LEU A CD1   1 
ATOM   3216  C  CD2   . LEU A 1  415  ? 145.541 181.824 184.893 1.00 72.42  ?  415  LEU A CD2   1 
ATOM   3217  N  N     . ARG A 1  416  ? 148.686 177.648 183.337 1.00 67.84  ?  416  ARG A N     1 
ATOM   3218  C  CA    . ARG A 1  416  ? 149.135 176.625 182.410 1.00 67.99  ?  416  ARG A CA    1 
ATOM   3219  C  C     . ARG A 1  416  ? 148.339 175.329 182.588 1.00 71.12  ?  416  ARG A C     1 
ATOM   3220  O  O     . ARG A 1  416  ? 148.187 174.585 181.620 1.00 70.68  ?  416  ARG A O     1 
ATOM   3221  C  CB    . ARG A 1  416  ? 150.598 176.361 182.718 1.00 70.13  ?  416  ARG A CB    1 
ATOM   3222  C  CG    . ARG A 1  416  ? 151.403 175.651 181.667 1.00 87.98  ?  416  ARG A CG    1 
ATOM   3223  C  CD    . ARG A 1  416  ? 152.782 175.352 182.250 1.00 102.60 ?  416  ARG A CD    1 
ATOM   3224  N  NE    . ARG A 1  416  ? 153.362 176.495 182.964 1.00 105.56 ?  416  ARG A NE    1 
ATOM   3225  C  CZ    . ARG A 1  416  ? 153.993 176.413 184.128 1.00 112.15 ?  416  ARG A CZ    1 
ATOM   3226  N  NH1   . ARG A 1  416  ? 154.133 175.240 184.736 1.00 82.03  1  416  ARG A NH1   1 
ATOM   3227  N  NH2   . ARG A 1  416  ? 154.497 177.504 184.694 1.00 106.47 ?  416  ARG A NH2   1 
ATOM   3228  N  N     . TYR A 1  417  ? 147.873 175.039 183.827 1.00 67.33  ?  417  TYR A N     1 
ATOM   3229  C  CA    . TYR A 1  417  ? 147.199 173.783 184.145 1.00 67.86  ?  417  TYR A CA    1 
ATOM   3230  C  C     . TYR A 1  417  ? 145.849 173.898 184.757 1.00 71.01  ?  417  TYR A C     1 
ATOM   3231  O  O     . TYR A 1  417  ? 145.052 172.973 184.597 1.00 72.70  ?  417  TYR A O     1 
ATOM   3232  C  CB    . TYR A 1  417  ? 148.072 172.891 185.030 1.00 70.39  ?  417  TYR A CB    1 
ATOM   3233  C  CG    . TYR A 1  417  ? 149.442 172.627 184.456 1.00 75.44  ?  417  TYR A CG    1 
ATOM   3234  C  CD1   . TYR A 1  417  ? 149.594 172.105 183.175 1.00 78.89  ?  417  TYR A CD1   1 
ATOM   3235  C  CD2   . TYR A 1  417  ? 150.592 172.922 185.181 1.00 76.81  ?  417  TYR A CD2   1 
ATOM   3236  C  CE1   . TYR A 1  417  ? 150.859 171.903 182.621 1.00 82.32  ?  417  TYR A CE1   1 
ATOM   3237  C  CE2   . TYR A 1  417  ? 151.863 172.716 184.642 1.00 78.17  ?  417  TYR A CE2   1 
ATOM   3238  C  CZ    . TYR A 1  417  ? 151.992 172.178 183.373 1.00 90.49  ?  417  TYR A CZ    1 
ATOM   3239  O  OH    . TYR A 1  417  ? 153.237 171.950 182.836 1.00 95.54  ?  417  TYR A OH    1 
ATOM   3240  N  N     . SER A 1  418  ? 145.574 174.988 185.482 1.00 65.13  ?  418  SER A N     1 
ATOM   3241  C  CA    . SER A 1  418  ? 144.272 175.154 186.117 1.00 64.31  ?  418  SER A CA    1 
ATOM   3242  C  C     . SER A 1  418  ? 143.137 174.884 185.160 1.00 68.28  ?  418  SER A C     1 
ATOM   3243  O  O     . SER A 1  418  ? 143.096 175.447 184.067 1.00 68.70  ?  418  SER A O     1 
ATOM   3244  C  CB    . SER A 1  418  ? 144.110 176.550 186.696 1.00 66.40  ?  418  SER A CB    1 
ATOM   3245  O  OG    . SER A 1  418  ? 142.781 176.673 187.176 1.00 74.84  ?  418  SER A OG    1 
ATOM   3246  N  N     . LYS A 1  419  ? 142.221 174.016 185.569 1.00 64.56  ?  419  LYS A N     1 
ATOM   3247  C  CA    . LYS A 1  419  ? 141.013 173.689 184.818 1.00 64.77  ?  419  LYS A CA    1 
ATOM   3248  C  C     . LYS A 1  419  ? 140.122 174.981 184.691 1.00 71.41  ?  419  LYS A C     1 
ATOM   3249  O  O     . LYS A 1  419  ? 139.294 175.098 183.771 1.00 73.22  ?  419  LYS A O     1 
ATOM   3250  C  CB    . LYS A 1  419  ? 140.263 172.548 185.527 1.00 65.98  ?  419  LYS A CB    1 
ATOM   3251  C  CG    . LYS A 1  419  ? 139.624 172.953 186.881 1.00 63.99  ?  419  LYS A CG    1 
ATOM   3252  C  CD    . LYS A 1  419  ? 138.925 171.803 187.597 1.00 63.92  ?  419  LYS A CD    1 
ATOM   3253  C  CE    . LYS A 1  419  ? 139.875 170.948 188.385 1.00 65.91  ?  419  LYS A CE    1 
ATOM   3254  N  NZ    . LYS A 1  419  ? 139.831 171.286 189.826 1.00 78.73  1  419  LYS A NZ    1 
ATOM   3255  N  N     . ARG A 1  420  ? 140.349 175.961 185.591 1.00 66.15  ?  420  ARG A N     1 
ATOM   3256  C  CA    . ARG A 1  420  ? 139.611 177.206 185.624 1.00 65.07  ?  420  ARG A CA    1 
ATOM   3257  C  C     . ARG A 1  420  ? 140.371 178.361 185.016 1.00 69.40  ?  420  ARG A C     1 
ATOM   3258  O  O     . ARG A 1  420  ? 139.989 179.513 185.241 1.00 67.79  ?  420  ARG A O     1 
ATOM   3259  C  CB    . ARG A 1  420  ? 139.234 177.519 187.057 1.00 62.38  ?  420  ARG A CB    1 
ATOM   3260  C  CG    . ARG A 1  420  ? 138.217 176.571 187.616 1.00 64.17  ?  420  ARG A CG    1 
ATOM   3261  C  CD    . ARG A 1  420  ? 137.510 177.177 188.791 1.00 62.85  ?  420  ARG A CD    1 
ATOM   3262  N  NE    . ARG A 1  420  ? 137.040 178.528 188.515 1.00 66.07  ?  420  ARG A NE    1 
ATOM   3263  C  CZ    . ARG A 1  420  ? 136.245 179.214 189.326 1.00 99.58  ?  420  ARG A CZ    1 
ATOM   3264  N  NH1   . ARG A 1  420  ? 135.798 178.666 190.450 1.00 98.52  1  420  ARG A NH1   1 
ATOM   3265  N  NH2   . ARG A 1  420  ? 135.884 180.454 189.018 1.00 93.94  ?  420  ARG A NH2   1 
ATOM   3266  N  N     . ALA A 1  421  ? 141.426 178.068 184.221 1.00 68.87  ?  421  ALA A N     1 
ATOM   3267  C  CA    . ALA A 1  421  ? 142.251 179.091 183.549 1.00 70.35  ?  421  ALA A CA    1 
ATOM   3268  C  C     . ALA A 1  421  ? 141.462 179.976 182.552 1.00 78.71  ?  421  ALA A C     1 
ATOM   3269  O  O     . ALA A 1  421  ? 141.882 181.116 182.262 1.00 78.22  ?  421  ALA A O     1 
ATOM   3270  C  CB    . ALA A 1  421  ? 143.445 178.455 182.869 1.00 70.79  ?  421  ALA A CB    1 
ATOM   3271  N  N     . GLY A 1  422  ? 140.339 179.434 182.056 1.00 77.37  ?  422  GLY A N     1 
ATOM   3272  C  CA    . GLY A 1  422  ? 139.424 180.134 181.174 1.00 78.46  ?  422  GLY A CA    1 
ATOM   3273  C  C     . GLY A 1  422  ? 138.543 181.029 182.013 1.00 85.68  ?  422  GLY A C     1 
ATOM   3274  O  O     . GLY A 1  422  ? 138.799 182.233 182.098 1.00 85.19  ?  422  GLY A O     1 
ATOM   3275  N  N     . ASP A 1  423  ? 137.552 180.415 182.715 1.00 85.58  ?  423  ASP A N     1 
ATOM   3276  C  CA    . ASP A 1  423  ? 136.579 181.053 183.621 1.00 87.14  ?  423  ASP A CA    1 
ATOM   3277  C  C     . ASP A 1  423  ? 137.227 181.493 184.940 1.00 90.15  ?  423  ASP A C     1 
ATOM   3278  O  O     . ASP A 1  423  ? 136.862 181.057 186.033 1.00 89.93  ?  423  ASP A O     1 
ATOM   3279  C  CB    . ASP A 1  423  ? 135.338 180.158 183.862 1.00 91.25  ?  423  ASP A CB    1 
ATOM   3280  C  CG    . ASP A 1  423  ? 135.533 178.957 184.800 1.00 116.01 ?  423  ASP A CG    1 
ATOM   3281  O  OD1   . ASP A 1  423  ? 136.313 178.031 184.440 1.00 127.40 ?  423  ASP A OD1   1 
ATOM   3282  O  OD2   . ASP A 1  423  ? 134.911 178.947 185.898 1.00 118.53 -1 423  ASP A OD2   1 
ATOM   3283  N  N     . ILE A 1  424  ? 138.182 182.379 184.828 1.00 85.51  ?  424  ILE A N     1 
ATOM   3284  C  CA    . ILE A 1  424  ? 138.859 182.881 185.990 1.00 84.28  ?  424  ILE A CA    1 
ATOM   3285  C  C     . ILE A 1  424  ? 138.331 184.263 186.274 1.00 87.65  ?  424  ILE A C     1 
ATOM   3286  O  O     . ILE A 1  424  ? 138.524 185.187 185.479 1.00 86.84  ?  424  ILE A O     1 
ATOM   3287  C  CB    . ILE A 1  424  ? 140.381 182.774 185.781 1.00 86.68  ?  424  ILE A CB    1 
ATOM   3288  C  CG1   . ILE A 1  424  ? 141.159 183.041 187.051 1.00 85.82  ?  424  ILE A CG1   1 
ATOM   3289  C  CG2   . ILE A 1  424  ? 140.892 183.524 184.537 1.00 88.84  ?  424  ILE A CG2   1 
ATOM   3290  C  CD1   . ILE A 1  424  ? 141.812 181.809 187.495 1.00 89.33  ?  424  ILE A CD1   1 
ATOM   3291  N  N     . GLN A 1  425  ? 137.567 184.395 187.347 1.00 84.93  ?  425  GLN A N     1 
ATOM   3292  C  CA    . GLN A 1  425  ? 137.081 185.732 187.598 1.00 85.27  ?  425  GLN A CA    1 
ATOM   3293  C  C     . GLN A 1  425  ? 137.761 186.495 188.735 1.00 84.74  ?  425  GLN A C     1 
ATOM   3294  O  O     . GLN A 1  425  ? 137.529 186.218 189.923 1.00 84.08  ?  425  GLN A O     1 
ATOM   3295  C  CB    . GLN A 1  425  ? 135.557 185.908 187.493 1.00 88.31  ?  425  GLN A CB    1 
ATOM   3296  C  CG    . GLN A 1  425  ? 135.189 187.035 186.498 1.00 122.09 ?  425  GLN A CG    1 
ATOM   3297  C  CD    . GLN A 1  425  ? 136.011 188.335 186.621 1.00 145.42 ?  425  GLN A CD    1 
ATOM   3298  O  OE1   . GLN A 1  425  ? 135.633 189.270 187.344 1.00 143.01 ?  425  GLN A OE1   1 
ATOM   3299  N  NE2   . GLN A 1  425  ? 137.158 188.429 185.919 1.00 128.86 ?  425  GLN A NE2   1 
ATOM   3300  N  N     . LEU A 1  426  ? 138.612 187.474 188.321 1.00 77.59  ?  426  LEU A N     1 
ATOM   3301  C  CA    . LEU A 1  426  ? 139.450 188.350 189.145 1.00 75.63  ?  426  LEU A CA    1 
ATOM   3302  C  C     . LEU A 1  426  ? 138.706 189.079 190.233 1.00 79.18  ?  426  LEU A C     1 
ATOM   3303  O  O     . LEU A 1  426  ? 137.496 189.236 190.127 1.00 79.75  ?  426  LEU A O     1 
ATOM   3304  C  CB    . LEU A 1  426  ? 140.237 189.346 188.270 1.00 74.61  ?  426  LEU A CB    1 
ATOM   3305  C  CG    . LEU A 1  426  ? 141.254 188.729 187.297 1.00 77.63  ?  426  LEU A CG    1 
ATOM   3306  C  CD1   . LEU A 1  426  ? 141.971 189.779 186.524 1.00 76.89  ?  426  LEU A CD1   1 
ATOM   3307  C  CD2   . LEU A 1  426  ? 142.288 187.886 188.022 1.00 79.02  ?  426  LEU A CD2   1 
ATOM   3308  N  N     . GLN A 1  427  ? 139.414 189.464 191.310 1.00 74.88  ?  427  GLN A N     1 
ATOM   3309  C  CA    . GLN A 1  427  ? 138.869 190.224 192.448 1.00 74.64  ?  427  GLN A CA    1 
ATOM   3310  C  C     . GLN A 1  427  ? 139.893 191.274 192.849 1.00 77.69  ?  427  GLN A C     1 
ATOM   3311  O  O     . GLN A 1  427  ? 141.085 190.950 192.907 1.00 76.71  ?  427  GLN A O     1 
ATOM   3312  C  CB    . GLN A 1  427  ? 138.553 189.319 193.647 1.00 75.81  ?  427  GLN A CB    1 
ATOM   3313  C  CG    . GLN A 1  427  ? 137.126 188.795 193.668 1.00 90.37  ?  427  GLN A CG    1 
ATOM   3314  C  CD    . GLN A 1  427  ? 137.079 187.346 194.125 1.00 118.81 ?  427  GLN A CD    1 
ATOM   3315  O  OE1   . GLN A 1  427  ? 137.451 187.004 195.267 1.00 118.13 ?  427  GLN A OE1   1 
ATOM   3316  N  NE2   . GLN A 1  427  ? 136.651 186.447 193.227 1.00 107.22 ?  427  GLN A NE2   1 
ATOM   3317  N  N     . TYR A 1  428  ? 139.447 192.526 193.112 1.00 73.53  ?  428  TYR A N     1 
ATOM   3318  C  CA    . TYR A 1  428  ? 140.341 193.606 193.513 1.00 73.33  ?  428  TYR A CA    1 
ATOM   3319  C  C     . TYR A 1  428  ? 141.278 193.152 194.619 1.00 78.53  ?  428  TYR A C     1 
ATOM   3320  O  O     . TYR A 1  428  ? 140.841 192.462 195.540 1.00 80.38  ?  428  TYR A O     1 
ATOM   3321  C  CB    . TYR A 1  428  ? 139.543 194.823 193.934 1.00 75.55  ?  428  TYR A CB    1 
ATOM   3322  C  CG    . TYR A 1  428  ? 138.788 195.460 192.795 1.00 79.96  ?  428  TYR A CG    1 
ATOM   3323  C  CD1   . TYR A 1  428  ? 139.224 195.326 191.481 1.00 82.85  ?  428  TYR A CD1   1 
ATOM   3324  C  CD2   . TYR A 1  428  ? 137.703 196.291 193.033 1.00 82.04  ?  428  TYR A CD2   1 
ATOM   3325  C  CE1   . TYR A 1  428  ? 138.545 195.935 190.426 1.00 86.38  ?  428  TYR A CE1   1 
ATOM   3326  C  CE2   . TYR A 1  428  ? 137.026 196.921 191.990 1.00 83.77  ?  428  TYR A CE2   1 
ATOM   3327  C  CZ    . TYR A 1  428  ? 137.438 196.728 190.684 1.00 93.80  ?  428  TYR A CZ    1 
ATOM   3328  O  OH    . TYR A 1  428  ? 136.751 197.332 189.653 1.00 97.20  ?  428  TYR A OH    1 
ATOM   3329  N  N     . GLY A 1  429  ? 142.563 193.432 194.478 1.00 73.69  ?  429  GLY A N     1 
ATOM   3330  C  CA    . GLY A 1  429  ? 143.539 192.971 195.460 1.00 73.23  ?  429  GLY A CA    1 
ATOM   3331  C  C     . GLY A 1  429  ? 144.275 191.699 195.070 1.00 76.17  ?  429  GLY A C     1 
ATOM   3332  O  O     . GLY A 1  429  ? 145.367 191.421 195.570 1.00 76.39  ?  429  GLY A O     1 
ATOM   3333  N  N     . TRP A 1  430  ? 143.728 190.928 194.157 1.00 71.28  ?  430  TRP A N     1 
ATOM   3334  C  CA    . TRP A 1  430  ? 144.449 189.759 193.705 1.00 70.41  ?  430  TRP A CA    1 
ATOM   3335  C  C     . TRP A 1  430  ? 145.648 190.226 192.897 1.00 71.38  ?  430  TRP A C     1 
ATOM   3336  O  O     . TRP A 1  430  ? 145.723 191.390 192.497 1.00 70.54  ?  430  TRP A O     1 
ATOM   3337  C  CB    . TRP A 1  430  ? 143.548 188.936 192.802 1.00 70.18  ?  430  TRP A CB    1 
ATOM   3338  C  CG    . TRP A 1  430  ? 142.497 188.159 193.523 1.00 72.39  ?  430  TRP A CG    1 
ATOM   3339  C  CD1   . TRP A 1  430  ? 142.100 188.300 194.820 1.00 75.74  ?  430  TRP A CD1   1 
ATOM   3340  C  CD2   . TRP A 1  430  ? 141.712 187.105 192.977 1.00 72.83  ?  430  TRP A CD2   1 
ATOM   3341  N  NE1   . TRP A 1  430  ? 141.135 187.374 195.120 1.00 75.74  ?  430  TRP A NE1   1 
ATOM   3342  C  CE2   . TRP A 1  430  ? 140.897 186.608 194.014 1.00 77.22  ?  430  TRP A CE2   1 
ATOM   3343  C  CE3   . TRP A 1  430  ? 141.640 186.503 191.712 1.00 74.40  ?  430  TRP A CE3   1 
ATOM   3344  C  CZ2   . TRP A 1  430  ? 140.002 185.562 193.818 1.00 77.38  ?  430  TRP A CZ2   1 
ATOM   3345  C  CZ3   . TRP A 1  430  ? 140.777 185.444 191.526 1.00 76.47  ?  430  TRP A CZ3   1 
ATOM   3346  C  CH2   . TRP A 1  430  ? 139.948 185.003 192.561 1.00 77.74  ?  430  TRP A CH2   1 
ATOM   3347  N  N     . LYS A 1  431  ? 146.583 189.330 192.654 1.00 66.17  ?  431  LYS A N     1 
ATOM   3348  C  CA    . LYS A 1  431  ? 147.736 189.662 191.835 1.00 64.29  ?  431  LYS A CA    1 
ATOM   3349  C  C     . LYS A 1  431  ? 147.739 188.820 190.547 1.00 68.21  ?  431  LYS A C     1 
ATOM   3350  O  O     . LYS A 1  431  ? 147.550 187.608 190.597 1.00 68.38  ?  431  LYS A O     1 
ATOM   3351  C  CB    . LYS A 1  431  ? 149.049 189.461 192.613 1.00 64.32  ?  431  LYS A CB    1 
ATOM   3352  C  CG    . LYS A 1  431  ? 149.392 190.570 193.574 1.00 62.69  ?  431  LYS A CG    1 
ATOM   3353  C  CD    . LYS A 1  431  ? 150.565 190.179 194.488 1.00 72.92  ?  431  LYS A CD    1 
ATOM   3354  C  CE    . LYS A 1  431  ? 150.245 190.226 195.975 1.00 90.46  ?  431  LYS A CE    1 
ATOM   3355  N  NZ    . LYS A 1  431  ? 149.074 189.371 196.370 1.00 106.22 1  431  LYS A NZ    1 
ATOM   3356  N  N     . VAL A 1  432  ? 147.957 189.459 189.403 1.00 63.98  ?  432  VAL A N     1 
ATOM   3357  C  CA    . VAL A 1  432  ? 148.132 188.747 188.154 1.00 63.46  ?  432  VAL A CA    1 
ATOM   3358  C  C     . VAL A 1  432  ? 149.617 188.812 187.823 1.00 64.49  ?  432  VAL A C     1 
ATOM   3359  O  O     . VAL A 1  432  ? 150.187 189.905 187.690 1.00 64.49  ?  432  VAL A O     1 
ATOM   3360  C  CB    . VAL A 1  432  ? 147.265 189.311 187.026 1.00 69.07  ?  432  VAL A CB    1 
ATOM   3361  C  CG1   . VAL A 1  432  ? 147.697 188.751 185.669 1.00 69.03  ?  432  VAL A CG1   1 
ATOM   3362  C  CG2   . VAL A 1  432  ? 145.805 189.000 187.291 1.00 69.90  ?  432  VAL A CG2   1 
ATOM   3363  N  N     . GLU A 1  433  ? 150.255 187.652 187.753 1.00 57.87  ?  433  GLU A N     1 
ATOM   3364  C  CA    . GLU A 1  433  ? 151.648 187.603 187.394 1.00 56.50  ?  433  GLU A CA    1 
ATOM   3365  C  C     . GLU A 1  433  ? 151.669 187.602 185.859 1.00 64.24  ?  433  GLU A C     1 
ATOM   3366  O  O     . GLU A 1  433  ? 151.489 186.569 185.206 1.00 65.45  ?  433  GLU A O     1 
ATOM   3367  C  CB    . GLU A 1  433  ? 152.313 186.388 188.023 1.00 57.09  ?  433  GLU A CB    1 
ATOM   3368  C  CG    . GLU A 1  433  ? 153.066 186.741 189.287 1.00 67.86  ?  433  GLU A CG    1 
ATOM   3369  C  CD    . GLU A 1  433  ? 153.941 185.652 189.874 1.00 90.46  ?  433  GLU A CD    1 
ATOM   3370  O  OE1   . GLU A 1  433  ? 154.617 184.938 189.098 1.00 89.27  ?  433  GLU A OE1   1 
ATOM   3371  O  OE2   . GLU A 1  433  ? 153.987 185.543 191.120 1.00 82.79  -1 433  GLU A OE2   1 
ATOM   3372  N  N     . ARG A 1  434  ? 151.779 188.789 185.280 1.00 61.95  ?  434  ARG A N     1 
ATOM   3373  C  CA    . ARG A 1  434  ? 151.745 188.940 183.831 1.00 62.68  ?  434  ARG A CA    1 
ATOM   3374  C  C     . ARG A 1  434  ? 153.120 189.070 183.202 1.00 67.34  ?  434  ARG A C     1 
ATOM   3375  O  O     . ARG A 1  434  ? 154.046 189.531 183.868 1.00 67.39  ?  434  ARG A O     1 
ATOM   3376  C  CB    . ARG A 1  434  ? 150.868 190.138 183.439 1.00 64.45  ?  434  ARG A CB    1 
ATOM   3377  C  CG    . ARG A 1  434  ? 151.287 191.461 184.081 1.00 76.35  ?  434  ARG A CG    1 
ATOM   3378  C  CD    . ARG A 1  434  ? 151.120 192.599 183.112 1.00 81.24  ?  434  ARG A CD    1 
ATOM   3379  N  NE    . ARG A 1  434  ? 152.423 193.117 182.723 1.00 80.43  ?  434  ARG A NE    1 
ATOM   3380  C  CZ    . ARG A 1  434  ? 152.920 194.265 183.151 1.00 80.69  ?  434  ARG A CZ    1 
ATOM   3381  N  NH1   . ARG A 1  434  ? 152.223 195.030 183.977 1.00 63.87  1  434  ARG A NH1   1 
ATOM   3382  N  NH2   . ARG A 1  434  ? 154.119 194.659 182.756 1.00 61.27  ?  434  ARG A NH2   1 
ATOM   3383  N  N     . HIS A 1  435  ? 153.229 188.736 181.889 1.00 63.74  ?  435  HIS A N     1 
ATOM   3384  C  CA    . HIS A 1  435  ? 154.454 188.855 181.092 1.00 62.83  ?  435  HIS A CA    1 
ATOM   3385  C  C     . HIS A 1  435  ? 155.006 190.279 181.151 1.00 70.52  ?  435  HIS A C     1 
ATOM   3386  O  O     . HIS A 1  435  ? 154.275 191.242 181.430 1.00 71.19  ?  435  HIS A O     1 
ATOM   3387  C  CB    . HIS A 1  435  ? 154.213 188.467 179.614 1.00 62.52  ?  435  HIS A CB    1 
ATOM   3388  C  CG    . HIS A 1  435  ? 153.878 187.023 179.401 1.00 65.31  ?  435  HIS A CG    1 
ATOM   3389  N  ND1   . HIS A 1  435  ? 152.726 186.637 178.755 1.00 67.27  ?  435  HIS A ND1   1 
ATOM   3390  C  CD2   . HIS A 1  435  ? 154.542 185.913 179.779 1.00 66.59  ?  435  HIS A CD2   1 
ATOM   3391  C  CE1   . HIS A 1  435  ? 152.735 185.314 178.734 1.00 66.42  ?  435  HIS A CE1   1 
ATOM   3392  N  NE2   . HIS A 1  435  ? 153.818 184.830 179.321 1.00 66.42  ?  435  HIS A NE2   1 
ATOM   3393  N  N     . ILE A 1  436  ? 156.314 190.394 180.911 1.00 67.47  ?  436  ILE A N     1 
ATOM   3394  C  CA    . ILE A 1  436  ? 157.044 191.655 180.813 1.00 66.45  ?  436  ILE A CA    1 
ATOM   3395  C  C     . ILE A 1  436  ? 156.526 192.309 179.508 1.00 68.64  ?  436  ILE A C     1 
ATOM   3396  O  O     . ILE A 1  436  ? 156.326 191.610 178.509 1.00 67.13  ?  436  ILE A O     1 
ATOM   3397  C  CB    . ILE A 1  436  ? 158.572 191.268 180.875 1.00 69.25  ?  436  ILE A CB    1 
ATOM   3398  C  CG1   . ILE A 1  436  ? 159.005 191.082 182.302 1.00 70.25  ?  436  ILE A CG1   1 
ATOM   3399  C  CG2   . ILE A 1  436  ? 159.529 192.220 180.219 1.00 69.63  ?  436  ILE A CG2   1 
ATOM   3400  C  CD1   . ILE A 1  436  ? 158.094 191.744 183.370 1.00 87.68  ?  436  ILE A CD1   1 
ATOM   3401  N  N     . MET A 1  437  ? 156.156 193.581 179.559 1.00 66.11  ?  437  MET A N     1 
ATOM   3402  C  CA    . MET A 1  437  ? 155.609 194.228 178.365 1.00 68.13  ?  437  MET A CA    1 
ATOM   3403  C  C     . MET A 1  437  ? 156.292 195.551 177.983 1.00 69.26  ?  437  MET A C     1 
ATOM   3404  O  O     . MET A 1  437  ? 156.828 196.261 178.849 1.00 68.31  ?  437  MET A O     1 
ATOM   3405  C  CB    . MET A 1  437  ? 154.103 194.457 178.500 1.00 72.69  ?  437  MET A CB    1 
ATOM   3406  C  CG    . MET A 1  437  ? 153.285 193.209 178.833 1.00 79.61  ?  437  MET A CG    1 
ATOM   3407  S  SD    . MET A 1  437  ? 151.464 193.454 178.745 1.00 87.67  ?  437  MET A SD    1 
ATOM   3408  C  CE    . MET A 1  437  ? 151.267 194.996 179.886 1.00 85.00  ?  437  MET A CE    1 
ATOM   3409  N  N     . ASP A 1  438  ? 156.211 195.910 176.674 1.00 63.06  ?  438  ASP A N     1 
ATOM   3410  C  CA    . ASP A 1  438  ? 156.762 197.139 176.114 1.00 61.01  ?  438  ASP A CA    1 
ATOM   3411  C  C     . ASP A 1  438  ? 156.561 198.278 177.101 1.00 64.22  ?  438  ASP A C     1 
ATOM   3412  O  O     . ASP A 1  438  ? 155.471 198.494 177.624 1.00 62.76  ?  438  ASP A O     1 
ATOM   3413  C  CB    . ASP A 1  438  ? 156.116 197.474 174.764 1.00 62.71  ?  438  ASP A CB    1 
ATOM   3414  C  CG    . ASP A 1  438  ? 156.683 196.760 173.553 1.00 77.63  ?  438  ASP A CG    1 
ATOM   3415  O  OD1   . ASP A 1  438  ? 156.695 195.518 173.549 1.00 81.13  ?  438  ASP A OD1   1 
ATOM   3416  O  OD2   . ASP A 1  438  ? 156.974 197.437 172.550 1.00 85.59  -1 438  ASP A OD2   1 
ATOM   3417  N  N     . ASN A 1  439  ? 157.661 198.928 177.424 1.00 62.53  ?  439  ASN A N     1 
ATOM   3418  C  CA    . ASN A 1  439  ? 157.785 200.059 178.334 1.00 62.39  ?  439  ASN A CA    1 
ATOM   3419  C  C     . ASN A 1  439  ? 157.837 199.743 179.817 1.00 67.56  ?  439  ASN A C     1 
ATOM   3420  O  O     . ASN A 1  439  ? 157.819 200.651 180.634 1.00 67.41  ?  439  ASN A O     1 
ATOM   3421  C  CB    . ASN A 1  439  ? 156.946 201.268 177.926 1.00 57.68  ?  439  ASN A CB    1 
ATOM   3422  C  CG    . ASN A 1  439  ? 157.415 201.827 176.596 1.00 87.52  ?  439  ASN A CG    1 
ATOM   3423  O  OD1   . ASN A 1  439  ? 158.537 201.569 176.098 1.00 78.64  ?  439  ASN A OD1   1 
ATOM   3424  N  ND2   . ASN A 1  439  ? 156.531 202.545 175.942 1.00 87.73  ?  439  ASN A ND2   1 
ATOM   3425  N  N     . ASP A 1  440  ? 158.054 198.481 180.170 1.00 65.08  ?  440  ASP A N     1 
ATOM   3426  C  CA    . ASP A 1  440  ? 158.277 198.177 181.576 1.00 65.73  ?  440  ASP A CA    1 
ATOM   3427  C  C     . ASP A 1  440  ? 159.714 198.620 181.925 1.00 69.52  ?  440  ASP A C     1 
ATOM   3428  O  O     . ASP A 1  440  ? 160.611 198.359 181.114 1.00 71.60  ?  440  ASP A O     1 
ATOM   3429  C  CB    . ASP A 1  440  ? 158.161 196.658 181.850 1.00 67.75  ?  440  ASP A CB    1 
ATOM   3430  C  CG    . ASP A 1  440  ? 156.748 196.119 181.951 1.00 81.08  ?  440  ASP A CG    1 
ATOM   3431  O  OD1   . ASP A 1  440  ? 155.812 196.932 182.151 1.00 82.65  ?  440  ASP A OD1   1 
ATOM   3432  O  OD2   . ASP A 1  440  ? 156.574 194.873 181.848 1.00 85.69  -1 440  ASP A OD2   1 
ATOM   3433  N  N     . PRO A 1  441  ? 159.991 199.242 183.100 1.00 62.01  ?  441  PRO A N     1 
ATOM   3434  C  CA    . PRO A 1  441  ? 161.385 199.517 183.461 1.00 60.69  ?  441  PRO A CA    1 
ATOM   3435  C  C     . PRO A 1  441  ? 162.093 198.213 183.893 1.00 61.92  ?  441  PRO A C     1 
ATOM   3436  O  O     . PRO A 1  441  ? 161.517 197.421 184.642 1.00 61.52  ?  441  PRO A O     1 
ATOM   3437  C  CB    . PRO A 1  441  ? 161.246 200.493 184.620 1.00 62.44  ?  441  PRO A CB    1 
ATOM   3438  C  CG    . PRO A 1  441  ? 160.000 200.114 185.275 1.00 66.68  ?  441  PRO A CG    1 
ATOM   3439  C  CD    . PRO A 1  441  ? 159.083 199.624 184.190 1.00 62.64  ?  441  PRO A CD    1 
ATOM   3440  N  N     . VAL A 1  442  ? 163.296 197.956 183.355 1.00 56.26  ?  442  VAL A N     1 
ATOM   3441  C  CA    . VAL A 1  442  ? 164.110 196.776 183.668 1.00 54.99  ?  442  VAL A CA    1 
ATOM   3442  C  C     . VAL A 1  442  ? 165.577 197.170 183.853 1.00 60.54  ?  442  VAL A C     1 
ATOM   3443  O  O     . VAL A 1  442  ? 166.047 198.118 183.206 1.00 60.06  ?  442  VAL A O     1 
ATOM   3444  C  CB    . VAL A 1  442  ? 163.953 195.595 182.680 1.00 58.02  ?  442  VAL A CB    1 
ATOM   3445  C  CG1   . VAL A 1  442  ? 162.561 195.021 182.733 1.00 58.28  ?  442  VAL A CG1   1 
ATOM   3446  C  CG2   . VAL A 1  442  ? 164.321 195.971 181.256 1.00 57.79  ?  442  VAL A CG2   1 
ATOM   3447  N  N     . LEU A 1  443  ? 166.297 196.454 184.757 1.00 57.38  ?  443  LEU A N     1 
ATOM   3448  C  CA    . LEU A 1  443  ? 167.720 196.694 185.021 1.00 56.08  ?  443  LEU A CA    1 
ATOM   3449  C  C     . LEU A 1  443  ? 168.500 195.907 184.000 1.00 58.45  ?  443  LEU A C     1 
ATOM   3450  O  O     . LEU A 1  443  ? 168.269 194.706 183.845 1.00 58.03  ?  443  LEU A O     1 
ATOM   3451  C  CB    . LEU A 1  443  ? 168.127 196.275 186.447 1.00 55.38  ?  443  LEU A CB    1 
ATOM   3452  C  CG    . LEU A 1  443  ? 169.023 197.229 187.272 1.00 59.51  ?  443  LEU A CG    1 
ATOM   3453  C  CD1   . LEU A 1  443  ? 170.220 196.534 187.785 1.00 58.88  ?  443  LEU A CD1   1 
ATOM   3454  C  CD2   . LEU A 1  443  ? 169.525 198.382 186.486 1.00 62.86  ?  443  LEU A CD2   1 
ATOM   3455  N  N     . PHE A 1  444  ? 169.343 196.592 183.237 1.00 53.73  ?  444  PHE A N     1 
ATOM   3456  C  CA    . PHE A 1  444  ? 170.161 195.945 182.220 1.00 53.58  ?  444  PHE A CA    1 
ATOM   3457  C  C     . PHE A 1  444  ? 171.575 196.044 182.698 1.00 59.78  ?  444  PHE A C     1 
ATOM   3458  O  O     . PHE A 1  444  ? 171.961 197.108 183.187 1.00 61.34  ?  444  PHE A O     1 
ATOM   3459  C  CB    . PHE A 1  444  ? 170.022 196.671 180.885 1.00 55.23  ?  444  PHE A CB    1 
ATOM   3460  C  CG    . PHE A 1  444  ? 170.445 195.906 179.657 1.00 55.94  ?  444  PHE A CG    1 
ATOM   3461  C  CD1   . PHE A 1  444  ? 170.178 194.545 179.538 1.00 58.21  ?  444  PHE A CD1   1 
ATOM   3462  C  CD2   . PHE A 1  444  ? 171.008 196.566 178.573 1.00 57.71  ?  444  PHE A CD2   1 
ATOM   3463  C  CE1   . PHE A 1  444  ? 170.506 193.854 178.374 1.00 59.33  ?  444  PHE A CE1   1 
ATOM   3464  C  CE2   . PHE A 1  444  ? 171.340 195.874 177.410 1.00 60.85  ?  444  PHE A CE2   1 
ATOM   3465  C  CZ    . PHE A 1  444  ? 171.082 194.523 177.317 1.00 59.06  ?  444  PHE A CZ    1 
ATOM   3466  N  N     . ASN A 1  445  ? 172.362 194.968 182.582 1.00 55.65  ?  445  ASN A N     1 
ATOM   3467  C  CA    . ASN A 1  445  ? 173.724 195.018 183.099 1.00 55.21  ?  445  ASN A CA    1 
ATOM   3468  C  C     . ASN A 1  445  ? 174.718 194.208 182.337 1.00 59.91  ?  445  ASN A C     1 
ATOM   3469  O  O     . ASN A 1  445  ? 174.445 193.059 181.999 1.00 60.04  ?  445  ASN A O     1 
ATOM   3470  C  CB    . ASN A 1  445  ? 173.736 194.649 184.597 1.00 53.57  ?  445  ASN A CB    1 
ATOM   3471  C  CG    . ASN A 1  445  ? 174.922 193.859 185.115 1.00 79.29  ?  445  ASN A CG    1 
ATOM   3472  O  OD1   . ASN A 1  445  ? 176.063 194.334 185.099 1.00 83.02  ?  445  ASN A OD1   1 
ATOM   3473  N  ND2   . ASN A 1  445  ? 174.663 192.664 185.660 1.00 65.33  ?  445  ASN A ND2   1 
ATOM   3474  N  N     . ARG A 1  446  ? 175.917 194.777 182.161 1.00 57.67  ?  446  ARG A N     1 
ATOM   3475  C  CA    . ARG A 1  446  ? 177.042 194.075 181.566 1.00 58.69  ?  446  ARG A CA    1 
ATOM   3476  C  C     . ARG A 1  446  ? 178.103 193.914 182.610 1.00 63.00  ?  446  ARG A C     1 
ATOM   3477  O  O     . ARG A 1  446  ? 178.630 194.921 183.113 1.00 61.96  ?  446  ARG A O     1 
ATOM   3478  C  CB    . ARG A 1  446  ? 177.640 194.801 180.363 1.00 60.86  ?  446  ARG A CB    1 
ATOM   3479  C  CG    . ARG A 1  446  ? 178.539 193.876 179.542 1.00 64.14  ?  446  ARG A CG    1 
ATOM   3480  C  CD    . ARG A 1  446  ? 179.578 194.645 178.774 1.00 59.64  ?  446  ARG A CD    1 
ATOM   3481  N  NE    . ARG A 1  446  ? 180.696 193.782 178.437 1.00 65.34  ?  446  ARG A NE    1 
ATOM   3482  C  CZ    . ARG A 1  446  ? 181.920 193.924 178.923 1.00 93.17  ?  446  ARG A CZ    1 
ATOM   3483  N  NH1   . ARG A 1  446  ? 182.208 194.935 179.739 1.00 92.68  1  446  ARG A NH1   1 
ATOM   3484  N  NH2   . ARG A 1  446  ? 182.877 193.083 178.567 1.00 88.62  ?  446  ARG A NH2   1 
ATOM   3485  N  N     . GLN A 1  447  ? 178.429 192.643 182.920 1.00 60.97  ?  447  GLN A N     1 
ATOM   3486  C  CA    . GLN A 1  447  ? 179.470 192.320 183.889 1.00 62.00  ?  447  GLN A CA    1 
ATOM   3487  C  C     . GLN A 1  447  ? 180.838 192.503 183.223 1.00 69.95  ?  447  GLN A C     1 
ATOM   3488  O  O     . GLN A 1  447  ? 180.877 192.321 182.011 1.00 72.55  ?  447  GLN A O     1 
ATOM   3489  C  CB    . GLN A 1  447  ? 179.256 190.930 184.483 1.00 62.69  ?  447  GLN A CB    1 
ATOM   3490  C  CG    . GLN A 1  447  ? 178.225 190.934 185.606 1.00 62.54  ?  447  GLN A CG    1 
ATOM   3491  C  CD    . GLN A 1  447  ? 177.465 189.645 185.628 1.00 96.39  ?  447  GLN A CD    1 
ATOM   3492  O  OE1   . GLN A 1  447  ? 177.299 188.974 184.597 1.00 98.85  ?  447  GLN A OE1   1 
ATOM   3493  N  NE2   . GLN A 1  447  ? 176.968 189.274 186.797 1.00 92.46  ?  447  GLN A NE2   1 
ATOM   3494  N  N     . PRO A 1  448  ? 181.908 193.028 183.863 1.00 66.68  ?  448  PRO A N     1 
ATOM   3495  C  CA    . PRO A 1  448  ? 182.137 193.179 185.290 1.00 67.53  ?  448  PRO A CA    1 
ATOM   3496  C  C     . PRO A 1  448  ? 181.213 194.015 186.154 1.00 75.43  ?  448  PRO A C     1 
ATOM   3497  O  O     . PRO A 1  448  ? 180.660 193.413 187.088 1.00 78.12  ?  448  PRO A O     1 
ATOM   3498  C  CB    . PRO A 1  448  ? 183.628 193.488 185.378 1.00 69.39  ?  448  PRO A CB    1 
ATOM   3499  C  CG    . PRO A 1  448  ? 184.183 192.845 184.186 1.00 73.29  ?  448  PRO A CG    1 
ATOM   3500  C  CD    . PRO A 1  448  ? 183.181 193.183 183.148 1.00 68.58  ?  448  PRO A CD    1 
ATOM   3501  N  N     . SER A 1  449  ? 181.003 195.326 185.886 1.00 69.78  ?  449  SER A N     1 
ATOM   3502  C  CA    . SER A 1  449  ? 180.143 196.202 186.731 1.00 68.70  ?  449  SER A CA    1 
ATOM   3503  C  C     . SER A 1  449  ? 181.016 196.967 187.689 1.00 74.34  ?  449  SER A C     1 
ATOM   3504  O  O     . SER A 1  449  ? 180.861 196.860 188.925 1.00 74.05  ?  449  SER A O     1 
ATOM   3505  C  CB    . SER A 1  449  ? 179.069 195.452 187.539 1.00 68.57  ?  449  SER A CB    1 
ATOM   3506  O  OG    . SER A 1  449  ? 178.018 194.884 186.782 1.00 71.26  ?  449  SER A OG    1 
ATOM   3507  N  N     . LEU A 1  450  ? 181.955 197.727 187.121 1.00 72.27  ?  450  LEU A N     1 
ATOM   3508  C  CA    . LEU A 1  450  ? 182.873 198.552 187.912 1.00 73.65  ?  450  LEU A CA    1 
ATOM   3509  C  C     . LEU A 1  450  ? 182.440 200.023 187.872 1.00 78.55  ?  450  LEU A C     1 
ATOM   3510  O  O     . LEU A 1  450  ? 183.223 200.928 188.163 1.00 80.34  ?  450  LEU A O     1 
ATOM   3511  C  CB    . LEU A 1  450  ? 184.324 198.388 187.424 1.00 74.20  ?  450  LEU A CB    1 
ATOM   3512  C  CG    . LEU A 1  450  ? 184.529 197.589 186.152 1.00 78.43  ?  450  LEU A CG    1 
ATOM   3513  C  CD1   . LEU A 1  450  ? 185.273 198.422 185.100 1.00 78.73  ?  450  LEU A CD1   1 
ATOM   3514  C  CD2   . LEU A 1  450  ? 185.244 196.298 186.459 1.00 80.24  ?  450  LEU A CD2   1 
ATOM   3515  N  N     . HIS A 1  451  ? 181.161 200.226 187.606 1.00 73.10  ?  451  HIS A N     1 
ATOM   3516  C  CA    . HIS A 1  451  ? 180.522 201.485 187.333 1.00 72.99  ?  451  HIS A CA    1 
ATOM   3517  C  C     . HIS A 1  451  ? 179.100 201.499 187.816 1.00 76.13  ?  451  HIS A C     1 
ATOM   3518  O  O     . HIS A 1  451  ? 178.424 200.469 187.652 1.00 75.66  ?  451  HIS A O     1 
ATOM   3519  C  CB    . HIS A 1  451  ? 180.323 201.413 185.835 1.00 74.18  ?  451  HIS A CB    1 
ATOM   3520  C  CG    . HIS A 1  451  ? 180.992 202.436 185.053 1.00 78.09  ?  451  HIS A CG    1 
ATOM   3521  N  ND1   . HIS A 1  451  ? 180.767 202.529 183.704 1.00 80.17  ?  451  HIS A ND1   1 
ATOM   3522  C  CD2   . HIS A 1  451  ? 181.878 203.372 185.435 1.00 80.96  ?  451  HIS A CD2   1 
ATOM   3523  C  CE1   . HIS A 1  451  ? 181.518 203.529 183.294 1.00 80.94  ?  451  HIS A CE1   1 
ATOM   3524  N  NE2   . HIS A 1  451  ? 182.212 204.062 184.305 1.00 81.72  ?  451  HIS A NE2   1 
ATOM   3525  N  N     . LYS A 1  452  ? 178.545 202.689 188.174 1.00 70.35  ?  452  LYS A N     1 
ATOM   3526  C  CA    . LYS A 1  452  ? 177.099 202.676 188.402 1.00 68.00  ?  452  LYS A CA    1 
ATOM   3527  C  C     . LYS A 1  452  ? 176.397 202.533 187.027 1.00 69.83  ?  452  LYS A C     1 
ATOM   3528  O  O     . LYS A 1  452  ? 175.417 201.810 186.924 1.00 68.23  ?  452  LYS A O     1 
ATOM   3529  C  CB    . LYS A 1  452  ? 176.575 203.807 189.322 1.00 69.27  ?  452  LYS A CB    1 
ATOM   3530  C  CG    . LYS A 1  452  ? 176.366 205.200 188.738 1.00 69.46  ?  452  LYS A CG    1 
ATOM   3531  C  CD    . LYS A 1  452  ? 176.398 206.226 189.886 1.00 72.56  ?  452  LYS A CD    1 
ATOM   3532  C  CE    . LYS A 1  452  ? 175.346 207.286 189.821 1.00 78.80  ?  452  LYS A CE    1 
ATOM   3533  N  NZ    . LYS A 1  452  ? 175.609 208.246 188.723 1.00 90.96  1  452  LYS A NZ    1 
ATOM   3534  N  N     . MET A 1  453  ? 177.030 203.069 185.954 1.00 66.91  ?  453  MET A N     1 
ATOM   3535  C  CA    . MET A 1  453  ? 176.563 202.993 184.561 1.00 66.66  ?  453  MET A CA    1 
ATOM   3536  C  C     . MET A 1  453  ? 176.652 201.625 183.966 1.00 67.64  ?  453  MET A C     1 
ATOM   3537  O  O     . MET A 1  453  ? 176.250 201.488 182.819 1.00 67.91  ?  453  MET A O     1 
ATOM   3538  C  CB    . MET A 1  453  ? 177.337 203.938 183.639 1.00 70.13  ?  453  MET A CB    1 
ATOM   3539  C  CG    . MET A 1  453  ? 177.115 205.372 183.938 1.00 75.37  ?  453  MET A CG    1 
ATOM   3540  S  SD    . MET A 1  453  ? 178.172 205.843 185.306 1.00 80.59  ?  453  MET A SD    1 
ATOM   3541  C  CE    . MET A 1  453  ? 179.640 206.457 184.401 1.00 78.09  ?  453  MET A CE    1 
ATOM   3542  N  N     . SER A 1  454  ? 177.206 200.626 184.686 1.00 61.73  ?  454  SER A N     1 
ATOM   3543  C  CA    . SER A 1  454  ? 177.283 199.251 184.184 1.00 60.92  ?  454  SER A CA    1 
ATOM   3544  C  C     . SER A 1  454  ? 175.937 198.472 184.391 1.00 63.75  ?  454  SER A C     1 
ATOM   3545  O  O     . SER A 1  454  ? 175.765 197.364 183.897 1.00 62.24  ?  454  SER A O     1 
ATOM   3546  C  CB    . SER A 1  454  ? 178.459 198.526 184.816 1.00 63.96  ?  454  SER A CB    1 
ATOM   3547  O  OG    . SER A 1  454  ? 179.271 197.946 183.811 1.00 76.45  ?  454  SER A OG    1 
ATOM   3548  N  N     . MET A 1  455  ? 175.002 199.098 185.136 1.00 60.11  ?  455  MET A N     1 
ATOM   3549  C  CA    . MET A 1  455  ? 173.659 198.668 185.471 1.00 59.05  ?  455  MET A CA    1 
ATOM   3550  C  C     . MET A 1  455  ? 172.758 199.878 185.301 1.00 60.61  ?  455  MET A C     1 
ATOM   3551  O  O     . MET A 1  455  ? 172.818 200.810 186.098 1.00 58.90  ?  455  MET A O     1 
ATOM   3552  C  CB    . MET A 1  455  ? 173.587 198.215 186.915 1.00 61.96  ?  455  MET A CB    1 
ATOM   3553  C  CG    . MET A 1  455  ? 174.395 197.028 187.185 1.00 67.89  ?  455  MET A CG    1 
ATOM   3554  S  SD    . MET A 1  455  ? 173.798 196.296 188.708 1.00 75.15  ?  455  MET A SD    1 
ATOM   3555  C  CE    . MET A 1  455  ? 173.149 194.732 188.107 1.00 71.59  ?  455  MET A CE    1 
ATOM   3556  N  N     . MET A 1  456  ? 171.972 199.902 184.225 1.00 57.83  ?  456  MET A N     1 
ATOM   3557  C  CA    . MET A 1  456  ? 171.047 201.007 183.957 1.00 58.15  ?  456  MET A CA    1 
ATOM   3558  C  C     . MET A 1  456  ? 169.639 200.493 183.623 1.00 60.75  ?  456  MET A C     1 
ATOM   3559  O  O     . MET A 1  456  ? 169.451 199.352 183.159 1.00 58.97  ?  456  MET A O     1 
ATOM   3560  C  CB    . MET A 1  456  ? 171.554 201.972 182.858 1.00 61.17  ?  456  MET A CB    1 
ATOM   3561  C  CG    . MET A 1  456  ? 172.841 202.709 183.193 1.00 65.01  ?  456  MET A CG    1 
ATOM   3562  S  SD    . MET A 1  456  ? 173.372 203.810 181.851 1.00 69.87  ?  456  MET A SD    1 
ATOM   3563  C  CE    . MET A 1  456  ? 173.772 202.691 180.608 1.00 65.98  ?  456  MET A CE    1 
ATOM   3564  N  N     . ALA A 1  457  ? 168.652 201.358 183.899 1.00 56.97  ?  457  ALA A N     1 
ATOM   3565  C  CA    . ALA A 1  457  ? 167.255 201.079 183.686 1.00 56.44  ?  457  ALA A CA    1 
ATOM   3566  C  C     . ALA A 1  457  ? 166.838 201.425 182.245 1.00 62.49  ?  457  ALA A C     1 
ATOM   3567  O  O     . ALA A 1  457  ? 167.063 202.540 181.766 1.00 63.08  ?  457  ALA A O     1 
ATOM   3568  C  CB    . ALA A 1  457  ? 166.431 201.835 184.710 1.00 56.94  ?  457  ALA A CB    1 
ATOM   3569  N  N     . HIS A 1  458  ? 166.270 200.439 181.543 1.00 59.05  ?  458  HIS A N     1 
ATOM   3570  C  CA    . HIS A 1  458  ? 165.815 200.600 180.160 1.00 58.65  ?  458  HIS A CA    1 
ATOM   3571  C  C     . HIS A 1  458  ? 164.312 200.339 180.043 1.00 61.44  ?  458  HIS A C     1 
ATOM   3572  O  O     . HIS A 1  458  ? 163.732 199.668 180.900 1.00 60.61  ?  458  HIS A O     1 
ATOM   3573  C  CB    . HIS A 1  458  ? 166.551 199.608 179.242 1.00 59.38  ?  458  HIS A CB    1 
ATOM   3574  C  CG    . HIS A 1  458  ? 168.010 199.875 179.048 1.00 63.26  ?  458  HIS A CG    1 
ATOM   3575  N  ND1   . HIS A 1  458  ? 168.536 200.117 177.787 1.00 65.57  ?  458  HIS A ND1   1 
ATOM   3576  C  CD2   . HIS A 1  458  ? 169.021 199.874 179.949 1.00 64.62  ?  458  HIS A CD2   1 
ATOM   3577  C  CE1   . HIS A 1  458  ? 169.837 200.270 177.967 1.00 64.77  ?  458  HIS A CE1   1 
ATOM   3578  N  NE2   . HIS A 1  458  ? 170.174 200.128 179.252 1.00 64.56  ?  458  HIS A NE2   1 
ATOM   3579  N  N     . ARG A 1  459  ? 163.691 200.838 178.961 1.00 57.52  ?  459  ARG A N     1 
ATOM   3580  C  CA    . ARG A 1  459  ? 162.285 200.589 178.620 1.00 56.56  ?  459  ARG A CA    1 
ATOM   3581  C  C     . ARG A 1  459  ? 162.221 199.242 177.864 1.00 61.92  ?  459  ARG A C     1 
ATOM   3582  O  O     . ARG A 1  459  ? 163.010 199.031 176.935 1.00 63.55  ?  459  ARG A O     1 
ATOM   3583  C  CB    . ARG A 1  459  ? 161.778 201.705 177.691 1.00 52.76  ?  459  ARG A CB    1 
ATOM   3584  C  CG    . ARG A 1  459  ? 161.273 202.944 178.393 1.00 48.24  ?  459  ARG A CG    1 
ATOM   3585  C  CD    . ARG A 1  459  ? 161.461 204.189 177.556 1.00 54.87  ?  459  ARG A CD    1 
ATOM   3586  N  NE    . ARG A 1  459  ? 160.482 204.342 176.481 1.00 70.30  ?  459  ARG A NE    1 
ATOM   3587  C  CZ    . ARG A 1  459  ? 160.794 204.477 175.191 1.00 90.30  ?  459  ARG A CZ    1 
ATOM   3588  N  NH1   . ARG A 1  459  ? 162.065 204.471 174.800 1.00 65.19  1  459  ARG A NH1   1 
ATOM   3589  N  NH2   . ARG A 1  459  ? 159.837 204.624 174.283 1.00 90.29  ?  459  ARG A NH2   1 
ATOM   3590  N  N     . VAL A 1  460  ? 161.312 198.334 178.225 1.00 57.28  ?  460  VAL A N     1 
ATOM   3591  C  CA    . VAL A 1  460  ? 161.236 197.078 177.455 1.00 57.34  ?  460  VAL A CA    1 
ATOM   3592  C  C     . VAL A 1  460  ? 160.702 197.392 176.040 1.00 65.04  ?  460  VAL A C     1 
ATOM   3593  O  O     . VAL A 1  460  ? 159.987 198.399 175.814 1.00 66.37  ?  460  VAL A O     1 
ATOM   3594  C  CB    . VAL A 1  460  ? 160.391 195.952 178.158 1.00 59.64  ?  460  VAL A CB    1 
ATOM   3595  C  CG1   . VAL A 1  460  ? 160.164 194.728 177.263 1.00 58.22  ?  460  VAL A CG1   1 
ATOM   3596  C  CG2   . VAL A 1  460  ? 161.038 195.525 179.462 1.00 59.27  ?  460  VAL A CG2   1 
ATOM   3597  N  N     . LYS A 1  461  ? 161.115 196.553 175.089 1.00 60.35  ?  461  LYS A N     1 
ATOM   3598  C  CA    . LYS A 1  461  ? 160.608 196.558 173.739 1.00 59.66  ?  461  LYS A CA    1 
ATOM   3599  C  C     . LYS A 1  461  ? 160.643 195.130 173.353 1.00 63.19  ?  461  LYS A C     1 
ATOM   3600  O  O     . LYS A 1  461  ? 161.725 194.637 173.017 1.00 65.11  ?  461  LYS A O     1 
ATOM   3601  C  CB    . LYS A 1  461  ? 161.479 197.369 172.777 1.00 61.65  ?  461  LYS A CB    1 
ATOM   3602  C  CG    . LYS A 1  461  ? 160.668 198.168 171.752 1.00 74.94  ?  461  LYS A CG    1 
ATOM   3603  C  CD    . LYS A 1  461  ? 159.862 197.359 170.735 1.00 79.12  ?  461  LYS A CD    1 
ATOM   3604  C  CE    . LYS A 1  461  ? 159.553 198.197 169.522 1.00 92.25  ?  461  LYS A CE    1 
ATOM   3605  N  NZ    . LYS A 1  461  ? 160.763 198.361 168.651 1.00 103.32 1  461  LYS A NZ    1 
ATOM   3606  N  N     . VAL A 1  462  ? 159.501 194.424 173.461 1.00 56.38  ?  462  VAL A N     1 
ATOM   3607  C  CA    . VAL A 1  462  ? 159.490 193.021 173.053 1.00 54.61  ?  462  VAL A CA    1 
ATOM   3608  C  C     . VAL A 1  462  ? 159.668 192.963 171.533 1.00 59.75  ?  462  VAL A C     1 
ATOM   3609  O  O     . VAL A 1  462  ? 158.963 193.667 170.779 1.00 59.54  ?  462  VAL A O     1 
ATOM   3610  C  CB    . VAL A 1  462  ? 158.309 192.152 173.530 1.00 56.64  ?  462  VAL A CB    1 
ATOM   3611  C  CG1   . VAL A 1  462  ? 158.665 190.682 173.399 1.00 55.88  ?  462  VAL A CG1   1 
ATOM   3612  C  CG2   . VAL A 1  462  ? 157.912 192.474 174.956 1.00 55.83  ?  462  VAL A CG2   1 
ATOM   3613  N  N     . ILE A 1  463  ? 160.667 192.156 171.112 1.00 55.85  ?  463  ILE A N     1 
ATOM   3614  C  CA    . ILE A 1  463  ? 161.066 191.954 169.725 1.00 55.25  ?  463  ILE A CA    1 
ATOM   3615  C  C     . ILE A 1  463  ? 161.292 190.473 169.391 1.00 58.99  ?  463  ILE A C     1 
ATOM   3616  O  O     . ILE A 1  463  ? 161.479 189.659 170.310 1.00 57.07  ?  463  ILE A O     1 
ATOM   3617  C  CB    . ILE A 1  463  ? 162.310 192.812 169.363 1.00 57.42  ?  463  ILE A CB    1 
ATOM   3618  C  CG1   . ILE A 1  463  ? 163.401 192.753 170.424 1.00 56.57  ?  463  ILE A CG1   1 
ATOM   3619  C  CG2   . ILE A 1  463  ? 161.917 194.217 169.016 1.00 58.61  ?  463  ILE A CG2   1 
ATOM   3620  C  CD1   . ILE A 1  463  ? 164.472 191.671 170.205 1.00 65.37  ?  463  ILE A CD1   1 
ATOM   3621  N  N     . PRO A 1  464  ? 161.356 190.121 168.077 1.00 56.84  ?  464  PRO A N     1 
ATOM   3622  C  CA    . PRO A 1  464  ? 161.652 188.734 167.709 1.00 58.09  ?  464  PRO A CA    1 
ATOM   3623  C  C     . PRO A 1  464  ? 163.150 188.466 167.821 1.00 68.31  ?  464  PRO A C     1 
ATOM   3624  O  O     . PRO A 1  464  ? 163.891 189.378 168.178 1.00 70.33  ?  464  PRO A O     1 
ATOM   3625  C  CB    . PRO A 1  464  ? 161.158 188.653 166.265 1.00 60.05  ?  464  PRO A CB    1 
ATOM   3626  C  CG    . PRO A 1  464  ? 161.319 190.011 165.745 1.00 63.75  ?  464  PRO A CG    1 
ATOM   3627  C  CD    . PRO A 1  464  ? 161.180 190.963 166.875 1.00 58.60  ?  464  PRO A CD    1 
ATOM   3628  N  N     . TYR A 1  465  ? 163.607 187.247 167.472 1.00 67.49  ?  465  TYR A N     1 
ATOM   3629  C  CA    . TYR A 1  465  ? 165.018 186.827 167.506 1.00 68.72  ?  465  TYR A CA    1 
ATOM   3630  C  C     . TYR A 1  465  ? 165.605 186.782 168.927 1.00 74.86  ?  465  TYR A C     1 
ATOM   3631  O  O     . TYR A 1  465  ? 165.218 187.548 169.832 1.00 74.68  ?  465  TYR A O     1 
ATOM   3632  C  CB    . TYR A 1  465  ? 165.899 187.569 166.491 1.00 70.63  ?  465  TYR A CB    1 
ATOM   3633  C  CG    . TYR A 1  465  ? 165.217 187.749 165.158 1.00 74.44  ?  465  TYR A CG    1 
ATOM   3634  C  CD1   . TYR A 1  465  ? 165.151 186.707 164.239 1.00 77.84  ?  465  TYR A CD1   1 
ATOM   3635  C  CD2   . TYR A 1  465  ? 164.599 188.949 164.826 1.00 75.91  ?  465  TYR A CD2   1 
ATOM   3636  C  CE1   . TYR A 1  465  ? 164.511 186.860 163.009 1.00 81.19  ?  465  TYR A CE1   1 
ATOM   3637  C  CE2   . TYR A 1  465  ? 163.933 189.110 163.611 1.00 78.32  ?  465  TYR A CE2   1 
ATOM   3638  C  CZ    . TYR A 1  465  ? 163.907 188.068 162.694 1.00 90.41  ?  465  TYR A CZ    1 
ATOM   3639  O  OH    . TYR A 1  465  ? 163.277 188.225 161.473 1.00 95.12  ?  465  TYR A OH    1 
ATOM   3640  N  N     . SER A 1  466  ? 166.503 185.820 169.124 1.00 70.02  ?  466  SER A N     1 
ATOM   3641  C  CA    . SER A 1  466  ? 167.037 185.514 170.434 1.00 67.44  ?  466  SER A CA    1 
ATOM   3642  C  C     . SER A 1  466  ? 168.045 186.476 171.112 1.00 69.35  ?  466  SER A C     1 
ATOM   3643  O  O     . SER A 1  466  ? 168.531 186.144 172.188 1.00 69.63  ?  466  SER A O     1 
ATOM   3644  C  CB    . SER A 1  466  ? 167.450 184.051 170.477 1.00 68.50  ?  466  SER A CB    1 
ATOM   3645  O  OG    . SER A 1  466  ? 166.429 183.271 169.865 1.00 70.52  ?  466  SER A OG    1 
ATOM   3646  N  N     . THR A 1  467  ? 168.293 187.689 170.568 1.00 63.83  ?  467  THR A N     1 
ATOM   3647  C  CA    . THR A 1  467  ? 169.254 188.612 171.201 1.00 62.50  ?  467  THR A CA    1 
ATOM   3648  C  C     . THR A 1  467  ? 168.654 189.830 171.840 1.00 66.86  ?  467  THR A C     1 
ATOM   3649  O  O     . THR A 1  467  ? 167.625 190.345 171.367 1.00 67.76  ?  467  THR A O     1 
ATOM   3650  C  CB    . THR A 1  467  ? 170.270 189.157 170.217 1.00 66.06  ?  467  THR A CB    1 
ATOM   3651  O  OG1   . THR A 1  467  ? 169.606 189.711 169.081 1.00 72.31  ?  467  THR A OG1   1 
ATOM   3652  C  CG2   . THR A 1  467  ? 171.306 188.158 169.835 1.00 62.49  ?  467  THR A CG2   1 
ATOM   3653  N  N     . PHE A 1  468  ? 169.361 190.336 172.879 1.00 61.78  ?  468  PHE A N     1 
ATOM   3654  C  CA    . PHE A 1  468  ? 169.041 191.580 173.569 1.00 60.89  ?  468  PHE A CA    1 
ATOM   3655  C  C     . PHE A 1  468  ? 169.576 192.681 172.667 1.00 64.94  ?  468  PHE A C     1 
ATOM   3656  O  O     . PHE A 1  468  ? 170.778 192.719 172.396 1.00 66.78  ?  468  PHE A O     1 
ATOM   3657  C  CB    . PHE A 1  468  ? 169.744 191.694 174.939 1.00 61.74  ?  468  PHE A CB    1 
ATOM   3658  C  CG    . PHE A 1  468  ? 169.146 190.963 176.103 1.00 63.05  ?  468  PHE A CG    1 
ATOM   3659  C  CD1   . PHE A 1  468  ? 167.773 190.913 176.283 1.00 66.81  ?  468  PHE A CD1   1 
ATOM   3660  C  CD2   . PHE A 1  468  ? 169.956 190.390 177.068 1.00 65.63  ?  468  PHE A CD2   1 
ATOM   3661  C  CE1   . PHE A 1  468  ? 167.218 190.241 177.374 1.00 67.34  ?  468  PHE A CE1   1 
ATOM   3662  C  CE2   . PHE A 1  468  ? 169.402 189.720 178.165 1.00 68.08  ?  468  PHE A CE2   1 
ATOM   3663  C  CZ    . PHE A 1  468  ? 168.040 189.645 178.304 1.00 66.09  ?  468  PHE A CZ    1 
ATOM   3664  N  N     . ARG A 1  469  ? 168.708 193.562 172.193 1.00 58.16  ?  469  ARG A N     1 
ATOM   3665  C  CA    . ARG A 1  469  ? 169.144 194.634 171.321 1.00 56.98  ?  469  ARG A CA    1 
ATOM   3666  C  C     . ARG A 1  469  ? 169.332 195.914 172.096 1.00 59.62  ?  469  ARG A C     1 
ATOM   3667  O  O     . ARG A 1  469  ? 168.465 196.282 172.891 1.00 59.11  ?  469  ARG A O     1 
ATOM   3668  C  CB    . ARG A 1  469  ? 168.163 194.827 170.169 1.00 56.25  ?  469  ARG A CB    1 
ATOM   3669  C  CG    . ARG A 1  469  ? 167.495 193.548 169.749 1.00 64.33  ?  469  ARG A CG    1 
ATOM   3670  C  CD    . ARG A 1  469  ? 167.234 193.506 168.273 1.00 70.69  ?  469  ARG A CD    1 
ATOM   3671  N  NE    . ARG A 1  469  ? 168.291 192.789 167.572 1.00 69.10  ?  469  ARG A NE    1 
ATOM   3672  C  CZ    . ARG A 1  469  ? 169.031 193.308 166.603 1.00 81.64  ?  469  ARG A CZ    1 
ATOM   3673  N  NH1   . ARG A 1  469  ? 168.827 194.556 166.195 1.00 57.16  1  469  ARG A NH1   1 
ATOM   3674  N  NH2   . ARG A 1  469  ? 169.964 192.581 166.018 1.00 83.17  ?  469  ARG A NH2   1 
ATOM   3675  N  N     . LEU A 1  470  ? 170.451 196.598 171.874 1.00 56.77  ?  470  LEU A N     1 
ATOM   3676  C  CA    . LEU A 1  470  ? 170.674 197.876 172.548 1.00 57.96  ?  470  LEU A CA    1 
ATOM   3677  C  C     . LEU A 1  470  ? 171.024 199.003 171.602 1.00 63.38  ?  470  LEU A C     1 
ATOM   3678  O  O     . LEU A 1  470  ? 171.618 198.732 170.545 1.00 63.80  ?  470  LEU A O     1 
ATOM   3679  C  CB    . LEU A 1  470  ? 171.696 197.786 173.703 1.00 58.15  ?  470  LEU A CB    1 
ATOM   3680  C  CG    . LEU A 1  470  ? 173.096 197.305 173.388 1.00 63.48  ?  470  LEU A CG    1 
ATOM   3681  C  CD1   . LEU A 1  470  ? 174.127 198.196 174.000 1.00 62.94  ?  470  LEU A CD1   1 
ATOM   3682  C  CD2   . LEU A 1  470  ? 173.280 195.949 173.918 1.00 68.07  ?  470  LEU A CD2   1 
ATOM   3683  N  N     . ASN A 1  471  ? 170.687 200.274 171.988 1.00 59.90  ?  471  ASN A N     1 
ATOM   3684  C  CA    . ASN A 1  471  ? 171.054 201.426 171.156 1.00 60.70  ?  471  ASN A CA    1 
ATOM   3685  C  C     . ASN A 1  471  ? 172.575 201.561 171.127 1.00 65.10  ?  471  ASN A C     1 
ATOM   3686  O  O     . ASN A 1  471  ? 173.222 201.394 172.159 1.00 64.93  ?  471  ASN A O     1 
ATOM   3687  C  CB    . ASN A 1  471  ? 170.413 202.737 171.621 1.00 61.06  ?  471  ASN A CB    1 
ATOM   3688  C  CG    . ASN A 1  471  ? 170.726 203.866 170.652 1.00 75.28  ?  471  ASN A CG    1 
ATOM   3689  O  OD1   . ASN A 1  471  ? 171.707 204.612 170.796 1.00 53.13  ?  471  ASN A OD1   1 
ATOM   3690  N  ND2   . ASN A 1  471  ? 170.020 203.888 169.538 1.00 75.60  ?  471  ASN A ND2   1 
ATOM   3691  N  N     . LEU A 1  472  ? 173.151 201.841 169.968 1.00 62.37  ?  472  LEU A N     1 
ATOM   3692  C  CA    . LEU A 1  472  ? 174.611 201.904 169.902 1.00 62.97  ?  472  LEU A CA    1 
ATOM   3693  C  C     . LEU A 1  472  ? 175.360 202.904 170.802 1.00 65.92  ?  472  LEU A C     1 
ATOM   3694  O  O     . LEU A 1  472  ? 176.491 202.643 171.209 1.00 63.65  ?  472  LEU A O     1 
ATOM   3695  C  CB    . LEU A 1  472  ? 175.099 201.952 168.459 1.00 64.11  ?  472  LEU A CB    1 
ATOM   3696  C  CG    . LEU A 1  472  ? 175.447 200.599 167.941 1.00 69.82  ?  472  LEU A CG    1 
ATOM   3697  C  CD1   . LEU A 1  472  ? 174.639 200.254 166.721 1.00 71.84  ?  472  LEU A CD1   1 
ATOM   3698  C  CD2   . LEU A 1  472  ? 176.906 200.476 167.740 1.00 72.36  ?  472  LEU A CD2   1 
ATOM   3699  N  N     . SER A 1  473  ? 174.733 204.031 171.109 1.00 63.91  ?  473  SER A N     1 
ATOM   3700  C  CA    . SER A 1  473  ? 175.411 205.039 171.894 1.00 64.69  ?  473  SER A CA    1 
ATOM   3701  C  C     . SER A 1  473  ? 175.563 204.681 173.378 1.00 71.51  ?  473  SER A C     1 
ATOM   3702  O  O     . SER A 1  473  ? 176.484 205.190 174.034 1.00 73.40  ?  473  SER A O     1 
ATOM   3703  C  CB    . SER A 1  473  ? 174.828 206.420 171.619 1.00 67.22  ?  473  SER A CB    1 
ATOM   3704  O  OG    . SER A 1  473  ? 175.076 206.803 170.270 1.00 69.96  ?  473  SER A OG    1 
ATOM   3705  N  N     . VAL A 1  474  ? 174.751 203.700 173.849 1.00 66.89  ?  474  VAL A N     1 
ATOM   3706  C  CA    . VAL A 1  474  ? 174.737 203.147 175.207 1.00 66.10  ?  474  VAL A CA    1 
ATOM   3707  C  C     . VAL A 1  474  ? 175.768 202.008 175.427 1.00 69.10  ?  474  VAL A C     1 
ATOM   3708  O  O     . VAL A 1  474  ? 175.928 201.475 176.532 1.00 66.51  ?  474  VAL A O     1 
ATOM   3709  C  CB    . VAL A 1  474  ? 173.299 202.751 175.579 1.00 70.35  ?  474  VAL A CB    1 
ATOM   3710  C  CG1   . VAL A 1  474  ? 173.041 201.260 175.417 1.00 69.56  ?  474  VAL A CG1   1 
ATOM   3711  C  CG2   . VAL A 1  474  ? 172.987 203.189 176.983 1.00 70.56  ?  474  VAL A CG2   1 
ATOM   3712  N  N     . THR A 1  475  ? 176.480 201.679 174.347 1.00 67.78  ?  475  THR A N     1 
ATOM   3713  C  CA    . THR A 1  475  ? 177.528 200.670 174.256 1.00 68.00  ?  475  THR A CA    1 
ATOM   3714  C  C     . THR A 1  475  ? 178.674 200.964 175.258 1.00 71.79  ?  475  THR A C     1 
ATOM   3715  O  O     . THR A 1  475  ? 178.964 200.142 176.129 1.00 70.53  ?  475  THR A O     1 
ATOM   3716  C  CB    . THR A 1  475  ? 177.925 200.547 172.751 1.00 77.51  ?  475  THR A CB    1 
ATOM   3717  O  OG1   . THR A 1  475  ? 177.975 199.182 172.316 1.00 77.17  ?  475  THR A OG1   1 
ATOM   3718  C  CG2   . THR A 1  475  ? 179.158 201.390 172.340 1.00 74.99  ?  475  THR A CG2   1 
ATOM   3719  N  N     . SER A 1  476  ? 179.269 202.170 175.142 1.00 69.60  ?  476  SER A N     1 
ATOM   3720  C  CA    . SER A 1  476  ? 180.363 202.718 175.955 1.00 69.51  ?  476  SER A CA    1 
ATOM   3721  C  C     . SER A 1  476  ? 180.172 202.570 177.479 1.00 69.16  ?  476  SER A C     1 
ATOM   3722  O  O     . SER A 1  476  ? 180.988 201.855 178.052 1.00 68.79  ?  476  SER A O     1 
ATOM   3723  C  CB    . SER A 1  476  ? 180.702 204.155 175.545 1.00 75.74  ?  476  SER A CB    1 
ATOM   3724  O  OG    . SER A 1  476  ? 179.700 204.729 174.709 1.00 91.04  ?  476  SER A OG    1 
ATOM   3725  N  N     . PRO A 1  477  ? 179.111 203.117 178.156 1.00 62.30  ?  477  PRO A N     1 
ATOM   3726  C  CA    . PRO A 1  477  ? 178.979 202.904 179.610 1.00 60.83  ?  477  PRO A CA    1 
ATOM   3727  C  C     . PRO A 1  477  ? 179.075 201.446 180.077 1.00 64.74  ?  477  PRO A C     1 
ATOM   3728  O  O     . PRO A 1  477  ? 179.816 201.168 181.035 1.00 65.42  ?  477  PRO A O     1 
ATOM   3729  C  CB    . PRO A 1  477  ? 177.626 203.542 179.950 1.00 62.09  ?  477  PRO A CB    1 
ATOM   3730  C  CG    . PRO A 1  477  ? 176.927 203.701 178.648 1.00 66.86  ?  477  PRO A CG    1 
ATOM   3731  C  CD    . PRO A 1  477  ? 178.002 203.956 177.659 1.00 63.24  ?  477  PRO A CD    1 
ATOM   3732  N  N     . TYR A 1  478  ? 178.368 200.510 179.379 1.00 60.11  ?  478  TYR A N     1 
ATOM   3733  C  CA    . TYR A 1  478  ? 178.362 199.061 179.677 1.00 58.29  ?  478  TYR A CA    1 
ATOM   3734  C  C     . TYR A 1  478  ? 179.712 198.403 179.400 1.00 61.02  ?  478  TYR A C     1 
ATOM   3735  O  O     . TYR A 1  478  ? 180.139 197.493 180.138 1.00 58.71  ?  478  TYR A O     1 
ATOM   3736  C  CB    . TYR A 1  478  ? 177.262 198.354 178.875 1.00 58.16  ?  478  TYR A CB    1 
ATOM   3737  C  CG    . TYR A 1  478  ? 175.882 198.647 179.400 1.00 59.81  ?  478  TYR A CG    1 
ATOM   3738  C  CD1   . TYR A 1  478  ? 175.546 198.383 180.729 1.00 61.57  ?  478  TYR A CD1   1 
ATOM   3739  C  CD2   . TYR A 1  478  ? 174.903 199.185 178.574 1.00 61.25  ?  478  TYR A CD2   1 
ATOM   3740  C  CE1   . TYR A 1  478  ? 174.276 198.671 181.227 1.00 62.05  ?  478  TYR A CE1   1 
ATOM   3741  C  CE2   . TYR A 1  478  ? 173.617 199.442 179.049 1.00 62.27  ?  478  TYR A CE2   1 
ATOM   3742  C  CZ    . TYR A 1  478  ? 173.310 199.188 180.378 1.00 71.43  ?  478  TYR A CZ    1 
ATOM   3743  O  OH    . TYR A 1  478  ? 172.054 199.475 180.854 1.00 74.87  ?  478  TYR A OH    1 
ATOM   3744  N  N     . ASN A 1  479  ? 180.389 198.944 178.348 1.00 58.20  ?  479  ASN A N     1 
ATOM   3745  C  CA    . ASN A 1  479  ? 181.635 198.528 177.735 1.00 58.82  ?  479  ASN A CA    1 
ATOM   3746  C  C     . ASN A 1  479  ? 181.369 197.280 176.904 1.00 65.54  ?  479  ASN A C     1 
ATOM   3747  O  O     . ASN A 1  479  ? 182.143 196.310 176.903 1.00 69.12  ?  479  ASN A O     1 
ATOM   3748  C  CB    . ASN A 1  479  ? 182.753 198.322 178.751 1.00 58.92  ?  479  ASN A CB    1 
ATOM   3749  C  CG    . ASN A 1  479  ? 184.082 198.484 178.099 1.00 77.32  ?  479  ASN A CG    1 
ATOM   3750  O  OD1   . ASN A 1  479  ? 184.703 197.505 177.710 1.00 53.57  ?  479  ASN A OD1   1 
ATOM   3751  N  ND2   . ASN A 1  479  ? 184.493 199.734 177.874 1.00 81.63  ?  479  ASN A ND2   1 
ATOM   3752  N  N     . ALA A 1  480  ? 180.268 197.315 176.174 1.00 58.75  ?  480  ALA A N     1 
ATOM   3753  C  CA    . ALA A 1  480  ? 179.871 196.204 175.353 1.00 57.41  ?  480  ALA A CA    1 
ATOM   3754  C  C     . ALA A 1  480  ? 180.198 196.409 173.870 1.00 61.79  ?  480  ALA A C     1 
ATOM   3755  O  O     . ALA A 1  480  ? 180.446 197.520 173.425 1.00 60.76  ?  480  ALA A O     1 
ATOM   3756  C  CB    . ALA A 1  480  ? 178.398 195.963 175.548 1.00 57.70  ?  480  ALA A CB    1 
ATOM   3757  N  N     . ASP A 1  481  ? 180.243 195.305 173.130 1.00 61.21  ?  481  ASP A N     1 
ATOM   3758  C  CA    . ASP A 1  481  ? 180.455 195.161 171.684 1.00 62.59  ?  481  ASP A CA    1 
ATOM   3759  C  C     . ASP A 1  481  ? 179.609 193.923 171.281 1.00 66.40  ?  481  ASP A C     1 
ATOM   3760  O  O     . ASP A 1  481  ? 178.968 193.282 172.144 1.00 64.89  ?  481  ASP A O     1 
ATOM   3761  C  CB    . ASP A 1  481  ? 181.962 194.983 171.338 1.00 65.92  ?  481  ASP A CB    1 
ATOM   3762  C  CG    . ASP A 1  481  ? 182.660 193.910 172.168 1.00 83.88  ?  481  ASP A CG    1 
ATOM   3763  O  OD1   . ASP A 1  481  ? 181.999 192.926 172.529 1.00 93.00  ?  481  ASP A OD1   1 
ATOM   3764  O  OD2   . ASP A 1  481  ? 183.859 194.079 172.486 1.00 83.82  -1 481  ASP A OD2   1 
ATOM   3765  N  N     . PHE A 1  482  ? 179.579 193.595 169.990 1.00 63.47  ?  482  PHE A N     1 
ATOM   3766  C  CA    . PHE A 1  482  ? 178.744 192.476 169.583 1.00 62.85  ?  482  PHE A CA    1 
ATOM   3767  C  C     . PHE A 1  482  ? 179.534 191.306 169.011 1.00 69.03  ?  482  PHE A C     1 
ATOM   3768  O  O     . PHE A 1  482  ? 179.020 190.545 168.194 1.00 70.70  ?  482  PHE A O     1 
ATOM   3769  C  CB    . PHE A 1  482  ? 177.538 192.957 168.749 1.00 64.02  ?  482  PHE A CB    1 
ATOM   3770  C  CG    . PHE A 1  482  ? 176.946 194.271 169.237 1.00 64.59  ?  482  PHE A CG    1 
ATOM   3771  C  CD1   . PHE A 1  482  ? 176.286 194.349 170.455 1.00 66.63  ?  482  PHE A CD1   1 
ATOM   3772  C  CD2   . PHE A 1  482  ? 177.099 195.439 168.501 1.00 67.23  ?  482  PHE A CD2   1 
ATOM   3773  C  CE1   . PHE A 1  482  ? 175.737 195.559 170.903 1.00 67.37  ?  482  PHE A CE1   1 
ATOM   3774  C  CE2   . PHE A 1  482  ? 176.582 196.655 168.967 1.00 69.74  ?  482  PHE A CE2   1 
ATOM   3775  C  CZ    . PHE A 1  482  ? 175.907 196.708 170.169 1.00 66.92  ?  482  PHE A CZ    1 
ATOM   3776  N  N     . ASP A 1  483  ? 180.775 191.117 169.526 1.00 64.69  ?  483  ASP A N     1 
ATOM   3777  C  CA    . ASP A 1  483  ? 181.692 190.026 169.179 1.00 64.65  ?  483  ASP A CA    1 
ATOM   3778  C  C     . ASP A 1  483  ? 181.342 188.710 169.925 1.00 68.84  ?  483  ASP A C     1 
ATOM   3779  O  O     . ASP A 1  483  ? 182.142 187.779 169.889 1.00 68.76  ?  483  ASP A O     1 
ATOM   3780  C  CB    . ASP A 1  483  ? 183.168 190.437 169.457 1.00 66.78  ?  483  ASP A CB    1 
ATOM   3781  C  CG    . ASP A 1  483  ? 183.516 190.675 170.929 1.00 81.19  ?  483  ASP A CG    1 
ATOM   3782  O  OD1   . ASP A 1  483  ? 182.709 190.279 171.807 1.00 82.64  ?  483  ASP A OD1   1 
ATOM   3783  O  OD2   . ASP A 1  483  ? 184.578 191.301 171.207 1.00 84.62  -1 483  ASP A OD2   1 
ATOM   3784  N  N     . GLY A 1  484  ? 180.202 188.675 170.636 1.00 65.74  ?  484  GLY A N     1 
ATOM   3785  C  CA    . GLY A 1  484  ? 179.754 187.512 171.403 1.00 65.44  ?  484  GLY A CA    1 
ATOM   3786  C  C     . GLY A 1  484  ? 179.504 187.768 172.879 1.00 68.57  ?  484  GLY A C     1 
ATOM   3787  O  O     . GLY A 1  484  ? 179.509 186.825 173.688 1.00 68.43  ?  484  GLY A O     1 
ATOM   3788  N  N     . ASP A 1  485  ? 179.255 189.047 173.227 1.00 63.58  ?  485  ASP A N     1 
ATOM   3789  C  CA    . ASP A 1  485  ? 179.014 189.519 174.595 1.00 61.98  ?  485  ASP A CA    1 
ATOM   3790  C  C     . ASP A 1  485  ? 177.614 189.137 174.996 1.00 65.58  ?  485  ASP A C     1 
ATOM   3791  O  O     . ASP A 1  485  ? 176.715 189.189 174.158 1.00 66.69  ?  485  ASP A O     1 
ATOM   3792  C  CB    . ASP A 1  485  ? 179.097 191.067 174.644 1.00 63.38  ?  485  ASP A CB    1 
ATOM   3793  C  CG    . ASP A 1  485  ? 180.453 191.759 174.719 1.00 69.17  ?  485  ASP A CG    1 
ATOM   3794  O  OD1   . ASP A 1  485  ? 181.436 191.250 174.109 1.00 69.21  ?  485  ASP A OD1   1 
ATOM   3795  O  OD2   . ASP A 1  485  ? 180.515 192.865 175.277 1.00 74.17  -1 485  ASP A OD2   1 
ATOM   3796  N  N     . GLU A 1  486  ? 177.402 188.797 176.268 1.00 61.04  ?  486  GLU A N     1 
ATOM   3797  C  CA    . GLU A 1  486  ? 176.055 188.508 176.794 1.00 60.37  ?  486  GLU A CA    1 
ATOM   3798  C  C     . GLU A 1  486  ? 175.754 189.565 177.872 1.00 66.05  ?  486  GLU A C     1 
ATOM   3799  O  O     . GLU A 1  486  ? 176.686 190.113 178.494 1.00 67.35  ?  486  GLU A O     1 
ATOM   3800  C  CB    . GLU A 1  486  ? 175.943 187.092 177.415 1.00 61.07  ?  486  GLU A CB    1 
ATOM   3801  C  CG    . GLU A 1  486  ? 175.727 185.933 176.454 1.00 70.76  ?  486  GLU A CG    1 
ATOM   3802  C  CD    . GLU A 1  486  ? 176.401 184.623 176.854 1.00 105.17 ?  486  GLU A CD    1 
ATOM   3803  O  OE1   . GLU A 1  486  ? 175.959 183.965 177.830 1.00 90.60  ?  486  GLU A OE1   1 
ATOM   3804  O  OE2   . GLU A 1  486  ? 177.393 184.261 176.181 1.00 126.36 -1 486  GLU A OE2   1 
ATOM   3805  N  N     . MET A 1  487  ? 174.467 189.853 178.106 1.00 60.97  ?  487  MET A N     1 
ATOM   3806  C  CA    . MET A 1  487  ? 174.094 190.819 179.130 1.00 59.81  ?  487  MET A CA    1 
ATOM   3807  C  C     . MET A 1  487  ? 172.982 190.354 180.055 1.00 64.16  ?  487  MET A C     1 
ATOM   3808  O  O     . MET A 1  487  ? 172.166 189.505 179.684 1.00 64.33  ?  487  MET A O     1 
ATOM   3809  C  CB    . MET A 1  487  ? 173.796 192.165 178.514 1.00 62.21  ?  487  MET A CB    1 
ATOM   3810  C  CG    . MET A 1  487  ? 175.035 192.910 178.157 1.00 66.74  ?  487  MET A CG    1 
ATOM   3811  S  SD    . MET A 1  487  ? 174.766 194.645 178.496 1.00 72.29  ?  487  MET A SD    1 
ATOM   3812  C  CE    . MET A 1  487  ? 174.853 195.245 176.878 1.00 69.72  ?  487  MET A CE    1 
ATOM   3813  N  N     . ASN A 1  488  ? 172.969 190.887 181.284 1.00 60.13  ?  488  ASN A N     1 
ATOM   3814  C  CA    . ASN A 1  488  ? 171.974 190.506 182.285 1.00 59.07  ?  488  ASN A CA    1 
ATOM   3815  C  C     . ASN A 1  488  ? 170.797 191.443 182.405 1.00 60.22  ?  488  ASN A C     1 
ATOM   3816  O  O     . ASN A 1  488  ? 170.950 192.664 182.323 1.00 58.67  ?  488  ASN A O     1 
ATOM   3817  C  CB    . ASN A 1  488  ? 172.632 190.273 183.628 1.00 60.39  ?  488  ASN A CB    1 
ATOM   3818  C  CG    . ASN A 1  488  ? 173.536 189.071 183.618 1.00 85.14  ?  488  ASN A CG    1 
ATOM   3819  O  OD1   . ASN A 1  488  ? 173.626 188.335 182.626 1.00 66.88  ?  488  ASN A OD1   1 
ATOM   3820  N  ND2   . ASN A 1  488  ? 174.205 188.830 184.739 1.00 86.13  ?  488  ASN A ND2   1 
ATOM   3821  N  N     . LEU A 1  489  ? 169.614 190.858 182.587 1.00 56.02  ?  489  LEU A N     1 
ATOM   3822  C  CA    . LEU A 1  489  ? 168.372 191.605 182.746 1.00 55.19  ?  489  LEU A CA    1 
ATOM   3823  C  C     . LEU A 1  489  ? 167.666 191.255 184.059 1.00 60.90  ?  489  LEU A C     1 
ATOM   3824  O  O     . LEU A 1  489  ? 167.397 190.087 184.326 1.00 61.05  ?  489  LEU A O     1 
ATOM   3825  C  CB    . LEU A 1  489  ? 167.444 191.364 181.565 1.00 54.43  ?  489  LEU A CB    1 
ATOM   3826  C  CG    . LEU A 1  489  ? 166.382 192.403 181.408 1.00 58.13  ?  489  LEU A CG    1 
ATOM   3827  C  CD1   . LEU A 1  489  ? 166.485 193.052 180.080 1.00 59.07  ?  489  LEU A CD1   1 
ATOM   3828  C  CD2   . LEU A 1  489  ? 165.035 191.811 181.587 1.00 58.19  ?  489  LEU A CD2   1 
ATOM   3829  N  N     . HIS A 1  490  ? 167.364 192.264 184.876 1.00 57.62  ?  490  HIS A N     1 
ATOM   3830  C  CA    . HIS A 1  490  ? 166.650 192.032 186.123 1.00 56.99  ?  490  HIS A CA    1 
ATOM   3831  C  C     . HIS A 1  490  ? 165.341 192.783 186.070 1.00 60.55  ?  490  HIS A C     1 
ATOM   3832  O  O     . HIS A 1  490  ? 165.315 193.919 185.587 1.00 60.48  ?  490  HIS A O     1 
ATOM   3833  C  CB    . HIS A 1  490  ? 167.495 192.448 187.319 1.00 57.69  ?  490  HIS A CB    1 
ATOM   3834  C  CG    . HIS A 1  490  ? 168.780 191.687 187.434 1.00 60.92  ?  490  HIS A CG    1 
ATOM   3835  N  ND1   . HIS A 1  490  ? 168.822 190.426 188.001 1.00 62.61  ?  490  HIS A ND1   1 
ATOM   3836  C  CD2   . HIS A 1  490  ? 170.035 192.043 187.061 1.00 62.01  ?  490  HIS A CD2   1 
ATOM   3837  C  CE1   . HIS A 1  490  ? 170.100 190.069 187.974 1.00 61.75  ?  490  HIS A CE1   1 
ATOM   3838  N  NE2   . HIS A 1  490  ? 170.867 191.012 187.414 1.00 61.71  ?  490  HIS A NE2   1 
ATOM   3839  N  N     . VAL A 1  491  ? 164.245 192.128 186.505 1.00 56.43  ?  491  VAL A N     1 
ATOM   3840  C  CA    . VAL A 1  491  ? 162.887 192.686 186.496 1.00 55.90  ?  491  VAL A CA    1 
ATOM   3841  C  C     . VAL A 1  491  ? 162.392 193.102 187.917 1.00 60.61  ?  491  VAL A C     1 
ATOM   3842  O  O     . VAL A 1  491  ? 162.234 192.221 188.762 1.00 59.40  ?  491  VAL A O     1 
ATOM   3843  C  CB    . VAL A 1  491  ? 161.906 191.703 185.815 1.00 58.98  ?  491  VAL A CB    1 
ATOM   3844  C  CG1   . VAL A 1  491  ? 160.472 192.230 185.863 1.00 58.87  ?  491  VAL A CG1   1 
ATOM   3845  C  CG2   . VAL A 1  491  ? 162.335 191.398 184.386 1.00 58.41  ?  491  VAL A CG2   1 
ATOM   3846  N  N     . PRO A 1  492  ? 162.099 194.415 188.182 1.00 58.89  ?  492  PRO A N     1 
ATOM   3847  C  CA    . PRO A 1  492  ? 161.560 194.823 189.502 1.00 59.20  ?  492  PRO A CA    1 
ATOM   3848  C  C     . PRO A 1  492  ? 160.183 194.192 189.728 1.00 65.00  ?  492  PRO A C     1 
ATOM   3849  O  O     . PRO A 1  492  ? 159.468 193.963 188.748 1.00 66.15  ?  492  PRO A O     1 
ATOM   3850  C  CB    . PRO A 1  492  ? 161.408 196.337 189.352 1.00 60.92  ?  492  PRO A CB    1 
ATOM   3851  C  CG    . PRO A 1  492  ? 161.197 196.546 187.893 1.00 65.32  ?  492  PRO A CG    1 
ATOM   3852  C  CD    . PRO A 1  492  ? 162.164 195.573 187.271 1.00 60.69  ?  492  PRO A CD    1 
ATOM   3853  N  N     . GLN A 1  493  ? 159.805 193.904 190.982 1.00 60.23  ?  493  GLN A N     1 
ATOM   3854  C  CA    . GLN A 1  493  ? 158.516 193.249 191.238 1.00 59.68  ?  493  GLN A CA    1 
ATOM   3855  C  C     . GLN A 1  493  ? 157.460 194.135 191.944 1.00 65.93  ?  493  GLN A C     1 
ATOM   3856  O  O     . GLN A 1  493  ? 156.302 193.719 192.116 1.00 66.38  ?  493  GLN A O     1 
ATOM   3857  C  CB    . GLN A 1  493  ? 158.726 191.920 192.006 1.00 60.09  ?  493  GLN A CB    1 
ATOM   3858  C  CG    . GLN A 1  493  ? 159.622 190.877 191.351 1.00 48.94  ?  493  GLN A CG    1 
ATOM   3859  C  CD    . GLN A 1  493  ? 159.061 190.437 190.039 1.00 72.99  ?  493  GLN A CD    1 
ATOM   3860  O  OE1   . GLN A 1  493  ? 158.079 189.674 189.981 1.00 75.97  ?  493  GLN A OE1   1 
ATOM   3861  N  NE2   . GLN A 1  493  ? 159.640 190.958 188.955 1.00 57.69  ?  493  GLN A NE2   1 
ATOM   3862  N  N     . SER A 1  494  ? 157.858 195.349 192.336 1.00 63.05  ?  494  SER A N     1 
ATOM   3863  C  CA    . SER A 1  494  ? 157.030 196.277 193.103 1.00 63.05  ?  494  SER A CA    1 
ATOM   3864  C  C     . SER A 1  494  ? 156.945 197.588 192.381 1.00 65.24  ?  494  SER A C     1 
ATOM   3865  O  O     . SER A 1  494  ? 157.865 197.954 191.665 1.00 63.66  ?  494  SER A O     1 
ATOM   3866  C  CB    . SER A 1  494  ? 157.655 196.460 194.501 1.00 67.65  ?  494  SER A CB    1 
ATOM   3867  O  OG    . SER A 1  494  ? 157.102 197.405 195.407 1.00 73.57  ?  494  SER A OG    1 
ATOM   3868  N  N     . GLU A 1  495  ? 155.865 198.330 192.626 1.00 63.46  ?  495  GLU A N     1 
ATOM   3869  C  CA    . GLU A 1  495  ? 155.651 199.687 192.096 1.00 63.11  ?  495  GLU A CA    1 
ATOM   3870  C  C     . GLU A 1  495  ? 156.784 200.617 192.595 1.00 64.49  ?  495  GLU A C     1 
ATOM   3871  O  O     . GLU A 1  495  ? 157.282 201.454 191.845 1.00 64.25  ?  495  GLU A O     1 
ATOM   3872  C  CB    . GLU A 1  495  ? 154.243 200.210 192.480 1.00 64.40  ?  495  GLU A CB    1 
ATOM   3873  C  CG    . GLU A 1  495  ? 153.612 201.058 191.396 1.00 73.62  ?  495  GLU A CG    1 
ATOM   3874  C  CD    . GLU A 1  495  ? 153.448 200.442 190.016 1.00 108.24 ?  495  GLU A CD    1 
ATOM   3875  O  OE1   . GLU A 1  495  ? 152.867 199.333 189.931 1.00 98.43  ?  495  GLU A OE1   1 
ATOM   3876  O  OE2   . GLU A 1  495  ? 153.856 201.089 189.017 1.00 108.88 -1 495  GLU A OE2   1 
ATOM   3877  N  N     . GLU A 1  496  ? 157.227 200.387 193.833 1.00 59.17  ?  496  GLU A N     1 
ATOM   3878  C  CA    . GLU A 1  496  ? 158.302 201.083 194.514 1.00 59.30  ?  496  GLU A CA    1 
ATOM   3879  C  C     . GLU A 1  496  ? 159.620 200.896 193.798 1.00 62.53  ?  496  GLU A C     1 
ATOM   3880  O  O     . GLU A 1  496  ? 160.336 201.872 193.591 1.00 64.21  ?  496  GLU A O     1 
ATOM   3881  C  CB    . GLU A 1  496  ? 158.468 200.473 195.904 1.00 61.09  ?  496  GLU A CB    1 
ATOM   3882  C  CG    . GLU A 1  496  ? 157.932 201.276 197.071 1.00 74.92  ?  496  GLU A CG    1 
ATOM   3883  C  CD    . GLU A 1  496  ? 158.528 200.726 198.347 1.00 99.91  ?  496  GLU A CD    1 
ATOM   3884  O  OE1   . GLU A 1  496  ? 158.424 199.492 198.550 1.00 108.81 ?  496  GLU A OE1   1 
ATOM   3885  O  OE2   . GLU A 1  496  ? 159.211 201.491 199.066 1.00 93.06  -1 496  GLU A OE2   1 
ATOM   3886  N  N     . THR A 1  497  ? 159.971 199.625 193.505 1.00 56.62  ?  497  THR A N     1 
ATOM   3887  C  CA    . THR A 1  497  ? 161.204 199.162 192.870 1.00 55.03  ?  497  THR A CA    1 
ATOM   3888  C  C     . THR A 1  497  ? 161.328 199.730 191.475 1.00 57.96  ?  497  THR A C     1 
ATOM   3889  O  O     . THR A 1  497  ? 162.411 200.174 191.077 1.00 56.96  ?  497  THR A O     1 
ATOM   3890  C  CB    . THR A 1  497  ? 161.179 197.656 192.758 1.00 61.90  ?  497  THR A CB    1 
ATOM   3891  O  OG1   . THR A 1  497  ? 160.601 197.081 193.913 1.00 65.25  ?  497  THR A OG1   1 
ATOM   3892  C  CG2   . THR A 1  497  ? 162.500 197.113 192.638 1.00 63.51  ?  497  THR A CG2   1 
ATOM   3893  N  N     . ARG A 1  498  ? 160.208 199.684 190.725 1.00 54.11  ?  498  ARG A N     1 
ATOM   3894  C  CA    . ARG A 1  498  ? 160.083 200.210 189.372 1.00 53.65  ?  498  ARG A CA    1 
ATOM   3895  C  C     . ARG A 1  498  ? 160.409 201.675 189.397 1.00 58.08  ?  498  ARG A C     1 
ATOM   3896  O  O     . ARG A 1  498  ? 161.205 202.117 188.567 1.00 59.51  ?  498  ARG A O     1 
ATOM   3897  C  CB    . ARG A 1  498  ? 158.655 200.064 188.867 1.00 53.40  ?  498  ARG A CB    1 
ATOM   3898  C  CG    . ARG A 1  498  ? 158.261 198.665 188.548 1.00 61.30  ?  498  ARG A CG    1 
ATOM   3899  C  CD    . ARG A 1  498  ? 156.831 198.643 188.115 1.00 64.73  ?  498  ARG A CD    1 
ATOM   3900  N  NE    . ARG A 1  498  ? 156.739 197.975 186.827 1.00 78.66  ?  498  ARG A NE    1 
ATOM   3901  C  CZ    . ARG A 1  498  ? 156.370 198.578 185.708 1.00 97.68  ?  498  ARG A CZ    1 
ATOM   3902  N  NH1   . ARG A 1  498  ? 156.027 199.864 185.720 1.00 80.37  1  498  ARG A NH1   1 
ATOM   3903  N  NH2   . ARG A 1  498  ? 156.333 197.901 184.568 1.00 88.74  ?  498  ARG A NH2   1 
ATOM   3904  N  N     . ALA A 1  499  ? 159.800 202.430 190.356 1.00 52.94  ?  499  ALA A N     1 
ATOM   3905  C  CA    . ALA A 1  499  ? 160.020 203.863 190.515 1.00 52.74  ?  499  ALA A CA    1 
ATOM   3906  C  C     . ALA A 1  499  ? 161.502 204.108 190.711 1.00 58.02  ?  499  ALA A C     1 
ATOM   3907  O  O     . ALA A 1  499  ? 162.077 204.936 189.999 1.00 59.68  ?  499  ALA A O     1 
ATOM   3908  C  CB    . ALA A 1  499  ? 159.233 204.406 191.695 1.00 53.39  ?  499  ALA A CB    1 
ATOM   3909  N  N     . GLU A 1  500  ? 162.145 203.315 191.589 1.00 52.17  ?  500  GLU A N     1 
ATOM   3910  C  CA    . GLU A 1  500  ? 163.562 203.452 191.857 1.00 50.86  ?  500  GLU A CA    1 
ATOM   3911  C  C     . GLU A 1  500  ? 164.351 203.443 190.561 1.00 52.97  ?  500  GLU A C     1 
ATOM   3912  O  O     . GLU A 1  500  ? 165.109 204.379 190.315 1.00 52.26  ?  500  GLU A O     1 
ATOM   3913  C  CB    . GLU A 1  500  ? 164.029 202.367 192.816 1.00 51.98  ?  500  GLU A CB    1 
ATOM   3914  C  CG    . GLU A 1  500  ? 164.880 202.911 193.938 1.00 63.02  ?  500  GLU A CG    1 
ATOM   3915  C  CD    . GLU A 1  500  ? 164.453 202.417 195.302 1.00 92.18  ?  500  GLU A CD    1 
ATOM   3916  O  OE1   . GLU A 1  500  ? 163.401 202.875 195.818 1.00 95.63  ?  500  GLU A OE1   1 
ATOM   3917  O  OE2   . GLU A 1  500  ? 165.174 201.552 195.849 1.00 75.03  -1 500  GLU A OE2   1 
ATOM   3918  N  N     . LEU A 1  501  ? 164.078 202.457 189.688 1.00 49.17  ?  501  LEU A N     1 
ATOM   3919  C  CA    . LEU A 1  501  ? 164.730 202.292 188.388 1.00 48.99  ?  501  LEU A CA    1 
ATOM   3920  C  C     . LEU A 1  501  ? 164.500 203.469 187.427 1.00 53.26  ?  501  LEU A C     1 
ATOM   3921  O  O     . LEU A 1  501  ? 165.452 204.108 186.950 1.00 52.86  ?  501  LEU A O     1 
ATOM   3922  C  CB    . LEU A 1  501  ? 164.280 200.964 187.761 1.00 48.68  ?  501  LEU A CB    1 
ATOM   3923  C  CG    . LEU A 1  501  ? 164.823 199.706 188.433 1.00 53.39  ?  501  LEU A CG    1 
ATOM   3924  C  CD1   . LEU A 1  501  ? 164.257 198.484 187.807 1.00 52.76  ?  501  LEU A CD1   1 
ATOM   3925  C  CD2   . LEU A 1  501  ? 166.352 199.637 188.327 1.00 57.64  ?  501  LEU A CD2   1 
ATOM   3926  N  N     . SER A 1  502  ? 163.230 203.774 187.196 1.00 50.02  ?  502  SER A N     1 
ATOM   3927  C  CA    . SER A 1  502  ? 162.801 204.824 186.295 1.00 51.17  ?  502  SER A CA    1 
ATOM   3928  C  C     . SER A 1  502  ? 163.213 206.214 186.751 1.00 58.77  ?  502  SER A C     1 
ATOM   3929  O  O     . SER A 1  502  ? 163.505 207.081 185.916 1.00 59.73  ?  502  SER A O     1 
ATOM   3930  C  CB    . SER A 1  502  ? 161.287 204.755 186.114 1.00 54.92  ?  502  SER A CB    1 
ATOM   3931  O  OG    . SER A 1  502  ? 160.573 205.232 187.241 1.00 63.58  ?  502  SER A OG    1 
ATOM   3932  N  N     . GLN A 1  503  ? 163.208 206.431 188.075 1.00 56.06  ?  503  GLN A N     1 
ATOM   3933  C  CA    . GLN A 1  503  ? 163.476 207.740 188.662 1.00 56.09  ?  503  GLN A CA    1 
ATOM   3934  C  C     . GLN A 1  503  ? 164.907 208.029 189.045 1.00 61.72  ?  503  GLN A C     1 
ATOM   3935  O  O     . GLN A 1  503  ? 165.256 209.206 189.172 1.00 61.82  ?  503  GLN A O     1 
ATOM   3936  C  CB    . GLN A 1  503  ? 162.481 208.075 189.792 1.00 56.72  ?  503  GLN A CB    1 
ATOM   3937  C  CG    . GLN A 1  503  ? 161.023 208.113 189.331 1.00 56.92  ?  503  GLN A CG    1 
ATOM   3938  C  CD    . GLN A 1  503  ? 160.832 208.930 188.072 1.00 81.02  ?  503  GLN A CD    1 
ATOM   3939  O  OE1   . GLN A 1  503  ? 161.036 210.156 188.058 1.00 76.59  ?  503  GLN A OE1   1 
ATOM   3940  N  NE2   . GLN A 1  503  ? 160.454 208.261 186.978 1.00 74.92  ?  503  GLN A NE2   1 
ATOM   3941  N  N     . LEU A 1  504  ? 165.752 206.987 189.198 1.00 58.44  ?  504  LEU A N     1 
ATOM   3942  C  CA    . LEU A 1  504  ? 167.156 207.194 189.583 1.00 57.30  ?  504  LEU A CA    1 
ATOM   3943  C  C     . LEU A 1  504  ? 168.173 206.653 188.581 1.00 60.38  ?  504  LEU A C     1 
ATOM   3944  O  O     . LEU A 1  504  ? 169.204 207.290 188.349 1.00 60.49  ?  504  LEU A O     1 
ATOM   3945  C  CB    . LEU A 1  504  ? 167.466 206.615 190.986 1.00 56.35  ?  504  LEU A CB    1 
ATOM   3946  C  CG    . LEU A 1  504  ? 166.624 207.052 192.186 1.00 60.19  ?  504  LEU A CG    1 
ATOM   3947  C  CD1   . LEU A 1  504  ? 166.943 206.199 193.380 1.00 60.37  ?  504  LEU A CD1   1 
ATOM   3948  C  CD2   . LEU A 1  504  ? 166.871 208.483 192.564 1.00 61.25  ?  504  LEU A CD2   1 
ATOM   3949  N  N     . CYS A 1  505  ? 167.915 205.482 188.022 1.00 56.04  ?  505  CYS A N     1 
ATOM   3950  C  CA    . CYS A 1  505  ? 168.910 204.854 187.175 1.00 56.72  ?  505  CYS A CA    1 
ATOM   3951  C  C     . CYS A 1  505  ? 168.559 204.664 185.706 1.00 59.33  ?  505  CYS A C     1 
ATOM   3952  O  O     . CYS A 1  505  ? 169.202 203.879 184.992 1.00 59.20  ?  505  CYS A O     1 
ATOM   3953  C  CB    . CYS A 1  505  ? 169.432 203.573 187.822 1.00 57.65  ?  505  CYS A CB    1 
ATOM   3954  S  SG    . CYS A 1  505  ? 168.332 202.870 189.081 1.00 61.80  ?  505  CYS A SG    1 
ATOM   3955  N  N     . ALA A 1  506  ? 167.592 205.419 185.234 1.00 53.72  ?  506  ALA A N     1 
ATOM   3956  C  CA    . ALA A 1  506  ? 167.252 205.308 183.835 1.00 52.94  ?  506  ALA A CA    1 
ATOM   3957  C  C     . ALA A 1  506  ? 168.331 205.926 182.959 1.00 54.89  ?  506  ALA A C     1 
ATOM   3958  O  O     . ALA A 1  506  ? 168.844 206.980 183.288 1.00 55.19  ?  506  ALA A O     1 
ATOM   3959  C  CB    . ALA A 1  506  ? 165.925 205.966 183.591 1.00 54.40  ?  506  ALA A CB    1 
ATOM   3960  N  N     . VAL A 1  507  ? 168.693 205.240 181.869 1.00 50.96  ?  507  VAL A N     1 
ATOM   3961  C  CA    . VAL A 1  507  ? 169.688 205.607 180.840 1.00 50.73  ?  507  VAL A CA    1 
ATOM   3962  C  C     . VAL A 1  507  ? 169.794 207.128 180.597 1.00 55.44  ?  507  VAL A C     1 
ATOM   3963  O  O     . VAL A 1  507  ? 170.922 207.627 180.689 1.00 55.15  ?  507  VAL A O     1 
ATOM   3964  C  CB    . VAL A 1  507  ? 169.465 204.821 179.511 1.00 54.03  ?  507  VAL A CB    1 
ATOM   3965  C  CG1   . VAL A 1  507  ? 170.438 205.259 178.425 1.00 54.03  ?  507  VAL A CG1   1 
ATOM   3966  C  CG2   . VAL A 1  507  ? 169.540 203.320 179.731 1.00 53.12  ?  507  VAL A CG2   1 
ATOM   3967  N  N     . PRO A 1  508  ? 168.686 207.896 180.308 1.00 52.17  ?  508  PRO A N     1 
ATOM   3968  C  CA    . PRO A 1  508  ? 168.855 209.346 180.073 1.00 52.92  ?  508  PRO A CA    1 
ATOM   3969  C  C     . PRO A 1  508  ? 169.485 210.063 181.255 1.00 58.80  ?  508  PRO A C     1 
ATOM   3970  O  O     . PRO A 1  508  ? 170.422 210.834 181.051 1.00 59.72  ?  508  PRO A O     1 
ATOM   3971  C  CB    . PRO A 1  508  ? 167.442 209.838 179.754 1.00 54.25  ?  508  PRO A CB    1 
ATOM   3972  C  CG    . PRO A 1  508  ? 166.726 208.618 179.297 1.00 57.74  ?  508  PRO A CG    1 
ATOM   3973  C  CD    . PRO A 1  508  ? 167.273 207.506 180.125 1.00 52.54  ?  508  PRO A CD    1 
ATOM   3974  N  N     . LEU A 1  509  ? 169.055 209.731 182.491 1.00 55.20  ?  509  LEU A N     1 
ATOM   3975  C  CA    . LEU A 1  509  ? 169.630 210.317 183.709 1.00 55.07  ?  509  LEU A CA    1 
ATOM   3976  C  C     . LEU A 1  509  ? 171.143 210.116 183.736 1.00 61.53  ?  509  LEU A C     1 
ATOM   3977  O  O     . LEU A 1  509  ? 171.882 211.092 183.929 1.00 63.77  ?  509  LEU A O     1 
ATOM   3978  C  CB    . LEU A 1  509  ? 168.967 209.792 185.003 1.00 54.04  ?  509  LEU A CB    1 
ATOM   3979  C  CG    . LEU A 1  509  ? 167.428 209.733 184.973 1.00 58.32  ?  509  LEU A CG    1 
ATOM   3980  C  CD1   . LEU A 1  509  ? 166.840 209.055 186.197 1.00 57.19  ?  509  LEU A CD1   1 
ATOM   3981  C  CD2   . LEU A 1  509  ? 166.836 211.094 184.807 1.00 63.69  ?  509  LEU A CD2   1 
ATOM   3982  N  N     . GLN A 1  510  ? 171.597 208.900 183.394 1.00 56.68  ?  510  GLN A N     1 
ATOM   3983  C  CA    . GLN A 1  510  ? 173.014 208.537 183.394 1.00 56.07  ?  510  GLN A CA    1 
ATOM   3984  C  C     . GLN A 1  510  ? 173.959 209.164 182.344 1.00 61.24  ?  510  GLN A C     1 
ATOM   3985  O  O     . GLN A 1  510  ? 175.169 209.048 182.568 1.00 61.46  ?  510  GLN A O     1 
ATOM   3986  C  CB    . GLN A 1  510  ? 173.218 207.028 183.563 1.00 56.19  ?  510  GLN A CB    1 
ATOM   3987  C  CG    . GLN A 1  510  ? 172.402 206.430 184.708 1.00 64.45  ?  510  GLN A CG    1 
ATOM   3988  C  CD    . GLN A 1  510  ? 172.971 206.743 186.067 1.00 89.09  ?  510  GLN A CD    1 
ATOM   3989  O  OE1   . GLN A 1  510  ? 174.191 206.719 186.274 1.00 88.14  ?  510  GLN A OE1   1 
ATOM   3990  N  NE2   . GLN A 1  510  ? 172.096 206.978 187.047 1.00 81.07  ?  510  GLN A NE2   1 
ATOM   3991  N  N     . ILE A 1  511  ? 173.435 209.892 181.282 1.00 57.96  ?  511  ILE A N     1 
ATOM   3992  C  CA    . ILE A 1  511  ? 174.212 210.571 180.197 1.00 58.84  ?  511  ILE A CA    1 
ATOM   3993  C  C     . ILE A 1  511  ? 175.406 211.404 180.705 1.00 66.81  ?  511  ILE A C     1 
ATOM   3994  O  O     . ILE A 1  511  ? 176.546 211.101 180.356 1.00 66.32  ?  511  ILE A O     1 
ATOM   3995  C  CB    . ILE A 1  511  ? 173.352 211.378 179.172 1.00 62.01  ?  511  ILE A CB    1 
ATOM   3996  C  CG1   . ILE A 1  511  ? 172.295 210.499 178.483 1.00 62.06  ?  511  ILE A CG1   1 
ATOM   3997  C  CG2   . ILE A 1  511  ? 174.241 212.050 178.119 1.00 62.23  ?  511  ILE A CG2   1 
ATOM   3998  C  CD1   . ILE A 1  511  ? 171.215 211.254 177.766 1.00 65.63  ?  511  ILE A CD1   1 
ATOM   3999  N  N     . VAL A 1  512  ? 175.155 212.464 181.490 1.00 66.72  ?  512  VAL A N     1 
ATOM   4000  C  CA    . VAL A 1  512  ? 176.257 213.229 182.076 1.00 68.32  ?  512  VAL A CA    1 
ATOM   4001  C  C     . VAL A 1  512  ? 176.609 212.490 183.376 1.00 75.74  ?  512  VAL A C     1 
ATOM   4002  O  O     . VAL A 1  512  ? 175.714 212.297 184.208 1.00 77.20  ?  512  VAL A O     1 
ATOM   4003  C  CB    . VAL A 1  512  ? 175.897 214.729 182.251 1.00 72.38  ?  512  VAL A CB    1 
ATOM   4004  C  CG1   . VAL A 1  512  ? 176.496 215.337 183.518 1.00 72.03  ?  512  VAL A CG1   1 
ATOM   4005  C  CG2   . VAL A 1  512  ? 176.337 215.515 181.025 1.00 72.98  ?  512  VAL A CG2   1 
ATOM   4006  N  N     . SER A 1  513  ? 177.856 211.974 183.499 1.00 71.93  ?  513  SER A N     1 
ATOM   4007  C  CA    . SER A 1  513  ? 178.271 211.195 184.680 1.00 70.88  ?  513  SER A CA    1 
ATOM   4008  C  C     . SER A 1  513  ? 179.134 212.014 185.620 1.00 73.56  ?  513  SER A C     1 
ATOM   4009  O  O     . SER A 1  513  ? 179.914 212.838 185.125 1.00 75.07  ?  513  SER A O     1 
ATOM   4010  C  CB    . SER A 1  513  ? 179.041 209.943 184.274 1.00 73.83  ?  513  SER A CB    1 
ATOM   4011  O  OG    . SER A 1  513  ? 180.431 210.111 184.520 1.00 79.80  ?  513  SER A OG    1 
ATOM   4012  N  N     . PRO A 1  514  ? 179.107 211.712 186.950 1.00 66.68  ?  514  PRO A N     1 
ATOM   4013  C  CA    . PRO A 1  514  ? 179.962 212.443 187.897 1.00 66.84  ?  514  PRO A CA    1 
ATOM   4014  C  C     . PRO A 1  514  ? 181.432 211.974 187.904 1.00 74.46  ?  514  PRO A C     1 
ATOM   4015  O  O     . PRO A 1  514  ? 182.285 212.592 188.537 1.00 73.60  ?  514  PRO A O     1 
ATOM   4016  C  CB    . PRO A 1  514  ? 179.274 212.173 189.238 1.00 67.18  ?  514  PRO A CB    1 
ATOM   4017  C  CG    . PRO A 1  514  ? 178.707 210.866 189.093 1.00 70.07  ?  514  PRO A CG    1 
ATOM   4018  C  CD    . PRO A 1  514  ? 178.275 210.725 187.663 1.00 66.02  ?  514  PRO A CD    1 
ATOM   4019  N  N     . GLN A 1  515  ? 181.728 210.875 187.199 1.00 74.43  ?  515  GLN A N     1 
ATOM   4020  C  CA    . GLN A 1  515  ? 183.061 210.286 187.138 1.00 75.70  ?  515  GLN A CA    1 
ATOM   4021  C  C     . GLN A 1  515  ? 184.039 211.294 186.656 1.00 82.25  ?  515  GLN A C     1 
ATOM   4022  O  O     . GLN A 1  515  ? 185.113 211.405 187.232 1.00 85.02  ?  515  GLN A O     1 
ATOM   4023  C  CB    . GLN A 1  515  ? 183.077 209.070 186.198 1.00 77.06  ?  515  GLN A CB    1 
ATOM   4024  C  CG    . GLN A 1  515  ? 184.361 208.254 186.210 1.00 88.22  ?  515  GLN A CG    1 
ATOM   4025  C  CD    . GLN A 1  515  ? 183.999 206.806 186.053 1.00 109.68 ?  515  GLN A CD    1 
ATOM   4026  O  OE1   . GLN A 1  515  ? 183.048 206.296 186.680 1.00 103.19 ?  515  GLN A OE1   1 
ATOM   4027  N  NE2   . GLN A 1  515  ? 184.749 206.114 185.217 1.00 104.73 ?  515  GLN A NE2   1 
ATOM   4028  N  N     . SER A 1  516  ? 183.672 212.041 185.620 1.00 77.73  ?  516  SER A N     1 
ATOM   4029  C  CA    . SER A 1  516  ? 184.576 212.999 185.016 1.00 78.50  ?  516  SER A CA    1 
ATOM   4030  C  C     . SER A 1  516  ? 183.834 214.255 184.632 1.00 80.65  ?  516  SER A C     1 
ATOM   4031  O  O     . SER A 1  516  ? 184.325 215.055 183.827 1.00 80.46  ?  516  SER A O     1 
ATOM   4032  C  CB    . SER A 1  516  ? 185.240 212.359 183.809 1.00 85.87  ?  516  SER A CB    1 
ATOM   4033  O  OG    . SER A 1  516  ? 184.275 211.540 183.163 1.00 107.89 ?  516  SER A OG    1 
ATOM   4034  N  N     . ASN A 1  517  ? 182.663 214.454 185.263 1.00 75.98  ?  517  ASN A N     1 
ATOM   4035  C  CA    . ASN A 1  517  ? 181.780 215.601 185.089 1.00 75.73  ?  517  ASN A CA    1 
ATOM   4036  C  C     . ASN A 1  517  ? 181.525 215.945 183.615 1.00 82.32  ?  517  ASN A C     1 
ATOM   4037  O  O     . ASN A 1  517  ? 181.506 217.123 183.234 1.00 84.63  ?  517  ASN A O     1 
ATOM   4038  C  CB    . ASN A 1  517  ? 182.246 216.799 185.928 1.00 72.46  ?  517  ASN A CB    1 
ATOM   4039  C  CG    . ASN A 1  517  ? 183.551 217.425 185.528 1.00 82.25  ?  517  ASN A CG    1 
ATOM   4040  O  OD1   . ASN A 1  517  ? 184.601 217.171 186.122 1.00 72.74  ?  517  ASN A OD1   1 
ATOM   4041  N  ND2   . ASN A 1  517  ? 183.502 218.301 184.542 1.00 76.10  ?  517  ASN A ND2   1 
ATOM   4042  N  N     . LYS A 1  518  ? 181.341 214.903 182.783 1.00 77.01  ?  518  LYS A N     1 
ATOM   4043  C  CA    . LYS A 1  518  ? 181.090 215.065 181.355 1.00 76.03  ?  518  LYS A CA    1 
ATOM   4044  C  C     . LYS A 1  518  ? 180.213 213.921 180.843 1.00 78.87  ?  518  LYS A C     1 
ATOM   4045  O  O     . LYS A 1  518  ? 179.999 212.944 181.575 1.00 78.15  ?  518  LYS A O     1 
ATOM   4046  C  CB    . LYS A 1  518  ? 182.417 215.187 180.562 1.00 78.21  ?  518  LYS A CB    1 
ATOM   4047  C  CG    . LYS A 1  518  ? 183.286 213.926 180.556 1.00 77.83  ?  518  LYS A CG    1 
ATOM   4048  C  CD    . LYS A 1  518  ? 183.931 213.652 179.202 1.00 73.60  ?  518  LYS A CD    1 
ATOM   4049  C  CE    . LYS A 1  518  ? 184.436 212.232 179.118 1.00 86.56  ?  518  LYS A CE    1 
ATOM   4050  N  NZ    . LYS A 1  518  ? 183.364 211.196 179.332 1.00 100.63 1  518  LYS A NZ    1 
ATOM   4051  N  N     . PRO A 1  519  ? 179.711 214.013 179.591 1.00 74.91  ?  519  PRO A N     1 
ATOM   4052  C  CA    . PRO A 1  519  ? 178.885 212.924 179.053 1.00 74.19  ?  519  PRO A CA    1 
ATOM   4053  C  C     . PRO A 1  519  ? 179.630 211.601 178.930 1.00 76.27  ?  519  PRO A C     1 
ATOM   4054  O  O     . PRO A 1  519  ? 180.766 211.595 178.458 1.00 76.73  ?  519  PRO A O     1 
ATOM   4055  C  CB    . PRO A 1  519  ? 178.500 213.428 177.658 1.00 76.89  ?  519  PRO A CB    1 
ATOM   4056  C  CG    . PRO A 1  519  ? 178.765 214.878 177.661 1.00 81.89  ?  519  PRO A CG    1 
ATOM   4057  C  CD    . PRO A 1  519  ? 179.875 215.097 178.603 1.00 77.18  ?  519  PRO A CD    1 
ATOM   4058  N  N     . CYS A 1  520  ? 178.982 210.484 179.321 1.00 70.64  ?  520  CYS A N     1 
ATOM   4059  C  CA    . CYS A 1  520  ? 179.565 209.132 179.230 1.00 69.37  ?  520  CYS A CA    1 
ATOM   4060  C  C     . CYS A 1  520  ? 179.033 208.261 178.076 1.00 69.74  ?  520  CYS A C     1 
ATOM   4061  O  O     . CYS A 1  520  ? 179.328 207.068 178.002 1.00 67.55  ?  520  CYS A O     1 
ATOM   4062  C  CB    . CYS A 1  520  ? 179.507 208.407 180.570 1.00 69.24  ?  520  CYS A CB    1 
ATOM   4063  S  SG    . CYS A 1  520  ? 177.846 207.923 181.089 1.00 72.50  ?  520  CYS A SG    1 
ATOM   4064  N  N     . MET A 1  521  ? 178.281 208.894 177.176 1.00 66.83  ?  521  MET A N     1 
ATOM   4065  C  CA    . MET A 1  521  ? 177.661 208.337 175.980 1.00 67.15  ?  521  MET A CA    1 
ATOM   4066  C  C     . MET A 1  521  ? 177.771 209.415 174.918 1.00 73.77  ?  521  MET A C     1 
ATOM   4067  O  O     . MET A 1  521  ? 177.485 210.593 175.192 1.00 73.57  ?  521  MET A O     1 
ATOM   4068  C  CB    . MET A 1  521  ? 176.159 208.071 176.224 1.00 68.84  ?  521  MET A CB    1 
ATOM   4069  C  CG    . MET A 1  521  ? 175.876 206.848 177.042 1.00 71.72  ?  521  MET A CG    1 
ATOM   4070  S  SD    . MET A 1  521  ? 174.217 206.823 177.758 1.00 75.35  ?  521  MET A SD    1 
ATOM   4071  C  CE    . MET A 1  521  ? 174.606 206.781 179.495 1.00 71.38  ?  521  MET A CE    1 
ATOM   4072  N  N     . GLY A 1  522  ? 178.154 209.013 173.713 1.00 71.38  ?  522  GLY A N     1 
ATOM   4073  C  CA    . GLY A 1  522  ? 178.237 209.943 172.586 1.00 71.76  ?  522  GLY A CA    1 
ATOM   4074  C  C     . GLY A 1  522  ? 177.898 209.257 171.286 1.00 74.67  ?  522  GLY A C     1 
ATOM   4075  O  O     . GLY A 1  522  ? 177.569 208.068 171.300 1.00 74.37  ?  522  GLY A O     1 
ATOM   4076  N  N     . ILE A 1  523  ? 178.002 209.978 170.156 1.00 70.25  ?  523  ILE A N     1 
ATOM   4077  C  CA    . ILE A 1  523  ? 177.758 209.367 168.849 1.00 70.01  ?  523  ILE A CA    1 
ATOM   4078  C  C     . ILE A 1  523  ? 178.977 208.494 168.424 1.00 75.48  ?  523  ILE A C     1 
ATOM   4079  O  O     . ILE A 1  523  ? 180.120 208.912 168.585 1.00 75.49  ?  523  ILE A O     1 
ATOM   4080  C  CB    . ILE A 1  523  ? 177.249 210.407 167.813 1.00 73.17  ?  523  ILE A CB    1 
ATOM   4081  C  CG1   . ILE A 1  523  ? 175.714 210.521 167.849 1.00 72.59  ?  523  ILE A CG1   1 
ATOM   4082  C  CG2   . ILE A 1  523  ? 177.660 210.045 166.405 1.00 74.77  ?  523  ILE A CG2   1 
ATOM   4083  C  CD1   . ILE A 1  523  ? 175.100 211.193 168.992 1.00 75.34  ?  523  ILE A CD1   1 
ATOM   4084  N  N     . VAL A 1  524  ? 178.734 207.249 167.984 1.00 72.95  ?  524  VAL A N     1 
ATOM   4085  C  CA    . VAL A 1  524  ? 179.825 206.327 167.641 1.00 73.34  ?  524  VAL A CA    1 
ATOM   4086  C  C     . VAL A 1  524  ? 179.727 205.767 166.219 1.00 79.32  ?  524  VAL A C     1 
ATOM   4087  O  O     . VAL A 1  524  ? 178.664 205.845 165.582 1.00 80.69  ?  524  VAL A O     1 
ATOM   4088  C  CB    . VAL A 1  524  ? 179.892 205.140 168.640 1.00 76.48  ?  524  VAL A CB    1 
ATOM   4089  C  CG1   . VAL A 1  524  ? 181.321 204.623 168.787 1.00 76.84  ?  524  VAL A CG1   1 
ATOM   4090  C  CG2   . VAL A 1  524  ? 179.300 205.489 169.996 1.00 75.70  ?  524  VAL A CG2   1 
ATOM   4091  N  N     . GLN A 1  525  ? 180.834 205.120 165.774 1.00 74.33  ?  525  GLN A N     1 
ATOM   4092  C  CA    . GLN A 1  525  ? 180.985 204.345 164.543 1.00 73.56  ?  525  GLN A CA    1 
ATOM   4093  C  C     . GLN A 1  525  ? 180.298 204.927 163.322 1.00 77.85  ?  525  GLN A C     1 
ATOM   4094  O  O     . GLN A 1  525  ? 180.627 206.063 162.963 1.00 78.44  ?  525  GLN A O     1 
ATOM   4095  C  CB    . GLN A 1  525  ? 180.628 202.862 164.770 1.00 73.21  ?  525  GLN A CB    1 
ATOM   4096  C  CG    . GLN A 1  525  ? 181.611 202.162 165.696 1.00 77.44  ?  525  GLN A CG    1 
ATOM   4097  C  CD    . GLN A 1  525  ? 181.988 200.764 165.285 1.00 92.50  ?  525  GLN A CD    1 
ATOM   4098  O  OE1   . GLN A 1  525  ? 181.270 200.065 164.551 1.00 82.81  ?  525  GLN A OE1   1 
ATOM   4099  N  NE2   . GLN A 1  525  ? 183.115 200.302 165.819 1.00 90.80  ?  525  GLN A NE2   1 
ATOM   4100  N  N     . ASP A 1  526  ? 179.352 204.165 162.688 1.00 72.92  ?  526  ASP A N     1 
ATOM   4101  C  CA    . ASP A 1  526  ? 178.633 204.594 161.483 1.00 73.15  ?  526  ASP A CA    1 
ATOM   4102  C  C     . ASP A 1  526  ? 178.146 206.028 161.595 1.00 77.12  ?  526  ASP A C     1 
ATOM   4103  O  O     . ASP A 1  526  ? 178.511 206.863 160.762 1.00 78.49  ?  526  ASP A O     1 
ATOM   4104  C  CB    . ASP A 1  526  ? 177.470 203.646 161.125 1.00 74.57  ?  526  ASP A CB    1 
ATOM   4105  C  CG    . ASP A 1  526  ? 177.880 202.357 160.449 1.00 86.41  ?  526  ASP A CG    1 
ATOM   4106  O  OD1   . ASP A 1  526  ? 179.045 201.943 160.624 1.00 85.70  ?  526  ASP A OD1   1 
ATOM   4107  O  OD2   . ASP A 1  526  ? 177.017 201.741 159.761 1.00 96.95  -1 526  ASP A OD2   1 
ATOM   4108  N  N     . THR A 1  527  ? 177.408 206.332 162.669 1.00 71.44  ?  527  THR A N     1 
ATOM   4109  C  CA    . THR A 1  527  ? 176.876 207.661 162.905 1.00 71.38  ?  527  THR A CA    1 
ATOM   4110  C  C     . THR A 1  527  ? 177.961 208.717 163.060 1.00 75.71  ?  527  THR A C     1 
ATOM   4111  O  O     . THR A 1  527  ? 177.755 209.840 162.610 1.00 74.84  ?  527  THR A O     1 
ATOM   4112  C  CB    . THR A 1  527  ? 175.882 207.629 164.029 1.00 84.52  ?  527  THR A CB    1 
ATOM   4113  O  OG1   . THR A 1  527  ? 175.124 206.425 163.924 1.00 87.08  ?  527  THR A OG1   1 
ATOM   4114  C  CG2   . THR A 1  527  ? 174.963 208.828 164.007 1.00 84.88  ?  527  THR A CG2   1 
ATOM   4115  N  N     . LEU A 1  528  ? 179.123 208.368 163.664 1.00 73.80  ?  528  LEU A N     1 
ATOM   4116  C  CA    . LEU A 1  528  ? 180.220 209.337 163.791 1.00 74.57  ?  528  LEU A CA    1 
ATOM   4117  C  C     . LEU A 1  528  ? 180.887 209.570 162.440 1.00 82.62  ?  528  LEU A C     1 
ATOM   4118  O  O     . LEU A 1  528  ? 181.128 210.719 162.045 1.00 82.43  ?  528  LEU A O     1 
ATOM   4119  C  CB    . LEU A 1  528  ? 181.252 208.967 164.874 1.00 73.25  ?  528  LEU A CB    1 
ATOM   4120  C  CG    . LEU A 1  528  ? 182.310 210.061 165.138 1.00 77.13  ?  528  LEU A CG    1 
ATOM   4121  C  CD1   . LEU A 1  528  ? 181.675 211.374 165.474 1.00 76.60  ?  528  LEU A CD1   1 
ATOM   4122  C  CD2   . LEU A 1  528  ? 183.216 209.690 166.258 1.00 79.42  ?  528  LEU A CD2   1 
ATOM   4123  N  N     . CYS A 1  529  ? 181.146 208.469 161.726 1.00 81.78  ?  529  CYS A N     1 
ATOM   4124  C  CA    . CYS A 1  529  ? 181.761 208.464 160.406 1.00 83.48  ?  529  CYS A CA    1 
ATOM   4125  C  C     . CYS A 1  529  ? 180.911 209.204 159.377 1.00 85.33  ?  529  CYS A C     1 
ATOM   4126  O  O     . CYS A 1  529  ? 181.450 210.013 158.615 1.00 86.17  ?  529  CYS A O     1 
ATOM   4127  C  CB    . CYS A 1  529  ? 182.057 207.037 159.963 1.00 84.59  ?  529  CYS A CB    1 
ATOM   4128  S  SG    . CYS A 1  529  ? 183.111 206.936 158.499 1.00 90.31  ?  529  CYS A SG    1 
ATOM   4129  N  N     . GLY A 1  530  ? 179.606 208.916 159.384 1.00 78.66  ?  530  GLY A N     1 
ATOM   4130  C  CA    . GLY A 1  530  ? 178.624 209.520 158.497 1.00 78.18  ?  530  GLY A CA    1 
ATOM   4131  C  C     . GLY A 1  530  ? 178.385 210.982 158.802 1.00 80.51  ?  530  GLY A C     1 
ATOM   4132  O  O     . GLY A 1  530  ? 178.098 211.768 157.895 1.00 79.97  ?  530  GLY A O     1 
ATOM   4133  N  N     . ILE A 1  531  ? 178.510 211.362 160.087 1.00 75.92  ?  531  ILE A N     1 
ATOM   4134  C  CA    . ILE A 1  531  ? 178.281 212.743 160.489 1.00 75.28  ?  531  ILE A CA    1 
ATOM   4135  C  C     . ILE A 1  531  ? 179.309 213.710 159.894 1.00 80.51  ?  531  ILE A C     1 
ATOM   4136  O  O     . ILE A 1  531  ? 178.910 214.784 159.451 1.00 82.03  ?  531  ILE A O     1 
ATOM   4137  C  CB    . ILE A 1  531  ? 177.872 212.955 161.985 1.00 76.30  ?  531  ILE A CB    1 
ATOM   4138  C  CG1   . ILE A 1  531  ? 176.987 214.191 162.160 1.00 75.78  ?  531  ILE A CG1   1 
ATOM   4139  C  CG2   . ILE A 1  531  ? 179.059 212.948 162.947 1.00 76.66  ?  531  ILE A CG2   1 
ATOM   4140  C  CD1   . ILE A 1  531  ? 176.180 214.172 163.318 1.00 76.92  ?  531  ILE A CD1   1 
ATOM   4141  N  N     . ARG A 1  532  ? 180.592 213.297 159.783 1.00 76.15  ?  532  ARG A N     1 
ATOM   4142  C  CA    . ARG A 1  532  ? 181.624 214.147 159.165 1.00 76.93  ?  532  ARG A CA    1 
ATOM   4143  C  C     . ARG A 1  532  ? 181.286 214.328 157.692 1.00 80.93  ?  532  ARG A C     1 
ATOM   4144  O  O     . ARG A 1  532  ? 181.112 215.457 157.217 1.00 80.32  ?  532  ARG A O     1 
ATOM   4145  C  CB    . ARG A 1  532  ? 183.023 213.533 159.302 1.00 77.37  ?  532  ARG A CB    1 
ATOM   4146  C  CG    . ARG A 1  532  ? 184.110 214.530 158.953 1.00 90.58  ?  532  ARG A CG    1 
ATOM   4147  C  CD    . ARG A 1  532  ? 185.472 213.897 158.840 1.00 102.36 ?  532  ARG A CD    1 
ATOM   4148  N  NE    . ARG A 1  532  ? 186.027 213.992 157.491 1.00 107.07 ?  532  ARG A NE    1 
ATOM   4149  C  CZ    . ARG A 1  532  ? 185.742 213.144 156.509 1.00 121.40 ?  532  ARG A CZ    1 
ATOM   4150  N  NH1   . ARG A 1  532  ? 184.866 212.158 156.705 1.00 106.80 1  532  ARG A NH1   1 
ATOM   4151  N  NH2   . ARG A 1  532  ? 186.316 213.283 155.318 1.00 105.61 ?  532  ARG A NH2   1 
ATOM   4152  N  N     . LYS A 1  533  ? 181.143 213.187 156.998 1.00 77.65  ?  533  LYS A N     1 
ATOM   4153  C  CA    . LYS A 1  533  ? 180.795 213.075 155.591 1.00 78.29  ?  533  LYS A CA    1 
ATOM   4154  C  C     . LYS A 1  533  ? 179.599 213.967 155.279 1.00 82.72  ?  533  LYS A C     1 
ATOM   4155  O  O     . LYS A 1  533  ? 179.701 214.792 154.389 1.00 84.71  ?  533  LYS A O     1 
ATOM   4156  C  CB    . LYS A 1  533  ? 180.509 211.602 155.198 1.00 80.06  ?  533  LYS A CB    1 
ATOM   4157  C  CG    . LYS A 1  533  ? 181.724 210.651 155.257 1.00 85.23  ?  533  LYS A CG    1 
ATOM   4158  C  CD    . LYS A 1  533  ? 181.684 209.574 154.181 1.00 86.46  ?  533  LYS A CD    1 
ATOM   4159  C  CE    . LYS A 1  533  ? 182.095 210.147 152.841 1.00 101.54 ?  533  LYS A CE    1 
ATOM   4160  N  NZ    . LYS A 1  533  ? 181.849 209.206 151.724 1.00 112.90 1  533  LYS A NZ    1 
ATOM   4161  N  N     . LEU A 1  534  ? 178.509 213.872 156.047 1.00 77.75  ?  534  LEU A N     1 
ATOM   4162  C  CA    . LEU A 1  534  ? 177.313 214.692 155.812 1.00 77.85  ?  534  LEU A CA    1 
ATOM   4163  C  C     . LEU A 1  534  ? 177.570 216.200 155.906 1.00 86.69  ?  534  LEU A C     1 
ATOM   4164  O  O     . LEU A 1  534  ? 177.046 216.968 155.097 1.00 87.77  ?  534  LEU A O     1 
ATOM   4165  C  CB    . LEU A 1  534  ? 176.195 214.301 156.809 1.00 75.64  ?  534  LEU A CB    1 
ATOM   4166  C  CG    . LEU A 1  534  ? 174.881 215.069 156.710 1.00 78.29  ?  534  LEU A CG    1 
ATOM   4167  C  CD1   . LEU A 1  534  ? 174.098 214.665 155.491 1.00 78.73  ?  534  LEU A CD1   1 
ATOM   4168  C  CD2   . LEU A 1  534  ? 174.058 214.894 157.942 1.00 77.04  ?  534  LEU A CD2   1 
ATOM   4169  N  N     . THR A 1  535  ? 178.362 216.615 156.905 1.00 84.40  ?  535  THR A N     1 
ATOM   4170  C  CA    . THR A 1  535  ? 178.576 218.021 157.211 1.00 84.68  ?  535  THR A CA    1 
ATOM   4171  C  C     . THR A 1  535  ? 179.746 218.737 156.553 1.00 90.67  ?  535  THR A C     1 
ATOM   4172  O  O     . THR A 1  535  ? 180.183 219.761 157.081 1.00 91.75  ?  535  THR A O     1 
ATOM   4173  C  CB    . THR A 1  535  ? 178.399 218.279 158.711 1.00 87.74  ?  535  THR A CB    1 
ATOM   4174  O  OG1   . THR A 1  535  ? 179.315 217.474 159.463 1.00 84.68  ?  535  THR A OG1   1 
ATOM   4175  C  CG2   . THR A 1  535  ? 176.967 218.044 159.166 1.00 82.47  ?  535  THR A CG2   1 
ATOM   4176  N  N     . LEU A 1  536  ? 180.210 218.267 155.378 1.00 87.64  ?  536  LEU A N     1 
ATOM   4177  C  CA    . LEU A 1  536  ? 181.266 218.974 154.628 1.00 88.87  ?  536  LEU A CA    1 
ATOM   4178  C  C     . LEU A 1  536  ? 180.595 220.070 153.759 1.00 96.39  ?  536  LEU A C     1 
ATOM   4179  O  O     . LEU A 1  536  ? 179.386 219.955 153.464 1.00 96.98  ?  536  LEU A O     1 
ATOM   4180  C  CB    . LEU A 1  536  ? 182.045 218.023 153.711 1.00 88.81  ?  536  LEU A CB    1 
ATOM   4181  C  CG    . LEU A 1  536  ? 182.443 216.663 154.248 1.00 91.58  ?  536  LEU A CG    1 
ATOM   4182  C  CD1   . LEU A 1  536  ? 182.595 215.683 153.119 1.00 92.11  ?  536  LEU A CD1   1 
ATOM   4183  C  CD2   . LEU A 1  536  ? 183.719 216.729 155.046 1.00 93.02  ?  536  LEU A CD2   1 
ATOM   4184  N  N     . ARG A 1  537  ? 181.357 221.131 153.342 1.00 93.18  ?  537  ARG A N     1 
ATOM   4185  C  CA    . ARG A 1  537  ? 180.760 222.173 152.487 1.00 93.63  ?  537  ARG A CA    1 
ATOM   4186  C  C     . ARG A 1  537  ? 180.273 221.551 151.198 1.00 98.49  ?  537  ARG A C     1 
ATOM   4187  O  O     . ARG A 1  537  ? 179.119 221.760 150.849 1.00 98.95  ?  537  ARG A O     1 
ATOM   4188  C  CB    . ARG A 1  537  ? 181.674 223.389 152.244 1.00 93.24  ?  537  ARG A CB    1 
ATOM   4189  C  CG    . ARG A 1  537  ? 181.407 224.529 153.220 1.00 99.80  ?  537  ARG A CG    1 
ATOM   4190  C  CD    . ARG A 1  537  ? 182.123 225.830 152.889 1.00 105.94 ?  537  ARG A CD    1 
ATOM   4191  N  NE    . ARG A 1  537  ? 183.433 225.963 153.544 1.00 113.57 ?  537  ARG A NE    1 
ATOM   4192  C  CZ    . ARG A 1  537  ? 183.631 226.439 154.774 1.00 126.10 ?  537  ARG A CZ    1 
ATOM   4193  N  NH1   . ARG A 1  537  ? 182.599 226.790 155.536 1.00 113.86 1  537  ARG A NH1   1 
ATOM   4194  N  NH2   . ARG A 1  537  ? 184.860 226.532 155.264 1.00 108.30 ?  537  ARG A NH2   1 
ATOM   4195  N  N     . ASP A 1  538  ? 181.099 220.669 150.595 1.00 95.15  ?  538  ASP A N     1 
ATOM   4196  C  CA    . ASP A 1  538  ? 180.860 219.864 149.393 1.00 96.28  ?  538  ASP A CA    1 
ATOM   4197  C  C     . ASP A 1  538  ? 179.517 219.117 149.357 1.00 101.22 ?  538  ASP A C     1 
ATOM   4198  O  O     . ASP A 1  538  ? 178.964 218.890 148.273 1.00 101.89 ?  538  ASP A O     1 
ATOM   4199  C  CB    . ASP A 1  538  ? 181.945 218.791 149.321 1.00 98.31  ?  538  ASP A CB    1 
ATOM   4200  C  CG    . ASP A 1  538  ? 183.126 219.120 148.453 1.00 116.85 ?  538  ASP A CG    1 
ATOM   4201  O  OD1   . ASP A 1  538  ? 183.156 220.241 147.889 1.00 119.82 ?  538  ASP A OD1   1 
ATOM   4202  O  OD2   . ASP A 1  538  ? 184.027 218.256 148.333 1.00 125.65 -1 538  ASP A OD2   1 
ATOM   4203  N  N     . THR A 1  539  ? 179.050 218.664 150.535 1.00 96.56  ?  539  THR A N     1 
ATOM   4204  C  CA    . THR A 1  539  ? 177.847 217.857 150.704 1.00 95.25  ?  539  THR A CA    1 
ATOM   4205  C  C     . THR A 1  539  ? 176.529 218.604 150.563 1.00 98.95  ?  539  THR A C     1 
ATOM   4206  O  O     . THR A 1  539  ? 176.160 219.378 151.454 1.00 97.79  ?  539  THR A O     1 
ATOM   4207  C  CB    . THR A 1  539  ? 177.992 216.962 151.937 1.00 100.36 ?  539  THR A CB    1 
ATOM   4208  O  OG1   . THR A 1  539  ? 179.169 216.170 151.762 1.00 103.74 ?  539  THR A OG1   1 
ATOM   4209  C  CG2   . THR A 1  539  ? 176.794 216.050 152.150 1.00 94.96  ?  539  THR A CG2   1 
ATOM   4210  N  N     . PHE A 1  540  ? 175.811 218.325 149.441 1.00 96.15  ?  540  PHE A N     1 
ATOM   4211  C  CA    . PHE A 1  540  ? 174.498 218.877 149.092 1.00 96.27  ?  540  PHE A CA    1 
ATOM   4212  C  C     . PHE A 1  540  ? 173.496 217.799 148.790 1.00 97.20  ?  540  PHE A C     1 
ATOM   4213  O  O     . PHE A 1  540  ? 173.813 216.846 148.083 1.00 97.37  ?  540  PHE A O     1 
ATOM   4214  C  CB    . PHE A 1  540  ? 174.585 219.830 147.907 1.00 100.52 ?  540  PHE A CB    1 
ATOM   4215  C  CG    . PHE A 1  540  ? 175.398 221.056 148.202 1.00 103.68 ?  540  PHE A CG    1 
ATOM   4216  C  CD1   . PHE A 1  540  ? 174.838 222.134 148.877 1.00 106.47 ?  540  PHE A CD1   1 
ATOM   4217  C  CD2   . PHE A 1  540  ? 176.739 221.123 147.841 1.00 108.45 ?  540  PHE A CD2   1 
ATOM   4218  C  CE1   . PHE A 1  540  ? 175.608 223.253 149.194 1.00 110.51 ?  540  PHE A CE1   1 
ATOM   4219  C  CE2   . PHE A 1  540  ? 177.503 222.253 148.133 1.00 110.47 ?  540  PHE A CE2   1 
ATOM   4220  C  CZ    . PHE A 1  540  ? 176.932 223.313 148.808 1.00 109.67 ?  540  PHE A CZ    1 
ATOM   4221  N  N     . ILE A 1  541  ? 172.276 217.960 149.294 1.00 91.61  ?  541  ILE A N     1 
ATOM   4222  C  CA    . ILE A 1  541  ? 171.216 216.969 149.127 1.00 90.38  ?  541  ILE A CA    1 
ATOM   4223  C  C     . ILE A 1  541  ? 170.040 217.462 148.273 1.00 95.70  ?  541  ILE A C     1 
ATOM   4224  O  O     . ILE A 1  541  ? 169.520 218.560 148.499 1.00 95.38  ?  541  ILE A O     1 
ATOM   4225  C  CB    . ILE A 1  541  ? 170.766 216.418 150.508 1.00 91.12  ?  541  ILE A CB    1 
ATOM   4226  C  CG1   . ILE A 1  541  ? 171.936 215.786 151.279 1.00 89.32  ?  541  ILE A CG1   1 
ATOM   4227  C  CG2   . ILE A 1  541  ? 169.643 215.422 150.349 1.00 92.03  ?  541  ILE A CG2   1 
ATOM   4228  C  CD1   . ILE A 1  541  ? 172.098 216.344 152.629 1.00 89.29  ?  541  ILE A CD1   1 
ATOM   4229  N  N     . GLU A 1  542  ? 169.609 216.616 147.312 1.00 93.29  ?  542  GLU A N     1 
ATOM   4230  C  CA    . GLU A 1  542  ? 168.481 216.909 146.432 1.00 94.30  ?  542  GLU A CA    1 
ATOM   4231  C  C     . GLU A 1  542  ? 167.170 216.757 147.189 1.00 98.04  ?  542  GLU A C     1 
ATOM   4232  O  O     . GLU A 1  542  ? 167.136 216.034 148.192 1.00 96.82  ?  542  GLU A O     1 
ATOM   4233  C  CB    . GLU A 1  542  ? 168.527 216.037 145.172 1.00 96.42  ?  542  GLU A CB    1 
ATOM   4234  C  CG    . GLU A 1  542  ? 169.394 216.662 144.097 1.00 111.02 ?  542  GLU A CG    1 
ATOM   4235  C  CD    . GLU A 1  542  ? 169.541 215.886 142.805 1.00 149.79 ?  542  GLU A CD    1 
ATOM   4236  O  OE1   . GLU A 1  542  ? 168.608 215.941 141.971 1.00 156.42 ?  542  GLU A OE1   1 
ATOM   4237  O  OE2   . GLU A 1  542  ? 170.630 215.308 142.582 1.00 152.58 -1 542  GLU A OE2   1 
ATOM   4238  N  N     . LEU A 1  543  ? 166.105 217.467 146.736 1.00 95.00  ?  543  LEU A N     1 
ATOM   4239  C  CA    . LEU A 1  543  ? 164.770 217.482 147.353 1.00 94.23  ?  543  LEU A CA    1 
ATOM   4240  C  C     . LEU A 1  543  ? 164.236 216.131 147.807 1.00 97.60  ?  543  LEU A C     1 
ATOM   4241  O  O     . LEU A 1  543  ? 163.853 216.006 148.972 1.00 95.84  ?  543  LEU A O     1 
ATOM   4242  C  CB    . LEU A 1  543  ? 163.745 218.199 146.459 1.00 95.52  ?  543  LEU A CB    1 
ATOM   4243  C  CG    . LEU A 1  543  ? 162.268 218.139 146.886 1.00 99.15  ?  543  LEU A CG    1 
ATOM   4244  C  CD1   . LEU A 1  543  ? 162.016 218.942 148.138 1.00 98.19  ?  543  LEU A CD1   1 
ATOM   4245  C  CD2   . LEU A 1  543  ? 161.381 218.658 145.787 1.00 103.06 ?  543  LEU A CD2   1 
ATOM   4246  N  N     . ASP A 1  544  ? 164.192 215.139 146.887 1.00 95.43  ?  544  ASP A N     1 
ATOM   4247  C  CA    . ASP A 1  544  ? 163.712 213.768 147.132 1.00 94.77  ?  544  ASP A CA    1 
ATOM   4248  C  C     . ASP A 1  544  ? 164.171 213.214 148.483 1.00 95.64  ?  544  ASP A C     1 
ATOM   4249  O  O     . ASP A 1  544  ? 163.338 212.946 149.356 1.00 94.13  ?  544  ASP A O     1 
ATOM   4250  C  CB    . ASP A 1  544  ? 164.126 212.820 145.984 1.00 98.05  ?  544  ASP A CB    1 
ATOM   4251  C  CG    . ASP A 1  544  ? 165.576 212.958 145.527 1.00 115.82 ?  544  ASP A CG    1 
ATOM   4252  O  OD1   . ASP A 1  544  ? 166.483 212.514 146.273 1.00 115.32 ?  544  ASP A OD1   1 
ATOM   4253  O  OD2   . ASP A 1  544  ? 165.801 213.507 144.423 1.00 128.18 -1 544  ASP A OD2   1 
ATOM   4254  N  N     . GLN A 1  545  ? 165.508 213.117 148.653 1.00 90.81  ?  545  GLN A N     1 
ATOM   4255  C  CA    . GLN A 1  545  ? 166.214 212.604 149.819 1.00 88.54  ?  545  GLN A CA    1 
ATOM   4256  C  C     . GLN A 1  545  ? 165.985 213.518 151.024 1.00 89.36  ?  545  GLN A C     1 
ATOM   4257  O  O     . GLN A 1  545  ? 165.774 213.005 152.121 1.00 88.31  ?  545  GLN A O     1 
ATOM   4258  C  CB    . GLN A 1  545  ? 167.708 212.445 149.492 1.00 90.05  ?  545  GLN A CB    1 
ATOM   4259  C  CG    . GLN A 1  545  ? 168.496 211.464 150.378 1.00 101.89 ?  545  GLN A CG    1 
ATOM   4260  C  CD    . GLN A 1  545  ? 170.017 211.541 150.164 1.00 123.47 ?  545  GLN A CD    1 
ATOM   4261  O  OE1   . GLN A 1  545  ? 170.815 210.948 150.910 1.00 116.57 ?  545  GLN A OE1   1 
ATOM   4262  N  NE2   . GLN A 1  545  ? 170.475 212.263 149.136 1.00 116.05 ?  545  GLN A NE2   1 
ATOM   4263  N  N     . VAL A 1  546  ? 165.965 214.857 150.825 1.00 83.80  ?  546  VAL A N     1 
ATOM   4264  C  CA    . VAL A 1  546  ? 165.714 215.795 151.930 1.00 81.82  ?  546  VAL A CA    1 
ATOM   4265  C  C     . VAL A 1  546  ? 164.383 215.461 152.607 1.00 85.35  ?  546  VAL A C     1 
ATOM   4266  O  O     . VAL A 1  546  ? 164.321 215.402 153.836 1.00 83.53  ?  546  VAL A O     1 
ATOM   4267  C  CB    . VAL A 1  546  ? 165.806 217.283 151.510 1.00 85.30  ?  546  VAL A CB    1 
ATOM   4268  C  CG1   . VAL A 1  546  ? 165.157 218.208 152.545 1.00 84.07  ?  546  VAL A CG1   1 
ATOM   4269  C  CG2   . VAL A 1  546  ? 167.250 217.683 151.266 1.00 85.35  ?  546  VAL A CG2   1 
ATOM   4270  N  N     . LEU A 1  547  ? 163.345 215.175 151.799 1.00 82.74  ?  547  LEU A N     1 
ATOM   4271  C  CA    . LEU A 1  547  ? 162.025 214.852 152.330 1.00 81.67  ?  547  LEU A CA    1 
ATOM   4272  C  C     . LEU A 1  547  ? 162.035 213.598 153.213 1.00 85.14  ?  547  LEU A C     1 
ATOM   4273  O  O     . LEU A 1  547  ? 161.500 213.649 154.328 1.00 83.39  ?  547  LEU A O     1 
ATOM   4274  C  CB    . LEU A 1  547  ? 160.923 214.873 151.248 1.00 82.20  ?  547  LEU A CB    1 
ATOM   4275  C  CG    . LEU A 1  547  ? 160.768 216.198 150.421 1.00 87.71  ?  547  LEU A CG    1 
ATOM   4276  C  CD1   . LEU A 1  547  ? 159.480 216.198 149.622 1.00 89.10  ?  547  LEU A CD1   1 
ATOM   4277  C  CD2   . LEU A 1  547  ? 160.801 217.470 151.292 1.00 87.33  ?  547  LEU A CD2   1 
ATOM   4278  N  N     . ASN A 1  548  ? 162.764 212.525 152.776 1.00 82.13  ?  548  ASN A N     1 
ATOM   4279  C  CA    . ASN A 1  548  ? 162.916 211.260 153.525 1.00 80.06  ?  548  ASN A CA    1 
ATOM   4280  C  C     . ASN A 1  548  ? 163.716 211.511 154.788 1.00 83.58  ?  548  ASN A C     1 
ATOM   4281  O  O     . ASN A 1  548  ? 163.267 211.131 155.871 1.00 84.34  ?  548  ASN A O     1 
ATOM   4282  C  CB    . ASN A 1  548  ? 163.555 210.154 152.683 1.00 75.51  ?  548  ASN A CB    1 
ATOM   4283  C  CG    . ASN A 1  548  ? 162.745 209.753 151.479 1.00 103.16 ?  548  ASN A CG    1 
ATOM   4284  O  OD1   . ASN A 1  548  ? 161.570 209.348 151.578 1.00 98.27  ?  548  ASN A OD1   1 
ATOM   4285  N  ND2   . ASN A 1  548  ? 163.365 209.850 150.309 1.00 97.78  ?  548  ASN A ND2   1 
ATOM   4286  N  N     . MET A 1  549  ? 164.841 212.241 154.664 1.00 77.79  ?  549  MET A N     1 
ATOM   4287  C  CA    . MET A 1  549  ? 165.687 212.622 155.786 1.00 75.74  ?  549  MET A CA    1 
ATOM   4288  C  C     . MET A 1  549  ? 164.897 213.407 156.836 1.00 80.79  ?  549  MET A C     1 
ATOM   4289  O  O     . MET A 1  549  ? 165.097 213.189 158.032 1.00 79.91  ?  549  MET A O     1 
ATOM   4290  C  CB    . MET A 1  549  ? 166.869 213.438 155.292 1.00 78.13  ?  549  MET A CB    1 
ATOM   4291  C  CG    . MET A 1  549  ? 167.778 212.647 154.432 1.00 81.39  ?  549  MET A CG    1 
ATOM   4292  S  SD    . MET A 1  549  ? 169.477 213.092 154.725 1.00 85.15  ?  549  MET A SD    1 
ATOM   4293  C  CE    . MET A 1  549  ? 169.771 213.843 153.341 1.00 83.39  ?  549  MET A CE    1 
ATOM   4294  N  N     . LEU A 1  550  ? 163.962 214.276 156.384 1.00 78.26  ?  550  LEU A N     1 
ATOM   4295  C  CA    . LEU A 1  550  ? 163.126 215.073 157.274 1.00 77.71  ?  550  LEU A CA    1 
ATOM   4296  C  C     . LEU A 1  550  ? 162.098 214.209 157.974 1.00 81.03  ?  550  LEU A C     1 
ATOM   4297  O  O     . LEU A 1  550  ? 162.009 214.239 159.202 1.00 78.96  ?  550  LEU A O     1 
ATOM   4298  C  CB    . LEU A 1  550  ? 162.424 216.208 156.512 1.00 78.77  ?  550  LEU A CB    1 
ATOM   4299  C  CG    . LEU A 1  550  ? 163.230 217.451 156.190 1.00 83.96  ?  550  LEU A CG    1 
ATOM   4300  C  CD1   . LEU A 1  550  ? 162.442 218.374 155.300 1.00 85.35  ?  550  LEU A CD1   1 
ATOM   4301  C  CD2   . LEU A 1  550  ? 163.647 218.184 157.442 1.00 85.58  ?  550  LEU A CD2   1 
ATOM   4302  N  N     . TYR A 1  551  ? 161.330 213.434 157.192 1.00 79.25  ?  551  TYR A N     1 
ATOM   4303  C  CA    . TYR A 1  551  ? 160.287 212.570 157.714 1.00 79.67  ?  551  TYR A CA    1 
ATOM   4304  C  C     . TYR A 1  551  ? 160.829 211.620 158.748 1.00 83.39  ?  551  TYR A C     1 
ATOM   4305  O  O     . TYR A 1  551  ? 160.119 211.340 159.715 1.00 82.18  ?  551  TYR A O     1 
ATOM   4306  C  CB    . TYR A 1  551  ? 159.586 211.798 156.586 1.00 82.82  ?  551  TYR A CB    1 
ATOM   4307  C  CG    . TYR A 1  551  ? 158.378 211.004 157.047 1.00 85.50  ?  551  TYR A CG    1 
ATOM   4308  C  CD1   . TYR A 1  551  ? 157.434 211.567 157.903 1.00 87.68  ?  551  TYR A CD1   1 
ATOM   4309  C  CD2   . TYR A 1  551  ? 158.161 209.701 156.602 1.00 85.97  ?  551  TYR A CD2   1 
ATOM   4310  C  CE1   . TYR A 1  551  ? 156.342 210.832 158.361 1.00 88.28  ?  551  TYR A CE1   1 
ATOM   4311  C  CE2   . TYR A 1  551  ? 157.051 208.967 157.029 1.00 86.15  ?  551  TYR A CE2   1 
ATOM   4312  C  CZ    . TYR A 1  551  ? 156.148 209.537 157.914 1.00 92.08  ?  551  TYR A CZ    1 
ATOM   4313  O  OH    . TYR A 1  551  ? 155.070 208.838 158.391 1.00 90.36  ?  551  TYR A OH    1 
ATOM   4314  N  N     . TRP A 1  552  ? 162.105 211.179 158.576 1.00 80.97  ?  552  TRP A N     1 
ATOM   4315  C  CA    . TRP A 1  552  ? 162.820 210.265 159.469 1.00 80.94  ?  552  TRP A CA    1 
ATOM   4316  C  C     . TRP A 1  552  ? 162.970 210.751 160.906 1.00 86.38  ?  552  TRP A C     1 
ATOM   4317  O  O     . TRP A 1  552  ? 163.004 209.920 161.827 1.00 84.06  ?  552  TRP A O     1 
ATOM   4318  C  CB    . TRP A 1  552  ? 164.160 209.846 158.886 1.00 80.33  ?  552  TRP A CB    1 
ATOM   4319  C  CG    . TRP A 1  552  ? 164.116 208.472 158.277 1.00 81.74  ?  552  TRP A CG    1 
ATOM   4320  C  CD1   . TRP A 1  552  ? 164.026 208.163 156.951 1.00 85.62  ?  552  TRP A CD1   1 
ATOM   4321  C  CD2   . TRP A 1  552  ? 164.120 207.225 158.979 1.00 80.65  ?  552  TRP A CD2   1 
ATOM   4322  N  NE1   . TRP A 1  552  ? 163.975 206.801 156.785 1.00 84.70  ?  552  TRP A NE1   1 
ATOM   4323  C  CE2   . TRP A 1  552  ? 164.047 206.199 158.013 1.00 85.04  ?  552  TRP A CE2   1 
ATOM   4324  C  CE3   . TRP A 1  552  ? 164.184 206.873 160.333 1.00 80.89  ?  552  TRP A CE3   1 
ATOM   4325  C  CZ2   . TRP A 1  552  ? 164.026 204.845 158.359 1.00 83.93  ?  552  TRP A CZ2   1 
ATOM   4326  C  CZ3   . TRP A 1  552  ? 164.177 205.535 160.673 1.00 81.81  ?  552  TRP A CZ3   1 
ATOM   4327  C  CH2   . TRP A 1  552  ? 164.093 204.536 159.694 1.00 82.88  ?  552  TRP A CH2   1 
ATOM   4328  N  N     . VAL A 1  553  ? 163.029 212.102 161.093 1.00 85.67  ?  553  VAL A N     1 
ATOM   4329  C  CA    . VAL A 1  553  ? 163.067 212.779 162.396 1.00 85.12  ?  553  VAL A CA    1 
ATOM   4330  C  C     . VAL A 1  553  ? 161.639 212.680 162.984 1.00 91.44  ?  553  VAL A C     1 
ATOM   4331  O  O     . VAL A 1  553  ? 160.672 213.249 162.434 1.00 91.20  ?  553  VAL A O     1 
ATOM   4332  C  CB    . VAL A 1  553  ? 163.580 214.238 162.333 1.00 88.85  ?  553  VAL A CB    1 
ATOM   4333  C  CG1   . VAL A 1  553  ? 163.393 214.940 163.672 1.00 88.26  ?  553  VAL A CG1   1 
ATOM   4334  C  CG2   . VAL A 1  553  ? 165.038 214.302 161.894 1.00 88.45  ?  553  VAL A CG2   1 
ATOM   4335  N  N     . PRO A 1  554  ? 161.521 211.904 164.087 1.00 88.99  ?  554  PRO A N     1 
ATOM   4336  C  CA    . PRO A 1  554  ? 160.195 211.656 164.695 1.00 88.87  ?  554  PRO A CA    1 
ATOM   4337  C  C     . PRO A 1  554  ? 159.459 212.833 165.328 1.00 94.63  ?  554  PRO A C     1 
ATOM   4338  O  O     . PRO A 1  554  ? 158.286 212.697 165.669 1.00 94.13  ?  554  PRO A O     1 
ATOM   4339  C  CB    . PRO A 1  554  ? 160.464 210.549 165.716 1.00 89.38  ?  554  PRO A CB    1 
ATOM   4340  C  CG    . PRO A 1  554  ? 161.907 210.532 165.925 1.00 93.67  ?  554  PRO A CG    1 
ATOM   4341  C  CD    . PRO A 1  554  ? 162.591 211.154 164.771 1.00 89.91  ?  554  PRO A CD    1 
ATOM   4342  N  N     . ASP A 1  555  ? 160.131 213.964 165.504 1.00 93.48  ?  555  ASP A N     1 
ATOM   4343  C  CA    . ASP A 1  555  ? 159.506 215.123 166.124 1.00 94.80  ?  555  ASP A CA    1 
ATOM   4344  C  C     . ASP A 1  555  ? 159.519 216.316 165.184 1.00 99.21  ?  555  ASP A C     1 
ATOM   4345  O  O     . ASP A 1  555  ? 159.246 217.443 165.621 1.00 100.84 ?  555  ASP A O     1 
ATOM   4346  C  CB    . ASP A 1  555  ? 160.211 215.472 167.452 1.00 97.35  ?  555  ASP A CB    1 
ATOM   4347  C  CG    . ASP A 1  555  ? 160.422 214.295 168.382 1.00 114.41 ?  555  ASP A CG    1 
ATOM   4348  O  OD1   . ASP A 1  555  ? 159.422 213.834 169.004 1.00 115.68 ?  555  ASP A OD1   1 
ATOM   4349  O  OD2   . ASP A 1  555  ? 161.576 213.826 168.484 1.00 120.83 -1 555  ASP A OD2   1 
ATOM   4350  N  N     . TRP A 1  556  ? 159.839 216.079 163.897 1.00 93.37  ?  556  TRP A N     1 
ATOM   4351  C  CA    . TRP A 1  556  ? 159.924 217.123 162.881 1.00 92.76  ?  556  TRP A CA    1 
ATOM   4352  C  C     . TRP A 1  556  ? 158.649 217.964 162.778 1.00 97.52  ?  556  TRP A C     1 
ATOM   4353  O  O     . TRP A 1  556  ? 157.558 217.417 162.596 1.00 97.37  ?  556  TRP A O     1 
ATOM   4354  C  CB    . TRP A 1  556  ? 160.314 216.518 161.539 1.00 91.04  ?  556  TRP A CB    1 
ATOM   4355  C  CG    . TRP A 1  556  ? 160.268 217.487 160.406 1.00 92.71  ?  556  TRP A CG    1 
ATOM   4356  C  CD1   . TRP A 1  556  ? 160.965 218.650 160.292 1.00 96.30  ?  556  TRP A CD1   1 
ATOM   4357  C  CD2   . TRP A 1  556  ? 159.505 217.357 159.210 1.00 93.15  ?  556  TRP A CD2   1 
ATOM   4358  N  NE1   . TRP A 1  556  ? 160.676 219.259 159.098 1.00 96.98  ?  556  TRP A NE1   1 
ATOM   4359  C  CE2   . TRP A 1  556  ? 159.797 218.475 158.404 1.00 98.58  ?  556  TRP A CE2   1 
ATOM   4360  C  CE3   . TRP A 1  556  ? 158.621 216.386 158.724 1.00 94.24  ?  556  TRP A CE3   1 
ATOM   4361  C  CZ2   . TRP A 1  556  ? 159.235 218.648 157.139 1.00 99.32  ?  556  TRP A CZ2   1 
ATOM   4362  C  CZ3   . TRP A 1  556  ? 158.048 216.568 157.483 1.00 96.90  ?  556  TRP A CZ3   1 
ATOM   4363  C  CH2   . TRP A 1  556  ? 158.338 217.698 156.714 1.00 98.99  ?  556  TRP A CH2   1 
ATOM   4364  N  N     . ASP A 1  557  ? 158.803 219.298 162.915 1.00 94.63  ?  557  ASP A N     1 
ATOM   4365  C  CA    . ASP A 1  557  ? 157.729 220.301 162.875 1.00 95.12  ?  557  ASP A CA    1 
ATOM   4366  C  C     . ASP A 1  557  ? 156.793 220.268 161.647 1.00 99.70  ?  557  ASP A C     1 
ATOM   4367  O  O     . ASP A 1  557  ? 155.696 220.824 161.717 1.00 100.10 ?  557  ASP A O     1 
ATOM   4368  C  CB    . ASP A 1  557  ? 158.295 221.716 163.102 1.00 97.93  ?  557  ASP A CB    1 
ATOM   4369  C  CG    . ASP A 1  557  ? 159.458 222.155 162.213 1.00 113.42 ?  557  ASP A CG    1 
ATOM   4370  O  OD1   . ASP A 1  557  ? 159.893 221.356 161.353 1.00 114.94 ?  557  ASP A OD1   1 
ATOM   4371  O  OD2   . ASP A 1  557  ? 159.918 223.308 162.365 1.00 120.60 -1 557  ASP A OD2   1 
ATOM   4372  N  N     . GLY A 1  558  ? 157.217 219.606 160.563 1.00 95.60  ?  558  GLY A N     1 
ATOM   4373  C  CA    . GLY A 1  558  ? 156.459 219.498 159.319 1.00 95.37  ?  558  GLY A CA    1 
ATOM   4374  C  C     . GLY A 1  558  ? 156.845 220.587 158.341 1.00 98.37  ?  558  GLY A C     1 
ATOM   4375  O  O     . GLY A 1  558  ? 156.354 220.619 157.208 1.00 97.73  ?  558  GLY A O     1 
ATOM   4376  N  N     . VAL A 1  559  ? 157.780 221.454 158.784 1.00 95.09  ?  559  VAL A N     1 
ATOM   4377  C  CA    . VAL A 1  559  ? 158.331 222.610 158.072 1.00 96.60  ?  559  VAL A CA    1 
ATOM   4378  C  C     . VAL A 1  559  ? 159.538 222.233 157.223 1.00 101.14 ?  559  VAL A C     1 
ATOM   4379  O  O     . VAL A 1  559  ? 160.589 221.879 157.777 1.00 100.41 ?  559  VAL A O     1 
ATOM   4380  C  CB    . VAL A 1  559  ? 158.719 223.726 159.074 1.00 100.66 ?  559  VAL A CB    1 
ATOM   4381  C  CG1   . VAL A 1  559  ? 159.411 224.899 158.376 1.00 101.50 ?  559  VAL A CG1   1 
ATOM   4382  C  CG2   . VAL A 1  559  ? 157.509 224.193 159.870 1.00 100.65 ?  559  VAL A CG2   1 
ATOM   4383  N  N     . ILE A 1  560  ? 159.410 222.376 155.890 1.00 97.81  ?  560  ILE A N     1 
ATOM   4384  C  CA    . ILE A 1  560  ? 160.511 222.109 154.966 1.00 97.57  ?  560  ILE A CA    1 
ATOM   4385  C  C     . ILE A 1  560  ? 161.422 223.343 155.005 1.00 102.21 ?  560  ILE A C     1 
ATOM   4386  O  O     . ILE A 1  560  ? 160.976 224.433 154.627 1.00 102.98 ?  560  ILE A O     1 
ATOM   4387  C  CB    . ILE A 1  560  ? 160.039 221.778 153.528 1.00 101.55 ?  560  ILE A CB    1 
ATOM   4388  C  CG1   . ILE A 1  560  ? 158.977 220.657 153.508 1.00 101.96 ?  560  ILE A CG1   1 
ATOM   4389  C  CG2   . ILE A 1  560  ? 161.227 221.425 152.641 1.00 101.91 ?  560  ILE A CG2   1 
ATOM   4390  C  CD1   . ILE A 1  560  ? 157.769 220.906 152.496 1.00 113.47 ?  560  ILE A CD1   1 
ATOM   4391  N  N     . PRO A 1  561  ? 162.677 223.214 155.502 1.00 98.08  ?  561  PRO A N     1 
ATOM   4392  C  CA    . PRO A 1  561  ? 163.558 224.385 155.558 1.00 98.39  ?  561  PRO A CA    1 
ATOM   4393  C  C     . PRO A 1  561  ? 163.898 224.913 154.177 1.00 103.71 ?  561  PRO A C     1 
ATOM   4394  O  O     . PRO A 1  561  ? 164.001 224.127 153.232 1.00 103.01 ?  561  PRO A O     1 
ATOM   4395  C  CB    . PRO A 1  561  ? 164.800 223.859 156.283 1.00 98.97  ?  561  PRO A CB    1 
ATOM   4396  C  CG    . PRO A 1  561  ? 164.799 222.412 156.061 1.00 102.42 ?  561  PRO A CG    1 
ATOM   4397  C  CD    . PRO A 1  561  ? 163.361 222.011 156.017 1.00 98.20  ?  561  PRO A CD    1 
ATOM   4398  N  N     . THR A 1  562  ? 164.031 226.245 154.057 1.00 102.02 ?  562  THR A N     1 
ATOM   4399  C  CA    . THR A 1  562  ? 164.375 226.886 152.790 1.00 103.18 ?  562  THR A CA    1 
ATOM   4400  C  C     . THR A 1  562  ? 165.760 226.411 152.353 1.00 105.12 ?  562  THR A C     1 
ATOM   4401  O  O     . THR A 1  562  ? 166.688 226.495 153.161 1.00 103.34 ?  562  THR A O     1 
ATOM   4402  C  CB    . THR A 1  562  ? 164.244 228.409 152.884 1.00 111.92 ?  562  THR A CB    1 
ATOM   4403  O  OG1   . THR A 1  562  ? 162.871 228.717 153.107 1.00 113.24 ?  562  THR A OG1   1 
ATOM   4404  C  CG2   . THR A 1  562  ? 164.709 229.114 151.619 1.00 110.86 ?  562  THR A CG2   1 
ATOM   4405  N  N     . PRO A 1  563  ? 165.886 225.856 151.115 1.00 101.50 ?  563  PRO A N     1 
ATOM   4406  C  CA    . PRO A 1  563  ? 167.189 225.368 150.644 1.00 101.16 ?  563  PRO A CA    1 
ATOM   4407  C  C     . PRO A 1  563  ? 168.253 226.445 150.671 1.00 105.60 ?  563  PRO A C     1 
ATOM   4408  O  O     . PRO A 1  563  ? 167.957 227.618 150.404 1.00 105.79 ?  563  PRO A O     1 
ATOM   4409  C  CB    . PRO A 1  563  ? 166.903 224.922 149.201 1.00 103.71 ?  563  PRO A CB    1 
ATOM   4410  C  CG    . PRO A 1  563  ? 165.667 225.633 148.809 1.00 108.94 ?  563  PRO A CG    1 
ATOM   4411  C  CD    . PRO A 1  563  ? 164.861 225.679 150.068 1.00 103.54 ?  563  PRO A CD    1 
ATOM   4412  N  N     . ALA A 1  564  ? 169.490 226.043 151.017 1.00 101.80 ?  564  ALA A N     1 
ATOM   4413  C  CA    . ALA A 1  564  ? 170.626 226.949 151.053 1.00 102.39 ?  564  ALA A CA    1 
ATOM   4414  C  C     . ALA A 1  564  ? 170.858 227.430 149.643 1.00 108.55 ?  564  ALA A C     1 
ATOM   4415  O  O     . ALA A 1  564  ? 171.258 228.569 149.472 1.00 110.48 ?  564  ALA A O     1 
ATOM   4416  C  CB    . ALA A 1  564  ? 171.858 226.246 151.584 1.00 102.28 ?  564  ALA A CB    1 
ATOM   4417  N  N     . ILE A 1  565  ? 170.542 226.600 148.633 1.00 104.94 ?  565  ILE A N     1 
ATOM   4418  C  CA    . ILE A 1  565  ? 170.640 227.002 147.236 1.00 106.75 ?  565  ILE A CA    1 
ATOM   4419  C  C     . ILE A 1  565  ? 169.259 226.940 146.568 1.00 115.21 ?  565  ILE A C     1 
ATOM   4420  O  O     . ILE A 1  565  ? 168.693 225.855 146.427 1.00 114.86 ?  565  ILE A O     1 
ATOM   4421  C  CB    . ILE A 1  565  ? 171.748 226.244 146.468 1.00 109.08 ?  565  ILE A CB    1 
ATOM   4422  C  CG1   . ILE A 1  565  ? 173.126 226.607 147.046 1.00 108.33 ?  565  ILE A CG1   1 
ATOM   4423  C  CG2   . ILE A 1  565  ? 171.685 226.559 144.960 1.00 111.15 ?  565  ILE A CG2   1 
ATOM   4424  C  CD1   . ILE A 1  565  ? 174.049 225.520 147.109 1.00 109.66 ?  565  ILE A CD1   1 
ATOM   4425  N  N     . ILE A 1  566  ? 168.709 228.109 146.195 1.00 114.68 ?  566  ILE A N     1 
ATOM   4426  C  CA    . ILE A 1  566  ? 167.413 228.205 145.517 1.00 116.13 ?  566  ILE A CA    1 
ATOM   4427  C  C     . ILE A 1  566  ? 167.739 228.643 144.115 1.00 125.11 ?  566  ILE A C     1 
ATOM   4428  O  O     . ILE A 1  566  ? 167.973 229.833 143.909 1.00 127.20 ?  566  ILE A O     1 
ATOM   4429  C  CB    . ILE A 1  566  ? 166.451 229.242 146.161 1.00 119.10 ?  566  ILE A CB    1 
ATOM   4430  C  CG1   . ILE A 1  566  ? 166.617 229.395 147.674 1.00 117.81 ?  566  ILE A CG1   1 
ATOM   4431  C  CG2   . ILE A 1  566  ? 165.001 229.032 145.723 1.00 120.05 ?  566  ILE A CG2   1 
ATOM   4432  C  CD1   . ILE A 1  566  ? 167.114 230.745 148.012 1.00 123.62 ?  566  ILE A CD1   1 
ATOM   4433  N  N     . LYS A 1  567  ? 167.781 227.713 143.155 1.00 122.66 ?  567  LYS A N     1 
ATOM   4434  C  CA    . LYS A 1  567  ? 168.110 228.030 141.752 1.00 124.41 ?  567  LYS A CA    1 
ATOM   4435  C  C     . LYS A 1  567  ? 169.584 228.489 141.459 1.00 126.72 ?  567  LYS A C     1 
ATOM   4436  O  O     . LYS A 1  567  ? 170.136 229.325 142.182 1.00 125.74 ?  567  LYS A O     1 
ATOM   4437  C  CB    . LYS A 1  567  ? 167.012 228.856 141.036 1.00 129.24 ?  567  LYS A CB    1 
ATOM   4438  C  CG    . LYS A 1  567  ? 165.721 228.043 140.849 1.00 148.06 ?  567  LYS A CG    1 
ATOM   4439  C  CD    . LYS A 1  567  ? 164.634 228.768 140.061 1.00 158.15 ?  567  LYS A CD    1 
ATOM   4440  C  CE    . LYS A 1  567  ? 163.485 227.835 139.741 1.00 161.88 ?  567  LYS A CE    1 
ATOM   4441  N  NZ    . LYS A 1  567  ? 162.374 228.524 139.032 1.00 168.27 1  567  LYS A NZ    1 
ATOM   4442  N  N     . PRO A 1  568  ? 170.259 227.904 140.434 1.00 122.42 ?  568  PRO A N     1 
ATOM   4443  C  CA    . PRO A 1  568  ? 169.768 226.846 139.522 1.00 122.25 ?  568  PRO A CA    1 
ATOM   4444  C  C     . PRO A 1  568  ? 169.605 225.555 140.330 1.00 125.58 ?  568  PRO A C     1 
ATOM   4445  O  O     . PRO A 1  568  ? 170.557 225.198 141.016 1.00 126.99 ?  568  PRO A O     1 
ATOM   4446  C  CB    . PRO A 1  568  ? 170.876 226.776 138.461 1.00 124.95 ?  568  PRO A CB    1 
ATOM   4447  C  CG    . PRO A 1  568  ? 172.134 227.219 139.178 1.00 128.46 ?  568  PRO A CG    1 
ATOM   4448  C  CD    . PRO A 1  568  ? 171.674 228.252 140.170 1.00 123.81 ?  568  PRO A CD    1 
ATOM   4449  N  N     . LYS A 1  569  ? 168.401 224.934 140.385 1.00 119.04 ?  569  LYS A N     1 
ATOM   4450  C  CA    . LYS A 1  569  ? 168.181 223.711 141.202 1.00 116.31 ?  569  LYS A CA    1 
ATOM   4451  C  C     . LYS A 1  569  ? 168.197 223.879 142.771 1.00 117.61 ?  569  LYS A C     1 
ATOM   4452  O  O     . LYS A 1  569  ? 169.254 224.124 143.367 1.00 115.35 ?  569  LYS A O     1 
ATOM   4453  C  CB    . LYS A 1  569  ? 169.048 222.505 140.711 1.00 117.55 ?  569  LYS A CB    1 
ATOM   4454  C  CG    . LYS A 1  569  ? 169.143 221.295 141.652 1.00 112.86 ?  569  LYS A CG    1 
ATOM   4455  C  CD    . LYS A 1  569  ? 170.004 220.177 141.074 1.00 113.94 ?  569  LYS A CD    1 
ATOM   4456  C  CE    . LYS A 1  569  ? 169.170 218.986 140.673 1.00 119.04 ?  569  LYS A CE    1 
ATOM   4457  N  NZ    . LYS A 1  569  ? 169.999 217.806 140.303 1.00 124.77 1  569  LYS A NZ    1 
ATOM   4458  N  N     . PRO A 1  570  ? 167.039 223.662 143.450 1.00 114.13 ?  570  PRO A N     1 
ATOM   4459  C  CA    . PRO A 1  570  ? 167.028 223.741 144.916 1.00 112.44 ?  570  PRO A CA    1 
ATOM   4460  C  C     . PRO A 1  570  ? 167.842 222.613 145.532 1.00 115.03 ?  570  PRO A C     1 
ATOM   4461  O  O     . PRO A 1  570  ? 167.628 221.427 145.232 1.00 114.27 ?  570  PRO A O     1 
ATOM   4462  C  CB    . PRO A 1  570  ? 165.544 223.649 145.274 1.00 113.67 ?  570  PRO A CB    1 
ATOM   4463  C  CG    . PRO A 1  570  ? 164.936 222.907 144.150 1.00 118.87 ?  570  PRO A CG    1 
ATOM   4464  C  CD    . PRO A 1  570  ? 165.698 223.322 142.927 1.00 116.13 ?  570  PRO A CD    1 
ATOM   4465  N  N     . LEU A 1  571  ? 168.804 223.011 146.374 1.00 110.28 ?  571  LEU A N     1 
ATOM   4466  C  CA    . LEU A 1  571  ? 169.733 222.124 147.056 1.00 108.13 ?  571  LEU A CA    1 
ATOM   4467  C  C     . LEU A 1  571  ? 169.912 222.518 148.528 1.00 110.10 ?  571  LEU A C     1 
ATOM   4468  O  O     . LEU A 1  571  ? 170.023 223.706 148.851 1.00 110.58 ?  571  LEU A O     1 
ATOM   4469  C  CB    . LEU A 1  571  ? 171.076 222.205 146.319 1.00 108.70 ?  571  LEU A CB    1 
ATOM   4470  C  CG    . LEU A 1  571  ? 171.655 220.928 145.733 1.00 112.60 ?  571  LEU A CG    1 
ATOM   4471  C  CD1   . LEU A 1  571  ? 170.632 220.145 144.931 1.00 112.63 ?  571  LEU A CD1   1 
ATOM   4472  C  CD2   . LEU A 1  571  ? 172.836 221.254 144.854 1.00 116.12 ?  571  LEU A CD2   1 
ATOM   4473  N  N     . TRP A 1  572  ? 169.938 221.509 149.413 1.00 103.53 ?  572  TRP A N     1 
ATOM   4474  C  CA    . TRP A 1  572  ? 170.138 221.668 150.850 1.00 101.27 ?  572  TRP A CA    1 
ATOM   4475  C  C     . TRP A 1  572  ? 171.507 221.138 151.200 1.00 102.93 ?  572  TRP A C     1 
ATOM   4476  O  O     . TRP A 1  572  ? 171.990 220.232 150.526 1.00 102.12 ?  572  TRP A O     1 
ATOM   4477  C  CB    . TRP A 1  572  ? 169.107 220.845 151.617 1.00 98.80  ?  572  TRP A CB    1 
ATOM   4478  C  CG    . TRP A 1  572  ? 167.718 221.385 151.537 1.00 100.33 ?  572  TRP A CG    1 
ATOM   4479  C  CD1   . TRP A 1  572  ? 167.049 222.061 152.512 1.00 102.93 ?  572  TRP A CD1   1 
ATOM   4480  C  CD2   . TRP A 1  572  ? 166.822 221.296 150.420 1.00 101.08 ?  572  TRP A CD2   1 
ATOM   4481  N  NE1   . TRP A 1  572  ? 165.790 222.406 152.071 1.00 103.06 ?  572  TRP A NE1   1 
ATOM   4482  C  CE2   . TRP A 1  572  ? 165.621 221.941 150.793 1.00 105.07 ?  572  TRP A CE2   1 
ATOM   4483  C  CE3   . TRP A 1  572  ? 166.912 220.720 149.142 1.00 103.23 ?  572  TRP A CE3   1 
ATOM   4484  C  CZ2   . TRP A 1  572  ? 164.519 222.029 149.935 1.00 105.11 ?  572  TRP A CZ2   1 
ATOM   4485  C  CZ3   . TRP A 1  572  ? 165.820 220.815 148.290 1.00 105.68 ?  572  TRP A CZ3   1 
ATOM   4486  C  CH2   . TRP A 1  572  ? 164.639 221.457 148.689 1.00 106.26 ?  572  TRP A CH2   1 
ATOM   4487  N  N     . SER A 1  573  ? 172.128 221.661 152.260 1.00 98.58  ?  573  SER A N     1 
ATOM   4488  C  CA    . SER A 1  573  ? 173.426 221.141 152.696 1.00 97.75  ?  573  SER A CA    1 
ATOM   4489  C  C     . SER A 1  573  ? 173.233 220.139 153.851 1.00 100.09 ?  573  SER A C     1 
ATOM   4490  O  O     . SER A 1  573  ? 172.137 220.068 154.434 1.00 100.01 ?  573  SER A O     1 
ATOM   4491  C  CB    . SER A 1  573  ? 174.358 222.275 153.108 1.00 101.35 ?  573  SER A CB    1 
ATOM   4492  O  OG    . SER A 1  573  ? 173.874 222.933 154.266 1.00 109.66 ?  573  SER A OG    1 
ATOM   4493  N  N     . GLY A 1  574  ? 174.284 219.365 154.151 1.00 93.89  ?  574  GLY A N     1 
ATOM   4494  C  CA    . GLY A 1  574  ? 174.259 218.392 155.235 1.00 90.80  ?  574  GLY A CA    1 
ATOM   4495  C  C     . GLY A 1  574  ? 173.964 219.103 156.529 1.00 91.28  ?  574  GLY A C     1 
ATOM   4496  O  O     . GLY A 1  574  ? 172.939 218.831 157.168 1.00 89.00  ?  574  GLY A O     1 
ATOM   4497  N  N     . LYS A 1  575  ? 174.816 220.125 156.825 1.00 87.71  ?  575  LYS A N     1 
ATOM   4498  C  CA    . LYS A 1  575  ? 174.743 221.053 157.968 1.00 86.79  ?  575  LYS A CA    1 
ATOM   4499  C  C     . LYS A 1  575  ? 173.300 221.458 158.215 1.00 90.47  ?  575  LYS A C     1 
ATOM   4500  O  O     . LYS A 1  575  ? 172.778 221.257 159.314 1.00 90.76  ?  575  LYS A O     1 
ATOM   4501  C  CB    . LYS A 1  575  ? 175.579 222.329 157.711 1.00 89.37  ?  575  LYS A CB    1 
ATOM   4502  C  CG    . LYS A 1  575  ? 177.061 222.073 157.548 1.00 91.97  ?  575  LYS A CG    1 
ATOM   4503  C  CD    . LYS A 1  575  ? 177.875 223.253 157.990 1.00 92.31  ?  575  LYS A CD    1 
ATOM   4504  C  CE    . LYS A 1  575  ? 179.339 222.987 157.814 1.00 101.76 ?  575  LYS A CE    1 
ATOM   4505  N  NZ    . LYS A 1  575  ? 179.694 222.785 156.388 1.00 116.93 1  575  LYS A NZ    1 
ATOM   4506  N  N     . GLN A 1  576  ? 172.641 221.954 157.159 1.00 85.27  ?  576  GLN A N     1 
ATOM   4507  C  CA    . GLN A 1  576  ? 171.252 222.367 157.159 1.00 83.59  ?  576  GLN A CA    1 
ATOM   4508  C  C     . GLN A 1  576  ? 170.314 221.260 157.657 1.00 83.83  ?  576  GLN A C     1 
ATOM   4509  O  O     . GLN A 1  576  ? 169.638 221.434 158.682 1.00 81.12  ?  576  GLN A O     1 
ATOM   4510  C  CB    . GLN A 1  576  ? 170.868 222.790 155.746 1.00 85.38  ?  576  GLN A CB    1 
ATOM   4511  C  CG    . GLN A 1  576  ? 169.842 223.884 155.694 1.00 82.61  ?  576  GLN A CG    1 
ATOM   4512  C  CD    . GLN A 1  576  ? 169.642 224.352 154.279 1.00 97.74  ?  576  GLN A CD    1 
ATOM   4513  O  OE1   . GLN A 1  576  ? 170.373 223.984 153.342 1.00 86.75  ?  576  GLN A OE1   1 
ATOM   4514  N  NE2   . GLN A 1  576  ? 168.634 225.184 154.097 1.00 96.46  ?  576  GLN A NE2   1 
ATOM   4515  N  N     . ILE A 1  577  ? 170.298 220.116 156.958 1.00 80.40  ?  577  ILE A N     1 
ATOM   4516  C  CA    . ILE A 1  577  ? 169.358 219.063 157.333 1.00 79.88  ?  577  ILE A CA    1 
ATOM   4517  C  C     . ILE A 1  577  ? 169.717 218.286 158.608 1.00 80.33  ?  577  ILE A C     1 
ATOM   4518  O  O     . ILE A 1  577  ? 168.855 217.585 159.153 1.00 78.58  ?  577  ILE A O     1 
ATOM   4519  C  CB    . ILE A 1  577  ? 168.761 218.218 156.160 1.00 84.06  ?  577  ILE A CB    1 
ATOM   4520  C  CG1   . ILE A 1  577  ? 169.779 217.249 155.568 1.00 85.43  ?  577  ILE A CG1   1 
ATOM   4521  C  CG2   . ILE A 1  577  ? 168.113 219.095 155.073 1.00 85.78  ?  577  ILE A CG2   1 
ATOM   4522  C  CD1   . ILE A 1  577  ? 169.863 215.962 156.327 1.00 97.63  ?  577  ILE A CD1   1 
ATOM   4523  N  N     . LEU A 1  578  ? 170.961 218.428 159.098 1.00 75.02  ?  578  LEU A N     1 
ATOM   4524  C  CA    . LEU A 1  578  ? 171.326 217.800 160.366 1.00 72.73  ?  578  LEU A CA    1 
ATOM   4525  C  C     . LEU A 1  578  ? 170.727 218.667 161.497 1.00 77.42  ?  578  LEU A C     1 
ATOM   4526  O  O     . LEU A 1  578  ? 170.204 218.142 162.486 1.00 75.10  ?  578  LEU A O     1 
ATOM   4527  C  CB    . LEU A 1  578  ? 172.854 217.689 160.512 1.00 71.83  ?  578  LEU A CB    1 
ATOM   4528  C  CG    . LEU A 1  578  ? 173.389 217.357 161.913 1.00 74.21  ?  578  LEU A CG    1 
ATOM   4529  C  CD1   . LEU A 1  578  ? 172.912 215.989 162.398 1.00 73.23  ?  578  LEU A CD1   1 
ATOM   4530  C  CD2   . LEU A 1  578  ? 174.869 217.407 161.948 1.00 75.17  ?  578  LEU A CD2   1 
ATOM   4531  N  N     . SER A 1  579  ? 170.758 220.003 161.296 1.00 75.86  ?  579  SER A N     1 
ATOM   4532  C  CA    . SER A 1  579  ? 170.284 221.024 162.228 1.00 75.89  ?  579  SER A CA    1 
ATOM   4533  C  C     . SER A 1  579  ? 168.827 220.864 162.641 1.00 79.57  ?  579  SER A C     1 
ATOM   4534  O  O     . SER A 1  579  ? 168.380 221.466 163.631 1.00 79.15  ?  579  SER A O     1 
ATOM   4535  C  CB    . SER A 1  579  ? 170.559 222.413 161.670 1.00 80.67  ?  579  SER A CB    1 
ATOM   4536  O  OG    . SER A 1  579  ? 171.956 222.623 161.544 1.00 88.19  ?  579  SER A OG    1 
ATOM   4537  N  N     . VAL A 1  580  ? 168.097 220.029 161.893 1.00 75.80  ?  580  VAL A N     1 
ATOM   4538  C  CA    . VAL A 1  580  ? 166.704 219.709 162.181 1.00 75.16  ?  580  VAL A CA    1 
ATOM   4539  C  C     . VAL A 1  580  ? 166.674 218.825 163.447 1.00 79.92  ?  580  VAL A C     1 
ATOM   4540  O  O     . VAL A 1  580  ? 165.725 218.914 164.227 1.00 79.80  ?  580  VAL A O     1 
ATOM   4541  C  CB    . VAL A 1  580  ? 165.972 219.066 160.976 1.00 78.22  ?  580  VAL A CB    1 
ATOM   4542  C  CG1   . VAL A 1  580  ? 164.470 219.051 161.202 1.00 77.50  ?  580  VAL A CG1   1 
ATOM   4543  C  CG2   . VAL A 1  580  ? 166.294 219.797 159.680 1.00 79.21  ?  580  VAL A CG2   1 
ATOM   4544  N  N     . ALA A 1  581  ? 167.734 218.022 163.679 1.00 76.45  ?  581  ALA A N     1 
ATOM   4545  C  CA    . ALA A 1  581  ? 167.805 217.188 164.873 1.00 75.80  ?  581  ALA A CA    1 
ATOM   4546  C  C     . ALA A 1  581  ? 168.186 218.038 166.075 1.00 80.83  ?  581  ALA A C     1 
ATOM   4547  O  O     . ALA A 1  581  ? 167.791 217.686 167.196 1.00 81.39  ?  581  ALA A O     1 
ATOM   4548  C  CB    . ALA A 1  581  ? 168.808 216.058 164.691 1.00 76.28  ?  581  ALA A CB    1 
ATOM   4549  N  N     . ILE A 1  582  ? 168.949 219.156 165.843 1.00 76.26  ?  582  ILE A N     1 
ATOM   4550  C  CA    . ILE A 1  582  ? 169.405 220.089 166.892 1.00 75.01  ?  582  ILE A CA    1 
ATOM   4551  C  C     . ILE A 1  582  ? 168.240 220.970 167.383 1.00 80.58  ?  582  ILE A C     1 
ATOM   4552  O  O     . ILE A 1  582  ? 167.668 221.749 166.589 1.00 81.59  ?  582  ILE A O     1 
ATOM   4553  C  CB    . ILE A 1  582  ? 170.675 220.907 166.532 1.00 77.69  ?  582  ILE A CB    1 
ATOM   4554  C  CG1   . ILE A 1  582  ? 171.675 220.075 165.681 1.00 77.27  ?  582  ILE A CG1   1 
ATOM   4555  C  CG2   . ILE A 1  582  ? 171.307 221.481 167.799 1.00 77.52  ?  582  ILE A CG2   1 
ATOM   4556  C  CD1   . ILE A 1  582  ? 173.165 220.431 165.752 1.00 80.94  ?  582  ILE A CD1   1 
ATOM   4557  N  N     . PRO A 1  583  ? 167.861 220.825 168.684 1.00 76.63  ?  583  PRO A N     1 
ATOM   4558  C  CA    . PRO A 1  583  ? 166.711 221.584 169.207 1.00 77.71  ?  583  PRO A CA    1 
ATOM   4559  C  C     . PRO A 1  583  ? 166.970 223.073 169.374 1.00 87.94  ?  583  PRO A C     1 
ATOM   4560  O  O     . PRO A 1  583  ? 168.115 223.490 169.582 1.00 88.81  ?  583  PRO A O     1 
ATOM   4561  C  CB    . PRO A 1  583  ? 166.396 220.903 170.541 1.00 77.51  ?  583  PRO A CB    1 
ATOM   4562  C  CG    . PRO A 1  583  ? 167.665 220.315 170.960 1.00 80.46  ?  583  PRO A CG    1 
ATOM   4563  C  CD    . PRO A 1  583  ? 168.441 219.952 169.723 1.00 76.24  ?  583  PRO A CD    1 
ATOM   4564  N  N     . ASN A 1  584  ? 165.896 223.871 169.298 1.00 86.89  ?  584  ASN A N     1 
ATOM   4565  C  CA    . ASN A 1  584  ? 165.982 225.311 169.432 1.00 88.23  ?  584  ASN A CA    1 
ATOM   4566  C  C     . ASN A 1  584  ? 166.510 225.754 170.798 1.00 93.92  ?  584  ASN A C     1 
ATOM   4567  O  O     . ASN A 1  584  ? 166.417 225.006 171.773 1.00 94.11  ?  584  ASN A O     1 
ATOM   4568  C  CB    . ASN A 1  584  ? 164.671 225.940 169.027 1.00 89.76  ?  584  ASN A CB    1 
ATOM   4569  C  CG    . ASN A 1  584  ? 164.479 225.875 167.528 1.00 128.49 ?  584  ASN A CG    1 
ATOM   4570  O  OD1   . ASN A 1  584  ? 165.340 225.386 166.763 1.00 126.84 ?  584  ASN A OD1   1 
ATOM   4571  N  ND2   . ASN A 1  584  ? 163.351 226.381 167.064 1.00 124.45 ?  584  ASN A ND2   1 
ATOM   4572  N  N     . GLY A 1  585  ? 167.182 226.893 170.834 1.00 90.65  ?  585  GLY A N     1 
ATOM   4573  C  CA    . GLY A 1  585  ? 167.772 227.366 172.075 1.00 90.48  ?  585  GLY A CA    1 
ATOM   4574  C  C     . GLY A 1  585  ? 169.184 226.868 172.317 1.00 94.64  ?  585  GLY A C     1 
ATOM   4575  O  O     . GLY A 1  585  ? 169.932 227.519 173.056 1.00 96.04  ?  585  GLY A O     1 
ATOM   4576  N  N     . ILE A 1  586  ? 169.573 225.724 171.696 1.00 89.24  ?  586  ILE A N     1 
ATOM   4577  C  CA    . ILE A 1  586  ? 170.929 225.153 171.810 1.00 87.90  ?  586  ILE A CA    1 
ATOM   4578  C  C     . ILE A 1  586  ? 172.032 226.059 171.196 1.00 96.12  ?  586  ILE A C     1 
ATOM   4579  O  O     . ILE A 1  586  ? 172.097 226.237 169.971 1.00 97.08  ?  586  ILE A O     1 
ATOM   4580  C  CB    . ILE A 1  586  ? 170.986 223.666 171.360 1.00 88.41  ?  586  ILE A CB    1 
ATOM   4581  C  CG1   . ILE A 1  586  ? 170.195 222.771 172.328 1.00 86.85  ?  586  ILE A CG1   1 
ATOM   4582  C  CG2   . ILE A 1  586  ? 172.419 223.157 171.171 1.00 87.87  ?  586  ILE A CG2   1 
ATOM   4583  C  CD1   . ILE A 1  586  ? 170.707 222.704 173.821 1.00 90.79  ?  586  ILE A CD1   1 
ATOM   4584  N  N     . HIS A 1  587  ? 172.871 226.651 172.066 1.00 93.90  ?  587  HIS A N     1 
ATOM   4585  C  CA    . HIS A 1  587  ? 173.939 227.523 171.610 1.00 95.57  ?  587  HIS A CA    1 
ATOM   4586  C  C     . HIS A 1  587  ? 175.315 226.909 171.884 1.00 93.84  ?  587  HIS A C     1 
ATOM   4587  O  O     . HIS A 1  587  ? 175.610 226.539 173.019 1.00 91.16  ?  587  HIS A O     1 
ATOM   4588  C  CB    . HIS A 1  587  ? 173.791 228.955 172.176 1.00 99.22  ?  587  HIS A CB    1 
ATOM   4589  C  CG    . HIS A 1  587  ? 174.699 229.965 171.516 1.00 105.56 ?  587  HIS A CG    1 
ATOM   4590  N  ND1   . HIS A 1  587  ? 176.093 229.923 171.678 1.00 108.08 ?  587  HIS A ND1   1 
ATOM   4591  C  CD2   . HIS A 1  587  ? 174.394 231.005 170.705 1.00 109.57 ?  587  HIS A CD2   1 
ATOM   4592  C  CE1   . HIS A 1  587  ? 176.576 230.923 170.953 1.00 108.96 ?  587  HIS A CE1   1 
ATOM   4593  N  NE2   . HIS A 1  587  ? 175.599 231.612 170.358 1.00 110.21 ?  587  HIS A NE2   1 
ATOM   4594  N  N     . LEU A 1  588  ? 176.159 226.823 170.830 1.00 89.60  ?  588  LEU A N     1 
ATOM   4595  C  CA    . LEU A 1  588  ? 177.514 226.264 170.896 1.00 88.78  ?  588  LEU A CA    1 
ATOM   4596  C  C     . LEU A 1  588  ? 178.550 227.008 170.025 1.00 94.13  ?  588  LEU A C     1 
ATOM   4597  O  O     . LEU A 1  588  ? 178.264 227.355 168.877 1.00 94.61  ?  588  LEU A O     1 
ATOM   4598  C  CB    . LEU A 1  588  ? 177.471 224.778 170.524 1.00 87.55  ?  588  LEU A CB    1 
ATOM   4599  C  CG    . LEU A 1  588  ? 178.738 223.983 170.720 1.00 90.65  ?  588  LEU A CG    1 
ATOM   4600  C  CD1   . LEU A 1  588  ? 178.982 223.725 172.162 1.00 90.11  ?  588  LEU A CD1   1 
ATOM   4601  C  CD2   . LEU A 1  588  ? 178.616 222.679 170.066 1.00 92.72  ?  588  LEU A CD2   1 
ATOM   4602  N  N     . GLN A 1  589  ? 179.757 227.225 170.587 1.00 90.52  ?  589  GLN A N     1 
ATOM   4603  C  CA    . GLN A 1  589  ? 180.895 227.894 169.949 1.00 91.48  ?  589  GLN A CA    1 
ATOM   4604  C  C     . GLN A 1  589  ? 182.169 227.134 170.264 1.00 95.08  ?  589  GLN A C     1 
ATOM   4605  O  O     . GLN A 1  589  ? 182.433 226.883 171.442 1.00 95.72  ?  589  GLN A O     1 
ATOM   4606  C  CB    . GLN A 1  589  ? 181.075 229.312 170.515 1.00 94.00  ?  589  GLN A CB    1 
ATOM   4607  C  CG    . GLN A 1  589  ? 180.175 230.385 169.916 1.00 116.36 ?  589  GLN A CG    1 
ATOM   4608  C  CD    . GLN A 1  589  ? 180.897 231.702 169.720 1.00 134.85 ?  589  GLN A CD    1 
ATOM   4609  O  OE1   . GLN A 1  589  ? 182.127 231.763 169.518 1.00 126.97 ?  589  GLN A OE1   1 
ATOM   4610  N  NE2   . GLN A 1  589  ? 180.130 232.786 169.729 1.00 127.97 ?  589  GLN A NE2   1 
ATOM   4611  N  N     . ARG A 1  590  ? 182.980 226.793 169.251 1.00 90.33  ?  590  ARG A N     1 
ATOM   4612  C  CA    . ARG A 1  590  ? 184.277 226.132 169.466 1.00 89.59  ?  590  ARG A CA    1 
ATOM   4613  C  C     . ARG A 1  590  ? 185.251 226.563 168.399 1.00 95.17  ?  590  ARG A C     1 
ATOM   4614  O  O     . ARG A 1  590  ? 184.921 226.531 167.207 1.00 94.79  ?  590  ARG A O     1 
ATOM   4615  C  CB    . ARG A 1  590  ? 184.178 224.590 169.552 1.00 87.51  ?  590  ARG A CB    1 
ATOM   4616  C  CG    . ARG A 1  590  ? 185.514 223.814 169.361 1.00 88.72  ?  590  ARG A CG    1 
ATOM   4617  C  CD    . ARG A 1  590  ? 185.386 222.307 169.544 1.00 88.45  ?  590  ARG A CD    1 
ATOM   4618  N  NE    . ARG A 1  590  ? 184.422 221.684 168.635 1.00 90.90  ?  590  ARG A NE    1 
ATOM   4619  C  CZ    . ARG A 1  590  ? 184.763 221.097 167.496 1.00 112.12 ?  590  ARG A CZ    1 
ATOM   4620  N  NH1   . ARG A 1  590  ? 186.033 221.045 167.125 1.00 106.62 1  590  ARG A NH1   1 
ATOM   4621  N  NH2   . ARG A 1  590  ? 183.836 220.556 166.717 1.00 98.50  ?  590  ARG A NH2   1 
ATOM   4622  N  N     . PHE A 1  591  ? 186.453 226.970 168.836 1.00 92.48  ?  591  PHE A N     1 
ATOM   4623  C  CA    . PHE A 1  591  ? 187.503 227.383 167.931 1.00 93.75  ?  591  PHE A CA    1 
ATOM   4624  C  C     . PHE A 1  591  ? 188.634 226.376 167.990 1.00 99.79  ?  591  PHE A C     1 
ATOM   4625  O  O     . PHE A 1  591  ? 189.158 226.100 169.069 1.00 98.25  ?  591  PHE A O     1 
ATOM   4626  C  CB    . PHE A 1  591  ? 187.952 228.809 168.264 1.00 96.77  ?  591  PHE A CB    1 
ATOM   4627  C  CG    . PHE A 1  591  ? 187.104 229.889 167.630 1.00 99.64  ?  591  PHE A CG    1 
ATOM   4628  C  CD1   . PHE A 1  591  ? 185.720 229.906 167.797 1.00 102.10 ?  591  PHE A CD1   1 
ATOM   4629  C  CD2   . PHE A 1  591  ? 187.681 230.881 166.855 1.00 104.21 ?  591  PHE A CD2   1 
ATOM   4630  C  CE1   . PHE A 1  591  ? 184.930 230.880 167.178 1.00 105.62 ?  591  PHE A CE1   1 
ATOM   4631  C  CE2   . PHE A 1  591  ? 186.893 231.865 166.249 1.00 106.30 ?  591  PHE A CE2   1 
ATOM   4632  C  CZ    . PHE A 1  591  ? 185.522 231.855 166.411 1.00 105.01 ?  591  PHE A CZ    1 
ATOM   4633  N  N     . ASP A 1  592  ? 188.917 225.729 166.846 1.00 100.27 ?  592  ASP A N     1 
ATOM   4634  C  CA    . ASP A 1  592  ? 189.998 224.747 166.686 1.00 101.90 ?  592  ASP A CA    1 
ATOM   4635  C  C     . ASP A 1  592  ? 191.167 225.501 166.061 1.00 109.68 ?  592  ASP A C     1 
ATOM   4636  O  O     . ASP A 1  592  ? 191.001 226.672 165.729 1.00 110.81 ?  592  ASP A O     1 
ATOM   4637  C  CB    . ASP A 1  592  ? 189.565 223.564 165.785 1.00 104.04 ?  592  ASP A CB    1 
ATOM   4638  C  CG    . ASP A 1  592  ? 188.595 222.537 166.369 1.00 114.75 ?  592  ASP A CG    1 
ATOM   4639  O  OD1   . ASP A 1  592  ? 188.268 222.632 167.590 1.00 113.58 ?  592  ASP A OD1   1 
ATOM   4640  O  OD2   . ASP A 1  592  ? 188.156 221.641 165.609 1.00 121.91 -1 592  ASP A OD2   1 
ATOM   4641  N  N     . GLU A 1  593  ? 192.339 224.873 165.912 1.00 108.60 ?  593  GLU A N     1 
ATOM   4642  C  CA    . GLU A 1  593  ? 193.498 225.589 165.368 1.00 110.98 ?  593  GLU A CA    1 
ATOM   4643  C  C     . GLU A 1  593  ? 193.319 226.226 163.993 1.00 114.34 ?  593  GLU A C     1 
ATOM   4644  O  O     . GLU A 1  593  ? 193.234 225.542 162.966 1.00 113.69 ?  593  GLU A O     1 
ATOM   4645  C  CB    . GLU A 1  593  ? 194.837 224.843 165.552 1.00 113.35 ?  593  GLU A CB    1 
ATOM   4646  C  CG    . GLU A 1  593  ? 194.979 223.550 164.761 1.00 132.67 ?  593  GLU A CG    1 
ATOM   4647  C  CD    . GLU A 1  593  ? 196.314 223.366 164.063 1.00 174.30 ?  593  GLU A CD    1 
ATOM   4648  O  OE1   . GLU A 1  593  ? 197.297 224.053 164.432 1.00 173.66 ?  593  GLU A OE1   1 
ATOM   4649  O  OE2   . GLU A 1  593  ? 196.370 222.526 163.134 1.00 184.37 -1 593  GLU A OE2   1 
ATOM   4650  N  N     . GLY A 1  594  ? 193.214 227.547 164.019 1.00 110.98 ?  594  GLY A N     1 
ATOM   4651  C  CA    . GLY A 1  594  ? 193.026 228.358 162.826 1.00 111.99 ?  594  GLY A CA    1 
ATOM   4652  C  C     . GLY A 1  594  ? 191.587 228.739 162.553 1.00 115.22 ?  594  GLY A C     1 
ATOM   4653  O  O     . GLY A 1  594  ? 191.256 229.107 161.421 1.00 116.09 ?  594  GLY A O     1 
ATOM   4654  N  N     . THR A 1  595  ? 190.716 228.657 163.572 1.00 109.71 ?  595  THR A N     1 
ATOM   4655  C  CA    . THR A 1  595  ? 189.326 229.026 163.362 1.00 108.88 ?  595  THR A CA    1 
ATOM   4656  C  C     . THR A 1  595  ? 189.205 230.524 163.483 1.00 115.05 ?  595  THR A C     1 
ATOM   4657  O  O     . THR A 1  595  ? 189.749 231.122 164.415 1.00 115.01 ?  595  THR A O     1 
ATOM   4658  C  CB    . THR A 1  595  ? 188.372 228.275 164.282 1.00 108.35 ?  595  THR A CB    1 
ATOM   4659  O  OG1   . THR A 1  595  ? 188.757 226.910 164.324 1.00 106.35 ?  595  THR A OG1   1 
ATOM   4660  C  CG2   . THR A 1  595  ? 186.930 228.364 163.818 1.00 104.56 ?  595  THR A CG2   1 
ATOM   4661  N  N     . THR A 1  596  ? 188.554 231.119 162.477 1.00 112.70 ?  596  THR A N     1 
ATOM   4662  C  CA    . THR A 1  596  ? 188.207 232.528 162.347 1.00 113.44 ?  596  THR A CA    1 
ATOM   4663  C  C     . THR A 1  596  ? 186.684 232.508 162.303 1.00 115.94 ?  596  THR A C     1 
ATOM   4664  O  O     . THR A 1  596  ? 186.102 231.425 162.257 1.00 113.88 ?  596  THR A O     1 
ATOM   4665  C  CB    . THR A 1  596  ? 188.722 233.079 161.008 1.00 125.88 ?  596  THR A CB    1 
ATOM   4666  O  OG1   . THR A 1  596  ? 189.881 232.361 160.586 1.00 127.40 ?  596  THR A OG1   1 
ATOM   4667  C  CG2   . THR A 1  596  ? 189.015 234.572 161.067 1.00 127.21 ?  596  THR A CG2   1 
ATOM   4668  N  N     . LEU A 1  597  ? 186.026 233.679 162.274 1.00 113.50 ?  597  LEU A N     1 
ATOM   4669  C  CA    . LEU A 1  597  ? 184.574 233.720 162.130 1.00 112.73 ?  597  LEU A CA    1 
ATOM   4670  C  C     . LEU A 1  597  ? 184.245 233.367 160.677 1.00 116.67 ?  597  LEU A C     1 
ATOM   4671  O  O     . LEU A 1  597  ? 183.078 233.234 160.318 1.00 115.86 ?  597  LEU A O     1 
ATOM   4672  C  CB    . LEU A 1  597  ? 184.004 235.099 162.513 1.00 113.69 ?  597  LEU A CB    1 
ATOM   4673  C  CG    . LEU A 1  597  ? 183.366 235.270 163.908 1.00 117.64 ?  597  LEU A CG    1 
ATOM   4674  C  CD1   . LEU A 1  597  ? 182.176 234.347 164.115 1.00 116.41 ?  597  LEU A CD1   1 
ATOM   4675  C  CD2   . LEU A 1  597  ? 184.397 235.169 165.036 1.00 120.73 ?  597  LEU A CD2   1 
ATOM   4676  N  N     . LEU A 1  598  ? 185.291 233.181 159.853 1.00 114.08 ?  598  LEU A N     1 
ATOM   4677  C  CA    . LEU A 1  598  ? 185.128 232.765 158.478 1.00 114.83 ?  598  LEU A CA    1 
ATOM   4678  C  C     . LEU A 1  598  ? 185.512 231.318 158.245 1.00 118.59 ?  598  LEU A C     1 
ATOM   4679  O  O     . LEU A 1  598  ? 185.412 230.855 157.111 1.00 119.25 ?  598  LEU A O     1 
ATOM   4680  C  CB    . LEU A 1  598  ? 185.820 233.701 157.495 1.00 116.72 ?  598  LEU A CB    1 
ATOM   4681  C  CG    . LEU A 1  598  ? 184.901 234.641 156.690 1.00 122.74 ?  598  LEU A CG    1 
ATOM   4682  C  CD1   . LEU A 1  598  ? 185.560 235.031 155.413 1.00 124.58 ?  598  LEU A CD1   1 
ATOM   4683  C  CD2   . LEU A 1  598  ? 183.556 234.000 156.345 1.00 124.40 ?  598  LEU A CD2   1 
ATOM   4684  N  N     . SER A 1  599  ? 185.898 230.592 159.325 1.00 113.81 ?  599  SER A N     1 
ATOM   4685  C  CA    . SER A 1  599  ? 186.257 229.156 159.366 1.00 112.10 ?  599  SER A CA    1 
ATOM   4686  C  C     . SER A 1  599  ? 186.654 228.594 157.989 1.00 115.18 ?  599  SER A C     1 
ATOM   4687  O  O     . SER A 1  599  ? 185.880 227.831 157.388 1.00 114.15 ?  599  SER A O     1 
ATOM   4688  C  CB    . SER A 1  599  ? 185.113 228.346 159.967 1.00 113.15 ?  599  SER A CB    1 
ATOM   4689  O  OG    . SER A 1  599  ? 185.451 226.977 160.103 1.00 118.02 ?  599  SER A OG    1 
ATOM   4690  N  N     . PRO A 1  600  ? 187.814 229.032 157.441 1.00 110.93 ?  600  PRO A N     1 
ATOM   4691  C  CA    . PRO A 1  600  ? 188.192 228.601 156.086 1.00 110.94 ?  600  PRO A CA    1 
ATOM   4692  C  C     . PRO A 1  600  ? 188.336 227.099 155.896 1.00 113.06 ?  600  PRO A C     1 
ATOM   4693  O  O     . PRO A 1  600  ? 187.907 226.580 154.869 1.00 113.72 ?  600  PRO A O     1 
ATOM   4694  C  CB    . PRO A 1  600  ? 189.498 229.349 155.831 1.00 113.53 ?  600  PRO A CB    1 
ATOM   4695  C  CG    . PRO A 1  600  ? 190.017 229.650 157.185 1.00 117.13 ?  600  PRO A CG    1 
ATOM   4696  C  CD    . PRO A 1  600  ? 188.818 229.956 157.999 1.00 112.11 ?  600  PRO A CD    1 
ATOM   4697  N  N     . LYS A 1  601  ? 188.885 226.402 156.889 1.00 106.88 ?  601  LYS A N     1 
ATOM   4698  C  CA    . LYS A 1  601  ? 189.085 224.966 156.789 1.00 105.59 ?  601  LYS A CA    1 
ATOM   4699  C  C     . LYS A 1  601  ? 187.858 224.140 157.255 1.00 108.98 ?  601  LYS A C     1 
ATOM   4700  O  O     . LYS A 1  601  ? 187.936 222.899 157.287 1.00 108.34 ?  601  LYS A O     1 
ATOM   4701  C  CB    . LYS A 1  601  ? 190.346 224.587 157.574 1.00 107.13 ?  601  LYS A CB    1 
ATOM   4702  C  CG    . LYS A 1  601  ? 191.648 224.910 156.849 1.00 116.55 ?  601  LYS A CG    1 
ATOM   4703  C  CD    . LYS A 1  601  ? 192.810 225.110 157.823 1.00 124.30 ?  601  LYS A CD    1 
ATOM   4704  C  CE    . LYS A 1  601  ? 193.505 223.843 158.263 1.00 132.80 ?  601  LYS A CE    1 
ATOM   4705  N  NZ    . LYS A 1  601  ? 194.409 224.102 159.416 1.00 142.60 1  601  LYS A NZ    1 
ATOM   4706  N  N     . ASP A 1  602  ? 186.715 224.830 157.570 1.00 104.39 ?  602  ASP A N     1 
ATOM   4707  C  CA    . ASP A 1  602  ? 185.473 224.273 158.149 1.00 102.21 ?  602  ASP A CA    1 
ATOM   4708  C  C     . ASP A 1  602  ? 185.879 223.643 159.502 1.00 106.15 ?  602  ASP A C     1 
ATOM   4709  O  O     . ASP A 1  602  ? 185.586 222.487 159.808 1.00 105.67 ?  602  ASP A O     1 
ATOM   4710  C  CB    . ASP A 1  602  ? 184.749 223.294 157.193 1.00 102.93 ?  602  ASP A CB    1 
ATOM   4711  C  CG    . ASP A 1  602  ? 183.235 223.459 156.997 1.00 103.50 ?  602  ASP A CG    1 
ATOM   4712  O  OD1   . ASP A 1  602  ? 182.669 224.501 157.455 1.00 102.37 ?  602  ASP A OD1   1 
ATOM   4713  O  OD2   . ASP A 1  602  ? 182.624 222.574 156.336 1.00 103.00 -1 602  ASP A OD2   1 
ATOM   4714  N  N     . ASN A 1  603  ? 186.656 224.435 160.260 1.00 102.98 ?  603  ASN A N     1 
ATOM   4715  C  CA    . ASN A 1  603  ? 187.249 224.181 161.571 1.00 101.19 ?  603  ASN A CA    1 
ATOM   4716  C  C     . ASN A 1  603  ? 186.240 224.477 162.651 1.00 103.13 ?  603  ASN A C     1 
ATOM   4717  O  O     . ASN A 1  603  ? 185.264 225.197 162.404 1.00 103.24 ?  603  ASN A O     1 
ATOM   4718  C  CB    . ASN A 1  603  ? 188.380 225.179 161.762 1.00 101.53 ?  603  ASN A CB    1 
ATOM   4719  C  CG    . ASN A 1  603  ? 189.749 224.619 161.680 1.00 127.20 ?  603  ASN A CG    1 
ATOM   4720  O  OD1   . ASN A 1  603  ? 190.667 225.310 161.240 1.00 124.76 ?  603  ASN A OD1   1 
ATOM   4721  N  ND2   . ASN A 1  603  ? 189.929 223.379 162.132 1.00 119.23 ?  603  ASN A ND2   1 
ATOM   4722  N  N     . GLY A 1  604  ? 186.515 223.988 163.855 1.00 97.20  ?  604  GLY A N     1 
ATOM   4723  C  CA    . GLY A 1  604  ? 185.684 224.243 165.023 1.00 95.80  ?  604  GLY A CA    1 
ATOM   4724  C  C     . GLY A 1  604  ? 184.193 224.048 164.840 1.00 98.84  ?  604  GLY A C     1 
ATOM   4725  O  O     . GLY A 1  604  ? 183.760 223.230 164.017 1.00 98.27  ?  604  GLY A O     1 
ATOM   4726  N  N     . MET A 1  605  ? 183.392 224.804 165.620 1.00 95.11  ?  605  MET A N     1 
ATOM   4727  C  CA    . MET A 1  605  ? 181.929 224.679 165.619 1.00 94.51  ?  605  MET A CA    1 
ATOM   4728  C  C     . MET A 1  605  ? 181.169 225.958 166.012 1.00 97.11  ?  605  MET A C     1 
ATOM   4729  O  O     . MET A 1  605  ? 181.548 226.656 166.961 1.00 96.44  ?  605  MET A O     1 
ATOM   4730  C  CB    . MET A 1  605  ? 181.500 223.517 166.563 1.00 95.50  ?  605  MET A CB    1 
ATOM   4731  C  CG    . MET A 1  605  ? 180.143 222.933 166.250 1.00 98.47  ?  605  MET A CG    1 
ATOM   4732  S  SD    . MET A 1  605  ? 180.189 222.080 164.665 1.00 103.31 ?  605  MET A SD    1 
ATOM   4733  C  CE    . MET A 1  605  ? 178.782 222.680 163.989 1.00 100.49 ?  605  MET A CE    1 
ATOM   4734  N  N     . LEU A 1  606  ? 180.056 226.215 165.315 1.00 92.09  ?  606  LEU A N     1 
ATOM   4735  C  CA    . LEU A 1  606  ? 179.195 227.331 165.636 1.00 91.83  ?  606  LEU A CA    1 
ATOM   4736  C  C     . LEU A 1  606  ? 177.743 226.976 165.389 1.00 96.06  ?  606  LEU A C     1 
ATOM   4737  O  O     . LEU A 1  606  ? 177.284 226.954 164.248 1.00 96.04  ?  606  LEU A O     1 
ATOM   4738  C  CB    . LEU A 1  606  ? 179.622 228.624 164.924 1.00 93.21  ?  606  LEU A CB    1 
ATOM   4739  C  CG    . LEU A 1  606  ? 178.793 229.879 165.214 1.00 97.98  ?  606  LEU A CG    1 
ATOM   4740  C  CD1   . LEU A 1  606  ? 178.649 230.127 166.706 1.00 97.77  ?  606  LEU A CD1   1 
ATOM   4741  C  CD2   . LEU A 1  606  ? 179.382 231.078 164.531 1.00 100.05 ?  606  LEU A CD2   1 
ATOM   4742  N  N     . ILE A 1  607  ? 177.033 226.670 166.482 1.00 92.53  ?  607  ILE A N     1 
ATOM   4743  C  CA    . ILE A 1  607  ? 175.612 226.314 166.480 1.00 91.82  ?  607  ILE A CA    1 
ATOM   4744  C  C     . ILE A 1  607  ? 174.870 227.429 167.205 1.00 96.68  ?  607  ILE A C     1 
ATOM   4745  O  O     . ILE A 1  607  ? 175.128 227.673 168.385 1.00 96.07  ?  607  ILE A O     1 
ATOM   4746  C  CB    . ILE A 1  607  ? 175.333 224.891 167.083 1.00 92.97  ?  607  ILE A CB    1 
ATOM   4747  C  CG1   . ILE A 1  607  ? 176.181 223.814 166.365 1.00 92.80  ?  607  ILE A CG1   1 
ATOM   4748  C  CG2   . ILE A 1  607  ? 173.832 224.535 167.030 1.00 92.24  ?  607  ILE A CG2   1 
ATOM   4749  C  CD1   . ILE A 1  607  ? 176.529 222.628 167.143 1.00 95.06  ?  607  ILE A CD1   1 
ATOM   4750  N  N     . ILE A 1  608  ? 173.995 228.137 166.474 1.00 93.89  ?  608  ILE A N     1 
ATOM   4751  C  CA    . ILE A 1  608  ? 173.189 229.229 167.016 1.00 93.83  ?  608  ILE A CA    1 
ATOM   4752  C  C     . ILE A 1  608  ? 171.699 228.885 166.920 1.00 99.47  ?  608  ILE A C     1 
ATOM   4753  O  O     . ILE A 1  608  ? 171.167 228.696 165.816 1.00 99.24  ?  608  ILE A O     1 
ATOM   4754  C  CB    . ILE A 1  608  ? 173.536 230.581 166.352 1.00 97.50  ?  608  ILE A CB    1 
ATOM   4755  C  CG1   . ILE A 1  608  ? 175.050 230.865 166.421 1.00 97.35  ?  608  ILE A CG1   1 
ATOM   4756  C  CG2   . ILE A 1  608  ? 172.716 231.704 166.986 1.00 98.67  ?  608  ILE A CG2   1 
ATOM   4757  C  CD1   . ILE A 1  608  ? 175.554 231.801 165.425 1.00 101.50 ?  608  ILE A CD1   1 
ATOM   4758  N  N     . ASP A 1  609  ? 171.032 228.811 168.092 1.00 97.14  ?  609  ASP A N     1 
ATOM   4759  C  CA    . ASP A 1  609  ? 169.601 228.488 168.232 1.00 97.40  ?  609  ASP A CA    1 
ATOM   4760  C  C     . ASP A 1  609  ? 169.290 227.083 167.682 1.00 102.55 ?  609  ASP A C     1 
ATOM   4761  O  O     . ASP A 1  609  ? 168.227 226.842 167.092 1.00 103.88 ?  609  ASP A O     1 
ATOM   4762  C  CB    . ASP A 1  609  ? 168.691 229.594 167.618 1.00 100.36 ?  609  ASP A CB    1 
ATOM   4763  C  CG    . ASP A 1  609  ? 167.226 229.540 168.027 1.00 111.60 ?  609  ASP A CG    1 
ATOM   4764  O  OD1   . ASP A 1  609  ? 166.942 229.143 169.186 1.00 110.66 ?  609  ASP A OD1   1 
ATOM   4765  O  OD2   . ASP A 1  609  ? 166.358 229.890 167.187 1.00 120.42 -1 609  ASP A OD2   1 
ATOM   4766  N  N     . GLY A 1  610  ? 170.230 226.163 167.891 1.00 97.44  ?  610  GLY A N     1 
ATOM   4767  C  CA    . GLY A 1  610  ? 170.095 224.784 167.443 1.00 95.72  ?  610  GLY A CA    1 
ATOM   4768  C  C     . GLY A 1  610  ? 170.068 224.654 165.938 1.00 97.73  ?  610  GLY A C     1 
ATOM   4769  O  O     . GLY A 1  610  ? 169.223 223.927 165.392 1.00 97.54  ?  610  GLY A O     1 
ATOM   4770  N  N     . GLN A 1  611  ? 170.954 225.440 165.272 1.00 91.94  ?  611  GLN A N     1 
ATOM   4771  C  CA    . GLN A 1  611  ? 171.196 225.504 163.828 1.00 91.33  ?  611  GLN A CA    1 
ATOM   4772  C  C     . GLN A 1  611  ? 172.711 225.707 163.625 1.00 93.73  ?  611  GLN A C     1 
ATOM   4773  O  O     . GLN A 1  611  ? 173.278 226.660 164.160 1.00 94.62  ?  611  GLN A O     1 
ATOM   4774  C  CB    . GLN A 1  611  ? 170.400 226.644 163.143 1.00 93.60  ?  611  GLN A CB    1 
ATOM   4775  C  CG    . GLN A 1  611  ? 168.862 226.583 163.269 1.00 116.74 ?  611  GLN A CG    1 
ATOM   4776  C  CD    . GLN A 1  611  ? 168.175 225.357 162.680 1.00 136.67 ?  611  GLN A CD    1 
ATOM   4777  O  OE1   . GLN A 1  611  ? 167.387 224.669 163.363 1.00 132.85 ?  611  GLN A OE1   1 
ATOM   4778  N  NE2   . GLN A 1  611  ? 168.405 225.093 161.390 1.00 122.99 ?  611  GLN A NE2   1 
ATOM   4779  N  N     . ILE A 1  612  ? 173.366 224.793 162.885 1.00 87.22  ?  612  ILE A N     1 
ATOM   4780  C  CA    . ILE A 1  612  ? 174.802 224.842 162.601 1.00 85.83  ?  612  ILE A CA    1 
ATOM   4781  C  C     . ILE A 1  612  ? 175.091 225.982 161.634 1.00 91.03  ?  612  ILE A C     1 
ATOM   4782  O  O     . ILE A 1  612  ? 174.461 226.048 160.575 1.00 91.56  ?  612  ILE A O     1 
ATOM   4783  C  CB    . ILE A 1  612  ? 175.282 223.487 162.010 1.00 87.69  ?  612  ILE A CB    1 
ATOM   4784  C  CG1   . ILE A 1  612  ? 175.188 222.338 163.027 1.00 85.64  ?  612  ILE A CG1   1 
ATOM   4785  C  CG2   . ILE A 1  612  ? 176.689 223.602 161.406 1.00 89.38  ?  612  ILE A CG2   1 
ATOM   4786  C  CD1   . ILE A 1  612  ? 174.843 221.022 162.430 1.00 86.45  ?  612  ILE A CD1   1 
ATOM   4787  N  N     . ILE A 1  613  ? 176.051 226.858 161.982 1.00 88.36  ?  613  ILE A N     1 
ATOM   4788  C  CA    . ILE A 1  613  ? 176.483 227.960 161.122 1.00 89.40  ?  613  ILE A CA    1 
ATOM   4789  C  C     . ILE A 1  613  ? 177.717 227.536 160.366 1.00 95.66  ?  613  ILE A C     1 
ATOM   4790  O  O     . ILE A 1  613  ? 177.758 227.714 159.149 1.00 97.56  ?  613  ILE A O     1 
ATOM   4791  C  CB    . ILE A 1  613  ? 176.630 229.308 161.869 1.00 92.26  ?  613  ILE A CB    1 
ATOM   4792  C  CG1   . ILE A 1  613  ? 175.319 230.089 161.837 1.00 92.55  ?  613  ILE A CG1   1 
ATOM   4793  C  CG2   . ILE A 1  613  ? 177.741 230.159 161.290 1.00 94.01  ?  613  ILE A CG2   1 
ATOM   4794  C  CD1   . ILE A 1  613  ? 174.363 229.707 162.875 1.00 99.42  ?  613  ILE A CD1   1 
ATOM   4795  N  N     . PHE A 1  614  ? 178.709 226.952 161.062 1.00 91.82  ?  614  PHE A N     1 
ATOM   4796  C  CA    . PHE A 1  614  ? 179.924 226.485 160.396 1.00 92.69  ?  614  PHE A CA    1 
ATOM   4797  C  C     . PHE A 1  614  ? 180.605 225.326 161.101 1.00 96.28  ?  614  PHE A C     1 
ATOM   4798  O  O     . PHE A 1  614  ? 180.333 225.057 162.281 1.00 94.91  ?  614  PHE A O     1 
ATOM   4799  C  CB    . PHE A 1  614  ? 180.933 227.640 160.140 1.00 95.93  ?  614  PHE A CB    1 
ATOM   4800  C  CG    . PHE A 1  614  ? 181.675 228.239 161.327 1.00 97.05  ?  614  PHE A CG    1 
ATOM   4801  C  CD1   . PHE A 1  614  ? 182.566 227.472 162.078 1.00 98.90  ?  614  PHE A CD1   1 
ATOM   4802  C  CD2   . PHE A 1  614  ? 181.559 229.589 161.629 1.00 99.34  ?  614  PHE A CD2   1 
ATOM   4803  C  CE1   . PHE A 1  614  ? 183.275 228.029 163.138 1.00 99.43  ?  614  PHE A CE1   1 
ATOM   4804  C  CE2   . PHE A 1  614  ? 182.268 230.144 162.693 1.00 102.10 ?  614  PHE A CE2   1 
ATOM   4805  C  CZ    . PHE A 1  614  ? 183.125 229.360 163.438 1.00 99.35  ?  614  PHE A CZ    1 
ATOM   4806  N  N     . GLY A 1  615  ? 181.557 224.724 160.386 1.00 93.07  ?  615  GLY A N     1 
ATOM   4807  C  CA    . GLY A 1  615  ? 182.403 223.654 160.896 1.00 91.58  ?  615  GLY A CA    1 
ATOM   4808  C  C     . GLY A 1  615  ? 181.857 222.266 160.680 1.00 92.49  ?  615  GLY A C     1 
ATOM   4809  O  O     . GLY A 1  615  ? 180.641 222.076 160.555 1.00 91.80  ?  615  GLY A O     1 
ATOM   4810  N  N     . VAL A 1  616  ? 182.759 221.285 160.649 1.00 86.39  ?  616  VAL A N     1 
ATOM   4811  C  CA    . VAL A 1  616  ? 182.326 219.919 160.463 1.00 84.52  ?  616  VAL A CA    1 
ATOM   4812  C  C     . VAL A 1  616  ? 182.096 219.224 161.810 1.00 88.06  ?  616  VAL A C     1 
ATOM   4813  O  O     . VAL A 1  616  ? 182.910 219.346 162.749 1.00 87.47  ?  616  VAL A O     1 
ATOM   4814  C  CB    . VAL A 1  616  ? 183.191 219.114 159.472 1.00 87.76  ?  616  VAL A CB    1 
ATOM   4815  C  CG1   . VAL A 1  616  ? 182.494 217.821 159.081 1.00 86.95  ?  616  VAL A CG1   1 
ATOM   4816  C  CG2   . VAL A 1  616  ? 183.487 219.927 158.224 1.00 88.83  ?  616  VAL A CG2   1 
ATOM   4817  N  N     . VAL A 1  617  ? 180.935 218.543 161.899 1.00 83.27  ?  617  VAL A N     1 
ATOM   4818  C  CA    . VAL A 1  617  ? 180.530 217.769 163.064 1.00 81.30  ?  617  VAL A CA    1 
ATOM   4819  C  C     . VAL A 1  617  ? 181.314 216.455 163.076 1.00 84.76  ?  617  VAL A C     1 
ATOM   4820  O  O     . VAL A 1  617  ? 181.342 215.736 162.069 1.00 84.72  ?  617  VAL A O     1 
ATOM   4821  C  CB    . VAL A 1  617  ? 179.001 217.533 163.125 1.00 83.52  ?  617  VAL A CB    1 
ATOM   4822  C  CG1   . VAL A 1  617  ? 178.594 216.866 164.445 1.00 81.49  ?  617  VAL A CG1   1 
ATOM   4823  C  CG2   . VAL A 1  617  ? 178.251 218.845 162.927 1.00 83.89  ?  617  VAL A CG2   1 
ATOM   4824  N  N     . GLU A 1  618  ? 181.987 216.187 164.213 1.00 79.75  ?  618  GLU A N     1 
ATOM   4825  C  CA    . GLU A 1  618  ? 182.762 214.976 164.488 1.00 78.28  ?  618  GLU A CA    1 
ATOM   4826  C  C     . GLU A 1  618  ? 182.918 214.695 166.016 1.00 79.71  ?  618  GLU A C     1 
ATOM   4827  O  O     . GLU A 1  618  ? 182.116 215.189 166.814 1.00 79.24  ?  618  GLU A O     1 
ATOM   4828  C  CB    . GLU A 1  618  ? 184.084 214.925 163.687 1.00 80.23  ?  618  GLU A CB    1 
ATOM   4829  C  CG    . GLU A 1  618  ? 184.901 216.192 163.763 1.00 91.15  ?  618  GLU A CG    1 
ATOM   4830  C  CD    . GLU A 1  618  ? 185.416 216.494 165.150 1.00 109.91 ?  618  GLU A CD    1 
ATOM   4831  O  OE1   . GLU A 1  618  ? 186.395 215.833 165.572 1.00 96.61  ?  618  GLU A OE1   1 
ATOM   4832  O  OE2   . GLU A 1  618  ? 184.773 217.314 165.850 1.00 102.99 -1 618  GLU A OE2   1 
ATOM   4833  N  N     . LYS A 1  619  ? 183.915 213.880 166.408 1.00 73.98  ?  619  LYS A N     1 
ATOM   4834  C  CA    . LYS A 1  619  ? 184.158 213.474 167.787 1.00 72.12  ?  619  LYS A CA    1 
ATOM   4835  C  C     . LYS A 1  619  ? 184.092 214.624 168.803 1.00 77.77  ?  619  LYS A C     1 
ATOM   4836  O  O     . LYS A 1  619  ? 183.339 214.521 169.763 1.00 77.49  ?  619  LYS A O     1 
ATOM   4837  C  CB    . LYS A 1  619  ? 185.470 212.687 167.879 1.00 73.42  ?  619  LYS A CB    1 
ATOM   4838  C  CG    . LYS A 1  619  ? 185.584 211.793 169.106 1.00 80.96  ?  619  LYS A CG    1 
ATOM   4839  C  CD    . LYS A 1  619  ? 186.451 210.569 168.808 1.00 88.85  ?  619  LYS A CD    1 
ATOM   4840  C  CE    . LYS A 1  619  ? 186.947 209.839 170.039 1.00 98.07  ?  619  LYS A CE    1 
ATOM   4841  N  NZ    . LYS A 1  619  ? 188.071 208.911 169.721 1.00 109.64 1  619  LYS A NZ    1 
ATOM   4842  N  N     . LYS A 1  620  ? 184.809 215.741 168.555 1.00 75.49  ?  620  LYS A N     1 
ATOM   4843  C  CA    . LYS A 1  620  ? 184.850 216.901 169.462 1.00 75.29  ?  620  LYS A CA    1 
ATOM   4844  C  C     . LYS A 1  620  ? 183.466 217.551 169.679 1.00 80.16  ?  620  LYS A C     1 
ATOM   4845  O  O     . LYS A 1  620  ? 183.202 218.130 170.736 1.00 80.62  ?  620  LYS A O     1 
ATOM   4846  C  CB    . LYS A 1  620  ? 185.859 217.968 168.980 1.00 77.98  ?  620  LYS A CB    1 
ATOM   4847  C  CG    . LYS A 1  620  ? 187.199 217.445 168.470 1.00 87.95  ?  620  LYS A CG    1 
ATOM   4848  C  CD    . LYS A 1  620  ? 188.156 218.586 168.095 1.00 97.65  ?  620  LYS A CD    1 
ATOM   4849  C  CE    . LYS A 1  620  ? 189.100 218.209 166.975 1.00 111.49 ?  620  LYS A CE    1 
ATOM   4850  N  NZ    . LYS A 1  620  ? 188.479 218.356 165.626 1.00 121.78 1  620  LYS A NZ    1 
ATOM   4851  N  N     . THR A 1  621  ? 182.605 217.466 168.674 1.00 75.86  ?  621  THR A N     1 
ATOM   4852  C  CA    . THR A 1  621  ? 181.295 218.084 168.708 1.00 75.28  ?  621  THR A CA    1 
ATOM   4853  C  C     . THR A 1  621  ? 180.235 217.144 169.267 1.00 81.70  ?  621  THR A C     1 
ATOM   4854  O  O     . THR A 1  621  ? 179.516 217.499 170.199 1.00 82.77  ?  621  THR A O     1 
ATOM   4855  C  CB    . THR A 1  621  ? 180.904 218.491 167.275 1.00 73.21  ?  621  THR A CB    1 
ATOM   4856  O  OG1   . THR A 1  621  ? 182.011 219.065 166.572 1.00 67.96  ?  621  THR A OG1   1 
ATOM   4857  C  CG2   . THR A 1  621  ? 179.685 219.377 167.229 1.00 69.11  ?  621  THR A CG2   1 
ATOM   4858  N  N     . VAL A 1  622  ? 180.113 215.966 168.662 1.00 77.73  ?  622  VAL A N     1 
ATOM   4859  C  CA    . VAL A 1  622  ? 179.047 215.027 168.907 1.00 76.22  ?  622  VAL A CA    1 
ATOM   4860  C  C     . VAL A 1  622  ? 179.455 213.763 169.661 1.00 79.43  ?  622  VAL A C     1 
ATOM   4861  O  O     . VAL A 1  622  ? 178.655 212.841 169.822 1.00 78.97  ?  622  VAL A O     1 
ATOM   4862  C  CB    . VAL A 1  622  ? 178.333 214.804 167.542 1.00 80.40  ?  622  VAL A CB    1 
ATOM   4863  C  CG1   . VAL A 1  622  ? 179.008 213.741 166.687 1.00 80.21  ?  622  VAL A CG1   1 
ATOM   4864  C  CG2   . VAL A 1  622  ? 176.856 214.527 167.706 1.00 79.85  ?  622  VAL A CG2   1 
ATOM   4865  N  N     . GLY A 1  623  ? 180.683 213.728 170.141 1.00 76.24  ?  623  GLY A N     1 
ATOM   4866  C  CA    . GLY A 1  623  ? 181.164 212.594 170.923 1.00 75.73  ?  623  GLY A CA    1 
ATOM   4867  C  C     . GLY A 1  623  ? 180.869 212.825 172.386 1.00 81.36  ?  623  GLY A C     1 
ATOM   4868  O  O     . GLY A 1  623  ? 180.136 213.776 172.718 1.00 82.00  ?  623  GLY A O     1 
ATOM   4869  N  N     . SER A 1  624  ? 181.457 211.970 173.277 1.00 78.43  ?  624  SER A N     1 
ATOM   4870  C  CA    . SER A 1  624  ? 181.292 212.055 174.748 1.00 78.21  ?  624  SER A CA    1 
ATOM   4871  C  C     . SER A 1  624  ? 182.330 212.995 175.329 1.00 84.12  ?  624  SER A C     1 
ATOM   4872  O  O     . SER A 1  624  ? 183.065 212.656 176.253 1.00 83.40  ?  624  SER A O     1 
ATOM   4873  C  CB    . SER A 1  624  ? 181.266 210.675 175.423 1.00 80.66  ?  624  SER A CB    1 
ATOM   4874  O  OG    . SER A 1  624  ? 182.311 209.788 175.053 1.00 90.11  ?  624  SER A OG    1 
ATOM   4875  N  N     . SER A 1  625  ? 182.375 214.199 174.735 1.00 83.34  ?  625  SER A N     1 
ATOM   4876  C  CA    . SER A 1  625  ? 183.286 215.312 175.007 1.00 84.49  ?  625  SER A CA    1 
ATOM   4877  C  C     . SER A 1  625  ? 182.768 216.292 176.044 1.00 86.84  ?  625  SER A C     1 
ATOM   4878  O  O     . SER A 1  625  ? 181.554 216.509 176.137 1.00 86.69  ?  625  SER A O     1 
ATOM   4879  C  CB    . SER A 1  625  ? 183.641 216.043 173.710 1.00 90.08  ?  625  SER A CB    1 
ATOM   4880  O  OG    . SER A 1  625  ? 182.518 216.273 172.873 1.00 100.28 ?  625  SER A OG    1 
ATOM   4881  N  N     . ASN A 1  626  ? 183.705 216.906 176.794 1.00 82.22  ?  626  ASN A N     1 
ATOM   4882  C  CA    . ASN A 1  626  ? 183.421 217.872 177.843 1.00 82.20  ?  626  ASN A CA    1 
ATOM   4883  C  C     . ASN A 1  626  ? 182.577 219.060 177.344 1.00 87.40  ?  626  ASN A C     1 
ATOM   4884  O  O     . ASN A 1  626  ? 181.531 219.368 177.932 1.00 86.98  ?  626  ASN A O     1 
ATOM   4885  C  CB    . ASN A 1  626  ? 184.706 218.332 178.517 1.00 84.02  ?  626  ASN A CB    1 
ATOM   4886  C  CG    . ASN A 1  626  ? 184.559 218.602 180.001 1.00 122.38 ?  626  ASN A CG    1 
ATOM   4887  O  OD1   . ASN A 1  626  ? 183.799 219.499 180.437 1.00 122.94 ?  626  ASN A OD1   1 
ATOM   4888  N  ND2   . ASN A 1  626  ? 185.325 217.857 180.813 1.00 112.34 ?  626  ASN A ND2   1 
ATOM   4889  N  N     . GLY A 1  627  ? 182.988 219.675 176.237 1.00 84.25  ?  627  GLY A N     1 
ATOM   4890  C  CA    . GLY A 1  627  ? 182.243 220.809 175.684 1.00 84.47  ?  627  GLY A CA    1 
ATOM   4891  C  C     . GLY A 1  627  ? 181.036 220.468 174.830 1.00 86.18  ?  627  GLY A C     1 
ATOM   4892  O  O     . GLY A 1  627  ? 180.258 221.357 174.475 1.00 84.32  ?  627  GLY A O     1 
ATOM   4893  N  N     . GLY A 1  628  ? 180.912 219.172 174.529 1.00 82.90  ?  628  GLY A N     1 
ATOM   4894  C  CA    . GLY A 1  628  ? 179.953 218.493 173.665 1.00 82.08  ?  628  GLY A CA    1 
ATOM   4895  C  C     . GLY A 1  628  ? 178.586 219.081 173.414 1.00 84.63  ?  628  GLY A C     1 
ATOM   4896  O  O     . GLY A 1  628  ? 178.012 219.757 174.270 1.00 84.34  ?  628  GLY A O     1 
ATOM   4897  N  N     . LEU A 1  629  ? 178.039 218.761 172.227 1.00 79.57  ?  629  LEU A N     1 
ATOM   4898  C  CA    . LEU A 1  629  ? 176.679 219.096 171.803 1.00 77.70  ?  629  LEU A CA    1 
ATOM   4899  C  C     . LEU A 1  629  ? 175.750 218.380 172.814 1.00 79.77  ?  629  LEU A C     1 
ATOM   4900  O  O     . LEU A 1  629  ? 174.769 218.967 173.269 1.00 78.31  ?  629  LEU A O     1 
ATOM   4901  C  CB    . LEU A 1  629  ? 176.457 218.585 170.351 1.00 76.93  ?  629  LEU A CB    1 
ATOM   4902  C  CG    . LEU A 1  629  ? 175.184 218.949 169.574 1.00 80.02  ?  629  LEU A CG    1 
ATOM   4903  C  CD1   . LEU A 1  629  ? 174.221 217.841 169.570 1.00 78.44  ?  629  LEU A CD1   1 
ATOM   4904  C  CD2   . LEU A 1  629  ? 174.542 220.218 170.052 1.00 82.53  ?  629  LEU A CD2   1 
ATOM   4905  N  N     . ILE A 1  630  ? 176.156 217.152 173.243 1.00 75.73  ?  630  ILE A N     1 
ATOM   4906  C  CA    . ILE A 1  630  ? 175.462 216.324 174.230 1.00 73.41  ?  630  ILE A CA    1 
ATOM   4907  C  C     . ILE A 1  630  ? 175.552 216.978 175.602 1.00 76.76  ?  630  ILE A C     1 
ATOM   4908  O  O     . ILE A 1  630  ? 174.499 217.211 176.197 1.00 75.71  ?  630  ILE A O     1 
ATOM   4909  C  CB    . ILE A 1  630  ? 175.929 214.844 174.178 1.00 74.35  ?  630  ILE A CB    1 
ATOM   4910  C  CG1   . ILE A 1  630  ? 175.300 214.143 172.976 1.00 73.22  ?  630  ILE A CG1   1 
ATOM   4911  C  CG2   . ILE A 1  630  ? 175.606 214.089 175.456 1.00 73.11  ?  630  ILE A CG2   1 
ATOM   4912  C  CD1   . ILE A 1  630  ? 176.257 213.466 172.203 1.00 76.07  ?  630  ILE A CD1   1 
ATOM   4913  N  N     . HIS A 1  631  ? 176.778 217.341 176.071 1.00 73.56  ?  631  HIS A N     1 
ATOM   4914  C  CA    . HIS A 1  631  ? 176.930 218.008 177.370 1.00 73.54  ?  631  HIS A CA    1 
ATOM   4915  C  C     . HIS A 1  631  ? 175.984 219.210 177.540 1.00 74.33  ?  631  HIS A C     1 
ATOM   4916  O  O     . HIS A 1  631  ? 175.265 219.273 178.540 1.00 73.46  ?  631  HIS A O     1 
ATOM   4917  C  CB    . HIS A 1  631  ? 178.383 218.409 177.669 1.00 75.72  ?  631  HIS A CB    1 
ATOM   4918  C  CG    . HIS A 1  631  ? 178.664 218.541 179.143 1.00 79.93  ?  631  HIS A CG    1 
ATOM   4919  N  ND1   . HIS A 1  631  ? 179.946 218.389 179.649 1.00 82.37  ?  631  HIS A ND1   1 
ATOM   4920  C  CD2   . HIS A 1  631  ? 177.814 218.775 180.179 1.00 81.99  ?  631  HIS A CD2   1 
ATOM   4921  C  CE1   . HIS A 1  631  ? 179.837 218.540 180.962 1.00 81.79  ?  631  HIS A CE1   1 
ATOM   4922  N  NE2   . HIS A 1  631  ? 178.570 218.769 181.328 1.00 81.84  ?  631  HIS A NE2   1 
ATOM   4923  N  N     . VAL A 1  632  ? 175.964 220.125 176.545 1.00 68.57  ?  632  VAL A N     1 
ATOM   4924  C  CA    . VAL A 1  632  ? 175.098 221.305 176.484 1.00 67.70  ?  632  VAL A CA    1 
ATOM   4925  C  C     . VAL A 1  632  ? 173.619 220.863 176.469 1.00 71.34  ?  632  VAL A C     1 
ATOM   4926  O  O     . VAL A 1  632  ? 172.839 221.367 177.277 1.00 71.35  ?  632  VAL A O     1 
ATOM   4927  C  CB    . VAL A 1  632  ? 175.391 222.134 175.219 1.00 71.63  ?  632  VAL A CB    1 
ATOM   4928  C  CG1   . VAL A 1  632  ? 174.469 223.338 175.120 1.00 71.80  ?  632  VAL A CG1   1 
ATOM   4929  C  CG2   . VAL A 1  632  ? 176.841 222.558 175.151 1.00 71.89  ?  632  VAL A CG2   1 
ATOM   4930  N  N     . VAL A 1  633  ? 173.232 219.945 175.538 1.00 66.04  ?  633  VAL A N     1 
ATOM   4931  C  CA    . VAL A 1  633  ? 171.849 219.491 175.443 1.00 64.84  ?  633  VAL A CA    1 
ATOM   4932  C  C     . VAL A 1  633  ? 171.335 218.899 176.755 1.00 69.32  ?  633  VAL A C     1 
ATOM   4933  O  O     . VAL A 1  633  ? 170.302 219.352 177.230 1.00 70.34  ?  633  VAL A O     1 
ATOM   4934  C  CB    . VAL A 1  633  ? 171.482 218.664 174.179 1.00 68.12  ?  633  VAL A CB    1 
ATOM   4935  C  CG1   . VAL A 1  633  ? 169.981 218.367 174.128 1.00 67.53  ?  633  VAL A CG1   1 
ATOM   4936  C  CG2   . VAL A 1  633  ? 171.904 219.384 172.907 1.00 68.78  ?  633  VAL A CG2   1 
ATOM   4937  N  N     . THR A 1  634  ? 172.064 217.965 177.388 1.00 65.62  ?  634  THR A N     1 
ATOM   4938  C  CA    . THR A 1  634  ? 171.598 217.390 178.662 1.00 65.22  ?  634  THR A CA    1 
ATOM   4939  C  C     . THR A 1  634  ? 171.367 218.495 179.664 1.00 72.37  ?  634  THR A C     1 
ATOM   4940  O  O     . THR A 1  634  ? 170.263 218.630 180.200 1.00 72.05  ?  634  THR A O     1 
ATOM   4941  C  CB    . THR A 1  634  ? 172.569 216.355 179.232 1.00 70.34  ?  634  THR A CB    1 
ATOM   4942  O  OG1   . THR A 1  634  ? 173.320 215.748 178.180 1.00 72.34  ?  634  THR A OG1   1 
ATOM   4943  C  CG2   . THR A 1  634  ? 171.854 215.293 180.075 1.00 67.11  ?  634  THR A CG2   1 
ATOM   4944  N  N     . ARG A 1  635  ? 172.398 219.328 179.849 1.00 71.64  ?  635  ARG A N     1 
ATOM   4945  C  CA    . ARG A 1  635  ? 172.375 220.449 180.760 1.00 72.84  ?  635  ARG A CA    1 
ATOM   4946  C  C     . ARG A 1  635  ? 171.329 221.477 180.403 1.00 79.11  ?  635  ARG A C     1 
ATOM   4947  O  O     . ARG A 1  635  ? 170.611 221.905 181.293 1.00 80.38  ?  635  ARG A O     1 
ATOM   4948  C  CB    . ARG A 1  635  ? 173.762 221.107 180.874 1.00 74.07  ?  635  ARG A CB    1 
ATOM   4949  C  CG    . ARG A 1  635  ? 174.731 220.393 181.814 1.00 80.77  ?  635  ARG A CG    1 
ATOM   4950  C  CD    . ARG A 1  635  ? 174.525 220.802 183.264 1.00 86.19  ?  635  ARG A CD    1 
ATOM   4951  N  NE    . ARG A 1  635  ? 174.704 219.662 184.156 1.00 97.22  ?  635  ARG A NE    1 
ATOM   4952  C  CZ    . ARG A 1  635  ? 173.745 218.797 184.475 1.00 116.36 ?  635  ARG A CZ    1 
ATOM   4953  N  NH1   . ARG A 1  635  ? 172.517 218.944 183.985 1.00 104.61 1  635  ARG A NH1   1 
ATOM   4954  N  NH2   . ARG A 1  635  ? 174.007 217.777 185.283 1.00 105.85 ?  635  ARG A NH2   1 
ATOM   4955  N  N     . GLU A 1  636  ? 171.217 221.876 179.142 1.00 76.29  ?  636  GLU A N     1 
ATOM   4956  C  CA    . GLU A 1  636  ? 170.267 222.930 178.816 1.00 77.72  ?  636  GLU A CA    1 
ATOM   4957  C  C     . GLU A 1  636  ? 168.822 222.482 178.652 1.00 83.14  ?  636  GLU A C     1 
ATOM   4958  O  O     . GLU A 1  636  ? 167.923 223.125 179.188 1.00 83.41  ?  636  GLU A O     1 
ATOM   4959  C  CB    . GLU A 1  636  ? 170.754 223.790 177.639 1.00 80.22  ?  636  GLU A CB    1 
ATOM   4960  C  CG    . GLU A 1  636  ? 170.318 225.250 177.701 1.00 95.39  ?  636  GLU A CG    1 
ATOM   4961  C  CD    . GLU A 1  636  ? 171.008 226.144 178.718 1.00 128.84 ?  636  GLU A CD    1 
ATOM   4962  O  OE1   . GLU A 1  636  ? 172.249 226.046 178.852 1.00 119.57 ?  636  GLU A OE1   1 
ATOM   4963  O  OE2   . GLU A 1  636  ? 170.309 226.978 179.345 1.00 141.04 -1 636  GLU A OE2   1 
ATOM   4964  N  N     . LYS A 1  637  ? 168.588 221.395 177.925 1.00 80.23  ?  637  LYS A N     1 
ATOM   4965  C  CA    . LYS A 1  637  ? 167.227 220.952 177.654 1.00 79.87  ?  637  LYS A CA    1 
ATOM   4966  C  C     . LYS A 1  637  ? 166.638 219.864 178.540 1.00 84.49  ?  637  LYS A C     1 
ATOM   4967  O  O     . LYS A 1  637  ? 165.425 219.862 178.729 1.00 85.20  ?  637  LYS A O     1 
ATOM   4968  C  CB    . LYS A 1  637  ? 166.998 220.686 176.156 1.00 82.22  ?  637  LYS A CB    1 
ATOM   4969  C  CG    . LYS A 1  637  ? 167.397 221.838 175.211 1.00 95.17  ?  637  LYS A CG    1 
ATOM   4970  C  CD    . LYS A 1  637  ? 166.666 223.175 175.426 1.00 103.63 ?  637  LYS A CD    1 
ATOM   4971  C  CE    . LYS A 1  637  ? 165.607 223.459 174.392 1.00 105.75 ?  637  LYS A CE    1 
ATOM   4972  N  NZ    . LYS A 1  637  ? 165.261 224.909 174.367 1.00 110.89 1  637  LYS A NZ    1 
ATOM   4973  N  N     . GLY A 1  638  ? 167.464 218.977 179.089 1.00 80.83  ?  638  GLY A N     1 
ATOM   4974  C  CA    . GLY A 1  638  ? 166.983 217.897 179.949 1.00 80.39  ?  638  GLY A CA    1 
ATOM   4975  C  C     . GLY A 1  638  ? 167.553 216.543 179.586 1.00 85.38  ?  638  GLY A C     1 
ATOM   4976  O  O     . GLY A 1  638  ? 168.129 216.406 178.505 1.00 86.91  ?  638  GLY A O     1 
ATOM   4977  N  N     . PRO A 1  639  ? 167.460 215.503 180.448 1.00 80.47  ?  639  PRO A N     1 
ATOM   4978  C  CA    . PRO A 1  639  ? 168.035 214.208 180.059 1.00 78.99  ?  639  PRO A CA    1 
ATOM   4979  C  C     . PRO A 1  639  ? 167.135 213.529 179.054 1.00 80.53  ?  639  PRO A C     1 
ATOM   4980  O  O     . PRO A 1  639  ? 167.636 212.849 178.156 1.00 80.12  ?  639  PRO A O     1 
ATOM   4981  C  CB    . PRO A 1  639  ? 168.123 213.430 181.378 1.00 80.25  ?  639  PRO A CB    1 
ATOM   4982  C  CG    . PRO A 1  639  ? 167.050 213.983 182.213 1.00 85.59  ?  639  PRO A CG    1 
ATOM   4983  C  CD    . PRO A 1  639  ? 166.810 215.423 181.770 1.00 82.29  ?  639  PRO A CD    1 
ATOM   4984  N  N     . GLN A 1  640  ? 165.807 213.754 179.185 1.00 74.86  ?  640  GLN A N     1 
ATOM   4985  C  CA    . GLN A 1  640  ? 164.849 213.151 178.292 1.00 73.36  ?  640  GLN A CA    1 
ATOM   4986  C  C     . GLN A 1  640  ? 164.929 213.727 176.879 1.00 73.82  ?  640  GLN A C     1 
ATOM   4987  O  O     . GLN A 1  640  ? 164.809 212.991 175.893 1.00 72.45  ?  640  GLN A O     1 
ATOM   4988  C  CB    . GLN A 1  640  ? 163.454 213.132 178.905 1.00 75.02  ?  640  GLN A CB    1 
ATOM   4989  C  CG    . GLN A 1  640  ? 162.963 211.695 179.182 1.00 108.49 ?  640  GLN A CG    1 
ATOM   4990  C  CD    . GLN A 1  640  ? 162.482 210.924 177.945 1.00 143.00 ?  640  GLN A CD    1 
ATOM   4991  O  OE1   . GLN A 1  640  ? 161.886 211.488 177.011 1.00 144.38 ?  640  GLN A OE1   1 
ATOM   4992  N  NE2   . GLN A 1  640  ? 162.683 209.599 177.929 1.00 131.18 ?  640  GLN A NE2   1 
ATOM   4993  N  N     . VAL A 1  641  ? 165.259 215.009 176.788 1.00 69.90  ?  641  VAL A N     1 
ATOM   4994  C  CA    . VAL A 1  641  ? 165.426 215.695 175.504 1.00 70.27  ?  641  VAL A CA    1 
ATOM   4995  C  C     . VAL A 1  641  ? 166.711 215.233 174.788 1.00 74.52  ?  641  VAL A C     1 
ATOM   4996  O  O     . VAL A 1  641  ? 166.693 214.991 173.575 1.00 75.44  ?  641  VAL A O     1 
ATOM   4997  C  CB    . VAL A 1  641  ? 165.409 217.220 175.703 1.00 74.42  ?  641  VAL A CB    1 
ATOM   4998  C  CG1   . VAL A 1  641  ? 165.372 217.947 174.363 1.00 74.96  ?  641  VAL A CG1   1 
ATOM   4999  C  CG2   . VAL A 1  641  ? 164.242 217.631 176.595 1.00 74.13  ?  641  VAL A CG2   1 
ATOM   5000  N  N     . CYS A 1  642  ? 167.815 215.123 175.549 1.00 68.48  ?  642  CYS A N     1 
ATOM   5001  C  CA    . CYS A 1  642  ? 169.108 214.708 175.049 1.00 67.60  ?  642  CYS A CA    1 
ATOM   5002  C  C     . CYS A 1  642  ? 169.051 213.268 174.554 1.00 70.16  ?  642  CYS A C     1 
ATOM   5003  O  O     . CYS A 1  642  ? 169.673 212.932 173.550 1.00 69.60  ?  642  CYS A O     1 
ATOM   5004  C  CB    . CYS A 1  642  ? 170.158 214.880 176.138 1.00 68.00  ?  642  CYS A CB    1 
ATOM   5005  S  SG    . CYS A 1  642  ? 171.867 214.634 175.579 1.00 72.57  ?  642  CYS A SG    1 
ATOM   5006  N  N     . ALA A 1  643  ? 168.300 212.416 175.252 1.00 66.13  ?  643  ALA A N     1 
ATOM   5007  C  CA    . ALA A 1  643  ? 168.198 211.011 174.893 1.00 65.55  ?  643  ALA A CA    1 
ATOM   5008  C  C     . ALA A 1  643  ? 167.488 210.880 173.540 1.00 71.98  ?  643  ALA A C     1 
ATOM   5009  O  O     . ALA A 1  643  ? 167.865 210.032 172.692 1.00 72.00  ?  643  ALA A O     1 
ATOM   5010  C  CB    . ALA A 1  643  ? 167.460 210.258 175.987 1.00 65.31  ?  643  ALA A CB    1 
ATOM   5011  N  N     . LYS A 1  644  ? 166.492 211.777 173.318 1.00 68.72  ?  644  LYS A N     1 
ATOM   5012  C  CA    . LYS A 1  644  ? 165.755 211.834 172.066 1.00 68.64  ?  644  LYS A CA    1 
ATOM   5013  C  C     . LYS A 1  644  ? 166.726 212.250 170.914 1.00 73.65  ?  644  LYS A C     1 
ATOM   5014  O  O     . LYS A 1  644  ? 166.767 211.587 169.874 1.00 74.73  ?  644  LYS A O     1 
ATOM   5015  C  CB    . LYS A 1  644  ? 164.533 212.749 172.205 1.00 70.72  ?  644  LYS A CB    1 
ATOM   5016  C  CG    . LYS A 1  644  ? 163.592 212.709 171.005 1.00 94.26  ?  644  LYS A CG    1 
ATOM   5017  C  CD    . LYS A 1  644  ? 162.737 211.438 170.927 1.00 108.89 ?  644  LYS A CD    1 
ATOM   5018  C  CE    . LYS A 1  644  ? 162.609 210.877 169.524 1.00 117.56 ?  644  LYS A CE    1 
ATOM   5019  N  NZ    . LYS A 1  644  ? 161.235 210.363 169.261 1.00 126.10 1  644  LYS A NZ    1 
ATOM   5020  N  N     . LEU A 1  645  ? 167.588 213.265 171.169 1.00 67.98  ?  645  LEU A N     1 
ATOM   5021  C  CA    . LEU A 1  645  ? 168.609 213.795 170.250 1.00 65.58  ?  645  LEU A CA    1 
ATOM   5022  C  C     . LEU A 1  645  ? 169.549 212.732 169.720 1.00 66.61  ?  645  LEU A C     1 
ATOM   5023  O  O     . LEU A 1  645  ? 169.948 212.820 168.568 1.00 66.42  ?  645  LEU A O     1 
ATOM   5024  C  CB    . LEU A 1  645  ? 169.406 214.894 170.957 1.00 64.52  ?  645  LEU A CB    1 
ATOM   5025  C  CG    . LEU A 1  645  ? 170.655 215.379 170.288 1.00 67.38  ?  645  LEU A CG    1 
ATOM   5026  C  CD1   . LEU A 1  645  ? 170.324 216.325 169.154 1.00 67.61  ?  645  LEU A CD1   1 
ATOM   5027  C  CD2   . LEU A 1  645  ? 171.586 215.994 171.302 1.00 68.67  ?  645  LEU A CD2   1 
ATOM   5028  N  N     . PHE A 1  646  ? 169.912 211.745 170.555 1.00 62.48  ?  646  PHE A N     1 
ATOM   5029  C  CA    . PHE A 1  646  ? 170.798 210.648 170.149 1.00 62.52  ?  646  PHE A CA    1 
ATOM   5030  C  C     . PHE A 1  646  ? 170.141 209.911 169.009 1.00 68.86  ?  646  PHE A C     1 
ATOM   5031  O  O     . PHE A 1  646  ? 170.729 209.839 167.922 1.00 68.80  ?  646  PHE A O     1 
ATOM   5032  C  CB    . PHE A 1  646  ? 171.077 209.672 171.309 1.00 62.80  ?  646  PHE A CB    1 
ATOM   5033  C  CG    . PHE A 1  646  ? 172.226 210.053 172.200 1.00 63.40  ?  646  PHE A CG    1 
ATOM   5034  C  CD1   . PHE A 1  646  ? 172.023 210.867 173.316 1.00 64.24  ?  646  PHE A CD1   1 
ATOM   5035  C  CD2   . PHE A 1  646  ? 173.514 209.609 171.926 1.00 66.09  ?  646  PHE A CD2   1 
ATOM   5036  C  CE1   . PHE A 1  646  ? 173.092 211.232 174.137 1.00 66.86  ?  646  PHE A CE1   1 
ATOM   5037  C  CE2   . PHE A 1  646  ? 174.584 209.962 172.755 1.00 66.77  ?  646  PHE A CE2   1 
ATOM   5038  C  CZ    . PHE A 1  646  ? 174.366 210.766 173.862 1.00 65.35  ?  646  PHE A CZ    1 
ATOM   5039  N  N     . GLY A 1  647  ? 168.899 209.450 169.262 1.00 65.73  ?  647  GLY A N     1 
ATOM   5040  C  CA    . GLY A 1  647  ? 168.066 208.726 168.305 1.00 65.42  ?  647  GLY A CA    1 
ATOM   5041  C  C     . GLY A 1  647  ? 167.894 209.516 167.030 1.00 68.95  ?  647  GLY A C     1 
ATOM   5042  O  O     . GLY A 1  647  ? 168.145 208.999 165.939 1.00 69.57  ?  647  GLY A O     1 
ATOM   5043  N  N     . ASN A 1  648  ? 167.562 210.810 167.184 1.00 64.13  ?  648  ASN A N     1 
ATOM   5044  C  CA    . ASN A 1  648  ? 167.390 211.741 166.083 1.00 63.94  ?  648  ASN A CA    1 
ATOM   5045  C  C     . ASN A 1  648  ? 168.644 211.867 165.224 1.00 65.15  ?  648  ASN A C     1 
ATOM   5046  O  O     . ASN A 1  648  ? 168.627 211.373 164.095 1.00 63.75  ?  648  ASN A O     1 
ATOM   5047  C  CB    . ASN A 1  648  ? 166.703 213.049 166.535 1.00 64.40  ?  648  ASN A CB    1 
ATOM   5048  C  CG    . ASN A 1  648  ? 165.227 212.773 166.809 1.00 92.12  ?  648  ASN A CG    1 
ATOM   5049  O  OD1   . ASN A 1  648  ? 164.834 211.641 167.140 1.00 95.78  ?  648  ASN A OD1   1 
ATOM   5050  N  ND2   . ASN A 1  648  ? 164.359 213.749 166.598 1.00 78.08  ?  648  ASN A ND2   1 
ATOM   5051  N  N     . ILE A 1  649  ? 169.764 212.329 165.799 1.00 60.84  ?  649  ILE A N     1 
ATOM   5052  C  CA    . ILE A 1  649  ? 171.036 212.388 165.078 1.00 61.25  ?  649  ILE A CA    1 
ATOM   5053  C  C     . ILE A 1  649  ? 171.325 211.059 164.342 1.00 68.35  ?  649  ILE A C     1 
ATOM   5054  O  O     . ILE A 1  649  ? 171.705 211.096 163.165 1.00 70.44  ?  649  ILE A O     1 
ATOM   5055  C  CB    . ILE A 1  649  ? 172.181 212.772 166.021 1.00 63.25  ?  649  ILE A CB    1 
ATOM   5056  C  CG1   . ILE A 1  649  ? 172.088 214.243 166.402 1.00 63.82  ?  649  ILE A CG1   1 
ATOM   5057  C  CG2   . ILE A 1  649  ? 173.563 212.404 165.445 1.00 63.00  ?  649  ILE A CG2   1 
ATOM   5058  C  CD1   . ILE A 1  649  ? 172.856 214.525 167.671 1.00 70.12  ?  649  ILE A CD1   1 
ATOM   5059  N  N     . GLN A 1  650  ? 171.110 209.895 165.008 1.00 63.02  ?  650  GLN A N     1 
ATOM   5060  C  CA    . GLN A 1  650  ? 171.370 208.629 164.329 1.00 61.56  ?  650  GLN A CA    1 
ATOM   5061  C  C     . GLN A 1  650  ? 170.383 208.269 163.210 1.00 65.88  ?  650  GLN A C     1 
ATOM   5062  O  O     . GLN A 1  650  ? 170.826 207.982 162.104 1.00 66.38  ?  650  GLN A O     1 
ATOM   5063  C  CB    . GLN A 1  650  ? 171.801 207.480 165.255 1.00 60.84  ?  650  GLN A CB    1 
ATOM   5064  C  CG    . GLN A 1  650  ? 170.908 207.216 166.440 1.00 66.50  ?  650  GLN A CG    1 
ATOM   5065  C  CD    . GLN A 1  650  ? 171.602 206.404 167.512 1.00 79.00  ?  650  GLN A CD    1 
ATOM   5066  O  OE1   . GLN A 1  650  ? 171.439 205.165 167.613 1.00 82.66  ?  650  GLN A OE1   1 
ATOM   5067  N  NE2   . GLN A 1  650  ? 172.380 207.081 168.346 1.00 49.61  ?  650  GLN A NE2   1 
ATOM   5068  N  N     . LYS A 1  651  ? 169.086 208.443 163.424 1.00 62.69  ?  651  LYS A N     1 
ATOM   5069  C  CA    . LYS A 1  651  ? 168.093 208.169 162.376 1.00 64.60  ?  651  LYS A CA    1 
ATOM   5070  C  C     . LYS A 1  651  ? 168.371 208.916 161.032 1.00 72.16  ?  651  LYS A C     1 
ATOM   5071  O  O     . LYS A 1  651  ? 168.148 208.344 159.949 1.00 71.27  ?  651  LYS A O     1 
ATOM   5072  C  CB    . LYS A 1  651  ? 166.656 208.450 162.881 1.00 67.05  ?  651  LYS A CB    1 
ATOM   5073  C  CG    . LYS A 1  651  ? 166.041 207.321 163.709 1.00 70.92  ?  651  LYS A CG    1 
ATOM   5074  C  CD    . LYS A 1  651  ? 164.892 207.795 164.594 1.00 75.53  ?  651  LYS A CD    1 
ATOM   5075  C  CE    . LYS A 1  651  ? 165.058 207.404 166.047 1.00 90.33  ?  651  LYS A CE    1 
ATOM   5076  N  NZ    . LYS A 1  651  ? 165.117 205.920 166.241 1.00 101.14 1  651  LYS A NZ    1 
ATOM   5077  N  N     . VAL A 1  652  ? 168.869 210.184 161.123 1.00 71.15  ?  652  VAL A N     1 
ATOM   5078  C  CA    . VAL A 1  652  ? 169.194 211.034 159.957 1.00 72.37  ?  652  VAL A CA    1 
ATOM   5079  C  C     . VAL A 1  652  ? 170.478 210.541 159.333 1.00 78.93  ?  652  VAL A C     1 
ATOM   5080  O  O     . VAL A 1  652  ? 170.503 210.200 158.141 1.00 80.32  ?  652  VAL A O     1 
ATOM   5081  C  CB    . VAL A 1  652  ? 169.346 212.555 160.248 1.00 75.43  ?  652  VAL A CB    1 
ATOM   5082  C  CG1   . VAL A 1  652  ? 169.107 213.355 158.980 1.00 76.20  ?  652  VAL A CG1   1 
ATOM   5083  C  CG2   . VAL A 1  652  ? 168.430 213.033 161.361 1.00 74.34  ?  652  VAL A CG2   1 
ATOM   5084  N  N     . VAL A 1  653  ? 171.556 210.549 160.145 1.00 74.42  ?  653  VAL A N     1 
ATOM   5085  C  CA    . VAL A 1  653  ? 172.896 210.174 159.732 1.00 74.22  ?  653  VAL A CA    1 
ATOM   5086  C  C     . VAL A 1  653  ? 172.971 208.783 159.138 1.00 78.22  ?  653  VAL A C     1 
ATOM   5087  O  O     . VAL A 1  653  ? 173.417 208.641 157.993 1.00 79.25  ?  653  VAL A O     1 
ATOM   5088  C  CB    . VAL A 1  653  ? 173.949 210.442 160.814 1.00 77.43  ?  653  VAL A CB    1 
ATOM   5089  C  CG1   . VAL A 1  653  ? 175.325 209.992 160.350 1.00 77.72  ?  653  VAL A CG1   1 
ATOM   5090  C  CG2   . VAL A 1  653  ? 173.976 211.924 161.178 1.00 77.62  ?  653  VAL A CG2   1 
ATOM   5091  N  N     . ASN A 1  654  ? 172.475 207.775 159.869 1.00 73.33  ?  654  ASN A N     1 
ATOM   5092  C  CA    . ASN A 1  654  ? 172.494 206.396 159.383 1.00 72.80  ?  654  ASN A CA    1 
ATOM   5093  C  C     . ASN A 1  654  ? 171.744 206.257 158.074 1.00 77.82  ?  654  ASN A C     1 
ATOM   5094  O  O     . ASN A 1  654  ? 172.198 205.515 157.194 1.00 77.73  ?  654  ASN A O     1 
ATOM   5095  C  CB    . ASN A 1  654  ? 171.913 205.425 160.401 1.00 69.78  ?  654  ASN A CB    1 
ATOM   5096  C  CG    . ASN A 1  654  ? 172.621 205.339 161.713 1.00 81.95  ?  654  ASN A CG    1 
ATOM   5097  O  OD1   . ASN A 1  654  ? 173.856 205.297 161.787 1.00 73.89  ?  654  ASN A OD1   1 
ATOM   5098  N  ND2   . ASN A 1  654  ? 171.827 205.225 162.771 1.00 72.37  ?  654  ASN A ND2   1 
ATOM   5099  N  N     . PHE A 1  655  ? 170.595 206.960 157.949 1.00 75.49  ?  655  PHE A N     1 
ATOM   5100  C  CA    . PHE A 1  655  ? 169.792 206.891 156.738 1.00 77.24  ?  655  PHE A CA    1 
ATOM   5101  C  C     . PHE A 1  655  ? 170.575 207.425 155.557 1.00 80.07  ?  655  PHE A C     1 
ATOM   5102  O  O     . PHE A 1  655  ? 170.566 206.797 154.485 1.00 79.74  ?  655  PHE A O     1 
ATOM   5103  C  CB    . PHE A 1  655  ? 168.453 207.637 156.882 1.00 80.43  ?  655  PHE A CB    1 
ATOM   5104  C  CG    . PHE A 1  655  ? 167.758 207.836 155.549 1.00 84.37  ?  655  PHE A CG    1 
ATOM   5105  C  CD1   . PHE A 1  655  ? 167.060 206.797 154.948 1.00 88.30  ?  655  PHE A CD1   1 
ATOM   5106  C  CD2   . PHE A 1  655  ? 167.852 209.042 154.869 1.00 88.37  ?  655  PHE A CD2   1 
ATOM   5107  C  CE1   . PHE A 1  655  ? 166.452 206.965 153.703 1.00 90.40  ?  655  PHE A CE1   1 
ATOM   5108  C  CE2   . PHE A 1  655  ? 167.253 209.202 153.620 1.00 92.87  ?  655  PHE A CE2   1 
ATOM   5109  C  CZ    . PHE A 1  655  ? 166.553 208.165 153.049 1.00 90.95  ?  655  PHE A CZ    1 
ATOM   5110  N  N     . TRP A 1  656  ? 171.228 208.602 155.758 1.00 75.15  ?  656  TRP A N     1 
ATOM   5111  C  CA    . TRP A 1  656  ? 172.023 209.282 154.750 1.00 75.08  ?  656  TRP A CA    1 
ATOM   5112  C  C     . TRP A 1  656  ? 173.172 208.407 154.272 1.00 78.06  ?  656  TRP A C     1 
ATOM   5113  O  O     . TRP A 1  656  ? 173.304 208.184 153.062 1.00 78.23  ?  656  TRP A O     1 
ATOM   5114  C  CB    . TRP A 1  656  ? 172.502 210.627 155.261 1.00 73.88  ?  656  TRP A CB    1 
ATOM   5115  C  CG    . TRP A 1  656  ? 173.324 211.347 154.246 1.00 76.54  ?  656  TRP A CG    1 
ATOM   5116  C  CD1   . TRP A 1  656  ? 172.871 212.119 153.221 1.00 80.72  ?  656  TRP A CD1   1 
ATOM   5117  C  CD2   . TRP A 1  656  ? 174.742 211.279 154.102 1.00 77.01  ?  656  TRP A CD2   1 
ATOM   5118  N  NE1   . TRP A 1  656  ? 173.925 212.573 152.466 1.00 81.20  ?  656  TRP A NE1   1 
ATOM   5119  C  CE2   . TRP A 1  656  ? 175.087 212.073 152.986 1.00 82.36  ?  656  TRP A CE2   1 
ATOM   5120  C  CE3   . TRP A 1  656  ? 175.760 210.618 154.809 1.00 77.91  ?  656  TRP A CE3   1 
ATOM   5121  C  CZ2   . TRP A 1  656  ? 176.410 212.235 152.566 1.00 82.73  ?  656  TRP A CZ2   1 
ATOM   5122  C  CZ3   . TRP A 1  656  ? 177.072 210.781 154.394 1.00 80.32  ?  656  TRP A CZ3   1 
ATOM   5123  C  CH2   . TRP A 1  656  ? 177.389 211.595 153.295 1.00 82.35  ?  656  TRP A CH2   1 
ATOM   5124  N  N     . LEU A 1  657  ? 173.958 207.876 155.227 1.00 73.57  ?  657  LEU A N     1 
ATOM   5125  C  CA    . LEU A 1  657  ? 175.072 206.974 154.976 1.00 74.12  ?  657  LEU A CA    1 
ATOM   5126  C  C     . LEU A 1  657  ? 174.599 205.654 154.359 1.00 78.75  ?  657  LEU A C     1 
ATOM   5127  O  O     . LEU A 1  657  ? 175.350 205.062 153.597 1.00 79.12  ?  657  LEU A O     1 
ATOM   5128  C  CB    . LEU A 1  657  ? 175.868 206.716 156.271 1.00 73.77  ?  657  LEU A CB    1 
ATOM   5129  C  CG    . LEU A 1  657  ? 177.180 205.888 156.162 1.00 79.48  ?  657  LEU A CG    1 
ATOM   5130  C  CD1   . LEU A 1  657  ? 178.297 206.692 155.519 1.00 81.29  ?  657  LEU A CD1   1 
ATOM   5131  C  CD2   . LEU A 1  657  ? 177.640 205.379 157.515 1.00 80.39  ?  657  LEU A CD2   1 
ATOM   5132  N  N     . LEU A 1  658  ? 173.369 205.192 154.650 1.00 75.92  ?  658  LEU A N     1 
ATOM   5133  C  CA    . LEU A 1  658  ? 172.881 203.957 154.023 1.00 76.50  ?  658  LEU A CA    1 
ATOM   5134  C  C     . LEU A 1  658  ? 172.905 204.125 152.514 1.00 82.81  ?  658  LEU A C     1 
ATOM   5135  O  O     . LEU A 1  658  ? 173.300 203.200 151.800 1.00 82.19  ?  658  LEU A O     1 
ATOM   5136  C  CB    . LEU A 1  658  ? 171.452 203.591 154.473 1.00 75.94  ?  658  LEU A CB    1 
ATOM   5137  C  CG    . LEU A 1  658  ? 170.752 202.492 153.646 1.00 81.20  ?  658  LEU A CG    1 
ATOM   5138  C  CD1   . LEU A 1  658  ? 171.023 201.132 154.200 1.00 80.68  ?  658  LEU A CD1   1 
ATOM   5139  C  CD2   . LEU A 1  658  ? 169.268 202.680 153.624 1.00 84.98  ?  658  LEU A CD2   1 
ATOM   5140  N  N     . HIS A 1  659  ? 172.512 205.331 152.051 1.00 81.42  ?  659  HIS A N     1 
ATOM   5141  C  CA    . HIS A 1  659  ? 172.431 205.687 150.641 1.00 82.93  ?  659  HIS A CA    1 
ATOM   5142  C  C     . HIS A 1  659  ? 173.678 206.249 150.061 1.00 85.69  ?  659  HIS A C     1 
ATOM   5143  O  O     . HIS A 1  659  ? 173.883 206.085 148.861 1.00 87.35  ?  659  HIS A O     1 
ATOM   5144  C  CB    . HIS A 1  659  ? 171.208 206.540 150.342 1.00 84.83  ?  659  HIS A CB    1 
ATOM   5145  C  CG    . HIS A 1  659  ? 169.960 205.807 150.669 1.00 88.10  ?  659  HIS A CG    1 
ATOM   5146  N  ND1   . HIS A 1  659  ? 169.438 204.871 149.800 1.00 90.57  ?  659  HIS A ND1   1 
ATOM   5147  C  CD2   . HIS A 1  659  ? 169.249 205.790 151.820 1.00 89.09  ?  659  HIS A CD2   1 
ATOM   5148  C  CE1   . HIS A 1  659  ? 168.397 204.343 150.430 1.00 89.33  ?  659  HIS A CE1   1 
ATOM   5149  N  NE2   . HIS A 1  659  ? 168.233 204.879 151.641 1.00 88.77  ?  659  HIS A NE2   1 
ATOM   5150  N  N     . ASN A 1  660  ? 174.534 206.868 150.884 1.00 79.84  ?  660  ASN A N     1 
ATOM   5151  C  CA    . ASN A 1  660  ? 175.830 207.363 150.415 1.00 79.93  ?  660  ASN A CA    1 
ATOM   5152  C  C     . ASN A 1  660  ? 176.833 206.196 150.284 1.00 82.70  ?  660  ASN A C     1 
ATOM   5153  O  O     . ASN A 1  660  ? 177.649 206.165 149.353 1.00 82.08  ?  660  ASN A O     1 
ATOM   5154  C  CB    . ASN A 1  660  ? 176.399 208.404 151.374 1.00 77.97  ?  660  ASN A CB    1 
ATOM   5155  C  CG    . ASN A 1  660  ? 177.612 209.084 150.808 1.00 95.94  ?  660  ASN A CG    1 
ATOM   5156  O  OD1   . ASN A 1  660  ? 177.514 210.140 150.175 1.00 91.73  ?  660  ASN A OD1   1 
ATOM   5157  N  ND2   . ASN A 1  660  ? 178.779 208.464 150.970 1.00 84.10  ?  660  ASN A ND2   1 
ATOM   5158  N  N     . GLY A 1  661  ? 176.770 205.284 151.259 1.00 78.15  ?  661  GLY A N     1 
ATOM   5159  C  CA    . GLY A 1  661  ? 177.661 204.141 151.404 1.00 76.88  ?  661  GLY A CA    1 
ATOM   5160  C  C     . GLY A 1  661  ? 179.002 204.586 151.953 1.00 78.29  ?  661  GLY A C     1 
ATOM   5161  O  O     . GLY A 1  661  ? 179.334 205.779 151.915 1.00 78.41  ?  661  GLY A O     1 
ATOM   5162  N  N     . PHE A 1  662  ? 179.770 203.629 152.484 1.00 72.01  ?  662  PHE A N     1 
ATOM   5163  C  CA    . PHE A 1  662  ? 181.125 203.842 152.982 1.00 71.35  ?  662  PHE A CA    1 
ATOM   5164  C  C     . PHE A 1  662  ? 181.817 202.492 153.058 1.00 76.13  ?  662  PHE A C     1 
ATOM   5165  O  O     . PHE A 1  662  ? 181.222 201.526 153.528 1.00 73.46  ?  662  PHE A O     1 
ATOM   5166  C  CB    . PHE A 1  662  ? 181.151 204.580 154.332 1.00 71.92  ?  662  PHE A CB    1 
ATOM   5167  C  CG    . PHE A 1  662  ? 182.542 204.897 154.828 1.00 73.51  ?  662  PHE A CG    1 
ATOM   5168  C  CD1   . PHE A 1  662  ? 183.214 206.026 154.385 1.00 78.24  ?  662  PHE A CD1   1 
ATOM   5169  C  CD2   . PHE A 1  662  ? 183.183 204.064 155.738 1.00 74.84  ?  662  PHE A CD2   1 
ATOM   5170  C  CE1   . PHE A 1  662  ? 184.514 206.311 154.836 1.00 79.39  ?  662  PHE A CE1   1 
ATOM   5171  C  CE2   . PHE A 1  662  ? 184.481 204.346 156.182 1.00 77.77  ?  662  PHE A CE2   1 
ATOM   5172  C  CZ    . PHE A 1  662  ? 185.139 205.467 155.731 1.00 76.78  ?  662  PHE A CZ    1 
ATOM   5173  N  N     . SER A 1  663  ? 183.059 202.415 152.559 1.00 76.27  ?  663  SER A N     1 
ATOM   5174  C  CA    . SER A 1  663  ? 183.836 201.171 152.568 1.00 77.20  ?  663  SER A CA    1 
ATOM   5175  C  C     . SER A 1  663  ? 185.276 201.439 153.021 1.00 84.64  ?  663  SER A C     1 
ATOM   5176  O  O     . SER A 1  663  ? 185.577 202.564 153.430 1.00 85.48  ?  663  SER A O     1 
ATOM   5177  C  CB    . SER A 1  663  ? 183.825 200.536 151.179 1.00 81.14  ?  663  SER A CB    1 
ATOM   5178  O  OG    . SER A 1  663  ? 184.437 199.255 151.184 1.00 86.21  ?  663  SER A OG    1 
ATOM   5179  N  N     . THR A 1  664  ? 186.148 200.396 152.991 1.00 81.41  ?  664  THR A N     1 
ATOM   5180  C  CA    . THR A 1  664  ? 187.584 200.458 153.299 1.00 81.11  ?  664  THR A CA    1 
ATOM   5181  C  C     . THR A 1  664  ? 188.305 199.265 152.661 1.00 86.46  ?  664  THR A C     1 
ATOM   5182  O  O     . THR A 1  664  ? 187.833 198.137 152.821 1.00 86.78  ?  664  THR A O     1 
ATOM   5183  C  CB    . THR A 1  664  ? 187.859 200.787 154.769 1.00 81.00  ?  664  THR A CB    1 
ATOM   5184  O  OG1   . THR A 1  664  ? 189.071 201.519 154.826 1.00 84.09  ?  664  THR A OG1   1 
ATOM   5185  C  CG2   . THR A 1  664  ? 187.936 199.581 155.646 1.00 75.60  ?  664  THR A CG2   1 
ATOM   5186  N  N     . GLY A 1  665  ? 189.360 199.524 151.880 1.00 83.74  ?  665  GLY A N     1 
ATOM   5187  C  CA    . GLY A 1  665  ? 190.084 198.486 151.141 1.00 84.50  ?  665  GLY A CA    1 
ATOM   5188  C  C     . GLY A 1  665  ? 191.592 198.523 151.253 1.00 89.43  ?  665  GLY A C     1 
ATOM   5189  O  O     . GLY A 1  665  ? 192.120 199.377 151.974 1.00 89.96  ?  665  GLY A O     1 
ATOM   5190  N  N     . ILE A 1  666  ? 192.312 197.589 150.543 1.00 85.45  ?  666  ILE A N     1 
ATOM   5191  C  CA    . ILE A 1  666  ? 193.798 197.568 150.574 1.00 85.16  ?  666  ILE A CA    1 
ATOM   5192  C  C     . ILE A 1  666  ? 194.316 198.838 149.953 1.00 90.85  ?  666  ILE A C     1 
ATOM   5193  O  O     . ILE A 1  666  ? 195.327 199.367 150.413 1.00 90.56  ?  666  ILE A O     1 
ATOM   5194  C  CB    . ILE A 1  666  ? 194.563 196.333 149.994 1.00 87.91  ?  666  ILE A CB    1 
ATOM   5195  C  CG1   . ILE A 1  666  ? 193.685 195.316 149.307 1.00 88.65  ?  666  ILE A CG1   1 
ATOM   5196  C  CG2   . ILE A 1  666  ? 195.562 195.719 150.970 1.00 86.08  ?  666  ILE A CG2   1 
ATOM   5197  C  CD1   . ILE A 1  666  ? 193.470 195.677 147.885 1.00 102.05 ?  666  ILE A CD1   1 
ATOM   5198  N  N     . GLY A 1  667  ? 193.589 199.350 148.957 1.00 88.84  ?  667  GLY A N     1 
ATOM   5199  C  CA    . GLY A 1  667  ? 193.935 200.598 148.286 1.00 90.33  ?  667  GLY A CA    1 
ATOM   5200  C  C     . GLY A 1  667  ? 194.147 201.783 149.223 1.00 93.17  ?  667  GLY A C     1 
ATOM   5201  O  O     . GLY A 1  667  ? 194.886 202.730 148.888 1.00 93.83  ?  667  GLY A O     1 
ATOM   5202  N  N     . ASP A 1  668  ? 193.480 201.722 150.407 1.00 86.29  ?  668  ASP A N     1 
ATOM   5203  C  CA    . ASP A 1  668  ? 193.535 202.723 151.458 1.00 84.75  ?  668  ASP A CA    1 
ATOM   5204  C  C     . ASP A 1  668  ? 194.828 202.627 152.283 1.00 89.98  ?  668  ASP A C     1 
ATOM   5205  O  O     . ASP A 1  668  ? 195.184 203.603 152.947 1.00 89.01  ?  668  ASP A O     1 
ATOM   5206  C  CB    . ASP A 1  668  ? 192.268 202.676 152.328 1.00 84.43  ?  668  ASP A CB    1 
ATOM   5207  C  CG    . ASP A 1  668  ? 190.993 203.033 151.580 1.00 86.42  ?  668  ASP A CG    1 
ATOM   5208  O  OD1   . ASP A 1  668  ? 190.828 204.216 151.214 1.00 85.64  ?  668  ASP A OD1   1 
ATOM   5209  O  OD2   . ASP A 1  668  ? 190.151 202.139 151.387 1.00 89.26  -1 668  ASP A OD2   1 
ATOM   5210  N  N     . THR A 1  669  ? 195.552 201.473 152.215 1.00 88.38  ?  669  THR A N     1 
ATOM   5211  C  CA    . THR A 1  669  ? 196.852 201.261 152.894 1.00 88.86  ?  669  THR A CA    1 
ATOM   5212  C  C     . THR A 1  669  ? 197.999 201.631 151.944 1.00 96.36  ?  669  THR A C     1 
ATOM   5213  O  O     . THR A 1  669  ? 199.102 201.932 152.395 1.00 97.34  ?  669  THR A O     1 
ATOM   5214  C  CB    . THR A 1  669  ? 197.055 199.794 153.367 1.00 94.96  ?  669  THR A CB    1 
ATOM   5215  O  OG1   . THR A 1  669  ? 197.211 198.923 152.245 1.00 94.25  ?  669  THR A OG1   1 
ATOM   5216  C  CG2   . THR A 1  669  ? 195.957 199.294 154.308 1.00 91.62  ?  669  THR A CG2   1 
ATOM   5217  N  N     . ILE A 1  670  ? 197.744 201.555 150.624 1.00 94.04  ?  670  ILE A N     1 
ATOM   5218  C  CA    . ILE A 1  670  ? 198.705 201.848 149.562 1.00 94.88  ?  670  ILE A CA    1 
ATOM   5219  C  C     . ILE A 1  670  ? 199.076 203.313 149.539 1.00 99.51  ?  670  ILE A C     1 
ATOM   5220  O  O     . ILE A 1  670  ? 198.192 204.173 149.538 1.00 98.62  ?  670  ILE A O     1 
ATOM   5221  C  CB    . ILE A 1  670  ? 198.139 201.353 148.211 1.00 98.32  ?  670  ILE A CB    1 
ATOM   5222  C  CG1   . ILE A 1  670  ? 198.342 199.841 148.094 1.00 98.29  ?  670  ILE A CG1   1 
ATOM   5223  C  CG2   . ILE A 1  670  ? 198.767 202.075 147.020 1.00 100.87 ?  670  ILE A CG2   1 
ATOM   5224  C  CD1   . ILE A 1  670  ? 197.230 199.120 147.481 1.00 105.10 ?  670  ILE A CD1   1 
ATOM   5225  N  N     . ALA A 1  671  ? 200.387 203.586 149.528 1.00 97.58  ?  671  ALA A N     1 
ATOM   5226  C  CA    . ALA A 1  671  ? 200.920 204.945 149.435 1.00 98.67  ?  671  ALA A CA    1 
ATOM   5227  C  C     . ALA A 1  671  ? 201.715 205.098 148.127 1.00 105.73 ?  671  ALA A C     1 
ATOM   5228  O  O     . ALA A 1  671  ? 202.306 204.118 147.656 1.00 106.14 ?  671  ALA A O     1 
ATOM   5229  C  CB    . ALA A 1  671  ? 201.806 205.236 150.629 1.00 98.86  ?  671  ALA A CB    1 
ATOM   5230  N  N     . ASP A 1  672  ? 201.713 206.325 147.545 1.00 103.65 ?  672  ASP A N     1 
ATOM   5231  C  CA    . ASP A 1  672  ? 202.395 206.746 146.302 1.00 105.32 ?  672  ASP A CA    1 
ATOM   5232  C  C     . ASP A 1  672  ? 203.718 206.045 146.030 1.00 112.19 ?  672  ASP A C     1 
ATOM   5233  O  O     . ASP A 1  672  ? 204.454 205.737 146.969 1.00 111.86 ?  672  ASP A O     1 
ATOM   5234  C  CB    . ASP A 1  672  ? 202.717 208.242 146.391 1.00 107.26 ?  672  ASP A CB    1 
ATOM   5235  C  CG    . ASP A 1  672  ? 202.161 209.138 145.313 1.00 118.26 ?  672  ASP A CG    1 
ATOM   5236  O  OD1   . ASP A 1  672  ? 200.979 208.966 144.950 1.00 119.77 ?  672  ASP A OD1   1 
ATOM   5237  O  OD2   . ASP A 1  672  ? 202.854 210.109 144.937 1.00 123.39 -1 672  ASP A OD2   1 
ATOM   5238  N  N     . GLY A 1  673  ? 204.039 205.872 144.747 1.00 111.43 ?  673  GLY A N     1 
ATOM   5239  C  CA    . GLY A 1  673  ? 205.318 205.330 144.286 1.00 112.96 ?  673  GLY A CA    1 
ATOM   5240  C  C     . GLY A 1  673  ? 206.492 206.164 144.789 1.00 117.90 ?  673  GLY A C     1 
ATOM   5241  O  O     . GLY A 1  673  ? 207.357 205.628 145.491 1.00 117.82 ?  673  GLY A O     1 
ATOM   5242  N  N     . PRO A 1  674  ? 206.517 207.501 144.539 1.00 114.51 ?  674  PRO A N     1 
ATOM   5243  C  CA    . PRO A 1  674  ? 207.587 208.331 145.103 1.00 114.75 ?  674  PRO A CA    1 
ATOM   5244  C  C     . PRO A 1  674  ? 207.552 208.460 146.640 1.00 116.16 ?  674  PRO A C     1 
ATOM   5245  O  O     . PRO A 1  674  ? 208.619 208.617 147.242 1.00 116.00 ?  674  PRO A O     1 
ATOM   5246  C  CB    . PRO A 1  674  ? 207.365 209.679 144.425 1.00 117.87 ?  674  PRO A CB    1 
ATOM   5247  C  CG    . PRO A 1  674  ? 205.927 209.716 144.130 1.00 121.61 ?  674  PRO A CG    1 
ATOM   5248  C  CD    . PRO A 1  674  ? 205.590 208.322 143.734 1.00 116.65 ?  674  PRO A CD    1 
ATOM   5249  N  N     . THR A 1  675  ? 206.351 208.402 147.278 1.00 110.50 ?  675  THR A N     1 
ATOM   5250  C  CA    . THR A 1  675  ? 206.260 208.474 148.744 1.00 108.94 ?  675  THR A CA    1 
ATOM   5251  C  C     . THR A 1  675  ? 206.937 207.246 149.342 1.00 113.93 ?  675  THR A C     1 
ATOM   5252  O  O     . THR A 1  675  ? 207.618 207.363 150.356 1.00 113.88 ?  675  THR A O     1 
ATOM   5253  C  CB    . THR A 1  675  ? 204.829 208.717 149.239 1.00 113.64 ?  675  THR A CB    1 
ATOM   5254  O  OG1   . THR A 1  675  ? 204.340 209.904 148.624 1.00 115.96 ?  675  THR A OG1   1 
ATOM   5255  C  CG2   . THR A 1  675  ? 204.741 208.880 150.762 1.00 108.64 ?  675  THR A CG2   1 
ATOM   5256  N  N     . MET A 1  676  ? 206.827 206.096 148.664 1.00 111.28 ?  676  MET A N     1 
ATOM   5257  C  CA    . MET A 1  676  ? 207.480 204.855 149.077 1.00 111.01 ?  676  MET A CA    1 
ATOM   5258  C  C     . MET A 1  676  ? 209.011 204.918 148.924 1.00 114.90 ?  676  MET A C     1 
ATOM   5259  O  O     . MET A 1  676  ? 209.730 204.383 149.771 1.00 113.65 ?  676  MET A O     1 
ATOM   5260  C  CB    . MET A 1  676  ? 206.868 203.644 148.361 1.00 113.48 ?  676  MET A CB    1 
ATOM   5261  C  CG    . MET A 1  676  ? 205.527 203.229 148.936 1.00 115.70 ?  676  MET A CG    1 
ATOM   5262  S  SD    . MET A 1  676  ? 205.655 202.740 150.677 1.00 118.73 ?  676  MET A SD    1 
ATOM   5263  C  CE    . MET A 1  676  ? 204.500 201.265 150.709 1.00 114.65 ?  676  MET A CE    1 
ATOM   5264  N  N     . ARG A 1  677  ? 209.500 205.607 147.877 1.00 112.59 ?  677  ARG A N     1 
ATOM   5265  C  CA    . ARG A 1  677  ? 210.924 205.847 147.642 1.00 113.66 ?  677  ARG A CA    1 
ATOM   5266  C  C     . ARG A 1  677  ? 211.412 206.748 148.778 1.00 114.34 ?  677  ARG A C     1 
ATOM   5267  O  O     . ARG A 1  677  ? 212.403 206.416 149.427 1.00 113.13 ?  677  ARG A O     1 
ATOM   5268  C  CB    . ARG A 1  677  ? 211.122 206.542 146.285 1.00 119.05 ?  677  ARG A CB    1 
ATOM   5269  C  CG    . ARG A 1  677  ? 212.561 207.008 145.960 1.00 141.23 ?  677  ARG A CG    1 
ATOM   5270  C  CD    . ARG A 1  677  ? 212.658 207.877 144.699 1.00 162.16 ?  677  ARG A CD    1 
ATOM   5271  N  NE    . ARG A 1  677  ? 211.646 207.516 143.696 1.00 178.66 ?  677  ARG A NE    1 
ATOM   5272  C  CZ    . ARG A 1  677  ? 210.680 208.327 143.275 1.00 194.95 ?  677  ARG A CZ    1 
ATOM   5273  N  NH1   . ARG A 1  677  ? 210.610 209.577 143.721 1.00 182.95 1  677  ARG A NH1   1 
ATOM   5274  N  NH2   . ARG A 1  677  ? 209.784 207.898 142.394 1.00 180.69 ?  677  ARG A NH2   1 
ATOM   5275  N  N     . GLU A 1  678  ? 210.665 207.854 149.046 1.00 109.48 ?  678  GLU A N     1 
ATOM   5276  C  CA    . GLU A 1  678  ? 210.944 208.823 150.107 1.00 108.51 ?  678  GLU A CA    1 
ATOM   5277  C  C     . GLU A 1  678  ? 210.952 208.175 151.500 1.00 109.20 ?  678  GLU A C     1 
ATOM   5278  O  O     . GLU A 1  678  ? 211.777 208.559 152.327 1.00 108.11 ?  678  GLU A O     1 
ATOM   5279  C  CB    . GLU A 1  678  ? 209.980 210.019 150.048 1.00 109.89 ?  678  GLU A CB    1 
ATOM   5280  C  CG    . GLU A 1  678  ? 210.570 211.295 150.642 1.00 126.34 ?  678  GLU A CG    1 
ATOM   5281  C  CD    . GLU A 1  678  ? 209.638 212.469 150.914 1.00 158.10 ?  678  GLU A CD    1 
ATOM   5282  O  OE1   . GLU A 1  678  ? 208.415 212.340 150.672 1.00 161.51 ?  678  GLU A OE1   1 
ATOM   5283  O  OE2   . GLU A 1  678  ? 210.132 213.512 151.405 1.00 146.80 -1 678  GLU A OE2   1 
ATOM   5284  N  N     . ILE A 1  679  ? 210.064 207.177 151.745 1.00 104.34 ?  679  ILE A N     1 
ATOM   5285  C  CA    . ILE A 1  679  ? 209.995 206.438 153.013 1.00 102.45 ?  679  ILE A CA    1 
ATOM   5286  C  C     . ILE A 1  679  ? 211.212 205.536 153.139 1.00 109.71 ?  679  ILE A C     1 
ATOM   5287  O  O     . ILE A 1  679  ? 211.906 205.589 154.153 1.00 109.25 ?  679  ILE A O     1 
ATOM   5288  C  CB    . ILE A 1  679  ? 208.663 205.666 153.181 1.00 103.29 ?  679  ILE A CB    1 
ATOM   5289  C  CG1   . ILE A 1  679  ? 207.548 206.617 153.624 1.00 102.94 ?  679  ILE A CG1   1 
ATOM   5290  C  CG2   . ILE A 1  679  ? 208.804 204.537 154.192 1.00 102.10 ?  679  ILE A CG2   1 
ATOM   5291  C  CD1   . ILE A 1  679  ? 206.147 206.248 153.162 1.00 110.25 ?  679  ILE A CD1   1 
ATOM   5292  N  N     . THR A 1  680  ? 211.488 204.730 152.098 1.00 109.22 ?  680  THR A N     1 
ATOM   5293  C  CA    . THR A 1  680  ? 212.628 203.820 152.072 1.00 110.61 ?  680  THR A CA    1 
ATOM   5294  C  C     . THR A 1  680  ? 213.906 204.590 152.375 1.00 117.27 ?  680  THR A C     1 
ATOM   5295  O  O     . THR A 1  680  ? 214.651 204.177 153.265 1.00 116.88 ?  680  THR A O     1 
ATOM   5296  C  CB    . THR A 1  680  ? 212.654 203.029 150.760 1.00 122.13 ?  680  THR A CB    1 
ATOM   5297  O  OG1   . THR A 1  680  ? 211.422 202.313 150.626 1.00 120.00 ?  680  THR A OG1   1 
ATOM   5298  C  CG2   . THR A 1  680  ? 213.812 202.053 150.696 1.00 123.58 ?  680  THR A CG2   1 
ATOM   5299  N  N     . GLU A 1  681  ? 214.100 205.757 151.711 1.00 116.24 ?  681  GLU A N     1 
ATOM   5300  C  CA    . GLU A 1  681  ? 215.270 206.617 151.927 1.00 117.64 ?  681  GLU A CA    1 
ATOM   5301  C  C     . GLU A 1  681  ? 215.296 207.367 153.276 1.00 119.33 ?  681  GLU A C     1 
ATOM   5302  O  O     . GLU A 1  681  ? 216.317 207.962 153.609 1.00 120.01 ?  681  GLU A O     1 
ATOM   5303  C  CB    . GLU A 1  681  ? 215.638 207.491 150.690 1.00 121.12 ?  681  GLU A CB    1 
ATOM   5304  C  CG    . GLU A 1  681  ? 214.707 208.657 150.373 1.00 134.60 ?  681  GLU A CG    1 
ATOM   5305  C  CD    . GLU A 1  681  ? 214.683 209.182 148.942 1.00 160.06 ?  681  GLU A CD    1 
ATOM   5306  O  OE1   . GLU A 1  681  ? 214.981 208.406 148.003 1.00 153.12 ?  681  GLU A OE1   1 
ATOM   5307  O  OE2   . GLU A 1  681  ? 214.297 210.360 148.759 1.00 155.06 -1 681  GLU A OE2   1 
ATOM   5308  N  N     . THR A 1  682  ? 214.193 207.316 154.053 1.00 112.85 ?  682  THR A N     1 
ATOM   5309  C  CA    . THR A 1  682  ? 214.104 207.910 155.387 1.00 111.09 ?  682  THR A CA    1 
ATOM   5310  C  C     . THR A 1  682  ? 214.674 206.891 156.346 1.00 114.36 ?  682  THR A C     1 
ATOM   5311  O  O     . THR A 1  682  ? 215.448 207.256 157.229 1.00 113.72 ?  682  THR A O     1 
ATOM   5312  C  CB    . THR A 1  682  ? 212.658 208.290 155.708 1.00 115.64 ?  682  THR A CB    1 
ATOM   5313  O  OG1   . THR A 1  682  ? 212.313 209.394 154.887 1.00 117.71 ?  682  THR A OG1   1 
ATOM   5314  C  CG2   . THR A 1  682  ? 212.434 208.653 157.171 1.00 110.82 ?  682  THR A CG2   1 
ATOM   5315  N  N     . ILE A 1  683  ? 214.296 205.608 156.168 1.00 111.31 ?  683  ILE A N     1 
ATOM   5316  C  CA    . ILE A 1  683  ? 214.794 204.505 156.988 1.00 111.16 ?  683  ILE A CA    1 
ATOM   5317  C  C     . ILE A 1  683  ? 216.287 204.350 156.703 1.00 117.45 ?  683  ILE A C     1 
ATOM   5318  O  O     . ILE A 1  683  ? 217.078 204.276 157.645 1.00 116.80 ?  683  ILE A O     1 
ATOM   5319  C  CB    . ILE A 1  683  ? 214.021 203.168 156.784 1.00 113.61 ?  683  ILE A CB    1 
ATOM   5320  C  CG1   . ILE A 1  683  ? 212.502 203.365 156.858 1.00 113.46 ?  683  ILE A CG1   1 
ATOM   5321  C  CG2   . ILE A 1  683  ? 214.457 202.142 157.823 1.00 113.31 ?  683  ILE A CG2   1 
ATOM   5322  C  CD1   . ILE A 1  683  ? 211.681 202.298 156.058 1.00 125.77 ?  683  ILE A CD1   1 
ATOM   5323  N  N     . ALA A 1  684  ? 216.661 204.365 155.400 1.00 116.00 ?  684  ALA A N     1 
ATOM   5324  C  CA    . ALA A 1  684  ? 218.035 204.229 154.916 1.00 117.52 ?  684  ALA A CA    1 
ATOM   5325  C  C     . ALA A 1  684  ? 219.000 205.179 155.636 1.00 122.24 ?  684  ALA A C     1 
ATOM   5326  O  O     . ALA A 1  684  ? 220.012 204.712 156.173 1.00 121.87 ?  684  ALA A O     1 
ATOM   5327  C  CB    . ALA A 1  684  ? 218.087 204.437 153.408 1.00 119.58 ?  684  ALA A CB    1 
ATOM   5328  N  N     . GLU A 1  685  ? 218.658 206.494 155.708 1.00 119.33 ?  685  GLU A N     1 
ATOM   5329  C  CA    . GLU A 1  685  ? 219.485 207.499 156.393 1.00 119.71 ?  685  GLU A CA    1 
ATOM   5330  C  C     . GLU A 1  685  ? 219.516 207.306 157.909 1.00 120.23 ?  685  GLU A C     1 
ATOM   5331  O  O     . GLU A 1  685  ? 220.576 207.469 158.513 1.00 121.41 ?  685  GLU A O     1 
ATOM   5332  C  CB    . GLU A 1  685  ? 219.213 208.964 155.950 1.00 122.06 ?  685  GLU A CB    1 
ATOM   5333  C  CG    . GLU A 1  685  ? 217.769 209.440 156.063 1.00 137.59 ?  685  GLU A CG    1 
ATOM   5334  C  CD    . GLU A 1  685  ? 217.346 210.229 157.292 1.00 168.00 ?  685  GLU A CD    1 
ATOM   5335  O  OE1   . GLU A 1  685  ? 218.165 211.027 157.808 1.00 176.25 ?  685  GLU A OE1   1 
ATOM   5336  O  OE2   . GLU A 1  685  ? 216.163 210.110 157.688 1.00 158.03 -1 685  GLU A OE2   1 
ATOM   5337  N  N     . ALA A 1  686  ? 218.396 206.882 158.508 1.00 112.52 ?  686  ALA A N     1 
ATOM   5338  C  CA    . ALA A 1  686  ? 218.344 206.594 159.940 1.00 110.17 ?  686  ALA A CA    1 
ATOM   5339  C  C     . ALA A 1  686  ? 219.192 205.334 160.249 1.00 111.40 ?  686  ALA A C     1 
ATOM   5340  O  O     . ALA A 1  686  ? 219.837 205.262 161.300 1.00 110.38 ?  686  ALA A O     1 
ATOM   5341  C  CB    . ALA A 1  686  ? 216.902 206.393 160.384 1.00 109.19 ?  686  ALA A CB    1 
ATOM   5342  N  N     . LYS A 1  687  ? 219.228 204.377 159.308 1.00 106.41 ?  687  LYS A N     1 
ATOM   5343  C  CA    . LYS A 1  687  ? 220.003 203.153 159.462 1.00 105.96 ?  687  LYS A CA    1 
ATOM   5344  C  C     . LYS A 1  687  ? 221.489 203.455 159.557 1.00 111.64 ?  687  LYS A C     1 
ATOM   5345  O  O     . LYS A 1  687  ? 222.183 202.818 160.358 1.00 111.54 ?  687  LYS A O     1 
ATOM   5346  C  CB    . LYS A 1  687  ? 219.712 202.170 158.326 1.00 108.09 ?  687  LYS A CB    1 
ATOM   5347  C  CG    . LYS A 1  687  ? 218.368 201.473 158.464 1.00 106.41 ?  687  LYS A CG    1 
ATOM   5348  C  CD    . LYS A 1  687  ? 218.342 200.150 157.745 1.00 107.38 ?  687  LYS A CD    1 
ATOM   5349  C  CE    . LYS A 1  687  ? 218.788 199.022 158.637 1.00 105.45 ?  687  LYS A CE    1 
ATOM   5350  N  NZ    . LYS A 1  687  ? 218.356 197.714 158.098 1.00 111.47 1  687  LYS A NZ    1 
ATOM   5351  N  N     . LYS A 1  688  ? 221.966 204.448 158.765 1.00 109.22 ?  688  LYS A N     1 
ATOM   5352  C  CA    . LYS A 1  688  ? 223.357 204.910 158.767 1.00 110.20 ?  688  LYS A CA    1 
ATOM   5353  C  C     . LYS A 1  688  ? 223.643 205.673 160.065 1.00 112.94 ?  688  LYS A C     1 
ATOM   5354  O  O     . LYS A 1  688  ? 224.620 205.345 160.733 1.00 113.47 ?  688  LYS A O     1 
ATOM   5355  C  CB    . LYS A 1  688  ? 223.665 205.786 157.541 1.00 114.23 ?  688  LYS A CB    1 
ATOM   5356  C  CG    . LYS A 1  688  ? 225.162 205.918 157.246 1.00 133.04 ?  688  LYS A CG    1 
ATOM   5357  C  CD    . LYS A 1  688  ? 225.599 207.373 157.154 1.00 144.88 ?  688  LYS A CD    1 
ATOM   5358  C  CE    . LYS A 1  688  ? 227.072 207.515 156.857 1.00 155.77 ?  688  LYS A CE    1 
ATOM   5359  N  NZ    . LYS A 1  688  ? 227.491 208.945 156.824 1.00 164.58 1  688  LYS A NZ    1 
ATOM   5360  N  N     . LYS A 1  689  ? 222.773 206.653 160.447 1.00 107.36 ?  689  LYS A N     1 
ATOM   5361  C  CA    . LYS A 1  689  ? 222.860 207.465 161.681 1.00 106.11 ?  689  LYS A CA    1 
ATOM   5362  C  C     . LYS A 1  689  ? 223.123 206.569 162.897 1.00 108.57 ?  689  LYS A C     1 
ATOM   5363  O  O     . LYS A 1  689  ? 223.920 206.919 163.769 1.00 108.29 ?  689  LYS A O     1 
ATOM   5364  C  CB    . LYS A 1  689  ? 221.561 208.269 161.879 1.00 107.38 ?  689  LYS A CB    1 
ATOM   5365  C  CG    . LYS A 1  689  ? 221.669 209.500 162.773 1.00 125.98 ?  689  LYS A CG    1 
ATOM   5366  C  CD    . LYS A 1  689  ? 220.319 210.244 162.833 1.00 141.72 ?  689  LYS A CD    1 
ATOM   5367  C  CE    . LYS A 1  689  ? 220.351 211.570 163.571 1.00 158.23 ?  689  LYS A CE    1 
ATOM   5368  N  NZ    . LYS A 1  689  ? 218.982 212.058 163.923 1.00 165.15 1  689  LYS A NZ    1 
ATOM   5369  N  N     . VAL A 1  690  ? 222.481 205.383 162.907 1.00 104.22 ?  690  VAL A N     1 
ATOM   5370  C  CA    . VAL A 1  690  ? 222.616 204.342 163.923 1.00 102.83 ?  690  VAL A CA    1 
ATOM   5371  C  C     . VAL A 1  690  ? 223.997 203.663 163.839 1.00 109.06 ?  690  VAL A C     1 
ATOM   5372  O  O     . VAL A 1  690  ? 224.670 203.563 164.870 1.00 109.00 ?  690  VAL A O     1 
ATOM   5373  C  CB    . VAL A 1  690  ? 221.412 203.369 163.888 1.00 103.90 ?  690  VAL A CB    1 
ATOM   5374  C  CG1   . VAL A 1  690  ? 221.764 201.997 164.453 1.00 102.92 ?  690  VAL A CG1   1 
ATOM   5375  C  CG2   . VAL A 1  690  ? 220.228 203.977 164.627 1.00 102.05 ?  690  VAL A CG2   1 
ATOM   5376  N  N     . LEU A 1  691  ? 224.432 203.246 162.618 1.00 106.72 ?  691  LEU A N     1 
ATOM   5377  C  CA    . LEU A 1  691  ? 225.753 202.637 162.370 1.00 107.89 ?  691  LEU A CA    1 
ATOM   5378  C  C     . LEU A 1  691  ? 226.868 203.607 162.826 1.00 113.64 ?  691  LEU A C     1 
ATOM   5379  O  O     . LEU A 1  691  ? 227.865 203.186 163.421 1.00 113.03 ?  691  LEU A O     1 
ATOM   5380  C  CB    . LEU A 1  691  ? 225.905 202.273 160.868 1.00 108.62 ?  691  LEU A CB    1 
ATOM   5381  C  CG    . LEU A 1  691  ? 227.312 201.920 160.347 1.00 113.96 ?  691  LEU A CG    1 
ATOM   5382  C  CD1   . LEU A 1  691  ? 227.286 200.684 159.493 1.00 113.21 ?  691  LEU A CD1   1 
ATOM   5383  C  CD2   . LEU A 1  691  ? 227.928 203.089 159.571 1.00 118.89 ?  691  LEU A CD2   1 
ATOM   5384  N  N     . ASP A 1  692  ? 226.659 204.902 162.552 1.00 111.94 ?  692  ASP A N     1 
ATOM   5385  C  CA    . ASP A 1  692  ? 227.554 205.994 162.900 1.00 113.66 ?  692  ASP A CA    1 
ATOM   5386  C  C     . ASP A 1  692  ? 227.756 206.099 164.419 1.00 117.49 ?  692  ASP A C     1 
ATOM   5387  O  O     . ASP A 1  692  ? 228.900 206.211 164.865 1.00 118.90 ?  692  ASP A O     1 
ATOM   5388  C  CB    . ASP A 1  692  ? 227.067 207.312 162.259 1.00 116.16 ?  692  ASP A CB    1 
ATOM   5389  C  CG    . ASP A 1  692  ? 227.238 207.394 160.735 1.00 128.98 ?  692  ASP A CG    1 
ATOM   5390  O  OD1   . ASP A 1  692  ? 227.645 206.369 160.111 1.00 128.96 ?  692  ASP A OD1   1 
ATOM   5391  O  OD2   . ASP A 1  692  ? 226.972 208.481 160.164 1.00 136.63 -1 692  ASP A OD2   1 
ATOM   5392  N  N     . VAL A 1  693  ? 226.669 205.976 165.206 1.00 111.59 ?  693  VAL A N     1 
ATOM   5393  C  CA    . VAL A 1  693  ? 226.743 205.988 166.672 1.00 110.33 ?  693  VAL A CA    1 
ATOM   5394  C  C     . VAL A 1  693  ? 227.367 204.683 167.175 1.00 115.60 ?  693  VAL A C     1 
ATOM   5395  O  O     . VAL A 1  693  ? 228.048 204.696 168.204 1.00 115.84 ?  693  VAL A O     1 
ATOM   5396  C  CB    . VAL A 1  693  ? 225.375 206.302 167.322 1.00 111.73 ?  693  VAL A CB    1 
ATOM   5397  C  CG1   . VAL A 1  693  ? 225.417 206.162 168.847 1.00 110.30 ?  693  VAL A CG1   1 
ATOM   5398  C  CG2   . VAL A 1  693  ? 224.922 207.699 166.933 1.00 111.78 ?  693  VAL A CG2   1 
ATOM   5399  N  N     . THR A 1  694  ? 227.157 203.569 166.430 1.00 112.29 ?  694  THR A N     1 
ATOM   5400  C  CA    . THR A 1  694  ? 227.712 202.255 166.756 1.00 112.22 ?  694  THR A CA    1 
ATOM   5401  C  C     . THR A 1  694  ? 229.210 202.271 166.534 1.00 118.31 ?  694  THR A C     1 
ATOM   5402  O  O     . THR A 1  694  ? 229.953 201.886 167.434 1.00 118.64 ?  694  THR A O     1 
ATOM   5403  C  CB    . THR A 1  694  ? 227.016 201.128 165.991 1.00 120.16 ?  694  THR A CB    1 
ATOM   5404  O  OG1   . THR A 1  694  ? 225.600 201.238 166.165 1.00 118.40 ?  694  THR A OG1   1 
ATOM   5405  C  CG2   . THR A 1  694  ? 227.484 199.748 166.443 1.00 119.38 ?  694  THR A CG2   1 
ATOM   5406  N  N     . LYS A 1  695  ? 229.659 202.761 165.365 1.00 116.05 ?  695  LYS A N     1 
ATOM   5407  C  CA    . LYS A 1  695  ? 231.084 202.866 165.057 1.00 117.58 ?  695  LYS A CA    1 
ATOM   5408  C  C     . LYS A 1  695  ? 231.771 203.754 166.090 1.00 122.65 ?  695  LYS A C     1 
ATOM   5409  O  O     . LYS A 1  695  ? 232.823 203.379 166.604 1.00 123.28 ?  695  LYS A O     1 
ATOM   5410  C  CB    . LYS A 1  695  ? 231.313 203.356 163.613 1.00 120.82 ?  695  LYS A CB    1 
ATOM   5411  C  CG    . LYS A 1  695  ? 231.146 202.266 162.541 1.00 127.49 ?  695  LYS A CG    1 
ATOM   5412  C  CD    . LYS A 1  695  ? 232.291 201.247 162.542 1.00 135.17 ?  695  LYS A CD    1 
ATOM   5413  C  CE    . LYS A 1  695  ? 232.102 200.120 161.559 1.00 145.19 ?  695  LYS A CE    1 
ATOM   5414  N  NZ    . LYS A 1  695  ? 233.286 199.215 161.531 1.00 157.69 1  695  LYS A NZ    1 
ATOM   5415  N  N     . GLU A 1  696  ? 231.112 204.866 166.470 1.00 119.50 ?  696  GLU A N     1 
ATOM   5416  C  CA    . GLU A 1  696  ? 231.544 205.830 167.490 1.00 120.27 ?  696  GLU A CA    1 
ATOM   5417  C  C     . GLU A 1  696  ? 231.699 205.166 168.878 1.00 123.71 ?  696  GLU A C     1 
ATOM   5418  O  O     . GLU A 1  696  ? 232.610 205.520 169.629 1.00 124.47 ?  696  GLU A O     1 
ATOM   5419  C  CB    . GLU A 1  696  ? 230.512 206.972 167.567 1.00 121.15 ?  696  GLU A CB    1 
ATOM   5420  C  CG    . GLU A 1  696  ? 230.948 208.216 168.322 1.00 136.12 ?  696  GLU A CG    1 
ATOM   5421  C  CD    . GLU A 1  696  ? 229.913 209.324 168.274 1.00 163.80 ?  696  GLU A CD    1 
ATOM   5422  O  OE1   . GLU A 1  696  ? 229.828 210.009 167.228 1.00 164.41 ?  696  GLU A OE1   1 
ATOM   5423  O  OE2   . GLU A 1  696  ? 229.174 209.498 169.271 1.00 156.13 -1 696  GLU A OE2   1 
ATOM   5424  N  N     . ALA A 1  697  ? 230.804 204.221 169.215 1.00 118.38 ?  697  ALA A N     1 
ATOM   5425  C  CA    . ALA A 1  697  ? 230.806 203.517 170.493 1.00 117.21 ?  697  ALA A CA    1 
ATOM   5426  C  C     . ALA A 1  697  ? 231.856 202.413 170.543 1.00 122.44 ?  697  ALA A C     1 
ATOM   5427  O  O     . ALA A 1  697  ? 232.412 202.140 171.608 1.00 121.31 ?  697  ALA A O     1 
ATOM   5428  C  CB    . ALA A 1  697  ? 229.427 202.948 170.772 1.00 116.08 ?  697  ALA A CB    1 
ATOM   5429  N  N     . GLN A 1  698  ? 232.117 201.774 169.394 1.00 121.65 ?  698  GLN A N     1 
ATOM   5430  C  CA    . GLN A 1  698  ? 233.104 200.696 169.257 1.00 123.60 ?  698  GLN A CA    1 
ATOM   5431  C  C     . GLN A 1  698  ? 234.536 201.246 169.317 1.00 131.05 ?  698  GLN A C     1 
ATOM   5432  O  O     . GLN A 1  698  ? 235.463 200.549 169.740 1.00 130.59 ?  698  GLN A O     1 
ATOM   5433  C  CB    . GLN A 1  698  ? 232.867 199.905 167.959 1.00 125.31 ?  698  GLN A CB    1 
ATOM   5434  C  CG    . GLN A 1  698  ? 231.565 199.094 167.964 1.00 134.03 ?  698  GLN A CG    1 
ATOM   5435  C  CD    . GLN A 1  698  ? 231.115 198.667 166.587 1.00 145.81 ?  698  GLN A CD    1 
ATOM   5436  O  OE1   . GLN A 1  698  ? 231.271 199.381 165.584 1.00 140.33 ?  698  GLN A OE1   1 
ATOM   5437  N  NE2   . GLN A 1  698  ? 230.511 197.496 166.519 1.00 135.40 ?  698  GLN A NE2   1 
ATOM   5438  N  N     . ALA A 1  699  ? 234.690 202.520 168.924 1.00 130.20 ?  699  ALA A N     1 
ATOM   5439  C  CA    . ALA A 1  699  ? 235.946 203.249 168.932 1.00 132.59 ?  699  ALA A CA    1 
ATOM   5440  C  C     . ALA A 1  699  ? 236.191 203.980 170.281 1.00 139.22 ?  699  ALA A C     1 
ATOM   5441  O  O     . ALA A 1  699  ? 237.169 204.725 170.399 1.00 140.94 ?  699  ALA A O     1 
ATOM   5442  C  CB    . ALA A 1  699  ? 235.978 204.220 167.764 1.00 134.19 ?  699  ALA A CB    1 
ATOM   5443  N  N     . ASN A 1  700  ? 235.323 203.730 171.306 1.00 135.31 ?  700  ASN A N     1 
ATOM   5444  C  CA    . ASN A 1  700  ? 235.391 204.277 172.680 1.00 135.26 ?  700  ASN A CA    1 
ATOM   5445  C  C     . ASN A 1  700  ? 235.358 205.825 172.771 1.00 141.64 ?  700  ASN A C     1 
ATOM   5446  O  O     . ASN A 1  700  ? 235.768 206.396 173.786 1.00 142.08 ?  700  ASN A O     1 
ATOM   5447  C  CB    . ASN A 1  700  ? 236.591 203.672 173.450 1.00 135.50 ?  700  ASN A CB    1 
ATOM   5448  C  CG    . ASN A 1  700  ? 236.531 203.717 174.966 1.00 153.56 ?  700  ASN A CG    1 
ATOM   5449  O  OD1   . ASN A 1  700  ? 235.525 204.089 175.586 1.00 143.71 ?  700  ASN A OD1   1 
ATOM   5450  N  ND2   . ASN A 1  700  ? 237.630 203.333 175.598 1.00 147.25 ?  700  ASN A ND2   1 
ATOM   5451  N  N     . LEU A 1  701  ? 234.831 206.496 171.727 1.00 138.86 ?  701  LEU A N     1 
ATOM   5452  C  CA    . LEU A 1  701  ? 234.735 207.963 171.647 1.00 138.96 ?  701  LEU A CA    1 
ATOM   5453  C  C     . LEU A 1  701  ? 233.439 208.507 172.265 1.00 142.32 ?  701  LEU A C     1 
ATOM   5454  O  O     . LEU A 1  701  ? 233.356 209.701 172.577 1.00 141.72 ?  701  LEU A O     1 
ATOM   5455  C  CB    . LEU A 1  701  ? 234.880 208.427 170.191 1.00 139.57 ?  701  LEU A CB    1 
ATOM   5456  C  CG    . LEU A 1  701  ? 235.979 207.753 169.380 1.00 145.09 ?  701  LEU A CG    1 
ATOM   5457  C  CD1   . LEU A 1  701  ? 235.714 207.884 167.912 1.00 145.83 ?  701  LEU A CD1   1 
ATOM   5458  C  CD2   . LEU A 1  701  ? 237.346 208.293 169.733 1.00 148.70 ?  701  LEU A CD2   1 
ATOM   5459  N  N     . LEU A 1  702  ? 232.442 207.619 172.453 1.00 138.52 ?  702  LEU A N     1 
ATOM   5460  C  CA    . LEU A 1  702  ? 231.145 207.925 173.049 1.00 137.54 ?  702  LEU A CA    1 
ATOM   5461  C  C     . LEU A 1  702  ? 231.350 208.375 174.494 1.00 143.37 ?  702  LEU A C     1 
ATOM   5462  O  O     . LEU A 1  702  ? 232.178 207.800 175.210 1.00 143.18 ?  702  LEU A O     1 
ATOM   5463  C  CB    . LEU A 1  702  ? 230.244 206.678 172.999 1.00 136.13 ?  702  LEU A CB    1 
ATOM   5464  C  CG    . LEU A 1  702  ? 228.790 206.876 172.566 1.00 139.01 ?  702  LEU A CG    1 
ATOM   5465  C  CD1   . LEU A 1  702  ? 228.631 206.686 171.062 1.00 139.47 ?  702  LEU A CD1   1 
ATOM   5466  C  CD2   . LEU A 1  702  ? 227.887 205.887 173.271 1.00 139.17 ?  702  LEU A CD2   1 
ATOM   5467  N  N     . THR A 1  703  ? 230.627 209.432 174.894 1.00 141.11 ?  703  THR A N     1 
ATOM   5468  C  CA    . THR A 1  703  ? 230.711 210.041 176.223 1.00 141.58 ?  703  THR A CA    1 
ATOM   5469  C  C     . THR A 1  703  ? 229.349 209.963 176.896 1.00 145.70 ?  703  THR A C     1 
ATOM   5470  O  O     . THR A 1  703  ? 228.456 210.739 176.549 1.00 144.71 ?  703  THR A O     1 
ATOM   5471  C  CB    . THR A 1  703  ? 231.227 211.487 176.084 1.00 150.70 ?  703  THR A CB    1 
ATOM   5472  O  OG1   . THR A 1  703  ? 232.436 211.476 175.321 1.00 152.43 ?  703  THR A OG1   1 
ATOM   5473  C  CG2   . THR A 1  703  ? 231.450 212.169 177.429 1.00 148.62 ?  703  THR A CG2   1 
ATOM   5474  N  N     . ALA A 1  704  ? 229.196 209.032 177.858 1.00 143.33 ?  704  ALA A N     1 
ATOM   5475  C  CA    . ALA A 1  704  ? 227.948 208.774 178.596 1.00 142.58 ?  704  ALA A CA    1 
ATOM   5476  C  C     . ALA A 1  704  ? 227.299 209.997 179.265 1.00 148.79 ?  704  ALA A C     1 
ATOM   5477  O  O     . ALA A 1  704  ? 228.010 210.889 179.743 1.00 149.97 ?  704  ALA A O     1 
ATOM   5478  C  CB    . ALA A 1  704  ? 228.165 207.679 179.627 1.00 142.80 ?  704  ALA A CB    1 
ATOM   5479  N  N     . LYS A 1  705  ? 225.943 210.032 179.287 1.00 145.02 ?  705  LYS A N     1 
ATOM   5480  C  CA    . LYS A 1  705  ? 225.140 211.085 179.930 1.00 144.64 ?  705  LYS A CA    1 
ATOM   5481  C  C     . LYS A 1  705  ? 225.210 210.822 181.435 1.00 150.88 ?  705  LYS A C     1 
ATOM   5482  O  O     . LYS A 1  705  ? 225.044 209.660 181.833 1.00 150.60 ?  705  LYS A O     1 
ATOM   5483  C  CB    . LYS A 1  705  ? 223.669 211.005 179.468 1.00 144.36 ?  705  LYS A CB    1 
ATOM   5484  C  CG    . LYS A 1  705  ? 223.440 211.365 178.009 1.00 141.16 ?  705  LYS A CG    1 
ATOM   5485  C  CD    . LYS A 1  705  ? 222.637 210.306 177.275 1.00 136.32 ?  705  LYS A CD    1 
ATOM   5486  C  CE    . LYS A 1  705  ? 222.331 210.720 175.855 1.00 133.18 ?  705  LYS A CE    1 
ATOM   5487  N  NZ    . LYS A 1  705  ? 221.594 209.659 175.120 1.00 132.52 1  705  LYS A NZ    1 
ATOM   5488  N  N     . HIS A 1  706  ? 225.481 211.867 182.271 1.00 148.40 ?  706  HIS A N     1 
ATOM   5489  C  CA    . HIS A 1  706  ? 225.587 211.716 183.738 1.00 147.94 ?  706  HIS A CA    1 
ATOM   5490  C  C     . HIS A 1  706  ? 224.424 210.883 184.307 1.00 148.36 ?  706  HIS A C     1 
ATOM   5491  O  O     . HIS A 1  706  ? 223.252 211.183 184.045 1.00 146.44 ?  706  HIS A O     1 
ATOM   5492  C  CB    . HIS A 1  706  ? 225.727 213.079 184.455 1.00 149.56 ?  706  HIS A CB    1 
ATOM   5493  C  CG    . HIS A 1  706  ? 225.983 212.991 185.938 1.00 153.12 ?  706  HIS A CG    1 
ATOM   5494  N  ND1   . HIS A 1  706  ? 227.255 213.161 186.465 1.00 156.30 ?  706  HIS A ND1   1 
ATOM   5495  C  CD2   . HIS A 1  706  ? 225.113 212.800 186.961 1.00 153.72 ?  706  HIS A CD2   1 
ATOM   5496  C  CE1   . HIS A 1  706  ? 227.120 213.054 187.780 1.00 155.32 ?  706  HIS A CE1   1 
ATOM   5497  N  NE2   . HIS A 1  706  ? 225.851 212.829 188.125 1.00 154.13 ?  706  HIS A NE2   1 
ATOM   5498  N  N     . GLY A 1  707  ? 224.791 209.803 185.000 1.00 143.36 ?  707  GLY A N     1 
ATOM   5499  C  CA    . GLY A 1  707  ? 223.865 208.852 185.606 1.00 140.88 ?  707  GLY A CA    1 
ATOM   5500  C  C     . GLY A 1  707  ? 223.384 207.778 184.651 1.00 141.23 ?  707  GLY A C     1 
ATOM   5501  O  O     . GLY A 1  707  ? 222.217 207.381 184.702 1.00 139.68 ?  707  GLY A O     1 
ATOM   5502  N  N     . MET A 1  708  ? 224.286 207.294 183.777 1.00 136.14 ?  708  MET A N     1 
ATOM   5503  C  CA    . MET A 1  708  ? 223.971 206.268 182.784 1.00 134.27 ?  708  MET A CA    1 
ATOM   5504  C  C     . MET A 1  708  ? 225.220 205.544 182.307 1.00 133.02 ?  708  MET A C     1 
ATOM   5505  O  O     . MET A 1  708  ? 226.264 206.181 182.146 1.00 134.21 ?  708  MET A O     1 
ATOM   5506  C  CB    . MET A 1  708  ? 223.302 206.916 181.567 1.00 137.11 ?  708  MET A CB    1 
ATOM   5507  C  CG    . MET A 1  708  ? 221.912 206.416 181.292 1.00 140.22 ?  708  MET A CG    1 
ATOM   5508  S  SD    . MET A 1  708  ? 221.293 207.089 179.727 1.00 145.46 ?  708  MET A SD    1 
ATOM   5509  C  CE    . MET A 1  708  ? 220.914 208.790 180.232 1.00 142.39 ?  708  MET A CE    1 
ATOM   5510  N  N     . THR A 1  709  ? 225.093 204.224 182.013 1.00 123.90 ?  709  THR A N     1 
ATOM   5511  C  CA    . THR A 1  709  ? 226.156 203.378 181.457 1.00 122.58 ?  709  THR A CA    1 
ATOM   5512  C  C     . THR A 1  709  ? 226.493 203.962 180.082 1.00 123.61 ?  709  THR A C     1 
ATOM   5513  O  O     . THR A 1  709  ? 225.661 204.650 179.485 1.00 121.23 ?  709  THR A O     1 
ATOM   5514  C  CB    . THR A 1  709  ? 225.646 201.911 181.276 1.00 127.79 ?  709  THR A CB    1 
ATOM   5515  O  OG1   . THR A 1  709  ? 225.077 201.411 182.479 1.00 125.83 ?  709  THR A OG1   1 
ATOM   5516  C  CG2   . THR A 1  709  ? 226.708 200.945 180.786 1.00 126.88 ?  709  THR A CG2   1 
ATOM   5517  N  N     . LEU A 1  710  ? 227.704 203.681 179.580 1.00 120.77 ?  710  LEU A N     1 
ATOM   5518  C  CA    . LEU A 1  710  ? 228.127 204.091 178.246 1.00 121.05 ?  710  LEU A CA    1 
ATOM   5519  C  C     . LEU A 1  710  ? 227.161 203.399 177.243 1.00 121.11 ?  710  LEU A C     1 
ATOM   5520  O  O     . LEU A 1  710  ? 226.628 204.047 176.333 1.00 120.49 ?  710  LEU A O     1 
ATOM   5521  C  CB    . LEU A 1  710  ? 229.596 203.658 178.032 1.00 122.92 ?  710  LEU A CB    1 
ATOM   5522  C  CG    . LEU A 1  710  ? 230.461 204.515 177.076 1.00 129.57 ?  710  LEU A CG    1 
ATOM   5523  C  CD1   . LEU A 1  710  ? 230.676 205.939 177.604 1.00 130.33 ?  710  LEU A CD1   1 
ATOM   5524  C  CD2   . LEU A 1  710  ? 231.813 203.852 176.811 1.00 133.02 ?  710  LEU A CD2   1 
ATOM   5525  N  N     . ARG A 1  711  ? 226.850 202.110 177.522 1.00 114.15 ?  711  ARG A N     1 
ATOM   5526  C  CA    . ARG A 1  711  ? 225.921 201.253 176.787 1.00 111.45 ?  711  ARG A CA    1 
ATOM   5527  C  C     . ARG A 1  711  ? 224.472 201.755 176.882 1.00 111.21 ?  711  ARG A C     1 
ATOM   5528  O  O     . ARG A 1  711  ? 223.834 201.928 175.845 1.00 109.90 ?  711  ARG A O     1 
ATOM   5529  C  CB    . ARG A 1  711  ? 226.045 199.801 177.268 1.00 109.34 ?  711  ARG A CB    1 
ATOM   5530  C  CG    . ARG A 1  711  ? 227.448 199.239 177.103 1.00 112.51 ?  711  ARG A CG    1 
ATOM   5531  C  CD    . ARG A 1  711  ? 227.500 197.754 177.375 1.00 115.09 ?  711  ARG A CD    1 
ATOM   5532  N  NE    . ARG A 1  711  ? 228.156 197.027 176.289 1.00 121.28 ?  711  ARG A NE    1 
ATOM   5533  C  CZ    . ARG A 1  711  ? 228.868 195.915 176.453 1.00 141.02 ?  711  ARG A CZ    1 
ATOM   5534  N  NH1   . ARG A 1  711  ? 229.033 195.396 177.663 1.00 130.48 1  711  ARG A NH1   1 
ATOM   5535  N  NH2   . ARG A 1  711  ? 229.423 195.316 175.409 1.00 131.85 ?  711  ARG A NH2   1 
ATOM   5536  N  N     . GLU A 1  712  ? 223.969 202.020 178.117 1.00 105.88 ?  712  GLU A N     1 
ATOM   5537  C  CA    . GLU A 1  712  ? 222.621 202.559 178.377 1.00 104.28 ?  712  GLU A CA    1 
ATOM   5538  C  C     . GLU A 1  712  ? 222.400 203.804 177.505 1.00 109.64 ?  712  GLU A C     1 
ATOM   5539  O  O     . GLU A 1  712  ? 221.365 203.926 176.843 1.00 108.17 ?  712  GLU A O     1 
ATOM   5540  C  CB    . GLU A 1  712  ? 222.450 202.965 179.866 1.00 104.98 ?  712  GLU A CB    1 
ATOM   5541  C  CG    . GLU A 1  712  ? 222.116 201.862 180.870 1.00 112.84 ?  712  GLU A CG    1 
ATOM   5542  C  CD    . GLU A 1  712  ? 221.965 202.269 182.334 1.00 128.15 ?  712  GLU A CD    1 
ATOM   5543  O  OE1   . GLU A 1  712  ? 222.463 203.352 182.722 1.00 118.98 ?  712  GLU A OE1   1 
ATOM   5544  O  OE2   . GLU A 1  712  ? 221.363 201.485 183.105 1.00 119.72 -1 712  GLU A OE2   1 
ATOM   5545  N  N     . SER A 1  713  ? 223.403 204.714 177.506 1.00 108.95 ?  713  SER A N     1 
ATOM   5546  C  CA    . SER A 1  713  ? 223.420 205.965 176.751 1.00 109.86 ?  713  SER A CA    1 
ATOM   5547  C  C     . SER A 1  713  ? 223.300 205.690 175.264 1.00 113.79 ?  713  SER A C     1 
ATOM   5548  O  O     . SER A 1  713  ? 222.487 206.338 174.601 1.00 113.63 ?  713  SER A O     1 
ATOM   5549  C  CB    . SER A 1  713  ? 224.689 206.759 177.048 1.00 115.48 ?  713  SER A CB    1 
ATOM   5550  O  OG    . SER A 1  713  ? 224.614 207.408 178.308 1.00 125.82 ?  713  SER A OG    1 
ATOM   5551  N  N     . PHE A 1  714  ? 224.065 204.697 174.757 1.00 109.58 ?  714  PHE A N     1 
ATOM   5552  C  CA    . PHE A 1  714  ? 224.043 204.293 173.354 1.00 109.37 ?  714  PHE A CA    1 
ATOM   5553  C  C     . PHE A 1  714  ? 222.665 203.773 172.932 1.00 112.12 ?  714  PHE A C     1 
ATOM   5554  O  O     . PHE A 1  714  ? 222.087 204.299 171.977 1.00 111.54 ?  714  PHE A O     1 
ATOM   5555  C  CB    . PHE A 1  714  ? 225.131 203.251 173.082 1.00 111.66 ?  714  PHE A CB    1 
ATOM   5556  C  CG    . PHE A 1  714  ? 224.935 202.405 171.846 1.00 112.89 ?  714  PHE A CG    1 
ATOM   5557  C  CD1   . PHE A 1  714  ? 225.352 202.857 170.602 1.00 116.94 ?  714  PHE A CD1   1 
ATOM   5558  C  CD2   . PHE A 1  714  ? 224.374 201.136 171.934 1.00 113.70 ?  714  PHE A CD2   1 
ATOM   5559  C  CE1   . PHE A 1  714  ? 225.200 202.061 169.467 1.00 118.03 ?  714  PHE A CE1   1 
ATOM   5560  C  CE2   . PHE A 1  714  ? 224.205 200.349 170.798 1.00 116.77 ?  714  PHE A CE2   1 
ATOM   5561  C  CZ    . PHE A 1  714  ? 224.636 200.808 169.573 1.00 116.07 ?  714  PHE A CZ    1 
ATOM   5562  N  N     . GLU A 1  715  ? 222.144 202.748 173.644 1.00 107.32 ?  715  GLU A N     1 
ATOM   5563  C  CA    . GLU A 1  715  ? 220.843 202.146 173.349 1.00 105.39 ?  715  GLU A CA    1 
ATOM   5564  C  C     . GLU A 1  715  ? 219.754 203.201 173.298 1.00 108.30 ?  715  GLU A C     1 
ATOM   5565  O  O     . GLU A 1  715  ? 218.940 203.167 172.379 1.00 107.42 ?  715  GLU A O     1 
ATOM   5566  C  CB    . GLU A 1  715  ? 220.499 201.028 174.337 1.00 105.52 ?  715  GLU A CB    1 
ATOM   5567  C  CG    . GLU A 1  715  ? 221.201 199.717 174.027 1.00 115.64 ?  715  GLU A CG    1 
ATOM   5568  C  CD    . GLU A 1  715  ? 220.582 198.887 172.919 1.00 132.94 ?  715  GLU A CD    1 
ATOM   5569  O  OE1   . GLU A 1  715  ? 219.389 198.518 173.033 1.00 116.19 ?  715  GLU A OE1   1 
ATOM   5570  O  OE2   . GLU A 1  715  ? 221.302 198.596 171.937 1.00 127.83 -1 715  GLU A OE2   1 
ATOM   5571  N  N     . ASP A 1  716  ? 219.797 204.187 174.224 1.00 104.68 ?  716  ASP A N     1 
ATOM   5572  C  CA    . ASP A 1  716  ? 218.851 205.292 174.248 1.00 104.24 ?  716  ASP A CA    1 
ATOM   5573  C  C     . ASP A 1  716  ? 218.851 205.999 172.896 1.00 108.27 ?  716  ASP A C     1 
ATOM   5574  O  O     . ASP A 1  716  ? 217.780 206.204 172.331 1.00 107.20 ?  716  ASP A O     1 
ATOM   5575  C  CB    . ASP A 1  716  ? 219.185 206.287 175.372 1.00 107.18 ?  716  ASP A CB    1 
ATOM   5576  C  CG    . ASP A 1  716  ? 218.379 207.583 175.303 1.00 126.19 ?  716  ASP A CG    1 
ATOM   5577  O  OD1   . ASP A 1  716  ? 217.210 207.580 175.755 1.00 127.51 ?  716  ASP A OD1   1 
ATOM   5578  O  OD2   . ASP A 1  716  ? 218.908 208.592 174.762 1.00 133.69 -1 716  ASP A OD2   1 
ATOM   5579  N  N     . ASN A 1  717  ? 220.046 206.338 172.367 1.00 106.18 ?  717  ASN A N     1 
ATOM   5580  C  CA    . ASN A 1  717  ? 220.203 207.038 171.088 1.00 106.76 ?  717  ASN A CA    1 
ATOM   5581  C  C     . ASN A 1  717  ? 219.639 206.233 169.928 1.00 108.81 ?  717  ASN A C     1 
ATOM   5582  O  O     . ASN A 1  717  ? 218.772 206.736 169.211 1.00 108.27 ?  717  ASN A O     1 
ATOM   5583  C  CB    . ASN A 1  717  ? 221.666 207.443 170.831 1.00 110.49 ?  717  ASN A CB    1 
ATOM   5584  C  CG    . ASN A 1  717  ? 222.286 208.337 171.889 1.00 139.92 ?  717  ASN A CG    1 
ATOM   5585  O  OD1   . ASN A 1  717  ? 221.707 209.343 172.331 1.00 138.20 ?  717  ASN A OD1   1 
ATOM   5586  N  ND2   . ASN A 1  717  ? 223.510 208.012 172.284 1.00 130.98 ?  717  ASN A ND2   1 
ATOM   5587  N  N     . VAL A 1  718  ? 220.081 204.968 169.791 1.00 103.95 ?  718  VAL A N     1 
ATOM   5588  C  CA    . VAL A 1  718  ? 219.649 204.034 168.747 1.00 103.15 ?  718  VAL A CA    1 
ATOM   5589  C  C     . VAL A 1  718  ? 218.122 203.992 168.663 1.00 105.93 ?  718  VAL A C     1 
ATOM   5590  O  O     . VAL A 1  718  ? 217.565 204.331 167.616 1.00 106.27 ?  718  VAL A O     1 
ATOM   5591  C  CB    . VAL A 1  718  ? 220.234 202.625 168.977 1.00 106.68 ?  718  VAL A CB    1 
ATOM   5592  C  CG1   . VAL A 1  718  ? 220.049 201.758 167.741 1.00 106.77 ?  718  VAL A CG1   1 
ATOM   5593  C  CG2   . VAL A 1  718  ? 221.699 202.694 169.369 1.00 107.50 ?  718  VAL A CG2   1 
ATOM   5594  N  N     . VAL A 1  719  ? 217.467 203.621 169.797 1.00 100.15 ?  719  VAL A N     1 
ATOM   5595  C  CA    . VAL A 1  719  ? 216.021 203.534 170.037 1.00 97.71  ?  719  VAL A CA    1 
ATOM   5596  C  C     . VAL A 1  719  ? 215.308 204.836 169.657 1.00 100.87 ?  719  VAL A C     1 
ATOM   5597  O  O     . VAL A 1  719  ? 214.263 204.789 169.013 1.00 99.15  ?  719  VAL A O     1 
ATOM   5598  C  CB    . VAL A 1  719  ? 215.802 203.137 171.516 1.00 100.42 ?  719  VAL A CB    1 
ATOM   5599  C  CG1   . VAL A 1  719  ? 214.573 203.789 172.139 1.00 99.02  ?  719  VAL A CG1   1 
ATOM   5600  C  CG2   . VAL A 1  719  ? 215.755 201.632 171.668 1.00 99.96  ?  719  VAL A CG2   1 
ATOM   5601  N  N     . ARG A 1  720  ? 215.895 205.985 170.029 1.00 98.88  ?  720  ARG A N     1 
ATOM   5602  C  CA    . ARG A 1  720  ? 215.372 207.306 169.730 1.00 99.42  ?  720  ARG A CA    1 
ATOM   5603  C  C     . ARG A 1  720  ? 215.413 207.595 168.222 1.00 104.95 ?  720  ARG A C     1 
ATOM   5604  O  O     . ARG A 1  720  ? 214.410 208.079 167.704 1.00 104.65 ?  720  ARG A O     1 
ATOM   5605  C  CB    . ARG A 1  720  ? 216.132 208.373 170.527 1.00 102.00 ?  720  ARG A CB    1 
ATOM   5606  C  CG    . ARG A 1  720  ? 215.399 209.711 170.662 1.00 115.67 ?  720  ARG A CG    1 
ATOM   5607  C  CD    . ARG A 1  720  ? 216.254 210.805 171.284 1.00 126.37 ?  720  ARG A CD    1 
ATOM   5608  N  NE    . ARG A 1  720  ? 217.484 211.031 170.523 1.00 141.51 ?  720  ARG A NE    1 
ATOM   5609  C  CZ    . ARG A 1  720  ? 218.687 210.632 170.923 1.00 162.33 ?  720  ARG A CZ    1 
ATOM   5610  N  NH1   . ARG A 1  720  ? 218.834 210.007 172.087 1.00 149.88 1  720  ARG A NH1   1 
ATOM   5611  N  NH2   . ARG A 1  720  ? 219.753 210.862 170.167 1.00 152.37 ?  720  ARG A NH2   1 
ATOM   5612  N  N     . PHE A 1  721  ? 216.526 207.273 167.510 1.00 103.05 ?  721  PHE A N     1 
ATOM   5613  C  CA    . PHE A 1  721  ? 216.633 207.510 166.051 1.00 104.37 ?  721  PHE A CA    1 
ATOM   5614  C  C     . PHE A 1  721  ? 215.642 206.704 165.265 1.00 106.54 ?  721  PHE A C     1 
ATOM   5615  O  O     . PHE A 1  721  ? 215.048 207.214 164.315 1.00 106.80 ?  721  PHE A O     1 
ATOM   5616  C  CB    . PHE A 1  721  ? 218.017 207.146 165.496 1.00 108.21 ?  721  PHE A CB    1 
ATOM   5617  C  CG    . PHE A 1  721  ? 219.178 207.957 165.994 1.00 111.40 ?  721  PHE A CG    1 
ATOM   5618  C  CD1   . PHE A 1  721  ? 218.999 209.275 166.417 1.00 114.99 ?  721  PHE A CD1   1 
ATOM   5619  C  CD2   . PHE A 1  721  ? 220.458 207.417 166.014 1.00 114.21 ?  721  PHE A CD2   1 
ATOM   5620  C  CE1   . PHE A 1  721  ? 220.068 210.010 166.912 1.00 116.88 ?  721  PHE A CE1   1 
ATOM   5621  C  CE2   . PHE A 1  721  ? 221.530 208.160 166.487 1.00 118.10 ?  721  PHE A CE2   1 
ATOM   5622  C  CZ    . PHE A 1  721  ? 221.329 209.448 166.938 1.00 116.76 ?  721  PHE A CZ    1 
ATOM   5623  N  N     . LEU A 1  722  ? 215.536 205.416 165.619 1.00 100.76 ?  722  LEU A N     1 
ATOM   5624  C  CA    . LEU A 1  722  ? 214.684 204.434 164.979 1.00 99.39  ?  722  LEU A CA    1 
ATOM   5625  C  C     . LEU A 1  722  ? 213.214 204.787 165.109 1.00 105.44 ?  722  LEU A C     1 
ATOM   5626  O  O     . LEU A 1  722  ? 212.436 204.482 164.204 1.00 106.24 ?  722  LEU A O     1 
ATOM   5627  C  CB    . LEU A 1  722  ? 214.964 203.050 165.571 1.00 98.10  ?  722  LEU A CB    1 
ATOM   5628  C  CG    . LEU A 1  722  ? 216.270 202.382 165.168 1.00 102.01 ?  722  LEU A CG    1 
ATOM   5629  C  CD1   . LEU A 1  722  ? 216.602 201.259 166.113 1.00 101.19 ?  722  LEU A CD1   1 
ATOM   5630  C  CD2   . LEU A 1  722  ? 216.212 201.878 163.737 1.00 102.86 ?  722  LEU A CD2   1 
ATOM   5631  N  N     . ASN A 1  723  ? 212.829 205.430 166.227 1.00 102.05 ?  723  ASN A N     1 
ATOM   5632  C  CA    . ASN A 1  723  ? 211.449 205.852 166.448 1.00 100.79 ?  723  ASN A CA    1 
ATOM   5633  C  C     . ASN A 1  723  ? 211.175 207.121 165.680 1.00 105.29 ?  723  ASN A C     1 
ATOM   5634  O  O     . ASN A 1  723  ? 210.203 207.158 164.925 1.00 104.31 ?  723  ASN A O     1 
ATOM   5635  C  CB    . ASN A 1  723  ? 211.129 205.951 167.926 1.00 99.26  ?  723  ASN A CB    1 
ATOM   5636  C  CG    . ASN A 1  723  ? 211.174 204.599 168.599 1.00 123.80 ?  723  ASN A CG    1 
ATOM   5637  O  OD1   . ASN A 1  723  ? 211.072 203.526 167.964 1.00 116.88 ?  723  ASN A OD1   1 
ATOM   5638  N  ND2   . ASN A 1  723  ? 211.375 204.624 169.898 1.00 117.55 ?  723  ASN A ND2   1 
ATOM   5639  N  N     . GLU A 1  724  ? 212.104 208.103 165.759 1.00 103.55 ?  724  GLU A N     1 
ATOM   5640  C  CA    . GLU A 1  724  ? 212.082 209.358 165.000 1.00 105.14 ?  724  GLU A CA    1 
ATOM   5641  C  C     . GLU A 1  724  ? 211.793 209.004 163.532 1.00 108.54 ?  724  GLU A C     1 
ATOM   5642  O  O     . GLU A 1  724  ? 211.047 209.716 162.851 1.00 108.09 ?  724  GLU A O     1 
ATOM   5643  C  CB    . GLU A 1  724  ? 213.481 210.015 165.038 1.00 108.57 ?  724  GLU A CB    1 
ATOM   5644  C  CG    . GLU A 1  724  ? 213.795 210.992 166.163 1.00 125.22 ?  724  GLU A CG    1 
ATOM   5645  C  CD    . GLU A 1  724  ? 215.241 211.481 166.196 1.00 164.29 ?  724  GLU A CD    1 
ATOM   5646  O  OE1   . GLU A 1  724  ? 216.027 211.140 165.278 1.00 162.96 ?  724  GLU A OE1   1 
ATOM   5647  O  OE2   . GLU A 1  724  ? 215.591 212.202 167.158 1.00 167.90 -1 724  GLU A OE2   1 
ATOM   5648  N  N     . ALA A 1  725  ? 212.399 207.884 163.075 1.00 104.83 ?  725  ALA A N     1 
ATOM   5649  C  CA    . ALA A 1  725  ? 212.314 207.339 161.733 1.00 105.35 ?  725  ALA A CA    1 
ATOM   5650  C  C     . ALA A 1  725  ? 210.946 206.788 161.451 1.00 108.99 ?  725  ALA A C     1 
ATOM   5651  O  O     . ALA A 1  725  ? 210.317 207.260 160.510 1.00 110.66 ?  725  ALA A O     1 
ATOM   5652  C  CB    . ALA A 1  725  ? 213.364 206.260 161.537 1.00 106.80 ?  725  ALA A CB    1 
ATOM   5653  N  N     . ARG A 1  726  ? 210.464 205.814 162.255 1.00 103.30 ?  726  ARG A N     1 
ATOM   5654  C  CA    . ARG A 1  726  ? 209.140 205.203 162.081 1.00 102.10 ?  726  ARG A CA    1 
ATOM   5655  C  C     . ARG A 1  726  ? 208.061 206.275 161.931 1.00 105.63 ?  726  ARG A C     1 
ATOM   5656  O  O     . ARG A 1  726  ? 207.197 206.166 161.056 1.00 105.78 ?  726  ARG A O     1 
ATOM   5657  C  CB    . ARG A 1  726  ? 208.815 204.256 163.253 1.00 101.86 ?  726  ARG A CB    1 
ATOM   5658  C  CG    . ARG A 1  726  ? 207.330 203.887 163.384 1.00 109.63 ?  726  ARG A CG    1 
ATOM   5659  C  CD    . ARG A 1  726  ? 207.014 202.942 164.536 1.00 115.29 ?  726  ARG A CD    1 
ATOM   5660  N  NE    . ARG A 1  726  ? 207.602 203.335 165.816 1.00 120.07 ?  726  ARG A NE    1 
ATOM   5661  C  CZ    . ARG A 1  726  ? 207.078 204.241 166.632 1.00 136.96 ?  726  ARG A CZ    1 
ATOM   5662  N  NH1   . ARG A 1  726  ? 205.963 204.878 166.299 1.00 124.26 1  726  ARG A NH1   1 
ATOM   5663  N  NH2   . ARG A 1  726  ? 207.674 204.533 167.779 1.00 129.70 ?  726  ARG A NH2   1 
ATOM   5664  N  N     . ASP A 1  727  ? 208.149 207.325 162.762 1.00 101.12 ?  727  ASP A N     1 
ATOM   5665  C  CA    . ASP A 1  727  ? 207.224 208.447 162.761 1.00 100.29 ?  727  ASP A CA    1 
ATOM   5666  C  C     . ASP A 1  727  ? 207.350 209.301 161.509 1.00 103.80 ?  727  ASP A C     1 
ATOM   5667  O  O     . ASP A 1  727  ? 206.328 209.615 160.912 1.00 103.91 ?  727  ASP A O     1 
ATOM   5668  C  CB    . ASP A 1  727  ? 207.369 209.271 164.043 1.00 102.14 ?  727  ASP A CB    1 
ATOM   5669  C  CG    . ASP A 1  727  ? 207.304 208.430 165.312 1.00 115.77 ?  727  ASP A CG    1 
ATOM   5670  O  OD1   . ASP A 1  727  ? 206.526 207.441 165.338 1.00 114.22 ?  727  ASP A OD1   1 
ATOM   5671  O  OD2   . ASP A 1  727  ? 208.038 208.750 166.271 1.00 126.77 -1 727  ASP A OD2   1 
ATOM   5672  N  N     . LYS A 1  728  ? 208.582 209.638 161.080 1.00 100.11 ?  728  LYS A N     1 
ATOM   5673  C  CA    . LYS A 1  728  ? 208.815 210.430 159.868 1.00 100.85 ?  728  LYS A CA    1 
ATOM   5674  C  C     . LYS A 1  728  ? 208.162 209.752 158.681 1.00 103.27 ?  728  LYS A C     1 
ATOM   5675  O  O     . LYS A 1  728  ? 207.317 210.363 158.023 1.00 102.04 ?  728  LYS A O     1 
ATOM   5676  C  CB    . LYS A 1  728  ? 210.322 210.658 159.640 1.00 105.49 ?  728  LYS A CB    1 
ATOM   5677  C  CG    . LYS A 1  728  ? 210.647 211.748 158.610 1.00 126.53 ?  728  LYS A CG    1 
ATOM   5678  C  CD    . LYS A 1  728  ? 211.918 212.578 158.948 1.00 137.61 ?  728  LYS A CD    1 
ATOM   5679  C  CE    . LYS A 1  728  ? 213.216 212.061 158.348 1.00 143.62 ?  728  LYS A CE    1 
ATOM   5680  N  NZ    . LYS A 1  728  ? 214.265 213.117 158.282 1.00 149.43 1  728  LYS A NZ    1 
ATOM   5681  N  N     . ALA A 1  729  ? 208.489 208.448 158.495 1.00 100.23 ?  729  ALA A N     1 
ATOM   5682  C  CA    . ALA A 1  729  ? 208.006 207.530 157.458 1.00 100.46 ?  729  ALA A CA    1 
ATOM   5683  C  C     . ALA A 1  729  ? 206.481 207.475 157.462 1.00 105.12 ?  729  ALA A C     1 
ATOM   5684  O  O     . ALA A 1  729  ? 205.851 207.488 156.397 1.00 104.52 ?  729  ALA A O     1 
ATOM   5685  C  CB    . ALA A 1  729  ? 208.586 206.141 157.693 1.00 100.77 ?  729  ALA A CB    1 
ATOM   5686  N  N     . GLY A 1  730  ? 205.914 207.453 158.670 1.00 102.12 ?  730  GLY A N     1 
ATOM   5687  C  CA    . GLY A 1  730  ? 204.478 207.458 158.899 1.00 101.24 ?  730  GLY A CA    1 
ATOM   5688  C  C     . GLY A 1  730  ? 203.873 208.763 158.434 1.00 106.86 ?  730  GLY A C     1 
ATOM   5689  O  O     . GLY A 1  730  ? 203.051 208.763 157.512 1.00 106.88 ?  730  GLY A O     1 
ATOM   5690  N  N     . ARG A 1  731  ? 204.357 209.894 159.003 1.00 104.51 ?  731  ARG A N     1 
ATOM   5691  C  CA    . ARG A 1  731  ? 203.906 211.253 158.678 1.00 105.05 ?  731  ARG A CA    1 
ATOM   5692  C  C     . ARG A 1  731  ? 204.051 211.572 157.191 1.00 110.56 ?  731  ARG A C     1 
ATOM   5693  O  O     . ARG A 1  731  ? 203.336 212.438 156.687 1.00 110.83 ?  731  ARG A O     1 
ATOM   5694  C  CB    . ARG A 1  731  ? 204.605 212.308 159.540 1.00 105.90 ?  731  ARG A CB    1 
ATOM   5695  C  CG    . ARG A 1  731  ? 204.226 212.309 161.021 1.00 115.06 ?  731  ARG A CG    1 
ATOM   5696  C  CD    . ARG A 1  731  ? 205.002 213.373 161.784 1.00 134.16 ?  731  ARG A CD    1 
ATOM   5697  N  NE    . ARG A 1  731  ? 206.388 213.000 162.110 1.00 150.06 ?  731  ARG A NE    1 
ATOM   5698  C  CZ    . ARG A 1  731  ? 207.477 213.337 161.408 1.00 163.58 ?  731  ARG A CZ    1 
ATOM   5699  N  NH1   . ARG A 1  731  ? 207.363 214.016 160.269 1.00 146.47 1  731  ARG A NH1   1 
ATOM   5700  N  NH2   . ARG A 1  731  ? 208.682 212.970 161.825 1.00 149.19 ?  731  ARG A NH2   1 
ATOM   5701  N  N     . LEU A 1  732  ? 204.926 210.836 156.480 1.00 107.72 ?  732  LEU A N     1 
ATOM   5702  C  CA    . LEU A 1  732  ? 205.087 210.978 155.035 1.00 109.08 ?  732  LEU A CA    1 
ATOM   5703  C  C     . LEU A 1  732  ? 203.840 210.445 154.315 1.00 113.09 ?  732  LEU A C     1 
ATOM   5704  O  O     . LEU A 1  732  ? 203.242 211.167 153.509 1.00 113.50 ?  732  LEU A O     1 
ATOM   5705  C  CB    . LEU A 1  732  ? 206.345 210.247 154.534 1.00 109.95 ?  732  LEU A CB    1 
ATOM   5706  C  CG    . LEU A 1  732  ? 207.677 210.914 154.830 1.00 114.79 ?  732  LEU A CG    1 
ATOM   5707  C  CD1   . LEU A 1  732  ? 208.809 209.970 154.577 1.00 115.46 ?  732  LEU A CD1   1 
ATOM   5708  C  CD2   . LEU A 1  732  ? 207.859 212.156 154.007 1.00 118.27 ?  732  LEU A CD2   1 
ATOM   5709  N  N     . ALA A 1  733  ? 203.437 209.193 154.643 1.00 108.32 ?  733  ALA A N     1 
ATOM   5710  C  CA    . ALA A 1  733  ? 202.264 208.517 154.086 1.00 107.17 ?  733  ALA A CA    1 
ATOM   5711  C  C     . ALA A 1  733  ? 200.991 209.282 154.426 1.00 110.14 ?  733  ALA A C     1 
ATOM   5712  O  O     . ALA A 1  733  ? 200.251 209.649 153.518 1.00 109.73 ?  733  ALA A O     1 
ATOM   5713  C  CB    . ALA A 1  733  ? 202.182 207.096 154.613 1.00 106.76 ?  733  ALA A CB    1 
ATOM   5714  N  N     . GLU A 1  734  ? 200.782 209.590 155.725 1.00 106.56 ?  734  GLU A N     1 
ATOM   5715  C  CA    . GLU A 1  734  ? 199.636 210.331 156.270 1.00 106.40 ?  734  GLU A CA    1 
ATOM   5716  C  C     . GLU A 1  734  ? 199.311 211.578 155.451 1.00 112.16 ?  734  GLU A C     1 
ATOM   5717  O  O     . GLU A 1  734  ? 198.137 211.884 155.227 1.00 111.96 ?  734  GLU A O     1 
ATOM   5718  C  CB    . GLU A 1  734  ? 199.892 210.657 157.757 1.00 107.12 ?  734  GLU A CB    1 
ATOM   5719  C  CG    . GLU A 1  734  ? 199.270 211.934 158.301 1.00 124.03 ?  734  GLU A CG    1 
ATOM   5720  C  CD    . GLU A 1  734  ? 199.636 212.213 159.747 1.00 165.79 ?  734  GLU A CD    1 
ATOM   5721  O  OE1   . GLU A 1  734  ? 200.786 212.646 160.006 1.00 167.15 ?  734  GLU A OE1   1 
ATOM   5722  O  OE2   . GLU A 1  734  ? 198.772 211.980 160.626 1.00 166.88 -1 734  GLU A OE2   1 
ATOM   5723  N  N     . VAL A 1  735  ? 200.361 212.259 154.973 1.00 109.87 ?  735  VAL A N     1 
ATOM   5724  C  CA    . VAL A 1  735  ? 200.277 213.471 154.172 1.00 110.68 ?  735  VAL A CA    1 
ATOM   5725  C  C     . VAL A 1  735  ? 199.944 213.182 152.711 1.00 116.31 ?  735  VAL A C     1 
ATOM   5726  O  O     . VAL A 1  735  ? 199.104 213.878 152.129 1.00 116.28 ?  735  VAL A O     1 
ATOM   5727  C  CB    . VAL A 1  735  ? 201.552 214.300 154.370 1.00 115.04 ?  735  VAL A CB    1 
ATOM   5728  C  CG1   . VAL A 1  735  ? 201.757 215.292 153.240 1.00 116.37 ?  735  VAL A CG1   1 
ATOM   5729  C  CG2   . VAL A 1  735  ? 201.506 215.014 155.716 1.00 114.12 ?  735  VAL A CG2   1 
ATOM   5730  N  N     . ASN A 1  736  ? 200.586 212.144 152.138 1.00 114.10 ?  736  ASN A N     1 
ATOM   5731  C  CA    . ASN A 1  736  ? 200.398 211.661 150.760 1.00 115.09 ?  736  ASN A CA    1 
ATOM   5732  C  C     . ASN A 1  736  ? 199.000 211.018 150.517 1.00 116.79 ?  736  ASN A C     1 
ATOM   5733  O  O     . ASN A 1  736  ? 198.555 210.916 149.361 1.00 116.96 ?  736  ASN A O     1 
ATOM   5734  C  CB    . ASN A 1  736  ? 201.529 210.685 150.375 1.00 117.96 ?  736  ASN A CB    1 
ATOM   5735  C  CG    . ASN A 1  736  ? 201.238 209.827 149.164 1.00 140.76 ?  736  ASN A CG    1 
ATOM   5736  O  OD1   . ASN A 1  736  ? 200.996 208.614 149.264 1.00 135.03 ?  736  ASN A OD1   1 
ATOM   5737  N  ND2   . ASN A 1  736  ? 201.134 210.471 148.012 1.00 131.35 ?  736  ASN A ND2   1 
ATOM   5738  N  N     . LEU A 1  737  ? 198.321 210.568 151.590 1.00 110.48 ?  737  LEU A N     1 
ATOM   5739  C  CA    . LEU A 1  737  ? 196.988 209.991 151.430 1.00 108.85 ?  737  LEU A CA    1 
ATOM   5740  C  C     . LEU A 1  737  ? 195.992 211.134 151.286 1.00 112.00 ?  737  LEU A C     1 
ATOM   5741  O  O     . LEU A 1  737  ? 195.972 212.049 152.117 1.00 111.87 ?  737  LEU A O     1 
ATOM   5742  C  CB    . LEU A 1  737  ? 196.599 209.052 152.593 1.00 107.00 ?  737  LEU A CB    1 
ATOM   5743  C  CG    . LEU A 1  737  ? 197.541 207.878 152.910 1.00 110.76 ?  737  LEU A CG    1 
ATOM   5744  C  CD1   . LEU A 1  737  ? 197.078 207.154 154.127 1.00 109.21 ?  737  LEU A CD1   1 
ATOM   5745  C  CD2   . LEU A 1  737  ? 197.710 206.912 151.728 1.00 112.25 ?  737  LEU A CD2   1 
ATOM   5746  N  N     . LYS A 1  738  ? 195.207 211.109 150.198 1.00 107.38 ?  738  LYS A N     1 
ATOM   5747  C  CA    . LYS A 1  738  ? 194.201 212.136 149.898 1.00 106.60 ?  738  LYS A CA    1 
ATOM   5748  C  C     . LYS A 1  738  ? 193.048 212.061 150.890 1.00 108.18 ?  738  LYS A C     1 
ATOM   5749  O  O     . LYS A 1  738  ? 192.947 211.090 151.645 1.00 107.10 ?  738  LYS A O     1 
ATOM   5750  C  CB    . LYS A 1  738  ? 193.654 211.987 148.465 1.00 109.58 ?  738  LYS A CB    1 
ATOM   5751  C  CG    . LYS A 1  738  ? 194.678 211.546 147.431 1.00 117.74 ?  738  LYS A CG    1 
ATOM   5752  C  CD    . LYS A 1  738  ? 194.504 210.089 147.034 1.00 119.33 ?  738  LYS A CD    1 
ATOM   5753  C  CE    . LYS A 1  738  ? 195.179 209.836 145.720 1.00 120.35 ?  738  LYS A CE    1 
ATOM   5754  N  NZ    . LYS A 1  738  ? 194.722 210.778 144.657 1.00 120.51 1  738  LYS A NZ    1 
ATOM   5755  N  N     . ASP A 1  739  ? 192.151 213.057 150.869 1.00 103.39 ?  739  ASP A N     1 
ATOM   5756  C  CA    . ASP A 1  739  ? 190.994 213.054 151.762 1.00 100.88 ?  739  ASP A CA    1 
ATOM   5757  C  C     . ASP A 1  739  ? 190.006 211.943 151.407 1.00 98.12  ?  739  ASP A C     1 
ATOM   5758  O  O     . ASP A 1  739  ? 189.139 211.615 152.218 1.00 96.92  ?  739  ASP A O     1 
ATOM   5759  C  CB    . ASP A 1  739  ? 190.322 214.434 151.795 1.00 104.33 ?  739  ASP A CB    1 
ATOM   5760  C  CG    . ASP A 1  739  ? 191.151 215.534 152.448 1.00 123.17 ?  739  ASP A CG    1 
ATOM   5761  O  OD1   . ASP A 1  739  ? 192.293 215.241 152.901 1.00 124.20 ?  739  ASP A OD1   1 
ATOM   5762  O  OD2   . ASP A 1  739  ? 190.654 216.681 152.527 1.00 133.07 -1 739  ASP A OD2   1 
ATOM   5763  N  N     . LEU A 1  740  ? 190.176 211.333 150.218 1.00 90.76  ?  740  LEU A N     1 
ATOM   5764  C  CA    . LEU A 1  740  ? 189.351 210.226 149.742 1.00 88.24  ?  740  LEU A CA    1 
ATOM   5765  C  C     . LEU A 1  740  ? 189.726 208.904 150.385 1.00 87.98  ?  740  LEU A C     1 
ATOM   5766  O  O     . LEU A 1  740  ? 188.981 207.935 150.243 1.00 86.99  ?  740  LEU A O     1 
ATOM   5767  C  CB    . LEU A 1  740  ? 189.331 210.125 148.202 1.00 89.47  ?  740  LEU A CB    1 
ATOM   5768  C  CG    . LEU A 1  740  ? 190.641 209.857 147.477 1.00 95.09  ?  740  LEU A CG    1 
ATOM   5769  C  CD1   . LEU A 1  740  ? 190.667 208.476 146.912 1.00 95.31  ?  740  LEU A CD1   1 
ATOM   5770  C  CD2   . LEU A 1  740  ? 190.808 210.805 146.349 1.00 99.45  ?  740  LEU A CD2   1 
ATOM   5771  N  N     . ASN A 1  741  ? 190.872 208.862 151.099 1.00 82.47  ?  741  ASN A N     1 
ATOM   5772  C  CA    . ASN A 1  741  ? 191.340 207.669 151.799 1.00 80.50  ?  741  ASN A CA    1 
ATOM   5773  C  C     . ASN A 1  741  ? 190.364 207.339 152.910 1.00 82.72  ?  741  ASN A C     1 
ATOM   5774  O  O     . ASN A 1  741  ? 190.190 208.122 153.852 1.00 81.22  ?  741  ASN A O     1 
ATOM   5775  C  CB    . ASN A 1  741  ? 192.747 207.852 152.352 1.00 78.49  ?  741  ASN A CB    1 
ATOM   5776  C  CG    . ASN A 1  741  ? 193.397 206.543 152.701 1.00 99.06  ?  741  ASN A CG    1 
ATOM   5777  O  OD1   . ASN A 1  741  ? 193.073 205.900 153.688 1.00 89.13  ?  741  ASN A OD1   1 
ATOM   5778  N  ND2   . ASN A 1  741  ? 194.303 206.089 151.868 1.00 98.35  ?  741  ASN A ND2   1 
ATOM   5779  N  N     . ASN A 1  742  ? 189.686 206.191 152.763 1.00 79.12  ?  742  ASN A N     1 
ATOM   5780  C  CA    . ASN A 1  742  ? 188.676 205.716 153.705 1.00 77.62  ?  742  ASN A CA    1 
ATOM   5781  C  C     . ASN A 1  742  ? 189.201 205.599 155.151 1.00 80.32  ?  742  ASN A C     1 
ATOM   5782  O  O     . ASN A 1  742  ? 188.473 205.944 156.092 1.00 79.88  ?  742  ASN A O     1 
ATOM   5783  C  CB    . ASN A 1  742  ? 188.010 204.449 153.195 1.00 77.18  ?  742  ASN A CB    1 
ATOM   5784  C  CG    . ASN A 1  742  ? 187.312 204.643 151.862 1.00 103.22 ?  742  ASN A CG    1 
ATOM   5785  O  OD1   . ASN A 1  742  ? 186.186 205.152 151.779 1.00 97.82  ?  742  ASN A OD1   1 
ATOM   5786  N  ND2   . ASN A 1  742  ? 187.963 204.221 150.788 1.00 96.40  ?  742  ASN A ND2   1 
ATOM   5787  N  N     . VAL A 1  743  ? 190.483 205.194 155.316 1.00 75.11  ?  743  VAL A N     1 
ATOM   5788  C  CA    . VAL A 1  743  ? 191.139 205.122 156.622 1.00 73.48  ?  743  VAL A CA    1 
ATOM   5789  C  C     . VAL A 1  743  ? 191.280 206.562 157.176 1.00 80.25  ?  743  VAL A C     1 
ATOM   5790  O  O     . VAL A 1  743  ? 190.766 206.858 158.257 1.00 79.48  ?  743  VAL A O     1 
ATOM   5791  C  CB    . VAL A 1  743  ? 192.483 204.342 156.591 1.00 75.69  ?  743  VAL A CB    1 
ATOM   5792  C  CG1   . VAL A 1  743  ? 193.153 204.319 157.970 1.00 74.30  ?  743  VAL A CG1   1 
ATOM   5793  C  CG2   . VAL A 1  743  ? 192.282 202.928 156.053 1.00 74.77  ?  743  VAL A CG2   1 
ATOM   5794  N  N     . LYS A 1  744  ? 191.888 207.463 156.391 1.00 79.54  ?  744  LYS A N     1 
ATOM   5795  C  CA    . LYS A 1  744  ? 192.057 208.868 156.769 1.00 80.61  ?  744  LYS A CA    1 
ATOM   5796  C  C     . LYS A 1  744  ? 190.702 209.419 157.186 1.00 83.89  ?  744  LYS A C     1 
ATOM   5797  O  O     . LYS A 1  744  ? 190.603 209.994 158.264 1.00 82.16  ?  744  LYS A O     1 
ATOM   5798  C  CB    . LYS A 1  744  ? 192.686 209.694 155.613 1.00 85.87  ?  744  LYS A CB    1 
ATOM   5799  C  CG    . LYS A 1  744  ? 193.559 210.868 156.073 1.00 107.50 ?  744  LYS A CG    1 
ATOM   5800  C  CD    . LYS A 1  744  ? 194.314 211.584 154.943 1.00 120.55 ?  744  LYS A CD    1 
ATOM   5801  C  CE    . LYS A 1  744  ? 194.902 212.901 155.425 1.00 132.18 ?  744  LYS A CE    1 
ATOM   5802  N  NZ    . LYS A 1  744  ? 195.480 213.718 154.322 1.00 142.02 1  744  LYS A NZ    1 
ATOM   5803  N  N     . GLN A 1  745  ? 189.644 209.133 156.385 1.00 81.64  ?  745  GLN A N     1 
ATOM   5804  C  CA    . GLN A 1  745  ? 188.260 209.545 156.643 1.00 81.24  ?  745  GLN A CA    1 
ATOM   5805  C  C     . GLN A 1  745  ? 187.752 209.102 158.036 1.00 84.33  ?  745  GLN A C     1 
ATOM   5806  O  O     . GLN A 1  745  ? 187.133 209.911 158.747 1.00 84.21  ?  745  GLN A O     1 
ATOM   5807  C  CB    . GLN A 1  745  ? 187.330 209.050 155.534 1.00 82.72  ?  745  GLN A CB    1 
ATOM   5808  C  CG    . GLN A 1  745  ? 187.319 209.911 154.286 1.00 95.32  ?  745  GLN A CG    1 
ATOM   5809  C  CD    . GLN A 1  745  ? 186.385 209.311 153.259 1.00 119.30 ?  745  GLN A CD    1 
ATOM   5810  O  OE1   . GLN A 1  745  ? 185.153 209.311 153.419 1.00 112.07 ?  745  GLN A OE1   1 
ATOM   5811  N  NE2   . GLN A 1  745  ? 186.951 208.734 152.205 1.00 114.61 ?  745  GLN A NE2   1 
ATOM   5812  N  N     . MET A 1  746  ? 188.045 207.835 158.434 1.00 78.70  ?  746  MET A N     1 
ATOM   5813  C  CA    . MET A 1  746  ? 187.667 207.314 159.750 1.00 76.29  ?  746  MET A CA    1 
ATOM   5814  C  C     . MET A 1  746  ? 188.488 208.003 160.845 1.00 82.36  ?  746  MET A C     1 
ATOM   5815  O  O     . MET A 1  746  ? 187.950 208.382 161.886 1.00 80.91  ?  746  MET A O     1 
ATOM   5816  C  CB    . MET A 1  746  ? 187.831 205.794 159.809 1.00 77.15  ?  746  MET A CB    1 
ATOM   5817  C  CG    . MET A 1  746  ? 186.661 205.047 159.231 1.00 79.33  ?  746  MET A CG    1 
ATOM   5818  S  SD    . MET A 1  746  ? 186.903 203.258 159.265 1.00 82.16  ?  746  MET A SD    1 
ATOM   5819  C  CE    . MET A 1  746  ? 187.929 203.052 157.838 1.00 79.94  ?  746  MET A CE    1 
ATOM   5820  N  N     . VAL A 1  747  ? 189.777 208.222 160.580 1.00 81.87  ?  747  VAL A N     1 
ATOM   5821  C  CA    . VAL A 1  747  ? 190.664 208.885 161.528 1.00 82.82  ?  747  VAL A CA    1 
ATOM   5822  C  C     . VAL A 1  747  ? 190.234 210.335 161.714 1.00 89.99  ?  747  VAL A C     1 
ATOM   5823  O  O     . VAL A 1  747  ? 190.244 210.832 162.839 1.00 88.62  ?  747  VAL A O     1 
ATOM   5824  C  CB    . VAL A 1  747  ? 192.159 208.748 161.133 1.00 87.42  ?  747  VAL A CB    1 
ATOM   5825  C  CG1   . VAL A 1  747  ? 193.065 209.249 162.250 1.00 86.98  ?  747  VAL A CG1   1 
ATOM   5826  C  CG2   . VAL A 1  747  ? 192.514 207.301 160.794 1.00 87.17  ?  747  VAL A CG2   1 
ATOM   5827  N  N     . MET A 1  748  ? 189.815 210.986 160.620 1.00 91.20  ?  748  MET A N     1 
ATOM   5828  C  CA    . MET A 1  748  ? 189.390 212.383 160.592 1.00 93.75  ?  748  MET A CA    1 
ATOM   5829  C  C     . MET A 1  748  ? 188.137 212.642 161.399 1.00 96.40  ?  748  MET A C     1 
ATOM   5830  O  O     . MET A 1  748  ? 188.037 213.686 162.055 1.00 95.87  ?  748  MET A O     1 
ATOM   5831  C  CB    . MET A 1  748  ? 189.203 212.874 159.155 1.00 98.51  ?  748  MET A CB    1 
ATOM   5832  C  CG    . MET A 1  748  ? 190.499 213.190 158.461 1.00 105.58 ?  748  MET A CG    1 
ATOM   5833  S  SD    . MET A 1  748  ? 190.257 213.987 156.851 1.00 113.94 ?  748  MET A SD    1 
ATOM   5834  C  CE    . MET A 1  748  ? 190.141 212.558 155.747 1.00 110.89 ?  748  MET A CE    1 
ATOM   5835  N  N     . ALA A 1  749  ? 187.179 211.705 161.347 1.00 91.84  ?  749  ALA A N     1 
ATOM   5836  C  CA    . ALA A 1  749  ? 185.920 211.835 162.070 1.00 90.91  ?  749  ALA A CA    1 
ATOM   5837  C  C     . ALA A 1  749  ? 186.107 211.436 163.523 1.00 94.38  ?  749  ALA A C     1 
ATOM   5838  O  O     . ALA A 1  749  ? 185.382 211.903 164.398 1.00 93.35  ?  749  ALA A O     1 
ATOM   5839  C  CB    . ALA A 1  749  ? 184.860 210.966 161.420 1.00 91.38  ?  749  ALA A CB    1 
ATOM   5840  N  N     . GLY A 1  750  ? 187.102 210.591 163.760 1.00 91.50  ?  750  GLY A N     1 
ATOM   5841  C  CA    . GLY A 1  750  ? 187.415 210.072 165.083 1.00 90.52  ?  750  GLY A CA    1 
ATOM   5842  C  C     . GLY A 1  750  ? 186.654 208.799 165.383 1.00 92.36  ?  750  GLY A C     1 
ATOM   5843  O  O     . GLY A 1  750  ? 186.676 208.317 166.518 1.00 91.90  ?  750  GLY A O     1 
ATOM   5844  N  N     . SER A 1  751  ? 185.983 208.240 164.358 1.00 86.85  ?  751  SER A N     1 
ATOM   5845  C  CA    . SER A 1  751  ? 185.183 207.030 164.451 1.00 84.79  ?  751  SER A CA    1 
ATOM   5846  C  C     . SER A 1  751  ? 186.000 205.808 164.798 1.00 86.17  ?  751  SER A C     1 
ATOM   5847  O  O     . SER A 1  751  ? 185.506 205.020 165.591 1.00 85.21  ?  751  SER A O     1 
ATOM   5848  C  CB    . SER A 1  751  ? 184.386 206.814 163.177 1.00 89.55  ?  751  SER A CB    1 
ATOM   5849  O  OG    . SER A 1  751  ? 185.268 206.574 162.093 1.00 102.38 ?  751  SER A OG    1 
ATOM   5850  N  N     . LYS A 1  752  ? 187.225 205.645 164.209 1.00 82.77  ?  752  LYS A N     1 
ATOM   5851  C  CA    . LYS A 1  752  ? 188.222 204.566 164.452 1.00 82.48  ?  752  LYS A CA    1 
ATOM   5852  C  C     . LYS A 1  752  ? 189.591 204.901 163.889 1.00 90.18  ?  752  LYS A C     1 
ATOM   5853  O  O     . LYS A 1  752  ? 189.689 205.644 162.913 1.00 91.13  ?  752  LYS A O     1 
ATOM   5854  C  CB    . LYS A 1  752  ? 187.815 203.180 163.904 1.00 82.67  ?  752  LYS A CB    1 
ATOM   5855  C  CG    . LYS A 1  752  ? 187.167 202.254 164.924 1.00 83.66  ?  752  LYS A CG    1 
ATOM   5856  C  CD    . LYS A 1  752  ? 188.002 201.819 166.138 1.00 85.88  ?  752  LYS A CD    1 
ATOM   5857  C  CE    . LYS A 1  752  ? 187.159 201.031 167.151 1.00 98.33  ?  752  LYS A CE    1 
ATOM   5858  N  NZ    . LYS A 1  752  ? 186.813 199.614 166.735 1.00 105.62 1  752  LYS A NZ    1 
ATOM   5859  N  N     . GLY A 1  753  ? 190.627 204.312 164.487 1.00 88.17  ?  753  GLY A N     1 
ATOM   5860  C  CA    . GLY A 1  753  ? 192.013 204.451 164.054 1.00 89.62  ?  753  GLY A CA    1 
ATOM   5861  C  C     . GLY A 1  753  ? 192.677 205.773 164.368 1.00 95.78  ?  753  GLY A C     1 
ATOM   5862  O  O     . GLY A 1  753  ? 192.006 206.806 164.487 1.00 97.16  ?  753  GLY A O     1 
ATOM   5863  N  N     . SER A 1  754  ? 194.015 205.746 164.485 1.00 91.51  ?  754  SER A N     1 
ATOM   5864  C  CA    . SER A 1  754  ? 194.832 206.914 164.806 1.00 91.20  ?  754  SER A CA    1 
ATOM   5865  C  C     . SER A 1  754  ? 195.988 207.008 163.827 1.00 93.90  ?  754  SER A C     1 
ATOM   5866  O  O     . SER A 1  754  ? 196.062 206.200 162.896 1.00 93.00  ?  754  SER A O     1 
ATOM   5867  C  CB    . SER A 1  754  ? 195.375 206.786 166.224 1.00 95.25  ?  754  SER A CB    1 
ATOM   5868  O  OG    . SER A 1  754  ? 196.567 206.014 166.246 1.00 107.14 ?  754  SER A OG    1 
ATOM   5869  N  N     . PHE A 1  755  ? 196.925 207.954 164.074 1.00 90.07  ?  755  PHE A N     1 
ATOM   5870  C  CA    . PHE A 1  755  ? 198.088 208.145 163.220 1.00 90.41  ?  755  PHE A CA    1 
ATOM   5871  C  C     . PHE A 1  755  ? 198.905 206.878 163.088 1.00 91.31  ?  755  PHE A C     1 
ATOM   5872  O  O     . PHE A 1  755  ? 199.185 206.444 161.973 1.00 90.58  ?  755  PHE A O     1 
ATOM   5873  C  CB    . PHE A 1  755  ? 198.974 209.299 163.721 1.00 93.23  ?  755  PHE A CB    1 
ATOM   5874  C  CG    . PHE A 1  755  ? 200.397 209.250 163.190 1.00 96.35  ?  755  PHE A CG    1 
ATOM   5875  C  CD1   . PHE A 1  755  ? 200.689 209.668 161.897 1.00 100.94 ?  755  PHE A CD1   1 
ATOM   5876  C  CD2   . PHE A 1  755  ? 201.438 208.762 163.978 1.00 98.87  ?  755  PHE A CD2   1 
ATOM   5877  C  CE1   . PHE A 1  755  ? 201.993 209.590 161.397 1.00 103.21 ?  755  PHE A CE1   1 
ATOM   5878  C  CE2   . PHE A 1  755  ? 202.741 208.670 163.472 1.00 102.88 ?  755  PHE A CE2   1 
ATOM   5879  C  CZ    . PHE A 1  755  ? 203.011 209.088 162.187 1.00 102.28 ?  755  PHE A CZ    1 
ATOM   5880  N  N     . ILE A 1  756  ? 199.309 206.304 164.224 1.00 86.50  ?  756  ILE A N     1 
ATOM   5881  C  CA    . ILE A 1  756  ? 200.173 205.136 164.232 1.00 86.51  ?  756  ILE A CA    1 
ATOM   5882  C  C     . ILE A 1  756  ? 199.685 203.999 163.348 1.00 90.34  ?  756  ILE A C     1 
ATOM   5883  O  O     . ILE A 1  756  ? 200.494 203.447 162.600 1.00 91.15  ?  756  ILE A O     1 
ATOM   5884  C  CB    . ILE A 1  756  ? 200.647 204.745 165.652 1.00 89.29  ?  756  ILE A CB    1 
ATOM   5885  C  CG1   . ILE A 1  756  ? 201.854 203.772 165.625 1.00 90.60  ?  756  ILE A CG1   1 
ATOM   5886  C  CG2   . ILE A 1  756  ? 199.498 204.283 166.552 1.00 88.70  ?  756  ILE A CG2   1 
ATOM   5887  C  CD1   . ILE A 1  756  ? 202.802 203.819 166.890 1.00 99.90  ?  756  ILE A CD1   1 
ATOM   5888  N  N     . ASN A 1  757  ? 198.353 203.726 163.362 1.00 85.33  ?  757  ASN A N     1 
ATOM   5889  C  CA    . ASN A 1  757  ? 197.699 202.698 162.541 1.00 84.58  ?  757  ASN A CA    1 
ATOM   5890  C  C     . ASN A 1  757  ? 198.008 202.896 161.045 1.00 88.93  ?  757  ASN A C     1 
ATOM   5891  O  O     . ASN A 1  757  ? 198.421 201.935 160.395 1.00 89.71  ?  757  ASN A O     1 
ATOM   5892  C  CB    . ASN A 1  757  ? 196.189 202.635 162.810 1.00 84.79  ?  757  ASN A CB    1 
ATOM   5893  C  CG    . ASN A 1  757  ? 195.826 202.267 164.235 1.00 114.13 ?  757  ASN A CG    1 
ATOM   5894  O  OD1   . ASN A 1  757  ? 195.173 203.030 164.954 1.00 111.45 ?  757  ASN A OD1   1 
ATOM   5895  N  ND2   . ASN A 1  757  ? 196.231 201.089 164.683 1.00 106.30 ?  757  ASN A ND2   1 
ATOM   5896  N  N     . ILE A 1  758  ? 197.903 204.154 160.523 1.00 83.78  ?  758  ILE A N     1 
ATOM   5897  C  CA    . ILE A 1  758  ? 198.248 204.513 159.130 1.00 82.88  ?  758  ILE A CA    1 
ATOM   5898  C  C     . ILE A 1  758  ? 199.725 204.200 158.925 1.00 85.59  ?  758  ILE A C     1 
ATOM   5899  O  O     . ILE A 1  758  ? 200.069 203.422 158.038 1.00 85.56  ?  758  ILE A O     1 
ATOM   5900  C  CB    . ILE A 1  758  ? 197.967 206.016 158.819 1.00 85.51  ?  758  ILE A CB    1 
ATOM   5901  C  CG1   . ILE A 1  758  ? 196.464 206.343 158.876 1.00 84.54  ?  758  ILE A CG1   1 
ATOM   5902  C  CG2   . ILE A 1  758  ? 198.583 206.428 157.474 1.00 86.98  ?  758  ILE A CG2   1 
ATOM   5903  C  CD1   . ILE A 1  758  ? 196.127 207.811 158.899 1.00 87.24  ?  758  ILE A CD1   1 
ATOM   5904  N  N     . ALA A 1  759  ? 200.575 204.782 159.786 1.00 81.28  ?  759  ALA A N     1 
ATOM   5905  C  CA    . ALA A 1  759  ? 202.021 204.634 159.783 1.00 82.47  ?  759  ALA A CA    1 
ATOM   5906  C  C     . ALA A 1  759  ? 202.473 203.168 159.664 1.00 86.16  ?  759  ALA A C     1 
ATOM   5907  O  O     . ALA A 1  759  ? 203.210 202.818 158.729 1.00 85.74  ?  759  ALA A O     1 
ATOM   5908  C  CB    . ALA A 1  759  ? 202.600 205.266 161.045 1.00 83.13  ?  759  ALA A CB    1 
ATOM   5909  N  N     . GLN A 1  760  ? 201.998 202.320 160.596 1.00 81.98  ?  760  GLN A N     1 
ATOM   5910  C  CA    . GLN A 1  760  ? 202.343 200.903 160.663 1.00 82.26  ?  760  GLN A CA    1 
ATOM   5911  C  C     . GLN A 1  760  ? 201.829 200.090 159.457 1.00 89.63  ?  760  GLN A C     1 
ATOM   5912  O  O     . GLN A 1  760  ? 202.501 199.159 158.991 1.00 90.45  ?  760  GLN A O     1 
ATOM   5913  C  CB    . GLN A 1  760  ? 201.855 200.304 161.981 1.00 81.73  ?  760  GLN A CB    1 
ATOM   5914  C  CG    . GLN A 1  760  ? 202.583 200.838 163.206 1.00 90.51  ?  760  GLN A CG    1 
ATOM   5915  C  CD    . GLN A 1  760  ? 202.520 199.883 164.378 1.00 116.16 ?  760  GLN A CD    1 
ATOM   5916  O  OE1   . GLN A 1  760  ? 201.492 199.252 164.676 1.00 109.95 ?  760  GLN A OE1   1 
ATOM   5917  N  NE2   . GLN A 1  760  ? 203.629 199.761 165.086 1.00 114.21 ?  760  GLN A NE2   1 
ATOM   5918  N  N     . MET A 1  761  ? 200.661 200.473 158.938 1.00 86.19  ?  761  MET A N     1 
ATOM   5919  C  CA    . MET A 1  761  ? 200.043 199.795 157.815 1.00 86.39  ?  761  MET A CA    1 
ATOM   5920  C  C     . MET A 1  761  ? 200.627 200.151 156.460 1.00 92.97  ?  761  MET A C     1 
ATOM   5921  O  O     . MET A 1  761  ? 200.846 199.262 155.634 1.00 92.20  ?  761  MET A O     1 
ATOM   5922  C  CB    . MET A 1  761  ? 198.549 200.090 157.812 1.00 87.75  ?  761  MET A CB    1 
ATOM   5923  C  CG    . MET A 1  761  ? 197.774 199.172 158.686 1.00 89.86  ?  761  MET A CG    1 
ATOM   5924  S  SD    . MET A 1  761  ? 196.046 199.202 158.215 1.00 93.25  ?  761  MET A SD    1 
ATOM   5925  C  CE    . MET A 1  761  ? 195.421 200.533 159.286 1.00 89.18  ?  761  MET A CE    1 
ATOM   5926  N  N     . SER A 1  762  ? 200.828 201.457 156.219 1.00 92.67  ?  762  SER A N     1 
ATOM   5927  C  CA    . SER A 1  762  ? 201.270 202.024 154.940 1.00 95.17  ?  762  SER A CA    1 
ATOM   5928  C  C     . SER A 1  762  ? 202.764 202.112 154.727 1.00 100.03 ?  762  SER A C     1 
ATOM   5929  O  O     . SER A 1  762  ? 203.235 201.756 153.639 1.00 100.27 ?  762  SER A O     1 
ATOM   5930  C  CB    . SER A 1  762  ? 200.665 203.412 154.740 1.00 100.87 ?  762  SER A CB    1 
ATOM   5931  O  OG    . SER A 1  762  ? 199.253 203.400 154.890 1.00 114.27 ?  762  SER A OG    1 
ATOM   5932  N  N     . ALA A 1  763  ? 203.495 202.602 155.767 1.00 96.12  ?  763  ALA A N     1 
ATOM   5933  C  CA    . ALA A 1  763  ? 204.925 202.908 155.765 1.00 96.73  ?  763  ALA A CA    1 
ATOM   5934  C  C     . ALA A 1  763  ? 205.890 201.928 156.462 1.00 101.39 ?  763  ALA A C     1 
ATOM   5935  O  O     . ALA A 1  763  ? 206.642 201.215 155.780 1.00 101.66 ?  763  ALA A O     1 
ATOM   5936  C  CB    . ALA A 1  763  ? 205.135 204.317 156.296 1.00 97.29  ?  763  ALA A CB    1 
ATOM   5937  N  N     . CYS A 1  764  ? 205.919 201.942 157.812 1.00 97.55  ?  764  CYS A N     1 
ATOM   5938  C  CA    . CYS A 1  764  ? 206.850 201.130 158.598 1.00 97.20  ?  764  CYS A CA    1 
ATOM   5939  C  C     . CYS A 1  764  ? 206.271 200.777 159.978 1.00 98.14  ?  764  CYS A C     1 
ATOM   5940  O  O     . CYS A 1  764  ? 205.795 201.674 160.679 1.00 96.92  ?  764  CYS A O     1 
ATOM   5941  C  CB    . CYS A 1  764  ? 208.190 201.857 158.710 1.00 98.74  ?  764  CYS A CB    1 
ATOM   5942  S  SG    . CYS A 1  764  ? 209.249 201.299 160.068 1.00 102.40 ?  764  CYS A SG    1 
ATOM   5943  N  N     . VAL A 1  765  ? 206.334 199.470 160.360 1.00 93.20  ?  765  VAL A N     1 
ATOM   5944  C  CA    . VAL A 1  765  ? 205.863 198.933 161.648 1.00 91.26  ?  765  VAL A CA    1 
ATOM   5945  C  C     . VAL A 1  765  ? 206.675 199.507 162.813 1.00 94.64  ?  765  VAL A C     1 
ATOM   5946  O  O     . VAL A 1  765  ? 206.093 199.983 163.777 1.00 92.98  ?  765  VAL A O     1 
ATOM   5947  C  CB    . VAL A 1  765  ? 205.802 197.387 161.668 1.00 94.79  ?  765  VAL A CB    1 
ATOM   5948  C  CG1   . VAL A 1  765  ? 205.441 196.854 163.050 1.00 93.19  ?  765  VAL A CG1   1 
ATOM   5949  C  CG2   . VAL A 1  765  ? 204.818 196.863 160.635 1.00 94.86  ?  765  VAL A CG2   1 
ATOM   5950  N  N     . GLY A 1  766  ? 207.994 199.464 162.710 1.00 93.05  ?  766  GLY A N     1 
ATOM   5951  C  CA    . GLY A 1  766  ? 208.876 200.050 163.712 1.00 93.79  ?  766  GLY A CA    1 
ATOM   5952  C  C     . GLY A 1  766  ? 209.560 199.101 164.668 1.00 98.81  ?  766  GLY A C     1 
ATOM   5953  O  O     . GLY A 1  766  ? 209.435 197.878 164.528 1.00 98.50  ?  766  GLY A O     1 
ATOM   5954  N  N     . GLN A 1  767  ? 210.315 199.684 165.642 1.00 95.47  ?  767  GLN A N     1 
ATOM   5955  C  CA    . GLN A 1  767  ? 211.069 198.956 166.673 1.00 94.30  ?  767  GLN A CA    1 
ATOM   5956  C  C     . GLN A 1  767  ? 210.123 198.189 167.613 1.00 96.59  ?  767  GLN A C     1 
ATOM   5957  O  O     . GLN A 1  767  ? 209.020 198.654 167.920 1.00 94.28  ?  767  GLN A O     1 
ATOM   5958  C  CB    . GLN A 1  767  ? 212.041 199.893 167.429 1.00 95.37  ?  767  GLN A CB    1 
ATOM   5959  C  CG    . GLN A 1  767  ? 212.951 199.226 168.475 1.00 98.79  ?  767  GLN A CG    1 
ATOM   5960  C  CD    . GLN A 1  767  ? 213.896 198.148 167.964 1.00 126.47 ?  767  GLN A CD    1 
ATOM   5961  O  OE1   . GLN A 1  767  ? 214.820 198.379 167.158 1.00 125.25 ?  767  GLN A OE1   1 
ATOM   5962  N  NE2   . GLN A 1  767  ? 213.778 196.968 168.547 1.00 119.49 ?  767  GLN A NE2   1 
ATOM   5963  N  N     . GLN A 1  768  ? 210.546 196.973 167.994 1.00 93.60  ?  768  GLN A N     1 
ATOM   5964  C  CA    . GLN A 1  768  ? 209.827 196.051 168.869 1.00 91.74  ?  768  GLN A CA    1 
ATOM   5965  C  C     . GLN A 1  768  ? 210.478 196.040 170.262 1.00 96.27  ?  768  GLN A C     1 
ATOM   5966  O  O     . GLN A 1  768  ? 211.703 195.965 170.371 1.00 97.91  ?  768  GLN A O     1 
ATOM   5967  C  CB    . GLN A 1  768  ? 209.799 194.638 168.235 1.00 92.23  ?  768  GLN A CB    1 
ATOM   5968  C  CG    . GLN A 1  768  ? 208.413 194.167 167.805 1.00 90.79  ?  768  GLN A CG    1 
ATOM   5969  C  CD    . GLN A 1  768  ? 207.625 195.172 166.994 1.00 110.20 ?  768  GLN A CD    1 
ATOM   5970  O  OE1   . GLN A 1  768  ? 206.550 195.647 167.402 1.00 106.55 ?  768  GLN A OE1   1 
ATOM   5971  N  NE2   . GLN A 1  768  ? 208.153 195.545 165.845 1.00 102.88 ?  768  GLN A NE2   1 
ATOM   5972  N  N     . SER A 1  769  ? 209.675 196.154 171.318 1.00 90.97  ?  769  SER A N     1 
ATOM   5973  C  CA    . SER A 1  769  ? 210.219 196.146 172.663 1.00 90.80  ?  769  SER A CA    1 
ATOM   5974  C  C     . SER A 1  769  ? 209.639 195.060 173.531 1.00 94.40  ?  769  SER A C     1 
ATOM   5975  O  O     . SER A 1  769  ? 208.450 194.723 173.433 1.00 94.42  ?  769  SER A O     1 
ATOM   5976  C  CB    . SER A 1  769  ? 209.986 197.492 173.345 1.00 95.33  ?  769  SER A CB    1 
ATOM   5977  O  OG    . SER A 1  769  ? 209.493 197.345 174.675 1.00 105.21 ?  769  SER A OG    1 
ATOM   5978  N  N     . VAL A 1  770  ? 210.479 194.576 174.445 1.00 89.89  ?  770  VAL A N     1 
ATOM   5979  C  CA    . VAL A 1  770  ? 210.123 193.656 175.505 1.00 88.40  ?  770  VAL A CA    1 
ATOM   5980  C  C     . VAL A 1  770  ? 210.846 194.172 176.734 1.00 94.38  ?  770  VAL A C     1 
ATOM   5981  O  O     . VAL A 1  770  ? 212.069 194.397 176.690 1.00 95.32  ?  770  VAL A O     1 
ATOM   5982  C  CB    . VAL A 1  770  ? 210.434 192.182 175.223 1.00 91.75  ?  770  VAL A CB    1 
ATOM   5983  C  CG1   . VAL A 1  770  ? 209.977 191.312 176.387 1.00 90.51  ?  770  VAL A CG1   1 
ATOM   5984  C  CG2   . VAL A 1  770  ? 209.770 191.724 173.934 1.00 91.71  ?  770  VAL A CG2   1 
ATOM   5985  N  N     . GLU A 1  771  ? 210.065 194.422 177.813 1.00 90.34  ?  771  GLU A N     1 
ATOM   5986  C  CA    . GLU A 1  771  ? 210.519 194.957 179.101 1.00 90.11  ?  771  GLU A CA    1 
ATOM   5987  C  C     . GLU A 1  771  ? 211.165 196.327 178.905 1.00 93.93  ?  771  GLU A C     1 
ATOM   5988  O  O     . GLU A 1  771  ? 212.071 196.711 179.642 1.00 94.53  ?  771  GLU A O     1 
ATOM   5989  C  CB    . GLU A 1  771  ? 211.427 193.954 179.861 1.00 92.16  ?  771  GLU A CB    1 
ATOM   5990  C  CG    . GLU A 1  771  ? 210.766 192.597 180.102 1.00 106.89 ?  771  GLU A CG    1 
ATOM   5991  C  CD    . GLU A 1  771  ? 211.459 191.624 181.042 1.00 135.24 ?  771  GLU A CD    1 
ATOM   5992  O  OE1   . GLU A 1  771  ? 212.706 191.513 180.983 1.00 143.25 ?  771  GLU A OE1   1 
ATOM   5993  O  OE2   . GLU A 1  771  ? 210.744 190.940 181.811 1.00 125.93 -1 771  GLU A OE2   1 
ATOM   5994  N  N     . GLY A 1  772  ? 210.684 197.049 177.897 1.00 89.84  ?  772  GLY A N     1 
ATOM   5995  C  CA    . GLY A 1  772  ? 211.181 198.378 177.563 1.00 90.44  ?  772  GLY A CA    1 
ATOM   5996  C  C     . GLY A 1  772  ? 212.366 198.383 176.622 1.00 95.28  ?  772  GLY A C     1 
ATOM   5997  O  O     . GLY A 1  772  ? 212.491 199.275 175.775 1.00 95.71  ?  772  GLY A O     1 
ATOM   5998  N  N     . LYS A 1  773  ? 213.238 197.387 176.760 1.00 91.88  ?  773  LYS A N     1 
ATOM   5999  C  CA    . LYS A 1  773  ? 214.443 197.285 175.944 1.00 92.94  ?  773  LYS A CA    1 
ATOM   6000  C  C     . LYS A 1  773  ? 214.156 196.553 174.618 1.00 94.64  ?  773  LYS A C     1 
ATOM   6001  O  O     . LYS A 1  773  ? 213.174 195.804 174.524 1.00 92.64  ?  773  LYS A O     1 
ATOM   6002  C  CB    . LYS A 1  773  ? 215.585 196.592 176.734 1.00 96.67  ?  773  LYS A CB    1 
ATOM   6003  C  CG    . LYS A 1  773  ? 215.798 197.080 178.181 1.00 110.90 ?  773  LYS A CG    1 
ATOM   6004  C  CD    . LYS A 1  773  ? 215.353 196.031 179.218 1.00 119.79 ?  773  LYS A CD    1 
ATOM   6005  C  CE    . LYS A 1  773  ? 215.150 196.589 180.614 1.00 126.05 ?  773  LYS A CE    1 
ATOM   6006  N  NZ    . LYS A 1  773  ? 216.429 196.746 181.350 1.00 135.22 1  773  LYS A NZ    1 
ATOM   6007  N  N     . ARG A 1  774  ? 215.039 196.753 173.602 1.00 90.49  ?  774  ARG A N     1 
ATOM   6008  C  CA    . ARG A 1  774  ? 214.957 196.082 172.304 1.00 89.58  ?  774  ARG A CA    1 
ATOM   6009  C  C     . ARG A 1  774  ? 215.097 194.577 172.539 1.00 93.61  ?  774  ARG A C     1 
ATOM   6010  O  O     . ARG A 1  774  ? 215.449 194.153 173.644 1.00 92.05  ?  774  ARG A O     1 
ATOM   6011  C  CB    . ARG A 1  774  ? 216.079 196.535 171.357 1.00 89.66  ?  774  ARG A CB    1 
ATOM   6012  C  CG    . ARG A 1  774  ? 216.483 198.006 171.400 1.00 99.39  ?  774  ARG A CG    1 
ATOM   6013  C  CD    . ARG A 1  774  ? 216.735 198.603 170.010 1.00 109.47 ?  774  ARG A CD    1 
ATOM   6014  N  NE    . ARG A 1  774  ? 217.795 197.946 169.229 1.00 112.00 ?  774  ARG A NE    1 
ATOM   6015  C  CZ    . ARG A 1  774  ? 219.086 198.272 169.275 1.00 112.44 ?  774  ARG A CZ    1 
ATOM   6016  N  NH1   . ARG A 1  774  ? 219.503 199.249 170.066 1.00 97.41  1  774  ARG A NH1   1 
ATOM   6017  N  NH2   . ARG A 1  774  ? 219.965 197.624 168.527 1.00 85.04  ?  774  ARG A NH2   1 
ATOM   6018  N  N     . ILE A 1  775  ? 214.809 193.765 171.514 1.00 92.28  ?  775  ILE A N     1 
ATOM   6019  C  CA    . ILE A 1  775  ? 214.899 192.306 171.623 1.00 92.67  ?  775  ILE A CA    1 
ATOM   6020  C  C     . ILE A 1  775  ? 216.299 191.967 172.103 1.00 99.84  ?  775  ILE A C     1 
ATOM   6021  O  O     . ILE A 1  775  ? 217.278 192.413 171.504 1.00 100.63 ?  775  ILE A O     1 
ATOM   6022  C  CB    . ILE A 1  775  ? 214.529 191.589 170.293 1.00 95.70  ?  775  ILE A CB    1 
ATOM   6023  C  CG1   . ILE A 1  775  ? 213.157 192.036 169.719 1.00 94.31  ?  775  ILE A CG1   1 
ATOM   6024  C  CG2   . ILE A 1  775  ? 214.649 190.062 170.410 1.00 97.19  ?  775  ILE A CG2   1 
ATOM   6025  C  CD1   . ILE A 1  775  ? 211.946 191.849 170.605 1.00 97.69  ?  775  ILE A CD1   1 
ATOM   6026  N  N     . ALA A 1  776  ? 216.388 191.270 173.235 1.00 97.93  ?  776  ALA A N     1 
ATOM   6027  C  CA    . ALA A 1  776  ? 217.676 190.935 173.832 1.00 99.69  ?  776  ALA A CA    1 
ATOM   6028  C  C     . ALA A 1  776  ? 218.277 189.644 173.334 1.00 104.74 ?  776  ALA A C     1 
ATOM   6029  O  O     . ALA A 1  776  ? 217.622 188.886 172.621 1.00 103.93 ?  776  ALA A O     1 
ATOM   6030  C  CB    . ALA A 1  776  ? 217.561 190.911 175.341 1.00 100.17 ?  776  ALA A CB    1 
ATOM   6031  N  N     . PHE A 1  777  ? 219.533 189.399 173.718 1.00 103.41 ?  777  PHE A N     1 
ATOM   6032  C  CA    . PHE A 1  777  ? 220.273 188.215 173.327 1.00 104.99 ?  777  PHE A CA    1 
ATOM   6033  C  C     . PHE A 1  777  ? 219.869 186.982 174.143 1.00 106.25 ?  777  PHE A C     1 
ATOM   6034  O  O     . PHE A 1  777  ? 220.514 186.676 175.145 1.00 105.77 ?  777  PHE A O     1 
ATOM   6035  C  CB    . PHE A 1  777  ? 221.786 188.484 173.426 1.00 109.33 ?  777  PHE A CB    1 
ATOM   6036  C  CG    . PHE A 1  777  ? 222.355 189.604 172.576 1.00 113.06 ?  777  PHE A CG    1 
ATOM   6037  C  CD1   . PHE A 1  777  ? 221.728 189.996 171.397 1.00 117.25 ?  777  PHE A CD1   1 
ATOM   6038  C  CD2   . PHE A 1  777  ? 223.555 190.215 172.920 1.00 116.99 ?  777  PHE A CD2   1 
ATOM   6039  C  CE1   . PHE A 1  777  ? 222.287 190.991 170.589 1.00 119.73 ?  777  PHE A CE1   1 
ATOM   6040  C  CE2   . PHE A 1  777  ? 224.113 191.210 172.110 1.00 121.04 ?  777  PHE A CE2   1 
ATOM   6041  C  CZ    . PHE A 1  777  ? 223.475 191.592 170.951 1.00 119.44 ?  777  PHE A CZ    1 
ATOM   6042  N  N     . GLY A 1  778  ? 218.824 186.281 173.694 1.00 101.40 ?  778  GLY A N     1 
ATOM   6043  C  CA    . GLY A 1  778  ? 218.325 185.058 174.330 1.00 100.49 ?  778  GLY A CA    1 
ATOM   6044  C  C     . GLY A 1  778  ? 219.329 183.945 174.157 1.00 105.05 ?  778  GLY A C     1 
ATOM   6045  O  O     . GLY A 1  778  ? 219.552 183.122 175.051 1.00 103.88 ?  778  GLY A O     1 
ATOM   6046  N  N     . PHE A 1  779  ? 219.954 183.961 172.987 1.00 103.17 ?  779  PHE A N     1 
ATOM   6047  C  CA    . PHE A 1  779  ? 221.053 183.107 172.628 1.00 104.63 ?  779  PHE A CA    1 
ATOM   6048  C  C     . PHE A 1  779  ? 222.270 183.898 173.060 1.00 110.58 ?  779  PHE A C     1 
ATOM   6049  O  O     . PHE A 1  779  ? 222.208 185.128 173.181 1.00 110.12 ?  779  PHE A O     1 
ATOM   6050  C  CB    . PHE A 1  779  ? 221.104 182.886 171.108 1.00 107.40 ?  779  PHE A CB    1 
ATOM   6051  C  CG    . PHE A 1  779  ? 220.021 181.995 170.546 1.00 108.55 ?  779  PHE A CG    1 
ATOM   6052  C  CD1   . PHE A 1  779  ? 220.193 180.616 170.487 1.00 111.59 ?  779  PHE A CD1   1 
ATOM   6053  C  CD2   . PHE A 1  779  ? 218.847 182.538 170.035 1.00 110.03 ?  779  PHE A CD2   1 
ATOM   6054  C  CE1   . PHE A 1  779  ? 219.201 179.795 169.948 1.00 111.74 ?  779  PHE A CE1   1 
ATOM   6055  C  CE2   . PHE A 1  779  ? 217.847 181.716 169.517 1.00 112.03 ?  779  PHE A CE2   1 
ATOM   6056  C  CZ    . PHE A 1  779  ? 218.033 180.351 169.473 1.00 110.33 ?  779  PHE A CZ    1 
ATOM   6057  N  N     . VAL A 1  780  ? 223.375 183.194 173.288 1.00 108.61 ?  780  VAL A N     1 
ATOM   6058  C  CA    . VAL A 1  780  ? 224.661 183.747 173.691 1.00 108.84 ?  780  VAL A CA    1 
ATOM   6059  C  C     . VAL A 1  780  ? 225.110 184.804 172.657 1.00 112.41 ?  780  VAL A C     1 
ATOM   6060  O  O     . VAL A 1  780  ? 225.357 184.463 171.499 1.00 113.35 ?  780  VAL A O     1 
ATOM   6061  C  CB    . VAL A 1  780  ? 225.658 182.568 173.881 1.00 113.63 ?  780  VAL A CB    1 
ATOM   6062  C  CG1   . VAL A 1  780  ? 227.121 183.010 173.838 1.00 115.29 ?  780  VAL A CG1   1 
ATOM   6063  C  CG2   . VAL A 1  780  ? 225.356 181.809 175.168 1.00 112.47 ?  780  VAL A CG2   1 
ATOM   6064  N  N     . ASP A 1  781  ? 225.097 186.093 173.064 1.00 107.08 ?  781  ASP A N     1 
ATOM   6065  C  CA    . ASP A 1  781  ? 225.541 187.246 172.268 1.00 107.51 ?  781  ASP A CA    1 
ATOM   6066  C  C     . ASP A 1  781  ? 224.807 187.528 170.921 1.00 108.83 ?  781  ASP A C     1 
ATOM   6067  O  O     . ASP A 1  781  ? 225.307 188.291 170.084 1.00 109.13 ?  781  ASP A O     1 
ATOM   6068  C  CB    . ASP A 1  781  ? 227.088 187.239 172.103 1.00 111.99 ?  781  ASP A CB    1 
ATOM   6069  C  CG    . ASP A 1  781  ? 227.935 187.600 173.333 1.00 126.58 ?  781  ASP A CG    1 
ATOM   6070  O  OD1   . ASP A 1  781  ? 227.523 188.517 174.100 1.00 125.86 ?  781  ASP A OD1   1 
ATOM   6071  O  OD2   . ASP A 1  781  ? 229.071 187.050 173.462 1.00 135.32 -1 781  ASP A OD2   1 
ATOM   6072  N  N     . ARG A 1  782  ? 223.617 186.950 170.726 1.00 102.81 ?  782  ARG A N     1 
ATOM   6073  C  CA    . ARG A 1  782  ? 222.825 187.166 169.508 1.00 101.73 ?  782  ARG A CA    1 
ATOM   6074  C  C     . ARG A 1  782  ? 221.330 186.936 169.792 1.00 104.16 ?  782  ARG A C     1 
ATOM   6075  O  O     . ARG A 1  782  ? 221.011 186.188 170.721 1.00 103.18 ?  782  ARG A O     1 
ATOM   6076  C  CB    . ARG A 1  782  ? 223.346 186.305 168.329 1.00 100.35 ?  782  ARG A CB    1 
ATOM   6077  C  CG    . ARG A 1  782  ? 223.168 184.793 168.502 1.00 100.33 ?  782  ARG A CG    1 
ATOM   6078  C  CD    . ARG A 1  782  ? 224.469 184.034 168.392 1.00 96.30  ?  782  ARG A CD    1 
ATOM   6079  N  NE    . ARG A 1  782  ? 224.254 182.595 168.231 1.00 94.45  ?  782  ARG A NE    1 
ATOM   6080  C  CZ    . ARG A 1  782  ? 224.358 181.943 167.071 1.00 105.21 ?  782  ARG A CZ    1 
ATOM   6081  N  NH1   . ARG A 1  782  ? 224.696 182.597 165.959 1.00 85.37  1  782  ARG A NH1   1 
ATOM   6082  N  NH2   . ARG A 1  782  ? 224.133 180.636 167.014 1.00 88.35  ?  782  ARG A NH2   1 
ATOM   6083  N  N     . THR A 1  783  ? 220.420 187.596 169.022 1.00 99.73  ?  783  THR A N     1 
ATOM   6084  C  CA    . THR A 1  783  ? 218.951 187.458 169.179 1.00 97.63  ?  783  THR A CA    1 
ATOM   6085  C  C     . THR A 1  783  ? 218.390 186.186 168.527 1.00 100.74 ?  783  THR A C     1 
ATOM   6086  O  O     . THR A 1  783  ? 217.406 185.622 169.009 1.00 98.76  ?  783  THR A O     1 
ATOM   6087  C  CB    . THR A 1  783  ? 218.216 188.679 168.645 1.00 102.26 ?  783  THR A CB    1 
ATOM   6088  O  OG1   . THR A 1  783  ? 218.728 188.988 167.352 1.00 100.86 ?  783  THR A OG1   1 
ATOM   6089  C  CG2   . THR A 1  783  ? 218.344 189.873 169.556 1.00 101.83 ?  783  THR A CG2   1 
ATOM   6090  N  N     . LEU A 1  784  ? 219.003 185.753 167.420 1.00 98.10  ?  784  LEU A N     1 
ATOM   6091  C  CA    . LEU A 1  784  ? 218.611 184.554 166.687 1.00 97.61  ?  784  LEU A CA    1 
ATOM   6092  C  C     . LEU A 1  784  ? 219.855 183.836 166.119 1.00 101.55 ?  784  LEU A C     1 
ATOM   6093  O  O     . LEU A 1  784  ? 220.887 184.490 165.924 1.00 101.29 ?  784  LEU A O     1 
ATOM   6094  C  CB    . LEU A 1  784  ? 217.636 184.926 165.542 1.00 97.32  ?  784  LEU A CB    1 
ATOM   6095  C  CG    . LEU A 1  784  ? 216.189 185.259 165.913 1.00 99.85  ?  784  LEU A CG    1 
ATOM   6096  C  CD1   . LEU A 1  784  ? 215.388 185.632 164.675 1.00 99.77  ?  784  LEU A CD1   1 
ATOM   6097  C  CD2   . LEU A 1  784  ? 215.521 184.103 166.641 1.00 100.96 ?  784  LEU A CD2   1 
ATOM   6098  N  N     . PRO A 1  785  ? 219.772 182.517 165.790 1.00 97.84  ?  785  PRO A N     1 
ATOM   6099  C  CA    . PRO A 1  785  ? 220.945 181.823 165.208 1.00 99.52  ?  785  PRO A CA    1 
ATOM   6100  C  C     . PRO A 1  785  ? 221.331 182.221 163.766 1.00 105.55 ?  785  PRO A C     1 
ATOM   6101  O  O     . PRO A 1  785  ? 222.332 181.735 163.236 1.00 105.98 ?  785  PRO A O     1 
ATOM   6102  C  CB    . PRO A 1  785  ? 220.566 180.344 165.315 1.00 100.86 ?  785  PRO A CB    1 
ATOM   6103  C  CG    . PRO A 1  785  ? 219.096 180.333 165.319 1.00 103.37 ?  785  PRO A CG    1 
ATOM   6104  C  CD    . PRO A 1  785  ? 218.626 181.599 165.949 1.00 97.71  ?  785  PRO A CD    1 
ATOM   6105  N  N     . HIS A 1  786  ? 220.535 183.116 163.146 1.00 102.91 ?  786  HIS A N     1 
ATOM   6106  C  CA    . HIS A 1  786  ? 220.704 183.645 161.789 1.00 103.81 ?  786  HIS A CA    1 
ATOM   6107  C  C     . HIS A 1  786  ? 221.561 184.876 161.815 1.00 108.25 ?  786  HIS A C     1 
ATOM   6108  O  O     . HIS A 1  786  ? 221.819 185.447 160.757 1.00 108.65 ?  786  HIS A O     1 
ATOM   6109  C  CB    . HIS A 1  786  ? 219.341 183.986 161.161 1.00 103.74 ?  786  HIS A CB    1 
ATOM   6110  C  CG    . HIS A 1  786  ? 218.336 182.915 161.385 1.00 106.10 ?  786  HIS A CG    1 
ATOM   6111  N  ND1   . HIS A 1  786  ? 217.555 182.901 162.520 1.00 106.37 ?  786  HIS A ND1   1 
ATOM   6112  C  CD2   . HIS A 1  786  ? 218.105 181.790 160.675 1.00 108.35 ?  786  HIS A CD2   1 
ATOM   6113  C  CE1   . HIS A 1  786  ? 216.842 181.793 162.444 1.00 105.50 ?  786  HIS A CE1   1 
ATOM   6114  N  NE2   . HIS A 1  786  ? 217.138 181.092 161.351 1.00 106.98 ?  786  HIS A NE2   1 
ATOM   6115  N  N     . PHE A 1  787  ? 221.991 185.297 163.016 1.00 105.18 ?  787  PHE A N     1 
ATOM   6116  C  CA    . PHE A 1  787  ? 222.848 186.461 163.203 1.00 106.43 ?  787  PHE A CA    1 
ATOM   6117  C  C     . PHE A 1  787  ? 224.242 186.108 163.754 1.00 111.44 ?  787  PHE A C     1 
ATOM   6118  O  O     . PHE A 1  787  ? 224.443 185.074 164.411 1.00 109.50 ?  787  PHE A O     1 
ATOM   6119  C  CB    . PHE A 1  787  ? 222.183 187.510 164.115 1.00 107.26 ?  787  PHE A CB    1 
ATOM   6120  C  CG    . PHE A 1  787  ? 220.874 188.098 163.649 1.00 108.34 ?  787  PHE A CG    1 
ATOM   6121  C  CD1   . PHE A 1  787  ? 220.843 189.069 162.656 1.00 112.28 ?  787  PHE A CD1   1 
ATOM   6122  C  CD2   . PHE A 1  787  ? 219.679 187.750 164.266 1.00 109.85 ?  787  PHE A CD2   1 
ATOM   6123  C  CE1   . PHE A 1  787  ? 219.629 189.641 162.247 1.00 112.44 ?  787  PHE A CE1   1 
ATOM   6124  C  CE2   . PHE A 1  787  ? 218.467 188.328 163.863 1.00 111.83 ?  787  PHE A CE2   1 
ATOM   6125  C  CZ    . PHE A 1  787  ? 218.452 189.267 162.853 1.00 110.21 ?  787  PHE A CZ    1 
ATOM   6126  N  N     . SER A 1  788  ? 225.199 187.008 163.482 1.00 110.48 ?  788  SER A N     1 
ATOM   6127  C  CA    . SER A 1  788  ? 226.554 186.935 163.996 1.00 112.08 ?  788  SER A CA    1 
ATOM   6128  C  C     . SER A 1  788  ? 226.503 187.458 165.433 1.00 117.97 ?  788  SER A C     1 
ATOM   6129  O  O     . SER A 1  788  ? 225.576 188.200 165.786 1.00 117.56 ?  788  SER A O     1 
ATOM   6130  C  CB    . SER A 1  788  ? 227.484 187.801 163.158 1.00 116.33 ?  788  SER A CB    1 
ATOM   6131  O  OG    . SER A 1  788  ? 228.329 186.988 162.359 1.00 125.81 ?  788  SER A OG    1 
ATOM   6132  N  N     . LYS A 1  789  ? 227.469 187.059 166.270 1.00 115.48 ?  789  LYS A N     1 
ATOM   6133  C  CA    . LYS A 1  789  ? 227.517 187.515 167.659 1.00 114.37 ?  789  LYS A CA    1 
ATOM   6134  C  C     . LYS A 1  789  ? 227.839 189.013 167.730 1.00 120.17 ?  789  LYS A C     1 
ATOM   6135  O  O     . LYS A 1  789  ? 228.392 189.579 166.772 1.00 120.58 ?  789  LYS A O     1 
ATOM   6136  C  CB    . LYS A 1  789  ? 228.513 186.680 168.487 1.00 116.25 ?  789  LYS A CB    1 
ATOM   6137  C  CG    . LYS A 1  789  ? 227.961 185.321 168.881 1.00 115.11 ?  789  LYS A CG    1 
ATOM   6138  C  CD    . LYS A 1  789  ? 228.938 184.469 169.670 1.00 118.05 ?  789  LYS A CD    1 
ATOM   6139  C  CE    . LYS A 1  789  ? 228.256 183.231 170.205 1.00 121.55 ?  789  LYS A CE    1 
ATOM   6140  N  NZ    . LYS A 1  789  ? 229.177 182.348 170.956 1.00 126.62 1  789  LYS A NZ    1 
ATOM   6141  N  N     . ASP A 1  790  ? 227.433 189.655 168.850 1.00 117.01 ?  790  ASP A N     1 
ATOM   6142  C  CA    . ASP A 1  790  ? 227.659 191.073 169.163 1.00 117.36 ?  790  ASP A CA    1 
ATOM   6143  C  C     . ASP A 1  790  ? 227.170 192.011 168.028 1.00 120.49 ?  790  ASP A C     1 
ATOM   6144  O  O     . ASP A 1  790  ? 227.905 192.893 167.553 1.00 119.82 ?  790  ASP A O     1 
ATOM   6145  C  CB    . ASP A 1  790  ? 229.132 191.304 169.591 1.00 121.29 ?  790  ASP A CB    1 
ATOM   6146  C  CG    . ASP A 1  790  ? 229.603 190.411 170.743 1.00 134.45 ?  790  ASP A CG    1 
ATOM   6147  O  OD1   . ASP A 1  790  ? 229.201 190.680 171.906 1.00 134.86 ?  790  ASP A OD1   1 
ATOM   6148  O  OD2   . ASP A 1  790  ? 230.399 189.451 170.482 1.00 139.03 -1 790  ASP A OD2   1 
ATOM   6149  N  N     . ASP A 1  791  ? 225.907 191.752 167.584 1.00 116.63 ?  791  ASP A N     1 
ATOM   6150  C  CA    . ASP A 1  791  ? 225.173 192.460 166.525 1.00 116.33 ?  791  ASP A CA    1 
ATOM   6151  C  C     . ASP A 1  791  ? 224.132 193.378 167.175 1.00 118.83 ?  791  ASP A C     1 
ATOM   6152  O  O     . ASP A 1  791  ? 223.079 192.912 167.612 1.00 117.11 ?  791  ASP A O     1 
ATOM   6153  C  CB    . ASP A 1  791  ? 224.500 191.446 165.552 1.00 117.77 ?  791  ASP A CB    1 
ATOM   6154  C  CG    . ASP A 1  791  ? 224.066 191.968 164.173 1.00 121.97 ?  791  ASP A CG    1 
ATOM   6155  O  OD1   . ASP A 1  791  ? 223.637 193.133 164.085 1.00 118.89 ?  791  ASP A OD1   1 
ATOM   6156  O  OD2   . ASP A 1  791  ? 224.078 191.168 163.197 1.00 127.90 -1 791  ASP A OD2   1 
ATOM   6157  N  N     . TYR A 1  792  ? 224.452 194.676 167.269 1.00 115.90 ?  792  TYR A N     1 
ATOM   6158  C  CA    . TYR A 1  792  ? 223.571 195.667 167.877 1.00 115.01 ?  792  TYR A CA    1 
ATOM   6159  C  C     . TYR A 1  792  ? 222.806 196.436 166.809 1.00 117.56 ?  792  TYR A C     1 
ATOM   6160  O  O     . TYR A 1  792  ? 222.198 197.460 167.107 1.00 116.68 ?  792  TYR A O     1 
ATOM   6161  C  CB    . TYR A 1  792  ? 224.359 196.601 168.830 1.00 117.89 ?  792  TYR A CB    1 
ATOM   6162  C  CG    . TYR A 1  792  ? 224.867 195.893 170.073 1.00 121.70 ?  792  TYR A CG    1 
ATOM   6163  C  CD1   . TYR A 1  792  ? 226.106 195.253 170.080 1.00 125.42 ?  792  TYR A CD1   1 
ATOM   6164  C  CD2   . TYR A 1  792  ? 224.091 195.825 171.231 1.00 121.62 ?  792  TYR A CD2   1 
ATOM   6165  C  CE1   . TYR A 1  792  ? 226.556 194.552 171.204 1.00 126.55 ?  792  TYR A CE1   1 
ATOM   6166  C  CE2   . TYR A 1  792  ? 224.540 195.143 172.369 1.00 122.65 ?  792  TYR A CE2   1 
ATOM   6167  C  CZ    . TYR A 1  792  ? 225.775 194.507 172.352 1.00 131.28 ?  792  TYR A CZ    1 
ATOM   6168  O  OH    . TYR A 1  792  ? 226.234 193.831 173.465 1.00 130.36 ?  792  TYR A OH    1 
ATOM   6169  N  N     . SER A 1  793  ? 222.798 195.912 165.568 1.00 114.13 ?  793  SER A N     1 
ATOM   6170  C  CA    . SER A 1  793  ? 222.119 196.523 164.420 1.00 113.76 ?  793  SER A CA    1 
ATOM   6171  C  C     . SER A 1  793  ? 220.618 196.564 164.617 1.00 114.58 ?  793  SER A C     1 
ATOM   6172  O  O     . SER A 1  793  ? 220.093 195.674 165.292 1.00 114.29 ?  793  SER A O     1 
ATOM   6173  C  CB    . SER A 1  793  ? 222.450 195.780 163.123 1.00 118.92 ?  793  SER A CB    1 
ATOM   6174  O  OG    . SER A 1  793  ? 221.871 194.486 163.044 1.00 125.74 ?  793  SER A OG    1 
ATOM   6175  N  N     . PRO A 1  794  ? 219.903 197.551 164.015 1.00 108.93 ?  794  PRO A N     1 
ATOM   6176  C  CA    . PRO A 1  794  ? 218.426 197.594 164.149 1.00 107.07 ?  794  PRO A CA    1 
ATOM   6177  C  C     . PRO A 1  794  ? 217.719 196.272 163.815 1.00 107.88 ?  794  PRO A C     1 
ATOM   6178  O  O     . PRO A 1  794  ? 216.877 195.827 164.601 1.00 105.38 ?  794  PRO A O     1 
ATOM   6179  C  CB    . PRO A 1  794  ? 218.019 198.708 163.171 1.00 109.21 ?  794  PRO A CB    1 
ATOM   6180  C  CG    . PRO A 1  794  ? 219.216 198.939 162.303 1.00 114.81 ?  794  PRO A CG    1 
ATOM   6181  C  CD    . PRO A 1  794  ? 220.383 198.666 163.179 1.00 110.83 ?  794  PRO A CD    1 
ATOM   6182  N  N     . GLU A 1  795  ? 218.136 195.633 162.678 1.00 103.76 ?  795  GLU A N     1 
ATOM   6183  C  CA    . GLU A 1  795  ? 217.675 194.362 162.123 1.00 102.60 ?  795  GLU A CA    1 
ATOM   6184  C  C     . GLU A 1  795  ? 217.903 193.235 163.095 1.00 106.70 ?  795  GLU A C     1 
ATOM   6185  O  O     . GLU A 1  795  ? 217.135 192.280 163.072 1.00 107.07 ?  795  GLU A O     1 
ATOM   6186  C  CB    . GLU A 1  795  ? 218.386 193.999 160.803 1.00 105.30 ?  795  GLU A CB    1 
ATOM   6187  C  CG    . GLU A 1  795  ? 218.903 195.155 159.967 1.00 118.62 ?  795  GLU A CG    1 
ATOM   6188  C  CD    . GLU A 1  795  ? 220.367 195.542 160.133 1.00 143.43 ?  795  GLU A CD    1 
ATOM   6189  O  OE1   . GLU A 1  795  ? 221.240 194.644 160.124 1.00 133.43 ?  795  GLU A OE1   1 
ATOM   6190  O  OE2   . GLU A 1  795  ? 220.648 196.761 160.205 1.00 139.45 -1 795  GLU A OE2   1 
ATOM   6191  N  N     . SER A 1  796  ? 218.959 193.299 163.920 1.00 103.49 ?  796  SER A N     1 
ATOM   6192  C  CA    . SER A 1  796  ? 219.214 192.229 164.889 1.00 103.51 ?  796  SER A CA    1 
ATOM   6193  C  C     . SER A 1  796  ? 218.412 192.400 166.170 1.00 106.65 ?  796  SER A C     1 
ATOM   6194  O  O     . SER A 1  796  ? 217.914 191.412 166.707 1.00 105.09 ?  796  SER A O     1 
ATOM   6195  C  CB    . SER A 1  796  ? 220.699 192.101 165.215 1.00 108.77 ?  796  SER A CB    1 
ATOM   6196  O  OG    . SER A 1  796  ? 220.947 191.038 166.126 1.00 117.46 ?  796  SER A OG    1 
ATOM   6197  N  N     . LYS A 1  797  ? 218.288 193.635 166.664 1.00 103.64 ?  797  LYS A N     1 
ATOM   6198  C  CA    . LYS A 1  797  ? 217.575 193.867 167.914 1.00 102.34 ?  797  LYS A CA    1 
ATOM   6199  C  C     . LYS A 1  797  ? 216.056 194.209 167.819 1.00 105.79 ?  797  LYS A C     1 
ATOM   6200  O  O     . LYS A 1  797  ? 215.480 194.779 168.753 1.00 104.62 ?  797  LYS A O     1 
ATOM   6201  C  CB    . LYS A 1  797  ? 218.390 194.743 168.882 1.00 104.40 ?  797  LYS A CB    1 
ATOM   6202  C  CG    . LYS A 1  797  ? 219.672 194.079 169.393 1.00 103.78 ?  797  LYS A CG    1 
ATOM   6203  C  CD    . LYS A 1  797  ? 220.313 194.861 170.532 1.00 105.98 ?  797  LYS A CD    1 
ATOM   6204  C  CE    . LYS A 1  797  ? 220.248 194.120 171.848 1.00 111.28 ?  797  LYS A CE    1 
ATOM   6205  N  NZ    . LYS A 1  797  ? 219.198 194.664 172.754 1.00 117.42 1  797  LYS A NZ    1 
ATOM   6206  N  N     . GLY A 1  798  ? 215.424 193.797 166.715 1.00 101.99 ?  798  GLY A N     1 
ATOM   6207  C  CA    . GLY A 1  798  ? 213.981 193.911 166.520 1.00 100.23 ?  798  GLY A CA    1 
ATOM   6208  C  C     . GLY A 1  798  ? 213.356 195.107 165.831 1.00 102.37 ?  798  GLY A C     1 
ATOM   6209  O  O     . GLY A 1  798  ? 212.201 195.432 166.135 1.00 100.39 ?  798  GLY A O     1 
ATOM   6210  N  N     . PHE A 1  799  ? 214.062 195.753 164.885 1.00 98.93  ?  799  PHE A N     1 
ATOM   6211  C  CA    . PHE A 1  799  ? 213.444 196.870 164.163 1.00 97.42  ?  799  PHE A CA    1 
ATOM   6212  C  C     . PHE A 1  799  ? 212.731 196.333 162.930 1.00 100.41 ?  799  PHE A C     1 
ATOM   6213  O  O     . PHE A 1  799  ? 213.378 195.785 162.025 1.00 101.07 ?  799  PHE A O     1 
ATOM   6214  C  CB    . PHE A 1  799  ? 214.435 198.015 163.823 1.00 99.44  ?  799  PHE A CB    1 
ATOM   6215  C  CG    . PHE A 1  799  ? 213.836 199.136 162.993 1.00 99.82  ?  799  PHE A CG    1 
ATOM   6216  C  CD1   . PHE A 1  799  ? 212.930 200.033 163.550 1.00 100.98 ?  799  PHE A CD1   1 
ATOM   6217  C  CD2   . PHE A 1  799  ? 214.165 199.284 161.652 1.00 101.66 ?  799  PHE A CD2   1 
ATOM   6218  C  CE1   . PHE A 1  799  ? 212.370 201.058 162.779 1.00 101.52 ?  799  PHE A CE1   1 
ATOM   6219  C  CE2   . PHE A 1  799  ? 213.613 200.317 160.886 1.00 103.97 ?  799  PHE A CE2   1 
ATOM   6220  C  CZ    . PHE A 1  799  ? 212.721 201.197 161.453 1.00 101.05 ?  799  PHE A CZ    1 
ATOM   6221  N  N     . VAL A 1  800  ? 211.387 196.448 162.929 1.00 94.73  ?  800  VAL A N     1 
ATOM   6222  C  CA    . VAL A 1  800  ? 210.558 196.009 161.809 1.00 94.13  ?  800  VAL A CA    1 
ATOM   6223  C  C     . VAL A 1  800  ? 210.478 197.164 160.808 1.00 98.85  ?  800  VAL A C     1 
ATOM   6224  O  O     . VAL A 1  800  ? 209.681 198.090 160.973 1.00 98.67  ?  800  VAL A O     1 
ATOM   6225  C  CB    . VAL A 1  800  ? 209.181 195.421 162.223 1.00 96.02  ?  800  VAL A CB    1 
ATOM   6226  C  CG1   . VAL A 1  800  ? 208.350 195.071 160.997 1.00 96.05  ?  800  VAL A CG1   1 
ATOM   6227  C  CG2   . VAL A 1  800  ? 209.360 194.190 163.097 1.00 94.98  ?  800  VAL A CG2   1 
ATOM   6228  N  N     . GLU A 1  801  ? 211.371 197.121 159.813 1.00 95.84  ?  801  GLU A N     1 
ATOM   6229  C  CA    . GLU A 1  801  ? 211.572 198.095 158.738 1.00 96.41  ?  801  GLU A CA    1 
ATOM   6230  C  C     . GLU A 1  801  ? 210.341 198.260 157.814 1.00 99.15  ?  801  GLU A C     1 
ATOM   6231  O  O     . GLU A 1  801  ? 210.003 199.376 157.400 1.00 97.46  ?  801  GLU A O     1 
ATOM   6232  C  CB    . GLU A 1  801  ? 212.846 197.675 157.960 1.00 99.35  ?  801  GLU A CB    1 
ATOM   6233  C  CG    . GLU A 1  801  ? 212.950 198.132 156.516 1.00 111.35 ?  801  GLU A CG    1 
ATOM   6234  C  CD    . GLU A 1  801  ? 214.103 199.062 156.214 1.00 139.45 ?  801  GLU A CD    1 
ATOM   6235  O  OE1   . GLU A 1  801  ? 215.161 198.933 156.870 1.00 137.71 ?  801  GLU A OE1   1 
ATOM   6236  O  OE2   . GLU A 1  801  ? 213.941 199.943 155.339 1.00 142.88 -1 801  GLU A OE2   1 
ATOM   6237  N  N     . ASN A 1  802  ? 209.691 197.128 157.505 1.00 96.47  ?  802  ASN A N     1 
ATOM   6238  C  CA    . ASN A 1  802  ? 208.555 197.003 156.594 1.00 96.39  ?  802  ASN A CA    1 
ATOM   6239  C  C     . ASN A 1  802  ? 207.179 197.416 157.137 1.00 99.72  ?  802  ASN A C     1 
ATOM   6240  O  O     . ASN A 1  802  ? 206.947 197.381 158.352 1.00 99.14  ?  802  ASN A O     1 
ATOM   6241  C  CB    . ASN A 1  802  ? 208.483 195.560 156.100 1.00 95.18  ?  802  ASN A CB    1 
ATOM   6242  C  CG    . ASN A 1  802  ? 209.593 195.194 155.170 1.00 116.36 ?  802  ASN A CG    1 
ATOM   6243  O  OD1   . ASN A 1  802  ? 209.752 195.776 154.089 1.00 111.80 ?  802  ASN A OD1   1 
ATOM   6244  N  ND2   . ASN A 1  802  ? 210.395 194.232 155.583 1.00 108.60 ?  802  ASN A ND2   1 
ATOM   6245  N  N     . SER A 1  803  ? 206.251 197.755 156.202 1.00 94.50  ?  803  SER A N     1 
ATOM   6246  C  CA    . SER A 1  803  ? 204.845 198.047 156.483 1.00 91.57  ?  803  SER A CA    1 
ATOM   6247  C  C     . SER A 1  803  ? 204.102 196.702 156.547 1.00 92.08  ?  803  SER A C     1 
ATOM   6248  O  O     . SER A 1  803  ? 204.642 195.670 156.117 1.00 91.03  ?  803  SER A O     1 
ATOM   6249  C  CB    . SER A 1  803  ? 204.243 198.930 155.386 1.00 94.61  ?  803  SER A CB    1 
ATOM   6250  O  OG    . SER A 1  803  ? 204.405 198.448 154.060 1.00 99.83  ?  803  SER A OG    1 
ATOM   6251  N  N     . TYR A 1  804  ? 202.865 196.701 157.089 1.00 86.65  ?  804  TYR A N     1 
ATOM   6252  C  CA    . TYR A 1  804  ? 202.065 195.475 157.124 1.00 84.65  ?  804  TYR A CA    1 
ATOM   6253  C  C     . TYR A 1  804  ? 201.676 195.114 155.699 1.00 88.71  ?  804  TYR A C     1 
ATOM   6254  O  O     . TYR A 1  804  ? 201.724 193.933 155.358 1.00 88.97  ?  804  TYR A O     1 
ATOM   6255  C  CB    . TYR A 1  804  ? 200.836 195.615 158.009 1.00 83.44  ?  804  TYR A CB    1 
ATOM   6256  C  CG    . TYR A 1  804  ? 201.119 195.511 159.492 1.00 83.84  ?  804  TYR A CG    1 
ATOM   6257  C  CD1   . TYR A 1  804  ? 201.654 194.347 160.045 1.00 84.43  ?  804  TYR A CD1   1 
ATOM   6258  C  CD2   . TYR A 1  804  ? 200.764 196.540 160.360 1.00 84.92  ?  804  TYR A CD2   1 
ATOM   6259  C  CE1   . TYR A 1  804  ? 201.879 194.234 161.418 1.00 83.48  ?  804  TYR A CE1   1 
ATOM   6260  C  CE2   . TYR A 1  804  ? 200.955 196.426 161.739 1.00 85.43  ?  804  TYR A CE2   1 
ATOM   6261  C  CZ    . TYR A 1  804  ? 201.516 195.273 162.265 1.00 92.11  ?  804  TYR A CZ    1 
ATOM   6262  O  OH    . TYR A 1  804  ? 201.701 195.199 163.629 1.00 92.18  ?  804  TYR A OH    1 
ATOM   6263  N  N     . LEU A 1  805  ? 201.394 196.148 154.845 1.00 84.27  ?  805  LEU A N     1 
ATOM   6264  C  CA    . LEU A 1  805  ? 201.090 196.047 153.407 1.00 83.76  ?  805  LEU A CA    1 
ATOM   6265  C  C     . LEU A 1  805  ? 202.206 195.335 152.650 1.00 88.54  ?  805  LEU A C     1 
ATOM   6266  O  O     . LEU A 1  805  ? 201.908 194.554 151.751 1.00 87.62  ?  805  LEU A O     1 
ATOM   6267  C  CB    . LEU A 1  805  ? 200.832 197.444 152.808 1.00 83.81  ?  805  LEU A CB    1 
ATOM   6268  C  CG    . LEU A 1  805  ? 201.011 197.649 151.296 1.00 89.04  ?  805  LEU A CG    1 
ATOM   6269  C  CD1   . LEU A 1  805  ? 199.780 197.276 150.535 1.00 87.39  ?  805  LEU A CD1   1 
ATOM   6270  C  CD2   . LEU A 1  805  ? 201.395 199.105 150.984 1.00 95.99  ?  805  LEU A CD2   1 
ATOM   6271  N  N     . ARG A 1  806  ? 203.484 195.587 153.024 1.00 87.60  ?  806  ARG A N     1 
ATOM   6272  C  CA    . ARG A 1  806  ? 204.650 194.961 152.383 1.00 89.55  ?  806  ARG A CA    1 
ATOM   6273  C  C     . ARG A 1  806  ? 204.908 193.553 152.860 1.00 94.02  ?  806  ARG A C     1 
ATOM   6274  O  O     . ARG A 1  806  ? 205.294 192.706 152.054 1.00 95.14  ?  806  ARG A O     1 
ATOM   6275  C  CB    . ARG A 1  806  ? 205.916 195.806 152.551 1.00 91.19  ?  806  ARG A CB    1 
ATOM   6276  C  CG    . ARG A 1  806  ? 206.274 196.582 151.301 1.00 105.50 ?  806  ARG A CG    1 
ATOM   6277  C  CD    . ARG A 1  806  ? 207.216 197.710 151.637 1.00 123.40 ?  806  ARG A CD    1 
ATOM   6278  N  NE    . ARG A 1  806  ? 208.402 197.679 150.787 1.00 139.04 ?  806  ARG A NE    1 
ATOM   6279  C  CZ    . ARG A 1  806  ? 209.291 198.663 150.703 1.00 160.17 ?  806  ARG A CZ    1 
ATOM   6280  N  NH1   . ARG A 1  806  ? 209.140 199.768 151.425 1.00 145.38 1  806  ARG A NH1   1 
ATOM   6281  N  NH2   . ARG A 1  806  ? 210.338 198.550 149.899 1.00 155.59 ?  806  ARG A NH2   1 
ATOM   6282  N  N     . GLY A 1  807  ? 204.695 193.320 154.152 1.00 89.17  ?  807  GLY A N     1 
ATOM   6283  C  CA    . GLY A 1  807  ? 204.943 192.034 154.779 1.00 88.50  ?  807  GLY A CA    1 
ATOM   6284  C  C     . GLY A 1  807  ? 206.223 192.035 155.592 1.00 93.28  ?  807  GLY A C     1 
ATOM   6285  O  O     . GLY A 1  807  ? 207.143 192.823 155.334 1.00 93.99  ?  807  GLY A O     1 
ATOM   6286  N  N     . LEU A 1  808  ? 206.282 191.128 156.580 1.00 88.44  ?  808  LEU A N     1 
ATOM   6287  C  CA    . LEU A 1  808  ? 207.400 190.965 157.515 1.00 87.29  ?  808  LEU A CA    1 
ATOM   6288  C  C     . LEU A 1  808  ? 208.323 189.800 157.153 1.00 92.09  ?  808  LEU A C     1 
ATOM   6289  O  O     . LEU A 1  808  ? 207.844 188.729 156.753 1.00 92.22  ?  808  LEU A O     1 
ATOM   6290  C  CB    . LEU A 1  808  ? 206.850 190.770 158.952 1.00 84.84  ?  808  LEU A CB    1 
ATOM   6291  C  CG    . LEU A 1  808  ? 206.597 192.036 159.768 1.00 87.27  ?  808  LEU A CG    1 
ATOM   6292  C  CD1   . LEU A 1  808  ? 205.327 192.776 159.325 1.00 86.17  ?  808  LEU A CD1   1 
ATOM   6293  C  CD2   . LEU A 1  808  ? 206.565 191.734 161.246 1.00 87.58  ?  808  LEU A CD2   1 
ATOM   6294  N  N     . THR A 1  809  ? 209.647 190.001 157.338 1.00 88.08  ?  809  THR A N     1 
ATOM   6295  C  CA    . THR A 1  809  ? 210.653 188.954 157.137 1.00 88.40  ?  809  THR A CA    1 
ATOM   6296  C  C     . THR A 1  809  ? 210.537 187.962 158.322 1.00 91.02  ?  809  THR A C     1 
ATOM   6297  O  O     . THR A 1  809  ? 210.022 188.360 159.372 1.00 90.40  ?  809  THR A O     1 
ATOM   6298  C  CB    . THR A 1  809  ? 212.047 189.554 157.075 1.00 96.73  ?  809  THR A CB    1 
ATOM   6299  O  OG1   . THR A 1  809  ? 212.364 190.093 158.356 1.00 96.43  ?  809  THR A OG1   1 
ATOM   6300  C  CG2   . THR A 1  809  ? 212.198 190.599 155.966 1.00 96.49  ?  809  THR A CG2   1 
ATOM   6301  N  N     . PRO A 1  810  ? 210.977 186.684 158.206 1.00 86.39  ?  810  PRO A N     1 
ATOM   6302  C  CA    . PRO A 1  810  ? 210.828 185.750 159.345 1.00 84.75  ?  810  PRO A CA    1 
ATOM   6303  C  C     . PRO A 1  810  ? 211.337 186.297 160.677 1.00 87.85  ?  810  PRO A C     1 
ATOM   6304  O  O     . PRO A 1  810  ? 210.653 186.161 161.697 1.00 85.14  ?  810  PRO A O     1 
ATOM   6305  C  CB    . PRO A 1  810  ? 211.594 184.510 158.889 1.00 87.23  ?  810  PRO A CB    1 
ATOM   6306  C  CG    . PRO A 1  810  ? 211.520 184.569 157.410 1.00 92.63  ?  810  PRO A CG    1 
ATOM   6307  C  CD    . PRO A 1  810  ? 211.587 186.010 157.042 1.00 88.70  ?  810  PRO A CD    1 
ATOM   6308  N  N     . GLN A 1  811  ? 212.504 186.983 160.638 1.00 86.44  ?  811  GLN A N     1 
ATOM   6309  C  CA    . GLN A 1  811  ? 213.138 187.630 161.788 1.00 86.05  ?  811  GLN A CA    1 
ATOM   6310  C  C     . GLN A 1  811  ? 212.179 188.723 162.317 1.00 89.03  ?  811  GLN A C     1 
ATOM   6311  O  O     . GLN A 1  811  ? 211.740 188.623 163.473 1.00 88.14  ?  811  GLN A O     1 
ATOM   6312  C  CB    . GLN A 1  811  ? 214.527 188.193 161.426 1.00 88.62  ?  811  GLN A CB    1 
ATOM   6313  C  CG    . GLN A 1  811  ? 215.443 187.216 160.668 1.00 106.31 ?  811  GLN A CG    1 
ATOM   6314  C  CD    . GLN A 1  811  ? 215.324 187.337 159.159 1.00 126.09 ?  811  GLN A CD    1 
ATOM   6315  O  OE1   . GLN A 1  811  ? 214.783 186.464 158.491 1.00 117.10 ?  811  GLN A OE1   1 
ATOM   6316  N  NE2   . GLN A 1  811  ? 215.826 188.419 158.578 1.00 125.65 ?  811  GLN A NE2   1 
ATOM   6317  N  N     . GLU A 1  812  ? 211.758 189.690 161.447 1.00 84.65  ?  812  GLU A N     1 
ATOM   6318  C  CA    . GLU A 1  812  ? 210.785 190.736 161.808 1.00 82.99  ?  812  GLU A CA    1 
ATOM   6319  C  C     . GLU A 1  812  ? 209.533 190.074 162.436 1.00 85.19  ?  812  GLU A C     1 
ATOM   6320  O  O     . GLU A 1  812  ? 209.113 190.490 163.515 1.00 83.94  ?  812  GLU A O     1 
ATOM   6321  C  CB    . GLU A 1  812  ? 210.359 191.553 160.570 1.00 84.69  ?  812  GLU A CB    1 
ATOM   6322  C  CG    . GLU A 1  812  ? 211.291 192.665 160.124 1.00 93.71  ?  812  GLU A CG    1 
ATOM   6323  C  CD    . GLU A 1  812  ? 210.840 193.388 158.865 1.00 115.63 ?  812  GLU A CD    1 
ATOM   6324  O  OE1   . GLU A 1  812  ? 210.349 192.716 157.926 1.00 116.77 ?  812  GLU A OE1   1 
ATOM   6325  O  OE2   . GLU A 1  812  ? 210.983 194.630 158.809 1.00 106.43 -1 812  GLU A OE2   1 
ATOM   6326  N  N     . PHE A 1  813  ? 208.987 189.013 161.783 1.00 80.66  ?  813  PHE A N     1 
ATOM   6327  C  CA    . PHE A 1  813  ? 207.818 188.278 162.235 1.00 79.38  ?  813  PHE A CA    1 
ATOM   6328  C  C     . PHE A 1  813  ? 207.942 187.718 163.647 1.00 83.78  ?  813  PHE A C     1 
ATOM   6329  O  O     . PHE A 1  813  ? 206.992 187.840 164.436 1.00 81.71  ?  813  PHE A O     1 
ATOM   6330  C  CB    . PHE A 1  813  ? 207.445 187.170 161.244 1.00 81.70  ?  813  PHE A CB    1 
ATOM   6331  C  CG    . PHE A 1  813  ? 206.212 186.370 161.637 1.00 82.19  ?  813  PHE A CG    1 
ATOM   6332  C  CD1   . PHE A 1  813  ? 204.931 186.828 161.318 1.00 84.24  ?  813  PHE A CD1   1 
ATOM   6333  C  CD2   . PHE A 1  813  ? 206.333 185.160 162.315 1.00 83.40  ?  813  PHE A CD2   1 
ATOM   6334  C  CE1   . PHE A 1  813  ? 203.802 186.087 161.661 1.00 83.80  ?  813  PHE A CE1   1 
ATOM   6335  C  CE2   . PHE A 1  813  ? 205.199 184.424 162.669 1.00 84.99  ?  813  PHE A CE2   1 
ATOM   6336  C  CZ    . PHE A 1  813  ? 203.944 184.883 162.327 1.00 82.41  ?  813  PHE A CZ    1 
ATOM   6337  N  N     . PHE A 1  814  ? 209.088 187.078 163.956 1.00 82.13  ?  814  PHE A N     1 
ATOM   6338  C  CA    . PHE A 1  814  ? 209.305 186.505 165.282 1.00 81.73  ?  814  PHE A CA    1 
ATOM   6339  C  C     . PHE A 1  814  ? 209.503 187.581 166.347 1.00 85.59  ?  814  PHE A C     1 
ATOM   6340  O  O     . PHE A 1  814  ? 208.985 187.438 167.449 1.00 83.31  ?  814  PHE A O     1 
ATOM   6341  C  CB    . PHE A 1  814  ? 210.455 185.495 165.277 1.00 84.53  ?  814  PHE A CB    1 
ATOM   6342  C  CG    . PHE A 1  814  ? 210.598 184.671 166.541 1.00 85.83  ?  814  PHE A CG    1 
ATOM   6343  C  CD1   . PHE A 1  814  ? 209.941 183.456 166.677 1.00 88.08  ?  814  PHE A CD1   1 
ATOM   6344  C  CD2   . PHE A 1  814  ? 211.423 185.092 167.582 1.00 88.77  ?  814  PHE A CD2   1 
ATOM   6345  C  CE1   . PHE A 1  814  ? 210.093 182.686 167.835 1.00 88.75  ?  814  PHE A CE1   1 
ATOM   6346  C  CE2   . PHE A 1  814  ? 211.574 184.320 168.741 1.00 91.00  ?  814  PHE A CE2   1 
ATOM   6347  C  CZ    . PHE A 1  814  ? 210.906 183.126 168.860 1.00 88.49  ?  814  PHE A CZ    1 
ATOM   6348  N  N     . PHE A 1  815  ? 210.234 188.657 166.025 1.00 84.60  ?  815  PHE A N     1 
ATOM   6349  C  CA    . PHE A 1  815  ? 210.455 189.737 166.984 1.00 85.06  ?  815  PHE A CA    1 
ATOM   6350  C  C     . PHE A 1  815  ? 209.160 190.458 167.309 1.00 89.94  ?  815  PHE A C     1 
ATOM   6351  O  O     . PHE A 1  815  ? 208.896 190.736 168.484 1.00 88.88  ?  815  PHE A O     1 
ATOM   6352  C  CB    . PHE A 1  815  ? 211.551 190.702 166.516 1.00 88.25  ?  815  PHE A CB    1 
ATOM   6353  C  CG    . PHE A 1  815  ? 212.931 190.091 166.365 1.00 91.48  ?  815  PHE A CG    1 
ATOM   6354  C  CD1   . PHE A 1  815  ? 213.329 189.015 167.155 1.00 94.30  ?  815  PHE A CD1   1 
ATOM   6355  C  CD2   . PHE A 1  815  ? 213.842 190.608 165.449 1.00 95.48  ?  815  PHE A CD2   1 
ATOM   6356  C  CE1   . PHE A 1  815  ? 214.600 188.450 167.008 1.00 96.46  ?  815  PHE A CE1   1 
ATOM   6357  C  CE2   . PHE A 1  815  ? 215.120 190.055 165.318 1.00 99.55  ?  815  PHE A CE2   1 
ATOM   6358  C  CZ    . PHE A 1  815  ? 215.489 188.980 166.099 1.00 97.35  ?  815  PHE A CZ    1 
ATOM   6359  N  N     . HIS A 1  816  ? 208.313 190.684 166.283 1.00 88.05  ?  816  HIS A N     1 
ATOM   6360  C  CA    . HIS A 1  816  ? 207.004 191.306 166.455 1.00 87.59  ?  816  HIS A CA    1 
ATOM   6361  C  C     . HIS A 1  816  ? 206.159 190.391 167.333 1.00 90.75  ?  816  HIS A C     1 
ATOM   6362  O  O     . HIS A 1  816  ? 205.410 190.869 168.197 1.00 89.84  ?  816  HIS A O     1 
ATOM   6363  C  CB    . HIS A 1  816  ? 206.326 191.589 165.100 1.00 89.31  ?  816  HIS A CB    1 
ATOM   6364  C  CG    . HIS A 1  816  ? 205.019 192.325 165.214 1.00 92.81  ?  816  HIS A CG    1 
ATOM   6365  N  ND1   . HIS A 1  816  ? 204.776 193.234 166.242 1.00 94.48  ?  816  HIS A ND1   1 
ATOM   6366  C  CD2   . HIS A 1  816  ? 203.919 192.268 164.423 1.00 94.99  ?  816  HIS A CD2   1 
ATOM   6367  C  CE1   . HIS A 1  816  ? 203.542 193.683 166.049 1.00 93.34  ?  816  HIS A CE1   1 
ATOM   6368  N  NE2   . HIS A 1  816  ? 202.983 193.134 164.970 1.00 93.86  ?  816  HIS A NE2   1 
ATOM   6369  N  N     . ALA A 1  817  ? 206.348 189.073 167.160 1.00 86.69  ?  817  ALA A N     1 
ATOM   6370  C  CA    . ALA A 1  817  ? 205.652 188.070 167.939 1.00 85.70  ?  817  ALA A CA    1 
ATOM   6371  C  C     . ALA A 1  817  ? 206.034 188.112 169.429 1.00 89.80  ?  817  ALA A C     1 
ATOM   6372  O  O     . ALA A 1  817  ? 205.167 187.956 170.286 1.00 88.25  ?  817  ALA A O     1 
ATOM   6373  C  CB    . ALA A 1  817  ? 205.915 186.709 167.352 1.00 87.08  ?  817  ALA A CB    1 
ATOM   6374  N  N     . MET A 1  818  ? 207.315 188.370 169.732 1.00 88.16  ?  818  MET A N     1 
ATOM   6375  C  CA    . MET A 1  818  ? 207.820 188.476 171.105 1.00 87.54  ?  818  MET A CA    1 
ATOM   6376  C  C     . MET A 1  818  ? 207.193 189.674 171.764 1.00 89.58  ?  818  MET A C     1 
ATOM   6377  O  O     . MET A 1  818  ? 206.586 189.529 172.828 1.00 87.49  ?  818  MET A O     1 
ATOM   6378  C  CB    . MET A 1  818  ? 209.350 188.606 171.123 1.00 90.95  ?  818  MET A CB    1 
ATOM   6379  C  CG    . MET A 1  818  ? 210.055 187.334 170.774 1.00 95.28  ?  818  MET A CG    1 
ATOM   6380  S  SD    . MET A 1  818  ? 211.793 187.611 170.452 1.00 101.10 ?  818  MET A SD    1 
ATOM   6381  C  CE    . MET A 1  818  ? 212.446 187.388 172.069 1.00 97.79  ?  818  MET A CE    1 
ATOM   6382  N  N     . GLY A 1  819  ? 207.310 190.823 171.086 1.00 87.39  ?  819  GLY A N     1 
ATOM   6383  C  CA    . GLY A 1  819  ? 206.756 192.111 171.496 1.00 87.45  ?  819  GLY A CA    1 
ATOM   6384  C  C     . GLY A 1  819  ? 205.250 192.095 171.675 1.00 89.97  ?  819  GLY A C     1 
ATOM   6385  O  O     . GLY A 1  819  ? 204.732 192.703 172.624 1.00 88.21  ?  819  GLY A O     1 
ATOM   6386  N  N     . GLY A 1  820  ? 204.576 191.358 170.778 1.00 86.17  ?  820  GLY A N     1 
ATOM   6387  C  CA    . GLY A 1  820  ? 203.131 191.154 170.770 1.00 85.08  ?  820  GLY A CA    1 
ATOM   6388  C  C     . GLY A 1  820  ? 202.647 190.347 171.961 1.00 87.60  ?  820  GLY A C     1 
ATOM   6389  O  O     . GLY A 1  820  ? 201.631 190.690 172.583 1.00 86.54  ?  820  GLY A O     1 
ATOM   6390  N  N     . ARG A 1  821  ? 203.402 189.275 172.293 1.00 83.05  ?  821  ARG A N     1 
ATOM   6391  C  CA    . ARG A 1  821  ? 203.148 188.393 173.421 1.00 81.46  ?  821  ARG A CA    1 
ATOM   6392  C  C     . ARG A 1  821  ? 203.206 189.172 174.737 1.00 87.86  ?  821  ARG A C     1 
ATOM   6393  O  O     . ARG A 1  821  ? 202.377 188.915 175.602 1.00 87.36  ?  821  ARG A O     1 
ATOM   6394  C  CB    . ARG A 1  821  ? 204.134 187.224 173.407 1.00 78.34  ?  821  ARG A CB    1 
ATOM   6395  C  CG    . ARG A 1  821  ? 204.266 186.442 174.706 1.00 79.64  ?  821  ARG A CG    1 
ATOM   6396  C  CD    . ARG A 1  821  ? 203.231 185.352 174.891 1.00 80.06  ?  821  ARG A CD    1 
ATOM   6397  N  NE    . ARG A 1  821  ? 203.712 184.049 174.434 1.00 89.98  ?  821  ARG A NE    1 
ATOM   6398  C  CZ    . ARG A 1  821  ? 203.555 183.591 173.193 1.00 112.78 ?  821  ARG A CZ    1 
ATOM   6399  N  NH1   . ARG A 1  821  ? 202.925 184.327 172.279 1.00 101.14 1  821  ARG A NH1   1 
ATOM   6400  N  NH2   . ARG A 1  821  ? 204.028 182.396 172.853 1.00 101.23 ?  821  ARG A NH2   1 
ATOM   6401  N  N     . GLU A 1  822  ? 204.122 190.159 174.873 1.00 86.56  ?  822  GLU A N     1 
ATOM   6402  C  CA    . GLU A 1  822  ? 204.243 190.966 176.098 1.00 86.41  ?  822  GLU A CA    1 
ATOM   6403  C  C     . GLU A 1  822  ? 202.928 191.646 176.530 1.00 88.10  ?  822  GLU A C     1 
ATOM   6404  O  O     . GLU A 1  822  ? 202.592 191.642 177.727 1.00 86.08  ?  822  GLU A O     1 
ATOM   6405  C  CB    . GLU A 1  822  ? 205.378 192.002 175.993 1.00 88.90  ?  822  GLU A CB    1 
ATOM   6406  C  CG    . GLU A 1  822  ? 205.889 192.439 177.364 1.00 100.87 ?  822  GLU A CG    1 
ATOM   6407  C  CD    . GLU A 1  822  ? 206.850 193.612 177.459 1.00 121.24 ?  822  GLU A CD    1 
ATOM   6408  O  OE1   . GLU A 1  822  ? 206.910 194.444 176.522 1.00 113.55 ?  822  GLU A OE1   1 
ATOM   6409  O  OE2   . GLU A 1  822  ? 207.519 193.715 178.512 1.00 113.81 -1 822  GLU A OE2   1 
ATOM   6410  N  N     . GLY A 1  823  ? 202.223 192.216 175.545 1.00 84.64  ?  823  GLY A N     1 
ATOM   6411  C  CA    . GLY A 1  823  ? 200.956 192.923 175.737 1.00 83.43  ?  823  GLY A CA    1 
ATOM   6412  C  C     . GLY A 1  823  ? 199.828 192.000 176.156 1.00 84.04  ?  823  GLY A C     1 
ATOM   6413  O  O     . GLY A 1  823  ? 199.010 192.344 177.021 1.00 82.36  ?  823  GLY A O     1 
ATOM   6414  N  N     . LEU A 1  824  ? 199.807 190.806 175.553 1.00 78.45  ?  824  LEU A N     1 
ATOM   6415  C  CA    . LEU A 1  824  ? 198.849 189.774 175.876 1.00 76.62  ?  824  LEU A CA    1 
ATOM   6416  C  C     . LEU A 1  824  ? 199.052 189.309 177.298 1.00 79.37  ?  824  LEU A C     1 
ATOM   6417  O  O     . LEU A 1  824  ? 198.076 189.029 177.972 1.00 78.01  ?  824  LEU A O     1 
ATOM   6418  C  CB    . LEU A 1  824  ? 198.968 188.609 174.900 1.00 76.99  ?  824  LEU A CB    1 
ATOM   6419  C  CG    . LEU A 1  824  ? 198.236 188.835 173.596 1.00 82.26  ?  824  LEU A CG    1 
ATOM   6420  C  CD1   . LEU A 1  824  ? 198.937 188.170 172.445 1.00 82.52  ?  824  LEU A CD1   1 
ATOM   6421  C  CD2   . LEU A 1  824  ? 196.777 188.391 173.708 1.00 87.38  ?  824  LEU A CD2   1 
ATOM   6422  N  N     . ILE A 1  825  ? 200.302 189.282 177.775 1.00 77.31  ?  825  ILE A N     1 
ATOM   6423  C  CA    . ILE A 1  825  ? 200.592 188.882 179.146 1.00 77.59  ?  825  ILE A CA    1 
ATOM   6424  C  C     . ILE A 1  825  ? 200.047 189.915 180.115 1.00 84.94  ?  825  ILE A C     1 
ATOM   6425  O  O     . ILE A 1  825  ? 199.324 189.541 181.039 1.00 83.44  ?  825  ILE A O     1 
ATOM   6426  C  CB    . ILE A 1  825  ? 202.077 188.519 179.406 1.00 80.88  ?  825  ILE A CB    1 
ATOM   6427  C  CG1   . ILE A 1  825  ? 202.518 187.344 178.532 1.00 81.27  ?  825  ILE A CG1   1 
ATOM   6428  C  CG2   . ILE A 1  825  ? 202.294 188.163 180.872 1.00 81.14  ?  825  ILE A CG2   1 
ATOM   6429  C  CD1   . ILE A 1  825  ? 203.926 187.429 178.122 1.00 86.63  ?  825  ILE A CD1   1 
ATOM   6430  N  N     . ASP A 1  826  ? 200.352 191.205 179.911 1.00 86.27  ?  826  ASP A N     1 
ATOM   6431  C  CA    . ASP A 1  826  ? 199.794 192.170 180.847 1.00 87.85  ?  826  ASP A CA    1 
ATOM   6432  C  C     . ASP A 1  826  ? 198.258 192.238 180.755 1.00 91.68  ?  826  ASP A C     1 
ATOM   6433  O  O     . ASP A 1  826  ? 197.614 192.125 181.799 1.00 90.26  ?  826  ASP A O     1 
ATOM   6434  C  CB    . ASP A 1  826  ? 200.547 193.515 180.900 1.00 91.83  ?  826  ASP A CB    1 
ATOM   6435  C  CG    . ASP A 1  826  ? 200.009 194.576 179.964 1.00 119.50 ?  826  ASP A CG    1 
ATOM   6436  O  OD1   . ASP A 1  826  ? 200.183 194.421 178.734 1.00 133.46 ?  826  ASP A OD1   1 
ATOM   6437  O  OD2   . ASP A 1  826  ? 199.418 195.578 180.467 1.00 121.39 -1 826  ASP A OD2   1 
ATOM   6438  N  N     . THR A 1  827  ? 197.672 192.226 179.524 1.00 89.56  ?  827  THR A N     1 
ATOM   6439  C  CA    . THR A 1  827  ? 196.204 192.187 179.359 1.00 89.61  ?  827  THR A CA    1 
ATOM   6440  C  C     . THR A 1  827  ? 195.626 191.106 180.268 1.00 96.22  ?  827  THR A C     1 
ATOM   6441  O  O     . THR A 1  827  ? 194.740 191.405 181.061 1.00 95.49  ?  827  THR A O     1 
ATOM   6442  C  CB    . THR A 1  827  ? 195.790 192.037 177.873 1.00 96.91  ?  827  THR A CB    1 
ATOM   6443  O  OG1   . THR A 1  827  ? 195.631 193.334 177.301 1.00 99.08  ?  827  THR A OG1   1 
ATOM   6444  C  CG2   . THR A 1  827  ? 194.485 191.260 177.678 1.00 93.18  ?  827  THR A CG2   1 
ATOM   6445  N  N     . ALA A 1  828  ? 196.212 189.883 180.215 1.00 95.69  ?  828  ALA A N     1 
ATOM   6446  C  CA    . ALA A 1  828  ? 195.836 188.706 180.999 1.00 95.89  ?  828  ALA A CA    1 
ATOM   6447  C  C     . ALA A 1  828  ? 195.960 188.945 182.500 1.00 102.38 ?  828  ALA A C     1 
ATOM   6448  O  O     . ALA A 1  828  ? 194.970 188.767 183.219 1.00 102.45 ?  828  ALA A O     1 
ATOM   6449  C  CB    . ALA A 1  828  ? 196.683 187.511 180.590 1.00 96.88  ?  828  ALA A CB    1 
ATOM   6450  N  N     . VAL A 1  829  ? 197.158 189.366 182.970 1.00 99.82  ?  829  VAL A N     1 
ATOM   6451  C  CA    . VAL A 1  829  ? 197.420 189.600 184.390 1.00 99.70  ?  829  VAL A CA    1 
ATOM   6452  C  C     . VAL A 1  829  ? 196.614 190.768 184.936 1.00 104.92 ?  829  VAL A C     1 
ATOM   6453  O  O     . VAL A 1  829  ? 195.727 190.535 185.760 1.00 103.05 ?  829  VAL A O     1 
ATOM   6454  C  CB    . VAL A 1  829  ? 198.918 189.722 184.717 1.00 103.68 ?  829  VAL A CB    1 
ATOM   6455  C  CG1   . VAL A 1  829  ? 199.129 189.950 186.211 1.00 103.38 ?  829  VAL A CG1   1 
ATOM   6456  C  CG2   . VAL A 1  829  ? 199.677 188.493 184.240 1.00 103.79 ?  829  VAL A CG2   1 
ATOM   6457  N  N     . LYS A 1  830  ? 196.902 192.008 184.460 1.00 104.16 ?  830  LYS A N     1 
ATOM   6458  C  CA    . LYS A 1  830  ? 196.227 193.254 184.859 1.00 104.79 ?  830  LYS A CA    1 
ATOM   6459  C  C     . LYS A 1  830  ? 194.774 193.001 185.260 1.00 108.31 ?  830  LYS A C     1 
ATOM   6460  O  O     . LYS A 1  830  ? 194.393 193.380 186.365 1.00 109.49 ?  830  LYS A O     1 
ATOM   6461  C  CB    . LYS A 1  830  ? 196.328 194.354 183.764 1.00 108.38 ?  830  LYS A CB    1 
ATOM   6462  C  CG    . LYS A 1  830  ? 197.275 195.540 184.095 1.00 129.99 ?  830  LYS A CG    1 
ATOM   6463  C  CD    . LYS A 1  830  ? 198.803 195.191 184.076 1.00 139.16 ?  830  LYS A CD    1 
ATOM   6464  C  CE    . LYS A 1  830  ? 199.713 196.405 184.070 1.00 137.47 ?  830  LYS A CE    1 
ATOM   6465  N  NZ    . LYS A 1  830  ? 201.140 196.010 183.944 1.00 135.86 1  830  LYS A NZ    1 
ATOM   6466  N  N     . THR A 1  831  ? 194.019 192.254 184.419 1.00 101.60 ?  831  THR A N     1 
ATOM   6467  C  CA    . THR A 1  831  ? 192.625 191.834 184.579 1.00 99.53  ?  831  THR A CA    1 
ATOM   6468  C  C     . THR A 1  831  ? 192.175 191.428 186.024 1.00 101.00 ?  831  THR A C     1 
ATOM   6469  O  O     . THR A 1  831  ? 191.070 191.785 186.443 1.00 100.35 ?  831  THR A O     1 
ATOM   6470  C  CB    . THR A 1  831  ? 192.286 190.866 183.422 1.00 108.65 ?  831  THR A CB    1 
ATOM   6471  O  OG1   . THR A 1  831  ? 191.598 191.579 182.396 1.00 107.08 ?  831  THR A OG1   1 
ATOM   6472  C  CG2   . THR A 1  831  ? 191.486 189.630 183.844 1.00 109.37 ?  831  THR A CG2   1 
ATOM   6473  N  N     . ALA A 1  832  ? 193.030 190.713 186.777 1.00 96.13  ?  832  ALA A N     1 
ATOM   6474  C  CA    . ALA A 1  832  ? 192.710 190.257 188.139 1.00 95.03  ?  832  ALA A CA    1 
ATOM   6475  C  C     . ALA A 1  832  ? 193.242 191.167 189.225 1.00 95.06  ?  832  ALA A C     1 
ATOM   6476  O  O     . ALA A 1  832  ? 192.605 191.305 190.264 1.00 93.69  ?  832  ALA A O     1 
ATOM   6477  C  CB    . ALA A 1  832  ? 193.239 188.860 188.344 1.00 96.59  ?  832  ALA A CB    1 
ATOM   6478  N  N     . GLU A 1  833  ? 194.440 191.738 188.994 1.00 90.71  ?  833  GLU A N     1 
ATOM   6479  C  CA    . GLU A 1  833  ? 195.148 192.715 189.829 1.00 90.03  ?  833  GLU A CA    1 
ATOM   6480  C  C     . GLU A 1  833  ? 194.221 193.959 189.952 1.00 90.68  ?  833  GLU A C     1 
ATOM   6481  O  O     . GLU A 1  833  ? 193.881 194.391 191.066 1.00 90.04  ?  833  GLU A O     1 
ATOM   6482  C  CB    . GLU A 1  833  ? 196.459 193.101 189.107 1.00 92.24  ?  833  GLU A CB    1 
ATOM   6483  C  CG    . GLU A 1  833  ? 197.751 192.867 189.881 1.00 109.57 ?  833  GLU A CG    1 
ATOM   6484  C  CD    . GLU A 1  833  ? 199.023 193.371 189.202 1.00 144.75 ?  833  GLU A CD    1 
ATOM   6485  O  OE1   . GLU A 1  833  ? 199.127 193.263 187.954 1.00 147.93 ?  833  GLU A OE1   1 
ATOM   6486  O  OE2   . GLU A 1  833  ? 199.928 193.855 189.925 1.00 134.35 -1 833  GLU A OE2   1 
ATOM   6487  N  N     . THR A 1  834  ? 193.773 194.469 188.772 1.00 84.20  ?  834  THR A N     1 
ATOM   6488  C  CA    . THR A 1  834  ? 192.866 195.592 188.567 1.00 82.68  ?  834  THR A CA    1 
ATOM   6489  C  C     . THR A 1  834  ? 191.507 195.332 189.247 1.00 85.05  ?  834  THR A C     1 
ATOM   6490  O  O     . THR A 1  834  ? 190.898 196.242 189.826 1.00 84.52  ?  834  THR A O     1 
ATOM   6491  C  CB    . THR A 1  834  ? 192.833 195.970 187.051 1.00 87.97  ?  834  THR A CB    1 
ATOM   6492  O  OG1   . THR A 1  834  ? 192.844 197.384 186.896 1.00 93.34  ?  834  THR A OG1   1 
ATOM   6493  C  CG2   . THR A 1  834  ? 191.664 195.355 186.263 1.00 82.73  ?  834  THR A CG2   1 
ATOM   6494  N  N     . GLY A 1  835  ? 191.065 194.085 189.192 1.00 80.75  ?  835  GLY A N     1 
ATOM   6495  C  CA    . GLY A 1  835  ? 189.799 193.676 189.777 1.00 79.98  ?  835  GLY A CA    1 
ATOM   6496  C  C     . GLY A 1  835  ? 189.788 193.795 191.284 1.00 81.52  ?  835  GLY A C     1 
ATOM   6497  O  O     . GLY A 1  835  ? 188.830 194.331 191.865 1.00 80.42  ?  835  GLY A O     1 
ATOM   6498  N  N     . TYR A 1  836  ? 190.866 193.284 191.909 1.00 76.15  ?  836  TYR A N     1 
ATOM   6499  C  CA    . TYR A 1  836  ? 191.012 193.292 193.349 1.00 75.69  ?  836  TYR A CA    1 
ATOM   6500  C  C     . TYR A 1  836  ? 191.180 194.707 193.875 1.00 79.55  ?  836  TYR A C     1 
ATOM   6501  O  O     . TYR A 1  836  ? 190.556 195.033 194.896 1.00 79.72  ?  836  TYR A O     1 
ATOM   6502  C  CB    . TYR A 1  836  ? 192.111 192.333 193.797 1.00 77.42  ?  836  TYR A CB    1 
ATOM   6503  C  CG    . TYR A 1  836  ? 192.396 192.282 195.284 1.00 80.31  ?  836  TYR A CG    1 
ATOM   6504  C  CD1   . TYR A 1  836  ? 191.400 191.949 196.196 1.00 82.08  ?  836  TYR A CD1   1 
ATOM   6505  C  CD2   . TYR A 1  836  ? 193.690 192.439 195.767 1.00 82.50  ?  836  TYR A CD2   1 
ATOM   6506  C  CE1   . TYR A 1  836  ? 191.668 191.860 197.565 1.00 83.92  ?  836  TYR A CE1   1 
ATOM   6507  C  CE2   . TYR A 1  836  ? 193.978 192.314 197.126 1.00 84.02  ?  836  TYR A CE2   1 
ATOM   6508  C  CZ    . TYR A 1  836  ? 192.965 192.032 198.024 1.00 91.40  ?  836  TYR A CZ    1 
ATOM   6509  O  OH    . TYR A 1  836  ? 193.260 191.990 199.367 1.00 93.50  ?  836  TYR A OH    1 
ATOM   6510  N  N     . ILE A 1  837  ? 191.935 195.580 193.136 1.00 74.01  ?  837  ILE A N     1 
ATOM   6511  C  CA    . ILE A 1  837  ? 192.112 197.003 193.503 1.00 71.75  ?  837  ILE A CA    1 
ATOM   6512  C  C     . ILE A 1  837  ? 190.731 197.646 193.675 1.00 72.48  ?  837  ILE A C     1 
ATOM   6513  O  O     . ILE A 1  837  ? 190.480 198.315 194.688 1.00 70.57  ?  837  ILE A O     1 
ATOM   6514  C  CB    . ILE A 1  837  ? 192.984 197.775 192.478 1.00 73.84  ?  837  ILE A CB    1 
ATOM   6515  C  CG1   . ILE A 1  837  ? 194.451 197.377 192.604 1.00 74.65  ?  837  ILE A CG1   1 
ATOM   6516  C  CG2   . ILE A 1  837  ? 192.802 199.286 192.615 1.00 72.56  ?  837  ILE A CG2   1 
ATOM   6517  C  CD1   . ILE A 1  837  ? 195.402 198.432 192.136 1.00 85.47  ?  837  ILE A CD1   1 
ATOM   6518  N  N     . GLN A 1  838  ? 189.826 197.368 192.690 1.00 68.02  ?  838  GLN A N     1 
ATOM   6519  C  CA    . GLN A 1  838  ? 188.454 197.872 192.632 1.00 66.86  ?  838  GLN A CA    1 
ATOM   6520  C  C     . GLN A 1  838  ? 187.721 197.475 193.927 1.00 67.78  ?  838  GLN A C     1 
ATOM   6521  O  O     . GLN A 1  838  ? 187.273 198.358 194.659 1.00 67.62  ?  838  GLN A O     1 
ATOM   6522  C  CB    . GLN A 1  838  ? 187.749 197.408 191.324 1.00 67.93  ?  838  GLN A CB    1 
ATOM   6523  C  CG    . GLN A 1  838  ? 186.519 198.242 190.884 1.00 89.05  ?  838  GLN A CG    1 
ATOM   6524  C  CD    . GLN A 1  838  ? 185.163 197.760 191.427 1.00 116.38 ?  838  GLN A CD    1 
ATOM   6525  O  OE1   . GLN A 1  838  ? 185.053 196.778 192.191 1.00 115.53 ?  838  GLN A OE1   1 
ATOM   6526  N  NE2   . GLN A 1  838  ? 184.079 198.454 191.053 1.00 101.30 ?  838  GLN A NE2   1 
ATOM   6527  N  N     . ARG A 1  839  ? 187.755 196.176 194.278 1.00 61.32  ?  839  ARG A N     1 
ATOM   6528  C  CA    . ARG A 1  839  ? 187.125 195.604 195.469 1.00 59.42  ?  839  ARG A CA    1 
ATOM   6529  C  C     . ARG A 1  839  ? 187.508 196.305 196.772 1.00 60.35  ?  839  ARG A C     1 
ATOM   6530  O  O     . ARG A 1  839  ? 186.649 196.621 197.607 1.00 57.25  ?  839  ARG A O     1 
ATOM   6531  C  CB    . ARG A 1  839  ? 187.498 194.120 195.581 1.00 58.49  ?  839  ARG A CB    1 
ATOM   6532  C  CG    . ARG A 1  839  ? 186.344 193.260 196.059 1.00 64.44  ?  839  ARG A CG    1 
ATOM   6533  C  CD    . ARG A 1  839  ? 186.747 192.188 197.037 1.00 56.93  ?  839  ARG A CD    1 
ATOM   6534  N  NE    . ARG A 1  839  ? 185.665 192.024 197.997 1.00 59.62  ?  839  ARG A NE    1 
ATOM   6535  C  CZ    . ARG A 1  839  ? 185.790 191.429 199.175 1.00 86.89  ?  839  ARG A CZ    1 
ATOM   6536  N  NH1   . ARG A 1  839  ? 186.965 190.906 199.547 1.00 76.95  1  839  ARG A NH1   1 
ATOM   6537  N  NH2   . ARG A 1  839  ? 184.746 191.345 199.993 1.00 75.48  ?  839  ARG A NH2   1 
ATOM   6538  N  N     . ARG A 1  840  ? 188.820 196.481 196.958 1.00 57.61  ?  840  ARG A N     1 
ATOM   6539  C  CA    . ARG A 1  840  ? 189.373 197.093 198.150 1.00 57.56  ?  840  ARG A CA    1 
ATOM   6540  C  C     . ARG A 1  840  ? 188.909 198.530 198.232 1.00 61.70  ?  840  ARG A C     1 
ATOM   6541  O  O     . ARG A 1  840  ? 188.462 198.932 199.301 1.00 63.39  ?  840  ARG A O     1 
ATOM   6542  C  CB    . ARG A 1  840  ? 190.890 197.024 198.141 1.00 56.96  ?  840  ARG A CB    1 
ATOM   6543  C  CG    . ARG A 1  840  ? 191.466 195.644 198.304 1.00 62.54  ?  840  ARG A CG    1 
ATOM   6544  C  CD    . ARG A 1  840  ? 192.628 195.490 197.352 1.00 70.06  ?  840  ARG A CD    1 
ATOM   6545  N  NE    . ARG A 1  840  ? 193.763 196.361 197.657 1.00 78.17  ?  840  ARG A NE    1 
ATOM   6546  C  CZ    . ARG A 1  840  ? 194.809 196.532 196.851 1.00 95.06  ?  840  ARG A CZ    1 
ATOM   6547  N  NH1   . ARG A 1  840  ? 194.879 195.881 195.688 1.00 85.34  1  840  ARG A NH1   1 
ATOM   6548  N  NH2   . ARG A 1  840  ? 195.789 197.361 197.193 1.00 74.05  ?  840  ARG A NH2   1 
ATOM   6549  N  N     . LEU A 1  841  ? 188.959 199.293 197.113 1.00 55.58  ?  841  LEU A N     1 
ATOM   6550  C  CA    . LEU A 1  841  ? 188.467 200.666 197.119 1.00 54.69  ?  841  LEU A CA    1 
ATOM   6551  C  C     . LEU A 1  841  ? 186.998 200.669 197.570 1.00 60.21  ?  841  LEU A C     1 
ATOM   6552  O  O     . LEU A 1  841  ? 186.627 201.440 198.452 1.00 60.59  ?  841  LEU A O     1 
ATOM   6553  C  CB    . LEU A 1  841  ? 188.545 201.296 195.730 1.00 54.18  ?  841  LEU A CB    1 
ATOM   6554  C  CG    . LEU A 1  841  ? 189.893 201.579 195.140 1.00 58.77  ?  841  LEU A CG    1 
ATOM   6555  C  CD1   . LEU A 1  841  ? 189.738 202.163 193.748 1.00 58.51  ?  841  LEU A CD1   1 
ATOM   6556  C  CD2   . LEU A 1  841  ? 190.679 202.515 196.012 1.00 61.62  ?  841  LEU A CD2   1 
ATOM   6557  N  N     . VAL A 1  842  ? 186.176 199.769 197.004 1.00 56.67  ?  842  VAL A N     1 
ATOM   6558  C  CA    . VAL A 1  842  ? 184.754 199.702 197.334 1.00 55.98  ?  842  VAL A CA    1 
ATOM   6559  C  C     . VAL A 1  842  ? 184.491 199.306 198.770 1.00 63.70  ?  842  VAL A C     1 
ATOM   6560  O  O     . VAL A 1  842  ? 183.713 199.953 199.488 1.00 64.27  ?  842  VAL A O     1 
ATOM   6561  C  CB    . VAL A 1  842  ? 183.951 198.877 196.330 1.00 57.42  ?  842  VAL A CB    1 
ATOM   6562  C  CG1   . VAL A 1  842  ? 182.486 198.842 196.723 1.00 56.41  ?  842  VAL A CG1   1 
ATOM   6563  C  CG2   . VAL A 1  842  ? 184.105 199.462 194.943 1.00 57.21  ?  842  VAL A CG2   1 
ATOM   6564  N  N     . LYS A 1  843  ? 185.170 198.276 199.202 1.00 61.50  ?  843  LYS A N     1 
ATOM   6565  C  CA    . LYS A 1  843  ? 184.961 197.856 200.560 1.00 61.20  ?  843  LYS A CA    1 
ATOM   6566  C  C     . LYS A 1  843  ? 185.416 198.898 201.593 1.00 65.79  ?  843  LYS A C     1 
ATOM   6567  O  O     . LYS A 1  843  ? 184.725 199.059 202.591 1.00 65.50  ?  843  LYS A O     1 
ATOM   6568  C  CB    . LYS A 1  843  ? 185.429 196.411 200.770 1.00 61.70  ?  843  LYS A CB    1 
ATOM   6569  C  CG    . LYS A 1  843  ? 184.382 195.400 200.304 1.00 43.38  ?  843  LYS A CG    1 
ATOM   6570  C  CD    . LYS A 1  843  ? 183.345 195.114 201.433 1.00 52.33  ?  843  LYS A CD    1 
ATOM   6571  C  CE    . LYS A 1  843  ? 181.951 194.706 200.984 1.00 72.30  ?  843  LYS A CE    1 
ATOM   6572  N  NZ    . LYS A 1  843  ? 181.871 193.379 200.288 1.00 85.49  1  843  LYS A NZ    1 
ATOM   6573  N  N     . ALA A 1  844  ? 186.449 199.709 201.283 1.00 63.71  ?  844  ALA A N     1 
ATOM   6574  C  CA    . ALA A 1  844  ? 186.920 200.766 202.204 1.00 65.41  ?  844  ALA A CA    1 
ATOM   6575  C  C     . ALA A 1  844  ? 185.988 201.971 202.244 1.00 72.32  ?  844  ALA A C     1 
ATOM   6576  O  O     . ALA A 1  844  ? 185.890 202.658 203.277 1.00 73.17  ?  844  ALA A O     1 
ATOM   6577  C  CB    . ALA A 1  844  ? 188.341 201.215 201.854 1.00 66.30  ?  844  ALA A CB    1 
ATOM   6578  N  N     . LEU A 1  845  ? 185.291 202.219 201.123 1.00 67.88  ?  845  LEU A N     1 
ATOM   6579  C  CA    . LEU A 1  845  ? 184.442 203.396 201.023 1.00 66.70  ?  845  LEU A CA    1 
ATOM   6580  C  C     . LEU A 1  845  ? 182.944 203.171 201.159 1.00 68.26  ?  845  LEU A C     1 
ATOM   6581  O  O     . LEU A 1  845  ? 182.259 204.109 201.563 1.00 67.78  ?  845  LEU A O     1 
ATOM   6582  C  CB    . LEU A 1  845  ? 184.785 204.236 199.771 1.00 66.52  ?  845  LEU A CB    1 
ATOM   6583  C  CG    . LEU A 1  845  ? 186.271 204.539 199.462 1.00 70.80  ?  845  LEU A CG    1 
ATOM   6584  C  CD1   . LEU A 1  845  ? 186.391 205.540 198.324 1.00 71.02  ?  845  LEU A CD1   1 
ATOM   6585  C  CD2   . LEU A 1  845  ? 187.053 205.010 200.691 1.00 71.44  ?  845  LEU A CD2   1 
ATOM   6586  N  N     . GLU A 1  846  ? 182.435 201.955 200.854 1.00 63.52  ?  846  GLU A N     1 
ATOM   6587  C  CA    . GLU A 1  846  ? 181.000 201.620 200.871 1.00 63.16  ?  846  GLU A CA    1 
ATOM   6588  C  C     . GLU A 1  846  ? 180.051 202.499 201.741 1.00 68.26  ?  846  GLU A C     1 
ATOM   6589  O  O     . GLU A 1  846  ? 179.263 203.278 201.172 1.00 68.10  ?  846  GLU A O     1 
ATOM   6590  C  CB    . GLU A 1  846  ? 180.735 200.103 200.982 1.00 63.92  ?  846  GLU A CB    1 
ATOM   6591  C  CG    . GLU A 1  846  ? 180.945 199.484 202.351 1.00 73.49  ?  846  GLU A CG    1 
ATOM   6592  C  CD    . GLU A 1  846  ? 180.946 197.968 202.390 1.00 96.44  ?  846  GLU A CD    1 
ATOM   6593  O  OE1   . GLU A 1  846  ? 180.219 197.343 201.586 1.00 90.46  ?  846  GLU A OE1   1 
ATOM   6594  O  OE2   . GLU A 1  846  ? 181.633 197.404 203.271 1.00 94.94  -1 846  GLU A OE2   1 
ATOM   6595  N  N     . ASP A 1  847  ? 180.236 202.457 203.095 1.00 64.44  ?  847  ASP A N     1 
ATOM   6596  C  CA    . ASP A 1  847  ? 179.487 203.163 204.144 1.00 64.36  ?  847  ASP A CA    1 
ATOM   6597  C  C     . ASP A 1  847  ? 179.574 204.695 204.148 1.00 71.81  ?  847  ASP A C     1 
ATOM   6598  O  O     . ASP A 1  847  ? 178.963 205.320 205.028 1.00 74.83  ?  847  ASP A O     1 
ATOM   6599  C  CB    . ASP A 1  847  ? 179.869 202.628 205.533 1.00 66.04  ?  847  ASP A CB    1 
ATOM   6600  C  CG    . ASP A 1  847  ? 181.293 202.926 206.004 1.00 75.64  ?  847  ASP A CG    1 
ATOM   6601  O  OD1   . ASP A 1  847  ? 182.189 203.126 205.140 1.00 76.23  ?  847  ASP A OD1   1 
ATOM   6602  O  OD2   . ASP A 1  847  ? 181.536 202.871 207.229 1.00 81.57  -1 847  ASP A OD2   1 
ATOM   6603  N  N     . ILE A 1  848  ? 180.326 205.312 203.206 1.00 66.69  ?  848  ILE A N     1 
ATOM   6604  C  CA    . ILE A 1  848  ? 180.429 206.776 203.137 1.00 65.65  ?  848  ILE A CA    1 
ATOM   6605  C  C     . ILE A 1  848  ? 179.287 207.333 202.285 1.00 67.32  ?  848  ILE A C     1 
ATOM   6606  O  O     . ILE A 1  848  ? 178.993 206.780 201.208 1.00 66.77  ?  848  ILE A O     1 
ATOM   6607  C  CB    . ILE A 1  848  ? 181.838 207.247 202.686 1.00 68.84  ?  848  ILE A CB    1 
ATOM   6608  C  CG1   . ILE A 1  848  ? 182.847 207.139 203.835 1.00 70.42  ?  848  ILE A CG1   1 
ATOM   6609  C  CG2   . ILE A 1  848  ? 181.827 208.657 202.177 1.00 69.15  ?  848  ILE A CG2   1 
ATOM   6610  C  CD1   . ILE A 1  848  ? 184.016 206.112 203.621 1.00 81.15  ?  848  ILE A CD1   1 
ATOM   6611  N  N     . MET A 1  849  ? 178.609 208.383 202.817 1.00 61.97  ?  849  MET A N     1 
ATOM   6612  C  CA    . MET A 1  849  ? 177.515 209.120 202.172 1.00 60.85  ?  849  MET A CA    1 
ATOM   6613  C  C     . MET A 1  849  ? 177.320 210.524 202.753 1.00 69.38  ?  849  MET A C     1 
ATOM   6614  O  O     . MET A 1  849  ? 177.752 210.777 203.890 1.00 70.72  ?  849  MET A O     1 
ATOM   6615  C  CB    . MET A 1  849  ? 176.195 208.336 202.158 1.00 61.38  ?  849  MET A CB    1 
ATOM   6616  C  CG    . MET A 1  849  ? 175.320 208.535 203.357 1.00 63.57  ?  849  MET A CG    1 
ATOM   6617  S  SD    . MET A 1  849  ? 173.597 208.136 202.995 1.00 65.50  ?  849  MET A SD    1 
ATOM   6618  C  CE    . MET A 1  849  ? 172.821 209.350 203.943 1.00 62.53  ?  849  MET A CE    1 
ATOM   6619  N  N     . VAL A 1  850  ? 176.651 211.426 201.976 1.00 66.28  ?  850  VAL A N     1 
ATOM   6620  C  CA    . VAL A 1  850  ? 176.351 212.807 202.382 1.00 66.40  ?  850  VAL A CA    1 
ATOM   6621  C  C     . VAL A 1  850  ? 175.130 212.766 203.267 1.00 71.13  ?  850  VAL A C     1 
ATOM   6622  O  O     . VAL A 1  850  ? 174.092 212.277 202.798 1.00 70.24  ?  850  VAL A O     1 
ATOM   6623  C  CB    . VAL A 1  850  ? 176.060 213.754 201.189 1.00 69.81  ?  850  VAL A CB    1 
ATOM   6624  C  CG1   . VAL A 1  850  ? 175.937 215.201 201.667 1.00 70.47  ?  850  VAL A CG1   1 
ATOM   6625  C  CG2   . VAL A 1  850  ? 177.096 213.621 200.081 1.00 69.14  ?  850  VAL A CG2   1 
ATOM   6626  N  N     . HIS A 1  851  ? 175.223 213.298 204.520 1.00 69.09  ?  851  HIS A N     1 
ATOM   6627  C  CA    . HIS A 1  851  ? 174.042 213.361 205.401 1.00 69.82  ?  851  HIS A CA    1 
ATOM   6628  C  C     . HIS A 1  851  ? 173.303 214.652 205.229 1.00 74.15  ?  851  HIS A C     1 
ATOM   6629  O  O     . HIS A 1  851  ? 173.783 215.549 204.517 1.00 73.93  ?  851  HIS A O     1 
ATOM   6630  C  CB    . HIS A 1  851  ? 174.350 213.134 206.863 1.00 71.17  ?  851  HIS A CB    1 
ATOM   6631  C  CG    . HIS A 1  851  ? 174.789 211.753 207.143 1.00 74.77  ?  851  HIS A CG    1 
ATOM   6632  N  ND1   . HIS A 1  851  ? 175.875 211.194 206.481 1.00 76.68  ?  851  HIS A ND1   1 
ATOM   6633  C  CD2   . HIS A 1  851  ? 174.319 210.870 208.044 1.00 77.08  ?  851  HIS A CD2   1 
ATOM   6634  C  CE1   . HIS A 1  851  ? 176.035 209.994 207.008 1.00 76.17  ?  851  HIS A CE1   1 
ATOM   6635  N  NE2   . HIS A 1  851  ? 175.126 209.757 207.961 1.00 76.78  ?  851  HIS A NE2   1 
ATOM   6636  N  N     . TYR A 1  852  ? 172.120 214.744 205.866 1.00 70.01  ?  852  TYR A N     1 
ATOM   6637  C  CA    . TYR A 1  852  ? 171.283 215.930 205.755 1.00 70.22  ?  852  TYR A CA    1 
ATOM   6638  C  C     . TYR A 1  852  ? 171.907 217.227 206.323 1.00 75.96  ?  852  TYR A C     1 
ATOM   6639  O  O     . TYR A 1  852  ? 171.250 218.273 206.265 1.00 78.42  ?  852  TYR A O     1 
ATOM   6640  C  CB    . TYR A 1  852  ? 169.868 215.665 206.274 1.00 70.67  ?  852  TYR A CB    1 
ATOM   6641  C  CG    . TYR A 1  852  ? 169.008 214.893 205.310 1.00 70.77  ?  852  TYR A CG    1 
ATOM   6642  C  CD1   . TYR A 1  852  ? 168.363 215.532 204.261 1.00 72.37  ?  852  TYR A CD1   1 
ATOM   6643  C  CD2   . TYR A 1  852  ? 168.773 213.534 205.491 1.00 71.34  ?  852  TYR A CD2   1 
ATOM   6644  C  CE1   . TYR A 1  852  ? 167.551 214.828 203.376 1.00 72.46  ?  852  TYR A CE1   1 
ATOM   6645  C  CE2   . TYR A 1  852  ? 167.935 212.824 204.631 1.00 71.87  ?  852  TYR A CE2   1 
ATOM   6646  C  CZ    . TYR A 1  852  ? 167.327 213.477 203.570 1.00 78.99  ?  852  TYR A CZ    1 
ATOM   6647  O  OH    . TYR A 1  852  ? 166.546 212.789 202.671 1.00 79.67  ?  852  TYR A OH    1 
ATOM   6648  N  N     . ASP A 1  853  ? 173.185 217.168 206.792 1.00 69.82  ?  853  ASP A N     1 
ATOM   6649  C  CA    . ASP A 1  853  ? 173.955 218.294 207.308 1.00 70.33  ?  853  ASP A CA    1 
ATOM   6650  C  C     . ASP A 1  853  ? 175.099 218.701 206.363 1.00 74.95  ?  853  ASP A C     1 
ATOM   6651  O  O     . ASP A 1  853  ? 176.010 219.464 206.726 1.00 74.68  ?  853  ASP A O     1 
ATOM   6652  C  CB    . ASP A 1  853  ? 174.455 217.990 208.732 1.00 73.10  ?  853  ASP A CB    1 
ATOM   6653  C  CG    . ASP A 1  853  ? 175.369 216.796 208.938 1.00 89.31  ?  853  ASP A CG    1 
ATOM   6654  O  OD1   . ASP A 1  853  ? 175.610 216.045 207.956 1.00 91.38  ?  853  ASP A OD1   1 
ATOM   6655  O  OD2   . ASP A 1  853  ? 175.873 216.624 210.079 1.00 95.53  -1 853  ASP A OD2   1 
ATOM   6656  N  N     . ASN A 1  854  ? 175.021 218.178 205.135 1.00 73.22  ?  854  ASN A N     1 
ATOM   6657  C  CA    . ASN A 1  854  ? 175.988 218.316 204.041 1.00 74.38  ?  854  ASN A CA    1 
ATOM   6658  C  C     . ASN A 1  854  ? 177.387 217.674 204.312 1.00 78.33  ?  854  ASN A C     1 
ATOM   6659  O  O     . ASN A 1  854  ? 178.278 217.699 203.449 1.00 77.67  ?  854  ASN A O     1 
ATOM   6660  C  CB    . ASN A 1  854  ? 176.025 219.742 203.459 1.00 79.69  ?  854  ASN A CB    1 
ATOM   6661  C  CG    . ASN A 1  854  ? 175.195 219.870 202.198 1.00 113.04 ?  854  ASN A CG    1 
ATOM   6662  O  OD1   . ASN A 1  854  ? 174.049 220.330 202.237 1.00 113.27 ?  854  ASN A OD1   1 
ATOM   6663  N  ND2   . ASN A 1  854  ? 175.734 219.421 201.051 1.00 102.78 ?  854  ASN A ND2   1 
ATOM   6664  N  N     . THR A 1  855  ? 177.512 217.029 205.493 1.00 74.19  ?  855  THR A N     1 
ATOM   6665  C  CA    . THR A 1  855  ? 178.683 216.340 206.027 1.00 73.13  ?  855  THR A CA    1 
ATOM   6666  C  C     . THR A 1  855  ? 178.799 214.979 205.429 1.00 74.36  ?  855  THR A C     1 
ATOM   6667  O  O     . THR A 1  855  ? 177.783 214.281 205.342 1.00 75.13  ?  855  THR A O     1 
ATOM   6668  C  CB    . THR A 1  855  ? 178.515 216.175 207.527 1.00 81.65  ?  855  THR A CB    1 
ATOM   6669  O  OG1   . THR A 1  855  ? 178.207 217.441 208.074 1.00 86.46  ?  855  THR A OG1   1 
ATOM   6670  C  CG2   . THR A 1  855  ? 179.728 215.679 208.185 1.00 82.26  ?  855  THR A CG2   1 
ATOM   6671  N  N     . THR A 1  856  ? 180.042 214.577 205.069 1.00 67.10  ?  856  THR A N     1 
ATOM   6672  C  CA    . THR A 1  856  ? 180.347 213.254 204.535 1.00 64.89  ?  856  THR A CA    1 
ATOM   6673  C  C     . THR A 1  856  ? 180.837 212.379 205.686 1.00 68.68  ?  856  THR A C     1 
ATOM   6674  O  O     . THR A 1  856  ? 181.894 212.650 206.282 1.00 68.96  ?  856  THR A O     1 
ATOM   6675  C  CB    . THR A 1  856  ? 181.314 213.350 203.377 1.00 68.40  ?  856  THR A CB    1 
ATOM   6676  O  OG1   . THR A 1  856  ? 180.784 214.245 202.414 1.00 65.54  ?  856  THR A OG1   1 
ATOM   6677  C  CG2   . THR A 1  856  ? 181.533 212.033 202.724 1.00 68.22  ?  856  THR A CG2   1 
ATOM   6678  N  N     . ARG A 1  857  ? 180.028 211.357 206.034 1.00 64.08  ?  857  ARG A N     1 
ATOM   6679  C  CA    . ARG A 1  857  ? 180.310 210.472 207.171 1.00 63.53  ?  857  ARG A CA    1 
ATOM   6680  C  C     . ARG A 1  857  ? 180.243 208.980 206.833 1.00 68.39  ?  857  ARG A C     1 
ATOM   6681  O  O     . ARG A 1  857  ? 179.618 208.564 205.840 1.00 69.41  ?  857  ARG A O     1 
ATOM   6682  C  CB    . ARG A 1  857  ? 179.356 210.766 208.345 1.00 60.95  ?  857  ARG A CB    1 
ATOM   6683  C  CG    . ARG A 1  857  ? 179.223 212.236 208.735 1.00 66.43  ?  857  ARG A CG    1 
ATOM   6684  C  CD    . ARG A 1  857  ? 178.596 212.373 210.091 1.00 65.95  ?  857  ARG A CD    1 
ATOM   6685  N  NE    . ARG A 1  857  ? 178.278 213.746 210.452 1.00 67.15  ?  857  ARG A NE    1 
ATOM   6686  C  CZ    . ARG A 1  857  ? 178.059 214.151 211.700 1.00 88.02  ?  857  ARG A CZ    1 
ATOM   6687  N  NH1   . ARG A 1  857  ? 178.113 213.287 212.709 1.00 65.78  1  857  ARG A NH1   1 
ATOM   6688  N  NH2   . ARG A 1  857  ? 177.738 215.414 211.946 1.00 88.91  ?  857  ARG A NH2   1 
ATOM   6689  N  N     . ASN A 1  858  ? 180.858 208.170 207.694 1.00 62.80  ?  858  ASN A N     1 
ATOM   6690  C  CA    . ASN A 1  858  ? 180.817 206.731 207.536 1.00 61.72  ?  858  ASN A CA    1 
ATOM   6691  C  C     . ASN A 1  858  ? 179.768 206.098 208.499 1.00 66.62  ?  858  ASN A C     1 
ATOM   6692  O  O     . ASN A 1  858  ? 179.026 206.831 209.171 1.00 66.70  ?  858  ASN A O     1 
ATOM   6693  C  CB    . ASN A 1  858  ? 182.223 206.170 207.730 1.00 61.58  ?  858  ASN A CB    1 
ATOM   6694  C  CG    . ASN A 1  858  ? 182.737 206.145 209.144 1.00 74.52  ?  858  ASN A CG    1 
ATOM   6695  O  OD1   . ASN A 1  858  ? 182.261 206.843 210.045 1.00 59.90  ?  858  ASN A OD1   1 
ATOM   6696  N  ND2   . ASN A 1  858  ? 183.723 205.303 209.367 1.00 71.87  ?  858  ASN A ND2   1 
ATOM   6697  N  N     . SER A 1  859  ? 179.730 204.747 208.591 1.00 63.43  ?  859  SER A N     1 
ATOM   6698  C  CA    . SER A 1  859  ? 178.816 204.013 209.477 1.00 64.38  ?  859  SER A CA    1 
ATOM   6699  C  C     . SER A 1  859  ? 179.007 204.314 211.011 1.00 71.13  ?  859  SER A C     1 
ATOM   6700  O  O     . SER A 1  859  ? 178.222 203.864 211.876 1.00 71.50  ?  859  SER A O     1 
ATOM   6701  C  CB    . SER A 1  859  ? 178.885 202.519 209.183 1.00 68.80  ?  859  SER A CB    1 
ATOM   6702  O  OG    . SER A 1  859  ? 180.187 202.004 209.399 1.00 82.41  ?  859  SER A OG    1 
ATOM   6703  N  N     . LEU A 1  860  ? 180.039 205.115 211.323 1.00 68.09  ?  860  LEU A N     1 
ATOM   6704  C  CA    . LEU A 1  860  ? 180.364 205.525 212.682 1.00 68.23  ?  860  LEU A CA    1 
ATOM   6705  C  C     . LEU A 1  860  ? 179.958 206.984 212.913 1.00 73.88  ?  860  LEU A C     1 
ATOM   6706  O  O     . LEU A 1  860  ? 180.068 207.491 214.042 1.00 76.03  ?  860  LEU A O     1 
ATOM   6707  C  CB    . LEU A 1  860  ? 181.870 205.331 212.956 1.00 67.91  ?  860  LEU A CB    1 
ATOM   6708  C  CG    . LEU A 1  860  ? 182.358 203.893 213.015 1.00 71.35  ?  860  LEU A CG    1 
ATOM   6709  C  CD1   . LEU A 1  860  ? 183.812 203.793 212.615 1.00 71.99  ?  860  LEU A CD1   1 
ATOM   6710  C  CD2   . LEU A 1  860  ? 182.125 203.289 214.374 1.00 72.35  ?  860  LEU A CD2   1 
ATOM   6711  N  N     . GLY A 1  861  ? 179.516 207.652 211.847 1.00 67.93  ?  861  GLY A N     1 
ATOM   6712  C  CA    . GLY A 1  861  ? 179.159 209.063 211.917 1.00 67.45  ?  861  GLY A CA    1 
ATOM   6713  C  C     . GLY A 1  861  ? 180.378 209.955 212.029 1.00 70.22  ?  861  GLY A C     1 
ATOM   6714  O  O     . GLY A 1  861  ? 180.261 211.159 212.260 1.00 69.24  ?  861  GLY A O     1 
ATOM   6715  N  N     . ASN A 1  862  ? 181.567 209.347 211.885 1.00 67.34  ?  862  ASN A N     1 
ATOM   6716  C  CA    . ASN A 1  862  ? 182.843 210.036 211.872 1.00 67.69  ?  862  ASN A CA    1 
ATOM   6717  C  C     . ASN A 1  862  ? 182.852 210.862 210.588 1.00 71.86  ?  862  ASN A C     1 
ATOM   6718  O  O     . ASN A 1  862  ? 182.415 210.382 209.529 1.00 70.77  ?  862  ASN A O     1 
ATOM   6719  C  CB    . ASN A 1  862  ? 184.022 209.041 211.900 1.00 66.60  ?  862  ASN A CB    1 
ATOM   6720  C  CG    . ASN A 1  862  ? 184.135 208.162 213.131 1.00 91.95  ?  862  ASN A CG    1 
ATOM   6721  O  OD1   . ASN A 1  862  ? 183.393 208.271 214.120 1.00 85.89  ?  862  ASN A OD1   1 
ATOM   6722  N  ND2   . ASN A 1  862  ? 185.100 207.267 213.098 1.00 88.79  ?  862  ASN A ND2   1 
ATOM   6723  N  N     . VAL A 1  863  ? 183.246 212.131 210.706 1.00 68.95  ?  863  VAL A N     1 
ATOM   6724  C  CA    . VAL A 1  863  ? 183.284 213.042 209.568 1.00 68.38  ?  863  VAL A CA    1 
ATOM   6725  C  C     . VAL A 1  863  ? 184.531 212.689 208.743 1.00 75.05  ?  863  VAL A C     1 
ATOM   6726  O  O     . VAL A 1  863  ? 185.636 212.555 209.314 1.00 75.33  ?  863  VAL A O     1 
ATOM   6727  C  CB    . VAL A 1  863  ? 183.268 214.529 210.026 1.00 71.31  ?  863  VAL A CB    1 
ATOM   6728  C  CG1   . VAL A 1  863  ? 183.302 215.483 208.839 1.00 70.55  ?  863  VAL A CG1   1 
ATOM   6729  C  CG2   . VAL A 1  863  ? 182.072 214.824 210.925 1.00 70.84  ?  863  VAL A CG2   1 
ATOM   6730  N  N     . ILE A 1  864  ? 184.334 212.464 207.418 1.00 71.55  ?  864  ILE A N     1 
ATOM   6731  C  CA    . ILE A 1  864  ? 185.445 212.203 206.505 1.00 71.51  ?  864  ILE A CA    1 
ATOM   6732  C  C     . ILE A 1  864  ? 185.798 213.532 205.871 1.00 75.99  ?  864  ILE A C     1 
ATOM   6733  O  O     . ILE A 1  864  ? 186.936 213.982 205.982 1.00 76.83  ?  864  ILE A O     1 
ATOM   6734  C  CB    . ILE A 1  864  ? 185.178 211.068 205.493 1.00 73.94  ?  864  ILE A CB    1 
ATOM   6735  C  CG1   . ILE A 1  864  ? 185.381 209.723 206.176 1.00 74.95  ?  864  ILE A CG1   1 
ATOM   6736  C  CG2   . ILE A 1  864  ? 186.123 211.160 204.292 1.00 74.76  ?  864  ILE A CG2   1 
ATOM   6737  C  CD1   . ILE A 1  864  ? 184.159 209.177 206.801 1.00 92.20  ?  864  ILE A CD1   1 
ATOM   6738  N  N     . GLN A 1  865  ? 184.800 214.165 205.254 1.00 71.45  ?  865  GLN A N     1 
ATOM   6739  C  CA    . GLN A 1  865  ? 184.853 215.483 204.646 1.00 71.28  ?  865  GLN A CA    1 
ATOM   6740  C  C     . GLN A 1  865  ? 183.775 216.267 205.384 1.00 75.60  ?  865  GLN A C     1 
ATOM   6741  O  O     . GLN A 1  865  ? 182.719 215.711 205.717 1.00 75.39  ?  865  GLN A O     1 
ATOM   6742  C  CB    . GLN A 1  865  ? 184.499 215.414 203.142 1.00 71.66  ?  865  GLN A CB    1 
ATOM   6743  C  CG    . GLN A 1  865  ? 185.605 214.882 202.232 1.00 80.68  ?  865  GLN A CG    1 
ATOM   6744  C  CD    . GLN A 1  865  ? 185.206 214.839 200.768 1.00 96.17  ?  865  GLN A CD    1 
ATOM   6745  O  OE1   . GLN A 1  865  ? 184.035 214.697 200.421 1.00 92.56  ?  865  GLN A OE1   1 
ATOM   6746  N  NE2   . GLN A 1  865  ? 186.179 214.884 199.864 1.00 85.10  ?  865  GLN A NE2   1 
ATOM   6747  N  N     . PHE A 1  866  ? 184.035 217.545 205.655 1.00 71.78  ?  866  PHE A N     1 
ATOM   6748  C  CA    . PHE A 1  866  ? 183.057 218.391 206.320 1.00 70.87  ?  866  PHE A CA    1 
ATOM   6749  C  C     . PHE A 1  866  ? 181.925 218.725 205.392 1.00 74.85  ?  866  PHE A C     1 
ATOM   6750  O  O     . PHE A 1  866  ? 180.775 218.756 205.825 1.00 74.92  ?  866  PHE A O     1 
ATOM   6751  C  CB    . PHE A 1  866  ? 183.707 219.635 206.936 1.00 72.78  ?  866  PHE A CB    1 
ATOM   6752  C  CG    . PHE A 1  866  ? 184.179 219.318 208.332 1.00 73.95  ?  866  PHE A CG    1 
ATOM   6753  C  CD1   . PHE A 1  866  ? 183.292 219.344 209.407 1.00 75.71  ?  866  PHE A CD1   1 
ATOM   6754  C  CD2   . PHE A 1  866  ? 185.490 218.913 208.564 1.00 76.66  ?  866  PHE A CD2   1 
ATOM   6755  C  CE1   . PHE A 1  866  ? 183.712 218.996 210.690 1.00 78.91  ?  866  PHE A CE1   1 
ATOM   6756  C  CE2   . PHE A 1  866  ? 185.909 218.555 209.849 1.00 78.03  ?  866  PHE A CE2   1 
ATOM   6757  C  CZ    . PHE A 1  866  ? 185.014 218.587 210.901 1.00 77.58  ?  866  PHE A CZ    1 
ATOM   6758  N  N     . ILE A 1  867  ? 182.250 218.933 204.107 1.00 71.39  ?  867  ILE A N     1 
ATOM   6759  C  CA    . ILE A 1  867  ? 181.326 219.270 203.021 1.00 71.36  ?  867  ILE A CA    1 
ATOM   6760  C  C     . ILE A 1  867  ? 181.798 218.463 201.784 1.00 73.60  ?  867  ILE A C     1 
ATOM   6761  O  O     . ILE A 1  867  ? 183.019 218.344 201.602 1.00 72.29  ?  867  ILE A O     1 
ATOM   6762  C  CB    . ILE A 1  867  ? 181.245 220.841 202.918 1.00 75.61  ?  867  ILE A CB    1 
ATOM   6763  C  CG1   . ILE A 1  867  ? 180.061 221.376 203.774 1.00 78.07  ?  867  ILE A CG1   1 
ATOM   6764  C  CG2   . ILE A 1  867  ? 181.263 221.452 201.525 1.00 73.96  ?  867  ILE A CG2   1 
ATOM   6765  C  CD1   . ILE A 1  867  ? 180.461 221.814 205.506 1.00 90.93  ?  867  ILE A CD1   1 
ATOM   6766  N  N     . TYR A 1  868  ? 180.855 217.800 201.017 1.00 69.00  ?  868  TYR A N     1 
ATOM   6767  C  CA    . TYR A 1  868  ? 181.258 216.934 199.887 1.00 68.43  ?  868  TYR A CA    1 
ATOM   6768  C  C     . TYR A 1  868  ? 182.171 217.566 198.860 1.00 74.17  ?  868  TYR A C     1 
ATOM   6769  O  O     . TYR A 1  868  ? 181.841 218.596 198.261 1.00 75.33  ?  868  TYR A O     1 
ATOM   6770  C  CB    . TYR A 1  868  ? 180.111 216.137 199.235 1.00 68.87  ?  868  TYR A CB    1 
ATOM   6771  C  CG    . TYR A 1  868  ? 180.480 215.298 198.010 1.00 70.42  ?  868  TYR A CG    1 
ATOM   6772  C  CD1   . TYR A 1  868  ? 181.324 214.199 198.118 1.00 72.13  ?  868  TYR A CD1   1 
ATOM   6773  C  CD2   . TYR A 1  868  ? 179.895 215.541 196.767 1.00 71.20  ?  868  TYR A CD2   1 
ATOM   6774  C  CE1   . TYR A 1  868  ? 181.643 213.417 197.003 1.00 73.14  ?  868  TYR A CE1   1 
ATOM   6775  C  CE2   . TYR A 1  868  ? 180.174 214.739 195.656 1.00 71.42  ?  868  TYR A CE2   1 
ATOM   6776  C  CZ    . TYR A 1  868  ? 181.046 213.675 195.781 1.00 78.57  ?  868  TYR A CZ    1 
ATOM   6777  O  OH    . TYR A 1  868  ? 181.313 212.866 194.701 1.00 80.33  ?  868  TYR A OH    1 
ATOM   6778  N  N     . GLY A 1  869  ? 183.325 216.932 198.685 1.00 70.05  ?  869  GLY A N     1 
ATOM   6779  C  CA    . GLY A 1  869  ? 184.357 217.376 197.763 1.00 69.90  ?  869  GLY A CA    1 
ATOM   6780  C  C     . GLY A 1  869  ? 184.753 218.828 197.960 1.00 73.52  ?  869  GLY A C     1 
ATOM   6781  O  O     . GLY A 1  869  ? 184.968 219.528 196.970 1.00 74.30  ?  869  GLY A O     1 
ATOM   6782  N  N     . GLU A 1  870  ? 184.802 219.299 199.244 1.00 67.92  ?  870  GLU A N     1 
ATOM   6783  C  CA    . GLU A 1  870  ? 185.191 220.651 199.690 1.00 67.50  ?  870  GLU A CA    1 
ATOM   6784  C  C     . GLU A 1  870  ? 184.322 221.824 199.132 1.00 72.42  ?  870  GLU A C     1 
ATOM   6785  O  O     . GLU A 1  870  ? 184.552 222.983 199.513 1.00 73.55  ?  870  GLU A O     1 
ATOM   6786  C  CB    . GLU A 1  870  ? 186.711 220.903 199.485 1.00 68.55  ?  870  GLU A CB    1 
ATOM   6787  C  CG    . GLU A 1  870  ? 187.599 219.820 200.058 1.00 74.58  ?  870  GLU A CG    1 
ATOM   6788  C  CD    . GLU A 1  870  ? 189.108 219.898 199.914 1.00 101.17 ?  870  GLU A CD    1 
ATOM   6789  O  OE1   . GLU A 1  870  ? 189.682 221.007 199.808 1.00 90.85  ?  870  GLU A OE1   1 
ATOM   6790  O  OE2   . GLU A 1  870  ? 189.727 218.814 199.997 1.00 104.87 -1 870  GLU A OE2   1 
ATOM   6791  N  N     . ASP A 1  871  ? 183.346 221.530 198.240 1.00 67.07  ?  871  ASP A N     1 
ATOM   6792  C  CA    . ASP A 1  871  ? 182.503 222.547 197.628 1.00 67.20  ?  871  ASP A CA    1 
ATOM   6793  C  C     . ASP A 1  871  ? 181.007 222.337 197.810 1.00 71.49  ?  871  ASP A C     1 
ATOM   6794  O  O     . ASP A 1  871  ? 180.227 223.248 197.511 1.00 71.19  ?  871  ASP A O     1 
ATOM   6795  C  CB    . ASP A 1  871  ? 182.893 222.797 196.146 1.00 69.34  ?  871  ASP A CB    1 
ATOM   6796  C  CG    . ASP A 1  871  ? 182.511 221.748 195.110 1.00 75.04  ?  871  ASP A CG    1 
ATOM   6797  O  OD1   . ASP A 1  871  ? 181.772 220.802 195.466 1.00 74.98  ?  871  ASP A OD1   1 
ATOM   6798  O  OD2   . ASP A 1  871  ? 182.957 221.878 193.930 1.00 75.35  -1 871  ASP A OD2   1 
ATOM   6799  N  N     . GLY A 1  872  ? 180.637 221.135 198.255 1.00 68.56  ?  872  GLY A N     1 
ATOM   6800  C  CA    . GLY A 1  872  ? 179.266 220.711 198.536 1.00 68.54  ?  872  GLY A CA    1 
ATOM   6801  C  C     . GLY A 1  872  ? 178.383 220.578 197.316 1.00 74.28  ?  872  GLY A C     1 
ATOM   6802  O  O     . GLY A 1  872  ? 177.156 220.596 197.443 1.00 74.70  ?  872  GLY A O     1 
ATOM   6803  N  N     . MET A 1  873  ? 179.001 220.371 196.137 1.00 70.88  ?  873  MET A N     1 
ATOM   6804  C  CA    . MET A 1  873  ? 178.347 220.255 194.838 1.00 70.24  ?  873  MET A CA    1 
ATOM   6805  C  C     . MET A 1  873  ? 178.356 218.811 194.310 1.00 72.82  ?  873  MET A C     1 
ATOM   6806  O  O     . MET A 1  873  ? 179.279 218.051 194.624 1.00 70.82  ?  873  MET A O     1 
ATOM   6807  C  CB    . MET A 1  873  ? 179.128 221.144 193.858 1.00 73.31  ?  873  MET A CB    1 
ATOM   6808  C  CG    . MET A 1  873  ? 178.297 222.104 193.080 1.00 78.23  ?  873  MET A CG    1 
ATOM   6809  S  SD    . MET A 1  873  ? 177.285 223.203 194.091 1.00 84.81  ?  873  MET A SD    1 
ATOM   6810  C  CE    . MET A 1  873  ? 178.595 224.275 194.900 1.00 83.11  ?  873  MET A CE    1 
ATOM   6811  N  N     . ASP A 1  874  ? 177.334 218.445 193.495 1.00 70.00  ?  874  ASP A N     1 
ATOM   6812  C  CA    . ASP A 1  874  ? 177.246 217.155 192.788 1.00 69.86  ?  874  ASP A CA    1 
ATOM   6813  C  C     . ASP A 1  874  ? 178.118 217.306 191.546 1.00 75.21  ?  874  ASP A C     1 
ATOM   6814  O  O     . ASP A 1  874  ? 177.976 218.294 190.822 1.00 75.69  ?  874  ASP A O     1 
ATOM   6815  C  CB    . ASP A 1  874  ? 175.790 216.825 192.360 1.00 71.83  ?  874  ASP A CB    1 
ATOM   6816  C  CG    . ASP A 1  874  ? 175.550 215.536 191.543 1.00 82.03  ?  874  ASP A CG    1 
ATOM   6817  O  OD1   . ASP A 1  874  ? 176.510 215.020 190.930 1.00 79.59  ?  874  ASP A OD1   1 
ATOM   6818  O  OD2   . ASP A 1  874  ? 174.380 215.094 191.461 1.00 93.57  -1 874  ASP A OD2   1 
ATOM   6819  N  N     . ALA A 1  875  ? 178.988 216.311 191.284 1.00 72.05  ?  875  ALA A N     1 
ATOM   6820  C  CA    . ALA A 1  875  ? 179.941 216.287 190.158 1.00 71.33  ?  875  ALA A CA    1 
ATOM   6821  C  C     . ALA A 1  875  ? 179.368 216.392 188.752 1.00 72.61  ?  875  ALA A C     1 
ATOM   6822  O  O     . ALA A 1  875  ? 180.046 216.951 187.898 1.00 72.04  ?  875  ALA A O     1 
ATOM   6823  C  CB    . ALA A 1  875  ? 180.843 215.084 190.261 1.00 71.54  ?  875  ALA A CB    1 
ATOM   6824  N  N     . ALA A 1  876  ? 178.131 215.891 188.522 1.00 67.56  ?  876  ALA A N     1 
ATOM   6825  C  CA    . ALA A 1  876  ? 177.436 215.921 187.234 1.00 67.74  ?  876  ALA A CA    1 
ATOM   6826  C  C     . ALA A 1  876  ? 177.124 217.357 186.786 1.00 75.47  ?  876  ALA A C     1 
ATOM   6827  O  O     . ALA A 1  876  ? 177.226 217.710 185.594 1.00 75.17  ?  876  ALA A O     1 
ATOM   6828  C  CB    . ALA A 1  876  ? 176.156 215.129 187.343 1.00 67.71  ?  876  ALA A CB    1 
ATOM   6829  N  N     . HIS A 1  877  ? 176.810 218.192 187.783 1.00 74.70  ?  877  HIS A N     1 
ATOM   6830  C  CA    . HIS A 1  877  ? 176.447 219.602 187.668 1.00 76.10  ?  877  HIS A CA    1 
ATOM   6831  C  C     . HIS A 1  877  ? 177.585 220.596 187.535 1.00 81.32  ?  877  HIS A C     1 
ATOM   6832  O  O     . HIS A 1  877  ? 177.338 221.812 187.574 1.00 81.94  ?  877  HIS A O     1 
ATOM   6833  C  CB    . HIS A 1  877  ? 175.588 219.972 188.856 1.00 76.93  ?  877  HIS A CB    1 
ATOM   6834  C  CG    . HIS A 1  877  ? 174.213 219.451 188.709 1.00 79.81  ?  877  HIS A CG    1 
ATOM   6835  N  ND1   . HIS A 1  877  ? 173.954 218.106 188.787 1.00 80.82  ?  877  HIS A ND1   1 
ATOM   6836  C  CD2   . HIS A 1  877  ? 173.074 220.110 188.418 1.00 82.03  ?  877  HIS A CD2   1 
ATOM   6837  C  CE1   . HIS A 1  877  ? 172.661 217.985 188.582 1.00 80.40  ?  877  HIS A CE1   1 
ATOM   6838  N  NE2   . HIS A 1  877  ? 172.090 219.169 188.366 1.00 81.45  ?  877  HIS A NE2   1 
ATOM   6839  N  N     . ILE A 1  878  ? 178.807 220.080 187.335 1.00 77.25  ?  878  ILE A N     1 
ATOM   6840  C  CA    . ILE A 1  878  ? 180.041 220.843 187.217 1.00 77.18  ?  878  ILE A CA    1 
ATOM   6841  C  C     . ILE A 1  878  ? 180.550 220.821 185.764 1.00 81.53  ?  878  ILE A C     1 
ATOM   6842  O  O     . ILE A 1  878  ? 180.265 219.867 185.026 1.00 81.52  ?  878  ILE A O     1 
ATOM   6843  C  CB    . ILE A 1  878  ? 180.993 220.251 188.272 1.00 79.55  ?  878  ILE A CB    1 
ATOM   6844  C  CG1   . ILE A 1  878  ? 180.646 220.819 189.635 1.00 80.51  ?  878  ILE A CG1   1 
ATOM   6845  C  CG2   . ILE A 1  878  ? 182.447 220.463 187.963 1.00 80.58  ?  878  ILE A CG2   1 
ATOM   6846  C  CD1   . ILE A 1  878  ? 180.988 219.894 190.757 1.00 95.30  ?  878  ILE A CD1   1 
ATOM   6847  N  N     . GLU A 1  879  ? 181.216 221.919 185.336 1.00 77.55  ?  879  GLU A N     1 
ATOM   6848  C  CA    . GLU A 1  879  ? 181.783 222.107 183.992 1.00 77.56  ?  879  GLU A CA    1 
ATOM   6849  C  C     . GLU A 1  879  ? 183.020 222.993 184.051 1.00 84.98  ?  879  GLU A C     1 
ATOM   6850  O  O     . GLU A 1  879  ? 183.056 223.977 184.812 1.00 84.83  ?  879  GLU A O     1 
ATOM   6851  C  CB    . GLU A 1  879  ? 180.795 222.816 183.068 1.00 78.69  ?  879  GLU A CB    1 
ATOM   6852  C  CG    . GLU A 1  879  ? 179.412 222.212 183.010 1.00 83.16  ?  879  GLU A CG    1 
ATOM   6853  C  CD    . GLU A 1  879  ? 178.534 222.870 181.978 1.00 87.61  ?  879  GLU A CD    1 
ATOM   6854  O  OE1   . GLU A 1  879  ? 179.095 223.447 181.015 1.00 61.62  ?  879  GLU A OE1   1 
ATOM   6855  O  OE2   . GLU A 1  879  ? 177.291 222.839 182.148 1.00 87.32  -1 879  GLU A OE2   1 
ATOM   6856  N  N     . LYS A 1  880  ? 184.009 222.690 183.185 1.00 83.30  ?  880  LYS A N     1 
ATOM   6857  C  CA    . LYS A 1  880  ? 185.249 223.473 183.107 1.00 84.02  ?  880  LYS A CA    1 
ATOM   6858  C  C     . LYS A 1  880  ? 184.879 224.867 182.629 1.00 85.56  ?  880  LYS A C     1 
ATOM   6859  O  O     . LYS A 1  880  ? 184.204 224.992 181.613 1.00 84.93  ?  880  LYS A O     1 
ATOM   6860  C  CB    . LYS A 1  880  ? 186.295 222.807 182.169 1.00 87.80  ?  880  LYS A CB    1 
ATOM   6861  C  CG    . LYS A 1  880  ? 187.759 222.881 182.649 1.00 99.40  ?  880  LYS A CG    1 
ATOM   6862  C  CD    . LYS A 1  880  ? 188.729 222.022 181.790 1.00 108.35 ?  880  LYS A CD    1 
ATOM   6863  C  CE    . LYS A 1  880  ? 188.678 220.525 182.077 1.00 119.62 ?  880  LYS A CE    1 
ATOM   6864  N  NZ    . LYS A 1  880  ? 190.031 219.874 182.060 1.00 127.41 1  880  LYS A NZ    1 
ATOM   6865  N  N     . GLN A 1  881  ? 185.206 225.884 183.435 1.00 81.20  ?  881  GLN A N     1 
ATOM   6866  C  CA    . GLN A 1  881  ? 184.960 227.304 183.163 1.00 80.91  ?  881  GLN A CA    1 
ATOM   6867  C  C     . GLN A 1  881  ? 186.239 228.078 183.353 1.00 85.72  ?  881  GLN A C     1 
ATOM   6868  O  O     . GLN A 1  881  ? 187.079 227.677 184.155 1.00 83.59  ?  881  GLN A O     1 
ATOM   6869  C  CB    . GLN A 1  881  ? 183.868 227.869 184.066 1.00 81.23  ?  881  GLN A CB    1 
ATOM   6870  C  CG    . GLN A 1  881  ? 182.498 227.543 183.559 1.00 81.28  ?  881  GLN A CG    1 
ATOM   6871  C  CD    . GLN A 1  881  ? 181.433 228.062 184.466 1.00 83.01  ?  881  GLN A CD    1 
ATOM   6872  O  OE1   . GLN A 1  881  ? 180.804 229.101 184.184 1.00 79.03  ?  881  GLN A OE1   1 
ATOM   6873  N  NE2   . GLN A 1  881  ? 181.176 227.313 185.539 1.00 58.00  ?  881  GLN A NE2   1 
ATOM   6874  N  N     . SER A 1  882  ? 186.386 229.186 182.614 1.00 85.36  ?  882  SER A N     1 
ATOM   6875  C  CA    . SER A 1  882  ? 187.558 230.052 182.666 1.00 86.95  ?  882  SER A CA    1 
ATOM   6876  C  C     . SER A 1  882  ? 187.361 231.187 183.654 1.00 93.42  ?  882  SER A C     1 
ATOM   6877  O  O     . SER A 1  882  ? 186.401 231.955 183.519 1.00 92.74  ?  882  SER A O     1 
ATOM   6878  C  CB    . SER A 1  882  ? 187.848 230.630 181.286 1.00 91.45  ?  882  SER A CB    1 
ATOM   6879  O  OG    . SER A 1  882  ? 188.989 231.470 181.302 1.00 102.51 ?  882  SER A OG    1 
ATOM   6880  N  N     . LEU A 1  883  ? 188.278 231.296 184.642 1.00 92.84  ?  883  LEU A N     1 
ATOM   6881  C  CA    . LEU A 1  883  ? 188.288 232.386 185.629 1.00 94.88  ?  883  LEU A CA    1 
ATOM   6882  C  C     . LEU A 1  883  ? 189.135 233.494 184.968 1.00 103.57 ?  883  LEU A C     1 
ATOM   6883  O  O     . LEU A 1  883  ? 190.374 233.393 184.922 1.00 103.97 ?  883  LEU A O     1 
ATOM   6884  C  CB    . LEU A 1  883  ? 188.884 231.922 186.980 1.00 94.46  ?  883  LEU A CB    1 
ATOM   6885  C  CG    . LEU A 1  883  ? 188.248 230.687 187.639 1.00 97.28  ?  883  LEU A CG    1 
ATOM   6886  C  CD1   . LEU A 1  883  ? 189.285 229.861 188.354 1.00 96.90  ?  883  LEU A CD1   1 
ATOM   6887  C  CD2   . LEU A 1  883  ? 187.164 231.073 188.613 1.00 98.72  ?  883  LEU A CD2   1 
ATOM   6888  N  N     . ASP A 1  884  ? 188.453 234.477 184.332 1.00 102.30 ?  884  ASP A N     1 
ATOM   6889  C  CA    . ASP A 1  884  ? 189.113 235.526 183.549 1.00 104.17 ?  884  ASP A CA    1 
ATOM   6890  C  C     . ASP A 1  884  ? 190.149 236.272 184.341 1.00 110.44 ?  884  ASP A C     1 
ATOM   6891  O  O     . ASP A 1  884  ? 191.337 236.138 184.031 1.00 111.80 ?  884  ASP A O     1 
ATOM   6892  C  CB    . ASP A 1  884  ? 188.108 236.441 182.860 1.00 106.53 ?  884  ASP A CB    1 
ATOM   6893  C  CG    . ASP A 1  884  ? 187.174 235.637 181.999 1.00 118.07 ?  884  ASP A CG    1 
ATOM   6894  O  OD1   . ASP A 1  884  ? 187.534 235.362 180.835 1.00 118.93 ?  884  ASP A OD1   1 
ATOM   6895  O  OD2   . ASP A 1  884  ? 186.143 235.169 182.527 1.00 125.78 -1 884  ASP A OD2   1 
ATOM   6896  N  N     . THR A 1  885  ? 189.707 236.935 185.432 1.00 105.64 ?  885  THR A N     1 
ATOM   6897  C  CA    . THR A 1  885  ? 190.474 237.663 186.440 1.00 105.32 ?  885  THR A CA    1 
ATOM   6898  C  C     . THR A 1  885  ? 191.932 237.139 186.615 1.00 109.51 ?  885  THR A C     1 
ATOM   6899  O  O     . THR A 1  885  ? 192.871 237.936 186.518 1.00 111.03 ?  885  THR A O     1 
ATOM   6900  C  CB    . THR A 1  885  ? 189.609 237.692 187.711 1.00 107.02 ?  885  THR A CB    1 
ATOM   6901  O  OG1   . THR A 1  885  ? 188.588 238.649 187.503 1.00 109.77 ?  885  THR A OG1   1 
ATOM   6902  C  CG2   . THR A 1  885  ? 190.349 238.075 188.944 1.00 102.53 ?  885  THR A CG2   1 
ATOM   6903  N  N     . ILE A 1  886  ? 192.104 235.799 186.783 1.00 103.26 ?  886  ILE A N     1 
ATOM   6904  C  CA    . ILE A 1  886  ? 193.375 235.082 186.983 1.00 101.77 ?  886  ILE A CA    1 
ATOM   6905  C  C     . ILE A 1  886  ? 194.598 235.543 186.163 1.00 106.06 ?  886  ILE A C     1 
ATOM   6906  O  O     . ILE A 1  886  ? 195.601 235.938 186.752 1.00 106.82 ?  886  ILE A O     1 
ATOM   6907  C  CB    . ILE A 1  886  ? 193.164 233.536 186.993 1.00 102.93 ?  886  ILE A CB    1 
ATOM   6908  C  CG1   . ILE A 1  886  ? 193.630 232.865 188.304 1.00 102.25 ?  886  ILE A CG1   1 
ATOM   6909  C  CG2   . ILE A 1  886  ? 193.687 232.827 185.748 1.00 103.63 ?  886  ILE A CG2   1 
ATOM   6910  C  CD1   . ILE A 1  886  ? 195.107 232.666 188.531 1.00 104.81 ?  886  ILE A CD1   1 
ATOM   6911  N  N     . GLY A 1  887  ? 194.498 235.499 184.836 1.00 101.93 ?  887  GLY A N     1 
ATOM   6912  C  CA    . GLY A 1  887  ? 195.608 235.827 183.949 1.00 102.29 ?  887  GLY A CA    1 
ATOM   6913  C  C     . GLY A 1  887  ? 195.591 237.194 183.301 1.00 106.64 ?  887  GLY A C     1 
ATOM   6914  O  O     . GLY A 1  887  ? 194.897 238.108 183.759 1.00 105.95 ?  887  GLY A O     1 
ATOM   6915  N  N     . GLY A 1  888  ? 196.396 237.313 182.243 1.00 104.31 ?  888  GLY A N     1 
ATOM   6916  C  CA    . GLY A 1  888  ? 196.560 238.528 181.454 1.00 105.82 ?  888  GLY A CA    1 
ATOM   6917  C  C     . GLY A 1  888  ? 197.478 239.549 182.093 1.00 111.49 ?  888  GLY A C     1 
ATOM   6918  O  O     . GLY A 1  888  ? 197.942 239.350 183.221 1.00 111.83 ?  888  GLY A O     1 
ATOM   6919  N  N     . SER A 1  889  ? 197.754 240.654 181.386 1.00 108.30 ?  889  SER A N     1 
ATOM   6920  C  CA    . SER A 1  889  ? 198.610 241.683 181.963 1.00 108.80 ?  889  SER A CA    1 
ATOM   6921  C  C     . SER A 1  889  ? 197.798 242.486 182.954 1.00 110.77 ?  889  SER A C     1 
ATOM   6922  O  O     . SER A 1  889  ? 196.568 242.523 182.849 1.00 108.62 ?  889  SER A O     1 
ATOM   6923  C  CB    . SER A 1  889  ? 199.173 242.596 180.882 1.00 114.38 ?  889  SER A CB    1 
ATOM   6924  O  OG    . SER A 1  889  ? 198.197 243.505 180.408 1.00 125.67 ?  889  SER A OG    1 
ATOM   6925  N  N     . ASP A 1  890  ? 198.484 243.144 183.901 1.00 107.99 ?  890  ASP A N     1 
ATOM   6926  C  CA    . ASP A 1  890  ? 197.836 244.005 184.887 1.00 108.05 ?  890  ASP A CA    1 
ATOM   6927  C  C     . ASP A 1  890  ? 197.073 245.160 184.174 1.00 112.13 ?  890  ASP A C     1 
ATOM   6928  O  O     . ASP A 1  890  ? 196.025 245.611 184.653 1.00 111.01 ?  890  ASP A O     1 
ATOM   6929  C  CB    . ASP A 1  890  ? 198.867 244.522 185.905 1.00 110.80 ?  890  ASP A CB    1 
ATOM   6930  C  CG    . ASP A 1  890  ? 199.236 243.515 186.984 1.00 122.31 ?  890  ASP A CG    1 
ATOM   6931  O  OD1   . ASP A 1  890  ? 198.397 243.268 187.884 1.00 123.53 ?  890  ASP A OD1   1 
ATOM   6932  O  OD2   . ASP A 1  890  ? 200.380 243.024 186.972 1.00 127.55 -1 890  ASP A OD2   1 
ATOM   6933  N  N     . ALA A 1  891  ? 197.576 245.564 182.987 1.00 109.38 ?  891  ALA A N     1 
ATOM   6934  C  CA    . ALA A 1  891  ? 197.022 246.614 182.131 1.00 109.82 ?  891  ALA A CA    1 
ATOM   6935  C  C     . ALA A 1  891  ? 195.802 246.150 181.397 1.00 111.02 ?  891  ALA A C     1 
ATOM   6936  O  O     . ALA A 1  891  ? 194.868 246.933 181.246 1.00 110.82 ?  891  ALA A O     1 
ATOM   6937  C  CB    . ALA A 1  891  ? 198.064 247.069 181.128 1.00 112.07 ?  891  ALA A CB    1 
ATOM   6938  N  N     . ALA A 1  892  ? 195.829 244.892 180.897 1.00 106.31 ?  892  ALA A N     1 
ATOM   6939  C  CA    . ALA A 1  892  ? 194.738 244.260 180.139 1.00 105.21 ?  892  ALA A CA    1 
ATOM   6940  C  C     . ALA A 1  892  ? 193.524 244.033 181.036 1.00 106.41 ?  892  ALA A C     1 
ATOM   6941  O  O     . ALA A 1  892  ? 192.377 244.166 180.578 1.00 106.04 ?  892  ALA A O     1 
ATOM   6942  C  CB    . ALA A 1  892  ? 195.203 242.941 179.536 1.00 105.18 ?  892  ALA A CB    1 
ATOM   6943  N  N     . PHE A 1  893  ? 193.796 243.696 182.322 1.00 99.95  ?  893  PHE A N     1 
ATOM   6944  C  CA    . PHE A 1  893  ? 192.805 243.499 183.373 1.00 97.77  ?  893  PHE A CA    1 
ATOM   6945  C  C     . PHE A 1  893  ? 192.082 244.834 183.545 1.00 103.12 ?  893  PHE A C     1 
ATOM   6946  O  O     . PHE A 1  893  ? 190.855 244.907 183.386 1.00 102.75 ?  893  PHE A O     1 
ATOM   6947  C  CB    . PHE A 1  893  ? 193.519 243.098 184.681 1.00 98.40  ?  893  PHE A CB    1 
ATOM   6948  C  CG    . PHE A 1  893  ? 192.664 243.033 185.927 1.00 98.44  ?  893  PHE A CG    1 
ATOM   6949  C  CD1   . PHE A 1  893  ? 192.357 244.186 186.643 1.00 100.73 ?  893  PHE A CD1   1 
ATOM   6950  C  CD2   . PHE A 1  893  ? 192.208 241.815 186.414 1.00 99.70  ?  893  PHE A CD2   1 
ATOM   6951  C  CE1   . PHE A 1  893  ? 191.577 244.125 187.798 1.00 102.84 ?  893  PHE A CE1   1 
ATOM   6952  C  CE2   . PHE A 1  893  ? 191.428 241.755 187.570 1.00 99.94  ?  893  PHE A CE2   1 
ATOM   6953  C  CZ    . PHE A 1  893  ? 191.123 242.908 188.257 1.00 99.74  ?  893  PHE A CZ    1 
ATOM   6954  N  N     . GLU A 1  894  ? 192.871 245.891 183.836 1.00 100.08 ?  894  GLU A N     1 
ATOM   6955  C  CA    . GLU A 1  894  ? 192.418 247.253 184.038 1.00 100.77 ?  894  GLU A CA    1 
ATOM   6956  C  C     . GLU A 1  894  ? 191.419 247.676 182.969 1.00 105.17 ?  894  GLU A C     1 
ATOM   6957  O  O     . GLU A 1  894  ? 190.316 248.076 183.332 1.00 104.43 ?  894  GLU A O     1 
ATOM   6958  C  CB    . GLU A 1  894  ? 193.616 248.199 184.078 1.00 103.55 ?  894  GLU A CB    1 
ATOM   6959  C  CG    . GLU A 1  894  ? 193.272 249.558 184.640 1.00 113.28 ?  894  GLU A CG    1 
ATOM   6960  C  CD    . GLU A 1  894  ? 194.458 250.453 184.908 1.00 133.73 ?  894  GLU A CD    1 
ATOM   6961  O  OE1   . GLU A 1  894  ? 195.474 249.948 185.440 1.00 127.37 ?  894  GLU A OE1   1 
ATOM   6962  O  OE2   . GLU A 1  894  ? 194.360 251.666 184.617 1.00 137.47 -1 894  GLU A OE2   1 
ATOM   6963  N  N     . LYS A 1  895  ? 191.780 247.532 181.660 1.00 102.89 ?  895  LYS A N     1 
ATOM   6964  C  CA    . LYS A 1  895  ? 190.929 247.887 180.502 1.00 103.54 ?  895  LYS A CA    1 
ATOM   6965  C  C     . LYS A 1  895  ? 189.591 247.140 180.528 1.00 107.12 ?  895  LYS A C     1 
ATOM   6966  O  O     . LYS A 1  895  ? 188.528 247.706 180.200 1.00 105.89 ?  895  LYS A O     1 
ATOM   6967  C  CB    . LYS A 1  895  ? 191.661 247.642 179.154 1.00 106.00 ?  895  LYS A CB    1 
ATOM   6968  C  CG    . LYS A 1  895  ? 190.848 248.095 177.922 1.00 117.96 ?  895  LYS A CG    1 
ATOM   6969  C  CD    . LYS A 1  895  ? 191.585 247.977 176.594 1.00 128.74 ?  895  LYS A CD    1 
ATOM   6970  C  CE    . LYS A 1  895  ? 190.810 248.659 175.487 1.00 143.85 ?  895  LYS A CE    1 
ATOM   6971  N  NZ    . LYS A 1  895  ? 191.680 249.038 174.341 1.00 156.71 1  895  LYS A NZ    1 
ATOM   6972  N  N     . ARG A 1  896  ? 189.661 245.863 180.926 1.00 103.60 ?  896  ARG A N     1 
ATOM   6973  C  CA    . ARG A 1  896  ? 188.496 245.017 180.989 1.00 102.63 ?  896  ARG A CA    1 
ATOM   6974  C  C     . ARG A 1  896  ? 187.577 245.353 182.151 1.00 107.68 ?  896  ARG A C     1 
ATOM   6975  O  O     . ARG A 1  896  ? 186.365 245.404 181.940 1.00 108.61 ?  896  ARG A O     1 
ATOM   6976  C  CB    . ARG A 1  896  ? 188.892 243.540 181.013 1.00 100.60 ?  896  ARG A CB    1 
ATOM   6977  C  CG    . ARG A 1  896  ? 188.056 242.729 180.047 1.00 109.83 ?  896  ARG A CG    1 
ATOM   6978  C  CD    . ARG A 1  896  ? 187.216 241.685 180.742 1.00 112.73 ?  896  ARG A CD    1 
ATOM   6979  N  NE    . ARG A 1  896  ? 187.216 240.434 179.985 1.00 119.70 ?  896  ARG A NE    1 
ATOM   6980  C  CZ    . ARG A 1  896  ? 188.134 239.477 180.111 1.00 137.52 ?  896  ARG A CZ    1 
ATOM   6981  N  NH1   . ARG A 1  896  ? 189.141 239.618 180.970 1.00 121.06 1  896  ARG A NH1   1 
ATOM   6982  N  NH2   . ARG A 1  896  ? 188.052 238.373 179.382 1.00 129.47 ?  896  ARG A NH2   1 
ATOM   6983  N  N     . TYR A 1  897  ? 188.133 245.613 183.353 1.00 102.92 ?  897  TYR A N     1 
ATOM   6984  C  CA    . TYR A 1  897  ? 187.323 245.808 184.554 1.00 102.02 ?  897  TYR A CA    1 
ATOM   6985  C  C     . TYR A 1  897  ? 187.063 247.198 185.117 1.00 106.05 ?  897  TYR A C     1 
ATOM   6986  O  O     . TYR A 1  897  ? 186.003 247.412 185.726 1.00 105.60 ?  897  TYR A O     1 
ATOM   6987  C  CB    . TYR A 1  897  ? 187.788 244.852 185.650 1.00 102.35 ?  897  TYR A CB    1 
ATOM   6988  C  CG    . TYR A 1  897  ? 187.648 243.400 185.258 1.00 103.13 ?  897  TYR A CG    1 
ATOM   6989  C  CD1   . TYR A 1  897  ? 186.445 242.722 185.434 1.00 103.94 ?  897  TYR A CD1   1 
ATOM   6990  C  CD2   . TYR A 1  897  ? 188.711 242.707 184.691 1.00 104.40 ?  897  TYR A CD2   1 
ATOM   6991  C  CE1   . TYR A 1  897  ? 186.305 241.387 185.054 1.00 104.06 ?  897  TYR A CE1   1 
ATOM   6992  C  CE2   . TYR A 1  897  ? 188.586 241.370 184.313 1.00 104.72 ?  897  TYR A CE2   1 
ATOM   6993  C  CZ    . TYR A 1  897  ? 187.382 240.711 184.501 1.00 111.75 ?  897  TYR A CZ    1 
ATOM   6994  O  OH    . TYR A 1  897  ? 187.278 239.385 184.157 1.00 111.35 ?  897  TYR A OH    1 
ATOM   6995  N  N     . ARG A 1  898  ? 188.027 248.119 184.964 1.00 102.42 ?  898  ARG A N     1 
ATOM   6996  C  CA    . ARG A 1  898  ? 187.937 249.464 185.523 1.00 102.23 ?  898  ARG A CA    1 
ATOM   6997  C  C     . ARG A 1  898  ? 186.930 250.391 184.906 1.00 105.55 ?  898  ARG A C     1 
ATOM   6998  O  O     . ARG A 1  898  ? 186.924 250.614 183.688 1.00 105.17 ?  898  ARG A O     1 
ATOM   6999  C  CB    . ARG A 1  898  ? 189.317 250.138 185.605 1.00 101.23 ?  898  ARG A CB    1 
ATOM   7000  C  CG    . ARG A 1  898  ? 189.359 251.468 186.356 1.00 109.96 ?  898  ARG A CG    1 
ATOM   7001  C  CD    . ARG A 1  898  ? 188.863 251.376 187.786 1.00 116.93 ?  898  ARG A CD    1 
ATOM   7002  N  NE    . ARG A 1  898  ? 189.537 252.359 188.631 1.00 126.08 ?  898  ARG A NE    1 
ATOM   7003  C  CZ    . ARG A 1  898  ? 189.018 252.881 189.737 1.00 139.91 ?  898  ARG A CZ    1 
ATOM   7004  N  NH1   . ARG A 1  898  ? 187.794 252.546 190.130 1.00 122.13 1  898  ARG A NH1   1 
ATOM   7005  N  NH2   . ARG A 1  898  ? 189.716 253.751 190.453 1.00 132.30 ?  898  ARG A NH2   1 
ATOM   7006  N  N     . VAL A 1  899  ? 186.104 250.967 185.795 1.00 101.65 ?  899  VAL A N     1 
ATOM   7007  C  CA    . VAL A 1  899  ? 185.128 252.021 185.526 1.00 102.13 ?  899  VAL A CA    1 
ATOM   7008  C  C     . VAL A 1  899  ? 185.542 253.146 186.460 1.00 107.46 ?  899  VAL A C     1 
ATOM   7009  O  O     . VAL A 1  899  ? 185.702 252.921 187.672 1.00 107.60 ?  899  VAL A O     1 
ATOM   7010  C  CB    . VAL A 1  899  ? 183.646 251.612 185.740 1.00 104.75 ?  899  VAL A CB    1 
ATOM   7011  C  CG1   . VAL A 1  899  ? 182.712 252.815 185.640 1.00 105.18 ?  899  VAL A CG1   1 
ATOM   7012  C  CG2   . VAL A 1  899  ? 183.229 250.527 184.753 1.00 103.59 ?  899  VAL A CG2   1 
ATOM   7013  N  N     . ASP A 1  900  ? 185.774 254.335 185.877 1.00 103.87 ?  900  ASP A N     1 
ATOM   7014  C  CA    . ASP A 1  900  ? 186.174 255.554 186.569 1.00 103.95 ?  900  ASP A CA    1 
ATOM   7015  C  C     . ASP A 1  900  ? 185.269 256.672 186.077 1.00 105.77 ?  900  ASP A C     1 
ATOM   7016  O  O     . ASP A 1  900  ? 185.589 257.319 185.080 1.00 105.82 ?  900  ASP A O     1 
ATOM   7017  C  CB    . ASP A 1  900  ? 187.655 255.858 186.279 1.00 106.92 ?  900  ASP A CB    1 
ATOM   7018  C  CG    . ASP A 1  900  ? 188.288 257.005 187.051 1.00 121.07 ?  900  ASP A CG    1 
ATOM   7019  O  OD1   . ASP A 1  900  ? 187.535 257.887 187.550 1.00 122.39 ?  900  ASP A OD1   1 
ATOM   7020  O  OD2   . ASP A 1  900  ? 189.541 257.044 187.130 1.00 127.34 -1 900  ASP A OD2   1 
ATOM   7021  N  N     . LEU A 1  901  ? 184.126 256.887 186.760 1.00 100.79 ?  901  LEU A N     1 
ATOM   7022  C  CA    . LEU A 1  901  ? 183.157 257.942 186.415 1.00 101.30 ?  901  LEU A CA    1 
ATOM   7023  C  C     . LEU A 1  901  ? 183.720 259.352 186.687 1.00 106.22 ?  901  LEU A C     1 
ATOM   7024  O  O     . LEU A 1  901  ? 183.053 260.342 186.382 1.00 107.19 ?  901  LEU A O     1 
ATOM   7025  C  CB    . LEU A 1  901  ? 181.830 257.797 187.181 1.00 100.58 ?  901  LEU A CB    1 
ATOM   7026  C  CG    . LEU A 1  901  ? 181.273 256.420 187.407 1.00 103.20 ?  901  LEU A CG    1 
ATOM   7027  C  CD1   . LEU A 1  901  ? 180.205 256.465 188.467 1.00 102.77 ?  901  LEU A CD1   1 
ATOM   7028  C  CD2   . LEU A 1  901  ? 180.718 255.855 186.132 1.00 106.29 ?  901  LEU A CD2   1 
ATOM   7029  N  N     . LEU A 1  902  ? 184.926 259.440 187.270 1.00 101.15 ?  902  LEU A N     1 
ATOM   7030  C  CA    . LEU A 1  902  ? 185.539 260.718 187.568 1.00 102.04 ?  902  LEU A CA    1 
ATOM   7031  C  C     . LEU A 1  902  ? 186.626 261.103 186.561 1.00 108.16 ?  902  LEU A C     1 
ATOM   7032  O  O     . LEU A 1  902  ? 187.307 262.112 186.762 1.00 110.20 ?  902  LEU A O     1 
ATOM   7033  C  CB    . LEU A 1  902  ? 186.062 260.765 189.012 1.00 101.70 ?  902  LEU A CB    1 
ATOM   7034  C  CG    . LEU A 1  902  ? 185.163 260.214 190.115 1.00 104.18 ?  902  LEU A CG    1 
ATOM   7035  C  CD1   . LEU A 1  902  ? 185.899 260.156 191.415 1.00 104.53 ?  902  LEU A CD1   1 
ATOM   7036  C  CD2   . LEU A 1  902  ? 183.872 260.987 190.268 1.00 104.13 ?  902  LEU A CD2   1 
ATOM   7037  N  N     . ASN A 1  903  ? 186.762 260.331 185.463 1.00 103.65 ?  903  ASN A N     1 
ATOM   7038  C  CA    . ASN A 1  903  ? 187.729 260.572 184.382 1.00 104.30 ?  903  ASN A CA    1 
ATOM   7039  C  C     . ASN A 1  903  ? 187.004 260.515 183.041 1.00 109.55 ?  903  ASN A C     1 
ATOM   7040  O  O     . ASN A 1  903  ? 186.383 259.494 182.736 1.00 108.21 ?  903  ASN A O     1 
ATOM   7041  C  CB    . ASN A 1  903  ? 188.856 259.533 184.433 1.00 102.13 ?  903  ASN A CB    1 
ATOM   7042  C  CG    . ASN A 1  903  ? 189.816 259.596 183.276 1.00 116.38 ?  903  ASN A CG    1 
ATOM   7043  O  OD1   . ASN A 1  903  ? 189.648 258.921 182.262 1.00 109.68 ?  903  ASN A OD1   1 
ATOM   7044  N  ND2   . ASN A 1  903  ? 190.857 260.391 183.411 1.00 109.28 ?  903  ASN A ND2   1 
ATOM   7045  N  N     . THR A 1  904  ? 187.111 261.579 182.232 1.00 108.69 ?  904  THR A N     1 
ATOM   7046  C  CA    . THR A 1  904  ? 186.446 261.671 180.932 1.00 109.92 ?  904  THR A CA    1 
ATOM   7047  C  C     . THR A 1  904  ? 186.708 260.543 179.912 1.00 115.55 ?  904  THR A C     1 
ATOM   7048  O  O     . THR A 1  904  ? 185.873 260.309 179.031 1.00 114.69 ?  904  THR A O     1 
ATOM   7049  C  CB    . THR A 1  904  ? 186.525 263.081 180.358 1.00 122.48 ?  904  THR A CB    1 
ATOM   7050  O  OG1   . THR A 1  904  ? 185.402 263.255 179.500 1.00 126.44 ?  904  THR A OG1   1 
ATOM   7051  C  CG2   . THR A 1  904  ? 187.823 263.355 179.590 1.00 120.67 ?  904  THR A CG2   1 
ATOM   7052  N  N     . ASP A 1  905  ? 187.853 259.852 180.034 1.00 113.75 ?  905  ASP A N     1 
ATOM   7053  C  CA    . ASP A 1  905  ? 188.236 258.761 179.139 1.00 113.58 ?  905  ASP A CA    1 
ATOM   7054  C  C     . ASP A 1  905  ? 187.795 257.386 179.656 1.00 118.96 ?  905  ASP A C     1 
ATOM   7055  O  O     . ASP A 1  905  ? 187.399 256.527 178.854 1.00 118.19 ?  905  ASP A O     1 
ATOM   7056  C  CB    . ASP A 1  905  ? 189.752 258.778 178.893 1.00 115.66 ?  905  ASP A CB    1 
ATOM   7057  C  CG    . ASP A 1  905  ? 190.296 260.139 178.520 1.00 127.46 ?  905  ASP A CG    1 
ATOM   7058  O  OD1   . ASP A 1  905  ? 189.629 260.850 177.732 1.00 128.78 ?  905  ASP A OD1   1 
ATOM   7059  O  OD2   . ASP A 1  905  ? 191.391 260.496 179.014 1.00 134.37 -1 905  ASP A OD2   1 
ATOM   7060  N  N     . HIS A 1  906  ? 187.874 257.173 180.988 1.00 116.36 ?  906  HIS A N     1 
ATOM   7061  C  CA    . HIS A 1  906  ? 187.548 255.887 181.598 1.00 115.15 ?  906  HIS A CA    1 
ATOM   7062  C  C     . HIS A 1  906  ? 186.138 255.706 182.183 1.00 117.51 ?  906  HIS A C     1 
ATOM   7063  O  O     . HIS A 1  906  ? 185.873 254.706 182.860 1.00 115.97 ?  906  HIS A O     1 
ATOM   7064  C  CB    . HIS A 1  906  ? 188.685 255.376 182.499 1.00 116.37 ?  906  HIS A CB    1 
ATOM   7065  C  CG    . HIS A 1  906  ? 190.053 255.560 181.908 1.00 121.38 ?  906  HIS A CG    1 
ATOM   7066  N  ND1   . HIS A 1  906  ? 190.247 255.675 180.538 1.00 123.93 ?  906  HIS A ND1   1 
ATOM   7067  C  CD2   . HIS A 1  906  ? 191.254 255.661 182.526 1.00 124.49 ?  906  HIS A CD2   1 
ATOM   7068  C  CE1   . HIS A 1  906  ? 191.547 255.863 180.371 1.00 124.54 ?  906  HIS A CE1   1 
ATOM   7069  N  NE2   . HIS A 1  906  ? 192.197 255.854 181.537 1.00 125.07 ?  906  HIS A NE2   1 
ATOM   7070  N  N     . THR A 1  907  ? 185.208 256.625 181.846 1.00 113.91 ?  907  THR A N     1 
ATOM   7071  C  CA    . THR A 1  907  ? 183.792 256.520 182.216 1.00 112.74 ?  907  THR A CA    1 
ATOM   7072  C  C     . THR A 1  907  ? 183.173 255.508 181.226 1.00 116.37 ?  907  THR A C     1 
ATOM   7073  O  O     . THR A 1  907  ? 183.835 255.050 180.280 1.00 115.65 ?  907  THR A O     1 
ATOM   7074  C  CB    . THR A 1  907  ? 183.121 257.928 182.154 1.00 116.34 ?  907  THR A CB    1 
ATOM   7075  O  OG1   . THR A 1  907  ? 183.775 258.756 183.097 1.00 120.29 ?  907  THR A OG1   1 
ATOM   7076  C  CG2   . THR A 1  907  ? 181.613 257.936 182.484 1.00 109.82 ?  907  THR A CG2   1 
ATOM   7077  N  N     . LEU A 1  908  ? 181.920 255.135 181.476 1.00 112.51 ?  908  LEU A N     1 
ATOM   7078  C  CA    . LEU A 1  908  ? 181.141 254.292 180.588 1.00 111.33 ?  908  LEU A CA    1 
ATOM   7079  C  C     . LEU A 1  908  ? 180.540 255.287 179.583 1.00 117.05 ?  908  LEU A C     1 
ATOM   7080  O  O     . LEU A 1  908  ? 179.940 256.290 179.997 1.00 118.02 ?  908  LEU A O     1 
ATOM   7081  C  CB    . LEU A 1  908  ? 180.036 253.563 181.381 1.00 109.86 ?  908  LEU A CB    1 
ATOM   7082  C  CG    . LEU A 1  908  ? 180.511 252.642 182.507 1.00 112.74 ?  908  LEU A CG    1 
ATOM   7083  C  CD1   . LEU A 1  908  ? 179.543 252.643 183.669 1.00 111.87 ?  908  LEU A CD1   1 
ATOM   7084  C  CD2   . LEU A 1  908  ? 180.729 251.238 181.999 1.00 114.55 ?  908  LEU A CD2   1 
ATOM   7085  N  N     . ASP A 1  909  ? 180.789 255.079 178.279 1.00 113.52 ?  909  ASP A N     1 
ATOM   7086  C  CA    . ASP A 1  909  ? 180.283 255.976 177.243 1.00 114.93 ?  909  ASP A CA    1 
ATOM   7087  C  C     . ASP A 1  909  ? 178.746 256.020 177.287 1.00 119.18 ?  909  ASP A C     1 
ATOM   7088  O  O     . ASP A 1  909  ? 178.144 254.970 177.523 1.00 118.08 ?  909  ASP A O     1 
ATOM   7089  C  CB    . ASP A 1  909  ? 180.771 255.528 175.863 1.00 117.29 ?  909  ASP A CB    1 
ATOM   7090  C  CG    . ASP A 1  909  ? 180.667 256.613 174.812 1.00 138.02 ?  909  ASP A CG    1 
ATOM   7091  O  OD1   . ASP A 1  909  ? 181.589 257.461 174.737 1.00 142.03 ?  909  ASP A OD1   1 
ATOM   7092  O  OD2   . ASP A 1  909  ? 179.635 256.657 174.107 1.00 145.47 -1 909  ASP A OD2   1 
ATOM   7093  N  N     . PRO A 1  910  ? 178.079 257.193 177.094 1.00 116.93 ?  910  PRO A N     1 
ATOM   7094  C  CA    . PRO A 1  910  ? 176.600 257.223 177.135 1.00 116.71 ?  910  PRO A CA    1 
ATOM   7095  C  C     . PRO A 1  910  ? 175.907 256.314 176.108 1.00 120.55 ?  910  PRO A C     1 
ATOM   7096  O  O     . PRO A 1  910  ? 174.676 256.224 176.086 1.00 120.35 ?  910  PRO A O     1 
ATOM   7097  C  CB    . PRO A 1  910  ? 176.275 258.697 176.908 1.00 120.30 ?  910  PRO A CB    1 
ATOM   7098  C  CG    . PRO A 1  910  ? 177.461 259.231 176.175 1.00 125.74 ?  910  PRO A CG    1 
ATOM   7099  C  CD    . PRO A 1  910  ? 178.616 258.538 176.817 1.00 120.32 ?  910  PRO A CD    1 
ATOM   7100  N  N     . SER A 1  911  ? 176.712 255.630 175.273 1.00 116.39 ?  911  SER A N     1 
ATOM   7101  C  CA    . SER A 1  911  ? 176.287 254.660 174.271 1.00 114.92 ?  911  SER A CA    1 
ATOM   7102  C  C     . SER A 1  911  ? 176.048 253.323 174.939 1.00 115.39 ?  911  SER A C     1 
ATOM   7103  O  O     . SER A 1  911  ? 175.295 252.509 174.398 1.00 114.32 ?  911  SER A O     1 
ATOM   7104  C  CB    . SER A 1  911  ? 177.373 254.489 173.217 1.00 118.93 ?  911  SER A CB    1 
ATOM   7105  O  OG    . SER A 1  911  ? 178.591 254.059 173.802 1.00 126.23 ?  911  SER A OG    1 
ATOM   7106  N  N     . LEU A 1  912  ? 176.732 253.088 176.087 1.00 110.24 ?  912  LEU A N     1 
ATOM   7107  C  CA    . LEU A 1  912  ? 176.677 251.858 176.875 1.00 108.43 ?  912  LEU A CA    1 
ATOM   7108  C  C     . LEU A 1  912  ? 175.406 251.731 177.695 1.00 112.70 ?  912  LEU A C     1 
ATOM   7109  O  O     . LEU A 1  912  ? 174.827 250.632 177.755 1.00 111.72 ?  912  LEU A O     1 
ATOM   7110  C  CB    . LEU A 1  912  ? 177.909 251.698 177.780 1.00 108.08 ?  912  LEU A CB    1 
ATOM   7111  C  CG    . LEU A 1  912  ? 179.275 251.589 177.105 1.00 112.97 ?  912  LEU A CG    1 
ATOM   7112  C  CD1   . LEU A 1  912  ? 180.373 251.492 178.133 1.00 112.62 ?  912  LEU A CD1   1 
ATOM   7113  C  CD2   . LEU A 1  912  ? 179.349 250.399 176.178 1.00 114.61 ?  912  LEU A CD2   1 
ATOM   7114  N  N     . LEU A 1  913  ? 174.985 252.841 178.346 1.00 109.36 ?  913  LEU A N     1 
ATOM   7115  C  CA    . LEU A 1  913  ? 173.765 252.901 179.157 1.00 108.87 ?  913  LEU A CA    1 
ATOM   7116  C  C     . LEU A 1  913  ? 173.155 254.272 179.072 1.00 114.86 ?  913  LEU A C     1 
ATOM   7117  O  O     . LEU A 1  913  ? 173.872 255.210 178.744 1.00 116.18 ?  913  LEU A O     1 
ATOM   7118  C  CB    . LEU A 1  913  ? 173.997 252.462 180.615 1.00 108.04 ?  913  LEU A CB    1 
ATOM   7119  C  CG    . LEU A 1  913  ? 174.664 253.415 181.608 1.00 113.70 ?  913  LEU A CG    1 
ATOM   7120  C  CD1   . LEU A 1  913  ? 174.650 252.806 182.992 1.00 112.99 ?  913  LEU A CD1   1 
ATOM   7121  C  CD2   . LEU A 1  913  ? 176.112 253.733 181.220 1.00 116.12 ?  913  LEU A CD2   1 
ATOM   7122  N  N     . GLU A 1  914  ? 171.841 254.390 179.350 1.00 111.69 ?  914  GLU A N     1 
ATOM   7123  C  CA    . GLU A 1  914  ? 171.067 255.644 179.279 1.00 113.37 ?  914  GLU A CA    1 
ATOM   7124  C  C     . GLU A 1  914  ? 171.534 256.743 180.254 1.00 119.36 ?  914  GLU A C     1 
ATOM   7125  O  O     . GLU A 1  914  ? 171.616 257.925 179.886 1.00 119.93 ?  914  GLU A O     1 
ATOM   7126  C  CB    . GLU A 1  914  ? 169.567 255.357 179.451 1.00 114.29 ?  914  GLU A CB    1 
ATOM   7127  C  CG    . GLU A 1  914  ? 168.944 254.668 178.243 1.00 124.01 ?  914  GLU A CG    1 
ATOM   7128  C  CD    . GLU A 1  914  ? 167.653 253.889 178.436 1.00 135.92 ?  914  GLU A CD    1 
ATOM   7129  O  OE1   . GLU A 1  914  ? 167.096 253.888 179.560 1.00 111.18 ?  914  GLU A OE1   1 
ATOM   7130  O  OE2   . GLU A 1  914  ? 167.201 253.271 177.443 1.00 128.07 -1 914  GLU A OE2   1 
ATOM   7131  N  N     . SER A 1  915  ? 171.877 256.335 181.482 1.00 115.89 ?  915  SER A N     1 
ATOM   7132  C  CA    . SER A 1  915  ? 172.343 257.223 182.543 1.00 116.79 ?  915  SER A CA    1 
ATOM   7133  C  C     . SER A 1  915  ? 173.785 257.767 182.349 1.00 121.18 ?  915  SER A C     1 
ATOM   7134  O  O     . SER A 1  915  ? 174.245 258.578 183.156 1.00 121.72 ?  915  SER A O     1 
ATOM   7135  C  CB    . SER A 1  915  ? 172.202 256.522 183.889 1.00 119.74 ?  915  SER A CB    1 
ATOM   7136  O  OG    . SER A 1  915  ? 172.832 255.251 183.889 1.00 128.54 ?  915  SER A OG    1 
ATOM   7137  N  N     . GLY A 1  916  ? 174.452 257.332 181.270 1.00 116.74 ?  916  GLY A N     1 
ATOM   7138  C  CA    . GLY A 1  916  ? 175.826 257.673 180.899 1.00 116.47 ?  916  GLY A CA    1 
ATOM   7139  C  C     . GLY A 1  916  ? 176.233 259.123 181.048 1.00 119.81 ?  916  GLY A C     1 
ATOM   7140  O  O     . GLY A 1  916  ? 177.308 259.423 181.585 1.00 119.42 ?  916  GLY A O     1 
ATOM   7141  N  N     . SER A 1  917  ? 175.365 260.025 180.579 1.00 115.95 ?  917  SER A N     1 
ATOM   7142  C  CA    . SER A 1  917  ? 175.583 261.466 180.637 1.00 117.14 ?  917  SER A CA    1 
ATOM   7143  C  C     . SER A 1  917  ? 175.504 262.002 182.062 1.00 119.21 ?  917  SER A C     1 
ATOM   7144  O  O     . SER A 1  917  ? 176.371 262.779 182.464 1.00 120.23 ?  917  SER A O     1 
ATOM   7145  C  CB    . SER A 1  917  ? 174.588 262.188 179.735 1.00 122.90 ?  917  SER A CB    1 
ATOM   7146  O  OG    . SER A 1  917  ? 173.297 261.607 179.825 1.00 133.87 ?  917  SER A OG    1 
ATOM   7147  N  N     . GLU A 1  918  ? 174.465 261.589 182.819 1.00 112.81 ?  918  GLU A N     1 
ATOM   7148  C  CA    . GLU A 1  918  ? 174.234 262.010 184.207 1.00 111.84 ?  918  GLU A CA    1 
ATOM   7149  C  C     . GLU A 1  918  ? 175.139 261.292 185.225 1.00 112.41 ?  918  GLU A C     1 
ATOM   7150  O  O     . GLU A 1  918  ? 175.240 261.724 186.374 1.00 111.47 ?  918  GLU A O     1 
ATOM   7151  C  CB    . GLU A 1  918  ? 172.735 261.922 184.592 1.00 112.81 ?  918  GLU A CB    1 
ATOM   7152  C  CG    . GLU A 1  918  ? 172.056 260.596 184.267 1.00 123.76 ?  918  GLU A CG    1 
ATOM   7153  C  CD    . GLU A 1  918  ? 170.653 260.368 184.804 1.00 152.44 ?  918  GLU A CD    1 
ATOM   7154  O  OE1   . GLU A 1  918  ? 170.483 260.353 186.045 1.00 148.76 ?  918  GLU A OE1   1 
ATOM   7155  O  OE2   . GLU A 1  918  ? 169.739 260.118 183.983 1.00 149.86 -1 918  GLU A OE2   1 
ATOM   7156  N  N     . ILE A 1  919  ? 175.813 260.223 184.795 1.00 107.01 ?  919  ILE A N     1 
ATOM   7157  C  CA    . ILE A 1  919  ? 176.669 259.438 185.668 1.00 106.15 ?  919  ILE A CA    1 
ATOM   7158  C  C     . ILE A 1  919  ? 178.076 260.034 185.919 1.00 108.90 ?  919  ILE A C     1 
ATOM   7159  O  O     . ILE A 1  919  ? 178.665 259.791 186.982 1.00 108.03 ?  919  ILE A O     1 
ATOM   7160  C  CB    . ILE A 1  919  ? 176.628 257.932 185.245 1.00 108.50 ?  919  ILE A CB    1 
ATOM   7161  C  CG1   . ILE A 1  919  ? 176.167 257.027 186.379 1.00 108.34 ?  919  ILE A CG1   1 
ATOM   7162  C  CG2   . ILE A 1  919  ? 177.888 257.404 184.552 1.00 109.51 ?  919  ILE A CG2   1 
ATOM   7163  C  CD1   . ILE A 1  919  ? 174.648 256.818 186.434 1.00 119.20 ?  919  ILE A CD1   1 
ATOM   7164  N  N     . LEU A 1  920  ? 178.602 260.812 184.949 1.00 104.79 ?  920  LEU A N     1 
ATOM   7165  C  CA    . LEU A 1  920  ? 179.926 261.440 185.017 1.00 104.49 ?  920  LEU A CA    1 
ATOM   7166  C  C     . LEU A 1  920  ? 180.111 262.280 186.261 1.00 109.70 ?  920  LEU A C     1 
ATOM   7167  O  O     . LEU A 1  920  ? 179.298 263.152 186.552 1.00 109.29 ?  920  LEU A O     1 
ATOM   7168  C  CB    . LEU A 1  920  ? 180.150 262.340 183.803 1.00 105.25 ?  920  LEU A CB    1 
ATOM   7169  C  CG    . LEU A 1  920  ? 181.418 262.134 183.007 1.00 108.78 ?  920  LEU A CG    1 
ATOM   7170  C  CD1   . LEU A 1  920  ? 181.473 263.115 181.874 1.00 110.05 ?  920  LEU A CD1   1 
ATOM   7171  C  CD2   . LEU A 1  920  ? 182.655 262.313 183.844 1.00 110.53 ?  920  LEU A CD2   1 
ATOM   7172  N  N     . GLY A 1  921  ? 181.188 262.013 186.976 1.00 108.02 ?  921  GLY A N     1 
ATOM   7173  C  CA    . GLY A 1  921  ? 181.551 262.744 188.184 1.00 109.58 ?  921  GLY A CA    1 
ATOM   7174  C  C     . GLY A 1  921  ? 180.761 262.416 189.436 1.00 114.97 ?  921  GLY A C     1 
ATOM   7175  O  O     . GLY A 1  921  ? 180.896 263.132 190.432 1.00 115.66 ?  921  GLY A O     1 
ATOM   7176  N  N     . ASP A 1  922  ? 179.945 261.332 189.427 1.00 110.98 ?  922  ASP A N     1 
ATOM   7177  C  CA    . ASP A 1  922  ? 179.168 260.981 190.617 1.00 110.25 ?  922  ASP A CA    1 
ATOM   7178  C  C     . ASP A 1  922  ? 180.073 260.338 191.651 1.00 112.38 ?  922  ASP A C     1 
ATOM   7179  O  O     . ASP A 1  922  ? 180.391 259.152 191.543 1.00 111.34 ?  922  ASP A O     1 
ATOM   7180  C  CB    . ASP A 1  922  ? 177.956 260.101 190.282 1.00 111.08 ?  922  ASP A CB    1 
ATOM   7181  C  CG    . ASP A 1  922  ? 176.864 260.093 191.344 1.00 124.46 ?  922  ASP A CG    1 
ATOM   7182  O  OD1   . ASP A 1  922  ? 177.202 260.022 192.552 1.00 125.35 ?  922  ASP A OD1   1 
ATOM   7183  O  OD2   . ASP A 1  922  ? 175.670 260.083 190.967 1.00 131.50 -1 922  ASP A OD2   1 
ATOM   7184  N  N     . LEU A 1  923  ? 180.505 261.138 192.642 1.00 108.02 ?  923  LEU A N     1 
ATOM   7185  C  CA    . LEU A 1  923  ? 181.401 260.701 193.714 1.00 106.63 ?  923  LEU A CA    1 
ATOM   7186  C  C     . LEU A 1  923  ? 180.807 259.551 194.528 1.00 107.86 ?  923  LEU A C     1 
ATOM   7187  O  O     . LEU A 1  923  ? 181.510 258.579 194.800 1.00 106.22 ?  923  LEU A O     1 
ATOM   7188  C  CB    . LEU A 1  923  ? 181.776 261.874 194.626 1.00 108.23 ?  923  LEU A CB    1 
ATOM   7189  C  CG    . LEU A 1  923  ? 182.563 263.009 193.972 1.00 114.49 ?  923  LEU A CG    1 
ATOM   7190  C  CD1   . LEU A 1  923  ? 181.651 264.169 193.611 1.00 116.53 ?  923  LEU A CD1   1 
ATOM   7191  C  CD2   . LEU A 1  923  ? 183.648 263.511 194.887 1.00 117.02 ?  923  LEU A CD2   1 
ATOM   7192  N  N     . LYS A 1  924  ? 179.497 259.645 194.859 1.00 103.28 ?  924  LYS A N     1 
ATOM   7193  C  CA    . LYS A 1  924  ? 178.734 258.645 195.616 1.00 100.71 ?  924  LYS A CA    1 
ATOM   7194  C  C     . LYS A 1  924  ? 178.732 257.304 194.894 1.00 101.23 ?  924  LYS A C     1 
ATOM   7195  O  O     . LYS A 1  924  ? 178.968 256.268 195.530 1.00 99.27  ?  924  LYS A O     1 
ATOM   7196  C  CB    . LYS A 1  924  ? 177.293 259.130 195.861 1.00 103.15 ?  924  LYS A CB    1 
ATOM   7197  C  CG    . LYS A 1  924  ? 177.141 260.081 197.052 1.00 111.64 ?  924  LYS A CG    1 
ATOM   7198  C  CD    . LYS A 1  924  ? 175.688 260.492 197.302 1.00 119.43 ?  924  LYS A CD    1 
ATOM   7199  C  CE    . LYS A 1  924  ? 175.279 261.729 196.530 1.00 142.10 ?  924  LYS A CE    1 
ATOM   7200  N  NZ    . LYS A 1  924  ? 173.919 262.209 196.909 1.00 155.63 1  924  LYS A NZ    1 
ATOM   7201  N  N     . LEU A 1  925  ? 178.488 257.331 193.561 1.00 97.05  ?  925  LEU A N     1 
ATOM   7202  C  CA    . LEU A 1  925  ? 178.472 256.144 192.699 1.00 95.04  ?  925  LEU A CA    1 
ATOM   7203  C  C     . LEU A 1  925  ? 179.856 255.580 192.538 1.00 97.79  ?  925  LEU A C     1 
ATOM   7204  O  O     . LEU A 1  925  ? 180.028 254.364 192.578 1.00 94.70  ?  925  LEU A O     1 
ATOM   7205  C  CB    . LEU A 1  925  ? 177.906 256.473 191.323 1.00 95.32  ?  925  LEU A CB    1 
ATOM   7206  C  CG    . LEU A 1  925  ? 176.435 256.229 191.145 1.00 99.81  ?  925  LEU A CG    1 
ATOM   7207  C  CD1   . LEU A 1  925  ? 175.902 257.038 190.010 1.00 101.51 ?  925  LEU A CD1   1 
ATOM   7208  C  CD2   . LEU A 1  925  ? 176.142 254.769 190.879 1.00 100.21 ?  925  LEU A CD2   1 
ATOM   7209  N  N     . GLN A 1  926  ? 180.851 256.466 192.395 1.00 96.96  ?  926  GLN A N     1 
ATOM   7210  C  CA    . GLN A 1  926  ? 182.238 256.060 192.255 1.00 97.11  ?  926  GLN A CA    1 
ATOM   7211  C  C     . GLN A 1  926  ? 182.734 255.266 193.426 1.00 104.15 ?  926  GLN A C     1 
ATOM   7212  O  O     . GLN A 1  926  ? 183.542 254.363 193.220 1.00 104.20 ?  926  GLN A O     1 
ATOM   7213  C  CB    . GLN A 1  926  ? 183.160 257.227 191.955 1.00 99.25  ?  926  GLN A CB    1 
ATOM   7214  C  CG    . GLN A 1  926  ? 183.630 257.209 190.513 1.00 98.72  ?  926  GLN A CG    1 
ATOM   7215  C  CD    . GLN A 1  926  ? 184.459 256.013 190.139 1.00 110.13 ?  926  GLN A CD    1 
ATOM   7216  O  OE1   . GLN A 1  926  ? 184.267 255.433 189.081 1.00 105.25 ?  926  GLN A OE1   1 
ATOM   7217  N  NE2   . GLN A 1  926  ? 185.379 255.605 190.994 1.00 104.24 ?  926  GLN A NE2   1 
ATOM   7218  N  N     . VAL A 1  927  ? 182.190 255.534 194.638 1.00 101.92 ?  927  VAL A N     1 
ATOM   7219  C  CA    . VAL A 1  927  ? 182.509 254.781 195.857 1.00 101.16 ?  927  VAL A CA    1 
ATOM   7220  C  C     . VAL A 1  927  ? 182.149 253.314 195.625 1.00 102.52 ?  927  VAL A C     1 
ATOM   7221  O  O     . VAL A 1  927  ? 182.916 252.434 196.034 1.00 101.43 ?  927  VAL A O     1 
ATOM   7222  C  CB    . VAL A 1  927  ? 181.790 255.339 197.105 1.00 105.97 ?  927  VAL A CB    1 
ATOM   7223  C  CG1   . VAL A 1  927  ? 182.159 254.545 198.355 1.00 105.06 ?  927  VAL A CG1   1 
ATOM   7224  C  CG2   . VAL A 1  927  ? 182.106 256.814 197.304 1.00 107.94 ?  927  VAL A CG2   1 
ATOM   7225  N  N     . LEU A 1  928  ? 181.010 253.063 194.933 1.00 97.38  ?  928  LEU A N     1 
ATOM   7226  C  CA    . LEU A 1  928  ? 180.557 251.715 194.614 1.00 95.35  ?  928  LEU A CA    1 
ATOM   7227  C  C     . LEU A 1  928  ? 181.412 251.010 193.567 1.00 97.29  ?  928  LEU A C     1 
ATOM   7228  O  O     . LEU A 1  928  ? 181.665 249.811 193.715 1.00 95.52  ?  928  LEU A O     1 
ATOM   7229  C  CB    . LEU A 1  928  ? 179.064 251.672 194.258 1.00 95.25  ?  928  LEU A CB    1 
ATOM   7230  C  CG    . LEU A 1  928  ? 178.112 251.526 195.449 1.00 100.28 ?  928  LEU A CG    1 
ATOM   7231  C  CD1   . LEU A 1  928  ? 176.674 251.774 195.045 1.00 100.05 ?  928  LEU A CD1   1 
ATOM   7232  C  CD2   . LEU A 1  928  ? 178.224 250.143 196.088 1.00 103.36 ?  928  LEU A CD2   1 
ATOM   7233  N  N     . LEU A 1  929  ? 181.883 251.740 192.532 1.00 94.02  ?  929  LEU A N     1 
ATOM   7234  C  CA    . LEU A 1  929  ? 182.743 251.153 191.493 1.00 93.45  ?  929  LEU A CA    1 
ATOM   7235  C  C     . LEU A 1  929  ? 184.168 250.865 192.021 1.00 99.94  ?  929  LEU A C     1 
ATOM   7236  O  O     . LEU A 1  929  ? 184.890 250.009 191.473 1.00 98.36  ?  929  LEU A O     1 
ATOM   7237  C  CB    . LEU A 1  929  ? 182.801 252.033 190.226 1.00 93.90  ?  929  LEU A CB    1 
ATOM   7238  C  CG    . LEU A 1  929  ? 181.635 251.998 189.212 1.00 96.37  ?  929  LEU A CG    1 
ATOM   7239  C  CD1   . LEU A 1  929  ? 181.036 250.630 189.046 1.00 93.40  ?  929  LEU A CD1   1 
ATOM   7240  C  CD2   . LEU A 1  929  ? 180.612 253.002 189.546 1.00 99.72  ?  929  LEU A CD2   1 
ATOM   7241  N  N     . ASP A 1  930  ? 184.560 251.602 193.087 1.00 98.94  ?  930  ASP A N     1 
ATOM   7242  C  CA    . ASP A 1  930  ? 185.834 251.450 193.780 1.00 99.00  ?  930  ASP A CA    1 
ATOM   7243  C  C     . ASP A 1  930  ? 185.775 250.156 194.551 1.00 100.98 ?  930  ASP A C     1 
ATOM   7244  O  O     . ASP A 1  930  ? 186.640 249.328 194.339 1.00 99.64  ?  930  ASP A O     1 
ATOM   7245  C  CB    . ASP A 1  930  ? 186.153 252.671 194.659 1.00 102.63 ?  930  ASP A CB    1 
ATOM   7246  C  CG    . ASP A 1  930  ? 186.601 253.895 193.857 1.00 118.04 ?  930  ASP A CG    1 
ATOM   7247  O  OD1   . ASP A 1  930  ? 187.060 253.715 192.699 1.00 118.88 ?  930  ASP A OD1   1 
ATOM   7248  O  OD2   . ASP A 1  930  ? 186.491 255.037 194.387 1.00 125.24 -1 930  ASP A OD2   1 
ATOM   7249  N  N     . GLU A 1  931  ? 184.691 249.911 195.311 1.00 97.91  ?  931  GLU A N     1 
ATOM   7250  C  CA    . GLU A 1  931  ? 184.472 248.643 196.009 1.00 97.31  ?  931  GLU A CA    1 
ATOM   7251  C  C     . GLU A 1  931  ? 184.591 247.532 194.980 1.00 98.76  ?  931  GLU A C     1 
ATOM   7252  O  O     . GLU A 1  931  ? 185.421 246.637 195.167 1.00 96.87  ?  931  GLU A O     1 
ATOM   7253  C  CB    . GLU A 1  931  ? 183.050 248.559 196.580 1.00 99.42  ?  931  GLU A CB    1 
ATOM   7254  C  CG    . GLU A 1  931  ? 182.710 249.464 197.755 1.00 122.93 ?  931  GLU A CG    1 
ATOM   7255  C  CD    . GLU A 1  931  ? 181.225 249.498 198.101 1.00 156.83 ?  931  GLU A CD    1 
ATOM   7256  O  OE1   . GLU A 1  931  ? 180.538 248.458 197.941 1.00 147.65 ?  931  GLU A OE1   1 
ATOM   7257  O  OE2   . GLU A 1  931  ? 180.744 250.581 198.514 1.00 156.77 -1 931  GLU A OE2   1 
ATOM   7258  N  N     . GLU A 1  932  ? 183.773 247.613 193.873 1.00 95.38  ?  932  GLU A N     1 
ATOM   7259  C  CA    . GLU A 1  932  ? 183.734 246.632 192.774 1.00 94.16  ?  932  GLU A CA    1 
ATOM   7260  C  C     . GLU A 1  932  ? 185.139 246.297 192.311 1.00 98.52  ?  932  GLU A C     1 
ATOM   7261  O  O     . GLU A 1  932  ? 185.538 245.142 192.454 1.00 97.54  ?  932  GLU A O     1 
ATOM   7262  C  CB    . GLU A 1  932  ? 182.828 247.064 191.581 1.00 95.72  ?  932  GLU A CB    1 
ATOM   7263  C  CG    . GLU A 1  932  ? 183.112 246.292 190.282 1.00 105.16 ?  932  GLU A CG    1 
ATOM   7264  C  CD    . GLU A 1  932  ? 182.317 246.581 189.017 1.00 115.50 ?  932  GLU A CD    1 
ATOM   7265  O  OE1   . GLU A 1  932  ? 181.071 246.475 189.078 1.00 101.57 ?  932  GLU A OE1   1 
ATOM   7266  O  OE2   . GLU A 1  932  ? 182.940 246.786 187.945 1.00 95.99  -1 932  GLU A OE2   1 
ATOM   7267  N  N     . TYR A 1  933  ? 185.900 247.308 191.812 1.00 95.91  ?  933  TYR A N     1 
ATOM   7268  C  CA    . TYR A 1  933  ? 187.265 247.114 191.319 1.00 95.52  ?  933  TYR A CA    1 
ATOM   7269  C  C     . TYR A 1  933  ? 188.201 246.547 192.392 1.00 96.53  ?  933  TYR A C     1 
ATOM   7270  O  O     . TYR A 1  933  ? 188.934 245.592 192.118 1.00 94.78  ?  933  TYR A O     1 
ATOM   7271  C  CB    . TYR A 1  933  ? 187.824 248.402 190.690 1.00 98.60  ?  933  TYR A CB    1 
ATOM   7272  C  CG    . TYR A 1  933  ? 189.053 248.177 189.831 1.00 101.24 ?  933  TYR A CG    1 
ATOM   7273  C  CD1   . TYR A 1  933  ? 188.941 247.701 188.529 1.00 104.14 ?  933  TYR A CD1   1 
ATOM   7274  C  CD2   . TYR A 1  933  ? 190.325 248.448 190.315 1.00 102.13 ?  933  TYR A CD2   1 
ATOM   7275  C  CE1   . TYR A 1  933  ? 190.072 247.488 187.734 1.00 106.83 ?  933  TYR A CE1   1 
ATOM   7276  C  CE2   . TYR A 1  933  ? 191.460 248.273 189.520 1.00 103.34 ?  933  TYR A CE2   1 
ATOM   7277  C  CZ    . TYR A 1  933  ? 191.329 247.797 188.226 1.00 112.13 ?  933  TYR A CZ    1 
ATOM   7278  O  OH    . TYR A 1  933  ? 192.448 247.619 187.440 1.00 113.37 ?  933  TYR A OH    1 
ATOM   7279  N  N     . LYS A 1  934  ? 188.108 247.075 193.626 1.00 92.47  ?  934  LYS A N     1 
ATOM   7280  C  CA    . LYS A 1  934  ? 188.931 246.634 194.750 1.00 91.57  ?  934  LYS A CA    1 
ATOM   7281  C  C     . LYS A 1  934  ? 188.730 245.172 195.079 1.00 92.18  ?  934  LYS A C     1 
ATOM   7282  O  O     . LYS A 1  934  ? 189.714 244.479 195.368 1.00 91.54  ?  934  LYS A O     1 
ATOM   7283  C  CB    . LYS A 1  934  ? 188.809 247.567 195.966 1.00 95.20  ?  934  LYS A CB    1 
ATOM   7284  C  CG    . LYS A 1  934  ? 189.811 248.734 195.892 1.00 116.44 ?  934  LYS A CG    1 
ATOM   7285  C  CD    . LYS A 1  934  ? 189.183 250.138 196.033 1.00 129.39 ?  934  LYS A CD    1 
ATOM   7286  C  CE    . LYS A 1  934  ? 189.993 251.215 195.332 1.00 137.35 ?  934  LYS A CE    1 
ATOM   7287  N  NZ    . LYS A 1  934  ? 189.532 252.583 195.687 1.00 144.72 1  934  LYS A NZ    1 
ATOM   7288  N  N     . GLN A 1  935  ? 187.476 244.682 194.940 1.00 86.29  ?  935  GLN A N     1 
ATOM   7289  C  CA    . GLN A 1  935  ? 187.155 243.268 195.146 1.00 83.92  ?  935  GLN A CA    1 
ATOM   7290  C  C     . GLN A 1  935  ? 187.754 242.446 194.029 1.00 85.91  ?  935  GLN A C     1 
ATOM   7291  O  O     . GLN A 1  935  ? 188.377 241.429 194.312 1.00 84.61  ?  935  GLN A O     1 
ATOM   7292  C  CB    . GLN A 1  935  ? 185.640 243.015 195.243 1.00 84.12  ?  935  GLN A CB    1 
ATOM   7293  C  CG    . GLN A 1  935  ? 185.265 241.556 195.490 1.00 84.60  ?  935  GLN A CG    1 
ATOM   7294  C  CD    . GLN A 1  935  ? 185.834 241.017 196.776 1.00 107.82 ?  935  GLN A CD    1 
ATOM   7295  O  OE1   . GLN A 1  935  ? 185.527 241.483 197.875 1.00 104.55 ?  935  GLN A OE1   1 
ATOM   7296  N  NE2   . GLN A 1  935  ? 186.699 240.033 196.667 1.00 105.63 ?  935  GLN A NE2   1 
ATOM   7297  N  N     . LEU A 1  936  ? 187.592 242.897 192.769 1.00 82.36  ?  936  LEU A N     1 
ATOM   7298  C  CA    . LEU A 1  936  ? 188.131 242.206 191.598 1.00 81.76  ?  936  LEU A CA    1 
ATOM   7299  C  C     . LEU A 1  936  ? 189.650 242.035 191.719 1.00 87.64  ?  936  LEU A C     1 
ATOM   7300  O  O     . LEU A 1  936  ? 190.171 240.952 191.404 1.00 86.52  ?  936  LEU A O     1 
ATOM   7301  C  CB    . LEU A 1  936  ? 187.752 242.904 190.278 1.00 82.08  ?  936  LEU A CB    1 
ATOM   7302  C  CG    . LEU A 1  936  ? 186.270 243.123 189.993 1.00 86.52  ?  936  LEU A CG    1 
ATOM   7303  C  CD1   . LEU A 1  936  ? 186.085 244.200 188.974 1.00 87.99  ?  936  LEU A CD1   1 
ATOM   7304  C  CD2   . LEU A 1  936  ? 185.586 241.867 189.530 1.00 87.71  ?  936  LEU A CD2   1 
ATOM   7305  N  N     . VAL A 1  937  ? 190.348 243.077 192.242 1.00 85.95  ?  937  VAL A N     1 
ATOM   7306  C  CA    . VAL A 1  937  ? 191.799 243.008 192.449 1.00 86.69  ?  937  VAL A CA    1 
ATOM   7307  C  C     . VAL A 1  937  ? 192.118 242.009 193.551 1.00 91.41  ?  937  VAL A C     1 
ATOM   7308  O  O     . VAL A 1  937  ? 193.012 241.183 193.361 1.00 89.58  ?  937  VAL A O     1 
ATOM   7309  C  CB    . VAL A 1  937  ? 192.484 244.372 192.670 1.00 91.93  ?  937  VAL A CB    1 
ATOM   7310  C  CG1   . VAL A 1  937  ? 193.998 244.217 192.665 1.00 92.06  ?  937  VAL A CG1   1 
ATOM   7311  C  CG2   . VAL A 1  937  ? 192.070 245.367 191.599 1.00 92.65  ?  937  VAL A CG2   1 
ATOM   7312  N  N     . LYS A 1  938  ? 191.338 242.045 194.671 1.00 89.78  ?  938  LYS A N     1 
ATOM   7313  C  CA    . LYS A 1  938  ? 191.460 241.124 195.821 1.00 89.01  ?  938  LYS A CA    1 
ATOM   7314  C  C     . LYS A 1  938  ? 191.430 239.697 195.295 1.00 90.94  ?  938  LYS A C     1 
ATOM   7315  O  O     . LYS A 1  938  ? 192.402 238.955 195.497 1.00 90.39  ?  938  LYS A O     1 
ATOM   7316  C  CB    . LYS A 1  938  ? 190.320 241.353 196.855 1.00 91.28  ?  938  LYS A CB    1 
ATOM   7317  C  CG    . LYS A 1  938  ? 190.547 240.703 198.237 1.00 99.76  ?  938  LYS A CG    1 
ATOM   7318  C  CD    . LYS A 1  938  ? 189.315 240.828 199.168 1.00 105.61 ?  938  LYS A CD    1 
ATOM   7319  C  CE    . LYS A 1  938  ? 189.566 240.318 200.578 1.00 106.99 ?  938  LYS A CE    1 
ATOM   7320  N  NZ    . LYS A 1  938  ? 188.305 240.204 201.367 1.00 114.03 1  938  LYS A NZ    1 
ATOM   7321  N  N     . ASP A 1  939  ? 190.337 239.369 194.549 1.00 85.83  ?  939  ASP A N     1 
ATOM   7322  C  CA    . ASP A 1  939  ? 190.036 238.098 193.897 1.00 83.93  ?  939  ASP A CA    1 
ATOM   7323  C  C     . ASP A 1  939  ? 191.194 237.606 193.053 1.00 87.53  ?  939  ASP A C     1 
ATOM   7324  O  O     . ASP A 1  939  ? 191.556 236.431 193.167 1.00 85.47  ?  939  ASP A O     1 
ATOM   7325  C  CB    . ASP A 1  939  ? 188.787 238.252 193.013 1.00 85.45  ?  939  ASP A CB    1 
ATOM   7326  C  CG    . ASP A 1  939  ? 187.482 238.300 193.779 1.00 94.12  ?  939  ASP A CG    1 
ATOM   7327  O  OD1   . ASP A 1  939  ? 187.504 238.035 195.010 1.00 95.44  ?  939  ASP A OD1   1 
ATOM   7328  O  OD2   . ASP A 1  939  ? 186.425 238.551 193.141 1.00 94.88  -1 939  ASP A OD2   1 
ATOM   7329  N  N     . ARG A 1  940  ? 191.787 238.512 192.219 1.00 85.32  ?  940  ARG A N     1 
ATOM   7330  C  CA    . ARG A 1  940  ? 192.922 238.192 191.341 1.00 84.99  ?  940  ARG A CA    1 
ATOM   7331  C  C     . ARG A 1  940  ? 194.089 237.640 192.121 1.00 87.91  ?  940  ARG A C     1 
ATOM   7332  O  O     . ARG A 1  940  ? 194.596 236.578 191.768 1.00 86.60  ?  940  ARG A O     1 
ATOM   7333  C  CB    . ARG A 1  940  ? 193.358 239.389 190.475 1.00 85.41  ?  940  ARG A CB    1 
ATOM   7334  C  CG    . ARG A 1  940  ? 194.074 238.951 189.200 1.00 90.67  ?  940  ARG A CG    1 
ATOM   7335  C  CD    . ARG A 1  940  ? 194.846 240.071 188.550 1.00 99.23  ?  940  ARG A CD    1 
ATOM   7336  N  NE    . ARG A 1  940  ? 195.064 239.848 187.120 1.00 104.25 ?  940  ARG A NE    1 
ATOM   7337  C  CZ    . ARG A 1  940  ? 196.064 240.383 186.425 1.00 117.77 ?  940  ARG A CZ    1 
ATOM   7338  N  NH1   . ARG A 1  940  ? 196.976 241.132 187.031 1.00 107.67 1  940  ARG A NH1   1 
ATOM   7339  N  NH2   . ARG A 1  940  ? 196.179 240.147 185.128 1.00 102.13 ?  940  ARG A NH2   1 
ATOM   7340  N  N     . LYS A 1  941  ? 194.471 238.329 193.210 1.00 84.98  ?  941  LYS A N     1 
ATOM   7341  C  CA    . LYS A 1  941  ? 195.573 237.910 194.064 1.00 85.07  ?  941  LYS A CA    1 
ATOM   7342  C  C     . LYS A 1  941  ? 195.240 236.558 194.646 1.00 88.17  ?  941  LYS A C     1 
ATOM   7343  O  O     . LYS A 1  941  ? 196.008 235.622 194.424 1.00 89.25  ?  941  LYS A O     1 
ATOM   7344  C  CB    . LYS A 1  941  ? 195.917 238.958 195.140 1.00 89.05  ?  941  LYS A CB    1 
ATOM   7345  C  CG    . LYS A 1  941  ? 195.932 240.429 194.622 1.00 124.50 ?  941  LYS A CG    1 
ATOM   7346  C  CD    . LYS A 1  941  ? 196.818 240.747 193.338 1.00 138.47 ?  941  LYS A CD    1 
ATOM   7347  C  CE    . LYS A 1  941  ? 196.070 241.476 192.220 1.00 134.41 ?  941  LYS A CE    1 
ATOM   7348  N  NZ    . LYS A 1  941  ? 196.929 241.854 191.054 1.00 130.64 1  941  LYS A NZ    1 
ATOM   7349  N  N     . PHE A 1  942  ? 194.042 236.414 195.251 1.00 81.76  ?  942  PHE A N     1 
ATOM   7350  C  CA    . PHE A 1  942  ? 193.571 235.166 195.844 1.00 79.97  ?  942  PHE A CA    1 
ATOM   7351  C  C     . PHE A 1  942  ? 193.648 233.942 194.904 1.00 83.60  ?  942  PHE A C     1 
ATOM   7352  O  O     . PHE A 1  942  ? 194.119 232.871 195.305 1.00 81.94  ?  942  PHE A O     1 
ATOM   7353  C  CB    . PHE A 1  942  ? 192.142 235.340 196.386 1.00 81.48  ?  942  PHE A CB    1 
ATOM   7354  C  CG    . PHE A 1  942  ? 191.505 234.033 196.801 1.00 81.88  ?  942  PHE A CG    1 
ATOM   7355  C  CD1   . PHE A 1  942  ? 191.863 233.416 197.995 1.00 84.75  ?  942  PHE A CD1   1 
ATOM   7356  C  CD2   . PHE A 1  942  ? 190.610 233.379 195.961 1.00 82.29  ?  942  PHE A CD2   1 
ATOM   7357  C  CE1   . PHE A 1  942  ? 191.302 232.194 198.359 1.00 84.11  ?  942  PHE A CE1   1 
ATOM   7358  C  CE2   . PHE A 1  942  ? 190.058 232.156 196.325 1.00 83.43  ?  942  PHE A CE2   1 
ATOM   7359  C  CZ    . PHE A 1  942  ? 190.398 231.578 197.528 1.00 81.43  ?  942  PHE A CZ    1 
ATOM   7360  N  N     . LEU A 1  943  ? 193.128 234.093 193.677 1.00 81.26  ?  943  LEU A N     1 
ATOM   7361  C  CA    . LEU A 1  943  ? 193.097 233.021 192.687 1.00 80.34  ?  943  LEU A CA    1 
ATOM   7362  C  C     . LEU A 1  943  ? 194.492 232.658 192.272 1.00 83.26  ?  943  LEU A C     1 
ATOM   7363  O  O     . LEU A 1  943  ? 194.774 231.490 192.042 1.00 82.21  ?  943  LEU A O     1 
ATOM   7364  C  CB    . LEU A 1  943  ? 192.277 233.422 191.457 1.00 80.95  ?  943  LEU A CB    1 
ATOM   7365  C  CG    . LEU A 1  943  ? 190.785 233.706 191.621 1.00 85.87  ?  943  LEU A CG    1 
ATOM   7366  C  CD1   . LEU A 1  943  ? 190.144 233.934 190.267 1.00 86.21  ?  943  LEU A CD1   1 
ATOM   7367  C  CD2   . LEU A 1  943  ? 190.074 232.583 192.351 1.00 88.12  ?  943  LEU A CD2   1 
ATOM   7368  N  N     . ARG A 1  944  ? 195.379 233.653 192.214 1.00 80.93  ?  944  ARG A N     1 
ATOM   7369  C  CA    . ARG A 1  944  ? 196.781 233.447 191.886 1.00 81.33  ?  944  ARG A CA    1 
ATOM   7370  C  C     . ARG A 1  944  ? 197.495 232.674 193.008 1.00 87.59  ?  944  ARG A C     1 
ATOM   7371  O  O     . ARG A 1  944  ? 198.505 232.005 192.745 1.00 87.84  ?  944  ARG A O     1 
ATOM   7372  C  CB    . ARG A 1  944  ? 197.471 234.773 191.544 1.00 79.29  ?  944  ARG A CB    1 
ATOM   7373  C  CG    . ARG A 1  944  ? 197.152 235.247 190.132 1.00 80.43  ?  944  ARG A CG    1 
ATOM   7374  C  CD    . ARG A 1  944  ? 198.222 236.137 189.549 1.00 83.72  ?  944  ARG A CD    1 
ATOM   7375  N  NE    . ARG A 1  944  ? 197.839 236.674 188.246 1.00 88.71  ?  944  ARG A NE    1 
ATOM   7376  C  CZ    . ARG A 1  944  ? 198.579 237.516 187.534 1.00 110.85 ?  944  ARG A CZ    1 
ATOM   7377  N  NH1   . ARG A 1  944  ? 199.766 237.917 187.986 1.00 102.77 1  944  ARG A NH1   1 
ATOM   7378  N  NH2   . ARG A 1  944  ? 198.146 237.962 186.366 1.00 101.45 ?  944  ARG A NH2   1 
ATOM   7379  N  N     . GLU A 1  945  ? 196.931 232.728 194.242 1.00 84.60  ?  945  GLU A N     1 
ATOM   7380  C  CA    . GLU A 1  945  ? 197.437 231.997 195.403 1.00 84.47  ?  945  GLU A CA    1 
ATOM   7381  C  C     . GLU A 1  945  ? 196.971 230.548 195.309 1.00 86.65  ?  945  GLU A C     1 
ATOM   7382  O  O     . GLU A 1  945  ? 197.765 229.643 195.583 1.00 86.23  ?  945  GLU A O     1 
ATOM   7383  C  CB    . GLU A 1  945  ? 196.971 232.620 196.734 1.00 86.44  ?  945  GLU A CB    1 
ATOM   7384  C  CG    . GLU A 1  945  ? 197.506 234.020 196.997 1.00 105.24 ?  945  GLU A CG    1 
ATOM   7385  C  CD    . GLU A 1  945  ? 197.077 234.704 198.287 1.00 140.68 ?  945  GLU A CD    1 
ATOM   7386  O  OE1   . GLU A 1  945  ? 196.390 234.061 199.118 1.00 149.12 ?  945  GLU A OE1   1 
ATOM   7387  O  OE2   . GLU A 1  945  ? 197.442 235.890 198.468 1.00 132.73 -1 945  GLU A OE2   1 
ATOM   7388  N  N     . VAL A 1  946  ? 195.692 230.321 194.926 1.00 81.31  ?  946  VAL A N     1 
ATOM   7389  C  CA    . VAL A 1  946  ? 195.150 228.969 194.810 1.00 79.85  ?  946  VAL A CA    1 
ATOM   7390  C  C     . VAL A 1  946  ? 195.836 228.246 193.656 1.00 86.87  ?  946  VAL A C     1 
ATOM   7391  O  O     . VAL A 1  946  ? 196.605 227.312 193.891 1.00 88.01  ?  946  VAL A O     1 
ATOM   7392  C  CB    . VAL A 1  946  ? 193.610 228.937 194.694 1.00 82.04  ?  946  VAL A CB    1 
ATOM   7393  C  CG1   . VAL A 1  946  ? 193.090 227.505 194.612 1.00 80.14  ?  946  VAL A CG1   1 
ATOM   7394  C  CG2   . VAL A 1  946  ? 192.966 229.679 195.850 1.00 82.08  ?  946  VAL A CG2   1 
ATOM   7395  N  N     . PHE A 1  947  ? 195.601 228.713 192.427 1.00 84.11  ?  947  PHE A N     1 
ATOM   7396  C  CA    . PHE A 1  947  ? 196.180 228.141 191.218 1.00 83.99  ?  947  PHE A CA    1 
ATOM   7397  C  C     . PHE A 1  947  ? 197.466 228.876 190.936 1.00 90.17  ?  947  PHE A C     1 
ATOM   7398  O  O     . PHE A 1  947  ? 197.461 229.924 190.292 1.00 91.06  ?  947  PHE A O     1 
ATOM   7399  C  CB    . PHE A 1  947  ? 195.182 228.227 190.056 1.00 85.30  ?  947  PHE A CB    1 
ATOM   7400  C  CG    . PHE A 1  947  ? 193.783 227.848 190.479 1.00 85.90  ?  947  PHE A CG    1 
ATOM   7401  C  CD1   . PHE A 1  947  ? 193.461 226.531 190.774 1.00 87.81  ?  947  PHE A CD1   1 
ATOM   7402  C  CD2   . PHE A 1  947  ? 192.812 228.817 190.664 1.00 88.61  ?  947  PHE A CD2   1 
ATOM   7403  C  CE1   . PHE A 1  947  ? 192.167 226.173 191.162 1.00 87.61  ?  947  PHE A CE1   1 
ATOM   7404  C  CE2   . PHE A 1  947  ? 191.528 228.463 191.089 1.00 90.89  ?  947  PHE A CE2   1 
ATOM   7405  C  CZ    . PHE A 1  947  ? 191.213 227.139 191.323 1.00 87.50  ?  947  PHE A CZ    1 
ATOM   7406  N  N     . VAL A 1  948  ? 198.566 228.352 191.501 1.00 87.31  ?  948  VAL A N     1 
ATOM   7407  C  CA    . VAL A 1  948  ? 199.915 228.928 191.430 1.00 88.12  ?  948  VAL A CA    1 
ATOM   7408  C  C     . VAL A 1  948  ? 200.468 229.131 190.015 1.00 93.00  ?  948  VAL A C     1 
ATOM   7409  O  O     . VAL A 1  948  ? 201.089 230.164 189.754 1.00 93.38  ?  948  VAL A O     1 
ATOM   7410  C  CB    . VAL A 1  948  ? 200.916 228.255 192.394 1.00 91.31  ?  948  VAL A CB    1 
ATOM   7411  C  CG1   . VAL A 1  948  ? 201.233 229.178 193.557 1.00 91.65  ?  948  VAL A CG1   1 
ATOM   7412  C  CG2   . VAL A 1  948  ? 200.390 226.909 192.897 1.00 89.98  ?  948  VAL A CG2   1 
ATOM   7413  N  N     . ASP A 1  949  ? 200.195 228.164 189.102 1.00 89.43  ?  949  ASP A N     1 
ATOM   7414  C  CA    . ASP A 1  949  ? 200.606 228.187 187.688 1.00 89.94  ?  949  ASP A CA    1 
ATOM   7415  C  C     . ASP A 1  949  ? 199.883 229.263 186.878 1.00 95.08  ?  949  ASP A C     1 
ATOM   7416  O  O     . ASP A 1  949  ? 200.406 229.718 185.862 1.00 96.11  ?  949  ASP A O     1 
ATOM   7417  C  CB    . ASP A 1  949  ? 200.422 226.812 187.009 1.00 90.98  ?  949  ASP A CB    1 
ATOM   7418  C  CG    . ASP A 1  949  ? 199.397 225.887 187.647 1.00 111.38 ?  949  ASP A CG    1 
ATOM   7419  O  OD1   . ASP A 1  949  ? 198.199 226.280 187.735 1.00 113.62 ?  949  ASP A OD1   1 
ATOM   7420  O  OD2   . ASP A 1  949  ? 199.776 224.764 188.030 1.00 121.51 -1 949  ASP A OD2   1 
ATOM   7421  N  N     . GLY A 1  950  ? 198.694 229.648 187.326 1.00 90.69  ?  950  GLY A N     1 
ATOM   7422  C  CA    . GLY A 1  950  ? 197.881 230.643 186.647 1.00 90.87  ?  950  GLY A CA    1 
ATOM   7423  C  C     . GLY A 1  950  ? 196.849 230.020 185.736 1.00 94.67  ?  950  GLY A C     1 
ATOM   7424  O  O     . GLY A 1  950  ? 196.291 230.705 184.866 1.00 95.07  ?  950  GLY A O     1 
ATOM   7425  N  N     . GLU A 1  951  ? 196.583 228.708 185.944 1.00 89.98  ?  951  GLU A N     1 
ATOM   7426  C  CA    . GLU A 1  951  ? 195.598 227.951 185.177 1.00 88.95  ?  951  GLU A CA    1 
ATOM   7427  C  C     . GLU A 1  951  ? 194.213 228.550 185.426 1.00 93.08  ?  951  GLU A C     1 
ATOM   7428  O  O     . GLU A 1  951  ? 193.787 228.649 186.576 1.00 92.41  ?  951  GLU A O     1 
ATOM   7429  C  CB    . GLU A 1  951  ? 195.669 226.448 185.513 1.00 89.24  ?  951  GLU A CB    1 
ATOM   7430  C  CG    . GLU A 1  951  ? 194.609 225.597 184.834 1.00 100.96 ?  951  GLU A CG    1 
ATOM   7431  C  CD    . GLU A 1  951  ? 194.516 225.725 183.327 1.00 124.96 ?  951  GLU A CD    1 
ATOM   7432  O  OE1   . GLU A 1  951  ? 195.249 224.989 182.627 1.00 132.29 ?  951  GLU A OE1   1 
ATOM   7433  O  OE2   . GLU A 1  951  ? 193.705 226.551 182.846 1.00 111.05 -1 951  GLU A OE2   1 
ATOM   7434  N  N     . ALA A 1  952  ? 193.562 229.034 184.354 1.00 90.60  ?  952  ALA A N     1 
ATOM   7435  C  CA    . ALA A 1  952  ? 192.253 229.706 184.404 1.00 90.59  ?  952  ALA A CA    1 
ATOM   7436  C  C     . ALA A 1  952  ? 191.054 228.782 184.360 1.00 91.92  ?  952  ALA A C     1 
ATOM   7437  O  O     . ALA A 1  952  ? 190.029 229.102 184.970 1.00 90.90  ?  952  ALA A O     1 
ATOM   7438  C  CB    . ALA A 1  952  ? 192.141 230.721 183.272 1.00 92.43  ?  952  ALA A CB    1 
ATOM   7439  N  N     . ASN A 1  953  ? 191.167 227.677 183.592 1.00 86.68  ?  953  ASN A N     1 
ATOM   7440  C  CA    . ASN A 1  953  ? 190.104 226.720 183.348 1.00 85.01  ?  953  ASN A CA    1 
ATOM   7441  C  C     . ASN A 1  953  ? 189.974 225.699 184.445 1.00 87.69  ?  953  ASN A C     1 
ATOM   7442  O  O     . ASN A 1  953  ? 190.884 224.910 184.673 1.00 87.30  ?  953  ASN A O     1 
ATOM   7443  C  CB    . ASN A 1  953  ? 190.271 226.091 181.984 1.00 86.40  ?  953  ASN A CB    1 
ATOM   7444  C  CG    . ASN A 1  953  ? 190.396 227.122 180.896 1.00 113.28 ?  953  ASN A CG    1 
ATOM   7445  O  OD1   . ASN A 1  953  ? 189.468 227.884 180.614 1.00 107.72 ?  953  ASN A OD1   1 
ATOM   7446  N  ND2   . ASN A 1  953  ? 191.573 227.203 180.303 1.00 107.49 ?  953  ASN A ND2   1 
ATOM   7447  N  N     . TRP A 1  954  ? 188.850 225.764 185.166 1.00 83.97  ?  954  TRP A N     1 
ATOM   7448  C  CA    . TRP A 1  954  ? 188.536 224.921 186.320 1.00 82.84  ?  954  TRP A CA    1 
ATOM   7449  C  C     . TRP A 1  954  ? 187.097 224.430 186.299 1.00 87.78  ?  954  TRP A C     1 
ATOM   7450  O  O     . TRP A 1  954  ? 186.211 225.127 185.789 1.00 89.29  ?  954  TRP A O     1 
ATOM   7451  C  CB    . TRP A 1  954  ? 188.851 225.667 187.623 1.00 81.46  ?  954  TRP A CB    1 
ATOM   7452  C  CG    . TRP A 1  954  ? 190.323 225.813 187.780 1.00 82.73  ?  954  TRP A CG    1 
ATOM   7453  C  CD1   . TRP A 1  954  ? 191.090 226.863 187.370 1.00 86.54  ?  954  TRP A CD1   1 
ATOM   7454  C  CD2   . TRP A 1  954  ? 191.230 224.768 188.134 1.00 82.04  ?  954  TRP A CD2   1 
ATOM   7455  N  NE1   . TRP A 1  954  ? 192.421 226.565 187.536 1.00 86.01  ?  954  TRP A NE1   1 
ATOM   7456  C  CE2   . TRP A 1  954  ? 192.535 225.271 187.967 1.00 86.21  ?  954  TRP A CE2   1 
ATOM   7457  C  CE3   . TRP A 1  954  ? 191.063 223.453 188.591 1.00 82.05  ?  954  TRP A CE3   1 
ATOM   7458  C  CZ2   . TRP A 1  954  ? 193.660 224.526 188.289 1.00 85.08  ?  954  TRP A CZ2   1 
ATOM   7459  C  CZ3   . TRP A 1  954  ? 192.179 222.722 188.918 1.00 82.86  ?  954  TRP A CZ3   1 
ATOM   7460  C  CH2   . TRP A 1  954  ? 193.458 223.259 188.769 1.00 84.26  ?  954  TRP A CH2   1 
ATOM   7461  N  N     . PRO A 1  955  ? 186.820 223.233 186.830 1.00 81.62  ?  955  PRO A N     1 
ATOM   7462  C  CA    . PRO A 1  955  ? 185.446 222.754 186.797 1.00 79.45  ?  955  PRO A CA    1 
ATOM   7463  C  C     . PRO A 1  955  ? 184.665 223.369 187.938 1.00 81.63  ?  955  PRO A C     1 
ATOM   7464  O  O     . PRO A 1  955  ? 185.026 223.201 189.112 1.00 82.01  ?  955  PRO A O     1 
ATOM   7465  C  CB    . PRO A 1  955  ? 185.596 221.237 186.861 1.00 80.48  ?  955  PRO A CB    1 
ATOM   7466  C  CG    . PRO A 1  955  ? 186.900 220.997 187.492 1.00 86.54  ?  955  PRO A CG    1 
ATOM   7467  C  CD    . PRO A 1  955  ? 187.705 222.273 187.513 1.00 83.28  ?  955  PRO A CD    1 
ATOM   7468  N  N     . LEU A 1  956  ? 183.652 224.169 187.580 1.00 75.97  ?  956  LEU A N     1 
ATOM   7469  C  CA    . LEU A 1  956  ? 182.800 224.861 188.546 1.00 74.97  ?  956  LEU A CA    1 
ATOM   7470  C  C     . LEU A 1  956  ? 181.326 224.691 188.177 1.00 76.69  ?  956  LEU A C     1 
ATOM   7471  O  O     . LEU A 1  956  ? 181.048 224.562 186.986 1.00 76.38  ?  956  LEU A O     1 
ATOM   7472  C  CB    . LEU A 1  956  ? 183.159 226.360 188.573 1.00 75.91  ?  956  LEU A CB    1 
ATOM   7473  C  CG    . LEU A 1  956  ? 184.496 226.711 189.223 1.00 80.76  ?  956  LEU A CG    1 
ATOM   7474  C  CD1   . LEU A 1  956  ? 185.328 227.574 188.323 1.00 81.77  ?  956  LEU A CD1   1 
ATOM   7475  C  CD2   . LEU A 1  956  ? 184.306 227.384 190.544 1.00 82.53  ?  956  LEU A CD2   1 
ATOM   7476  N  N     . PRO A 1  957  ? 180.356 224.753 189.143 1.00 71.33  ?  957  PRO A N     1 
ATOM   7477  C  CA    . PRO A 1  957  ? 178.930 224.690 188.760 1.00 69.83  ?  957  PRO A CA    1 
ATOM   7478  C  C     . PRO A 1  957  ? 178.478 225.935 187.986 1.00 72.17  ?  957  PRO A C     1 
ATOM   7479  O  O     . PRO A 1  957  ? 179.240 226.891 187.896 1.00 72.18  ?  957  PRO A O     1 
ATOM   7480  C  CB    . PRO A 1  957  ? 178.208 224.569 190.107 1.00 71.03  ?  957  PRO A CB    1 
ATOM   7481  C  CG    . PRO A 1  957  ? 179.100 225.185 191.072 1.00 76.26  ?  957  PRO A CG    1 
ATOM   7482  C  CD    . PRO A 1  957  ? 180.502 224.934 190.604 1.00 72.59  ?  957  PRO A CD    1 
ATOM   7483  N  N     . VAL A 1  958  ? 177.267 225.913 187.405 1.00 68.59  ?  958  VAL A N     1 
ATOM   7484  C  CA    . VAL A 1  958  ? 176.673 227.037 186.646 1.00 69.61  ?  958  VAL A CA    1 
ATOM   7485  C  C     . VAL A 1  958  ? 177.505 227.589 185.480 1.00 75.89  ?  958  VAL A C     1 
ATOM   7486  O  O     . VAL A 1  958  ? 178.353 228.457 185.709 1.00 74.91  ?  958  VAL A O     1 
ATOM   7487  C  CB    . VAL A 1  958  ? 176.155 228.188 187.551 1.00 73.30  ?  958  VAL A CB    1 
ATOM   7488  C  CG1   . VAL A 1  958  ? 175.336 229.198 186.759 1.00 73.33  ?  958  VAL A CG1   1 
ATOM   7489  C  CG2   . VAL A 1  958  ? 175.341 227.640 188.701 1.00 72.54  ?  958  VAL A CG2   1 
ATOM   7490  N  N     . ASN A 1  959  ? 177.206 227.151 184.221 1.00 74.44  ?  959  ASN A N     1 
ATOM   7491  C  CA    . ASN A 1  959  ? 177.911 227.723 183.077 1.00 75.21  ?  959  ASN A CA    1 
ATOM   7492  C  C     . ASN A 1  959  ? 177.308 229.099 182.819 1.00 81.94  ?  959  ASN A C     1 
ATOM   7493  O  O     . ASN A 1  959  ? 176.217 229.236 182.234 1.00 81.25  ?  959  ASN A O     1 
ATOM   7494  C  CB    . ASN A 1  959  ? 177.902 226.849 181.832 1.00 72.44  ?  959  ASN A CB    1 
ATOM   7495  C  CG    . ASN A 1  959  ? 178.944 227.266 180.805 1.00 96.59  ?  959  ASN A CG    1 
ATOM   7496  O  OD1   . ASN A 1  959  ? 179.283 228.442 180.631 1.00 87.79  ?  959  ASN A OD1   1 
ATOM   7497  N  ND2   . ASN A 1  959  ? 179.469 226.304 180.079 1.00 95.46  ?  959  ASN A ND2   1 
ATOM   7498  N  N     . ILE A 1  960  ? 178.013 230.112 183.350 1.00 79.64  ?  960  ILE A N     1 
ATOM   7499  C  CA    . ILE A 1  960  ? 177.620 231.501 183.248 1.00 80.40  ?  960  ILE A CA    1 
ATOM   7500  C  C     . ILE A 1  960  ? 177.703 231.948 181.793 1.00 86.70  ?  960  ILE A C     1 
ATOM   7501  O  O     . ILE A 1  960  ? 176.774 232.621 181.333 1.00 86.91  ?  960  ILE A O     1 
ATOM   7502  C  CB    . ILE A 1  960  ? 178.404 232.368 184.266 1.00 83.74  ?  960  ILE A CB    1 
ATOM   7503  C  CG1   . ILE A 1  960  ? 177.869 232.110 185.691 1.00 83.84  ?  960  ILE A CG1   1 
ATOM   7504  C  CG2   . ILE A 1  960  ? 178.326 233.859 183.935 1.00 85.36  ?  960  ILE A CG2   1 
ATOM   7505  C  CD1   . ILE A 1  960  ? 178.904 232.176 186.820 1.00 93.04  ?  960  ILE A CD1   1 
ATOM   7506  N  N     . ARG A 1  961  ? 178.761 231.499 181.046 1.00 84.02  ?  961  ARG A N     1 
ATOM   7507  C  CA    . ARG A 1  961  ? 178.943 231.834 179.623 1.00 84.57  ?  961  ARG A CA    1 
ATOM   7508  C  C     . ARG A 1  961  ? 177.671 231.557 178.850 1.00 87.03  ?  961  ARG A C     1 
ATOM   7509  O  O     . ARG A 1  961  ? 177.171 232.458 178.164 1.00 87.47  ?  961  ARG A O     1 
ATOM   7510  C  CB    . ARG A 1  961  ? 180.129 231.081 178.996 1.00 87.24  ?  961  ARG A CB    1 
ATOM   7511  C  CG    . ARG A 1  961  ? 180.378 231.407 177.508 1.00 105.02 ?  961  ARG A CG    1 
ATOM   7512  C  CD    . ARG A 1  961  ? 181.490 230.557 176.890 1.00 122.88 ?  961  ARG A CD    1 
ATOM   7513  N  NE    . ARG A 1  961  ? 181.561 230.694 175.431 1.00 138.84 ?  961  ARG A NE    1 
ATOM   7514  C  CZ    . ARG A 1  961  ? 182.197 231.672 174.791 1.00 161.33 ?  961  ARG A CZ    1 
ATOM   7515  N  NH1   . ARG A 1  961  ? 182.830 232.622 175.472 1.00 148.27 1  961  ARG A NH1   1 
ATOM   7516  N  NH2   . ARG A 1  961  ? 182.196 231.713 173.465 1.00 155.29 ?  961  ARG A NH2   1 
ATOM   7517  N  N     . ARG A 1  962  ? 177.118 230.337 179.015 1.00 81.73  ?  962  ARG A N     1 
ATOM   7518  C  CA    . ARG A 1  962  ? 175.878 229.927 178.356 1.00 80.78  ?  962  ARG A CA    1 
ATOM   7519  C  C     . ARG A 1  962  ? 174.656 230.741 178.757 1.00 83.21  ?  962  ARG A C     1 
ATOM   7520  O  O     . ARG A 1  962  ? 173.873 231.081 177.868 1.00 83.46  ?  962  ARG A O     1 
ATOM   7521  C  CB    . ARG A 1  962  ? 175.614 228.437 178.496 1.00 78.41  ?  962  ARG A CB    1 
ATOM   7522  C  CG    . ARG A 1  962  ? 175.731 227.729 177.168 1.00 82.53  ?  962  ARG A CG    1 
ATOM   7523  C  CD    . ARG A 1  962  ? 175.275 226.298 177.274 1.00 86.41  ?  962  ARG A CD    1 
ATOM   7524  N  NE    . ARG A 1  962  ? 176.155 225.501 178.129 1.00 85.09  ?  962  ARG A NE    1 
ATOM   7525  C  CZ    . ARG A 1  962  ? 175.763 224.887 179.240 1.00 93.86  ?  962  ARG A CZ    1 
ATOM   7526  N  NH1   . ARG A 1  962  ? 174.499 224.963 179.641 1.00 81.94  1  962  ARG A NH1   1 
ATOM   7527  N  NH2   . ARG A 1  962  ? 176.626 224.189 179.953 1.00 73.51  ?  962  ARG A NH2   1 
ATOM   7528  N  N     . ILE A 1  963  ? 174.503 231.082 180.067 1.00 77.28  ?  963  ILE A N     1 
ATOM   7529  C  CA    . ILE A 1  963  ? 173.367 231.894 180.520 1.00 76.51  ?  963  ILE A CA    1 
ATOM   7530  C  C     . ILE A 1  963  ? 173.361 233.213 179.751 1.00 82.33  ?  963  ILE A C     1 
ATOM   7531  O  O     . ILE A 1  963  ? 172.326 233.559 179.176 1.00 82.81  ?  963  ILE A O     1 
ATOM   7532  C  CB    . ILE A 1  963  ? 173.238 232.083 182.065 1.00 78.64  ?  963  ILE A CB    1 
ATOM   7533  C  CG1   . ILE A 1  963  ? 173.411 230.755 182.837 1.00 77.11  ?  963  ILE A CG1   1 
ATOM   7534  C  CG2   . ILE A 1  963  ? 171.899 232.759 182.425 1.00 79.31  ?  963  ILE A CG2   1 
ATOM   7535  C  CD1   . ILE A 1  963  ? 173.221 230.845 184.347 1.00 74.63  ?  963  ILE A CD1   1 
ATOM   7536  N  N     . ILE A 1  964  ? 174.522 233.897 179.663 1.00 79.76  ?  964  ILE A N     1 
ATOM   7537  C  CA    . ILE A 1  964  ? 174.629 235.148 178.907 1.00 81.21  ?  964  ILE A CA    1 
ATOM   7538  C  C     . ILE A 1  964  ? 174.213 234.951 177.449 1.00 84.35  ?  964  ILE A C     1 
ATOM   7539  O  O     . ILE A 1  964  ? 173.350 235.690 176.959 1.00 84.72  ?  964  ILE A O     1 
ATOM   7540  C  CB    . ILE A 1  964  ? 176.006 235.844 179.090 1.00 85.49  ?  964  ILE A CB    1 
ATOM   7541  C  CG1   . ILE A 1  964  ? 175.996 236.729 180.348 1.00 86.75  ?  964  ILE A CG1   1 
ATOM   7542  C  CG2   . ILE A 1  964  ? 176.424 236.673 177.866 1.00 87.35  ?  964  ILE A CG2   1 
ATOM   7543  C  CD1   . ILE A 1  964  ? 176.495 236.040 181.583 1.00 97.28  ?  964  ILE A CD1   1 
ATOM   7544  N  N     . GLN A 1  965  ? 174.765 233.908 176.793 1.00 78.73  ?  965  GLN A N     1 
ATOM   7545  C  CA    . GLN A 1  965  ? 174.447 233.570 175.403 1.00 78.03  ?  965  GLN A CA    1 
ATOM   7546  C  C     . GLN A 1  965  ? 172.935 233.487 175.200 1.00 79.61  ?  965  GLN A C     1 
ATOM   7547  O  O     . GLN A 1  965  ? 172.396 234.120 174.283 1.00 77.93  ?  965  GLN A O     1 
ATOM   7548  C  CB    . GLN A 1  965  ? 175.128 232.252 174.994 1.00 78.61  ?  965  GLN A CB    1 
ATOM   7549  C  CG    . GLN A 1  965  ? 176.650 232.355 174.969 1.00 99.13  ?  965  GLN A CG    1 
ATOM   7550  C  CD    . GLN A 1  965  ? 177.348 231.128 174.441 1.00 117.68 ?  965  GLN A CD    1 
ATOM   7551  O  OE1   . GLN A 1  965  ? 176.930 229.980 174.672 1.00 111.21 ?  965  GLN A OE1   1 
ATOM   7552  N  NE2   . GLN A 1  965  ? 178.468 231.351 173.752 1.00 109.81 ?  965  GLN A NE2   1 
ATOM   7553  N  N     . ASN A 1  966  ? 172.257 232.755 176.112 1.00 76.52  ?  966  ASN A N     1 
ATOM   7554  C  CA    . ASN A 1  966  ? 170.812 232.552 176.094 1.00 76.93  ?  966  ASN A CA    1 
ATOM   7555  C  C     . ASN A 1  966  ? 170.089 233.849 176.301 1.00 81.97  ?  966  ASN A C     1 
ATOM   7556  O  O     . ASN A 1  966  ? 169.222 234.151 175.489 1.00 82.56  ?  966  ASN A O     1 
ATOM   7557  C  CB    . ASN A 1  966  ? 170.345 231.492 177.097 1.00 79.72  ?  966  ASN A CB    1 
ATOM   7558  C  CG    . ASN A 1  966  ? 171.022 230.130 177.015 1.00 109.23 ?  966  ASN A CG    1 
ATOM   7559  O  OD1   . ASN A 1  966  ? 171.697 229.760 176.025 1.00 98.81  ?  966  ASN A OD1   1 
ATOM   7560  N  ND2   . ASN A 1  966  ? 170.863 229.360 178.100 1.00 102.27 ?  966  ASN A ND2   1 
ATOM   7561  N  N     . ALA A 1  967  ? 170.501 234.669 177.309 1.00 78.20  ?  967  ALA A N     1 
ATOM   7562  C  CA    . ALA A 1  967  ? 169.891 235.986 177.567 1.00 78.46  ?  967  ALA A CA    1 
ATOM   7563  C  C     . ALA A 1  967  ? 169.884 236.801 176.300 1.00 83.38  ?  967  ALA A C     1 
ATOM   7564  O  O     . ALA A 1  967  ? 168.850 237.348 175.924 1.00 81.80  ?  967  ALA A O     1 
ATOM   7565  C  CB    . ALA A 1  967  ? 170.648 236.717 178.651 1.00 79.34  ?  967  ALA A CB    1 
ATOM   7566  N  N     . GLN A 1  968  ? 171.021 236.769 175.583 1.00 83.08  ?  968  GLN A N     1 
ATOM   7567  C  CA    . GLN A 1  968  ? 171.204 237.434 174.303 1.00 85.31  ?  968  GLN A CA    1 
ATOM   7568  C  C     . GLN A 1  968  ? 170.186 236.940 173.247 1.00 92.56  ?  968  GLN A C     1 
ATOM   7569  O  O     . GLN A 1  968  ? 169.449 237.792 172.743 1.00 93.95  ?  968  GLN A O     1 
ATOM   7570  C  CB    . GLN A 1  968  ? 172.677 237.424 173.855 1.00 86.58  ?  968  GLN A CB    1 
ATOM   7571  C  CG    . GLN A 1  968  ? 173.564 238.172 174.844 1.00 96.55  ?  968  GLN A CG    1 
ATOM   7572  C  CD    . GLN A 1  968  ? 175.010 238.177 174.460 1.00 123.10 ?  968  GLN A CD    1 
ATOM   7573  O  OE1   . GLN A 1  968  ? 175.708 237.168 174.576 1.00 119.12 ?  968  GLN A OE1   1 
ATOM   7574  N  NE2   . GLN A 1  968  ? 175.505 239.332 174.043 1.00 121.17 ?  968  GLN A NE2   1 
ATOM   7575  N  N     . GLN A 1  969  ? 170.043 235.603 172.980 1.00 89.02  ?  969  GLN A N     1 
ATOM   7576  C  CA    . GLN A 1  969  ? 168.975 235.239 172.026 1.00 89.75  ?  969  GLN A CA    1 
ATOM   7577  C  C     . GLN A 1  969  ? 167.554 235.369 172.605 1.00 93.76  ?  969  GLN A C     1 
ATOM   7578  O  O     . GLN A 1  969  ? 166.705 235.946 171.932 1.00 94.68  ?  969  GLN A O     1 
ATOM   7579  C  CB    . GLN A 1  969  ? 169.218 234.006 171.094 1.00 90.62  ?  969  GLN A CB    1 
ATOM   7580  C  CG    . GLN A 1  969  ? 169.287 232.616 171.744 1.00 116.84 ?  969  GLN A CG    1 
ATOM   7581  C  CD    . GLN A 1  969  ? 170.167 231.652 170.947 1.00 141.09 ?  969  GLN A CD    1 
ATOM   7582  O  OE1   . GLN A 1  969  ? 170.293 231.785 169.717 1.00 142.24 ?  969  GLN A OE1   1 
ATOM   7583  N  NE2   . GLN A 1  969  ? 170.817 230.666 171.622 1.00 118.10 ?  969  GLN A NE2   1 
ATOM   7584  N  N     . THR A 1  970  ? 167.339 234.974 173.883 1.00 88.55  ?  970  THR A N     1 
ATOM   7585  C  CA    . THR A 1  970  ? 166.048 235.060 174.584 1.00 88.11  ?  970  THR A CA    1 
ATOM   7586  C  C     . THR A 1  970  ? 165.474 236.458 174.505 1.00 93.69  ?  970  THR A C     1 
ATOM   7587  O  O     . THR A 1  970  ? 164.296 236.612 174.184 1.00 92.62  ?  970  THR A O     1 
ATOM   7588  C  CB    . THR A 1  970  ? 166.192 234.599 176.051 1.00 98.25  ?  970  THR A CB    1 
ATOM   7589  O  OG1   . THR A 1  970  ? 166.615 233.230 176.091 1.00 103.35 ?  970  THR A OG1   1 
ATOM   7590  C  CG2   . THR A 1  970  ? 164.919 234.772 176.863 1.00 94.40  ?  970  THR A CG2   1 
ATOM   7591  N  N     . PHE A 1  971  ? 166.321 237.471 174.762 1.00 93.36  ?  971  PHE A N     1 
ATOM   7592  C  CA    . PHE A 1  971  ? 165.922 238.870 174.787 1.00 95.85  ?  971  PHE A CA    1 
ATOM   7593  C  C     . PHE A 1  971  ? 166.259 239.685 173.552 1.00 108.32 ?  971  PHE A C     1 
ATOM   7594  O  O     . PHE A 1  971  ? 165.997 240.890 173.533 1.00 109.52 ?  971  PHE A O     1 
ATOM   7595  C  CB    . PHE A 1  971  ? 166.405 239.543 176.070 1.00 97.07  ?  971  PHE A CB    1 
ATOM   7596  C  CG    . PHE A 1  971  ? 165.861 238.899 177.320 1.00 97.07  ?  971  PHE A CG    1 
ATOM   7597  C  CD1   . PHE A 1  971  ? 164.602 239.229 177.799 1.00 99.56  ?  971  PHE A CD1   1 
ATOM   7598  C  CD2   . PHE A 1  971  ? 166.612 237.964 178.024 1.00 98.19  ?  971  PHE A CD2   1 
ATOM   7599  C  CE1   . PHE A 1  971  ? 164.107 238.643 178.965 1.00 99.76  ?  971  PHE A CE1   1 
ATOM   7600  C  CE2   . PHE A 1  971  ? 166.110 237.367 179.182 1.00 99.85  ?  971  PHE A CE2   1 
ATOM   7601  C  CZ    . PHE A 1  971  ? 164.862 237.713 179.647 1.00 97.97  ?  971  PHE A CZ    1 
ATOM   7602  N  N     . HIS A 1  972  ? 166.783 239.030 172.497 1.00 110.55 ?  972  HIS A N     1 
ATOM   7603  C  CA    . HIS A 1  972  ? 167.129 239.667 171.216 1.00 114.54 ?  972  HIS A CA    1 
ATOM   7604  C  C     . HIS A 1  972  ? 167.867 240.979 171.455 1.00 119.71 ?  972  HIS A C     1 
ATOM   7605  O  O     . HIS A 1  972  ? 167.407 242.064 171.085 1.00 119.79 ?  972  HIS A O     1 
ATOM   7606  C  CB    . HIS A 1  972  ? 165.893 239.805 170.307 1.00 117.86 ?  972  HIS A CB    1 
ATOM   7607  C  CG    . HIS A 1  972  ? 165.093 238.536 170.224 1.00 121.97 ?  972  HIS A CG    1 
ATOM   7608  N  ND1   . HIS A 1  972  ? 165.559 237.430 169.520 1.00 123.88 ?  972  HIS A ND1   1 
ATOM   7609  C  CD2   . HIS A 1  972  ? 163.912 238.216 170.810 1.00 124.53 ?  972  HIS A CD2   1 
ATOM   7610  C  CE1   . HIS A 1  972  ? 164.634 236.489 169.674 1.00 122.98 ?  972  HIS A CE1   1 
ATOM   7611  N  NE2   . HIS A 1  972  ? 163.633 236.908 170.457 1.00 123.48 ?  972  HIS A NE2   1 
ATOM   7612  N  N     . ILE A 1  973  ? 168.997 240.838 172.167 1.00 117.00 ?  973  ILE A N     1 
ATOM   7613  C  CA    . ILE A 1  973  ? 169.905 241.880 172.611 1.00 118.33 ?  973  ILE A CA    1 
ATOM   7614  C  C     . ILE A 1  973  ? 170.479 242.698 171.453 1.00 127.12 ?  973  ILE A C     1 
ATOM   7615  O  O     . ILE A 1  973  ? 171.199 242.156 170.599 1.00 126.81 ?  973  ILE A O     1 
ATOM   7616  C  CB    . ILE A 1  973  ? 170.928 241.286 173.634 1.00 119.93 ?  973  ILE A CB    1 
ATOM   7617  C  CG1   . ILE A 1  973  ? 170.837 241.973 174.999 1.00 120.06 ?  973  ILE A CG1   1 
ATOM   7618  C  CG2   . ILE A 1  973  ? 172.365 241.183 173.135 1.00 120.68 ?  973  ILE A CG2   1 
ATOM   7619  C  CD1   . ILE A 1  973  ? 169.649 241.562 175.818 1.00 123.66 ?  973  ILE A CD1   1 
ATOM   7620  N  N     . ASP A 1  974  ? 170.080 243.992 171.391 1.00 127.08 ?  974  ASP A N     1 
ATOM   7621  C  CA    . ASP A 1  974  ? 170.505 244.926 170.349 1.00 129.34 ?  974  ASP A CA    1 
ATOM   7622  C  C     . ASP A 1  974  ? 171.848 245.545 170.692 1.00 135.28 ?  974  ASP A C     1 
ATOM   7623  O  O     . ASP A 1  974  ? 171.917 246.497 171.480 1.00 135.19 ?  974  ASP A O     1 
ATOM   7624  C  CB    . ASP A 1  974  ? 169.437 246.000 170.076 1.00 132.59 ?  974  ASP A CB    1 
ATOM   7625  C  CG    . ASP A 1  974  ? 169.863 247.016 169.035 1.00 144.34 ?  974  ASP A CG    1 
ATOM   7626  O  OD1   . ASP A 1  974  ? 170.267 246.595 167.923 1.00 144.19 ?  974  ASP A OD1   1 
ATOM   7627  O  OD2   . ASP A 1  974  ? 169.821 248.227 169.340 1.00 152.18 -1 974  ASP A OD2   1 
ATOM   7628  N  N     . HIS A 1  975  ? 172.915 245.015 170.070 1.00 133.44 ?  975  HIS A N     1 
ATOM   7629  C  CA    . HIS A 1  975  ? 174.299 245.441 170.300 1.00 134.80 ?  975  HIS A CA    1 
ATOM   7630  C  C     . HIS A 1  975  ? 174.593 246.891 169.844 1.00 137.63 ?  975  HIS A C     1 
ATOM   7631  O  O     . HIS A 1  975  ? 175.753 247.261 169.644 1.00 136.70 ?  975  HIS A O     1 
ATOM   7632  C  CB    . HIS A 1  975  ? 175.302 244.396 169.735 1.00 136.20 ?  975  HIS A CB    1 
ATOM   7633  C  CG    . HIS A 1  975  ? 175.429 243.120 170.545 1.00 138.79 ?  975  HIS A CG    1 
ATOM   7634  N  ND1   . HIS A 1  975  ? 176.454 242.943 171.477 1.00 140.39 ?  975  HIS A ND1   1 
ATOM   7635  C  CD2   . HIS A 1  975  ? 174.688 241.982 170.502 1.00 139.62 ?  975  HIS A CD2   1 
ATOM   7636  C  CE1   . HIS A 1  975  ? 176.289 241.724 171.971 1.00 138.31 ?  975  HIS A CE1   1 
ATOM   7637  N  NE2   . HIS A 1  975  ? 175.245 241.104 171.414 1.00 138.13 ?  975  HIS A NE2   1 
ATOM   7638  N  N     . THR A 1  976  ? 173.529 247.714 169.725 1.00 134.46 ?  976  THR A N     1 
ATOM   7639  C  CA    . THR A 1  976  ? 173.602 249.117 169.320 1.00 135.86 ?  976  THR A CA    1 
ATOM   7640  C  C     . THR A 1  976  ? 173.077 250.061 170.406 1.00 140.14 ?  976  THR A C     1 
ATOM   7641  O  O     . THR A 1  976  ? 173.845 250.895 170.907 1.00 141.79 ?  976  THR A O     1 
ATOM   7642  C  CB    . THR A 1  976  ? 172.975 249.391 167.913 1.00 141.07 ?  976  THR A CB    1 
ATOM   7643  O  OG1   . THR A 1  976  ? 171.692 250.022 168.018 1.00 135.74 ?  976  THR A OG1   1 
ATOM   7644  C  CG2   . THR A 1  976  ? 172.929 248.156 167.004 1.00 139.86 ?  976  THR A CG2   1 
ATOM   7645  N  N     . LYS A 1  977  ? 171.768 249.938 170.751 1.00 133.83 ?  977  LYS A N     1 
ATOM   7646  C  CA    . LYS A 1  977  ? 171.083 250.798 171.727 1.00 132.72 ?  977  LYS A CA    1 
ATOM   7647  C  C     . LYS A 1  977  ? 171.630 250.722 173.178 1.00 131.65 ?  977  LYS A C     1 
ATOM   7648  O  O     . LYS A 1  977  ? 172.218 249.693 173.534 1.00 131.20 ?  977  LYS A O     1 
ATOM   7649  C  CB    . LYS A 1  977  ? 169.559 250.632 171.637 1.00 135.06 ?  977  LYS A CB    1 
ATOM   7650  C  CG    . LYS A 1  977  ? 168.953 251.465 170.509 1.00 150.60 ?  977  LYS A CG    1 
ATOM   7651  C  CD    . LYS A 1  977  ? 167.440 251.317 170.459 1.00 160.87 ?  977  LYS A CD    1 
ATOM   7652  C  CE    . LYS A 1  977  ? 166.780 252.358 169.586 1.00 170.58 ?  977  LYS A CE    1 
ATOM   7653  N  NZ    . LYS A 1  977  ? 165.296 252.327 169.716 1.00 176.13 1  977  LYS A NZ    1 
ATOM   7654  N  N     . PRO A 1  978  ? 171.530 251.807 174.005 1.00 123.23 ?  978  PRO A N     1 
ATOM   7655  C  CA    . PRO A 1  978  ? 172.096 251.746 175.361 1.00 120.08 ?  978  PRO A CA    1 
ATOM   7656  C  C     . PRO A 1  978  ? 171.182 251.078 176.380 1.00 116.69 ?  978  PRO A C     1 
ATOM   7657  O  O     . PRO A 1  978  ? 169.959 251.170 176.280 1.00 116.37 ?  978  PRO A O     1 
ATOM   7658  C  CB    . PRO A 1  978  ? 172.361 253.210 175.696 1.00 123.48 ?  978  PRO A CB    1 
ATOM   7659  C  CG    . PRO A 1  978  ? 171.359 253.950 174.937 1.00 129.88 ?  978  PRO A CG    1 
ATOM   7660  C  CD    . PRO A 1  978  ? 170.908 253.122 173.761 1.00 125.51 ?  978  PRO A CD    1 
ATOM   7661  N  N     . SER A 1  979  ? 171.800 250.419 177.368 1.00 107.53 ?  979  SER A N     1 
ATOM   7662  C  CA    . SER A 1  979  ? 171.135 249.683 178.439 1.00 104.18 ?  979  SER A CA    1 
ATOM   7663  C  C     . SER A 1  979  ? 170.287 250.547 179.373 1.00 106.88 ?  979  SER A C     1 
ATOM   7664  O  O     . SER A 1  979  ? 170.571 251.730 179.568 1.00 107.75 ?  979  SER A O     1 
ATOM   7665  C  CB    . SER A 1  979  ? 172.165 248.895 179.247 1.00 103.83 ?  979  SER A CB    1 
ATOM   7666  O  OG    . SER A 1  979  ? 171.570 248.203 180.333 1.00 103.73 ?  979  SER A OG    1 
ATOM   7667  N  N     . ASP A 1  980  ? 169.266 249.922 179.974 1.00 101.35 ?  980  ASP A N     1 
ATOM   7668  C  CA    . ASP A 1  980  ? 168.374 250.527 180.957 1.00 101.54 ?  980  ASP A CA    1 
ATOM   7669  C  C     . ASP A 1  980  ? 168.802 250.116 182.398 1.00 103.79 ?  980  ASP A C     1 
ATOM   7670  O  O     . ASP A 1  980  ? 168.008 250.143 183.346 1.00 102.47 ?  980  ASP A O     1 
ATOM   7671  C  CB    . ASP A 1  980  ? 166.911 250.165 180.645 1.00 103.73 ?  980  ASP A CB    1 
ATOM   7672  C  CG    . ASP A 1  980  ? 166.587 248.683 180.682 1.00 121.72 ?  980  ASP A CG    1 
ATOM   7673  O  OD1   . ASP A 1  980  ? 167.373 247.884 180.115 1.00 123.34 ?  980  ASP A OD1   1 
ATOM   7674  O  OD2   . ASP A 1  980  ? 165.526 248.319 181.242 1.00 129.64 -1 980  ASP A OD2   1 
ATOM   7675  N  N     . LEU A 1  981  ? 170.076 249.745 182.547 1.00 100.24 ?  981  LEU A N     1 
ATOM   7676  C  CA    . LEU A 1  981  ? 170.646 249.381 183.835 1.00 99.48  ?  981  LEU A CA    1 
ATOM   7677  C  C     . LEU A 1  981  ? 171.257 250.617 184.511 1.00 106.80 ?  981  LEU A C     1 
ATOM   7678  O  O     . LEU A 1  981  ? 171.661 251.583 183.840 1.00 108.12 ?  981  LEU A O     1 
ATOM   7679  C  CB    . LEU A 1  981  ? 171.724 248.297 183.662 1.00 98.04  ?  981  LEU A CB    1 
ATOM   7680  C  CG    . LEU A 1  981  ? 171.241 246.861 183.453 1.00 100.76 ?  981  LEU A CG    1 
ATOM   7681  C  CD1   . LEU A 1  981  ? 172.318 246.010 182.832 1.00 99.73  ?  981  LEU A CD1   1 
ATOM   7682  C  CD2   . LEU A 1  981  ? 170.833 246.226 184.759 1.00 102.56 ?  981  LEU A CD2   1 
ATOM   7683  N  N     . THR A 1  982  ? 171.288 250.577 185.855 1.00 103.34 ?  982  THR A N     1 
ATOM   7684  C  CA    . THR A 1  982  ? 171.904 251.560 186.751 1.00 103.58 ?  982  THR A CA    1 
ATOM   7685  C  C     . THR A 1  982  ? 173.218 250.898 187.154 1.00 105.22 ?  982  THR A C     1 
ATOM   7686  O  O     . THR A 1  982  ? 173.372 249.681 186.976 1.00 102.62 ?  982  THR A O     1 
ATOM   7687  C  CB    . THR A 1  982  ? 171.053 251.726 188.039 1.00 111.24 ?  982  THR A CB    1 
ATOM   7688  O  OG1   . THR A 1  982  ? 169.666 251.773 187.718 1.00 110.86 ?  982  THR A OG1   1 
ATOM   7689  C  CG2   . THR A 1  982  ? 171.441 252.951 188.860 1.00 113.68 ?  982  THR A CG2   1 
ATOM   7690  N  N     . ILE A 1  983  ? 174.157 251.669 187.719 1.00 102.13 ?  983  ILE A N     1 
ATOM   7691  C  CA    . ILE A 1  983  ? 175.372 251.058 188.232 1.00 100.60 ?  983  ILE A CA    1 
ATOM   7692  C  C     . ILE A 1  983  ? 174.948 250.262 189.477 1.00 103.37 ?  983  ILE A C     1 
ATOM   7693  O  O     . ILE A 1  983  ? 175.372 249.111 189.631 1.00 102.95 ?  983  ILE A O     1 
ATOM   7694  C  CB    . ILE A 1  983  ? 176.500 252.082 188.467 1.00 104.37 ?  983  ILE A CB    1 
ATOM   7695  C  CG1   . ILE A 1  983  ? 177.190 252.421 187.148 1.00 105.68 ?  983  ILE A CG1   1 
ATOM   7696  C  CG2   . ILE A 1  983  ? 177.518 251.561 189.451 1.00 103.56 ?  983  ILE A CG2   1 
ATOM   7697  C  CD1   . ILE A 1  983  ? 176.529 253.515 186.371 1.00 118.72 ?  983  ILE A CD1   1 
ATOM   7698  N  N     . LYS A 1  984  ? 174.015 250.837 190.284 1.00 98.45  ?  984  LYS A N     1 
ATOM   7699  C  CA    . LYS A 1  984  ? 173.424 250.213 191.475 1.00 96.47  ?  984  LYS A CA    1 
ATOM   7700  C  C     . LYS A 1  984  ? 172.721 248.886 191.093 1.00 98.37  ?  984  LYS A C     1 
ATOM   7701  O  O     . LYS A 1  984  ? 172.922 247.864 191.763 1.00 96.29  ?  984  LYS A O     1 
ATOM   7702  C  CB    . LYS A 1  984  ? 172.469 251.190 192.193 1.00 98.71  ?  984  LYS A CB    1 
ATOM   7703  C  CG    . LYS A 1  984  ? 173.184 252.350 192.891 1.00 100.17 ?  984  LYS A CG    1 
ATOM   7704  C  CD    . LYS A 1  984  ? 172.281 253.160 193.831 1.00 106.02 ?  984  LYS A CD    1 
ATOM   7705  C  CE    . LYS A 1  984  ? 172.379 252.758 195.293 1.00 106.20 ?  984  LYS A CE    1 
ATOM   7706  N  NZ    . LYS A 1  984  ? 171.581 253.665 196.169 1.00 110.40 1  984  LYS A NZ    1 
ATOM   7707  N  N     . ASP A 1  985  ? 171.976 248.893 189.960 1.00 94.68  ?  985  ASP A N     1 
ATOM   7708  C  CA    . ASP A 1  985  ? 171.307 247.708 189.426 1.00 93.00  ?  985  ASP A CA    1 
ATOM   7709  C  C     . ASP A 1  985  ? 172.296 246.563 189.273 1.00 93.82  ?  985  ASP A C     1 
ATOM   7710  O  O     . ASP A 1  985  ? 172.017 245.475 189.766 1.00 93.42  ?  985  ASP A O     1 
ATOM   7711  C  CB    . ASP A 1  985  ? 170.656 248.000 188.065 1.00 95.79  ?  985  ASP A CB    1 
ATOM   7712  C  CG    . ASP A 1  985  ? 169.250 248.564 188.113 1.00 113.73 ?  985  ASP A CG    1 
ATOM   7713  O  OD1   . ASP A 1  985  ? 168.655 248.590 189.219 1.00 115.94 ?  985  ASP A OD1   1 
ATOM   7714  O  OD2   . ASP A 1  985  ? 168.727 248.959 187.032 1.00 122.05 -1 985  ASP A OD2   1 
ATOM   7715  N  N     . ILE A 1  986  ? 173.456 246.813 188.632 1.00 88.13  ?  986  ILE A N     1 
ATOM   7716  C  CA    . ILE A 1  986  ? 174.483 245.797 188.424 1.00 86.35  ?  986  ILE A CA    1 
ATOM   7717  C  C     . ILE A 1  986  ? 175.176 245.470 189.736 1.00 89.92  ?  986  ILE A C     1 
ATOM   7718  O  O     . ILE A 1  986  ? 175.010 244.366 190.256 1.00 88.54  ?  986  ILE A O     1 
ATOM   7719  C  CB    . ILE A 1  986  ? 175.486 246.160 187.284 1.00 89.79  ?  986  ILE A CB    1 
ATOM   7720  C  CG1   . ILE A 1  986  ? 174.751 246.438 185.965 1.00 91.25  ?  986  ILE A CG1   1 
ATOM   7721  C  CG2   . ILE A 1  986  ? 176.550 245.064 187.088 1.00 88.19  ?  986  ILE A CG2   1 
ATOM   7722  C  CD1   . ILE A 1  986  ? 175.506 247.310 184.978 1.00 103.31 ?  986  ILE A CD1   1 
ATOM   7723  N  N     . VAL A 1  987  ? 175.943 246.434 190.267 1.00 87.69  ?  987  VAL A N     1 
ATOM   7724  C  CA    . VAL A 1  987  ? 176.763 246.309 191.479 1.00 87.38  ?  987  VAL A CA    1 
ATOM   7725  C  C     . VAL A 1  987  ? 176.063 245.600 192.652 1.00 91.51  ?  987  VAL A C     1 
ATOM   7726  O  O     . VAL A 1  987  ? 176.564 244.574 193.152 1.00 89.83  ?  987  VAL A O     1 
ATOM   7727  C  CB    . VAL A 1  987  ? 177.443 247.661 191.853 1.00 91.45  ?  987  VAL A CB    1 
ATOM   7728  C  CG1   . VAL A 1  987  ? 178.085 247.632 193.237 1.00 90.87  ?  987  VAL A CG1   1 
ATOM   7729  C  CG2   . VAL A 1  987  ? 178.469 248.048 190.799 1.00 91.67  ?  987  VAL A CG2   1 
ATOM   7730  N  N     . LEU A 1  988  ? 174.888 246.121 193.037 1.00 88.42  ?  988  LEU A N     1 
ATOM   7731  C  CA    . LEU A 1  988  ? 174.146 245.587 194.157 1.00 87.78  ?  988  LEU A CA    1 
ATOM   7732  C  C     . LEU A 1  988  ? 173.470 244.325 193.831 1.00 93.37  ?  988  LEU A C     1 
ATOM   7733  O  O     . LEU A 1  988  ? 173.457 243.454 194.695 1.00 93.61  ?  988  LEU A O     1 
ATOM   7734  C  CB    . LEU A 1  988  ? 173.177 246.594 194.740 1.00 88.65  ?  988  LEU A CB    1 
ATOM   7735  C  CG    . LEU A 1  988  ? 173.801 247.943 195.020 1.00 95.17  ?  988  LEU A CG    1 
ATOM   7736  C  CD1   . LEU A 1  988  ? 172.750 249.001 195.162 1.00 96.72  ?  988  LEU A CD1   1 
ATOM   7737  C  CD2   . LEU A 1  988  ? 174.752 247.890 196.207 1.00 97.82  ?  988  LEU A CD2   1 
ATOM   7738  N  N     . GLY A 1  989  ? 172.963 244.202 192.592 1.00 90.52  ?  989  GLY A N     1 
ATOM   7739  C  CA    . GLY A 1  989  ? 172.275 243.008 192.078 1.00 88.82  ?  989  GLY A CA    1 
ATOM   7740  C  C     . GLY A 1  989  ? 173.075 241.733 192.262 1.00 89.25  ?  989  GLY A C     1 
ATOM   7741  O  O     . GLY A 1  989  ? 172.558 240.721 192.764 1.00 86.61  ?  989  GLY A O     1 
ATOM   7742  N  N     . VAL A 1  990  ? 174.372 241.828 191.903 1.00 85.66  ?  990  VAL A N     1 
ATOM   7743  C  CA    . VAL A 1  990  ? 175.391 240.795 192.041 1.00 84.65  ?  990  VAL A CA    1 
ATOM   7744  C  C     . VAL A 1  990  ? 175.653 240.561 193.530 1.00 87.77  ?  990  VAL A C     1 
ATOM   7745  O  O     . VAL A 1  990  ? 175.534 239.433 193.984 1.00 85.71  ?  990  VAL A O     1 
ATOM   7746  C  CB    . VAL A 1  990  ? 176.680 241.149 191.245 1.00 89.40  ?  990  VAL A CB    1 
ATOM   7747  C  CG1   . VAL A 1  990  ? 177.767 240.092 191.455 1.00 88.29  ?  990  VAL A CG1   1 
ATOM   7748  C  CG2   . VAL A 1  990  ? 176.375 241.305 189.753 1.00 89.51  ?  990  VAL A CG2   1 
ATOM   7749  N  N     . LYS A 1  991  ? 175.939 241.625 194.294 1.00 87.02  ?  991  LYS A N     1 
ATOM   7750  C  CA    . LYS A 1  991  ? 176.158 241.547 195.742 1.00 87.84  ?  991  LYS A CA    1 
ATOM   7751  C  C     . LYS A 1  991  ? 175.049 240.719 196.414 1.00 93.39  ?  991  LYS A C     1 
ATOM   7752  O  O     . LYS A 1  991  ? 175.357 239.827 197.208 1.00 92.50  ?  991  LYS A O     1 
ATOM   7753  C  CB    . LYS A 1  991  ? 176.255 242.960 196.371 1.00 91.52  ?  991  LYS A CB    1 
ATOM   7754  C  CG    . LYS A 1  991  ? 177.641 243.287 196.934 1.00 103.06 ?  991  LYS A CG    1 
ATOM   7755  C  CD    . LYS A 1  991  ? 177.670 244.587 197.752 1.00 114.96 ?  991  LYS A CD    1 
ATOM   7756  C  CE    . LYS A 1  991  ? 179.053 244.896 198.305 1.00 127.43 ?  991  LYS A CE    1 
ATOM   7757  N  NZ    . LYS A 1  991  ? 179.174 246.290 198.822 1.00 132.40 1  991  LYS A NZ    1 
ATOM   7758  N  N     . ASP A 1  992  ? 173.774 240.962 196.016 1.00 91.81  ?  992  ASP A N     1 
ATOM   7759  C  CA    . ASP A 1  992  ? 172.572 240.295 196.522 1.00 91.51  ?  992  ASP A CA    1 
ATOM   7760  C  C     . ASP A 1  992  ? 172.444 238.875 196.078 1.00 91.92  ?  992  ASP A C     1 
ATOM   7761  O  O     . ASP A 1  992  ? 172.160 238.024 196.914 1.00 90.91  ?  992  ASP A O     1 
ATOM   7762  C  CB    . ASP A 1  992  ? 171.306 241.086 196.191 1.00 95.46  ?  992  ASP A CB    1 
ATOM   7763  C  CG    . ASP A 1  992  ? 171.201 242.418 196.942 1.00 127.79 ?  992  ASP A CG    1 
ATOM   7764  O  OD1   . ASP A 1  992  ? 172.237 242.865 197.534 1.00 131.61 ?  992  ASP A OD1   1 
ATOM   7765  O  OD2   . ASP A 1  992  ? 170.094 243.031 196.926 1.00 141.43 -1 992  ASP A OD2   1 
ATOM   7766  N  N     . LEU A 1  993  ? 172.677 238.595 194.784 1.00 86.61  ?  993  LEU A N     1 
ATOM   7767  C  CA    . LEU A 1  993  ? 172.603 237.229 194.256 1.00 84.27  ?  993  LEU A CA    1 
ATOM   7768  C  C     . LEU A 1  993  ? 173.486 236.287 195.056 1.00 86.29  ?  993  LEU A C     1 
ATOM   7769  O  O     . LEU A 1  993  ? 173.079 235.156 195.326 1.00 85.19  ?  993  LEU A O     1 
ATOM   7770  C  CB    . LEU A 1  993  ? 172.989 237.187 192.761 1.00 84.01  ?  993  LEU A CB    1 
ATOM   7771  C  CG    . LEU A 1  993  ? 173.448 235.832 192.172 1.00 87.31  ?  993  LEU A CG    1 
ATOM   7772  C  CD1   . LEU A 1  993  ? 172.307 234.847 192.047 1.00 86.58  ?  993  LEU A CD1   1 
ATOM   7773  C  CD2   . LEU A 1  993  ? 174.054 236.016 190.825 1.00 90.51  ?  993  LEU A CD2   1 
ATOM   7774  N  N     . GLN A 1  994  ? 174.687 236.769 195.433 1.00 82.16  ?  994  GLN A N     1 
ATOM   7775  C  CA    . GLN A 1  994  ? 175.728 236.044 196.154 1.00 80.96  ?  994  GLN A CA    1 
ATOM   7776  C  C     . GLN A 1  994  ? 175.247 235.475 197.469 1.00 84.11  ?  994  GLN A C     1 
ATOM   7777  O  O     . GLN A 1  994  ? 175.583 234.332 197.803 1.00 82.68  ?  994  GLN A O     1 
ATOM   7778  C  CB    . GLN A 1  994  ? 176.942 236.944 196.383 1.00 83.22  ?  994  GLN A CB    1 
ATOM   7779  C  CG    . GLN A 1  994  ? 177.815 237.140 195.157 1.00 97.37  ?  994  GLN A CG    1 
ATOM   7780  C  CD    . GLN A 1  994  ? 178.936 238.098 195.452 1.00 120.09 ?  994  GLN A CD    1 
ATOM   7781  O  OE1   . GLN A 1  994  ? 178.863 239.301 195.158 1.00 114.08 ?  994  GLN A OE1   1 
ATOM   7782  N  NE2   . GLN A 1  994  ? 179.984 237.587 196.081 1.00 116.02 ?  994  GLN A NE2   1 
ATOM   7783  N  N     . GLU A 1  995  ? 174.457 236.272 198.209 1.00 81.68  ?  995  GLU A N     1 
ATOM   7784  C  CA    . GLU A 1  995  ? 173.882 235.902 199.507 1.00 81.95  ?  995  GLU A CA    1 
ATOM   7785  C  C     . GLU A 1  995  ? 172.859 234.750 199.390 1.00 82.63  ?  995  GLU A C     1 
ATOM   7786  O  O     . GLU A 1  995  ? 172.570 234.076 200.381 1.00 80.71  ?  995  GLU A O     1 
ATOM   7787  C  CB    . GLU A 1  995  ? 173.241 237.144 200.166 1.00 85.23  ?  995  GLU A CB    1 
ATOM   7788  C  CG    . GLU A 1  995  ? 174.216 238.039 200.924 1.00 101.77 ?  995  GLU A CG    1 
ATOM   7789  C  CD    . GLU A 1  995  ? 174.797 237.470 202.210 1.00 142.51 ?  995  GLU A CD    1 
ATOM   7790  O  OE1   . GLU A 1  995  ? 174.078 236.733 202.927 1.00 147.86 ?  995  GLU A OE1   1 
ATOM   7791  O  OE2   . GLU A 1  995  ? 175.972 237.785 202.511 1.00 145.65 -1 995  GLU A OE2   1 
ATOM   7792  N  N     . ASN A 1  996  ? 172.333 234.536 198.168 1.00 78.62  ?  996  ASN A N     1 
ATOM   7793  C  CA    . ASN A 1  996  ? 171.351 233.513 197.811 1.00 77.27  ?  996  ASN A CA    1 
ATOM   7794  C  C     . ASN A 1  996  ? 171.953 232.218 197.228 1.00 76.41  ?  996  ASN A C     1 
ATOM   7795  O  O     . ASN A 1  996  ? 171.204 231.315 196.840 1.00 74.64  ?  996  ASN A O     1 
ATOM   7796  C  CB    . ASN A 1  996  ? 170.289 234.103 196.866 1.00 81.70  ?  996  ASN A CB    1 
ATOM   7797  C  CG    . ASN A 1  996  ? 169.324 235.050 197.526 1.00 112.82 ?  996  ASN A CG    1 
ATOM   7798  O  OD1   . ASN A 1  996  ? 168.806 234.786 198.620 1.00 106.99 ?  996  ASN A OD1   1 
ATOM   7799  N  ND2   . ASN A 1  996  ? 169.016 236.150 196.840 1.00 108.34 ?  996  ASN A ND2   1 
ATOM   7800  N  N     . LEU A 1  997  ? 173.282 232.124 197.168 1.00 71.36  ?  997  LEU A N     1 
ATOM   7801  C  CA    . LEU A 1  997  ? 173.933 230.917 196.651 1.00 70.39  ?  997  LEU A CA    1 
ATOM   7802  C  C     . LEU A 1  997  ? 174.196 229.964 197.828 1.00 74.35  ?  997  LEU A C     1 
ATOM   7803  O  O     . LEU A 1  997  ? 175.322 229.808 198.304 1.00 73.59  ?  997  LEU A O     1 
ATOM   7804  C  CB    . LEU A 1  997  ? 175.213 231.240 195.833 1.00 70.44  ?  997  LEU A CB    1 
ATOM   7805  C  CG    . LEU A 1  997  ? 175.104 232.306 194.738 1.00 74.79  ?  997  LEU A CG    1 
ATOM   7806  C  CD1   . LEU A 1  997  ? 176.423 232.514 194.064 1.00 73.89  ?  997  LEU A CD1   1 
ATOM   7807  C  CD2   . LEU A 1  997  ? 174.045 231.946 193.711 1.00 78.18  ?  997  LEU A CD2   1 
ATOM   7808  N  N     . LEU A 1  998  ? 173.122 229.333 198.297 1.00 70.98  ?  998  LEU A N     1 
ATOM   7809  C  CA    . LEU A 1  998  ? 173.139 228.483 199.479 1.00 70.15  ?  998  LEU A CA    1 
ATOM   7810  C  C     . LEU A 1  998  ? 173.519 227.012 199.371 1.00 75.55  ?  998  LEU A C     1 
ATOM   7811  O  O     . LEU A 1  998  ? 172.844 226.220 198.699 1.00 76.26  ?  998  LEU A O     1 
ATOM   7812  C  CB    . LEU A 1  998  ? 171.861 228.676 200.267 1.00 69.40  ?  998  LEU A CB    1 
ATOM   7813  C  CG    . LEU A 1  998  ? 171.843 229.950 201.020 1.00 73.27  ?  998  LEU A CG    1 
ATOM   7814  C  CD1   . LEU A 1  998  ? 170.843 230.884 200.449 1.00 72.73  ?  998  LEU A CD1   1 
ATOM   7815  C  CD2   . LEU A 1  998  ? 171.611 229.676 202.473 1.00 77.34  ?  998  LEU A CD2   1 
ATOM   7816  N  N     . VAL A 1  999  ? 174.565 226.648 200.125 1.00 71.60  ?  999  VAL A N     1 
ATOM   7817  C  CA    . VAL A 1  999  ? 175.116 225.306 200.238 1.00 71.06  ?  999  VAL A CA    1 
ATOM   7818  C  C     . VAL A 1  999  ? 174.844 224.768 201.642 1.00 79.88  ?  999  VAL A C     1 
ATOM   7819  O  O     . VAL A 1  999  ? 174.538 223.583 201.780 1.00 80.05  ?  999  VAL A O     1 
ATOM   7820  C  CB    . VAL A 1  999  ? 176.625 225.273 199.955 1.00 74.37  ?  999  VAL A CB    1 
ATOM   7821  C  CG1   . VAL A 1  999  ? 177.048 223.892 199.504 1.00 73.28  ?  999  VAL A CG1   1 
ATOM   7822  C  CG2   . VAL A 1  999  ? 177.026 226.311 198.926 1.00 75.05  ?  999  VAL A CG2   1 
ATOM   7823  N  N     . LEU A 1  1000 ? 175.005 225.619 202.687 1.00 79.17  ?  1000 LEU A N     1 
ATOM   7824  C  CA    . LEU A 1  1000 ? 174.800 225.275 204.104 1.00 79.81  ?  1000 LEU A CA    1 
ATOM   7825  C  C     . LEU A 1  1000 ? 173.791 226.217 204.708 1.00 87.64  ?  1000 LEU A C     1 
ATOM   7826  O  O     . LEU A 1  1000 ? 173.786 227.406 204.380 1.00 88.23  ?  1000 LEU A O     1 
ATOM   7827  C  CB    . LEU A 1  1000 ? 176.112 225.312 204.866 1.00 80.17  ?  1000 LEU A CB    1 
ATOM   7828  C  CG    . LEU A 1  1000 ? 177.086 224.238 204.460 1.00 84.33  ?  1000 LEU A CG    1 
ATOM   7829  C  CD1   . LEU A 1  1000 ? 178.454 224.801 204.309 1.00 84.75  ?  1000 LEU A CD1   1 
ATOM   7830  C  CD2   . LEU A 1  1000 ? 177.039 223.079 205.425 1.00 88.93  ?  1000 LEU A CD2   1 
ATOM   7831  N  N     . ARG A 1  1001 ? 172.896 225.700 205.551 1.00 86.67  ?  1001 ARG A N     1 
ATOM   7832  C  CA    . ARG A 1  1001 ? 171.809 226.555 205.990 1.00 88.07  ?  1001 ARG A CA    1 
ATOM   7833  C  C     . ARG A 1  1001 ? 171.765 227.078 207.412 1.00 94.06  ?  1001 ARG A C     1 
ATOM   7834  O  O     . ARG A 1  1001 ? 171.210 228.174 207.611 1.00 96.10  ?  1001 ARG A O     1 
ATOM   7835  C  CB    . ARG A 1  1001 ? 170.454 226.023 205.489 1.00 87.84  ?  1001 ARG A CB    1 
ATOM   7836  C  CG    . ARG A 1  1001 ? 169.913 226.793 204.287 1.00 90.29  ?  1001 ARG A CG    1 
ATOM   7837  C  CD    . ARG A 1  1001 ? 168.859 225.998 203.564 1.00 94.37  ?  1001 ARG A CD    1 
ATOM   7838  N  NE    . ARG A 1  1001 ? 169.432 225.288 202.423 1.00 100.09 ?  1001 ARG A NE    1 
ATOM   7839  C  CZ    . ARG A 1  1001 ? 169.291 225.672 201.158 1.00 105.80 ?  1001 ARG A CZ    1 
ATOM   7840  N  NH1   . ARG A 1  1001 ? 168.564 226.751 200.857 1.00 74.20  1  1001 ARG A NH1   1 
ATOM   7841  N  NH2   . ARG A 1  1001 ? 169.855 224.968 200.178 1.00 91.69  ?  1001 ARG A NH2   1 
ATOM   7842  N  N     . GLY A 1  1002 ? 172.358 226.345 208.360 1.00 89.51  ?  1002 GLY A N     1 
ATOM   7843  C  CA    . GLY A 1  1002 ? 172.398 226.727 209.776 1.00 90.60  ?  1002 GLY A CA    1 
ATOM   7844  C  C     . GLY A 1  1002 ? 172.600 228.202 210.135 1.00 95.59  ?  1002 GLY A C     1 
ATOM   7845  O  O     . GLY A 1  1002 ? 173.374 228.915 209.482 1.00 94.73  ?  1002 GLY A O     1 
ATOM   7846  N  N     . LYS A 1  1003 ? 171.885 228.672 211.189 1.00 93.39  ?  1003 LYS A N     1 
ATOM   7847  C  CA    . LYS A 1  1003 ? 171.971 230.048 211.695 1.00 94.89  ?  1003 LYS A CA    1 
ATOM   7848  C  C     . LYS A 1  1003 ? 172.981 230.123 212.864 1.00 99.36  ?  1003 LYS A C     1 
ATOM   7849  O  O     . LYS A 1  1003 ? 172.590 230.024 214.036 1.00 100.09 ?  1003 LYS A O     1 
ATOM   7850  C  CB    . LYS A 1  1003 ? 170.584 230.569 212.136 1.00 98.28  ?  1003 LYS A CB    1 
ATOM   7851  C  CG    . LYS A 1  1003 ? 169.694 231.067 211.008 1.00 117.15 ?  1003 LYS A CG    1 
ATOM   7852  C  CD    . LYS A 1  1003 ? 168.332 231.559 211.542 1.00 125.62 ?  1003 LYS A CD    1 
ATOM   7853  C  CE    . LYS A 1  1003 ? 167.477 232.235 210.488 1.00 129.69 ?  1003 LYS A CE    1 
ATOM   7854  N  NZ    . LYS A 1  1003 ? 166.160 232.675 211.028 1.00 135.42 1  1003 LYS A NZ    1 
ATOM   7855  N  N     . ASN A 1  1004 ? 174.283 230.244 212.531 1.00 94.35  ?  1004 ASN A N     1 
ATOM   7856  C  CA    . ASN A 1  1004 ? 175.395 230.333 213.480 1.00 94.10  ?  1004 ASN A CA    1 
ATOM   7857  C  C     . ASN A 1  1004 ? 176.712 230.569 212.786 1.00 97.00  ?  1004 ASN A C     1 
ATOM   7858  O  O     . ASN A 1  1004 ? 176.938 230.063 211.688 1.00 94.68  ?  1004 ASN A O     1 
ATOM   7859  C  CB    . ASN A 1  1004 ? 175.499 229.108 214.374 1.00 93.71  ?  1004 ASN A CB    1 
ATOM   7860  C  CG    . ASN A 1  1004 ? 175.821 227.864 213.634 1.00 121.63 ?  1004 ASN A CG    1 
ATOM   7861  O  OD1   . ASN A 1  1004 ? 176.989 227.579 213.346 1.00 117.44 ?  1004 ASN A OD1   1 
ATOM   7862  N  ND2   . ASN A 1  1004 ? 174.796 227.081 213.357 1.00 117.73 ?  1004 ASN A ND2   1 
ATOM   7863  N  N     . GLU A 1  1005 ? 177.606 231.285 213.465 1.00 95.08  ?  1005 GLU A N     1 
ATOM   7864  C  CA    . GLU A 1  1005 ? 178.912 231.627 212.944 1.00 95.32  ?  1005 GLU A CA    1 
ATOM   7865  C  C     . GLU A 1  1005 ? 179.650 230.457 212.274 1.00 91.85  ?  1005 GLU A C     1 
ATOM   7866  O  O     . GLU A 1  1005 ? 180.030 230.613 211.122 1.00 90.11  ?  1005 GLU A O     1 
ATOM   7867  C  CB    . GLU A 1  1005 ? 179.749 232.353 214.013 1.00 99.38  ?  1005 GLU A CB    1 
ATOM   7868  C  CG    . GLU A 1  1005 ? 181.042 232.999 213.509 1.00 122.93 ?  1005 GLU A CG    1 
ATOM   7869  C  CD    . GLU A 1  1005 ? 180.963 234.287 212.700 1.00 161.58 ?  1005 GLU A CD    1 
ATOM   7870  O  OE1   . GLU A 1  1005 ? 179.877 234.616 212.162 1.00 164.37 ?  1005 GLU A OE1   1 
ATOM   7871  O  OE2   . GLU A 1  1005 ? 182.019 234.954 212.582 1.00 157.13 -1 1005 GLU A OE2   1 
ATOM   7872  N  N     . ILE A 1  1006 ? 179.784 229.291 212.947 1.00 84.50  ?  1006 ILE A N     1 
ATOM   7873  C  CA    . ILE A 1  1006 ? 180.460 228.114 212.375 1.00 81.97  ?  1006 ILE A CA    1 
ATOM   7874  C  C     . ILE A 1  1006 ? 179.906 227.757 211.002 1.00 83.45  ?  1006 ILE A C     1 
ATOM   7875  O  O     . ILE A 1  1006 ? 180.664 227.724 210.026 1.00 82.90  ?  1006 ILE A O     1 
ATOM   7876  C  CB    . ILE A 1  1006 ? 180.519 226.872 213.327 1.00 84.34  ?  1006 ILE A CB    1 
ATOM   7877  C  CG1   . ILE A 1  1006 ? 181.488 227.126 214.485 1.00 86.08  ?  1006 ILE A CG1   1 
ATOM   7878  C  CG2   . ILE A 1  1006 ? 180.928 225.595 212.572 1.00 83.29  ?  1006 ILE A CG2   1 
ATOM   7879  C  CD1   . ILE A 1  1006 ? 181.730 225.971 215.472 1.00 92.15  ?  1006 ILE A CD1   1 
ATOM   7880  N  N     . ILE A 1  1007 ? 178.589 227.500 210.930 1.00 78.18  ?  1007 ILE A N     1 
ATOM   7881  C  CA    . ILE A 1  1007 ? 177.900 227.085 209.702 1.00 76.00  ?  1007 ILE A CA    1 
ATOM   7882  C  C     . ILE A 1  1007 ? 177.842 228.218 208.680 1.00 79.89  ?  1007 ILE A C     1 
ATOM   7883  O  O     . ILE A 1  1007 ? 177.964 227.963 207.478 1.00 78.08  ?  1007 ILE A O     1 
ATOM   7884  C  CB    . ILE A 1  1007 ? 176.524 226.411 210.006 1.00 77.91  ?  1007 ILE A CB    1 
ATOM   7885  C  CG1   . ILE A 1  1007 ? 176.640 225.242 211.031 1.00 77.34  ?  1007 ILE A CG1   1 
ATOM   7886  C  CG2   . ILE A 1  1007 ? 175.809 225.956 208.743 1.00 78.57  ?  1007 ILE A CG2   1 
ATOM   7887  C  CD1   . ILE A 1  1007 ? 177.747 224.095 210.759 1.00 82.27  ?  1007 ILE A CD1   1 
ATOM   7888  N  N     . GLN A 1  1008 ? 177.713 229.473 209.163 1.00 77.72  ?  1008 GLN A N     1 
ATOM   7889  C  CA    . GLN A 1  1008 ? 177.660 230.624 208.270 1.00 77.43  ?  1008 GLN A CA    1 
ATOM   7890  C  C     . GLN A 1  1008 ? 179.007 230.928 207.639 1.00 80.01  ?  1008 GLN A C     1 
ATOM   7891  O  O     . GLN A 1  1008 ? 179.097 231.071 206.414 1.00 77.90  ?  1008 GLN A O     1 
ATOM   7892  C  CB    . GLN A 1  1008 ? 176.947 231.822 208.901 1.00 79.55  ?  1008 GLN A CB    1 
ATOM   7893  C  CG    . GLN A 1  1008 ? 175.422 231.682 208.872 1.00 85.79  ?  1008 GLN A CG    1 
ATOM   7894  C  CD    . GLN A 1  1008 ? 174.884 231.637 207.460 1.00 109.12 ?  1008 GLN A CD    1 
ATOM   7895  O  OE1   . GLN A 1  1008 ? 175.106 232.552 206.656 1.00 104.77 ?  1008 GLN A OE1   1 
ATOM   7896  N  NE2   . GLN A 1  1008 ? 174.207 230.543 207.111 1.00 103.87 ?  1008 GLN A NE2   1 
ATOM   7897  N  N     . ASN A 1  1009 ? 180.067 230.879 208.447 1.00 78.31  ?  1009 ASN A N     1 
ATOM   7898  C  CA    . ASN A 1  1009 ? 181.438 231.012 207.953 1.00 79.10  ?  1009 ASN A CA    1 
ATOM   7899  C  C     . ASN A 1  1009 ? 181.738 229.856 206.969 1.00 81.09  ?  1009 ASN A C     1 
ATOM   7900  O  O     . ASN A 1  1009 ? 182.369 230.084 205.935 1.00 80.90  ?  1009 ASN A O     1 
ATOM   7901  C  CB    . ASN A 1  1009 ? 182.445 231.014 209.107 1.00 81.55  ?  1009 ASN A CB    1 
ATOM   7902  C  CG    . ASN A 1  1009 ? 183.293 232.237 209.125 1.00 110.36 ?  1009 ASN A CG    1 
ATOM   7903  O  OD1   . ASN A 1  1009 ? 183.297 232.982 210.108 1.00 111.17 ?  1009 ASN A OD1   1 
ATOM   7904  N  ND2   . ASN A 1  1009 ? 183.963 232.520 208.001 1.00 102.17 ?  1009 ASN A ND2   1 
ATOM   7905  N  N     . ALA A 1  1010 ? 181.224 228.646 207.278 1.00 75.15  ?  1010 ALA A N     1 
ATOM   7906  C  CA    . ALA A 1  1010 ? 181.340 227.461 206.445 1.00 74.35  ?  1010 ALA A CA    1 
ATOM   7907  C  C     . ALA A 1  1010 ? 180.732 227.686 205.060 1.00 77.07  ?  1010 ALA A C     1 
ATOM   7908  O  O     . ALA A 1  1010 ? 181.333 227.298 204.041 1.00 74.84  ?  1010 ALA A O     1 
ATOM   7909  C  CB    . ALA A 1  1010 ? 180.629 226.302 207.112 1.00 74.95  ?  1010 ALA A CB    1 
ATOM   7910  N  N     . GLN A 1  1011 ? 179.510 228.289 205.040 1.00 73.87  ?  1011 GLN A N     1 
ATOM   7911  C  CA    . GLN A 1  1011 ? 178.780 228.596 203.824 1.00 72.59  ?  1011 GLN A CA    1 
ATOM   7912  C  C     . GLN A 1  1011 ? 179.642 229.521 202.985 1.00 81.31  ?  1011 GLN A C     1 
ATOM   7913  O  O     . GLN A 1  1011 ? 179.924 229.166 201.836 1.00 82.03  ?  1011 GLN A O     1 
ATOM   7914  C  CB    . GLN A 1  1011 ? 177.412 229.196 204.137 1.00 72.70  ?  1011 GLN A CB    1 
ATOM   7915  C  CG    . GLN A 1  1011 ? 176.799 230.014 203.001 1.00 73.36  ?  1011 GLN A CG    1 
ATOM   7916  C  CD    . GLN A 1  1011 ? 176.520 229.245 201.731 1.00 82.33  ?  1011 GLN A CD    1 
ATOM   7917  O  OE1   . GLN A 1  1011 ? 175.778 228.271 201.717 1.00 81.47  ?  1011 GLN A OE1   1 
ATOM   7918  N  NE2   . GLN A 1  1011 ? 177.055 229.709 200.623 1.00 66.57  ?  1011 GLN A NE2   1 
ATOM   7919  N  N     . ARG A 1  1012 ? 180.136 230.643 203.585 1.00 80.02  ?  1012 ARG A N     1 
ATOM   7920  C  CA    . ARG A 1  1012 ? 181.005 231.627 202.920 1.00 81.63  ?  1012 ARG A CA    1 
ATOM   7921  C  C     . ARG A 1  1012 ? 182.156 230.925 202.208 1.00 86.38  ?  1012 ARG A C     1 
ATOM   7922  O  O     . ARG A 1  1012 ? 182.367 231.150 201.016 1.00 85.61  ?  1012 ARG A O     1 
ATOM   7923  C  CB    . ARG A 1  1012 ? 181.574 232.648 203.928 1.00 85.68  ?  1012 ARG A CB    1 
ATOM   7924  C  CG    . ARG A 1  1012 ? 180.588 233.691 204.451 1.00 101.41 ?  1012 ARG A CG    1 
ATOM   7925  C  CD    . ARG A 1  1012 ? 181.127 234.357 205.709 1.00 115.50 ?  1012 ARG A CD    1 
ATOM   7926  N  NE    . ARG A 1  1012 ? 180.091 234.497 206.741 1.00 129.79 ?  1012 ARG A NE    1 
ATOM   7927  C  CZ    . ARG A 1  1012 ? 180.338 234.710 208.032 1.00 147.37 ?  1012 ARG A CZ    1 
ATOM   7928  N  NH1   . ARG A 1  1012 ? 181.588 234.810 208.471 1.00 138.88 1  1012 ARG A NH1   1 
ATOM   7929  N  NH2   . ARG A 1  1012 ? 179.333 234.827 208.897 1.00 130.19 ?  1012 ARG A NH2   1 
ATOM   7930  N  N     . ASP A 1  1013 ? 182.853 230.031 202.943 1.00 84.21  ?  1013 ASP A N     1 
ATOM   7931  C  CA    . ASP A 1  1013 ? 184.000 229.248 202.495 1.00 84.78  ?  1013 ASP A CA    1 
ATOM   7932  C  C     . ASP A 1  1013 ? 183.684 228.452 201.226 1.00 86.56  ?  1013 ASP A C     1 
ATOM   7933  O  O     . ASP A 1  1013 ? 184.311 228.702 200.203 1.00 85.90  ?  1013 ASP A O     1 
ATOM   7934  C  CB    . ASP A 1  1013 ? 184.527 228.322 203.634 1.00 87.82  ?  1013 ASP A CB    1 
ATOM   7935  C  CG    . ASP A 1  1013 ? 185.266 229.010 204.789 1.00 106.31 ?  1013 ASP A CG    1 
ATOM   7936  O  OD1   . ASP A 1  1013 ? 186.093 229.921 204.511 1.00 111.54 ?  1013 ASP A OD1   1 
ATOM   7937  O  OD2   . ASP A 1  1013 ? 185.062 228.595 205.975 1.00 107.23 -1 1013 ASP A OD2   1 
ATOM   7938  N  N     . ALA A 1  1014 ? 182.686 227.547 201.278 1.00 81.87  ?  1014 ALA A N     1 
ATOM   7939  C  CA    . ALA A 1  1014 ? 182.255 226.699 200.152 1.00 81.03  ?  1014 ALA A CA    1 
ATOM   7940  C  C     . ALA A 1  1014 ? 181.965 227.481 198.839 1.00 84.24  ?  1014 ALA A C     1 
ATOM   7941  O  O     . ALA A 1  1014 ? 182.245 227.039 197.704 1.00 82.35  ?  1014 ALA A O     1 
ATOM   7942  C  CB    . ALA A 1  1014 ? 181.012 225.922 200.564 1.00 81.20  ?  1014 ALA A CB    1 
ATOM   7943  N  N     . VAL A 1  1015 ? 181.402 228.659 199.025 1.00 81.06  ?  1015 VAL A N     1 
ATOM   7944  C  CA    . VAL A 1  1015 ? 180.992 229.509 197.938 1.00 80.19  ?  1015 VAL A CA    1 
ATOM   7945  C  C     . VAL A 1  1015 ? 182.084 230.450 197.347 1.00 83.75  ?  1015 VAL A C     1 
ATOM   7946  O  O     . VAL A 1  1015 ? 181.917 230.918 196.216 1.00 84.03  ?  1015 VAL A O     1 
ATOM   7947  C  CB    . VAL A 1  1015 ? 179.633 230.128 198.328 1.00 83.08  ?  1015 VAL A CB    1 
ATOM   7948  C  CG1   . VAL A 1  1015 ? 179.623 231.645 198.306 1.00 83.86  ?  1015 VAL A CG1   1 
ATOM   7949  C  CG2   . VAL A 1  1015 ? 178.522 229.540 197.491 1.00 81.91  ?  1015 VAL A CG2   1 
ATOM   7950  N  N     . THR A 1  1016 ? 183.228 230.630 198.069 1.00 78.34  ?  1016 THR A N     1 
ATOM   7951  C  CA    . THR A 1  1016 ? 184.363 231.496 197.700 1.00 78.07  ?  1016 THR A CA    1 
ATOM   7952  C  C     . THR A 1  1016 ? 184.715 231.530 196.211 1.00 81.45  ?  1016 THR A C     1 
ATOM   7953  O  O     . THR A 1  1016 ? 184.490 232.547 195.550 1.00 81.46  ?  1016 THR A O     1 
ATOM   7954  C  CB    . THR A 1  1016 ? 185.595 231.187 198.561 1.00 83.84  ?  1016 THR A CB    1 
ATOM   7955  O  OG1   . THR A 1  1016 ? 185.306 231.371 199.949 1.00 90.54  ?  1016 THR A OG1   1 
ATOM   7956  C  CG2   . THR A 1  1016 ? 186.798 231.993 198.164 1.00 78.32  ?  1016 THR A CG2   1 
ATOM   7957  N  N     . LEU A 1  1017 ? 185.268 230.414 195.699 1.00 77.70  ?  1017 LEU A N     1 
ATOM   7958  C  CA    . LEU A 1  1017 ? 185.730 230.256 194.325 1.00 77.02  ?  1017 LEU A CA    1 
ATOM   7959  C  C     . LEU A 1  1017 ? 184.658 230.600 193.313 1.00 80.68  ?  1017 LEU A C     1 
ATOM   7960  O  O     . LEU A 1  1017 ? 184.898 231.457 192.459 1.00 80.03  ?  1017 LEU A O     1 
ATOM   7961  C  CB    . LEU A 1  1017 ? 186.302 228.843 194.108 1.00 75.81  ?  1017 LEU A CB    1 
ATOM   7962  C  CG    . LEU A 1  1017 ? 187.030 228.537 192.801 1.00 79.32  ?  1017 LEU A CG    1 
ATOM   7963  C  CD1   . LEU A 1  1017 ? 188.122 229.557 192.499 1.00 79.71  ?  1017 LEU A CD1   1 
ATOM   7964  C  CD2   . LEU A 1  1017 ? 187.552 227.107 192.798 1.00 79.36  ?  1017 LEU A CD2   1 
ATOM   7965  N  N     . PHE A 1  1018 ? 183.456 230.002 193.448 1.00 77.61  ?  1018 PHE A N     1 
ATOM   7966  C  CA    . PHE A 1  1018 ? 182.365 230.301 192.514 1.00 78.20  ?  1018 PHE A CA    1 
ATOM   7967  C  C     . PHE A 1  1018 ? 182.091 231.803 192.404 1.00 83.77  ?  1018 PHE A C     1 
ATOM   7968  O  O     . PHE A 1  1018 ? 181.857 232.310 191.306 1.00 83.92  ?  1018 PHE A O     1 
ATOM   7969  C  CB    . PHE A 1  1018 ? 181.073 229.508 192.838 1.00 79.31  ?  1018 PHE A CB    1 
ATOM   7970  C  CG    . PHE A 1  1018 ? 179.922 229.791 191.891 1.00 80.92  ?  1018 PHE A CG    1 
ATOM   7971  C  CD1   . PHE A 1  1018 ? 179.911 229.264 190.603 1.00 83.23  ?  1018 PHE A CD1   1 
ATOM   7972  C  CD2   . PHE A 1  1018 ? 178.869 230.619 192.275 1.00 83.90  ?  1018 PHE A CD2   1 
ATOM   7973  C  CE1   . PHE A 1  1018 ? 178.876 229.568 189.717 1.00 84.40  ?  1018 PHE A CE1   1 
ATOM   7974  C  CE2   . PHE A 1  1018 ? 177.829 230.913 191.392 1.00 86.51  ?  1018 PHE A CE2   1 
ATOM   7975  C  CZ    . PHE A 1  1018 ? 177.836 230.384 190.122 1.00 84.25  ?  1018 PHE A CZ    1 
ATOM   7976  N  N     . CYS A 1  1019 ? 182.161 232.508 193.527 1.00 81.16  ?  1019 CYS A N     1 
ATOM   7977  C  CA    . CYS A 1  1019 ? 181.902 233.928 193.530 1.00 82.46  ?  1019 CYS A CA    1 
ATOM   7978  C  C     . CYS A 1  1019 ? 182.929 234.716 192.786 1.00 85.85  ?  1019 CYS A C     1 
ATOM   7979  O  O     . CYS A 1  1019 ? 182.533 235.596 192.025 1.00 85.00  ?  1019 CYS A O     1 
ATOM   7980  C  CB    . CYS A 1  1019 ? 181.684 234.440 194.941 1.00 83.99  ?  1019 CYS A CB    1 
ATOM   7981  S  SG    . CYS A 1  1019 ? 180.226 233.729 195.741 1.00 87.46  ?  1019 CYS A SG    1 
ATOM   7982  N  N     . CYS A 1  1020 ? 184.234 234.349 192.911 1.00 82.77  ?  1020 CYS A N     1 
ATOM   7983  C  CA    . CYS A 1  1020 ? 185.327 235.016 192.165 1.00 83.51  ?  1020 CYS A CA    1 
ATOM   7984  C  C     . CYS A 1  1020 ? 185.024 234.967 190.671 1.00 86.52  ?  1020 CYS A C     1 
ATOM   7985  O  O     . CYS A 1  1020 ? 185.282 235.945 189.956 1.00 87.73  ?  1020 CYS A O     1 
ATOM   7986  C  CB    . CYS A 1  1020 ? 186.683 234.382 192.457 1.00 83.55  ?  1020 CYS A CB    1 
ATOM   7987  S  SG    . CYS A 1  1020 ? 187.119 234.323 194.205 1.00 87.50  ?  1020 CYS A SG    1 
ATOM   7988  N  N     . LEU A 1  1021 ? 184.486 233.810 190.213 1.00 79.24  ?  1021 LEU A N     1 
ATOM   7989  C  CA    . LEU A 1  1021 ? 184.099 233.598 188.841 1.00 77.28  ?  1021 LEU A CA    1 
ATOM   7990  C  C     . LEU A 1  1021 ? 182.928 234.515 188.560 1.00 81.87  ?  1021 LEU A C     1 
ATOM   7991  O  O     . LEU A 1  1021 ? 183.002 235.296 187.614 1.00 83.11  ?  1021 LEU A O     1 
ATOM   7992  C  CB    . LEU A 1  1021 ? 183.728 232.125 188.601 1.00 75.29  ?  1021 LEU A CB    1 
ATOM   7993  C  CG    . LEU A 1  1021 ? 182.935 231.816 187.325 1.00 78.68  ?  1021 LEU A CG    1 
ATOM   7994  C  CD1   . LEU A 1  1021 ? 183.799 231.942 186.066 1.00 78.42  ?  1021 LEU A CD1   1 
ATOM   7995  C  CD2   . LEU A 1  1021 ? 182.301 230.454 187.408 1.00 80.33  ?  1021 LEU A CD2   1 
ATOM   7996  N  N     . LEU A 1  1022 ? 181.886 234.466 189.419 1.00 77.38  ?  1022 LEU A N     1 
ATOM   7997  C  CA    . LEU A 1  1022 ? 180.668 235.260 189.285 1.00 77.32  ?  1022 LEU A CA    1 
ATOM   7998  C  C     . LEU A 1  1022 ? 180.951 236.769 189.190 1.00 83.03  ?  1022 LEU A C     1 
ATOM   7999  O  O     . LEU A 1  1022 ? 180.434 237.442 188.288 1.00 82.56  ?  1022 LEU A O     1 
ATOM   8000  C  CB    . LEU A 1  1022 ? 179.702 234.938 190.436 1.00 76.63  ?  1022 LEU A CB    1 
ATOM   8001  C  CG    . LEU A 1  1022 ? 178.343 235.615 190.350 1.00 81.84  ?  1022 LEU A CG    1 
ATOM   8002  C  CD1   . LEU A 1  1022 ? 177.444 234.861 189.442 1.00 81.84  ?  1022 LEU A CD1   1 
ATOM   8003  C  CD2   . LEU A 1  1022 ? 177.696 235.731 191.711 1.00 83.96  ?  1022 LEU A CD2   1 
ATOM   8004  N  N     . ARG A 1  1023 ? 181.809 237.278 190.096 1.00 80.72  ?  1023 ARG A N     1 
ATOM   8005  C  CA    . ARG A 1  1023 ? 182.202 238.687 190.155 1.00 81.89  ?  1023 ARG A CA    1 
ATOM   8006  C  C     . ARG A 1  1023 ? 182.989 239.088 188.909 1.00 87.66  ?  1023 ARG A C     1 
ATOM   8007  O  O     . ARG A 1  1023 ? 182.777 240.193 188.404 1.00 88.85  ?  1023 ARG A O     1 
ATOM   8008  C  CB    . ARG A 1  1023 ? 182.969 239.008 191.450 1.00 81.24  ?  1023 ARG A CB    1 
ATOM   8009  C  CG    . ARG A 1  1023 ? 182.146 238.825 192.734 1.00 86.09  ?  1023 ARG A CG    1 
ATOM   8010  C  CD    . ARG A 1  1023 ? 182.870 239.380 193.942 1.00 92.78  ?  1023 ARG A CD    1 
ATOM   8011  N  NE    . ARG A 1  1023 ? 182.741 238.533 195.127 1.00 96.24  ?  1023 ARG A NE    1 
ATOM   8012  C  CZ    . ARG A 1  1023 ? 183.618 237.597 195.480 1.00 110.20 ?  1023 ARG A CZ    1 
ATOM   8013  N  NH1   . ARG A 1  1023 ? 184.694 237.376 194.737 1.00 94.61  1  1023 ARG A NH1   1 
ATOM   8014  N  NH2   . ARG A 1  1023 ? 183.418 236.866 196.573 1.00 96.76  ?  1023 ARG A NH2   1 
ATOM   8015  N  N     . SER A 1  1024 ? 183.852 238.173 188.384 1.00 83.95  ?  1024 SER A N     1 
ATOM   8016  C  CA    . SER A 1  1024 ? 184.644 238.374 187.159 1.00 83.95  ?  1024 SER A CA    1 
ATOM   8017  C  C     . SER A 1  1024 ? 183.718 238.491 185.942 1.00 87.66  ?  1024 SER A C     1 
ATOM   8018  O  O     . SER A 1  1024 ? 183.845 239.437 185.167 1.00 89.54  ?  1024 SER A O     1 
ATOM   8019  C  CB    . SER A 1  1024 ? 185.668 237.250 186.958 1.00 85.75  ?  1024 SER A CB    1 
ATOM   8020  O  OG    . SER A 1  1024 ? 185.215 236.110 186.239 1.00 87.48  ?  1024 SER A OG    1 
ATOM   8021  N  N     . ARG A 1  1025 ? 182.764 237.562 185.810 1.00 80.83  ?  1025 ARG A N     1 
ATOM   8022  C  CA    . ARG A 1  1025 ? 181.847 237.560 184.681 1.00 79.73  ?  1025 ARG A CA    1 
ATOM   8023  C  C     . ARG A 1  1025 ? 180.739 238.617 184.812 1.00 83.08  ?  1025 ARG A C     1 
ATOM   8024  O  O     . ARG A 1  1025 ? 180.188 239.025 183.798 1.00 82.19  ?  1025 ARG A O     1 
ATOM   8025  C  CB    . ARG A 1  1025 ? 181.294 236.140 184.398 1.00 77.92  ?  1025 ARG A CB    1 
ATOM   8026  C  CG    . ARG A 1  1025 ? 182.367 235.030 184.256 1.00 83.17  ?  1025 ARG A CG    1 
ATOM   8027  C  CD    . ARG A 1  1025 ? 182.646 234.629 182.820 1.00 81.43  ?  1025 ARG A CD    1 
ATOM   8028  N  NE    . ARG A 1  1025 ? 183.558 233.486 182.712 1.00 86.30  ?  1025 ARG A NE    1 
ATOM   8029  C  CZ    . ARG A 1  1025 ? 183.192 232.264 182.316 1.00 121.59 ?  1025 ARG A CZ    1 
ATOM   8030  N  NH1   . ARG A 1  1025 ? 181.920 232.002 182.021 1.00 112.62 1  1025 ARG A NH1   1 
ATOM   8031  N  NH2   . ARG A 1  1025 ? 184.092 231.292 182.222 1.00 121.84 ?  1025 ARG A NH2   1 
ATOM   8032  N  N     . LEU A 1  1026 ? 180.430 239.098 186.028 1.00 80.08  ?  1026 LEU A N     1 
ATOM   8033  C  CA    . LEU A 1  1026 ? 179.356 240.095 186.143 1.00 80.88  ?  1026 LEU A CA    1 
ATOM   8034  C  C     . LEU A 1  1026 ? 179.731 241.511 186.600 1.00 89.37  ?  1026 LEU A C     1 
ATOM   8035  O  O     . LEU A 1  1026 ? 178.859 242.271 187.045 1.00 90.33  ?  1026 LEU A O     1 
ATOM   8036  C  CB    . LEU A 1  1026 ? 178.133 239.559 186.884 1.00 79.62  ?  1026 LEU A CB    1 
ATOM   8037  C  CG    . LEU A 1  1026 ? 177.441 238.391 186.229 1.00 82.25  ?  1026 LEU A CG    1 
ATOM   8038  C  CD1   . LEU A 1  1026 ? 176.486 237.745 187.188 1.00 81.26  ?  1026 LEU A CD1   1 
ATOM   8039  C  CD2   . LEU A 1  1026 ? 176.754 238.815 184.958 1.00 84.54  ?  1026 LEU A CD2   1 
ATOM   8040  N  N     . ALA A 1  1027 ? 181.015 241.887 186.435 1.00 86.95  ?  1027 ALA A N     1 
ATOM   8041  C  CA    . ALA A 1  1027 ? 181.495 243.225 186.758 1.00 87.88  ?  1027 ALA A CA    1 
ATOM   8042  C  C     . ALA A 1  1027 ? 180.843 244.229 185.783 1.00 92.27  ?  1027 ALA A C     1 
ATOM   8043  O  O     . ALA A 1  1027 ? 180.614 243.894 184.621 1.00 90.34  ?  1027 ALA A O     1 
ATOM   8044  C  CB    . ALA A 1  1027 ? 183.008 243.264 186.639 1.00 89.05  ?  1027 ALA A CB    1 
ATOM   8045  N  N     . THR A 1  1028 ? 180.507 245.433 186.273 1.00 91.47  ?  1028 THR A N     1 
ATOM   8046  C  CA    . THR A 1  1028 ? 179.831 246.499 185.516 1.00 92.65  ?  1028 THR A CA    1 
ATOM   8047  C  C     . THR A 1  1028 ? 180.304 246.698 184.075 1.00 97.83  ?  1028 THR A C     1 
ATOM   8048  O  O     . THR A 1  1028 ? 179.482 246.553 183.161 1.00 97.41  ?  1028 THR A O     1 
ATOM   8049  C  CB    . THR A 1  1028 ? 179.742 247.793 186.331 1.00 99.17  ?  1028 THR A CB    1 
ATOM   8050  O  OG1   . THR A 1  1028 ? 179.148 247.497 187.591 1.00 97.40  ?  1028 THR A OG1   1 
ATOM   8051  C  CG2   . THR A 1  1028 ? 178.904 248.852 185.648 1.00 98.91  ?  1028 THR A CG2   1 
ATOM   8052  N  N     . ARG A 1  1029 ? 181.612 247.012 183.871 1.00 95.16  ?  1029 ARG A N     1 
ATOM   8053  C  CA    . ARG A 1  1029 ? 182.180 247.237 182.533 1.00 95.77  ?  1029 ARG A CA    1 
ATOM   8054  C  C     . ARG A 1  1029 ? 181.867 246.088 181.591 1.00 97.47  ?  1029 ARG A C     1 
ATOM   8055  O  O     . ARG A 1  1029 ? 181.359 246.319 180.497 1.00 97.47  ?  1029 ARG A O     1 
ATOM   8056  C  CB    . ARG A 1  1029 ? 183.690 247.526 182.587 1.00 98.97  ?  1029 ARG A CB    1 
ATOM   8057  C  CG    . ARG A 1  1029 ? 184.316 247.813 181.216 1.00 111.27 ?  1029 ARG A CG    1 
ATOM   8058  C  CD    . ARG A 1  1029 ? 185.323 248.944 181.240 1.00 115.90 ?  1029 ARG A CD    1 
ATOM   8059  N  NE    . ARG A 1  1029 ? 184.886 250.026 180.361 1.00 121.95 ?  1029 ARG A NE    1 
ATOM   8060  C  CZ    . ARG A 1  1029 ? 184.701 251.281 180.748 1.00 142.98 ?  1029 ARG A CZ    1 
ATOM   8061  N  NH1   . ARG A 1  1029 ? 184.948 251.639 182.002 1.00 133.97 1  1029 ARG A NH1   1 
ATOM   8062  N  NH2   . ARG A 1  1029 ? 184.291 252.196 179.879 1.00 133.50 ?  1029 ARG A NH2   1 
ATOM   8063  N  N     . ARG A 1  1030 ? 182.104 244.856 182.056 1.00 92.14  ?  1030 ARG A N     1 
ATOM   8064  C  CA    . ARG A 1  1030 ? 181.839 243.616 181.330 1.00 90.38  ?  1030 ARG A CA    1 
ATOM   8065  C  C     . ARG A 1  1030 ? 180.357 243.518 180.873 1.00 91.19  ?  1030 ARG A C     1 
ATOM   8066  O  O     . ARG A 1  1030 ? 180.089 243.440 179.675 1.00 89.88  ?  1030 ARG A O     1 
ATOM   8067  C  CB    . ARG A 1  1030 ? 182.244 242.425 182.212 1.00 89.55  ?  1030 ARG A CB    1 
ATOM   8068  C  CG    . ARG A 1  1030 ? 182.427 241.132 181.458 1.00 100.66 ?  1030 ARG A CG    1 
ATOM   8069  C  CD    . ARG A 1  1030 ? 183.690 240.447 181.907 1.00 107.06 ?  1030 ARG A CD    1 
ATOM   8070  N  NE    . ARG A 1  1030 ? 184.209 239.556 180.876 1.00 106.30 ?  1030 ARG A NE    1 
ATOM   8071  C  CZ    . ARG A 1  1030 ? 184.586 238.307 181.101 1.00 113.37 ?  1030 ARG A CZ    1 
ATOM   8072  N  NH1   . ARG A 1  1030 ? 184.502 237.791 182.323 1.00 86.86  1  1030 ARG A NH1   1 
ATOM   8073  N  NH2   . ARG A 1  1030 ? 185.056 237.561 180.109 1.00 108.75 ?  1030 ARG A NH2   1 
ATOM   8074  N  N     . VAL A 1  1031 ? 179.416 243.604 181.822 1.00 86.50  ?  1031 VAL A N     1 
ATOM   8075  C  CA    . VAL A 1  1031 ? 177.977 243.517 181.584 1.00 85.94  ?  1031 VAL A CA    1 
ATOM   8076  C  C     . VAL A 1  1031 ? 177.497 244.499 180.513 1.00 91.86  ?  1031 VAL A C     1 
ATOM   8077  O  O     . VAL A 1  1031 ? 176.655 244.140 179.680 1.00 91.70  ?  1031 VAL A O     1 
ATOM   8078  C  CB    . VAL A 1  1031 ? 177.187 243.666 182.915 1.00 89.17  ?  1031 VAL A CB    1 
ATOM   8079  C  CG1   . VAL A 1  1031 ? 175.676 243.712 182.684 1.00 88.58  ?  1031 VAL A CG1   1 
ATOM   8080  C  CG2   . VAL A 1  1031 ? 177.541 242.546 183.885 1.00 87.76  ?  1031 VAL A CG2   1 
ATOM   8081  N  N     . LEU A 1  1032 ? 178.036 245.720 180.522 1.00 89.52  ?  1032 LEU A N     1 
ATOM   8082  C  CA    . LEU A 1  1032 ? 177.565 246.745 179.598 1.00 90.97  ?  1032 LEU A CA    1 
ATOM   8083  C  C     . LEU A 1  1032 ? 178.252 246.785 178.249 1.00 96.02  ?  1032 LEU A C     1 
ATOM   8084  O  O     . LEU A 1  1032 ? 177.577 246.888 177.217 1.00 95.74  ?  1032 LEU A O     1 
ATOM   8085  C  CB    . LEU A 1  1032 ? 177.592 248.141 180.250 1.00 92.11  ?  1032 LEU A CB    1 
ATOM   8086  C  CG    . LEU A 1  1032 ? 176.816 248.317 181.542 1.00 95.79  ?  1032 LEU A CG    1 
ATOM   8087  C  CD1   . LEU A 1  1032 ? 177.328 249.492 182.290 1.00 97.31  ?  1032 LEU A CD1   1 
ATOM   8088  C  CD2   . LEU A 1  1032 ? 175.340 248.498 181.281 1.00 97.19  ?  1032 LEU A CD2   1 
ATOM   8089  N  N     . GLN A 1  1033 ? 179.594 246.783 178.266 1.00 92.63  ?  1033 GLN A N     1 
ATOM   8090  C  CA    . GLN A 1  1033 ? 180.418 246.902 177.070 1.00 93.01  ?  1033 GLN A CA    1 
ATOM   8091  C  C     . GLN A 1  1033 ? 180.410 245.628 176.253 1.00 97.71  ?  1033 GLN A C     1 
ATOM   8092  O  O     . GLN A 1  1033 ? 180.182 245.682 175.038 1.00 98.09  ?  1033 GLN A O     1 
ATOM   8093  C  CB    . GLN A 1  1033 ? 181.842 247.292 177.458 1.00 94.41  ?  1033 GLN A CB    1 
ATOM   8094  C  CG    . GLN A 1  1033 ? 182.593 248.056 176.395 1.00 109.08 ?  1033 GLN A CG    1 
ATOM   8095  C  CD    . GLN A 1  1033 ? 183.785 248.732 177.011 1.00 141.99 ?  1033 GLN A CD    1 
ATOM   8096  O  OE1   . GLN A 1  1033 ? 183.939 249.958 176.943 1.00 141.74 ?  1033 GLN A OE1   1 
ATOM   8097  N  NE2   . GLN A 1  1033 ? 184.634 247.952 177.676 1.00 140.51 ?  1033 GLN A NE2   1 
ATOM   8098  N  N     . GLU A 1  1034 ? 180.654 244.484 176.925 1.00 93.33  ?  1034 GLU A N     1 
ATOM   8099  C  CA    . GLU A 1  1034 ? 180.709 243.174 176.300 1.00 92.01  ?  1034 GLU A CA    1 
ATOM   8100  C  C     . GLU A 1  1034 ? 179.302 242.600 176.073 1.00 96.60  ?  1034 GLU A C     1 
ATOM   8101  O  O     . GLU A 1  1034 ? 178.819 242.611 174.937 1.00 97.51  ?  1034 GLU A O     1 
ATOM   8102  C  CB    . GLU A 1  1034 ? 181.612 242.208 177.100 1.00 91.96  ?  1034 GLU A CB    1 
ATOM   8103  C  CG    . GLU A 1  1034 ? 183.079 242.592 177.113 1.00 100.02 ?  1034 GLU A CG    1 
ATOM   8104  C  CD    . GLU A 1  1034 ? 183.889 241.916 178.201 1.00 125.15 ?  1034 GLU A CD    1 
ATOM   8105  O  OE1   . GLU A 1  1034 ? 184.046 240.675 178.147 1.00 120.20 ?  1034 GLU A OE1   1 
ATOM   8106  O  OE2   . GLU A 1  1034 ? 184.384 242.635 179.102 1.00 123.61 -1 1034 GLU A OE2   1 
ATOM   8107  N  N     . TYR A 1  1035 ? 178.631 242.161 177.154 1.00 91.87  ?  1035 TYR A N     1 
ATOM   8108  C  CA    . TYR A 1  1035 ? 177.315 241.519 177.110 1.00 90.76  ?  1035 TYR A CA    1 
ATOM   8109  C  C     . TYR A 1  1035 ? 176.186 242.383 176.559 1.00 93.57  ?  1035 TYR A C     1 
ATOM   8110  O  O     . TYR A 1  1035 ? 175.241 241.841 175.962 1.00 92.30  ?  1035 TYR A O     1 
ATOM   8111  C  CB    . TYR A 1  1035 ? 176.937 240.909 178.475 1.00 91.47  ?  1035 TYR A CB    1 
ATOM   8112  C  CG    . TYR A 1  1035 ? 178.031 240.122 179.165 1.00 93.69  ?  1035 TYR A CG    1 
ATOM   8113  C  CD1   . TYR A 1  1035 ? 179.009 239.450 178.431 1.00 96.20  ?  1035 TYR A CD1   1 
ATOM   8114  C  CD2   . TYR A 1  1035 ? 178.068 240.010 180.548 1.00 94.42  ?  1035 TYR A CD2   1 
ATOM   8115  C  CE1   . TYR A 1  1035 ? 180.037 238.747 179.062 1.00 97.72  ?  1035 TYR A CE1   1 
ATOM   8116  C  CE2   . TYR A 1  1035 ? 179.080 239.295 181.189 1.00 95.25  ?  1035 TYR A CE2   1 
ATOM   8117  C  CZ    . TYR A 1  1035 ? 180.060 238.656 180.443 1.00 104.14 ?  1035 TYR A CZ    1 
ATOM   8118  O  OH    . TYR A 1  1035 ? 181.065 237.943 181.061 1.00 104.64 ?  1035 TYR A OH    1 
ATOM   8119  N  N     . ARG A 1  1036 ? 176.283 243.719 176.757 1.00 89.80  ?  1036 ARG A N     1 
ATOM   8120  C  CA    . ARG A 1  1036 ? 175.284 244.688 176.314 1.00 90.21  ?  1036 ARG A CA    1 
ATOM   8121  C  C     . ARG A 1  1036 ? 173.871 244.344 176.855 1.00 92.79  ?  1036 ARG A C     1 
ATOM   8122  O  O     . ARG A 1  1036 ? 172.869 244.595 176.176 1.00 92.70  ?  1036 ARG A O     1 
ATOM   8123  C  CB    . ARG A 1  1036 ? 175.295 244.818 174.771 1.00 90.91  ?  1036 ARG A CB    1 
ATOM   8124  C  CG    . ARG A 1  1036 ? 176.202 245.900 174.213 1.00 104.64 ?  1036 ARG A CG    1 
ATOM   8125  C  CD    . ARG A 1  1036 ? 175.724 247.323 174.532 1.00 119.42 ?  1036 ARG A CD    1 
ATOM   8126  N  NE    . ARG A 1  1036 ? 176.241 248.343 173.613 1.00 134.43 ?  1036 ARG A NE    1 
ATOM   8127  C  CZ    . ARG A 1  1036 ? 177.532 248.593 173.380 1.00 150.70 ?  1036 ARG A CZ    1 
ATOM   8128  N  NH1   . ARG A 1  1036 ? 178.476 247.859 173.960 1.00 130.56 1  1036 ARG A NH1   1 
ATOM   8129  N  NH2   . ARG A 1  1036 ? 177.887 249.559 172.542 1.00 142.29 ?  1036 ARG A NH2   1 
ATOM   8130  N  N     . LEU A 1  1037 ? 173.798 243.778 178.081 1.00 87.84  ?  1037 LEU A N     1 
ATOM   8131  C  CA    . LEU A 1  1037 ? 172.531 243.355 178.688 1.00 86.87  ?  1037 LEU A CA    1 
ATOM   8132  C  C     . LEU A 1  1037 ? 171.599 244.480 179.054 1.00 92.72  ?  1037 LEU A C     1 
ATOM   8133  O  O     . LEU A 1  1037 ? 172.053 245.526 179.504 1.00 93.68  ?  1037 LEU A O     1 
ATOM   8134  C  CB    . LEU A 1  1037 ? 172.741 242.471 179.934 1.00 85.42  ?  1037 LEU A CB    1 
ATOM   8135  C  CG    . LEU A 1  1037 ? 173.477 241.138 179.789 1.00 88.09  ?  1037 LEU A CG    1 
ATOM   8136  C  CD1   . LEU A 1  1037 ? 173.265 240.285 181.015 1.00 86.94  ?  1037 LEU A CD1   1 
ATOM   8137  C  CD2   . LEU A 1  1037 ? 173.069 240.381 178.534 1.00 88.39  ?  1037 LEU A CD2   1 
ATOM   8138  N  N     . THR A 1  1038 ? 170.287 244.239 178.914 1.00 89.82  ?  1038 THR A N     1 
ATOM   8139  C  CA    . THR A 1  1038 ? 169.243 245.175 179.335 1.00 90.93  ?  1038 THR A CA    1 
ATOM   8140  C  C     . THR A 1  1038 ? 168.955 244.825 180.796 1.00 94.74  ?  1038 THR A C     1 
ATOM   8141  O  O     . THR A 1  1038 ? 169.479 243.812 181.284 1.00 93.73  ?  1038 THR A O     1 
ATOM   8142  C  CB    . THR A 1  1038 ? 167.987 245.063 178.447 1.00 101.83 ?  1038 THR A CB    1 
ATOM   8143  O  OG1   . THR A 1  1038 ? 167.142 243.991 178.878 1.00 102.72 ?  1038 THR A OG1   1 
ATOM   8144  C  CG2   . THR A 1  1038 ? 168.320 244.940 176.969 1.00 101.70 ?  1038 THR A CG2   1 
ATOM   8145  N  N     . LYS A 1  1039 ? 168.136 245.627 181.496 1.00 91.71  ?  1039 LYS A N     1 
ATOM   8146  C  CA    . LYS A 1  1039 ? 167.805 245.328 182.888 1.00 91.25  ?  1039 LYS A CA    1 
ATOM   8147  C  C     . LYS A 1  1039 ? 167.100 243.967 183.006 1.00 97.01  ?  1039 LYS A C     1 
ATOM   8148  O  O     . LYS A 1  1039 ? 167.540 243.130 183.807 1.00 96.76  ?  1039 LYS A O     1 
ATOM   8149  C  CB    . LYS A 1  1039 ? 167.036 246.487 183.542 1.00 93.80  ?  1039 LYS A CB    1 
ATOM   8150  C  CG    . LYS A 1  1039 ? 166.121 246.141 184.711 1.00 95.87  ?  1039 LYS A CG    1 
ATOM   8151  C  CD    . LYS A 1  1039 ? 166.840 246.039 186.027 1.00 100.38 ?  1039 LYS A CD    1 
ATOM   8152  C  CE    . LYS A 1  1039 ? 165.852 246.059 187.163 1.00 112.05 ?  1039 LYS A CE    1 
ATOM   8153  N  NZ    . LYS A 1  1039 ? 166.326 245.248 188.319 1.00 122.28 1  1039 LYS A NZ    1 
ATOM   8154  N  N     . GLN A 1  1040 ? 166.078 243.710 182.156 1.00 93.64  ?  1040 GLN A N     1 
ATOM   8155  C  CA    . GLN A 1  1040 ? 165.357 242.436 182.188 1.00 92.03  ?  1040 GLN A CA    1 
ATOM   8156  C  C     . GLN A 1  1040 ? 166.238 241.245 181.871 1.00 94.47  ?  1040 GLN A C     1 
ATOM   8157  O  O     . GLN A 1  1040 ? 166.093 240.192 182.507 1.00 94.43  ?  1040 GLN A O     1 
ATOM   8158  C  CB    . GLN A 1  1040 ? 164.087 242.451 181.322 1.00 93.77  ?  1040 GLN A CB    1 
ATOM   8159  C  CG    . GLN A 1  1040 ? 164.299 242.527 179.808 1.00 105.97 ?  1040 GLN A CG    1 
ATOM   8160  C  CD    . GLN A 1  1040 ? 163.116 242.015 179.015 1.00 115.29 ?  1040 GLN A CD    1 
ATOM   8161  O  OE1   . GLN A 1  1040 ? 162.195 241.351 179.530 1.00 101.69 ?  1040 GLN A OE1   1 
ATOM   8162  N  NE2   . GLN A 1  1040 ? 163.160 242.257 177.716 1.00 112.10 ?  1040 GLN A NE2   1 
ATOM   8163  N  N     . ALA A 1  1041 ? 167.158 241.418 180.901 1.00 89.35  ?  1041 ALA A N     1 
ATOM   8164  C  CA    . ALA A 1  1041 ? 168.110 240.391 180.491 1.00 87.74  ?  1041 ALA A CA    1 
ATOM   8165  C  C     . ALA A 1  1041 ? 168.959 239.991 181.714 1.00 90.58  ?  1041 ALA A C     1 
ATOM   8166  O  O     . ALA A 1  1041 ? 169.057 238.798 182.043 1.00 88.42  ?  1041 ALA A O     1 
ATOM   8167  C  CB    . ALA A 1  1041 ? 168.998 240.932 179.380 1.00 89.05  ?  1041 ALA A CB    1 
ATOM   8168  N  N     . PHE A 1  1042 ? 169.497 241.024 182.423 1.00 86.93  ?  1042 PHE A N     1 
ATOM   8169  C  CA    . PHE A 1  1042 ? 170.324 240.915 183.618 1.00 85.29  ?  1042 PHE A CA    1 
ATOM   8170  C  C     . PHE A 1  1042 ? 169.548 240.271 184.754 1.00 88.46  ?  1042 PHE A C     1 
ATOM   8171  O  O     . PHE A 1  1042 ? 170.043 239.321 185.362 1.00 88.05  ?  1042 PHE A O     1 
ATOM   8172  C  CB    . PHE A 1  1042 ? 170.842 242.295 184.029 1.00 87.72  ?  1042 PHE A CB    1 
ATOM   8173  C  CG    . PHE A 1  1042 ? 171.742 242.294 185.240 1.00 88.74  ?  1042 PHE A CG    1 
ATOM   8174  C  CD1   . PHE A 1  1042 ? 173.099 242.009 185.120 1.00 91.31  ?  1042 PHE A CD1   1 
ATOM   8175  C  CD2   . PHE A 1  1042 ? 171.243 242.604 186.499 1.00 90.64  ?  1042 PHE A CD2   1 
ATOM   8176  C  CE1   . PHE A 1  1042 ? 173.937 242.024 186.241 1.00 91.81  ?  1042 PHE A CE1   1 
ATOM   8177  C  CE2   . PHE A 1  1042 ? 172.085 242.628 187.619 1.00 93.09  ?  1042 PHE A CE2   1 
ATOM   8178  C  CZ    . PHE A 1  1042 ? 173.424 242.331 187.483 1.00 90.79  ?  1042 PHE A CZ    1 
ATOM   8179  N  N     . ASP A 1  1043 ? 168.328 240.767 185.020 1.00 84.37  ?  1043 ASP A N     1 
ATOM   8180  C  CA    . ASP A 1  1043 ? 167.451 240.257 186.070 1.00 83.28  ?  1043 ASP A CA    1 
ATOM   8181  C  C     . ASP A 1  1043 ? 167.232 238.745 185.926 1.00 85.05  ?  1043 ASP A C     1 
ATOM   8182  O  O     . ASP A 1  1043 ? 167.274 238.007 186.918 1.00 82.58  ?  1043 ASP A O     1 
ATOM   8183  C  CB    . ASP A 1  1043 ? 166.119 241.026 186.039 1.00 85.91  ?  1043 ASP A CB    1 
ATOM   8184  C  CG    . ASP A 1  1043 ? 166.064 242.317 186.852 1.00 97.29  ?  1043 ASP A CG    1 
ATOM   8185  O  OD1   . ASP A 1  1043 ? 167.113 242.714 187.423 1.00 100.20 ?  1043 ASP A OD1   1 
ATOM   8186  O  OD2   . ASP A 1  1043 ? 164.963 242.911 186.951 1.00 99.22  -1 1043 ASP A OD2   1 
ATOM   8187  N  N     . TRP A 1  1044 ? 167.077 238.302 184.664 1.00 82.54  ?  1044 TRP A N     1 
ATOM   8188  C  CA    . TRP A 1  1044 ? 166.884 236.919 184.247 1.00 82.05  ?  1044 TRP A CA    1 
ATOM   8189  C  C     . TRP A 1  1044 ? 168.160 236.100 184.437 1.00 82.36  ?  1044 TRP A C     1 
ATOM   8190  O  O     . TRP A 1  1044 ? 168.086 234.991 184.968 1.00 80.28  ?  1044 TRP A O     1 
ATOM   8191  C  CB    . TRP A 1  1044 ? 166.430 236.901 182.789 1.00 82.35  ?  1044 TRP A CB    1 
ATOM   8192  C  CG    . TRP A 1  1044 ? 166.120 235.551 182.194 1.00 83.45  ?  1044 TRP A CG    1 
ATOM   8193  C  CD1   . TRP A 1  1044 ? 164.909 234.918 182.188 1.00 86.05  ?  1044 TRP A CD1   1 
ATOM   8194  C  CD2   . TRP A 1  1044 ? 166.982 234.769 181.353 1.00 83.17  ?  1044 TRP A CD2   1 
ATOM   8195  N  NE1   . TRP A 1  1044 ? 164.979 233.766 181.439 1.00 84.71  ?  1044 TRP A NE1   1 
ATOM   8196  C  CE2   . TRP A 1  1044 ? 166.231 233.664 180.894 1.00 86.15  ?  1044 TRP A CE2   1 
ATOM   8197  C  CE3   . TRP A 1  1044 ? 168.326 234.888 180.951 1.00 84.75  ?  1044 TRP A CE3   1 
ATOM   8198  C  CZ2   . TRP A 1  1044 ? 166.775 232.690 180.052 1.00 84.87  ?  1044 TRP A CZ2   1 
ATOM   8199  C  CZ3   . TRP A 1  1044 ? 168.866 233.908 180.131 1.00 85.39  ?  1044 TRP A CZ3   1 
ATOM   8200  C  CH2   . TRP A 1  1044 ? 168.086 232.847 179.663 1.00 85.16  ?  1044 TRP A CH2   1 
ATOM   8201  N  N     . VAL A 1  1045 ? 169.326 236.645 184.007 1.00 78.01  ?  1045 VAL A N     1 
ATOM   8202  C  CA    . VAL A 1  1045 ? 170.649 236.007 184.158 1.00 75.96  ?  1045 VAL A CA    1 
ATOM   8203  C  C     . VAL A 1  1045 ? 170.887 235.697 185.632 1.00 77.48  ?  1045 VAL A C     1 
ATOM   8204  O  O     . VAL A 1  1045 ? 171.263 234.577 185.978 1.00 75.21  ?  1045 VAL A O     1 
ATOM   8205  C  CB    . VAL A 1  1045 ? 171.790 236.862 183.538 1.00 79.59  ?  1045 VAL A CB    1 
ATOM   8206  C  CG1   . VAL A 1  1045 ? 173.131 236.590 184.198 1.00 78.47  ?  1045 VAL A CG1   1 
ATOM   8207  C  CG2   . VAL A 1  1045 ? 171.889 236.626 182.045 1.00 79.48  ?  1045 VAL A CG2   1 
ATOM   8208  N  N     . LEU A 1  1046 ? 170.592 236.674 186.495 1.00 74.36  ?  1046 LEU A N     1 
ATOM   8209  C  CA    . LEU A 1  1046 ? 170.744 236.521 187.927 1.00 73.65  ?  1046 LEU A CA    1 
ATOM   8210  C  C     . LEU A 1  1046 ? 169.883 235.407 188.473 1.00 76.50  ?  1046 LEU A C     1 
ATOM   8211  O  O     . LEU A 1  1046 ? 170.430 234.492 189.086 1.00 74.89  ?  1046 LEU A O     1 
ATOM   8212  C  CB    . LEU A 1  1046 ? 170.480 237.831 188.664 1.00 74.45  ?  1046 LEU A CB    1 
ATOM   8213  C  CG    . LEU A 1  1046 ? 171.492 238.959 188.522 1.00 78.94  ?  1046 LEU A CG    1 
ATOM   8214  C  CD1   . LEU A 1  1046 ? 171.420 239.853 189.726 1.00 79.71  ?  1046 LEU A CD1   1 
ATOM   8215  C  CD2   . LEU A 1  1046 ? 172.918 238.444 188.360 1.00 79.19  ?  1046 LEU A CD2   1 
ATOM   8216  N  N     . SER A 1  1047 ? 168.570 235.426 188.191 1.00 74.08  ?  1047 SER A N     1 
ATOM   8217  C  CA    . SER A 1  1047 ? 167.672 234.361 188.659 1.00 74.26  ?  1047 SER A CA    1 
ATOM   8218  C  C     . SER A 1  1047 ? 168.136 232.922 188.242 1.00 77.00  ?  1047 SER A C     1 
ATOM   8219  O  O     . SER A 1  1047 ? 168.036 231.955 189.027 1.00 74.23  ?  1047 SER A O     1 
ATOM   8220  C  CB    . SER A 1  1047 ? 166.241 234.627 188.201 1.00 79.15  ?  1047 SER A CB    1 
ATOM   8221  O  OG    . SER A 1  1047 ? 165.798 233.689 187.231 1.00 90.20  ?  1047 SER A OG    1 
ATOM   8222  N  N     . ASN A 1  1048 ? 168.637 232.818 186.992 1.00 73.93  ?  1048 ASN A N     1 
ATOM   8223  C  CA    . ASN A 1  1048 ? 169.107 231.577 186.405 1.00 72.44  ?  1048 ASN A CA    1 
ATOM   8224  C  C     . ASN A 1  1048 ? 170.369 231.070 187.048 1.00 75.37  ?  1048 ASN A C     1 
ATOM   8225  O  O     . ASN A 1  1048 ? 170.428 229.881 187.346 1.00 74.58  ?  1048 ASN A O     1 
ATOM   8226  C  CB    . ASN A 1  1048 ? 169.186 231.669 184.897 1.00 72.83  ?  1048 ASN A CB    1 
ATOM   8227  C  CG    . ASN A 1  1048 ? 167.855 231.349 184.274 1.00 100.61 ?  1048 ASN A CG    1 
ATOM   8228  O  OD1   . ASN A 1  1048 ? 167.543 230.182 184.020 1.00 103.51 ?  1048 ASN A OD1   1 
ATOM   8229  N  ND2   . ASN A 1  1048 ? 167.007 232.359 184.091 1.00 89.45  ?  1048 ASN A ND2   1 
ATOM   8230  N  N     . ILE A 1  1049 ? 171.341 231.960 187.352 1.00 71.58  ?  1049 ILE A N     1 
ATOM   8231  C  CA    . ILE A 1  1049 ? 172.559 231.559 188.069 1.00 70.39  ?  1049 ILE A CA    1 
ATOM   8232  C  C     . ILE A 1  1049 ? 172.093 230.935 189.381 1.00 73.61  ?  1049 ILE A C     1 
ATOM   8233  O  O     . ILE A 1  1049 ? 172.481 229.810 189.663 1.00 72.03  ?  1049 ILE A O     1 
ATOM   8234  C  CB    . ILE A 1  1049 ? 173.566 232.730 188.316 1.00 73.84  ?  1049 ILE A CB    1 
ATOM   8235  C  CG1   . ILE A 1  1049 ? 174.180 233.222 187.013 1.00 74.22  ?  1049 ILE A CG1   1 
ATOM   8236  C  CG2   . ILE A 1  1049 ? 174.682 232.299 189.265 1.00 73.80  ?  1049 ILE A CG2   1 
ATOM   8237  C  CD1   . ILE A 1  1049 ? 174.573 234.562 187.047 1.00 80.31  ?  1049 ILE A CD1   1 
ATOM   8238  N  N     . GLU A 1  1050 ? 171.198 231.639 190.131 1.00 71.16  ?  1050 GLU A N     1 
ATOM   8239  C  CA    . GLU A 1  1050 ? 170.649 231.182 191.406 1.00 70.60  ?  1050 GLU A CA    1 
ATOM   8240  C  C     . GLU A 1  1050 ? 170.053 229.790 191.261 1.00 74.69  ?  1050 GLU A C     1 
ATOM   8241  O  O     . GLU A 1  1050 ? 170.554 228.849 191.875 1.00 73.44  ?  1050 GLU A O     1 
ATOM   8242  C  CB    . GLU A 1  1050 ? 169.604 232.167 191.975 1.00 72.55  ?  1050 GLU A CB    1 
ATOM   8243  C  CG    . GLU A 1  1050 ? 169.523 232.068 193.492 1.00 85.63  ?  1050 GLU A CG    1 
ATOM   8244  C  CD    . GLU A 1  1050 ? 168.269 232.528 194.214 1.00 112.96 ?  1050 GLU A CD    1 
ATOM   8245  O  OE1   . GLU A 1  1050 ? 167.566 233.426 193.699 1.00 116.13 ?  1050 GLU A OE1   1 
ATOM   8246  O  OE2   . GLU A 1  1050 ? 168.039 232.040 195.345 1.00 109.32 -1 1050 GLU A OE2   1 
ATOM   8247  N  N     . ALA A 1  1051 ? 169.025 229.649 190.406 1.00 71.71  ?  1051 ALA A N     1 
ATOM   8248  C  CA    . ALA A 1  1051 ? 168.346 228.378 190.165 1.00 69.99  ?  1051 ALA A CA    1 
ATOM   8249  C  C     . ALA A 1  1051 ? 169.319 227.244 189.873 1.00 69.73  ?  1051 ALA A C     1 
ATOM   8250  O  O     . ALA A 1  1051 ? 169.285 226.217 190.557 1.00 68.58  ?  1051 ALA A O     1 
ATOM   8251  C  CB    . ALA A 1  1051 ? 167.378 228.533 189.019 1.00 71.17  ?  1051 ALA A CB    1 
ATOM   8252  N  N     . GLN A 1  1052 ? 170.215 227.466 188.894 1.00 64.48  ?  1052 GLN A N     1 
ATOM   8253  C  CA    . GLN A 1  1052 ? 171.214 226.494 188.460 1.00 63.43  ?  1052 GLN A CA    1 
ATOM   8254  C  C     . GLN A 1  1052 ? 172.121 226.088 189.604 1.00 68.63  ?  1052 GLN A C     1 
ATOM   8255  O  O     . GLN A 1  1052 ? 172.213 224.898 189.913 1.00 68.12  ?  1052 GLN A O     1 
ATOM   8256  C  CB    . GLN A 1  1052 ? 171.980 226.972 187.209 1.00 64.75  ?  1052 GLN A CB    1 
ATOM   8257  C  CG    . GLN A 1  1052 ? 171.136 226.876 185.928 1.00 72.78  ?  1052 GLN A CG    1 
ATOM   8258  C  CD    . GLN A 1  1052 ? 171.744 227.470 184.673 1.00 94.60  ?  1052 GLN A CD    1 
ATOM   8259  O  OE1   . GLN A 1  1052 ? 172.970 227.513 184.466 1.00 87.67  ?  1052 GLN A OE1   1 
ATOM   8260  N  NE2   . GLN A 1  1052 ? 170.871 227.876 183.761 1.00 94.87  ?  1052 GLN A NE2   1 
ATOM   8261  N  N     . PHE A 1  1053 ? 172.688 227.079 190.303 1.00 66.62  ?  1053 PHE A N     1 
ATOM   8262  C  CA    . PHE A 1  1053 ? 173.540 226.882 191.465 1.00 66.18  ?  1053 PHE A CA    1 
ATOM   8263  C  C     . PHE A 1  1053 ? 172.844 225.971 192.476 1.00 69.06  ?  1053 PHE A C     1 
ATOM   8264  O  O     . PHE A 1  1053 ? 173.407 224.958 192.855 1.00 69.55  ?  1053 PHE A O     1 
ATOM   8265  C  CB    . PHE A 1  1053 ? 173.936 228.229 192.097 1.00 69.32  ?  1053 PHE A CB    1 
ATOM   8266  C  CG    . PHE A 1  1053 ? 174.842 228.018 193.269 1.00 72.41  ?  1053 PHE A CG    1 
ATOM   8267  C  CD1   . PHE A 1  1053 ? 174.320 227.793 194.539 1.00 76.11  ?  1053 PHE A CD1   1 
ATOM   8268  C  CD2   . PHE A 1  1053 ? 176.218 227.931 193.093 1.00 77.55  ?  1053 PHE A CD2   1 
ATOM   8269  C  CE1   . PHE A 1  1053 ? 175.161 227.488 195.616 1.00 79.95  ?  1053 PHE A CE1   1 
ATOM   8270  C  CE2   . PHE A 1  1053 ? 177.061 227.638 194.173 1.00 79.23  ?  1053 PHE A CE2   1 
ATOM   8271  C  CZ    . PHE A 1  1053 ? 176.525 227.410 195.424 1.00 78.55  ?  1053 PHE A CZ    1 
ATOM   8272  N  N     . LEU A 1  1054 ? 171.616 226.286 192.863 1.00 64.24  ?  1054 LEU A N     1 
ATOM   8273  C  CA    . LEU A 1  1054 ? 170.882 225.489 193.828 1.00 63.22  ?  1054 LEU A CA    1 
ATOM   8274  C  C     . LEU A 1  1054 ? 170.690 224.029 193.394 1.00 68.34  ?  1054 LEU A C     1 
ATOM   8275  O  O     . LEU A 1  1054 ? 170.968 223.116 194.188 1.00 66.18  ?  1054 LEU A O     1 
ATOM   8276  C  CB    . LEU A 1  1054 ? 169.579 226.184 194.162 1.00 63.31  ?  1054 LEU A CB    1 
ATOM   8277  C  CG    . LEU A 1  1054 ? 169.767 227.521 194.848 1.00 68.61  ?  1054 LEU A CG    1 
ATOM   8278  C  CD1   . LEU A 1  1054 ? 168.630 228.453 194.543 1.00 69.53  ?  1054 LEU A CD1   1 
ATOM   8279  C  CD2   . LEU A 1  1054 ? 170.027 227.359 196.352 1.00 71.19  ?  1054 LEU A CD2   1 
ATOM   8280  N  N     . ARG A 1  1055 ? 170.322 223.814 192.099 1.00 67.18  ?  1055 ARG A N     1 
ATOM   8281  C  CA    . ARG A 1  1055 ? 170.167 222.481 191.480 1.00 66.91  ?  1055 ARG A CA    1 
ATOM   8282  C  C     . ARG A 1  1055 ? 171.481 221.707 191.519 1.00 70.90  ?  1055 ARG A C     1 
ATOM   8283  O  O     . ARG A 1  1055 ? 171.476 220.469 191.675 1.00 70.14  ?  1055 ARG A O     1 
ATOM   8284  C  CB    . ARG A 1  1055 ? 169.711 222.602 190.025 1.00 67.81  ?  1055 ARG A CB    1 
ATOM   8285  C  CG    . ARG A 1  1055 ? 168.277 223.073 189.919 1.00 83.58  ?  1055 ARG A CG    1 
ATOM   8286  C  CD    . ARG A 1  1055 ? 167.676 222.804 188.563 1.00 97.62  ?  1055 ARG A CD    1 
ATOM   8287  N  NE    . ARG A 1  1055 ? 166.925 223.972 188.111 1.00 115.24 ?  1055 ARG A NE    1 
ATOM   8288  C  CZ    . ARG A 1  1055 ? 167.358 224.824 187.189 1.00 137.15 ?  1055 ARG A CZ    1 
ATOM   8289  N  NH1   . ARG A 1  1055 ? 168.521 224.618 186.577 1.00 128.30 1  1055 ARG A NH1   1 
ATOM   8290  N  NH2   . ARG A 1  1055 ? 166.617 225.871 186.845 1.00 124.34 ?  1055 ARG A NH2   1 
ATOM   8291  N  N     . SER A 1  1056 ? 172.604 222.478 191.419 1.00 66.40  ?  1056 SER A N     1 
ATOM   8292  C  CA    . SER A 1  1056 ? 173.980 222.008 191.412 1.00 64.88  ?  1056 SER A CA    1 
ATOM   8293  C  C     . SER A 1  1056 ? 174.493 221.375 192.711 1.00 69.81  ?  1056 SER A C     1 
ATOM   8294  O  O     . SER A 1  1056 ? 175.383 220.526 192.631 1.00 69.95  ?  1056 SER A O     1 
ATOM   8295  C  CB    . SER A 1  1056 ? 174.925 223.072 190.864 1.00 66.51  ?  1056 SER A CB    1 
ATOM   8296  O  OG    . SER A 1  1056 ? 174.821 223.225 189.455 1.00 72.22  ?  1056 SER A OG    1 
ATOM   8297  N  N     . VAL A 1  1057 ? 173.908 221.710 193.889 1.00 66.47  ?  1057 VAL A N     1 
ATOM   8298  C  CA    . VAL A 1  1057 ? 174.338 221.133 195.189 1.00 65.78  ?  1057 VAL A CA    1 
ATOM   8299  C  C     . VAL A 1  1057 ? 174.076 219.595 195.274 1.00 72.07  ?  1057 VAL A C     1 
ATOM   8300  O  O     . VAL A 1  1057 ? 173.114 219.127 194.630 1.00 72.24  ?  1057 VAL A O     1 
ATOM   8301  C  CB    . VAL A 1  1057 ? 173.713 221.917 196.372 1.00 68.22  ?  1057 VAL A CB    1 
ATOM   8302  C  CG1   . VAL A 1  1057 ? 173.945 221.210 197.701 1.00 67.61  ?  1057 VAL A CG1   1 
ATOM   8303  C  CG2   . VAL A 1  1057 ? 174.238 223.349 196.430 1.00 68.44  ?  1057 VAL A CG2   1 
ATOM   8304  N  N     . VAL A 1  1058 ? 174.943 218.816 196.037 1.00 69.14  ?  1058 VAL A N     1 
ATOM   8305  C  CA    . VAL A 1  1058 ? 174.793 217.342 196.257 1.00 68.84  ?  1058 VAL A CA    1 
ATOM   8306  C  C     . VAL A 1  1058 ? 173.507 217.050 197.023 1.00 75.16  ?  1058 VAL A C     1 
ATOM   8307  O  O     . VAL A 1  1058 ? 173.126 217.837 197.909 1.00 76.65  ?  1058 VAL A O     1 
ATOM   8308  C  CB    . VAL A 1  1058 ? 175.934 216.623 197.022 1.00 71.69  ?  1058 VAL A CB    1 
ATOM   8309  C  CG1   . VAL A 1  1058 ? 176.286 215.299 196.381 1.00 70.13  ?  1058 VAL A CG1   1 
ATOM   8310  C  CG2   . VAL A 1  1058 ? 177.150 217.487 197.198 1.00 72.43  ?  1058 VAL A CG2   1 
ATOM   8311  N  N     . HIS A 1  1059 ? 172.890 215.884 196.749 1.00 70.22  ?  1059 HIS A N     1 
ATOM   8312  C  CA    . HIS A 1  1059 ? 171.662 215.492 197.427 1.00 70.01  ?  1059 HIS A CA    1 
ATOM   8313  C  C     . HIS A 1  1059 ? 171.930 214.618 198.659 1.00 71.41  ?  1059 HIS A C     1 
ATOM   8314  O  O     . HIS A 1  1059 ? 172.453 213.513 198.489 1.00 71.25  ?  1059 HIS A O     1 
ATOM   8315  C  CB    . HIS A 1  1059 ? 170.755 214.729 196.464 1.00 71.24  ?  1059 HIS A CB    1 
ATOM   8316  C  CG    . HIS A 1  1059 ? 170.126 215.571 195.409 1.00 76.12  ?  1059 HIS A CG    1 
ATOM   8317  N  ND1   . HIS A 1  1059 ? 168.767 215.518 195.175 1.00 78.36  ?  1059 HIS A ND1   1 
ATOM   8318  C  CD2   . HIS A 1  1059 ? 170.693 216.427 194.525 1.00 79.68  ?  1059 HIS A CD2   1 
ATOM   8319  C  CE1   . HIS A 1  1059 ? 168.542 216.359 194.178 1.00 78.89  ?  1059 HIS A CE1   1 
ATOM   8320  N  NE2   . HIS A 1  1059 ? 169.670 216.940 193.760 1.00 79.80  ?  1059 HIS A NE2   1 
ATOM   8321  N  N     . PRO A 1  1060 ? 171.539 215.025 199.895 1.00 65.30  ?  1060 PRO A N     1 
ATOM   8322  C  CA    . PRO A 1  1060 ? 171.728 214.133 201.042 1.00 64.16  ?  1060 PRO A CA    1 
ATOM   8323  C  C     . PRO A 1  1060 ? 171.083 212.780 200.755 1.00 67.24  ?  1060 PRO A C     1 
ATOM   8324  O  O     . PRO A 1  1060 ? 169.916 212.679 200.332 1.00 66.72  ?  1060 PRO A O     1 
ATOM   8325  C  CB    . PRO A 1  1060 ? 171.054 214.889 202.173 1.00 66.14  ?  1060 PRO A CB    1 
ATOM   8326  C  CG    . PRO A 1  1060 ? 171.198 216.298 201.787 1.00 71.34  ?  1060 PRO A CG    1 
ATOM   8327  C  CD    . PRO A 1  1060 ? 170.916 216.286 200.324 1.00 66.73  ?  1060 PRO A CD    1 
ATOM   8328  N  N     . GLY A 1  1061 ? 171.918 211.762 200.878 1.00 63.15  ?  1061 GLY A N     1 
ATOM   8329  C  CA    . GLY A 1  1061 ? 171.586 210.386 200.549 1.00 62.40  ?  1061 GLY A CA    1 
ATOM   8330  C  C     . GLY A 1  1061 ? 172.611 209.847 199.569 1.00 66.81  ?  1061 GLY A C     1 
ATOM   8331  O  O     . GLY A 1  1061 ? 172.867 208.632 199.546 1.00 65.95  ?  1061 GLY A O     1 
ATOM   8332  N  N     . GLU A 1  1062 ? 173.247 210.772 198.769 1.00 63.41  ?  1062 GLU A N     1 
ATOM   8333  C  CA    . GLU A 1  1062 ? 174.248 210.404 197.766 1.00 62.49  ?  1062 GLU A CA    1 
ATOM   8334  C  C     . GLU A 1  1062 ? 175.287 209.554 198.375 1.00 67.15  ?  1062 GLU A C     1 
ATOM   8335  O  O     . GLU A 1  1062 ? 175.894 209.945 199.368 1.00 67.94  ?  1062 GLU A O     1 
ATOM   8336  C  CB    . GLU A 1  1062 ? 174.874 211.598 197.037 1.00 64.00  ?  1062 GLU A CB    1 
ATOM   8337  C  CG    . GLU A 1  1062 ? 174.286 211.825 195.648 1.00 77.93  ?  1062 GLU A CG    1 
ATOM   8338  C  CD    . GLU A 1  1062 ? 174.948 211.114 194.479 1.00 111.45 ?  1062 GLU A CD    1 
ATOM   8339  O  OE1   . GLU A 1  1062 ? 175.067 209.866 194.509 1.00 118.87 ?  1062 GLU A OE1   1 
ATOM   8340  O  OE2   . GLU A 1  1062 ? 175.315 211.813 193.507 1.00 105.17 -1 1062 GLU A OE2   1 
ATOM   8341  N  N     . MET A 1  1063 ? 175.423 208.345 197.838 1.00 63.14  ?  1063 MET A N     1 
ATOM   8342  C  CA    . MET A 1  1063 ? 176.403 207.372 198.286 1.00 62.50  ?  1063 MET A CA    1 
ATOM   8343  C  C     . MET A 1  1063 ? 177.783 207.610 197.638 1.00 66.79  ?  1063 MET A C     1 
ATOM   8344  O  O     . MET A 1  1063 ? 178.343 206.776 196.914 1.00 66.16  ?  1063 MET A O     1 
ATOM   8345  C  CB    . MET A 1  1063 ? 175.859 205.978 198.069 1.00 63.92  ?  1063 MET A CB    1 
ATOM   8346  C  CG    . MET A 1  1063 ? 174.602 205.745 198.848 1.00 67.01  ?  1063 MET A CG    1 
ATOM   8347  S  SD    . MET A 1  1063 ? 174.807 205.640 200.640 1.00 70.54  ?  1063 MET A SD    1 
ATOM   8348  C  CE    . MET A 1  1063 ? 176.439 204.737 200.758 1.00 66.65  ?  1063 MET A CE    1 
ATOM   8349  N  N     . VAL A 1  1064 ? 178.323 208.776 197.952 1.00 63.92  ?  1064 VAL A N     1 
ATOM   8350  C  CA    . VAL A 1  1064 ? 179.587 209.317 197.482 1.00 64.92  ?  1064 VAL A CA    1 
ATOM   8351  C  C     . VAL A 1  1064 ? 180.810 208.416 197.712 1.00 71.41  ?  1064 VAL A C     1 
ATOM   8352  O  O     . VAL A 1  1064 ? 181.847 208.605 197.051 1.00 72.50  ?  1064 VAL A O     1 
ATOM   8353  C  CB    . VAL A 1  1064 ? 179.774 210.740 198.027 1.00 69.29  ?  1064 VAL A CB    1 
ATOM   8354  C  CG1   . VAL A 1  1064 ? 178.750 211.669 197.397 1.00 69.86  ?  1064 VAL A CG1   1 
ATOM   8355  C  CG2   . VAL A 1  1064 ? 179.654 210.772 199.546 1.00 68.94  ?  1064 VAL A CG2   1 
ATOM   8356  N  N     . GLY A 1  1065 ? 180.655 207.438 198.614 1.00 66.57  ?  1065 GLY A N     1 
ATOM   8357  C  CA    . GLY A 1  1065 ? 181.686 206.478 198.961 1.00 65.26  ?  1065 GLY A CA    1 
ATOM   8358  C  C     . GLY A 1  1065 ? 181.947 205.593 197.776 1.00 66.02  ?  1065 GLY A C     1 
ATOM   8359  O  O     . GLY A 1  1065 ? 182.978 205.742 197.104 1.00 64.75  ?  1065 GLY A O     1 
ATOM   8360  N  N     . VAL A 1  1066 ? 180.958 204.719 197.486 1.00 60.79  ?  1066 VAL A N     1 
ATOM   8361  C  CA    . VAL A 1  1066 ? 180.985 203.768 196.363 1.00 59.50  ?  1066 VAL A CA    1 
ATOM   8362  C  C     . VAL A 1  1066 ? 181.334 204.506 195.070 1.00 62.44  ?  1066 VAL A C     1 
ATOM   8363  O  O     . VAL A 1  1066 ? 182.242 204.076 194.354 1.00 61.74  ?  1066 VAL A O     1 
ATOM   8364  C  CB    . VAL A 1  1066 ? 179.658 202.975 196.239 1.00 62.04  ?  1066 VAL A CB    1 
ATOM   8365  C  CG1   . VAL A 1  1066 ? 179.685 202.022 195.053 1.00 60.79  ?  1066 VAL A CG1   1 
ATOM   8366  C  CG2   . VAL A 1  1066 ? 179.358 202.219 197.524 1.00 61.86  ?  1066 VAL A CG2   1 
ATOM   8367  N  N     . LEU A 1  1067 ? 180.635 205.643 194.816 1.00 58.10  ?  1067 LEU A N     1 
ATOM   8368  C  CA    . LEU A 1  1067 ? 180.827 206.528 193.670 1.00 57.75  ?  1067 LEU A CA    1 
ATOM   8369  C  C     . LEU A 1  1067 ? 182.334 206.742 193.472 1.00 63.31  ?  1067 LEU A C     1 
ATOM   8370  O  O     . LEU A 1  1067 ? 182.877 206.345 192.444 1.00 61.99  ?  1067 LEU A O     1 
ATOM   8371  C  CB    . LEU A 1  1067 ? 180.134 207.878 193.960 1.00 57.83  ?  1067 LEU A CB    1 
ATOM   8372  C  CG    . LEU A 1  1067 ? 179.672 208.799 192.823 1.00 62.25  ?  1067 LEU A CG    1 
ATOM   8373  C  CD1   . LEU A 1  1067 ? 180.447 208.607 191.560 1.00 61.54  ?  1067 LEU A CD1   1 
ATOM   8374  C  CD2   . LEU A 1  1067 ? 178.192 208.616 192.549 1.00 68.24  ?  1067 LEU A CD2   1 
ATOM   8375  N  N     . ALA A 1  1068 ? 183.008 207.312 194.490 1.00 62.25  ?  1068 ALA A N     1 
ATOM   8376  C  CA    . ALA A 1  1068 ? 184.437 207.617 194.467 1.00 62.79  ?  1068 ALA A CA    1 
ATOM   8377  C  C     . ALA A 1  1068 ? 185.311 206.387 194.168 1.00 64.25  ?  1068 ALA A C     1 
ATOM   8378  O  O     . ALA A 1  1068 ? 186.226 206.462 193.341 1.00 62.57  ?  1068 ALA A O     1 
ATOM   8379  C  CB    . ALA A 1  1068 ? 184.848 208.270 195.776 1.00 64.18  ?  1068 ALA A CB    1 
ATOM   8380  N  N     . ALA A 1  1069 ? 184.987 205.252 194.813 1.00 60.16  ?  1069 ALA A N     1 
ATOM   8381  C  CA    . ALA A 1  1069 ? 185.707 203.988 194.635 1.00 59.12  ?  1069 ALA A CA    1 
ATOM   8382  C  C     . ALA A 1  1069 ? 185.655 203.536 193.160 1.00 58.74  ?  1069 ALA A C     1 
ATOM   8383  O  O     . ALA A 1  1069 ? 186.706 203.371 192.528 1.00 56.92  ?  1069 ALA A O     1 
ATOM   8384  C  CB    . ALA A 1  1069 ? 185.136 202.926 195.571 1.00 59.35  ?  1069 ALA A CB    1 
ATOM   8385  N  N     . GLN A 1  1070 ? 184.428 203.462 192.606 1.00 53.15  ?  1070 GLN A N     1 
ATOM   8386  C  CA    . GLN A 1  1070 ? 184.134 203.088 191.224 1.00 52.04  ?  1070 GLN A CA    1 
ATOM   8387  C  C     . GLN A 1  1070 ? 184.693 204.131 190.236 1.00 56.83  ?  1070 GLN A C     1 
ATOM   8388  O  O     . GLN A 1  1070 ? 185.177 203.784 189.153 1.00 55.38  ?  1070 GLN A O     1 
ATOM   8389  C  CB    . GLN A 1  1070 ? 182.621 202.891 191.036 1.00 52.55  ?  1070 GLN A CB    1 
ATOM   8390  C  CG    . GLN A 1  1070 ? 182.038 201.808 191.926 1.00 66.52  ?  1070 GLN A CG    1 
ATOM   8391  C  CD    . GLN A 1  1070 ? 180.683 201.311 191.488 1.00 92.35  ?  1070 GLN A CD    1 
ATOM   8392  O  OE1   . GLN A 1  1070 ? 179.753 202.099 191.218 1.00 82.52  ?  1070 GLN A OE1   1 
ATOM   8393  N  NE2   . GLN A 1  1070 ? 180.534 199.970 191.472 1.00 90.59  ?  1070 GLN A NE2   1 
ATOM   8394  N  N     . SER A 1  1071 ? 184.672 205.406 190.630 1.00 55.61  ?  1071 SER A N     1 
ATOM   8395  C  CA    . SER A 1  1071 ? 185.209 206.463 189.780 1.00 56.15  ?  1071 SER A CA    1 
ATOM   8396  C  C     . SER A 1  1071 ? 186.729 206.409 189.632 1.00 61.03  ?  1071 SER A C     1 
ATOM   8397  O  O     . SER A 1  1071 ? 187.238 207.050 188.727 1.00 61.63  ?  1071 SER A O     1 
ATOM   8398  C  CB    . SER A 1  1071 ? 184.711 207.838 190.211 1.00 57.76  ?  1071 SER A CB    1 
ATOM   8399  O  OG    . SER A 1  1071 ? 183.308 207.881 190.014 1.00 61.32  ?  1071 SER A OG    1 
ATOM   8400  N  N     . ILE A 1  1072 ? 187.431 205.626 190.485 1.00 57.09  ?  1072 ILE A N     1 
ATOM   8401  C  CA    . ILE A 1  1072 ? 188.880 205.417 190.434 1.00 57.79  ?  1072 ILE A CA    1 
ATOM   8402  C  C     . ILE A 1  1072 ? 189.122 203.989 189.909 1.00 65.29  ?  1072 ILE A C     1 
ATOM   8403  O  O     . ILE A 1  1072 ? 190.039 203.766 189.110 1.00 65.65  ?  1072 ILE A O     1 
ATOM   8404  C  CB    . ILE A 1  1072 ? 189.568 205.637 191.814 1.00 60.56  ?  1072 ILE A CB    1 
ATOM   8405  C  CG1   . ILE A 1  1072 ? 189.268 207.049 192.393 1.00 61.83  ?  1072 ILE A CG1   1 
ATOM   8406  C  CG2   . ILE A 1  1072 ? 191.072 205.386 191.696 1.00 59.37  ?  1072 ILE A CG2   1 
ATOM   8407  C  CD1   . ILE A 1  1072 ? 189.789 207.397 193.909 1.00 66.61  ?  1072 ILE A CD1   1 
ATOM   8408  N  N     . GLY A 1  1073 ? 188.315 203.046 190.404 1.00 63.11  ?  1073 GLY A N     1 
ATOM   8409  C  CA    . GLY A 1  1073 ? 188.338 201.635 190.036 1.00 63.42  ?  1073 GLY A CA    1 
ATOM   8410  C  C     . GLY A 1  1073 ? 188.203 201.425 188.541 1.00 69.33  ?  1073 GLY A C     1 
ATOM   8411  O  O     . GLY A 1  1073 ? 189.160 200.967 187.922 1.00 70.31  ?  1073 GLY A O     1 
ATOM   8412  N  N     . GLU A 1  1074 ? 187.045 201.805 187.941 1.00 65.96  ?  1074 GLU A N     1 
ATOM   8413  C  CA    . GLU A 1  1074 ? 186.797 201.729 186.490 1.00 66.36  ?  1074 GLU A CA    1 
ATOM   8414  C  C     . GLU A 1  1074 ? 188.016 202.238 185.662 1.00 72.57  ?  1074 GLU A C     1 
ATOM   8415  O  O     . GLU A 1  1074 ? 188.585 201.431 184.934 1.00 71.27  ?  1074 GLU A O     1 
ATOM   8416  C  CB    . GLU A 1  1074 ? 185.491 202.457 186.094 1.00 67.45  ?  1074 GLU A CB    1 
ATOM   8417  C  CG    . GLU A 1  1074 ? 185.005 202.165 184.685 1.00 76.82  ?  1074 GLU A CG    1 
ATOM   8418  C  CD    . GLU A 1  1074 ? 185.707 202.846 183.523 1.00 113.51 ?  1074 GLU A CD    1 
ATOM   8419  O  OE1   . GLU A 1  1074 ? 186.240 203.968 183.697 1.00 96.87  ?  1074 GLU A OE1   1 
ATOM   8420  O  OE2   . GLU A 1  1074 ? 185.688 202.259 182.417 1.00 129.26 -1 1074 GLU A OE2   1 
ATOM   8421  N  N     . PRO A 1  1075 ? 188.479 203.513 185.772 1.00 72.40  ?  1075 PRO A N     1 
ATOM   8422  C  CA    . PRO A 1  1075 ? 189.670 203.926 184.987 1.00 73.81  ?  1075 PRO A CA    1 
ATOM   8423  C  C     . PRO A 1  1075 ? 190.952 203.077 185.159 1.00 77.74  ?  1075 PRO A C     1 
ATOM   8424  O  O     . PRO A 1  1075 ? 191.700 202.913 184.189 1.00 77.93  ?  1075 PRO A O     1 
ATOM   8425  C  CB    . PRO A 1  1075 ? 189.897 205.390 185.401 1.00 76.13  ?  1075 PRO A CB    1 
ATOM   8426  C  CG    . PRO A 1  1075 ? 189.077 205.595 186.597 1.00 79.86  ?  1075 PRO A CG    1 
ATOM   8427  C  CD    . PRO A 1  1075 ? 187.938 204.648 186.553 1.00 74.13  ?  1075 PRO A CD    1 
ATOM   8428  N  N     . ALA A 1  1076 ? 191.198 202.534 186.375 1.00 73.15  ?  1076 ALA A N     1 
ATOM   8429  C  CA    . ALA A 1  1076 ? 192.346 201.677 186.663 1.00 73.21  ?  1076 ALA A CA    1 
ATOM   8430  C  C     . ALA A 1  1076 ? 192.295 200.420 185.807 1.00 80.72  ?  1076 ALA A C     1 
ATOM   8431  O  O     . ALA A 1  1076 ? 193.329 199.882 185.432 1.00 81.65  ?  1076 ALA A O     1 
ATOM   8432  C  CB    . ALA A 1  1076 ? 192.348 201.296 188.122 1.00 73.43  ?  1076 ALA A CB    1 
ATOM   8433  N  N     . THR A 1  1077 ? 191.083 199.980 185.468 1.00 79.04  ?  1077 THR A N     1 
ATOM   8434  C  CA    . THR A 1  1077 ? 190.790 198.821 184.643 1.00 79.48  ?  1077 THR A CA    1 
ATOM   8435  C  C     . THR A 1  1077 ? 191.282 199.023 183.216 1.00 88.73  ?  1077 THR A C     1 
ATOM   8436  O  O     . THR A 1  1077 ? 191.616 198.043 182.565 1.00 89.37  ?  1077 THR A O     1 
ATOM   8437  C  CB    . THR A 1  1077 ? 189.309 198.510 184.793 1.00 82.40  ?  1077 THR A CB    1 
ATOM   8438  O  OG1   . THR A 1  1077 ? 189.107 198.079 186.134 1.00 77.74  ?  1077 THR A OG1   1 
ATOM   8439  C  CG2   . THR A 1  1077 ? 188.801 197.466 183.829 1.00 84.56  ?  1077 THR A CG2   1 
ATOM   8440  N  N     . GLN A 1  1078 ? 191.363 200.275 182.738 1.00 89.30  ?  1078 GLN A N     1 
ATOM   8441  C  CA    . GLN A 1  1078 ? 191.829 200.566 181.372 1.00 91.69  ?  1078 GLN A CA    1 
ATOM   8442  C  C     . GLN A 1  1078 ? 193.307 201.029 181.355 1.00 98.88  ?  1078 GLN A C     1 
ATOM   8443  O  O     . GLN A 1  1078 ? 193.656 201.944 180.599 1.00 99.81  ?  1078 GLN A O     1 
ATOM   8444  C  CB    . GLN A 1  1078 ? 190.902 201.580 180.620 1.00 93.58  ?  1078 GLN A CB    1 
ATOM   8445  C  CG    . GLN A 1  1078 ? 189.526 201.895 181.242 1.00 117.22 ?  1078 GLN A CG    1 
ATOM   8446  C  CD    . GLN A 1  1078 ? 188.440 200.903 180.865 1.00 139.79 ?  1078 GLN A CD    1 
ATOM   8447  O  OE1   . GLN A 1  1078 ? 188.319 199.818 181.452 1.00 133.32 ?  1078 GLN A OE1   1 
ATOM   8448  N  NE2   . GLN A 1  1078 ? 187.583 201.280 179.920 1.00 132.43 ?  1078 GLN A NE2   1 
ATOM   8449  N  N     . MET A 1  1079 ? 194.178 200.393 182.159 1.00 96.63  ?  1079 MET A N     1 
ATOM   8450  C  CA    . MET A 1  1079 ? 195.571 200.841 182.218 1.00 98.49  ?  1079 MET A CA    1 
ATOM   8451  C  C     . MET A 1  1079 ? 196.625 199.898 181.640 1.00 108.57 ?  1079 MET A C     1 
ATOM   8452  O  O     . MET A 1  1079 ? 196.827 198.796 182.175 1.00 109.96 ?  1079 MET A O     1 
ATOM   8453  C  CB    . MET A 1  1079 ? 195.965 201.328 183.631 1.00 100.38 ?  1079 MET A CB    1 
ATOM   8454  C  CG    . MET A 1  1079 ? 195.103 202.463 184.151 1.00 103.08 ?  1079 MET A CG    1 
ATOM   8455  S  SD    . MET A 1  1079 ? 195.967 203.583 185.267 1.00 107.22 ?  1079 MET A SD    1 
ATOM   8456  C  CE    . MET A 1  1079 ? 196.005 202.620 186.770 1.00 103.31 ?  1079 MET A CE    1 
ATOM   8457  N  N     . THR A 1  1080 ? 197.346 200.370 180.581 1.00 107.00 ?  1080 THR A N     1 
ATOM   8458  C  CA    . THR A 1  1080 ? 198.447 199.650 179.909 1.00 134.85 ?  1080 THR A CA    1 
ATOM   8459  C  C     . THR A 1  1080 ? 199.658 199.513 180.851 1.00 158.69 ?  1080 THR A C     1 
ATOM   8460  O  O     . THR A 1  1080 ? 200.174 200.517 181.346 1.00 117.56 ?  1080 THR A O     1 
ATOM   8461  C  CB    . THR A 1  1080 ? 198.827 200.359 178.594 1.00 140.10 ?  1080 THR A CB    1 
ATOM   8462  O  OG1   . THR A 1  1080 ? 197.642 200.568 177.816 1.00 137.38 ?  1080 THR A OG1   1 
ATOM   8463  C  CG2   . THR A 1  1080 ? 199.895 199.595 177.792 1.00 136.98 ?  1080 THR A CG2   1 
ATOM   8464  N  N     . LYS A 1  1092 ? 213.031 211.340 183.886 1.00 146.41 ?  1092 LYS A N     1 
ATOM   8465  C  CA    . LYS A 1  1092 ? 213.186 210.212 184.821 1.00 145.66 ?  1092 LYS A CA    1 
ATOM   8466  C  C     . LYS A 1  1092 ? 212.134 209.069 184.634 1.00 147.65 ?  1092 LYS A C     1 
ATOM   8467  O  O     . LYS A 1  1092 ? 210.949 209.358 184.413 1.00 147.14 ?  1092 LYS A O     1 
ATOM   8468  C  CB    . LYS A 1  1092 ? 213.228 210.734 186.285 1.00 147.67 ?  1092 LYS A CB    1 
ATOM   8469  C  CG    . LYS A 1  1092 ? 213.203 209.679 187.409 1.00 151.73 ?  1092 LYS A CG    1 
ATOM   8470  C  CD    . LYS A 1  1092 ? 214.473 208.829 187.504 1.00 158.66 ?  1092 LYS A CD    1 
ATOM   8471  C  CE    . LYS A 1  1092 ? 214.451 207.917 188.704 1.00 164.84 ?  1092 LYS A CE    1 
ATOM   8472  N  NZ    . LYS A 1  1092 ? 214.692 208.662 189.971 1.00 171.89 1  1092 LYS A NZ    1 
ATOM   8473  N  N     . LYS A 1  1093 ? 212.582 207.776 184.731 1.00 141.97 ?  1093 LYS A N     1 
ATOM   8474  C  CA    . LYS A 1  1093 ? 211.708 206.589 184.627 1.00 139.32 ?  1093 LYS A CA    1 
ATOM   8475  C  C     . LYS A 1  1093 ? 211.306 206.052 186.020 1.00 137.92 ?  1093 LYS A C     1 
ATOM   8476  O  O     . LYS A 1  1093 ? 212.102 205.402 186.710 1.00 137.50 ?  1093 LYS A O     1 
ATOM   8477  C  CB    . LYS A 1  1093 ? 212.289 205.494 183.696 1.00 141.99 ?  1093 LYS A CB    1 
ATOM   8478  C  CG    . LYS A 1  1093 ? 211.986 205.738 182.214 1.00 152.47 ?  1093 LYS A CG    1 
ATOM   8479  C  CD    . LYS A 1  1093 ? 212.512 204.624 181.309 1.00 161.22 ?  1093 LYS A CD    1 
ATOM   8480  C  CE    . LYS A 1  1093 ? 212.269 204.916 179.842 1.00 169.67 ?  1093 LYS A CE    1 
ATOM   8481  N  NZ    . LYS A 1  1093 ? 212.719 203.801 178.962 1.00 176.15 1  1093 LYS A NZ    1 
ATOM   8482  N  N     . VAL A 1  1094 ? 210.064 206.375 186.428 1.00 129.84 ?  1094 VAL A N     1 
ATOM   8483  C  CA    . VAL A 1  1094 ? 209.484 206.029 187.720 1.00 127.23 ?  1094 VAL A CA    1 
ATOM   8484  C  C     . VAL A 1  1094 ? 208.296 205.071 187.581 1.00 126.35 ?  1094 VAL A C     1 
ATOM   8485  O  O     . VAL A 1  1094 ? 207.519 205.198 186.629 1.00 125.41 ?  1094 VAL A O     1 
ATOM   8486  C  CB    . VAL A 1  1094 ? 209.156 207.338 188.489 1.00 131.13 ?  1094 VAL A CB    1 
ATOM   8487  C  CG1   . VAL A 1  1094 ? 207.879 207.251 189.324 1.00 130.06 ?  1094 VAL A CG1   1 
ATOM   8488  C  CG2   . VAL A 1  1094 ? 210.336 207.766 189.344 1.00 131.94 ?  1094 VAL A CG2   1 
ATOM   8489  N  N     . THR A 1  1095 ? 208.178 204.106 188.532 1.00 119.64 ?  1095 THR A N     1 
ATOM   8490  C  CA    . THR A 1  1095 ? 207.093 203.124 188.623 1.00 117.12 ?  1095 THR A CA    1 
ATOM   8491  C  C     . THR A 1  1095 ? 205.783 203.872 188.580 1.00 120.42 ?  1095 THR A C     1 
ATOM   8492  O  O     . THR A 1  1095 ? 205.574 204.790 189.376 1.00 120.30 ?  1095 THR A O     1 
ATOM   8493  C  CB    . THR A 1  1095 ? 207.216 202.271 189.887 1.00 117.16 ?  1095 THR A CB    1 
ATOM   8494  O  OG1   . THR A 1  1095 ? 207.269 203.110 191.047 1.00 112.45 ?  1095 THR A OG1   1 
ATOM   8495  C  CG2   . THR A 1  1095 ? 208.407 201.337 189.835 1.00 115.96 ?  1095 THR A CG2   1 
ATOM   8496  N  N     . SER A 1  1096 ? 204.954 203.557 187.580 1.00 116.16 ?  1096 SER A N     1 
ATOM   8497  C  CA    . SER A 1  1096 ? 203.681 204.239 187.328 1.00 114.66 ?  1096 SER A CA    1 
ATOM   8498  C  C     . SER A 1  1096 ? 202.576 203.254 186.939 1.00 113.41 ?  1096 SER A C     1 
ATOM   8499  O  O     . SER A 1  1096 ? 202.851 202.057 186.829 1.00 113.18 ?  1096 SER A O     1 
ATOM   8500  C  CB    . SER A 1  1096 ? 203.866 205.322 186.267 1.00 120.49 ?  1096 SER A CB    1 
ATOM   8501  O  OG    . SER A 1  1096 ? 204.790 204.911 185.270 1.00 134.78 ?  1096 SER A OG    1 
ATOM   8502  N  N     . GLY A 1  1097 ? 201.349 203.761 186.772 1.00 105.47 ?  1097 GLY A N     1 
ATOM   8503  C  CA    . GLY A 1  1097 ? 200.173 202.976 186.407 1.00 102.21 ?  1097 GLY A CA    1 
ATOM   8504  C  C     . GLY A 1  1097 ? 199.686 202.014 187.476 1.00 99.56  ?  1097 GLY A C     1 
ATOM   8505  O  O     . GLY A 1  1097 ? 199.825 202.280 188.672 1.00 98.85  ?  1097 GLY A O     1 
ATOM   8506  N  N     . VAL A 1  1098 ? 199.111 200.884 187.039 1.00 91.72  ?  1098 VAL A N     1 
ATOM   8507  C  CA    . VAL A 1  1098 ? 198.566 199.829 187.901 1.00 89.25  ?  1098 VAL A CA    1 
ATOM   8508  C  C     . VAL A 1  1098 ? 199.513 199.429 189.065 1.00 90.08  ?  1098 VAL A C     1 
ATOM   8509  O  O     . VAL A 1  1098 ? 199.077 199.473 190.218 1.00 88.50  ?  1098 VAL A O     1 
ATOM   8510  C  CB    . VAL A 1  1098 ? 198.056 198.612 187.072 1.00 92.24  ?  1098 VAL A CB    1 
ATOM   8511  C  CG1   . VAL A 1  1098 ? 198.008 197.336 187.906 1.00 91.63  ?  1098 VAL A CG1   1 
ATOM   8512  C  CG2   . VAL A 1  1098 ? 196.697 198.895 186.446 1.00 91.23  ?  1098 VAL A CG2   1 
ATOM   8513  N  N     . PRO A 1  1099 ? 200.802 199.080 188.813 1.00 85.56  ?  1099 PRO A N     1 
ATOM   8514  C  CA    . PRO A 1  1099 ? 201.677 198.675 189.932 1.00 84.76  ?  1099 PRO A CA    1 
ATOM   8515  C  C     . PRO A 1  1099 ? 201.990 199.783 190.928 1.00 86.01  ?  1099 PRO A C     1 
ATOM   8516  O  O     . PRO A 1  1099 ? 202.280 199.483 192.092 1.00 85.07  ?  1099 PRO A O     1 
ATOM   8517  C  CB    . PRO A 1  1099 ? 202.933 198.157 189.233 1.00 87.54  ?  1099 PRO A CB    1 
ATOM   8518  C  CG    . PRO A 1  1099 ? 202.944 198.848 187.917 1.00 92.66  ?  1099 PRO A CG    1 
ATOM   8519  C  CD    . PRO A 1  1099 ? 201.509 198.956 187.519 1.00 87.47  ?  1099 PRO A CD    1 
ATOM   8520  N  N     . ARG A 1  1100 ? 201.946 201.057 190.470 1.00 81.20  ?  1100 ARG A N     1 
ATOM   8521  C  CA    . ARG A 1  1100 ? 202.149 202.207 191.343 1.00 80.61  ?  1100 ARG A CA    1 
ATOM   8522  C  C     . ARG A 1  1100 ? 200.879 202.409 192.182 1.00 83.31  ?  1100 ARG A C     1 
ATOM   8523  O  O     . ARG A 1  1100 ? 200.978 202.582 193.398 1.00 83.97  ?  1100 ARG A O     1 
ATOM   8524  C  CB    . ARG A 1  1100 ? 202.497 203.472 190.547 1.00 79.89  ?  1100 ARG A CB    1 
ATOM   8525  C  CG    . ARG A 1  1100 ? 202.526 204.787 191.368 1.00 90.20  ?  1100 ARG A CG    1 
ATOM   8526  C  CD    . ARG A 1  1100 ? 203.439 204.739 192.585 1.00 91.99  ?  1100 ARG A CD    1 
ATOM   8527  N  NE    . ARG A 1  1100 ? 203.627 206.045 193.201 1.00 92.39  ?  1100 ARG A NE    1 
ATOM   8528  C  CZ    . ARG A 1  1100 ? 204.113 206.212 194.424 1.00 108.08 ?  1100 ARG A CZ    1 
ATOM   8529  N  NH1   . ARG A 1  1100 ? 204.423 205.158 195.172 1.00 90.27  1  1100 ARG A NH1   1 
ATOM   8530  N  NH2   . ARG A 1  1100 ? 204.271 207.429 194.920 1.00 100.77 ?  1100 ARG A NH2   1 
ATOM   8531  N  N     . LEU A 1  1101 ? 199.689 202.370 191.542 1.00 76.14  ?  1101 LEU A N     1 
ATOM   8532  C  CA    . LEU A 1  1101 ? 198.431 202.500 192.259 1.00 73.36  ?  1101 LEU A CA    1 
ATOM   8533  C  C     . LEU A 1  1101 ? 198.411 201.452 193.375 1.00 76.73  ?  1101 LEU A C     1 
ATOM   8534  O  O     . LEU A 1  1101 ? 198.015 201.773 194.494 1.00 76.96  ?  1101 LEU A O     1 
ATOM   8535  C  CB    . LEU A 1  1101 ? 197.254 202.328 191.288 1.00 71.77  ?  1101 LEU A CB    1 
ATOM   8536  C  CG    . LEU A 1  1101 ? 195.835 202.395 191.855 1.00 73.37  ?  1101 LEU A CG    1 
ATOM   8537  C  CD1   . LEU A 1  1101 ? 195.671 203.538 192.830 1.00 72.48  ?  1101 LEU A CD1   1 
ATOM   8538  C  CD2   . LEU A 1  1101 ? 194.852 202.559 190.749 1.00 73.76  ?  1101 LEU A CD2   1 
ATOM   8539  N  N     . LYS A 1  1102 ? 198.924 200.240 193.083 1.00 72.73  ?  1102 LYS A N     1 
ATOM   8540  C  CA    . LYS A 1  1102 ? 199.044 199.130 194.027 1.00 73.03  ?  1102 LYS A CA    1 
ATOM   8541  C  C     . LYS A 1  1102 ? 199.947 199.560 195.206 1.00 77.74  ?  1102 LYS A C     1 
ATOM   8542  O  O     . LYS A 1  1102 ? 199.561 199.420 196.366 1.00 77.00  ?  1102 LYS A O     1 
ATOM   8543  C  CB    . LYS A 1  1102 ? 199.597 197.879 193.305 1.00 76.54  ?  1102 LYS A CB    1 
ATOM   8544  C  CG    . LYS A 1  1102 ? 198.962 196.540 193.728 1.00 95.55  ?  1102 LYS A CG    1 
ATOM   8545  C  CD    . LYS A 1  1102 ? 199.571 195.318 192.987 1.00 106.23 ?  1102 LYS A CD    1 
ATOM   8546  C  CE    . LYS A 1  1102 ? 200.566 194.524 193.820 1.00 110.89 ?  1102 LYS A CE    1 
ATOM   8547  N  NZ    . LYS A 1  1102 ? 201.416 193.626 192.982 1.00 117.43 1  1102 LYS A NZ    1 
ATOM   8548  N  N     . GLU A 1  1103 ? 201.107 200.155 194.896 1.00 75.52  ?  1103 GLU A N     1 
ATOM   8549  C  CA    . GLU A 1  1103 ? 202.057 200.680 195.885 1.00 75.97  ?  1103 GLU A CA    1 
ATOM   8550  C  C     . GLU A 1  1103 ? 201.304 201.698 196.787 1.00 77.31  ?  1103 GLU A C     1 
ATOM   8551  O  O     . GLU A 1  1103 ? 201.262 201.516 198.010 1.00 76.03  ?  1103 GLU A O     1 
ATOM   8552  C  CB    . GLU A 1  1103 ? 203.241 201.361 195.141 1.00 78.09  ?  1103 GLU A CB    1 
ATOM   8553  C  CG    . GLU A 1  1103 ? 204.627 201.003 195.634 1.00 86.84  ?  1103 GLU A CG    1 
ATOM   8554  C  CD    . GLU A 1  1103 ? 205.748 201.145 194.618 1.00 115.01 ?  1103 GLU A CD    1 
ATOM   8555  O  OE1   . GLU A 1  1103 ? 205.862 202.213 193.970 1.00 105.39 ?  1103 GLU A OE1   1 
ATOM   8556  O  OE2   . GLU A 1  1103 ? 206.558 200.193 194.517 1.00 118.60 -1 1103 GLU A OE2   1 
ATOM   8557  N  N     . ILE A 1  1104 ? 200.636 202.704 196.148 1.00 72.09  ?  1104 ILE A N     1 
ATOM   8558  C  CA    . ILE A 1  1104 ? 199.896 203.779 196.807 1.00 71.44  ?  1104 ILE A CA    1 
ATOM   8559  C  C     . ILE A 1  1104 ? 198.854 203.244 197.787 1.00 77.97  ?  1104 ILE A C     1 
ATOM   8560  O  O     . ILE A 1  1104 ? 198.954 203.526 198.980 1.00 79.11  ?  1104 ILE A O     1 
ATOM   8561  C  CB    . ILE A 1  1104 ? 199.308 204.853 195.833 1.00 73.50  ?  1104 ILE A CB    1 
ATOM   8562  C  CG1   . ILE A 1  1104 ? 200.347 205.368 194.811 1.00 73.82  ?  1104 ILE A CG1   1 
ATOM   8563  C  CG2   . ILE A 1  1104 ? 198.701 206.022 196.627 1.00 74.17  ?  1104 ILE A CG2   1 
ATOM   8564  C  CD1   . ILE A 1  1104 ? 199.822 206.357 193.692 1.00 75.76  ?  1104 ILE A CD1   1 
ATOM   8565  N  N     . LEU A 1  1105 ? 197.880 202.457 197.298 1.00 74.45  ?  1105 LEU A N     1 
ATOM   8566  C  CA    . LEU A 1  1105 ? 196.816 201.904 198.127 1.00 74.14  ?  1105 LEU A CA    1 
ATOM   8567  C  C     . LEU A 1  1105 ? 197.320 201.059 199.274 1.00 82.49  ?  1105 LEU A C     1 
ATOM   8568  O  O     . LEU A 1  1105 ? 196.755 201.103 200.366 1.00 82.91  ?  1105 LEU A O     1 
ATOM   8569  C  CB    . LEU A 1  1105 ? 195.818 201.112 197.287 1.00 72.90  ?  1105 LEU A CB    1 
ATOM   8570  C  CG    . LEU A 1  1105 ? 195.071 201.875 196.197 1.00 76.82  ?  1105 LEU A CG    1 
ATOM   8571  C  CD1   . LEU A 1  1105 ? 194.046 201.002 195.588 1.00 76.36  ?  1105 LEU A CD1   1 
ATOM   8572  C  CD2   . LEU A 1  1105 ? 194.381 203.133 196.729 1.00 77.96  ?  1105 LEU A CD2   1 
ATOM   8573  N  N     . ASN A 1  1106 ? 198.408 200.335 199.058 1.00 81.73  ?  1106 ASN A N     1 
ATOM   8574  C  CA    . ASN A 1  1106 ? 198.947 199.477 200.097 1.00 83.16  ?  1106 ASN A CA    1 
ATOM   8575  C  C     . ASN A 1  1106 ? 199.754 200.204 201.143 1.00 90.44  ?  1106 ASN A C     1 
ATOM   8576  O  O     . ASN A 1  1106 ? 200.202 199.548 202.097 1.00 90.78  ?  1106 ASN A O     1 
ATOM   8577  C  CB    . ASN A 1  1106 ? 199.819 198.391 199.474 1.00 85.25  ?  1106 ASN A CB    1 
ATOM   8578  C  CG    . ASN A 1  1106 ? 199.075 197.388 198.648 1.00 108.09 ?  1106 ASN A CG    1 
ATOM   8579  O  OD1   . ASN A 1  1106 ? 199.633 196.832 197.708 1.00 112.91 ?  1106 ASN A OD1   1 
ATOM   8580  N  ND2   . ASN A 1  1106 ? 197.812 197.120 198.975 1.00 89.71  ?  1106 ASN A ND2   1 
ATOM   8581  N  N     . VAL A 1  1107 ? 200.000 201.530 200.955 1.00 88.67  ?  1107 VAL A N     1 
ATOM   8582  C  CA    . VAL A 1  1107 ? 200.900 202.326 201.814 1.00 89.87  ?  1107 VAL A CA    1 
ATOM   8583  C  C     . VAL A 1  1107 ? 202.176 201.450 201.969 1.00 95.95  ?  1107 VAL A C     1 
ATOM   8584  O  O     . VAL A 1  1107 ? 202.528 200.974 203.061 1.00 95.50  ?  1107 VAL A O     1 
ATOM   8585  C  CB    . VAL A 1  1107 ? 200.282 202.840 203.149 1.00 93.26  ?  1107 VAL A CB    1 
ATOM   8586  C  CG1   . VAL A 1  1107 ? 201.256 203.748 203.884 1.00 94.05  ?  1107 VAL A CG1   1 
ATOM   8587  C  CG2   . VAL A 1  1107 ? 198.979 203.582 202.901 1.00 92.15  ?  1107 VAL A CG2   1 
ATOM   8588  N  N     . ALA A 1  1108 ? 202.738 201.109 200.795 1.00 94.09  ?  1108 ALA A N     1 
ATOM   8589  C  CA    . ALA A 1  1108 ? 203.873 200.228 200.617 1.00 95.45  ?  1108 ALA A CA    1 
ATOM   8590  C  C     . ALA A 1  1108 ? 205.075 200.840 201.278 1.00 104.26 ?  1108 ALA A C     1 
ATOM   8591  O  O     . ALA A 1  1108 ? 205.402 201.999 200.979 1.00 105.91 ?  1108 ALA A O     1 
ATOM   8592  C  CB    . ALA A 1  1108 ? 204.125 200.036 199.135 1.00 95.90  ?  1108 ALA A CB    1 
ATOM   8593  N  N     . LYS A 1  1109 ? 205.694 200.115 202.234 1.00 102.03 ?  1109 LYS A N     1 
ATOM   8594  C  CA    . LYS A 1  1109 ? 206.848 200.708 202.902 1.00 103.40 ?  1109 LYS A CA    1 
ATOM   8595  C  C     . LYS A 1  1109 ? 208.066 200.769 201.983 1.00 108.60 ?  1109 LYS A C     1 
ATOM   8596  O  O     . LYS A 1  1109 ? 208.589 201.863 201.744 1.00 108.95 ?  1109 LYS A O     1 
ATOM   8597  C  CB    . LYS A 1  1109 ? 207.136 200.113 204.298 1.00 106.53 ?  1109 LYS A CB    1 
ATOM   8598  C  CG    . LYS A 1  1109 ? 208.311 200.800 205.056 1.00 127.71 ?  1109 LYS A CG    1 
ATOM   8599  C  CD    . LYS A 1  1109 ? 208.115 202.328 205.366 1.00 136.54 ?  1109 LYS A CD    1 
ATOM   8600  C  CE    . LYS A 1  1109 ? 209.400 203.082 205.684 1.00 138.23 ?  1109 LYS A CE    1 
ATOM   8601  N  NZ    . LYS A 1  1109 ? 209.211 204.565 205.693 1.00 135.99 1  1109 LYS A NZ    1 
ATOM   8602  N  N     . ASN A 1  1110 ? 208.463 199.621 201.414 1.00 105.24 ?  1110 ASN A N     1 
ATOM   8603  C  CA    . ASN A 1  1110 ? 209.608 199.565 200.510 1.00 105.25 ?  1110 ASN A CA    1 
ATOM   8604  C  C     . ASN A 1  1110 ? 209.193 199.751 199.051 1.00 104.10 ?  1110 ASN A C     1 
ATOM   8605  O  O     . ASN A 1  1110 ? 209.029 198.774 198.311 1.00 103.99 ?  1110 ASN A O     1 
ATOM   8606  C  CB    . ASN A 1  1110 ? 210.462 198.316 200.764 1.00 110.67 ?  1110 ASN A CB    1 
ATOM   8607  C  CG    . ASN A 1  1110 ? 211.272 198.432 202.038 1.00 153.07 ?  1110 ASN A CG    1 
ATOM   8608  O  OD1   . ASN A 1  1110 ? 212.363 199.024 202.066 1.00 154.48 ?  1110 ASN A OD1   1 
ATOM   8609  N  ND2   . ASN A 1  1110 ? 210.734 197.915 203.134 1.00 147.12 ?  1110 ASN A ND2   1 
ATOM   8610  N  N     . MET A 1  1111 ? 208.980 201.023 198.662 1.00 96.17  ?  1111 MET A N     1 
ATOM   8611  C  CA    . MET A 1  1111 ? 208.567 201.387 197.309 1.00 94.02  ?  1111 MET A CA    1 
ATOM   8612  C  C     . MET A 1  1111 ? 209.655 201.194 196.261 1.00 97.07  ?  1111 MET A C     1 
ATOM   8613  O  O     . MET A 1  1111 ? 210.829 201.087 196.631 1.00 97.20  ?  1111 MET A O     1 
ATOM   8614  C  CB    . MET A 1  1111 ? 207.836 202.748 197.237 1.00 95.85  ?  1111 MET A CB    1 
ATOM   8615  C  CG    . MET A 1  1111 ? 208.618 203.955 197.731 1.00 99.72  ?  1111 MET A CG    1 
ATOM   8616  S  SD    . MET A 1  1111 ? 208.010 205.536 197.071 1.00 102.81 ?  1111 MET A SD    1 
ATOM   8617  C  CE    . MET A 1  1111 ? 208.143 205.221 195.271 1.00 99.08  ?  1111 MET A CE    1 
ATOM   8618  N  N     . LYS A 1  1112 ? 209.266 201.085 194.967 1.00 93.14  ?  1112 LYS A N     1 
ATOM   8619  C  CA    . LYS A 1  1112 ? 210.194 200.783 193.870 1.00 94.05  ?  1112 LYS A CA    1 
ATOM   8620  C  C     . LYS A 1  1112 ? 211.043 201.890 193.304 1.00 99.06  ?  1112 LYS A C     1 
ATOM   8621  O  O     . LYS A 1  1112 ? 212.219 201.654 193.049 1.00 99.56  ?  1112 LYS A O     1 
ATOM   8622  C  CB    . LYS A 1  1112 ? 209.571 199.917 192.765 1.00 96.88  ?  1112 LYS A CB    1 
ATOM   8623  C  CG    . LYS A 1  1112 ? 209.327 198.453 193.157 1.00 121.12 ?  1112 LYS A CG    1 
ATOM   8624  C  CD    . LYS A 1  1112 ? 208.549 197.705 192.068 1.00 135.03 ?  1112 LYS A CD    1 
ATOM   8625  C  CE    . LYS A 1  1112 ? 207.691 196.584 192.608 1.00 143.99 ?  1112 LYS A CE    1 
ATOM   8626  N  NZ    . LYS A 1  1112 ? 206.996 195.844 191.519 1.00 148.46 1  1112 LYS A NZ    1 
ATOM   8627  N  N     . THR A 1  1113 ? 210.486 203.084 193.098 1.00 96.46  ?  1113 THR A N     1 
ATOM   8628  C  CA    . THR A 1  1113 ? 211.284 204.200 192.562 1.00 97.22  ?  1113 THR A CA    1 
ATOM   8629  C  C     . THR A 1  1113 ? 211.383 205.428 193.519 1.00 101.80 ?  1113 THR A C     1 
ATOM   8630  O  O     . THR A 1  1113 ? 211.036 206.525 193.068 1.00 102.52 ?  1113 THR A O     1 
ATOM   8631  C  CB    . THR A 1  1113 ? 210.817 204.587 191.136 1.00 102.06 ?  1113 THR A CB    1 
ATOM   8632  O  OG1   . THR A 1  1113 ? 209.400 204.804 191.116 1.00 100.44 ?  1113 THR A OG1   1 
ATOM   8633  C  CG2   . THR A 1  1113 ? 211.232 203.583 190.089 1.00 100.48 ?  1113 THR A CG2   1 
ATOM   8634  N  N     . PRO A 1  1114 ? 211.847 205.331 194.804 1.00 97.17  ?  1114 PRO A N     1 
ATOM   8635  C  CA    . PRO A 1  1114 ? 211.880 206.538 195.648 1.00 97.20  ?  1114 PRO A CA    1 
ATOM   8636  C  C     . PRO A 1  1114 ? 212.704 207.640 195.000 1.00 102.64 ?  1114 PRO A C     1 
ATOM   8637  O  O     . PRO A 1  1114 ? 213.726 207.340 194.368 1.00 103.99 ?  1114 PRO A O     1 
ATOM   8638  C  CB    . PRO A 1  1114 ? 212.474 206.041 196.969 1.00 99.21  ?  1114 PRO A CB    1 
ATOM   8639  C  CG    . PRO A 1  1114 ? 212.174 204.596 196.996 1.00 103.03 ?  1114 PRO A CG    1 
ATOM   8640  C  CD    . PRO A 1  1114 ? 212.320 204.156 195.564 1.00 98.63  ?  1114 PRO A CD    1 
ATOM   8641  N  N     . SER A 1  1115 ? 212.189 208.891 195.048 1.00 97.79  ?  1115 SER A N     1 
ATOM   8642  C  CA    . SER A 1  1115 ? 212.816 210.048 194.417 1.00 97.78  ?  1115 SER A CA    1 
ATOM   8643  C  C     . SER A 1  1115 ? 212.404 211.343 195.064 1.00 101.85 ?  1115 SER A C     1 
ATOM   8644  O  O     . SER A 1  1115 ? 211.236 211.525 195.409 1.00 100.68 ?  1115 SER A O     1 
ATOM   8645  C  CB    . SER A 1  1115 ? 212.472 210.096 192.927 1.00 100.07 ?  1115 SER A CB    1 
ATOM   8646  O  OG    . SER A 1  1115 ? 212.741 211.355 192.325 1.00 107.52 ?  1115 SER A OG    1 
ATOM   8647  N  N     . LEU A 1  1116 ? 213.373 212.267 195.156 1.00 99.76  ?  1116 LEU A N     1 
ATOM   8648  C  CA    . LEU A 1  1116 ? 213.221 213.640 195.640 1.00 99.82  ?  1116 LEU A CA    1 
ATOM   8649  C  C     . LEU A 1  1116 ? 213.280 214.571 194.416 1.00 103.22 ?  1116 LEU A C     1 
ATOM   8650  O  O     . LEU A 1  1116 ? 213.945 214.256 193.421 1.00 103.01 ?  1116 LEU A O     1 
ATOM   8651  C  CB    . LEU A 1  1116 ? 214.368 213.979 196.606 1.00 101.00 ?  1116 LEU A CB    1 
ATOM   8652  C  CG    . LEU A 1  1116 ? 214.112 214.169 198.102 1.00 106.22 ?  1116 LEU A CG    1 
ATOM   8653  C  CD1   . LEU A 1  1116 ? 213.202 213.154 198.664 1.00 105.85 ?  1116 LEU A CD1   1 
ATOM   8654  C  CD2   . LEU A 1  1116 ? 215.390 214.008 198.867 1.00 111.20 ?  1116 LEU A CD2   1 
ATOM   8655  N  N     . THR A 1  1117 ? 212.543 215.684 194.469 1.00 99.00  ?  1117 THR A N     1 
ATOM   8656  C  CA    . THR A 1  1117 ? 212.515 216.696 193.407 1.00 98.49  ?  1117 THR A CA    1 
ATOM   8657  C  C     . THR A 1  1117 ? 212.932 217.985 194.107 1.00 102.48 ?  1117 THR A C     1 
ATOM   8658  O  O     . THR A 1  1117 ? 212.151 218.609 194.828 1.00 101.02 ?  1117 THR A O     1 
ATOM   8659  C  CB    . THR A 1  1117 ? 211.199 216.644 192.600 1.00 99.26  ?  1117 THR A CB    1 
ATOM   8660  O  OG1   . THR A 1  1117 ? 210.969 215.287 192.223 1.00 97.57  ?  1117 THR A OG1   1 
ATOM   8661  C  CG2   . THR A 1  1117 ? 211.243 217.496 191.336 1.00 94.24  ?  1117 THR A CG2   1 
ATOM   8662  N  N     . VAL A 1  1118 ? 214.235 218.269 194.009 1.00 100.56 ?  1118 VAL A N     1 
ATOM   8663  C  CA    . VAL A 1  1118 ? 214.902 219.366 194.693 1.00 101.59 ?  1118 VAL A CA    1 
ATOM   8664  C  C     . VAL A 1  1118 ? 214.937 220.642 193.872 1.00 106.81 ?  1118 VAL A C     1 
ATOM   8665  O  O     . VAL A 1  1118 ? 215.654 220.719 192.862 1.00 106.59 ?  1118 VAL A O     1 
ATOM   8666  C  CB    . VAL A 1  1118 ? 216.292 218.973 195.244 1.00 106.31 ?  1118 VAL A CB    1 
ATOM   8667  C  CG1   . VAL A 1  1118 ? 216.457 219.485 196.666 1.00 107.00 ?  1118 VAL A CG1   1 
ATOM   8668  C  CG2   . VAL A 1  1118 ? 216.519 217.462 195.191 1.00 105.20 ?  1118 VAL A CG2   1 
ATOM   8669  N  N     . TYR A 1  1119 ? 214.123 221.633 194.304 1.00 103.67 ?  1119 TYR A N     1 
ATOM   8670  C  CA    . TYR A 1  1119 ? 214.007 222.929 193.648 1.00 103.93 ?  1119 TYR A CA    1 
ATOM   8671  C  C     . TYR A 1  1119 ? 215.010 223.831 194.268 1.00 113.65 ?  1119 TYR A C     1 
ATOM   8672  O  O     . TYR A 1  1119 ? 215.256 223.743 195.476 1.00 113.45 ?  1119 TYR A O     1 
ATOM   8673  C  CB    . TYR A 1  1119 ? 212.596 223.502 193.786 1.00 102.77 ?  1119 TYR A CB    1 
ATOM   8674  C  CG    . TYR A 1  1119 ? 211.557 222.730 193.004 1.00 101.34 ?  1119 TYR A CG    1 
ATOM   8675  C  CD1   . TYR A 1  1119 ? 211.374 222.953 191.640 1.00 103.15 ?  1119 TYR A CD1   1 
ATOM   8676  C  CD2   . TYR A 1  1119 ? 210.740 221.790 193.628 1.00 100.22 ?  1119 TYR A CD2   1 
ATOM   8677  C  CE1   . TYR A 1  1119 ? 210.412 222.248 190.913 1.00 102.30 ?  1119 TYR A CE1   1 
ATOM   8678  C  CE2   . TYR A 1  1119 ? 209.766 221.088 192.913 1.00 99.81  ?  1119 TYR A CE2   1 
ATOM   8679  C  CZ    . TYR A 1  1119 ? 209.612 221.314 191.553 1.00 106.48 ?  1119 TYR A CZ    1 
ATOM   8680  O  OH    . TYR A 1  1119 ? 208.681 220.611 190.830 1.00 105.15 ?  1119 TYR A OH    1 
ATOM   8681  N  N     . LEU A 1  1120 ? 215.616 224.679 193.435 1.00 114.95 ?  1120 LEU A N     1 
ATOM   8682  C  CA    . LEU A 1  1120 ? 216.678 225.605 193.824 1.00 117.96 ?  1120 LEU A CA    1 
ATOM   8683  C  C     . LEU A 1  1120 ? 216.194 226.870 194.539 1.00 127.25 ?  1120 LEU A C     1 
ATOM   8684  O  O     . LEU A 1  1120 ? 215.021 227.231 194.425 1.00 126.63 ?  1120 LEU A O     1 
ATOM   8685  C  CB    . LEU A 1  1120 ? 217.472 225.976 192.564 1.00 118.67 ?  1120 LEU A CB    1 
ATOM   8686  C  CG    . LEU A 1  1120 ? 218.835 225.308 192.338 1.00 123.30 ?  1120 LEU A CG    1 
ATOM   8687  C  CD1   . LEU A 1  1120 ? 218.934 223.912 192.960 1.00 121.93 ?  1120 LEU A CD1   1 
ATOM   8688  C  CD2   . LEU A 1  1120 ? 219.155 225.266 190.864 1.00 125.97 ?  1120 LEU A CD2   1 
ATOM   8689  N  N     . GLU A 1  1121 ? 217.120 227.556 195.255 1.00 128.37 ?  1121 GLU A N     1 
ATOM   8690  C  CA    . GLU A 1  1121 ? 216.879 228.812 195.976 1.00 130.32 ?  1121 GLU A CA    1 
ATOM   8691  C  C     . GLU A 1  1121 ? 216.363 229.884 195.010 1.00 137.92 ?  1121 GLU A C     1 
ATOM   8692  O  O     . GLU A 1  1121 ? 216.833 229.936 193.867 1.00 137.42 ?  1121 GLU A O     1 
ATOM   8693  C  CB    . GLU A 1  1121 ? 218.149 229.291 196.688 1.00 133.20 ?  1121 GLU A CB    1 
ATOM   8694  C  CG    . GLU A 1  1121 ? 217.942 229.570 198.168 1.00 145.79 ?  1121 GLU A CG    1 
ATOM   8695  C  CD    . GLU A 1  1121 ? 219.128 229.256 199.063 1.00 173.88 ?  1121 GLU A CD    1 
ATOM   8696  O  OE1   . GLU A 1  1121 ? 220.251 229.716 198.752 1.00 174.91 ?  1121 GLU A OE1   1 
ATOM   8697  O  OE2   . GLU A 1  1121 ? 218.935 228.545 200.078 1.00 166.67 -1 1121 GLU A OE2   1 
ATOM   8698  N  N     . PRO A 1  1122 ? 215.359 230.693 195.442 1.00 137.60 ?  1122 PRO A N     1 
ATOM   8699  C  CA    . PRO A 1  1122 ? 214.746 231.695 194.544 1.00 138.70 ?  1122 PRO A CA    1 
ATOM   8700  C  C     . PRO A 1  1122 ? 215.597 232.359 193.458 1.00 146.34 ?  1122 PRO A C     1 
ATOM   8701  O  O     . PRO A 1  1122 ? 215.288 232.205 192.271 1.00 144.94 ?  1122 PRO A O     1 
ATOM   8702  C  CB    . PRO A 1  1122 ? 214.135 232.698 195.519 1.00 140.69 ?  1122 PRO A CB    1 
ATOM   8703  C  CG    . PRO A 1  1122 ? 213.735 231.861 196.684 1.00 143.98 ?  1122 PRO A CG    1 
ATOM   8704  C  CD    . PRO A 1  1122 ? 214.682 230.688 196.758 1.00 139.08 ?  1122 PRO A CD    1 
ATOM   8705  N  N     . GLY A 1  1123 ? 216.657 233.057 193.871 1.00 146.95 ?  1123 GLY A N     1 
ATOM   8706  C  CA    . GLY A 1  1123 ? 217.569 233.760 192.972 1.00 149.27 ?  1123 GLY A CA    1 
ATOM   8707  C  C     . GLY A 1  1123 ? 218.222 232.863 191.942 1.00 155.59 ?  1123 GLY A C     1 
ATOM   8708  O  O     . GLY A 1  1123 ? 217.882 232.914 190.756 1.00 155.22 ?  1123 GLY A O     1 
ATOM   8709  N  N     . HIS A 1  1124 ? 219.109 231.988 192.415 1.00 153.83 ?  1124 HIS A N     1 
ATOM   8710  C  CA    . HIS A 1  1124 ? 219.876 231.028 191.619 1.00 154.56 ?  1124 HIS A CA    1 
ATOM   8711  C  C     . HIS A 1  1124 ? 219.015 229.865 191.093 1.00 154.91 ?  1124 HIS A C     1 
ATOM   8712  O  O     . HIS A 1  1124 ? 219.294 228.692 191.351 1.00 153.29 ?  1124 HIS A O     1 
ATOM   8713  C  CB    . HIS A 1  1124 ? 221.093 230.537 192.423 1.00 157.14 ?  1124 HIS A CB    1 
ATOM   8714  C  CG    . HIS A 1  1124 ? 221.223 231.166 193.780 1.00 161.80 ?  1124 HIS A CG    1 
ATOM   8715  N  ND1   . HIS A 1  1124 ? 220.236 231.011 194.747 1.00 162.83 ?  1124 HIS A ND1   1 
ATOM   8716  C  CD2   . HIS A 1  1124 ? 222.204 231.954 194.278 1.00 165.46 ?  1124 HIS A CD2   1 
ATOM   8717  C  CE1   . HIS A 1  1124 ? 220.651 231.704 195.794 1.00 163.33 ?  1124 HIS A CE1   1 
ATOM   8718  N  NE2   . HIS A 1  1124 ? 221.831 232.286 195.563 1.00 165.22 ?  1124 HIS A NE2   1 
ATOM   8719  N  N     . ALA A 1  1125 ? 217.979 230.217 190.327 1.00 150.27 ?  1125 ALA A N     1 
ATOM   8720  C  CA    . ALA A 1  1125 ? 217.025 229.298 189.723 1.00 148.38 ?  1125 ALA A CA    1 
ATOM   8721  C  C     . ALA A 1  1125 ? 217.409 228.940 188.281 1.00 151.69 ?  1125 ALA A C     1 
ATOM   8722  O  O     . ALA A 1  1125 ? 217.127 227.826 187.838 1.00 150.00 ?  1125 ALA A O     1 
ATOM   8723  C  CB    . ALA A 1  1125 ? 215.643 229.918 189.756 1.00 148.41 ?  1125 ALA A CB    1 
ATOM   8724  N  N     . ALA A 1  1126 ? 218.037 229.893 187.555 1.00 149.14 ?  1126 ALA A N     1 
ATOM   8725  C  CA    . ALA A 1  1126 ? 218.487 229.749 186.161 1.00 148.94 ?  1126 ALA A CA    1 
ATOM   8726  C  C     . ALA A 1  1126 ? 219.973 229.409 186.078 1.00 151.69 ?  1126 ALA A C     1 
ATOM   8727  O  O     . ALA A 1  1126 ? 220.450 228.972 185.026 1.00 151.02 ?  1126 ALA A O     1 
ATOM   8728  C  CB    . ALA A 1  1126 ? 218.212 231.033 185.397 1.00 150.65 ?  1126 ALA A CB    1 
ATOM   8729  N  N     . ASP A 1  1127 ? 220.695 229.628 187.194 1.00 148.00 ?  1127 ASP A N     1 
ATOM   8730  C  CA    . ASP A 1  1127 ? 222.123 229.365 187.365 1.00 148.50 ?  1127 ASP A CA    1 
ATOM   8731  C  C     . ASP A 1  1127 ? 222.356 227.849 187.334 1.00 149.91 ?  1127 ASP A C     1 
ATOM   8732  O  O     . ASP A 1  1127 ? 222.000 227.150 188.291 1.00 148.95 ?  1127 ASP A O     1 
ATOM   8733  C  CB    . ASP A 1  1127 ? 222.603 229.981 188.704 1.00 151.18 ?  1127 ASP A CB    1 
ATOM   8734  C  CG    . ASP A 1  1127 ? 224.099 229.954 189.000 1.00 163.36 ?  1127 ASP A CG    1 
ATOM   8735  O  OD1   . ASP A 1  1127 ? 224.879 229.510 188.121 1.00 165.08 ?  1127 ASP A OD1   1 
ATOM   8736  O  OD2   . ASP A 1  1127 ? 224.491 230.386 190.109 1.00 168.47 -1 1127 ASP A OD2   1 
ATOM   8737  N  N     . GLN A 1  1128 ? 222.913 227.340 186.212 1.00 144.58 ?  1128 GLN A N     1 
ATOM   8738  C  CA    . GLN A 1  1128 ? 223.196 225.912 186.041 1.00 142.48 ?  1128 GLN A CA    1 
ATOM   8739  C  C     . GLN A 1  1128 ? 224.343 225.505 186.941 1.00 144.85 ?  1128 GLN A C     1 
ATOM   8740  O  O     . GLN A 1  1128 ? 224.358 224.385 187.448 1.00 143.13 ?  1128 GLN A O     1 
ATOM   8741  C  CB    . GLN A 1  1128 ? 223.518 225.573 184.578 1.00 143.86 ?  1128 GLN A CB    1 
ATOM   8742  C  CG    . GLN A 1  1128 ? 223.533 224.067 184.300 1.00 149.08 ?  1128 GLN A CG    1 
ATOM   8743  C  CD    . GLN A 1  1128 ? 224.205 223.693 183.006 1.00 162.55 ?  1128 GLN A CD    1 
ATOM   8744  O  OE1   . GLN A 1  1128 ? 223.623 223.001 182.161 1.00 154.88 ?  1128 GLN A OE1   1 
ATOM   8745  N  NE2   . GLN A 1  1128 ? 225.467 224.083 182.845 1.00 155.04 ?  1128 GLN A NE2   1 
ATOM   8746  N  N     . GLU A 1  1129 ? 225.298 226.420 187.145 1.00 142.32 ?  1129 GLU A N     1 
ATOM   8747  C  CA    . GLU A 1  1129 ? 226.455 226.162 187.994 1.00 143.02 ?  1129 GLU A CA    1 
ATOM   8748  C  C     . GLU A 1  1129 ? 226.082 225.983 189.465 1.00 144.64 ?  1129 GLU A C     1 
ATOM   8749  O  O     . GLU A 1  1129 ? 226.731 225.192 190.151 1.00 144.46 ?  1129 GLU A O     1 
ATOM   8750  C  CB    . GLU A 1  1129 ? 227.588 227.183 187.768 1.00 146.47 ?  1129 GLU A CB    1 
ATOM   8751  C  CG    . GLU A 1  1129 ? 228.251 227.092 186.392 1.00 158.43 ?  1129 GLU A CG    1 
ATOM   8752  C  CD    . GLU A 1  1129 ? 228.683 225.719 185.895 1.00 175.97 ?  1129 GLU A CD    1 
ATOM   8753  O  OE1   . GLU A 1  1129 ? 229.421 225.015 186.623 1.00 165.14 ?  1129 GLU A OE1   1 
ATOM   8754  O  OE2   . GLU A 1  1129 ? 228.283 225.352 184.765 1.00 167.34 -1 1129 GLU A OE2   1 
ATOM   8755  N  N     . GLN A 1  1130 ? 225.000 226.658 189.926 1.00 138.76 ?  1130 GLN A N     1 
ATOM   8756  C  CA    . GLN A 1  1130 ? 224.468 226.520 191.287 1.00 136.87 ?  1130 GLN A CA    1 
ATOM   8757  C  C     . GLN A 1  1130 ? 223.835 225.134 191.410 1.00 136.44 ?  1130 GLN A C     1 
ATOM   8758  O  O     . GLN A 1  1130 ? 224.016 224.466 192.427 1.00 135.95 ?  1130 GLN A O     1 
ATOM   8759  C  CB    . GLN A 1  1130 ? 223.433 227.620 191.594 1.00 137.92 ?  1130 GLN A CB    1 
ATOM   8760  C  CG    . GLN A 1  1130 ? 222.503 227.319 192.777 1.00 146.30 ?  1130 GLN A CG    1 
ATOM   8761  C  CD    . GLN A 1  1130 ? 222.902 227.968 194.077 1.00 159.49 ?  1130 GLN A CD    1 
ATOM   8762  O  OE1   . GLN A 1  1130 ? 223.960 228.607 194.205 1.00 155.67 ?  1130 GLN A OE1   1 
ATOM   8763  N  NE2   . GLN A 1  1130 ? 222.021 227.847 195.063 1.00 145.70 ?  1130 GLN A NE2   1 
ATOM   8764  N  N     . ALA A 1  1131 ? 223.109 224.700 190.363 1.00 129.60 ?  1131 ALA A N     1 
ATOM   8765  C  CA    . ALA A 1  1131 ? 222.469 223.391 190.344 1.00 127.05 ?  1131 ALA A CA    1 
ATOM   8766  C  C     . ALA A 1  1131 ? 223.517 222.301 190.577 1.00 128.86 ?  1131 ALA A C     1 
ATOM   8767  O  O     . ALA A 1  1131 ? 223.355 221.496 191.500 1.00 127.63 ?  1131 ALA A O     1 
ATOM   8768  C  CB    . ALA A 1  1131 ? 221.753 223.179 189.022 1.00 127.09 ?  1131 ALA A CB    1 
ATOM   8769  N  N     . LYS A 1  1132 ? 224.641 222.363 189.806 1.00 124.43 ?  1132 LYS A N     1 
ATOM   8770  C  CA    . LYS A 1  1132 ? 225.782 221.443 189.868 1.00 123.55 ?  1132 LYS A CA    1 
ATOM   8771  C  C     . LYS A 1  1132 ? 226.333 221.382 191.278 1.00 125.71 ?  1132 LYS A C     1 
ATOM   8772  O  O     . LYS A 1  1132 ? 226.618 220.287 191.762 1.00 124.94 ?  1132 LYS A O     1 
ATOM   8773  C  CB    . LYS A 1  1132 ? 226.898 221.867 188.898 1.00 127.26 ?  1132 LYS A CB    1 
ATOM   8774  C  CG    . LYS A 1  1132 ? 226.559 221.741 187.422 1.00 142.76 ?  1132 LYS A CG    1 
ATOM   8775  C  CD    . LYS A 1  1132 ? 227.748 222.092 186.541 1.00 158.43 ?  1132 LYS A CD    1 
ATOM   8776  C  CE    . LYS A 1  1132 ? 227.384 222.166 185.078 1.00 170.70 ?  1132 LYS A CE    1 
ATOM   8777  N  NZ    . LYS A 1  1132 ? 228.517 222.669 184.254 1.00 179.67 1  1132 LYS A NZ    1 
ATOM   8778  N  N     . LEU A 1  1133 ? 226.463 222.560 191.939 1.00 121.70 ?  1133 LEU A N     1 
ATOM   8779  C  CA    . LEU A 1  1133 ? 226.977 222.713 193.306 1.00 121.59 ?  1133 LEU A CA    1 
ATOM   8780  C  C     . LEU A 1  1133 ? 226.152 221.920 194.303 1.00 121.67 ?  1133 LEU A C     1 
ATOM   8781  O  O     . LEU A 1  1133 ? 226.723 221.275 195.185 1.00 121.08 ?  1133 LEU A O     1 
ATOM   8782  C  CB    . LEU A 1  1133 ? 227.027 224.195 193.742 1.00 122.83 ?  1133 LEU A CB    1 
ATOM   8783  C  CG    . LEU A 1  1133 ? 228.067 225.101 193.096 1.00 129.51 ?  1133 LEU A CG    1 
ATOM   8784  C  CD1   . LEU A 1  1133 ? 227.660 226.559 193.212 1.00 130.02 ?  1133 LEU A CD1   1 
ATOM   8785  C  CD2   . LEU A 1  1133 ? 229.434 224.900 193.719 1.00 134.97 ?  1133 LEU A CD2   1 
ATOM   8786  N  N     . ILE A 1  1134 ? 224.812 221.969 194.173 1.00 115.72 ?  1134 ILE A N     1 
ATOM   8787  C  CA    . ILE A 1  1134 ? 223.952 221.225 195.082 1.00 113.82 ?  1134 ILE A CA    1 
ATOM   8788  C  C     . ILE A 1  1134 ? 224.016 219.752 194.714 1.00 116.63 ?  1134 ILE A C     1 
ATOM   8789  O  O     . ILE A 1  1134 ? 224.266 218.927 195.595 1.00 115.70 ?  1134 ILE A O     1 
ATOM   8790  C  CB    . ILE A 1  1134 ? 222.520 221.803 195.247 1.00 115.51 ?  1134 ILE A CB    1 
ATOM   8791  C  CG1   . ILE A 1  1134 ? 222.572 223.215 195.837 1.00 116.45 ?  1134 ILE A CG1   1 
ATOM   8792  C  CG2   . ILE A 1  1134 ? 221.705 220.929 196.192 1.00 115.42 ?  1134 ILE A CG2   1 
ATOM   8793  C  CD1   . ILE A 1  1134 ? 222.067 224.224 194.984 1.00 125.33 ?  1134 ILE A CD1   1 
ATOM   8794  N  N     . ARG A 1  1135 ? 223.904 219.438 193.400 1.00 112.57 ?  1135 ARG A N     1 
ATOM   8795  C  CA    . ARG A 1  1135 ? 224.005 218.077 192.873 1.00 111.45 ?  1135 ARG A CA    1 
ATOM   8796  C  C     . ARG A 1  1135 ? 225.166 217.383 193.556 1.00 116.03 ?  1135 ARG A C     1 
ATOM   8797  O  O     . ARG A 1  1135 ? 224.967 216.342 194.175 1.00 114.23 ?  1135 ARG A O     1 
ATOM   8798  C  CB    . ARG A 1  1135 ? 224.198 218.086 191.345 1.00 111.60 ?  1135 ARG A CB    1 
ATOM   8799  C  CG    . ARG A 1  1135 ? 223.996 216.716 190.712 1.00 123.41 ?  1135 ARG A CG    1 
ATOM   8800  C  CD    . ARG A 1  1135 ? 225.287 216.073 190.251 1.00 138.56 ?  1135 ARG A CD    1 
ATOM   8801  N  NE    . ARG A 1  1135 ? 225.411 216.168 188.799 1.00 151.94 ?  1135 ARG A NE    1 
ATOM   8802  C  CZ    . ARG A 1  1135 ? 226.066 217.132 188.163 1.00 172.76 ?  1135 ARG A CZ    1 
ATOM   8803  N  NH1   . ARG A 1  1135 ? 226.694 218.084 188.847 1.00 163.91 1  1135 ARG A NH1   1 
ATOM   8804  N  NH2   . ARG A 1  1135 ? 226.108 217.147 186.839 1.00 162.24 ?  1135 ARG A NH2   1 
ATOM   8805  N  N     . SER A 1  1136 ? 226.346 218.035 193.529 1.00 115.46 ?  1136 SER A N     1 
ATOM   8806  C  CA    . SER A 1  1136 ? 227.599 217.587 194.144 1.00 116.80 ?  1136 SER A CA    1 
ATOM   8807  C  C     . SER A 1  1136 ? 227.487 217.442 195.676 1.00 121.21 ?  1136 SER A C     1 
ATOM   8808  O  O     . SER A 1  1136 ? 227.941 216.424 196.218 1.00 122.14 ?  1136 SER A O     1 
ATOM   8809  C  CB    . SER A 1  1136 ? 228.745 218.530 193.772 1.00 121.16 ?  1136 SER A CB    1 
ATOM   8810  O  OG    . SER A 1  1136 ? 228.892 218.637 192.364 1.00 128.10 ?  1136 SER A OG    1 
ATOM   8811  N  N     . ALA A 1  1137 ? 226.845 218.430 196.357 1.00 115.58 ?  1137 ALA A N     1 
ATOM   8812  C  CA    . ALA A 1  1137 ? 226.667 218.472 197.813 1.00 114.34 ?  1137 ALA A CA    1 
ATOM   8813  C  C     . ALA A 1  1137 ? 225.701 217.436 198.364 1.00 115.52 ?  1137 ALA A C     1 
ATOM   8814  O  O     . ALA A 1  1137 ? 225.758 217.152 199.565 1.00 113.48 ?  1137 ALA A O     1 
ATOM   8815  C  CB    . ALA A 1  1137 ? 226.221 219.857 198.236 1.00 115.41 ?  1137 ALA A CB    1 
ATOM   8816  N  N     . ILE A 1  1138 ? 224.807 216.886 197.493 1.00 112.41 ?  1138 ILE A N     1 
ATOM   8817  C  CA    . ILE A 1  1138 ? 223.769 215.898 197.844 1.00 111.08 ?  1138 ILE A CA    1 
ATOM   8818  C  C     . ILE A 1  1138 ? 223.987 214.465 197.329 1.00 116.46 ?  1138 ILE A C     1 
ATOM   8819  O  O     . ILE A 1  1138 ? 223.738 213.524 198.087 1.00 114.97 ?  1138 ILE A O     1 
ATOM   8820  C  CB    . ILE A 1  1138 ? 222.311 216.408 197.615 1.00 112.58 ?  1138 ILE A CB    1 
ATOM   8821  C  CG1   . ILE A 1  1138 ? 221.966 216.605 196.112 1.00 111.91 ?  1138 ILE A CG1   1 
ATOM   8822  C  CG2   . ILE A 1  1138 ? 222.027 217.664 198.448 1.00 113.98 ?  1138 ILE A CG2   1 
ATOM   8823  C  CD1   . ILE A 1  1138 ? 220.506 216.512 195.782 1.00 111.40 ?  1138 ILE A CD1   1 
ATOM   8824  N  N     . GLU A 1  1139 ? 224.419 214.294 196.051 1.00 115.52 ?  1139 GLU A N     1 
ATOM   8825  C  CA    . GLU A 1  1139 ? 224.652 212.970 195.445 1.00 115.87 ?  1139 GLU A CA    1 
ATOM   8826  C  C     . GLU A 1  1139 ? 225.746 212.253 196.206 1.00 122.30 ?  1139 GLU A C     1 
ATOM   8827  O  O     . GLU A 1  1139 ? 226.866 212.773 196.319 1.00 123.84 ?  1139 GLU A O     1 
ATOM   8828  C  CB    . GLU A 1  1139 ? 225.024 213.071 193.952 1.00 117.62 ?  1139 GLU A CB    1 
ATOM   8829  C  CG    . GLU A 1  1139 ? 224.898 211.752 193.208 1.00 125.65 ?  1139 GLU A CG    1 
ATOM   8830  C  CD    . GLU A 1  1139 ? 225.727 211.629 191.946 1.00 140.38 ?  1139 GLU A CD    1 
ATOM   8831  O  OE1   . GLU A 1  1139 ? 225.665 212.537 191.083 1.00 122.12 ?  1139 GLU A OE1   1 
ATOM   8832  O  OE2   . GLU A 1  1139 ? 226.411 210.589 191.804 1.00 134.88 -1 1139 GLU A OE2   1 
ATOM   8833  N  N     . HIS A 1  1140 ? 225.396 211.077 196.755 1.00 118.50 ?  1140 HIS A N     1 
ATOM   8834  C  CA    . HIS A 1  1140 ? 226.273 210.233 197.572 1.00 119.15 ?  1140 HIS A CA    1 
ATOM   8835  C  C     . HIS A 1  1140 ? 227.509 209.725 196.845 1.00 124.52 ?  1140 HIS A C     1 
ATOM   8836  O  O     . HIS A 1  1140 ? 227.418 209.210 195.717 1.00 124.55 ?  1140 HIS A O     1 
ATOM   8837  C  CB    . HIS A 1  1140 ? 225.492 209.062 198.183 1.00 118.46 ?  1140 HIS A CB    1 
ATOM   8838  C  CG    . HIS A 1  1140 ? 226.225 208.308 199.242 1.00 121.78 ?  1140 HIS A CG    1 
ATOM   8839  N  ND1   . HIS A 1  1140 ? 226.562 208.898 200.448 1.00 123.69 ?  1140 HIS A ND1   1 
ATOM   8840  C  CD2   . HIS A 1  1140 ? 226.604 207.012 199.262 1.00 123.08 ?  1140 HIS A CD2   1 
ATOM   8841  C  CE1   . HIS A 1  1140 ? 227.146 207.950 201.154 1.00 123.43 ?  1140 HIS A CE1   1 
ATOM   8842  N  NE2   . HIS A 1  1140 ? 227.203 206.802 200.478 1.00 123.53 ?  1140 HIS A NE2   1 
ATOM   8843  N  N     . THR A 1  1141 ? 228.669 209.881 197.517 1.00 120.71 ?  1141 THR A N     1 
ATOM   8844  C  CA    . THR A 1  1141 ? 229.971 209.442 197.034 1.00 120.75 ?  1141 THR A CA    1 
ATOM   8845  C  C     . THR A 1  1141 ? 230.729 208.725 198.161 1.00 123.54 ?  1141 THR A C     1 
ATOM   8846  O  O     . THR A 1  1141 ? 230.847 209.254 199.277 1.00 122.57 ?  1141 THR A O     1 
ATOM   8847  C  CB    . THR A 1  1141 ? 230.753 210.597 196.391 1.00 128.46 ?  1141 THR A CB    1 
ATOM   8848  O  OG1   . THR A 1  1141 ? 229.880 211.387 195.583 1.00 125.78 ?  1141 THR A OG1   1 
ATOM   8849  C  CG2   . THR A 1  1141 ? 231.912 210.109 195.543 1.00 129.47 ?  1141 THR A CG2   1 
ATOM   8850  N  N     . THR A 1  1142 ? 231.193 207.489 197.857 1.00 119.52 ?  1142 THR A N     1 
ATOM   8851  C  CA    . THR A 1  1142 ? 231.965 206.604 198.743 1.00 119.36 ?  1142 THR A CA    1 
ATOM   8852  C  C     . THR A 1  1142 ? 233.368 206.413 198.184 1.00 122.03 ?  1142 THR A C     1 
ATOM   8853  O  O     . THR A 1  1142 ? 233.578 206.508 196.966 1.00 121.94 ?  1142 THR A O     1 
ATOM   8854  C  CB    . THR A 1  1142 ? 231.321 205.218 198.864 1.00 126.16 ?  1142 THR A CB    1 
ATOM   8855  O  OG1   . THR A 1  1142 ? 230.235 205.106 197.941 1.00 125.06 ?  1142 THR A OG1   1 
ATOM   8856  C  CG2   . THR A 1  1142 ? 230.894 204.889 200.292 1.00 123.17 ?  1142 THR A CG2   1 
ATOM   8857  N  N     . LEU A 1  1143 ? 234.319 206.086 199.071 1.00 116.35 ?  1143 LEU A N     1 
ATOM   8858  C  CA    . LEU A 1  1143 ? 235.701 205.851 198.678 1.00 115.82 ?  1143 LEU A CA    1 
ATOM   8859  C  C     . LEU A 1  1143 ? 235.785 204.740 197.648 1.00 116.45 ?  1143 LEU A C     1 
ATOM   8860  O  O     . LEU A 1  1143 ? 236.695 204.753 196.830 1.00 116.75 ?  1143 LEU A O     1 
ATOM   8861  C  CB    . LEU A 1  1143 ? 236.556 205.552 199.920 1.00 116.49 ?  1143 LEU A CB    1 
ATOM   8862  C  CG    . LEU A 1  1143 ? 238.069 205.372 199.783 1.00 121.61 ?  1143 LEU A CG    1 
ATOM   8863  C  CD1   . LEU A 1  1143 ? 238.708 206.483 198.979 1.00 122.30 ?  1143 LEU A CD1   1 
ATOM   8864  C  CD2   . LEU A 1  1143 ? 238.700 205.316 201.134 1.00 124.28 ?  1143 LEU A CD2   1 
ATOM   8865  N  N     . LYS A 1  1144 ? 234.791 203.839 197.632 1.00 110.34 ?  1144 LYS A N     1 
ATOM   8866  C  CA    . LYS A 1  1144 ? 234.739 202.728 196.690 1.00 110.07 ?  1144 LYS A CA    1 
ATOM   8867  C  C     . LYS A 1  1144 ? 234.587 203.188 195.231 1.00 114.68 ?  1144 LYS A C     1 
ATOM   8868  O  O     . LYS A 1  1144 ? 235.274 202.666 194.334 1.00 113.74 ?  1144 LYS A O     1 
ATOM   8869  C  CB    . LYS A 1  1144 ? 233.623 201.749 197.082 1.00 110.88 ?  1144 LYS A CB    1 
ATOM   8870  C  CG    . LYS A 1  1144 ? 233.783 200.363 196.461 1.00 119.21 ?  1144 LYS A CG    1 
ATOM   8871  C  CD    . LYS A 1  1144 ? 232.600 199.480 196.782 1.00 125.98 ?  1144 LYS A CD    1 
ATOM   8872  C  CE    . LYS A 1  1144 ? 232.775 198.061 196.312 1.00 134.53 ?  1144 LYS A CE    1 
ATOM   8873  N  NZ    . LYS A 1  1144 ? 231.673 197.204 196.813 1.00 145.34 1  1144 LYS A NZ    1 
ATOM   8874  N  N     . SER A 1  1145 ? 233.697 204.178 195.008 1.00 111.96 ?  1145 SER A N     1 
ATOM   8875  C  CA    . SER A 1  1145 ? 233.384 204.725 193.683 1.00 111.91 ?  1145 SER A CA    1 
ATOM   8876  C  C     . SER A 1  1145 ? 234.564 205.385 192.956 1.00 117.28 ?  1145 SER A C     1 
ATOM   8877  O  O     . SER A 1  1145 ? 234.534 205.507 191.732 1.00 116.83 ?  1145 SER A O     1 
ATOM   8878  C  CB    . SER A 1  1145 ? 232.168 205.650 193.742 1.00 114.58 ?  1145 SER A CB    1 
ATOM   8879  O  OG    . SER A 1  1145 ? 232.160 206.470 194.899 1.00 124.11 ?  1145 SER A OG    1 
ATOM   8880  N  N     . VAL A 1  1146 ? 235.609 205.765 193.695 1.00 115.07 ?  1146 VAL A N     1 
ATOM   8881  C  CA    . VAL A 1  1146 ? 236.782 206.427 193.126 1.00 116.31 ?  1146 VAL A CA    1 
ATOM   8882  C  C     . VAL A 1  1146 ? 237.995 205.513 192.966 1.00 121.19 ?  1146 VAL A C     1 
ATOM   8883  O  O     . VAL A 1  1146 ? 238.886 205.828 192.173 1.00 122.41 ?  1146 VAL A O     1 
ATOM   8884  C  CB    . VAL A 1  1146 ? 237.136 207.732 193.890 1.00 121.19 ?  1146 VAL A CB    1 
ATOM   8885  C  CG1   . VAL A 1  1146 ? 236.090 208.820 193.655 1.00 120.25 ?  1146 VAL A CG1   1 
ATOM   8886  C  CG2   . VAL A 1  1146 ? 237.331 207.481 195.385 1.00 121.14 ?  1146 VAL A CG2   1 
ATOM   8887  N  N     . THR A 1  1147 ? 238.028 204.389 193.719 1.00 116.54 ?  1147 THR A N     1 
ATOM   8888  C  CA    . THR A 1  1147 ? 239.142 203.425 193.786 1.00 116.32 ?  1147 THR A CA    1 
ATOM   8889  C  C     . THR A 1  1147 ? 239.259 202.442 192.625 1.00 117.63 ?  1147 THR A C     1 
ATOM   8890  O  O     . THR A 1  1147 ? 238.291 201.741 192.309 1.00 116.38 ?  1147 THR A O     1 
ATOM   8891  C  CB    . THR A 1  1147 ? 239.102 202.664 195.120 1.00 122.53 ?  1147 THR A CB    1 
ATOM   8892  O  OG1   . THR A 1  1147 ? 238.744 203.539 196.187 1.00 121.01 ?  1147 THR A OG1   1 
ATOM   8893  C  CG2   . THR A 1  1147 ? 240.413 202.005 195.441 1.00 125.17 ?  1147 THR A CG2   1 
ATOM   8894  N  N     . ILE A 1  1148 ? 240.468 202.345 192.041 1.00 113.85 ?  1148 ILE A N     1 
ATOM   8895  C  CA    . ILE A 1  1148 ? 240.766 201.383 190.972 1.00 113.75 ?  1148 ILE A CA    1 
ATOM   8896  C  C     . ILE A 1  1148 ? 241.042 200.012 191.607 1.00 118.45 ?  1148 ILE A C     1 
ATOM   8897  O  O     . ILE A 1  1148 ? 240.482 199.008 191.158 1.00 117.92 ?  1148 ILE A O     1 
ATOM   8898  C  CB    . ILE A 1  1148 ? 241.925 201.806 190.017 1.00 118.06 ?  1148 ILE A CB    1 
ATOM   8899  C  CG1   . ILE A 1  1148 ? 241.827 203.289 189.607 1.00 118.82 ?  1148 ILE A CG1   1 
ATOM   8900  C  CG2   . ILE A 1  1148 ? 241.978 200.879 188.784 1.00 117.68 ?  1148 ILE A CG2   1 
ATOM   8901  C  CD1   . ILE A 1  1148 ? 243.013 203.859 188.744 1.00 128.47 ?  1148 ILE A CD1   1 
ATOM   8902  N  N     . ALA A 1  1149 ? 241.920 199.980 192.640 1.00 115.14 ?  1149 ALA A N     1 
ATOM   8903  C  CA    . ALA A 1  1149 ? 242.339 198.785 193.379 1.00 114.66 ?  1149 ALA A CA    1 
ATOM   8904  C  C     . ALA A 1  1149 ? 243.050 199.159 194.673 1.00 118.56 ?  1149 ALA A C     1 
ATOM   8905  O  O     . ALA A 1  1149 ? 243.754 200.175 194.717 1.00 119.19 ?  1149 ALA A O     1 
ATOM   8906  C  CB    . ALA A 1  1149 ? 243.299 197.975 192.525 1.00 116.60 ?  1149 ALA A CB    1 
ATOM   8907  N  N     . SER A 1  1150 ? 242.914 198.314 195.711 1.00 114.15 ?  1150 SER A N     1 
ATOM   8908  C  CA    . SER A 1  1150 ? 243.656 198.500 196.967 1.00 114.58 ?  1150 SER A CA    1 
ATOM   8909  C  C     . SER A 1  1150 ? 244.720 197.386 197.090 1.00 116.52 ?  1150 SER A C     1 
ATOM   8910  O  O     . SER A 1  1150 ? 244.516 196.280 196.596 1.00 116.17 ?  1150 SER A O     1 
ATOM   8911  C  CB    . SER A 1  1150 ? 242.728 198.563 198.179 1.00 117.61 ?  1150 SER A CB    1 
ATOM   8912  O  OG    . SER A 1  1150 ? 242.052 197.345 198.442 1.00 125.13 ?  1150 SER A OG    1 
ATOM   8913  N  N     . GLU A 1  1151 ? 245.873 197.690 197.668 1.00 111.42 ?  1151 GLU A N     1 
ATOM   8914  C  CA    . GLU A 1  1151 ? 246.936 196.698 197.769 1.00 111.26 ?  1151 GLU A CA    1 
ATOM   8915  C  C     . GLU A 1  1151 ? 247.582 196.699 199.150 1.00 113.04 ?  1151 GLU A C     1 
ATOM   8916  O  O     . GLU A 1  1151 ? 247.803 197.761 199.729 1.00 112.67 ?  1151 GLU A O     1 
ATOM   8917  C  CB    . GLU A 1  1151 ? 248.031 196.968 196.718 1.00 114.09 ?  1151 GLU A CB    1 
ATOM   8918  C  CG    . GLU A 1  1151 ? 247.722 196.638 195.264 1.00 121.36 ?  1151 GLU A CG    1 
ATOM   8919  C  CD    . GLU A 1  1151 ? 248.857 196.956 194.297 1.00 130.78 ?  1151 GLU A CD    1 
ATOM   8920  O  OE1   . GLU A 1  1151 ? 249.431 198.070 194.379 1.00 107.19 ?  1151 GLU A OE1   1 
ATOM   8921  O  OE2   . GLU A 1  1151 ? 249.164 196.092 193.444 1.00 117.56 -1 1151 GLU A OE2   1 
ATOM   8922  N  N     . ILE A 1  1152 ? 247.923 195.514 199.657 1.00 108.13 ?  1152 ILE A N     1 
ATOM   8923  C  CA    . ILE A 1  1152 ? 248.650 195.391 200.916 1.00 108.15 ?  1152 ILE A CA    1 
ATOM   8924  C  C     . ILE A 1  1152 ? 250.070 194.925 200.595 1.00 113.50 ?  1152 ILE A C     1 
ATOM   8925  O  O     . ILE A 1  1152 ? 250.260 193.929 199.898 1.00 113.25 ?  1152 ILE A O     1 
ATOM   8926  C  CB    . ILE A 1  1152 ? 247.947 194.561 202.015 1.00 109.85 ?  1152 ILE A CB    1 
ATOM   8927  C  CG1   . ILE A 1  1152 ? 246.499 195.055 202.245 1.00 107.80 ?  1152 ILE A CG1   1 
ATOM   8928  C  CG2   . ILE A 1  1152 ? 248.773 194.604 203.317 1.00 111.44 ?  1152 ILE A CG2   1 
ATOM   8929  C  CD1   . ILE A 1  1152 ? 245.679 194.230 203.219 1.00 111.36 ?  1152 ILE A CD1   1 
ATOM   8930  N  N     . TYR A 1  1153 ? 251.051 195.709 201.049 1.00 111.23 ?  1153 TYR A N     1 
ATOM   8931  C  CA    . TYR A 1  1153 ? 252.470 195.510 200.826 1.00 112.93 ?  1153 TYR A CA    1 
ATOM   8932  C  C     . TYR A 1  1153 ? 253.179 195.454 202.150 1.00 119.38 ?  1153 TYR A C     1 
ATOM   8933  O  O     . TYR A 1  1153 ? 252.716 196.040 203.132 1.00 118.44 ?  1153 TYR A O     1 
ATOM   8934  C  CB    . TYR A 1  1153 ? 253.048 196.733 200.097 1.00 114.98 ?  1153 TYR A CB    1 
ATOM   8935  C  CG    . TYR A 1  1153 ? 252.789 196.820 198.615 1.00 117.31 ?  1153 TYR A CG    1 
ATOM   8936  C  CD1   . TYR A 1  1153 ? 251.563 197.251 198.129 1.00 118.58 ?  1153 TYR A CD1   1 
ATOM   8937  C  CD2   . TYR A 1  1153 ? 253.814 196.620 197.698 1.00 119.72 ?  1153 TYR A CD2   1 
ATOM   8938  C  CE1   . TYR A 1  1153 ? 251.334 197.391 196.763 1.00 120.88 ?  1153 TYR A CE1   1 
ATOM   8939  C  CE2   . TYR A 1  1153 ? 253.601 196.763 196.330 1.00 120.59 ?  1153 TYR A CE2   1 
ATOM   8940  C  CZ    . TYR A 1  1153 ? 252.355 197.143 195.864 1.00 129.98 ?  1153 TYR A CZ    1 
ATOM   8941  O  OH    . TYR A 1  1153 ? 252.117 197.276 194.516 1.00 134.24 ?  1153 TYR A OH    1 
ATOM   8942  N  N     . TYR A 1  1154 ? 254.360 194.835 202.157 1.00 118.92 ?  1154 TYR A N     1 
ATOM   8943  C  CA    . TYR A 1  1154 ? 255.218 194.848 203.322 1.00 120.53 ?  1154 TYR A CA    1 
ATOM   8944  C  C     . TYR A 1  1154 ? 256.298 195.874 202.987 1.00 130.41 ?  1154 TYR A C     1 
ATOM   8945  O  O     . TYR A 1  1154 ? 257.176 195.597 202.172 1.00 131.04 ?  1154 TYR A O     1 
ATOM   8946  C  CB    . TYR A 1  1154 ? 255.802 193.456 203.634 1.00 121.34 ?  1154 TYR A CB    1 
ATOM   8947  C  CG    . TYR A 1  1154 ? 256.770 193.471 204.799 1.00 123.65 ?  1154 TYR A CG    1 
ATOM   8948  C  CD1   . TYR A 1  1154 ? 256.314 193.557 206.109 1.00 125.09 ?  1154 TYR A CD1   1 
ATOM   8949  C  CD2   . TYR A 1  1154 ? 258.146 193.433 204.590 1.00 126.12 ?  1154 TYR A CD2   1 
ATOM   8950  C  CE1   . TYR A 1  1154 ? 257.203 193.614 207.182 1.00 126.88 ?  1154 TYR A CE1   1 
ATOM   8951  C  CE2   . TYR A 1  1154 ? 259.042 193.451 205.658 1.00 128.16 ?  1154 TYR A CE2   1 
ATOM   8952  C  CZ    . TYR A 1  1154 ? 258.565 193.560 206.951 1.00 132.51 ?  1154 TYR A CZ    1 
ATOM   8953  O  OH    . TYR A 1  1154 ? 259.433 193.602 208.010 1.00 132.93 ?  1154 TYR A OH    1 
ATOM   8954  N  N     . ASP A 1  1155 ? 256.161 197.097 203.531 1.00 131.19 ?  1155 ASP A N     1 
ATOM   8955  C  CA    . ASP A 1  1155 ? 257.127 198.189 203.353 1.00 134.32 ?  1155 ASP A CA    1 
ATOM   8956  C  C     . ASP A 1  1155 ? 257.653 198.547 204.752 1.00 140.41 ?  1155 ASP A C     1 
ATOM   8957  O  O     . ASP A 1  1155 ? 257.040 199.349 205.467 1.00 140.18 ?  1155 ASP A O     1 
ATOM   8958  C  CB    . ASP A 1  1155 ? 256.493 199.392 202.633 1.00 135.99 ?  1155 ASP A CB    1 
ATOM   8959  C  CG    . ASP A 1  1155 ? 257.465 200.130 201.734 1.00 153.63 ?  1155 ASP A CG    1 
ATOM   8960  O  OD1   . ASP A 1  1155 ? 258.603 200.425 202.191 1.00 156.72 ?  1155 ASP A OD1   1 
ATOM   8961  O  OD2   . ASP A 1  1155 ? 257.104 200.389 200.566 1.00 160.41 -1 1155 ASP A OD2   1 
ATOM   8962  N  N     . PRO A 1  1156 ? 258.712 197.856 205.205 1.00 138.35 ?  1156 PRO A N     1 
ATOM   8963  C  CA    . PRO A 1  1156 ? 259.151 198.021 206.592 1.00 139.96 ?  1156 PRO A CA    1 
ATOM   8964  C  C     . PRO A 1  1156 ? 259.761 199.349 207.010 1.00 147.79 ?  1156 PRO A C     1 
ATOM   8965  O  O     . PRO A 1  1156 ? 259.694 199.680 208.195 1.00 147.77 ?  1156 PRO A O     1 
ATOM   8966  C  CB    . PRO A 1  1156 ? 260.069 196.827 206.812 1.00 142.92 ?  1156 PRO A CB    1 
ATOM   8967  C  CG    . PRO A 1  1156 ? 260.601 196.531 205.475 1.00 147.24 ?  1156 PRO A CG    1 
ATOM   8968  C  CD    . PRO A 1  1156 ? 259.495 196.816 204.517 1.00 140.45 ?  1156 PRO A CD    1 
ATOM   8969  N  N     . ASP A 1  1157 ? 260.356 200.102 206.081 1.00 147.40 ?  1157 ASP A N     1 
ATOM   8970  C  CA    . ASP A 1  1157 ? 260.904 201.394 206.470 1.00 149.97 ?  1157 ASP A CA    1 
ATOM   8971  C  C     . ASP A 1  1157 ? 259.848 202.477 206.212 1.00 156.34 ?  1157 ASP A C     1 
ATOM   8972  O  O     . ASP A 1  1157 ? 259.504 202.707 205.045 1.00 156.39 ?  1157 ASP A O     1 
ATOM   8973  C  CB    . ASP A 1  1157 ? 262.220 201.703 205.738 1.00 154.01 ?  1157 ASP A CB    1 
ATOM   8974  C  CG    . ASP A 1  1157 ? 262.993 202.904 206.278 1.00 168.29 ?  1157 ASP A CG    1 
ATOM   8975  O  OD1   . ASP A 1  1157 ? 262.501 203.558 207.235 1.00 167.70 ?  1157 ASP A OD1   1 
ATOM   8976  O  OD2   . ASP A 1  1157 ? 264.096 203.185 205.755 1.00 178.56 -1 1157 ASP A OD2   1 
ATOM   8977  N  N     . PRO A 1  1158 ? 259.291 203.152 207.258 1.00 154.02 ?  1158 PRO A N     1 
ATOM   8978  C  CA    . PRO A 1  1158 ? 258.284 204.196 206.994 1.00 152.86 ?  1158 PRO A CA    1 
ATOM   8979  C  C     . PRO A 1  1158 ? 258.849 205.335 206.145 1.00 158.44 ?  1158 PRO A C     1 
ATOM   8980  O  O     . PRO A 1  1158 ? 258.138 205.857 205.286 1.00 157.28 ?  1158 PRO A O     1 
ATOM   8981  C  CB    . PRO A 1  1158 ? 257.861 204.655 208.397 1.00 154.34 ?  1158 PRO A CB    1 
ATOM   8982  C  CG    . PRO A 1  1158 ? 258.254 203.541 209.307 1.00 158.98 ?  1158 PRO A CG    1 
ATOM   8983  C  CD    . PRO A 1  1158 ? 259.532 203.015 208.708 1.00 156.29 ?  1158 PRO A CD    1 
ATOM   8984  N  N     . ARG A 1  1159 ? 260.153 205.641 206.328 1.00 156.49 ?  1159 ARG A N     1 
ATOM   8985  C  CA    . ARG A 1  1159 ? 260.893 206.686 205.622 1.00 157.53 ?  1159 ARG A CA    1 
ATOM   8986  C  C     . ARG A 1  1159 ? 261.305 206.337 204.176 1.00 162.73 ?  1159 ARG A C     1 
ATOM   8987  O  O     . ARG A 1  1159 ? 261.406 207.249 203.359 1.00 162.79 ?  1159 ARG A O     1 
ATOM   8988  C  CB    . ARG A 1  1159 ? 262.108 207.153 206.443 1.00 159.41 ?  1159 ARG A CB    1 
ATOM   8989  C  CG    . ARG A 1  1159 ? 261.760 207.670 207.834 1.00 166.54 ?  1159 ARG A CG    1 
ATOM   8990  C  CD    . ARG A 1  1159 ? 262.722 208.744 208.294 1.00 177.47 ?  1159 ARG A CD    1 
ATOM   8991  N  NE    . ARG A 1  1159 ? 262.062 210.045 208.410 1.00 184.94 ?  1159 ARG A NE    1 
ATOM   8992  C  CZ    . ARG A 1  1159 ? 262.658 211.163 208.820 1.00 194.98 ?  1159 ARG A CZ    1 
ATOM   8993  N  NH1   . ARG A 1  1159 ? 263.942 211.154 209.159 1.00 186.80 1  1159 ARG A NH1   1 
ATOM   8994  N  NH2   . ARG A 1  1159 ? 261.973 212.297 208.897 1.00 184.30 ?  1159 ARG A NH2   1 
ATOM   8995  N  N     . SER A 1  1160 ? 261.557 205.048 203.852 1.00 159.59 ?  1160 SER A N     1 
ATOM   8996  C  CA    . SER A 1  1160 ? 261.949 204.641 202.490 1.00 159.77 ?  1160 SER A CA    1 
ATOM   8997  C  C     . SER A 1  1160 ? 261.054 203.532 201.910 1.00 160.79 ?  1160 SER A C     1 
ATOM   8998  O  O     . SER A 1  1160 ? 260.786 202.533 202.578 1.00 160.06 ?  1160 SER A O     1 
ATOM   8999  C  CB    . SER A 1  1160 ? 263.436 204.291 202.410 1.00 166.33 ?  1160 SER A CB    1 
ATOM   9000  O  OG    . SER A 1  1160 ? 263.745 203.038 202.999 1.00 177.76 ?  1160 SER A OG    1 
ATOM   9001  N  N     . THR A 1  1161 ? 260.622 203.702 200.657 1.00 154.69 ?  1161 THR A N     1 
ATOM   9002  C  CA    . THR A 1  1161 ? 259.676 202.804 200.015 1.00 152.23 ?  1161 THR A CA    1 
ATOM   9003  C  C     . THR A 1  1161 ? 260.200 201.851 198.933 1.00 155.86 ?  1161 THR A C     1 
ATOM   9004  O  O     . THR A 1  1161 ? 260.944 202.250 198.039 1.00 155.50 ?  1161 THR A O     1 
ATOM   9005  C  CB    . THR A 1  1161 ? 258.426 203.620 199.699 1.00 156.40 ?  1161 THR A CB    1 
ATOM   9006  O  OG1   . THR A 1  1161 ? 257.776 203.881 200.939 1.00 156.17 ?  1161 THR A OG1   1 
ATOM   9007  C  CG2   . THR A 1  1161 ? 257.466 202.965 198.713 1.00 152.42 ?  1161 THR A CG2   1 
ATOM   9008  N  N     . VAL A 1  1162 ? 259.746 200.585 199.029 1.00 152.25 ?  1162 VAL A N     1 
ATOM   9009  C  CA    . VAL A 1  1162 ? 260.000 199.455 198.127 1.00 152.65 ?  1162 VAL A CA    1 
ATOM   9010  C  C     . VAL A 1  1162 ? 259.334 199.694 196.749 1.00 157.33 ?  1162 VAL A C     1 
ATOM   9011  O  O     . VAL A 1  1162 ? 259.790 199.133 195.752 1.00 157.28 ?  1162 VAL A O     1 
ATOM   9012  C  CB    . VAL A 1  1162 ? 259.546 198.117 198.773 1.00 155.52 ?  1162 VAL A CB    1 
ATOM   9013  C  CG1   . VAL A 1  1162 ? 260.049 196.907 197.983 1.00 156.02 ?  1162 VAL A CG1   1 
ATOM   9014  C  CG2   . VAL A 1  1162 ? 260.006 198.028 200.227 1.00 156.09 ?  1162 VAL A CG2   1 
ATOM   9015  N  N     . ILE A 1  1163 ? 258.260 200.515 196.695 1.00 153.75 ?  1163 ILE A N     1 
ATOM   9016  C  CA    . ILE A 1  1163 ? 257.600 200.903 195.442 1.00 153.06 ?  1163 ILE A CA    1 
ATOM   9017  C  C     . ILE A 1  1163 ? 258.347 202.158 194.938 1.00 160.92 ?  1163 ILE A C     1 
ATOM   9018  O  O     . ILE A 1  1163 ? 258.266 203.210 195.588 1.00 160.18 ?  1163 ILE A O     1 
ATOM   9019  C  CB    . ILE A 1  1163 ? 256.073 201.148 195.571 1.00 153.52 ?  1163 ILE A CB    1 
ATOM   9020  C  CG1   . ILE A 1  1163 ? 255.350 199.988 196.285 1.00 152.48 ?  1163 ILE A CG1   1 
ATOM   9021  C  CG2   . ILE A 1  1163 ? 255.463 201.400 194.191 1.00 153.29 ?  1163 ILE A CG2   1 
ATOM   9022  C  CD1   . ILE A 1  1163 ? 254.963 200.271 197.702 1.00 156.97 ?  1163 ILE A CD1   1 
ATOM   9023  N  N     . PRO A 1  1164 ? 259.118 202.063 193.821 1.00 159.84 ?  1164 PRO A N     1 
ATOM   9024  C  CA    . PRO A 1  1164 ? 259.896 203.234 193.358 1.00 160.67 ?  1164 PRO A CA    1 
ATOM   9025  C  C     . PRO A 1  1164 ? 259.044 204.403 192.872 1.00 161.89 ?  1164 PRO A C     1 
ATOM   9026  O  O     . PRO A 1  1164 ? 259.499 205.553 192.878 1.00 162.08 ?  1164 PRO A O     1 
ATOM   9027  C  CB    . PRO A 1  1164 ? 260.780 202.658 192.251 1.00 163.78 ?  1164 PRO A CB    1 
ATOM   9028  C  CG    . PRO A 1  1164 ? 260.034 201.471 191.749 1.00 167.07 ?  1164 PRO A CG    1 
ATOM   9029  C  CD    . PRO A 1  1164 ? 259.342 200.892 192.946 1.00 161.59 ?  1164 PRO A CD    1 
ATOM   9030  N  N     . GLU A 1  1165 ? 257.805 204.097 192.458 1.00 156.61 ?  1165 GLU A N     1 
ATOM   9031  C  CA    . GLU A 1  1165 ? 256.839 205.081 191.995 1.00 154.96 ?  1165 GLU A CA    1 
ATOM   9032  C  C     . GLU A 1  1165 ? 256.635 206.108 193.116 1.00 159.14 ?  1165 GLU A C     1 
ATOM   9033  O  O     . GLU A 1  1165 ? 257.023 207.272 192.978 1.00 160.23 ?  1165 GLU A O     1 
ATOM   9034  C  CB    . GLU A 1  1165 ? 255.509 204.399 191.658 1.00 153.79 ?  1165 GLU A CB    1 
ATOM   9035  C  CG    . GLU A 1  1165 ? 255.600 203.265 190.662 1.00 163.11 ?  1165 GLU A CG    1 
ATOM   9036  C  CD    . GLU A 1  1165 ? 254.219 202.941 190.136 1.00 192.67 ?  1165 GLU A CD    1 
ATOM   9037  O  OE1   . GLU A 1  1165 ? 253.491 202.165 190.797 1.00 197.78 ?  1165 GLU A OE1   1 
ATOM   9038  O  OE2   . GLU A 1  1165 ? 253.822 203.554 189.120 1.00 190.39 -1 1165 GLU A OE2   1 
ATOM   9039  N  N     . ASP A 1  1166 ? 256.138 205.621 194.263 1.00 154.47 ?  1166 ASP A N     1 
ATOM   9040  C  CA    . ASP A 1  1166 ? 255.848 206.369 195.477 1.00 153.62 ?  1166 ASP A CA    1 
ATOM   9041  C  C     . ASP A 1  1166 ? 257.021 207.170 196.035 1.00 160.54 ?  1166 ASP A C     1 
ATOM   9042  O  O     . ASP A 1  1166 ? 256.768 208.146 196.730 1.00 160.48 ?  1166 ASP A O     1 
ATOM   9043  C  CB    . ASP A 1  1166 ? 255.283 205.430 196.560 1.00 153.85 ?  1166 ASP A CB    1 
ATOM   9044  C  CG    . ASP A 1  1166 ? 254.024 204.654 196.193 1.00 157.41 ?  1166 ASP A CG    1 
ATOM   9045  O  OD1   . ASP A 1  1166 ? 253.621 204.686 195.003 1.00 156.42 ?  1166 ASP A OD1   1 
ATOM   9046  O  OD2   . ASP A 1  1166 ? 253.463 203.989 197.083 1.00 160.14 -1 1166 ASP A OD2   1 
ATOM   9047  N  N     . GLU A 1  1167 ? 258.291 206.789 195.722 1.00 159.75 ?  1167 GLU A N     1 
ATOM   9048  C  CA    . GLU A 1  1167 ? 259.518 207.451 196.214 1.00 162.06 ?  1167 GLU A CA    1 
ATOM   9049  C  C     . GLU A 1  1167 ? 259.438 208.968 196.340 1.00 167.47 ?  1167 GLU A C     1 
ATOM   9050  O  O     . GLU A 1  1167 ? 259.883 209.529 197.349 1.00 167.33 ?  1167 GLU A O     1 
ATOM   9051  C  CB    . GLU A 1  1167 ? 260.754 207.046 195.401 1.00 165.19 ?  1167 GLU A CB    1 
ATOM   9052  C  CG    . GLU A 1  1167 ? 261.319 205.692 195.793 1.00 176.67 ?  1167 GLU A CG    1 
ATOM   9053  C  CD    . GLU A 1  1167 ? 262.529 205.230 195.006 1.00 190.79 ?  1167 GLU A CD    1 
ATOM   9054  O  OE1   . GLU A 1  1167 ? 262.523 205.366 193.762 1.00 185.19 ?  1167 GLU A OE1   1 
ATOM   9055  O  OE2   . GLU A 1  1167 ? 263.485 204.721 195.635 1.00 183.61 -1 1167 GLU A OE2   1 
ATOM   9056  N  N     . GLU A 1  1168 ? 258.843 209.618 195.325 1.00 165.01 ?  1168 GLU A N     1 
ATOM   9057  C  CA    . GLU A 1  1168 ? 258.672 211.069 195.270 1.00 165.64 ?  1168 GLU A CA    1 
ATOM   9058  C  C     . GLU A 1  1168 ? 257.632 211.594 196.268 1.00 167.94 ?  1168 GLU A C     1 
ATOM   9059  O  O     . GLU A 1  1168 ? 257.868 212.644 196.866 1.00 167.98 ?  1168 GLU A O     1 
ATOM   9060  C  CB    . GLU A 1  1168 ? 258.379 211.546 193.833 1.00 167.14 ?  1168 GLU A CB    1 
ATOM   9061  C  CG    . GLU A 1  1168 ? 259.590 211.513 192.901 1.00 184.34 ?  1168 GLU A CG    1 
ATOM   9062  C  CD    . GLU A 1  1168 ? 260.557 212.688 192.957 1.00 203.49 ?  1168 GLU A CD    1 
ATOM   9063  O  OE1   . GLU A 1  1168 ? 260.142 213.821 192.615 1.00 201.63 ?  1168 GLU A OE1   1 
ATOM   9064  O  OE2   . GLU A 1  1168 ? 261.751 212.461 193.261 1.00 194.64 -1 1168 GLU A OE2   1 
ATOM   9065  N  N     . ILE A 1  1169 ? 256.501 210.861 196.461 1.00 162.67 ?  1169 ILE A N     1 
ATOM   9066  C  CA    . ILE A 1  1169 ? 255.408 211.225 197.392 1.00 161.06 ?  1169 ILE A CA    1 
ATOM   9067  C  C     . ILE A 1  1169 ? 255.917 211.325 198.844 1.00 165.65 ?  1169 ILE A C     1 
ATOM   9068  O  O     . ILE A 1  1169 ? 255.481 212.212 199.585 1.00 164.46 ?  1169 ILE A O     1 
ATOM   9069  C  CB    . ILE A 1  1169 ? 254.141 210.306 197.279 1.00 161.81 ?  1169 ILE A CB    1 
ATOM   9070  C  CG1   . ILE A 1  1169 ? 253.777 209.960 195.810 1.00 161.32 ?  1169 ILE A CG1   1 
ATOM   9071  C  CG2   . ILE A 1  1169 ? 252.938 210.920 198.016 1.00 160.88 ?  1169 ILE A CG2   1 
ATOM   9072  C  CD1   . ILE A 1  1169 ? 252.954 208.680 195.631 1.00 163.56 ?  1169 ILE A CD1   1 
ATOM   9073  N  N     . ILE A 1  1170 ? 256.848 210.424 199.232 1.00 162.81 ?  1170 ILE A N     1 
ATOM   9074  C  CA    . ILE A 1  1170 ? 257.453 210.398 200.564 1.00 163.63 ?  1170 ILE A CA    1 
ATOM   9075  C  C     . ILE A 1  1170 ? 258.359 211.611 200.718 1.00 169.71 ?  1170 ILE A C     1 
ATOM   9076  O  O     . ILE A 1  1170 ? 258.175 212.370 201.668 1.00 169.92 ?  1170 ILE A O     1 
ATOM   9077  C  CB    . ILE A 1  1170 ? 258.202 209.073 200.851 1.00 167.05 ?  1170 ILE A CB    1 
ATOM   9078  C  CG1   . ILE A 1  1170 ? 257.309 207.866 200.609 1.00 165.12 ?  1170 ILE A CG1   1 
ATOM   9079  C  CG2   . ILE A 1  1170 ? 258.747 209.039 202.271 1.00 168.03 ?  1170 ILE A CG2   1 
ATOM   9080  C  CD1   . ILE A 1  1170 ? 257.789 207.053 199.569 1.00 171.44 ?  1170 ILE A CD1   1 
ATOM   9081  N  N     . GLN A 1  1171 ? 259.279 211.825 199.749 1.00 168.02 ?  1171 GLN A N     1 
ATOM   9082  C  CA    . GLN A 1  1171 ? 260.249 212.929 199.689 1.00 170.32 ?  1171 GLN A CA    1 
ATOM   9083  C  C     . GLN A 1  1171 ? 259.689 214.324 200.051 1.00 174.83 ?  1171 GLN A C     1 
ATOM   9084  O  O     . GLN A 1  1171 ? 260.450 215.216 200.447 1.00 175.70 ?  1171 GLN A O     1 
ATOM   9085  C  CB    . GLN A 1  1171 ? 260.897 212.966 198.293 1.00 172.59 ?  1171 GLN A CB    1 
ATOM   9086  C  CG    . GLN A 1  1171 ? 262.326 213.507 198.276 1.00 184.43 ?  1171 GLN A CG    1 
ATOM   9087  C  CD    . GLN A 1  1171 ? 263.318 212.562 198.913 1.00 191.57 ?  1171 GLN A CD    1 
ATOM   9088  O  OE1   . GLN A 1  1171 ? 263.313 211.344 198.670 1.00 185.80 ?  1171 GLN A OE1   1 
ATOM   9089  N  NE2   . GLN A 1  1171 ? 264.201 213.109 199.736 1.00 184.54 ?  1171 GLN A NE2   1 
ATOM   9090  N  N     . LEU A 1  1172 ? 258.360 214.490 199.932 1.00 170.88 ?  1172 LEU A N     1 
ATOM   9091  C  CA    . LEU A 1  1172 ? 257.662 215.746 200.174 1.00 170.52 ?  1172 LEU A CA    1 
ATOM   9092  C  C     . LEU A 1  1172 ? 256.772 215.706 201.426 1.00 175.53 ?  1172 LEU A C     1 
ATOM   9093  O  O     . LEU A 1  1172 ? 256.965 216.529 202.326 1.00 174.97 ?  1172 LEU A O     1 
ATOM   9094  C  CB    . LEU A 1  1172 ? 256.855 216.160 198.918 1.00 169.21 ?  1172 LEU A CB    1 
ATOM   9095  C  CG    . LEU A 1  1172 ? 257.373 215.702 197.533 1.00 174.35 ?  1172 LEU A CG    1 
ATOM   9096  C  CD1   . LEU A 1  1172 ? 256.346 215.946 196.457 1.00 172.23 ?  1172 LEU A CD1   1 
ATOM   9097  C  CD2   . LEU A 1  1172 ? 258.704 216.366 197.156 1.00 179.69 ?  1172 LEU A CD2   1 
ATOM   9098  N  N     . HIS A 1  1173 ? 255.816 214.735 201.491 1.00 173.35 ?  1173 HIS A N     1 
ATOM   9099  C  CA    . HIS A 1  1173 ? 254.857 214.522 202.598 1.00 173.06 ?  1173 HIS A CA    1 
ATOM   9100  C  C     . HIS A 1  1173 ? 255.607 214.083 203.894 1.00 180.21 ?  1173 HIS A C     1 
ATOM   9101  O  O     . HIS A 1  1173 ? 255.031 213.407 204.755 1.00 178.55 ?  1173 HIS A O     1 
ATOM   9102  C  CB    . HIS A 1  1173 ? 253.789 213.472 202.180 1.00 171.78 ?  1173 HIS A CB    1 
ATOM   9103  C  CG    . HIS A 1  1173 ? 252.357 213.954 202.043 1.00 173.33 ?  1173 HIS A CG    1 
ATOM   9104  N  ND1   . HIS A 1  1173 ? 251.674 213.867 200.829 1.00 173.84 ?  1173 HIS A ND1   1 
ATOM   9105  C  CD2   . HIS A 1  1173 ? 251.486 214.389 202.990 1.00 174.06 ?  1173 HIS A CD2   1 
ATOM   9106  C  CE1   . HIS A 1  1173 ? 250.439 214.293 201.071 1.00 171.52 ?  1173 HIS A CE1   1 
ATOM   9107  N  NE2   . HIS A 1  1173 ? 250.275 214.615 202.353 1.00 171.93 ?  1173 HIS A NE2   1 
ATOM   9108  N  N     . PHE A 1  1174 ? 256.892 214.495 204.014 1.00 180.83 ?  1174 PHE A N     1 
ATOM   9109  C  CA    . PHE A 1  1174 ? 257.809 214.239 205.122 1.00 183.38 ?  1174 PHE A CA    1 
ATOM   9110  C  C     . PHE A 1  1174 ? 258.538 215.505 205.513 1.00 188.37 ?  1174 PHE A C     1 
ATOM   9111  O  O     . PHE A 1  1174 ? 258.548 215.853 206.696 1.00 188.91 ?  1174 PHE A O     1 
ATOM   9112  C  CB    . PHE A 1  1174 ? 258.830 213.156 204.750 1.00 186.02 ?  1174 PHE A CB    1 
ATOM   9113  C  CG    . PHE A 1  1174 ? 258.550 211.803 205.353 1.00 187.35 ?  1174 PHE A CG    1 
ATOM   9114  C  CD1   . PHE A 1  1174 ? 257.406 211.089 205.003 1.00 188.66 ?  1174 PHE A CD1   1 
ATOM   9115  C  CD2   . PHE A 1  1174 ? 259.443 211.225 206.250 1.00 188.31 ?  1174 PHE A CD2   1 
ATOM   9116  C  CE1   . PHE A 1  1174 ? 257.150 209.832 205.555 1.00 188.85 ?  1174 PHE A CE1   1 
ATOM   9117  C  CE2   . PHE A 1  1174 ? 259.186 209.966 206.802 1.00 189.97 ?  1174 PHE A CE2   1 
ATOM   9118  C  CZ    . PHE A 1  1174 ? 258.044 209.277 206.448 1.00 189.02 ?  1174 PHE A CZ    1 
ATOM   9119  N  N     . SER A 1  1175 ? 259.165 216.188 204.527 1.00 187.24 ?  1175 SER A N     1 
ATOM   9120  C  CA    . SER A 1  1175 ? 259.909 217.435 204.740 1.00 187.71 ?  1175 SER A CA    1 
ATOM   9121  C  C     . SER A 1  1175 ? 258.953 218.638 204.953 1.00 189.50 ?  1175 SER A C     1 
ATOM   9122  O  O     . SER A 1  1175 ? 258.223 218.649 205.951 1.00 188.87 ?  1175 SER A O     1 
ATOM   9123  C  CB    . SER A 1  1175 ? 260.936 217.664 203.626 1.00 190.81 ?  1175 SER A CB    1 
ATOM   9124  O  OG    . SER A 1  1175 ? 260.446 217.310 202.341 1.00 196.90 ?  1175 SER A OG    1 
ATOM   9125  N  N     . LEU A 1  1176 ? 258.930 219.628 204.033 1.00 186.43 ?  1176 LEU A N     1 
ATOM   9126  C  CA    . LEU A 1  1176 ? 258.042 220.788 204.165 1.00 190.92 ?  1176 LEU A CA    1 
ATOM   9127  C  C     . LEU A 1  1176 ? 256.656 220.467 203.600 1.00 189.43 ?  1176 LEU A C     1 
ATOM   9128  O  O     . LEU A 1  1176 ? 256.126 219.381 203.841 1.00 141.79 ?  1176 LEU A O     1 
ATOM   9129  C  CB    . LEU A 1  1176 ? 258.648 222.046 203.502 1.00 191.32 ?  1176 LEU A CB    1 
ATOM   9130  C  CG    . LEU A 1  1176 ? 258.384 223.382 204.218 1.00 194.10 ?  1176 LEU A CG    1 
ATOM   9131  C  CD1   . LEU A 1  1176 ? 259.672 224.138 204.462 1.00 194.70 ?  1176 LEU A CD1   1 
ATOM   9132  C  CD2   . LEU A 1  1176 ? 257.410 224.247 203.441 1.00 195.10 ?  1176 LEU A CD2   1 
ATOM   9133  N  N     . GLN A 1  1187 ? 258.050 203.669 215.131 1.00 146.62 ?  1187 GLN A N     1 
ATOM   9134  C  CA    . GLN A 1  1187 ? 256.918 204.523 215.472 1.00 145.60 ?  1187 GLN A CA    1 
ATOM   9135  C  C     . GLN A 1  1187 ? 255.567 204.023 214.918 1.00 148.35 ?  1187 GLN A C     1 
ATOM   9136  O  O     . GLN A 1  1187 ? 254.551 204.106 215.618 1.00 146.30 ?  1187 GLN A O     1 
ATOM   9137  C  CB    . GLN A 1  1187 ? 257.184 205.998 215.092 1.00 147.57 ?  1187 GLN A CB    1 
ATOM   9138  C  CG    . GLN A 1  1187 ? 257.295 206.305 213.586 1.00 157.43 ?  1187 GLN A CG    1 
ATOM   9139  C  CD    . GLN A 1  1187 ? 256.813 207.696 213.220 1.00 166.09 ?  1187 GLN A CD    1 
ATOM   9140  O  OE1   . GLN A 1  1187 ? 255.663 208.090 213.482 1.00 159.37 ?  1187 GLN A OE1   1 
ATOM   9141  N  NE2   . GLN A 1  1187 ? 257.669 208.452 212.548 1.00 152.12 ?  1187 GLN A NE2   1 
ATOM   9142  N  N     . GLN A 1  1188 ? 255.567 203.500 213.666 1.00 145.59 ?  1188 GLN A N     1 
ATOM   9143  C  CA    . GLN A 1  1188 ? 254.378 202.996 212.948 1.00 143.49 ?  1188 GLN A CA    1 
ATOM   9144  C  C     . GLN A 1  1188 ? 254.576 201.592 212.302 1.00 147.55 ?  1188 GLN A C     1 
ATOM   9145  O  O     . GLN A 1  1188 ? 255.701 201.082 212.238 1.00 148.56 ?  1188 GLN A O     1 
ATOM   9146  C  CB    . GLN A 1  1188 ? 253.856 204.039 211.918 1.00 143.66 ?  1188 GLN A CB    1 
ATOM   9147  C  CG    . GLN A 1  1188 ? 254.908 204.511 210.891 1.00 149.63 ?  1188 GLN A CG    1 
ATOM   9148  C  CD    . GLN A 1  1188 ? 254.543 205.772 210.136 1.00 146.32 ?  1188 GLN A CD    1 
ATOM   9149  O  OE1   . GLN A 1  1188 ? 254.410 205.766 208.905 1.00 134.15 ?  1188 GLN A OE1   1 
ATOM   9150  N  NE2   . GLN A 1  1188 ? 254.472 206.901 210.840 1.00 132.13 ?  1188 GLN A NE2   1 
ATOM   9151  N  N     . SER A 1  1189 ? 253.460 200.994 211.825 1.00 141.97 ?  1189 SER A N     1 
ATOM   9152  C