data_4W8F
# 
_entry.id   4W8F 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4W8F         
WWPDB D_1000203374 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4W8F 
_pdbx_database_status.recvd_initial_deposition_date   2014-08-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Cheng, H.-C.' 1 
'Bhabha, G.'   2 
'Zhang, N.'    3 
'Vale, R.D.'   4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   ? 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Cell 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1097-4172 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            159 
_citation.language                  ? 
_citation.page_first                857 
_citation.page_last                 868 
_citation.title                     'Allosteric communication in the Dynein motor domain.' 
_citation.year                      2014 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2014.10.018 
_citation.pdbx_database_id_PubMed   25417161 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Bhabha, G.'  1 ? 
primary 'Cheng, H.C.' 2 ? 
primary 'Zhang, N.'   3 ? 
primary 'Moeller, A.' 4 ? 
primary 'Liao, M.'    5 ? 
primary 'Speir, J.A.' 6 ? 
primary 'Cheng, Y.'   7 ? 
primary 'Vale, R.D.'  8 ? 
# 
_cell.entry_id           4W8F 
_cell.length_a           137.730 
_cell.length_b           154.380 
_cell.length_c           177.550 
_cell.angle_alpha        90.00 
_cell.angle_beta         96.59 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4W8F 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Dynein heavy chain lysozyme chimera'         304889.875 2 3.2.1.17 E1849Q ? ? 
2 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196    8 ?        ?      ? ? 
3 non-polymer syn 'MAGNESIUM ION'                               24.305     2 ?        ?      ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Dynein heavy chain,cytosolic,DYHC,Lysis protein,Muramidase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GEFVIEKSLNRIKKFWKEAQYEVIEHSSGLKLVREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQ
VNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSS
LSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLEDFITGVRSVEGEVLNLNEKIELKDSI
QAQEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVVVSKYIFQAILLSAQVMWTELVEKCLQTNQFSKYWKEVDMKIKG
LLDKLNKSSDNVKKKIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEY
IGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIG
AWGCFDQFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMK
SPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSPLISEFGEGEKTVVESLKRVI
LPSLGDTDELVFKDELSKIFDSAGTPLNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTA
TWKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEY
VEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISSKIDHLLNKSYEALDNKLS
MFELDKLKDLISDSFDMASLTNIFTCSNDLVHILGVRTFNKLETAVQLAVHLISSYRQWFQNLDDKSLKDVITLLIKRSL
LYALAGDSTGESQRAFIQTINTYFGHDSQELSDYSTIVIANDKLSFSSFCSEIPSVSLEAHEVMRPDIVIPTIDTIKHEK
IFYDLLNSKRGIILCGPPGSGKTMIMNNALRNSSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNL
VLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYP
SGKSLSQIYEIYYKAIFKLVPEFRSYTEPFARASVHLYNECKARYSTGLQSHYLFSPRELTRLVRGVYTAINTGPRQTLR
SLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQDLGNISSTSLLFSGLLSLDFKEVNKTDLVNFIEERFKT
FCDEELEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKA
ISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGLLLDTEQELYDWFVGEIA
KNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIR
DAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLGSGS
GSNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGIL
RNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWD
AYGSGSGSSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVN
YRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTVLLSFLEEGFVKRLENA
IRFGSVVIIQDGEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKE
SIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSE
SEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVY
CQFSTALDKKFKMIMAMTMFCLYKFDIESEQYKEAVLTMIGVLSESSDGVPKLTVDTNDDLRYLWDYVTTKSYISALNWF
KNEFFVDEWNIADVVANSENNYFTMASERDVDGTFKLIELAKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQN
IQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRVVYEDIPGILDTVKDLWGSQFFTGKISGV
WSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKD
LEVVAKLCAHVFCGSDNLQIVPGVRIPQPLLQQSEEEERARLTAILSNTIEPADSLSSWLQLPRESILDYERLQAKEVAS
STEQLLQEMGSGSGSHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GEFVIEKSLNRIKKFWKEAQYEVIEHSSGLKLVREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQ
VNWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSS
LSTFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLEDFITGVRSVEGEVLNLNEKIELKDSI
QAQEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVVVSKYIFQAILLSAQVMWTELVEKCLQTNQFSKYWKEVDMKIKG
LLDKLNKSSDNVKKKIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEY
IGIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIG
AWGCFDQFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMK
SPQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSPLISEFGEGEKTVVESLKRVI
LPSLGDTDELVFKDELSKIFDSAGTPLNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTA
TWKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEY
VEAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISSKIDHLLNKSYEALDNKLS
MFELDKLKDLISDSFDMASLTNIFTCSNDLVHILGVRTFNKLETAVQLAVHLISSYRQWFQNLDDKSLKDVITLLIKRSL
LYALAGDSTGESQRAFIQTINTYFGHDSQELSDYSTIVIANDKLSFSSFCSEIPSVSLEAHEVMRPDIVIPTIDTIKHEK
IFYDLLNSKRGIILCGPPGSGKTMIMNNALRNSSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNL
VLFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYP
SGKSLSQIYEIYYKAIFKLVPEFRSYTEPFARASVHLYNECKARYSTGLQSHYLFSPRELTRLVRGVYTAINTGPRQTLR
SLIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQDLGNISSTSLLFSGLLSLDFKEVNKTDLVNFIEERFKT
FCDEELEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKA
ISDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGLLLDTEQELYDWFVGEIA
KNLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIR
DAVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTLGSGS
GSNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQDVDAAVRGIL
RNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAKRVITTFRTGTWD
AYGSGSGSSISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVN
YRFIDYLVTLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTVLLSFLEEGFVKRLENA
IRFGSVVIIQDGEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKE
SIETRIFDITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSE
SEEFFPQFDNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVY
CQFSTALDKKFKMIMAMTMFCLYKFDIESEQYKEAVLTMIGVLSESSDGVPKLTVDTNDDLRYLWDYVTTKSYISALNWF
KNEFFVDEWNIADVVANSENNYFTMASERDVDGTFKLIELAKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQN
IQMSLSWVKTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRVVYEDIPGILDTVKDLWGSQFFTGKISGV
WSVYCTFLLSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKD
LEVVAKLCAHVFCGSDNLQIVPGVRIPQPLLQQSEEEERARLTAILSNTIEPADSLSSWLQLPRESILDYERLQAKEVAS
STEQLLQEMGSGSGSHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    GLY n 
1 2    GLU n 
1 3    PHE n 
1 4    VAL n 
1 5    ILE n 
1 6    GLU n 
1 7    LYS n 
1 8    SER n 
1 9    LEU n 
1 10   ASN n 
1 11   ARG n 
1 12   ILE n 
1 13   LYS n 
1 14   LYS n 
1 15   PHE n 
1 16   TRP n 
1 17   LYS n 
1 18   GLU n 
1 19   ALA n 
1 20   GLN n 
1 21   TYR n 
1 22   GLU n 
1 23   VAL n 
1 24   ILE n 
1 25   GLU n 
1 26   HIS n 
1 27   SER n 
1 28   SER n 
1 29   GLY n 
1 30   LEU n 
1 31   LYS n 
1 32   LEU n 
1 33   VAL n 
1 34   ARG n 
1 35   GLU n 
1 36   TRP n 
1 37   ASP n 
1 38   VAL n 
1 39   LEU n 
1 40   GLU n 
1 41   GLN n 
1 42   ALA n 
1 43   CYS n 
1 44   LYS n 
1 45   GLU n 
1 46   ASP n 
1 47   LEU n 
1 48   GLU n 
1 49   GLU n 
1 50   LEU n 
1 51   VAL n 
1 52   SER n 
1 53   MET n 
1 54   LYS n 
1 55   ALA n 
1 56   SER n 
1 57   ASN n 
1 58   TYR n 
1 59   TYR n 
1 60   LYS n 
1 61   ILE n 
1 62   PHE n 
1 63   GLU n 
1 64   GLN n 
1 65   ASP n 
1 66   CYS n 
1 67   LEU n 
1 68   ASP n 
1 69   LEU n 
1 70   GLU n 
1 71   SER n 
1 72   LYS n 
1 73   LEU n 
1 74   THR n 
1 75   LYS n 
1 76   LEU n 
1 77   SER n 
1 78   GLU n 
1 79   ILE n 
1 80   GLN n 
1 81   VAL n 
1 82   ASN n 
1 83   TRP n 
1 84   VAL n 
1 85   GLU n 
1 86   VAL n 
1 87   GLN n 
1 88   PHE n 
1 89   TYR n 
1 90   TRP n 
1 91   LEU n 
1 92   ASP n 
1 93   LEU n 
1 94   TYR n 
1 95   GLY n 
1 96   ILE n 
1 97   LEU n 
1 98   GLY n 
1 99   GLU n 
1 100  ASN n 
1 101  LEU n 
1 102  ASP n 
1 103  ILE n 
1 104  GLN n 
1 105  ASN n 
1 106  PHE n 
1 107  LEU n 
1 108  PRO n 
1 109  LEU n 
1 110  GLU n 
1 111  THR n 
1 112  SER n 
1 113  LYS n 
1 114  PHE n 
1 115  LYS n 
1 116  SER n 
1 117  LEU n 
1 118  THR n 
1 119  SER n 
1 120  GLU n 
1 121  TYR n 
1 122  LYS n 
1 123  MET n 
1 124  ILE n 
1 125  THR n 
1 126  THR n 
1 127  ARG n 
1 128  ALA n 
1 129  PHE n 
1 130  GLN n 
1 131  LEU n 
1 132  ASP n 
1 133  THR n 
1 134  THR n 
1 135  ILE n 
1 136  GLU n 
1 137  VAL n 
1 138  ILE n 
1 139  HIS n 
1 140  ILE n 
1 141  PRO n 
1 142  ASN n 
1 143  PHE n 
1 144  ASP n 
1 145  THR n 
1 146  THR n 
1 147  LEU n 
1 148  LYS n 
1 149  LEU n 
1 150  THR n 
1 151  ILE n 
1 152  ASP n 
1 153  SER n 
1 154  LEU n 
1 155  LYS n 
1 156  MET n 
1 157  ILE n 
1 158  LYS n 
1 159  SER n 
1 160  SER n 
1 161  LEU n 
1 162  SER n 
1 163  THR n 
1 164  PHE n 
1 165  LEU n 
1 166  GLU n 
1 167  ARG n 
1 168  GLN n 
1 169  ARG n 
1 170  ARG n 
1 171  GLN n 
1 172  PHE n 
1 173  PRO n 
1 174  ARG n 
1 175  PHE n 
1 176  TYR n 
1 177  PHE n 
1 178  LEU n 
1 179  GLY n 
1 180  ASN n 
1 181  ASP n 
1 182  ASP n 
1 183  LEU n 
1 184  LEU n 
1 185  LYS n 
1 186  ILE n 
1 187  ILE n 
1 188  GLY n 
1 189  SER n 
1 190  GLY n 
1 191  LYS n 
1 192  HIS n 
1 193  HIS n 
1 194  ASP n 
1 195  GLN n 
1 196  VAL n 
1 197  SER n 
1 198  LYS n 
1 199  PHE n 
1 200  MET n 
1 201  LYS n 
1 202  LYS n 
1 203  MET n 
1 204  PHE n 
1 205  GLY n 
1 206  SER n 
1 207  ILE n 
1 208  GLU n 
1 209  SER n 
1 210  ILE n 
1 211  ILE n 
1 212  PHE n 
1 213  LEU n 
1 214  GLU n 
1 215  ASP n 
1 216  PHE n 
1 217  ILE n 
1 218  THR n 
1 219  GLY n 
1 220  VAL n 
1 221  ARG n 
1 222  SER n 
1 223  VAL n 
1 224  GLU n 
1 225  GLY n 
1 226  GLU n 
1 227  VAL n 
1 228  LEU n 
1 229  ASN n 
1 230  LEU n 
1 231  ASN n 
1 232  GLU n 
1 233  LYS n 
1 234  ILE n 
1 235  GLU n 
1 236  LEU n 
1 237  LYS n 
1 238  ASP n 
1 239  SER n 
1 240  ILE n 
1 241  GLN n 
1 242  ALA n 
1 243  GLN n 
1 244  GLU n 
1 245  TRP n 
1 246  LEU n 
1 247  ASN n 
1 248  ILE n 
1 249  LEU n 
1 250  ASP n 
1 251  THR n 
1 252  GLU n 
1 253  ILE n 
1 254  LYS n 
1 255  LEU n 
1 256  SER n 
1 257  VAL n 
1 258  PHE n 
1 259  THR n 
1 260  GLN n 
1 261  PHE n 
1 262  ARG n 
1 263  ASP n 
1 264  CYS n 
1 265  LEU n 
1 266  GLY n 
1 267  GLN n 
1 268  LEU n 
1 269  LYS n 
1 270  ASP n 
1 271  GLY n 
1 272  THR n 
1 273  ASP n 
1 274  ILE n 
1 275  GLU n 
1 276  VAL n 
1 277  VAL n 
1 278  VAL n 
1 279  SER n 
1 280  LYS n 
1 281  TYR n 
1 282  ILE n 
1 283  PHE n 
1 284  GLN n 
1 285  ALA n 
1 286  ILE n 
1 287  LEU n 
1 288  LEU n 
1 289  SER n 
1 290  ALA n 
1 291  GLN n 
1 292  VAL n 
1 293  MET n 
1 294  TRP n 
1 295  THR n 
1 296  GLU n 
1 297  LEU n 
1 298  VAL n 
1 299  GLU n 
1 300  LYS n 
1 301  CYS n 
1 302  LEU n 
1 303  GLN n 
1 304  THR n 
1 305  ASN n 
1 306  GLN n 
1 307  PHE n 
1 308  SER n 
1 309  LYS n 
1 310  TYR n 
1 311  TRP n 
1 312  LYS n 
1 313  GLU n 
1 314  VAL n 
1 315  ASP n 
1 316  MET n 
1 317  LYS n 
1 318  ILE n 
1 319  LYS n 
1 320  GLY n 
1 321  LEU n 
1 322  LEU n 
1 323  ASP n 
1 324  LYS n 
1 325  LEU n 
1 326  ASN n 
1 327  LYS n 
1 328  SER n 
1 329  SER n 
1 330  ASP n 
1 331  ASN n 
1 332  VAL n 
1 333  LYS n 
1 334  LYS n 
1 335  LYS n 
1 336  ILE n 
1 337  GLU n 
1 338  ALA n 
1 339  LEU n 
1 340  LEU n 
1 341  VAL n 
1 342  GLU n 
1 343  TYR n 
1 344  LEU n 
1 345  HIS n 
1 346  PHE n 
1 347  ASN n 
1 348  ASN n 
1 349  VAL n 
1 350  ILE n 
1 351  GLY n 
1 352  GLN n 
1 353  LEU n 
1 354  LYS n 
1 355  ASN n 
1 356  CYS n 
1 357  SER n 
1 358  THR n 
1 359  LYS n 
1 360  GLU n 
1 361  GLU n 
1 362  ALA n 
1 363  ARG n 
1 364  LEU n 
1 365  LEU n 
1 366  TRP n 
1 367  ALA n 
1 368  LYS n 
1 369  VAL n 
1 370  GLN n 
1 371  LYS n 
1 372  PHE n 
1 373  TYR n 
1 374  GLN n 
1 375  LYS n 
1 376  ASN n 
1 377  ASP n 
1 378  THR n 
1 379  LEU n 
1 380  ASP n 
1 381  ASP n 
1 382  LEU n 
1 383  ASN n 
1 384  SER n 
1 385  VAL n 
1 386  PHE n 
1 387  ILE n 
1 388  SER n 
1 389  GLN n 
1 390  SER n 
1 391  GLY n 
1 392  TYR n 
1 393  LEU n 
1 394  LEU n 
1 395  GLN n 
1 396  TYR n 
1 397  LYS n 
1 398  PHE n 
1 399  GLU n 
1 400  TYR n 
1 401  ILE n 
1 402  GLY n 
1 403  ILE n 
1 404  PRO n 
1 405  GLU n 
1 406  ARG n 
1 407  LEU n 
1 408  ILE n 
1 409  TYR n 
1 410  THR n 
1 411  PRO n 
1 412  LEU n 
1 413  LEU n 
1 414  LEU n 
1 415  ILE n 
1 416  GLY n 
1 417  PHE n 
1 418  ALA n 
1 419  THR n 
1 420  LEU n 
1 421  THR n 
1 422  ASP n 
1 423  SER n 
1 424  LEU n 
1 425  HIS n 
1 426  GLN n 
1 427  LYS n 
1 428  TYR n 
1 429  GLY n 
1 430  GLY n 
1 431  CYS n 
1 432  PHE n 
1 433  PHE n 
1 434  GLY n 
1 435  PRO n 
1 436  ALA n 
1 437  GLY n 
1 438  THR n 
1 439  GLY n 
1 440  LYS n 
1 441  THR n 
1 442  GLU n 
1 443  THR n 
1 444  VAL n 
1 445  LYS n 
1 446  ALA n 
1 447  PHE n 
1 448  GLY n 
1 449  GLN n 
1 450  ASN n 
1 451  LEU n 
1 452  GLY n 
1 453  ARG n 
1 454  VAL n 
1 455  VAL n 
1 456  VAL n 
1 457  VAL n 
1 458  PHE n 
1 459  ASN n 
1 460  CYS n 
1 461  ASP n 
1 462  ASP n 
1 463  SER n 
1 464  PHE n 
1 465  ASP n 
1 466  TYR n 
1 467  GLN n 
1 468  VAL n 
1 469  LEU n 
1 470  SER n 
1 471  ARG n 
1 472  LEU n 
1 473  LEU n 
1 474  VAL n 
1 475  GLY n 
1 476  ILE n 
1 477  THR n 
1 478  GLN n 
1 479  ILE n 
1 480  GLY n 
1 481  ALA n 
1 482  TRP n 
1 483  GLY n 
1 484  CYS n 
1 485  PHE n 
1 486  ASP n 
1 487  GLN n 
1 488  PHE n 
1 489  ASN n 
1 490  ARG n 
1 491  LEU n 
1 492  ASP n 
1 493  GLU n 
1 494  LYS n 
1 495  VAL n 
1 496  LEU n 
1 497  SER n 
1 498  ALA n 
1 499  VAL n 
1 500  SER n 
1 501  ALA n 
1 502  ASN n 
1 503  ILE n 
1 504  GLN n 
1 505  GLN n 
1 506  ILE n 
1 507  GLN n 
1 508  ASN n 
1 509  GLY n 
1 510  LEU n 
1 511  GLN n 
1 512  VAL n 
1 513  GLY n 
1 514  LYS n 
1 515  SER n 
1 516  HIS n 
1 517  ILE n 
1 518  THR n 
1 519  LEU n 
1 520  LEU n 
1 521  GLU n 
1 522  GLU n 
1 523  GLU n 
1 524  THR n 
1 525  PRO n 
1 526  LEU n 
1 527  SER n 
1 528  PRO n 
1 529  HIS n 
1 530  THR n 
1 531  ALA n 
1 532  VAL n 
1 533  PHE n 
1 534  ILE n 
1 535  THR n 
1 536  LEU n 
1 537  ASN n 
1 538  PRO n 
1 539  GLY n 
1 540  TYR n 
1 541  ASN n 
1 542  GLY n 
1 543  ARG n 
1 544  SER n 
1 545  GLU n 
1 546  LEU n 
1 547  PRO n 
1 548  GLU n 
1 549  ASN n 
1 550  LEU n 
1 551  LYS n 
1 552  LYS n 
1 553  SER n 
1 554  PHE n 
1 555  ARG n 
1 556  GLU n 
1 557  PHE n 
1 558  SER n 
1 559  MET n 
1 560  LYS n 
1 561  SER n 
1 562  PRO n 
1 563  GLN n 
1 564  SER n 
1 565  GLY n 
1 566  THR n 
1 567  ILE n 
1 568  ALA n 
1 569  GLU n 
1 570  MET n 
1 571  ILE n 
1 572  LEU n 
1 573  GLN n 
1 574  ILE n 
1 575  MET n 
1 576  GLY n 
1 577  PHE n 
1 578  GLU n 
1 579  ASP n 
1 580  SER n 
1 581  LYS n 
1 582  SER n 
1 583  LEU n 
1 584  ALA n 
1 585  SER n 
1 586  LYS n 
1 587  ILE n 
1 588  VAL n 
1 589  HIS n 
1 590  PHE n 
1 591  LEU n 
1 592  GLU n 
1 593  LEU n 
1 594  LEU n 
1 595  SER n 
1 596  SER n 
1 597  LYS n 
1 598  CYS n 
1 599  SER n 
1 600  SER n 
1 601  MET n 
1 602  ASN n 
1 603  HIS n 
1 604  TYR n 
1 605  HIS n 
1 606  PHE n 
1 607  GLY n 
1 608  LEU n 
1 609  ARG n 
1 610  THR n 
1 611  LEU n 
1 612  LYS n 
1 613  GLY n 
1 614  VAL n 
1 615  LEU n 
1 616  ARG n 
1 617  ASN n 
1 618  CYS n 
1 619  SER n 
1 620  PRO n 
1 621  LEU n 
1 622  ILE n 
1 623  SER n 
1 624  GLU n 
1 625  PHE n 
1 626  GLY n 
1 627  GLU n 
1 628  GLY n 
1 629  GLU n 
1 630  LYS n 
1 631  THR n 
1 632  VAL n 
1 633  VAL n 
1 634  GLU n 
1 635  SER n 
1 636  LEU n 
1 637  LYS n 
1 638  ARG n 
1 639  VAL n 
1 640  ILE n 
1 641  LEU n 
1 642  PRO n 
1 643  SER n 
1 644  LEU n 
1 645  GLY n 
1 646  ASP n 
1 647  THR n 
1 648  ASP n 
1 649  GLU n 
1 650  LEU n 
1 651  VAL n 
1 652  PHE n 
1 653  LYS n 
1 654  ASP n 
1 655  GLU n 
1 656  LEU n 
1 657  SER n 
1 658  LYS n 
1 659  ILE n 
1 660  PHE n 
1 661  ASP n 
1 662  SER n 
1 663  ALA n 
1 664  GLY n 
1 665  THR n 
1 666  PRO n 
1 667  LEU n 
1 668  ASN n 
1 669  SER n 
1 670  LYS n 
1 671  ALA n 
1 672  ILE n 
1 673  VAL n 
1 674  GLN n 
1 675  CYS n 
1 676  LEU n 
1 677  LYS n 
1 678  ASP n 
1 679  ALA n 
1 680  GLY n 
1 681  GLN n 
1 682  ARG n 
1 683  SER n 
1 684  GLY n 
1 685  PHE n 
1 686  SER n 
1 687  MET n 
1 688  SER n 
1 689  GLU n 
1 690  GLU n 
1 691  PHE n 
1 692  LEU n 
1 693  LYS n 
1 694  LYS n 
1 695  CYS n 
1 696  MET n 
1 697  GLN n 
1 698  PHE n 
1 699  TYR n 
1 700  TYR n 
1 701  MET n 
1 702  GLN n 
1 703  LYS n 
1 704  THR n 
1 705  GLN n 
1 706  GLN n 
1 707  ALA n 
1 708  LEU n 
1 709  ILE n 
1 710  LEU n 
1 711  VAL n 
1 712  GLY n 
1 713  LYS n 
1 714  ALA n 
1 715  GLY n 
1 716  CYS n 
1 717  GLY n 
1 718  LYS n 
1 719  THR n 
1 720  ALA n 
1 721  THR n 
1 722  TRP n 
1 723  LYS n 
1 724  THR n 
1 725  VAL n 
1 726  ILE n 
1 727  ASP n 
1 728  ALA n 
1 729  MET n 
1 730  ALA n 
1 731  ILE n 
1 732  PHE n 
1 733  ASP n 
1 734  GLY n 
1 735  HIS n 
1 736  ALA n 
1 737  ASN n 
1 738  VAL n 
1 739  VAL n 
1 740  TYR n 
1 741  VAL n 
1 742  ILE n 
1 743  ASP n 
1 744  THR n 
1 745  LYS n 
1 746  VAL n 
1 747  LEU n 
1 748  THR n 
1 749  LYS n 
1 750  GLU n 
1 751  SER n 
1 752  LEU n 
1 753  TYR n 
1 754  GLY n 
1 755  SER n 
1 756  MET n 
1 757  LEU n 
1 758  LYS n 
1 759  ALA n 
1 760  THR n 
1 761  LEU n 
1 762  GLU n 
1 763  TRP n 
1 764  ARG n 
1 765  ASP n 
1 766  GLY n 
1 767  LEU n 
1 768  PHE n 
1 769  THR n 
1 770  SER n 
1 771  ILE n 
1 772  LEU n 
1 773  ARG n 
1 774  ARG n 
1 775  VAL n 
1 776  ASN n 
1 777  ASP n 
1 778  ASP n 
1 779  ILE n 
1 780  THR n 
1 781  GLY n 
1 782  THR n 
1 783  PHE n 
1 784  LYS n 
1 785  ASN n 
1 786  SER n 
1 787  ARG n 
1 788  ILE n 
1 789  TRP n 
1 790  VAL n 
1 791  VAL n 
1 792  PHE n 
1 793  ASP n 
1 794  SER n 
1 795  ASP n 
1 796  LEU n 
1 797  ASP n 
1 798  PRO n 
1 799  GLU n 
1 800  TYR n 
1 801  VAL n 
1 802  GLU n 
1 803  ALA n 
1 804  MET n 
1 805  ASN n 
1 806  SER n 
1 807  VAL n 
1 808  LEU n 
1 809  ASP n 
1 810  ASP n 
1 811  ASN n 
1 812  LYS n 
1 813  ILE n 
1 814  LEU n 
1 815  THR n 
1 816  LEU n 
1 817  PRO n 
1 818  ASN n 
1 819  GLY n 
1 820  GLU n 
1 821  ARG n 
1 822  LEU n 
1 823  PRO n 
1 824  ILE n 
1 825  PRO n 
1 826  PRO n 
1 827  ASN n 
1 828  PHE n 
1 829  ARG n 
1 830  ILE n 
1 831  LEU n 
1 832  PHE n 
1 833  GLU n 
1 834  THR n 
1 835  ASP n 
1 836  ASN n 
1 837  LEU n 
1 838  ASP n 
1 839  HIS n 
1 840  THR n 
1 841  THR n 
1 842  PRO n 
1 843  ALA n 
1 844  THR n 
1 845  ILE n 
1 846  THR n 
1 847  ARG n 
1 848  CYS n 
1 849  GLY n 
1 850  LEU n 
1 851  LEU n 
1 852  TRP n 
1 853  PHE n 
1 854  SER n 
1 855  THR n 
1 856  ASP n 
1 857  VAL n 
1 858  CYS n 
1 859  SER n 
1 860  ILE n 
1 861  SER n 
1 862  SER n 
1 863  LYS n 
1 864  ILE n 
1 865  ASP n 
1 866  HIS n 
1 867  LEU n 
1 868  LEU n 
1 869  ASN n 
1 870  LYS n 
1 871  SER n 
1 872  TYR n 
1 873  GLU n 
1 874  ALA n 
1 875  LEU n 
1 876  ASP n 
1 877  ASN n 
1 878  LYS n 
1 879  LEU n 
1 880  SER n 
1 881  MET n 
1 882  PHE n 
1 883  GLU n 
1 884  LEU n 
1 885  ASP n 
1 886  LYS n 
1 887  LEU n 
1 888  LYS n 
1 889  ASP n 
1 890  LEU n 
1 891  ILE n 
1 892  SER n 
1 893  ASP n 
1 894  SER n 
1 895  PHE n 
1 896  ASP n 
1 897  MET n 
1 898  ALA n 
1 899  SER n 
1 900  LEU n 
1 901  THR n 
1 902  ASN n 
1 903  ILE n 
1 904  PHE n 
1 905  THR n 
1 906  CYS n 
1 907  SER n 
1 908  ASN n 
1 909  ASP n 
1 910  LEU n 
1 911  VAL n 
1 912  HIS n 
1 913  ILE n 
1 914  LEU n 
1 915  GLY n 
1 916  VAL n 
1 917  ARG n 
1 918  THR n 
1 919  PHE n 
1 920  ASN n 
1 921  LYS n 
1 922  LEU n 
1 923  GLU n 
1 924  THR n 
1 925  ALA n 
1 926  VAL n 
1 927  GLN n 
1 928  LEU n 
1 929  ALA n 
1 930  VAL n 
1 931  HIS n 
1 932  LEU n 
1 933  ILE n 
1 934  SER n 
1 935  SER n 
1 936  TYR n 
1 937  ARG n 
1 938  GLN n 
1 939  TRP n 
1 940  PHE n 
1 941  GLN n 
1 942  ASN n 
1 943  LEU n 
1 944  ASP n 
1 945  ASP n 
1 946  LYS n 
1 947  SER n 
1 948  LEU n 
1 949  LYS n 
1 950  ASP n 
1 951  VAL n 
1 952  ILE n 
1 953  THR n 
1 954  LEU n 
1 955  LEU n 
1 956  ILE n 
1 957  LYS n 
1 958  ARG n 
1 959  SER n 
1 960  LEU n 
1 961  LEU n 
1 962  TYR n 
1 963  ALA n 
1 964  LEU n 
1 965  ALA n 
1 966  GLY n 
1 967  ASP n 
1 968  SER n 
1 969  THR n 
1 970  GLY n 
1 971  GLU n 
1 972  SER n 
1 973  GLN n 
1 974  ARG n 
1 975  ALA n 
1 976  PHE n 
1 977  ILE n 
1 978  GLN n 
1 979  THR n 
1 980  ILE n 
1 981  ASN n 
1 982  THR n 
1 983  TYR n 
1 984  PHE n 
1 985  GLY n 
1 986  HIS n 
1 987  ASP n 
1 988  SER n 
1 989  GLN n 
1 990  GLU n 
1 991  LEU n 
1 992  SER n 
1 993  ASP n 
1 994  TYR n 
1 995  SER n 
1 996  THR n 
1 997  ILE n 
1 998  VAL n 
1 999  ILE n 
1 1000 ALA n 
1 1001 ASN n 
1 1002 ASP n 
1 1003 LYS n 
1 1004 LEU n 
1 1005 SER n 
1 1006 PHE n 
1 1007 SER n 
1 1008 SER n 
1 1009 PHE n 
1 1010 CYS n 
1 1011 SER n 
1 1012 GLU n 
1 1013 ILE n 
1 1014 PRO n 
1 1015 SER n 
1 1016 VAL n 
1 1017 SER n 
1 1018 LEU n 
1 1019 GLU n 
1 1020 ALA n 
1 1021 HIS n 
1 1022 GLU n 
1 1023 VAL n 
1 1024 MET n 
1 1025 ARG n 
1 1026 PRO n 
1 1027 ASP n 
1 1028 ILE n 
1 1029 VAL n 
1 1030 ILE n 
1 1031 PRO n 
1 1032 THR n 
1 1033 ILE n 
1 1034 ASP n 
1 1035 THR n 
1 1036 ILE n 
1 1037 LYS n 
1 1038 HIS n 
1 1039 GLU n 
1 1040 LYS n 
1 1041 ILE n 
1 1042 PHE n 
1 1043 TYR n 
1 1044 ASP n 
1 1045 LEU n 
1 1046 LEU n 
1 1047 ASN n 
1 1048 SER n 
1 1049 LYS n 
1 1050 ARG n 
1 1051 GLY n 
1 1052 ILE n 
1 1053 ILE n 
1 1054 LEU n 
1 1055 CYS n 
1 1056 GLY n 
1 1057 PRO n 
1 1058 PRO n 
1 1059 GLY n 
1 1060 SER n 
1 1061 GLY n 
1 1062 LYS n 
1 1063 THR n 
1 1064 MET n 
1 1065 ILE n 
1 1066 MET n 
1 1067 ASN n 
1 1068 ASN n 
1 1069 ALA n 
1 1070 LEU n 
1 1071 ARG n 
1 1072 ASN n 
1 1073 SER n 
1 1074 SER n 
1 1075 LEU n 
1 1076 TYR n 
1 1077 ASP n 
1 1078 VAL n 
1 1079 VAL n 
1 1080 GLY n 
1 1081 ILE n 
1 1082 ASN n 
1 1083 PHE n 
1 1084 SER n 
1 1085 LYS n 
1 1086 ASP n 
1 1087 THR n 
1 1088 THR n 
1 1089 THR n 
1 1090 GLU n 
1 1091 HIS n 
1 1092 ILE n 
1 1093 LEU n 
1 1094 SER n 
1 1095 ALA n 
1 1096 LEU n 
1 1097 HIS n 
1 1098 ARG n 
1 1099 HIS n 
1 1100 THR n 
1 1101 ASN n 
1 1102 TYR n 
1 1103 VAL n 
1 1104 THR n 
1 1105 THR n 
1 1106 SER n 
1 1107 LYS n 
1 1108 GLY n 
1 1109 LEU n 
1 1110 THR n 
1 1111 LEU n 
1 1112 LEU n 
1 1113 PRO n 
1 1114 LYS n 
1 1115 SER n 
1 1116 ASP n 
1 1117 ILE n 
1 1118 LYS n 
1 1119 ASN n 
1 1120 LEU n 
1 1121 VAL n 
1 1122 LEU n 
1 1123 PHE n 
1 1124 CYS n 
1 1125 ASP n 
1 1126 GLU n 
1 1127 ILE n 
1 1128 ASN n 
1 1129 LEU n 
1 1130 PRO n 
1 1131 LYS n 
1 1132 LEU n 
1 1133 ASP n 
1 1134 LYS n 
1 1135 TYR n 
1 1136 GLY n 
1 1137 SER n 
1 1138 GLN n 
1 1139 ASN n 
1 1140 VAL n 
1 1141 VAL n 
1 1142 LEU n 
1 1143 PHE n 
1 1144 LEU n 
1 1145 ARG n 
1 1146 GLN n 
1 1147 LEU n 
1 1148 MET n 
1 1149 GLU n 
1 1150 LYS n 
1 1151 GLN n 
1 1152 GLY n 
1 1153 PHE n 
1 1154 TRP n 
1 1155 LYS n 
1 1156 THR n 
1 1157 PRO n 
1 1158 GLU n 
1 1159 ASN n 
1 1160 LYS n 
1 1161 TRP n 
1 1162 VAL n 
1 1163 THR n 
1 1164 ILE n 
1 1165 GLU n 
1 1166 ARG n 
1 1167 ILE n 
1 1168 HIS n 
1 1169 ILE n 
1 1170 VAL n 
1 1171 GLY n 
1 1172 ALA n 
1 1173 CYS n 
1 1174 ASN n 
1 1175 PRO n 
1 1176 PRO n 
1 1177 THR n 
1 1178 ASP n 
1 1179 PRO n 
1 1180 GLY n 
1 1181 ARG n 
1 1182 ILE n 
1 1183 PRO n 
1 1184 MET n 
1 1185 SER n 
1 1186 GLU n 
1 1187 ARG n 
1 1188 PHE n 
1 1189 THR n 
1 1190 ARG n 
1 1191 HIS n 
1 1192 ALA n 
1 1193 ALA n 
1 1194 ILE n 
1 1195 LEU n 
1 1196 TYR n 
1 1197 LEU n 
1 1198 GLY n 
1 1199 TYR n 
1 1200 PRO n 
1 1201 SER n 
1 1202 GLY n 
1 1203 LYS n 
1 1204 SER n 
1 1205 LEU n 
1 1206 SER n 
1 1207 GLN n 
1 1208 ILE n 
1 1209 TYR n 
1 1210 GLU n 
1 1211 ILE n 
1 1212 TYR n 
1 1213 TYR n 
1 1214 LYS n 
1 1215 ALA n 
1 1216 ILE n 
1 1217 PHE n 
1 1218 LYS n 
1 1219 LEU n 
1 1220 VAL n 
1 1221 PRO n 
1 1222 GLU n 
1 1223 PHE n 
1 1224 ARG n 
1 1225 SER n 
1 1226 TYR n 
1 1227 THR n 
1 1228 GLU n 
1 1229 PRO n 
1 1230 PHE n 
1 1231 ALA n 
1 1232 ARG n 
1 1233 ALA n 
1 1234 SER n 
1 1235 VAL n 
1 1236 HIS n 
1 1237 LEU n 
1 1238 TYR n 
1 1239 ASN n 
1 1240 GLU n 
1 1241 CYS n 
1 1242 LYS n 
1 1243 ALA n 
1 1244 ARG n 
1 1245 TYR n 
1 1246 SER n 
1 1247 THR n 
1 1248 GLY n 
1 1249 LEU n 
1 1250 GLN n 
1 1251 SER n 
1 1252 HIS n 
1 1253 TYR n 
1 1254 LEU n 
1 1255 PHE n 
1 1256 SER n 
1 1257 PRO n 
1 1258 ARG n 
1 1259 GLU n 
1 1260 LEU n 
1 1261 THR n 
1 1262 ARG n 
1 1263 LEU n 
1 1264 VAL n 
1 1265 ARG n 
1 1266 GLY n 
1 1267 VAL n 
1 1268 TYR n 
1 1269 THR n 
1 1270 ALA n 
1 1271 ILE n 
1 1272 ASN n 
1 1273 THR n 
1 1274 GLY n 
1 1275 PRO n 
1 1276 ARG n 
1 1277 GLN n 
1 1278 THR n 
1 1279 LEU n 
1 1280 ARG n 
1 1281 SER n 
1 1282 LEU n 
1 1283 ILE n 
1 1284 ARG n 
1 1285 LEU n 
1 1286 TRP n 
1 1287 ALA n 
1 1288 TYR n 
1 1289 GLU n 
1 1290 ALA n 
1 1291 TRP n 
1 1292 ARG n 
1 1293 ILE n 
1 1294 PHE n 
1 1295 ALA n 
1 1296 ASP n 
1 1297 ARG n 
1 1298 LEU n 
1 1299 VAL n 
1 1300 GLY n 
1 1301 VAL n 
1 1302 LYS n 
1 1303 GLU n 
1 1304 LYS n 
1 1305 ASN n 
1 1306 SER n 
1 1307 PHE n 
1 1308 GLU n 
1 1309 GLN n 
1 1310 LEU n 
1 1311 LEU n 
1 1312 TYR n 
1 1313 GLU n 
1 1314 THR n 
1 1315 VAL n 
1 1316 ASP n 
1 1317 LYS n 
1 1318 TYR n 
1 1319 LEU n 
1 1320 PRO n 
1 1321 ASN n 
1 1322 GLN n 
1 1323 ASP n 
1 1324 LEU n 
1 1325 GLY n 
1 1326 ASN n 
1 1327 ILE n 
1 1328 SER n 
1 1329 SER n 
1 1330 THR n 
1 1331 SER n 
1 1332 LEU n 
1 1333 LEU n 
1 1334 PHE n 
1 1335 SER n 
1 1336 GLY n 
1 1337 LEU n 
1 1338 LEU n 
1 1339 SER n 
1 1340 LEU n 
1 1341 ASP n 
1 1342 PHE n 
1 1343 LYS n 
1 1344 GLU n 
1 1345 VAL n 
1 1346 ASN n 
1 1347 LYS n 
1 1348 THR n 
1 1349 ASP n 
1 1350 LEU n 
1 1351 VAL n 
1 1352 ASN n 
1 1353 PHE n 
1 1354 ILE n 
1 1355 GLU n 
1 1356 GLU n 
1 1357 ARG n 
1 1358 PHE n 
1 1359 LYS n 
1 1360 THR n 
1 1361 PHE n 
1 1362 CYS n 
1 1363 ASP n 
1 1364 GLU n 
1 1365 GLU n 
1 1366 LEU n 
1 1367 GLU n 
1 1368 VAL n 
1 1369 PRO n 
1 1370 MET n 
1 1371 VAL n 
1 1372 ILE n 
1 1373 HIS n 
1 1374 GLU n 
1 1375 SER n 
1 1376 MET n 
1 1377 VAL n 
1 1378 ASP n 
1 1379 HIS n 
1 1380 ILE n 
1 1381 LEU n 
1 1382 ARG n 
1 1383 ILE n 
1 1384 ASP n 
1 1385 ARG n 
1 1386 ALA n 
1 1387 LEU n 
1 1388 LYS n 
1 1389 GLN n 
1 1390 VAL n 
1 1391 GLN n 
1 1392 GLY n 
1 1393 HIS n 
1 1394 MET n 
1 1395 MET n 
1 1396 LEU n 
1 1397 ILE n 
1 1398 GLY n 
1 1399 ALA n 
1 1400 SER n 
1 1401 ARG n 
1 1402 THR n 
1 1403 GLY n 
1 1404 LYS n 
1 1405 THR n 
1 1406 ILE n 
1 1407 LEU n 
1 1408 THR n 
1 1409 ARG n 
1 1410 PHE n 
1 1411 VAL n 
1 1412 ALA n 
1 1413 TRP n 
1 1414 LEU n 
1 1415 ASN n 
1 1416 GLY n 
1 1417 LEU n 
1 1418 LYS n 
1 1419 ILE n 
1 1420 VAL n 
1 1421 GLN n 
1 1422 PRO n 
1 1423 LYS n 
1 1424 ILE n 
1 1425 HIS n 
1 1426 ARG n 
1 1427 HIS n 
1 1428 SER n 
1 1429 ASN n 
1 1430 LEU n 
1 1431 SER n 
1 1432 ASP n 
1 1433 PHE n 
1 1434 ASP n 
1 1435 MET n 
1 1436 ILE n 
1 1437 LEU n 
1 1438 LYS n 
1 1439 LYS n 
1 1440 ALA n 
1 1441 ILE n 
1 1442 SER n 
1 1443 ASP n 
1 1444 CYS n 
1 1445 SER n 
1 1446 LEU n 
1 1447 LYS n 
1 1448 GLU n 
1 1449 SER n 
1 1450 ARG n 
1 1451 THR n 
1 1452 CYS n 
1 1453 LEU n 
1 1454 ILE n 
1 1455 ILE n 
1 1456 ASP n 
1 1457 GLU n 
1 1458 SER n 
1 1459 ASN n 
1 1460 ILE n 
1 1461 LEU n 
1 1462 GLU n 
1 1463 THR n 
1 1464 ALA n 
1 1465 PHE n 
1 1466 LEU n 
1 1467 GLU n 
1 1468 ARG n 
1 1469 MET n 
1 1470 ASN n 
1 1471 THR n 
1 1472 LEU n 
1 1473 LEU n 
1 1474 ALA n 
1 1475 ASN n 
1 1476 ALA n 
1 1477 ASP n 
1 1478 ILE n 
1 1479 PRO n 
1 1480 ASP n 
1 1481 LEU n 
1 1482 PHE n 
1 1483 GLN n 
1 1484 GLY n 
1 1485 GLU n 
1 1486 GLU n 
1 1487 TYR n 
1 1488 ASP n 
1 1489 LYS n 
1 1490 LEU n 
1 1491 LEU n 
1 1492 ASN n 
1 1493 ASN n 
1 1494 LEU n 
1 1495 ARG n 
1 1496 ASN n 
1 1497 LYS n 
1 1498 THR n 
1 1499 ARG n 
1 1500 SER n 
1 1501 LEU n 
1 1502 GLY n 
1 1503 LEU n 
1 1504 LEU n 
1 1505 LEU n 
1 1506 ASP n 
1 1507 THR n 
1 1508 GLU n 
1 1509 GLN n 
1 1510 GLU n 
1 1511 LEU n 
1 1512 TYR n 
1 1513 ASP n 
1 1514 TRP n 
1 1515 PHE n 
1 1516 VAL n 
1 1517 GLY n 
1 1518 GLU n 
1 1519 ILE n 
1 1520 ALA n 
1 1521 LYS n 
1 1522 ASN n 
1 1523 LEU n 
1 1524 HIS n 
1 1525 VAL n 
1 1526 VAL n 
1 1527 PHE n 
1 1528 THR n 
1 1529 ILE n 
1 1530 CYS n 
1 1531 ASP n 
1 1532 PRO n 
1 1533 THR n 
1 1534 ASN n 
1 1535 ASN n 
1 1536 LYS n 
1 1537 SER n 
1 1538 SER n 
1 1539 ALA n 
1 1540 MET n 
1 1541 ILE n 
1 1542 SER n 
1 1543 SER n 
1 1544 PRO n 
1 1545 ALA n 
1 1546 LEU n 
1 1547 PHE n 
1 1548 ASN n 
1 1549 ARG n 
1 1550 CYS n 
1 1551 ILE n 
1 1552 ILE n 
1 1553 ASN n 
1 1554 TRP n 
1 1555 MET n 
1 1556 GLY n 
1 1557 ASP n 
1 1558 TRP n 
1 1559 ASP n 
1 1560 THR n 
1 1561 LYS n 
1 1562 THR n 
1 1563 MET n 
1 1564 SER n 
1 1565 GLN n 
1 1566 VAL n 
1 1567 ALA n 
1 1568 ASN n 
1 1569 ASN n 
1 1570 MET n 
1 1571 VAL n 
1 1572 ASP n 
1 1573 VAL n 
1 1574 ILE n 
1 1575 PRO n 
1 1576 MET n 
1 1577 GLU n 
1 1578 PHE n 
1 1579 THR n 
1 1580 ASP n 
1 1581 PHE n 
1 1582 ILE n 
1 1583 VAL n 
1 1584 PRO n 
1 1585 GLU n 
1 1586 VAL n 
1 1587 ASN n 
1 1588 LYS n 
1 1589 GLU n 
1 1590 LEU n 
1 1591 VAL n 
1 1592 PHE n 
1 1593 THR n 
1 1594 GLU n 
1 1595 PRO n 
1 1596 ILE n 
1 1597 GLN n 
1 1598 THR n 
1 1599 ILE n 
1 1600 ARG n 
1 1601 ASP n 
1 1602 ALA n 
1 1603 VAL n 
1 1604 VAL n 
1 1605 ASN n 
1 1606 ILE n 
1 1607 LEU n 
1 1608 ILE n 
1 1609 HIS n 
1 1610 PHE n 
1 1611 ASP n 
1 1612 ARG n 
1 1613 ASN n 
1 1614 PHE n 
1 1615 TYR n 
1 1616 GLN n 
1 1617 LYS n 
1 1618 MET n 
1 1619 LYS n 
1 1620 VAL n 
1 1621 GLY n 
1 1622 VAL n 
1 1623 ASN n 
1 1624 PRO n 
1 1625 ARG n 
1 1626 SER n 
1 1627 PRO n 
1 1628 GLY n 
1 1629 TYR n 
1 1630 PHE n 
1 1631 ILE n 
1 1632 ASP n 
1 1633 GLY n 
1 1634 LEU n 
1 1635 ARG n 
1 1636 ALA n 
1 1637 LEU n 
1 1638 VAL n 
1 1639 LYS n 
1 1640 LEU n 
1 1641 VAL n 
1 1642 THR n 
1 1643 ALA n 
1 1644 LYS n 
1 1645 TYR n 
1 1646 GLN n 
1 1647 ASP n 
1 1648 LEU n 
1 1649 GLN n 
1 1650 GLU n 
1 1651 ASN n 
1 1652 GLN n 
1 1653 ARG n 
1 1654 PHE n 
1 1655 VAL n 
1 1656 ASN n 
1 1657 VAL n 
1 1658 GLY n 
1 1659 LEU n 
1 1660 GLU n 
1 1661 LYS n 
1 1662 LEU n 
1 1663 ASN n 
1 1664 GLU n 
1 1665 SER n 
1 1666 VAL n 
1 1667 LEU n 
1 1668 LYS n 
1 1669 VAL n 
1 1670 ASN n 
1 1671 GLU n 
1 1672 LEU n 
1 1673 ASN n 
1 1674 LYS n 
1 1675 THR n 
1 1676 LEU n 
1 1677 GLY n 
1 1678 SER n 
1 1679 GLY n 
1 1680 SER n 
1 1681 GLY n 
1 1682 SER n 
1 1683 ASN n 
1 1684 ILE n 
1 1685 PHE n 
1 1686 GLU n 
1 1687 MET n 
1 1688 LEU n 
1 1689 ARG n 
1 1690 ILE n 
1 1691 ASP n 
1 1692 GLU n 
1 1693 GLY n 
1 1694 LEU n 
1 1695 ARG n 
1 1696 LEU n 
1 1697 LYS n 
1 1698 ILE n 
1 1699 TYR n 
1 1700 LYS n 
1 1701 ASP n 
1 1702 THR n 
1 1703 GLU n 
1 1704 GLY n 
1 1705 TYR n 
1 1706 TYR n 
1 1707 THR n 
1 1708 ILE n 
1 1709 GLY n 
1 1710 ILE n 
1 1711 GLY n 
1 1712 HIS n 
1 1713 LEU n 
1 1714 LEU n 
1 1715 THR n 
1 1716 LYS n 
1 1717 SER n 
1 1718 PRO n 
1 1719 SER n 
1 1720 LEU n 
1 1721 ASN n 
1 1722 ALA n 
1 1723 ALA n 
1 1724 LYS n 
1 1725 SER n 
1 1726 GLU n 
1 1727 LEU n 
1 1728 ASP n 
1 1729 LYS n 
1 1730 ALA n 
1 1731 ILE n 
1 1732 GLY n 
1 1733 ARG n 
1 1734 ASN n 
1 1735 THR n 
1 1736 ASN n 
1 1737 GLY n 
1 1738 VAL n 
1 1739 ILE n 
1 1740 THR n 
1 1741 LYS n 
1 1742 ASP n 
1 1743 GLU n 
1 1744 ALA n 
1 1745 GLU n 
1 1746 LYS n 
1 1747 LEU n 
1 1748 PHE n 
1 1749 ASN n 
1 1750 GLN n 
1 1751 ASP n 
1 1752 VAL n 
1 1753 ASP n 
1 1754 ALA n 
1 1755 ALA n 
1 1756 VAL n 
1 1757 ARG n 
1 1758 GLY n 
1 1759 ILE n 
1 1760 LEU n 
1 1761 ARG n 
1 1762 ASN n 
1 1763 ALA n 
1 1764 LYS n 
1 1765 LEU n 
1 1766 LYS n 
1 1767 PRO n 
1 1768 VAL n 
1 1769 TYR n 
1 1770 ASP n 
1 1771 SER n 
1 1772 LEU n 
1 1773 ASP n 
1 1774 ALA n 
1 1775 VAL n 
1 1776 ARG n 
1 1777 ARG n 
1 1778 ALA n 
1 1779 ALA n 
1 1780 LEU n 
1 1781 ILE n 
1 1782 ASN n 
1 1783 MET n 
1 1784 VAL n 
1 1785 PHE n 
1 1786 GLN n 
1 1787 MET n 
1 1788 GLY n 
1 1789 GLU n 
1 1790 THR n 
1 1791 GLY n 
1 1792 VAL n 
1 1793 ALA n 
1 1794 GLY n 
1 1795 PHE n 
1 1796 THR n 
1 1797 ASN n 
1 1798 SER n 
1 1799 LEU n 
1 1800 ARG n 
1 1801 MET n 
1 1802 LEU n 
1 1803 GLN n 
1 1804 GLN n 
1 1805 LYS n 
1 1806 ARG n 
1 1807 TRP n 
1 1808 ASP n 
1 1809 GLU n 
1 1810 ALA n 
1 1811 ALA n 
1 1812 VAL n 
1 1813 ASN n 
1 1814 LEU n 
1 1815 ALA n 
1 1816 LYS n 
1 1817 SER n 
1 1818 ARG n 
1 1819 TRP n 
1 1820 TYR n 
1 1821 ASN n 
1 1822 GLN n 
1 1823 THR n 
1 1824 PRO n 
1 1825 ASN n 
1 1826 ARG n 
1 1827 ALA n 
1 1828 LYS n 
1 1829 ARG n 
1 1830 VAL n 
1 1831 ILE n 
1 1832 THR n 
1 1833 THR n 
1 1834 PHE n 
1 1835 ARG n 
1 1836 THR n 
1 1837 GLY n 
1 1838 THR n 
1 1839 TRP n 
1 1840 ASP n 
1 1841 ALA n 
1 1842 TYR n 
1 1843 GLY n 
1 1844 SER n 
1 1845 GLY n 
1 1846 SER n 
1 1847 GLY n 
1 1848 SER n 
1 1849 SER n 
1 1850 ILE n 
1 1851 SER n 
1 1852 LEU n 
1 1853 VAL n 
1 1854 LYS n 
1 1855 SER n 
1 1856 LEU n 
1 1857 THR n 
1 1858 PHE n 
1 1859 GLU n 
1 1860 LYS n 
1 1861 GLU n 
1 1862 ARG n 
1 1863 TRP n 
1 1864 LEU n 
1 1865 ASN n 
1 1866 THR n 
1 1867 THR n 
1 1868 LYS n 
1 1869 GLN n 
1 1870 PHE n 
1 1871 SER n 
1 1872 LYS n 
1 1873 THR n 
1 1874 SER n 
1 1875 GLN n 
1 1876 GLU n 
1 1877 LEU n 
1 1878 ILE n 
1 1879 GLY n 
1 1880 ASN n 
1 1881 CYS n 
1 1882 ILE n 
1 1883 ILE n 
1 1884 SER n 
1 1885 SER n 
1 1886 ILE n 
1 1887 TYR n 
1 1888 GLU n 
1 1889 THR n 
1 1890 TYR n 
1 1891 PHE n 
1 1892 GLY n 
1 1893 HIS n 
1 1894 LEU n 
1 1895 ASN n 
1 1896 GLU n 
1 1897 ARG n 
1 1898 GLU n 
1 1899 ARG n 
1 1900 ALA n 
1 1901 ASP n 
1 1902 MET n 
1 1903 LEU n 
1 1904 VAL n 
1 1905 ILE n 
1 1906 LEU n 
1 1907 LYS n 
1 1908 ARG n 
1 1909 LEU n 
1 1910 LEU n 
1 1911 GLY n 
1 1912 LYS n 
1 1913 PHE n 
1 1914 ALA n 
1 1915 VAL n 
1 1916 LYS n 
1 1917 TYR n 
1 1918 ASP n 
1 1919 VAL n 
1 1920 ASN n 
1 1921 TYR n 
1 1922 ARG n 
1 1923 PHE n 
1 1924 ILE n 
1 1925 ASP n 
1 1926 TYR n 
1 1927 LEU n 
1 1928 VAL n 
1 1929 THR n 
1 1930 LEU n 
1 1931 ASP n 
1 1932 GLU n 
1 1933 LYS n 
1 1934 MET n 
1 1935 LYS n 
1 1936 TRP n 
1 1937 LEU n 
1 1938 GLU n 
1 1939 CYS n 
1 1940 GLY n 
1 1941 LEU n 
1 1942 ASP n 
1 1943 LYS n 
1 1944 ASN n 
1 1945 ASP n 
1 1946 TYR n 
1 1947 PHE n 
1 1948 LEU n 
1 1949 GLU n 
1 1950 ASN n 
1 1951 MET n 
1 1952 SER n 
1 1953 ILE n 
1 1954 VAL n 
1 1955 MET n 
1 1956 ASN n 
1 1957 SER n 
1 1958 GLN n 
1 1959 ASP n 
1 1960 ALA n 
1 1961 VAL n 
1 1962 PRO n 
1 1963 PHE n 
1 1964 LEU n 
1 1965 LEU n 
1 1966 ASP n 
1 1967 PRO n 
1 1968 SER n 
1 1969 SER n 
1 1970 HIS n 
1 1971 MET n 
1 1972 ILE n 
1 1973 THR n 
1 1974 VAL n 
1 1975 ILE n 
1 1976 SER n 
1 1977 ASN n 
1 1978 TYR n 
1 1979 TYR n 
1 1980 GLY n 
1 1981 ASN n 
1 1982 LYS n 
1 1983 THR n 
1 1984 VAL n 
1 1985 LEU n 
1 1986 LEU n 
1 1987 SER n 
1 1988 PHE n 
1 1989 LEU n 
1 1990 GLU n 
1 1991 GLU n 
1 1992 GLY n 
1 1993 PHE n 
1 1994 VAL n 
1 1995 LYS n 
1 1996 ARG n 
1 1997 LEU n 
1 1998 GLU n 
1 1999 ASN n 
1 2000 ALA n 
1 2001 ILE n 
1 2002 ARG n 
1 2003 PHE n 
1 2004 GLY n 
1 2005 SER n 
1 2006 VAL n 
1 2007 VAL n 
1 2008 ILE n 
1 2009 ILE n 
1 2010 GLN n 
1 2011 ASP n 
1 2012 GLY n 
1 2013 GLU n 
1 2014 PHE n 
1 2015 PHE n 
1 2016 ASP n 
1 2017 PRO n 
1 2018 ILE n 
1 2019 ILE n 
1 2020 SER n 
1 2021 ARG n 
1 2022 LEU n 
1 2023 ILE n 
1 2024 SER n 
1 2025 ARG n 
1 2026 GLU n 
1 2027 PHE n 
1 2028 ASN n 
1 2029 HIS n 
1 2030 ALA n 
1 2031 GLY n 
1 2032 ASN n 
1 2033 ARG n 
1 2034 VAL n 
1 2035 THR n 
1 2036 VAL n 
1 2037 GLU n 
1 2038 ILE n 
1 2039 GLY n 
1 2040 ASP n 
1 2041 HIS n 
1 2042 GLU n 
1 2043 VAL n 
1 2044 ASP n 
1 2045 VAL n 
1 2046 SER n 
1 2047 GLY n 
1 2048 ASP n 
1 2049 PHE n 
1 2050 LYS n 
1 2051 LEU n 
1 2052 PHE n 
1 2053 ILE n 
1 2054 HIS n 
1 2055 SER n 
1 2056 CYS n 
1 2057 ASP n 
1 2058 PRO n 
1 2059 SER n 
1 2060 GLY n 
1 2061 ASP n 
1 2062 ILE n 
1 2063 PRO n 
1 2064 ILE n 
1 2065 PHE n 
1 2066 LEU n 
1 2067 ARG n 
1 2068 SER n 
1 2069 ARG n 
1 2070 VAL n 
1 2071 ARG n 
1 2072 LEU n 
1 2073 VAL n 
1 2074 HIS n 
1 2075 PHE n 
1 2076 VAL n 
1 2077 THR n 
1 2078 ASN n 
1 2079 LYS n 
1 2080 GLU n 
1 2081 SER n 
1 2082 ILE n 
1 2083 GLU n 
1 2084 THR n 
1 2085 ARG n 
1 2086 ILE n 
1 2087 PHE n 
1 2088 ASP n 
1 2089 ILE n 
1 2090 THR n 
1 2091 LEU n 
1 2092 THR n 
1 2093 GLU n 
1 2094 GLU n 
1 2095 ASN n 
1 2096 ALA n 
1 2097 GLU n 
1 2098 MET n 
1 2099 GLN n 
1 2100 ARG n 
1 2101 LYS n 
1 2102 ARG n 
1 2103 GLU n 
1 2104 ASP n 
1 2105 LEU n 
1 2106 ILE n 
1 2107 LYS n 
1 2108 LEU n 
1 2109 ASN n 
1 2110 THR n 
1 2111 GLU n 
1 2112 TYR n 
1 2113 LYS n 
1 2114 LEU n 
1 2115 LYS n 
1 2116 LEU n 
1 2117 LYS n 
1 2118 ASN n 
1 2119 LEU n 
1 2120 GLU n 
1 2121 LYS n 
1 2122 ARG n 
1 2123 LEU n 
1 2124 LEU n 
1 2125 GLU n 
1 2126 GLU n 
1 2127 LEU n 
1 2128 ASN n 
1 2129 ASN n 
1 2130 SER n 
1 2131 GLN n 
1 2132 GLY n 
1 2133 ASN n 
1 2134 MET n 
1 2135 LEU n 
1 2136 GLU n 
1 2137 ASN n 
1 2138 ASP n 
1 2139 GLU n 
1 2140 LEU n 
1 2141 MET n 
1 2142 VAL n 
1 2143 THR n 
1 2144 LEU n 
1 2145 ASN n 
1 2146 ASN n 
1 2147 LEU n 
1 2148 LYS n 
1 2149 LYS n 
1 2150 GLU n 
1 2151 ALA n 
1 2152 MET n 
1 2153 ASN n 
1 2154 ILE n 
1 2155 GLU n 
1 2156 LYS n 
1 2157 LYS n 
1 2158 LEU n 
1 2159 SER n 
1 2160 GLU n 
1 2161 SER n 
1 2162 GLU n 
1 2163 GLU n 
1 2164 PHE n 
1 2165 PHE n 
1 2166 PRO n 
1 2167 GLN n 
1 2168 PHE n 
1 2169 ASP n 
1 2170 ASN n 
1 2171 LEU n 
1 2172 VAL n 
1 2173 GLU n 
1 2174 GLU n 
1 2175 TYR n 
1 2176 SER n 
1 2177 ILE n 
1 2178 ILE n 
1 2179 GLY n 
1 2180 LYS n 
1 2181 HIS n 
1 2182 SER n 
1 2183 VAL n 
1 2184 LYS n 
1 2185 ILE n 
1 2186 PHE n 
1 2187 SER n 
1 2188 MET n 
1 2189 LEU n 
1 2190 GLU n 
1 2191 LYS n 
1 2192 PHE n 
1 2193 GLY n 
1 2194 GLN n 
1 2195 PHE n 
1 2196 HIS n 
1 2197 TRP n 
1 2198 PHE n 
1 2199 TYR n 
1 2200 GLY n 
1 2201 ILE n 
1 2202 SER n 
1 2203 ILE n 
1 2204 GLY n 
1 2205 GLN n 
1 2206 PHE n 
1 2207 LEU n 
1 2208 SER n 
1 2209 CYS n 
1 2210 PHE n 
1 2211 LYS n 
1 2212 ARG n 
1 2213 VAL n 
1 2214 PHE n 
1 2215 ILE n 
1 2216 LYS n 
1 2217 LYS n 
1 2218 SER n 
1 2219 ARG n 
1 2220 GLU n 
1 2221 THR n 
1 2222 ARG n 
1 2223 ALA n 
1 2224 ALA n 
1 2225 ARG n 
1 2226 THR n 
1 2227 ARG n 
1 2228 VAL n 
1 2229 ASP n 
1 2230 GLU n 
1 2231 ILE n 
1 2232 LEU n 
1 2233 TRP n 
1 2234 LEU n 
1 2235 LEU n 
1 2236 TYR n 
1 2237 GLN n 
1 2238 GLU n 
1 2239 VAL n 
1 2240 TYR n 
1 2241 CYS n 
1 2242 GLN n 
1 2243 PHE n 
1 2244 SER n 
1 2245 THR n 
1 2246 ALA n 
1 2247 LEU n 
1 2248 ASP n 
1 2249 LYS n 
1 2250 LYS n 
1 2251 PHE n 
1 2252 LYS n 
1 2253 MET n 
1 2254 ILE n 
1 2255 MET n 
1 2256 ALA n 
1 2257 MET n 
1 2258 THR n 
1 2259 MET n 
1 2260 PHE n 
1 2261 CYS n 
1 2262 LEU n 
1 2263 TYR n 
1 2264 LYS n 
1 2265 PHE n 
1 2266 ASP n 
1 2267 ILE n 
1 2268 GLU n 
1 2269 SER n 
1 2270 GLU n 
1 2271 GLN n 
1 2272 TYR n 
1 2273 LYS n 
1 2274 GLU n 
1 2275 ALA n 
1 2276 VAL n 
1 2277 LEU n 
1 2278 THR n 
1 2279 MET n 
1 2280 ILE n 
1 2281 GLY n 
1 2282 VAL n 
1 2283 LEU n 
1 2284 SER n 
1 2285 GLU n 
1 2286 SER n 
1 2287 SER n 
1 2288 ASP n 
1 2289 GLY n 
1 2290 VAL n 
1 2291 PRO n 
1 2292 LYS n 
1 2293 LEU n 
1 2294 THR n 
1 2295 VAL n 
1 2296 ASP n 
1 2297 THR n 
1 2298 ASN n 
1 2299 ASP n 
1 2300 ASP n 
1 2301 LEU n 
1 2302 ARG n 
1 2303 TYR n 
1 2304 LEU n 
1 2305 TRP n 
1 2306 ASP n 
1 2307 TYR n 
1 2308 VAL n 
1 2309 THR n 
1 2310 THR n 
1 2311 LYS n 
1 2312 SER n 
1 2313 TYR n 
1 2314 ILE n 
1 2315 SER n 
1 2316 ALA n 
1 2317 LEU n 
1 2318 ASN n 
1 2319 TRP n 
1 2320 PHE n 
1 2321 LYS n 
1 2322 ASN n 
1 2323 GLU n 
1 2324 PHE n 
1 2325 PHE n 
1 2326 VAL n 
1 2327 ASP n 
1 2328 GLU n 
1 2329 TRP n 
1 2330 ASN n 
1 2331 ILE n 
1 2332 ALA n 
1 2333 ASP n 
1 2334 VAL n 
1 2335 VAL n 
1 2336 ALA n 
1 2337 ASN n 
1 2338 SER n 
1 2339 GLU n 
1 2340 ASN n 
1 2341 ASN n 
1 2342 TYR n 
1 2343 PHE n 
1 2344 THR n 
1 2345 MET n 
1 2346 ALA n 
1 2347 SER n 
1 2348 GLU n 
1 2349 ARG n 
1 2350 ASP n 
1 2351 VAL n 
1 2352 ASP n 
1 2353 GLY n 
1 2354 THR n 
1 2355 PHE n 
1 2356 LYS n 
1 2357 LEU n 
1 2358 ILE n 
1 2359 GLU n 
1 2360 LEU n 
1 2361 ALA n 
1 2362 LYS n 
1 2363 ALA n 
1 2364 SER n 
1 2365 LYS n 
1 2366 GLU n 
1 2367 SER n 
1 2368 LEU n 
1 2369 LYS n 
1 2370 ILE n 
1 2371 ILE n 
1 2372 PRO n 
1 2373 LEU n 
1 2374 GLY n 
1 2375 SER n 
1 2376 ILE n 
1 2377 GLU n 
1 2378 ASN n 
1 2379 LEU n 
1 2380 ASN n 
1 2381 TYR n 
1 2382 ALA n 
1 2383 GLN n 
1 2384 GLU n 
1 2385 GLU n 
1 2386 ILE n 
1 2387 SER n 
1 2388 LYS n 
1 2389 SER n 
1 2390 LYS n 
1 2391 ILE n 
1 2392 GLU n 
1 2393 GLY n 
1 2394 GLY n 
1 2395 TRP n 
1 2396 ILE n 
1 2397 LEU n 
1 2398 LEU n 
1 2399 GLN n 
1 2400 ASN n 
1 2401 ILE n 
1 2402 GLN n 
1 2403 MET n 
1 2404 SER n 
1 2405 LEU n 
1 2406 SER n 
1 2407 TRP n 
1 2408 VAL n 
1 2409 LYS n 
1 2410 THR n 
1 2411 TYR n 
1 2412 LEU n 
1 2413 HIS n 
1 2414 LYS n 
1 2415 HIS n 
1 2416 VAL n 
1 2417 GLU n 
1 2418 GLU n 
1 2419 THR n 
1 2420 LYS n 
1 2421 ALA n 
1 2422 ALA n 
1 2423 GLU n 
1 2424 GLU n 
1 2425 HIS n 
1 2426 GLU n 
1 2427 LYS n 
1 2428 PHE n 
1 2429 LYS n 
1 2430 MET n 
1 2431 PHE n 
1 2432 MET n 
1 2433 THR n 
1 2434 CYS n 
1 2435 HIS n 
1 2436 LEU n 
1 2437 THR n 
1 2438 GLY n 
1 2439 ASP n 
1 2440 LYS n 
1 2441 LEU n 
1 2442 PRO n 
1 2443 ALA n 
1 2444 PRO n 
1 2445 LEU n 
1 2446 LEU n 
1 2447 GLN n 
1 2448 ARG n 
1 2449 THR n 
1 2450 ASP n 
1 2451 ARG n 
1 2452 VAL n 
1 2453 VAL n 
1 2454 TYR n 
1 2455 GLU n 
1 2456 ASP n 
1 2457 ILE n 
1 2458 PRO n 
1 2459 GLY n 
1 2460 ILE n 
1 2461 LEU n 
1 2462 ASP n 
1 2463 THR n 
1 2464 VAL n 
1 2465 LYS n 
1 2466 ASP n 
1 2467 LEU n 
1 2468 TRP n 
1 2469 GLY n 
1 2470 SER n 
1 2471 GLN n 
1 2472 PHE n 
1 2473 PHE n 
1 2474 THR n 
1 2475 GLY n 
1 2476 LYS n 
1 2477 ILE n 
1 2478 SER n 
1 2479 GLY n 
1 2480 VAL n 
1 2481 TRP n 
1 2482 SER n 
1 2483 VAL n 
1 2484 TYR n 
1 2485 CYS n 
1 2486 THR n 
1 2487 PHE n 
1 2488 LEU n 
1 2489 LEU n 
1 2490 SER n 
1 2491 TRP n 
1 2492 PHE n 
1 2493 HIS n 
1 2494 ALA n 
1 2495 LEU n 
1 2496 ILE n 
1 2497 THR n 
1 2498 ALA n 
1 2499 ARG n 
1 2500 THR n 
1 2501 ARG n 
1 2502 LEU n 
1 2503 VAL n 
1 2504 PRO n 
1 2505 HIS n 
1 2506 GLY n 
1 2507 PHE n 
1 2508 SER n 
1 2509 LYS n 
1 2510 LYS n 
1 2511 TYR n 
1 2512 TYR n 
1 2513 PHE n 
1 2514 ASN n 
1 2515 ASP n 
1 2516 CYS n 
1 2517 ASP n 
1 2518 PHE n 
1 2519 GLN n 
1 2520 PHE n 
1 2521 ALA n 
1 2522 SER n 
1 2523 VAL n 
1 2524 TYR n 
1 2525 LEU n 
1 2526 GLU n 
1 2527 ASN n 
1 2528 VAL n 
1 2529 LEU n 
1 2530 ALA n 
1 2531 THR n 
1 2532 ASN n 
1 2533 SER n 
1 2534 THR n 
1 2535 ASN n 
1 2536 ASN n 
1 2537 ILE n 
1 2538 PRO n 
1 2539 TRP n 
1 2540 ALA n 
1 2541 GLN n 
1 2542 VAL n 
1 2543 ARG n 
1 2544 ASP n 
1 2545 HIS n 
1 2546 ILE n 
1 2547 ALA n 
1 2548 THR n 
1 2549 ILE n 
1 2550 VAL n 
1 2551 TYR n 
1 2552 GLY n 
1 2553 GLY n 
1 2554 LYS n 
1 2555 ILE n 
1 2556 ASP n 
1 2557 GLU n 
1 2558 GLU n 
1 2559 LYS n 
1 2560 ASP n 
1 2561 LEU n 
1 2562 GLU n 
1 2563 VAL n 
1 2564 VAL n 
1 2565 ALA n 
1 2566 LYS n 
1 2567 LEU n 
1 2568 CYS n 
1 2569 ALA n 
1 2570 HIS n 
1 2571 VAL n 
1 2572 PHE n 
1 2573 CYS n 
1 2574 GLY n 
1 2575 SER n 
1 2576 ASP n 
1 2577 ASN n 
1 2578 LEU n 
1 2579 GLN n 
1 2580 ILE n 
1 2581 VAL n 
1 2582 PRO n 
1 2583 GLY n 
1 2584 VAL n 
1 2585 ARG n 
1 2586 ILE n 
1 2587 PRO n 
1 2588 GLN n 
1 2589 PRO n 
1 2590 LEU n 
1 2591 LEU n 
1 2592 GLN n 
1 2593 GLN n 
1 2594 SER n 
1 2595 GLU n 
1 2596 GLU n 
1 2597 GLU n 
1 2598 GLU n 
1 2599 ARG n 
1 2600 ALA n 
1 2601 ARG n 
1 2602 LEU n 
1 2603 THR n 
1 2604 ALA n 
1 2605 ILE n 
1 2606 LEU n 
1 2607 SER n 
1 2608 ASN n 
1 2609 THR n 
1 2610 ILE n 
1 2611 GLU n 
1 2612 PRO n 
1 2613 ALA n 
1 2614 ASP n 
1 2615 SER n 
1 2616 LEU n 
1 2617 SER n 
1 2618 SER n 
1 2619 TRP n 
1 2620 LEU n 
1 2621 GLN n 
1 2622 LEU n 
1 2623 PRO n 
1 2624 ARG n 
1 2625 GLU n 
1 2626 SER n 
1 2627 ILE n 
1 2628 LEU n 
1 2629 ASP n 
1 2630 TYR n 
1 2631 GLU n 
1 2632 ARG n 
1 2633 LEU n 
1 2634 GLN n 
1 2635 ALA n 
1 2636 LYS n 
1 2637 GLU n 
1 2638 VAL n 
1 2639 ALA n 
1 2640 SER n 
1 2641 SER n 
1 2642 THR n 
1 2643 GLU n 
1 2644 GLN n 
1 2645 LEU n 
1 2646 LEU n 
1 2647 GLN n 
1 2648 GLU n 
1 2649 MET n 
1 2650 GLY n 
1 2651 SER n 
1 2652 GLY n 
1 2653 SER n 
1 2654 GLY n 
1 2655 SER n 
1 2656 HIS n 
1 2657 HIS n 
1 2658 HIS n 
1 2659 HIS n 
1 2660 HIS n 
1 2661 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1    1682 
;Baker's yeast
;
? 'DYN1, DHC1, YKR054C' ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae' 559292 ? ? ? ? ? ? ? ? 
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 2 sample 'Biological sequence' 1683 1848 ?               ? ?                     ? ?                     ? ? ? ? 
'Enterobacteria phage T4'  10665  ? ? ? ? ? ? ? ? 'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
1 3 sample 'Biological sequence' 1849 2661 
;Baker's yeast
;
? 'DYN1, DHC1, YKR054C' ? 'ATCC 204508 / S288c' ? ? ? ? 'Saccharomyces cerevisiae' 559292 ? ? ? ? ? ? ? ? 
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP DYHC_YEAST P36022 ? 1 
;EFVIEKSLNRIKKFWKEAQYEVIEHSSGLKLVREWDVLEQACKEDLEELVSMKASNYYKIFEQDCLDLESKLTKLSEIQV
NWVEVQFYWLDLYGILGENLDIQNFLPLETSKFKSLTSEYKMITTRAFQLDTTIEVIHIPNFDTTLKLTIDSLKMIKSSL
STFLERQRRQFPRFYFLGNDDLLKIIGSGKHHDQVSKFMKKMFGSIESIIFLEDFITGVRSVEGEVLNLNEKIELKDSIQ
AQEWLNILDTEIKLSVFTQFRDCLGQLKDGTDIEVVVSKYIFQAILLSAQVMWTELVEKCLQTNQFSKYWKEVDMKIKGL
LDKLNKSSDNVKKKIEALLVEYLHFNNVIGQLKNCSTKEEARLLWAKVQKFYQKNDTLDDLNSVFISQSGYLLQYKFEYI
GIPERLIYTPLLLIGFATLTDSLHQKYGGCFFGPAGTGKTETVKAFGQNLGRVVVVFNCDDSFDYQVLSRLLVGITQIGA
WGCFDEFNRLDEKVLSAVSANIQQIQNGLQVGKSHITLLEEETPLSPHTAVFITLNPGYNGRSELPENLKKSFREFSMKS
PQSGTIAEMILQIMGFEDSKSLASKIVHFLELLSSKCSSMNHYHFGLRTLKGVLRNCSPLISEFGEGEKTVVESLKRVIL
PSLGDTDELVFKDELSKIFDSAGTPLNSKAIVQCLKDAGQRSGFSMSEEFLKKCMQFYYMQKTQQALILVGKAGCGKTAT
WKTVIDAMAIFDGHANVVYVIDTKVLTKESLYGSMLKATLEWRDGLFTSILRRVNDDITGTFKNSRIWVVFDSDLDPEYV
EAMNSVLDDNKILTLPNGERLPIPPNFRILFETDNLDHTTPATITRCGLLWFSTDVCSISSKIDHLLNKSYEALDNKLSM
FELDKLKDLISDSFDMASLTNIFTCSNDLVHILGVRTFNKLETAVQLAVHLISSYRQWFQNLDDKSLKDVITLLIKRSLL
YALAGDSTGESQRAFIQTINTYFGHDSQELSDYSTIVIANDKLSFSSFCSEIPSVSLEAHEVMRPDIVIPTIDTIKHEKI
FYDLLNSKRGIILCGPPGSGKTMIMNNALRNSSLYDVVGINFSKDTTTEHILSALHRHTNYVTTSKGLTLLPKSDIKNLV
LFCDEINLPKLDKYGSQNVVLFLRQLMEKQGFWKTPENKWVTIERIHIVGACNPPTDPGRIPMSERFTRHAAILYLGYPS
GKSLSQIYEIYYKAIFKLVPEFRSYTEPFARASVHLYNECKARYSTGLQSHYLFSPRELTRLVRGVYTAINTGPRQTLRS
LIRLWAYEAWRIFADRLVGVKEKNSFEQLLYETVDKYLPNQDLGNISSTSLLFSGLLSLDFKEVNKTDLVNFIEERFKTF
CDEELEVPMVIHESMVDHILRIDRALKQVQGHMMLIGASRTGKTILTRFVAWLNGLKIVQPKIHRHSNLSDFDMILKKAI
SDCSLKESRTCLIIDESNILETAFLERMNTLLANADIPDLFQGEEYDKLLNNLRNKTRSLGLLLDTEQELYDWFVGEIAK
NLHVVFTICDPTNNKSSAMISSPALFNRCIINWMGDWDTKTMSQVANNMVDVIPMEFTDFIVPEVNKELVFTEPIQTIRD
AVVNILIHFDRNFYQKMKVGVNPRSPGYFIDGLRALVKLVTAKYQDLQENQRFVNVGLEKLNESVLKVNELNKTL
;
1364 
2 UNP ENLYS_BPT4 P00720 ? 1 
;NIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRN
AKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAY

;
2    
3 UNP DYHC_YEAST P36022 ? 1 
;SISLVKSLTFEKERWLNTTKQFSKTSQELIGNCIISSIYETYFGHLNERERADMLVILKRLLGKFAVKYDVNYRFIDYLV
TLDEKMKWLECGLDKNDYFLENMSIVMNSQDAVPFLLDPSSHMITVISNYYGNKTVLLSFLEEGFVKRLENAIRFGSVVI
IQDGEFFDPIISRLISREFNHAGNRVTVEIGDHEVDVSGDFKLFIHSCDPSGDIPIFLRSRVRLVHFVTNKESIETRIFD
ITLTEENAEMQRKREDLIKLNTEYKLKLKNLEKRLLEELNNSQGNMLENDELMVTLNNLKKEAMNIEKKLSESEEFFPQF
DNLVEEYSIIGKHSVKIFSMLEKFGQFHWFYGISIGQFLSCFKRVFIKKSRETRAARTRVDEILWLLYQEVYCQFSTALD
KKFKMIMAMTMFCLYKFDIESEQYKEAVLTMIGVLSESSDGVPKLTVDTNNDLRYLWDYVTTKSYISALNWFKNEFFVDE
WNIADVVANSENNYFTMASERDVDGTFKLIELAKASKESLKIIPLGSIENLNYAQEEISKSKIEGGWILLQNIQMSLSWV
KTYLHKHVEETKAAEEHEKFKMFMTCHLTGDKLPAPLLQRTDRFVYEDIPGILDTVKDLWGSQFFTGKISGVWSVYCTFL
LSWFHALITARTRLVPHGFSKKYYFNDCDFQFASVYLENVLATNSTNNIPWAQVRDHIATIVYGGKIDEEKDLEVVAKLC
AHVFCGSDNLQIVPGVRIPQPLLQQSEEEERARLTAILSNTIEPADSLSSWLQLPRESILNYERLQAKEVASSTEQLLQE
M
;
3292 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4W8F A 2    ? 1676 ? P36022 1364 ? 3038 ? 1364 3119 
2 2 4W8F A 1683 ? 1842 ? P00720 2    ? 161  ? 3126 3285 
3 3 4W8F A 1849 ? 2649 ? P36022 3292 ? 4092 ? 3292 4092 
4 1 4W8F B 2    ? 1676 ? P36022 1364 ? 3038 ? 1364 3119 
5 2 4W8F B 1683 ? 1842 ? P00720 2    ? 161  ? 3126 3285 
6 3 4W8F B 1849 ? 2649 ? P36022 3292 ? 4092 ? 3292 4092 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4W8F GLY A 1    ? UNP P36022 ?   ?    'expression tag'      1363 1  
1 4W8F GLN A 487  ? UNP P36022 GLU 1849 'engineered mutation' 1849 2  
1 4W8F GLY A 1677 ? UNP P36022 ?   ?    linker                3120 3  
1 4W8F SER A 1678 ? UNP P36022 ?   ?    linker                3121 4  
1 4W8F GLY A 1679 ? UNP P36022 ?   ?    linker                3122 5  
1 4W8F SER A 1680 ? UNP P36022 ?   ?    linker                3123 6  
1 4W8F GLY A 1681 ? UNP P36022 ?   ?    linker                3124 7  
1 4W8F SER A 1682 ? UNP P36022 ?   ?    linker                3125 8  
2 4W8F GLY A 1693 ? UNP P00720 ARG 12   conflict              3136 9  
2 4W8F THR A 1735 ? UNP P00720 CYS 54   conflict              3178 10 
2 4W8F ALA A 1778 ? UNP P00720 CYS 97   conflict              3221 11 
2 4W8F ARG A 1818 ? UNP P00720 ILE 137  conflict              3261 12 
2 4W8F GLY A 1843 ? UNP P00720 ?   ?    linker                3286 13 
2 4W8F SER A 1844 ? UNP P00720 ?   ?    linker                3287 14 
2 4W8F GLY A 1845 ? UNP P00720 ?   ?    linker                3288 15 
2 4W8F SER A 1846 ? UNP P00720 ?   ?    linker                3289 16 
2 4W8F GLY A 1847 ? UNP P00720 ?   ?    linker                3290 17 
2 4W8F SER A 1848 ? UNP P00720 ?   ?    linker                3291 18 
3 4W8F ASP A 2299 ? UNP P36022 ASN 3742 conflict              3742 19 
3 4W8F VAL A 2452 ? UNP P36022 PHE 3895 conflict              3895 20 
3 4W8F ASP A 2629 ? UNP P36022 ASN 4072 conflict              4072 21 
3 4W8F GLY A 2650 ? UNP P36022 ?   ?    linker                4093 22 
3 4W8F SER A 2651 ? UNP P36022 ?   ?    linker                4094 23 
3 4W8F GLY A 2652 ? UNP P36022 ?   ?    linker                4095 24 
3 4W8F SER A 2653 ? UNP P36022 ?   ?    linker                4096 25 
3 4W8F GLY A 2654 ? UNP P36022 ?   ?    linker                4097 26 
3 4W8F SER A 2655 ? UNP P36022 ?   ?    linker                4098 27 
3 4W8F HIS A 2656 ? UNP P36022 ?   ?    'expression tag'      4099 28 
3 4W8F HIS A 2657 ? UNP P36022 ?   ?    'expression tag'      4100 29 
3 4W8F HIS A 2658 ? UNP P36022 ?   ?    'expression tag'      4101 30 
3 4W8F HIS A 2659 ? UNP P36022 ?   ?    'expression tag'      4102 31 
3 4W8F HIS A 2660 ? UNP P36022 ?   ?    'expression tag'      4103 32 
3 4W8F HIS A 2661 ? UNP P36022 ?   ?    'expression tag'      4104 33 
4 4W8F GLY B 1    ? UNP P36022 ?   ?    'expression tag'      1363 34 
4 4W8F GLN B 487  ? UNP P36022 GLU 1849 'engineered mutation' 1849 35 
4 4W8F GLY B 1677 ? UNP P36022 ?   ?    linker                3120 36 
4 4W8F SER B 1678 ? UNP P36022 ?   ?    linker                3121 37 
4 4W8F GLY B 1679 ? UNP P36022 ?   ?    linker                3122 38 
4 4W8F SER B 1680 ? UNP P36022 ?   ?    linker                3123 39 
4 4W8F GLY B 1681 ? UNP P36022 ?   ?    linker                3124 40 
4 4W8F SER B 1682 ? UNP P36022 ?   ?    linker                3125 41 
5 4W8F GLY B 1693 ? UNP P00720 ARG 12   conflict              3136 42 
5 4W8F THR B 1735 ? UNP P00720 CYS 54   conflict              3178 43 
5 4W8F ALA B 1778 ? UNP P00720 CYS 97   conflict              3221 44 
5 4W8F ARG B 1818 ? UNP P00720 ILE 137  conflict              3261 45 
5 4W8F GLY B 1843 ? UNP P00720 ?   ?    linker                3286 46 
5 4W8F SER B 1844 ? UNP P00720 ?   ?    linker                3287 47 
5 4W8F GLY B 1845 ? UNP P00720 ?   ?    linker                3288 48 
5 4W8F SER B 1846 ? UNP P00720 ?   ?    linker                3289 49 
5 4W8F GLY B 1847 ? UNP P00720 ?   ?    linker                3290 50 
5 4W8F SER B 1848 ? UNP P00720 ?   ?    linker                3291 51 
6 4W8F ASP B 2299 ? UNP P36022 ASN 3742 conflict              3742 52 
6 4W8F VAL B 2452 ? UNP P36022 PHE 3895 conflict              3895 53 
6 4W8F ASP B 2629 ? UNP P36022 ASN 4072 conflict              4072 54 
6 4W8F GLY B 2650 ? UNP P36022 ?   ?    linker                4093 55 
6 4W8F SER B 2651 ? UNP P36022 ?   ?    linker                4094 56 
6 4W8F GLY B 2652 ? UNP P36022 ?   ?    linker                4095 57 
6 4W8F SER B 2653 ? UNP P36022 ?   ?    linker                4096 58 
6 4W8F GLY B 2654 ? UNP P36022 ?   ?    linker                4097 59 
6 4W8F SER B 2655 ? UNP P36022 ?   ?    linker                4098 60 
6 4W8F HIS B 2656 ? UNP P36022 ?   ?    'expression tag'      4099 61 
6 4W8F HIS B 2657 ? UNP P36022 ?   ?    'expression tag'      4100 62 
6 4W8F HIS B 2658 ? UNP P36022 ?   ?    'expression tag'      4101 63 
6 4W8F HIS B 2659 ? UNP P36022 ?   ?    'expression tag'      4102 64 
6 4W8F HIS B 2660 ? UNP P36022 ?   ?    'expression tag'      4103 65 
6 4W8F HIS B 2661 ? UNP P36022 ?   ?    'expression tag'      4104 66 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4W8F 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.13 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         60.70 
_exptl_crystal.description                 'thin plates' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '4-10% PEG 3350 and 200-300 mM NaAc' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2012-12-06 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Si 111 CHANNEL' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.1159 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 8.3.1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.1159 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   8.3.1 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4W8F 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.54 
_reflns.d_resolution_low                 49.4 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       82983 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       3.3 
_reflns.percent_possible_obs             92.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  10.9 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  . 
_reflns_shell.d_res_low                   ? 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4W8F 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.541 
_refine.ls_d_res_low                             49.400 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     82942 
_refine.ls_number_reflns_R_free                  4187 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    92.20 
_refine.ls_percent_reflns_R_free                 5.05 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2299 
_refine.ls_R_factor_R_free                       0.2620 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2282 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.37 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.86 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.46 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.006  ? 43243 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.149  ? 58485 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 15.213 ? 16067 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.045  ? 6632  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 7352  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 3.5411  3.5813  . . 44  689  25.00  . . . 0.3172 . 0.2683 . . . . . . . . 
'X-RAY DIFFRACTION' 3.5813  3.6234  . . 76  1283 45.00  . . . 0.3457 . 0.2625 . . . . . . . . 
'X-RAY DIFFRACTION' 3.6234  3.6676  . . 85  1628 59.00  . . . 0.2808 . 0.2764 . . . . . . . . 
'X-RAY DIFFRACTION' 3.6676  3.7140  . . 103 1982 69.00  . . . 0.2754 . 0.2713 . . . . . . . . 
'X-RAY DIFFRACTION' 3.7140  3.7628  . . 138 2284 81.00  . . . 0.3082 . 0.2742 . . . . . . . . 
'X-RAY DIFFRACTION' 3.7628  3.8144  . . 127 2535 90.00  . . . 0.3155 . 0.2606 . . . . . . . . 
'X-RAY DIFFRACTION' 3.8144  3.8688  . . 161 2788 99.00  . . . 0.3192 . 0.2701 . . . . . . . . 
'X-RAY DIFFRACTION' 3.8688  3.9266  . . 154 2855 100.00 . . . 0.3192 . 0.2582 . . . . . . . . 
'X-RAY DIFFRACTION' 3.9266  3.9879  . . 135 2829 100.00 . . . 0.2476 . 0.2627 . . . . . . . . 
'X-RAY DIFFRACTION' 3.9879  4.0533  . . 153 2854 100.00 . . . 0.3005 . 0.2518 . . . . . . . . 
'X-RAY DIFFRACTION' 4.0533  4.1231  . . 147 2819 100.00 . . . 0.3120 . 0.2438 . . . . . . . . 
'X-RAY DIFFRACTION' 4.1231  4.1980  . . 152 2824 100.00 . . . 0.2774 . 0.2447 . . . . . . . . 
'X-RAY DIFFRACTION' 4.1980  4.2787  . . 149 2844 100.00 . . . 0.2854 . 0.2283 . . . . . . . . 
'X-RAY DIFFRACTION' 4.2787  4.3660  . . 152 2818 100.00 . . . 0.2604 . 0.2159 . . . . . . . . 
'X-RAY DIFFRACTION' 4.3660  4.4609  . . 157 2845 100.00 . . . 0.2240 . 0.2213 . . . . . . . . 
'X-RAY DIFFRACTION' 4.4609  4.5646  . . 138 2888 100.00 . . . 0.2371 . 0.2185 . . . . . . . . 
'X-RAY DIFFRACTION' 4.5646  4.6787  . . 166 2805 100.00 . . . 0.2438 . 0.2251 . . . . . . . . 
'X-RAY DIFFRACTION' 4.6787  4.8051  . . 160 2837 100.00 . . . 0.2440 . 0.2200 . . . . . . . . 
'X-RAY DIFFRACTION' 4.8051  4.9463  . . 146 2852 100.00 . . . 0.2650 . 0.2219 . . . . . . . . 
'X-RAY DIFFRACTION' 4.9463  5.1058  . . 146 2833 100.00 . . . 0.2783 . 0.2196 . . . . . . . . 
'X-RAY DIFFRACTION' 5.1058  5.2881  . . 156 2825 100.00 . . . 0.2647 . 0.2267 . . . . . . . . 
'X-RAY DIFFRACTION' 5.2881  5.4996  . . 151 2862 100.00 . . . 0.2815 . 0.2170 . . . . . . . . 
'X-RAY DIFFRACTION' 5.4996  5.7495  . . 162 2869 100.00 . . . 0.2520 . 0.2303 . . . . . . . . 
'X-RAY DIFFRACTION' 5.7495  6.0522  . . 140 2833 100.00 . . . 0.2769 . 0.2448 . . . . . . . . 
'X-RAY DIFFRACTION' 6.0522  6.4306  . . 141 2872 100.00 . . . 0.2812 . 0.2463 . . . . . . . . 
'X-RAY DIFFRACTION' 6.4306  6.9259  . . 148 2863 100.00 . . . 0.2358 . 0.2199 . . . . . . . . 
'X-RAY DIFFRACTION' 6.9259  7.6206  . . 153 2860 100.00 . . . 0.2480 . 0.2079 . . . . . . . . 
'X-RAY DIFFRACTION' 7.6206  8.7181  . . 175 2842 100.00 . . . 0.1977 . 0.1729 . . . . . . . . 
'X-RAY DIFFRACTION' 8.7181  10.9640 . . 127 2901 100.00 . . . 0.1690 . 0.1572 . . . . . . . . 
'X-RAY DIFFRACTION' 10.9640 49.4051 . . 145 2936 99.00  . . . 0.2565 . 0.2364 . . . . . . . . 
# 
_struct.entry_id                     4W8F 
_struct.title                        'Crystal structure of the dynein motor domain in the AMPPNP-bound state' 
_struct.pdbx_descriptor              ANP,MG 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4W8F 
_struct_keywords.text            'cytoplasmic dynein, microtubule, ATPase, AAA+, AMPPNP, MOTOR PROTEIN' 
_struct_keywords.pdbx_keywords   'MOTOR PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 2 ? 
L N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 ILE A 5    ? LYS A 17   ? ILE A 1367 LYS A 1379 1 ? 13 
HELX_P HELX_P2   AA2 TRP A 36   ? MET A 53   ? TRP A 1398 MET A 1415 1 ? 18 
HELX_P HELX_P3   AA3 LYS A 54   ? SER A 56   ? LYS A 1416 SER A 1418 5 ? 3  
HELX_P HELX_P4   AA4 PHE A 62   ? LEU A 97   ? PHE A 1424 LEU A 1459 1 ? 36 
HELX_P HELX_P5   AA5 ASN A 100  ? LEU A 107  ? ASN A 1462 LEU A 1469 1 ? 8  
HELX_P HELX_P6   AA6 LEU A 107  ? GLN A 130  ? LEU A 1469 GLN A 1492 1 ? 24 
HELX_P HELX_P7   AA7 THR A 134  ? ILE A 140  ? THR A 1496 ILE A 1502 5 ? 7  
HELX_P HELX_P8   AA8 PHE A 143  ? ARG A 170  ? PHE A 1505 ARG A 1532 1 ? 28 
HELX_P HELX_P9   AA9 GLN A 171  ? LEU A 178  ? GLN A 1533 LEU A 1540 5 ? 8  
HELX_P HELX_P10  AB1 GLY A 179  ? GLY A 190  ? GLY A 1541 GLY A 1552 1 ? 12 
HELX_P HELX_P11  AB2 VAL A 196  ? LYS A 202  ? VAL A 1558 LYS A 1564 5 ? 7  
HELX_P HELX_P12  AB3 GLN A 241  ? ASP A 270  ? GLN A 1603 ASP A 1632 1 ? 30 
HELX_P HELX_P13  AB4 ASP A 273  ? TYR A 281  ? ASP A 1635 TYR A 1643 1 ? 9  
HELX_P HELX_P14  AB5 ILE A 282  ? ASN A 305  ? ILE A 1644 ASN A 1667 1 ? 24 
HELX_P HELX_P15  AB6 GLN A 306  ? LYS A 327  ? GLN A 1668 LYS A 1689 1 ? 22 
HELX_P HELX_P16  AB7 SER A 329  ? CYS A 356  ? SER A 1691 CYS A 1718 1 ? 28 
HELX_P HELX_P17  AB8 THR A 358  ? LYS A 368  ? THR A 1720 LYS A 1730 1 ? 11 
HELX_P HELX_P18  AB9 ASP A 380  ? ASN A 383  ? ASP A 1742 ASN A 1745 5 ? 4  
HELX_P HELX_P19  AC1 THR A 410  ? GLN A 426  ? THR A 1772 GLN A 1788 1 ? 17 
HELX_P HELX_P20  AC2 LYS A 440  ? LEU A 451  ? LYS A 1802 LEU A 1813 1 ? 12 
HELX_P HELX_P21  AC3 ASP A 465  ? GLY A 480  ? ASP A 1827 GLY A 1842 1 ? 16 
HELX_P HELX_P22  AC4 ASP A 492  ? GLY A 513  ? ASP A 1854 GLY A 1875 1 ? 22 
HELX_P HELX_P23  AC5 PRO A 547  ? LYS A 552  ? PRO A 1909 LYS A 1914 1 ? 6  
HELX_P HELX_P24  AC6 GLN A 563  ? MET A 575  ? GLN A 1925 MET A 1937 1 ? 13 
HELX_P HELX_P25  AC7 ASP A 579  ? CYS A 598  ? ASP A 1941 CYS A 1960 1 ? 20 
HELX_P HELX_P26  AC8 GLY A 607  ? ILE A 622  ? GLY A 1969 ILE A 1984 1 ? 16 
HELX_P HELX_P27  AC9 GLY A 628  ? ILE A 640  ? GLY A 1990 ILE A 2002 1 ? 13 
HELX_P HELX_P28  AD1 LEU A 641  ? LEU A 644  ? LEU A 2003 LEU A 2006 5 ? 4  
HELX_P HELX_P29  AD2 GLY A 645  ? LYS A 658  ? GLY A 2007 LYS A 2020 1 ? 14 
HELX_P HELX_P30  AD3 SER A 669  ? GLY A 684  ? SER A 2031 GLY A 2046 1 ? 16 
HELX_P HELX_P31  AD4 SER A 688  ? GLN A 705  ? SER A 2050 GLN A 2067 1 ? 18 
HELX_P HELX_P32  AD5 GLY A 717  ? GLY A 734  ? GLY A 2079 GLY A 2096 1 ? 18 
HELX_P HELX_P33  AD6 ASP A 743  ? LEU A 747  ? ASP A 2105 LEU A 2109 5 ? 5  
HELX_P HELX_P34  AD7 THR A 748  ? TYR A 753  ? THR A 2110 TYR A 2115 1 ? 6  
HELX_P HELX_P35  AD8 GLY A 766  ? ASN A 776  ? GLY A 2128 ASN A 2138 1 ? 11 
HELX_P HELX_P36  AD9 ASP A 797  ? ASP A 809  ? ASP A 2159 ASP A 2171 1 ? 13 
HELX_P HELX_P37  AE1 THR A 841  ? CYS A 848  ? THR A 2203 CYS A 2210 1 ? 8  
HELX_P HELX_P38  AE2 SER A 859  ? LEU A 879  ? SER A 2221 LEU A 2241 1 ? 21 
HELX_P HELX_P39  AE3 SER A 880  ? PHE A 895  ? SER A 2242 PHE A 2257 1 ? 16 
HELX_P HELX_P40  AE4 ASP A 896  ? ASP A 909  ? ASP A 2258 ASP A 2271 1 ? 14 
HELX_P HELX_P41  AE5 ARG A 917  ? TYR A 936  ? ARG A 2279 TYR A 2298 1 ? 20 
HELX_P HELX_P42  AE6 ARG A 937  ? PHE A 940  ? ARG A 2299 PHE A 2302 5 ? 4  
HELX_P HELX_P43  AE7 ASP A 944  ? GLY A 966  ? ASP A 2306 GLY A 2328 1 ? 23 
HELX_P HELX_P44  AE8 GLY A 970  ? PHE A 984  ? GLY A 2332 PHE A 2346 1 ? 15 
HELX_P HELX_P45  AE9 GLU A 1019 ? VAL A 1023 ? GLU A 2381 VAL A 2385 5 ? 5  
HELX_P HELX_P46  AF1 THR A 1032 ? SER A 1048 ? THR A 2394 SER A 2410 1 ? 17 
HELX_P HELX_P47  AF2 GLY A 1061 ? SER A 1073 ? GLY A 2423 SER A 2435 1 ? 13 
HELX_P HELX_P48  AF3 THR A 1088 ? HIS A 1097 ? THR A 2450 HIS A 2459 1 ? 10 
HELX_P HELX_P49  AF4 GLN A 1138 ? GLN A 1151 ? GLN A 2500 GLN A 2513 1 ? 14 
HELX_P HELX_P50  AF5 SER A 1185 ? ARG A 1190 ? SER A 2547 ARG A 2552 1 ? 6  
HELX_P HELX_P51  AF6 GLY A 1202 ? PHE A 1217 ? GLY A 2564 PHE A 2579 1 ? 16 
HELX_P HELX_P52  AF7 LYS A 1218 ? SER A 1225 ? LYS A 2580 SER A 2587 5 ? 8  
HELX_P HELX_P53  AF8 TYR A 1226 ? TYR A 1245 ? TYR A 2588 TYR A 2607 1 ? 20 
HELX_P HELX_P54  AF9 SER A 1256 ? GLY A 1274 ? SER A 2618 GLY A 2636 1 ? 19 
HELX_P HELX_P55  AG1 THR A 1278 ? PHE A 1294 ? THR A 2640 PHE A 2656 1 ? 17 
HELX_P HELX_P56  AG2 ALA A 1295 ? LEU A 1298 ? ALA A 2657 LEU A 2660 5 ? 4  
HELX_P HELX_P57  AG3 VAL A 1301 ? LEU A 1319 ? VAL A 2663 LEU A 2681 1 ? 19 
HELX_P HELX_P58  AG4 LYS A 1347 ? GLU A 1365 ? LYS A 2709 GLU A 2727 1 ? 19 
HELX_P HELX_P59  AG5 HIS A 1373 ? GLN A 1389 ? HIS A 2735 GLN A 2751 1 ? 17 
HELX_P HELX_P60  AG6 GLY A 1403 ? ASN A 1415 ? GLY A 2765 ASN A 2777 1 ? 13 
HELX_P HELX_P61  AG7 ASN A 1429 ? LEU A 1446 ? ASN A 2791 LEU A 2808 1 ? 18 
HELX_P HELX_P62  AG8 THR A 1463 ? ASN A 1475 ? THR A 2825 ASN A 2837 1 ? 13 
HELX_P HELX_P63  AG9 GLY A 1484 ? LEU A 1501 ? GLY A 2846 LEU A 2863 1 ? 18 
HELX_P HELX_P64  AH1 THR A 1507 ? ASN A 1522 ? THR A 2869 ASN A 2884 1 ? 16 
HELX_P HELX_P65  AH2 ASN A 1534 ? SER A 1543 ? ASN A 2896 SER A 2905 1 ? 10 
HELX_P HELX_P66  AH3 SER A 1543 ? ARG A 1549 ? SER A 2905 ARG A 2911 1 ? 7  
HELX_P HELX_P67  AH4 LYS A 1561 ? VAL A 1571 ? LYS A 2923 VAL A 2933 1 ? 11 
HELX_P HELX_P68  AH5 THR A 1598 ? MET A 1618 ? THR A 2960 MET A 2980 1 ? 21 
HELX_P HELX_P69  AH6 GLY A 1628 ? VAL A 1666 ? GLY A 2990 VAL A 3028 1 ? 39 
HELX_P HELX_P70  AH7 ILE A 1684 ? GLU A 1692 ? ILE A 3127 GLU A 3135 1 ? 9  
HELX_P HELX_P71  AH8 LEU A 1720 ? GLY A 1732 ? LEU A 3163 GLY A 3175 1 ? 13 
HELX_P HELX_P72  AH9 THR A 1740 ? ASN A 1762 ? THR A 3183 ASN A 3205 1 ? 23 
HELX_P HELX_P73  AI1 LEU A 1765 ? LEU A 1772 ? LEU A 3208 LEU A 3215 1 ? 8  
HELX_P HELX_P74  AI2 ASP A 1773 ? GLY A 1788 ? ASP A 3216 GLY A 3231 1 ? 16 
HELX_P HELX_P75  AI3 GLY A 1788 ? GLY A 1794 ? GLY A 3231 GLY A 3237 1 ? 7  
HELX_P HELX_P76  AI4 PHE A 1795 ? GLN A 1804 ? PHE A 3238 GLN A 3247 1 ? 10 
HELX_P HELX_P77  AI5 ARG A 1806 ? ALA A 1815 ? ARG A 3249 ALA A 3258 1 ? 10 
HELX_P HELX_P78  AI6 SER A 1817 ? THR A 1823 ? SER A 3260 THR A 3266 1 ? 7  
HELX_P HELX_P79  AI7 ASN A 1825 ? GLY A 1837 ? ASN A 3268 GLY A 3280 1 ? 13 
HELX_P HELX_P80  AI8 SER A 1855 ? GLU A 1861 ? SER A 3298 GLU A 3304 1 ? 7  
HELX_P HELX_P81  AI9 ARG A 1862 ? LEU A 1864 ? ARG A 3305 LEU A 3307 5 ? 3  
HELX_P HELX_P82  AJ1 ASN A 1865 ? GLU A 1876 ? ASN A 3308 GLU A 3319 1 ? 12 
HELX_P HELX_P83  AJ2 GLU A 1876 ? TYR A 1890 ? GLU A 3319 TYR A 3333 1 ? 15 
HELX_P HELX_P84  AJ3 PHE A 1891 ? LEU A 1894 ? PHE A 3334 LEU A 3337 5 ? 4  
HELX_P HELX_P85  AJ4 ASN A 1895 ? PHE A 1913 ? ASN A 3338 PHE A 3356 1 ? 19 
HELX_P HELX_P86  AJ5 ARG A 1922 ? VAL A 1928 ? ARG A 3365 VAL A 3371 1 ? 7  
HELX_P HELX_P87  AJ6 THR A 1929 ? CYS A 1939 ? THR A 3372 CYS A 3382 1 ? 11 
HELX_P HELX_P88  AJ7 ASN A 1944 ? SER A 1957 ? ASN A 3387 SER A 3400 1 ? 14 
HELX_P HELX_P89  AJ8 MET A 1971 ? GLY A 1980 ? MET A 3414 GLY A 3423 1 ? 10 
HELX_P HELX_P90  AJ9 GLY A 1992 ? GLY A 2004 ? GLY A 3435 GLY A 3447 1 ? 13 
HELX_P HELX_P91  AK1 ASP A 2016 ? ILE A 2018 ? ASP A 3459 ILE A 3461 5 ? 3  
HELX_P HELX_P92  AK2 ILE A 2019 ? SER A 2024 ? ILE A 3462 SER A 3467 1 ? 6  
HELX_P HELX_P93  AK3 PRO A 2063 ? VAL A 2070 ? PRO A 3506 VAL A 3513 1 ? 8  
HELX_P HELX_P94  AK4 SER A 2081 ? ASN A 2095 ? SER A 3524 ASN A 3538 1 ? 15 
HELX_P HELX_P95  AK5 ALA A 2096 ? ASP A 2104 ? ALA A 3539 ASP A 3547 1 ? 9  
HELX_P HELX_P96  AK6 ILE A 2106 ? ASN A 2129 ? ILE A 3549 ASN A 3572 1 ? 24 
HELX_P HELX_P97  AK7 LEU A 2135 ? TYR A 2175 ? LEU A 3578 TYR A 3618 1 ? 41 
HELX_P HELX_P98  AK8 TYR A 2175 ? HIS A 2196 ? TYR A 3618 HIS A 3639 1 ? 22 
HELX_P HELX_P99  AK9 TRP A 2197 ? GLY A 2200 ? TRP A 3640 GLY A 3643 5 ? 4  
HELX_P HELX_P100 AL1 SER A 2202 ? ARG A 2212 ? SER A 3645 ARG A 3655 1 ? 11 
HELX_P HELX_P101 AL2 ARG A 2227 ? SER A 2244 ? ARG A 3670 SER A 3687 1 ? 18 
HELX_P HELX_P102 AL3 THR A 2245 ? LEU A 2247 ? THR A 3688 LEU A 3690 5 ? 3  
HELX_P HELX_P103 AL4 ASP A 2248 ? GLU A 2268 ? ASP A 3691 GLU A 3711 1 ? 21 
HELX_P HELX_P104 AL5 SER A 2269 ? SER A 2284 ? SER A 3712 SER A 3727 1 ? 16 
HELX_P HELX_P105 AL6 ASP A 2299 ? THR A 2310 ? ASP A 3742 THR A 3753 1 ? 12 
HELX_P HELX_P106 AL7 SER A 2312 ? ASN A 2318 ? SER A 3755 ASN A 3761 1 ? 7  
HELX_P HELX_P107 AL8 ASN A 2318 ? PHE A 2325 ? ASN A 3761 PHE A 3768 1 ? 8  
HELX_P HELX_P108 AL9 ASN A 2330 ? SER A 2338 ? ASN A 3773 SER A 3781 1 ? 9  
HELX_P HELX_P109 AM1 GLY A 2353 ? SER A 2364 ? GLY A 3796 SER A 3807 1 ? 12 
HELX_P HELX_P110 AM2 SER A 2375 ? GLY A 2393 ? SER A 3818 GLY A 3836 1 ? 19 
HELX_P HELX_P111 AM3 ASN A 2400 ? SER A 2404 ? ASN A 3843 SER A 3847 5 ? 5  
HELX_P HELX_P112 AM4 LEU A 2405 ? GLU A 2418 ? LEU A 3848 GLU A 3861 1 ? 14 
HELX_P HELX_P113 AM5 PRO A 2442 ? ARG A 2448 ? PRO A 3885 ARG A 3891 1 ? 7  
HELX_P HELX_P114 AM6 GLY A 2459 ? PHE A 2472 ? GLY A 3902 PHE A 3915 1 ? 14 
HELX_P HELX_P115 AM7 PHE A 2473 ? GLY A 2475 ? PHE A 3916 GLY A 3918 5 ? 3  
HELX_P HELX_P116 AM8 GLY A 2479 ? VAL A 2503 ? GLY A 3922 VAL A 3946 1 ? 25 
HELX_P HELX_P117 AM9 ASN A 2514 ? ASN A 2532 ? ASN A 3957 ASN A 3975 1 ? 19 
HELX_P HELX_P118 AN1 PRO A 2538 ? ILE A 2549 ? PRO A 3981 ILE A 3992 1 ? 12 
HELX_P HELX_P119 AN2 TYR A 2551 ? ILE A 2555 ? TYR A 3994 ILE A 3998 5 ? 5  
HELX_P HELX_P120 AN3 GLU A 2557 ? PHE A 2572 ? GLU A 4000 PHE A 4015 1 ? 16 
HELX_P HELX_P121 AN4 SER A 2594 ? ASN A 2608 ? SER A 4037 ASN A 4051 1 ? 15 
HELX_P HELX_P122 AN5 ASP A 2614 ? TRP A 2619 ? ASP A 4057 TRP A 4062 1 ? 6  
HELX_P HELX_P123 AN6 PRO A 2623 ? GLU A 2648 ? PRO A 4066 GLU A 4091 1 ? 26 
HELX_P HELX_P124 AN7 ILE B 5    ? GLU B 18   ? ILE B 1367 GLU B 1380 1 ? 14 
HELX_P HELX_P125 AN8 TRP B 36   ? LYS B 54   ? TRP B 1398 LYS B 1416 1 ? 19 
HELX_P HELX_P126 AN9 TYR B 58   ? LEU B 97   ? TYR B 1420 LEU B 1459 1 ? 40 
HELX_P HELX_P127 AO1 ASN B 100  ? LEU B 107  ? ASN B 1462 LEU B 1469 1 ? 8  
HELX_P HELX_P128 AO2 LEU B 107  ? GLN B 130  ? LEU B 1469 GLN B 1492 1 ? 24 
HELX_P HELX_P129 AO3 THR B 134  ? ILE B 140  ? THR B 1496 ILE B 1502 5 ? 7  
HELX_P HELX_P130 AO4 PHE B 143  ? PHE B 172  ? PHE B 1505 PHE B 1534 1 ? 30 
HELX_P HELX_P131 AO5 PRO B 173  ? LEU B 178  ? PRO B 1535 LEU B 1540 5 ? 6  
HELX_P HELX_P132 AO6 GLY B 179  ? GLY B 190  ? GLY B 1541 GLY B 1552 1 ? 12 
HELX_P HELX_P133 AO7 VAL B 196  ? LYS B 198  ? VAL B 1558 LYS B 1560 5 ? 3  
HELX_P HELX_P134 AO8 PHE B 199  ? PHE B 204  ? PHE B 1561 PHE B 1566 1 ? 6  
HELX_P HELX_P135 AO9 GLN B 241  ? ASP B 270  ? GLN B 1603 ASP B 1632 1 ? 30 
HELX_P HELX_P136 AP1 ASP B 273  ? TYR B 281  ? ASP B 1635 TYR B 1643 1 ? 9  
HELX_P HELX_P137 AP2 ILE B 282  ? ASN B 305  ? ILE B 1644 ASN B 1667 1 ? 24 
HELX_P HELX_P138 AP3 GLN B 306  ? LYS B 327  ? GLN B 1668 LYS B 1689 1 ? 22 
HELX_P HELX_P139 AP4 SER B 329  ? ASN B 355  ? SER B 1691 ASN B 1717 1 ? 27 
HELX_P HELX_P140 AP5 THR B 358  ? LYS B 368  ? THR B 1720 LYS B 1730 1 ? 11 
HELX_P HELX_P141 AP6 ASP B 380  ? ASN B 383  ? ASP B 1742 ASN B 1745 5 ? 4  
HELX_P HELX_P142 AP7 THR B 410  ? GLN B 426  ? THR B 1772 GLN B 1788 1 ? 17 
HELX_P HELX_P143 AP8 LYS B 440  ? LEU B 451  ? LYS B 1802 LEU B 1813 1 ? 12 
HELX_P HELX_P144 AP9 ASP B 465  ? GLY B 480  ? ASP B 1827 GLY B 1842 1 ? 16 
HELX_P HELX_P145 AQ1 ASP B 492  ? GLY B 513  ? ASP B 1854 GLY B 1875 1 ? 22 
HELX_P HELX_P146 AQ2 PRO B 547  ? LYS B 552  ? PRO B 1909 LYS B 1914 1 ? 6  
HELX_P HELX_P147 AQ3 SER B 564  ? MET B 575  ? SER B 1926 MET B 1937 1 ? 12 
HELX_P HELX_P148 AQ4 ASP B 579  ? CYS B 598  ? ASP B 1941 CYS B 1960 1 ? 20 
HELX_P HELX_P149 AQ5 GLY B 607  ? CYS B 618  ? GLY B 1969 CYS B 1980 1 ? 12 
HELX_P HELX_P150 AQ6 CYS B 618  ? PHE B 625  ? CYS B 1980 PHE B 1987 1 ? 8  
HELX_P HELX_P151 AQ7 GLY B 628  ? ILE B 640  ? GLY B 1990 ILE B 2002 1 ? 13 
HELX_P HELX_P152 AQ8 LEU B 641  ? LEU B 644  ? LEU B 2003 LEU B 2006 5 ? 4  
HELX_P HELX_P153 AQ9 GLY B 645  ? LYS B 658  ? GLY B 2007 LYS B 2020 1 ? 14 
HELX_P HELX_P154 AR1 SER B 669  ? GLY B 684  ? SER B 2031 GLY B 2046 1 ? 16 
HELX_P HELX_P155 AR2 SER B 688  ? GLN B 705  ? SER B 2050 GLN B 2067 1 ? 18 
HELX_P HELX_P156 AR3 GLY B 717  ? GLY B 734  ? GLY B 2079 GLY B 2096 1 ? 18 
HELX_P HELX_P157 AR4 ASP B 743  ? LEU B 747  ? ASP B 2105 LEU B 2109 5 ? 5  
HELX_P HELX_P158 AR5 THR B 748  ? TYR B 753  ? THR B 2110 TYR B 2115 1 ? 6  
HELX_P HELX_P159 AR6 GLY B 766  ? ASN B 776  ? GLY B 2128 ASN B 2138 1 ? 11 
HELX_P HELX_P160 AR7 ASP B 797  ? ASP B 809  ? ASP B 2159 ASP B 2171 1 ? 13 
HELX_P HELX_P161 AR8 THR B 841  ? CYS B 848  ? THR B 2203 CYS B 2210 1 ? 8  
HELX_P HELX_P162 AR9 SER B 859  ? LEU B 879  ? SER B 2221 LEU B 2241 1 ? 21 
HELX_P HELX_P163 AS1 SER B 880  ? PHE B 895  ? SER B 2242 PHE B 2257 1 ? 16 
HELX_P HELX_P164 AS2 ASP B 896  ? ASP B 909  ? ASP B 2258 ASP B 2271 1 ? 14 
HELX_P HELX_P165 AS3 ARG B 917  ? TYR B 936  ? ARG B 2279 TYR B 2298 1 ? 20 
HELX_P HELX_P166 AS4 ARG B 937  ? PHE B 940  ? ARG B 2299 PHE B 2302 5 ? 4  
HELX_P HELX_P167 AS5 ASP B 944  ? GLY B 966  ? ASP B 2306 GLY B 2328 1 ? 23 
HELX_P HELX_P168 AS6 GLY B 970  ? TYR B 983  ? GLY B 2332 TYR B 2345 1 ? 14 
HELX_P HELX_P169 AS7 GLU B 1019 ? VAL B 1023 ? GLU B 2381 VAL B 2385 5 ? 5  
HELX_P HELX_P170 AS8 THR B 1032 ? SER B 1048 ? THR B 2394 SER B 2410 1 ? 17 
HELX_P HELX_P171 AS9 GLY B 1061 ? SER B 1073 ? GLY B 2423 SER B 2435 1 ? 13 
HELX_P HELX_P172 AT1 THR B 1088 ? HIS B 1097 ? THR B 2450 HIS B 2459 1 ? 10 
HELX_P HELX_P173 AT2 GLN B 1138 ? GLN B 1151 ? GLN B 2500 GLN B 2513 1 ? 14 
HELX_P HELX_P174 AT3 SER B 1185 ? ARG B 1190 ? SER B 2547 ARG B 2552 1 ? 6  
HELX_P HELX_P175 AT4 GLY B 1202 ? PHE B 1217 ? GLY B 2564 PHE B 2579 1 ? 16 
HELX_P HELX_P176 AT5 LYS B 1218 ? SER B 1225 ? LYS B 2580 SER B 2587 5 ? 8  
HELX_P HELX_P177 AT6 TYR B 1226 ? TYR B 1245 ? TYR B 2588 TYR B 2607 1 ? 20 
HELX_P HELX_P178 AT7 SER B 1256 ? GLY B 1274 ? SER B 2618 GLY B 2636 1 ? 19 
HELX_P HELX_P179 AT8 THR B 1278 ? PHE B 1294 ? THR B 2640 PHE B 2656 1 ? 17 
HELX_P HELX_P180 AT9 ALA B 1295 ? LEU B 1298 ? ALA B 2657 LEU B 2660 5 ? 4  
HELX_P HELX_P181 AU1 VAL B 1301 ? LEU B 1319 ? VAL B 2663 LEU B 2681 1 ? 19 
HELX_P HELX_P182 AU2 LYS B 1347 ? GLU B 1365 ? LYS B 2709 GLU B 2727 1 ? 19 
HELX_P HELX_P183 AU3 HIS B 1373 ? GLN B 1389 ? HIS B 2735 GLN B 2751 1 ? 17 
HELX_P HELX_P184 AU4 LYS B 1404 ? GLY B 1416 ? LYS B 2766 GLY B 2778 1 ? 13 
HELX_P HELX_P185 AU5 ASN B 1429 ? LEU B 1446 ? ASN B 2791 LEU B 2808 1 ? 18 
HELX_P HELX_P186 AU6 THR B 1463 ? ASN B 1475 ? THR B 2825 ASN B 2837 1 ? 13 
HELX_P HELX_P187 AU7 GLY B 1484 ? LEU B 1501 ? GLY B 2846 LEU B 2863 1 ? 18 
HELX_P HELX_P188 AU8 THR B 1507 ? ASN B 1522 ? THR B 2869 ASN B 2884 1 ? 16 
HELX_P HELX_P189 AU9 ASN B 1534 ? SER B 1543 ? ASN B 2896 SER B 2905 1 ? 10 
HELX_P HELX_P190 AV1 SER B 1543 ? ARG B 1549 ? SER B 2905 ARG B 2911 1 ? 7  
HELX_P HELX_P191 AV2 THR B 1560 ? VAL B 1571 ? THR B 2922 VAL B 2933 1 ? 12 
HELX_P HELX_P192 AV3 THR B 1598 ? MET B 1618 ? THR B 2960 MET B 2980 1 ? 21 
HELX_P HELX_P193 AV4 GLY B 1628 ? SER B 1665 ? GLY B 2990 SER B 3027 1 ? 38 
HELX_P HELX_P194 AV5 VAL B 1666 ? LYS B 1668 ? VAL B 3028 LYS B 3030 5 ? 3  
HELX_P HELX_P195 AV6 ILE B 1684 ? GLU B 1692 ? ILE B 3127 GLU B 3135 1 ? 9  
HELX_P HELX_P196 AV7 ASN B 1721 ? GLY B 1732 ? ASN B 3164 GLY B 3175 1 ? 12 
HELX_P HELX_P197 AV8 THR B 1740 ? ALA B 1763 ? THR B 3183 ALA B 3206 1 ? 24 
HELX_P HELX_P198 AV9 LEU B 1765 ? LEU B 1772 ? LEU B 3208 LEU B 3215 1 ? 8  
HELX_P HELX_P199 AW1 ASP B 1773 ? GLY B 1788 ? ASP B 3216 GLY B 3231 1 ? 16 
HELX_P HELX_P200 AW2 GLY B 1788 ? GLY B 1794 ? GLY B 3231 GLY B 3237 1 ? 7  
HELX_P HELX_P201 AW3 PHE B 1795 ? GLN B 1804 ? PHE B 3238 GLN B 3247 1 ? 10 
HELX_P HELX_P202 AW4 ARG B 1806 ? ALA B 1815 ? ARG B 3249 ALA B 3258 1 ? 10 
HELX_P HELX_P203 AW5 SER B 1817 ? THR B 1823 ? SER B 3260 THR B 3266 1 ? 7  
HELX_P HELX_P204 AW6 THR B 1823 ? GLY B 1837 ? THR B 3266 GLY B 3280 1 ? 15 
HELX_P HELX_P205 AW7 LEU B 1852 ? ARG B 1862 ? LEU B 3295 ARG B 3305 1 ? 11 
HELX_P HELX_P206 AW8 ASN B 1865 ? GLU B 1876 ? ASN B 3308 GLU B 3319 1 ? 12 
HELX_P HELX_P207 AW9 GLU B 1876 ? PHE B 1891 ? GLU B 3319 PHE B 3334 1 ? 16 
HELX_P HELX_P208 AX1 GLY B 1892 ? LEU B 1894 ? GLY B 3335 LEU B 3337 5 ? 3  
HELX_P HELX_P209 AX2 ASN B 1895 ? PHE B 1913 ? ASN B 3338 PHE B 3356 1 ? 19 
HELX_P HELX_P210 AX3 ARG B 1922 ? VAL B 1928 ? ARG B 3365 VAL B 3371 1 ? 7  
HELX_P HELX_P211 AX4 THR B 1929 ? CYS B 1939 ? THR B 3372 CYS B 3382 1 ? 11 
HELX_P HELX_P212 AX5 ASN B 1944 ? SER B 1957 ? ASN B 3387 SER B 3400 1 ? 14 
HELX_P HELX_P213 AX6 MET B 1971 ? GLY B 1980 ? MET B 3414 GLY B 3423 1 ? 10 
HELX_P HELX_P214 AX7 GLY B 1992 ? GLY B 2004 ? GLY B 3435 GLY B 3447 1 ? 13 
HELX_P HELX_P215 AX8 ASP B 2016 ? ILE B 2023 ? ASP B 3459 ILE B 3466 5 ? 8  
HELX_P HELX_P216 AX9 PRO B 2063 ? VAL B 2070 ? PRO B 3506 VAL B 3513 1 ? 8  
HELX_P HELX_P217 AY1 GLU B 2080 ? ASN B 2095 ? GLU B 3523 ASN B 3538 1 ? 16 
HELX_P HELX_P218 AY2 ASN B 2095 ? ASP B 2104 ? ASN B 3538 ASP B 3547 1 ? 10 
HELX_P HELX_P219 AY3 ILE B 2106 ? ASN B 2129 ? ILE B 3549 ASN B 3572 1 ? 24 
HELX_P HELX_P220 AY4 LEU B 2135 ? TYR B 2175 ? LEU B 3578 TYR B 3618 1 ? 41 
HELX_P HELX_P221 AY5 TYR B 2175 ? HIS B 2196 ? TYR B 3618 HIS B 3639 1 ? 22 
HELX_P HELX_P222 AY6 TRP B 2197 ? GLY B 2200 ? TRP B 3640 GLY B 3643 5 ? 4  
HELX_P HELX_P223 AY7 SER B 2202 ? ARG B 2212 ? SER B 3645 ARG B 3655 1 ? 11 
HELX_P HELX_P224 AY8 VAL B 2213 ? ILE B 2215 ? VAL B 3656 ILE B 3658 5 ? 3  
HELX_P HELX_P225 AY9 ARG B 2227 ? SER B 2244 ? ARG B 3670 SER B 3687 1 ? 18 
HELX_P HELX_P226 AZ1 THR B 2245 ? LEU B 2247 ? THR B 3688 LEU B 3690 5 ? 3  
HELX_P HELX_P227 AZ2 ASP B 2248 ? GLU B 2268 ? ASP B 3691 GLU B 3711 1 ? 21 
HELX_P HELX_P228 AZ3 SER B 2269 ? SER B 2284 ? SER B 3712 SER B 3727 1 ? 16 
HELX_P HELX_P229 AZ4 ASN B 2298 ? THR B 2310 ? ASN B 3741 THR B 3753 1 ? 13 
HELX_P HELX_P230 AZ5 SER B 2312 ? PHE B 2325 ? SER B 3755 PHE B 3768 1 ? 14 
HELX_P HELX_P231 AZ6 ASN B 2330 ? SER B 2338 ? ASN B 3773 SER B 3781 1 ? 9  
HELX_P HELX_P232 AZ7 GLY B 2353 ? SER B 2364 ? GLY B 3796 SER B 3807 1 ? 12 
HELX_P HELX_P233 AZ8 SER B 2375 ? GLY B 2393 ? SER B 3818 GLY B 3836 1 ? 19 
HELX_P HELX_P234 AZ9 ASN B 2400 ? SER B 2404 ? ASN B 3843 SER B 3847 5 ? 5  
HELX_P HELX_P235 BA1 LEU B 2405 ? GLU B 2418 ? LEU B 3848 GLU B 3861 1 ? 14 
HELX_P HELX_P236 BA2 PRO B 2442 ? THR B 2449 ? PRO B 3885 THR B 3892 1 ? 8  
HELX_P HELX_P237 BA3 GLY B 2459 ? GLN B 2471 ? GLY B 3902 GLN B 3914 1 ? 13 
HELX_P HELX_P238 BA4 PHE B 2472 ? GLY B 2475 ? PHE B 3915 GLY B 3918 5 ? 4  
HELX_P HELX_P239 BA5 GLY B 2479 ? ARG B 2501 ? GLY B 3922 ARG B 3944 1 ? 23 
HELX_P HELX_P240 BA6 ASN B 2514 ? ASN B 2532 ? ASN B 3957 ASN B 3975 1 ? 19 
HELX_P HELX_P241 BA7 PRO B 2538 ? ILE B 2549 ? PRO B 3981 ILE B 3992 1 ? 12 
HELX_P HELX_P242 BA8 TYR B 2551 ? ILE B 2555 ? TYR B 3994 ILE B 3998 5 ? 5  
HELX_P HELX_P243 BA9 GLU B 2557 ? PHE B 2572 ? GLU B 4000 PHE B 4015 1 ? 16 
HELX_P HELX_P244 BB1 SER B 2594 ? ASN B 2608 ? SER B 4037 ASN B 4051 1 ? 15 
HELX_P HELX_P245 BB2 ASP B 2614 ? TRP B 2619 ? ASP B 4057 TRP B 4062 1 ? 6  
HELX_P HELX_P246 BB3 PRO B 2623 ? GLU B 2648 ? PRO B 4066 GLU B 4091 1 ? 26 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A THR 719 OG1 ? ? ? 1_555 G MG . MG ? ? A THR 2081 A MG 5005 1_555 ? ? ? ? ? ? ? 2.574 ? 
metalc2 metalc ? ? A GLU 833 OE1 ? ? ? 1_555 G MG . MG ? ? A GLU 2195 A MG 5005 1_555 ? ? ? ? ? ? ? 2.610 ? 
metalc3 metalc ? ? B THR 719 OG1 ? ? ? 1_555 L MG . MG ? ? B THR 2081 B MG 5005 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc4 metalc ? ? B GLU 833 OE2 ? ? ? 1_555 L MG . MG ? ? B GLU 2195 B MG 5005 1_555 ? ? ? ? ? ? ? 2.100 ? 
metalc5 metalc ? ? D ANP .   O3G ? ? ? 1_555 G MG . MG ? ? A ANP 5002 A MG 5005 1_555 ? ? ? ? ? ? ? 1.936 ? 
metalc6 metalc ? ? D ANP .   O2B ? ? ? 1_555 G MG . MG ? ? A ANP 5002 A MG 5005 1_555 ? ? ? ? ? ? ? 2.705 ? 
metalc7 metalc ? ? I ANP .   O1G ? ? ? 1_555 L MG . MG ? ? B ANP 5002 B MG 5005 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc8 metalc ? ? I ANP .   O2B ? ? ? 1_555 L MG . MG ? ? B ANP 5002 B MG 5005 1_555 ? ? ? ? ? ? ? 2.064 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 3 ? 
AA3 ? 3 ? 
AA4 ? 5 ? 
AA5 ? 2 ? 
AA6 ? 5 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 5 ? 
AB2 ? 4 ? 
AB3 ? 5 ? 
AB4 ? 3 ? 
AB5 ? 5 ? 
AB6 ? 3 ? 
AB7 ? 5 ? 
AB8 ? 2 ? 
AB9 ? 3 ? 
AC1 ? 3 ? 
AC2 ? 5 ? 
AC3 ? 2 ? 
AC4 ? 5 ? 
AC5 ? 2 ? 
AC6 ? 2 ? 
AC7 ? 5 ? 
AC8 ? 4 ? 
AC9 ? 5 ? 
AD1 ? 3 ? 
AD2 ? 5 ? 
AD3 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? parallel      
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
AA5 1 2 ? anti-parallel 
AA6 1 2 ? parallel      
AA6 2 3 ? parallel      
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? parallel      
AB1 2 3 ? parallel      
AB1 3 4 ? parallel      
AB1 4 5 ? parallel      
AB2 1 2 ? anti-parallel 
AB2 2 3 ? parallel      
AB2 3 4 ? anti-parallel 
AB3 1 2 ? parallel      
AB3 2 3 ? parallel      
AB3 3 4 ? parallel      
AB3 4 5 ? parallel      
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? parallel      
AB5 2 3 ? parallel      
AB5 3 4 ? parallel      
AB5 4 5 ? parallel      
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB7 1 2 ? parallel      
AB7 2 3 ? parallel      
AB7 3 4 ? parallel      
AB7 4 5 ? parallel      
AB8 1 2 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? parallel      
AC2 2 3 ? parallel      
AC2 3 4 ? parallel      
AC2 4 5 ? parallel      
AC3 1 2 ? anti-parallel 
AC4 1 2 ? parallel      
AC4 2 3 ? parallel      
AC4 3 4 ? parallel      
AC4 4 5 ? parallel      
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC7 1 2 ? parallel      
AC7 2 3 ? parallel      
AC7 3 4 ? parallel      
AC7 4 5 ? parallel      
AC8 1 2 ? anti-parallel 
AC8 2 3 ? parallel      
AC8 3 4 ? anti-parallel 
AC9 1 2 ? parallel      
AC9 2 3 ? parallel      
AC9 3 4 ? parallel      
AC9 4 5 ? parallel      
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD2 1 2 ? parallel      
AD2 2 3 ? parallel      
AD2 3 4 ? parallel      
AD2 4 5 ? parallel      
AD3 1 2 ? parallel      
AD3 2 3 ? parallel      
AD3 3 4 ? parallel      
AD3 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLU A 22   ? GLU A 25   ? GLU A 1384 GLU A 1387 
AA1 2 LYS A 31   ? ARG A 34   ? LYS A 1393 ARG A 1396 
AA2 1 ILE A 207  ? PHE A 212  ? ILE A 1569 PHE A 1574 
AA2 2 PHE A 216  ? SER A 222  ? PHE A 1578 SER A 1584 
AA2 3 VAL A 227  ? GLU A 235  ? VAL A 1589 GLU A 1597 
AA3 1 LYS A 371  ? GLN A 374  ? LYS A 1733 GLN A 1736 
AA3 2 VAL A 385  ? GLN A 389  ? VAL A 1747 GLN A 1751 
AA3 3 TYR A 392  ? GLN A 395  ? TYR A 1754 GLN A 1757 
AA4 1 VAL A 456  ? ASN A 459  ? VAL A 1818 ASN A 1821 
AA4 2 TRP A 482  ? ASP A 486  ? TRP A 1844 ASP A 1848 
AA4 3 ALA A 531  ? LEU A 536  ? ALA A 1893 LEU A 1898 
AA4 4 GLY A 429  ? PHE A 433  ? GLY A 1791 PHE A 1795 
AA4 5 PHE A 554  ? SER A 558  ? PHE A 1916 SER A 1920 
AA5 1 HIS A 516  ? LEU A 519  ? HIS A 1878 LEU A 1881 
AA5 2 GLU A 522  ? PRO A 525  ? GLU A 1884 PRO A 1887 
AA6 1 ASN A 737  ? ILE A 742  ? ASN A 2099 ILE A 2104 
AA6 2 ARG A 787  ? PHE A 792  ? ARG A 2149 PHE A 2154 
AA6 3 PHE A 828  ? THR A 834  ? PHE A 2190 THR A 2196 
AA6 4 ALA A 707  ? VAL A 711  ? ALA A 2069 VAL A 2073 
AA6 5 GLY A 849  ? TRP A 852  ? GLY A 2211 TRP A 2214 
AA7 1 GLY A 754  ? MET A 756  ? GLY A 2116 MET A 2118 
AA7 2 TRP A 763  ? ASP A 765  ? TRP A 2125 ASP A 2127 
AA8 1 ILE A 813  ? LEU A 814  ? ILE A 2175 LEU A 2176 
AA8 2 LEU A 822  ? PRO A 823  ? LEU A 2184 PRO A 2185 
AA9 1 ILE A 997  ? VAL A 998  ? ILE A 2359 VAL A 2360 
AA9 2 SER A 1007 ? SER A 1008 ? SER A 2369 SER A 2370 
AB1 1 TYR A 1076 ? ASN A 1082 ? TYR A 2438 ASN A 2444 
AB1 2 ASN A 1119 ? ASP A 1125 ? ASN A 2481 ASP A 2487 
AB1 3 ILE A 1167 ? CYS A 1173 ? ILE A 2529 CYS A 2535 
AB1 4 GLY A 1051 ? CYS A 1055 ? GLY A 2413 CYS A 2417 
AB1 5 ALA A 1192 ? TYR A 1196 ? ALA A 2554 TYR A 2558 
AB2 1 VAL A 1103 ? THR A 1105 ? VAL A 2465 THR A 2467 
AB2 2 LEU A 1109 ? LEU A 1112 ? LEU A 2471 LEU A 2474 
AB2 3 LYS A 1160 ? ILE A 1164 ? LYS A 2522 ILE A 2526 
AB2 4 GLY A 1152 ? LYS A 1155 ? GLY A 2514 LYS A 2517 
AB3 1 LYS A 1418 ? VAL A 1420 ? LYS A 2780 VAL A 2782 
AB3 2 THR A 1451 ? ASP A 1456 ? THR A 2813 ASP A 2818 
AB3 3 LEU A 1523 ? ILE A 1529 ? LEU A 2885 ILE A 2891 
AB3 4 HIS A 1393 ? ILE A 1397 ? HIS A 2755 ILE A 2759 
AB3 5 CYS A 1550 ? TRP A 1554 ? CYS A 2912 TRP A 2916 
AB4 1 ARG A 1695 ? LYS A 1700 ? ARG A 3138 LYS A 3143 
AB4 2 TYR A 1706 ? GLY A 1709 ? TYR A 3149 GLY A 3152 
AB4 3 HIS A 1712 ? THR A 1715 ? HIS A 3155 THR A 3158 
AB5 1 THR A 1983 ? LEU A 1986 ? THR A 3426 LEU A 3429 
AB5 2 VAL A 2006 ? ILE A 2009 ? VAL A 3449 ILE A 3452 
AB5 3 LYS A 2050 ? SER A 2055 ? LYS A 3493 SER A 3498 
AB5 4 PRO A 1962 ? LEU A 1965 ? PRO A 3405 LEU A 3408 
AB5 5 ARG A 2071 ? HIS A 2074 ? ARG A 3514 HIS A 3517 
AB6 1 ASN A 2028 ? HIS A 2029 ? ASN A 3471 HIS A 3472 
AB6 2 VAL A 2034 ? ILE A 2038 ? VAL A 3477 ILE A 3481 
AB6 3 HIS A 2041 ? ASP A 2044 ? HIS A 3484 ASP A 3487 
AB7 1 LEU A 2368 ? PRO A 2372 ? LEU A 3811 PRO A 3815 
AB7 2 TRP A 2395 ? GLN A 2399 ? TRP A 3838 GLN A 3842 
AB7 3 MET A 2430 ? THR A 2433 ? MET A 3873 THR A 3876 
AB7 4 TYR A 2342 ? ALA A 2346 ? TYR A 3785 ALA A 3789 
AB7 5 ASP A 2450 ? VAL A 2453 ? ASP A 3893 VAL A 3896 
AB8 1 GLU B 22   ? GLU B 25   ? GLU B 1384 GLU B 1387 
AB8 2 LYS B 31   ? ARG B 34   ? LYS B 1393 ARG B 1396 
AB9 1 ILE B 207  ? PHE B 212  ? ILE B 1569 PHE B 1574 
AB9 2 PHE B 216  ? SER B 222  ? PHE B 1578 SER B 1584 
AB9 3 VAL B 227  ? GLU B 235  ? VAL B 1589 GLU B 1597 
AC1 1 LYS B 371  ? GLN B 374  ? LYS B 1733 GLN B 1736 
AC1 2 VAL B 385  ? GLN B 389  ? VAL B 1747 GLN B 1751 
AC1 3 TYR B 392  ? GLN B 395  ? TYR B 1754 GLN B 1757 
AC2 1 VAL B 456  ? ASN B 459  ? VAL B 1818 ASN B 1821 
AC2 2 TRP B 482  ? ASP B 486  ? TRP B 1844 ASP B 1848 
AC2 3 ALA B 531  ? LEU B 536  ? ALA B 1893 LEU B 1898 
AC2 4 GLY B 429  ? PHE B 433  ? GLY B 1791 PHE B 1795 
AC2 5 PHE B 554  ? SER B 558  ? PHE B 1916 SER B 1920 
AC3 1 HIS B 516  ? LEU B 519  ? HIS B 1878 LEU B 1881 
AC3 2 GLU B 522  ? PRO B 525  ? GLU B 1884 PRO B 1887 
AC4 1 ASN B 737  ? ILE B 742  ? ASN B 2099 ILE B 2104 
AC4 2 ARG B 787  ? PHE B 792  ? ARG B 2149 PHE B 2154 
AC4 3 PHE B 828  ? THR B 834  ? PHE B 2190 THR B 2196 
AC4 4 ALA B 707  ? GLY B 712  ? ALA B 2069 GLY B 2074 
AC4 5 GLY B 849  ? PHE B 853  ? GLY B 2211 PHE B 2215 
AC5 1 GLY B 754  ? MET B 756  ? GLY B 2116 MET B 2118 
AC5 2 TRP B 763  ? ASP B 765  ? TRP B 2125 ASP B 2127 
AC6 1 ILE B 813  ? LEU B 814  ? ILE B 2175 LEU B 2176 
AC6 2 LEU B 822  ? PRO B 823  ? LEU B 2184 PRO B 2185 
AC7 1 TYR B 1076 ? ASN B 1082 ? TYR B 2438 ASN B 2444 
AC7 2 ASN B 1119 ? ASP B 1125 ? ASN B 2481 ASP B 2487 
AC7 3 ILE B 1167 ? CYS B 1173 ? ILE B 2529 CYS B 2535 
AC7 4 GLY B 1051 ? CYS B 1055 ? GLY B 2413 CYS B 2417 
AC7 5 ALA B 1192 ? TYR B 1196 ? ALA B 2554 TYR B 2558 
AC8 1 VAL B 1103 ? THR B 1105 ? VAL B 2465 THR B 2467 
AC8 2 LEU B 1109 ? LEU B 1112 ? LEU B 2471 LEU B 2474 
AC8 3 LYS B 1160 ? ILE B 1164 ? LYS B 2522 ILE B 2526 
AC8 4 GLY B 1152 ? LYS B 1155 ? GLY B 2514 LYS B 2517 
AC9 1 LYS B 1418 ? VAL B 1420 ? LYS B 2780 VAL B 2782 
AC9 2 THR B 1451 ? ASP B 1456 ? THR B 2813 ASP B 2818 
AC9 3 LEU B 1523 ? ILE B 1529 ? LEU B 2885 ILE B 2891 
AC9 4 HIS B 1393 ? ILE B 1397 ? HIS B 2755 ILE B 2759 
AC9 5 CYS B 1550 ? ASN B 1553 ? CYS B 2912 ASN B 2915 
AD1 1 ARG B 1695 ? LYS B 1700 ? ARG B 3138 LYS B 3143 
AD1 2 TYR B 1706 ? GLY B 1709 ? TYR B 3149 GLY B 3152 
AD1 3 HIS B 1712 ? THR B 1715 ? HIS B 3155 THR B 3158 
AD2 1 THR B 1983 ? LEU B 1986 ? THR B 3426 LEU B 3429 
AD2 2 VAL B 2006 ? ILE B 2009 ? VAL B 3449 ILE B 3452 
AD2 3 LEU B 2051 ? SER B 2055 ? LEU B 3494 SER B 3498 
AD2 4 PRO B 1962 ? LEU B 1965 ? PRO B 3405 LEU B 3408 
AD2 5 ARG B 2071 ? HIS B 2074 ? ARG B 3514 HIS B 3517 
AD3 1 LEU B 2368 ? PRO B 2372 ? LEU B 3811 PRO B 3815 
AD3 2 TRP B 2395 ? GLN B 2399 ? TRP B 3838 GLN B 3842 
AD3 3 MET B 2430 ? HIS B 2435 ? MET B 3873 HIS B 3878 
AD3 4 TYR B 2342 ? SER B 2347 ? TYR B 3785 SER B 3790 
AD3 5 ASP B 2450 ? VAL B 2453 ? ASP B 3893 VAL B 3896 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 24   ? N ILE A 1386 O LEU A 32   ? O LEU A 1394 
AA2 1 2 N ILE A 211  ? N ILE A 1573 O GLY A 219  ? O GLY A 1581 
AA2 2 3 N THR A 218  ? N THR A 1580 O LEU A 230  ? O LEU A 1592 
AA3 1 2 N LYS A 371  ? N LYS A 1733 O SER A 388  ? O SER A 1750 
AA3 2 3 N ILE A 387  ? N ILE A 1749 O LEU A 394  ? O LEU A 1756 
AA4 1 2 N PHE A 458  ? N PHE A 1820 O CYS A 484  ? O CYS A 1846 
AA4 2 3 N GLY A 483  ? N GLY A 1845 O PHE A 533  ? O PHE A 1895 
AA4 3 4 O ILE A 534  ? O ILE A 1896 N PHE A 432  ? N PHE A 1794 
AA4 4 5 N PHE A 433  ? N PHE A 1795 O PHE A 557  ? O PHE A 1919 
AA5 1 2 N LEU A 519  ? N LEU A 1881 O GLU A 522  ? O GLU A 1884 
AA6 1 2 N TYR A 740  ? N TYR A 2102 O VAL A 791  ? O VAL A 2153 
AA6 2 3 N PHE A 792  ? N PHE A 2154 O LEU A 831  ? O LEU A 2193 
AA6 3 4 O PHE A 832  ? O PHE A 2194 N LEU A 710  ? N LEU A 2072 
AA6 4 5 N ILE A 709  ? N ILE A 2071 O LEU A 851  ? O LEU A 2213 
AA7 1 2 N SER A 755  ? N SER A 2117 O ARG A 764  ? O ARG A 2126 
AA8 1 2 N LEU A 814  ? N LEU A 2176 O LEU A 822  ? O LEU A 2184 
AA9 1 2 N VAL A 998  ? N VAL A 2360 O SER A 1007 ? O SER A 2369 
AB1 1 2 N ASP A 1077 ? N ASP A 2439 O VAL A 1121 ? O VAL A 2483 
AB1 2 3 N LEU A 1122 ? N LEU A 2484 O HIS A 1168 ? O HIS A 2530 
AB1 3 4 O GLY A 1171 ? O GLY A 2533 N LEU A 1054 ? N LEU A 2416 
AB1 4 5 N GLY A 1051 ? N GLY A 2413 O ALA A 1193 ? O ALA A 2555 
AB2 1 2 N THR A 1105 ? N THR A 2467 O LEU A 1109 ? O LEU A 2471 
AB2 2 3 N LEU A 1112 ? N LEU A 2474 O THR A 1163 ? O THR A 2525 
AB2 3 4 O VAL A 1162 ? O VAL A 2524 N PHE A 1153 ? N PHE A 2515 
AB3 1 2 N LYS A 1418 ? N LYS A 2780 O CYS A 1452 ? O CYS A 2814 
AB3 2 3 N LEU A 1453 ? N LEU A 2815 O HIS A 1524 ? O HIS A 2886 
AB3 3 4 O PHE A 1527 ? O PHE A 2889 N LEU A 1396 ? N LEU A 2758 
AB3 4 5 N ILE A 1397 ? N ILE A 2759 O ASN A 1553 ? O ASN A 2915 
AB4 1 2 N TYR A 1699 ? N TYR A 3142 O THR A 1707 ? O THR A 3150 
AB4 2 3 N TYR A 1706 ? N TYR A 3149 O THR A 1715 ? O THR A 3158 
AB5 1 2 N VAL A 1984 ? N VAL A 3427 O VAL A 2006 ? O VAL A 3449 
AB5 2 3 N ILE A 2009 ? N ILE A 3452 O PHE A 2052 ? O PHE A 3495 
AB5 3 4 O ILE A 2053 ? O ILE A 3496 N LEU A 1964 ? N LEU A 3407 
AB5 4 5 N PHE A 1963 ? N PHE A 3406 O VAL A 2073 ? O VAL A 3516 
AB6 1 2 N ASN A 2028 ? N ASN A 3471 O THR A 2035 ? O THR A 3478 
AB6 2 3 N VAL A 2036 ? N VAL A 3479 O VAL A 2043 ? O VAL A 3486 
AB7 1 2 N ILE A 2371 ? N ILE A 3814 O LEU A 2397 ? O LEU A 3840 
AB7 2 3 N ILE A 2396 ? N ILE A 3839 O PHE A 2431 ? O PHE A 3874 
AB7 3 4 O MET A 2430 ? O MET A 3873 N PHE A 2343 ? N PHE A 3786 
AB7 4 5 N TYR A 2342 ? N TYR A 3785 O ASP A 2450 ? O ASP A 3893 
AB8 1 2 N ILE B 24   ? N ILE B 1386 O LEU B 32   ? O LEU B 1394 
AB9 1 2 N SER B 209  ? N SER B 1571 O ARG B 221  ? O ARG B 1583 
AB9 2 3 N THR B 218  ? N THR B 1580 O LEU B 230  ? O LEU B 1592 
AC1 1 2 N TYR B 373  ? N TYR B 1735 O PHE B 386  ? O PHE B 1748 
AC1 2 3 N ILE B 387  ? N ILE B 1749 O LEU B 394  ? O LEU B 1756 
AC2 1 2 N PHE B 458  ? N PHE B 1820 O CYS B 484  ? O CYS B 1846 
AC2 2 3 N GLY B 483  ? N GLY B 1845 O ALA B 531  ? O ALA B 1893 
AC2 3 4 O ILE B 534  ? O ILE B 1896 N PHE B 432  ? N PHE B 1794 
AC2 4 5 N PHE B 433  ? N PHE B 1795 O PHE B 557  ? O PHE B 1919 
AC3 1 2 N ILE B 517  ? N ILE B 1879 O THR B 524  ? O THR B 1886 
AC4 1 2 N VAL B 738  ? N VAL B 2100 O TRP B 789  ? O TRP B 2151 
AC4 2 3 N PHE B 792  ? N PHE B 2154 O LEU B 831  ? O LEU B 2193 
AC4 3 4 O PHE B 832  ? O PHE B 2194 N LEU B 710  ? N LEU B 2072 
AC4 4 5 N VAL B 711  ? N VAL B 2073 O PHE B 853  ? O PHE B 2215 
AC5 1 2 N SER B 755  ? N SER B 2117 O ARG B 764  ? O ARG B 2126 
AC6 1 2 N LEU B 814  ? N LEU B 2176 O LEU B 822  ? O LEU B 2184 
AC7 1 2 N ASP B 1077 ? N ASP B 2439 O VAL B 1121 ? O VAL B 2483 
AC7 2 3 N LEU B 1122 ? N LEU B 2484 O HIS B 1168 ? O HIS B 2530 
AC7 3 4 O GLY B 1171 ? O GLY B 2533 N LEU B 1054 ? N LEU B 2416 
AC7 4 5 N GLY B 1051 ? N GLY B 2413 O ALA B 1193 ? O ALA B 2555 
AC8 1 2 N THR B 1105 ? N THR B 2467 O LEU B 1109 ? O LEU B 2471 
AC8 2 3 N LEU B 1112 ? N LEU B 2474 O THR B 1163 ? O THR B 2525 
AC8 3 4 O VAL B 1162 ? O VAL B 2524 N PHE B 1153 ? N PHE B 2515 
AC9 1 2 N LYS B 1418 ? N LYS B 2780 O CYS B 1452 ? O CYS B 2814 
AC9 2 3 N LEU B 1453 ? N LEU B 2815 O HIS B 1524 ? O HIS B 2886 
AC9 3 4 O PHE B 1527 ? O PHE B 2889 N MET B 1394 ? N MET B 2756 
AC9 4 5 N HIS B 1393 ? N HIS B 2755 O ILE B 1551 ? O ILE B 2913 
AD1 1 2 N TYR B 1699 ? N TYR B 3142 O THR B 1707 ? O THR B 3150 
AD1 2 3 N TYR B 1706 ? N TYR B 3149 O THR B 1715 ? O THR B 3158 
AD2 1 2 N LEU B 1986 ? N LEU B 3429 O ILE B 2008 ? O ILE B 3451 
AD2 2 3 N ILE B 2009 ? N ILE B 3452 O HIS B 2054 ? O HIS B 3497 
AD2 3 4 O ILE B 2053 ? O ILE B 3496 N LEU B 1964 ? N LEU B 3407 
AD2 4 5 N PHE B 1963 ? N PHE B 3406 O VAL B 2073 ? O VAL B 3516 
AD3 1 2 N ILE B 2371 ? N ILE B 3814 O LEU B 2397 ? O LEU B 3840 
AD3 2 3 N ILE B 2396 ? N ILE B 3839 O PHE B 2431 ? O PHE B 3874 
AD3 3 4 O MET B 2430 ? O MET B 3873 N PHE B 2343 ? N PHE B 3786 
AD3 4 5 N ALA B 2346 ? N ALA B 3789 O VAL B 2452 ? O VAL B 3895 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ANP 5001 ? 12 'binding site for residue ANP A 5001' 
AC2 Software A ANP 5002 ? 17 'binding site for residue ANP A 5002' 
AC3 Software A ANP 5003 ? 14 'binding site for residue ANP A 5003' 
AC4 Software A ANP 5004 ? 12 'binding site for residue ANP A 5004' 
AC5 Software A MG  5005 ? 4  'binding site for residue MG A 5005'  
AC6 Software B ANP 5001 ? 12 'binding site for residue ANP B 5001' 
AC7 Software B ANP 5002 ? 18 'binding site for residue ANP B 5002' 
AC8 Software B ANP 5003 ? 16 'binding site for residue ANP B 5003' 
AC9 Software B ANP 5004 ? 12 'binding site for residue ANP B 5004' 
AD1 Software B MG  5005 ? 4  'binding site for residue MG B 5005'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 12 ILE A 408  ? ILE A 1770 . ? 1_555 ? 
2   AC1 12 ALA A 436  ? ALA A 1798 . ? 1_555 ? 
3   AC1 12 GLY A 437  ? GLY A 1799 . ? 1_555 ? 
4   AC1 12 THR A 438  ? THR A 1800 . ? 1_555 ? 
5   AC1 12 GLY A 439  ? GLY A 1801 . ? 1_555 ? 
6   AC1 12 LYS A 440  ? LYS A 1802 . ? 1_555 ? 
7   AC1 12 THR A 441  ? THR A 1803 . ? 1_555 ? 
8   AC1 12 GLU A 442  ? GLU A 1804 . ? 1_555 ? 
9   AC1 12 ASN A 537  ? ASN A 1899 . ? 1_555 ? 
10  AC1 12 ILE A 567  ? ILE A 1929 . ? 1_555 ? 
11  AC1 12 LEU A 608  ? LEU A 1970 . ? 1_555 ? 
12  AC1 12 LYS A 612  ? LYS A 1974 . ? 1_555 ? 
13  AC2 17 SER A 686  ? SER A 2048 . ? 1_555 ? 
14  AC2 17 PHE A 691  ? PHE A 2053 . ? 1_555 ? 
15  AC2 17 GLY A 715  ? GLY A 2077 . ? 1_555 ? 
16  AC2 17 CYS A 716  ? CYS A 2078 . ? 1_555 ? 
17  AC2 17 GLY A 717  ? GLY A 2079 . ? 1_555 ? 
18  AC2 17 LYS A 718  ? LYS A 2080 . ? 1_555 ? 
19  AC2 17 THR A 719  ? THR A 2081 . ? 1_555 ? 
20  AC2 17 ALA A 720  ? ALA A 2082 . ? 1_555 ? 
21  AC2 17 GLU A 833  ? GLU A 2195 . ? 1_555 ? 
22  AC2 17 VAL A 857  ? VAL A 2219 . ? 1_555 ? 
23  AC2 17 CYS A 858  ? CYS A 2220 . ? 1_555 ? 
24  AC2 17 LYS A 863  ? LYS A 2225 . ? 1_555 ? 
25  AC2 17 HIS A 866  ? HIS A 2228 . ? 1_555 ? 
26  AC2 17 ARG A 1145 ? ARG A 2507 . ? 1_555 ? 
27  AC2 17 ARG A 1187 ? ARG A 2549 . ? 1_555 ? 
28  AC2 17 ARG A 1190 ? ARG A 2552 . ? 1_555 ? 
29  AC2 17 MG  G .    ? MG  A 5005 . ? 1_555 ? 
30  AC3 14 ILE A 1030 ? ILE A 2392 . ? 1_555 ? 
31  AC3 14 PRO A 1058 ? PRO A 2420 . ? 1_555 ? 
32  AC3 14 GLY A 1059 ? GLY A 2421 . ? 1_555 ? 
33  AC3 14 GLY A 1061 ? GLY A 2423 . ? 1_555 ? 
34  AC3 14 LYS A 1062 ? LYS A 2424 . ? 1_555 ? 
35  AC3 14 THR A 1063 ? THR A 2425 . ? 1_555 ? 
36  AC3 14 MET A 1064 ? MET A 2426 . ? 1_555 ? 
37  AC3 14 GLU A 1126 ? GLU A 2488 . ? 1_555 ? 
38  AC3 14 ASN A 1174 ? ASN A 2536 . ? 1_555 ? 
39  AC3 14 ILE A 1208 ? ILE A 2570 . ? 1_555 ? 
40  AC3 14 ARG A 1258 ? ARG A 2620 . ? 1_555 ? 
41  AC3 14 THR A 1261 ? THR A 2623 . ? 1_555 ? 
42  AC3 14 PRO A 1544 ? PRO A 2906 . ? 1_555 ? 
43  AC3 14 ARG A 1549 ? ARG A 2911 . ? 1_555 ? 
44  AC4 12 MET A 1370 ? MET A 2732 . ? 1_555 ? 
45  AC4 12 VAL A 1371 ? VAL A 2733 . ? 1_555 ? 
46  AC4 12 ARG A 1401 ? ARG A 2763 . ? 1_555 ? 
47  AC4 12 THR A 1402 ? THR A 2764 . ? 1_555 ? 
48  AC4 12 GLY A 1403 ? GLY A 2765 . ? 1_555 ? 
49  AC4 12 LYS A 1404 ? LYS A 2766 . ? 1_555 ? 
50  AC4 12 THR A 1405 ? THR A 2767 . ? 1_555 ? 
51  AC4 12 ILE A 1406 ? ILE A 2768 . ? 1_555 ? 
52  AC4 12 ASP A 1456 ? ASP A 2818 . ? 1_555 ? 
53  AC4 12 CYS A 1530 ? CYS A 2892 . ? 1_555 ? 
54  AC4 12 ILE A 1631 ? ILE A 2993 . ? 1_555 ? 
55  AC4 12 ARG A 2069 ? ARG A 3512 . ? 1_555 ? 
56  AC5 4  THR A 719  ? THR A 2081 . ? 1_555 ? 
57  AC5 4  GLU A 833  ? GLU A 2195 . ? 1_555 ? 
58  AC5 4  GLU A 1149 ? GLU A 2511 . ? 1_555 ? 
59  AC5 4  ANP D .    ? ANP A 5002 . ? 1_555 ? 
60  AC6 12 ILE B 408  ? ILE B 1770 . ? 1_555 ? 
61  AC6 12 GLY B 437  ? GLY B 1799 . ? 1_555 ? 
62  AC6 12 GLY B 439  ? GLY B 1801 . ? 1_555 ? 
63  AC6 12 LYS B 440  ? LYS B 1802 . ? 1_555 ? 
64  AC6 12 THR B 441  ? THR B 1803 . ? 1_555 ? 
65  AC6 12 GLU B 442  ? GLU B 1804 . ? 1_555 ? 
66  AC6 12 ASP B 486  ? ASP B 1848 . ? 1_555 ? 
67  AC6 12 ASN B 537  ? ASN B 1899 . ? 1_555 ? 
68  AC6 12 ILE B 567  ? ILE B 1929 . ? 1_555 ? 
69  AC6 12 LEU B 608  ? LEU B 1970 . ? 1_555 ? 
70  AC6 12 ARG B 609  ? ARG B 1971 . ? 1_555 ? 
71  AC6 12 LYS B 612  ? LYS B 1974 . ? 1_555 ? 
72  AC7 18 PHE B 685  ? PHE B 2047 . ? 1_555 ? 
73  AC7 18 SER B 686  ? SER B 2048 . ? 1_555 ? 
74  AC7 18 PHE B 691  ? PHE B 2053 . ? 1_555 ? 
75  AC7 18 GLY B 715  ? GLY B 2077 . ? 1_555 ? 
76  AC7 18 GLY B 717  ? GLY B 2079 . ? 1_555 ? 
77  AC7 18 LYS B 718  ? LYS B 2080 . ? 1_555 ? 
78  AC7 18 THR B 719  ? THR B 2081 . ? 1_555 ? 
79  AC7 18 ALA B 720  ? ALA B 2082 . ? 1_555 ? 
80  AC7 18 GLU B 833  ? GLU B 2195 . ? 1_555 ? 
81  AC7 18 VAL B 857  ? VAL B 2219 . ? 1_555 ? 
82  AC7 18 CYS B 858  ? CYS B 2220 . ? 1_555 ? 
83  AC7 18 LYS B 863  ? LYS B 2225 . ? 1_555 ? 
84  AC7 18 HIS B 866  ? HIS B 2228 . ? 1_555 ? 
85  AC7 18 ARG B 1145 ? ARG B 2507 . ? 1_555 ? 
86  AC7 18 GLU B 1149 ? GLU B 2511 . ? 1_555 ? 
87  AC7 18 ARG B 1187 ? ARG B 2549 . ? 1_555 ? 
88  AC7 18 ARG B 1190 ? ARG B 2552 . ? 1_555 ? 
89  AC7 18 MG  L .    ? MG  B 5005 . ? 1_555 ? 
90  AC8 16 ILE B 1030 ? ILE B 2392 . ? 1_555 ? 
91  AC8 16 PRO B 1058 ? PRO B 2420 . ? 1_555 ? 
92  AC8 16 GLY B 1059 ? GLY B 2421 . ? 1_555 ? 
93  AC8 16 SER B 1060 ? SER B 2422 . ? 1_555 ? 
94  AC8 16 GLY B 1061 ? GLY B 2423 . ? 1_555 ? 
95  AC8 16 LYS B 1062 ? LYS B 2424 . ? 1_555 ? 
96  AC8 16 THR B 1063 ? THR B 2425 . ? 1_555 ? 
97  AC8 16 MET B 1064 ? MET B 2426 . ? 1_555 ? 
98  AC8 16 GLU B 1126 ? GLU B 2488 . ? 1_555 ? 
99  AC8 16 ASN B 1174 ? ASN B 2536 . ? 1_555 ? 
100 AC8 16 ILE B 1208 ? ILE B 2570 . ? 1_555 ? 
101 AC8 16 TYR B 1212 ? TYR B 2574 . ? 1_555 ? 
102 AC8 16 ARG B 1258 ? ARG B 2620 . ? 1_555 ? 
103 AC8 16 THR B 1261 ? THR B 2623 . ? 1_555 ? 
104 AC8 16 ALA B 1545 ? ALA B 2907 . ? 1_555 ? 
105 AC8 16 ARG B 1549 ? ARG B 2911 . ? 1_555 ? 
106 AC9 12 MET B 1370 ? MET B 2732 . ? 1_555 ? 
107 AC9 12 VAL B 1371 ? VAL B 2733 . ? 1_555 ? 
108 AC9 12 SER B 1400 ? SER B 2762 . ? 1_555 ? 
109 AC9 12 ARG B 1401 ? ARG B 2763 . ? 1_555 ? 
110 AC9 12 GLY B 1403 ? GLY B 2765 . ? 1_555 ? 
111 AC9 12 LYS B 1404 ? LYS B 2766 . ? 1_555 ? 
112 AC9 12 THR B 1405 ? THR B 2767 . ? 1_555 ? 
113 AC9 12 ILE B 1406 ? ILE B 2768 . ? 1_555 ? 
114 AC9 12 CYS B 1530 ? CYS B 2892 . ? 1_555 ? 
115 AC9 12 TRP B 1558 ? TRP B 2920 . ? 1_555 ? 
116 AC9 12 MET B 1570 ? MET B 2932 . ? 1_555 ? 
117 AC9 12 ARG B 2069 ? ARG B 3512 . ? 1_555 ? 
118 AD1 4  THR B 719  ? THR B 2081 . ? 1_555 ? 
119 AD1 4  GLU B 833  ? GLU B 2195 . ? 1_555 ? 
120 AD1 4  GLU B 1149 ? GLU B 2511 . ? 1_555 ? 
121 AD1 4  ANP I .    ? ANP B 5002 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4W8F 
_atom_sites.fract_transf_matrix[1][1]   0.007261 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000839 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006478 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005670 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
H  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N      . PHE A 1 3    ? 49.898  -73.390 4.075   1.00 92.66  ? 1365 PHE A N      1 
ATOM   2     C  CA     . PHE A 1 3    ? 49.767  -73.003 2.674   1.00 96.73  ? 1365 PHE A CA     1 
ATOM   3     C  C      . PHE A 1 3    ? 48.568  -72.056 2.504   1.00 101.72 ? 1365 PHE A C      1 
ATOM   4     O  O      . PHE A 1 3    ? 47.947  -71.999 1.447   1.00 103.27 ? 1365 PHE A O      1 
ATOM   5     C  CB     . PHE A 1 3    ? 49.625  -74.256 1.792   1.00 100.23 ? 1365 PHE A CB     1 
ATOM   6     C  CG     . PHE A 1 3    ? 49.628  -73.973 0.315   1.00 102.06 ? 1365 PHE A CG     1 
ATOM   7     C  CD1    . PHE A 1 3    ? 50.792  -73.595 -0.337  1.00 104.38 ? 1365 PHE A CD1    1 
ATOM   8     C  CD2    . PHE A 1 3    ? 48.462  -74.094 -0.421  1.00 98.62  ? 1365 PHE A CD2    1 
ATOM   9     C  CE1    . PHE A 1 3    ? 50.784  -73.333 -1.695  1.00 103.33 ? 1365 PHE A CE1    1 
ATOM   10    C  CE2    . PHE A 1 3    ? 48.448  -73.835 -1.767  1.00 97.76  ? 1365 PHE A CE2    1 
ATOM   11    C  CZ     . PHE A 1 3    ? 49.610  -73.455 -2.410  1.00 101.19 ? 1365 PHE A CZ     1 
ATOM   12    H  HA     . PHE A 1 3    ? 50.567  -72.529 2.399   1.00 116.08 ? 1365 PHE A HA     1 
ATOM   13    H  HB2    . PHE A 1 3    ? 50.365  -74.854 1.980   1.00 120.28 ? 1365 PHE A HB2    1 
ATOM   14    H  HB3    . PHE A 1 3    ? 48.787  -74.694 2.007   1.00 120.28 ? 1365 PHE A HB3    1 
ATOM   15    H  HD1    . PHE A 1 3    ? 51.583  -73.509 0.144   1.00 125.26 ? 1365 PHE A HD1    1 
ATOM   16    H  HD2    . PHE A 1 3    ? 47.675  -74.347 0.005   1.00 118.35 ? 1365 PHE A HD2    1 
ATOM   17    H  HE1    . PHE A 1 3    ? 51.568  -73.078 -2.125  1.00 124.00 ? 1365 PHE A HE1    1 
ATOM   18    H  HE2    . PHE A 1 3    ? 47.656  -73.919 -2.248  1.00 117.31 ? 1365 PHE A HE2    1 
ATOM   19    H  HZ     . PHE A 1 3    ? 49.601  -73.283 -3.324  1.00 121.43 ? 1365 PHE A HZ     1 
ATOM   20    N  N      . VAL A 1 4    ? 48.244  -71.325 3.570   1.00 77.50  ? 1366 VAL A N      1 
ATOM   21    C  CA     . VAL A 1 4    ? 47.166  -70.326 3.581   1.00 76.92  ? 1366 VAL A CA     1 
ATOM   22    C  C      . VAL A 1 4    ? 45.799  -71.009 3.634   1.00 76.13  ? 1366 VAL A C      1 
ATOM   23    O  O      . VAL A 1 4    ? 44.805  -70.385 4.003   1.00 78.23  ? 1366 VAL A O      1 
ATOM   24    C  CB     . VAL A 1 4    ? 47.209  -69.379 2.335   1.00 76.80  ? 1366 VAL A CB     1 
ATOM   25    C  CG1    . VAL A 1 4    ? 46.339  -68.144 2.551   1.00 75.49  ? 1366 VAL A CG1    1 
ATOM   26    C  CG2    . VAL A 1 4    ? 48.641  -68.941 2.009   1.00 78.92  ? 1366 VAL A CG2    1 
ATOM   27    H  H      . VAL A 1 4    ? 48.648  -71.389 4.326   1.00 93.00  ? 1366 VAL A H      1 
ATOM   28    H  HA     . VAL A 1 4    ? 47.255  -69.777 4.375   1.00 92.31  ? 1366 VAL A HA     1 
ATOM   29    H  HB     . VAL A 1 4    ? 46.862  -69.857 1.565   1.00 92.16  ? 1366 VAL A HB     1 
ATOM   30    H  HG11   . VAL A 1 4    ? 46.389  -67.581 1.763   1.00 90.59  ? 1366 VAL A HG11   1 
ATOM   31    H  HG12   . VAL A 1 4    ? 45.423  -68.426 2.699   1.00 90.59  ? 1366 VAL A HG12   1 
ATOM   32    H  HG13   . VAL A 1 4    ? 46.666  -67.660 3.325   1.00 90.59  ? 1366 VAL A HG13   1 
ATOM   33    H  HG21   . VAL A 1 4    ? 48.623  -68.357 1.234   1.00 94.71  ? 1366 VAL A HG21   1 
ATOM   34    H  HG22   . VAL A 1 4    ? 49.007  -68.467 2.772   1.00 94.71  ? 1366 VAL A HG22   1 
ATOM   35    H  HG23   . VAL A 1 4    ? 49.176  -69.727 1.820   1.00 94.71  ? 1366 VAL A HG23   1 
ATOM   36    N  N      . ILE A 1 5    ? 45.764  -72.297 3.281   1.00 75.68  ? 1367 ILE A N      1 
ATOM   37    C  CA     . ILE A 1 5    ? 44.519  -73.043 3.140   1.00 75.02  ? 1367 ILE A CA     1 
ATOM   38    C  C      . ILE A 1 5    ? 44.524  -74.225 4.090   1.00 74.87  ? 1367 ILE A C      1 
ATOM   39    O  O      . ILE A 1 5    ? 43.675  -74.326 4.973   1.00 78.11  ? 1367 ILE A O      1 
ATOM   40    C  CB     . ILE A 1 5    ? 44.341  -73.554 1.711   1.00 76.15  ? 1367 ILE A CB     1 
ATOM   41    C  CG1    . ILE A 1 5    ? 44.354  -72.373 0.737   1.00 76.42  ? 1367 ILE A CG1    1 
ATOM   42    C  CG2    . ILE A 1 5    ? 43.042  -74.358 1.607   1.00 75.49  ? 1367 ILE A CG2    1 
ATOM   43    C  CD1    . ILE A 1 5    ? 44.271  -72.778 -0.711  1.00 77.68  ? 1367 ILE A CD1    1 
ATOM   44    H  H      . ILE A 1 5    ? 46.466  -72.766 3.114   1.00 90.82  ? 1367 ILE A H      1 
ATOM   45    H  HA     . ILE A 1 5    ? 43.768  -72.470 3.361   1.00 90.02  ? 1367 ILE A HA     1 
ATOM   46    H  HB     . ILE A 1 5    ? 45.085  -74.139 1.497   1.00 91.38  ? 1367 ILE A HB     1 
ATOM   47    H  HG12   . ILE A 1 5    ? 43.595  -71.801 0.929   1.00 91.70  ? 1367 ILE A HG12   1 
ATOM   48    H  HG13   . ILE A 1 5    ? 45.179  -71.877 0.859   1.00 91.70  ? 1367 ILE A HG13   1 
ATOM   49    H  HG21   . ILE A 1 5    ? 42.940  -74.677 0.697   1.00 90.59  ? 1367 ILE A HG21   1 
ATOM   50    H  HG22   . ILE A 1 5    ? 43.087  -75.110 2.218   1.00 90.59  ? 1367 ILE A HG22   1 
ATOM   51    H  HG23   . ILE A 1 5    ? 42.296  -73.785 1.842   1.00 90.59  ? 1367 ILE A HG23   1 
ATOM   52    H  HD11   . ILE A 1 5    ? 44.284  -71.981 -1.263  1.00 93.22  ? 1367 ILE A HD11   1 
ATOM   53    H  HD12   . ILE A 1 5    ? 45.030  -73.343 -0.924  1.00 93.22  ? 1367 ILE A HD12   1 
ATOM   54    H  HD13   . ILE A 1 5    ? 43.445  -73.267 -0.854  1.00 93.22  ? 1367 ILE A HD13   1 
ATOM   55    N  N      . GLU A 1 6    ? 45.479  -75.126 3.880   1.00 84.20  ? 1368 GLU A N      1 
ATOM   56    C  CA     . GLU A 1 6    ? 45.624  -76.308 4.720   1.00 85.64  ? 1368 GLU A CA     1 
ATOM   57    C  C      . GLU A 1 6    ? 45.746  -75.901 6.178   1.00 85.28  ? 1368 GLU A C      1 
ATOM   58    O  O      . GLU A 1 6    ? 45.361  -76.646 7.080   1.00 86.75  ? 1368 GLU A O      1 
ATOM   59    C  CB     . GLU A 1 6    ? 46.844  -77.134 4.312   1.00 88.26  ? 1368 GLU A CB     1 
ATOM   60    C  CG     . GLU A 1 6    ? 46.865  -78.514 4.966   1.00 91.67  ? 1368 GLU A CG     1 
ATOM   61    C  CD     . GLU A 1 6    ? 47.591  -79.571 4.154   1.00 92.11  ? 1368 GLU A CD     1 
ATOM   62    O  OE1    . GLU A 1 6    ? 48.184  -79.234 3.107   1.00 93.55  ? 1368 GLU A OE1    1 
ATOM   63    O  OE2    . GLU A 1 6    ? 47.565  -80.749 4.572   1.00 92.54  1 1368 GLU A OE2    1 
ATOM   64    H  H      . GLU A 1 6    ? 46.061  -75.075 3.249   1.00 101.05 ? 1368 GLU A H      1 
ATOM   65    H  HA     . GLU A 1 6    ? 44.836  -76.865 4.626   1.00 102.77 ? 1368 GLU A HA     1 
ATOM   66    H  HB2    . GLU A 1 6    ? 46.835  -77.258 3.350   1.00 105.91 ? 1368 GLU A HB2    1 
ATOM   67    H  HB3    . GLU A 1 6    ? 47.649  -76.663 4.578   1.00 105.91 ? 1368 GLU A HB3    1 
ATOM   68    H  HG2    . GLU A 1 6    ? 47.308  -78.445 5.826   1.00 110.01 ? 1368 GLU A HG2    1 
ATOM   69    H  HG3    . GLU A 1 6    ? 45.951  -78.813 5.092   1.00 110.01 ? 1368 GLU A HG3    1 
ATOM   70    N  N      . LYS A 1 7    ? 46.280  -74.705 6.393   1.00 64.88  ? 1369 LYS A N      1 
ATOM   71    C  CA     . LYS A 1 7    ? 46.406  -74.148 7.727   1.00 63.92  ? 1369 LYS A CA     1 
ATOM   72    C  C      . LYS A 1 7    ? 45.025  -73.965 8.344   1.00 62.28  ? 1369 LYS A C      1 
ATOM   73    O  O      . LYS A 1 7    ? 44.811  -74.274 9.515   1.00 61.59  ? 1369 LYS A O      1 
ATOM   74    C  CB     . LYS A 1 7    ? 47.162  -72.821 7.673   1.00 64.03  ? 1369 LYS A CB     1 
ATOM   75    C  CG     . LYS A 1 7    ? 47.415  -72.209 9.035   1.00 63.21  ? 1369 LYS A CG     1 
ATOM   76    C  CD     . LYS A 1 7    ? 48.349  -71.011 8.948   1.00 63.64  ? 1369 LYS A CD     1 
ATOM   77    C  CE     . LYS A 1 7    ? 47.608  -69.741 8.588   1.00 62.72  ? 1369 LYS A CE     1 
ATOM   78    N  NZ     . LYS A 1 7    ? 46.622  -69.373 9.644   1.00 61.13  1 1369 LYS A NZ     1 
ATOM   79    H  H      . LYS A 1 7    ? 46.581  -74.192 5.772   1.00 77.86  ? 1369 LYS A H      1 
ATOM   80    H  HA     . LYS A 1 7    ? 46.909  -74.762 8.284   1.00 76.70  ? 1369 LYS A HA     1 
ATOM   81    H  HB2    . LYS A 1 7    ? 48.022  -72.968 7.249   1.00 76.83  ? 1369 LYS A HB2    1 
ATOM   82    H  HB3    . LYS A 1 7    ? 46.644  -72.186 7.154   1.00 76.83  ? 1369 LYS A HB3    1 
ATOM   83    H  HG2    . LYS A 1 7    ? 46.572  -71.910 9.412   1.00 75.85  ? 1369 LYS A HG2    1 
ATOM   84    H  HG3    . LYS A 1 7    ? 47.824  -72.872 9.612   1.00 75.85  ? 1369 LYS A HG3    1 
ATOM   85    H  HD2    . LYS A 1 7    ? 48.778  -70.878 9.808   1.00 76.36  ? 1369 LYS A HD2    1 
ATOM   86    H  HD3    . LYS A 1 7    ? 49.016  -71.176 8.264   1.00 76.36  ? 1369 LYS A HD3    1 
ATOM   87    H  HE2    . LYS A 1 7    ? 48.243  -69.013 8.497   1.00 75.27  ? 1369 LYS A HE2    1 
ATOM   88    H  HE3    . LYS A 1 7    ? 47.127  -69.874 7.756   1.00 75.27  ? 1369 LYS A HE3    1 
ATOM   89    H  HZ1    . LYS A 1 7    ? 46.197  -68.625 9.416   1.00 73.35  ? 1369 LYS A HZ1    1 
ATOM   90    H  HZ2    . LYS A 1 7    ? 46.026  -70.026 9.744   1.00 73.35  ? 1369 LYS A HZ2    1 
ATOM   91    H  HZ3    . LYS A 1 7    ? 47.041  -69.242 10.419  1.00 73.35  ? 1369 LYS A HZ3    1 
ATOM   92    N  N      . SER A 1 8    ? 44.096  -73.449 7.548   1.00 69.83  ? 1370 SER A N      1 
ATOM   93    C  CA     . SER A 1 8    ? 42.722  -73.249 7.991   1.00 68.34  ? 1370 SER A CA     1 
ATOM   94    C  C      . SER A 1 8    ? 41.914  -74.551 8.062   1.00 68.25  ? 1370 SER A C      1 
ATOM   95    O  O      . SER A 1 8    ? 41.214  -74.796 9.045   1.00 71.78  ? 1370 SER A O      1 
ATOM   96    C  CB     . SER A 1 8    ? 42.025  -72.250 7.068   1.00 67.89  ? 1370 SER A CB     1 
ATOM   97    O  OG     . SER A 1 8    ? 42.293  -72.551 5.711   1.00 69.08  ? 1370 SER A OG     1 
ATOM   98    H  H      . SER A 1 8    ? 44.239  -73.204 6.736   1.00 83.79  ? 1370 SER A H      1 
ATOM   99    H  HA     . SER A 1 8    ? 42.737  -72.865 8.881   1.00 82.01  ? 1370 SER A HA     1 
ATOM   100   H  HB2    . SER A 1 8    ? 41.068  -72.295 7.218   1.00 81.47  ? 1370 SER A HB2    1 
ATOM   101   H  HB3    . SER A 1 8    ? 42.351  -71.358 7.264   1.00 81.47  ? 1370 SER A HB3    1 
ATOM   102   H  HG     . SER A 1 8    ? 42.017  -73.323 5.528   1.00 82.90  ? 1370 SER A HG     1 
ATOM   103   N  N      . LEU A 1 9    ? 42.015  -75.384 7.028   1.00 66.56  ? 1371 LEU A N      1 
ATOM   104   C  CA     . LEU A 1 9    ? 41.280  -76.650 6.983   1.00 66.67  ? 1371 LEU A CA     1 
ATOM   105   C  C      . LEU A 1 9    ? 41.627  -77.561 8.164   1.00 66.76  ? 1371 LEU A C      1 
ATOM   106   O  O      . LEU A 1 9    ? 40.725  -78.102 8.802   1.00 66.02  ? 1371 LEU A O      1 
ATOM   107   C  CB     . LEU A 1 9    ? 41.534  -77.370 5.652   1.00 68.09  ? 1371 LEU A CB     1 
ATOM   108   C  CG     . LEU A 1 9    ? 40.760  -76.801 4.454   1.00 67.95  ? 1371 LEU A CG     1 
ATOM   109   C  CD1    . LEU A 1 9    ? 41.297  -77.331 3.137   1.00 69.58  ? 1371 LEU A CD1    1 
ATOM   110   C  CD2    . LEU A 1 9    ? 39.277  -77.129 4.551   1.00 66.92  ? 1371 LEU A CD2    1 
ATOM   111   H  H      . LEU A 1 9    ? 42.504  -75.239 6.335   1.00 79.88  ? 1371 LEU A H      1 
ATOM   112   H  HA     . LEU A 1 9    ? 40.331  -76.457 7.034   1.00 80.00  ? 1371 LEU A HA     1 
ATOM   113   H  HB2    . LEU A 1 9    ? 42.480  -77.312 5.444   1.00 81.71  ? 1371 LEU A HB2    1 
ATOM   114   H  HB3    . LEU A 1 9    ? 41.279  -78.301 5.750   1.00 81.71  ? 1371 LEU A HB3    1 
ATOM   115   H  HG     . LEU A 1 9    ? 40.853  -75.836 4.448   1.00 81.54  ? 1371 LEU A HG     1 
ATOM   116   H  HD11   . LEU A 1 9    ? 40.783  -76.949 2.409   1.00 83.49  ? 1371 LEU A HD11   1 
ATOM   117   H  HD12   . LEU A 1 9    ? 42.230  -77.078 3.053   1.00 83.49  ? 1371 LEU A HD12   1 
ATOM   118   H  HD13   . LEU A 1 9    ? 41.215  -78.298 3.129   1.00 83.49  ? 1371 LEU A HD13   1 
ATOM   119   H  HD21   . LEU A 1 9    ? 38.820  -76.756 3.781   1.00 80.30  ? 1371 LEU A HD21   1 
ATOM   120   H  HD22   . LEU A 1 9    ? 39.168  -78.093 4.566   1.00 80.30  ? 1371 LEU A HD22   1 
ATOM   121   H  HD23   . LEU A 1 9    ? 38.921  -76.743 5.367   1.00 80.30  ? 1371 LEU A HD23   1 
ATOM   122   N  N      . ASN A 1 10   ? 42.916  -77.735 8.456   1.00 71.46  ? 1372 ASN A N      1 
ATOM   123   C  CA     . ASN A 1 10   ? 43.324  -78.502 9.632   1.00 71.60  ? 1372 ASN A CA     1 
ATOM   124   C  C      . ASN A 1 10   ? 42.631  -78.023 10.901  1.00 70.11  ? 1372 ASN A C      1 
ATOM   125   O  O      . ASN A 1 10   ? 42.194  -78.831 11.719  1.00 69.86  ? 1372 ASN A O      1 
ATOM   126   C  CB     . ASN A 1 10   ? 44.843  -78.437 9.853   1.00 72.70  ? 1372 ASN A CB     1 
ATOM   127   C  CG     . ASN A 1 10   ? 45.627  -79.265 8.854   1.00 75.14  ? 1372 ASN A CG     1 
ATOM   128   O  OD1    . ASN A 1 10   ? 45.152  -80.294 8.371   1.00 80.56  ? 1372 ASN A OD1    1 
ATOM   129   N  ND2    . ASN A 1 10   ? 46.860  -78.851 8.584   1.00 76.69  ? 1372 ASN A ND2    1 
ATOM   130   H  H      . ASN A 1 10   ? 43.569  -77.421 7.992   1.00 85.75  ? 1372 ASN A H      1 
ATOM   131   H  HA     . ASN A 1 10   ? 43.084  -79.432 9.496   1.00 85.92  ? 1372 ASN A HA     1 
ATOM   132   H  HB2    . ASN A 1 10   ? 45.134  -77.515 9.771   1.00 87.24  ? 1372 ASN A HB2    1 
ATOM   133   H  HB3    . ASN A 1 10   ? 45.046  -78.770 10.741  1.00 87.24  ? 1372 ASN A HB3    1 
ATOM   134   H  HD21   . ASN A 1 10   ? 47.347  -79.285 8.024   1.00 92.02  ? 1372 ASN A HD21   1 
ATOM   135   H  HD22   . ASN A 1 10   ? 47.171  -78.148 8.970   1.00 92.02  ? 1372 ASN A HD22   1 
ATOM   136   N  N      . ARG A 1 11   ? 42.519  -76.709 11.057  1.00 85.53  ? 1373 ARG A N      1 
ATOM   137   C  CA     . ARG A 1 11   ? 42.010  -76.138 12.298  1.00 84.23  ? 1373 ARG A CA     1 
ATOM   138   C  C      . ARG A 1 11   ? 40.494  -76.257 12.422  1.00 83.05  ? 1373 ARG A C      1 
ATOM   139   O  O      . ARG A 1 11   ? 39.970  -76.301 13.534  1.00 82.19  ? 1373 ARG A O      1 
ATOM   140   C  CB     . ARG A 1 11   ? 42.417  -74.667 12.409  1.00 83.74  ? 1373 ARG A CB     1 
ATOM   141   C  CG     . ARG A 1 11   ? 43.901  -74.448 12.669  1.00 85.03  ? 1373 ARG A CG     1 
ATOM   142   C  CD     . ARG A 1 11   ? 44.228  -72.966 12.827  1.00 92.49  ? 1373 ARG A CD     1 
ATOM   143   N  NE     . ARG A 1 11   ? 45.661  -72.735 12.995  1.00 93.96  ? 1373 ARG A NE     1 
ATOM   144   C  CZ     . ARG A 1 11   ? 46.222  -71.533 13.106  1.00 89.45  ? 1373 ARG A CZ     1 
ATOM   145   N  NH1    . ARG A 1 11   ? 45.473  -70.436 13.076  1.00 92.15  1 1373 ARG A NH1    1 
ATOM   146   N  NH2    . ARG A 1 11   ? 47.537  -71.426 13.252  1.00 86.26  ? 1373 ARG A NH2    1 
ATOM   147   H  H      . ARG A 1 11   ? 42.732  -76.127 10.461  1.00 102.63 ? 1373 ARG A H      1 
ATOM   148   H  HA     . ARG A 1 11   ? 42.406  -76.613 13.045  1.00 101.07 ? 1373 ARG A HA     1 
ATOM   149   H  HB2    . ARG A 1 11   ? 42.193  -74.219 11.578  1.00 100.49 ? 1373 ARG A HB2    1 
ATOM   150   H  HB3    . ARG A 1 11   ? 41.926  -74.263 13.141  1.00 100.49 ? 1373 ARG A HB3    1 
ATOM   151   H  HG2    . ARG A 1 11   ? 44.153  -74.903 13.487  1.00 102.03 ? 1373 ARG A HG2    1 
ATOM   152   H  HG3    . ARG A 1 11   ? 44.412  -74.794 11.920  1.00 102.03 ? 1373 ARG A HG3    1 
ATOM   153   H  HD2    . ARG A 1 11   ? 43.936  -72.490 12.033  1.00 110.99 ? 1373 ARG A HD2    1 
ATOM   154   H  HD3    . ARG A 1 11   ? 43.771  -72.621 13.610  1.00 110.99 ? 1373 ARG A HD3    1 
ATOM   155   H  HE     . ARG A 1 11   ? 46.177  -73.422 13.025  1.00 112.76 ? 1373 ARG A HE     1 
ATOM   156   H  HH11   . ARG A 1 11   ? 44.621  -70.500 12.981  1.00 110.58 ? 1373 ARG A HH11   1 
ATOM   157   H  HH12   . ARG A 1 11   ? 45.841  -69.662 13.150  1.00 110.58 ? 1373 ARG A HH12   1 
ATOM   158   H  HH21   . ARG A 1 11   ? 48.026  -72.133 13.274  1.00 103.52 ? 1373 ARG A HH21   1 
ATOM   159   H  HH22   . ARG A 1 11   ? 47.900  -70.650 13.327  1.00 103.52 ? 1373 ARG A HH22   1 
ATOM   160   N  N      . ILE A 1 12   ? 39.785  -76.305 11.298  1.00 51.97  ? 1374 ILE A N      1 
ATOM   161   C  CA     . ILE A 1 12   ? 38.349  -76.572 11.344  1.00 51.02  ? 1374 ILE A CA     1 
ATOM   162   C  C      . ILE A 1 12   ? 38.152  -78.007 11.827  1.00 51.48  ? 1374 ILE A C      1 
ATOM   163   O  O      . ILE A 1 12   ? 37.344  -78.262 12.720  1.00 50.65  ? 1374 ILE A O      1 
ATOM   164   C  CB     . ILE A 1 12   ? 37.654  -76.362 9.983   1.00 51.06  ? 1374 ILE A CB     1 
ATOM   165   C  CG1    . ILE A 1 12   ? 37.813  -74.906 9.534   1.00 50.65  ? 1374 ILE A CG1    1 
ATOM   166   C  CG2    . ILE A 1 12   ? 36.172  -76.748 10.077  1.00 50.17  ? 1374 ILE A CG2    1 
ATOM   167   C  CD1    . ILE A 1 12   ? 37.193  -74.593 8.189   1.00 50.77  ? 1374 ILE A CD1    1 
ATOM   168   H  H      . ILE A 1 12   ? 40.105  -76.189 10.508  1.00 62.37  ? 1374 ILE A H      1 
ATOM   169   H  HA     . ILE A 1 12   ? 37.936  -75.977 11.988  1.00 61.23  ? 1374 ILE A HA     1 
ATOM   170   H  HB     . ILE A 1 12   ? 38.081  -76.935 9.327   1.00 61.28  ? 1374 ILE A HB     1 
ATOM   171   H  HG12   . ILE A 1 12   ? 37.394  -74.331 10.192  1.00 60.78  ? 1374 ILE A HG12   1 
ATOM   172   H  HG13   . ILE A 1 12   ? 38.760  -74.701 9.476   1.00 60.78  ? 1374 ILE A HG13   1 
ATOM   173   H  HG21   . ILE A 1 12   ? 35.754  -76.609 9.213   1.00 60.20  ? 1374 ILE A HG21   1 
ATOM   174   H  HG22   . ILE A 1 12   ? 36.104  -77.682 10.331  1.00 60.20  ? 1374 ILE A HG22   1 
ATOM   175   H  HG23   . ILE A 1 12   ? 35.743  -76.191 10.746  1.00 60.20  ? 1374 ILE A HG23   1 
ATOM   176   H  HD11   . ILE A 1 12   ? 37.340  -73.656 7.985   1.00 60.92  ? 1374 ILE A HD11   1 
ATOM   177   H  HD12   . ILE A 1 12   ? 37.610  -75.149 7.512   1.00 60.92  ? 1374 ILE A HD12   1 
ATOM   178   H  HD13   . ILE A 1 12   ? 36.242  -74.778 8.230   1.00 60.92  ? 1374 ILE A HD13   1 
ATOM   179   N  N      . LYS A 1 13   ? 38.877  -78.942 11.213  1.00 51.09  ? 1375 LYS A N      1 
ATOM   180   C  CA     . LYS A 1 13   ? 38.802  -80.349 11.596  1.00 51.76  ? 1375 LYS A CA     1 
ATOM   181   C  C      . LYS A 1 13   ? 39.161  -80.532 13.068  1.00 51.50  ? 1375 LYS A C      1 
ATOM   182   O  O      . LYS A 1 13   ? 38.385  -81.096 13.834  1.00 51.00  ? 1375 LYS A O      1 
ATOM   183   C  CB     . LYS A 1 13   ? 39.740  -81.205 10.745  1.00 53.43  ? 1375 LYS A CB     1 
ATOM   184   C  CG     . LYS A 1 13   ? 39.414  -81.325 9.259   1.00 54.02  ? 1375 LYS A CG     1 
ATOM   185   C  CD     . LYS A 1 13   ? 40.547  -82.106 8.583   1.00 55.78  ? 1375 LYS A CD     1 
ATOM   186   C  CE     . LYS A 1 13   ? 40.397  -82.269 7.075   1.00 56.64  ? 1375 LYS A CE     1 
ATOM   187   N  NZ     . LYS A 1 13   ? 41.563  -83.028 6.529   1.00 58.41  1 1375 LYS A NZ     1 
ATOM   188   H  H      . LYS A 1 13   ? 39.423  -78.784 10.568  1.00 61.31  ? 1375 LYS A H      1 
ATOM   189   H  HA     . LYS A 1 13   ? 37.896  -80.668 11.463  1.00 62.11  ? 1375 LYS A HA     1 
ATOM   190   H  HB2    . LYS A 1 13   ? 40.633  -80.831 10.812  1.00 64.12  ? 1375 LYS A HB2    1 
ATOM   191   H  HB3    . LYS A 1 13   ? 39.743  -82.103 11.111  1.00 64.12  ? 1375 LYS A HB3    1 
ATOM   192   H  HG2    . LYS A 1 13   ? 38.583  -81.812 9.141   1.00 64.83  ? 1375 LYS A HG2    1 
ATOM   193   H  HG3    . LYS A 1 13   ? 39.359  -80.443 8.860   1.00 64.83  ? 1375 LYS A HG3    1 
ATOM   194   H  HD2    . LYS A 1 13   ? 41.383  -81.642 8.746   1.00 66.94  ? 1375 LYS A HD2    1 
ATOM   195   H  HD3    . LYS A 1 13   ? 40.586  -82.994 8.972   1.00 66.94  ? 1375 LYS A HD3    1 
ATOM   196   H  HE2    . LYS A 1 13   ? 39.586  -82.765 6.881   1.00 67.96  ? 1375 LYS A HE2    1 
ATOM   197   H  HE3    . LYS A 1 13   ? 40.371  -81.395 6.655   1.00 67.96  ? 1375 LYS A HE3    1 
ATOM   198   H  HZ1    . LYS A 1 13   ? 41.477  -83.125 5.648   1.00 70.09  ? 1375 LYS A HZ1    1 
ATOM   199   H  HZ2    . LYS A 1 13   ? 42.318  -82.590 6.700   1.00 70.09  ? 1375 LYS A HZ2    1 
ATOM   200   H  HZ3    . LYS A 1 13   ? 41.605  -83.834 6.905   1.00 70.09  ? 1375 LYS A HZ3    1 
ATOM   201   N  N      . LYS A 1 14   ? 40.336  -80.036 13.453  1.00 68.86  ? 1376 LYS A N      1 
ATOM   202   C  CA     . LYS A 1 14   ? 40.813  -80.116 14.835  1.00 68.74  ? 1376 LYS A CA     1 
ATOM   203   C  C      . LYS A 1 14   ? 39.749  -79.622 15.813  1.00 67.27  ? 1376 LYS A C      1 
ATOM   204   O  O      . LYS A 1 14   ? 39.636  -80.136 16.929  1.00 67.16  ? 1376 LYS A O      1 
ATOM   205   C  CB     . LYS A 1 14   ? 42.112  -79.314 15.000  1.00 69.17  ? 1376 LYS A CB     1 
ATOM   206   C  CG     . LYS A 1 14   ? 42.706  -79.317 16.413  1.00 70.52  ? 1376 LYS A CG     1 
ATOM   207   C  CD     . LYS A 1 14   ? 43.619  -78.116 16.631  1.00 74.67  ? 1376 LYS A CD     1 
ATOM   208   C  CE     . LYS A 1 14   ? 44.403  -78.229 17.930  1.00 77.49  ? 1376 LYS A CE     1 
ATOM   209   N  NZ     . LYS A 1 14   ? 45.363  -79.365 17.893  1.00 79.08  1 1376 LYS A NZ     1 
ATOM   210   H  H      . LYS A 1 14   ? 40.885  -79.641 12.923  1.00 82.64  ? 1376 LYS A H      1 
ATOM   211   H  HA     . LYS A 1 14   ? 41.006  -81.043 15.047  1.00 82.49  ? 1376 LYS A HA     1 
ATOM   212   H  HB2    . LYS A 1 14   ? 42.780  -79.684 14.401  1.00 83.00  ? 1376 LYS A HB2    1 
ATOM   213   H  HB3    . LYS A 1 14   ? 41.936  -78.391 14.759  1.00 83.00  ? 1376 LYS A HB3    1 
ATOM   214   H  HG2    . LYS A 1 14   ? 41.988  -79.276 17.064  1.00 84.62  ? 1376 LYS A HG2    1 
ATOM   215   H  HG3    . LYS A 1 14   ? 43.229  -80.124 16.539  1.00 84.62  ? 1376 LYS A HG3    1 
ATOM   216   H  HD2    . LYS A 1 14   ? 44.253  -78.059 15.899  1.00 89.61  ? 1376 LYS A HD2    1 
ATOM   217   H  HD3    . LYS A 1 14   ? 43.081  -77.309 16.672  1.00 89.61  ? 1376 LYS A HD3    1 
ATOM   218   H  HE2    . LYS A 1 14   ? 44.905  -77.411 18.073  1.00 92.98  ? 1376 LYS A HE2    1 
ATOM   219   H  HE3    . LYS A 1 14   ? 43.786  -78.376 18.664  1.00 92.98  ? 1376 LYS A HE3    1 
ATOM   220   H  HZ1    . LYS A 1 14   ? 44.924  -80.129 17.766  1.00 94.89  ? 1376 LYS A HZ1    1 
ATOM   221   H  HZ2    . LYS A 1 14   ? 45.943  -79.251 17.228  1.00 94.89  ? 1376 LYS A HZ2    1 
ATOM   222   H  HZ3    . LYS A 1 14   ? 45.809  -79.411 18.662  1.00 94.89  ? 1376 LYS A HZ3    1 
ATOM   223   N  N      . PHE A 1 15   ? 38.976  -78.623 15.398  1.00 49.65  ? 1377 PHE A N      1 
ATOM   224   C  CA     . PHE A 1 15   ? 37.911  -78.091 16.241  1.00 48.26  ? 1377 PHE A CA     1 
ATOM   225   C  C      . PHE A 1 15   ? 36.711  -79.026 16.364  1.00 47.95  ? 1377 PHE A C      1 
ATOM   226   O  O      . PHE A 1 15   ? 36.127  -79.142 17.440  1.00 47.29  ? 1377 PHE A O      1 
ATOM   227   C  CB     . PHE A 1 15   ? 37.430  -76.734 15.724  1.00 47.29  ? 1377 PHE A CB     1 
ATOM   228   C  CG     . PHE A 1 15   ? 36.227  -76.209 16.455  1.00 45.89  ? 1377 PHE A CG     1 
ATOM   229   C  CD1    . PHE A 1 15   ? 36.353  -75.612 17.698  1.00 45.27  ? 1377 PHE A CD1    1 
ATOM   230   C  CD2    . PHE A 1 15   ? 34.964  -76.326 15.898  1.00 45.27  ? 1377 PHE A CD2    1 
ATOM   231   C  CE1    . PHE A 1 15   ? 35.240  -75.142 18.369  1.00 44.06  ? 1377 PHE A CE1    1 
ATOM   232   C  CE2    . PHE A 1 15   ? 33.851  -75.858 16.562  1.00 44.05  ? 1377 PHE A CE2    1 
ATOM   233   C  CZ     . PHE A 1 15   ? 33.988  -75.262 17.797  1.00 43.44  ? 1377 PHE A CZ     1 
ATOM   234   H  H      . PHE A 1 15   ? 39.048  -78.236 14.633  1.00 59.58  ? 1377 PHE A H      1 
ATOM   235   H  HA     . PHE A 1 15   ? 38.265  -77.954 17.134  1.00 57.91  ? 1377 PHE A HA     1 
ATOM   236   H  HB2    . PHE A 1 15   ? 38.146  -76.087 15.825  1.00 56.74  ? 1377 PHE A HB2    1 
ATOM   237   H  HB3    . PHE A 1 15   ? 37.194  -76.821 14.787  1.00 56.74  ? 1377 PHE A HB3    1 
ATOM   238   H  HD1    . PHE A 1 15   ? 37.194  -75.529 18.086  1.00 54.32  ? 1377 PHE A HD1    1 
ATOM   239   H  HD2    . PHE A 1 15   ? 34.866  -76.727 15.064  1.00 54.33  ? 1377 PHE A HD2    1 
ATOM   240   H  HE1    . PHE A 1 15   ? 35.335  -74.739 19.202  1.00 52.87  ? 1377 PHE A HE1    1 
ATOM   241   H  HE2    . PHE A 1 15   ? 33.009  -75.940 16.175  1.00 52.85  ? 1377 PHE A HE2    1 
ATOM   242   H  HZ     . PHE A 1 15   ? 33.239  -74.944 18.247  1.00 52.13  ? 1377 PHE A HZ     1 
ATOM   243   N  N      . TRP A 1 16   ? 36.344  -79.694 15.275  1.00 48.07  ? 1378 TRP A N      1 
ATOM   244   C  CA     . TRP A 1 16   ? 35.101  -80.458 15.259  1.00 47.74  ? 1378 TRP A CA     1 
ATOM   245   C  C      . TRP A 1 16   ? 35.253  -81.889 15.747  1.00 48.68  ? 1378 TRP A C      1 
ATOM   246   O  O      . TRP A 1 16   ? 34.257  -82.565 15.997  1.00 48.43  ? 1378 TRP A O      1 
ATOM   247   C  CB     . TRP A 1 16   ? 34.497  -80.456 13.855  1.00 47.85  ? 1378 TRP A CB     1 
ATOM   248   C  CG     . TRP A 1 16   ? 33.829  -79.167 13.566  1.00 46.67  ? 1378 TRP A CG     1 
ATOM   249   C  CD1    . TRP A 1 16   ? 34.208  -78.220 12.664  1.00 46.69  ? 1378 TRP A CD1    1 
ATOM   250   C  CD2    . TRP A 1 16   ? 32.682  -78.650 14.237  1.00 45.33  ? 1378 TRP A CD2    1 
ATOM   251   N  NE1    . TRP A 1 16   ? 33.347  -77.151 12.715  1.00 45.46  ? 1378 TRP A NE1    1 
ATOM   252   C  CE2    . TRP A 1 16   ? 32.401  -77.392 13.677  1.00 44.59  ? 1378 TRP A CE2    1 
ATOM   253   C  CE3    . TRP A 1 16   ? 31.858  -79.137 15.254  1.00 44.75  ? 1378 TRP A CE3    1 
ATOM   254   C  CZ2    . TRP A 1 16   ? 31.327  -76.615 14.097  1.00 43.29  ? 1378 TRP A CZ2    1 
ATOM   255   C  CZ3    . TRP A 1 16   ? 30.796  -78.369 15.668  1.00 43.46  ? 1378 TRP A CZ3    1 
ATOM   256   C  CH2    . TRP A 1 16   ? 30.537  -77.120 15.093  1.00 42.73  ? 1378 TRP A CH2    1 
ATOM   257   H  H      . TRP A 1 16   ? 36.791  -79.722 14.541  1.00 57.69  ? 1378 TRP A H      1 
ATOM   258   H  HA     . TRP A 1 16   ? 34.467  -80.019 15.847  1.00 57.29  ? 1378 TRP A HA     1 
ATOM   259   H  HB2    . TRP A 1 16   ? 35.201  -80.589 13.202  1.00 57.42  ? 1378 TRP A HB2    1 
ATOM   260   H  HB3    . TRP A 1 16   ? 33.837  -81.164 13.789  1.00 57.42  ? 1378 TRP A HB3    1 
ATOM   261   H  HD1    . TRP A 1 16   ? 34.937  -78.291 12.090  1.00 56.03  ? 1378 TRP A HD1    1 
ATOM   262   H  HE1    . TRP A 1 16   ? 33.395  -76.446 12.226  1.00 54.55  ? 1378 TRP A HE1    1 
ATOM   263   H  HE3    . TRP A 1 16   ? 32.023  -79.967 15.640  1.00 53.70  ? 1378 TRP A HE3    1 
ATOM   264   H  HZ2    . TRP A 1 16   ? 31.153  -75.785 13.715  1.00 51.95  ? 1378 TRP A HZ2    1 
ATOM   265   H  HZ3    . TRP A 1 16   ? 30.240  -78.685 16.344  1.00 52.15  ? 1378 TRP A HZ3    1 
ATOM   266   H  HH2    . TRP A 1 16   ? 29.811  -76.623 15.394  1.00 51.28  ? 1378 TRP A HH2    1 
ATOM   267   N  N      . LYS A 1 17   ? 36.486  -82.353 15.889  1.00 51.70  ? 1379 LYS A N      1 
ATOM   268   C  CA     . LYS A 1 17   ? 36.721  -83.664 16.474  1.00 52.66  ? 1379 LYS A CA     1 
ATOM   269   C  C      . LYS A 1 17   ? 36.701  -83.606 18.000  1.00 52.16  ? 1379 LYS A C      1 
ATOM   270   O  O      . LYS A 1 17   ? 36.533  -84.637 18.649  1.00 52.69  ? 1379 LYS A O      1 
ATOM   271   C  CB     . LYS A 1 17   ? 38.039  -84.241 15.955  1.00 54.20  ? 1379 LYS A CB     1 
ATOM   272   C  CG     . LYS A 1 17   ? 38.110  -84.326 14.418  1.00 54.85  ? 1379 LYS A CG     1 
ATOM   273   C  CD     . LYS A 1 17   ? 36.793  -84.800 13.775  1.00 54.54  ? 1379 LYS A CD     1 
ATOM   274   C  CE     . LYS A 1 17   ? 36.829  -84.692 12.259  1.00 55.10  ? 1379 LYS A CE     1 
ATOM   275   N  NZ     . LYS A 1 17   ? 35.501  -84.972 11.649  1.00 54.68  1 1379 LYS A NZ     1 
ATOM   276   H  H      . LYS A 1 17   ? 37.199  -81.932 15.656  1.00 62.04  ? 1379 LYS A H      1 
ATOM   277   H  HA     . LYS A 1 17   ? 36.009  -84.260 16.194  1.00 63.19  ? 1379 LYS A HA     1 
ATOM   278   H  HB2    . LYS A 1 17   ? 38.769  -83.677 16.255  1.00 65.04  ? 1379 LYS A HB2    1 
ATOM   279   H  HB3    . LYS A 1 17   ? 38.149  -85.138 16.308  1.00 65.04  ? 1379 LYS A HB3    1 
ATOM   280   H  HG2    . LYS A 1 17   ? 38.316  -83.447 14.063  1.00 65.82  ? 1379 LYS A HG2    1 
ATOM   281   H  HG3    . LYS A 1 17   ? 38.806  -84.954 14.169  1.00 65.82  ? 1379 LYS A HG3    1 
ATOM   282   H  HD2    . LYS A 1 17   ? 36.641  -85.729 14.009  1.00 65.45  ? 1379 LYS A HD2    1 
ATOM   283   H  HD3    . LYS A 1 17   ? 36.064  -84.249 14.100  1.00 65.45  ? 1379 LYS A HD3    1 
ATOM   284   H  HE2    . LYS A 1 17   ? 37.092  -83.792 12.010  1.00 66.12  ? 1379 LYS A HE2    1 
ATOM   285   H  HE3    . LYS A 1 17   ? 37.465  -85.336 11.909  1.00 66.12  ? 1379 LYS A HE3    1 
ATOM   286   H  HZ1    . LYS A 1 17   ? 35.552  -84.902 10.763  1.00 65.61  ? 1379 LYS A HZ1    1 
ATOM   287   H  HZ2    . LYS A 1 17   ? 35.238  -85.796 11.859  1.00 65.61  ? 1379 LYS A HZ2    1 
ATOM   288   H  HZ3    . LYS A 1 17   ? 34.899  -84.390 11.951  1.00 65.61  ? 1379 LYS A HZ3    1 
ATOM   289   N  N      . GLU A 1 18   ? 36.894  -82.417 18.570  1.00 78.71  ? 1380 GLU A N      1 
ATOM   290   C  CA     . GLU A 1 18   ? 36.730  -82.225 20.014  1.00 79.18  ? 1380 GLU A CA     1 
ATOM   291   C  C      . GLU A 1 18   ? 35.363  -81.612 20.381  1.00 78.50  ? 1380 GLU A C      1 
ATOM   292   O  O      . GLU A 1 18   ? 35.102  -81.346 21.554  1.00 78.57  ? 1380 GLU A O      1 
ATOM   293   C  CB     . GLU A 1 18   ? 37.858  -81.353 20.574  1.00 79.04  ? 1380 GLU A CB     1 
ATOM   294   C  CG     . GLU A 1 18   ? 38.191  -81.665 22.033  1.00 80.37  ? 1380 GLU A CG     1 
ATOM   295   C  CD     . GLU A 1 18   ? 38.926  -80.537 22.731  1.00 81.41  ? 1380 GLU A CD     1 
ATOM   296   O  OE1    . GLU A 1 18   ? 39.926  -80.038 22.172  1.00 84.19  ? 1380 GLU A OE1    1 
ATOM   297   O  OE2    . GLU A 1 18   ? 38.500  -80.152 23.841  1.00 80.80  1 1380 GLU A OE2    1 
ATOM   298   H  H      . GLU A 1 18   ? 37.120  -81.705 18.144  1.00 94.46  ? 1380 GLU A H      1 
ATOM   299   H  HA     . GLU A 1 18   ? 36.787  -83.090 20.448  1.00 95.02  ? 1380 GLU A HA     1 
ATOM   300   H  HB2    . GLU A 1 18   ? 38.659  -81.499 20.047  1.00 94.85  ? 1380 GLU A HB2    1 
ATOM   301   H  HB3    . GLU A 1 18   ? 37.592  -80.422 20.521  1.00 94.85  ? 1380 GLU A HB3    1 
ATOM   302   H  HG2    . GLU A 1 18   ? 37.366  -81.828 22.516  1.00 96.45  ? 1380 GLU A HG2    1 
ATOM   303   H  HG3    . GLU A 1 18   ? 38.754  -82.454 22.065  1.00 96.45  ? 1380 GLU A HG3    1 
ATOM   304   N  N      . ALA A 1 19   ? 34.505  -81.379 19.385  1.00 49.97  ? 1381 ALA A N      1 
ATOM   305   C  CA     . ALA A 1 19   ? 33.185  -80.769 19.604  1.00 48.64  ? 1381 ALA A CA     1 
ATOM   306   C  C      . ALA A 1 19   ? 32.307  -81.568 20.577  1.00 48.45  ? 1381 ALA A C      1 
ATOM   307   O  O      . ALA A 1 19   ? 32.156  -82.779 20.430  1.00 49.29  ? 1381 ALA A O      1 
ATOM   308   C  CB     . ALA A 1 19   ? 32.465  -80.598 18.274  1.00 48.38  ? 1381 ALA A CB     1 
ATOM   309   H  H      . ALA A 1 19   ? 34.665  -81.567 18.561  1.00 59.97  ? 1381 ALA A H      1 
ATOM   310   H  HA     . ALA A 1 19   ? 33.313  -79.885 19.984  1.00 58.36  ? 1381 ALA A HA     1 
ATOM   311   H  HB1    . ALA A 1 19   ? 31.598  -80.195 18.434  1.00 58.06  ? 1381 ALA A HB1    1 
ATOM   312   H  HB2    . ALA A 1 19   ? 32.996  -80.024 17.699  1.00 58.06  ? 1381 ALA A HB2    1 
ATOM   313   H  HB3    . ALA A 1 19   ? 32.355  -81.468 17.861  1.00 58.06  ? 1381 ALA A HB3    1 
ATOM   314   N  N      . GLN A 1 20   ? 31.736  -80.876 21.564  1.00 59.21  ? 1382 GLN A N      1 
ATOM   315   C  CA     . GLN A 1 20   ? 30.916  -81.500 22.607  1.00 59.01  ? 1382 GLN A CA     1 
ATOM   316   C  C      . GLN A 1 20   ? 29.666  -80.683 22.939  1.00 57.64  ? 1382 GLN A C      1 
ATOM   317   O  O      . GLN A 1 20   ? 29.778  -79.500 23.259  1.00 56.84  ? 1382 GLN A O      1 
ATOM   318   C  CB     . GLN A 1 20   ? 31.732  -81.669 23.886  1.00 68.50  ? 1382 GLN A CB     1 
ATOM   319   C  CG     . GLN A 1 20   ? 32.840  -82.699 23.822  1.00 81.61  ? 1382 GLN A CG     1 
ATOM   320   C  CD     . GLN A 1 20   ? 33.613  -82.764 25.126  1.00 89.77  ? 1382 GLN A CD     1 
ATOM   321   O  OE1    . GLN A 1 20   ? 33.165  -82.246 26.150  1.00 89.28  ? 1382 GLN A OE1    1 
ATOM   322   N  NE2    . GLN A 1 20   ? 34.797  -83.364 25.087  1.00 95.64  ? 1382 GLN A NE2    1 
ATOM   323   H  H      . GLN A 1 20   ? 31.811  -80.024 21.653  1.00 71.05  ? 1382 GLN A H      1 
ATOM   324   H  HA     . GLN A 1 20   ? 30.634  -82.378 22.308  1.00 70.81  ? 1382 GLN A HA     1 
ATOM   325   H  HB2    . GLN A 1 20   ? 32.140  -80.816 24.104  1.00 82.20  ? 1382 GLN A HB2    1 
ATOM   326   H  HB3    . GLN A 1 20   ? 31.131  -81.932 24.600  1.00 82.20  ? 1382 GLN A HB3    1 
ATOM   327   H  HG2    . GLN A 1 20   ? 32.455  -83.573 23.653  1.00 97.94  ? 1382 GLN A HG2    1 
ATOM   328   H  HG3    . GLN A 1 20   ? 33.458  -82.461 23.114  1.00 97.94  ? 1382 GLN A HG3    1 
ATOM   329   H  HE21   . GLN A 1 20   ? 35.089  -83.691 24.347  1.00 114.77 ? 1382 GLN A HE21   1 
ATOM   330   H  HE22   . GLN A 1 20   ? 35.272  -83.425 25.801  1.00 114.77 ? 1382 GLN A HE22   1 
ATOM   331   N  N      . TYR A 1 21   ? 28.484  -81.298 22.883  1.00 52.24  ? 1383 TYR A N      1 
ATOM   332   C  CA     . TYR A 1 21   ? 27.275  -80.660 23.421  1.00 51.06  ? 1383 TYR A CA     1 
ATOM   333   C  C      . TYR A 1 21   ? 27.193  -80.910 24.931  1.00 51.07  ? 1383 TYR A C      1 
ATOM   334   O  O      . TYR A 1 21   ? 27.388  -82.036 25.387  1.00 55.11  ? 1383 TYR A O      1 
ATOM   335   C  CB     . TYR A 1 21   ? 26.010  -81.205 22.745  1.00 50.86  ? 1383 TYR A CB     1 
ATOM   336   C  CG     . TYR A 1 21   ? 25.432  -80.352 21.628  1.00 50.84  ? 1383 TYR A CG     1 
ATOM   337   C  CD1    . TYR A 1 21   ? 24.747  -79.170 21.892  1.00 48.88  ? 1383 TYR A CD1    1 
ATOM   338   C  CD2    . TYR A 1 21   ? 25.552  -80.750 20.304  1.00 50.67  ? 1383 TYR A CD2    1 
ATOM   339   C  CE1    . TYR A 1 21   ? 24.215  -78.408 20.857  1.00 48.28  ? 1383 TYR A CE1    1 
ATOM   340   C  CE2    . TYR A 1 21   ? 25.029  -80.000 19.279  1.00 50.08  ? 1383 TYR A CE2    1 
ATOM   341   C  CZ     . TYR A 1 21   ? 24.365  -78.839 19.552  1.00 48.89  ? 1383 TYR A CZ     1 
ATOM   342   O  OH     . TYR A 1 21   ? 23.869  -78.123 18.492  1.00 48.42  ? 1383 TYR A OH     1 
ATOM   343   H  H      . TYR A 1 21   ? 28.354  -82.077 22.543  1.00 62.69  ? 1383 TYR A H      1 
ATOM   344   H  HA     . TYR A 1 21   ? 27.318  -79.703 23.269  1.00 61.27  ? 1383 TYR A HA     1 
ATOM   345   H  HB2    . TYR A 1 21   ? 26.216  -82.075 22.368  1.00 61.03  ? 1383 TYR A HB2    1 
ATOM   346   H  HB3    . TYR A 1 21   ? 25.321  -81.302 23.421  1.00 61.03  ? 1383 TYR A HB3    1 
ATOM   347   H  HD1    . TYR A 1 21   ? 24.648  -78.882 22.771  1.00 58.66  ? 1383 TYR A HD1    1 
ATOM   348   H  HD2    . TYR A 1 21   ? 26.002  -81.540 20.106  1.00 60.80  ? 1383 TYR A HD2    1 
ATOM   349   H  HE1    . TYR A 1 21   ? 23.765  -77.615 21.041  1.00 57.93  ? 1383 TYR A HE1    1 
ATOM   350   H  HE2    . TYR A 1 21   ? 25.127  -80.284 18.398  1.00 60.10  ? 1383 TYR A HE2    1 
ATOM   351   H  HH     . TYR A 1 21   ? 23.487  -77.428 18.767  1.00 58.10  ? 1383 TYR A HH     1 
ATOM   352   N  N      . GLU A 1 22   ? 26.899  -79.868 25.704  1.00 58.12  ? 1384 GLU A N      1 
ATOM   353   C  CA     . GLU A 1 22   ? 26.644  -80.030 27.134  1.00 62.61  ? 1384 GLU A CA     1 
ATOM   354   C  C      . GLU A 1 22   ? 25.263  -80.658 27.290  1.00 57.41  ? 1384 GLU A C      1 
ATOM   355   O  O      . GLU A 1 22   ? 24.327  -80.265 26.596  1.00 56.76  ? 1384 GLU A O      1 
ATOM   356   C  CB     . GLU A 1 22   ? 26.704  -78.682 27.868  1.00 70.46  ? 1384 GLU A CB     1 
ATOM   357   C  CG     . GLU A 1 22   ? 28.043  -77.938 27.796  1.00 77.16  ? 1384 GLU A CG     1 
ATOM   358   C  CD     . GLU A 1 22   ? 29.008  -78.325 28.905  1.00 81.01  ? 1384 GLU A CD     1 
ATOM   359   O  OE1    . GLU A 1 22   ? 29.416  -79.506 28.969  1.00 83.56  ? 1384 GLU A OE1    1 
ATOM   360   O  OE2    . GLU A 1 22   ? 29.352  -77.436 29.717  1.00 82.35  1 1384 GLU A OE2    1 
ATOM   361   H  H      . GLU A 1 22   ? 26.841  -79.056 25.426  1.00 69.74  ? 1384 GLU A H      1 
ATOM   362   H  HA     . GLU A 1 22   ? 27.304  -80.626 27.521  1.00 75.14  ? 1384 GLU A HA     1 
ATOM   363   H  HB2    . GLU A 1 22   ? 26.028  -78.099 27.490  1.00 84.56  ? 1384 GLU A HB2    1 
ATOM   364   H  HB3    . GLU A 1 22   ? 26.509  -78.836 28.805  1.00 84.56  ? 1384 GLU A HB3    1 
ATOM   365   H  HG2    . GLU A 1 22   ? 28.469  -78.139 26.948  1.00 92.59  ? 1384 GLU A HG2    1 
ATOM   366   H  HG3    . GLU A 1 22   ? 27.877  -76.985 27.865  1.00 92.59  ? 1384 GLU A HG3    1 
ATOM   367   N  N      . VAL A 1 23   ? 25.131  -81.620 28.200  1.00 54.75  ? 1385 VAL A N      1 
ATOM   368   C  CA     . VAL A 1 23   ? 23.871  -82.348 28.376  1.00 54.70  ? 1385 VAL A CA     1 
ATOM   369   C  C      . VAL A 1 23   ? 23.460  -82.546 29.829  1.00 57.78  ? 1385 VAL A C      1 
ATOM   370   O  O      . VAL A 1 23   ? 24.237  -83.047 30.643  1.00 65.44  ? 1385 VAL A O      1 
ATOM   371   C  CB     . VAL A 1 23   ? 23.940  -83.737 27.719  1.00 55.82  ? 1385 VAL A CB     1 
ATOM   372   C  CG1    . VAL A 1 23   ? 22.626  -84.488 27.903  1.00 55.85  ? 1385 VAL A CG1    1 
ATOM   373   C  CG2    . VAL A 1 23   ? 24.283  -83.615 26.247  1.00 55.88  ? 1385 VAL A CG2    1 
ATOM   374   H  H      . VAL A 1 23   ? 25.758  -81.873 28.732  1.00 65.70  ? 1385 VAL A H      1 
ATOM   375   H  HA     . VAL A 1 23   ? 23.164  -81.850 27.936  1.00 65.64  ? 1385 VAL A HA     1 
ATOM   376   H  HB     . VAL A 1 23   ? 24.641  -84.253 28.147  1.00 66.99  ? 1385 VAL A HB     1 
ATOM   377   H  HG11   . VAL A 1 23   ? 22.698  -85.358 27.480  1.00 67.01  ? 1385 VAL A HG11   1 
ATOM   378   H  HG12   . VAL A 1 23   ? 22.453  -84.594 28.852  1.00 67.01  ? 1385 VAL A HG12   1 
ATOM   379   H  HG13   . VAL A 1 23   ? 21.911  -83.978 27.491  1.00 67.01  ? 1385 VAL A HG13   1 
ATOM   380   H  HG21   . VAL A 1 23   ? 24.320  -84.503 25.857  1.00 67.06  ? 1385 VAL A HG21   1 
ATOM   381   H  HG22   . VAL A 1 23   ? 23.598  -83.088 25.806  1.00 67.06  ? 1385 VAL A HG22   1 
ATOM   382   H  HG23   . VAL A 1 23   ? 25.144  -83.179 26.159  1.00 67.06  ? 1385 VAL A HG23   1 
ATOM   383   N  N      . ILE A 1 24   ? 22.224  -82.158 30.133  1.00 43.79  ? 1386 ILE A N      1 
ATOM   384   C  CA     . ILE A 1 24   ? 21.605  -82.459 31.421  1.00 43.90  ? 1386 ILE A CA     1 
ATOM   385   C  C      . ILE A 1 24   ? 20.203  -83.011 31.184  1.00 43.72  ? 1386 ILE A C      1 
ATOM   386   O  O      . ILE A 1 24   ? 19.422  -82.397 30.459  1.00 42.82  ? 1386 ILE A O      1 
ATOM   387   C  CB     . ILE A 1 24   ? 21.533  -81.207 32.327  1.00 43.03  ? 1386 ILE A CB     1 
ATOM   388   C  CG1    . ILE A 1 24   ? 20.795  -81.538 33.629  1.00 43.20  ? 1386 ILE A CG1    1 
ATOM   389   C  CG2    . ILE A 1 24   ? 20.900  -80.025 31.578  1.00 41.77  ? 1386 ILE A CG2    1 
ATOM   390   C  CD1    . ILE A 1 24   ? 20.811  -80.420 34.652  1.00 42.57  ? 1386 ILE A CD1    1 
ATOM   391   H  H      . ILE A 1 24   ? 21.716  -81.713 29.602  1.00 52.55  ? 1386 ILE A H      1 
ATOM   392   H  HA     . ILE A 1 24   ? 22.127  -83.137 31.878  1.00 52.69  ? 1386 ILE A HA     1 
ATOM   393   H  HB     . ILE A 1 24   ? 22.441  -80.957 32.558  1.00 51.64  ? 1386 ILE A HB     1 
ATOM   394   H  HG12   . ILE A 1 24   ? 19.868  -81.734 33.421  1.00 51.84  ? 1386 ILE A HG12   1 
ATOM   395   H  HG13   . ILE A 1 24   ? 21.211  -82.315 34.035  1.00 51.84  ? 1386 ILE A HG13   1 
ATOM   396   H  HG21   . ILE A 1 24   ? 20.869  -79.257 32.170  1.00 50.12  ? 1386 ILE A HG21   1 
ATOM   397   H  HG22   . ILE A 1 24   ? 21.440  -79.820 30.799  1.00 50.12  ? 1386 ILE A HG22   1 
ATOM   398   H  HG23   . ILE A 1 24   ? 20.002  -80.269 31.305  1.00 50.12  ? 1386 ILE A HG23   1 
ATOM   399   H  HD11   . ILE A 1 24   ? 20.326  -80.707 35.441  1.00 51.09  ? 1386 ILE A HD11   1 
ATOM   400   H  HD12   . ILE A 1 24   ? 21.731  -80.218 34.883  1.00 51.09  ? 1386 ILE A HD12   1 
ATOM   401   H  HD13   . ILE A 1 24   ? 20.386  -79.636 34.269  1.00 51.09  ? 1386 ILE A HD13   1 
ATOM   402   N  N      . GLU A 1 25   ? 19.875  -84.169 31.756  1.00 68.21  ? 1387 GLU A N      1 
ATOM   403   C  CA     . GLU A 1 25   ? 18.547  -84.732 31.507  1.00 71.41  ? 1387 GLU A CA     1 
ATOM   404   C  C      . GLU A 1 25   ? 17.520  -84.099 32.428  1.00 66.31  ? 1387 GLU A C      1 
ATOM   405   O  O      . GLU A 1 25   ? 17.831  -83.718 33.555  1.00 66.44  ? 1387 GLU A O      1 
ATOM   406   C  CB     . GLU A 1 25   ? 18.496  -86.255 31.688  1.00 76.61  ? 1387 GLU A CB     1 
ATOM   407   C  CG     . GLU A 1 25   ? 19.052  -86.817 32.984  1.00 77.31  ? 1387 GLU A CG     1 
ATOM   408   C  CD     . GLU A 1 25   ? 18.944  -88.332 33.032  1.00 76.45  ? 1387 GLU A CD     1 
ATOM   409   O  OE1    . GLU A 1 25   ? 17.805  -88.838 32.928  1.00 75.56  ? 1387 GLU A OE1    1 
ATOM   410   O  OE2    . GLU A 1 25   ? 19.984  -89.012 33.166  1.00 76.64  1 1387 GLU A OE2    1 
ATOM   411   H  H      . GLU A 1 25   ? 20.380  -84.634 32.273  1.00 81.85  ? 1387 GLU A H      1 
ATOM   412   H  HA     . GLU A 1 25   ? 18.290  -84.533 30.593  1.00 85.70  ? 1387 GLU A HA     1 
ATOM   413   H  HB2    . GLU A 1 25   ? 17.568  -86.534 31.632  1.00 91.94  ? 1387 GLU A HB2    1 
ATOM   414   H  HB3    . GLU A 1 25   ? 18.995  -86.662 30.963  1.00 91.94  ? 1387 GLU A HB3    1 
ATOM   415   H  HG2    . GLU A 1 25   ? 19.989  -86.577 33.059  1.00 92.77  ? 1387 GLU A HG2    1 
ATOM   416   H  HG3    . GLU A 1 25   ? 18.552  -86.453 33.731  1.00 92.77  ? 1387 GLU A HG3    1 
ATOM   417   N  N      . HIS A 1 26   ? 16.297  -83.978 31.923  1.00 61.58  ? 1388 HIS A N      1 
ATOM   418   C  CA     . HIS A 1 26   ? 15.182  -83.457 32.702  1.00 67.95  ? 1388 HIS A CA     1 
ATOM   419   C  C      . HIS A 1 26   ? 14.529  -84.631 33.427  1.00 65.50  ? 1388 HIS A C      1 
ATOM   420   O  O      . HIS A 1 26   ? 15.007  -85.763 33.330  1.00 63.25  ? 1388 HIS A O      1 
ATOM   421   C  CB     . HIS A 1 26   ? 14.183  -82.706 31.823  1.00 73.82  ? 1388 HIS A CB     1 
ATOM   422   C  CG     . HIS A 1 26   ? 13.085  -83.563 31.278  1.00 80.91  ? 1388 HIS A CG     1 
ATOM   423   N  ND1    . HIS A 1 26   ? 11.801  -83.528 31.776  1.00 84.62  ? 1388 HIS A ND1    1 
ATOM   424   C  CD2    . HIS A 1 26   ? 13.078  -84.476 30.280  1.00 87.00  ? 1388 HIS A CD2    1 
ATOM   425   C  CE1    . HIS A 1 26   ? 11.049  -84.383 31.108  1.00 87.69  ? 1388 HIS A CE1    1 
ATOM   426   N  NE2    . HIS A 1 26   ? 11.799  -84.973 30.195  1.00 89.12  ? 1388 HIS A NE2    1 
ATOM   427   H  H      . HIS A 1 26   ? 16.086  -84.194 31.118  1.00 73.89  ? 1388 HIS A H      1 
ATOM   428   H  HA     . HIS A 1 26   ? 15.521  -82.840 33.369  1.00 81.54  ? 1388 HIS A HA     1 
ATOM   429   H  HB2    . HIS A 1 26   ? 13.775  -82.001 32.348  1.00 88.58  ? 1388 HIS A HB2    1 
ATOM   430   H  HB3    . HIS A 1 26   ? 14.659  -82.321 31.070  1.00 88.58  ? 1388 HIS A HB3    1 
ATOM   431   H  HD1    . HIS A 1 26   ? 11.531  -83.027 32.421  1.00 101.55 ? 1388 HIS A HD1    1 
ATOM   432   H  HD2    . HIS A 1 26   ? 13.802  -84.723 29.751  1.00 104.40 ? 1388 HIS A HD2    1 
ATOM   433   H  HE1    . HIS A 1 26   ? 10.145  -84.544 31.256  1.00 105.23 ? 1388 HIS A HE1    1 
ATOM   434   N  N      . SER A 1 27   ? 13.438  -84.353 34.134  1.00 76.67  ? 1389 SER A N      1 
ATOM   435   C  CA     . SER A 1 27   ? 12.887  -85.251 35.149  1.00 77.92  ? 1389 SER A CA     1 
ATOM   436   C  C      . SER A 1 27   ? 12.811  -86.719 34.746  1.00 83.40  ? 1389 SER A C      1 
ATOM   437   O  O      . SER A 1 27   ? 13.237  -87.592 35.505  1.00 81.50  ? 1389 SER A O      1 
ATOM   438   C  CB     . SER A 1 27   ? 11.475  -84.787 35.515  1.00 76.36  ? 1389 SER A CB     1 
ATOM   439   O  OG     . SER A 1 27   ? 10.582  -84.993 34.432  1.00 75.06  ? 1389 SER A OG     1 
ATOM   440   H  H      . SER A 1 27   ? 12.985  -83.628 34.042  1.00 92.00  ? 1389 SER A H      1 
ATOM   441   H  HA     . SER A 1 27   ? 13.435  -85.191 35.947  1.00 93.50  ? 1389 SER A HA     1 
ATOM   442   H  HB2    . SER A 1 27   ? 11.165  -85.294 36.282  1.00 91.63  ? 1389 SER A HB2    1 
ATOM   443   H  HB3    . SER A 1 27   ? 11.498  -83.841 35.729  1.00 91.63  ? 1389 SER A HB3    1 
ATOM   444   H  HG     . SER A 1 27   ? 10.840  -84.560 33.760  1.00 90.07  ? 1389 SER A HG     1 
ATOM   445   N  N      . SER A 1 28   ? 12.272  -86.989 33.564  1.00 67.51  ? 1390 SER A N      1 
ATOM   446   C  CA     . SER A 1 28   ? 12.160  -88.361 33.081  1.00 69.85  ? 1390 SER A CA     1 
ATOM   447   C  C      . SER A 1 28   ? 12.606  -88.436 31.636  1.00 64.41  ? 1390 SER A C      1 
ATOM   448   O  O      . SER A 1 28   ? 12.178  -87.632 30.805  1.00 59.21  ? 1390 SER A O      1 
ATOM   449   C  CB     . SER A 1 28   ? 10.724  -88.870 33.223  1.00 77.62  ? 1390 SER A CB     1 
ATOM   450   O  OG     . SER A 1 28   ? 9.820   -88.077 32.476  1.00 80.29  ? 1390 SER A OG     1 
ATOM   451   H  H      . SER A 1 28   ? 11.963  -86.398 33.022  1.00 81.01  ? 1390 SER A H      1 
ATOM   452   H  HA     . SER A 1 28   ? 12.740  -88.933 33.608  1.00 83.82  ? 1390 SER A HA     1 
ATOM   453   H  HB2    . SER A 1 28   ? 10.681  -89.784 32.900  1.00 93.15  ? 1390 SER A HB2    1 
ATOM   454   H  HB3    . SER A 1 28   ? 10.470  -88.839 34.159  1.00 93.15  ? 1390 SER A HB3    1 
ATOM   455   H  HG     . SER A 1 28   ? 9.038   -88.370 32.565  1.00 96.34  ? 1390 SER A HG     1 
ATOM   456   N  N      . GLY A 1 29   ? 13.461  -89.410 31.335  1.00 43.26  ? 1391 GLY A N      1 
ATOM   457   C  CA     . GLY A 1 29   ? 13.897  -89.593 29.968  1.00 43.39  ? 1391 GLY A CA     1 
ATOM   458   C  C      . GLY A 1 29   ? 14.780  -88.485 29.425  1.00 42.51  ? 1391 GLY A C      1 
ATOM   459   O  O      . GLY A 1 29   ? 15.893  -88.251 29.903  1.00 42.70  ? 1391 GLY A O      1 
ATOM   460   H  H      . GLY A 1 29   ? 13.795  -89.967 31.898  1.00 51.92  ? 1391 GLY A H      1 
ATOM   461   H  HA2    . GLY A 1 29   ? 14.389  -90.426 29.903  1.00 52.07  ? 1391 GLY A HA2    1 
ATOM   462   H  HA3    . GLY A 1 29   ? 13.116  -89.660 29.395  1.00 52.07  ? 1391 GLY A HA3    1 
ATOM   463   N  N      . LEU A 1 30   ? 14.252  -87.811 28.409  1.00 41.60  ? 1392 LEU A N      1 
ATOM   464   C  CA     . LEU A 1 30   ? 15.028  -87.113 27.396  1.00 41.14  ? 1392 LEU A CA     1 
ATOM   465   C  C      . LEU A 1 30   ? 16.140  -86.234 27.948  1.00 40.73  ? 1392 LEU A C      1 
ATOM   466   O  O      . LEU A 1 30   ? 15.932  -85.429 28.857  1.00 39.99  ? 1392 LEU A O      1 
ATOM   467   C  CB     . LEU A 1 30   ? 14.058  -86.262 26.559  1.00 40.01  ? 1392 LEU A CB     1 
ATOM   468   C  CG     . LEU A 1 30   ? 14.480  -85.630 25.231  1.00 39.59  ? 1392 LEU A CG     1 
ATOM   469   C  CD1    . LEU A 1 30   ? 15.037  -84.243 25.433  1.00 39.86  ? 1392 LEU A CD1    1 
ATOM   470   C  CD2    . LEU A 1 30   ? 15.493  -86.492 24.516  1.00 43.93  ? 1392 LEU A CD2    1 
ATOM   471   H  H      . LEU A 1 30   ? 13.404  -87.742 28.282  1.00 49.92  ? 1392 LEU A H      1 
ATOM   472   H  HA     . LEU A 1 30   ? 15.434  -87.768 26.807  1.00 49.36  ? 1392 LEU A HA     1 
ATOM   473   H  HB2    . LEU A 1 30   ? 13.291  -86.821 26.358  1.00 48.01  ? 1392 LEU A HB2    1 
ATOM   474   H  HB3    . LEU A 1 30   ? 13.763  -85.530 27.123  1.00 48.01  ? 1392 LEU A HB3    1 
ATOM   475   H  HG     . LEU A 1 30   ? 13.700  -85.554 24.659  1.00 47.50  ? 1392 LEU A HG     1 
ATOM   476   H  HD11   . LEU A 1 30   ? 15.292  -83.877 24.571  1.00 47.83  ? 1392 LEU A HD11   1 
ATOM   477   H  HD12   . LEU A 1 30   ? 14.355  -83.686 25.840  1.00 47.83  ? 1392 LEU A HD12   1 
ATOM   478   H  HD13   . LEU A 1 30   ? 15.812  -84.296 26.013  1.00 47.83  ? 1392 LEU A HD13   1 
ATOM   479   H  HD21   . LEU A 1 30   ? 15.738  -86.064 23.681  1.00 52.72  ? 1392 LEU A HD21   1 
ATOM   480   H  HD22   . LEU A 1 30   ? 16.276  -86.592 25.080  1.00 52.72  ? 1392 LEU A HD22   1 
ATOM   481   H  HD23   . LEU A 1 30   ? 15.098  -87.360 24.339  1.00 52.72  ? 1392 LEU A HD23   1 
ATOM   482   N  N      . LYS A 1 31   ? 17.332  -86.418 27.384  1.00 64.69  ? 1393 LYS A N      1 
ATOM   483   C  CA     . LYS A 1 31   ? 18.489  -85.603 27.721  1.00 64.52  ? 1393 LYS A CA     1 
ATOM   484   C  C      . LYS A 1 31   ? 18.503  -84.330 26.878  1.00 62.66  ? 1393 LYS A C      1 
ATOM   485   O  O      . LYS A 1 31   ? 18.584  -84.372 25.649  1.00 62.33  ? 1393 LYS A O      1 
ATOM   486   C  CB     . LYS A 1 31   ? 19.776  -86.408 27.544  1.00 66.24  ? 1393 LYS A CB     1 
ATOM   487   C  CG     . LYS A 1 31   ? 19.753  -87.738 28.300  1.00 68.17  ? 1393 LYS A CG     1 
ATOM   488   C  CD     . LYS A 1 31   ? 21.110  -88.425 28.354  1.00 68.52  ? 1393 LYS A CD     1 
ATOM   489   C  CE     . LYS A 1 31   ? 21.056  -89.688 29.219  1.00 69.01  ? 1393 LYS A CE     1 
ATOM   490   N  NZ     . LYS A 1 31   ? 20.845  -89.424 30.677  1.00 68.61  1 1393 LYS A NZ     1 
ATOM   491   H  H      . LYS A 1 31   ? 17.495  -87.021 26.793  1.00 77.63  ? 1393 LYS A H      1 
ATOM   492   H  HA     . LYS A 1 31   ? 18.428  -85.341 28.653  1.00 77.42  ? 1393 LYS A HA     1 
ATOM   493   H  HB2    . LYS A 1 31   ? 19.901  -86.601 26.602  1.00 79.48  ? 1393 LYS A HB2    1 
ATOM   494   H  HB3    . LYS A 1 31   ? 20.523  -85.886 27.878  1.00 79.48  ? 1393 LYS A HB3    1 
ATOM   495   H  HG2    . LYS A 1 31   ? 19.465  -87.576 29.212  1.00 81.80  ? 1393 LYS A HG2    1 
ATOM   496   H  HG3    . LYS A 1 31   ? 19.132  -88.339 27.860  1.00 81.80  ? 1393 LYS A HG3    1 
ATOM   497   H  HD2    . LYS A 1 31   ? 21.376  -88.681 27.457  1.00 82.23  ? 1393 LYS A HD2    1 
ATOM   498   H  HD3    . LYS A 1 31   ? 21.762  -87.819 28.739  1.00 82.23  ? 1393 LYS A HD3    1 
ATOM   499   H  HE2    . LYS A 1 31   ? 20.325  -90.246 28.911  1.00 82.81  ? 1393 LYS A HE2    1 
ATOM   500   H  HE3    . LYS A 1 31   ? 21.895  -90.166 29.124  1.00 82.81  ? 1393 LYS A HE3    1 
ATOM   501   H  HZ1    . LYS A 1 31   ? 20.823  -90.193 31.125  1.00 82.33  ? 1393 LYS A HZ1    1 
ATOM   502   H  HZ2    . LYS A 1 31   ? 21.508  -88.923 30.994  1.00 82.33  ? 1393 LYS A HZ2    1 
ATOM   503   H  HZ3    . LYS A 1 31   ? 20.074  -88.996 30.800  1.00 82.33  ? 1393 LYS A HZ3    1 
ATOM   504   N  N      . LEU A 1 32   ? 18.407  -83.202 27.571  1.00 48.63  ? 1394 LEU A N      1 
ATOM   505   C  CA     . LEU A 1 32   ? 18.435  -81.873 26.970  1.00 47.57  ? 1394 LEU A CA     1 
ATOM   506   C  C      . LEU A 1 32   ? 19.842  -81.372 26.695  1.00 49.75  ? 1394 LEU A C      1 
ATOM   507   O  O      . LEU A 1 32   ? 20.795  -81.823 27.327  1.00 56.19  ? 1394 LEU A O      1 
ATOM   508   C  CB     . LEU A 1 32   ? 17.730  -80.901 27.910  1.00 46.57  ? 1394 LEU A CB     1 
ATOM   509   C  CG     . LEU A 1 32   ? 16.355  -81.400 28.350  1.00 46.46  ? 1394 LEU A CG     1 
ATOM   510   C  CD1    . LEU A 1 32   ? 15.728  -80.450 29.335  1.00 45.58  ? 1394 LEU A CD1    1 
ATOM   511   C  CD2    . LEU A 1 32   ? 15.468  -81.558 27.145  1.00 46.22  ? 1394 LEU A CD2    1 
ATOM   512   H  H      . LEU A 1 32   ? 18.320  -83.180 28.427  1.00 58.35  ? 1394 LEU A H      1 
ATOM   513   H  HA     . LEU A 1 32   ? 17.949  -81.891 26.130  1.00 57.08  ? 1394 LEU A HA     1 
ATOM   514   H  HB2    . LEU A 1 32   ? 18.273  -80.779 28.704  1.00 55.88  ? 1394 LEU A HB2    1 
ATOM   515   H  HB3    . LEU A 1 32   ? 17.610  -80.053 27.456  1.00 55.88  ? 1394 LEU A HB3    1 
ATOM   516   H  HG     . LEU A 1 32   ? 16.448  -82.266 28.777  1.00 55.75  ? 1394 LEU A HG     1 
ATOM   517   H  HD11   . LEU A 1 32   ? 14.858  -80.793 29.594  1.00 54.69  ? 1394 LEU A HD11   1 
ATOM   518   H  HD12   . LEU A 1 32   ? 16.302  -80.378 30.113  1.00 54.69  ? 1394 LEU A HD12   1 
ATOM   519   H  HD13   . LEU A 1 32   ? 15.629  -79.581 28.915  1.00 54.69  ? 1394 LEU A HD13   1 
ATOM   520   H  HD21   . LEU A 1 32   ? 14.598  -81.875 27.433  1.00 55.46  ? 1394 LEU A HD21   1 
ATOM   521   H  HD22   . LEU A 1 32   ? 15.379  -80.699 26.704  1.00 55.46  ? 1394 LEU A HD22   1 
ATOM   522   H  HD23   . LEU A 1 32   ? 15.871  -82.201 26.539  1.00 55.46  ? 1394 LEU A HD23   1 
ATOM   523   N  N      . VAL A 1 33   ? 19.971  -80.443 25.751  1.00 41.46  ? 1395 VAL A N      1 
ATOM   524   C  CA     . VAL A 1 33   ? 21.248  -79.777 25.520  1.00 41.55  ? 1395 VAL A CA     1 
ATOM   525   C  C      . VAL A 1 33   ? 21.178  -78.314 25.933  1.00 45.94  ? 1395 VAL A C      1 
ATOM   526   O  O      . VAL A 1 33   ? 20.288  -77.571 25.525  1.00 59.98  ? 1395 VAL A O      1 
ATOM   527   C  CB     . VAL A 1 33   ? 21.715  -79.854 24.059  1.00 41.90  ? 1395 VAL A CB     1 
ATOM   528   C  CG1    . VAL A 1 33   ? 22.017  -81.263 23.664  1.00 43.09  ? 1395 VAL A CG1    1 
ATOM   529   C  CG2    . VAL A 1 33   ? 20.698  -79.305 23.142  1.00 41.14  ? 1395 VAL A CG2    1 
ATOM   530   H  H      . VAL A 1 33   ? 19.336  -80.182 25.233  1.00 49.76  ? 1395 VAL A H      1 
ATOM   531   H  HA     . VAL A 1 33   ? 21.924  -80.205 26.068  1.00 49.86  ? 1395 VAL A HA     1 
ATOM   532   H  HB     . VAL A 1 33   ? 22.526  -79.332 23.957  1.00 50.28  ? 1395 VAL A HB     1 
ATOM   533   H  HG11   . VAL A 1 33   ? 22.308  -81.275 22.738  1.00 51.71  ? 1395 VAL A HG11   1 
ATOM   534   H  HG12   . VAL A 1 33   ? 22.721  -81.607 24.236  1.00 51.71  ? 1395 VAL A HG12   1 
ATOM   535   H  HG13   . VAL A 1 33   ? 21.215  -81.798 23.766  1.00 51.71  ? 1395 VAL A HG13   1 
ATOM   536   H  HG21   . VAL A 1 33   ? 21.027  -79.370 22.232  1.00 49.37  ? 1395 VAL A HG21   1 
ATOM   537   H  HG22   . VAL A 1 33   ? 19.879  -79.816 23.237  1.00 49.37  ? 1395 VAL A HG22   1 
ATOM   538   H  HG23   . VAL A 1 33   ? 20.537  -78.376 23.370  1.00 49.37  ? 1395 VAL A HG23   1 
ATOM   539   N  N      . ARG A 1 34   ? 22.087  -77.946 26.820  1.00 65.79  ? 1396 ARG A N      1 
ATOM   540   C  CA     . ARG A 1 34   ? 22.417  -76.557 27.098  1.00 64.86  ? 1396 ARG A CA     1 
ATOM   541   C  C      . ARG A 1 34   ? 23.308  -76.025 25.970  1.00 65.70  ? 1396 ARG A C      1 
ATOM   542   O  O      . ARG A 1 34   ? 23.858  -76.810 25.198  1.00 70.60  ? 1396 ARG A O      1 
ATOM   543   C  CB     . ARG A 1 34   ? 23.112  -76.466 28.453  1.00 65.39  ? 1396 ARG A CB     1 
ATOM   544   C  CG     . ARG A 1 34   ? 22.335  -77.146 29.579  1.00 71.63  ? 1396 ARG A CG     1 
ATOM   545   C  CD     . ARG A 1 34   ? 23.255  -77.652 30.672  1.00 76.12  ? 1396 ARG A CD     1 
ATOM   546   N  NE     . ARG A 1 34   ? 24.228  -76.671 31.137  1.00 78.33  ? 1396 ARG A NE     1 
ATOM   547   C  CZ     . ARG A 1 34   ? 25.167  -76.939 32.041  1.00 80.54  ? 1396 ARG A CZ     1 
ATOM   548   N  NH1    . ARG A 1 34   ? 25.264  -78.158 32.558  1.00 79.90  1 1396 ARG A NH1    1 
ATOM   549   N  NH2    . ARG A 1 34   ? 26.022  -75.998 32.417  1.00 82.96  ? 1396 ARG A NH2    1 
ATOM   550   H  H      . ARG A 1 34   ? 22.543  -78.503 27.291  1.00 78.94  ? 1396 ARG A H      1 
ATOM   551   H  HA     . ARG A 1 34   ? 21.605  -76.028 27.129  1.00 77.83  ? 1396 ARG A HA     1 
ATOM   552   H  HB2    . ARG A 1 34   ? 23.980  -76.894 28.390  1.00 78.47  ? 1396 ARG A HB2    1 
ATOM   553   H  HB3    . ARG A 1 34   ? 23.221  -75.532 28.689  1.00 78.47  ? 1396 ARG A HB3    1 
ATOM   554   H  HG2    . ARG A 1 34   ? 21.719  -76.508 29.972  1.00 85.95  ? 1396 ARG A HG2    1 
ATOM   555   H  HG3    . ARG A 1 34   ? 21.847  -77.903 29.218  1.00 85.95  ? 1396 ARG A HG3    1 
ATOM   556   H  HD2    . ARG A 1 34   ? 22.717  -77.917 31.434  1.00 91.35  ? 1396 ARG A HD2    1 
ATOM   557   H  HD3    . ARG A 1 34   ? 23.746  -78.418 30.336  1.00 91.35  ? 1396 ARG A HD3    1 
ATOM   558   H  HE     . ARG A 1 34   ? 24.114  -75.851 30.906  1.00 94.00  ? 1396 ARG A HE     1 
ATOM   559   H  HH11   . ARG A 1 34   ? 24.713  -78.773 32.317  1.00 95.88  ? 1396 ARG A HH11   1 
ATOM   560   H  HH12   . ARG A 1 34   ? 25.873  -78.331 33.141  1.00 95.88  ? 1396 ARG A HH12   1 
ATOM   561   H  HH21   . ARG A 1 34   ? 25.966  -75.208 32.083  1.00 99.55  ? 1396 ARG A HH21   1 
ATOM   562   H  HH22   . ARG A 1 34   ? 26.629  -76.177 32.999  1.00 99.55  ? 1396 ARG A HH22   1 
ATOM   563   N  N      . GLU A 1 35   ? 23.431  -74.705 25.855  1.00 58.07  ? 1397 GLU A N      1 
ATOM   564   C  CA     . GLU A 1 35   ? 24.447  -74.099 24.987  1.00 58.30  ? 1397 GLU A CA     1 
ATOM   565   C  C      . GLU A 1 35   ? 24.312  -74.515 23.512  1.00 58.58  ? 1397 GLU A C      1 
ATOM   566   O  O      . GLU A 1 35   ? 25.189  -75.174 22.950  1.00 59.47  ? 1397 GLU A O      1 
ATOM   567   C  CB     . GLU A 1 35   ? 25.847  -74.479 25.518  1.00 61.69  ? 1397 GLU A CB     1 
ATOM   568   C  CG     . GLU A 1 35   ? 26.723  -73.326 25.996  1.00 72.68  ? 1397 GLU A CG     1 
ATOM   569   C  CD     . GLU A 1 35   ? 28.127  -73.794 26.359  1.00 83.62  ? 1397 GLU A CD     1 
ATOM   570   O  OE1    . GLU A 1 35   ? 28.652  -74.700 25.670  1.00 87.58  ? 1397 GLU A OE1    1 
ATOM   571   O  OE2    . GLU A 1 35   ? 28.694  -73.268 27.340  1.00 85.76  1 1397 GLU A OE2    1 
ATOM   572   H  H      . GLU A 1 35   ? 22.938  -74.134 26.268  1.00 69.69  ? 1397 GLU A H      1 
ATOM   573   H  HA     . GLU A 1 35   ? 24.363  -73.134 25.032  1.00 69.95  ? 1397 GLU A HA     1 
ATOM   574   H  HB2    . GLU A 1 35   ? 25.734  -75.085 26.268  1.00 74.02  ? 1397 GLU A HB2    1 
ATOM   575   H  HB3    . GLU A 1 35   ? 26.329  -74.932 24.809  1.00 74.02  ? 1397 GLU A HB3    1 
ATOM   576   H  HG2    . GLU A 1 35   ? 26.796  -72.666 25.289  1.00 87.21  ? 1397 GLU A HG2    1 
ATOM   577   H  HG3    . GLU A 1 35   ? 26.323  -72.927 26.785  1.00 87.21  ? 1397 GLU A HG3    1 
ATOM   578   N  N      . TRP A 1 36   ? 23.210  -74.114 22.883  1.00 61.43  ? 1398 TRP A N      1 
ATOM   579   C  CA     . TRP A 1 36   ? 23.020  -74.343 21.450  1.00 61.25  ? 1398 TRP A CA     1 
ATOM   580   C  C      . TRP A 1 36   ? 23.860  -73.416 20.594  1.00 61.00  ? 1398 TRP A C      1 
ATOM   581   O  O      . TRP A 1 36   ? 24.563  -73.841 19.674  1.00 61.08  ? 1398 TRP A O      1 
ATOM   582   C  CB     . TRP A 1 36   ? 21.557  -74.136 21.075  1.00 60.74  ? 1398 TRP A CB     1 
ATOM   583   C  CG     . TRP A 1 36   ? 20.719  -75.318 21.290  1.00 61.28  ? 1398 TRP A CG     1 
ATOM   584   C  CD1    . TRP A 1 36   ? 19.857  -75.540 22.317  1.00 61.54  ? 1398 TRP A CD1    1 
ATOM   585   C  CD2    . TRP A 1 36   ? 20.658  -76.467 20.451  1.00 70.47  ? 1398 TRP A CD2    1 
ATOM   586   N  NE1    . TRP A 1 36   ? 19.253  -76.765 22.165  1.00 65.84  ? 1398 TRP A NE1    1 
ATOM   587   C  CE2    . TRP A 1 36   ? 19.728  -77.352 21.021  1.00 71.00  ? 1398 TRP A CE2    1 
ATOM   588   C  CE3    . TRP A 1 36   ? 21.292  -76.828 19.262  1.00 80.53  ? 1398 TRP A CE3    1 
ATOM   589   C  CZ2    . TRP A 1 36   ? 19.429  -78.587 20.449  1.00 79.50  ? 1398 TRP A CZ2    1 
ATOM   590   C  CZ3    . TRP A 1 36   ? 20.990  -78.044 18.695  1.00 86.95  ? 1398 TRP A CZ3    1 
ATOM   591   C  CH2    . TRP A 1 36   ? 20.070  -78.911 19.288  1.00 85.97  ? 1398 TRP A CH2    1 
ATOM   592   H  H      . TRP A 1 36   ? 22.555  -73.707 23.263  1.00 73.72  ? 1398 TRP A H      1 
ATOM   593   H  HA     . TRP A 1 36   ? 23.262  -75.258 21.237  1.00 73.49  ? 1398 TRP A HA     1 
ATOM   594   H  HB2    . TRP A 1 36   ? 21.195  -73.414 21.612  1.00 72.89  ? 1398 TRP A HB2    1 
ATOM   595   H  HB3    . TRP A 1 36   ? 21.505  -73.903 20.134  1.00 72.89  ? 1398 TRP A HB3    1 
ATOM   596   H  HD1    . TRP A 1 36   ? 19.698  -74.950 23.017  1.00 73.85  ? 1398 TRP A HD1    1 
ATOM   597   H  HE1    . TRP A 1 36   ? 18.674  -77.108 22.700  1.00 79.01  ? 1398 TRP A HE1    1 
ATOM   598   H  HE3    . TRP A 1 36   ? 21.908  -76.258 18.861  1.00 96.64  ? 1398 TRP A HE3    1 
ATOM   599   H  HZ2    . TRP A 1 36   ? 18.813  -79.164 20.839  1.00 95.40  ? 1398 TRP A HZ2    1 
ATOM   600   H  HZ3    . TRP A 1 36   ? 21.411  -78.297 17.905  1.00 104.34 ? 1398 TRP A HZ3    1 
ATOM   601   H  HH2    . TRP A 1 36   ? 19.886  -79.727 18.881  1.00 103.16 ? 1398 TRP A HH2    1 
ATOM   602   N  N      . ASP A 1 37   ? 23.765  -72.137 20.929  1.00 56.12  ? 1399 ASP A N      1 
ATOM   603   C  CA     . ASP A 1 37   ? 24.245  -71.050 20.094  1.00 56.04  ? 1399 ASP A CA     1 
ATOM   604   C  C      . ASP A 1 37   ? 25.732  -71.179 19.780  1.00 56.95  ? 1399 ASP A C      1 
ATOM   605   O  O      . ASP A 1 37   ? 26.192  -70.716 18.736  1.00 57.25  ? 1399 ASP A O      1 
ATOM   606   C  CB     . ASP A 1 37   ? 23.939  -69.714 20.772  1.00 69.18  ? 1399 ASP A CB     1 
ATOM   607   C  CG     . ASP A 1 37   ? 22.446  -69.418 20.823  1.00 81.39  ? 1399 ASP A CG     1 
ATOM   608   O  OD1    . ASP A 1 37   ? 21.650  -70.275 20.378  1.00 85.03  ? 1399 ASP A OD1    1 
ATOM   609   O  OD2    . ASP A 1 37   ? 22.064  -68.336 21.317  1.00 86.99  1 1399 ASP A OD2    1 
ATOM   610   H  H      . ASP A 1 37   ? 23.412  -71.866 21.665  1.00 67.35  ? 1399 ASP A H      1 
ATOM   611   H  HA     . ASP A 1 37   ? 23.764  -71.070 19.251  1.00 67.25  ? 1399 ASP A HA     1 
ATOM   612   H  HB2    . ASP A 1 37   ? 24.273  -69.737 21.682  1.00 83.02  ? 1399 ASP A HB2    1 
ATOM   613   H  HB3    . ASP A 1 37   ? 24.371  -69.001 20.277  1.00 83.02  ? 1399 ASP A HB3    1 
ATOM   614   N  N      . VAL A 1 38   ? 26.479  -71.804 20.687  1.00 45.60  ? 1400 VAL A N      1 
ATOM   615   C  CA     . VAL A 1 38   ? 27.933  -71.888 20.558  1.00 46.48  ? 1400 VAL A CA     1 
ATOM   616   C  C      . VAL A 1 38   ? 28.343  -72.554 19.254  1.00 47.32  ? 1400 VAL A C      1 
ATOM   617   O  O      . VAL A 1 38   ? 29.129  -72.008 18.480  1.00 47.72  ? 1400 VAL A O      1 
ATOM   618   C  CB     . VAL A 1 38   ? 28.571  -72.713 21.697  1.00 47.03  ? 1400 VAL A CB     1 
ATOM   619   C  CG1    . VAL A 1 38   ? 30.095  -72.610 21.634  1.00 47.89  ? 1400 VAL A CG1    1 
ATOM   620   C  CG2    . VAL A 1 38   ? 28.061  -72.271 23.054  1.00 46.60  ? 1400 VAL A CG2    1 
ATOM   621   H  H      . VAL A 1 38   ? 26.167  -72.188 21.391  1.00 54.72  ? 1400 VAL A H      1 
ATOM   622   H  HA     . VAL A 1 38   ? 28.311  -70.995 20.577  1.00 55.78  ? 1400 VAL A HA     1 
ATOM   623   H  HB     . VAL A 1 38   ? 28.332  -73.646 21.579  1.00 56.43  ? 1400 VAL A HB     1 
ATOM   624   H  HG11   . VAL A 1 38   ? 30.476  -73.133 22.357  1.00 57.47  ? 1400 VAL A HG11   1 
ATOM   625   H  HG12   . VAL A 1 38   ? 30.400  -72.953 20.780  1.00 57.47  ? 1400 VAL A HG12   1 
ATOM   626   H  HG13   . VAL A 1 38   ? 30.352  -71.679 21.728  1.00 57.47  ? 1400 VAL A HG13   1 
ATOM   627   H  HG21   . VAL A 1 38   ? 28.483  -72.810 23.741  1.00 55.93  ? 1400 VAL A HG21   1 
ATOM   628   H  HG22   . VAL A 1 38   ? 28.282  -71.335 23.185  1.00 55.93  ? 1400 VAL A HG22   1 
ATOM   629   H  HG23   . VAL A 1 38   ? 27.099  -72.391 23.084  1.00 55.93  ? 1400 VAL A HG23   1 
ATOM   630   N  N      . LEU A 1 39   ? 27.814  -73.752 19.038  1.00 38.09  ? 1401 LEU A N      1 
ATOM   631   C  CA     . LEU A 1 39   ? 28.180  -74.563 17.887  1.00 39.02  ? 1401 LEU A CA     1 
ATOM   632   C  C      . LEU A 1 39   ? 27.421  -74.128 16.636  1.00 38.72  ? 1401 LEU A C      1 
ATOM   633   O  O      . LEU A 1 39   ? 27.958  -74.178 15.527  1.00 39.42  ? 1401 LEU A O      1 
ATOM   634   C  CB     . LEU A 1 39   ? 27.925  -76.035 18.186  1.00 39.61  ? 1401 LEU A CB     1 
ATOM   635   C  CG     . LEU A 1 39   ? 28.694  -76.567 19.395  1.00 40.06  ? 1401 LEU A CG     1 
ATOM   636   C  CD1    . LEU A 1 39   ? 27.976  -77.754 19.993  1.00 40.24  ? 1401 LEU A CD1    1 
ATOM   637   C  CD2    . LEU A 1 39   ? 30.104  -76.950 18.984  1.00 41.21  ? 1401 LEU A CD2    1 
ATOM   638   H  H      . LEU A 1 39   ? 27.232  -74.122 19.552  1.00 45.71  ? 1401 LEU A H      1 
ATOM   639   H  HA     . LEU A 1 39   ? 29.128  -74.453 17.714  1.00 46.82  ? 1401 LEU A HA     1 
ATOM   640   H  HB2    . LEU A 1 39   ? 26.979  -76.158 18.361  1.00 47.53  ? 1401 LEU A HB2    1 
ATOM   641   H  HB3    . LEU A 1 39   ? 28.187  -76.560 17.414  1.00 47.53  ? 1401 LEU A HB3    1 
ATOM   642   H  HG     . LEU A 1 39   ? 28.751  -75.873 20.070  1.00 48.07  ? 1401 LEU A HG     1 
ATOM   643   H  HD11   . LEU A 1 39   ? 28.480  -78.076 20.756  1.00 48.29  ? 1401 LEU A HD11   1 
ATOM   644   H  HD12   . LEU A 1 39   ? 27.090  -77.477 20.274  1.00 48.29  ? 1401 LEU A HD12   1 
ATOM   645   H  HD13   . LEU A 1 39   ? 27.908  -78.452 19.323  1.00 48.29  ? 1401 LEU A HD13   1 
ATOM   646   H  HD21   . LEU A 1 39   ? 30.578  -77.286 19.761  1.00 49.46  ? 1401 LEU A HD21   1 
ATOM   647   H  HD22   . LEU A 1 39   ? 30.057  -77.638 18.302  1.00 49.46  ? 1401 LEU A HD22   1 
ATOM   648   H  HD23   . LEU A 1 39   ? 30.554  -76.166 18.634  1.00 49.46  ? 1401 LEU A HD23   1 
ATOM   649   N  N      . GLU A 1 40   ? 26.174  -73.701 16.823  1.00 43.45  ? 1402 GLU A N      1 
ATOM   650   C  CA     . GLU A 1 40   ? 25.378  -73.138 15.736  1.00 43.09  ? 1402 GLU A CA     1 
ATOM   651   C  C      . GLU A 1 40   ? 26.139  -71.976 15.112  1.00 43.17  ? 1402 GLU A C      1 
ATOM   652   O  O      . GLU A 1 40   ? 26.109  -71.776 13.898  1.00 43.51  ? 1402 GLU A O      1 
ATOM   653   C  CB     . GLU A 1 40   ? 24.012  -72.688 16.252  1.00 41.98  ? 1402 GLU A CB     1 
ATOM   654   C  CG     . GLU A 1 40   ? 23.253  -71.739 15.345  1.00 41.44  ? 1402 GLU A CG     1 
ATOM   655   C  CD     . GLU A 1 40   ? 22.008  -71.208 16.013  1.00 41.95  ? 1402 GLU A CD     1 
ATOM   656   O  OE1    . GLU A 1 40   ? 20.989  -71.930 16.032  1.00 46.28  ? 1402 GLU A OE1    1 
ATOM   657   O  OE2    . GLU A 1 40   ? 22.060  -70.079 16.547  1.00 46.74  1 1402 GLU A OE2    1 
ATOM   658   H  H      . GLU A 1 40   ? 25.762  -73.727 17.578  1.00 52.14  ? 1402 GLU A H      1 
ATOM   659   H  HA     . GLU A 1 40   ? 25.239  -73.815 15.054  1.00 51.70  ? 1402 GLU A HA     1 
ATOM   660   H  HB2    . GLU A 1 40   ? 23.458  -73.473 16.381  1.00 50.37  ? 1402 GLU A HB2    1 
ATOM   661   H  HB3    . GLU A 1 40   ? 24.138  -72.238 17.103  1.00 50.37  ? 1402 GLU A HB3    1 
ATOM   662   H  HG2    . GLU A 1 40   ? 23.822  -70.986 15.121  1.00 49.73  ? 1402 GLU A HG2    1 
ATOM   663   H  HG3    . GLU A 1 40   ? 22.988  -72.210 14.539  1.00 49.73  ? 1402 GLU A HG3    1 
ATOM   664   N  N      . GLN A 1 41   ? 26.817  -71.213 15.963  1.00 47.44  ? 1403 GLN A N      1 
ATOM   665   C  CA     . GLN A 1 41   ? 27.665  -70.117 15.520  1.00 47.62  ? 1403 GLN A CA     1 
ATOM   666   C  C      . GLN A 1 41   ? 28.949  -70.622 14.890  1.00 48.81  ? 1403 GLN A C      1 
ATOM   667   O  O      . GLN A 1 41   ? 29.303  -70.225 13.781  1.00 49.29  ? 1403 GLN A O      1 
ATOM   668   C  CB     . GLN A 1 41   ? 27.997  -69.193 16.691  1.00 47.07  ? 1403 GLN A CB     1 
ATOM   669   C  CG     . GLN A 1 41   ? 28.613  -67.874 16.272  1.00 47.10  ? 1403 GLN A CG     1 
ATOM   670   C  CD     . GLN A 1 41   ? 27.661  -66.993 15.498  1.00 53.62  ? 1403 GLN A CD     1 
ATOM   671   O  OE1    . GLN A 1 41   ? 26.482  -66.872 15.835  1.00 56.14  ? 1403 GLN A OE1    1 
ATOM   672   N  NE2    . GLN A 1 41   ? 28.170  -66.389 14.430  1.00 58.63  ? 1403 GLN A NE2    1 
ATOM   673   H  H      . GLN A 1 41   ? 26.801  -71.314 16.817  1.00 56.93  ? 1403 GLN A H      1 
ATOM   674   H  HA     . GLN A 1 41   ? 27.187  -69.598 14.854  1.00 57.15  ? 1403 GLN A HA     1 
ATOM   675   H  HB2    . GLN A 1 41   ? 27.180  -68.998 17.177  1.00 56.48  ? 1403 GLN A HB2    1 
ATOM   676   H  HB3    . GLN A 1 41   ? 28.627  -69.642 17.275  1.00 56.48  ? 1403 GLN A HB3    1 
ATOM   677   H  HG2    . GLN A 1 41   ? 28.889  -67.390 17.066  1.00 56.52  ? 1403 GLN A HG2    1 
ATOM   678   H  HG3    . GLN A 1 41   ? 29.382  -68.051 15.708  1.00 56.52  ? 1403 GLN A HG3    1 
ATOM   679   H  HE21   . GLN A 1 41   ? 28.994  -66.512 14.218  1.00 70.36  ? 1403 GLN A HE21   1 
ATOM   680   H  HE22   . GLN A 1 41   ? 27.675  -65.875 13.950  1.00 70.36  ? 1403 GLN A HE22   1 
ATOM   681   N  N      . ALA A 1 42   ? 29.641  -71.501 15.603  1.00 39.12  ? 1404 ALA A N      1 
ATOM   682   C  CA     . ALA A 1 42   ? 30.945  -71.970 15.167  1.00 40.28  ? 1404 ALA A CA     1 
ATOM   683   C  C      . ALA A 1 42   ? 30.833  -72.736 13.856  1.00 41.06  ? 1404 ALA A C      1 
ATOM   684   O  O      . ALA A 1 42   ? 31.731  -72.676 13.017  1.00 41.94  ? 1404 ALA A O      1 
ATOM   685   C  CB     . ALA A 1 42   ? 31.577  -72.834 16.242  1.00 40.71  ? 1404 ALA A CB     1 
ATOM   686   H  H      . ALA A 1 42   ? 29.376  -71.841 16.346  1.00 46.94  ? 1404 ALA A H      1 
ATOM   687   H  HA     . ALA A 1 42   ? 31.523  -71.205 15.019  1.00 48.34  ? 1404 ALA A HA     1 
ATOM   688   H  HB1    . ALA A 1 42   ? 32.445  -73.137 15.933  1.00 48.85  ? 1404 ALA A HB1    1 
ATOM   689   H  HB2    . ALA A 1 42   ? 31.678  -72.308 17.051  1.00 48.85  ? 1404 ALA A HB2    1 
ATOM   690   H  HB3    . ALA A 1 42   ? 31.002  -73.596 16.413  1.00 48.85  ? 1404 ALA A HB3    1 
ATOM   691   N  N      . CYS A 1 43   ? 29.727  -73.451 13.677  1.00 51.23  ? 1405 CYS A N      1 
ATOM   692   C  CA     . CYS A 1 43   ? 29.486  -74.155 12.424  1.00 51.95  ? 1405 CYS A CA     1 
ATOM   693   C  C      . CYS A 1 43   ? 29.252  -73.130 11.325  1.00 55.04  ? 1405 CYS A C      1 
ATOM   694   O  O      . CYS A 1 43   ? 29.819  -73.236 10.238  1.00 57.63  ? 1405 CYS A O      1 
ATOM   695   C  CB     . CYS A 1 43   ? 28.293  -75.110 12.529  1.00 51.69  ? 1405 CYS A CB     1 
ATOM   696   S  SG     . CYS A 1 43   ? 28.050  -76.125 11.043  1.00 54.23  ? 1405 CYS A SG     1 
ATOM   697   H  H      . CYS A 1 43   ? 29.103  -73.543 14.262  1.00 61.47  ? 1405 CYS A H      1 
ATOM   698   H  HA     . CYS A 1 43   ? 30.272  -74.675 12.194  1.00 62.34  ? 1405 CYS A HA     1 
ATOM   699   H  HB2    . CYS A 1 43   ? 28.435  -75.709 13.279  1.00 62.03  ? 1405 CYS A HB2    1 
ATOM   700   H  HB3    . CYS A 1 43   ? 27.486  -74.591 12.670  1.00 62.03  ? 1405 CYS A HB3    1 
ATOM   701   H  HG     . CYS A 1 43   ? 27.101  -76.840 11.209  1.00 65.07  ? 1405 CYS A HG     1 
ATOM   702   N  N      . LYS A 1 44   ? 28.414  -72.139 11.611  1.00 50.74  ? 1406 LYS A N      1 
ATOM   703   C  CA     . LYS A 1 44   ? 28.124  -71.093 10.641  1.00 50.57  ? 1406 LYS A CA     1 
ATOM   704   C  C      . LYS A 1 44   ? 29.391  -70.327 10.278  1.00 51.20  ? 1406 LYS A C      1 
ATOM   705   O  O      . LYS A 1 44   ? 29.594  -69.967 9.122   1.00 51.79  ? 1406 LYS A O      1 
ATOM   706   C  CB     . LYS A 1 44   ? 27.076  -70.119 11.181  1.00 49.30  ? 1406 LYS A CB     1 
ATOM   707   C  CG     . LYS A 1 44   ? 26.661  -69.061 10.165  1.00 49.16  ? 1406 LYS A CG     1 
ATOM   708   C  CD     . LYS A 1 44   ? 25.495  -68.201 10.643  1.00 47.96  ? 1406 LYS A CD     1 
ATOM   709   C  CE     . LYS A 1 44   ? 25.925  -67.243 11.748  1.00 48.22  ? 1406 LYS A CE     1 
ATOM   710   N  NZ     . LYS A 1 44   ? 24.821  -66.351 12.202  1.00 47.66  1 1406 LYS A NZ     1 
ATOM   711   H  H      . LYS A 1 44   ? 28.001  -72.050 12.360  1.00 60.88  ? 1406 LYS A H      1 
ATOM   712   H  HA     . LYS A 1 44   ? 27.774  -71.498 9.832   1.00 60.68  ? 1406 LYS A HA     1 
ATOM   713   H  HB2    . LYS A 1 44   ? 26.283  -70.618 11.433  1.00 59.16  ? 1406 LYS A HB2    1 
ATOM   714   H  HB3    . LYS A 1 44   ? 27.440  -69.662 11.955  1.00 59.16  ? 1406 LYS A HB3    1 
ATOM   715   H  HG2    . LYS A 1 44   ? 27.415  -68.475 9.994   1.00 58.99  ? 1406 LYS A HG2    1 
ATOM   716   H  HG3    . LYS A 1 44   ? 26.392  -69.501 9.343   1.00 58.99  ? 1406 LYS A HG3    1 
ATOM   717   H  HD2    . LYS A 1 44   ? 25.158  -67.677 9.900   1.00 57.55  ? 1406 LYS A HD2    1 
ATOM   718   H  HD3    . LYS A 1 44   ? 24.797  -68.776 10.994  1.00 57.55  ? 1406 LYS A HD3    1 
ATOM   719   H  HE2    . LYS A 1 44   ? 26.228  -67.758 12.512  1.00 57.87  ? 1406 LYS A HE2    1 
ATOM   720   H  HE3    . LYS A 1 44   ? 26.646  -66.684 11.417  1.00 57.87  ? 1406 LYS A HE3    1 
ATOM   721   H  HZ1    . LYS A 1 44   ? 25.113  -65.810 12.845  1.00 57.19  ? 1406 LYS A HZ1    1 
ATOM   722   H  HZ2    . LYS A 1 44   ? 24.528  -65.860 11.520  1.00 57.19  ? 1406 LYS A HZ2    1 
ATOM   723   H  HZ3    . LYS A 1 44   ? 24.147  -66.839 12.518  1.00 57.19  ? 1406 LYS A HZ3    1 
ATOM   724   N  N      . GLU A 1 45   ? 30.243  -70.082 11.267  1.00 53.68  ? 1407 GLU A N      1 
ATOM   725   C  CA     . GLU A 1 45   ? 31.500  -69.379 11.032  1.00 54.33  ? 1407 GLU A CA     1 
ATOM   726   C  C      . GLU A 1 45   ? 32.464  -70.183 10.160  1.00 55.70  ? 1407 GLU A C      1 
ATOM   727   O  O      . GLU A 1 45   ? 33.047  -69.639 9.223   1.00 56.37  ? 1407 GLU A O      1 
ATOM   728   C  CB     . GLU A 1 45   ? 32.153  -69.007 12.366  1.00 54.00  ? 1407 GLU A CB     1 
ATOM   729   C  CG     . GLU A 1 45   ? 31.487  -67.805 13.041  1.00 52.87  ? 1407 GLU A CG     1 
ATOM   730   C  CD     . GLU A 1 45   ? 32.148  -67.407 14.349  1.00 52.63  ? 1407 GLU A CD     1 
ATOM   731   O  OE1    . GLU A 1 45   ? 33.294  -67.843 14.595  1.00 53.44  ? 1407 GLU A OE1    1 
ATOM   732   O  OE2    . GLU A 1 45   ? 31.527  -66.640 15.117  1.00 51.70  1 1407 GLU A OE2    1 
ATOM   733   H  H      . GLU A 1 45   ? 30.118  -70.313 12.086  1.00 64.42  ? 1407 GLU A H      1 
ATOM   734   H  HA     . GLU A 1 45   ? 31.305  -68.552 10.563  1.00 65.20  ? 1407 GLU A HA     1 
ATOM   735   H  HB2    . GLU A 1 45   ? 32.089  -69.763 12.970  1.00 64.80  ? 1407 GLU A HB2    1 
ATOM   736   H  HB3    . GLU A 1 45   ? 33.085  -68.785 12.211  1.00 64.80  ? 1407 GLU A HB3    1 
ATOM   737   H  HG2    . GLU A 1 45   ? 31.531  -67.043 12.441  1.00 63.44  ? 1407 GLU A HG2    1 
ATOM   738   H  HG3    . GLU A 1 45   ? 30.561  -68.024 13.230  1.00 63.44  ? 1407 GLU A HG3    1 
ATOM   739   N  N      . ASP A 1 46   ? 32.629  -71.470 10.458  1.00 61.39  ? 1408 ASP A N      1 
ATOM   740   C  CA     . ASP A 1 46   ? 33.564  -72.305 9.704   1.00 62.29  ? 1408 ASP A CA     1 
ATOM   741   C  C      . ASP A 1 46   ? 33.050  -72.541 8.291   1.00 65.77  ? 1408 ASP A C      1 
ATOM   742   O  O      . ASP A 1 46   ? 33.831  -72.600 7.343   1.00 67.61  ? 1408 ASP A O      1 
ATOM   743   C  CB     . ASP A 1 46   ? 33.804  -73.646 10.403  1.00 62.13  ? 1408 ASP A CB     1 
ATOM   744   C  CG     . ASP A 1 46   ? 34.634  -73.510 11.664  1.00 62.40  ? 1408 ASP A CG     1 
ATOM   745   O  OD1    . ASP A 1 46   ? 35.634  -72.759 11.641  1.00 62.94  ? 1408 ASP A OD1    1 
ATOM   746   O  OD2    . ASP A 1 46   ? 34.288  -74.154 12.676  1.00 62.06  1 1408 ASP A OD2    1 
ATOM   747   H  H      . ASP A 1 46   ? 32.215  -71.883 11.088  1.00 73.67  ? 1408 ASP A H      1 
ATOM   748   H  HA     . ASP A 1 46   ? 34.416  -71.845 9.639   1.00 74.75  ? 1408 ASP A HA     1 
ATOM   749   H  HB2    . ASP A 1 46   ? 32.949  -74.033 10.648  1.00 74.56  ? 1408 ASP A HB2    1 
ATOM   750   H  HB3    . ASP A 1 46   ? 34.275  -74.240 9.797   1.00 74.56  ? 1408 ASP A HB3    1 
ATOM   751   N  N      . LEU A 1 47   ? 31.737  -72.699 8.155   1.00 44.35  ? 1409 LEU A N      1 
ATOM   752   C  CA     . LEU A 1 47   ? 31.131  -72.817 6.834   1.00 44.77  ? 1409 LEU A CA     1 
ATOM   753   C  C      . LEU A 1 47   ? 31.479  -71.605 5.988   1.00 44.98  ? 1409 LEU A C      1 
ATOM   754   O  O      . LEU A 1 47   ? 31.915  -71.744 4.847   1.00 46.06  ? 1409 LEU A O      1 
ATOM   755   C  CB     . LEU A 1 47   ? 29.607  -72.966 6.937   1.00 43.82  ? 1409 LEU A CB     1 
ATOM   756   C  CG     . LEU A 1 47   ? 29.041  -74.361 7.216   1.00 43.98  ? 1409 LEU A CG     1 
ATOM   757   C  CD1    . LEU A 1 47   ? 27.520  -74.322 7.346   1.00 42.99  ? 1409 LEU A CD1    1 
ATOM   758   C  CD2    . LEU A 1 47   ? 29.451  -75.333 6.117   1.00 45.39  ? 1409 LEU A CD2    1 
ATOM   759   H  H      . LEU A 1 47   ? 31.178  -72.741 8.807   1.00 53.21  ? 1409 LEU A H      1 
ATOM   760   H  HA     . LEU A 1 47   ? 31.483  -73.606 6.392   1.00 53.73  ? 1409 LEU A HA     1 
ATOM   761   H  HB2    . LEU A 1 47   ? 29.298  -72.388 7.651   1.00 52.58  ? 1409 LEU A HB2    1 
ATOM   762   H  HB3    . LEU A 1 47   ? 29.221  -72.667 6.098   1.00 52.58  ? 1409 LEU A HB3    1 
ATOM   763   H  HG     . LEU A 1 47   ? 29.405  -74.687 8.054   1.00 52.78  ? 1409 LEU A HG     1 
ATOM   764   H  HD11   . LEU A 1 47   ? 27.195  -75.219 7.522   1.00 51.58  ? 1409 LEU A HD11   1 
ATOM   765   H  HD12   . LEU A 1 47   ? 27.281  -73.734 8.079   1.00 51.58  ? 1409 LEU A HD12   1 
ATOM   766   H  HD13   . LEU A 1 47   ? 27.141  -73.989 6.517   1.00 51.58  ? 1409 LEU A HD13   1 
ATOM   767   H  HD21   . LEU A 1 47   ? 29.081  -76.207 6.315   1.00 54.47  ? 1409 LEU A HD21   1 
ATOM   768   H  HD22   . LEU A 1 47   ? 29.106  -75.013 5.268   1.00 54.47  ? 1409 LEU A HD22   1 
ATOM   769   H  HD23   . LEU A 1 47   ? 30.419  -75.382 6.084   1.00 54.47  ? 1409 LEU A HD23   1 
ATOM   770   N  N      . GLU A 1 48   ? 31.285  -70.417 6.548   1.00 44.04  ? 1410 GLU A N      1 
ATOM   771   C  CA     . GLU A 1 48   ? 31.625  -69.190 5.843   1.00 44.25  ? 1410 GLU A CA     1 
ATOM   772   C  C      . GLU A 1 48   ? 33.095  -69.156 5.453   1.00 45.47  ? 1410 GLU A C      1 
ATOM   773   O  O      . GLU A 1 48   ? 33.434  -68.696 4.366   1.00 46.27  ? 1410 GLU A O      1 
ATOM   774   C  CB     . GLU A 1 48   ? 31.278  -67.958 6.678   1.00 43.09  ? 1410 GLU A CB     1 
ATOM   775   C  CG     . GLU A 1 48   ? 29.792  -67.625 6.664   1.00 42.04  ? 1410 GLU A CG     1 
ATOM   776   C  CD     . GLU A 1 48   ? 29.478  -66.279 7.287   1.00 41.08  ? 1410 GLU A CD     1 
ATOM   777   O  OE1    . GLU A 1 48   ? 30.339  -65.375 7.235   1.00 41.42  ? 1410 GLU A OE1    1 
ATOM   778   O  OE2    . GLU A 1 48   ? 28.363  -66.127 7.828   1.00 40.03  1 1410 GLU A OE2    1 
ATOM   779   H  H      . GLU A 1 48   ? 30.959  -70.295 7.335   1.00 52.84  ? 1410 GLU A H      1 
ATOM   780   H  HA     . GLU A 1 48   ? 31.103  -69.147 5.026   1.00 53.10  ? 1410 GLU A HA     1 
ATOM   781   H  HB2    . GLU A 1 48   ? 31.540  -68.117 7.598   1.00 51.71  ? 1410 GLU A HB2    1 
ATOM   782   H  HB3    . GLU A 1 48   ? 31.759  -67.193 6.326   1.00 51.71  ? 1410 GLU A HB3    1 
ATOM   783   H  HG2    . GLU A 1 48   ? 29.482  -67.608 5.745   1.00 50.45  ? 1410 GLU A HG2    1 
ATOM   784   H  HG3    . GLU A 1 48   ? 29.313  -68.304 7.163   1.00 50.45  ? 1410 GLU A HG3    1 
ATOM   785   N  N      . GLU A 1 49   ? 33.969  -69.637 6.331   1.00 45.68  ? 1411 GLU A N      1 
ATOM   786   C  CA     . GLU A 1 49   ? 35.389  -69.645 6.015   1.00 46.88  ? 1411 GLU A CA     1 
ATOM   787   C  C      . GLU A 1 49   ? 35.613  -70.582 4.832   1.00 48.15  ? 1411 GLU A C      1 
ATOM   788   O  O      . GLU A 1 49   ? 36.431  -70.299 3.967   1.00 49.23  ? 1411 GLU A O      1 
ATOM   789   C  CB     . GLU A 1 49   ? 36.245  -70.071 7.218   1.00 46.91  ? 1411 GLU A CB     1 
ATOM   790   C  CG     . GLU A 1 49   ? 37.751  -69.955 6.958   1.00 48.14  ? 1411 GLU A CG     1 
ATOM   791   C  CD     . GLU A 1 49   ? 38.610  -70.300 8.166   1.00 48.20  ? 1411 GLU A CD     1 
ATOM   792   O  OE1    . GLU A 1 49   ? 38.095  -70.277 9.303   1.00 47.17  ? 1411 GLU A OE1    1 
ATOM   793   O  OE2    . GLU A 1 49   ? 39.807  -70.597 7.972   1.00 49.34  1 1411 GLU A OE2    1 
ATOM   794   H  H      . GLU A 1 49   ? 33.769  -69.959 7.103   1.00 54.82  ? 1411 GLU A H      1 
ATOM   795   H  HA     . GLU A 1 49   ? 35.662  -68.753 5.751   1.00 56.26  ? 1411 GLU A HA     1 
ATOM   796   H  HB2    . GLU A 1 49   ? 36.028  -69.504 7.975   1.00 56.29  ? 1411 GLU A HB2    1 
ATOM   797   H  HB3    . GLU A 1 49   ? 36.050  -70.997 7.431   1.00 56.29  ? 1411 GLU A HB3    1 
ATOM   798   H  HG2    . GLU A 1 49   ? 37.992  -70.561 6.240   1.00 57.77  ? 1411 GLU A HG2    1 
ATOM   799   H  HG3    . GLU A 1 49   ? 37.954  -69.042 6.701   1.00 57.77  ? 1411 GLU A HG3    1 
ATOM   800   N  N      . LEU A 1 50   ? 34.870  -71.684 4.783   1.00 48.09  ? 1412 LEU A N      1 
ATOM   801   C  CA     . LEU A 1 50   ? 35.035  -72.661 3.708   1.00 49.35  ? 1412 LEU A CA     1 
ATOM   802   C  C      . LEU A 1 50   ? 34.517  -72.160 2.360   1.00 49.73  ? 1412 LEU A C      1 
ATOM   803   O  O      . LEU A 1 50   ? 35.094  -72.463 1.319   1.00 51.04  ? 1412 LEU A O      1 
ATOM   804   C  CB     . LEU A 1 50   ? 34.320  -73.968 4.050   1.00 49.21  ? 1412 LEU A CB     1 
ATOM   805   C  CG     . LEU A 1 50   ? 34.943  -74.882 5.108   1.00 49.39  ? 1412 LEU A CG     1 
ATOM   806   C  CD1    . LEU A 1 50   ? 33.958  -75.981 5.433   1.00 49.07  ? 1412 LEU A CD1    1 
ATOM   807   C  CD2    . LEU A 1 50   ? 36.282  -75.467 4.690   1.00 50.91  ? 1412 LEU A CD2    1 
ATOM   808   H  H      . LEU A 1 50   ? 34.265  -71.890 5.358   1.00 57.71  ? 1412 LEU A H      1 
ATOM   809   H  HA     . LEU A 1 50   ? 35.979  -72.857 3.608   1.00 59.22  ? 1412 LEU A HA     1 
ATOM   810   H  HB2    . LEU A 1 50   ? 33.428  -73.747 4.360   1.00 59.05  ? 1412 LEU A HB2    1 
ATOM   811   H  HB3    . LEU A 1 50   ? 34.251  -74.490 3.235   1.00 59.05  ? 1412 LEU A HB3    1 
ATOM   812   H  HG     . LEU A 1 50   ? 35.086  -74.366 5.917   1.00 59.27  ? 1412 LEU A HG     1 
ATOM   813   H  HD11   . LEU A 1 50   ? 34.346  -76.564 6.104   1.00 58.89  ? 1412 LEU A HD11   1 
ATOM   814   H  HD12   . LEU A 1 50   ? 33.141  -75.582 5.773   1.00 58.89  ? 1412 LEU A HD12   1 
ATOM   815   H  HD13   . LEU A 1 50   ? 33.769  -76.484 4.626   1.00 58.89  ? 1412 LEU A HD13   1 
ATOM   816   H  HD21   . LEU A 1 50   ? 36.616  -76.032 5.404   1.00 61.09  ? 1412 LEU A HD21   1 
ATOM   817   H  HD22   . LEU A 1 50   ? 36.159  -75.991 3.883   1.00 61.09  ? 1412 LEU A HD22   1 
ATOM   818   H  HD23   . LEU A 1 50   ? 36.904  -74.742 4.522   1.00 61.09  ? 1412 LEU A HD23   1 
ATOM   819   N  N      . VAL A 1 51   ? 33.409  -71.425 2.378   1.00 65.89  ? 1413 VAL A N      1 
ATOM   820   C  CA     . VAL A 1 51   ? 32.848  -70.858 1.154   1.00 66.20  ? 1413 VAL A CA     1 
ATOM   821   C  C      . VAL A 1 51   ? 33.806  -69.837 0.558   1.00 66.95  ? 1413 VAL A C      1 
ATOM   822   O  O      . VAL A 1 51   ? 34.121  -69.880 -0.632  1.00 68.14  ? 1413 VAL A O      1 
ATOM   823   C  CB     . VAL A 1 51   ? 31.471  -70.200 1.406   1.00 64.84  ? 1413 VAL A CB     1 
ATOM   824   C  CG1    . VAL A 1 51   ? 31.055  -69.305 0.232   1.00 65.15  ? 1413 VAL A CG1    1 
ATOM   825   C  CG2    . VAL A 1 51   ? 30.412  -71.271 1.673   1.00 64.36  ? 1413 VAL A CG2    1 
ATOM   826   H  H      . VAL A 1 51   ? 32.960  -71.239 3.088   1.00 79.07  ? 1413 VAL A H      1 
ATOM   827   H  HA     . VAL A 1 51   ? 32.726  -71.568 0.505   1.00 79.44  ? 1413 VAL A HA     1 
ATOM   828   H  HB     . VAL A 1 51   ? 31.533  -69.642 2.197   1.00 77.81  ? 1413 VAL A HB     1 
ATOM   829   H  HG11   . VAL A 1 51   ? 30.190  -68.912 0.427   1.00 78.18  ? 1413 VAL A HG11   1 
ATOM   830   H  HG12   . VAL A 1 51   ? 31.718  -68.606 0.118   1.00 78.18  ? 1413 VAL A HG12   1 
ATOM   831   H  HG13   . VAL A 1 51   ? 31.001  -69.844 -0.572  1.00 78.18  ? 1413 VAL A HG13   1 
ATOM   832   H  HG21   . VAL A 1 51   ? 29.558  -70.838 1.828   1.00 77.23  ? 1413 VAL A HG21   1 
ATOM   833   H  HG22   . VAL A 1 51   ? 30.352  -71.855 0.900   1.00 77.23  ? 1413 VAL A HG22   1 
ATOM   834   H  HG23   . VAL A 1 51   ? 30.671  -71.783 2.455   1.00 77.23  ? 1413 VAL A HG23   1 
ATOM   835   N  N      . SER A 1 52   ? 34.264  -68.917 1.398   1.00 49.06  ? 1414 SER A N      1 
ATOM   836   C  CA     . SER A 1 52   ? 35.124  -67.831 0.952   1.00 49.68  ? 1414 SER A CA     1 
ATOM   837   C  C      . SER A 1 52   ? 36.481  -68.350 0.486   1.00 51.19  ? 1414 SER A C      1 
ATOM   838   O  O      . SER A 1 52   ? 37.166  -67.683 -0.289  1.00 52.14  ? 1414 SER A O      1 
ATOM   839   C  CB     . SER A 1 52   ? 35.312  -66.811 2.073   1.00 48.67  ? 1414 SER A CB     1 
ATOM   840   O  OG     . SER A 1 52   ? 35.687  -67.453 3.279   1.00 48.24  ? 1414 SER A OG     1 
ATOM   841   H  H      . SER A 1 52   ? 34.088  -68.901 2.240   1.00 58.87  ? 1414 SER A H      1 
ATOM   842   H  HA     . SER A 1 52   ? 34.702  -67.380 0.204   1.00 59.61  ? 1414 SER A HA     1 
ATOM   843   H  HB2    . SER A 1 52   ? 36.008  -66.185 1.818   1.00 58.41  ? 1414 SER A HB2    1 
ATOM   844   H  HB3    . SER A 1 52   ? 34.476  -66.338 2.213   1.00 58.41  ? 1414 SER A HB3    1 
ATOM   845   H  HG     . SER A 1 52   ? 35.093  -67.998 3.512   1.00 57.89  ? 1414 SER A HG     1 
ATOM   846   N  N      . MET A 1 53   ? 36.865  -69.535 0.956   1.00 51.49  ? 1415 MET A N      1 
ATOM   847   C  CA     . MET A 1 53   ? 38.126  -70.150 0.547   1.00 52.98  ? 1415 MET A CA     1 
ATOM   848   C  C      . MET A 1 53   ? 38.187  -70.290 -0.959  1.00 54.30  ? 1415 MET A C      1 
ATOM   849   O  O      . MET A 1 53   ? 39.256  -70.229 -1.560  1.00 55.61  ? 1415 MET A O      1 
ATOM   850   C  CB     . MET A 1 53   ? 38.298  -71.536 1.162   1.00 53.14  ? 1415 MET A CB     1 
ATOM   851   C  CG     . MET A 1 53   ? 38.902  -71.581 2.540   1.00 52.59  ? 1415 MET A CG     1 
ATOM   852   S  SD     . MET A 1 53   ? 38.579  -73.194 3.262   1.00 52.50  ? 1415 MET A SD     1 
ATOM   853   C  CE     . MET A 1 53   ? 39.164  -72.950 4.933   1.00 51.69  ? 1415 MET A CE     1 
ATOM   854   H  H      . MET A 1 53   ? 36.412  -70.004 1.515   1.00 61.79  ? 1415 MET A H      1 
ATOM   855   H  HA     . MET A 1 53   ? 38.863  -69.594 0.845   1.00 63.57  ? 1415 MET A HA     1 
ATOM   856   H  HB2    . MET A 1 53   ? 37.425  -71.956 1.216   1.00 63.77  ? 1415 MET A HB2    1 
ATOM   857   H  HB3    . MET A 1 53   ? 38.870  -72.059 0.580   1.00 63.77  ? 1415 MET A HB3    1 
ATOM   858   H  HG2    . MET A 1 53   ? 39.861  -71.451 2.483   1.00 63.11  ? 1415 MET A HG2    1 
ATOM   859   H  HG3    . MET A 1 53   ? 38.495  -70.902 3.100   1.00 63.11  ? 1415 MET A HG3    1 
ATOM   860   H  HE1    . MET A 1 53   ? 39.039  -73.772 5.434   1.00 62.03  ? 1415 MET A HE1    1 
ATOM   861   H  HE2    . MET A 1 53   ? 40.105  -72.718 4.907   1.00 62.03  ? 1415 MET A HE2    1 
ATOM   862   H  HE3    . MET A 1 53   ? 38.657  -72.232 5.343   1.00 62.03  ? 1415 MET A HE3    1 
ATOM   863   N  N      . LYS A 1 54   ? 37.022  -70.482 -1.562  1.00 68.12  ? 1416 LYS A N      1 
ATOM   864   C  CA     . LYS A 1 54   ? 36.930  -70.752 -2.987  1.00 69.39  ? 1416 LYS A CA     1 
ATOM   865   C  C      . LYS A 1 54   ? 37.446  -69.569 -3.800  1.00 70.10  ? 1416 LYS A C      1 
ATOM   866   O  O      . LYS A 1 54   ? 37.700  -69.693 -4.999  1.00 71.45  ? 1416 LYS A O      1 
ATOM   867   C  CB     . LYS A 1 54   ? 35.483  -71.084 -3.354  1.00 68.77  ? 1416 LYS A CB     1 
ATOM   868   C  CG     . LYS A 1 54   ? 34.936  -72.298 -2.599  1.00 68.19  ? 1416 LYS A CG     1 
ATOM   869   C  CD     . LYS A 1 54   ? 33.472  -72.564 -2.909  1.00 67.54  ? 1416 LYS A CD     1 
ATOM   870   C  CE     . LYS A 1 54   ? 32.920  -73.696 -2.054  1.00 66.92  ? 1416 LYS A CE     1 
ATOM   871   N  NZ     . LYS A 1 54   ? 31.461  -73.890 -2.271  1.00 66.22  1 1416 LYS A NZ     1 
ATOM   872   H  H      . LYS A 1 54   ? 36.261  -70.460 -1.162  1.00 81.74  ? 1416 LYS A H      1 
ATOM   873   H  HA     . LYS A 1 54   ? 37.478  -71.524 -3.198  1.00 83.26  ? 1416 LYS A HA     1 
ATOM   874   H  HB2    . LYS A 1 54   ? 34.921  -70.322 -3.143  1.00 82.52  ? 1416 LYS A HB2    1 
ATOM   875   H  HB3    . LYS A 1 54   ? 35.435  -71.277 -4.304  1.00 82.52  ? 1416 LYS A HB3    1 
ATOM   876   H  HG2    . LYS A 1 54   ? 35.445  -73.084 -2.851  1.00 81.82  ? 1416 LYS A HG2    1 
ATOM   877   H  HG3    . LYS A 1 54   ? 35.018  -72.140 -1.645  1.00 81.82  ? 1416 LYS A HG3    1 
ATOM   878   H  HD2    . LYS A 1 54   ? 32.955  -71.764 -2.726  1.00 81.05  ? 1416 LYS A HD2    1 
ATOM   879   H  HD3    . LYS A 1 54   ? 33.382  -72.816 -3.841  1.00 81.05  ? 1416 LYS A HD3    1 
ATOM   880   H  HE2    . LYS A 1 54   ? 33.373  -74.522 -2.285  1.00 80.30  ? 1416 LYS A HE2    1 
ATOM   881   H  HE3    . LYS A 1 54   ? 33.062  -73.487 -1.117  1.00 80.30  ? 1416 LYS A HE3    1 
ATOM   882   H  HZ1    . LYS A 1 54   ? 31.163  -74.555 -1.761  1.00 79.46  ? 1416 LYS A HZ1    1 
ATOM   883   H  HZ2    . LYS A 1 54   ? 31.021  -73.145 -2.061  1.00 79.46  ? 1416 LYS A HZ2    1 
ATOM   884   H  HZ3    . LYS A 1 54   ? 31.304  -74.087 -3.125  1.00 79.46  ? 1416 LYS A HZ3    1 
ATOM   885   N  N      . ALA A 1 55   ? 37.603  -68.425 -3.137  1.00 64.57  ? 1417 ALA A N      1 
ATOM   886   C  CA     . ALA A 1 55   ? 38.208  -67.249 -3.750  1.00 65.26  ? 1417 ALA A CA     1 
ATOM   887   C  C      . ALA A 1 55   ? 39.709  -67.440 -4.029  1.00 66.76  ? 1417 ALA A C      1 
ATOM   888   O  O      . ALA A 1 55   ? 40.243  -66.858 -4.974  1.00 67.93  ? 1417 ALA A O      1 
ATOM   889   C  CB     . ALA A 1 55   ? 37.987  -66.028 -2.862  1.00 63.99  ? 1417 ALA A CB     1 
ATOM   890   H  H      . ALA A 1 55   ? 37.363  -68.306 -2.320  1.00 77.48  ? 1417 ALA A H      1 
ATOM   891   H  HA     . ALA A 1 55   ? 37.770  -67.080 -4.598  1.00 78.32  ? 1417 ALA A HA     1 
ATOM   892   H  HB1    . ALA A 1 55   ? 38.394  -65.255 -3.282  1.00 76.79  ? 1417 ALA A HB1    1 
ATOM   893   H  HB2    . ALA A 1 55   ? 37.034  -65.884 -2.756  1.00 76.79  ? 1417 ALA A HB2    1 
ATOM   894   H  HB3    . ALA A 1 55   ? 38.395  -66.189 -1.997  1.00 76.79  ? 1417 ALA A HB3    1 
ATOM   895   N  N      . SER A 1 56   ? 40.382  -68.259 -3.218  1.00 63.60  ? 1418 SER A N      1 
ATOM   896   C  CA     . SER A 1 56   ? 41.839  -68.422 -3.316  1.00 64.93  ? 1418 SER A CA     1 
ATOM   897   C  C      . SER A 1 56   ? 42.298  -69.015 -4.643  1.00 72.28  ? 1418 SER A C      1 
ATOM   898   O  O      . SER A 1 56   ? 41.629  -69.869 -5.226  1.00 85.39  ? 1418 SER A O      1 
ATOM   899   C  CB     . SER A 1 56   ? 42.360  -69.304 -2.179  1.00 64.61  ? 1418 SER A CB     1 
ATOM   900   O  OG     . SER A 1 56   ? 43.747  -69.559 -2.343  1.00 66.01  ? 1418 SER A OG     1 
ATOM   901   H  H      . SER A 1 56   ? 40.018  -68.735 -2.601  1.00 76.32  ? 1418 SER A H      1 
ATOM   902   H  HA     . SER A 1 56   ? 42.254  -67.550 -3.225  1.00 77.91  ? 1418 SER A HA     1 
ATOM   903   H  HB2    . SER A 1 56   ? 42.219  -68.849 -1.334  1.00 77.54  ? 1418 SER A HB2    1 
ATOM   904   H  HB3    . SER A 1 56   ? 41.880  -70.148 -2.187  1.00 77.54  ? 1418 SER A HB3    1 
ATOM   905   H  HG     . SER A 1 56   ? 44.027  -70.043 -1.716  1.00 79.22  ? 1418 SER A HG     1 
ATOM   906   N  N      . ASN A 1 57   ? 43.458  -68.552 -5.104  1.00 112.70 ? 1419 ASN A N      1 
ATOM   907   C  CA     . ASN A 1 57   ? 44.019  -68.993 -6.376  1.00 115.43 ? 1419 ASN A CA     1 
ATOM   908   C  C      . ASN A 1 57   ? 44.758  -70.316 -6.266  1.00 115.55 ? 1419 ASN A C      1 
ATOM   909   O  O      . ASN A 1 57   ? 44.966  -71.009 -7.262  1.00 115.76 ? 1419 ASN A O      1 
ATOM   910   C  CB     . ASN A 1 57   ? 44.988  -67.937 -6.904  1.00 114.79 ? 1419 ASN A CB     1 
ATOM   911   C  CG     . ASN A 1 57   ? 44.317  -66.609 -7.180  1.00 114.57 ? 1419 ASN A CG     1 
ATOM   912   O  OD1    . ASN A 1 57   ? 43.163  -66.390 -6.809  1.00 114.76 ? 1419 ASN A OD1    1 
ATOM   913   N  ND2    . ASN A 1 57   ? 45.046  -65.705 -7.823  1.00 114.08 ? 1419 ASN A ND2    1 
ATOM   914   H  H      . ASN A 1 57   ? 43.944  -67.974 -4.693  1.00 135.24 ? 1419 ASN A H      1 
ATOM   915   H  HA     . ASN A 1 57   ? 43.302  -69.098 -7.021  1.00 138.51 ? 1419 ASN A HA     1 
ATOM   916   H  HB2    . ASN A 1 57   ? 45.684  -67.790 -6.245  1.00 137.75 ? 1419 ASN A HB2    1 
ATOM   917   H  HB3    . ASN A 1 57   ? 45.378  -68.254 -7.734  1.00 137.75 ? 1419 ASN A HB3    1 
ATOM   918   H  HD21   . ASN A 1 57   ? 44.712  -64.934 -8.005  1.00 136.90 ? 1419 ASN A HD21   1 
ATOM   919   H  HD22   . ASN A 1 57   ? 45.852  -65.891 -8.058  1.00 136.90 ? 1419 ASN A HD22   1 
ATOM   920   N  N      . TYR A 1 58   ? 45.151  -70.658 -5.046  1.00 112.62 ? 1420 TYR A N      1 
ATOM   921   C  CA     . TYR A 1 58   ? 45.849  -71.903 -4.773  1.00 112.51 ? 1420 TYR A CA     1 
ATOM   922   C  C      . TYR A 1 58   ? 44.895  -72.999 -4.277  1.00 114.02 ? 1420 TYR A C      1 
ATOM   923   O  O      . TYR A 1 58   ? 45.321  -74.105 -3.940  1.00 117.08 ? 1420 TYR A O      1 
ATOM   924   C  CB     . TYR A 1 58   ? 46.970  -71.643 -3.763  1.00 106.93 ? 1420 TYR A CB     1 
ATOM   925   C  CG     . TYR A 1 58   ? 47.959  -70.557 -4.175  1.00 104.89 ? 1420 TYR A CG     1 
ATOM   926   C  CD1    . TYR A 1 58   ? 47.624  -69.207 -4.117  1.00 103.58 ? 1420 TYR A CD1    1 
ATOM   927   C  CD2    . TYR A 1 58   ? 49.240  -70.891 -4.606  1.00 104.94 ? 1420 TYR A CD2    1 
ATOM   928   C  CE1    . TYR A 1 58   ? 48.534  -68.225 -4.495  1.00 103.36 ? 1420 TYR A CE1    1 
ATOM   929   C  CE2    . TYR A 1 58   ? 50.153  -69.916 -4.983  1.00 105.85 ? 1420 TYR A CE2    1 
ATOM   930   C  CZ     . TYR A 1 58   ? 49.796  -68.587 -4.922  1.00 105.06 ? 1420 TYR A CZ     1 
ATOM   931   O  OH     . TYR A 1 58   ? 50.700  -67.616 -5.293  1.00 106.05 ? 1420 TYR A OH     1 
ATOM   932   H  H      . TYR A 1 58   ? 45.021  -70.174 -4.347  1.00 135.14 ? 1420 TYR A H      1 
ATOM   933   H  HA     . TYR A 1 58   ? 46.259  -72.218 -5.594  1.00 135.02 ? 1420 TYR A HA     1 
ATOM   934   H  HB2    . TYR A 1 58   ? 46.571  -71.373 -2.921  1.00 128.31 ? 1420 TYR A HB2    1 
ATOM   935   H  HB3    . TYR A 1 58   ? 47.471  -72.464 -3.638  1.00 128.31 ? 1420 TYR A HB3    1 
ATOM   936   H  HD1    . TYR A 1 58   ? 46.775  -68.958 -3.831  1.00 124.29 ? 1420 TYR A HD1    1 
ATOM   937   H  HD2    . TYR A 1 58   ? 49.486  -71.787 -4.651  1.00 125.93 ? 1420 TYR A HD2    1 
ATOM   938   H  HE1    . TYR A 1 58   ? 48.295  -67.327 -4.454  1.00 124.03 ? 1420 TYR A HE1    1 
ATOM   939   H  HE2    . TYR A 1 58   ? 51.003  -70.159 -5.271  1.00 127.02 ? 1420 TYR A HE2    1 
ATOM   940   H  HH     . TYR A 1 58   ? 51.423  -67.972 -5.530  1.00 127.26 ? 1420 TYR A HH     1 
ATOM   941   N  N      . TYR A 1 59   ? 43.607  -72.665 -4.227  1.00 131.27 ? 1421 TYR A N      1 
ATOM   942   C  CA     . TYR A 1 59   ? 42.562  -73.549 -3.713  1.00 128.25 ? 1421 TYR A CA     1 
ATOM   943   C  C      . TYR A 1 59   ? 42.113  -74.649 -4.684  1.00 124.44 ? 1421 TYR A C      1 
ATOM   944   O  O      . TYR A 1 59   ? 41.542  -75.656 -4.264  1.00 120.63 ? 1421 TYR A O      1 
ATOM   945   C  CB     . TYR A 1 59   ? 41.358  -72.694 -3.311  1.00 127.57 ? 1421 TYR A CB     1 
ATOM   946   C  CG     . TYR A 1 59   ? 40.094  -73.456 -2.991  1.00 122.86 ? 1421 TYR A CG     1 
ATOM   947   C  CD1    . TYR A 1 59   ? 39.929  -74.043 -1.745  1.00 119.91 ? 1421 TYR A CD1    1 
ATOM   948   C  CD2    . TYR A 1 59   ? 39.060  -73.570 -3.914  1.00 120.96 ? 1421 TYR A CD2    1 
ATOM   949   C  CE1    . TYR A 1 59   ? 38.782  -74.732 -1.426  1.00 116.31 ? 1421 TYR A CE1    1 
ATOM   950   C  CE2    . TYR A 1 59   ? 37.901  -74.262 -3.602  1.00 116.34 ? 1421 TYR A CE2    1 
ATOM   951   C  CZ     . TYR A 1 59   ? 37.768  -74.839 -2.355  1.00 113.44 ? 1421 TYR A CZ     1 
ATOM   952   O  OH     . TYR A 1 59   ? 36.621  -75.529 -2.030  1.00 111.95 ? 1421 TYR A OH     1 
ATOM   953   H  H      . TYR A 1 59   ? 43.305  -71.905 -4.494  1.00 157.53 ? 1421 TYR A H      1 
ATOM   954   H  HA     . TYR A 1 59   ? 42.893  -73.985 -2.912  1.00 153.90 ? 1421 TYR A HA     1 
ATOM   955   H  HB2    . TYR A 1 59   ? 41.595  -72.182 -2.522  1.00 153.08 ? 1421 TYR A HB2    1 
ATOM   956   H  HB3    . TYR A 1 59   ? 41.155  -72.088 -4.041  1.00 153.08 ? 1421 TYR A HB3    1 
ATOM   957   H  HD1    . TYR A 1 59   ? 40.608  -73.973 -1.114  1.00 143.89 ? 1421 TYR A HD1    1 
ATOM   958   H  HD2    . TYR A 1 59   ? 39.150  -73.180 -4.754  1.00 145.16 ? 1421 TYR A HD2    1 
ATOM   959   H  HE1    . TYR A 1 59   ? 38.689  -75.122 -0.587  1.00 139.57 ? 1421 TYR A HE1    1 
ATOM   960   H  HE2    . TYR A 1 59   ? 37.217  -74.335 -4.228  1.00 139.60 ? 1421 TYR A HE2    1 
ATOM   961   H  HH     . TYR A 1 59   ? 36.087  -75.520 -2.678  1.00 134.34 ? 1421 TYR A HH     1 
ATOM   962   N  N      . LYS A 1 60   ? 42.390  -74.462 -5.972  1.00 116.66 ? 1422 LYS A N      1 
ATOM   963   C  CA     . LYS A 1 60   ? 41.825  -75.308 -7.026  1.00 117.91 ? 1422 LYS A CA     1 
ATOM   964   C  C      . LYS A 1 60   ? 42.091  -76.795 -6.822  1.00 117.63 ? 1422 LYS A C      1 
ATOM   965   O  O      . LYS A 1 60   ? 41.182  -77.618 -6.932  1.00 117.75 ? 1422 LYS A O      1 
ATOM   966   C  CB     . LYS A 1 60   ? 42.391  -74.892 -8.389  1.00 118.51 ? 1422 LYS A CB     1 
ATOM   967   C  CG     . LYS A 1 60   ? 41.722  -75.557 -9.595  1.00 118.36 ? 1422 LYS A CG     1 
ATOM   968   C  CD     . LYS A 1 60   ? 40.234  -75.218 -9.700  1.00 117.50 ? 1422 LYS A CD     1 
ATOM   969   C  CE     . LYS A 1 60   ? 40.015  -73.729 -9.951  1.00 117.24 ? 1422 LYS A CE     1 
ATOM   970   N  NZ     . LYS A 1 60   ? 40.656  -73.297 -11.224 1.00 117.64 1 1422 LYS A NZ     1 
ATOM   971   H  H      . LYS A 1 60   ? 42.910  -73.843 -6.267  1.00 139.99 ? 1422 LYS A H      1 
ATOM   972   H  HA     . LYS A 1 60   ? 40.864  -75.178 -7.050  1.00 141.49 ? 1422 LYS A HA     1 
ATOM   973   H  HB2    . LYS A 1 60   ? 42.285  -73.933 -8.487  1.00 142.21 ? 1422 LYS A HB2    1 
ATOM   974   H  HB3    . LYS A 1 60   ? 43.334  -75.119 -8.414  1.00 142.21 ? 1422 LYS A HB3    1 
ATOM   975   H  HG2    . LYS A 1 60   ? 42.157  -75.254 -10.407 1.00 142.04 ? 1422 LYS A HG2    1 
ATOM   976   H  HG3    . LYS A 1 60   ? 41.806  -76.520 -9.513  1.00 142.04 ? 1422 LYS A HG3    1 
ATOM   977   H  HD2    . LYS A 1 60   ? 39.844  -75.711 -10.440 1.00 141.00 ? 1422 LYS A HD2    1 
ATOM   978   H  HD3    . LYS A 1 60   ? 39.792  -75.455 -8.870  1.00 141.00 ? 1422 LYS A HD3    1 
ATOM   979   H  HE2    . LYS A 1 60   ? 39.064  -73.550 -10.011 1.00 140.68 ? 1422 LYS A HE2    1 
ATOM   980   H  HE3    . LYS A 1 60   ? 40.408  -73.220 -9.224  1.00 140.68 ? 1422 LYS A HE3    1 
ATOM   981   H  HZ1    . LYS A 1 60   ? 40.309  -73.749 -11.907 1.00 141.17 ? 1422 LYS A HZ1    1 
ATOM   982   H  HZ2    . LYS A 1 60   ? 40.519  -72.427 -11.353 1.00 141.17 ? 1422 LYS A HZ2    1 
ATOM   983   H  HZ3    . LYS A 1 60   ? 41.532  -73.450 -11.191 1.00 141.17 ? 1422 LYS A HZ3    1 
ATOM   984   N  N      . ILE A 1 61   ? 43.340  -77.136 -6.546  1.00 110.58 ? 1423 ILE A N      1 
ATOM   985   C  CA     . ILE A 1 61   ? 43.735  -78.529 -6.374  1.00 113.40 ? 1423 ILE A CA     1 
ATOM   986   C  C      . ILE A 1 61   ? 43.201  -79.138 -5.067  1.00 114.35 ? 1423 ILE A C      1 
ATOM   987   O  O      . ILE A 1 61   ? 42.835  -80.314 -5.039  1.00 119.53 ? 1423 ILE A O      1 
ATOM   988   C  CB     . ILE A 1 61   ? 45.266  -78.685 -6.455  1.00 109.99 ? 1423 ILE A CB     1 
ATOM   989   C  CG1    . ILE A 1 61   ? 45.968  -77.733 -5.484  1.00 104.64 ? 1423 ILE A CG1    1 
ATOM   990   C  CG2    . ILE A 1 61   ? 45.743  -78.419 -7.880  1.00 110.00 ? 1423 ILE A CG2    1 
ATOM   991   C  CD1    . ILE A 1 61   ? 46.687  -78.446 -4.404  1.00 98.71  ? 1423 ILE A CD1    1 
ATOM   992   H  H      . ILE A 1 61   ? 43.986  -76.575 -6.453  1.00 132.70 ? 1423 ILE A H      1 
ATOM   993   H  HA     . ILE A 1 61   ? 43.355  -79.042 -7.105  1.00 136.08 ? 1423 ILE A HA     1 
ATOM   994   H  HB     . ILE A 1 61   ? 45.498  -79.597 -6.217  1.00 131.98 ? 1423 ILE A HB     1 
ATOM   995   H  HG12   . ILE A 1 61   ? 46.614  -77.200 -5.974  1.00 125.57 ? 1423 ILE A HG12   1 
ATOM   996   H  HG13   . ILE A 1 61   ? 45.305  -77.156 -5.072  1.00 125.57 ? 1423 ILE A HG13   1 
ATOM   997   H  HG21   . ILE A 1 61   ? 46.707  -78.521 -7.915  1.00 132.00 ? 1423 ILE A HG21   1 
ATOM   998   H  HG22   . ILE A 1 61   ? 45.321  -79.056 -8.478  1.00 132.00 ? 1423 ILE A HG22   1 
ATOM   999   H  HG23   . ILE A 1 61   ? 45.496  -77.515 -8.131  1.00 132.00 ? 1423 ILE A HG23   1 
ATOM   1000  H  HD11   . ILE A 1 61   ? 47.110  -77.795 -3.823  1.00 118.45 ? 1423 ILE A HD11   1 
ATOM   1001  H  HD12   . ILE A 1 61   ? 46.051  -78.978 -3.900  1.00 118.45 ? 1423 ILE A HD12   1 
ATOM   1002  H  HD13   . ILE A 1 61   ? 47.360  -79.022 -4.801  1.00 118.45 ? 1423 ILE A HD13   1 
ATOM   1003  N  N      . PHE A 1 62   ? 43.152  -78.348 -3.992  1.00 112.15 ? 1424 PHE A N      1 
ATOM   1004  C  CA     . PHE A 1 62   ? 42.637  -78.836 -2.706  1.00 108.64 ? 1424 PHE A CA     1 
ATOM   1005  C  C      . PHE A 1 62   ? 41.118  -78.764 -2.599  1.00 104.86 ? 1424 PHE A C      1 
ATOM   1006  O  O      . PHE A 1 62   ? 40.564  -79.068 -1.542  1.00 102.58 ? 1424 PHE A O      1 
ATOM   1007  C  CB     . PHE A 1 62   ? 43.246  -78.061 -1.524  1.00 106.07 ? 1424 PHE A CB     1 
ATOM   1008  C  CG     . PHE A 1 62   ? 44.720  -78.279 -1.330  1.00 103.51 ? 1424 PHE A CG     1 
ATOM   1009  C  CD1    . PHE A 1 62   ? 45.295  -79.516 -1.580  1.00 106.10 ? 1424 PHE A CD1    1 
ATOM   1010  C  CD2    . PHE A 1 62   ? 45.528  -77.252 -0.872  1.00 99.52  ? 1424 PHE A CD2    1 
ATOM   1011  C  CE1    . PHE A 1 62   ? 46.649  -79.717 -1.397  1.00 107.04 ? 1424 PHE A CE1    1 
ATOM   1012  C  CE2    . PHE A 1 62   ? 46.882  -77.447 -0.686  1.00 101.56 ? 1424 PHE A CE2    1 
ATOM   1013  C  CZ     . PHE A 1 62   ? 47.443  -78.683 -0.947  1.00 105.34 ? 1424 PHE A CZ     1 
ATOM   1014  H  H      . PHE A 1 62   ? 43.410  -77.528 -3.979  1.00 134.58 ? 1424 PHE A H      1 
ATOM   1015  H  HA     . PHE A 1 62   ? 42.891  -79.767 -2.607  1.00 130.37 ? 1424 PHE A HA     1 
ATOM   1016  H  HB2    . PHE A 1 62   ? 43.106  -77.112 -1.670  1.00 127.28 ? 1424 PHE A HB2    1 
ATOM   1017  H  HB3    . PHE A 1 62   ? 42.798  -78.335 -0.709  1.00 127.28 ? 1424 PHE A HB3    1 
ATOM   1018  H  HD1    . PHE A 1 62   ? 44.764  -80.216 -1.885  1.00 127.32 ? 1424 PHE A HD1    1 
ATOM   1019  H  HD2    . PHE A 1 62   ? 45.155  -76.418 -0.697  1.00 119.42 ? 1424 PHE A HD2    1 
ATOM   1020  H  HE1    . PHE A 1 62   ? 47.024  -80.550 -1.572  1.00 128.44 ? 1424 PHE A HE1    1 
ATOM   1021  H  HE2    . PHE A 1 62   ? 47.416  -76.749 -0.383  1.00 121.87 ? 1424 PHE A HE2    1 
ATOM   1022  H  HZ     . PHE A 1 62   ? 48.355  -78.816 -0.822  1.00 126.41 ? 1424 PHE A HZ     1 
ATOM   1023  N  N      . GLU A 1 63   ? 40.452  -78.344 -3.672  1.00 93.63  ? 1425 GLU A N      1 
ATOM   1024  C  CA     . GLU A 1 63   ? 39.011  -78.091 -3.635  1.00 97.93  ? 1425 GLU A CA     1 
ATOM   1025  C  C      . GLU A 1 63   ? 38.249  -79.282 -3.052  1.00 100.61 ? 1425 GLU A C      1 
ATOM   1026  O  O      . GLU A 1 63   ? 37.323  -79.105 -2.263  1.00 106.02 ? 1425 GLU A O      1 
ATOM   1027  C  CB     . GLU A 1 63   ? 38.478  -77.752 -5.032  1.00 94.26  ? 1425 GLU A CB     1 
ATOM   1028  C  CG     . GLU A 1 63   ? 38.500  -78.904 -6.026  1.00 94.02  ? 1425 GLU A CG     1 
ATOM   1029  C  CD     . GLU A 1 63   ? 38.083  -78.475 -7.423  1.00 93.90  ? 1425 GLU A CD     1 
ATOM   1030  O  OE1    . GLU A 1 63   ? 37.097  -77.712 -7.541  1.00 92.69  ? 1425 GLU A OE1    1 
ATOM   1031  O  OE2    . GLU A 1 63   ? 38.741  -78.900 -8.398  1.00 94.97  1 1425 GLU A OE2    1 
ATOM   1032  H  H      . GLU A 1 63   ? 40.813  -78.196 -4.438  1.00 112.36 ? 1425 GLU A H      1 
ATOM   1033  H  HA     . GLU A 1 63   ? 38.845  -77.326 -3.063  1.00 117.52 ? 1425 GLU A HA     1 
ATOM   1034  H  HB2    . GLU A 1 63   ? 37.558  -77.457 -4.948  1.00 113.11 ? 1425 GLU A HB2    1 
ATOM   1035  H  HB3    . GLU A 1 63   ? 39.016  -77.036 -5.403  1.00 113.11 ? 1425 GLU A HB3    1 
ATOM   1036  H  HG2    . GLU A 1 63   ? 39.400  -79.262 -6.078  1.00 112.83 ? 1425 GLU A HG2    1 
ATOM   1037  H  HG3    . GLU A 1 63   ? 37.885  -79.593 -5.727  1.00 112.83 ? 1425 GLU A HG3    1 
ATOM   1038  N  N      . GLN A 1 64   ? 38.655  -80.492 -3.427  1.00 106.13 ? 1426 GLN A N      1 
ATOM   1039  C  CA     . GLN A 1 64   ? 38.002  -81.704 -2.942  1.00 105.56 ? 1426 GLN A CA     1 
ATOM   1040  C  C      . GLN A 1 64   ? 38.048  -81.785 -1.421  1.00 103.02 ? 1426 GLN A C      1 
ATOM   1041  O  O      . GLN A 1 64   ? 37.007  -81.852 -0.769  1.00 101.30 ? 1426 GLN A O      1 
ATOM   1042  C  CB     . GLN A 1 64   ? 38.669  -82.949 -3.542  1.00 107.73 ? 1426 GLN A CB     1 
ATOM   1043  C  CG     . GLN A 1 64   ? 37.869  -84.255 -3.417  1.00 108.67 ? 1426 GLN A CG     1 
ATOM   1044  C  CD     . GLN A 1 64   ? 36.872  -84.473 -4.542  1.00 109.74 ? 1426 GLN A CD     1 
ATOM   1045  O  OE1    . GLN A 1 64   ? 37.215  -84.361 -5.718  1.00 111.89 ? 1426 GLN A OE1    1 
ATOM   1046  N  NE2    . GLN A 1 64   ? 35.642  -84.830 -4.187  1.00 108.97 ? 1426 GLN A NE2    1 
ATOM   1047  H  H      . GLN A 1 64   ? 39.311  -80.638 -3.964  1.00 127.35 ? 1426 GLN A H      1 
ATOM   1048  H  HA     . GLN A 1 64   ? 37.072  -81.697 -3.217  1.00 126.67 ? 1426 GLN A HA     1 
ATOM   1049  H  HB2    . GLN A 1 64   ? 38.821  -82.790 -4.486  1.00 129.28 ? 1426 GLN A HB2    1 
ATOM   1050  H  HB3    . GLN A 1 64   ? 39.520  -83.086 -3.096  1.00 129.28 ? 1426 GLN A HB3    1 
ATOM   1051  H  HG2    . GLN A 1 64   ? 38.488  -85.002 -3.420  1.00 130.40 ? 1426 GLN A HG2    1 
ATOM   1052  H  HG3    . GLN A 1 64   ? 37.375  -84.240 -2.582  1.00 130.40 ? 1426 GLN A HG3    1 
ATOM   1053  H  HE21   . GLN A 1 64   ? 35.445  -84.926 -3.356  1.00 130.77 ? 1426 GLN A HE21   1 
ATOM   1054  H  HE22   . GLN A 1 64   ? 35.043  -84.965 -4.789  1.00 130.77 ? 1426 GLN A HE22   1 
ATOM   1055  N  N      . ASP A 1 65   ? 39.255  -81.760 -0.861  1.00 79.83  ? 1427 ASP A N      1 
ATOM   1056  C  CA     . ASP A 1 65   ? 39.429  -81.901 0.581   1.00 78.92  ? 1427 ASP A CA     1 
ATOM   1057  C  C      . ASP A 1 65   ? 38.649  -80.822 1.327   1.00 77.04  ? 1427 ASP A C      1 
ATOM   1058  O  O      . ASP A 1 65   ? 38.183  -81.046 2.442   1.00 78.22  ? 1427 ASP A O      1 
ATOM   1059  C  CB     . ASP A 1 65   ? 40.916  -81.844 0.944   1.00 79.75  ? 1427 ASP A CB     1 
ATOM   1060  C  CG     . ASP A 1 65   ? 41.195  -82.320 2.362   1.00 79.25  ? 1427 ASP A CG     1 
ATOM   1061  O  OD1    . ASP A 1 65   ? 40.246  -82.725 3.069   1.00 78.29  ? 1427 ASP A OD1    1 
ATOM   1062  O  OD2    . ASP A 1 65   ? 42.379  -82.308 2.761   1.00 79.89  1 1427 ASP A OD2    1 
ATOM   1063  H  H      . ASP A 1 65   ? 39.991  -81.662 -1.296  1.00 95.80  ? 1427 ASP A H      1 
ATOM   1064  H  HA     . ASP A 1 65   ? 39.085  -82.765 0.857   1.00 94.70  ? 1427 ASP A HA     1 
ATOM   1065  H  HB2    . ASP A 1 65   ? 41.412  -82.413 0.334   1.00 95.70  ? 1427 ASP A HB2    1 
ATOM   1066  H  HB3    . ASP A 1 65   ? 41.224  -80.928 0.869   1.00 95.70  ? 1427 ASP A HB3    1 
ATOM   1067  N  N      . CYS A 1 66   ? 38.504  -79.654 0.712   1.00 82.22  ? 1428 CYS A N      1 
ATOM   1068  C  CA     . CYS A 1 66   ? 37.666  -78.608 1.282   1.00 75.60  ? 1428 CYS A CA     1 
ATOM   1069  C  C      . CYS A 1 66   ? 36.195  -79.004 1.183   1.00 76.00  ? 1428 CYS A C      1 
ATOM   1070  O  O      . CYS A 1 66   ? 35.464  -78.962 2.174   1.00 77.13  ? 1428 CYS A O      1 
ATOM   1071  C  CB     . CYS A 1 66   ? 37.893  -77.266 0.588   1.00 75.88  ? 1428 CYS A CB     1 
ATOM   1072  S  SG     . CYS A 1 66   ? 36.719  -75.995 1.117   1.00 75.60  ? 1428 CYS A SG     1 
ATOM   1073  H  H      . CYS A 1 66   ? 38.879  -79.443 -0.032  1.00 98.66  ? 1428 CYS A H      1 
ATOM   1074  H  HA     . CYS A 1 66   ? 37.887  -78.502 2.221   1.00 90.72  ? 1428 CYS A HA     1 
ATOM   1075  H  HB2    . CYS A 1 66   ? 38.788  -76.952 0.792   1.00 91.05  ? 1428 CYS A HB2    1 
ATOM   1076  H  HB3    . CYS A 1 66   ? 37.795  -77.386 -0.370  1.00 91.05  ? 1428 CYS A HB3    1 
ATOM   1077  H  HG     . CYS A 1 66   ? 36.958  -74.975 0.531   1.00 90.72  ? 1428 CYS A HG     1 
ATOM   1078  N  N      . LEU A 1 67   ? 35.772  -79.388 -0.020  1.00 60.40  ? 1429 LEU A N      1 
ATOM   1079  C  CA     . LEU A 1 67   ? 34.358  -79.636 -0.308  1.00 62.42  ? 1429 LEU A CA     1 
ATOM   1080  C  C      . LEU A 1 67   ? 33.769  -80.743 0.563   1.00 66.26  ? 1429 LEU A C      1 
ATOM   1081  O  O      . LEU A 1 67   ? 32.614  -80.654 0.979   1.00 68.98  ? 1429 LEU A O      1 
ATOM   1082  C  CB     . LEU A 1 67   ? 34.160  -79.984 -1.791  1.00 61.09  ? 1429 LEU A CB     1 
ATOM   1083  C  CG     . LEU A 1 67   ? 34.220  -78.843 -2.818  1.00 61.29  ? 1429 LEU A CG     1 
ATOM   1084  C  CD1    . LEU A 1 67   ? 34.122  -79.385 -4.238  1.00 62.81  ? 1429 LEU A CD1    1 
ATOM   1085  C  CD2    . LEU A 1 67   ? 33.125  -77.816 -2.573  1.00 59.73  ? 1429 LEU A CD2    1 
ATOM   1086  H  H      . LEU A 1 67   ? 36.290  -79.515 -0.695  1.00 72.48  ? 1429 LEU A H      1 
ATOM   1087  H  HA     . LEU A 1 67   ? 33.859  -78.824 -0.128  1.00 74.91  ? 1429 LEU A HA     1 
ATOM   1088  H  HB2    . LEU A 1 67   ? 34.845  -80.624 -2.041  1.00 73.31  ? 1429 LEU A HB2    1 
ATOM   1089  H  HB3    . LEU A 1 67   ? 33.289  -80.401 -1.885  1.00 73.31  ? 1429 LEU A HB3    1 
ATOM   1090  H  HG     . LEU A 1 67   ? 35.074  -78.391 -2.732  1.00 73.55  ? 1429 LEU A HG     1 
ATOM   1091  H  HD11   . LEU A 1 67   ? 34.163  -78.644 -4.862  1.00 75.37  ? 1429 LEU A HD11   1 
ATOM   1092  H  HD12   . LEU A 1 67   ? 34.862  -79.992 -4.396  1.00 75.37  ? 1429 LEU A HD12   1 
ATOM   1093  H  HD13   . LEU A 1 67   ? 33.280  -79.856 -4.338  1.00 75.37  ? 1429 LEU A HD13   1 
ATOM   1094  H  HD21   . LEU A 1 67   ? 33.196  -77.114 -3.239  1.00 71.67  ? 1429 LEU A HD21   1 
ATOM   1095  H  HD22   . LEU A 1 67   ? 32.262  -78.253 -2.643  1.00 71.67  ? 1429 LEU A HD22   1 
ATOM   1096  H  HD23   . LEU A 1 67   ? 33.236  -77.443 -1.685  1.00 71.67  ? 1429 LEU A HD23   1 
ATOM   1097  N  N      . ASP A 1 68   ? 34.545  -81.790 0.821   1.00 99.66  ? 1430 ASP A N      1 
ATOM   1098  C  CA     . ASP A 1 68   ? 34.094  -82.865 1.700   1.00 99.42  ? 1430 ASP A CA     1 
ATOM   1099  C  C      . ASP A 1 68   ? 33.726  -82.305 3.064   1.00 98.34  ? 1430 ASP A C      1 
ATOM   1100  O  O      . ASP A 1 68   ? 32.689  -82.654 3.632   1.00 97.94  ? 1430 ASP A O      1 
ATOM   1101  C  CB     . ASP A 1 68   ? 35.165  -83.946 1.861   1.00 102.77 ? 1430 ASP A CB     1 
ATOM   1102  C  CG     . ASP A 1 68   ? 35.797  -84.351 0.542   1.00 107.05 ? 1430 ASP A CG     1 
ATOM   1103  O  OD1    . ASP A 1 68   ? 35.265  -83.961 -0.519  1.00 108.83 ? 1430 ASP A OD1    1 
ATOM   1104  O  OD2    . ASP A 1 68   ? 36.822  -85.067 0.567   1.00 107.06 1 1430 ASP A OD2    1 
ATOM   1105  H  H      . ASP A 1 68   ? 35.336  -81.902 0.500   1.00 119.59 ? 1430 ASP A H      1 
ATOM   1106  H  HA     . ASP A 1 68   ? 33.303  -83.278 1.318   1.00 119.31 ? 1430 ASP A HA     1 
ATOM   1107  H  HB2    . ASP A 1 68   ? 35.867  -83.611 2.440   1.00 123.32 ? 1430 ASP A HB2    1 
ATOM   1108  H  HB3    . ASP A 1 68   ? 34.760  -84.735 2.254   1.00 123.32 ? 1430 ASP A HB3    1 
ATOM   1109  N  N      . LEU A 1 69   ? 34.591  -81.444 3.595   1.00 55.68  ? 1431 LEU A N      1 
ATOM   1110  C  CA     . LEU A 1 69   ? 34.355  -80.851 4.903   1.00 54.25  ? 1431 LEU A CA     1 
ATOM   1111  C  C      . LEU A 1 69   ? 33.094  -80.000 4.862   1.00 52.87  ? 1431 LEU A C      1 
ATOM   1112  O  O      . LEU A 1 69   ? 32.283  -80.027 5.787   1.00 51.77  ? 1431 LEU A O      1 
ATOM   1113  C  CB     . LEU A 1 69   ? 35.548  -80.002 5.356   1.00 54.22  ? 1431 LEU A CB     1 
ATOM   1114  C  CG     . LEU A 1 69   ? 35.509  -79.625 6.840   1.00 53.04  ? 1431 LEU A CG     1 
ATOM   1115  C  CD1    . LEU A 1 69   ? 35.524  -80.875 7.714   1.00 53.37  ? 1431 LEU A CD1    1 
ATOM   1116  C  CD2    . LEU A 1 69   ? 36.653  -78.706 7.222   1.00 53.05  ? 1431 LEU A CD2    1 
ATOM   1117  H  H      . LEU A 1 69   ? 35.321  -81.190 3.218   1.00 66.81  ? 1431 LEU A H      1 
ATOM   1118  H  HA     . LEU A 1 69   ? 34.223  -81.557 5.554   1.00 65.10  ? 1431 LEU A HA     1 
ATOM   1119  H  HB2    . LEU A 1 69   ? 36.365  -80.501 5.198   1.00 65.06  ? 1431 LEU A HB2    1 
ATOM   1120  H  HB3    . LEU A 1 69   ? 35.560  -79.180 4.841   1.00 65.06  ? 1431 LEU A HB3    1 
ATOM   1121  H  HG     . LEU A 1 69   ? 34.681  -79.152 7.017   1.00 63.65  ? 1431 LEU A HG     1 
ATOM   1122  H  HD11   . LEU A 1 69   ? 35.499  -80.608 8.647   1.00 64.05  ? 1431 LEU A HD11   1 
ATOM   1123  H  HD12   . LEU A 1 69   ? 34.747  -81.417 7.504   1.00 64.05  ? 1431 LEU A HD12   1 
ATOM   1124  H  HD13   . LEU A 1 69   ? 36.335  -81.375 7.535   1.00 64.05  ? 1431 LEU A HD13   1 
ATOM   1125  H  HD21   . LEU A 1 69   ? 36.586  -78.496 8.166   1.00 63.66  ? 1431 LEU A HD21   1 
ATOM   1126  H  HD22   . LEU A 1 69   ? 37.493  -79.156 7.041   1.00 63.66  ? 1431 LEU A HD22   1 
ATOM   1127  H  HD23   . LEU A 1 69   ? 36.593  -77.893 6.696   1.00 63.66  ? 1431 LEU A HD23   1 
ATOM   1128  N  N      . GLU A 1 70   ? 32.948  -79.228 3.791   1.00 69.44  ? 1432 GLU A N      1 
ATOM   1129  C  CA     . GLU A 1 70   ? 31.766  -78.402 3.596   1.00 68.29  ? 1432 GLU A CA     1 
ATOM   1130  C  C      . GLU A 1 70   ? 30.502  -79.258 3.635   1.00 67.99  ? 1432 GLU A C      1 
ATOM   1131  O  O      . GLU A 1 70   ? 29.540  -78.921 4.319   1.00 67.55  ? 1432 GLU A O      1 
ATOM   1132  C  CB     . GLU A 1 70   ? 31.857  -77.650 2.263   1.00 69.42  ? 1432 GLU A CB     1 
ATOM   1133  C  CG     . GLU A 1 70   ? 30.747  -76.634 2.019   1.00 69.01  ? 1432 GLU A CG     1 
ATOM   1134  C  CD     . GLU A 1 70   ? 30.939  -75.873 0.718   1.00 68.40  ? 1432 GLU A CD     1 
ATOM   1135  O  OE1    . GLU A 1 70   ? 31.949  -75.144 0.597   1.00 68.77  ? 1432 GLU A OE1    1 
ATOM   1136  O  OE2    . GLU A 1 70   ? 30.083  -76.010 -0.184  1.00 68.63  1 1432 GLU A OE2    1 
ATOM   1137  H  H      . GLU A 1 70   ? 33.525  -79.166 3.157   1.00 83.33  ? 1432 GLU A H      1 
ATOM   1138  H  HA     . GLU A 1 70   ? 31.712  -77.748 4.310   1.00 81.95  ? 1432 GLU A HA     1 
ATOM   1139  H  HB2    . GLU A 1 70   ? 32.701  -77.173 2.235   1.00 83.31  ? 1432 GLU A HB2    1 
ATOM   1140  H  HB3    . GLU A 1 70   ? 31.825  -78.297 1.541   1.00 83.31  ? 1432 GLU A HB3    1 
ATOM   1141  H  HG2    . GLU A 1 70   ? 29.896  -77.098 1.974   1.00 82.82  ? 1432 GLU A HG2    1 
ATOM   1142  H  HG3    . GLU A 1 70   ? 30.738  -75.992 2.746   1.00 82.82  ? 1432 GLU A HG3    1 
ATOM   1143  N  N      . SER A 1 71   ? 30.522  -80.380 2.921   1.00 69.84  ? 1433 SER A N      1 
ATOM   1144  C  CA     . SER A 1 71   ? 29.358  -81.259 2.823   1.00 71.30  ? 1433 SER A CA     1 
ATOM   1145  C  C      . SER A 1 71   ? 28.992  -81.896 4.158   1.00 68.30  ? 1433 SER A C      1 
ATOM   1146  O  O      . SER A 1 71   ? 27.824  -82.169 4.430   1.00 67.70  ? 1433 SER A O      1 
ATOM   1147  C  CB     . SER A 1 71   ? 29.604  -82.356 1.793   1.00 78.38  ? 1433 SER A CB     1 
ATOM   1148  O  OG     . SER A 1 71   ? 29.727  -81.813 0.492   1.00 85.42  ? 1433 SER A OG     1 
ATOM   1149  H  H      . SER A 1 71   ? 31.205  -80.659 2.478   1.00 83.81  ? 1433 SER A H      1 
ATOM   1150  H  HA     . SER A 1 71   ? 28.596  -80.736 2.526   1.00 85.56  ? 1433 SER A HA     1 
ATOM   1151  H  HB2    . SER A 1 71   ? 30.424  -82.822 2.019   1.00 94.05  ? 1433 SER A HB2    1 
ATOM   1152  H  HB3    . SER A 1 71   ? 28.857  -82.975 1.807   1.00 94.05  ? 1433 SER A HB3    1 
ATOM   1153  H  HG     . SER A 1 71   ? 30.371  -81.275 0.465   1.00 102.50 ? 1433 SER A HG     1 
ATOM   1154  N  N      . LYS A 1 72   ? 30.002  -82.140 4.984   1.00 50.68  ? 1434 LYS A N      1 
ATOM   1155  C  CA     . LYS A 1 72   ? 29.792  -82.684 6.318   1.00 50.14  ? 1434 LYS A CA     1 
ATOM   1156  C  C      . LYS A 1 72   ? 29.194  -81.632 7.249   1.00 48.48  ? 1434 LYS A C      1 
ATOM   1157  O  O      . LYS A 1 72   ? 28.196  -81.884 7.920   1.00 47.70  ? 1434 LYS A O      1 
ATOM   1158  C  CB     . LYS A 1 72   ? 31.113  -83.231 6.854   1.00 51.04  ? 1434 LYS A CB     1 
ATOM   1159  C  CG     . LYS A 1 72   ? 31.520  -84.544 6.188   1.00 52.70  ? 1434 LYS A CG     1 
ATOM   1160  C  CD     . LYS A 1 72   ? 33.006  -84.849 6.344   1.00 53.79  ? 1434 LYS A CD     1 
ATOM   1161  C  CE     . LYS A 1 72   ? 33.429  -85.128 7.773   1.00 53.47  ? 1434 LYS A CE     1 
ATOM   1162  N  NZ     . LYS A 1 72   ? 34.911  -85.266 7.827   1.00 54.53  1 1434 LYS A NZ     1 
ATOM   1163  H  H      . LYS A 1 72   ? 30.828  -81.998 4.793   1.00 60.82  ? 1434 LYS A H      1 
ATOM   1164  H  HA     . LYS A 1 72   ? 29.165  -83.422 6.262   1.00 60.17  ? 1434 LYS A HA     1 
ATOM   1165  H  HB2    . LYS A 1 72   ? 31.814  -82.581 6.689   1.00 61.25  ? 1434 LYS A HB2    1 
ATOM   1166  H  HB3    . LYS A 1 72   ? 31.026  -83.391 7.806   1.00 61.25  ? 1434 LYS A HB3    1 
ATOM   1167  H  HG2    . LYS A 1 72   ? 31.020  -85.271 6.593   1.00 63.24  ? 1434 LYS A HG2    1 
ATOM   1168  H  HG3    . LYS A 1 72   ? 31.322  -84.493 5.240   1.00 63.24  ? 1434 LYS A HG3    1 
ATOM   1169  H  HD2    . LYS A 1 72   ? 33.222  -85.632 5.813   1.00 64.55  ? 1434 LYS A HD2    1 
ATOM   1170  H  HD3    . LYS A 1 72   ? 33.516  -84.088 6.028   1.00 64.55  ? 1434 LYS A HD3    1 
ATOM   1171  H  HE2    . LYS A 1 72   ? 33.164  -84.389 8.343   1.00 64.16  ? 1434 LYS A HE2    1 
ATOM   1172  H  HE3    . LYS A 1 72   ? 33.028  -85.957 8.077   1.00 64.16  ? 1434 LYS A HE3    1 
ATOM   1173  H  HZ1    . LYS A 1 72   ? 35.170  -85.431 8.662   1.00 65.44  ? 1434 LYS A HZ1    1 
ATOM   1174  H  HZ2    . LYS A 1 72   ? 35.173  -85.938 7.305   1.00 65.44  ? 1434 LYS A HZ2    1 
ATOM   1175  H  HZ3    . LYS A 1 72   ? 35.296  -84.515 7.546   1.00 65.44  ? 1434 LYS A HZ3    1 
ATOM   1176  N  N      . LEU A 1 73   ? 29.801  -80.451 7.280   1.00 48.00  ? 1435 LEU A N      1 
ATOM   1177  C  CA     . LEU A 1 73   ? 29.321  -79.362 8.125   1.00 46.52  ? 1435 LEU A CA     1 
ATOM   1178  C  C      . LEU A 1 73   ? 27.939  -78.883 7.713   1.00 45.63  ? 1435 LEU A C      1 
ATOM   1179  O  O      . LEU A 1 73   ? 27.101  -78.587 8.564   1.00 44.50  ? 1435 LEU A O      1 
ATOM   1180  C  CB     . LEU A 1 73   ? 30.307  -78.193 8.095   1.00 46.40  ? 1435 LEU A CB     1 
ATOM   1181  C  CG     . LEU A 1 73   ? 31.672  -78.476 8.715   1.00 47.09  ? 1435 LEU A CG     1 
ATOM   1182  C  CD1    . LEU A 1 73   ? 32.536  -77.235 8.668   1.00 46.93  ? 1435 LEU A CD1    1 
ATOM   1183  C  CD2    . LEU A 1 73   ? 31.529  -78.957 10.153  1.00 46.57  ? 1435 LEU A CD2    1 
ATOM   1184  H  H      . LEU A 1 73   ? 30.498  -80.252 6.817   1.00 57.61  ? 1435 LEU A H      1 
ATOM   1185  H  HA     . LEU A 1 73   ? 29.264  -79.679 9.040   1.00 55.83  ? 1435 LEU A HA     1 
ATOM   1186  H  HB2    . LEU A 1 73   ? 30.454  -77.938 7.171   1.00 55.68  ? 1435 LEU A HB2    1 
ATOM   1187  H  HB3    . LEU A 1 73   ? 29.916  -77.448 8.579   1.00 55.68  ? 1435 LEU A HB3    1 
ATOM   1188  H  HG     . LEU A 1 73   ? 32.115  -79.173 8.206   1.00 56.51  ? 1435 LEU A HG     1 
ATOM   1189  H  HD11   . LEU A 1 73   ? 33.397  -77.435 9.065   1.00 56.31  ? 1435 LEU A HD11   1 
ATOM   1190  H  HD12   . LEU A 1 73   ? 32.652  -76.967 7.743   1.00 56.31  ? 1435 LEU A HD12   1 
ATOM   1191  H  HD13   . LEU A 1 73   ? 32.097  -76.527 9.165   1.00 56.31  ? 1435 LEU A HD13   1 
ATOM   1192  H  HD21   . LEU A 1 73   ? 32.411  -79.128 10.517  1.00 55.88  ? 1435 LEU A HD21   1 
ATOM   1193  H  HD22   . LEU A 1 73   ? 31.083  -78.269 10.672  1.00 55.88  ? 1435 LEU A HD22   1 
ATOM   1194  H  HD23   . LEU A 1 73   ? 31.003  -79.772 10.162  1.00 55.88  ? 1435 LEU A HD23   1 
ATOM   1195  N  N      . THR A 1 74   ? 27.704  -78.793 6.410   1.00 46.19  ? 1436 THR A N      1 
ATOM   1196  C  CA     . THR A 1 74   ? 26.399  -78.391 5.908   1.00 45.49  ? 1436 THR A CA     1 
ATOM   1197  C  C      . THR A 1 74   ? 25.302  -79.335 6.391   1.00 45.20  ? 1436 THR A C      1 
ATOM   1198  O  O      . THR A 1 74   ? 24.196  -78.888 6.687   1.00 44.16  ? 1436 THR A O      1 
ATOM   1199  C  CB     . THR A 1 74   ? 26.378  -78.332 4.374   1.00 46.41  ? 1436 THR A CB     1 
ATOM   1200  O  OG1    . THR A 1 74   ? 27.032  -79.488 3.842   1.00 50.38  ? 1436 THR A OG1    1 
ATOM   1201  C  CG2    . THR A 1 74   ? 27.078  -77.073 3.874   1.00 46.38  ? 1436 THR A CG2    1 
ATOM   1202  H  H      . THR A 1 74   ? 28.284  -78.960 5.797   1.00 55.42  ? 1436 THR A H      1 
ATOM   1203  H  HA     . THR A 1 74   ? 26.196  -77.503 6.242   1.00 54.59  ? 1436 THR A HA     1 
ATOM   1204  H  HB     . THR A 1 74   ? 25.458  -78.313 4.065   1.00 55.69  ? 1436 THR A HB     1 
ATOM   1205  H  HG1    . THR A 1 74   ? 27.829  -79.514 4.106   1.00 60.45  ? 1436 THR A HG1    1 
ATOM   1206  H  HG21   . THR A 1 74   ? 27.058  -77.046 2.905   1.00 55.66  ? 1436 THR A HG21   1 
ATOM   1207  H  HG22   . THR A 1 74   ? 26.630  -76.286 4.221   1.00 55.66  ? 1436 THR A HG22   1 
ATOM   1208  H  HG23   . THR A 1 74   ? 28.001  -77.068 4.171   1.00 55.66  ? 1436 THR A HG23   1 
ATOM   1209  N  N      . LYS A 1 75   ? 25.594  -80.630 6.488   1.00 48.55  ? 1437 LYS A N      1 
ATOM   1210  C  CA     . LYS A 1 75   ? 24.595  -81.574 6.990   1.00 48.39  ? 1437 LYS A CA     1 
ATOM   1211  C  C      . LYS A 1 75   ? 24.468  -81.507 8.504   1.00 47.45  ? 1437 LYS A C      1 
ATOM   1212  O  O      . LYS A 1 75   ? 23.437  -81.886 9.046   1.00 46.93  ? 1437 LYS A O      1 
ATOM   1213  C  CB     . LYS A 1 75   ? 24.898  -83.012 6.578   1.00 49.85  ? 1437 LYS A CB     1 
ATOM   1214  C  CG     . LYS A 1 75   ? 23.635  -83.874 6.552   1.00 49.89  ? 1437 LYS A CG     1 
ATOM   1215  C  CD     . LYS A 1 75   ? 23.894  -85.282 7.064   1.00 50.86  ? 1437 LYS A CD     1 
ATOM   1216  C  CE     . LYS A 1 75   ? 22.602  -86.017 7.406   1.00 50.66  ? 1437 LYS A CE     1 
ATOM   1217  N  NZ     . LYS A 1 75   ? 22.887  -87.431 7.788   1.00 51.82  1 1437 LYS A NZ     1 
ATOM   1218  H  H      . LYS A 1 75   ? 26.348  -80.983 6.274   1.00 58.26  ? 1437 LYS A H      1 
ATOM   1219  H  HA     . LYS A 1 75   ? 23.733  -81.338 6.614   1.00 58.07  ? 1437 LYS A HA     1 
ATOM   1220  H  HB2    . LYS A 1 75   ? 25.286  -83.015 5.689   1.00 59.82  ? 1437 LYS A HB2    1 
ATOM   1221  H  HB3    . LYS A 1 75   ? 25.518  -83.402 7.215   1.00 59.82  ? 1437 LYS A HB3    1 
ATOM   1222  H  HG2    . LYS A 1 75   ? 22.959  -83.467 7.117   1.00 59.86  ? 1437 LYS A HG2    1 
ATOM   1223  H  HG3    . LYS A 1 75   ? 23.312  -83.939 5.639   1.00 59.86  ? 1437 LYS A HG3    1 
ATOM   1224  H  HD2    . LYS A 1 75   ? 24.357  -85.789 6.379   1.00 61.04  ? 1437 LYS A HD2    1 
ATOM   1225  H  HD3    . LYS A 1 75   ? 24.435  -85.233 7.867   1.00 61.04  ? 1437 LYS A HD3    1 
ATOM   1226  H  HE2    . LYS A 1 75   ? 22.169  -85.578 8.154   1.00 60.79  ? 1437 LYS A HE2    1 
ATOM   1227  H  HE3    . LYS A 1 75   ? 22.018  -86.021 6.631   1.00 60.79  ? 1437 LYS A HE3    1 
ATOM   1228  H  HZ1    . LYS A 1 75   ? 23.285  -87.854 7.114   1.00 62.19  ? 1437 LYS A HZ1    1 
ATOM   1229  H  HZ2    . LYS A 1 75   ? 23.422  -87.451 8.499   1.00 62.19  ? 1437 LYS A HZ2    1 
ATOM   1230  H  HZ3    . LYS A 1 75   ? 22.127  -87.851 7.986   1.00 62.19  ? 1437 LYS A HZ3    1 
ATOM   1231  N  N      . LEU A 1 76   ? 25.515  -81.063 9.193   1.00 44.96  ? 1438 LEU A N      1 
ATOM   1232  C  CA     . LEU A 1 76   ? 25.393  -80.759 10.613  1.00 43.99  ? 1438 LEU A CA     1 
ATOM   1233  C  C      . LEU A 1 76   ? 24.438  -79.576 10.772  1.00 42.61  ? 1438 LEU A C      1 
ATOM   1234  O  O      . LEU A 1 76   ? 23.537  -79.600 11.605  1.00 41.79  ? 1438 LEU A O      1 
ATOM   1235  C  CB     . LEU A 1 76   ? 26.750  -80.452 11.250  1.00 44.22  ? 1438 LEU A CB     1 
ATOM   1236  C  CG     . LEU A 1 76   ? 26.728  -80.166 12.757  1.00 43.36  ? 1438 LEU A CG     1 
ATOM   1237  C  CD1    . LEU A 1 76   ? 26.252  -81.375 13.559  1.00 43.64  ? 1438 LEU A CD1    1 
ATOM   1238  C  CD2    . LEU A 1 76   ? 28.090  -79.709 13.239  1.00 43.62  ? 1438 LEU A CD2    1 
ATOM   1239  H  H      . LEU A 1 76   ? 26.299  -80.932 8.865   1.00 53.95  ? 1438 LEU A H      1 
ATOM   1240  H  HA     . LEU A 1 76   ? 25.009  -81.523 11.071  1.00 52.79  ? 1438 LEU A HA     1 
ATOM   1241  H  HB2    . LEU A 1 76   ? 27.334  -81.214 11.108  1.00 53.06  ? 1438 LEU A HB2    1 
ATOM   1242  H  HB3    . LEU A 1 76   ? 27.125  -79.672 10.812  1.00 53.06  ? 1438 LEU A HB3    1 
ATOM   1243  H  HG     . LEU A 1 76   ? 26.103  -79.443 12.923  1.00 52.04  ? 1438 LEU A HG     1 
ATOM   1244  H  HD11   . LEU A 1 76   ? 26.254  -81.148 14.502  1.00 52.37  ? 1438 LEU A HD11   1 
ATOM   1245  H  HD12   . LEU A 1 76   ? 25.354  -81.607 13.276  1.00 52.37  ? 1438 LEU A HD12   1 
ATOM   1246  H  HD13   . LEU A 1 76   ? 26.854  -82.118 13.395  1.00 52.37  ? 1438 LEU A HD13   1 
ATOM   1247  H  HD21   . LEU A 1 76   ? 28.045  -79.536 14.192  1.00 52.35  ? 1438 LEU A HD21   1 
ATOM   1248  H  HD22   . LEU A 1 76   ? 28.738  -80.408 13.059  1.00 52.35  ? 1438 LEU A HD22   1 
ATOM   1249  H  HD23   . LEU A 1 76   ? 28.336  -78.899 12.766  1.00 52.35  ? 1438 LEU A HD23   1 
ATOM   1250  N  N      . SER A 1 77   ? 24.640  -78.534 9.968   1.00 42.41  ? 1439 SER A N      1 
ATOM   1251  C  CA     . SER A 1 77   ? 23.774  -77.358 10.024  1.00 41.20  ? 1439 SER A CA     1 
ATOM   1252  C  C      . SER A 1 77   ? 22.322  -77.723 9.754   1.00 40.83  ? 1439 SER A C      1 
ATOM   1253  O  O      . SER A 1 77   ? 21.413  -77.212 10.407  1.00 39.76  ? 1439 SER A O      1 
ATOM   1254  C  CB     . SER A 1 77   ? 24.216  -76.305 9.010   1.00 41.32  ? 1439 SER A CB     1 
ATOM   1255  O  OG     . SER A 1 77   ? 23.100  -75.539 8.577   1.00 40.54  ? 1439 SER A OG     1 
ATOM   1256  H  H      . SER A 1 77   ? 25.268  -78.483 9.383   1.00 50.89  ? 1439 SER A H      1 
ATOM   1257  H  HA     . SER A 1 77   ? 23.828  -76.966 10.910  1.00 49.44  ? 1439 SER A HA     1 
ATOM   1258  H  HB2    . SER A 1 77   ? 24.863  -75.714 9.426   1.00 49.59  ? 1439 SER A HB2    1 
ATOM   1259  H  HB3    . SER A 1 77   ? 24.613  -76.748 8.244   1.00 49.59  ? 1439 SER A HB3    1 
ATOM   1260  H  HG     . SER A 1 77   ? 23.346  -74.961 8.020   1.00 48.65  ? 1439 SER A HG     1 
ATOM   1261  N  N      . GLU A 1 78   ? 22.114  -78.602 8.780   1.00 51.70  ? 1440 GLU A N      1 
ATOM   1262  C  CA     . GLU A 1 78   ? 20.778  -79.072 8.449   1.00 52.29  ? 1440 GLU A CA     1 
ATOM   1263  C  C      . GLU A 1 78   ? 20.092  -79.707 9.656   1.00 51.04  ? 1440 GLU A C      1 
ATOM   1264  O  O      . GLU A 1 78   ? 18.905  -79.493 9.879   1.00 50.26  ? 1440 GLU A O      1 
ATOM   1265  C  CB     . GLU A 1 78   ? 20.836  -80.080 7.296   1.00 55.71  ? 1440 GLU A CB     1 
ATOM   1266  C  CG     . GLU A 1 78   ? 21.034  -79.460 5.918   1.00 61.12  ? 1440 GLU A CG     1 
ATOM   1267  C  CD     . GLU A 1 78   ? 20.923  -80.486 4.804   1.00 63.56  ? 1440 GLU A CD     1 
ATOM   1268  O  OE1    . GLU A 1 78   ? 20.987  -81.697 5.101   1.00 63.81  ? 1440 GLU A OE1    1 
ATOM   1269  O  OE2    . GLU A 1 78   ? 20.768  -80.082 3.632   1.00 64.16  1 1440 GLU A OE2    1 
ATOM   1270  H  H      . GLU A 1 78   ? 22.736  -78.943 8.293   1.00 62.04  ? 1440 GLU A H      1 
ATOM   1271  H  HA     . GLU A 1 78   ? 20.240  -78.317 8.161   1.00 62.75  ? 1440 GLU A HA     1 
ATOM   1272  H  HB2    . GLU A 1 78   ? 21.576  -80.687 7.454   1.00 66.85  ? 1440 GLU A HB2    1 
ATOM   1273  H  HB3    . GLU A 1 78   ? 20.004  -80.577 7.278   1.00 66.85  ? 1440 GLU A HB3    1 
ATOM   1274  H  HG2    . GLU A 1 78   ? 20.355  -78.784 5.773   1.00 73.34  ? 1440 GLU A HG2    1 
ATOM   1275  H  HG3    . GLU A 1 78   ? 21.917  -79.061 5.873   1.00 73.34  ? 1440 GLU A HG3    1 
ATOM   1276  N  N      . ILE A 1 79   ? 20.839  -80.499 10.419  1.00 41.64  ? 1441 ILE A N      1 
ATOM   1277  C  CA     . ILE A 1 79   ? 20.294  -81.146 11.613  1.00 41.32  ? 1441 ILE A CA     1 
ATOM   1278  C  C      . ILE A 1 79   ? 20.308  -80.258 12.870  1.00 40.18  ? 1441 ILE A C      1 
ATOM   1279  O  O      . ILE A 1 79   ? 19.429  -80.398 13.717  1.00 39.56  ? 1441 ILE A O      1 
ATOM   1280  C  CB     . ILE A 1 79   ? 21.008  -82.499 11.900  1.00 42.53  ? 1441 ILE A CB     1 
ATOM   1281  C  CG1    . ILE A 1 79   ? 22.521  -82.317 12.045  1.00 43.04  ? 1441 ILE A CG1    1 
ATOM   1282  C  CG2    . ILE A 1 79   ? 20.699  -83.478 10.776  1.00 43.64  ? 1441 ILE A CG2    1 
ATOM   1283  C  CD1    . ILE A 1 79   ? 23.315  -83.616 12.073  1.00 44.42  ? 1441 ILE A CD1    1 
ATOM   1284  H  H      . ILE A 1 79   ? 21.667  -80.680 10.268  1.00 49.97  ? 1441 ILE A H      1 
ATOM   1285  H  HA     . ILE A 1 79   ? 19.365  -81.355 11.433  1.00 49.59  ? 1441 ILE A HA     1 
ATOM   1286  H  HB     . ILE A 1 79   ? 20.660  -82.861 12.730  1.00 51.04  ? 1441 ILE A HB     1 
ATOM   1287  H  HG12   . ILE A 1 79   ? 22.844  -81.792 11.296  1.00 51.65  ? 1441 ILE A HG12   1 
ATOM   1288  H  HG13   . ILE A 1 79   ? 22.699  -81.846 12.874  1.00 51.65  ? 1441 ILE A HG13   1 
ATOM   1289  H  HG21   . ILE A 1 79   ? 21.145  -84.319 10.959  1.00 52.37  ? 1441 ILE A HG21   1 
ATOM   1290  H  HG22   . ILE A 1 79   ? 19.739  -83.615 10.732  1.00 52.37  ? 1441 ILE A HG22   1 
ATOM   1291  H  HG23   . ILE A 1 79   ? 21.019  -83.108 9.938   1.00 52.37  ? 1441 ILE A HG23   1 
ATOM   1292  H  HD11   . ILE A 1 79   ? 24.258  -83.408 12.167  1.00 53.30  ? 1441 ILE A HD11   1 
ATOM   1293  H  HD12   . ILE A 1 79   ? 23.018  -84.151 12.826  1.00 53.30  ? 1441 ILE A HD12   1 
ATOM   1294  H  HD13   . ILE A 1 79   ? 23.163  -84.097 11.244  1.00 53.30  ? 1441 ILE A HD13   1 
ATOM   1295  N  N      . GLN A 1 80   ? 21.271  -79.348 13.003  1.00 39.94  ? 1442 GLN A N      1 
ATOM   1296  C  CA     . GLN A 1 80   ? 21.260  -78.414 14.134  1.00 38.89  ? 1442 GLN A CA     1 
ATOM   1297  C  C      . GLN A 1 80   ? 20.011  -77.558 14.158  1.00 37.76  ? 1442 GLN A C      1 
ATOM   1298  O  O      . GLN A 1 80   ? 19.306  -77.503 15.162  1.00 37.07  ? 1442 GLN A O      1 
ATOM   1299  C  CB     . GLN A 1 80   ? 22.472  -77.492 14.110  1.00 38.89  ? 1442 GLN A CB     1 
ATOM   1300  C  CG     . GLN A 1 80   ? 23.757  -78.179 14.465  1.00 39.83  ? 1442 GLN A CG     1 
ATOM   1301  C  CD     . GLN A 1 80   ? 24.925  -77.222 14.522  1.00 39.81  ? 1442 GLN A CD     1 
ATOM   1302  O  OE1    . GLN A 1 80   ? 24.951  -76.206 13.825  1.00 39.48  ? 1442 GLN A OE1    1 
ATOM   1303  N  NE2    . GLN A 1 80   ? 25.918  -77.563 15.330  1.00 40.27  ? 1442 GLN A NE2    1 
ATOM   1304  H  H      . GLN A 1 80   ? 21.933  -79.249 12.463  1.00 47.93  ? 1442 GLN A H      1 
ATOM   1305  H  HA     . GLN A 1 80   ? 21.289  -78.922 14.960  1.00 46.67  ? 1442 GLN A HA     1 
ATOM   1306  H  HB2    . GLN A 1 80   ? 22.569  -77.125 13.217  1.00 46.67  ? 1442 GLN A HB2    1 
ATOM   1307  H  HB3    . GLN A 1 80   ? 22.333  -76.775 14.748  1.00 46.67  ? 1442 GLN A HB3    1 
ATOM   1308  H  HG2    . GLN A 1 80   ? 23.665  -78.593 15.337  1.00 47.79  ? 1442 GLN A HG2    1 
ATOM   1309  H  HG3    . GLN A 1 80   ? 23.953  -78.853 13.795  1.00 47.79  ? 1442 GLN A HG3    1 
ATOM   1310  H  HE21   . GLN A 1 80   ? 25.873  -78.292 15.783  1.00 48.32  ? 1442 GLN A HE21   1 
ATOM   1311  H  HE22   . GLN A 1 80   ? 26.608  -77.054 15.401  1.00 48.32  ? 1442 GLN A HE22   1 
ATOM   1312  N  N      . VAL A 1 81   ? 19.761  -76.879 13.044  1.00 37.65  ? 1443 VAL A N      1 
ATOM   1313  C  CA     . VAL A 1 81   ? 18.587  -76.033 12.893  1.00 36.69  ? 1443 VAL A CA     1 
ATOM   1314  C  C      . VAL A 1 81   ? 17.321  -76.762 13.335  1.00 36.42  ? 1443 VAL A C      1 
ATOM   1315  O  O      . VAL A 1 81   ? 16.441  -76.170 13.964  1.00 35.48  ? 1443 VAL A O      1 
ATOM   1316  C  CB     . VAL A 1 81   ? 18.429  -75.569 11.432  1.00 36.97  ? 1443 VAL A CB     1 
ATOM   1317  C  CG1    . VAL A 1 81   ? 17.041  -74.967 11.192  1.00 36.16  ? 1443 VAL A CG1    1 
ATOM   1318  C  CG2    . VAL A 1 81   ? 19.514  -74.562 11.079  1.00 37.05  ? 1443 VAL A CG2    1 
ATOM   1319  H  H      . VAL A 1 81   ? 20.267  -76.894 12.349  1.00 45.18  ? 1443 VAL A H      1 
ATOM   1320  H  HA     . VAL A 1 81   ? 18.691  -75.245 13.450  1.00 44.03  ? 1443 VAL A HA     1 
ATOM   1321  H  HB     . VAL A 1 81   ? 18.529  -76.335 10.845  1.00 44.37  ? 1443 VAL A HB     1 
ATOM   1322  H  HG11   . VAL A 1 81   ? 16.975  -74.686 10.266  1.00 43.39  ? 1443 VAL A HG11   1 
ATOM   1323  H  HG12   . VAL A 1 81   ? 16.369  -75.640 11.383  1.00 43.39  ? 1443 VAL A HG12   1 
ATOM   1324  H  HG13   . VAL A 1 81   ? 16.922  -74.204 11.779  1.00 43.39  ? 1443 VAL A HG13   1 
ATOM   1325  H  HG21   . VAL A 1 81   ? 19.398  -74.283 10.157  1.00 44.46  ? 1443 VAL A HG21   1 
ATOM   1326  H  HG22   . VAL A 1 81   ? 19.437  -73.796 11.669  1.00 44.46  ? 1443 VAL A HG22   1 
ATOM   1327  H  HG23   . VAL A 1 81   ? 20.382  -74.981 11.191  1.00 44.46  ? 1443 VAL A HG23   1 
ATOM   1328  N  N      . ASN A 1 82   ? 17.229  -78.042 12.988  1.00 37.32  ? 1444 ASN A N      1 
ATOM   1329  C  CA     . ASN A 1 82   ? 16.077  -78.855 13.357  1.00 37.26  ? 1444 ASN A CA     1 
ATOM   1330  C  C      . ASN A 1 82   ? 16.158  -79.383 14.784  1.00 37.14  ? 1444 ASN A C      1 
ATOM   1331  O  O      . ASN A 1 82   ? 15.156  -79.395 15.492  1.00 36.54  ? 1444 ASN A O      1 
ATOM   1332  C  CB     . ASN A 1 82   ? 15.905  -80.014 12.374  1.00 38.37  ? 1444 ASN A CB     1 
ATOM   1333  C  CG     . ASN A 1 82   ? 15.488  -79.546 10.990  1.00 38.47  ? 1444 ASN A CG     1 
ATOM   1334  O  OD1    . ASN A 1 82   ? 14.302  -79.363 10.720  1.00 38.03  ? 1444 ASN A OD1    1 
ATOM   1335  N  ND2    . ASN A 1 82   ? 16.456  -79.352 10.108  1.00 40.17  ? 1444 ASN A ND2    1 
ATOM   1336  H  H      . ASN A 1 82   ? 17.825  -78.465 12.535  1.00 44.79  ? 1444 ASN A H      1 
ATOM   1337  H  HA     . ASN A 1 82   ? 15.282  -78.302 13.297  1.00 44.71  ? 1444 ASN A HA     1 
ATOM   1338  H  HB2    . ASN A 1 82   ? 16.747  -80.487 12.290  1.00 46.05  ? 1444 ASN A HB2    1 
ATOM   1339  H  HB3    . ASN A 1 82   ? 15.219  -80.613 12.708  1.00 46.05  ? 1444 ASN A HB3    1 
ATOM   1340  H  HD21   . ASN A 1 82   ? 16.266  -79.087 9.312   1.00 48.20  ? 1444 ASN A HD21   1 
ATOM   1341  H  HD22   . ASN A 1 82   ? 17.275  -79.491 10.331  1.00 48.20  ? 1444 ASN A HD22   1 
ATOM   1342  N  N      . TRP A 1 83   ? 17.341  -79.810 15.209  1.00 37.76  ? 1445 TRP A N      1 
ATOM   1343  C  CA     . TRP A 1 83   ? 17.497  -80.439 16.516  1.00 37.87  ? 1445 TRP A CA     1 
ATOM   1344  C  C      . TRP A 1 83   ? 17.038  -79.488 17.620  1.00 36.71  ? 1445 TRP A C      1 
ATOM   1345  O  O      . TRP A 1 83   ? 16.370  -79.906 18.563  1.00 36.52  ? 1445 TRP A O      1 
ATOM   1346  C  CB     . TRP A 1 83   ? 18.952  -80.876 16.734  1.00 38.72  ? 1445 TRP A CB     1 
ATOM   1347  C  CG     . TRP A 1 83   ? 19.162  -81.867 17.855  1.00 39.25  ? 1445 TRP A CG     1 
ATOM   1348  C  CD1    . TRP A 1 83   ? 18.227  -82.339 18.731  1.00 39.02  ? 1445 TRP A CD1    1 
ATOM   1349  C  CD2    . TRP A 1 83   ? 20.394  -82.515 18.200  1.00 40.19  ? 1445 TRP A CD2    1 
ATOM   1350  N  NE1    . TRP A 1 83   ? 18.801  -83.234 19.601  1.00 39.78  ? 1445 TRP A NE1    1 
ATOM   1351  C  CE2    . TRP A 1 83   ? 20.131  -83.358 19.296  1.00 40.50  ? 1445 TRP A CE2    1 
ATOM   1352  C  CE3    . TRP A 1 83   ? 21.694  -82.459 17.689  1.00 40.86  ? 1445 TRP A CE3    1 
ATOM   1353  C  CZ2    . TRP A 1 83   ? 21.120  -84.139 19.888  1.00 41.45  ? 1445 TRP A CZ2    1 
ATOM   1354  C  CZ3    . TRP A 1 83   ? 22.672  -83.235 18.278  1.00 41.77  ? 1445 TRP A CZ3    1 
ATOM   1355  C  CH2    . TRP A 1 83   ? 22.380  -84.064 19.365  1.00 42.06  ? 1445 TRP A CH2    1 
ATOM   1356  H  H      . TRP A 1 83   ? 18.072  -79.748 14.759  1.00 45.31  ? 1445 TRP A H      1 
ATOM   1357  H  HA     . TRP A 1 83   ? 16.938  -81.231 16.553  1.00 45.44  ? 1445 TRP A HA     1 
ATOM   1358  H  HB2    . TRP A 1 83   ? 19.276  -81.286 15.917  1.00 46.46  ? 1445 TRP A HB2    1 
ATOM   1359  H  HB3    . TRP A 1 83   ? 19.482  -80.090 16.936  1.00 46.46  ? 1445 TRP A HB3    1 
ATOM   1360  H  HD1    . TRP A 1 83   ? 17.331  -82.089 18.739  1.00 46.82  ? 1445 TRP A HD1    1 
ATOM   1361  H  HE1    . TRP A 1 83   ? 18.392  -83.648 20.235  1.00 47.73  ? 1445 TRP A HE1    1 
ATOM   1362  H  HE3    . TRP A 1 83   ? 21.896  -81.911 16.966  1.00 49.03  ? 1445 TRP A HE3    1 
ATOM   1363  H  HZ2    . TRP A 1 83   ? 20.929  -84.691 20.612  1.00 49.74  ? 1445 TRP A HZ2    1 
ATOM   1364  H  HZ3    . TRP A 1 83   ? 23.540  -83.205 17.946  1.00 50.13  ? 1445 TRP A HZ3    1 
ATOM   1365  H  HH2    . TRP A 1 83   ? 23.060  -84.574 19.743  1.00 50.47  ? 1445 TRP A HH2    1 
ATOM   1366  N  N      . VAL A 1 84   ? 17.392  -78.212 17.508  1.00 36.02  ? 1446 VAL A N      1 
ATOM   1367  C  CA     . VAL A 1 84   ? 17.058  -77.247 18.555  1.00 35.01  ? 1446 VAL A CA     1 
ATOM   1368  C  C      . VAL A 1 84   ? 15.564  -76.977 18.681  1.00 34.23  ? 1446 VAL A C      1 
ATOM   1369  O  O      . VAL A 1 84   ? 15.041  -76.919 19.794  1.00 33.76  ? 1446 VAL A O      1 
ATOM   1370  C  CB     . VAL A 1 84   ? 17.785  -75.899 18.344  1.00 34.52  ? 1446 VAL A CB     1 
ATOM   1371  C  CG1    . VAL A 1 84   ? 17.402  -75.255 17.015  1.00 34.34  ? 1446 VAL A CG1    1 
ATOM   1372  C  CG2    . VAL A 1 84   ? 17.496  -74.961 19.514  1.00 33.60  ? 1446 VAL A CG2    1 
ATOM   1373  H  H      . VAL A 1 84   ? 17.823  -77.879 16.843  1.00 43.22  ? 1446 VAL A H      1 
ATOM   1374  H  HA     . VAL A 1 84   ? 17.358  -77.606 19.405  1.00 42.01  ? 1446 VAL A HA     1 
ATOM   1375  H  HB     . VAL A 1 84   ? 18.741  -76.062 18.327  1.00 41.43  ? 1446 VAL A HB     1 
ATOM   1376  H  HG11   . VAL A 1 84   ? 17.878  -74.415 16.922  1.00 41.21  ? 1446 VAL A HG11   1 
ATOM   1377  H  HG12   . VAL A 1 84   ? 17.644  -75.854 16.292  1.00 41.21  ? 1446 VAL A HG12   1 
ATOM   1378  H  HG13   . VAL A 1 84   ? 16.445  -75.095 17.006  1.00 41.21  ? 1446 VAL A HG13   1 
ATOM   1379  H  HG21   . VAL A 1 84   ? 17.959  -74.122 19.367  1.00 40.32  ? 1446 VAL A HG21   1 
ATOM   1380  H  HG22   . VAL A 1 84   ? 16.540  -74.808 19.567  1.00 40.32  ? 1446 VAL A HG22   1 
ATOM   1381  H  HG23   . VAL A 1 84   ? 17.811  -75.374 20.334  1.00 40.32  ? 1446 VAL A HG23   1 
ATOM   1382  N  N      . GLU A 1 85   ? 14.874  -76.809 17.558  1.00 55.09  ? 1447 GLU A N      1 
ATOM   1383  C  CA     . GLU A 1 85   ? 13.443  -76.532 17.598  1.00 59.09  ? 1447 GLU A CA     1 
ATOM   1384  C  C      . GLU A 1 85   ? 12.650  -77.757 18.046  1.00 64.44  ? 1447 GLU A C      1 
ATOM   1385  O  O      . GLU A 1 85   ? 11.614  -77.624 18.699  1.00 64.10  ? 1447 GLU A O      1 
ATOM   1386  C  CB     . GLU A 1 85   ? 12.936  -76.039 16.243  1.00 59.96  ? 1447 GLU A CB     1 
ATOM   1387  C  CG     . GLU A 1 85   ? 13.567  -74.735 15.774  1.00 59.75  ? 1447 GLU A CG     1 
ATOM   1388  C  CD     . GLU A 1 85   ? 13.006  -74.266 14.444  1.00 60.51  ? 1447 GLU A CD     1 
ATOM   1389  O  OE1    . GLU A 1 85   ? 11.767  -74.296 14.277  1.00 59.74  ? 1447 GLU A OE1    1 
ATOM   1390  O  OE2    . GLU A 1 85   ? 13.806  -73.876 13.567  1.00 61.83  1 1447 GLU A OE2    1 
ATOM   1391  H  H      . GLU A 1 85   ? 15.207  -76.850 16.766  1.00 66.11  ? 1447 GLU A H      1 
ATOM   1392  H  HA     . GLU A 1 85   ? 13.283  -75.827 18.245  1.00 70.91  ? 1447 GLU A HA     1 
ATOM   1393  H  HB2    . GLU A 1 85   ? 13.127  -76.715 15.575  1.00 71.95  ? 1447 GLU A HB2    1 
ATOM   1394  H  HB3    . GLU A 1 85   ? 11.978  -75.898 16.301  1.00 71.95  ? 1447 GLU A HB3    1 
ATOM   1395  H  HG2    . GLU A 1 85   ? 13.395  -74.044 16.433  1.00 71.70  ? 1447 GLU A HG2    1 
ATOM   1396  H  HG3    . GLU A 1 85   ? 14.523  -74.864 15.669  1.00 71.70  ? 1447 GLU A HG3    1 
ATOM   1397  N  N      . VAL A 1 86   ? 13.131  -78.950 17.697  1.00 34.90  ? 1448 VAL A N      1 
ATOM   1398  C  CA     . VAL A 1 86   ? 12.500  -80.176 18.176  1.00 35.45  ? 1448 VAL A CA     1 
ATOM   1399  C  C      . VAL A 1 86   ? 12.521  -80.185 19.703  1.00 35.14  ? 1448 VAL A C      1 
ATOM   1400  O  O      . VAL A 1 86   ? 11.521  -80.513 20.339  1.00 34.96  ? 1448 VAL A O      1 
ATOM   1401  C  CB     . VAL A 1 86   ? 13.196  -81.443 17.630  1.00 36.75  ? 1448 VAL A CB     1 
ATOM   1402  C  CG1    . VAL A 1 86   ? 12.690  -82.697 18.348  1.00 37.39  ? 1448 VAL A CG1    1 
ATOM   1403  C  CG2    . VAL A 1 86   ? 12.948  -81.582 16.136  1.00 37.17  ? 1448 VAL A CG2    1 
ATOM   1404  H  H      . VAL A 1 86   ? 13.814  -79.074 17.189  1.00 41.88  ? 1448 VAL A H      1 
ATOM   1405  H  HA     . VAL A 1 86   ? 11.574  -80.192 17.887  1.00 42.54  ? 1448 VAL A HA     1 
ATOM   1406  H  HB     . VAL A 1 86   ? 14.153  -81.373 17.776  1.00 44.09  ? 1448 VAL A HB     1 
ATOM   1407  H  HG11   . VAL A 1 86   ? 13.144  -83.473 17.985  1.00 44.87  ? 1448 VAL A HG11   1 
ATOM   1408  H  HG12   . VAL A 1 86   ? 12.880  -82.615 19.296  1.00 44.87  ? 1448 VAL A HG12   1 
ATOM   1409  H  HG13   . VAL A 1 86   ? 11.733  -82.776 18.208  1.00 44.87  ? 1448 VAL A HG13   1 
ATOM   1410  H  HG21   . VAL A 1 86   ? 13.393  -82.382 15.816  1.00 44.60  ? 1448 VAL A HG21   1 
ATOM   1411  H  HG22   . VAL A 1 86   ? 11.992  -81.649 15.981  1.00 44.60  ? 1448 VAL A HG22   1 
ATOM   1412  H  HG23   . VAL A 1 86   ? 13.303  -80.801 15.684  1.00 44.60  ? 1448 VAL A HG23   1 
ATOM   1413  N  N      . GLN A 1 87   ? 13.658  -79.812 20.286  1.00 37.86  ? 1449 GLN A N      1 
ATOM   1414  C  CA     . GLN A 1 87   ? 13.780  -79.753 21.739  1.00 37.64  ? 1449 GLN A CA     1 
ATOM   1415  C  C      . GLN A 1 87   ? 12.835  -78.704 22.301  1.00 36.52  ? 1449 GLN A C      1 
ATOM   1416  O  O      . GLN A 1 87   ? 11.997  -79.002 23.147  1.00 36.37  ? 1449 GLN A O      1 
ATOM   1417  C  CB     . GLN A 1 87   ? 15.213  -79.427 22.171  1.00 37.85  ? 1449 GLN A CB     1 
ATOM   1418  C  CG     . GLN A 1 87   ? 15.384  -79.384 23.694  1.00 37.72  ? 1449 GLN A CG     1 
ATOM   1419  C  CD     . GLN A 1 87   ? 16.837  -79.317 24.149  1.00 38.17  ? 1449 GLN A CD     1 
ATOM   1420  O  OE1    . GLN A 1 87   ? 17.563  -80.313 24.113  1.00 39.17  ? 1449 GLN A OE1    1 
ATOM   1421  N  NE2    . GLN A 1 87   ? 17.254  -78.142 24.622  1.00 37.50  ? 1449 GLN A NE2    1 
ATOM   1422  H  H      . GLN A 1 87   ? 14.372  -79.589 19.863  1.00 45.43  ? 1449 GLN A H      1 
ATOM   1423  H  HA     . GLN A 1 87   ? 13.538  -80.614 22.115  1.00 45.16  ? 1449 GLN A HA     1 
ATOM   1424  H  HB2    . GLN A 1 87   ? 15.810  -80.106 21.821  1.00 45.41  ? 1449 GLN A HB2    1 
ATOM   1425  H  HB3    . GLN A 1 87   ? 15.458  -78.557 21.818  1.00 45.41  ? 1449 GLN A HB3    1 
ATOM   1426  H  HG2    . GLN A 1 87   ? 14.929  -78.600 24.038  1.00 45.26  ? 1449 GLN A HG2    1 
ATOM   1427  H  HG3    . GLN A 1 87   ? 14.991  -80.185 24.075  1.00 45.26  ? 1449 GLN A HG3    1 
ATOM   1428  H  HE21   . GLN A 1 87   ? 16.712  -77.476 24.657  1.00 45.00  ? 1449 GLN A HE21   1 
ATOM   1429  H  HE22   . GLN A 1 87   ? 18.065  -78.051 24.892  1.00 45.00  ? 1449 GLN A HE22   1 
ATOM   1430  N  N      . PHE A 1 88   ? 12.983  -77.476 21.816  1.00 35.71  ? 1450 PHE A N      1 
ATOM   1431  C  CA     . PHE A 1 88   ? 12.228  -76.329 22.311  1.00 34.67  ? 1450 PHE A CA     1 
ATOM   1432  C  C      . PHE A 1 88   ? 10.721  -76.618 22.316  1.00 34.39  ? 1450 PHE A C      1 
ATOM   1433  O  O      . PHE A 1 88   ? 10.062  -76.463 23.345  1.00 33.99  ? 1450 PHE A O      1 
ATOM   1434  C  CB     . PHE A 1 88   ? 12.549  -75.092 21.465  1.00 34.14  ? 1450 PHE A CB     1 
ATOM   1435  C  CG     . PHE A 1 88   ? 11.632  -73.923 21.703  1.00 33.14  ? 1450 PHE A CG     1 
ATOM   1436  C  CD1    . PHE A 1 88   ? 11.599  -73.295 22.938  1.00 32.64  ? 1450 PHE A CD1    1 
ATOM   1437  C  CD2    . PHE A 1 88   ? 10.816  -73.442 20.694  1.00 32.79  ? 1450 PHE A CD2    1 
ATOM   1438  C  CE1    . PHE A 1 88   ? 10.764  -72.218 23.162  1.00 31.79  ? 1450 PHE A CE1    1 
ATOM   1439  C  CE2    . PHE A 1 88   ? 9.982   -72.367 20.914  1.00 31.94  ? 1450 PHE A CE2    1 
ATOM   1440  C  CZ     . PHE A 1 88   ? 9.954   -71.756 22.150  1.00 31.44  ? 1450 PHE A CZ     1 
ATOM   1441  H  H      . PHE A 1 88   ? 13.529  -77.277 21.183  1.00 42.85  ? 1450 PHE A H      1 
ATOM   1442  H  HA     . PHE A 1 88   ? 12.499  -76.144 23.224  1.00 41.60  ? 1450 PHE A HA     1 
ATOM   1443  H  HB2    . PHE A 1 88   ? 13.453  -74.804 21.667  1.00 40.97  ? 1450 PHE A HB2    1 
ATOM   1444  H  HB3    . PHE A 1 88   ? 12.484  -75.331 20.527  1.00 40.97  ? 1450 PHE A HB3    1 
ATOM   1445  H  HD1    . PHE A 1 88   ? 12.143  -73.605 23.626  1.00 39.16  ? 1450 PHE A HD1    1 
ATOM   1446  H  HD2    . PHE A 1 88   ? 10.829  -73.851 19.859  1.00 39.34  ? 1450 PHE A HD2    1 
ATOM   1447  H  HE1    . PHE A 1 88   ? 10.748  -71.807 23.997  1.00 38.15  ? 1450 PHE A HE1    1 
ATOM   1448  H  HE2    . PHE A 1 88   ? 9.435   -72.055 20.229  1.00 38.32  ? 1450 PHE A HE2    1 
ATOM   1449  H  HZ     . PHE A 1 88   ? 9.391   -71.031 22.298  1.00 37.72  ? 1450 PHE A HZ     1 
ATOM   1450  N  N      . TYR A 1 89   ? 10.183  -77.041 21.173  1.00 36.68  ? 1451 TYR A N      1 
ATOM   1451  C  CA     . TYR A 1 89   ? 8.759   -77.367 21.062  1.00 36.51  ? 1451 TYR A CA     1 
ATOM   1452  C  C      . TYR A 1 89   ? 8.321   -78.505 21.974  1.00 37.05  ? 1451 TYR A C      1 
ATOM   1453  O  O      . TYR A 1 89   ? 7.252   -78.451 22.577  1.00 36.68  ? 1451 TYR A O      1 
ATOM   1454  C  CB     . TYR A 1 89   ? 8.403   -77.752 19.625  1.00 36.92  ? 1451 TYR A CB     1 
ATOM   1455  C  CG     . TYR A 1 89   ? 8.078   -76.602 18.700  1.00 36.28  ? 1451 TYR A CG     1 
ATOM   1456  C  CD1    . TYR A 1 89   ? 9.085   -75.871 18.089  1.00 37.83  ? 1451 TYR A CD1    1 
ATOM   1457  C  CD2    . TYR A 1 89   ? 6.759   -76.260 18.423  1.00 35.79  ? 1451 TYR A CD2    1 
ATOM   1458  C  CE1    . TYR A 1 89   ? 8.794   -74.829 17.236  1.00 43.92  ? 1451 TYR A CE1    1 
ATOM   1459  C  CE2    . TYR A 1 89   ? 6.457   -75.218 17.570  1.00 40.00  ? 1451 TYR A CE2    1 
ATOM   1460  C  CZ     . TYR A 1 89   ? 7.480   -74.505 16.979  1.00 48.80  ? 1451 TYR A CZ     1 
ATOM   1461  O  OH     . TYR A 1 89   ? 7.195   -73.464 16.126  1.00 59.21  ? 1451 TYR A OH     1 
ATOM   1462  H  H      . TYR A 1 89   ? 10.623  -77.148 20.442  1.00 44.01  ? 1451 TYR A H      1 
ATOM   1463  H  HA     . TYR A 1 89   ? 8.240   -76.582 21.297  1.00 43.82  ? 1451 TYR A HA     1 
ATOM   1464  H  HB2    . TYR A 1 89   ? 9.154   -78.230 19.241  1.00 44.30  ? 1451 TYR A HB2    1 
ATOM   1465  H  HB3    . TYR A 1 89   ? 7.627   -78.334 19.648  1.00 44.30  ? 1451 TYR A HB3    1 
ATOM   1466  H  HD1    . TYR A 1 89   ? 9.974   -76.087 18.258  1.00 45.40  ? 1451 TYR A HD1    1 
ATOM   1467  H  HD2    . TYR A 1 89   ? 6.069   -76.741 18.821  1.00 42.95  ? 1451 TYR A HD2    1 
ATOM   1468  H  HE1    . TYR A 1 89   ? 9.481   -74.347 16.836  1.00 52.71  ? 1451 TYR A HE1    1 
ATOM   1469  H  HE2    . TYR A 1 89   ? 5.570   -74.998 17.396  1.00 48.00  ? 1451 TYR A HE2    1 
ATOM   1470  H  HH     . TYR A 1 89   ? 6.363   -73.370 16.055  1.00 71.05  ? 1451 TYR A HH     1 
ATOM   1471  N  N      . TRP A 1 90   ? 9.146   -79.541 22.056  1.00 33.33  ? 1452 TRP A N      1 
ATOM   1472  C  CA     . TRP A 1 90   ? 8.834   -80.716 22.861  1.00 34.03  ? 1452 TRP A CA     1 
ATOM   1473  C  C      . TRP A 1 90   ? 8.718   -80.318 24.319  1.00 33.59  ? 1452 TRP A C      1 
ATOM   1474  O  O      . TRP A 1 90   ? 7.767   -80.679 25.013  1.00 33.61  ? 1452 TRP A O      1 
ATOM   1475  C  CB     . TRP A 1 90   ? 9.916   -81.783 22.683  1.00 35.15  ? 1452 TRP A CB     1 
ATOM   1476  C  CG     . TRP A 1 90   ? 9.685   -83.053 23.446  1.00 36.05  ? 1452 TRP A CG     1 
ATOM   1477  C  CD1    . TRP A 1 90   ? 9.068   -84.180 22.992  1.00 36.87  ? 1452 TRP A CD1    1 
ATOM   1478  C  CD2    . TRP A 1 90   ? 10.078  -83.326 24.798  1.00 36.30  ? 1452 TRP A CD2    1 
ATOM   1479  N  NE1    . TRP A 1 90   ? 9.052   -85.139 23.976  1.00 37.63  ? 1452 TRP A NE1    1 
ATOM   1480  C  CE2    . TRP A 1 90   ? 9.666   -84.639 25.095  1.00 37.31  ? 1452 TRP A CE2    1 
ATOM   1481  C  CE3    . TRP A 1 90   ? 10.736  -82.587 25.785  1.00 35.85  ? 1452 TRP A CE3    1 
ATOM   1482  C  CZ2    . TRP A 1 90   ? 9.890   -85.229 26.338  1.00 37.88  ? 1452 TRP A CZ2    1 
ATOM   1483  C  CZ3    . TRP A 1 90   ? 10.957  -83.174 27.018  1.00 36.41  ? 1452 TRP A CZ3    1 
ATOM   1484  C  CH2    . TRP A 1 90   ? 10.537  -84.481 27.283  1.00 37.41  ? 1452 TRP A CH2    1 
ATOM   1485  H  H      . TRP A 1 90   ? 9.903   -79.589 21.650  1.00 39.99  ? 1452 TRP A H      1 
ATOM   1486  H  HA     . TRP A 1 90   ? 7.985   -81.088 22.575  1.00 40.84  ? 1452 TRP A HA     1 
ATOM   1487  H  HB2    . TRP A 1 90   ? 9.971   -82.013 21.743  1.00 42.18  ? 1452 TRP A HB2    1 
ATOM   1488  H  HB3    . TRP A 1 90   ? 10.763  -81.415 22.978  1.00 42.18  ? 1452 TRP A HB3    1 
ATOM   1489  H  HD1    . TRP A 1 90   ? 8.714   -84.286 22.139  1.00 44.24  ? 1452 TRP A HD1    1 
ATOM   1490  H  HE1    . TRP A 1 90   ? 8.711   -85.926 23.902  1.00 45.16  ? 1452 TRP A HE1    1 
ATOM   1491  H  HE3    . TRP A 1 90   ? 11.021  -81.718 25.616  1.00 43.02  ? 1452 TRP A HE3    1 
ATOM   1492  H  HZ2    . TRP A 1 90   ? 9.610   -86.097 26.518  1.00 45.45  ? 1452 TRP A HZ2    1 
ATOM   1493  H  HZ3    . TRP A 1 90   ? 11.396  -82.692 27.682  1.00 43.69  ? 1452 TRP A HZ3    1 
ATOM   1494  H  HH2    . TRP A 1 90   ? 10.698  -84.850 28.121  1.00 44.89  ? 1452 TRP A HH2    1 
ATOM   1495  N  N      . LEU A 1 91   ? 9.717   -79.572 24.771  1.00 33.28  ? 1453 LEU A N      1 
ATOM   1496  C  CA     . LEU A 1 91   ? 9.783   -79.105 26.146  1.00 32.93  ? 1453 LEU A CA     1 
ATOM   1497  C  C      . LEU A 1 91   ? 8.537   -78.304 26.488  1.00 32.05  ? 1453 LEU A C      1 
ATOM   1498  O  O      . LEU A 1 91   ? 7.942   -78.487 27.550  1.00 32.05  ? 1453 LEU A O      1 
ATOM   1499  C  CB     . LEU A 1 91   ? 11.053  -78.260 26.354  1.00 32.70  ? 1453 LEU A CB     1 
ATOM   1500  C  CG     . LEU A 1 91   ? 12.089  -78.690 27.396  1.00 33.31  ? 1453 LEU A CG     1 
ATOM   1501  C  CD1    . LEU A 1 91   ? 12.217  -80.202 27.529  1.00 34.45  ? 1453 LEU A CD1    1 
ATOM   1502  C  CD2    . LEU A 1 91   ? 13.441  -78.105 27.036  1.00 33.33  ? 1453 LEU A CD2    1 
ATOM   1503  H  H      . LEU A 1 91   ? 10.382  -79.319 24.289  1.00 39.94  ? 1453 LEU A H      1 
ATOM   1504  H  HA     . LEU A 1 91   ? 9.825   -79.869 26.742  1.00 39.52  ? 1453 LEU A HA     1 
ATOM   1505  H  HB2    . LEU A 1 91   ? 11.518  -78.218 25.503  1.00 39.23  ? 1453 LEU A HB2    1 
ATOM   1506  H  HB3    . LEU A 1 91   ? 10.770  -77.364 26.599  1.00 39.23  ? 1453 LEU A HB3    1 
ATOM   1507  H  HG     . LEU A 1 91   ? 11.831  -78.335 28.261  1.00 39.98  ? 1453 LEU A HG     1 
ATOM   1508  H  HD11   . LEU A 1 91   ? 12.886  -80.404 28.202  1.00 41.34  ? 1453 LEU A HD11   1 
ATOM   1509  H  HD12   . LEU A 1 91   ? 11.359  -80.569 27.795  1.00 41.34  ? 1453 LEU A HD12   1 
ATOM   1510  H  HD13   . LEU A 1 91   ? 12.486  -80.572 26.674  1.00 41.34  ? 1453 LEU A HD13   1 
ATOM   1511  H  HD21   . LEU A 1 91   ? 14.092  -78.382 27.700  1.00 40.00  ? 1453 LEU A HD21   1 
ATOM   1512  H  HD22   . LEU A 1 91   ? 13.703  -78.431 26.161  1.00 40.00  ? 1453 LEU A HD22   1 
ATOM   1513  H  HD23   . LEU A 1 91   ? 13.373  -77.138 27.022  1.00 40.00  ? 1453 LEU A HD23   1 
ATOM   1514  N  N      . ASP A 1 92   ? 8.154   -77.408 25.587  1.00 56.28  ? 1454 ASP A N      1 
ATOM   1515  C  CA     . ASP A 1 92   ? 6.974   -76.585 25.796  1.00 56.74  ? 1454 ASP A CA     1 
ATOM   1516  C  C      . ASP A 1 92   ? 5.717   -77.450 25.872  1.00 56.53  ? 1454 ASP A C      1 
ATOM   1517  O  O      . ASP A 1 92   ? 4.802   -77.162 26.639  1.00 57.13  ? 1454 ASP A O      1 
ATOM   1518  C  CB     . ASP A 1 92   ? 6.833   -75.551 24.678  1.00 62.63  ? 1454 ASP A CB     1 
ATOM   1519  C  CG     . ASP A 1 92   ? 5.553   -74.741 24.794  1.00 69.21  ? 1454 ASP A CG     1 
ATOM   1520  O  OD1    . ASP A 1 92   ? 5.528   -73.776 25.590  1.00 72.61  ? 1454 ASP A OD1    1 
ATOM   1521  O  OD2    . ASP A 1 92   ? 4.574   -75.074 24.089  1.00 70.16  1 1454 ASP A OD2    1 
ATOM   1522  H  H      . ASP A 1 92   ? 8.563   -77.258 24.845  1.00 67.54  ? 1454 ASP A H      1 
ATOM   1523  H  HA     . ASP A 1 92   ? 7.064   -76.109 26.636  1.00 68.09  ? 1454 ASP A HA     1 
ATOM   1524  H  HB2    . ASP A 1 92   ? 7.582   -74.936 24.719  1.00 75.15  ? 1454 ASP A HB2    1 
ATOM   1525  H  HB3    . ASP A 1 92   ? 6.823   -76.008 23.823  1.00 75.15  ? 1454 ASP A HB3    1 
ATOM   1526  N  N      . LEU A 1 93   ? 5.669   -78.504 25.065  1.00 31.55  ? 1455 LEU A N      1 
ATOM   1527  C  CA     . LEU A 1 93   ? 4.486   -79.357 25.005  1.00 31.93  ? 1455 LEU A CA     1 
ATOM   1528  C  C      . LEU A 1 93   ? 4.394   -80.360 26.148  1.00 32.64  ? 1455 LEU A C      1 
ATOM   1529  O  O      . LEU A 1 93   ? 3.298   -80.801 26.491  1.00 32.80  ? 1455 LEU A O      1 
ATOM   1530  C  CB     . LEU A 1 93   ? 4.429   -80.123 23.681  1.00 32.54  ? 1455 LEU A CB     1 
ATOM   1531  C  CG     . LEU A 1 93   ? 3.638   -79.449 22.562  1.00 31.99  ? 1455 LEU A CG     1 
ATOM   1532  C  CD1    . LEU A 1 93   ? 3.948   -80.117 21.232  1.00 32.69  ? 1455 LEU A CD1    1 
ATOM   1533  C  CD2    . LEU A 1 93   ? 2.140   -79.469 22.859  1.00 31.73  ? 1455 LEU A CD2    1 
ATOM   1534  H  H      . LEU A 1 93   ? 6.308   -78.747 24.542  1.00 37.86  ? 1455 LEU A H      1 
ATOM   1535  H  HA     . LEU A 1 93   ? 3.699   -78.792 25.049  1.00 38.31  ? 1455 LEU A HA     1 
ATOM   1536  H  HB2    . LEU A 1 93   ? 5.336   -80.249 23.361  1.00 39.05  ? 1455 LEU A HB2    1 
ATOM   1537  H  HB3    . LEU A 1 93   ? 4.022   -80.988 23.846  1.00 39.05  ? 1455 LEU A HB3    1 
ATOM   1538  H  HG     . LEU A 1 93   ? 3.915   -78.522 22.498  1.00 38.39  ? 1455 LEU A HG     1 
ATOM   1539  H  HD11   . LEU A 1 93   ? 3.439   -79.678 20.533  1.00 39.23  ? 1455 LEU A HD11   1 
ATOM   1540  H  HD12   . LEU A 1 93   ? 4.898   -80.035 21.052  1.00 39.23  ? 1455 LEU A HD12   1 
ATOM   1541  H  HD13   . LEU A 1 93   ? 3.701   -81.053 21.284  1.00 39.23  ? 1455 LEU A HD13   1 
ATOM   1542  H  HD21   . LEU A 1 93   ? 1.668   -79.035 22.131  1.00 38.07  ? 1455 LEU A HD21   1 
ATOM   1543  H  HD22   . LEU A 1 93   ? 1.847   -80.390 22.941  1.00 38.07  ? 1455 LEU A HD22   1 
ATOM   1544  H  HD23   . LEU A 1 93   ? 1.977   -78.994 23.689  1.00 38.07  ? 1455 LEU A HD23   1 
ATOM   1545  N  N      . TYR A 1 94   ? 5.530   -80.730 26.731  1.00 47.78  ? 1456 TYR A N      1 
ATOM   1546  C  CA     . TYR A 1 94   ? 5.539   -81.765 27.762  1.00 48.63  ? 1456 TYR A CA     1 
ATOM   1547  C  C      . TYR A 1 94   ? 4.688   -81.388 28.970  1.00 60.84  ? 1456 TYR A C      1 
ATOM   1548  O  O      . TYR A 1 94   ? 3.937   -82.216 29.490  1.00 76.89  ? 1456 TYR A O      1 
ATOM   1549  C  CB     . TYR A 1 94   ? 6.972   -82.047 28.217  1.00 49.18  ? 1456 TYR A CB     1 
ATOM   1550  C  CG     . TYR A 1 94   ? 7.058   -83.022 29.369  1.00 50.10  ? 1456 TYR A CG     1 
ATOM   1551  C  CD1    . TYR A 1 94   ? 6.457   -84.269 29.292  1.00 51.03  ? 1456 TYR A CD1    1 
ATOM   1552  C  CD2    . TYR A 1 94   ? 7.745   -82.697 30.530  1.00 50.11  ? 1456 TYR A CD2    1 
ATOM   1553  C  CE1    . TYR A 1 94   ? 6.533   -85.162 30.338  1.00 51.96  ? 1456 TYR A CE1    1 
ATOM   1554  C  CE2    . TYR A 1 94   ? 7.826   -83.584 31.582  1.00 51.03  ? 1456 TYR A CE2    1 
ATOM   1555  C  CZ     . TYR A 1 94   ? 7.219   -84.817 31.480  1.00 51.96  ? 1456 TYR A CZ     1 
ATOM   1556  O  OH     . TYR A 1 94   ? 7.292   -85.713 32.524  1.00 52.97  ? 1456 TYR A OH     1 
ATOM   1557  H  H      . TYR A 1 94   ? 6.304   -80.401 26.550  1.00 57.33  ? 1456 TYR A H      1 
ATOM   1558  H  HA     . TYR A 1 94   ? 5.179   -82.584 27.388  1.00 58.36  ? 1456 TYR A HA     1 
ATOM   1559  H  HB2    . TYR A 1 94   ? 7.469   -82.421 27.473  1.00 59.02  ? 1456 TYR A HB2    1 
ATOM   1560  H  HB3    . TYR A 1 94   ? 7.380   -81.214 28.501  1.00 59.02  ? 1456 TYR A HB3    1 
ATOM   1561  H  HD1    . TYR A 1 94   ? 5.993   -84.505 28.522  1.00 61.24  ? 1456 TYR A HD1    1 
ATOM   1562  H  HD2    . TYR A 1 94   ? 8.156   -81.865 30.600  1.00 60.13  ? 1456 TYR A HD2    1 
ATOM   1563  H  HE1    . TYR A 1 94   ? 6.123   -85.994 30.272  1.00 62.35  ? 1456 TYR A HE1    1 
ATOM   1564  H  HE2    . TYR A 1 94   ? 8.289   -83.353 32.355  1.00 61.23  ? 1456 TYR A HE2    1 
ATOM   1565  H  HH     . TYR A 1 94   ? 7.736   -85.381 33.156  1.00 63.57  ? 1456 TYR A HH     1 
ATOM   1566  N  N      . GLY A 1 95   ? 4.810   -80.140 29.409  1.00 78.26  ? 1457 GLY A N      1 
ATOM   1567  C  CA     . GLY A 1 95   ? 4.020   -79.627 30.515  1.00 77.99  ? 1457 GLY A CA     1 
ATOM   1568  C  C      . GLY A 1 95   ? 2.523   -79.744 30.296  1.00 77.12  ? 1457 GLY A C      1 
ATOM   1569  O  O      . GLY A 1 95   ? 1.764   -80.038 31.221  1.00 80.55  ? 1457 GLY A O      1 
ATOM   1570  H  H      . GLY A 1 95   ? 5.353   -79.563 29.074  1.00 93.91  ? 1457 GLY A H      1 
ATOM   1571  H  HA2    . GLY A 1 95   ? 4.248   -80.115 31.322  1.00 93.59  ? 1457 GLY A HA2    1 
ATOM   1572  H  HA3    . GLY A 1 95   ? 4.234   -78.692 30.654  1.00 93.59  ? 1457 GLY A HA3    1 
ATOM   1573  N  N      . ILE A 1 96   ? 2.104   -79.503 29.059  1.00 53.16  ? 1458 ILE A N      1 
ATOM   1574  C  CA     . ILE A 1 96   ? 0.692   -79.510 28.702  1.00 51.10  ? 1458 ILE A CA     1 
ATOM   1575  C  C      . ILE A 1 96   ? 0.147   -80.931 28.473  1.00 51.95  ? 1458 ILE A C      1 
ATOM   1576  O  O      . ILE A 1 96   ? -1.033  -81.182 28.713  1.00 53.06  ? 1458 ILE A O      1 
ATOM   1577  C  CB     . ILE A 1 96   ? 0.443   -78.642 27.438  1.00 49.78  ? 1458 ILE A CB     1 
ATOM   1578  C  CG1    . ILE A 1 96   ? 1.225   -77.318 27.523  1.00 48.95  ? 1458 ILE A CG1    1 
ATOM   1579  C  CG2    . ILE A 1 96   ? -1.059  -78.437 27.203  1.00 49.45  ? 1458 ILE A CG2    1 
ATOM   1580  C  CD1    . ILE A 1 96   ? 1.061   -76.538 28.824  1.00 48.49  ? 1458 ILE A CD1    1 
ATOM   1581  H  H      . ILE A 1 96   ? 2.627   -79.330 28.399  1.00 63.79  ? 1458 ILE A H      1 
ATOM   1582  H  HA     . ILE A 1 96   ? 0.188   -79.118 29.432  1.00 61.31  ? 1458 ILE A HA     1 
ATOM   1583  H  HB     . ILE A 1 96   ? 0.789   -79.134 26.677  1.00 59.74  ? 1458 ILE A HB     1 
ATOM   1584  H  HG12   . ILE A 1 96   ? 2.169   -77.512 27.418  1.00 58.75  ? 1458 ILE A HG12   1 
ATOM   1585  H  HG13   . ILE A 1 96   ? 0.932   -76.742 26.800  1.00 58.75  ? 1458 ILE A HG13   1 
ATOM   1586  H  HG21   . ILE A 1 96   ? -1.182  -77.893 26.410  1.00 59.35  ? 1458 ILE A HG21   1 
ATOM   1587  H  HG22   . ILE A 1 96   ? -1.480  -79.302 27.081  1.00 59.35  ? 1458 ILE A HG22   1 
ATOM   1588  H  HG23   . ILE A 1 96   ? -1.440  -77.989 27.975  1.00 59.35  ? 1458 ILE A HG23   1 
ATOM   1589  H  HD11   . ILE A 1 96   ? 1.591   -75.727 28.774  1.00 58.19  ? 1458 ILE A HD11   1 
ATOM   1590  H  HD12   . ILE A 1 96   ? 0.125   -76.315 28.942  1.00 58.19  ? 1458 ILE A HD12   1 
ATOM   1591  H  HD13   . ILE A 1 96   ? 1.366   -77.088 29.562  1.00 58.19  ? 1458 ILE A HD13   1 
ATOM   1592  N  N      . LEU A 1 97   ? 0.995   -81.850 28.007  1.00 62.98  ? 1459 LEU A N      1 
ATOM   1593  C  CA     . LEU A 1 97   ? 0.533   -83.166 27.541  1.00 61.55  ? 1459 LEU A CA     1 
ATOM   1594  C  C      . LEU A 1 97   ? 0.966   -84.344 28.410  1.00 67.68  ? 1459 LEU A C      1 
ATOM   1595  O  O      . LEU A 1 97   ? 0.123   -85.026 28.983  1.00 74.35  ? 1459 LEU A O      1 
ATOM   1596  C  CB     . LEU A 1 97   ? 1.019   -83.395 26.108  1.00 56.27  ? 1459 LEU A CB     1 
ATOM   1597  C  CG     . LEU A 1 97   ? 0.306   -82.574 25.034  1.00 49.12  ? 1459 LEU A CG     1 
ATOM   1598  C  CD1    . LEU A 1 97   ? 0.893   -82.874 23.668  1.00 49.49  ? 1459 LEU A CD1    1 
ATOM   1599  C  CD2    . LEU A 1 97   ? -1.192  -82.863 25.020  1.00 49.21  ? 1459 LEU A CD2    1 
ATOM   1600  H  H      . LEU A 1 97   ? 1.845   -81.739 27.949  1.00 75.57  ? 1459 LEU A H      1 
ATOM   1601  H  HA     . LEU A 1 97   ? -0.436  -83.161 27.523  1.00 73.87  ? 1459 LEU A HA     1 
ATOM   1602  H  HB2    . LEU A 1 97   ? 1.962   -83.174 26.064  1.00 67.52  ? 1459 LEU A HB2    1 
ATOM   1603  H  HB3    . LEU A 1 97   ? 0.895   -84.332 25.888  1.00 67.52  ? 1459 LEU A HB3    1 
ATOM   1604  H  HG     . LEU A 1 97   ? 0.431   -81.629 25.217  1.00 58.95  ? 1459 LEU A HG     1 
ATOM   1605  H  HD11   . LEU A 1 97   ? 0.429   -82.344 23.001  1.00 59.39  ? 1459 LEU A HD11   1 
ATOM   1606  H  HD12   . LEU A 1 97   ? 1.836   -82.647 23.673  1.00 59.39  ? 1459 LEU A HD12   1 
ATOM   1607  H  HD13   . LEU A 1 97   ? 0.781   -83.819 23.477  1.00 59.39  ? 1459 LEU A HD13   1 
ATOM   1608  H  HD21   . LEU A 1 97   ? -1.611  -82.327 24.329  1.00 59.05  ? 1459 LEU A HD21   1 
ATOM   1609  H  HD22   . LEU A 1 97   ? -1.330  -83.806 24.837  1.00 59.05  ? 1459 LEU A HD22   1 
ATOM   1610  H  HD23   . LEU A 1 97   ? -1.565  -82.637 25.887  1.00 59.05  ? 1459 LEU A HD23   1 
ATOM   1611  N  N      . GLY A 1 98   ? 2.270   -84.591 28.483  1.00 80.05  ? 1460 GLY A N      1 
ATOM   1612  C  CA     . GLY A 1 98   ? 2.802   -85.787 29.117  1.00 78.59  ? 1460 GLY A CA     1 
ATOM   1613  C  C      . GLY A 1 98   ? 2.492   -86.011 30.589  1.00 78.02  ? 1460 GLY A C      1 
ATOM   1614  O  O      . GLY A 1 98   ? 2.524   -87.155 31.048  1.00 78.08  ? 1460 GLY A O      1 
ATOM   1615  H  H      . GLY A 1 98   ? 2.876   -84.069 28.166  1.00 96.05  ? 1460 GLY A H      1 
ATOM   1616  H  HA2    . GLY A 1 98   ? 2.473   -86.559 28.632  1.00 94.31  ? 1460 GLY A HA2    1 
ATOM   1617  H  HA3    . GLY A 1 98   ? 3.768   -85.775 29.025  1.00 94.31  ? 1460 GLY A HA3    1 
ATOM   1618  N  N      . GLU A 1 99   ? 2.179   -84.949 31.329  1.00 98.29  ? 1461 GLU A N      1 
ATOM   1619  C  CA     . GLU A 1 99   ? 1.975   -85.073 32.774  1.00 99.82  ? 1461 GLU A CA     1 
ATOM   1620  C  C      . GLU A 1 99   ? 0.517   -85.215 33.211  1.00 99.36  ? 1461 GLU A C      1 
ATOM   1621  O  O      . GLU A 1 99   ? 0.094   -86.302 33.606  1.00 103.05 ? 1461 GLU A O      1 
ATOM   1622  C  CB     . GLU A 1 99   ? 2.573   -83.862 33.489  1.00 100.53 ? 1461 GLU A CB     1 
ATOM   1623  C  CG     . GLU A 1 99   ? 4.079   -83.752 33.394  1.00 101.73 ? 1461 GLU A CG     1 
ATOM   1624  C  CD     . GLU A 1 99   ? 4.610   -82.559 34.166  1.00 104.32 ? 1461 GLU A CD     1 
ATOM   1625  O  OE1    . GLU A 1 99   ? 4.104   -82.298 35.278  1.00 107.16 ? 1461 GLU A OE1    1 
ATOM   1626  O  OE2    . GLU A 1 99   ? 5.521   -81.875 33.657  1.00 105.95 1 1461 GLU A OE2    1 
ATOM   1627  H  H      . GLU A 1 99   ? 2.079   -84.152 31.022  1.00 117.94 ? 1461 GLU A H      1 
ATOM   1628  H  HA     . GLU A 1 99   ? 2.450   -85.860 33.085  1.00 119.78 ? 1461 GLU A HA     1 
ATOM   1629  H  HB2    . GLU A 1 99   ? 2.195   -83.057 33.102  1.00 120.64 ? 1461 GLU A HB2    1 
ATOM   1630  H  HB3    . GLU A 1 99   ? 2.341   -83.913 34.429  1.00 120.64 ? 1461 GLU A HB3    1 
ATOM   1631  H  HG2    . GLU A 1 99   ? 4.481   -84.554 33.763  1.00 122.08 ? 1461 GLU A HG2    1 
ATOM   1632  H  HG3    . GLU A 1 99   ? 4.333   -83.647 32.464  1.00 122.08 ? 1461 GLU A HG3    1 
ATOM   1633  N  N      . ASN A 1 100  ? -0.250  -84.129 33.139  1.00 61.05  ? 1462 ASN A N      1 
ATOM   1634  C  CA     . ASN A 1 100  ? -1.599  -84.130 33.699  1.00 58.36  ? 1462 ASN A CA     1 
ATOM   1635  C  C      . ASN A 1 100  ? -2.472  -85.143 32.972  1.00 57.95  ? 1462 ASN A C      1 
ATOM   1636  O  O      . ASN A 1 100  ? -2.647  -85.060 31.760  1.00 57.62  ? 1462 ASN A O      1 
ATOM   1637  C  CB     . ASN A 1 100  ? -2.216  -82.731 33.620  1.00 61.64  ? 1462 ASN A CB     1 
ATOM   1638  C  CG     . ASN A 1 100  ? -3.618  -82.678 34.209  1.00 61.25  ? 1462 ASN A CG     1 
ATOM   1639  O  OD1    . ASN A 1 100  ? -4.590  -83.083 33.571  1.00 60.28  ? 1462 ASN A OD1    1 
ATOM   1640  N  ND2    . ASN A 1 100  ? -3.727  -82.167 35.432  1.00 59.78  ? 1462 ASN A ND2    1 
ATOM   1641  H  H      . ASN A 1 100  ? -0.016  -83.385 32.775  1.00 73.26  ? 1462 ASN A H      1 
ATOM   1642  H  HA     . ASN A 1 100  ? -1.553  -84.387 34.633  1.00 70.04  ? 1462 ASN A HA     1 
ATOM   1643  H  HB2    . ASN A 1 100  ? -1.659  -82.110 34.115  1.00 73.97  ? 1462 ASN A HB2    1 
ATOM   1644  H  HB3    . ASN A 1 100  ? -2.270  -82.460 32.690  1.00 73.97  ? 1462 ASN A HB3    1 
ATOM   1645  H  HD21   . ASN A 1 100  ? -4.499  -82.115 35.809  1.00 71.74  ? 1462 ASN A HD21   1 
ATOM   1646  H  HD22   . ASN A 1 100  ? -3.027  -81.888 35.846  1.00 71.74  ? 1462 ASN A HD22   1 
ATOM   1647  N  N      . LEU A 1 101  ? -3.047  -86.073 33.731  1.00 77.39  ? 1463 LEU A N      1 
ATOM   1648  C  CA     . LEU A 1 101  ? -3.773  -87.200 33.153  1.00 79.30  ? 1463 LEU A CA     1 
ATOM   1649  C  C      . LEU A 1 101  ? -5.117  -86.749 32.607  1.00 75.02  ? 1463 LEU A C      1 
ATOM   1650  O  O      . LEU A 1 101  ? -5.578  -87.252 31.584  1.00 77.45  ? 1463 LEU A O      1 
ATOM   1651  C  CB     . LEU A 1 101  ? -3.962  -88.308 34.201  1.00 79.14  ? 1463 LEU A CB     1 
ATOM   1652  C  CG     . LEU A 1 101  ? -4.586  -89.648 33.777  1.00 78.94  ? 1463 LEU A CG     1 
ATOM   1653  C  CD1    . LEU A 1 101  ? -4.130  -90.763 34.715  1.00 79.95  ? 1463 LEU A CD1    1 
ATOM   1654  C  CD2    . LEU A 1 101  ? -6.115  -89.597 33.749  1.00 77.66  ? 1463 LEU A CD2    1 
ATOM   1655  H  H      . LEU A 1 101  ? -3.030  -86.074 34.591  1.00 92.87  ? 1463 LEU A H      1 
ATOM   1656  H  HA     . LEU A 1 101  ? -3.257  -87.565 32.417  1.00 95.17  ? 1463 LEU A HA     1 
ATOM   1657  H  HB2    . LEU A 1 101  ? -3.089  -88.514 34.570  1.00 94.97  ? 1463 LEU A HB2    1 
ATOM   1658  H  HB3    . LEU A 1 101  ? -4.524  -87.952 34.906  1.00 94.97  ? 1463 LEU A HB3    1 
ATOM   1659  H  HG     . LEU A 1 101  ? -4.279  -89.867 32.883  1.00 94.72  ? 1463 LEU A HG     1 
ATOM   1660  H  HD11   . LEU A 1 101  ? -4.533  -91.599 34.431  1.00 95.94  ? 1463 LEU A HD11   1 
ATOM   1661  H  HD12   . LEU A 1 101  ? -3.163  -90.833 34.676  1.00 95.94  ? 1463 LEU A HD12   1 
ATOM   1662  H  HD13   . LEU A 1 101  ? -4.411  -90.550 35.618  1.00 95.94  ? 1463 LEU A HD13   1 
ATOM   1663  H  HD21   . LEU A 1 101  ? -6.454  -90.463 33.476  1.00 93.19  ? 1463 LEU A HD21   1 
ATOM   1664  H  HD22   . LEU A 1 101  ? -6.439  -89.378 34.636  1.00 93.19  ? 1463 LEU A HD22   1 
ATOM   1665  H  HD23   . LEU A 1 101  ? -6.396  -88.917 33.116  1.00 93.19  ? 1463 LEU A HD23   1 
ATOM   1666  N  N      . ASP A 1 102  ? -5.738  -85.790 33.283  1.00 66.40  ? 1464 ASP A N      1 
ATOM   1667  C  CA     . ASP A 1 102  ? -7.082  -85.362 32.923  1.00 70.03  ? 1464 ASP A CA     1 
ATOM   1668  C  C      . ASP A 1 102  ? -7.069  -84.690 31.561  1.00 63.44  ? 1464 ASP A C      1 
ATOM   1669  O  O      . ASP A 1 102  ? -7.961  -84.908 30.744  1.00 63.52  ? 1464 ASP A O      1 
ATOM   1670  C  CB     . ASP A 1 102  ? -7.662  -84.414 33.975  1.00 78.10  ? 1464 ASP A CB     1 
ATOM   1671  C  CG     . ASP A 1 102  ? -9.181  -84.340 33.918  1.00 86.56  ? 1464 ASP A CG     1 
ATOM   1672  O  OD1    . ASP A 1 102  ? -9.751  -84.523 32.819  1.00 87.84  ? 1464 ASP A OD1    1 
ATOM   1673  O  OD2    . ASP A 1 102  ? -9.804  -84.104 34.977  1.00 90.60  1 1464 ASP A OD2    1 
ATOM   1674  H  H      . ASP A 1 102  ? -5.402  -85.371 33.954  1.00 79.68  ? 1464 ASP A H      1 
ATOM   1675  H  HA     . ASP A 1 102  ? -7.658  -86.141 32.869  1.00 84.03  ? 1464 ASP A HA     1 
ATOM   1676  H  HB2    . ASP A 1 102  ? -7.409  -84.727 34.858  1.00 93.71  ? 1464 ASP A HB2    1 
ATOM   1677  H  HB3    . ASP A 1 102  ? -7.312  -83.522 33.825  1.00 93.71  ? 1464 ASP A HB3    1 
ATOM   1678  N  N      . ILE A 1 103  ? -6.081  -83.838 31.324  1.00 44.39  ? 1465 ILE A N      1 
ATOM   1679  C  CA     . ILE A 1 103  ? -6.085  -83.082 30.086  1.00 45.23  ? 1465 ILE A CA     1 
ATOM   1680  C  C      . ILE A 1 103  ? -5.727  -84.009 28.920  1.00 45.15  ? 1465 ILE A C      1 
ATOM   1681  O  O      . ILE A 1 103  ? -6.317  -83.908 27.845  1.00 55.35  ? 1465 ILE A O      1 
ATOM   1682  C  CB     . ILE A 1 103  ? -5.126  -81.863 30.133  1.00 42.52  ? 1465 ILE A CB     1 
ATOM   1683  C  CG1    . ILE A 1 103  ? -5.209  -81.076 28.824  1.00 41.72  ? 1465 ILE A CG1    1 
ATOM   1684  C  CG2    . ILE A 1 103  ? -3.701  -82.287 30.437  1.00 42.97  ? 1465 ILE A CG2    1 
ATOM   1685  C  CD1    . ILE A 1 103  ? -6.635  -80.686 28.431  1.00 41.34  ? 1465 ILE A CD1    1 
ATOM   1686  H  H      . ILE A 1 103  ? -5.415  -83.684 31.847  1.00 53.27  ? 1465 ILE A H      1 
ATOM   1687  H  HA     . ILE A 1 103  ? -6.981  -82.745 29.931  1.00 54.28  ? 1465 ILE A HA     1 
ATOM   1688  H  HB     . ILE A 1 103  ? -5.422  -81.280 30.849  1.00 51.02  ? 1465 ILE A HB     1 
ATOM   1689  H  HG12   . ILE A 1 103  ? -4.692  -80.260 28.916  1.00 50.06  ? 1465 ILE A HG12   1 
ATOM   1690  H  HG13   . ILE A 1 103  ? -4.842  -81.619 28.109  1.00 50.06  ? 1465 ILE A HG13   1 
ATOM   1691  H  HG21   . ILE A 1 103  ? -3.135  -81.499 30.458  1.00 51.56  ? 1465 ILE A HG21   1 
ATOM   1692  H  HG22   . ILE A 1 103  ? -3.681  -82.731 31.299  1.00 51.56  ? 1465 ILE A HG22   1 
ATOM   1693  H  HG23   . ILE A 1 103  ? -3.398  -82.894 29.744  1.00 51.56  ? 1465 ILE A HG23   1 
ATOM   1694  H  HD11   . ILE A 1 103  ? -6.609  -80.193 27.596  1.00 49.61  ? 1465 ILE A HD11   1 
ATOM   1695  H  HD12   . ILE A 1 103  ? -7.164  -81.492 28.323  1.00 49.61  ? 1465 ILE A HD12   1 
ATOM   1696  H  HD13   . ILE A 1 103  ? -7.015  -80.132 29.131  1.00 49.61  ? 1465 ILE A HD13   1 
ATOM   1697  N  N      . GLN A 1 104  ? -4.762  -84.904 29.124  1.00 74.68  ? 1466 GLN A N      1 
ATOM   1698  C  CA     . GLN A 1 104  ? -4.374  -85.845 28.074  1.00 72.17  ? 1466 GLN A CA     1 
ATOM   1699  C  C      . GLN A 1 104  ? -5.486  -86.867 27.857  1.00 72.58  ? 1466 GLN A C      1 
ATOM   1700  O  O      . GLN A 1 104  ? -5.492  -87.590 26.862  1.00 76.50  ? 1466 GLN A O      1 
ATOM   1701  C  CB     . GLN A 1 104  ? -3.049  -86.551 28.403  1.00 72.92  ? 1466 GLN A CB     1 
ATOM   1702  C  CG     . GLN A 1 104  ? -3.048  -87.404 29.665  1.00 74.60  ? 1466 GLN A CG     1 
ATOM   1703  C  CD     . GLN A 1 104  ? -1.664  -87.951 29.988  1.00 76.80  ? 1466 GLN A CD     1 
ATOM   1704  O  OE1    . GLN A 1 104  ? -0.668  -87.529 29.401  1.00 76.90  ? 1466 GLN A OE1    1 
ATOM   1705  N  NE2    . GLN A 1 104  ? -1.591  -88.873 30.943  1.00 78.29  ? 1466 GLN A NE2    1 
ATOM   1706  H  H      . GLN A 1 104  ? -4.318  -84.987 29.857  1.00 89.61  ? 1466 GLN A H      1 
ATOM   1707  H  HA     . GLN A 1 104  ? -4.252  -85.357 27.245  1.00 86.60  ? 1466 GLN A HA     1 
ATOM   1708  H  HB2    . GLN A 1 104  ? -2.818  -87.132 27.661  1.00 87.50  ? 1466 GLN A HB2    1 
ATOM   1709  H  HB3    . GLN A 1 104  ? -2.361  -85.876 28.510  1.00 87.50  ? 1466 GLN A HB3    1 
ATOM   1710  H  HG2    . GLN A 1 104  ? -3.342  -86.864 30.414  1.00 89.51  ? 1466 GLN A HG2    1 
ATOM   1711  H  HG3    . GLN A 1 104  ? -3.648  -88.157 29.540  1.00 89.51  ? 1466 GLN A HG3    1 
ATOM   1712  H  HE21   . GLN A 1 104  ? -2.306  -89.133 31.345  1.00 93.95  ? 1466 GLN A HE21   1 
ATOM   1713  H  HE22   . GLN A 1 104  ? -0.830  -89.210 31.159  1.00 93.95  ? 1466 GLN A HE22   1 
ATOM   1714  N  N      . ASN A 1 105  ? -6.423  -86.925 28.800  1.00 64.33  ? 1467 ASN A N      1 
ATOM   1715  C  CA     . ASN A 1 105  ? -7.569  -87.813 28.687  1.00 64.82  ? 1467 ASN A CA     1 
ATOM   1716  C  C      . ASN A 1 105  ? -8.536  -87.323 27.608  1.00 64.26  ? 1467 ASN A C      1 
ATOM   1717  O  O      . ASN A 1 105  ? -8.994  -88.106 26.780  1.00 65.00  ? 1467 ASN A O      1 
ATOM   1718  C  CB     . ASN A 1 105  ? -8.269  -87.935 30.045  1.00 79.71  ? 1467 ASN A CB     1 
ATOM   1719  C  CG     . ASN A 1 105  ? -9.439  -88.884 30.021  1.00 93.66  ? 1467 ASN A CG     1 
ATOM   1720  O  OD1    . ASN A 1 105  ? -9.268  -90.106 30.040  1.00 99.40  ? 1467 ASN A OD1    1 
ATOM   1721  N  ND2    . ASN A 1 105  ? -10.646 -88.326 30.009  1.00 97.07  ? 1467 ASN A ND2    1 
ATOM   1722  H  H      . ASN A 1 105  ? -6.415  -86.455 29.520  1.00 77.20  ? 1467 ASN A H      1 
ATOM   1723  H  HA     . ASN A 1 105  ? -7.259  -88.696 28.430  1.00 77.78  ? 1467 ASN A HA     1 
ATOM   1724  H  HB2    . ASN A 1 105  ? -7.632  -88.261 30.700  1.00 95.65  ? 1467 ASN A HB2    1 
ATOM   1725  H  HB3    . ASN A 1 105  ? -8.598  -87.061 30.310  1.00 95.65  ? 1467 ASN A HB3    1 
ATOM   1726  H  HD21   . ASN A 1 105  ? -11.348 -88.822 29.996  1.00 116.48 ? 1467 ASN A HD21   1 
ATOM   1727  H  HD22   . ASN A 1 105  ? -10.724 -87.470 30.015  1.00 116.48 ? 1467 ASN A HD22   1 
ATOM   1728  N  N      . PHE A 1 106  ? -8.838  -86.028 27.611  1.00 83.18  ? 1468 PHE A N      1 
ATOM   1729  C  CA     . PHE A 1 106  ? -9.745  -85.455 26.616  1.00 84.19  ? 1468 PHE A CA     1 
ATOM   1730  C  C      . PHE A 1 106  ? -9.061  -85.229 25.282  1.00 77.83  ? 1468 PHE A C      1 
ATOM   1731  O  O      . PHE A 1 106  ? -9.710  -84.887 24.297  1.00 74.04  ? 1468 PHE A O      1 
ATOM   1732  C  CB     . PHE A 1 106  ? -10.361 -84.148 27.130  1.00 86.19  ? 1468 PHE A CB     1 
ATOM   1733  C  CG     . PHE A 1 106  ? -11.349 -84.340 28.251  1.00 90.50  ? 1468 PHE A CG     1 
ATOM   1734  C  CD1    . PHE A 1 106  ? -11.803 -85.607 28.592  1.00 92.70  ? 1468 PHE A CD1    1 
ATOM   1735  C  CD2    . PHE A 1 106  ? -11.843 -83.254 28.950  1.00 92.16  ? 1468 PHE A CD2    1 
ATOM   1736  C  CE1    . PHE A 1 106  ? -12.713 -85.787 29.608  1.00 95.70  ? 1468 PHE A CE1    1 
ATOM   1737  C  CE2    . PHE A 1 106  ? -12.760 -83.432 29.973  1.00 96.38  ? 1468 PHE A CE2    1 
ATOM   1738  C  CZ     . PHE A 1 106  ? -13.194 -84.702 30.298  1.00 96.90  ? 1468 PHE A CZ     1 
ATOM   1739  H  H      . PHE A 1 106  ? -8.532  -85.458 28.178  1.00 99.81  ? 1468 PHE A H      1 
ATOM   1740  H  HA     . PHE A 1 106  ? -10.472 -86.080 26.467  1.00 101.03 ? 1468 PHE A HA     1 
ATOM   1741  H  HB2    . PHE A 1 106  ? -9.649  -83.575 27.456  1.00 103.43 ? 1468 PHE A HB2    1 
ATOM   1742  H  HB3    . PHE A 1 106  ? -10.824 -83.712 26.398  1.00 103.43 ? 1468 PHE A HB3    1 
ATOM   1743  H  HD1    . PHE A 1 106  ? -11.483 -86.347 28.128  1.00 111.24 ? 1468 PHE A HD1    1 
ATOM   1744  H  HD2    . PHE A 1 106  ? -11.554 -82.397 28.733  1.00 110.59 ? 1468 PHE A HD2    1 
ATOM   1745  H  HE1    . PHE A 1 106  ? -13.003 -86.643 29.825  1.00 114.85 ? 1468 PHE A HE1    1 
ATOM   1746  H  HE2    . PHE A 1 106  ? -13.084 -82.696 30.440  1.00 115.66 ? 1468 PHE A HE2    1 
ATOM   1747  H  HZ     . PHE A 1 106  ? -13.808 -84.822 30.986  1.00 116.28 ? 1468 PHE A HZ     1 
ATOM   1748  N  N      . LEU A 1 107  ? -7.753  -85.426 25.255  1.00 63.26  ? 1469 LEU A N      1 
ATOM   1749  C  CA     . LEU A 1 107  ? -6.999  -85.369 24.016  1.00 65.91  ? 1469 LEU A CA     1 
ATOM   1750  C  C      . LEU A 1 107  ? -6.247  -86.668 23.860  1.00 76.39  ? 1469 LEU A C      1 
ATOM   1751  O  O      . LEU A 1 107  ? -5.020  -86.703 23.986  1.00 88.50  ? 1469 LEU A O      1 
ATOM   1752  C  CB     . LEU A 1 107  ? -6.044  -84.184 23.999  1.00 62.76  ? 1469 LEU A CB     1 
ATOM   1753  C  CG     . LEU A 1 107  ? -6.739  -82.841 23.804  1.00 60.98  ? 1469 LEU A CG     1 
ATOM   1754  C  CD1    . LEU A 1 107  ? -5.757  -81.712 24.058  1.00 61.79  ? 1469 LEU A CD1    1 
ATOM   1755  C  CD2    . LEU A 1 107  ? -7.330  -82.748 22.397  1.00 63.49  ? 1469 LEU A CD2    1 
ATOM   1756  H  H      . LEU A 1 107  ? -7.274  -85.597 25.949  1.00 75.91  ? 1469 LEU A H      1 
ATOM   1757  H  HA     . LEU A 1 107  ? -7.611  -85.278 23.270  1.00 79.09  ? 1469 LEU A HA     1 
ATOM   1758  H  HB2    . LEU A 1 107  ? -5.570  -84.153 24.845  1.00 75.32  ? 1469 LEU A HB2    1 
ATOM   1759  H  HB3    . LEU A 1 107  ? -5.413  -84.301 23.272  1.00 75.32  ? 1469 LEU A HB3    1 
ATOM   1760  H  HG     . LEU A 1 107  ? -7.464  -82.761 24.443  1.00 73.17  ? 1469 LEU A HG     1 
ATOM   1761  H  HD11   . LEU A 1 107  ? -6.212  -80.865 23.930  1.00 74.14  ? 1469 LEU A HD11   1 
ATOM   1762  H  HD12   . LEU A 1 107  ? -5.429  -81.778 24.968  1.00 74.14  ? 1469 LEU A HD12   1 
ATOM   1763  H  HD13   . LEU A 1 107  ? -5.020  -81.790 23.433  1.00 74.14  ? 1469 LEU A HD13   1 
ATOM   1764  H  HD21   . LEU A 1 107  ? -7.767  -81.887 22.295  1.00 76.19  ? 1469 LEU A HD21   1 
ATOM   1765  H  HD22   . LEU A 1 107  ? -6.615  -82.835 21.748  1.00 76.19  ? 1469 LEU A HD22   1 
ATOM   1766  H  HD23   . LEU A 1 107  ? -7.975  -83.462 22.278  1.00 76.19  ? 1469 LEU A HD23   1 
ATOM   1767  N  N      . PRO A 1 108  ? -6.993  -87.751 23.590  1.00 105.54 ? 1470 PRO A N      1 
ATOM   1768  C  CA     . PRO A 1 108  ? -6.362  -89.063 23.477  1.00 105.84 ? 1470 PRO A CA     1 
ATOM   1769  C  C      . PRO A 1 108  ? -5.346  -89.003 22.375  1.00 104.71 ? 1470 PRO A C      1 
ATOM   1770  O  O      . PRO A 1 108  ? -4.295  -89.641 22.393  1.00 105.53 ? 1470 PRO A O      1 
ATOM   1771  C  CB     . PRO A 1 108  ? -7.522  -89.983 23.086  1.00 105.28 ? 1470 PRO A CB     1 
ATOM   1772  C  CG     . PRO A 1 108  ? -8.451  -89.084 22.338  1.00 104.28 ? 1470 PRO A CG     1 
ATOM   1773  C  CD     . PRO A 1 108  ? -8.358  -87.753 23.029  1.00 105.29 ? 1470 PRO A CD     1 
ATOM   1774  H  HA     . PRO A 1 108  ? -5.958  -89.346 24.313  1.00 127.00 ? 1470 PRO A HA     1 
ATOM   1775  H  HB2    . PRO A 1 108  ? -7.198  -90.699 22.518  1.00 126.34 ? 1470 PRO A HB2    1 
ATOM   1776  H  HB3    . PRO A 1 108  ? -7.947  -90.336 23.883  1.00 126.34 ? 1470 PRO A HB3    1 
ATOM   1777  H  HG2    . PRO A 1 108  ? -8.163  -89.012 21.414  1.00 125.14 ? 1470 PRO A HG2    1 
ATOM   1778  H  HG3    . PRO A 1 108  ? -9.355  -89.434 22.389  1.00 125.14 ? 1470 PRO A HG3    1 
ATOM   1779  H  HD2    . PRO A 1 108  ? -8.461  -87.032 22.389  1.00 126.35 ? 1470 PRO A HD2    1 
ATOM   1780  H  HD3    . PRO A 1 108  ? -9.015  -87.694 23.740  1.00 126.35 ? 1470 PRO A HD3    1 
ATOM   1781  N  N      . LEU A 1 109  ? -5.700  -88.185 21.396  1.00 65.84  ? 1471 LEU A N      1 
ATOM   1782  C  CA     . LEU A 1 109  ? -4.995  -88.170 20.158  1.00 64.20  ? 1471 LEU A CA     1 
ATOM   1783  C  C      . LEU A 1 109  ? -3.658  -87.423 20.148  1.00 63.18  ? 1471 LEU A C      1 
ATOM   1784  O  O      . LEU A 1 109  ? -2.651  -87.960 19.685  1.00 63.83  ? 1471 LEU A O      1 
ATOM   1785  C  CB     . LEU A 1 109  ? -5.912  -87.566 19.097  1.00 67.47  ? 1471 LEU A CB     1 
ATOM   1786  C  CG     . LEU A 1 109  ? -5.286  -87.585 17.717  1.00 65.12  ? 1471 LEU A CG     1 
ATOM   1787  C  CD1    . LEU A 1 109  ? -4.925  -89.085 17.483  1.00 65.24  ? 1471 LEU A CD1    1 
ATOM   1788  C  CD2    . LEU A 1 109  ? -6.316  -86.986 16.760  1.00 65.98  ? 1471 LEU A CD2    1 
ATOM   1789  H  H      . LEU A 1 109  ? -6.355  -87.629 21.437  1.00 79.00  ? 1471 LEU A H      1 
ATOM   1790  H  HA     . LEU A 1 109  ? -4.815  -89.087 19.899  1.00 77.04  ? 1471 LEU A HA     1 
ATOM   1791  H  HB2    . LEU A 1 109  ? -6.736  -88.077 19.062  1.00 80.97  ? 1471 LEU A HB2    1 
ATOM   1792  H  HB3    . LEU A 1 109  ? -6.102  -86.643 19.330  1.00 80.97  ? 1471 LEU A HB3    1 
ATOM   1793  H  HG     . LEU A 1 109  ? -4.478  -87.049 17.705  1.00 78.14  ? 1471 LEU A HG     1 
ATOM   1794  H  HD11   . LEU A 1 109  ? -4.515  -89.177 16.609  1.00 78.29  ? 1471 LEU A HD11   1 
ATOM   1795  H  HD12   . LEU A 1 109  ? -4.305  -89.371 18.172  1.00 78.29  ? 1471 LEU A HD12   1 
ATOM   1796  H  HD13   . LEU A 1 109  ? -5.736  -89.615 17.526  1.00 78.29  ? 1471 LEU A HD13   1 
ATOM   1797  H  HD21   . LEU A 1 109  ? -5.948  -86.982 15.863  1.00 79.18  ? 1471 LEU A HD21   1 
ATOM   1798  H  HD22   . LEU A 1 109  ? -7.121  -87.525 16.785  1.00 79.18  ? 1471 LEU A HD22   1 
ATOM   1799  H  HD23   . LEU A 1 109  ? -6.516  -86.079 17.040  1.00 79.18  ? 1471 LEU A HD23   1 
ATOM   1800  N  N      . GLU A 1 110  ? -3.656  -86.174 20.611  1.00 63.51  ? 1472 GLU A N      1 
ATOM   1801  C  CA     . GLU A 1 110  ? -2.431  -85.377 20.610  1.00 66.39  ? 1472 GLU A CA     1 
ATOM   1802  C  C      . GLU A 1 110  ? -1.418  -86.042 21.524  1.00 73.81  ? 1472 GLU A C      1 
ATOM   1803  O  O      . GLU A 1 110  ? -0.211  -85.993 21.285  1.00 77.09  ? 1472 GLU A O      1 
ATOM   1804  C  CB     . GLU A 1 110  ? -2.689  -83.940 21.064  1.00 62.05  ? 1472 GLU A CB     1 
ATOM   1805  C  CG     . GLU A 1 110  ? -3.360  -83.075 20.020  1.00 60.68  ? 1472 GLU A CG     1 
ATOM   1806  C  CD     . GLU A 1 110  ? -4.799  -83.474 19.787  1.00 62.87  ? 1472 GLU A CD     1 
ATOM   1807  O  OE1    . GLU A 1 110  ? -5.590  -82.632 19.312  1.00 60.19  ? 1472 GLU A OE1    1 
ATOM   1808  O  OE2    . GLU A 1 110  ? -5.142  -84.637 20.078  1.00 67.04  1 1472 GLU A OE2    1 
ATOM   1809  H  H      . GLU A 1 110  ? -4.344  -85.768 20.929  1.00 76.21  ? 1472 GLU A H      1 
ATOM   1810  H  HA     . GLU A 1 110  ? -2.063  -85.353 19.713  1.00 79.67  ? 1472 GLU A HA     1 
ATOM   1811  H  HB2    . GLU A 1 110  ? -3.263  -83.958 21.846  1.00 74.46  ? 1472 GLU A HB2    1 
ATOM   1812  H  HB3    . GLU A 1 110  ? -1.841  -83.527 21.290  1.00 74.46  ? 1472 GLU A HB3    1 
ATOM   1813  H  HG2    . GLU A 1 110  ? -3.347  -82.152 20.317  1.00 72.82  ? 1472 GLU A HG2    1 
ATOM   1814  H  HG3    . GLU A 1 110  ? -2.883  -83.163 19.181  1.00 72.82  ? 1472 GLU A HG3    1 
ATOM   1815  N  N      . THR A 1 111  ? -1.930  -86.668 22.578  1.00 83.37  ? 1473 THR A N      1 
ATOM   1816  C  CA     . THR A 1 111  ? -1.107  -87.422 23.511  1.00 82.31  ? 1473 THR A CA     1 
ATOM   1817  C  C      . THR A 1 111  ? -0.582  -88.701 22.875  1.00 87.16  ? 1473 THR A C      1 
ATOM   1818  O  O      . THR A 1 111  ? 0.608   -89.012 22.973  1.00 89.75  ? 1473 THR A O      1 
ATOM   1819  C  CB     . THR A 1 111  ? -1.892  -87.800 24.769  1.00 75.99  ? 1473 THR A CB     1 
ATOM   1820  O  OG1    . THR A 1 111  ? -2.597  -86.652 25.256  1.00 72.71  ? 1473 THR A OG1    1 
ATOM   1821  C  CG2    . THR A 1 111  ? -0.948  -88.334 25.843  1.00 77.02  ? 1473 THR A CG2    1 
ATOM   1822  H  H      . THR A 1 111  ? -2.767  -86.670 22.776  1.00 100.04 ? 1473 THR A H      1 
ATOM   1823  H  HA     . THR A 1 111  ? -0.347  -86.881 23.777  1.00 98.78  ? 1473 THR A HA     1 
ATOM   1824  H  HB     . THR A 1 111  ? -2.529  -88.497 24.550  1.00 91.19  ? 1473 THR A HB     1 
ATOM   1825  H  HG1    . THR A 1 111  ? -3.131  -86.374 24.670  1.00 87.25  ? 1473 THR A HG1    1 
ATOM   1826  H  HG21   . THR A 1 111  ? -1.451  -88.571 26.638  1.00 92.42  ? 1473 THR A HG21   1 
ATOM   1827  H  HG22   . THR A 1 111  ? -0.485  -89.121 25.516  1.00 92.42  ? 1473 THR A HG22   1 
ATOM   1828  H  HG23   . THR A 1 111  ? -0.293  -87.657 26.075  1.00 92.42  ? 1473 THR A HG23   1 
ATOM   1829  N  N      . SER A 1 112  ? -1.486  -89.438 22.232  1.00 40.61  ? 1474 SER A N      1 
ATOM   1830  C  CA     . SER A 1 112  ? -1.139  -90.691 21.566  1.00 42.01  ? 1474 SER A CA     1 
ATOM   1831  C  C      . SER A 1 112  ? -0.011  -90.502 20.567  1.00 42.02  ? 1474 SER A C      1 
ATOM   1832  O  O      . SER A 1 112  ? 0.800   -91.403 20.363  1.00 43.10  ? 1474 SER A O      1 
ATOM   1833  C  CB     . SER A 1 112  ? -2.355  -91.283 20.861  1.00 42.63  ? 1474 SER A CB     1 
ATOM   1834  O  OG     . SER A 1 112  ? -1.995  -92.433 20.118  1.00 44.00  ? 1474 SER A OG     1 
ATOM   1835  H  H      . SER A 1 112  ? -2.318  -89.231 22.166  1.00 48.74  ? 1474 SER A H      1 
ATOM   1836  H  HA     . SER A 1 112  ? -0.842  -91.329 22.233  1.00 50.41  ? 1474 SER A HA     1 
ATOM   1837  H  HB2    . SER A 1 112  ? -3.016  -91.532 21.526  1.00 51.15  ? 1474 SER A HB2    1 
ATOM   1838  H  HB3    . SER A 1 112  ? -2.725  -90.620 20.257  1.00 51.15  ? 1474 SER A HB3    1 
ATOM   1839  H  HG     . SER A 1 112  ? -2.671  -92.750 19.734  1.00 52.80  ? 1474 SER A HG     1 
ATOM   1840  N  N      . LYS A 1 113  ? 0.031   -89.336 19.935  1.00 68.11  ? 1475 LYS A N      1 
ATOM   1841  C  CA     . LYS A 1 113  ? 1.141   -89.008 19.061  1.00 68.05  ? 1475 LYS A CA     1 
ATOM   1842  C  C      . LYS A 1 113  ? 2.350   -88.576 19.879  1.00 67.64  ? 1475 LYS A C      1 
ATOM   1843  O  O      . LYS A 1 113  ? 3.482   -88.890 19.526  1.00 68.18  ? 1475 LYS A O      1 
ATOM   1844  C  CB     . LYS A 1 113  ? 0.769   -87.917 18.067  1.00 67.11  ? 1475 LYS A CB     1 
ATOM   1845  C  CG     . LYS A 1 113  ? 0.622   -88.447 16.661  1.00 67.93  ? 1475 LYS A CG     1 
ATOM   1846  C  CD     . LYS A 1 113  ? 0.588   -87.321 15.671  1.00 78.49  ? 1475 LYS A CD     1 
ATOM   1847  C  CE     . LYS A 1 113  ? 0.697   -87.838 14.255  1.00 89.34  ? 1475 LYS A CE     1 
ATOM   1848  N  NZ     . LYS A 1 113  ? 0.868   -86.716 13.305  1.00 95.76  1 1475 LYS A NZ     1 
ATOM   1849  H  H      . LYS A 1 113  ? -0.569  -88.722 19.996  1.00 81.73  ? 1475 LYS A H      1 
ATOM   1850  H  HA     . LYS A 1 113  ? 1.389   -89.799 18.557  1.00 81.66  ? 1475 LYS A HA     1 
ATOM   1851  H  HB2    . LYS A 1 113  ? -0.077  -87.523 18.330  1.00 80.53  ? 1475 LYS A HB2    1 
ATOM   1852  H  HB3    . LYS A 1 113  ? 1.465   -87.241 18.062  1.00 80.53  ? 1475 LYS A HB3    1 
ATOM   1853  H  HG2    . LYS A 1 113  ? 1.377   -89.017 16.450  1.00 81.51  ? 1475 LYS A HG2    1 
ATOM   1854  H  HG3    . LYS A 1 113  ? -0.208  -88.943 16.589  1.00 81.51  ? 1475 LYS A HG3    1 
ATOM   1855  H  HD2    . LYS A 1 113  ? -0.252  -86.843 15.757  1.00 94.18  ? 1475 LYS A HD2    1 
ATOM   1856  H  HD3    . LYS A 1 113  ? 1.334   -86.725 15.837  1.00 94.18  ? 1475 LYS A HD3    1 
ATOM   1857  H  HE2    . LYS A 1 113  ? 1.469   -88.421 14.183  1.00 107.21 ? 1475 LYS A HE2    1 
ATOM   1858  H  HE3    . LYS A 1 113  ? -0.113  -88.317 14.022  1.00 107.21 ? 1475 LYS A HE3    1 
ATOM   1859  H  HZ1    . LYS A 1 113  ? 0.932   -87.029 12.474  1.00 114.91 ? 1475 LYS A HZ1    1 
ATOM   1860  H  HZ2    . LYS A 1 113  ? 0.169   -86.167 13.355  1.00 114.91 ? 1475 LYS A HZ2    1 
ATOM   1861  H  HZ3    . LYS A 1 113  ? 1.608   -86.262 13.501  1.00 114.91 ? 1475 LYS A HZ3    1 
ATOM   1862  N  N      . PHE A 1 114  ? 2.116   -87.851 20.969  1.00 43.29  ? 1476 PHE A N      1 
ATOM   1863  C  CA     . PHE A 1 114  ? 3.224   -87.289 21.730  1.00 42.82  ? 1476 PHE A CA     1 
ATOM   1864  C  C      . PHE A 1 114  ? 4.104   -88.393 22.306  1.00 43.98  ? 1476 PHE A C      1 
ATOM   1865  O  O      . PHE A 1 114  ? 5.328   -88.268 22.319  1.00 44.07  ? 1476 PHE A O      1 
ATOM   1866  C  CB     . PHE A 1 114  ? 2.724   -86.389 22.863  1.00 41.79  ? 1476 PHE A CB     1 
ATOM   1867  C  CG     . PHE A 1 114  ? 3.811   -85.558 23.492  1.00 41.16  ? 1476 PHE A CG     1 
ATOM   1868  C  CD1    . PHE A 1 114  ? 4.197   -84.355 22.922  1.00 40.20  ? 1476 PHE A CD1    1 
ATOM   1869  C  CD2    . PHE A 1 114  ? 4.462   -85.991 24.636  1.00 41.62  ? 1476 PHE A CD2    1 
ATOM   1870  C  CE1    . PHE A 1 114  ? 5.200   -83.593 23.487  1.00 39.69  ? 1476 PHE A CE1    1 
ATOM   1871  C  CE2    . PHE A 1 114  ? 5.466   -85.233 25.206  1.00 41.10  ? 1476 PHE A CE2    1 
ATOM   1872  C  CZ     . PHE A 1 114  ? 5.836   -84.034 24.630  1.00 40.13  ? 1476 PHE A CZ     1 
ATOM   1873  H  H      . PHE A 1 114  ? 1.336   -87.673 21.285  1.00 51.94  ? 1476 PHE A H      1 
ATOM   1874  H  HA     . PHE A 1 114  ? 3.771   -86.749 21.138  1.00 51.39  ? 1476 PHE A HA     1 
ATOM   1875  H  HB2    . PHE A 1 114  ? 2.053   -85.783 22.510  1.00 50.15  ? 1476 PHE A HB2    1 
ATOM   1876  H  HB3    . PHE A 1 114  ? 2.334   -86.944 23.557  1.00 50.15  ? 1476 PHE A HB3    1 
ATOM   1877  H  HD1    . PHE A 1 114  ? 3.771   -84.054 22.152  1.00 48.23  ? 1476 PHE A HD1    1 
ATOM   1878  H  HD2    . PHE A 1 114  ? 4.216   -86.798 25.028  1.00 49.94  ? 1476 PHE A HD2    1 
ATOM   1879  H  HE1    . PHE A 1 114  ? 5.447   -82.786 23.098  1.00 47.62  ? 1476 PHE A HE1    1 
ATOM   1880  H  HE2    . PHE A 1 114  ? 5.893   -85.531 25.977  1.00 49.32  ? 1476 PHE A HE2    1 
ATOM   1881  H  HZ     . PHE A 1 114  ? 6.511   -83.522 25.014  1.00 48.16  ? 1476 PHE A HZ     1 
ATOM   1882  N  N      . LYS A 1 115  ? 3.484   -89.474 22.773  1.00 50.81  ? 1477 LYS A N      1 
ATOM   1883  C  CA     . LYS A 1 115  ? 4.242   -90.577 23.354  1.00 52.03  ? 1477 LYS A CA     1 
ATOM   1884  C  C      . LYS A 1 115  ? 5.206   -91.181 22.341  1.00 52.91  ? 1477 LYS A C      1 
ATOM   1885  O  O      . LYS A 1 115  ? 6.378   -91.399 22.647  1.00 53.33  ? 1477 LYS A O      1 
ATOM   1886  C  CB     . LYS A 1 115  ? 3.311   -91.669 23.901  1.00 53.03  ? 1477 LYS A CB     1 
ATOM   1887  C  CG     . LYS A 1 115  ? 2.650   -91.308 25.228  1.00 56.10  ? 1477 LYS A CG     1 
ATOM   1888  C  CD     . LYS A 1 115  ? 1.585   -92.318 25.648  1.00 62.51  ? 1477 LYS A CD     1 
ATOM   1889  C  CE     . LYS A 1 115  ? 1.356   -92.289 27.160  1.00 63.86  ? 1477 LYS A CE     1 
ATOM   1890  N  NZ     . LYS A 1 115  ? 1.050   -90.924 27.679  1.00 63.92  1 1477 LYS A NZ     1 
ATOM   1891  H  H      . LYS A 1 115  ? 2.632   -89.591 22.767  1.00 60.97  ? 1477 LYS A H      1 
ATOM   1892  H  HA     . LYS A 1 115  ? 4.767   -90.238 24.095  1.00 62.44  ? 1477 LYS A HA     1 
ATOM   1893  H  HB2    . LYS A 1 115  ? 2.607   -91.832 23.254  1.00 63.64  ? 1477 LYS A HB2    1 
ATOM   1894  H  HB3    . LYS A 1 115  ? 3.827   -92.479 24.036  1.00 63.64  ? 1477 LYS A HB3    1 
ATOM   1895  H  HG2    . LYS A 1 115  ? 3.328   -91.281 25.922  1.00 67.32  ? 1477 LYS A HG2    1 
ATOM   1896  H  HG3    . LYS A 1 115  ? 2.225   -90.440 25.145  1.00 67.32  ? 1477 LYS A HG3    1 
ATOM   1897  H  HD2    . LYS A 1 115  ? 0.747   -92.102 25.209  1.00 75.01  ? 1477 LYS A HD2    1 
ATOM   1898  H  HD3    . LYS A 1 115  ? 1.873   -93.211 25.400  1.00 75.01  ? 1477 LYS A HD3    1 
ATOM   1899  H  HE2    . LYS A 1 115  ? 0.607   -92.866 27.376  1.00 76.63  ? 1477 LYS A HE2    1 
ATOM   1900  H  HE3    . LYS A 1 115  ? 2.157   -92.606 27.605  1.00 76.63  ? 1477 LYS A HE3    1 
ATOM   1901  H  HZ1    . LYS A 1 115  ? 0.925   -90.955 28.560  1.00 76.70  ? 1477 LYS A HZ1    1 
ATOM   1902  H  HZ2    . LYS A 1 115  ? 1.726   -90.373 27.502  1.00 76.70  ? 1477 LYS A HZ2    1 
ATOM   1903  H  HZ3    . LYS A 1 115  ? 0.312   -90.611 27.293  1.00 76.70  ? 1477 LYS A HZ3    1 
ATOM   1904  N  N      . SER A 1 116  ? 4.716   -91.434 21.132  1.00 68.05  ? 1478 SER A N      1 
ATOM   1905  C  CA     . SER A 1 116  ? 5.531   -92.063 20.100  1.00 69.78  ? 1478 SER A CA     1 
ATOM   1906  C  C      . SER A 1 116  ? 6.675   -91.154 19.658  1.00 70.68  ? 1478 SER A C      1 
ATOM   1907  O  O      . SER A 1 116  ? 7.806   -91.610 19.507  1.00 72.45  ? 1478 SER A O      1 
ATOM   1908  C  CB     . SER A 1 116  ? 4.663   -92.454 18.899  1.00 69.60  ? 1478 SER A CB     1 
ATOM   1909  O  OG     . SER A 1 116  ? 3.923   -91.346 18.418  1.00 69.68  ? 1478 SER A OG     1 
ATOM   1910  H  H      . SER A 1 116  ? 3.914   -91.250 20.884  1.00 81.66  ? 1478 SER A H      1 
ATOM   1911  H  HA     . SER A 1 116  ? 5.920   -92.875 20.461  1.00 83.73  ? 1478 SER A HA     1 
ATOM   1912  H  HB2    . SER A 1 116  ? 5.237   -92.780 18.189  1.00 83.52  ? 1478 SER A HB2    1 
ATOM   1913  H  HB3    . SER A 1 116  ? 4.045   -93.151 19.171  1.00 83.52  ? 1478 SER A HB3    1 
ATOM   1914  H  HG     . SER A 1 116  ? 3.419   -91.053 19.023  1.00 83.61  ? 1478 SER A HG     1 
ATOM   1915  N  N      . LEU A 1 117  ? 6.381   -89.879 19.432  1.00 62.03  ? 1479 LEU A N      1 
ATOM   1916  C  CA     . LEU A 1 117  ? 7.421   -88.914 19.099  1.00 63.46  ? 1479 LEU A CA     1 
ATOM   1917  C  C      . LEU A 1 117  ? 8.485   -88.900 20.185  1.00 61.39  ? 1479 LEU A C      1 
ATOM   1918  O  O      . LEU A 1 117  ? 9.682   -88.915 19.900  1.00 61.75  ? 1479 LEU A O      1 
ATOM   1919  C  CB     . LEU A 1 117  ? 6.830   -87.516 18.927  1.00 70.51  ? 1479 LEU A CB     1 
ATOM   1920  C  CG     . LEU A 1 117  ? 5.768   -87.397 17.835  1.00 82.34  ? 1479 LEU A CG     1 
ATOM   1921  C  CD1    . LEU A 1 117  ? 5.131   -86.016 17.870  1.00 86.79  ? 1479 LEU A CD1    1 
ATOM   1922  C  CD2    . LEU A 1 117  ? 6.350   -87.703 16.461  1.00 89.41  ? 1479 LEU A CD2    1 
ATOM   1923  H  H      . LEU A 1 117  ? 5.588   -89.547 19.466  1.00 74.44  ? 1479 LEU A H      1 
ATOM   1924  H  HA     . LEU A 1 117  ? 7.842   -89.172 18.264  1.00 76.15  ? 1479 LEU A HA     1 
ATOM   1925  H  HB2    . LEU A 1 117  ? 6.421   -87.248 19.765  1.00 84.61  ? 1479 LEU A HB2    1 
ATOM   1926  H  HB3    . LEU A 1 117  ? 7.548   -86.902 18.705  1.00 84.61  ? 1479 LEU A HB3    1 
ATOM   1927  H  HG     . LEU A 1 117  ? 5.070   -88.048 18.010  1.00 98.81  ? 1479 LEU A HG     1 
ATOM   1928  H  HD11   . LEU A 1 117  ? 4.460   -85.960 17.171  1.00 104.14 ? 1479 LEU A HD11   1 
ATOM   1929  H  HD12   . LEU A 1 117  ? 4.717   -85.882 18.737  1.00 104.14 ? 1479 LEU A HD12   1 
ATOM   1930  H  HD13   . LEU A 1 117  ? 5.818   -85.348 17.724  1.00 104.14 ? 1479 LEU A HD13   1 
ATOM   1931  H  HD21   . LEU A 1 117  ? 5.650   -87.619 15.796  1.00 107.30 ? 1479 LEU A HD21   1 
ATOM   1932  H  HD22   . LEU A 1 117  ? 7.063   -87.073 16.274  1.00 107.30 ? 1479 LEU A HD22   1 
ATOM   1933  H  HD23   . LEU A 1 117  ? 6.700   -88.608 16.461  1.00 107.30 ? 1479 LEU A HD23   1 
ATOM   1934  N  N      . THR A 1 118  ? 8.029   -88.876 21.434  1.00 41.11  ? 1480 THR A N      1 
ATOM   1935  C  CA     . THR A 1 118  ? 8.923   -88.775 22.581  1.00 41.10  ? 1480 THR A CA     1 
ATOM   1936  C  C      . THR A 1 118  ? 9.880   -89.951 22.645  1.00 42.52  ? 1480 THR A C      1 
ATOM   1937  O  O      . THR A 1 118  ? 11.088  -89.768 22.775  1.00 42.64  ? 1480 THR A O      1 
ATOM   1938  C  CB     . THR A 1 118  ? 8.133   -88.724 23.903  1.00 40.78  ? 1480 THR A CB     1 
ATOM   1939  O  OG1    . THR A 1 118  ? 7.191   -87.644 23.868  1.00 39.52  ? 1480 THR A OG1    1 
ATOM   1940  C  CG2    . THR A 1 118  ? 9.072   -88.543 25.090  1.00 40.78  ? 1480 THR A CG2    1 
ATOM   1941  H  H      . THR A 1 118  ? 7.196   -88.917 21.645  1.00 49.33  ? 1480 THR A H      1 
ATOM   1942  H  HA     . THR A 1 118  ? 9.446   -87.961 22.507  1.00 49.33  ? 1480 THR A HA     1 
ATOM   1943  H  HB     . THR A 1 118  ? 7.655   -89.559 24.021  1.00 48.94  ? 1480 THR A HB     1 
ATOM   1944  H  HG1    . THR A 1 118  ? 6.760   -87.615 24.588  1.00 47.43  ? 1480 THR A HG1    1 
ATOM   1945  H  HG21   . THR A 1 118  ? 8.561   -88.512 25.914  1.00 48.94  ? 1480 THR A HG21   1 
ATOM   1946  H  HG22   . THR A 1 118  ? 9.697   -89.283 25.133  1.00 48.94  ? 1480 THR A HG22   1 
ATOM   1947  H  HG23   . THR A 1 118  ? 9.569   -87.716 24.996  1.00 48.94  ? 1480 THR A HG23   1 
ATOM   1948  N  N      . SER A 1 119  ? 9.332   -91.154 22.520  1.00 55.71  ? 1481 SER A N      1 
ATOM   1949  C  CA     . SER A 1 119  ? 10.124  -92.374 22.592  1.00 57.21  ? 1481 SER A CA     1 
ATOM   1950  C  C      . SER A 1 119  ? 11.162  -92.404 21.478  1.00 57.62  ? 1481 SER A C      1 
ATOM   1951  O  O      . SER A 1 119  ? 12.335  -92.679 21.721  1.00 58.22  ? 1481 SER A O      1 
ATOM   1952  C  CB     . SER A 1 119  ? 9.217   -93.599 22.514  1.00 60.73  ? 1481 SER A CB     1 
ATOM   1953  O  OG     . SER A 1 119  ? 8.773   -93.815 21.188  1.00 68.34  ? 1481 SER A OG     1 
ATOM   1954  H  H      . SER A 1 119  ? 8.492   -91.291 22.392  1.00 66.85  ? 1481 SER A H      1 
ATOM   1955  H  HA     . SER A 1 119  ? 10.593  -92.399 23.441  1.00 68.65  ? 1481 SER A HA     1 
ATOM   1956  H  HB2    . SER A 1 119  ? 9.713   -94.378 22.811  1.00 72.88  ? 1481 SER A HB2    1 
ATOM   1957  H  HB3    . SER A 1 119  ? 8.447   -93.459 23.086  1.00 72.88  ? 1481 SER A HB3    1 
ATOM   1958  H  HG     . SER A 1 119  ? 8.341   -93.146 20.917  1.00 82.01  ? 1481 SER A HG     1 
ATOM   1959  N  N      . GLU A 1 120  ? 10.717  -92.121 20.259  1.00 85.62  ? 1482 GLU A N      1 
ATOM   1960  C  CA     . GLU A 1 120  ? 11.603  -92.068 19.104  1.00 86.16  ? 1482 GLU A CA     1 
ATOM   1961  C  C      . GLU A 1 120  ? 12.687  -91.003 19.304  1.00 83.43  ? 1482 GLU A C      1 
ATOM   1962  O  O      . GLU A 1 120  ? 13.870  -91.279 19.109  1.00 81.91  ? 1482 GLU A O      1 
ATOM   1963  C  CB     . GLU A 1 120  ? 10.791  -91.796 17.833  1.00 83.87  ? 1482 GLU A CB     1 
ATOM   1964  C  CG     . GLU A 1 120  ? 9.925   -92.985 17.398  1.00 82.72  ? 1482 GLU A CG     1 
ATOM   1965  C  CD     . GLU A 1 120  ? 8.873   -92.621 16.361  1.00 81.74  ? 1482 GLU A CD     1 
ATOM   1966  O  OE1    . GLU A 1 120  ? 8.504   -91.429 16.270  1.00 81.10  ? 1482 GLU A OE1    1 
ATOM   1967  O  OE2    . GLU A 1 120  ? 8.407   -93.532 15.642  1.00 82.02  1 1482 GLU A OE2    1 
ATOM   1968  H  H      . GLU A 1 120  ? 9.894   -91.954 20.074  1.00 102.74 ? 1482 GLU A H      1 
ATOM   1969  H  HA     . GLU A 1 120  ? 12.041  -92.927 19.002  1.00 103.40 ? 1482 GLU A HA     1 
ATOM   1970  H  HB2    . GLU A 1 120  ? 10.202  -91.042 17.992  1.00 100.64 ? 1482 GLU A HB2    1 
ATOM   1971  H  HB3    . GLU A 1 120  ? 11.401  -91.591 17.108  1.00 100.64 ? 1482 GLU A HB3    1 
ATOM   1972  H  HG2    . GLU A 1 120  ? 10.499  -93.666 17.013  1.00 99.26  ? 1482 GLU A HG2    1 
ATOM   1973  H  HG3    . GLU A 1 120  ? 9.467   -93.340 18.175  1.00 99.26  ? 1482 GLU A HG3    1 
ATOM   1974  N  N      . TYR A 1 121  ? 12.287  -89.796 19.699  1.00 61.48  ? 1483 TYR A N      1 
ATOM   1975  C  CA     . TYR A 1 121  ? 13.244  -88.714 19.936  1.00 58.76  ? 1483 TYR A CA     1 
ATOM   1976  C  C      . TYR A 1 121  ? 14.180  -89.083 21.083  1.00 58.65  ? 1483 TYR A C      1 
ATOM   1977  O  O      . TYR A 1 121  ? 15.324  -88.637 21.134  1.00 58.59  ? 1483 TYR A O      1 
ATOM   1978  C  CB     . TYR A 1 121  ? 12.523  -87.393 20.234  1.00 56.64  ? 1483 TYR A CB     1 
ATOM   1979  C  CG     . TYR A 1 121  ? 13.451  -86.253 20.613  1.00 55.82  ? 1483 TYR A CG     1 
ATOM   1980  C  CD1    . TYR A 1 121  ? 14.487  -85.868 19.771  1.00 55.95  ? 1483 TYR A CD1    1 
ATOM   1981  C  CD2    . TYR A 1 121  ? 13.279  -85.547 21.799  1.00 56.59  ? 1483 TYR A CD2    1 
ATOM   1982  C  CE1    . TYR A 1 121  ? 15.337  -84.826 20.106  1.00 55.71  ? 1483 TYR A CE1    1 
ATOM   1983  C  CE2    . TYR A 1 121  ? 14.124  -84.501 22.139  1.00 58.01  ? 1483 TYR A CE2    1 
ATOM   1984  C  CZ     . TYR A 1 121  ? 15.152  -84.145 21.289  1.00 56.11  ? 1483 TYR A CZ     1 
ATOM   1985  O  OH     . TYR A 1 121  ? 16.001  -83.109 21.620  1.00 55.36  ? 1483 TYR A OH     1 
ATOM   1986  H  H      . TYR A 1 121  ? 11.467  -89.576 19.837  1.00 73.78  ? 1483 TYR A H      1 
ATOM   1987  H  HA     . TYR A 1 121  ? 13.782  -88.588 19.139  1.00 70.51  ? 1483 TYR A HA     1 
ATOM   1988  H  HB2    . TYR A 1 121  ? 12.030  -87.122 19.443  1.00 67.96  ? 1483 TYR A HB2    1 
ATOM   1989  H  HB3    . TYR A 1 121  ? 11.909  -87.532 20.972  1.00 67.96  ? 1483 TYR A HB3    1 
ATOM   1990  H  HD1    . TYR A 1 121  ? 14.619  -86.325 18.972  1.00 67.14  ? 1483 TYR A HD1    1 
ATOM   1991  H  HD2    . TYR A 1 121  ? 12.589  -85.785 22.376  1.00 67.91  ? 1483 TYR A HD2    1 
ATOM   1992  H  HE1    . TYR A 1 121  ? 16.029  -84.586 19.533  1.00 66.85  ? 1483 TYR A HE1    1 
ATOM   1993  H  HE2    . TYR A 1 121  ? 14.000  -84.042 22.939  1.00 69.61  ? 1483 TYR A HE2    1 
ATOM   1994  H  HH     . TYR A 1 121  ? 15.780  -82.781 22.361  1.00 66.43  ? 1483 TYR A HH     1 
ATOM   1995  N  N      . LYS A 1 122  ? 13.681  -89.907 21.998  1.00 60.57  ? 1484 LYS A N      1 
ATOM   1996  C  CA     . LYS A 1 122  ? 14.487  -90.429 23.092  1.00 61.25  ? 1484 LYS A CA     1 
ATOM   1997  C  C      . LYS A 1 122  ? 15.568  -91.376 22.562  1.00 67.12  ? 1484 LYS A C      1 
ATOM   1998  O  O      . LYS A 1 122  ? 16.733  -91.242 22.933  1.00 75.10  ? 1484 LYS A O      1 
ATOM   1999  C  CB     . LYS A 1 122  ? 13.600  -91.131 24.123  1.00 61.64  ? 1484 LYS A CB     1 
ATOM   2000  C  CG     . LYS A 1 122  ? 14.181  -91.203 25.531  1.00 61.86  ? 1484 LYS A CG     1 
ATOM   2001  C  CD     . LYS A 1 122  ? 13.116  -91.600 26.564  1.00 61.96  ? 1484 LYS A CD     1 
ATOM   2002  C  CE     . LYS A 1 122  ? 12.071  -90.493 26.773  1.00 60.51  ? 1484 LYS A CE     1 
ATOM   2003  N  NZ     . LYS A 1 122  ? 11.042  -90.810 27.807  1.00 60.61  1 1484 LYS A NZ     1 
ATOM   2004  H  H      . LYS A 1 122  ? 12.866  -90.181 22.007  1.00 72.68  ? 1484 LYS A H      1 
ATOM   2005  H  HA     . LYS A 1 122  ? 14.931  -89.690 23.536  1.00 73.50  ? 1484 LYS A HA     1 
ATOM   2006  H  HB2    . LYS A 1 122  ? 12.756  -90.655 24.179  1.00 73.97  ? 1484 LYS A HB2    1 
ATOM   2007  H  HB3    . LYS A 1 122  ? 13.441  -92.041 23.825  1.00 73.97  ? 1484 LYS A HB3    1 
ATOM   2008  H  HG2    . LYS A 1 122  ? 14.887  -91.869 25.552  1.00 74.23  ? 1484 LYS A HG2    1 
ATOM   2009  H  HG3    . LYS A 1 122  ? 14.533  -90.333 25.776  1.00 74.23  ? 1484 LYS A HG3    1 
ATOM   2010  H  HD2    . LYS A 1 122  ? 12.655  -92.396 26.257  1.00 74.36  ? 1484 LYS A HD2    1 
ATOM   2011  H  HD3    . LYS A 1 122  ? 13.547  -91.772 27.416  1.00 74.36  ? 1484 LYS A HD3    1 
ATOM   2012  H  HE2    . LYS A 1 122  ? 12.528  -89.682 27.049  1.00 72.61  ? 1484 LYS A HE2    1 
ATOM   2013  H  HE3    . LYS A 1 122  ? 11.609  -90.339 25.934  1.00 72.61  ? 1484 LYS A HE3    1 
ATOM   2014  H  HZ1    . LYS A 1 122  ? 10.468  -90.134 27.882  1.00 72.73  ? 1484 LYS A HZ1    1 
ATOM   2015  H  HZ2    . LYS A 1 122  ? 10.596  -91.545 27.576  1.00 72.73  ? 1484 LYS A HZ2    1 
ATOM   2016  H  HZ3    . LYS A 1 122  ? 11.434  -90.945 28.595  1.00 72.73  ? 1484 LYS A HZ3    1 
ATOM   2017  N  N      . MET A 1 123  ? 15.193  -92.331 21.705  1.00 96.43  ? 1485 MET A N      1 
ATOM   2018  C  CA     . MET A 1 123  ? 16.172  -93.280 21.162  1.00 96.85  ? 1485 MET A CA     1 
ATOM   2019  C  C      . MET A 1 123  ? 17.280  -92.548 20.405  1.00 95.69  ? 1485 MET A C      1 
ATOM   2020  O  O      . MET A 1 123  ? 18.466  -92.758 20.658  1.00 97.58  ? 1485 MET A O      1 
ATOM   2021  C  CB     . MET A 1 123  ? 15.527  -94.291 20.197  1.00 96.88  ? 1485 MET A CB     1 
ATOM   2022  C  CG     . MET A 1 123  ? 14.319  -95.087 20.688  1.00 97.13  ? 1485 MET A CG     1 
ATOM   2023  S  SD     . MET A 1 123  ? 14.549  -96.039 22.200  1.00 160.67 ? 1485 MET A SD     1 
ATOM   2024  C  CE     . MET A 1 123  ? 12.846  -96.454 22.589  1.00 88.27  ? 1485 MET A CE     1 
ATOM   2025  H  H      . MET A 1 123  ? 14.389  -92.450 21.425  1.00 115.71 ? 1485 MET A H      1 
ATOM   2026  H  HA     . MET A 1 123  ? 16.567  -93.778 21.895  1.00 116.22 ? 1485 MET A HA     1 
ATOM   2027  H  HB2    . MET A 1 123  ? 15.242  -93.807 19.406  1.00 116.26 ? 1485 MET A HB2    1 
ATOM   2028  H  HB3    . MET A 1 123  ? 16.206  -94.936 19.944  1.00 116.26 ? 1485 MET A HB3    1 
ATOM   2029  H  HG2    . MET A 1 123  ? 13.591  -94.466 20.847  1.00 116.56 ? 1485 MET A HG2    1 
ATOM   2030  H  HG3    . MET A 1 123  ? 14.063  -95.711 19.991  1.00 116.56 ? 1485 MET A HG3    1 
ATOM   2031  H  HE1    . MET A 1 123  ? 12.828  -96.981 23.403  1.00 105.92 ? 1485 MET A HE1    1 
ATOM   2032  H  HE2    . MET A 1 123  ? 12.342  -95.635 22.713  1.00 105.92 ? 1485 MET A HE2    1 
ATOM   2033  H  HE3    . MET A 1 123  ? 12.470  -96.966 21.855  1.00 105.92 ? 1485 MET A HE3    1 
ATOM   2034  N  N      . ILE A 1 124  ? 16.874  -91.693 19.470  1.00 49.84  ? 1486 ILE A N      1 
ATOM   2035  C  CA     . ILE A 1 124  ? 17.803  -90.978 18.600  1.00 49.62  ? 1486 ILE A CA     1 
ATOM   2036  C  C      . ILE A 1 124  ? 18.781  -90.113 19.393  1.00 48.96  ? 1486 ILE A C      1 
ATOM   2037  O  O      . ILE A 1 124  ? 19.976  -90.091 19.103  1.00 49.48  ? 1486 ILE A O      1 
ATOM   2038  C  CB     . ILE A 1 124  ? 17.018  -90.123 17.564  1.00 48.69  ? 1486 ILE A CB     1 
ATOM   2039  C  CG1    . ILE A 1 124  ? 17.050  -90.810 16.192  1.00 60.77  ? 1486 ILE A CG1    1 
ATOM   2040  C  CG2    . ILE A 1 124  ? 17.598  -88.728 17.408  1.00 47.58  ? 1486 ILE A CG2    1 
ATOM   2041  C  CD1    . ILE A 1 124  ? 16.393  -92.186 16.156  1.00 70.30  ? 1486 ILE A CD1    1 
ATOM   2042  H  H      . ILE A 1 124  ? 16.048  -91.507 19.318  1.00 59.81  ? 1486 ILE A H      1 
ATOM   2043  H  HA     . ILE A 1 124  ? 18.325  -91.629 18.105  1.00 59.54  ? 1486 ILE A HA     1 
ATOM   2044  H  HB     . ILE A 1 124  ? 16.096  -90.048 17.856  1.00 58.43  ? 1486 ILE A HB     1 
ATOM   2045  H  HG12   . ILE A 1 124  ? 16.587  -90.247 15.553  1.00 72.93  ? 1486 ILE A HG12   1 
ATOM   2046  H  HG13   . ILE A 1 124  ? 17.975  -90.919 15.921  1.00 72.93  ? 1486 ILE A HG13   1 
ATOM   2047  H  HG21   . ILE A 1 124  ? 17.073  -88.240 16.754  1.00 57.09  ? 1486 ILE A HG21   1 
ATOM   2048  H  HG22   . ILE A 1 124  ? 17.563  -88.274 18.265  1.00 57.09  ? 1486 ILE A HG22   1 
ATOM   2049  H  HG23   . ILE A 1 124  ? 18.517  -88.799 17.109  1.00 57.09  ? 1486 ILE A HG23   1 
ATOM   2050  H  HD11   . ILE A 1 124  ? 16.459  -92.543 15.256  1.00 84.36  ? 1486 ILE A HD11   1 
ATOM   2051  H  HD12   . ILE A 1 124  ? 16.852  -92.771 16.779  1.00 84.36  ? 1486 ILE A HD12   1 
ATOM   2052  H  HD13   . ILE A 1 124  ? 15.461  -92.098 16.410  1.00 84.36  ? 1486 ILE A HD13   1 
ATOM   2053  N  N      . THR A 1 125  ? 18.271  -89.403 20.392  1.00 44.93  ? 1487 THR A N      1 
ATOM   2054  C  CA     . THR A 1 125  ? 19.108  -88.563 21.240  1.00 44.32  ? 1487 THR A CA     1 
ATOM   2055  C  C      . THR A 1 125  ? 20.041  -89.402 22.090  1.00 45.40  ? 1487 THR A C      1 
ATOM   2056  O  O      . THR A 1 125  ? 21.216  -89.078 22.240  1.00 45.56  ? 1487 THR A O      1 
ATOM   2057  C  CB     . THR A 1 125  ? 18.269  -87.680 22.165  1.00 43.03  ? 1487 THR A CB     1 
ATOM   2058  O  OG1    . THR A 1 125  ? 17.112  -88.417 22.580  1.00 43.25  ? 1487 THR A OG1    1 
ATOM   2059  C  CG2    . THR A 1 125  ? 17.830  -86.411 21.450  1.00 41.79  ? 1487 THR A CG2    1 
ATOM   2060  H  H      . THR A 1 125  ? 17.437  -89.391 20.601  1.00 53.91  ? 1487 THR A H      1 
ATOM   2061  H  HA     . THR A 1 125  ? 19.648  -87.985 20.679  1.00 53.18  ? 1487 THR A HA     1 
ATOM   2062  H  HB     . THR A 1 125  ? 18.793  -87.432 22.942  1.00 51.64  ? 1487 THR A HB     1 
ATOM   2063  H  HG1    . THR A 1 125  ? 16.639  -87.945 23.090  1.00 51.90  ? 1487 THR A HG1    1 
ATOM   2064  H  HG21   . THR A 1 125  ? 17.299  -85.861 22.047  1.00 50.14  ? 1487 THR A HG21   1 
ATOM   2065  H  HG22   . THR A 1 125  ? 18.607  -85.906 21.163  1.00 50.14  ? 1487 THR A HG22   1 
ATOM   2066  H  HG23   . THR A 1 125  ? 17.296  -86.637 20.671  1.00 50.14  ? 1487 THR A HG23   1 
ATOM   2067  N  N      . THR A 1 126  ? 19.511  -90.473 22.666  1.00 46.19  ? 1488 THR A N      1 
ATOM   2068  C  CA     . THR A 1 126  ? 20.326  -91.330 23.512  1.00 47.33  ? 1488 THR A CA     1 
ATOM   2069  C  C      . THR A 1 126  ? 21.483  -91.924 22.711  1.00 48.50  ? 1488 THR A C      1 
ATOM   2070  O  O      . THR A 1 126  ? 22.597  -91.994 23.216  1.00 49.02  ? 1488 THR A O      1 
ATOM   2071  C  CB     . THR A 1 126  ? 19.496  -92.462 24.151  1.00 48.15  ? 1488 THR A CB     1 
ATOM   2072  O  OG1    . THR A 1 126  ? 18.629  -93.038 23.167  1.00 48.50  ? 1488 THR A OG1    1 
ATOM   2073  C  CG2    . THR A 1 126  ? 18.660  -91.930 25.317  1.00 47.22  ? 1488 THR A CG2    1 
ATOM   2074  H  H      . THR A 1 126  ? 18.692  -90.722 22.585  1.00 55.43  ? 1488 THR A H      1 
ATOM   2075  H  HA     . THR A 1 126  ? 20.702  -90.796 24.229  1.00 56.79  ? 1488 THR A HA     1 
ATOM   2076  H  HB     . THR A 1 126  ? 20.094  -93.145 24.491  1.00 57.78  ? 1488 THR A HB     1 
ATOM   2077  H  HG1    . THR A 1 126  ? 18.108  -92.453 22.865  1.00 58.20  ? 1488 THR A HG1    1 
ATOM   2078  H  HG21   . THR A 1 126  ? 18.143  -92.651 25.710  1.00 56.66  ? 1488 THR A HG21   1 
ATOM   2079  H  HG22   . THR A 1 126  ? 19.240  -91.553 25.996  1.00 56.66  ? 1488 THR A HG22   1 
ATOM   2080  H  HG23   . THR A 1 126  ? 18.052  -91.242 25.003  1.00 56.66  ? 1488 THR A HG23   1 
ATOM   2081  N  N      . ARG A 1 127  ? 21.242  -92.326 21.463  1.00 49.49  ? 1489 ARG A N      1 
ATOM   2082  C  CA     . ARG A 1 127  ? 22.343  -92.807 20.622  1.00 50.60  ? 1489 ARG A CA     1 
ATOM   2083  C  C      . ARG A 1 127  ? 23.272  -91.644 20.293  1.00 49.85  ? 1489 ARG A C      1 
ATOM   2084  O  O      . ARG A 1 127  ? 24.477  -91.826 20.147  1.00 50.63  ? 1489 ARG A O      1 
ATOM   2085  C  CB     . ARG A 1 127  ? 21.863  -93.461 19.315  1.00 51.32  ? 1489 ARG A CB     1 
ATOM   2086  C  CG     . ARG A 1 127  ? 23.037  -94.119 18.545  1.00 52.72  ? 1489 ARG A CG     1 
ATOM   2087  C  CD     . ARG A 1 127  ? 22.735  -94.641 17.129  1.00 53.50  ? 1489 ARG A CD     1 
ATOM   2088  N  NE     . ARG A 1 127  ? 22.041  -95.925 17.126  1.00 54.65  ? 1489 ARG A NE     1 
ATOM   2089  C  CZ     . ARG A 1 127  ? 21.169  -96.313 16.199  1.00 54.96  ? 1489 ARG A CZ     1 
ATOM   2090  N  NH1    . ARG A 1 127  ? 20.906  -95.547 15.148  1.00 54.27  1 1489 ARG A NH1    1 
ATOM   2091  N  NH2    . ARG A 1 127  ? 20.591  -97.503 16.298  1.00 56.10  ? 1489 ARG A NH2    1 
ATOM   2092  H  H      . ARG A 1 127  ? 20.470  -92.332 21.085  1.00 59.39  ? 1489 ARG A H      1 
ATOM   2093  H  HA     . ARG A 1 127  ? 22.853  -93.467 21.117  1.00 60.72  ? 1489 ARG A HA     1 
ATOM   2094  H  HB2    . ARG A 1 127  ? 21.212  -94.149 19.522  1.00 61.59  ? 1489 ARG A HB2    1 
ATOM   2095  H  HB3    . ARG A 1 127  ? 21.467  -92.784 18.745  1.00 61.59  ? 1489 ARG A HB3    1 
ATOM   2096  H  HG2    . ARG A 1 127  ? 23.748  -93.465 18.464  1.00 63.27  ? 1489 ARG A HG2    1 
ATOM   2097  H  HG3    . ARG A 1 127  ? 23.354  -94.873 19.066  1.00 63.27  ? 1489 ARG A HG3    1 
ATOM   2098  H  HD2    . ARG A 1 127  ? 22.174  -93.997 16.669  1.00 64.19  ? 1489 ARG A HD2    1 
ATOM   2099  H  HD3    . ARG A 1 127  ? 23.571  -94.752 16.650  1.00 64.19  ? 1489 ARG A HD3    1 
ATOM   2100  H  HE     . ARG A 1 127  ? 22.207  -96.470 17.770  1.00 65.58  ? 1489 ARG A HE     1 
ATOM   2101  H  HH11   . ARG A 1 127  ? 21.278  -94.775 15.075  1.00 65.12  ? 1489 ARG A HH11   1 
ATOM   2102  H  HH12   . ARG A 1 127  ? 20.347  -95.813 14.551  1.00 65.12  ? 1489 ARG A HH12   1 
ATOM   2103  H  HH21   . ARG A 1 127  ? 20.764  -98.010 16.971  1.00 67.33  ? 1489 ARG A HH21   1 
ATOM   2104  H  HH22   . ARG A 1 127  ? 20.037  -97.764 15.694  1.00 67.33  ? 1489 ARG A HH22   1 
ATOM   2105  N  N      . ALA A 1 128  ? 22.702  -90.450 20.178  1.00 48.94  ? 1490 ALA A N      1 
ATOM   2106  C  CA     . ALA A 1 128  ? 23.459  -89.285 19.739  1.00 48.22  ? 1490 ALA A CA     1 
ATOM   2107  C  C      . ALA A 1 128  ? 24.522  -88.903 20.756  1.00 48.19  ? 1490 ALA A C      1 
ATOM   2108  O  O      . ALA A 1 128  ? 25.664  -88.631 20.391  1.00 48.55  ? 1490 ALA A O      1 
ATOM   2109  C  CB     . ALA A 1 128  ? 22.524  -88.105 19.490  1.00 46.72  ? 1490 ALA A CB     1 
ATOM   2110  H  H      . ALA A 1 128  ? 21.875  -90.287 20.350  1.00 58.73  ? 1490 ALA A H      1 
ATOM   2111  H  HA     . ALA A 1 128  ? 23.905  -89.496 18.904  1.00 57.87  ? 1490 ALA A HA     1 
ATOM   2112  H  HB1    . ALA A 1 128  ? 23.050  -87.343 19.199  1.00 56.06  ? 1490 ALA A HB1    1 
ATOM   2113  H  HB2    . ALA A 1 128  ? 21.885  -88.348 18.802  1.00 56.06  ? 1490 ALA A HB2    1 
ATOM   2114  H  HB3    . ALA A 1 128  ? 22.059  -87.891 20.313  1.00 56.06  ? 1490 ALA A HB3    1 
ATOM   2115  N  N      . PHE A 1 129  ? 24.151  -88.885 22.029  1.00 46.73  ? 1491 PHE A N      1 
ATOM   2116  C  CA     . PHE A 1 129  ? 25.069  -88.450 23.071  1.00 46.65  ? 1491 PHE A CA     1 
ATOM   2117  C  C      . PHE A 1 129  ? 25.946  -89.593 23.556  1.00 48.14  ? 1491 PHE A C      1 
ATOM   2118  O  O      . PHE A 1 129  ? 26.846  -89.391 24.371  1.00 48.34  ? 1491 PHE A O      1 
ATOM   2119  C  CB     . PHE A 1 129  ? 24.303  -87.812 24.220  1.00 45.58  ? 1491 PHE A CB     1 
ATOM   2120  C  CG     . PHE A 1 129  ? 23.594  -86.564 23.812  1.00 44.14  ? 1491 PHE A CG     1 
ATOM   2121  C  CD1    . PHE A 1 129  ? 24.316  -85.459 23.393  1.00 43.55  ? 1491 PHE A CD1    1 
ATOM   2122  C  CD2    . PHE A 1 129  ? 22.212  -86.495 23.830  1.00 43.44  ? 1491 PHE A CD2    1 
ATOM   2123  C  CE1    . PHE A 1 129  ? 23.676  -84.311 23.000  1.00 42.31  ? 1491 PHE A CE1    1 
ATOM   2124  C  CE2    . PHE A 1 129  ? 21.564  -85.346 23.442  1.00 42.17  ? 1491 PHE A CE2    1 
ATOM   2125  C  CZ     . PHE A 1 129  ? 22.296  -84.253 23.027  1.00 41.61  ? 1491 PHE A CZ     1 
ATOM   2126  H  H      . PHE A 1 129  ? 23.374  -89.119 22.316  1.00 56.08  ? 1491 PHE A H      1 
ATOM   2127  H  HA     . PHE A 1 129  ? 25.655  -87.772 22.700  1.00 55.98  ? 1491 PHE A HA     1 
ATOM   2128  H  HB2    . PHE A 1 129  ? 23.641  -88.440 24.546  1.00 54.70  ? 1491 PHE A HB2    1 
ATOM   2129  H  HB3    . PHE A 1 129  ? 24.925  -87.586 24.928  1.00 54.70  ? 1491 PHE A HB3    1 
ATOM   2130  H  HD1    . PHE A 1 129  ? 25.245  -85.498 23.373  1.00 52.26  ? 1491 PHE A HD1    1 
ATOM   2131  H  HD2    . PHE A 1 129  ? 21.718  -87.232 24.107  1.00 52.13  ? 1491 PHE A HD2    1 
ATOM   2132  H  HE1    . PHE A 1 129  ? 24.169  -83.573 22.724  1.00 50.77  ? 1491 PHE A HE1    1 
ATOM   2133  H  HE2    . PHE A 1 129  ? 20.635  -85.306 23.459  1.00 50.60  ? 1491 PHE A HE2    1 
ATOM   2134  H  HZ     . PHE A 1 129  ? 21.860  -83.474 22.766  1.00 49.93  ? 1491 PHE A HZ     1 
ATOM   2135  N  N      . GLN A 1 130  ? 25.674  -90.798 23.065  1.00 54.50  ? 1492 GLN A N      1 
ATOM   2136  C  CA     . GLN A 1 130  ? 26.572  -91.920 23.297  1.00 56.08  ? 1492 GLN A CA     1 
ATOM   2137  C  C      . GLN A 1 130  ? 27.803  -91.823 22.392  1.00 56.71  ? 1492 GLN A C      1 
ATOM   2138  O  O      . GLN A 1 130  ? 28.788  -92.525 22.609  1.00 57.94  ? 1492 GLN A O      1 
ATOM   2139  C  CB     . GLN A 1 130  ? 25.854  -93.250 23.046  1.00 58.37  ? 1492 GLN A CB     1 
ATOM   2140  C  CG     . GLN A 1 130  ? 24.976  -93.743 24.193  1.00 66.57  ? 1492 GLN A CG     1 
ATOM   2141  C  CD     . GLN A 1 130  ? 24.255  -95.040 23.854  1.00 67.82  ? 1492 GLN A CD     1 
ATOM   2142  O  OE1    . GLN A 1 130  ? 24.059  -95.370 22.681  1.00 67.02  ? 1492 GLN A OE1    1 
ATOM   2143  N  NE2    . GLN A 1 130  ? 23.850  -95.778 24.884  1.00 69.08  ? 1492 GLN A NE2    1 
ATOM   2144  H  H      . GLN A 1 130  ? 24.979  -90.990 22.596  1.00 65.40  ? 1492 GLN A H      1 
ATOM   2145  H  HA     . GLN A 1 130  ? 26.871  -91.905 24.220  1.00 67.30  ? 1492 GLN A HA     1 
ATOM   2146  H  HB2    . GLN A 1 130  ? 25.286  -93.151 22.266  1.00 70.04  ? 1492 GLN A HB2    1 
ATOM   2147  H  HB3    . GLN A 1 130  ? 26.521  -93.933 22.876  1.00 70.04  ? 1492 GLN A HB3    1 
ATOM   2148  H  HG2    . GLN A 1 130  ? 25.531  -93.901 24.973  1.00 79.88  ? 1492 GLN A HG2    1 
ATOM   2149  H  HG3    . GLN A 1 130  ? 24.306  -93.069 24.392  1.00 79.88  ? 1492 GLN A HG3    1 
ATOM   2150  H  HE21   . GLN A 1 130  ? 24.000  -95.514 25.688  1.00 82.89  ? 1492 GLN A HE21   1 
ATOM   2151  H  HE22   . GLN A 1 130  ? 23.438  -96.520 24.745  1.00 82.89  ? 1492 GLN A HE22   1 
ATOM   2152  N  N      . LEU A 1 131  ? 27.749  -90.954 21.382  1.00 65.54  ? 1493 LEU A N      1 
ATOM   2153  C  CA     . LEU A 1 131  ? 28.815  -90.876 20.381  1.00 66.19  ? 1493 LEU A CA     1 
ATOM   2154  C  C      . LEU A 1 131  ? 30.011  -90.038 20.819  1.00 67.20  ? 1493 LEU A C      1 
ATOM   2155  O  O      . LEU A 1 131  ? 31.074  -90.098 20.198  1.00 78.46  ? 1493 LEU A O      1 
ATOM   2156  C  CB     . LEU A 1 131  ? 28.267  -90.303 19.070  1.00 65.58  ? 1493 LEU A CB     1 
ATOM   2157  C  CG     . LEU A 1 131  ? 27.311  -91.164 18.244  1.00 66.11  ? 1493 LEU A CG     1 
ATOM   2158  C  CD1    . LEU A 1 131  ? 26.871  -90.401 17.003  1.00 65.43  ? 1493 LEU A CD1    1 
ATOM   2159  C  CD2    . LEU A 1 131  ? 27.956  -92.486 17.850  1.00 67.90  ? 1493 LEU A CD2    1 
ATOM   2160  H  H      . LEU A 1 131  ? 27.106  -90.397 21.255  1.00 78.64  ? 1493 LEU A H      1 
ATOM   2161  H  HA     . LEU A 1 131  ? 29.135  -91.774 20.199  1.00 79.43  ? 1493 LEU A HA     1 
ATOM   2162  H  HB2    . LEU A 1 131  ? 27.795  -89.481 19.280  1.00 78.69  ? 1493 LEU A HB2    1 
ATOM   2163  H  HB3    . LEU A 1 131  ? 29.023  -90.095 18.499  1.00 78.69  ? 1493 LEU A HB3    1 
ATOM   2164  H  HG     . LEU A 1 131  ? 26.521  -91.359 18.773  1.00 79.33  ? 1493 LEU A HG     1 
ATOM   2165  H  HD11   . LEU A 1 131  ? 26.265  -90.958 16.489  1.00 78.51  ? 1493 LEU A HD11   1 
ATOM   2166  H  HD12   . LEU A 1 131  ? 26.420  -89.587 17.276  1.00 78.51  ? 1493 LEU A HD12   1 
ATOM   2167  H  HD13   . LEU A 1 131  ? 27.653  -90.184 16.472  1.00 78.51  ? 1493 LEU A HD13   1 
ATOM   2168  H  HD21   . LEU A 1 131  ? 27.322  -93.003 17.329  1.00 81.48  ? 1493 LEU A HD21   1 
ATOM   2169  H  HD22   . LEU A 1 131  ? 28.749  -92.304 17.322  1.00 81.48  ? 1493 LEU A HD22   1 
ATOM   2170  H  HD23   . LEU A 1 131  ? 28.197  -92.970 18.655  1.00 81.48  ? 1493 LEU A HD23   1 
ATOM   2171  N  N      . ASP A 1 132  ? 29.831  -89.251 21.874  1.00 98.82  ? 1494 ASP A N      1 
ATOM   2172  C  CA     . ASP A 1 132  ? 30.925  -88.508 22.500  1.00 100.66 ? 1494 ASP A CA     1 
ATOM   2173  C  C      . ASP A 1 132  ? 31.545  -87.473 21.550  1.00 99.45  ? 1494 ASP A C      1 
ATOM   2174  O  O      . ASP A 1 132  ? 32.642  -86.971 21.794  1.00 98.78  ? 1494 ASP A O      1 
ATOM   2175  C  CB     . ASP A 1 132  ? 31.997  -89.479 23.019  1.00 109.24 ? 1494 ASP A CB     1 
ATOM   2176  C  CG     . ASP A 1 132  ? 31.501  -90.315 24.188  1.00 116.67 ? 1494 ASP A CG     1 
ATOM   2177  O  OD1    . ASP A 1 132  ? 30.345  -90.103 24.621  1.00 118.97 ? 1494 ASP A OD1    1 
ATOM   2178  O  OD2    . ASP A 1 132  ? 32.268  -91.175 24.678  1.00 118.25 1 1494 ASP A OD2    1 
ATOM   2179  H  H      . ASP A 1 132  ? 29.070  -89.126 22.255  1.00 118.59 ? 1494 ASP A H      1 
ATOM   2180  H  HA     . ASP A 1 132  ? 30.572  -88.027 23.264  1.00 120.80 ? 1494 ASP A HA     1 
ATOM   2181  H  HB2    . ASP A 1 132  ? 32.252  -90.083 22.304  1.00 131.09 ? 1494 ASP A HB2    1 
ATOM   2182  H  HB3    . ASP A 1 132  ? 32.767  -88.972 23.317  1.00 131.09 ? 1494 ASP A HB3    1 
ATOM   2183  N  N      . THR A 1 133  ? 30.842  -87.166 20.463  1.00 55.32  ? 1495 THR A N      1 
ATOM   2184  C  CA     . THR A 1 133  ? 31.186  -86.041 19.595  1.00 54.71  ? 1495 THR A CA     1 
ATOM   2185  C  C      . THR A 1 133  ? 29.935  -85.582 18.864  1.00 53.74  ? 1495 THR A C      1 
ATOM   2186  O  O      . THR A 1 133  ? 29.045  -86.388 18.594  1.00 53.99  ? 1495 THR A O      1 
ATOM   2187  C  CB     . THR A 1 133  ? 32.256  -86.391 18.563  1.00 55.89  ? 1495 THR A CB     1 
ATOM   2188  O  OG1    . THR A 1 133  ? 33.271  -87.194 19.172  1.00 57.07  ? 1495 THR A OG1    1 
ATOM   2189  C  CG2    . THR A 1 133  ? 32.879  -85.126 18.011  1.00 55.34  ? 1495 THR A CG2    1 
ATOM   2190  H  H      . THR A 1 133  ? 30.148  -87.602 20.202  1.00 66.38  ? 1495 THR A H      1 
ATOM   2191  H  HA     . THR A 1 133  ? 31.512  -85.305 20.136  1.00 65.65  ? 1495 THR A HA     1 
ATOM   2192  H  HB     . THR A 1 133  ? 31.852  -86.881 17.830  1.00 67.06  ? 1495 THR A HB     1 
ATOM   2193  H  HG1    . THR A 1 133  ? 33.627  -86.773 19.806  1.00 68.49  ? 1495 THR A HG1    1 
ATOM   2194  H  HG21   . THR A 1 133  ? 33.558  -85.350 17.356  1.00 66.41  ? 1495 THR A HG21   1 
ATOM   2195  H  HG22   . THR A 1 133  ? 32.199  -84.580 17.587  1.00 66.41  ? 1495 THR A HG22   1 
ATOM   2196  H  HG23   . THR A 1 133  ? 33.288  -84.618 18.729  1.00 66.41  ? 1495 THR A HG23   1 
ATOM   2197  N  N      . THR A 1 134  ? 29.846  -84.290 18.569  1.00 64.79  ? 1496 THR A N      1 
ATOM   2198  C  CA     . THR A 1 134  ? 28.662  -83.754 17.908  1.00 63.20  ? 1496 THR A CA     1 
ATOM   2199  C  C      . THR A 1 134  ? 28.701  -83.942 16.393  1.00 62.13  ? 1496 THR A C      1 
ATOM   2200  O  O      . THR A 1 134  ? 27.668  -84.193 15.775  1.00 64.39  ? 1496 THR A O      1 
ATOM   2201  C  CB     . THR A 1 134  ? 28.481  -82.263 18.227  1.00 63.09  ? 1496 THR A CB     1 
ATOM   2202  O  OG1    . THR A 1 134  ? 28.212  -82.111 19.626  1.00 69.30  ? 1496 THR A OG1    1 
ATOM   2203  C  CG2    . THR A 1 134  ? 27.326  -81.669 17.421  1.00 60.90  ? 1496 THR A CG2    1 
ATOM   2204  H  H      . THR A 1 134  ? 30.453  -83.706 18.740  1.00 77.74  ? 1496 THR A H      1 
ATOM   2205  H  HA     . THR A 1 134  ? 27.881  -84.224 18.243  1.00 75.83  ? 1496 THR A HA     1 
ATOM   2206  H  HB     . THR A 1 134  ? 29.292  -81.784 18.000  1.00 75.71  ? 1496 THR A HB     1 
ATOM   2207  H  HG1    . THR A 1 134  ? 28.111  -81.298 19.813  1.00 83.16  ? 1496 THR A HG1    1 
ATOM   2208  H  HG21   . THR A 1 134  ? 27.224  -80.728 17.632  1.00 73.08  ? 1496 THR A HG21   1 
ATOM   2209  H  HG22   . THR A 1 134  ? 27.503  -81.762 16.471  1.00 73.08  ? 1496 THR A HG22   1 
ATOM   2210  H  HG23   . THR A 1 134  ? 26.501  -82.132 17.634  1.00 73.08  ? 1496 THR A HG23   1 
ATOM   2211  N  N      . ILE A 1 135  ? 29.873  -83.799 15.783  1.00 46.72  ? 1497 ILE A N      1 
ATOM   2212  C  CA     . ILE A 1 135  ? 29.967  -83.942 14.333  1.00 47.39  ? 1497 ILE A CA     1 
ATOM   2213  C  C      . ILE A 1 135  ? 29.528  -85.350 13.939  1.00 48.41  ? 1497 ILE A C      1 
ATOM   2214  O  O      . ILE A 1 135  ? 28.880  -85.534 12.915  1.00 48.59  ? 1497 ILE A O      1 
ATOM   2215  C  CB     . ILE A 1 135  ? 31.386  -83.631 13.789  1.00 48.20  ? 1497 ILE A CB     1 
ATOM   2216  C  CG1    . ILE A 1 135  ? 31.367  -83.551 12.260  1.00 48.74  ? 1497 ILE A CG1    1 
ATOM   2217  C  CG2    . ILE A 1 135  ? 32.406  -84.656 14.256  1.00 49.46  ? 1497 ILE A CG2    1 
ATOM   2218  C  CD1    . ILE A 1 135  ? 30.619  -82.353 11.715  1.00 47.61  ? 1497 ILE A CD1    1 
ATOM   2219  H  H      . ILE A 1 135  ? 30.617  -83.621 16.177  1.00 56.07  ? 1497 ILE A H      1 
ATOM   2220  H  HA     . ILE A 1 135  ? 29.351  -83.317 13.920  1.00 56.86  ? 1497 ILE A HA     1 
ATOM   2221  H  HB     . ILE A 1 135  ? 31.654  -82.763 14.131  1.00 57.83  ? 1497 ILE A HB     1 
ATOM   2222  H  HG12   . ILE A 1 135  ? 32.281  -83.500 11.939  1.00 58.48  ? 1497 ILE A HG12   1 
ATOM   2223  H  HG13   . ILE A 1 135  ? 30.941  -84.350 11.911  1.00 58.48  ? 1497 ILE A HG13   1 
ATOM   2224  H  HG21   . ILE A 1 135  ? 33.275  -84.423 13.894  1.00 59.36  ? 1497 ILE A HG21   1 
ATOM   2225  H  HG22   . ILE A 1 135  ? 32.438  -84.650 15.225  1.00 59.36  ? 1497 ILE A HG22   1 
ATOM   2226  H  HG23   . ILE A 1 135  ? 32.139  -85.533 13.939  1.00 59.36  ? 1497 ILE A HG23   1 
ATOM   2227  H  HD11   . ILE A 1 135  ? 30.653  -82.375 10.746  1.00 57.13  ? 1497 ILE A HD11   1 
ATOM   2228  H  HD12   . ILE A 1 135  ? 29.698  -82.394 12.015  1.00 57.13  ? 1497 ILE A HD12   1 
ATOM   2229  H  HD13   . ILE A 1 135  ? 31.040  -81.543 12.043  1.00 57.13  ? 1497 ILE A HD13   1 
ATOM   2230  N  N      . GLU A 1 136  ? 29.865  -86.332 14.775  1.00 56.74  ? 1498 GLU A N      1 
ATOM   2231  C  CA     . GLU A 1 136  ? 29.562  -87.740 14.508  1.00 57.89  ? 1498 GLU A CA     1 
ATOM   2232  C  C      . GLU A 1 136  ? 28.082  -87.974 14.206  1.00 57.38  ? 1498 GLU A C      1 
ATOM   2233  O  O      . GLU A 1 136  ? 27.716  -88.969 13.584  1.00 58.32  ? 1498 GLU A O      1 
ATOM   2234  C  CB     . GLU A 1 136  ? 29.980  -88.603 15.702  1.00 58.53  ? 1498 GLU A CB     1 
ATOM   2235  C  CG     . GLU A 1 136  ? 31.479  -88.726 15.899  1.00 59.46  ? 1498 GLU A CG     1 
ATOM   2236  C  CD     . GLU A 1 136  ? 32.047  -89.959 15.232  1.00 66.83  ? 1498 GLU A CD     1 
ATOM   2237  O  OE1    . GLU A 1 136  ? 31.604  -91.076 15.575  1.00 71.49  ? 1498 GLU A OE1    1 
ATOM   2238  O  OE2    . GLU A 1 136  ? 32.934  -89.814 14.366  1.00 71.26  1 1498 GLU A OE2    1 
ATOM   2239  H  H      . GLU A 1 136  ? 30.278  -86.205 15.518  1.00 68.09  ? 1498 GLU A H      1 
ATOM   2240  H  HA     . GLU A 1 136  ? 30.074  -88.030 13.736  1.00 69.47  ? 1498 GLU A HA     1 
ATOM   2241  H  HB2    . GLU A 1 136  ? 29.608  -88.216 16.510  1.00 70.23  ? 1498 GLU A HB2    1 
ATOM   2242  H  HB3    . GLU A 1 136  ? 29.626  -89.498 15.576  1.00 70.23  ? 1498 GLU A HB3    1 
ATOM   2243  H  HG2    . GLU A 1 136  ? 31.914  -87.948 15.516  1.00 71.35  ? 1498 GLU A HG2    1 
ATOM   2244  H  HG3    . GLU A 1 136  ? 31.671  -88.781 16.849  1.00 71.35  ? 1498 GLU A HG3    1 
ATOM   2245  N  N      . VAL A 1 137  ? 27.240  -87.062 14.674  1.00 54.81  ? 1499 VAL A N      1 
ATOM   2246  C  CA     . VAL A 1 137  ? 25.793  -87.175 14.535  1.00 54.19  ? 1499 VAL A CA     1 
ATOM   2247  C  C      . VAL A 1 137  ? 25.334  -87.310 13.080  1.00 54.61  ? 1499 VAL A C      1 
ATOM   2248  O  O      . VAL A 1 137  ? 24.281  -87.887 12.810  1.00 54.70  ? 1499 VAL A O      1 
ATOM   2249  C  CB     . VAL A 1 137  ? 25.108  -85.943 15.177  1.00 52.55  ? 1499 VAL A CB     1 
ATOM   2250  C  CG1    . VAL A 1 137  ? 23.604  -85.907 14.890  1.00 51.87  ? 1499 VAL A CG1    1 
ATOM   2251  C  CG2    . VAL A 1 137  ? 25.363  -85.930 16.683  1.00 52.21  ? 1499 VAL A CG2    1 
ATOM   2252  H  H      . VAL A 1 137  ? 27.489  -86.349 15.085  1.00 65.77  ? 1499 VAL A H      1 
ATOM   2253  H  HA     . VAL A 1 137  ? 25.495  -87.964 15.014  1.00 65.03  ? 1499 VAL A HA     1 
ATOM   2254  H  HB     . VAL A 1 137  ? 25.499  -85.138 14.803  1.00 63.06  ? 1499 VAL A HB     1 
ATOM   2255  H  HG11   . VAL A 1 137  ? 23.221  -85.121 15.310  1.00 62.24  ? 1499 VAL A HG11   1 
ATOM   2256  H  HG12   . VAL A 1 137  ? 23.467  -85.870 13.930  1.00 62.24  ? 1499 VAL A HG12   1 
ATOM   2257  H  HG13   . VAL A 1 137  ? 23.195  -86.709 15.252  1.00 62.24  ? 1499 VAL A HG13   1 
ATOM   2258  H  HG21   . VAL A 1 137  ? 24.928  -85.154 17.070  1.00 62.65  ? 1499 VAL A HG21   1 
ATOM   2259  H  HG22   . VAL A 1 137  ? 25.000  -86.741 17.072  1.00 62.65  ? 1499 VAL A HG22   1 
ATOM   2260  H  HG23   . VAL A 1 137  ? 26.319  -85.887 16.841  1.00 62.65  ? 1499 VAL A HG23   1 
ATOM   2261  N  N      . ILE A 1 138  ? 26.124  -86.789 12.146  1.00 48.46  ? 1500 ILE A N      1 
ATOM   2262  C  CA     . ILE A 1 138  ? 25.736  -86.795 10.736  1.00 48.87  ? 1500 ILE A CA     1 
ATOM   2263  C  C      . ILE A 1 138  ? 25.679  -88.211 10.170  1.00 50.37  ? 1500 ILE A C      1 
ATOM   2264  O  O      . ILE A 1 138  ? 24.941  -88.478 9.219   1.00 50.69  ? 1500 ILE A O      1 
ATOM   2265  C  CB     . ILE A 1 138  ? 26.705  -85.947 9.875   1.00 49.06  ? 1500 ILE A CB     1 
ATOM   2266  C  CG1    . ILE A 1 138  ? 28.134  -86.507 9.940   1.00 50.29  ? 1500 ILE A CG1    1 
ATOM   2267  C  CG2    . ILE A 1 138  ? 26.651  -84.496 10.324  1.00 47.62  ? 1500 ILE A CG2    1 
ATOM   2268  C  CD1    . ILE A 1 138  ? 29.150  -85.727 9.118   1.00 50.62  ? 1500 ILE A CD1    1 
ATOM   2269  H  H      . ILE A 1 138  ? 26.888  -86.425 12.301  1.00 58.15  ? 1500 ILE A H      1 
ATOM   2270  H  HA     . ILE A 1 138  ? 24.850  -86.408 10.654  1.00 58.65  ? 1500 ILE A HA     1 
ATOM   2271  H  HB     . ILE A 1 138  ? 26.406  -85.989 8.953   1.00 58.87  ? 1500 ILE A HB     1 
ATOM   2272  H  HG12   . ILE A 1 138  ? 28.430  -86.496 10.863  1.00 60.35  ? 1500 ILE A HG12   1 
ATOM   2273  H  HG13   . ILE A 1 138  ? 28.125  -87.419 9.609   1.00 60.35  ? 1500 ILE A HG13   1 
ATOM   2274  H  HG21   . ILE A 1 138  ? 27.261  -83.975 9.779   1.00 57.14  ? 1500 ILE A HG21   1 
ATOM   2275  H  HG22   . ILE A 1 138  ? 25.745  -84.166 10.216  1.00 57.14  ? 1500 ILE A HG22   1 
ATOM   2276  H  HG23   . ILE A 1 138  ? 26.913  -84.445 11.256  1.00 57.14  ? 1500 ILE A HG23   1 
ATOM   2277  H  HD11   . ILE A 1 138  ? 30.021  -86.145 9.214   1.00 60.74  ? 1500 ILE A HD11   1 
ATOM   2278  H  HD12   . ILE A 1 138  ? 28.879  -85.738 8.187   1.00 60.74  ? 1500 ILE A HD12   1 
ATOM   2279  H  HD13   . ILE A 1 138  ? 29.184  -84.814 9.443   1.00 60.74  ? 1500 ILE A HD13   1 
ATOM   2280  N  N      . HIS A 1 139  ? 26.454  -89.114 10.766  1.00 51.34  ? 1501 HIS A N      1 
ATOM   2281  C  CA     . HIS A 1 139  ? 26.553  -90.491 10.288  1.00 52.93  ? 1501 HIS A CA     1 
ATOM   2282  C  C      . HIS A 1 139  ? 25.512  -91.443 10.889  1.00 53.06  ? 1501 HIS A C      1 
ATOM   2283  O  O      . HIS A 1 139  ? 25.456  -92.616 10.516  1.00 54.40  ? 1501 HIS A O      1 
ATOM   2284  C  CB     . HIS A 1 139  ? 27.961  -91.023 10.562  1.00 54.08  ? 1501 HIS A CB     1 
ATOM   2285  C  CG     . HIS A 1 139  ? 28.985  -90.535 9.584   1.00 54.63  ? 1501 HIS A CG     1 
ATOM   2286  N  ND1    . HIS A 1 139  ? 30.113  -89.841 9.965   1.00 54.43  ? 1501 HIS A ND1    1 
ATOM   2287  C  CD2    . HIS A 1 139  ? 29.049  -90.645 8.237   1.00 55.45  ? 1501 HIS A CD2    1 
ATOM   2288  C  CE1    . HIS A 1 139  ? 30.827  -89.545 8.894   1.00 55.10  ? 1501 HIS A CE1    1 
ATOM   2289  N  NE2    . HIS A 1 139  ? 30.204  -90.023 7.834   1.00 55.74  ? 1501 HIS A NE2    1 
ATOM   2290  H  H      . HIS A 1 139  ? 26.938  -88.952 11.458  1.00 61.61  ? 1501 HIS A H      1 
ATOM   2291  H  HA     . HIS A 1 139  ? 26.424  -90.491 9.327   1.00 63.51  ? 1501 HIS A HA     1 
ATOM   2292  H  HB2    . HIS A 1 139  ? 28.237  -90.740 11.448  1.00 64.90  ? 1501 HIS A HB2    1 
ATOM   2293  H  HB3    . HIS A 1 139  ? 27.944  -91.992 10.516  1.00 64.90  ? 1501 HIS A HB3    1 
ATOM   2294  H  HD2    . HIS A 1 139  ? 28.428  -91.066 7.688   1.00 66.54  ? 1501 HIS A HD2    1 
ATOM   2295  H  HE1    . HIS A 1 139  ? 31.632  -89.079 8.889   1.00 66.12  ? 1501 HIS A HE1    1 
ATOM   2296  H  HE2    . HIS A 1 139  ? 30.476  -89.953 7.021   1.00 66.89  ? 1501 HIS A HE2    1 
ATOM   2297  N  N      . ILE A 1 140  ? 24.699  -90.950 11.821  1.00 51.76  ? 1502 ILE A N      1 
ATOM   2298  C  CA     . ILE A 1 140  ? 23.611  -91.749 12.376  1.00 51.82  ? 1502 ILE A CA     1 
ATOM   2299  C  C      . ILE A 1 140  ? 22.538  -91.954 11.298  1.00 51.96  ? 1502 ILE A C      1 
ATOM   2300  O  O      . ILE A 1 140  ? 22.075  -90.984 10.699  1.00 51.02  ? 1502 ILE A O      1 
ATOM   2301  C  CB     . ILE A 1 140  ? 22.976  -91.091 13.619  1.00 50.38  ? 1502 ILE A CB     1 
ATOM   2302  C  CG1    . ILE A 1 140  ? 24.027  -90.918 14.721  1.00 50.32  ? 1502 ILE A CG1    1 
ATOM   2303  C  CG2    . ILE A 1 140  ? 21.785  -91.929 14.110  1.00 50.52  ? 1502 ILE A CG2    1 
ATOM   2304  C  CD1    . ILE A 1 140  ? 23.528  -90.172 15.942  1.00 48.96  ? 1502 ILE A CD1    1 
ATOM   2305  H  H      . ILE A 1 140  ? 24.757  -90.156 12.148  1.00 62.11  ? 1502 ILE A H      1 
ATOM   2306  H  HA     . ILE A 1 140  ? 23.953  -92.619 12.635  1.00 62.18  ? 1502 ILE A HA     1 
ATOM   2307  H  HB     . ILE A 1 140  ? 22.649  -90.213 13.367  1.00 60.46  ? 1502 ILE A HB     1 
ATOM   2308  H  HG12   . ILE A 1 140  ? 24.322  -91.795 15.011  1.00 60.39  ? 1502 ILE A HG12   1 
ATOM   2309  H  HG13   . ILE A 1 140  ? 24.778  -90.422 14.359  1.00 60.39  ? 1502 ILE A HG13   1 
ATOM   2310  H  HG21   . ILE A 1 140  ? 21.399  -91.501 14.890  1.00 60.62  ? 1502 ILE A HG21   1 
ATOM   2311  H  HG22   . ILE A 1 140  ? 21.125  -91.984 13.401  1.00 60.62  ? 1502 ILE A HG22   1 
ATOM   2312  H  HG23   . ILE A 1 140  ? 22.099  -92.817 14.340  1.00 60.62  ? 1502 ILE A HG23   1 
ATOM   2313  H  HD11   . ILE A 1 140  ? 23.240  -89.285 15.675  1.00 58.76  ? 1502 ILE A HD11   1 
ATOM   2314  H  HD12   . ILE A 1 140  ? 22.784  -90.660 16.328  1.00 58.76  ? 1502 ILE A HD12   1 
ATOM   2315  H  HD13   . ILE A 1 140  ? 24.250  -90.106 16.588  1.00 58.76  ? 1502 ILE A HD13   1 
ATOM   2316  N  N      . PRO A 1 141  ? 22.151  -93.212 11.031  1.00 53.22  ? 1503 PRO A N      1 
ATOM   2317  C  CA     . PRO A 1 141  ? 21.112  -93.457 10.019  1.00 53.46  ? 1503 PRO A CA     1 
ATOM   2318  C  C      . PRO A 1 141  ? 19.749  -92.889 10.411  1.00 52.09  ? 1503 PRO A C      1 
ATOM   2319  O  O      . PRO A 1 141  ? 19.308  -93.108 11.539  1.00 51.67  ? 1503 PRO A O      1 
ATOM   2320  C  CB     . PRO A 1 141  ? 21.047  -94.987 9.945   1.00 55.14  ? 1503 PRO A CB     1 
ATOM   2321  C  CG     . PRO A 1 141  ? 21.615  -95.461 11.236  1.00 55.36  ? 1503 PRO A CG     1 
ATOM   2322  C  CD     . PRO A 1 141  ? 22.657  -94.467 11.609  1.00 54.57  ? 1503 PRO A CD     1 
ATOM   2323  H  HA     . PRO A 1 141  ? 21.381  -93.100 9.159   1.00 64.15  ? 1503 PRO A HA     1 
ATOM   2324  H  HB2    . PRO A 1 141  ? 20.125  -95.271 9.851   1.00 66.17  ? 1503 PRO A HB2    1 
ATOM   2325  H  HB3    . PRO A 1 141  ? 21.581  -95.301 9.199   1.00 66.17  ? 1503 PRO A HB3    1 
ATOM   2326  H  HG2    . PRO A 1 141  ? 20.916  -95.490 11.907  1.00 66.43  ? 1503 PRO A HG2    1 
ATOM   2327  H  HG3    . PRO A 1 141  ? 22.009  -96.339 11.115  1.00 66.43  ? 1503 PRO A HG3    1 
ATOM   2328  H  HD2    . PRO A 1 141  ? 22.724  -94.392 12.574  1.00 65.48  ? 1503 PRO A HD2    1 
ATOM   2329  H  HD3    . PRO A 1 141  ? 23.509  -94.704 11.210  1.00 65.48  ? 1503 PRO A HD3    1 
ATOM   2330  N  N      . ASN A 1 142  ? 19.094  -92.181 9.493   1.00 69.58  ? 1504 ASN A N      1 
ATOM   2331  C  CA     . ASN A 1 142  ? 17.794  -91.572 9.770   1.00 70.36  ? 1504 ASN A CA     1 
ATOM   2332  C  C      . ASN A 1 142  ? 17.836  -90.663 10.995  1.00 77.71  ? 1504 ASN A C      1 
ATOM   2333  O  O      . ASN A 1 142  ? 17.053  -90.832 11.927  1.00 73.63  ? 1504 ASN A O      1 
ATOM   2334  C  CB     . ASN A 1 142  ? 16.710  -92.645 9.953   1.00 70.50  ? 1504 ASN A CB     1 
ATOM   2335  C  CG     . ASN A 1 142  ? 16.089  -93.079 8.646   1.00 71.40  ? 1504 ASN A CG     1 
ATOM   2336  O  OD1    . ASN A 1 142  ? 16.630  -92.833 7.567   1.00 72.41  ? 1504 ASN A OD1    1 
ATOM   2337  N  ND2    . ASN A 1 142  ? 14.917  -93.701 8.738   1.00 71.20  ? 1504 ASN A ND2    1 
ATOM   2338  H  H      . ASN A 1 142  ? 19.384  -92.036 8.696   1.00 83.49  ? 1504 ASN A H      1 
ATOM   2339  H  HA     . ASN A 1 142  ? 17.540  -91.027 9.009   1.00 84.43  ? 1504 ASN A HA     1 
ATOM   2340  H  HB2    . ASN A 1 142  ? 17.106  -93.426 10.371  1.00 84.61  ? 1504 ASN A HB2    1 
ATOM   2341  H  HB3    . ASN A 1 142  ? 16.005  -92.289 10.516  1.00 84.61  ? 1504 ASN A HB3    1 
ATOM   2342  H  HD21   . ASN A 1 142  ? 14.517  -93.971 8.027   1.00 85.44  ? 1504 ASN A HD21   1 
ATOM   2343  H  HD22   . ASN A 1 142  ? 14.560  -93.833 9.509   1.00 85.44  ? 1504 ASN A HD22   1 
ATOM   2344  N  N      . PHE A 1 143  ? 18.777  -89.725 11.016  1.00 48.21  ? 1505 PHE A N      1 
ATOM   2345  C  CA     . PHE A 1 143  ? 18.809  -88.730 12.082  1.00 46.83  ? 1505 PHE A CA     1 
ATOM   2346  C  C      . PHE A 1 143  ? 18.093  -87.477 11.597  1.00 45.57  ? 1505 PHE A C      1 
ATOM   2347  O  O      . PHE A 1 143  ? 17.087  -87.070 12.176  1.00 44.57  ? 1505 PHE A O      1 
ATOM   2348  C  CB     . PHE A 1 143  ? 20.235  -88.406 12.511  1.00 46.95  ? 1505 PHE A CB     1 
ATOM   2349  C  CG     . PHE A 1 143  ? 20.336  -87.914 13.928  1.00 46.01  ? 1505 PHE A CG     1 
ATOM   2350  C  CD1    . PHE A 1 143  ? 20.049  -86.599 14.247  1.00 44.59  ? 1505 PHE A CD1    1 
ATOM   2351  C  CD2    . PHE A 1 143  ? 20.718  -88.772 14.940  1.00 46.64  ? 1505 PHE A CD2    1 
ATOM   2352  C  CE1    . PHE A 1 143  ? 20.143  -86.155 15.552  1.00 43.81  ? 1505 PHE A CE1    1 
ATOM   2353  C  CE2    . PHE A 1 143  ? 20.819  -88.332 16.241  1.00 45.88  ? 1505 PHE A CE2    1 
ATOM   2354  C  CZ     . PHE A 1 143  ? 20.528  -87.025 16.550  1.00 44.46  ? 1505 PHE A CZ     1 
ATOM   2355  H  H      . PHE A 1 143  ? 19.402  -89.642 10.431  1.00 57.85  ? 1505 PHE A H      1 
ATOM   2356  H  HA     . PHE A 1 143  ? 18.331  -89.073 12.854  1.00 56.19  ? 1505 PHE A HA     1 
ATOM   2357  H  HB2    . PHE A 1 143  ? 20.776  -89.208 12.436  1.00 56.35  ? 1505 PHE A HB2    1 
ATOM   2358  H  HB3    . PHE A 1 143  ? 20.589  -87.715 11.930  1.00 56.35  ? 1505 PHE A HB3    1 
ATOM   2359  H  HD1    . PHE A 1 143  ? 19.788  -86.009 13.577  1.00 53.51  ? 1505 PHE A HD1    1 
ATOM   2360  H  HD2    . PHE A 1 143  ? 20.916  -89.658 14.739  1.00 55.97  ? 1505 PHE A HD2    1 
ATOM   2361  H  HE1    . PHE A 1 143  ? 19.948  -85.269 15.757  1.00 52.58  ? 1505 PHE A HE1    1 
ATOM   2362  H  HE2    . PHE A 1 143  ? 21.077  -88.922 16.912  1.00 55.05  ? 1505 PHE A HE2    1 
ATOM   2363  H  HZ     . PHE A 1 143  ? 20.594  -86.727 17.429  1.00 53.35  ? 1505 PHE A HZ     1 
ATOM   2364  N  N      . ASP A 1 144  ? 18.628  -86.861 10.547  1.00 88.29  ? 1506 ASP A N      1 
ATOM   2365  C  CA     . ASP A 1 144  ? 18.014  -85.684 9.946   1.00 89.37  ? 1506 ASP A CA     1 
ATOM   2366  C  C      . ASP A 1 144  ? 16.533  -85.963 9.685   1.00 88.82  ? 1506 ASP A C      1 
ATOM   2367  O  O      . ASP A 1 144  ? 15.674  -85.138 10.002  1.00 88.96  ? 1506 ASP A O      1 
ATOM   2368  C  CB     . ASP A 1 144  ? 18.744  -85.300 8.648   1.00 91.79  ? 1506 ASP A CB     1 
ATOM   2369  C  CG     . ASP A 1 144  ? 18.247  -83.985 8.043   1.00 93.99  ? 1506 ASP A CG     1 
ATOM   2370  O  OD1    . ASP A 1 144  ? 17.128  -83.534 8.368   1.00 94.86  ? 1506 ASP A OD1    1 
ATOM   2371  O  OD2    . ASP A 1 144  ? 18.991  -83.395 7.231   1.00 94.75  1 1506 ASP A OD2    1 
ATOM   2372  H  H      . ASP A 1 144  ? 19.356  -87.109 10.161  1.00 105.94 ? 1506 ASP A H      1 
ATOM   2373  H  HA     . ASP A 1 144  ? 18.078  -84.938 10.563  1.00 107.24 ? 1506 ASP A HA     1 
ATOM   2374  H  HB2    . ASP A 1 144  ? 19.691  -85.202 8.836   1.00 110.15 ? 1506 ASP A HB2    1 
ATOM   2375  H  HB3    . ASP A 1 144  ? 18.609  -86.001 7.991   1.00 110.15 ? 1506 ASP A HB3    1 
ATOM   2376  N  N      . THR A 1 145  ? 16.240  -87.139 9.134   1.00 69.96  ? 1507 THR A N      1 
ATOM   2377  C  CA     . THR A 1 145  ? 14.868  -87.499 8.788   1.00 68.30  ? 1507 THR A CA     1 
ATOM   2378  C  C      . THR A 1 145  ? 14.009  -87.542 10.041  1.00 63.50  ? 1507 THR A C      1 
ATOM   2379  O  O      . THR A 1 145  ? 12.878  -87.055 10.051  1.00 62.50  ? 1507 THR A O      1 
ATOM   2380  C  CB     . THR A 1 145  ? 14.780  -88.862 8.092   1.00 73.00  ? 1507 THR A CB     1 
ATOM   2381  O  OG1    . THR A 1 145  ? 15.938  -89.069 7.276   1.00 76.60  ? 1507 THR A OG1    1 
ATOM   2382  C  CG2    . THR A 1 145  ? 13.515  -88.932 7.238   1.00 76.52  ? 1507 THR A CG2    1 
ATOM   2383  H  H      . THR A 1 145  ? 16.819  -87.747 8.950   1.00 83.95  ? 1507 THR A H      1 
ATOM   2384  H  HA     . THR A 1 145  ? 14.503  -86.828 8.190   1.00 81.96  ? 1507 THR A HA     1 
ATOM   2385  H  HB     . THR A 1 145  ? 14.732  -89.561 8.763   1.00 87.60  ? 1507 THR A HB     1 
ATOM   2386  H  HG1    . THR A 1 145  ? 15.891  -89.816 6.894   1.00 91.92  ? 1507 THR A HG1    1 
ATOM   2387  H  HG21   . THR A 1 145  ? 13.459  -89.795 6.798   1.00 91.83  ? 1507 THR A HG21   1 
ATOM   2388  H  HG22   . THR A 1 145  ? 12.731  -88.812 7.797   1.00 91.83  ? 1507 THR A HG22   1 
ATOM   2389  H  HG23   . THR A 1 145  ? 13.531  -88.235 6.564   1.00 91.83  ? 1507 THR A HG23   1 
ATOM   2390  N  N      . THR A 1 146  ? 14.560  -88.132 11.095  1.00 64.78  ? 1508 THR A N      1 
ATOM   2391  C  CA     . THR A 1 146  ? 13.834  -88.305 12.344  1.00 64.07  ? 1508 THR A CA     1 
ATOM   2392  C  C      . THR A 1 146  ? 13.417  -86.971 12.928  1.00 67.33  ? 1508 THR A C      1 
ATOM   2393  O  O      . THR A 1 146  ? 12.283  -86.800 13.372  1.00 68.14  ? 1508 THR A O      1 
ATOM   2394  C  CB     . THR A 1 146  ? 14.698  -89.032 13.394  1.00 64.48  ? 1508 THR A CB     1 
ATOM   2395  O  OG1    . THR A 1 146  ? 15.092  -90.312 12.891  1.00 66.48  ? 1508 THR A OG1    1 
ATOM   2396  C  CG2    . THR A 1 146  ? 13.941  -89.210 14.704  1.00 64.51  ? 1508 THR A CG2    1 
ATOM   2397  H  H      . THR A 1 146  ? 15.362  -88.443 11.112  1.00 77.74  ? 1508 THR A H      1 
ATOM   2398  H  HA     . THR A 1 146  ? 13.036  -88.833 12.183  1.00 76.88  ? 1508 THR A HA     1 
ATOM   2399  H  HB     . THR A 1 146  ? 15.491  -88.504 13.573  1.00 77.38  ? 1508 THR A HB     1 
ATOM   2400  H  HG1    . THR A 1 146  ? 15.538  -90.219 12.185  1.00 79.77  ? 1508 THR A HG1    1 
ATOM   2401  H  HG21   . THR A 1 146  ? 14.501  -89.669 15.350  1.00 77.41  ? 1508 THR A HG21   1 
ATOM   2402  H  HG22   . THR A 1 146  ? 13.691  -88.344 15.062  1.00 77.41  ? 1508 THR A HG22   1 
ATOM   2403  H  HG23   . THR A 1 146  ? 13.138  -89.733 14.554  1.00 77.41  ? 1508 THR A HG23   1 
ATOM   2404  N  N      . LEU A 1 147  ? 14.342  -86.025 12.919  1.00 43.88  ? 1509 LEU A N      1 
ATOM   2405  C  CA     . LEU A 1 147  ? 14.086  -84.724 13.502  1.00 42.46  ? 1509 LEU A CA     1 
ATOM   2406  C  C      . LEU A 1 147  ? 13.026  -83.980 12.704  1.00 41.78  ? 1509 LEU A C      1 
ATOM   2407  O  O      . LEU A 1 147  ? 12.058  -83.482 13.275  1.00 40.84  ? 1509 LEU A O      1 
ATOM   2408  C  CB     . LEU A 1 147  ? 15.386  -83.923 13.579  1.00 42.22  ? 1509 LEU A CB     1 
ATOM   2409  C  CG     . LEU A 1 147  ? 16.427  -84.493 14.553  1.00 42.74  ? 1509 LEU A CG     1 
ATOM   2410  C  CD1    . LEU A 1 147  ? 17.604  -83.546 14.691  1.00 42.37  ? 1509 LEU A CD1    1 
ATOM   2411  C  CD2    . LEU A 1 147  ? 15.844  -84.826 15.922  1.00 42.37  ? 1509 LEU A CD2    1 
ATOM   2412  H  H      . LEU A 1 147  ? 15.128  -86.112 12.580  1.00 52.65  ? 1509 LEU A H      1 
ATOM   2413  H  HA     . LEU A 1 147  ? 13.753  -84.842 14.405  1.00 50.95  ? 1509 LEU A HA     1 
ATOM   2414  H  HB2    . LEU A 1 147  ? 15.789  -83.900 12.697  1.00 50.67  ? 1509 LEU A HB2    1 
ATOM   2415  H  HB3    . LEU A 1 147  ? 15.178  -83.020 13.866  1.00 50.67  ? 1509 LEU A HB3    1 
ATOM   2416  H  HG     . LEU A 1 147  ? 16.769  -85.321 14.179  1.00 51.29  ? 1509 LEU A HG     1 
ATOM   2417  H  HD11   . LEU A 1 147  ? 18.245  -83.928 15.310  1.00 50.85  ? 1509 LEU A HD11   1 
ATOM   2418  H  HD12   . LEU A 1 147  ? 18.015  -83.424 13.821  1.00 50.85  ? 1509 LEU A HD12   1 
ATOM   2419  H  HD13   . LEU A 1 147  ? 17.285  -82.695 15.029  1.00 50.85  ? 1509 LEU A HD13   1 
ATOM   2420  H  HD21   . LEU A 1 147  ? 16.548  -85.180 16.487  1.00 50.85  ? 1509 LEU A HD21   1 
ATOM   2421  H  HD22   . LEU A 1 147  ? 15.480  -84.017 16.315  1.00 50.85  ? 1509 LEU A HD22   1 
ATOM   2422  H  HD23   . LEU A 1 147  ? 15.142  -85.487 15.814  1.00 50.85  ? 1509 LEU A HD23   1 
ATOM   2423  N  N      . LYS A 1 148  ? 13.209  -83.904 11.390  1.00 49.05  ? 1510 LYS A N      1 
ATOM   2424  C  CA     . LYS A 1 148  ? 12.247  -83.218 10.533  1.00 48.55  ? 1510 LYS A CA     1 
ATOM   2425  C  C      . LYS A 1 148  ? 10.840  -83.787 10.715  1.00 49.42  ? 1510 LYS A C      1 
ATOM   2426  O  O      . LYS A 1 148  ? 9.871   -83.032 10.771  1.00 53.46  ? 1510 LYS A O      1 
ATOM   2427  C  CB     . LYS A 1 148  ? 12.673  -83.290 9.063   1.00 49.43  ? 1510 LYS A CB     1 
ATOM   2428  C  CG     . LYS A 1 148  ? 13.367  -82.012 8.590   1.00 51.32  ? 1510 LYS A CG     1 
ATOM   2429  C  CD     . LYS A 1 148  ? 13.373  -81.862 7.075   1.00 52.61  ? 1510 LYS A CD     1 
ATOM   2430  C  CE     . LYS A 1 148  ? 13.600  -80.406 6.672   1.00 48.83  ? 1510 LYS A CE     1 
ATOM   2431  N  NZ     . LYS A 1 148  ? 14.878  -79.846 7.197   1.00 48.61  1 1510 LYS A NZ     1 
ATOM   2432  H  H      . LYS A 1 148  ? 13.880  -84.240 10.970  1.00 58.86  ? 1510 LYS A H      1 
ATOM   2433  H  HA     . LYS A 1 148  ? 12.220  -82.282 10.785  1.00 58.26  ? 1510 LYS A HA     1 
ATOM   2434  H  HB2    . LYS A 1 148  ? 13.292  -84.028 8.948   1.00 59.32  ? 1510 LYS A HB2    1 
ATOM   2435  H  HB3    . LYS A 1 148  ? 11.886  -83.426 8.511   1.00 59.32  ? 1510 LYS A HB3    1 
ATOM   2436  H  HG2    . LYS A 1 148  ? 12.905  -81.245 8.964   1.00 61.58  ? 1510 LYS A HG2    1 
ATOM   2437  H  HG3    . LYS A 1 148  ? 14.289  -82.023 8.893   1.00 61.58  ? 1510 LYS A HG3    1 
ATOM   2438  H  HD2    . LYS A 1 148  ? 14.090  -82.398 6.701   1.00 63.13  ? 1510 LYS A HD2    1 
ATOM   2439  H  HD3    . LYS A 1 148  ? 12.517  -82.148 6.720   1.00 63.13  ? 1510 LYS A HD3    1 
ATOM   2440  H  HE2    . LYS A 1 148  ? 13.623  -80.347 5.704   1.00 58.59  ? 1510 LYS A HE2    1 
ATOM   2441  H  HE3    . LYS A 1 148  ? 12.872  -79.866 7.019   1.00 58.59  ? 1510 LYS A HE3    1 
ATOM   2442  H  HZ1    . LYS A 1 148  ? 14.882  -79.879 8.087   1.00 58.33  ? 1510 LYS A HZ1    1 
ATOM   2443  H  HZ2    . LYS A 1 148  ? 15.566  -80.317 6.887   1.00 58.33  ? 1510 LYS A HZ2    1 
ATOM   2444  H  HZ3    . LYS A 1 148  ? 14.968  -78.999 6.939   1.00 58.33  ? 1510 LYS A HZ3    1 
ATOM   2445  N  N      . LEU A 1 149  ? 10.723  -85.108 10.810  1.00 60.55  ? 1511 LEU A N      1 
ATOM   2446  C  CA     . LEU A 1 149  ? 9.424   -85.731 11.053  1.00 61.97  ? 1511 LEU A CA     1 
ATOM   2447  C  C      . LEU A 1 149  ? 8.903   -85.357 12.430  1.00 58.17  ? 1511 LEU A C      1 
ATOM   2448  O  O      . LEU A 1 149  ? 7.701   -85.194 12.628  1.00 62.93  ? 1511 LEU A O      1 
ATOM   2449  C  CB     . LEU A 1 149  ? 9.508   -87.254 10.937  1.00 58.89  ? 1511 LEU A CB     1 
ATOM   2450  C  CG     . LEU A 1 149  ? 9.073   -87.844 9.596   1.00 58.48  ? 1511 LEU A CG     1 
ATOM   2451  C  CD1    . LEU A 1 149  ? 10.049  -87.462 8.494   1.00 58.49  ? 1511 LEU A CD1    1 
ATOM   2452  C  CD2    . LEU A 1 149  ? 8.929   -89.354 9.708   1.00 58.95  ? 1511 LEU A CD2    1 
ATOM   2453  H  H      . LEU A 1 149  ? 11.376  -85.664 10.738  1.00 72.66  ? 1511 LEU A H      1 
ATOM   2454  H  HA     . LEU A 1 149  ? 8.789   -85.411 10.392  1.00 74.36  ? 1511 LEU A HA     1 
ATOM   2455  H  HB2    . LEU A 1 149  ? 10.428  -87.522 11.086  1.00 70.66  ? 1511 LEU A HB2    1 
ATOM   2456  H  HB3    . LEU A 1 149  ? 8.943   -87.645 11.622  1.00 70.66  ? 1511 LEU A HB3    1 
ATOM   2457  H  HG     . LEU A 1 149  ? 8.205   -87.480 9.362   1.00 70.18  ? 1511 LEU A HG     1 
ATOM   2458  H  HD11   . LEU A 1 149  ? 9.748   -87.849 7.658   1.00 70.18  ? 1511 LEU A HD11   1 
ATOM   2459  H  HD12   . LEU A 1 149  ? 10.078  -86.495 8.420   1.00 70.18  ? 1511 LEU A HD12   1 
ATOM   2460  H  HD13   . LEU A 1 149  ? 10.929  -87.803 8.720   1.00 70.18  ? 1511 LEU A HD13   1 
ATOM   2461  H  HD21   . LEU A 1 149  ? 8.653   -89.709 8.849   1.00 70.74  ? 1511 LEU A HD21   1 
ATOM   2462  H  HD22   . LEU A 1 149  ? 9.784   -89.734 9.964   1.00 70.74  ? 1511 LEU A HD22   1 
ATOM   2463  H  HD23   . LEU A 1 149  ? 8.261   -89.558 10.381  1.00 70.74  ? 1511 LEU A HD23   1 
ATOM   2464  N  N      . THR A 1 150  ? 9.818   -85.226 13.381  1.00 40.08  ? 1512 THR A N      1 
ATOM   2465  C  CA     . THR A 1 150  ? 9.452   -84.915 14.752  1.00 39.25  ? 1512 THR A CA     1 
ATOM   2466  C  C      . THR A 1 150  ? 8.963   -83.477 14.905  1.00 37.86  ? 1512 THR A C      1 
ATOM   2467  O  O      . THR A 1 150  ? 7.904   -83.246 15.485  1.00 37.23  ? 1512 THR A O      1 
ATOM   2468  C  CB     . THR A 1 150  ? 10.633  -85.162 15.713  1.00 39.50  ? 1512 THR A CB     1 
ATOM   2469  O  OG1    . THR A 1 150  ? 11.045  -86.532 15.625  1.00 40.86  ? 1512 THR A OG1    1 
ATOM   2470  C  CG2    . THR A 1 150  ? 10.234  -84.855 17.149  1.00 38.73  ? 1512 THR A CG2    1 
ATOM   2471  H  H      . THR A 1 150  ? 10.664  -85.312 13.255  1.00 48.10  ? 1512 THR A H      1 
ATOM   2472  H  HA     . THR A 1 150  ? 8.728   -85.502 15.020  1.00 47.10  ? 1512 THR A HA     1 
ATOM   2473  H  HB     . THR A 1 150  ? 11.374  -84.585 15.470  1.00 47.40  ? 1512 THR A HB     1 
ATOM   2474  H  HG1    . THR A 1 150  ? 11.287  -86.710 14.840  1.00 49.03  ? 1512 THR A HG1    1 
ATOM   2475  H  HG21   . THR A 1 150  ? 10.984  -85.014 17.743  1.00 46.48  ? 1512 THR A HG21   1 
ATOM   2476  H  HG22   . THR A 1 150  ? 9.962   -83.927 17.226  1.00 46.48  ? 1512 THR A HG22   1 
ATOM   2477  H  HG23   . THR A 1 150  ? 9.495   -85.424 17.416  1.00 46.48  ? 1512 THR A HG23   1 
ATOM   2478  N  N      . ILE A 1 151  ? 9.718   -82.510 14.387  1.00 37.45  ? 1513 ILE A N      1 
ATOM   2479  C  CA     . ILE A 1 151  ? 9.324   -81.111 14.522  1.00 36.22  ? 1513 ILE A CA     1 
ATOM   2480  C  C      . ILE A 1 151  ? 8.004   -80.850 13.811  1.00 35.92  ? 1513 ILE A C      1 
ATOM   2481  O  O      . ILE A 1 151  ? 7.149   -80.124 14.316  1.00 35.00  ? 1513 ILE A O      1 
ATOM   2482  C  CB     . ILE A 1 151  ? 10.393  -80.139 13.965  1.00 36.00  ? 1513 ILE A CB     1 
ATOM   2483  C  CG1    . ILE A 1 151  ? 9.966   -78.684 14.189  1.00 34.78  ? 1513 ILE A CG1    1 
ATOM   2484  C  CG2    . ILE A 1 151  ? 10.647  -80.374 12.487  1.00 36.79  ? 1513 ILE A CG2    1 
ATOM   2485  C  CD1    . ILE A 1 151  ? 9.806   -78.301 15.655  1.00 34.00  ? 1513 ILE A CD1    1 
ATOM   2486  H  H      . ILE A 1 151  ? 10.454  -82.636 13.958  1.00 44.95  ? 1513 ILE A H      1 
ATOM   2487  H  HA     . ILE A 1 151  ? 9.201   -80.911 15.462  1.00 43.47  ? 1513 ILE A HA     1 
ATOM   2488  H  HB     . ILE A 1 151  ? 11.222  -80.290 14.445  1.00 43.20  ? 1513 ILE A HB     1 
ATOM   2489  H  HG12   . ILE A 1 151  ? 10.636  -78.100 13.803  1.00 41.73  ? 1513 ILE A HG12   1 
ATOM   2490  H  HG13   . ILE A 1 151  ? 9.112   -78.539 13.751  1.00 41.73  ? 1513 ILE A HG13   1 
ATOM   2491  H  HG21   . ILE A 1 151  ? 11.320  -79.747 12.179  1.00 44.15  ? 1513 ILE A HG21   1 
ATOM   2492  H  HG22   . ILE A 1 151  ? 10.960  -81.284 12.361  1.00 44.15  ? 1513 ILE A HG22   1 
ATOM   2493  H  HG23   . ILE A 1 151  ? 9.819   -80.238 11.999  1.00 44.15  ? 1513 ILE A HG23   1 
ATOM   2494  H  HD11   . ILE A 1 151  ? 9.536   -77.371 15.711  1.00 40.80  ? 1513 ILE A HD11   1 
ATOM   2495  H  HD12   . ILE A 1 151  ? 9.129   -78.867 16.057  1.00 40.80  ? 1513 ILE A HD12   1 
ATOM   2496  H  HD13   . ILE A 1 151  ? 10.654  -78.427 16.108  1.00 40.80  ? 1513 ILE A HD13   1 
ATOM   2497  N  N      . ASP A 1 152  ? 7.848   -81.444 12.634  1.00 40.45  ? 1514 ASP A N      1 
ATOM   2498  C  CA     . ASP A 1 152  ? 6.618   -81.321 11.868  1.00 40.36  ? 1514 ASP A CA     1 
ATOM   2499  C  C      . ASP A 1 152  ? 5.445   -81.845 12.678  1.00 40.18  ? 1514 ASP A C      1 
ATOM   2500  O  O      . ASP A 1 152  ? 4.392   -81.211 12.748  1.00 39.45  ? 1514 ASP A O      1 
ATOM   2501  C  CB     . ASP A 1 152  ? 6.730   -82.087 10.547  1.00 41.53  ? 1514 ASP A CB     1 
ATOM   2502  C  CG     . ASP A 1 152  ? 7.643   -81.406 9.544   1.00 43.85  ? 1514 ASP A CG     1 
ATOM   2503  O  OD1    . ASP A 1 152  ? 7.963   -80.211 9.736   1.00 51.83  ? 1514 ASP A OD1    1 
ATOM   2504  O  OD2    . ASP A 1 152  ? 8.050   -82.078 8.568   1.00 44.60  1 1514 ASP A OD2    1 
ATOM   2505  H  H      . ASP A 1 152  ? 8.449   -81.929 12.253  1.00 48.54  ? 1514 ASP A H      1 
ATOM   2506  H  HA     . ASP A 1 152  ? 6.457   -80.386 11.667  1.00 48.43  ? 1514 ASP A HA     1 
ATOM   2507  H  HB2    . ASP A 1 152  ? 7.086   -82.972 10.724  1.00 49.83  ? 1514 ASP A HB2    1 
ATOM   2508  H  HB3    . ASP A 1 152  ? 5.848   -82.159 10.149  1.00 49.83  ? 1514 ASP A HB3    1 
ATOM   2509  N  N      . SER A 1 153  ? 5.637   -83.006 13.291  1.00 37.22  ? 1515 SER A N      1 
ATOM   2510  C  CA     . SER A 1 153  ? 4.582   -83.636 14.068  1.00 37.26  ? 1515 SER A CA     1 
ATOM   2511  C  C      . SER A 1 153  ? 4.278   -82.831 15.316  1.00 36.14  ? 1515 SER A C      1 
ATOM   2512  O  O      . SER A 1 153  ? 3.120   -82.711 15.707  1.00 35.72  ? 1515 SER A O      1 
ATOM   2513  C  CB     . SER A 1 153  ? 4.961   -85.063 14.452  1.00 38.42  ? 1515 SER A CB     1 
ATOM   2514  O  OG     . SER A 1 153  ? 3.808   -85.784 14.845  1.00 38.72  ? 1515 SER A OG     1 
ATOM   2515  H  H      . SER A 1 153  ? 6.374   -83.451 13.272  1.00 44.67  ? 1515 SER A H      1 
ATOM   2516  H  HA     . SER A 1 153  ? 3.775   -83.674 13.531  1.00 44.71  ? 1515 SER A HA     1 
ATOM   2517  H  HB2    . SER A 1 153  ? 5.365   -85.502 13.687  1.00 46.11  ? 1515 SER A HB2    1 
ATOM   2518  H  HB3    . SER A 1 153  ? 5.587   -85.038 15.192  1.00 46.11  ? 1515 SER A HB3    1 
ATOM   2519  H  HG     . SER A 1 153  ? 4.018   -86.569 15.056  1.00 46.47  ? 1515 SER A HG     1 
ATOM   2520  N  N      . LEU A 1 154  ? 5.309   -82.296 15.959  1.00 35.73  ? 1516 LEU A N      1 
ATOM   2521  C  CA     . LEU A 1 154  ? 5.093   -81.515 17.165  1.00 34.75  ? 1516 LEU A CA     1 
ATOM   2522  C  C      . LEU A 1 154  ? 4.267   -80.291 16.800  1.00 33.75  ? 1516 LEU A C      1 
ATOM   2523  O  O      . LEU A 1 154  ? 3.274   -79.991 17.458  1.00 33.18  ? 1516 LEU A O      1 
ATOM   2524  C  CB     . LEU A 1 154  ? 6.416   -81.116 17.823  1.00 34.57  ? 1516 LEU A CB     1 
ATOM   2525  C  CG     . LEU A 1 154  ? 7.180   -82.231 18.553  1.00 35.45  ? 1516 LEU A CG     1 
ATOM   2526  C  CD1    . LEU A 1 154  ? 8.408   -81.656 19.239  1.00 35.16  ? 1516 LEU A CD1    1 
ATOM   2527  C  CD2    . LEU A 1 154  ? 6.320   -83.001 19.556  1.00 35.69  ? 1516 LEU A CD2    1 
ATOM   2528  H  H      . LEU A 1 154  ? 6.132   -82.370 15.721  1.00 42.88  ? 1516 LEU A H      1 
ATOM   2529  H  HA     . LEU A 1 154  ? 4.586   -82.044 17.801  1.00 41.70  ? 1516 LEU A HA     1 
ATOM   2530  H  HB2    . LEU A 1 154  ? 7.004   -80.767 17.135  1.00 41.49  ? 1516 LEU A HB2    1 
ATOM   2531  H  HB3    . LEU A 1 154  ? 6.233   -80.420 18.473  1.00 41.49  ? 1516 LEU A HB3    1 
ATOM   2532  H  HG     . LEU A 1 154  ? 7.492   -82.869 17.892  1.00 42.55  ? 1516 LEU A HG     1 
ATOM   2533  H  HD11   . LEU A 1 154  ? 8.879   -82.371 19.694  1.00 42.19  ? 1516 LEU A HD11   1 
ATOM   2534  H  HD12   . LEU A 1 154  ? 8.984   -81.253 18.570  1.00 42.19  ? 1516 LEU A HD12   1 
ATOM   2535  H  HD13   . LEU A 1 154  ? 8.125   -80.984 19.880  1.00 42.19  ? 1516 LEU A HD13   1 
ATOM   2536  H  HD21   . LEU A 1 154  ? 6.863   -83.685 19.977  1.00 42.83  ? 1516 LEU A HD21   1 
ATOM   2537  H  HD22   . LEU A 1 154  ? 5.987   -82.383 20.225  1.00 42.83  ? 1516 LEU A HD22   1 
ATOM   2538  H  HD23   . LEU A 1 154  ? 5.578   -83.411 19.085  1.00 42.83  ? 1516 LEU A HD23   1 
ATOM   2539  N  N      . LYS A 1 155  ? 4.677   -79.592 15.746  1.00 36.29  ? 1517 LYS A N      1 
ATOM   2540  C  CA     . LYS A 1 155  ? 3.943   -78.426 15.262  1.00 35.46  ? 1517 LYS A CA     1 
ATOM   2541  C  C      . LYS A 1 155  ? 2.496   -78.780 14.926  1.00 35.55  ? 1517 LYS A C      1 
ATOM   2542  O  O      . LYS A 1 155  ? 1.594   -77.969 15.137  1.00 34.77  ? 1517 LYS A O      1 
ATOM   2543  C  CB     . LYS A 1 155  ? 4.639   -77.814 14.050  1.00 35.58  ? 1517 LYS A CB     1 
ATOM   2544  C  CG     . LYS A 1 155  ? 5.873   -76.998 14.413  1.00 35.20  ? 1517 LYS A CG     1 
ATOM   2545  C  CD     . LYS A 1 155  ? 6.694   -76.600 13.190  1.00 35.57  ? 1517 LYS A CD     1 
ATOM   2546  C  CE     . LYS A 1 155  ? 5.912   -75.698 12.244  1.00 35.20  ? 1517 LYS A CE     1 
ATOM   2547  N  NZ     . LYS A 1 155  ? 5.406   -74.471 12.917  1.00 34.10  1 1517 LYS A NZ     1 
ATOM   2548  H  H      . LYS A 1 155  ? 5.383   -79.774 15.290  1.00 43.55  ? 1517 LYS A H      1 
ATOM   2549  H  HA     . LYS A 1 155  ? 3.927   -77.756 15.963  1.00 42.56  ? 1517 LYS A HA     1 
ATOM   2550  H  HB2    . LYS A 1 155  ? 4.917   -78.527 13.454  1.00 42.70  ? 1517 LYS A HB2    1 
ATOM   2551  H  HB3    . LYS A 1 155  ? 4.016   -77.226 13.594  1.00 42.70  ? 1517 LYS A HB3    1 
ATOM   2552  H  HG2    . LYS A 1 155  ? 5.594   -76.186 14.864  1.00 42.24  ? 1517 LYS A HG2    1 
ATOM   2553  H  HG3    . LYS A 1 155  ? 6.440   -77.525 14.997  1.00 42.24  ? 1517 LYS A HG3    1 
ATOM   2554  H  HD2    . LYS A 1 155  ? 7.485   -76.119 13.480  1.00 42.69  ? 1517 LYS A HD2    1 
ATOM   2555  H  HD3    . LYS A 1 155  ? 6.948   -77.399 12.703  1.00 42.69  ? 1517 LYS A HD3    1 
ATOM   2556  H  HE2    . LYS A 1 155  ? 6.492   -75.425 11.515  1.00 42.24  ? 1517 LYS A HE2    1 
ATOM   2557  H  HE3    . LYS A 1 155  ? 5.150   -76.188 11.897  1.00 42.24  ? 1517 LYS A HE3    1 
ATOM   2558  H  HZ1    . LYS A 1 155  ? 4.865   -74.694 13.588  1.00 40.92  ? 1517 LYS A HZ1    1 
ATOM   2559  H  HZ2    . LYS A 1 155  ? 6.087   -73.999 13.240  1.00 40.92  ? 1517 LYS A HZ2    1 
ATOM   2560  H  HZ3    . LYS A 1 155  ? 4.955   -73.970 12.336  1.00 40.92  ? 1517 LYS A HZ3    1 
ATOM   2561  N  N      . MET A 1 156  ? 2.275   -79.981 14.397  1.00 64.59  ? 1518 MET A N      1 
ATOM   2562  C  CA     . MET A 1 156  ? 0.921   -80.436 14.080  1.00 74.48  ? 1518 MET A CA     1 
ATOM   2563  C  C      . MET A 1 156  ? 0.115   -80.618 15.368  1.00 73.13  ? 1518 MET A C      1 
ATOM   2564  O  O      . MET A 1 156  ? -1.100  -80.408 15.387  1.00 70.33  ? 1518 MET A O      1 
ATOM   2565  C  CB     . MET A 1 156  ? 0.960   -81.748 13.281  1.00 79.25  ? 1518 MET A CB     1 
ATOM   2566  C  CG     . MET A 1 156  ? -0.411  -82.303 12.886  1.00 82.68  ? 1518 MET A CG     1 
ATOM   2567  S  SD     . MET A 1 156  ? -1.204  -81.404 11.536  1.00 69.49  ? 1518 MET A SD     1 
ATOM   2568  C  CE     . MET A 1 156  ? -0.134  -81.818 10.163  1.00 67.24  ? 1518 MET A CE     1 
ATOM   2569  H  H      . MET A 1 156  ? 2.891   -80.552 14.211  1.00 77.51  ? 1518 MET A H      1 
ATOM   2570  H  HA     . MET A 1 156  ? 0.486   -79.766 13.530  1.00 89.37  ? 1518 MET A HA     1 
ATOM   2571  H  HB2    . MET A 1 156  ? 1.461   -81.597 12.464  1.00 95.10  ? 1518 MET A HB2    1 
ATOM   2572  H  HB3    . MET A 1 156  ? 1.406   -82.422 13.816  1.00 95.10  ? 1518 MET A HB3    1 
ATOM   2573  H  HG2    . MET A 1 156  ? -0.305  -83.226 12.605  1.00 99.22  ? 1518 MET A HG2    1 
ATOM   2574  H  HG3    . MET A 1 156  ? -0.999  -82.260 13.656  1.00 99.22  ? 1518 MET A HG3    1 
ATOM   2575  H  HE1    . MET A 1 156  ? -0.466  -81.383 9.362   1.00 80.69  ? 1518 MET A HE1    1 
ATOM   2576  H  HE2    . MET A 1 156  ? 0.765   -81.510 10.359  1.00 80.69  ? 1518 MET A HE2    1 
ATOM   2577  H  HE3    . MET A 1 156  ? -0.135  -82.781 10.041  1.00 80.69  ? 1518 MET A HE3    1 
ATOM   2578  N  N      . ILE A 1 157  ? 0.793   -81.010 16.444  1.00 38.31  ? 1519 ILE A N      1 
ATOM   2579  C  CA     . ILE A 1 157  ? 0.155   -81.118 17.751  1.00 37.99  ? 1519 ILE A CA     1 
ATOM   2580  C  C      . ILE A 1 157  ? -0.143  -79.737 18.326  1.00 36.78  ? 1519 ILE A C      1 
ATOM   2581  O  O      . ILE A 1 157  ? -1.262  -79.470 18.762  1.00 36.36  ? 1519 ILE A O      1 
ATOM   2582  C  CB     . ILE A 1 157  ? 1.023   -81.913 18.748  1.00 38.52  ? 1519 ILE A CB     1 
ATOM   2583  C  CG1    . ILE A 1 157  ? 1.084   -83.382 18.324  1.00 39.82  ? 1519 ILE A CG1    1 
ATOM   2584  C  CG2    . ILE A 1 157  ? 0.468   -81.784 20.170  1.00 38.09  ? 1519 ILE A CG2    1 
ATOM   2585  C  CD1    . ILE A 1 157  ? 1.929   -84.260 19.225  1.00 40.51  ? 1519 ILE A CD1    1 
ATOM   2586  H  H      . ILE A 1 157  ? 1.627   -81.220 16.442  1.00 45.97  ? 1519 ILE A H      1 
ATOM   2587  H  HA     . ILE A 1 157  ? -0.688  -81.588 17.651  1.00 45.58  ? 1519 ILE A HA     1 
ATOM   2588  H  HB     . ILE A 1 157  ? 1.922   -81.549 18.733  1.00 46.22  ? 1519 ILE A HB     1 
ATOM   2589  H  HG12   . ILE A 1 157  ? 0.183   -83.743 18.323  1.00 47.78  ? 1519 ILE A HG12   1 
ATOM   2590  H  HG13   . ILE A 1 157  ? 1.457   -83.432 17.430  1.00 47.78  ? 1519 ILE A HG13   1 
ATOM   2591  H  HG21   . ILE A 1 157  ? 1.031   -82.291 20.776  1.00 45.71  ? 1519 ILE A HG21   1 
ATOM   2592  H  HG22   . ILE A 1 157  ? 0.468   -80.848 20.425  1.00 45.71  ? 1519 ILE A HG22   1 
ATOM   2593  H  HG23   . ILE A 1 157  ? -0.437  -82.132 20.189  1.00 45.71  ? 1519 ILE A HG23   1 
ATOM   2594  H  HD11   . ILE A 1 157  ? 1.913   -85.169 18.886  1.00 48.62  ? 1519 ILE A HD11   1 
ATOM   2595  H  HD12   . ILE A 1 157  ? 2.839   -83.924 19.229  1.00 48.62  ? 1519 ILE A HD12   1 
ATOM   2596  H  HD13   . ILE A 1 157  ? 1.563   -84.235 20.123  1.00 48.62  ? 1519 ILE A HD13   1 
ATOM   2597  N  N      . LYS A 1 158  ? 0.874   -78.876 18.340  1.00 49.41  ? 1520 LYS A N      1 
ATOM   2598  C  CA     . LYS A 1 158  ? 0.757   -77.530 18.899  1.00 48.26  ? 1520 LYS A CA     1 
ATOM   2599  C  C      . LYS A 1 158  ? -0.413  -76.822 18.222  1.00 47.87  ? 1520 LYS A C      1 
ATOM   2600  O  O      . LYS A 1 158  ? -1.242  -76.190 18.881  1.00 50.67  ? 1520 LYS A O      1 
ATOM   2601  C  CB     . LYS A 1 158  ? 2.059   -76.748 18.688  1.00 47.20  ? 1520 LYS A CB     1 
ATOM   2602  C  CG     . LYS A 1 158  ? 2.130   -75.351 19.313  1.00 46.78  ? 1520 LYS A CG     1 
ATOM   2603  C  CD     . LYS A 1 158  ? 2.006   -75.383 20.836  1.00 47.54  ? 1520 LYS A CD     1 
ATOM   2604  C  CE     . LYS A 1 158  ? 2.062   -73.977 21.436  1.00 47.90  ? 1520 LYS A CE     1 
ATOM   2605  N  NZ     . LYS A 1 158  ? 1.945   -73.969 22.925  1.00 47.12  1 1520 LYS A NZ     1 
ATOM   2606  H  H      . LYS A 1 158  ? 1.656   -79.052 18.027  1.00 59.29  ? 1520 LYS A H      1 
ATOM   2607  H  HA     . LYS A 1 158  ? 0.579   -77.586 19.851  1.00 57.91  ? 1520 LYS A HA     1 
ATOM   2608  H  HB2    . LYS A 1 158  ? 2.788   -77.267 19.062  1.00 56.64  ? 1520 LYS A HB2    1 
ATOM   2609  H  HB3    . LYS A 1 158  ? 2.198   -76.643 17.734  1.00 56.64  ? 1520 LYS A HB3    1 
ATOM   2610  H  HG2    . LYS A 1 158  ? 2.983   -74.947 19.089  1.00 56.14  ? 1520 LYS A HG2    1 
ATOM   2611  H  HG3    . LYS A 1 158  ? 1.404   -74.811 18.964  1.00 56.14  ? 1520 LYS A HG3    1 
ATOM   2612  H  HD2    . LYS A 1 158  ? 1.157   -75.784 21.080  1.00 57.05  ? 1520 LYS A HD2    1 
ATOM   2613  H  HD3    . LYS A 1 158  ? 2.740   -75.900 21.206  1.00 57.05  ? 1520 LYS A HD3    1 
ATOM   2614  H  HE2    . LYS A 1 158  ? 2.909   -73.568 21.200  1.00 57.48  ? 1520 LYS A HE2    1 
ATOM   2615  H  HE3    . LYS A 1 158  ? 1.330   -73.453 21.076  1.00 57.48  ? 1520 LYS A HE3    1 
ATOM   2616  H  HZ1    . LYS A 1 158  ? 2.612   -74.438 23.284  1.00 56.55  ? 1520 LYS A HZ1    1 
ATOM   2617  H  HZ2    . LYS A 1 158  ? 1.983   -73.133 23.228  1.00 56.55  ? 1520 LYS A HZ2    1 
ATOM   2618  H  HZ3    . LYS A 1 158  ? 1.171   -74.332 23.171  1.00 56.55  ? 1520 LYS A HZ3    1 
ATOM   2619  N  N      . SER A 1 159  ? -0.469  -76.938 16.897  1.00 30.61  ? 1521 SER A N      1 
ATOM   2620  C  CA     . SER A 1 159  ? -1.578  -76.406 16.118  1.00 30.34  ? 1521 SER A CA     1 
ATOM   2621  C  C      . SER A 1 159  ? -2.919  -76.994 16.537  1.00 30.47  ? 1521 SER A C      1 
ATOM   2622  O  O      . SER A 1 159  ? -3.894  -76.268 16.721  1.00 29.87  ? 1521 SER A O      1 
ATOM   2623  C  CB     . SER A 1 159  ? -1.361  -76.680 14.632  1.00 30.98  ? 1521 SER A CB     1 
ATOM   2624  O  OG     . SER A 1 159  ? -2.576  -76.512 13.916  1.00 30.98  ? 1521 SER A OG     1 
ATOM   2625  H  H      . SER A 1 159  ? 0.134   -77.326 16.422  1.00 36.73  ? 1521 SER A H      1 
ATOM   2626  H  HA     . SER A 1 159  ? -1.620  -75.445 16.243  1.00 36.41  ? 1521 SER A HA     1 
ATOM   2627  H  HB2    . SER A 1 159  ? -0.702  -76.057 14.287  1.00 37.18  ? 1521 SER A HB2    1 
ATOM   2628  H  HB3    . SER A 1 159  ? -1.050  -77.592 14.519  1.00 37.18  ? 1521 SER A HB3    1 
ATOM   2629  H  HG     . SER A 1 159  ? -2.452  -76.664 13.099  1.00 37.17  ? 1521 SER A HG     1 
ATOM   2630  N  N      . SER A 1 160  ? -2.957  -78.315 16.690  1.00 38.49  ? 1522 SER A N      1 
ATOM   2631  C  CA     . SER A 1 160  ? -4.196  -79.017 17.006  1.00 38.82  ? 1522 SER A CA     1 
ATOM   2632  C  C      . SER A 1 160  ? -4.746  -78.538 18.336  1.00 38.14  ? 1522 SER A C      1 
ATOM   2633  O  O      . SER A 1 160  ? -5.949  -78.321 18.490  1.00 37.90  ? 1522 SER A O      1 
ATOM   2634  C  CB     . SER A 1 160  ? -3.960  -80.529 17.053  1.00 39.95  ? 1522 SER A CB     1 
ATOM   2635  O  OG     . SER A 1 160  ? -5.113  -81.209 17.528  1.00 40.31  ? 1522 SER A OG     1 
ATOM   2636  H  H      . SER A 1 160  ? -2.273  -78.831 16.614  1.00 46.19  ? 1522 SER A H      1 
ATOM   2637  H  HA     . SER A 1 160  ? -4.855  -78.832 16.319  1.00 46.58  ? 1522 SER A HA     1 
ATOM   2638  H  HB2    . SER A 1 160  ? -3.754  -80.844 16.159  1.00 47.94  ? 1522 SER A HB2    1 
ATOM   2639  H  HB3    . SER A 1 160  ? -3.217  -80.713 17.649  1.00 47.94  ? 1522 SER A HB3    1 
ATOM   2640  H  HG     . SER A 1 160  ? -5.304  -80.946 18.303  1.00 48.37  ? 1522 SER A HG     1 
ATOM   2641  N  N      . LEU A 1 161  ? -3.840  -78.388 19.295  1.00 34.75  ? 1523 LEU A N      1 
ATOM   2642  C  CA     . LEU A 1 161  ? -4.188  -77.916 20.625  1.00 34.18  ? 1523 LEU A CA     1 
ATOM   2643  C  C      . LEU A 1 161  ? -4.776  -76.525 20.601  1.00 33.20  ? 1523 LEU A C      1 
ATOM   2644  O  O      . LEU A 1 161  ? -5.820  -76.261 21.201  1.00 32.90  ? 1523 LEU A O      1 
ATOM   2645  C  CB     . LEU A 1 161  ? -2.958  -77.912 21.521  1.00 34.15  ? 1523 LEU A CB     1 
ATOM   2646  C  CG     . LEU A 1 161  ? -3.037  -78.824 22.732  1.00 34.67  ? 1523 LEU A CG     1 
ATOM   2647  C  CD1    . LEU A 1 161  ? -1.730  -78.745 23.493  1.00 34.67  ? 1523 LEU A CD1    1 
ATOM   2648  C  CD2    . LEU A 1 161  ? -4.205  -78.411 23.608  1.00 34.23  ? 1523 LEU A CD2    1 
ATOM   2649  H  H      . LEU A 1 161  ? -3.003  -78.557 19.196  1.00 41.70  ? 1523 LEU A H      1 
ATOM   2650  H  HA     . LEU A 1 161  ? -4.844  -78.516 21.014  1.00 41.02  ? 1523 LEU A HA     1 
ATOM   2651  H  HB2    . LEU A 1 161  ? -2.193  -78.192 20.995  1.00 40.98  ? 1523 LEU A HB2    1 
ATOM   2652  H  HB3    . LEU A 1 161  ? -2.816  -77.009 21.845  1.00 40.98  ? 1523 LEU A HB3    1 
ATOM   2653  H  HG     . LEU A 1 161  ? -3.174  -79.740 22.443  1.00 41.61  ? 1523 LEU A HG     1 
ATOM   2654  H  HD11   . LEU A 1 161  ? -1.780  -79.328 24.267  1.00 41.60  ? 1523 LEU A HD11   1 
ATOM   2655  H  HD12   . LEU A 1 161  ? -1.009  -79.030 22.911  1.00 41.60  ? 1523 LEU A HD12   1 
ATOM   2656  H  HD13   . LEU A 1 161  ? -1.586  -77.829 23.777  1.00 41.60  ? 1523 LEU A HD13   1 
ATOM   2657  H  HD21   . LEU A 1 161  ? -4.246  -79.000 24.378  1.00 41.08  ? 1523 LEU A HD21   1 
ATOM   2658  H  HD22   . LEU A 1 161  ? -4.073  -77.495 23.898  1.00 41.08  ? 1523 LEU A HD22   1 
ATOM   2659  H  HD23   . LEU A 1 161  ? -5.025  -78.480 23.094  1.00 41.08  ? 1523 LEU A HD23   1 
ATOM   2660  N  N      . SER A 1 162  ? -4.063  -75.631 19.930  1.00 41.03  ? 1524 SER A N      1 
ATOM   2661  C  CA     . SER A 1 162  ? -4.515  -74.265 19.754  1.00 40.69  ? 1524 SER A CA     1 
ATOM   2662  C  C      . SER A 1 162  ? -5.913  -74.262 19.152  1.00 40.22  ? 1524 SER A C      1 
ATOM   2663  O  O      . SER A 1 162  ? -6.789  -73.524 19.597  1.00 39.67  ? 1524 SER A O      1 
ATOM   2664  C  CB     . SER A 1 162  ? -3.539  -73.496 18.864  1.00 56.24  ? 1524 SER A CB     1 
ATOM   2665  O  OG     . SER A 1 162  ? -3.992  -72.172 18.636  1.00 67.46  ? 1524 SER A OG     1 
ATOM   2666  H  H      . SER A 1 162  ? -3.302  -75.796 19.564  1.00 49.24  ? 1524 SER A H      1 
ATOM   2667  H  HA     . SER A 1 162  ? -4.553  -73.824 20.617  1.00 48.83  ? 1524 SER A HA     1 
ATOM   2668  H  HB2    . SER A 1 162  ? -2.673  -73.461 19.301  1.00 67.49  ? 1524 SER A HB2    1 
ATOM   2669  H  HB3    . SER A 1 162  ? -3.461  -73.953 18.012  1.00 67.49  ? 1524 SER A HB3    1 
ATOM   2670  H  HG     . SER A 1 162  ? -3.447  -71.762 18.146  1.00 80.95  ? 1524 SER A HG     1 
ATOM   2671  N  N      . THR A 1 163  ? -6.117  -75.101 18.143  1.00 32.19  ? 1525 THR A N      1 
ATOM   2672  C  CA     . THR A 1 163  ? -7.405  -75.169 17.472  1.00 32.34  ? 1525 THR A CA     1 
ATOM   2673  C  C      . THR A 1 163  ? -8.440  -75.720 18.440  1.00 32.47  ? 1525 THR A C      1 
ATOM   2674  O  O      . THR A 1 163  ? -9.543  -75.192 18.542  1.00 32.11  ? 1525 THR A O      1 
ATOM   2675  C  CB     . THR A 1 163  ? -7.364  -76.047 16.198  1.00 33.22  ? 1525 THR A CB     1 
ATOM   2676  O  OG1    . THR A 1 163  ? -6.307  -75.606 15.335  1.00 33.21  ? 1525 THR A OG1    1 
ATOM   2677  C  CG2    . THR A 1 163  ? -8.689  -75.967 15.449  1.00 33.35  ? 1525 THR A CG2    1 
ATOM   2678  H  H      . THR A 1 163  ? -5.525  -75.641 17.830  1.00 38.63  ? 1525 THR A H      1 
ATOM   2679  H  HA     . THR A 1 163  ? -7.677  -74.274 17.214  1.00 38.81  ? 1525 THR A HA     1 
ATOM   2680  H  HB     . THR A 1 163  ? -7.209  -76.971 16.449  1.00 39.86  ? 1525 THR A HB     1 
ATOM   2681  H  HG1    . THR A 1 163  ? -5.569  -75.665 15.732  1.00 39.86  ? 1525 THR A HG1    1 
ATOM   2682  H  HG21   . THR A 1 163  ? -8.654  -76.520 14.653  1.00 40.02  ? 1525 THR A HG21   1 
ATOM   2683  H  HG22   . THR A 1 163  ? -9.410  -76.279 16.018  1.00 40.02  ? 1525 THR A HG22   1 
ATOM   2684  H  HG23   . THR A 1 163  ? -8.867  -75.050 15.188  1.00 40.02  ? 1525 THR A HG23   1 
ATOM   2685  N  N      . PHE A 1 164  ? -8.072  -76.775 19.161  1.00 31.56  ? 1526 PHE A N      1 
ATOM   2686  C  CA     . PHE A 1 164  ? -8.991  -77.423 20.090  1.00 31.86  ? 1526 PHE A CA     1 
ATOM   2687  C  C      . PHE A 1 164  ? -9.560  -76.421 21.082  1.00 31.04  ? 1526 PHE A C      1 
ATOM   2688  O  O      . PHE A 1 164  ? -10.770 -76.347 21.285  1.00 31.00  ? 1526 PHE A O      1 
ATOM   2689  C  CB     . PHE A 1 164  ? -8.293  -78.542 20.867  1.00 32.54  ? 1526 PHE A CB     1 
ATOM   2690  C  CG     . PHE A 1 164  ? -9.105  -79.069 22.018  1.00 32.81  ? 1526 PHE A CG     1 
ATOM   2691  C  CD1    . PHE A 1 164  ? -10.385 -79.550 21.806  1.00 33.22  ? 1526 PHE A CD1    1 
ATOM   2692  C  CD2    . PHE A 1 164  ? -8.607  -79.054 23.309  1.00 32.69  ? 1526 PHE A CD2    1 
ATOM   2693  C  CE1    . PHE A 1 164  ? -11.140 -80.025 22.850  1.00 33.54  ? 1526 PHE A CE1    1 
ATOM   2694  C  CE2    . PHE A 1 164  ? -9.362  -79.531 24.358  1.00 33.02  ? 1526 PHE A CE2    1 
ATOM   2695  C  CZ     . PHE A 1 164  ? -10.632 -80.014 24.127  1.00 33.45  ? 1526 PHE A CZ     1 
ATOM   2696  H  H      . PHE A 1 164  ? -7.292  -77.136 19.130  1.00 37.88  ? 1526 PHE A H      1 
ATOM   2697  H  HA     . PHE A 1 164  ? -9.727  -77.811 19.593  1.00 38.23  ? 1526 PHE A HA     1 
ATOM   2698  H  HB2    . PHE A 1 164  ? -8.118  -79.281 20.263  1.00 39.05  ? 1526 PHE A HB2    1 
ATOM   2699  H  HB3    . PHE A 1 164  ? -7.457  -78.203 21.223  1.00 39.05  ? 1526 PHE A HB3    1 
ATOM   2700  H  HD1    . PHE A 1 164  ? -10.734 -79.561 20.944  1.00 39.87  ? 1526 PHE A HD1    1 
ATOM   2701  H  HD2    . PHE A 1 164  ? -7.750  -78.730 23.468  1.00 39.23  ? 1526 PHE A HD2    1 
ATOM   2702  H  HE1    . PHE A 1 164  ? -11.997 -80.351 22.694  1.00 40.25  ? 1526 PHE A HE1    1 
ATOM   2703  H  HE2    . PHE A 1 164  ? -9.017  -79.523 25.221  1.00 39.63  ? 1526 PHE A HE2    1 
ATOM   2704  H  HZ     . PHE A 1 164  ? -11.143 -80.335 24.835  1.00 40.14  ? 1526 PHE A HZ     1 
ATOM   2705  N  N      . LEU A 1 165  ? -8.670  -75.652 21.694  1.00 28.39  ? 1527 LEU A N      1 
ATOM   2706  C  CA     . LEU A 1 165  ? -9.053  -74.632 22.661  1.00 27.65  ? 1527 LEU A CA     1 
ATOM   2707  C  C      . LEU A 1 165  ? -9.938  -73.553 22.063  1.00 27.07  ? 1527 LEU A C      1 
ATOM   2708  O  O      . LEU A 1 165  ? -10.987 -73.225 22.612  1.00 26.85  ? 1527 LEU A O      1 
ATOM   2709  C  CB     . LEU A 1 165  ? -7.796  -74.003 23.261  1.00 27.23  ? 1527 LEU A CB     1 
ATOM   2710  C  CG     . LEU A 1 165  ? -7.042  -74.978 24.154  1.00 27.79  ? 1527 LEU A CG     1 
ATOM   2711  C  CD1    . LEU A 1 165  ? -5.657  -74.463 24.478  1.00 27.50  ? 1527 LEU A CD1    1 
ATOM   2712  C  CD2    . LEU A 1 165  ? -7.835  -75.199 25.427  1.00 27.89  ? 1527 LEU A CD2    1 
ATOM   2713  H  H      . LEU A 1 165  ? -7.821  -75.702 21.564  1.00 34.07  ? 1527 LEU A H      1 
ATOM   2714  H  HA     . LEU A 1 165  ? -9.547  -75.055 23.381  1.00 33.18  ? 1527 LEU A HA     1 
ATOM   2715  H  HB2    . LEU A 1 165  ? -7.204  -73.730 22.543  1.00 32.67  ? 1527 LEU A HB2    1 
ATOM   2716  H  HB3    . LEU A 1 165  ? -8.049  -73.235 23.797  1.00 32.67  ? 1527 LEU A HB3    1 
ATOM   2717  H  HG     . LEU A 1 165  ? -6.952  -75.830 23.698  1.00 33.34  ? 1527 LEU A HG     1 
ATOM   2718  H  HD11   . LEU A 1 165  ? -5.206  -75.106 25.047  1.00 33.00  ? 1527 LEU A HD11   1 
ATOM   2719  H  HD12   . LEU A 1 165  ? -5.163  -74.347 23.651  1.00 33.00  ? 1527 LEU A HD12   1 
ATOM   2720  H  HD13   . LEU A 1 165  ? -5.737  -73.613 24.938  1.00 33.00  ? 1527 LEU A HD13   1 
ATOM   2721  H  HD21   . LEU A 1 165  ? -7.354  -75.820 25.995  1.00 33.46  ? 1527 LEU A HD21   1 
ATOM   2722  H  HD22   . LEU A 1 165  ? -7.944  -74.349 25.882  1.00 33.46  ? 1527 LEU A HD22   1 
ATOM   2723  H  HD23   . LEU A 1 165  ? -8.704  -75.565 25.197  1.00 33.46  ? 1527 LEU A HD23   1 
ATOM   2724  N  N      . GLU A 1 166  ? -9.497  -72.983 20.949  1.00 54.60  ? 1528 GLU A N      1 
ATOM   2725  C  CA     . GLU A 1 166  ? -10.242 -71.908 20.310  1.00 53.39  ? 1528 GLU A CA     1 
ATOM   2726  C  C      . GLU A 1 166  ? -11.642 -72.381 19.909  1.00 51.51  ? 1528 GLU A C      1 
ATOM   2727  O  O      . GLU A 1 166  ? -12.570 -71.580 19.862  1.00 51.74  ? 1528 GLU A O      1 
ATOM   2728  C  CB     . GLU A 1 166  ? -9.468  -71.368 19.101  1.00 53.44  ? 1528 GLU A CB     1 
ATOM   2729  C  CG     . GLU A 1 166  ? -9.232  -69.855 19.146  1.00 54.35  ? 1528 GLU A CG     1 
ATOM   2730  C  CD     . GLU A 1 166  ? -10.388 -69.047 18.578  1.00 58.08  ? 1528 GLU A CD     1 
ATOM   2731  O  OE1    . GLU A 1 166  ? -11.268 -69.635 17.913  1.00 61.84  ? 1528 GLU A OE1    1 
ATOM   2732  O  OE2    . GLU A 1 166  ? -10.413 -67.816 18.799  1.00 57.24  1 1528 GLU A OE2    1 
ATOM   2733  H  H      . GLU A 1 166  ? -8.770  -73.200 20.544  1.00 65.52  ? 1528 GLU A H      1 
ATOM   2734  H  HA     . GLU A 1 166  ? -10.345 -71.181 20.943  1.00 64.07  ? 1528 GLU A HA     1 
ATOM   2735  H  HB2    . GLU A 1 166  ? -8.601  -71.803 19.064  1.00 64.13  ? 1528 GLU A HB2    1 
ATOM   2736  H  HB3    . GLU A 1 166  ? -9.969  -71.566 18.294  1.00 64.13  ? 1528 GLU A HB3    1 
ATOM   2737  H  HG2    . GLU A 1 166  ? -9.105  -69.585 20.069  1.00 65.22  ? 1528 GLU A HG2    1 
ATOM   2738  H  HG3    . GLU A 1 166  ? -8.439  -69.645 18.629  1.00 65.22  ? 1528 GLU A HG3    1 
ATOM   2739  N  N      . ARG A 1 167  ? -11.794 -73.669 19.608  1.00 66.85  ? 1529 ARG A N      1 
ATOM   2740  C  CA     . ARG A 1 167  ? -13.116 -74.236 19.317  1.00 72.18  ? 1529 ARG A CA     1 
ATOM   2741  C  C      . ARG A 1 167  ? -13.893 -74.435 20.623  1.00 66.86  ? 1529 ARG A C      1 
ATOM   2742  O  O      . ARG A 1 167  ? -15.126 -74.420 20.637  1.00 66.54  ? 1529 ARG A O      1 
ATOM   2743  C  CB     . ARG A 1 167  ? -12.998 -75.552 18.536  1.00 76.31  ? 1529 ARG A CB     1 
ATOM   2744  C  CG     . ARG A 1 167  ? -12.524 -75.348 17.091  1.00 82.44  ? 1529 ARG A CG     1 
ATOM   2745  C  CD     . ARG A 1 167  ? -12.493 -76.629 16.253  1.00 88.39  ? 1529 ARG A CD     1 
ATOM   2746  N  NE     . ARG A 1 167  ? -11.841 -76.391 14.964  1.00 97.30  ? 1529 ARG A NE     1 
ATOM   2747  C  CZ     . ARG A 1 167  ? -11.461 -77.344 14.116  1.00 105.95 ? 1529 ARG A CZ     1 
ATOM   2748  N  NH1    . ARG A 1 167  ? -11.663 -78.623 14.406  1.00 108.87 1 1529 ARG A NH1    1 
ATOM   2749  N  NH2    . ARG A 1 167  ? -10.870 -77.017 12.972  1.00 108.51 ? 1529 ARG A NH2    1 
ATOM   2750  H  H      . ARG A 1 167  ? -11.150 -74.237 19.565  1.00 80.22  ? 1529 ARG A H      1 
ATOM   2751  H  HA     . ARG A 1 167  ? -13.612 -73.609 18.768  1.00 86.62  ? 1529 ARG A HA     1 
ATOM   2752  H  HB2    . ARG A 1 167  ? -12.359 -76.129 18.983  1.00 91.57  ? 1529 ARG A HB2    1 
ATOM   2753  H  HB3    . ARG A 1 167  ? -13.868 -75.981 18.508  1.00 91.57  ? 1529 ARG A HB3    1 
ATOM   2754  H  HG2    . ARG A 1 167  ? -13.122 -74.723 16.653  1.00 98.93  ? 1529 ARG A HG2    1 
ATOM   2755  H  HG3    . ARG A 1 167  ? -11.625 -74.985 17.108  1.00 98.93  ? 1529 ARG A HG3    1 
ATOM   2756  H  HD2    . ARG A 1 167  ? -11.994 -77.312 16.727  1.00 106.07 ? 1529 ARG A HD2    1 
ATOM   2757  H  HD3    . ARG A 1 167  ? -13.401 -76.927 16.086  1.00 106.07 ? 1529 ARG A HD3    1 
ATOM   2758  H  HE     . ARG A 1 167  ? -11.692 -75.575 14.737  1.00 116.77 ? 1529 ARG A HE     1 
ATOM   2759  H  HH11   . ARG A 1 167  ? -12.043 -78.841 15.146  1.00 130.64 ? 1529 ARG A HH11   1 
ATOM   2760  H  HH12   . ARG A 1 167  ? -11.415 -79.234 13.854  1.00 130.64 ? 1529 ARG A HH12   1 
ATOM   2761  H  HH21   . ARG A 1 167  ? -10.736 -76.190 12.778  1.00 130.21 ? 1529 ARG A HH21   1 
ATOM   2762  H  HH22   . ARG A 1 167  ? -10.626 -77.633 12.423  1.00 130.21 ? 1529 ARG A HH22   1 
ATOM   2763  N  N      . GLN A 1 168  ? -13.148 -74.619 21.712  1.00 36.01  ? 1530 GLN A N      1 
ATOM   2764  C  CA     . GLN A 1 168  ? -13.710 -74.823 23.047  1.00 34.53  ? 1530 GLN A CA     1 
ATOM   2765  C  C      . GLN A 1 168  ? -14.327 -73.547 23.605  1.00 30.95  ? 1530 GLN A C      1 
ATOM   2766  O  O      . GLN A 1 168  ? -15.388 -73.571 24.224  1.00 31.05  ? 1530 GLN A O      1 
ATOM   2767  C  CB     . GLN A 1 168  ? -12.612 -75.312 23.995  1.00 36.20  ? 1530 GLN A CB     1 
ATOM   2768  C  CG     . GLN A 1 168  ? -13.100 -75.985 25.267  1.00 36.26  ? 1530 GLN A CG     1 
ATOM   2769  C  CD     . GLN A 1 168  ? -13.870 -77.265 25.015  1.00 34.43  ? 1530 GLN A CD     1 
ATOM   2770  O  OE1    . GLN A 1 168  ? -14.755 -77.627 25.793  1.00 36.38  ? 1530 GLN A OE1    1 
ATOM   2771  N  NE2    . GLN A 1 168  ? -13.539 -77.966 23.933  1.00 33.80  ? 1530 GLN A NE2    1 
ATOM   2772  H  H      . GLN A 1 168  ? -12.288 -74.630 21.702  1.00 43.21  ? 1530 GLN A H      1 
ATOM   2773  H  HA     . GLN A 1 168  ? -14.401 -75.503 23.004  1.00 41.44  ? 1530 GLN A HA     1 
ATOM   2774  H  HB2    . GLN A 1 168  ? -12.059 -75.953 23.521  1.00 43.44  ? 1530 GLN A HB2    1 
ATOM   2775  H  HB3    . GLN A 1 168  ? -12.072 -74.551 24.258  1.00 43.44  ? 1530 GLN A HB3    1 
ATOM   2776  H  HG2    . GLN A 1 168  ? -12.334 -76.202 25.820  1.00 43.51  ? 1530 GLN A HG2    1 
ATOM   2777  H  HG3    . GLN A 1 168  ? -13.686 -75.373 25.740  1.00 43.51  ? 1530 GLN A HG3    1 
ATOM   2778  H  HE21   . GLN A 1 168  ? -12.913 -77.686 23.415  1.00 40.56  ? 1530 GLN A HE21   1 
ATOM   2779  H  HE22   . GLN A 1 168  ? -13.951 -78.699 23.753  1.00 40.56  ? 1530 GLN A HE22   1 
ATOM   2780  N  N      . ARG A 1 169  ? -13.651 -72.429 23.375  1.00 30.52  ? 1531 ARG A N      1 
ATOM   2781  C  CA     . ARG A 1 169  ? -14.143 -71.129 23.806  1.00 29.82  ? 1531 ARG A CA     1 
ATOM   2782  C  C      . ARG A 1 169  ? -15.439 -70.767 23.096  1.00 29.79  ? 1531 ARG A C      1 
ATOM   2783  O  O      . ARG A 1 169  ? -16.331 -70.177 23.693  1.00 29.55  ? 1531 ARG A O      1 
ATOM   2784  C  CB     . ARG A 1 169  ? -13.085 -70.045 23.562  1.00 29.20  ? 1531 ARG A CB     1 
ATOM   2785  C  CG     . ARG A 1 169  ? -11.743 -70.336 24.240  1.00 29.24  ? 1531 ARG A CG     1 
ATOM   2786  C  CD     . ARG A 1 169  ? -11.038 -69.078 24.750  1.00 28.58  ? 1531 ARG A CD     1 
ATOM   2787  N  NE     . ARG A 1 169  ? -9.636  -69.032 24.342  1.00 28.55  ? 1531 ARG A NE     1 
ATOM   2788  C  CZ     . ARG A 1 169  ? -8.639  -69.618 24.999  1.00 28.80  ? 1531 ARG A CZ     1 
ATOM   2789  N  NH1    . ARG A 1 169  ? -8.875  -70.306 26.105  1.00 29.13  1 1531 ARG A NH1    1 
ATOM   2790  N  NH2    . ARG A 1 169  ? -7.400  -69.520 24.548  1.00 28.79  ? 1531 ARG A NH2    1 
ATOM   2791  H  H      . ARG A 1 169  ? -12.896 -72.398 22.965  1.00 36.62  ? 1531 ARG A H      1 
ATOM   2792  H  HA     . ARG A 1 169  ? -14.323 -71.161 24.758  1.00 35.78  ? 1531 ARG A HA     1 
ATOM   2793  H  HB2    . ARG A 1 169  ? -12.927 -69.971 22.608  1.00 35.04  ? 1531 ARG A HB2    1 
ATOM   2794  H  HB3    . ARG A 1 169  ? -13.416 -69.201 23.908  1.00 35.04  ? 1531 ARG A HB3    1 
ATOM   2795  H  HG2    . ARG A 1 169  ? -11.895 -70.921 24.998  1.00 35.09  ? 1531 ARG A HG2    1 
ATOM   2796  H  HG3    . ARG A 1 169  ? -11.156 -70.769 23.601  1.00 35.09  ? 1531 ARG A HG3    1 
ATOM   2797  H  HD2    . ARG A 1 169  ? -11.483 -68.295 24.390  1.00 34.30  ? 1531 ARG A HD2    1 
ATOM   2798  H  HD3    . ARG A 1 169  ? -11.072 -69.065 25.719  1.00 34.30  ? 1531 ARG A HD3    1 
ATOM   2799  H  HE     . ARG A 1 169  ? -9.441  -68.596 23.627  1.00 34.26  ? 1531 ARG A HE     1 
ATOM   2800  H  HH11   . ARG A 1 169  ? -9.678  -70.375 26.405  1.00 34.95  ? 1531 ARG A HH11   1 
ATOM   2801  H  HH12   . ARG A 1 169  ? -8.226  -70.682 26.524  1.00 34.95  ? 1531 ARG A HH12   1 
ATOM   2802  H  HH21   . ARG A 1 169  ? -7.237  -69.075 23.830  1.00 34.55  ? 1531 ARG A HH21   1 
ATOM   2803  H  HH22   . ARG A 1 169  ? -6.756  -69.900 24.974  1.00 34.55  ? 1531 ARG A HH22   1 
ATOM   2804  N  N      . ARG A 1 170  ? -15.537 -71.109 21.818  1.00 37.88  ? 1532 ARG A N      1 
ATOM   2805  C  CA     . ARG A 1 170  ? -16.651 -70.655 20.994  1.00 37.85  ? 1532 ARG A CA     1 
ATOM   2806  C  C      . ARG A 1 170  ? -17.977 -71.279 21.412  1.00 41.25  ? 1532 ARG A C      1 
ATOM   2807  O  O      . ARG A 1 170  ? -19.040 -70.830 20.988  1.00 40.20  ? 1532 ARG A O      1 
ATOM   2808  C  CB     . ARG A 1 170  ? -16.360 -70.935 19.521  1.00 38.18  ? 1532 ARG A CB     1 
ATOM   2809  C  CG     . ARG A 1 170  ? -15.317 -69.984 18.970  1.00 37.69  ? 1532 ARG A CG     1 
ATOM   2810  C  CD     . ARG A 1 170  ? -15.167 -70.032 17.463  1.00 40.60  ? 1532 ARG A CD     1 
ATOM   2811  N  NE     . ARG A 1 170  ? -14.012 -69.247 17.025  1.00 47.39  ? 1532 ARG A NE     1 
ATOM   2812  C  CZ     . ARG A 1 170  ? -13.503 -69.274 15.796  1.00 56.30  ? 1532 ARG A CZ     1 
ATOM   2813  N  NH1    . ARG A 1 170  ? -14.038 -70.056 14.866  1.00 60.34  1 1532 ARG A NH1    1 
ATOM   2814  N  NH2    . ARG A 1 170  ? -12.450 -68.523 15.498  1.00 58.39  ? 1532 ARG A NH2    1 
ATOM   2815  H  H      . ARG A 1 170  ? -14.971 -71.604 21.402  1.00 45.45  ? 1532 ARG A H      1 
ATOM   2816  H  HA     . ARG A 1 170  ? -16.736 -69.694 21.096  1.00 45.42  ? 1532 ARG A HA     1 
ATOM   2817  H  HB2    . ARG A 1 170  ? -16.026 -71.841 19.427  1.00 45.82  ? 1532 ARG A HB2    1 
ATOM   2818  H  HB3    . ARG A 1 170  ? -17.175 -70.823 19.007  1.00 45.82  ? 1532 ARG A HB3    1 
ATOM   2819  H  HG2    . ARG A 1 170  ? -15.562 -69.077 19.214  1.00 45.23  ? 1532 ARG A HG2    1 
ATOM   2820  H  HG3    . ARG A 1 170  ? -14.456 -70.206 19.360  1.00 45.23  ? 1532 ARG A HG3    1 
ATOM   2821  H  HD2    . ARG A 1 170  ? -15.036 -70.952 17.182  1.00 48.72  ? 1532 ARG A HD2    1 
ATOM   2822  H  HD3    . ARG A 1 170  ? -15.963 -69.663 17.049  1.00 48.72  ? 1532 ARG A HD3    1 
ATOM   2823  H  HE     . ARG A 1 170  ? -13.637 -68.731 17.602  1.00 56.87  ? 1532 ARG A HE     1 
ATOM   2824  H  HH11   . ARG A 1 170  ? -14.720 -70.545 15.055  1.00 72.41  ? 1532 ARG A HH11   1 
ATOM   2825  H  HH12   . ARG A 1 170  ? -13.705 -70.072 14.073  1.00 72.41  ? 1532 ARG A HH12   1 
ATOM   2826  H  HH21   . ARG A 1 170  ? -12.100 -68.016 16.098  1.00 70.07  ? 1532 ARG A HH21   1 
ATOM   2827  H  HH22   . ARG A 1 170  ? -12.120 -68.541 14.704  1.00 70.07  ? 1532 ARG A HH22   1 
ATOM   2828  N  N      . GLN A 1 171  ? -17.919 -72.314 22.241  1.00 73.90  ? 1533 GLN A N      1 
ATOM   2829  C  CA     . GLN A 1 171  ? -19.130 -72.911 22.790  1.00 75.76  ? 1533 GLN A CA     1 
ATOM   2830  C  C      . GLN A 1 171  ? -19.667 -72.042 23.945  1.00 74.94  ? 1533 GLN A C      1 
ATOM   2831  O  O      . GLN A 1 171  ? -20.876 -71.945 24.144  1.00 75.17  ? 1533 GLN A O      1 
ATOM   2832  C  CB     . GLN A 1 171  ? -18.850 -74.344 23.259  1.00 77.86  ? 1533 GLN A CB     1 
ATOM   2833  C  CG     . GLN A 1 171  ? -18.634 -75.364 22.122  1.00 86.38  ? 1533 GLN A CG     1 
ATOM   2834  C  CD     . GLN A 1 171  ? -19.881 -75.648 21.294  1.00 84.30  ? 1533 GLN A CD     1 
ATOM   2835  O  OE1    . GLN A 1 171  ? -20.587 -76.628 21.535  1.00 82.49  ? 1533 GLN A OE1    1 
ATOM   2836  N  NE2    . GLN A 1 171  ? -20.144 -74.803 20.300  1.00 82.11  ? 1533 GLN A NE2    1 
ATOM   2837  H  H      . GLN A 1 171  ? -17.190 -72.690 22.501  1.00 88.68  ? 1533 GLN A H      1 
ATOM   2838  H  HA     . GLN A 1 171  ? -19.809 -72.946 22.098  1.00 90.91  ? 1533 GLN A HA     1 
ATOM   2839  H  HB2    . GLN A 1 171  ? -18.049 -74.339 23.806  1.00 93.44  ? 1533 GLN A HB2    1 
ATOM   2840  H  HB3    . GLN A 1 171  ? -19.604 -74.649 23.788  1.00 93.44  ? 1533 GLN A HB3    1 
ATOM   2841  H  HG2    . GLN A 1 171  ? -17.952 -75.022 21.522  1.00 103.66 ? 1533 GLN A HG2    1 
ATOM   2842  H  HG3    . GLN A 1 171  ? -18.339 -76.203 22.509  1.00 103.66 ? 1533 GLN A HG3    1 
ATOM   2843  H  HE21   . GLN A 1 171  ? -19.621 -74.137 20.152  1.00 98.53  ? 1533 GLN A HE21   1 
ATOM   2844  H  HE22   . GLN A 1 171  ? -20.838 -74.923 19.806  1.00 98.53  ? 1533 GLN A HE22   1 
ATOM   2845  N  N      . PHE A 1 172  ? -18.760 -71.422 24.701  1.00 48.12  ? 1534 PHE A N      1 
ATOM   2846  C  CA     . PHE A 1 172  ? -19.116 -70.514 25.804  1.00 47.29  ? 1534 PHE A CA     1 
ATOM   2847  C  C      . PHE A 1 172  ? -18.164 -69.306 25.791  1.00 39.16  ? 1534 PHE A C      1 
ATOM   2848  O  O      . PHE A 1 172  ? -17.184 -69.285 26.542  1.00 41.10  ? 1534 PHE A O      1 
ATOM   2849  C  CB     . PHE A 1 172  ? -19.060 -71.235 27.150  1.00 38.52  ? 1534 PHE A CB     1 
ATOM   2850  C  CG     . PHE A 1 172  ? -19.529 -70.400 28.319  1.00 37.97  ? 1534 PHE A CG     1 
ATOM   2851  C  CD1    . PHE A 1 172  ? -20.850 -69.983 28.415  1.00 36.94  ? 1534 PHE A CD1    1 
ATOM   2852  C  CD2    . PHE A 1 172  ? -18.655 -70.065 29.341  1.00 36.69  ? 1534 PHE A CD2    1 
ATOM   2853  C  CE1    . PHE A 1 172  ? -21.280 -69.229 29.497  1.00 36.75  ? 1534 PHE A CE1    1 
ATOM   2854  C  CE2    . PHE A 1 172  ? -19.083 -69.320 30.428  1.00 36.52  ? 1534 PHE A CE2    1 
ATOM   2855  C  CZ     . PHE A 1 172  ? -20.396 -68.901 30.503  1.00 36.55  ? 1534 PHE A CZ     1 
ATOM   2856  H  H      . PHE A 1 172  ? -17.911 -71.511 24.595  1.00 57.74  ? 1534 PHE A H      1 
ATOM   2857  H  HA     . PHE A 1 172  ? -20.021 -70.190 25.671  1.00 56.75  ? 1534 PHE A HA     1 
ATOM   2858  H  HB2    . PHE A 1 172  ? -19.624 -72.023 27.104  1.00 46.23  ? 1534 PHE A HB2    1 
ATOM   2859  H  HB3    . PHE A 1 172  ? -18.143 -71.498 27.324  1.00 46.23  ? 1534 PHE A HB3    1 
ATOM   2860  H  HD1    . PHE A 1 172  ? -21.451 -70.202 27.740  1.00 44.33  ? 1534 PHE A HD1    1 
ATOM   2861  H  HD2    . PHE A 1 172  ? -17.770 -70.345 29.298  1.00 44.03  ? 1534 PHE A HD2    1 
ATOM   2862  H  HE1    . PHE A 1 172  ? -22.166 -68.950 29.547  1.00 44.10  ? 1534 PHE A HE1    1 
ATOM   2863  H  HE2    . PHE A 1 172  ? -18.484 -69.096 31.102  1.00 43.83  ? 1534 PHE A HE2    1 
ATOM   2864  H  HZ     . PHE A 1 172  ? -20.682 -68.396 31.229  1.00 43.86  ? 1534 PHE A HZ     1 
ATOM   2865  N  N      . PRO A 1 173  ? -18.446 -68.303 24.932  1.00 29.15  ? 1535 PRO A N      1 
ATOM   2866  C  CA     . PRO A 1 173  ? -17.501 -67.234 24.552  1.00 28.55  ? 1535 PRO A CA     1 
ATOM   2867  C  C      . PRO A 1 173  ? -16.879 -66.492 25.733  1.00 28.15  ? 1535 PRO A C      1 
ATOM   2868  O  O      . PRO A 1 173  ? -15.800 -65.926 25.600  1.00 27.81  ? 1535 PRO A O      1 
ATOM   2869  C  CB     . PRO A 1 173  ? -18.371 -66.276 23.730  1.00 28.30  ? 1535 PRO A CB     1 
ATOM   2870  C  CG     . PRO A 1 173  ? -19.517 -67.094 23.267  1.00 30.76  ? 1535 PRO A CG     1 
ATOM   2871  C  CD     . PRO A 1 173  ? -19.788 -68.046 24.380  1.00 29.25  ? 1535 PRO A CD     1 
ATOM   2872  H  HA     . PRO A 1 173  ? -16.797 -67.591 23.989  1.00 34.26  ? 1535 PRO A HA     1 
ATOM   2873  H  HB2    . PRO A 1 173  ? -18.675 -65.547 24.292  1.00 33.97  ? 1535 PRO A HB2    1 
ATOM   2874  H  HB3    . PRO A 1 173  ? -17.863 -65.939 22.975  1.00 33.97  ? 1535 PRO A HB3    1 
ATOM   2875  H  HG2    . PRO A 1 173  ? -20.285 -66.522 23.110  1.00 36.92  ? 1535 PRO A HG2    1 
ATOM   2876  H  HG3    . PRO A 1 173  ? -19.273 -67.571 22.458  1.00 36.92  ? 1535 PRO A HG3    1 
ATOM   2877  H  HD2    . PRO A 1 173  ? -20.357 -67.633 25.049  1.00 35.10  ? 1535 PRO A HD2    1 
ATOM   2878  H  HD3    . PRO A 1 173  ? -20.176 -68.866 24.038  1.00 35.10  ? 1535 PRO A HD3    1 
ATOM   2879  N  N      . ARG A 1 174  ? -17.562 -66.498 26.870  1.00 27.72  ? 1536 ARG A N      1 
ATOM   2880  C  CA     . ARG A 1 174  ? -17.020 -65.946 28.107  1.00 27.50  ? 1536 ARG A CA     1 
ATOM   2881  C  C      . ARG A 1 174  ? -15.622 -66.462 28.382  1.00 27.57  ? 1536 ARG A C      1 
ATOM   2882  O  O      . ARG A 1 174  ? -14.809 -65.793 29.015  1.00 27.27  ? 1536 ARG A O      1 
ATOM   2883  C  CB     . ARG A 1 174  ? -17.917 -66.305 29.273  1.00 27.86  ? 1536 ARG A CB     1 
ATOM   2884  C  CG     . ARG A 1 174  ? -19.329 -65.799 29.151  1.00 27.85  ? 1536 ARG A CG     1 
ATOM   2885  C  CD     . ARG A 1 174  ? -19.462 -64.525 29.925  1.00 27.47  ? 1536 ARG A CD     1 
ATOM   2886  N  NE     . ARG A 1 174  ? -20.797 -63.956 29.852  1.00 27.49  ? 1536 ARG A NE     1 
ATOM   2887  C  CZ     . ARG A 1 174  ? -21.130 -62.801 30.415  1.00 27.23  ? 1536 ARG A CZ     1 
ATOM   2888  N  NH1    . ARG A 1 174  ? -20.217 -62.096 31.072  1.00 26.95  1 1536 ARG A NH1    1 
ATOM   2889  N  NH2    . ARG A 1 174  ? -22.368 -62.346 30.310  1.00 27.31  ? 1536 ARG A NH2    1 
ATOM   2890  H  H      . ARG A 1 174  ? -18.355 -66.821 26.953  1.00 33.27  ? 1536 ARG A H      1 
ATOM   2891  H  HA     . ARG A 1 174  ? -16.981 -64.979 28.037  1.00 32.99  ? 1536 ARG A HA     1 
ATOM   2892  H  HB2    . ARG A 1 174  ? -17.956 -67.272 29.348  1.00 33.43  ? 1536 ARG A HB2    1 
ATOM   2893  H  HB3    . ARG A 1 174  ? -17.539 -65.930 30.083  1.00 33.43  ? 1536 ARG A HB3    1 
ATOM   2894  H  HG2    . ARG A 1 174  ? -19.534 -65.620 28.220  1.00 33.42  ? 1536 ARG A HG2    1 
ATOM   2895  H  HG3    . ARG A 1 174  ? -19.945 -66.453 29.518  1.00 33.42  ? 1536 ARG A HG3    1 
ATOM   2896  H  HD2    . ARG A 1 174  ? -19.262 -64.701 30.858  1.00 32.97  ? 1536 ARG A HD2    1 
ATOM   2897  H  HD3    . ARG A 1 174  ? -18.838 -63.873 29.570  1.00 32.97  ? 1536 ARG A HD3    1 
ATOM   2898  H  HE     . ARG A 1 174  ? -21.429 -64.450 29.543  1.00 32.98  ? 1536 ARG A HE     1 
ATOM   2899  H  HH11   . ARG A 1 174  ? -19.413 -62.391 31.141  1.00 32.34  ? 1536 ARG A HH11   1 
ATOM   2900  H  HH12   . ARG A 1 174  ? -20.432 -61.346 31.435  1.00 32.34  ? 1536 ARG A HH12   1 
ATOM   2901  H  HH21   . ARG A 1 174  ? -22.959 -62.801 29.881  1.00 32.78  ? 1536 ARG A HH21   1 
ATOM   2902  H  HH22   . ARG A 1 174  ? -22.582 -61.595 30.671  1.00 32.78  ? 1536 ARG A HH22   1 
ATOM   2903  N  N      . PHE A 1 175  ? -15.365 -67.675 27.916  1.00 27.55  ? 1537 PHE A N      1 
ATOM   2904  C  CA     . PHE A 1 175  ? -14.064 -68.305 28.054  1.00 27.72  ? 1537 PHE A CA     1 
ATOM   2905  C  C      . PHE A 1 175  ? -12.938 -67.486 27.437  1.00 27.24  ? 1537 PHE A C      1 
ATOM   2906  O  O      . PHE A 1 175  ? -11.785 -67.623 27.840  1.00 27.26  ? 1537 PHE A O      1 
ATOM   2907  C  CB     . PHE A 1 175  ? -14.104 -69.700 27.416  1.00 28.35  ? 1537 PHE A CB     1 
ATOM   2908  C  CG     . PHE A 1 175  ? -14.777 -70.760 28.262  1.00 29.01  ? 1537 PHE A CG     1 
ATOM   2909  C  CD1    . PHE A 1 175  ? -14.929 -70.606 29.633  1.00 29.08  ? 1537 PHE A CD1    1 
ATOM   2910  C  CD2    . PHE A 1 175  ? -15.257 -71.918 27.671  1.00 29.65  ? 1537 PHE A CD2    1 
ATOM   2911  C  CE1    . PHE A 1 175  ? -15.539 -71.584 30.390  1.00 29.78  ? 1537 PHE A CE1    1 
ATOM   2912  C  CE2    . PHE A 1 175  ? -15.867 -72.897 28.428  1.00 30.35  ? 1537 PHE A CE2    1 
ATOM   2913  C  CZ     . PHE A 1 175  ? -16.011 -72.728 29.785  1.00 30.41  ? 1537 PHE A CZ     1 
ATOM   2914  H  H      . PHE A 1 175  ? -15.942 -68.164 27.507  1.00 33.06  ? 1537 PHE A H      1 
ATOM   2915  H  HA     . PHE A 1 175  ? -13.869 -68.415 28.998  1.00 33.27  ? 1537 PHE A HA     1 
ATOM   2916  H  HB2    . PHE A 1 175  ? -14.586 -69.644 26.576  1.00 34.02  ? 1537 PHE A HB2    1 
ATOM   2917  H  HB3    . PHE A 1 175  ? -13.193 -69.991 27.251  1.00 34.02  ? 1537 PHE A HB3    1 
ATOM   2918  H  HD1    . PHE A 1 175  ? -14.612 -69.836 30.046  1.00 34.90  ? 1537 PHE A HD1    1 
ATOM   2919  H  HD2    . PHE A 1 175  ? -15.162 -72.038 26.754  1.00 35.58  ? 1537 PHE A HD2    1 
ATOM   2920  H  HE1    . PHE A 1 175  ? -15.636 -71.469 31.308  1.00 35.73  ? 1537 PHE A HE1    1 
ATOM   2921  H  HE2    . PHE A 1 175  ? -16.186 -73.669 28.019  1.00 36.42  ? 1537 PHE A HE2    1 
ATOM   2922  H  HZ     . PHE A 1 175  ? -16.424 -73.387 30.295  1.00 36.49  ? 1537 PHE A HZ     1 
ATOM   2923  N  N      . TYR A 1 176  ? -13.265 -66.642 26.463  1.00 23.59  ? 1538 TYR A N      1 
ATOM   2924  C  CA     . TYR A 1 176  ? -12.270 -65.778 25.834  1.00 23.19  ? 1538 TYR A CA     1 
ATOM   2925  C  C      . TYR A 1 176  ? -11.634 -64.839 26.866  1.00 22.83  ? 1538 TYR A C      1 
ATOM   2926  O  O      . TYR A 1 176  ? -10.572 -64.274 26.625  1.00 22.61  ? 1538 TYR A O      1 
ATOM   2927  C  CB     . TYR A 1 176  ? -12.904 -64.963 24.701  1.00 22.95  ? 1538 TYR A CB     1 
ATOM   2928  C  CG     . TYR A 1 176  ? -13.072 -65.716 23.392  1.00 23.30  ? 1538 TYR A CG     1 
ATOM   2929  C  CD1    . TYR A 1 176  ? -11.979 -66.027 22.590  1.00 23.43  ? 1538 TYR A CD1    1 
ATOM   2930  C  CD2    . TYR A 1 176  ? -14.331 -66.108 22.953  1.00 23.56  ? 1538 TYR A CD2    1 
ATOM   2931  C  CE1    . TYR A 1 176  ? -12.142 -66.714 21.395  1.00 23.84  ? 1538 TYR A CE1    1 
ATOM   2932  C  CE2    . TYR A 1 176  ? -14.498 -66.789 21.766  1.00 23.96  ? 1538 TYR A CE2    1 
ATOM   2933  C  CZ     . TYR A 1 176  ? -13.405 -67.091 20.993  1.00 24.11  ? 1538 TYR A CZ     1 
ATOM   2934  O  OH     . TYR A 1 176  ? -13.579 -67.771 19.810  1.00 24.58  ? 1538 TYR A OH     1 
ATOM   2935  H  H      . TYR A 1 176  ? -14.059 -66.549 26.148  1.00 28.30  ? 1538 TYR A H      1 
ATOM   2936  H  HA     . TYR A 1 176  ? -11.567 -66.328 25.453  1.00 27.83  ? 1538 TYR A HA     1 
ATOM   2937  H  HB2    . TYR A 1 176  ? -13.784 -64.670 24.986  1.00 27.53  ? 1538 TYR A HB2    1 
ATOM   2938  H  HB3    . TYR A 1 176  ? -12.345 -64.190 24.525  1.00 27.53  ? 1538 TYR A HB3    1 
ATOM   2939  H  HD1    . TYR A 1 176  ? -11.125 -65.775 22.860  1.00 28.12  ? 1538 TYR A HD1    1 
ATOM   2940  H  HD2    . TYR A 1 176  ? -15.077 -65.909 23.472  1.00 28.27  ? 1538 TYR A HD2    1 
ATOM   2941  H  HE1    . TYR A 1 176  ? -11.404 -66.918 20.869  1.00 28.61  ? 1538 TYR A HE1    1 
ATOM   2942  H  HE2    . TYR A 1 176  ? -15.349 -67.045 21.491  1.00 28.75  ? 1538 TYR A HE2    1 
ATOM   2943  H  HH     . TYR A 1 176  ? -12.836 -67.889 19.436  1.00 29.50  ? 1538 TYR A HH     1 
ATOM   2944  N  N      . PHE A 1 177  ? -12.298 -64.664 28.006  1.00 22.84  ? 1539 PHE A N      1 
ATOM   2945  C  CA     . PHE A 1 177  ? -11.796 -63.814 29.091  1.00 22.61  ? 1539 PHE A CA     1 
ATOM   2946  C  C      . PHE A 1 177  ? -10.848 -64.537 30.020  1.00 22.92  ? 1539 PHE A C      1 
ATOM   2947  O  O      . PHE A 1 177  ? -10.135 -63.913 30.803  1.00 22.79  ? 1539 PHE A O      1 
ATOM   2948  C  CB     . PHE A 1 177  ? -12.963 -63.269 29.922  1.00 22.57  ? 1539 PHE A CB     1 
ATOM   2949  C  CG     . PHE A 1 177  ? -13.873 -62.334 29.175  1.00 22.28  ? 1539 PHE A CG     1 
ATOM   2950  C  CD1    . PHE A 1 177  ? -13.442 -61.672 28.040  1.00 21.98  ? 1539 PHE A CD1    1 
ATOM   2951  C  CD2    . PHE A 1 177  ? -15.168 -62.136 29.611  1.00 22.36  ? 1539 PHE A CD2    1 
ATOM   2952  C  CE1    . PHE A 1 177  ? -14.274 -60.816 27.365  1.00 21.79  ? 1539 PHE A CE1    1 
ATOM   2953  C  CE2    . PHE A 1 177  ? -16.011 -61.287 28.940  1.00 22.14  ? 1539 PHE A CE2    1 
ATOM   2954  C  CZ     . PHE A 1 177  ? -15.565 -60.623 27.810  1.00 21.86  ? 1539 PHE A CZ     1 
ATOM   2955  H  H      . PHE A 1 177  ? -13.055 -65.032 28.181  1.00 27.41  ? 1539 PHE A H      1 
ATOM   2956  H  HA     . PHE A 1 177  ? -11.323 -63.059 28.707  1.00 27.14  ? 1539 PHE A HA     1 
ATOM   2957  H  HB2    . PHE A 1 177  ? -13.499 -64.016 30.232  1.00 27.09  ? 1539 PHE A HB2    1 
ATOM   2958  H  HB3    . PHE A 1 177  ? -12.604 -62.786 30.682  1.00 27.09  ? 1539 PHE A HB3    1 
ATOM   2959  H  HD1    . PHE A 1 177  ? -12.572 -61.797 27.738  1.00 26.38  ? 1539 PHE A HD1    1 
ATOM   2960  H  HD2    . PHE A 1 177  ? -15.470 -62.578 30.371  1.00 26.83  ? 1539 PHE A HD2    1 
ATOM   2961  H  HE1    . PHE A 1 177  ? -13.972 -60.375 26.604  1.00 26.15  ? 1539 PHE A HE1    1 
ATOM   2962  H  HE2    . PHE A 1 177  ? -16.881 -61.157 29.243  1.00 26.57  ? 1539 PHE A HE2    1 
ATOM   2963  H  HZ     . PHE A 1 177  ? -16.134 -60.047 27.352  1.00 26.23  ? 1539 PHE A HZ     1 
ATOM   2964  N  N      . LEU A 1 178  ? -10.866 -65.858 29.949  1.00 30.57  ? 1540 LEU A N      1 
ATOM   2965  C  CA     . LEU A 1 178  ? -10.043 -66.671 30.819  1.00 32.75  ? 1540 LEU A CA     1 
ATOM   2966  C  C      . LEU A 1 178  ? -8.632  -66.778 30.277  1.00 33.35  ? 1540 LEU A C      1 
ATOM   2967  O  O      . LEU A 1 178  ? -7.687  -66.341 30.925  1.00 39.07  ? 1540 LEU A O      1 
ATOM   2968  C  CB     . LEU A 1 178  ? -10.701 -68.048 31.006  1.00 34.94  ? 1540 LEU A CB     1 
ATOM   2969  C  CG     . LEU A 1 178  ? -11.818 -68.082 32.059  1.00 35.91  ? 1540 LEU A CG     1 
ATOM   2970  C  CD1    . LEU A 1 178  ? -12.322 -69.494 32.290  1.00 35.95  ? 1540 LEU A CD1    1 
ATOM   2971  C  CD2    . LEU A 1 178  ? -11.335 -67.521 33.402  1.00 36.40  ? 1540 LEU A CD2    1 
ATOM   2972  H  H      . LEU A 1 178  ? -11.351 -66.309 29.400  1.00 36.69  ? 1540 LEU A H      1 
ATOM   2973  H  HA     . LEU A 1 178  ? -9.994  -66.246 31.690  1.00 39.31  ? 1540 LEU A HA     1 
ATOM   2974  H  HB2    . LEU A 1 178  ? -11.085 -68.326 30.160  1.00 41.93  ? 1540 LEU A HB2    1 
ATOM   2975  H  HB3    . LEU A 1 178  ? -10.020 -68.683 31.279  1.00 41.93  ? 1540 LEU A HB3    1 
ATOM   2976  H  HG     . LEU A 1 178  ? -12.562 -67.540 31.753  1.00 43.09  ? 1540 LEU A HG     1 
ATOM   2977  H  HD11   . LEU A 1 178  ? -13.024 -69.472 32.959  1.00 43.14  ? 1540 LEU A HD11   1 
ATOM   2978  H  HD12   . LEU A 1 178  ? -12.671 -69.845 31.455  1.00 43.14  ? 1540 LEU A HD12   1 
ATOM   2979  H  HD13   . LEU A 1 178  ? -11.586 -70.045 32.600  1.00 43.14  ? 1540 LEU A HD13   1 
ATOM   2980  H  HD21   . LEU A 1 178  ? -12.065 -67.558 34.039  1.00 43.69  ? 1540 LEU A HD21   1 
ATOM   2981  H  HD22   . LEU A 1 178  ? -10.591 -68.057 33.718  1.00 43.69  ? 1540 LEU A HD22   1 
ATOM   2982  H  HD23   . LEU A 1 178  ? -11.051 -66.602 33.276  1.00 43.69  ? 1540 LEU A HD23   1 
ATOM   2983  N  N      . GLY A 1 179  ? -8.486  -67.361 29.097  1.00 23.88  ? 1541 GLY A N      1 
ATOM   2984  C  CA     . GLY A 1 179  ? -7.171  -67.638 28.562  1.00 23.98  ? 1541 GLY A CA     1 
ATOM   2985  C  C      . GLY A 1 179  ? -6.786  -69.070 28.863  1.00 24.65  ? 1541 GLY A C      1 
ATOM   2986  O  O      . GLY A 1 179  ? -7.347  -69.706 29.756  1.00 25.03  ? 1541 GLY A O      1 
ATOM   2987  H  H      . GLY A 1 179  ? -9.135  -67.604 28.588  1.00 28.66  ? 1541 GLY A H      1 
ATOM   2988  H  HA2    . GLY A 1 179  ? -7.169  -67.506 27.601  1.00 28.78  ? 1541 GLY A HA2    1 
ATOM   2989  H  HA3    . GLY A 1 179  ? -6.517  -67.045 28.964  1.00 28.78  ? 1541 GLY A HA3    1 
ATOM   2990  N  N      . ASN A 1 180  ? -5.809  -69.560 28.112  1.00 61.75  ? 1542 ASN A N      1 
ATOM   2991  C  CA     . ASN A 1 180  ? -5.580  -70.989 27.922  1.00 55.67  ? 1542 ASN A CA     1 
ATOM   2992  C  C      . ASN A 1 180  ? -5.473  -71.820 29.192  1.00 49.60  ? 1542 ASN A C      1 
ATOM   2993  O  O      . ASN A 1 180  ? -6.220  -72.783 29.377  1.00 53.93  ? 1542 ASN A O      1 
ATOM   2994  C  CB     . ASN A 1 180  ? -4.298  -71.173 27.115  1.00 46.84  ? 1542 ASN A CB     1 
ATOM   2995  C  CG     . ASN A 1 180  ? -4.544  -71.184 25.624  1.00 45.89  ? 1542 ASN A CG     1 
ATOM   2996  O  OD1    . ASN A 1 180  ? -5.687  -71.210 25.163  1.00 45.90  ? 1542 ASN A OD1    1 
ATOM   2997  N  ND2    . ASN A 1 180  ? -3.465  -71.146 24.855  1.00 46.99  ? 1542 ASN A ND2    1 
ATOM   2998  H  H      . ASN A 1 180  ? -5.245  -69.068 27.688  1.00 74.10  ? 1542 ASN A H      1 
ATOM   2999  H  HA     . ASN A 1 180  ? -6.312  -71.350 27.397  1.00 66.81  ? 1542 ASN A HA     1 
ATOM   3000  H  HB2    . ASN A 1 180  ? -3.692  -70.442 27.313  1.00 56.21  ? 1542 ASN A HB2    1 
ATOM   3001  H  HB3    . ASN A 1 180  ? -3.890  -72.018 27.358  1.00 56.21  ? 1542 ASN A HB3    1 
ATOM   3002  H  HD21   . ASN A 1 180  ? -3.547  -71.151 23.999  1.00 56.39  ? 1542 ASN A HD21   1 
ATOM   3003  H  HD22   . ASN A 1 180  ? -2.683  -71.117 25.212  1.00 56.39  ? 1542 ASN A HD22   1 
ATOM   3004  N  N      . ASP A 1 181  ? -4.541  -71.435 30.057  1.00 59.06  ? 1543 ASP A N      1 
ATOM   3005  C  CA     . ASP A 1 181  ? -4.235  -72.178 31.273  1.00 57.60  ? 1543 ASP A CA     1 
ATOM   3006  C  C      . ASP A 1 181  ? -5.486  -72.491 32.080  1.00 56.62  ? 1543 ASP A C      1 
ATOM   3007  O  O      . ASP A 1 181  ? -5.849  -73.653 32.273  1.00 58.56  ? 1543 ASP A O      1 
ATOM   3008  C  CB     . ASP A 1 181  ? -3.259  -71.367 32.128  1.00 60.44  ? 1543 ASP A CB     1 
ATOM   3009  C  CG     . ASP A 1 181  ? -2.349  -72.233 32.969  1.00 71.04  ? 1543 ASP A CG     1 
ATOM   3010  O  OD1    . ASP A 1 181  ? -2.772  -73.338 33.370  1.00 79.75  ? 1543 ASP A OD1    1 
ATOM   3011  O  OD2    . ASP A 1 181  ? -1.209  -71.800 33.235  1.00 70.95  1 1543 ASP A OD2    1 
ATOM   3012  H  H      . ASP A 1 181  ? -4.060  -70.729 29.958  1.00 70.88  ? 1543 ASP A H      1 
ATOM   3013  H  HA     . ASP A 1 181  ? -3.808  -73.016 31.037  1.00 69.12  ? 1543 ASP A HA     1 
ATOM   3014  H  HB2    . ASP A 1 181  ? -2.703  -70.827 31.544  1.00 72.53  ? 1543 ASP A HB2    1 
ATOM   3015  H  HB3    . ASP A 1 181  ? -3.764  -70.794 32.726  1.00 72.53  ? 1543 ASP A HB3    1 
ATOM   3016  N  N      . ASP A 1 182  ? -6.141  -71.433 32.539  1.00 67.35  ? 1544 ASP A N      1 
ATOM   3017  C  CA     . ASP A 1 182  ? -7.342  -71.542 33.351  1.00 68.45  ? 1544 ASP A CA     1 
ATOM   3018  C  C      . ASP A 1 182  ? -8.451  -72.312 32.645  1.00 68.03  ? 1544 ASP A C      1 
ATOM   3019  O  O      . ASP A 1 182  ? -9.220  -73.027 33.285  1.00 71.68  ? 1544 ASP A O      1 
ATOM   3020  C  CB     . ASP A 1 182  ? -7.831  -70.149 33.733  1.00 70.84  ? 1544 ASP A CB     1 
ATOM   3021  C  CG     . ASP A 1 182  ? -6.744  -69.313 34.394  1.00 74.94  ? 1544 ASP A CG     1 
ATOM   3022  O  OD1    . ASP A 1 182  ? -6.585  -69.396 35.630  1.00 76.07  ? 1544 ASP A OD1    1 
ATOM   3023  O  OD2    . ASP A 1 182  ? -6.035  -68.582 33.670  1.00 77.21  1 1544 ASP A OD2    1 
ATOM   3024  H  H      . ASP A 1 182  ? -5.902  -70.620 32.389  1.00 80.82  ? 1544 ASP A H      1 
ATOM   3025  H  HA     . ASP A 1 182  ? -7.126  -72.017 34.169  1.00 82.14  ? 1544 ASP A HA     1 
ATOM   3026  H  HB2    . ASP A 1 182  ? -8.124  -69.684 32.933  1.00 85.01  ? 1544 ASP A HB2    1 
ATOM   3027  H  HB3    . ASP A 1 182  ? -8.569  -70.232 34.358  1.00 85.01  ? 1544 ASP A HB3    1 
ATOM   3028  N  N      . LEU A 1 183  ? -8.561  -72.147 31.331  1.00 27.02  ? 1545 LEU A N      1 
ATOM   3029  C  CA     . LEU A 1 183  ? -9.597  -72.854 30.600  1.00 27.33  ? 1545 LEU A CA     1 
ATOM   3030  C  C      . LEU A 1 183  ? -9.359  -74.357 30.733  1.00 28.25  ? 1545 LEU A C      1 
ATOM   3031  O  O      . LEU A 1 183  ? -10.291 -75.120 30.990  1.00 28.81  ? 1545 LEU A O      1 
ATOM   3032  C  CB     . LEU A 1 183  ? -9.639  -72.441 29.125  1.00 26.92  ? 1545 LEU A CB     1 
ATOM   3033  C  CG     . LEU A 1 183  ? -10.888 -72.986 28.412  1.00 27.21  ? 1545 LEU A CG     1 
ATOM   3034  C  CD1    . LEU A 1 183  ? -11.314 -72.077 27.297  1.00 26.63  ? 1545 LEU A CD1    1 
ATOM   3035  C  CD2    . LEU A 1 183  ? -10.686 -74.381 27.846  1.00 28.00  ? 1545 LEU A CD2    1 
ATOM   3036  H  H      . LEU A 1 183  ? -8.058  -71.642 30.851  1.00 32.42  ? 1545 LEU A H      1 
ATOM   3037  H  HA     . LEU A 1 183  ? -10.460 -72.650 30.994  1.00 32.79  ? 1545 LEU A HA     1 
ATOM   3038  H  HB2    . LEU A 1 183  ? -9.655  -71.473 29.066  1.00 32.30  ? 1545 LEU A HB2    1 
ATOM   3039  H  HB3    . LEU A 1 183  ? -8.855  -72.792 28.674  1.00 32.30  ? 1545 LEU A HB3    1 
ATOM   3040  H  HG     . LEU A 1 183  ? -11.616 -73.030 29.051  1.00 32.65  ? 1545 LEU A HG     1 
ATOM   3041  H  HD11   . LEU A 1 183  ? -12.102 -72.450 26.870  1.00 31.96  ? 1545 LEU A HD11   1 
ATOM   3042  H  HD12   . LEU A 1 183  ? -11.519 -71.203 27.663  1.00 31.96  ? 1545 LEU A HD12   1 
ATOM   3043  H  HD13   . LEU A 1 183  ? -10.591 -72.006 26.654  1.00 31.96  ? 1545 LEU A HD13   1 
ATOM   3044  H  HD21   . LEU A 1 183  ? -11.505 -74.667 27.411  1.00 33.60  ? 1545 LEU A HD21   1 
ATOM   3045  H  HD22   . LEU A 1 183  ? -9.960  -74.359 27.203  1.00 33.60  ? 1545 LEU A HD22   1 
ATOM   3046  H  HD23   . LEU A 1 183  ? -10.467 -74.987 28.571  1.00 33.60  ? 1545 LEU A HD23   1 
ATOM   3047  N  N      . LEU A 1 184  ? -8.107  -74.777 30.582  1.00 38.35  ? 1546 LEU A N      1 
ATOM   3048  C  CA     . LEU A 1 184  ? -7.769  -76.194 30.670  1.00 39.29  ? 1546 LEU A CA     1 
ATOM   3049  C  C      . LEU A 1 184  ? -8.130  -76.743 32.039  1.00 39.90  ? 1546 LEU A C      1 
ATOM   3050  O  O      . LEU A 1 184  ? -8.511  -77.906 32.173  1.00 42.26  ? 1546 LEU A O      1 
ATOM   3051  C  CB     . LEU A 1 184  ? -6.278  -76.427 30.390  1.00 39.42  ? 1546 LEU A CB     1 
ATOM   3052  C  CG     . LEU A 1 184  ? -5.808  -76.293 28.940  1.00 39.17  ? 1546 LEU A CG     1 
ATOM   3053  C  CD1    . LEU A 1 184  ? -4.321  -76.592 28.825  1.00 39.42  ? 1546 LEU A CD1    1 
ATOM   3054  C  CD2    . LEU A 1 184  ? -6.603  -77.197 28.018  1.00 39.70  ? 1546 LEU A CD2    1 
ATOM   3055  H  H      . LEU A 1 184  ? -7.436  -74.262 30.428  1.00 46.02  ? 1546 LEU A H      1 
ATOM   3056  H  HA     . LEU A 1 184  ? -8.279  -76.683 30.006  1.00 47.15  ? 1546 LEU A HA     1 
ATOM   3057  H  HB2    . LEU A 1 184  ? -5.770  -75.789 30.914  1.00 47.30  ? 1546 LEU A HB2    1 
ATOM   3058  H  HB3    . LEU A 1 184  ? -6.055  -77.326 30.679  1.00 47.30  ? 1546 LEU A HB3    1 
ATOM   3059  H  HG     . LEU A 1 184  ? -5.948  -75.378 28.650  1.00 47.01  ? 1546 LEU A HG     1 
ATOM   3060  H  HD11   . LEU A 1 184  ? -4.052  -76.500 27.898  1.00 47.31  ? 1546 LEU A HD11   1 
ATOM   3061  H  HD12   . LEU A 1 184  ? -3.829  -75.965 29.377  1.00 47.31  ? 1546 LEU A HD12   1 
ATOM   3062  H  HD13   . LEU A 1 184  ? -4.158  -77.499 29.128  1.00 47.31  ? 1546 LEU A HD13   1 
ATOM   3063  H  HD21   . LEU A 1 184  ? -6.279  -77.085 27.110  1.00 47.64  ? 1546 LEU A HD21   1 
ATOM   3064  H  HD22   . LEU A 1 184  ? -6.487  -78.117 28.301  1.00 47.64  ? 1546 LEU A HD22   1 
ATOM   3065  H  HD23   . LEU A 1 184  ? -7.540  -76.951 28.067  1.00 47.64  ? 1546 LEU A HD23   1 
ATOM   3066  N  N      . LYS A 1 185  ? -7.981  -75.905 33.055  1.00 48.38  ? 1547 LYS A N      1 
ATOM   3067  C  CA     . LYS A 1 185  ? -8.359  -76.271 34.410  1.00 47.14  ? 1547 LYS A CA     1 
ATOM   3068  C  C      . LYS A 1 185  ? -9.873  -76.499 34.501  1.00 47.37  ? 1547 LYS A C      1 
ATOM   3069  O  O      . LYS A 1 185  ? -10.325 -77.429 35.167  1.00 48.23  ? 1547 LYS A O      1 
ATOM   3070  C  CB     . LYS A 1 185  ? -7.899  -75.179 35.376  1.00 46.66  ? 1547 LYS A CB     1 
ATOM   3071  C  CG     . LYS A 1 185  ? -6.384  -75.100 35.495  1.00 46.64  ? 1547 LYS A CG     1 
ATOM   3072  C  CD     . LYS A 1 185  ? -5.943  -74.409 36.765  1.00 53.28  ? 1547 LYS A CD     1 
ATOM   3073  C  CE     . LYS A 1 185  ? -4.441  -74.183 36.755  1.00 61.77  ? 1547 LYS A CE     1 
ATOM   3074  N  NZ     . LYS A 1 185  ? -4.032  -73.116 37.707  1.00 66.57  1 1547 LYS A NZ     1 
ATOM   3075  H  H      . LYS A 1 185  ? -7.661  -75.110 32.985  1.00 58.06  ? 1547 LYS A H      1 
ATOM   3076  H  HA     . LYS A 1 185  ? -7.913  -77.097 34.653  1.00 56.57  ? 1547 LYS A HA     1 
ATOM   3077  H  HB2    . LYS A 1 185  ? -8.221  -74.321 35.060  1.00 55.99  ? 1547 LYS A HB2    1 
ATOM   3078  H  HB3    . LYS A 1 185  ? -8.260  -75.365 36.257  1.00 55.99  ? 1547 LYS A HB3    1 
ATOM   3079  H  HG2    . LYS A 1 185  ? -6.018  -75.998 35.499  1.00 55.97  ? 1547 LYS A HG2    1 
ATOM   3080  H  HG3    . LYS A 1 185  ? -6.032  -74.599 34.743  1.00 55.97  ? 1547 LYS A HG3    1 
ATOM   3081  H  HD2    . LYS A 1 185  ? -6.383  -73.547 36.834  1.00 63.93  ? 1547 LYS A HD2    1 
ATOM   3082  H  HD3    . LYS A 1 185  ? -6.165  -74.964 37.529  1.00 63.93  ? 1547 LYS A HD3    1 
ATOM   3083  H  HE2    . LYS A 1 185  ? -3.993  -75.005 37.011  1.00 74.13  ? 1547 LYS A HE2    1 
ATOM   3084  H  HE3    . LYS A 1 185  ? -4.165  -73.916 35.864  1.00 74.13  ? 1547 LYS A HE3    1 
ATOM   3085  H  HZ1    . LYS A 1 185  ? -3.150  -73.005 37.679  1.00 79.88  ? 1547 LYS A HZ1    1 
ATOM   3086  H  HZ2    . LYS A 1 185  ? -4.427  -72.348 37.490  1.00 79.88  ? 1547 LYS A HZ2    1 
ATOM   3087  H  HZ3    . LYS A 1 185  ? -4.270  -73.340 38.535  1.00 79.88  ? 1547 LYS A HZ3    1 
ATOM   3088  N  N      . ILE A 1 186  ? -10.654 -75.659 33.820  1.00 42.38  ? 1548 ILE A N      1 
ATOM   3089  C  CA     . ILE A 1 186  ? -12.110 -75.824 33.796  1.00 42.58  ? 1548 ILE A CA     1 
ATOM   3090  C  C      . ILE A 1 186  ? -12.518 -77.093 33.051  1.00 43.32  ? 1548 ILE A C      1 
ATOM   3091  O  O      . ILE A 1 186  ? -13.405 -77.820 33.499  1.00 45.92  ? 1548 ILE A O      1 
ATOM   3092  C  CB     . ILE A 1 186  ? -12.840 -74.616 33.143  1.00 41.68  ? 1548 ILE A CB     1 
ATOM   3093  C  CG1    . ILE A 1 186  ? -12.715 -73.373 34.036  1.00 41.10  ? 1548 ILE A CG1    1 
ATOM   3094  C  CG2    . ILE A 1 186  ? -14.320 -74.970 32.858  1.00 41.99  ? 1548 ILE A CG2    1 
ATOM   3095  C  CD1    . ILE A 1 186  ? -13.712 -72.260 33.737  1.00 40.45  ? 1548 ILE A CD1    1 
ATOM   3096  H  H      . ILE A 1 186  ? -10.367 -74.988 33.365  1.00 50.85  ? 1548 ILE A H      1 
ATOM   3097  H  HA     . ILE A 1 186  ? -12.428 -75.902 34.709  1.00 51.09  ? 1548 ILE A HA     1 
ATOM   3098  H  HB     . ILE A 1 186  ? -12.408 -74.424 32.296  1.00 50.02  ? 1548 ILE A HB     1 
ATOM   3099  H  HG12   . ILE A 1 186  ? -12.845 -73.642 34.959  1.00 49.32  ? 1548 ILE A HG12   1 
ATOM   3100  H  HG13   . ILE A 1 186  ? -11.824 -73.004 33.928  1.00 49.32  ? 1548 ILE A HG13   1 
ATOM   3101  H  HG21   . ILE A 1 186  ? -14.755 -74.204 32.452  1.00 50.39  ? 1548 ILE A HG21   1 
ATOM   3102  H  HG22   . ILE A 1 186  ? -14.352 -75.728 32.253  1.00 50.39  ? 1548 ILE A HG22   1 
ATOM   3103  H  HG23   . ILE A 1 186  ? -14.758 -75.194 33.694  1.00 50.39  ? 1548 ILE A HG23   1 
ATOM   3104  H  HD11   . ILE A 1 186  ? -13.555 -71.523 34.348  1.00 48.54  ? 1548 ILE A HD11   1 
ATOM   3105  H  HD12   . ILE A 1 186  ? -13.588 -71.963 32.822  1.00 48.54  ? 1548 ILE A HD12   1 
ATOM   3106  H  HD13   . ILE A 1 186  ? -14.612 -72.603 33.855  1.00 48.54  ? 1548 ILE A HD13   1 
ATOM   3107  N  N      . ILE A 1 187  ? -11.895 -77.341 31.903  1.00 48.20  ? 1549 ILE A N      1 
ATOM   3108  C  CA     . ILE A 1 187  ? -12.227 -78.509 31.091  1.00 48.93  ? 1549 ILE A CA     1 
ATOM   3109  C  C      . ILE A 1 187  ? -12.017 -79.804 31.864  1.00 50.06  ? 1549 ILE A C      1 
ATOM   3110  O  O      . ILE A 1 187  ? -12.819 -80.730 31.762  1.00 50.85  ? 1549 ILE A O      1 
ATOM   3111  C  CB     . ILE A 1 187  ? -11.382 -78.556 29.788  1.00 58.86  ? 1549 ILE A CB     1 
ATOM   3112  C  CG1    . ILE A 1 187  ? -11.814 -77.452 28.816  1.00 54.08  ? 1549 ILE A CG1    1 
ATOM   3113  C  CG2    . ILE A 1 187  ? -11.453 -79.940 29.126  1.00 61.70  ? 1549 ILE A CG2    1 
ATOM   3114  C  CD1    . ILE A 1 187  ? -13.268 -77.510 28.378  1.00 50.36  ? 1549 ILE A CD1    1 
ATOM   3115  H  H      . ILE A 1 187  ? -11.274 -76.848 31.571  1.00 57.83  ? 1549 ILE A H      1 
ATOM   3116  H  HA     . ILE A 1 187  ? -13.162 -78.460 30.839  1.00 58.72  ? 1549 ILE A HA     1 
ATOM   3117  H  HB     . ILE A 1 187  ? -10.457 -78.391 30.030  1.00 70.63  ? 1549 ILE A HB     1 
ATOM   3118  H  HG12   . ILE A 1 187  ? -11.672 -76.592 29.242  1.00 64.90  ? 1549 ILE A HG12   1 
ATOM   3119  H  HG13   . ILE A 1 187  ? -11.266 -77.513 28.018  1.00 64.90  ? 1549 ILE A HG13   1 
ATOM   3120  H  HG21   . ILE A 1 187  ? -10.916 -79.931 28.319  1.00 74.04  ? 1549 ILE A HG21   1 
ATOM   3121  H  HG22   . ILE A 1 187  ? -11.110 -80.604 29.745  1.00 74.04  ? 1549 ILE A HG22   1 
ATOM   3122  H  HG23   . ILE A 1 187  ? -12.377 -80.138 28.907  1.00 74.04  ? 1549 ILE A HG23   1 
ATOM   3123  H  HD11   . ILE A 1 187  ? -13.443 -76.776 27.768  1.00 60.43  ? 1549 ILE A HD11   1 
ATOM   3124  H  HD12   . ILE A 1 187  ? -13.429 -78.356 27.932  1.00 60.43  ? 1549 ILE A HD12   1 
ATOM   3125  H  HD13   . ILE A 1 187  ? -13.836 -77.433 29.160  1.00 60.43  ? 1549 ILE A HD13   1 
ATOM   3126  N  N      . GLY A 1 188  ? -10.934 -79.861 32.635  1.00 34.38  ? 1550 GLY A N      1 
ATOM   3127  C  CA     . GLY A 1 188  ? -10.587 -81.052 33.390  1.00 35.49  ? 1550 GLY A CA     1 
ATOM   3128  C  C      . GLY A 1 188  ? -11.317 -81.195 34.713  1.00 35.99  ? 1550 GLY A C      1 
ATOM   3129  O  O      . GLY A 1 188  ? -11.628 -82.309 35.137  1.00 38.12  ? 1550 GLY A O      1 
ATOM   3130  H  H      . GLY A 1 188  ? -10.379 -79.212 32.735  1.00 41.25  ? 1550 GLY A H      1 
ATOM   3131  H  HA2    . GLY A 1 188  ? -10.784 -81.835 32.853  1.00 42.58  ? 1550 GLY A HA2    1 
ATOM   3132  H  HA3    . GLY A 1 188  ? -9.634  -81.043 33.572  1.00 42.58  ? 1550 GLY A HA3    1 
ATOM   3133  N  N      . SER A 1 189  ? -11.599 -80.072 35.363  1.00 88.30  ? 1551 SER A N      1 
ATOM   3134  C  CA     . SER A 1 189  ? -12.222 -80.083 36.682  1.00 89.94  ? 1551 SER A CA     1 
ATOM   3135  C  C      . SER A 1 189  ? -13.733 -80.234 36.595  1.00 89.96  ? 1551 SER A C      1 
ATOM   3136  O  O      . SER A 1 189  ? -14.420 -80.236 37.617  1.00 89.90  ? 1551 SER A O      1 
ATOM   3137  C  CB     . SER A 1 189  ? -11.887 -78.806 37.442  1.00 91.37  ? 1551 SER A CB     1 
ATOM   3138  O  OG     . SER A 1 189  ? -12.493 -77.684 36.830  1.00 92.16  ? 1551 SER A OG     1 
ATOM   3139  H  H      . SER A 1 189  ? -11.439 -79.283 35.059  1.00 105.96 ? 1551 SER A H      1 
ATOM   3140  H  HA     . SER A 1 189  ? -11.874 -80.833 37.189  1.00 107.93 ? 1551 SER A HA     1 
ATOM   3141  H  HB2    . SER A 1 189  ? -12.213 -78.884 38.352  1.00 109.64 ? 1551 SER A HB2    1 
ATOM   3142  H  HB3    . SER A 1 189  ? -10.924 -78.683 37.444  1.00 109.64 ? 1551 SER A HB3    1 
ATOM   3143  H  HG     . SER A 1 189  ? -12.219 -77.604 36.040  1.00 110.59 ? 1551 SER A HG     1 
ATOM   3144  N  N      . GLY A 1 190  ? -14.248 -80.376 35.376  1.00 94.56  ? 1552 GLY A N      1 
ATOM   3145  C  CA     . GLY A 1 190  ? -15.676 -80.535 35.165  1.00 93.54  ? 1552 GLY A CA     1 
ATOM   3146  C  C      . GLY A 1 190  ? -16.198 -81.796 35.828  1.00 92.54  ? 1552 GLY A C      1 
ATOM   3147  O  O      . GLY A 1 190  ? -17.400 -82.060 35.828  1.00 92.62  ? 1552 GLY A O      1 
ATOM   3148  H  H      . GLY A 1 190  ? -13.785 -80.383 34.652  1.00 113.47 ? 1552 GLY A H      1 
ATOM   3149  H  HA2    . GLY A 1 190  ? -16.147 -79.772 35.533  1.00 112.25 ? 1552 GLY A HA2    1 
ATOM   3150  H  HA3    . GLY A 1 190  ? -15.861 -80.585 34.214  1.00 112.25 ? 1552 GLY A HA3    1 
ATOM   3151  N  N      . LYS A 1 191  ? -15.283 -82.586 36.378  1.00 74.08  ? 1553 LYS A N      1 
ATOM   3152  C  CA     . LYS A 1 191  ? -15.638 -83.690 37.248  1.00 75.52  ? 1553 LYS A CA     1 
ATOM   3153  C  C      . LYS A 1 191  ? -16.166 -83.138 38.573  1.00 66.50  ? 1553 LYS A C      1 
ATOM   3154  O  O      . LYS A 1 191  ? -17.223 -83.546 39.054  1.00 67.25  ? 1553 LYS A O      1 
ATOM   3155  C  CB     . LYS A 1 191  ? -14.420 -84.591 37.487  1.00 84.91  ? 1553 LYS A CB     1 
ATOM   3156  C  CG     . LYS A 1 191  ? -13.672 -84.998 36.215  1.00 84.66  ? 1553 LYS A CG     1 
ATOM   3157  C  CD     . LYS A 1 191  ? -12.390 -85.764 36.531  1.00 77.61  ? 1553 LYS A CD     1 
ATOM   3158  C  CE     . LYS A 1 191  ? -12.658 -87.096 37.207  1.00 69.30  ? 1553 LYS A CE     1 
ATOM   3159  N  NZ     . LYS A 1 191  ? -11.387 -87.831 37.442  1.00 70.00  1 1553 LYS A NZ     1 
ATOM   3160  H  H      . LYS A 1 191  ? -14.436 -82.499 36.257  1.00 88.90  ? 1553 LYS A H      1 
ATOM   3161  H  HA     . LYS A 1 191  ? -16.337 -84.219 36.833  1.00 90.62  ? 1553 LYS A HA     1 
ATOM   3162  H  HB2    . LYS A 1 191  ? -13.794 -84.120 38.059  1.00 101.89 ? 1553 LYS A HB2    1 
ATOM   3163  H  HB3    . LYS A 1 191  ? -14.717 -85.403 37.926  1.00 101.89 ? 1553 LYS A HB3    1 
ATOM   3164  H  HG2    . LYS A 1 191  ? -14.243 -85.570 35.679  1.00 101.59 ? 1553 LYS A HG2    1 
ATOM   3165  H  HG3    . LYS A 1 191  ? -13.434 -84.201 35.717  1.00 101.59 ? 1553 LYS A HG3    1 
ATOM   3166  H  HD2    . LYS A 1 191  ? -11.913 -85.936 35.705  1.00 93.13  ? 1553 LYS A HD2    1 
ATOM   3167  H  HD3    . LYS A 1 191  ? -11.841 -85.230 37.127  1.00 93.13  ? 1553 LYS A HD3    1 
ATOM   3168  H  HE2    . LYS A 1 191  ? -13.086 -86.943 38.064  1.00 83.16  ? 1553 LYS A HE2    1 
ATOM   3169  H  HE3    . LYS A 1 191  ? -13.225 -87.639 36.637  1.00 83.16  ? 1553 LYS A HE3    1 
ATOM   3170  H  HZ1    . LYS A 1 191  ? -11.555 -88.610 37.838  1.00 84.00  ? 1553 LYS A HZ1    1 
ATOM   3171  H  HZ2    . LYS A 1 191  ? -10.976 -87.983 36.667  1.00 84.00  ? 1553 LYS A HZ2    1 
ATOM   3172  H  HZ3    . LYS A 1 191  ? -10.850 -87.350 37.965  1.00 84.00  ? 1553 LYS A HZ3    1 
ATOM   3173  N  N      . HIS A 1 192  ? -15.413 -82.205 39.154  1.00 81.20  ? 1554 HIS A N      1 
ATOM   3174  C  CA     . HIS A 1 192  ? -15.707 -81.683 40.490  1.00 79.59  ? 1554 HIS A CA     1 
ATOM   3175  C  C      . HIS A 1 192  ? -16.760 -80.573 40.564  1.00 78.34  ? 1554 HIS A C      1 
ATOM   3176  O  O      . HIS A 1 192  ? -17.552 -80.554 41.504  1.00 78.76  ? 1554 HIS A O      1 
ATOM   3177  C  CB     . HIS A 1 192  ? -14.417 -81.170 41.134  1.00 79.90  ? 1554 HIS A CB     1 
ATOM   3178  C  CG     . HIS A 1 192  ? -13.414 -82.244 41.409  1.00 81.01  ? 1554 HIS A CG     1 
ATOM   3179  N  ND1    . HIS A 1 192  ? -13.177 -83.285 40.537  1.00 81.50  ? 1554 HIS A ND1    1 
ATOM   3180  C  CD2    . HIS A 1 192  ? -12.597 -82.447 42.469  1.00 81.20  ? 1554 HIS A CD2    1 
ATOM   3181  C  CE1    . HIS A 1 192  ? -12.249 -84.077 41.043  1.00 80.90  ? 1554 HIS A CE1    1 
ATOM   3182  N  NE2    . HIS A 1 192  ? -11.880 -83.591 42.215  1.00 80.91  ? 1554 HIS A NE2    1 
ATOM   3183  H  H      . HIS A 1 192  ? -14.717 -81.854 38.791  1.00 97.44  ? 1554 HIS A H      1 
ATOM   3184  H  HA     . HIS A 1 192  ? -16.029 -82.417 41.036  1.00 95.51  ? 1554 HIS A HA     1 
ATOM   3185  H  HB2    . HIS A 1 192  ? -14.005 -80.525 40.537  1.00 95.89  ? 1554 HIS A HB2    1 
ATOM   3186  H  HB3    . HIS A 1 192  ? -14.636 -80.744 41.977  1.00 95.89  ? 1554 HIS A HB3    1 
ATOM   3187  H  HD2    . HIS A 1 192  ? -12.529 -81.909 43.225  1.00 97.44  ? 1554 HIS A HD2    1 
ATOM   3188  H  HE1    . HIS A 1 192  ? -11.914 -84.847 40.644  1.00 97.08  ? 1554 HIS A HE1    1 
ATOM   3189  H  HE2    . HIS A 1 192  ? -11.289 -83.936 42.735  1.00 97.09  ? 1554 HIS A HE2    1 
ATOM   3190  N  N      . HIS A 1 193  ? -16.730 -79.642 39.608  1.00 51.71  ? 1555 HIS A N      1 
ATOM   3191  C  CA     . HIS A 1 193  ? -17.673 -78.514 39.532  1.00 50.94  ? 1555 HIS A CA     1 
ATOM   3192  C  C      . HIS A 1 193  ? -17.342 -77.375 40.502  1.00 50.43  ? 1555 HIS A C      1 
ATOM   3193  O  O      . HIS A 1 193  ? -17.850 -76.265 40.338  1.00 49.63  ? 1555 HIS A O      1 
ATOM   3194  C  CB     . HIS A 1 193  ? -19.128 -78.975 39.765  1.00 51.68  ? 1555 HIS A CB     1 
ATOM   3195  C  CG     . HIS A 1 193  ? -19.631 -79.947 38.743  1.00 60.04  ? 1555 HIS A CG     1 
ATOM   3196  N  ND1    . HIS A 1 193  ? -20.759 -80.715 38.941  1.00 67.36  ? 1555 HIS A ND1    1 
ATOM   3197  C  CD2    . HIS A 1 193  ? -19.201 -80.230 37.489  1.00 69.76  ? 1555 HIS A CD2    1 
ATOM   3198  C  CE1    . HIS A 1 193  ? -20.979 -81.458 37.871  1.00 71.69  ? 1555 HIS A CE1    1 
ATOM   3199  N  NE2    . HIS A 1 193  ? -20.050 -81.182 36.974  1.00 73.05  ? 1555 HIS A NE2    1 
ATOM   3200  H  H      . HIS A 1 193  ? -16.153 -79.641 38.970  1.00 62.05  ? 1555 HIS A H      1 
ATOM   3201  H  HA     . HIS A 1 193  ? -17.630 -78.146 38.635  1.00 61.13  ? 1555 HIS A HA     1 
ATOM   3202  H  HB2    . HIS A 1 193  ? -19.183 -79.405 40.633  1.00 62.01  ? 1555 HIS A HB2    1 
ATOM   3203  H  HB3    . HIS A 1 193  ? -19.709 -78.198 39.746  1.00 62.01  ? 1555 HIS A HB3    1 
ATOM   3204  H  HD2    . HIS A 1 193  ? -18.459 -79.865 37.064  1.00 83.71  ? 1555 HIS A HD2    1 
ATOM   3205  H  HE1    . HIS A 1 193  ? -21.674 -82.067 37.765  1.00 86.03  ? 1555 HIS A HE1    1 
ATOM   3206  H  HE2    . HIS A 1 193  ? -19.986 -81.539 36.194  1.00 87.65  ? 1555 HIS A HE2    1 
ATOM   3207  N  N      . ASP A 1 194  ? -16.495 -77.632 41.496  1.00 53.87  ? 1556 ASP A N      1 
ATOM   3208  C  CA     . ASP A 1 194  ? -16.231 -76.632 42.536  1.00 53.59  ? 1556 ASP A CA     1 
ATOM   3209  C  C      . ASP A 1 194  ? -15.033 -75.761 42.182  1.00 52.62  ? 1556 ASP A C      1 
ATOM   3210  O  O      . ASP A 1 194  ? -14.791 -74.735 42.816  1.00 52.20  ? 1556 ASP A O      1 
ATOM   3211  C  CB     . ASP A 1 194  ? -15.983 -77.302 43.894  1.00 54.75  ? 1556 ASP A CB     1 
ATOM   3212  C  CG     . ASP A 1 194  ? -14.766 -78.215 43.890  1.00 60.53  ? 1556 ASP A CG     1 
ATOM   3213  O  OD1    . ASP A 1 194  ? -13.633 -77.694 43.946  1.00 61.73  ? 1556 ASP A OD1    1 
ATOM   3214  O  OD2    . ASP A 1 194  ? -14.939 -79.451 43.839  1.00 64.91  1 1556 ASP A OD2    1 
ATOM   3215  H  H      . ASP A 1 194  ? -16.063 -78.369 41.594  1.00 64.64  ? 1556 ASP A H      1 
ATOM   3216  H  HA     . ASP A 1 194  ? -17.006 -76.055 42.623  1.00 64.31  ? 1556 ASP A HA     1 
ATOM   3217  H  HB2    . ASP A 1 194  ? -15.839 -76.614 44.563  1.00 65.70  ? 1556 ASP A HB2    1 
ATOM   3218  H  HB3    . ASP A 1 194  ? -16.758 -77.836 44.129  1.00 65.70  ? 1556 ASP A HB3    1 
ATOM   3219  N  N      . GLN A 1 195  ? -14.291 -76.177 41.161  1.00 59.62  ? 1557 GLN A N      1 
ATOM   3220  C  CA     . GLN A 1 195  ? -13.076 -75.484 40.751  1.00 60.17  ? 1557 GLN A CA     1 
ATOM   3221  C  C      . GLN A 1 195  ? -13.395 -74.418 39.715  1.00 62.19  ? 1557 GLN A C      1 
ATOM   3222  O  O      . GLN A 1 195  ? -12.548 -73.591 39.374  1.00 56.96  ? 1557 GLN A O      1 
ATOM   3223  C  CB     . GLN A 1 195  ? -12.055 -76.497 40.230  1.00 59.65  ? 1557 GLN A CB     1 
ATOM   3224  C  CG     . GLN A 1 195  ? -12.048 -77.765 41.068  1.00 63.59  ? 1557 GLN A CG     1 
ATOM   3225  C  CD     . GLN A 1 195  ? -10.777 -78.570 40.913  1.00 62.60  ? 1557 GLN A CD     1 
ATOM   3226  O  OE1    . GLN A 1 195  ? -10.161 -78.583 39.849  1.00 60.45  ? 1557 GLN A OE1    1 
ATOM   3227  N  NE2    . GLN A 1 195  ? -10.310 -79.140 42.021  1.00 62.32  ? 1557 GLN A NE2    1 
ATOM   3228  H  H      . GLN A 1 195  ? -14.473 -76.869 40.684  1.00 71.55  ? 1557 GLN A H      1 
ATOM   3229  H  HA     . GLN A 1 195  ? -12.690 -75.043 41.523  1.00 72.21  ? 1557 GLN A HA     1 
ATOM   3230  H  HB2    . GLN A 1 195  ? -12.279 -76.737 39.318  1.00 71.58  ? 1557 GLN A HB2    1 
ATOM   3231  H  HB3    . GLN A 1 195  ? -11.168 -76.105 40.266  1.00 71.58  ? 1557 GLN A HB3    1 
ATOM   3232  H  HG2    . GLN A 1 195  ? -12.137 -77.525 42.004  1.00 76.31  ? 1557 GLN A HG2    1 
ATOM   3233  H  HG3    . GLN A 1 195  ? -12.792 -78.325 40.798  1.00 76.31  ? 1557 GLN A HG3    1 
ATOM   3234  H  HE21   . GLN A 1 195  ? -10.728 -79.039 42.766  1.00 74.78  ? 1557 GLN A HE21   1 
ATOM   3235  H  HE22   . GLN A 1 195  ? -9.590  -79.610 41.992  1.00 74.78  ? 1557 GLN A HE22   1 
ATOM   3236  N  N      . VAL A 1 196  ? -14.636 -74.437 39.243  1.00 30.50  ? 1558 VAL A N      1 
ATOM   3237  C  CA     . VAL A 1 196  ? -15.127 -73.456 38.291  1.00 29.56  ? 1558 VAL A CA     1 
ATOM   3238  C  C      . VAL A 1 196  ? -15.477 -72.155 39.011  1.00 29.09  ? 1558 VAL A C      1 
ATOM   3239  O  O      . VAL A 1 196  ? -15.432 -71.077 38.418  1.00 38.37  ? 1558 VAL A O      1 
ATOM   3240  C  CB     . VAL A 1 196  ? -16.358 -74.004 37.530  1.00 29.80  ? 1558 VAL A CB     1 
ATOM   3241  C  CG1    . VAL A 1 196  ? -17.123 -72.898 36.820  1.00 28.98  ? 1558 VAL A CG1    1 
ATOM   3242  C  CG2    . VAL A 1 196  ? -15.929 -75.080 36.549  1.00 30.12  ? 1558 VAL A CG2    1 
ATOM   3243  H  H      . VAL A 1 196  ? -15.225 -75.023 39.467  1.00 36.59  ? 1558 VAL A H      1 
ATOM   3244  H  HA     . VAL A 1 196  ? -14.431 -73.265 37.643  1.00 35.47  ? 1558 VAL A HA     1 
ATOM   3245  H  HB     . VAL A 1 196  ? -16.961 -74.414 38.170  1.00 35.76  ? 1558 VAL A HB     1 
ATOM   3246  H  HG11   . VAL A 1 196  ? -17.882 -73.285 36.359  1.00 34.77  ? 1558 VAL A HG11   1 
ATOM   3247  H  HG12   . VAL A 1 196  ? -17.428 -72.253 37.478  1.00 34.77  ? 1558 VAL A HG12   1 
ATOM   3248  H  HG13   . VAL A 1 196  ? -16.533 -72.466 36.183  1.00 34.77  ? 1558 VAL A HG13   1 
ATOM   3249  H  HG21   . VAL A 1 196  ? -16.712 -75.411 36.082  1.00 36.14  ? 1558 VAL A HG21   1 
ATOM   3250  H  HG22   . VAL A 1 196  ? -15.303 -74.697 35.915  1.00 36.14  ? 1558 VAL A HG22   1 
ATOM   3251  H  HG23   . VAL A 1 196  ? -15.506 -75.802 37.039  1.00 36.14  ? 1558 VAL A HG23   1 
ATOM   3252  N  N      . SER A 1 197  ? -15.807 -72.261 40.296  1.00 90.16  ? 1559 SER A N      1 
ATOM   3253  C  CA     . SER A 1 197  ? -16.187 -71.100 41.097  1.00 87.45  ? 1559 SER A CA     1 
ATOM   3254  C  C      . SER A 1 197  ? -15.130 -70.001 41.131  1.00 87.45  ? 1559 SER A C      1 
ATOM   3255  O  O      . SER A 1 197  ? -15.462 -68.816 41.145  1.00 87.55  ? 1559 SER A O      1 
ATOM   3256  C  CB     . SER A 1 197  ? -16.500 -71.543 42.530  1.00 92.40  ? 1559 SER A CB     1 
ATOM   3257  O  OG     . SER A 1 197  ? -15.322 -71.953 43.202  1.00 97.96  ? 1559 SER A OG     1 
ATOM   3258  H  H      . SER A 1 197  ? -15.818 -73.003 40.731  1.00 108.19 ? 1559 SER A H      1 
ATOM   3259  H  HA     . SER A 1 197  ? -16.996 -70.718 40.723  1.00 104.94 ? 1559 SER A HA     1 
ATOM   3260  H  HB2    . SER A 1 197  ? -16.895 -70.799 43.011  1.00 110.88 ? 1559 SER A HB2    1 
ATOM   3261  H  HB3    . SER A 1 197  ? -17.122 -72.287 42.502  1.00 110.88 ? 1559 SER A HB3    1 
ATOM   3262  H  HG     . SER A 1 197  ? -14.969 -72.598 42.796  1.00 117.55 ? 1559 SER A HG     1 
ATOM   3263  N  N      . LYS A 1 198  ? -13.863 -70.397 41.154  1.00 54.91  ? 1560 LYS A N      1 
ATOM   3264  C  CA     . LYS A 1 198  ? -12.759 -69.444 41.213  1.00 55.47  ? 1560 LYS A CA     1 
ATOM   3265  C  C      . LYS A 1 198  ? -12.794 -68.442 40.067  1.00 54.46  ? 1560 LYS A C      1 
ATOM   3266  O  O      . LYS A 1 198  ? -12.459 -67.271 40.239  1.00 55.99  ? 1560 LYS A O      1 
ATOM   3267  C  CB     . LYS A 1 198  ? -11.417 -70.178 41.203  1.00 58.56  ? 1560 LYS A CB     1 
ATOM   3268  C  CG     . LYS A 1 198  ? -11.242 -71.164 42.339  1.00 69.95  ? 1560 LYS A CG     1 
ATOM   3269  C  CD     . LYS A 1 198  ? -9.869  -71.808 42.297  1.00 84.49  ? 1560 LYS A CD     1 
ATOM   3270  C  CE     . LYS A 1 198  ? -9.617  -72.641 43.544  1.00 96.89  ? 1560 LYS A CE     1 
ATOM   3271  N  NZ     . LYS A 1 198  ? -8.199  -73.091 43.658  1.00 104.20 1 1560 LYS A NZ     1 
ATOM   3272  H  H      . LYS A 1 198  ? -13.613 -71.220 41.136  1.00 65.89  ? 1560 LYS A H      1 
ATOM   3273  H  HA     . LYS A 1 198  ? -12.820 -68.947 42.043  1.00 66.57  ? 1560 LYS A HA     1 
ATOM   3274  H  HB2    . LYS A 1 198  ? -11.337 -70.669 40.370  1.00 70.27  ? 1560 LYS A HB2    1 
ATOM   3275  H  HB3    . LYS A 1 198  ? -10.704 -69.524 41.267  1.00 70.27  ? 1560 LYS A HB3    1 
ATOM   3276  H  HG2    . LYS A 1 198  ? -11.335 -70.699 43.185  1.00 83.95  ? 1560 LYS A HG2    1 
ATOM   3277  H  HG3    . LYS A 1 198  ? -11.910 -71.863 42.263  1.00 83.95  ? 1560 LYS A HG3    1 
ATOM   3278  H  HD2    . LYS A 1 198  ? -9.810  -72.391 41.524  1.00 101.39 ? 1560 LYS A HD2    1 
ATOM   3279  H  HD3    . LYS A 1 198  ? -9.190  -71.116 42.250  1.00 101.39 ? 1560 LYS A HD3    1 
ATOM   3280  H  HE2    . LYS A 1 198  ? -9.826  -72.108 44.328  1.00 116.27 ? 1560 LYS A HE2    1 
ATOM   3281  H  HE3    . LYS A 1 198  ? -10.181 -73.429 43.518  1.00 116.27 ? 1560 LYS A HE3    1 
ATOM   3282  H  HZ1    . LYS A 1 198  ? -8.092  -73.574 44.398  1.00 125.04 ? 1560 LYS A HZ1    1 
ATOM   3283  H  HZ2    . LYS A 1 198  ? -7.981  -73.590 42.954  1.00 125.04 ? 1560 LYS A HZ2    1 
ATOM   3284  H  HZ3    . LYS A 1 198  ? -7.658  -72.386 43.692  1.00 125.04 ? 1560 LYS A HZ3    1 
ATOM   3285  N  N      . PHE A 1 199  ? -13.219 -68.908 38.901  1.00 27.04  ? 1561 PHE A N      1 
ATOM   3286  C  CA     . PHE A 1 199  ? -13.079 -68.140 37.671  1.00 26.22  ? 1561 PHE A CA     1 
ATOM   3287  C  C      . PHE A 1 199  ? -14.251 -67.231 37.372  1.00 25.81  ? 1561 PHE A C      1 
ATOM   3288  O  O      . PHE A 1 199  ? -14.215 -66.465 36.409  1.00 25.17  ? 1561 PHE A O      1 
ATOM   3289  C  CB     . PHE A 1 199  ? -12.889 -69.097 36.500  1.00 26.29  ? 1561 PHE A CB     1 
ATOM   3290  C  CG     . PHE A 1 199  ? -11.688 -69.968 36.638  1.00 26.69  ? 1561 PHE A CG     1 
ATOM   3291  C  CD1    . PHE A 1 199  ? -10.431 -69.406 36.695  1.00 26.36  ? 1561 PHE A CD1    1 
ATOM   3292  C  CD2    . PHE A 1 199  ? -11.815 -71.340 36.734  1.00 27.46  ? 1561 PHE A CD2    1 
ATOM   3293  C  CE1    . PHE A 1 199  ? -9.323  -70.191 36.833  1.00 26.77  ? 1561 PHE A CE1    1 
ATOM   3294  C  CE2    . PHE A 1 199  ? -10.706 -72.134 36.872  1.00 27.89  ? 1561 PHE A CE2    1 
ATOM   3295  C  CZ     . PHE A 1 199  ? -9.456  -71.559 36.922  1.00 27.53  ? 1561 PHE A CZ     1 
ATOM   3296  H  H      . PHE A 1 199  ? -13.596 -69.674 38.793  1.00 32.45  ? 1561 PHE A H      1 
ATOM   3297  H  HA     . PHE A 1 199  ? -12.285 -67.588 37.737  1.00 31.47  ? 1561 PHE A HA     1 
ATOM   3298  H  HB2    . PHE A 1 199  ? -13.668 -69.672 36.434  1.00 31.55  ? 1561 PHE A HB2    1 
ATOM   3299  H  HB3    . PHE A 1 199  ? -12.790 -68.580 35.685  1.00 31.55  ? 1561 PHE A HB3    1 
ATOM   3300  H  HD1    . PHE A 1 199  ? -10.336 -68.483 36.636  1.00 31.63  ? 1561 PHE A HD1    1 
ATOM   3301  H  HD2    . PHE A 1 199  ? -12.660 -71.728 36.701  1.00 32.96  ? 1561 PHE A HD2    1 
ATOM   3302  H  HE1    . PHE A 1 199  ? -8.479  -69.802 36.866  1.00 32.12  ? 1561 PHE A HE1    1 
ATOM   3303  H  HE2    . PHE A 1 199  ? -10.798 -73.058 36.932  1.00 33.47  ? 1561 PHE A HE2    1 
ATOM   3304  H  HZ     . PHE A 1 199  ? -8.701  -72.094 37.015  1.00 33.04  ? 1561 PHE A HZ     1 
ATOM   3305  N  N      . MET A 1 200  ? -15.280 -67.290 38.201  1.00 53.51  ? 1562 MET A N      1 
ATOM   3306  C  CA     . MET A 1 200  ? -16.501 -66.581 37.886  1.00 43.52  ? 1562 MET A CA     1 
ATOM   3307  C  C      . MET A 1 200  ? -16.380 -65.090 38.128  1.00 45.90  ? 1562 MET A C      1 
ATOM   3308  O  O      . MET A 1 200  ? -17.304 -64.348 37.814  1.00 42.48  ? 1562 MET A O      1 
ATOM   3309  C  CB     . MET A 1 200  ? -17.666 -67.167 38.672  1.00 41.61  ? 1562 MET A CB     1 
ATOM   3310  C  CG     . MET A 1 200  ? -18.109 -68.492 38.091  1.00 42.09  ? 1562 MET A CG     1 
ATOM   3311  S  SD     . MET A 1 200  ? -19.893 -68.610 37.959  1.00 42.41  ? 1562 MET A SD     1 
ATOM   3312  C  CE     . MET A 1 200  ? -20.174 -67.372 36.703  1.00 41.45  ? 1562 MET A CE     1 
ATOM   3313  H  H      . MET A 1 200  ? -15.295 -67.728 38.941  1.00 64.21  ? 1562 MET A H      1 
ATOM   3314  H  HA     . MET A 1 200  ? -16.694 -66.718 36.946  1.00 52.22  ? 1562 MET A HA     1 
ATOM   3315  H  HB2    . MET A 1 200  ? -17.392 -67.313 39.591  1.00 49.94  ? 1562 MET A HB2    1 
ATOM   3316  H  HB3    . MET A 1 200  ? -18.416 -66.553 38.638  1.00 49.94  ? 1562 MET A HB3    1 
ATOM   3317  H  HG2    . MET A 1 200  ? -17.733 -68.591 37.202  1.00 50.51  ? 1562 MET A HG2    1 
ATOM   3318  H  HG3    . MET A 1 200  ? -17.800 -69.210 38.666  1.00 50.51  ? 1562 MET A HG3    1 
ATOM   3319  H  HE1    . MET A 1 200  ? -19.851 -66.516 37.025  1.00 49.74  ? 1562 MET A HE1    1 
ATOM   3320  H  HE2    . MET A 1 200  ? -19.695 -67.625 35.898  1.00 49.74  ? 1562 MET A HE2    1 
ATOM   3321  H  HE3    . MET A 1 200  ? -21.125 -67.319 36.519  1.00 49.74  ? 1562 MET A HE3    1 
ATOM   3322  N  N      . LYS A 1 201  ? -15.259 -64.640 38.681  1.00 34.76  ? 1563 LYS A N      1 
ATOM   3323  C  CA     . LYS A 1 201  ? -14.976 -63.212 38.657  1.00 34.22  ? 1563 LYS A CA     1 
ATOM   3324  C  C      . LYS A 1 201  ? -14.440 -62.850 37.276  1.00 33.58  ? 1563 LYS A C      1 
ATOM   3325  O  O      . LYS A 1 201  ? -14.734 -61.784 36.760  1.00 33.12  ? 1563 LYS A O      1 
ATOM   3326  C  CB     . LYS A 1 201  ? -13.985 -62.789 39.740  1.00 34.40  ? 1563 LYS A CB     1 
ATOM   3327  C  CG     . LYS A 1 201  ? -13.962 -61.264 39.922  1.00 34.01  ? 1563 LYS A CG     1 
ATOM   3328  C  CD     . LYS A 1 201  ? -12.713 -60.754 40.616  1.00 34.06  ? 1563 LYS A CD     1 
ATOM   3329  C  CE     . LYS A 1 201  ? -12.764 -59.240 40.758  1.00 33.76  ? 1563 LYS A CE     1 
ATOM   3330  N  NZ     . LYS A 1 201  ? -11.490 -58.696 41.289  1.00 33.80  1 1563 LYS A NZ     1 
ATOM   3331  H  H      . LYS A 1 201  ? -14.663 -65.125 39.066  1.00 41.72  ? 1563 LYS A H      1 
ATOM   3332  H  HA     . LYS A 1 201  ? -15.802 -62.723 38.797  1.00 41.07  ? 1563 LYS A HA     1 
ATOM   3333  H  HB2    . LYS A 1 201  ? -14.243 -63.191 40.584  1.00 41.28  ? 1563 LYS A HB2    1 
ATOM   3334  H  HB3    . LYS A 1 201  ? -13.094 -63.078 39.489  1.00 41.28  ? 1563 LYS A HB3    1 
ATOM   3335  H  HG2    . LYS A 1 201  ? -14.010 -60.844 39.049  1.00 40.81  ? 1563 LYS A HG2    1 
ATOM   3336  H  HG3    . LYS A 1 201  ? -14.727 -61.001 40.457  1.00 40.81  ? 1563 LYS A HG3    1 
ATOM   3337  H  HD2    . LYS A 1 201  ? -12.653 -61.144 41.502  1.00 40.87  ? 1563 LYS A HD2    1 
ATOM   3338  H  HD3    . LYS A 1 201  ? -11.932 -60.987 40.090  1.00 40.87  ? 1563 LYS A HD3    1 
ATOM   3339  H  HE2    . LYS A 1 201  ? -12.924 -58.843 39.888  1.00 40.51  ? 1563 LYS A HE2    1 
ATOM   3340  H  HE3    . LYS A 1 201  ? -13.475 -59.001 41.373  1.00 40.51  ? 1563 LYS A HE3    1 
ATOM   3341  H  HZ1    . LYS A 1 201  ? -11.545 -57.811 41.363  1.00 40.56  ? 1563 LYS A HZ1    1 
ATOM   3342  H  HZ2    . LYS A 1 201  ? -11.322 -59.044 42.091  1.00 40.56  ? 1563 LYS A HZ2    1 
ATOM   3343  H  HZ3    . LYS A 1 201  ? -10.820 -58.900 40.739  1.00 40.56  ? 1563 LYS A HZ3    1 
ATOM   3344  N  N      . LYS A 1 202  ? -13.655 -63.730 36.669  1.00 35.55  ? 1564 LYS A N      1 
ATOM   3345  C  CA     . LYS A 1 202  ? -12.962 -63.354 35.444  1.00 35.03  ? 1564 LYS A CA     1 
ATOM   3346  C  C      . LYS A 1 202  ? -13.853 -63.403 34.202  1.00 34.80  ? 1564 LYS A C      1 
ATOM   3347  O  O      . LYS A 1 202  ? -13.670 -62.596 33.292  1.00 34.33  ? 1564 LYS A O      1 
ATOM   3348  C  CB     . LYS A 1 202  ? -11.732 -64.240 35.228  1.00 35.20  ? 1564 LYS A CB     1 
ATOM   3349  C  CG     . LYS A 1 202  ? -10.601 -63.998 36.215  1.00 35.34  ? 1564 LYS A CG     1 
ATOM   3350  C  CD     . LYS A 1 202  ? -9.312  -64.666 35.746  1.00 39.76  ? 1564 LYS A CD     1 
ATOM   3351  C  CE     . LYS A 1 202  ? -8.346  -64.898 36.904  1.00 55.25  ? 1564 LYS A CE     1 
ATOM   3352  N  NZ     . LYS A 1 202  ? -7.464  -66.088 36.696  1.00 65.18  1 1564 LYS A NZ     1 
ATOM   3353  H  H      . LYS A 1 202  ? -13.510 -64.534 36.937  1.00 42.66  ? 1564 LYS A H      1 
ATOM   3354  H  HA     . LYS A 1 202  ? -12.648 -62.441 35.539  1.00 42.03  ? 1564 LYS A HA     1 
ATOM   3355  H  HB2    . LYS A 1 202  ? -12.001 -65.168 35.309  1.00 42.24  ? 1564 LYS A HB2    1 
ATOM   3356  H  HB3    . LYS A 1 202  ? -11.385 -64.077 34.337  1.00 42.24  ? 1564 LYS A HB3    1 
ATOM   3357  H  HG2    . LYS A 1 202  ? -10.440 -63.045 36.293  1.00 42.41  ? 1564 LYS A HG2    1 
ATOM   3358  H  HG3    . LYS A 1 202  ? -10.842 -64.371 37.078  1.00 42.41  ? 1564 LYS A HG3    1 
ATOM   3359  H  HD2    . LYS A 1 202  ? -9.523  -65.526 35.350  1.00 47.71  ? 1564 LYS A HD2    1 
ATOM   3360  H  HD3    . LYS A 1 202  ? -8.875  -64.095 35.096  1.00 47.71  ? 1564 LYS A HD3    1 
ATOM   3361  H  HE2    . LYS A 1 202  ? -7.778  -64.118 37.002  1.00 66.30  ? 1564 LYS A HE2    1 
ATOM   3362  H  HE3    . LYS A 1 202  ? -8.856  -65.042 37.716  1.00 66.30  ? 1564 LYS A HE3    1 
ATOM   3363  H  HZ1    . LYS A 1 202  ? -6.918  -66.187 37.392  1.00 78.22  ? 1564 LYS A HZ1    1 
ATOM   3364  H  HZ2    . LYS A 1 202  ? -7.959  -66.822 36.611  1.00 78.22  ? 1564 LYS A HZ2    1 
ATOM   3365  H  HZ3    . LYS A 1 202  ? -6.976  -65.980 35.960  1.00 78.22  ? 1564 LYS A HZ3    1 
ATOM   3366  N  N      . MET A 1 203  ? -14.810 -64.325 34.148  1.00 27.06  ? 1565 MET A N      1 
ATOM   3367  C  CA     . MET A 1 203  ? -15.690 -64.415 32.974  1.00 26.92  ? 1565 MET A CA     1 
ATOM   3368  C  C      . MET A 1 203  ? -17.009 -63.638 33.100  1.00 26.83  ? 1565 MET A C      1 
ATOM   3369  O  O      . MET A 1 203  ? -17.707 -63.457 32.108  1.00 26.67  ? 1565 MET A O      1 
ATOM   3370  C  CB     . MET A 1 203  ? -15.972 -65.877 32.595  1.00 27.43  ? 1565 MET A CB     1 
ATOM   3371  C  CG     . MET A 1 203  ? -16.217 -66.881 33.704  1.00 28.11  ? 1565 MET A CG     1 
ATOM   3372  S  SD     . MET A 1 203  ? -15.940 -68.539 33.041  1.00 28.69  ? 1565 MET A SD     1 
ATOM   3373  C  CE     . MET A 1 203  ? -16.736 -69.542 34.293  1.00 29.57  ? 1565 MET A CE     1 
ATOM   3374  H  H      . MET A 1 203  ? -14.973 -64.903 34.763  1.00 32.47  ? 1565 MET A H      1 
ATOM   3375  H  HA     . MET A 1 203  ? -15.205 -64.031 32.227  1.00 32.31  ? 1565 MET A HA     1 
ATOM   3376  H  HB2    . MET A 1 203  ? -16.759 -65.889 32.028  1.00 32.92  ? 1565 MET A HB2    1 
ATOM   3377  H  HB3    . MET A 1 203  ? -15.213 -66.202 32.086  1.00 32.92  ? 1565 MET A HB3    1 
ATOM   3378  H  HG2    . MET A 1 203  ? -15.595 -66.726 34.432  1.00 33.74  ? 1565 MET A HG2    1 
ATOM   3379  H  HG3    . MET A 1 203  ? -17.134 -66.815 34.013  1.00 33.74  ? 1565 MET A HG3    1 
ATOM   3380  H  HE1    . MET A 1 203  ? -16.655 -70.477 34.046  1.00 35.49  ? 1565 MET A HE1    1 
ATOM   3381  H  HE2    . MET A 1 203  ? -16.302 -69.385 35.145  1.00 35.49  ? 1565 MET A HE2    1 
ATOM   3382  H  HE3    . MET A 1 203  ? -17.672 -69.294 34.347  1.00 35.49  ? 1565 MET A HE3    1 
ATOM   3383  N  N      . PHE A 1 204  ? -17.338 -63.161 34.295  1.00 27.83  ? 1566 PHE A N      1 
ATOM   3384  C  CA     . PHE A 1 204  ? -18.531 -62.328 34.504  1.00 27.78  ? 1566 PHE A CA     1 
ATOM   3385  C  C      . PHE A 1 204  ? -18.109 -60.979 35.086  1.00 27.48  ? 1566 PHE A C      1 
ATOM   3386  O  O      . PHE A 1 204  ? -18.464 -59.935 34.543  1.00 27.12  ? 1566 PHE A O      1 
ATOM   3387  C  CB     . PHE A 1 204  ? -19.559 -63.069 35.361  1.00 28.40  ? 1566 PHE A CB     1 
ATOM   3388  C  CG     . PHE A 1 204  ? -20.223 -64.197 34.623  1.00 28.71  ? 1566 PHE A CG     1 
ATOM   3389  C  CD1    . PHE A 1 204  ? -19.542 -65.369 34.359  1.00 28.97  ? 1566 PHE A CD1    1 
ATOM   3390  C  CD2    . PHE A 1 204  ? -21.517 -64.068 34.153  1.00 28.79  ? 1566 PHE A CD2    1 
ATOM   3391  C  CE1    . PHE A 1 204  ? -20.146 -66.397 33.659  1.00 29.33  ? 1566 PHE A CE1    1 
ATOM   3392  C  CE2    . PHE A 1 204  ? -22.123 -65.095 33.456  1.00 29.14  ? 1566 PHE A CE2    1 
ATOM   3393  C  CZ     . PHE A 1 204  ? -21.434 -66.259 33.207  1.00 29.41  ? 1566 PHE A CZ     1 
ATOM   3394  H  H      . PHE A 1 204  ? -16.886 -63.304 35.012  1.00 33.39  ? 1566 PHE A H      1 
ATOM   3395  H  HA     . PHE A 1 204  ? -18.941 -62.157 33.642  1.00 33.33  ? 1566 PHE A HA     1 
ATOM   3396  H  HB2    . PHE A 1 204  ? -19.114 -63.440 36.139  1.00 34.08  ? 1566 PHE A HB2    1 
ATOM   3397  H  HB3    . PHE A 1 204  ? -20.248 -62.445 35.638  1.00 34.08  ? 1566 PHE A HB3    1 
ATOM   3398  H  HD1    . PHE A 1 204  ? -18.668 -65.469 34.660  1.00 34.77  ? 1566 PHE A HD1    1 
ATOM   3399  H  HD2    . PHE A 1 204  ? -21.988 -63.283 34.316  1.00 34.55  ? 1566 PHE A HD2    1 
ATOM   3400  H  HE1    . PHE A 1 204  ? -19.679 -67.184 33.495  1.00 35.20  ? 1566 PHE A HE1    1 
ATOM   3401  H  HE2    . PHE A 1 204  ? -22.997 -64.998 33.152  1.00 34.96  ? 1566 PHE A HE2    1 
ATOM   3402  H  HZ     . PHE A 1 204  ? -21.843 -66.952 32.741  1.00 35.30  ? 1566 PHE A HZ     1 
ATOM   3403  N  N      . GLY A 1 205  ? -17.404 -60.999 36.209  1.00 40.14  ? 1567 GLY A N      1 
ATOM   3404  C  CA     . GLY A 1 205  ? -16.870 -59.785 36.812  1.00 39.95  ? 1567 GLY A CA     1 
ATOM   3405  C  C      . GLY A 1 205  ? -17.782 -59.180 37.842  1.00 42.73  ? 1567 GLY A C      1 
ATOM   3406  O  O      . GLY A 1 205  ? -17.323 -58.553 38.795  1.00 40.81  ? 1567 GLY A O      1 
ATOM   3407  H  H      . GLY A 1 205  ? -17.217 -61.714 36.648  1.00 48.17  ? 1567 GLY A H      1 
ATOM   3408  H  HA2    . GLY A 1 205  ? -16.022 -59.985 37.237  1.00 47.94  ? 1567 GLY A HA2    1 
ATOM   3409  H  HA3    . GLY A 1 205  ? -16.715 -59.125 36.118  1.00 47.94  ? 1567 GLY A HA3    1 
ATOM   3410  N  N      . SER A 1 206  ? -19.076 -59.384 37.660  1.00 23.87  ? 1568 SER A N      1 
ATOM   3411  C  CA     . SER A 1 206  ? -20.044 -58.927 38.629  1.00 24.26  ? 1568 SER A CA     1 
ATOM   3412  C  C      . SER A 1 206  ? -20.070 -59.961 39.732  1.00 24.92  ? 1568 SER A C      1 
ATOM   3413  O  O      . SER A 1 206  ? -20.061 -59.648 40.918  1.00 25.33  ? 1568 SER A O      1 
ATOM   3414  C  CB     . SER A 1 206  ? -21.411 -58.771 37.996  1.00 24.25  ? 1568 SER A CB     1 
ATOM   3415  O  OG     . SER A 1 206  ? -22.373 -58.434 38.973  1.00 29.60  ? 1568 SER A OG     1 
ATOM   3416  H  H      . SER A 1 206  ? -19.417 -59.785 36.981  1.00 28.64  ? 1568 SER A H      1 
ATOM   3417  H  HA     . SER A 1 206  ? -19.767 -58.075 39.000  1.00 29.11  ? 1568 SER A HA     1 
ATOM   3418  H  HB2    . SER A 1 206  ? -21.373 -58.066 37.331  1.00 29.10  ? 1568 SER A HB2    1 
ATOM   3419  H  HB3    . SER A 1 206  ? -21.664 -59.609 37.579  1.00 29.10  ? 1568 SER A HB3    1 
ATOM   3420  H  HG     . SER A 1 206  ? -23.128 -58.349 38.615  1.00 35.53  ? 1568 SER A HG     1 
ATOM   3421  N  N      . ILE A 1 207  ? -20.077 -61.213 39.293  1.00 26.91  ? 1569 ILE A N      1 
ATOM   3422  C  CA     . ILE A 1 207  ? -20.201 -62.375 40.156  1.00 27.62  ? 1569 ILE A CA     1 
ATOM   3423  C  C      . ILE A 1 207  ? -18.843 -62.791 40.692  1.00 27.75  ? 1569 ILE A C      1 
ATOM   3424  O  O      . ILE A 1 207  ? -17.878 -62.815 39.940  1.00 27.30  ? 1569 ILE A O      1 
ATOM   3425  C  CB     . ILE A 1 207  ? -20.808 -63.570 39.383  1.00 27.83  ? 1569 ILE A CB     1 
ATOM   3426  C  CG1    . ILE A 1 207  ? -22.240 -63.263 38.935  1.00 27.84  ? 1569 ILE A CG1    1 
ATOM   3427  C  CG2    . ILE A 1 207  ? -20.760 -64.848 40.223  1.00 28.64  ? 1569 ILE A CG2    1 
ATOM   3428  C  CD1    . ILE A 1 207  ? -22.808 -64.291 37.971  1.00 27.99  ? 1569 ILE A CD1    1 
ATOM   3429  H  H      . ILE A 1 207  ? -20.007 -61.420 38.462  1.00 32.29  ? 1569 ILE A H      1 
ATOM   3430  H  HA     . ILE A 1 207  ? -20.779 -62.164 40.906  1.00 33.15  ? 1569 ILE A HA     1 
ATOM   3431  H  HB     . ILE A 1 207  ? -20.271 -63.716 38.588  1.00 33.40  ? 1569 ILE A HB     1 
ATOM   3432  H  HG12   . ILE A 1 207  ? -22.814 -63.238 39.716  1.00 33.41  ? 1569 ILE A HG12   1 
ATOM   3433  H  HG13   . ILE A 1 207  ? -22.251 -62.401 38.490  1.00 33.41  ? 1569 ILE A HG13   1 
ATOM   3434  H  HG21   . ILE A 1 207  ? -21.146 -65.576 39.712  1.00 34.37  ? 1569 ILE A HG21   1 
ATOM   3435  H  HG22   . ILE A 1 207  ? -19.835 -65.048 40.439  1.00 34.37  ? 1569 ILE A HG22   1 
ATOM   3436  H  HG23   . ILE A 1 207  ? -21.267 -64.708 41.038  1.00 34.37  ? 1569 ILE A HG23   1 
ATOM   3437  H  HD11   . ILE A 1 207  ? -23.712 -64.033 37.732  1.00 33.59  ? 1569 ILE A HD11   1 
ATOM   3438  H  HD12   . ILE A 1 207  ? -22.251 -64.321 37.178  1.00 33.59  ? 1569 ILE A HD12   1 
ATOM   3439  H  HD13   . ILE A 1 207  ? -22.815 -65.159 38.405  1.00 33.59  ? 1569 ILE A HD13   1 
ATOM   3440  N  N      . GLU A 1 208  ? -18.744 -63.093 41.981  1.00 45.50  ? 1570 GLU A N      1 
ATOM   3441  C  CA     . GLU A 1 208  ? -17.480 -63.595 42.518  1.00 45.74  ? 1570 GLU A CA     1 
ATOM   3442  C  C      . GLU A 1 208  ? -17.418 -65.118 42.496  1.00 46.29  ? 1570 GLU A C      1 
ATOM   3443  O  O      . GLU A 1 208  ? -16.575 -65.697 41.813  1.00 46.09  ? 1570 GLU A O      1 
ATOM   3444  C  CB     . GLU A 1 208  ? -17.215 -63.095 43.929  1.00 46.22  ? 1570 GLU A CB     1 
ATOM   3445  C  CG     . GLU A 1 208  ? -15.875 -63.609 44.435  1.00 49.18  ? 1570 GLU A CG     1 
ATOM   3446  C  CD     . GLU A 1 208  ? -15.341 -62.850 45.632  1.00 59.69  ? 1570 GLU A CD     1 
ATOM   3447  O  OE1    . GLU A 1 208  ? -15.894 -63.008 46.743  1.00 68.04  ? 1570 GLU A OE1    1 
ATOM   3448  O  OE2    . GLU A 1 208  ? -14.349 -62.105 45.454  1.00 60.21  1 1570 GLU A OE2    1 
ATOM   3449  H  H      . GLU A 1 208  ? -19.378 -63.018 42.558  1.00 54.61  ? 1570 GLU A H      1 
ATOM   3450  H  HA     . GLU A 1 208  ? -16.761 -63.269 41.955  1.00 54.88  ? 1570 GLU A HA     1 
ATOM   3451  H  HB2    . GLU A 1 208  ? -17.192 -62.125 43.930  1.00 55.46  ? 1570 GLU A HB2    1 
ATOM   3452  H  HB3    . GLU A 1 208  ? -17.911 -63.418 44.523  1.00 55.46  ? 1570 GLU A HB3    1 
ATOM   3453  H  HG2    . GLU A 1 208  ? -15.974 -64.539 44.693  1.00 59.02  ? 1570 GLU A HG2    1 
ATOM   3454  H  HG3    . GLU A 1 208  ? -15.222 -63.534 43.721  1.00 59.02  ? 1570 GLU A HG3    1 
ATOM   3455  N  N      . SER A 1 209  ? -18.313 -65.756 43.244  1.00 35.62  ? 1571 SER A N      1 
ATOM   3456  C  CA     . SER A 1 209  ? -18.287 -67.207 43.412  1.00 36.34  ? 1571 SER A CA     1 
ATOM   3457  C  C      . SER A 1 209  ? -19.664 -67.803 43.161  1.00 36.74  ? 1571 SER A C      1 
ATOM   3458  O  O      . SER A 1 209  ? -20.593 -67.077 42.821  1.00 36.41  ? 1571 SER A O      1 
ATOM   3459  C  CB     . SER A 1 209  ? -17.813 -67.547 44.818  1.00 37.17  ? 1571 SER A CB     1 
ATOM   3460  O  OG     . SER A 1 209  ? -16.607 -66.861 45.111  1.00 36.82  ? 1571 SER A OG     1 
ATOM   3461  H  H      . SER A 1 209  ? -18.952 -65.368 43.670  1.00 42.75  ? 1571 SER A H      1 
ATOM   3462  H  HA     . SER A 1 209  ? -17.665 -67.594 42.776  1.00 43.61  ? 1571 SER A HA     1 
ATOM   3463  H  HB2    . SER A 1 209  ? -18.493 -67.279 45.456  1.00 44.60  ? 1571 SER A HB2    1 
ATOM   3464  H  HB3    . SER A 1 209  ? -17.657 -68.503 44.878  1.00 44.60  ? 1571 SER A HB3    1 
ATOM   3465  H  HG     . SER A 1 209  ? -16.350 -67.052 45.887  1.00 44.19  ? 1571 SER A HG     1 
ATOM   3466  N  N      . ILE A 1 210  ? -19.795 -69.119 43.307  1.00 30.03  ? 1572 ILE A N      1 
ATOM   3467  C  CA     . ILE A 1 210  ? -21.031 -69.797 42.909  1.00 30.44  ? 1572 ILE A CA     1 
ATOM   3468  C  C      . ILE A 1 210  ? -21.530 -70.767 43.989  1.00 31.65  ? 1572 ILE A C      1 
ATOM   3469  O  O      . ILE A 1 210  ? -20.748 -71.500 44.600  1.00 32.24  ? 1572 ILE A O      1 
ATOM   3470  C  CB     . ILE A 1 210  ? -20.831 -70.521 41.555  1.00 30.14  ? 1572 ILE A CB     1 
ATOM   3471  C  CG1    . ILE A 1 210  ? -22.058 -71.350 41.186  1.00 30.71  ? 1572 ILE A CG1    1 
ATOM   3472  C  CG2    . ILE A 1 210  ? -19.551 -71.343 41.556  1.00 30.35  ? 1572 ILE A CG2    1 
ATOM   3473  C  CD1    . ILE A 1 210  ? -22.021 -71.850 39.762  1.00 30.38  ? 1572 ILE A CD1    1 
ATOM   3474  H  H      . ILE A 1 210  ? -19.192 -69.639 43.631  1.00 36.03  ? 1572 ILE A H      1 
ATOM   3475  H  HA     . ILE A 1 210  ? -21.720 -69.126 42.780  1.00 36.52  ? 1572 ILE A HA     1 
ATOM   3476  H  HB     . ILE A 1 210  ? -20.732 -69.837 40.875  1.00 36.17  ? 1572 ILE A HB     1 
ATOM   3477  H  HG12   . ILE A 1 210  ? -22.106 -72.120 41.773  1.00 36.86  ? 1572 ILE A HG12   1 
ATOM   3478  H  HG13   . ILE A 1 210  ? -22.852 -70.803 41.291  1.00 36.86  ? 1572 ILE A HG13   1 
ATOM   3479  H  HG21   . ILE A 1 210  ? -19.458 -71.782 40.696  1.00 36.42  ? 1572 ILE A HG21   1 
ATOM   3480  H  HG22   . ILE A 1 210  ? -18.797 -70.753 41.710  1.00 36.42  ? 1572 ILE A HG22   1 
ATOM   3481  H  HG23   . ILE A 1 210  ? -19.603 -72.006 42.262  1.00 36.42  ? 1572 ILE A HG23   1 
ATOM   3482  H  HD11   . ILE A 1 210  ? -22.823 -72.368 39.589  1.00 36.45  ? 1572 ILE A HD11   1 
ATOM   3483  H  HD12   . ILE A 1 210  ? -21.981 -71.090 39.161  1.00 36.45  ? 1572 ILE A HD12   1 
ATOM   3484  H  HD13   . ILE A 1 210  ? -21.236 -72.407 39.644  1.00 36.45  ? 1572 ILE A HD13   1 
ATOM   3485  N  N      . ILE A 1 211  ? -22.846 -70.748 44.210  1.00 32.07  ? 1573 ILE A N      1 
ATOM   3486  C  CA     . ILE A 1 211  ? -23.485 -71.440 45.334  1.00 33.27  ? 1573 ILE A CA     1 
ATOM   3487  C  C      . ILE A 1 211  ? -24.129 -72.756 44.912  1.00 34.01  ? 1573 ILE A C      1 
ATOM   3488  O  O      . ILE A 1 211  ? -24.958 -72.788 44.002  1.00 33.75  ? 1573 ILE A O      1 
ATOM   3489  C  CB     . ILE A 1 211  ? -24.562 -70.552 45.993  1.00 33.42  ? 1573 ILE A CB     1 
ATOM   3490  C  CG1    . ILE A 1 211  ? -23.943 -69.231 46.457  1.00 32.80  ? 1573 ILE A CG1    1 
ATOM   3491  C  CG2    . ILE A 1 211  ? -25.223 -71.281 47.160  1.00 42.38  ? 1573 ILE A CG2    1 
ATOM   3492  C  CD1    . ILE A 1 211  ? -24.932 -68.266 47.069  1.00 32.93  ? 1573 ILE A CD1    1 
ATOM   3493  H  H      . ILE A 1 211  ? -23.405 -70.330 43.708  1.00 38.48  ? 1573 ILE A H      1 
ATOM   3494  H  HA     . ILE A 1 211  ? -22.812 -71.639 46.004  1.00 39.92  ? 1573 ILE A HA     1 
ATOM   3495  H  HB     . ILE A 1 211  ? -25.243 -70.355 45.331  1.00 40.11  ? 1573 ILE A HB     1 
ATOM   3496  H  HG12   . ILE A 1 211  ? -23.266 -69.423 47.124  1.00 39.36  ? 1573 ILE A HG12   1 
ATOM   3497  H  HG13   . ILE A 1 211  ? -23.537 -68.793 45.693  1.00 39.36  ? 1573 ILE A HG13   1 
ATOM   3498  H  HG21   . ILE A 1 211  ? -25.894 -70.702 47.555  1.00 50.86  ? 1573 ILE A HG21   1 
ATOM   3499  H  HG22   . ILE A 1 211  ? -25.638 -72.093 46.831  1.00 50.86  ? 1573 ILE A HG22   1 
ATOM   3500  H  HG23   . ILE A 1 211  ? -24.545 -71.500 47.819  1.00 50.86  ? 1573 ILE A HG23   1 
ATOM   3501  H  HD11   . ILE A 1 211  ? -24.462 -67.460 47.335  1.00 39.52  ? 1573 ILE A HD11   1 
ATOM   3502  H  HD12   . ILE A 1 211  ? -25.612 -68.052 46.411  1.00 39.52  ? 1573 ILE A HD12   1 
ATOM   3503  H  HD13   . ILE A 1 211  ? -25.340 -68.682 47.844  1.00 39.52  ? 1573 ILE A HD13   1 
ATOM   3504  N  N      . PHE A 1 212  ? -23.760 -73.829 45.606  1.00 43.31  ? 1574 PHE A N      1 
ATOM   3505  C  CA     . PHE A 1 212  ? -24.248 -75.174 45.310  1.00 44.19  ? 1574 PHE A CA     1 
ATOM   3506  C  C      . PHE A 1 212  ? -25.126 -75.765 46.416  1.00 45.54  ? 1574 PHE A C      1 
ATOM   3507  O  O      . PHE A 1 212  ? -24.956 -75.440 47.590  1.00 49.74  ? 1574 PHE A O      1 
ATOM   3508  C  CB     . PHE A 1 212  ? -23.058 -76.102 45.100  1.00 44.42  ? 1574 PHE A CB     1 
ATOM   3509  C  CG     . PHE A 1 212  ? -22.081 -75.625 44.071  1.00 43.25  ? 1574 PHE A CG     1 
ATOM   3510  C  CD1    . PHE A 1 212  ? -22.350 -75.741 42.719  1.00 42.68  ? 1574 PHE A CD1    1 
ATOM   3511  C  CD2    . PHE A 1 212  ? -20.886 -75.053 44.463  1.00 42.78  ? 1574 PHE A CD2    1 
ATOM   3512  C  CE1    . PHE A 1 212  ? -21.436 -75.300 41.779  1.00 41.68  ? 1574 PHE A CE1    1 
ATOM   3513  C  CE2    . PHE A 1 212  ? -19.972 -74.610 43.531  1.00 41.77  ? 1574 PHE A CE2    1 
ATOM   3514  C  CZ     . PHE A 1 212  ? -20.248 -74.730 42.187  1.00 41.23  ? 1574 PHE A CZ     1 
ATOM   3515  H  H      . PHE A 1 212  ? -23.215 -73.802 46.271  1.00 51.97  ? 1574 PHE A H      1 
ATOM   3516  H  HA     . PHE A 1 212  ? -24.766 -75.152 44.490  1.00 53.03  ? 1574 PHE A HA     1 
ATOM   3517  H  HB2    . PHE A 1 212  ? -22.582 -76.191 45.940  1.00 53.30  ? 1574 PHE A HB2    1 
ATOM   3518  H  HB3    . PHE A 1 212  ? -23.386 -76.969 44.816  1.00 53.30  ? 1574 PHE A HB3    1 
ATOM   3519  H  HD1    . PHE A 1 212  ? -23.150 -76.124 42.439  1.00 51.21  ? 1574 PHE A HD1    1 
ATOM   3520  H  HD2    . PHE A 1 212  ? -20.693 -74.969 45.369  1.00 51.33  ? 1574 PHE A HD2    1 
ATOM   3521  H  HE1    . PHE A 1 212  ? -21.625 -75.381 40.872  1.00 50.02  ? 1574 PHE A HE1    1 
ATOM   3522  H  HE2    . PHE A 1 212  ? -19.171 -74.227 43.809  1.00 50.12  ? 1574 PHE A HE2    1 
ATOM   3523  H  HZ     . PHE A 1 212  ? -19.633 -74.432 41.557  1.00 49.47  ? 1574 PHE A HZ     1 
ATOM   3524  N  N      . LEU A 1 213  ? -26.078 -76.612 46.032  1.00 42.61  ? 1575 LEU A N      1 
ATOM   3525  C  CA     . LEU A 1 213  ? -26.713 -77.556 46.957  1.00 44.11  ? 1575 LEU A CA     1 
ATOM   3526  C  C      . LEU A 1 213  ? -26.029 -78.936 46.847  1.00 44.93  ? 1575 LEU A C      1 
ATOM   3527  O  O      . LEU A 1 213  ? -26.555 -79.926 47.352  1.00 46.26  ? 1575 LEU A O      1 
ATOM   3528  C  CB     . LEU A 1 213  ? -28.229 -77.643 46.724  1.00 44.54  ? 1575 LEU A CB     1 
ATOM   3529  C  CG     . LEU A 1 213  ? -29.083 -78.305 47.824  1.00 46.10  ? 1575 LEU A CG     1 
ATOM   3530  C  CD1    . LEU A 1 213  ? -28.810 -77.757 49.236  1.00 46.53  ? 1575 LEU A CD1    1 
ATOM   3531  C  CD2    . LEU A 1 213  ? -30.560 -78.121 47.484  1.00 46.28  ? 1575 LEU A CD2    1 
ATOM   3532  H  H      . LEU A 1 213  ? -26.380 -76.662 45.228  1.00 51.13  ? 1575 LEU A H      1 
ATOM   3533  H  HA     . LEU A 1 213  ? -26.577 -77.235 47.863  1.00 52.94  ? 1575 LEU A HA     1 
ATOM   3534  H  HB2    . LEU A 1 213  ? -28.566 -76.741 46.607  1.00 53.45  ? 1575 LEU A HB2    1 
ATOM   3535  H  HB3    . LEU A 1 213  ? -28.378 -78.146 45.908  1.00 53.45  ? 1575 LEU A HB3    1 
ATOM   3536  H  HG     . LEU A 1 213  ? -28.897 -79.256 47.834  1.00 55.31  ? 1575 LEU A HG     1 
ATOM   3537  H  HD11   . LEU A 1 213  ? -29.381 -78.219 49.869  1.00 55.83  ? 1575 LEU A HD11   1 
ATOM   3538  H  HD12   . LEU A 1 213  ? -27.878 -77.909 49.458  1.00 55.83  ? 1575 LEU A HD12   1 
ATOM   3539  H  HD13   . LEU A 1 213  ? -29.002 -76.806 49.248  1.00 55.83  ? 1575 LEU A HD13   1 
ATOM   3540  H  HD21   . LEU A 1 213  ? -31.097 -78.538 48.176  1.00 55.53  ? 1575 LEU A HD21   1 
ATOM   3541  H  HD22   . LEU A 1 213  ? -30.758 -77.173 47.437  1.00 55.53  ? 1575 LEU A HD22   1 
ATOM   3542  H  HD23   . LEU A 1 213  ? -30.741 -78.540 46.628  1.00 55.53  ? 1575 LEU A HD23   1 
ATOM   3543  N  N      . GLU A 1 214  ? -24.896 -78.979 46.140  1.00 61.31  ? 1576 GLU A N      1 
ATOM   3544  C  CA     . GLU A 1 214  ? -24.022 -80.163 45.977  1.00 61.94  ? 1576 GLU A CA     1 
ATOM   3545  C  C      . GLU A 1 214  ? -24.480 -81.105 44.871  1.00 62.23  ? 1576 GLU A C      1 
ATOM   3546  O  O      . GLU A 1 214  ? -23.721 -81.953 44.405  1.00 62.49  ? 1576 GLU A O      1 
ATOM   3547  C  CB     . GLU A 1 214  ? -23.932 -80.976 47.282  1.00 63.44  ? 1576 GLU A CB     1 
ATOM   3548  C  CG     . GLU A 1 214  ? -23.530 -80.180 48.521  1.00 65.37  ? 1576 GLU A CG     1 
ATOM   3549  C  CD     . GLU A 1 214  ? -23.905 -80.888 49.816  1.00 67.87  ? 1576 GLU A CD     1 
ATOM   3550  O  OE1    . GLU A 1 214  ? -24.277 -80.190 50.785  1.00 68.35  ? 1576 GLU A OE1    1 
ATOM   3551  O  OE2    . GLU A 1 214  ? -23.827 -82.136 49.868  1.00 69.37  1 1576 GLU A OE2    1 
ATOM   3552  H  H      . GLU A 1 214  ? -24.592 -78.294 45.719  1.00 73.57  ? 1576 GLU A H      1 
ATOM   3553  H  HA     . GLU A 1 214  ? -23.127 -79.861 45.755  1.00 74.33  ? 1576 GLU A HA     1 
ATOM   3554  H  HB2    . GLU A 1 214  ? -24.801 -81.370 47.459  1.00 76.13  ? 1576 GLU A HB2    1 
ATOM   3555  H  HB3    . GLU A 1 214  ? -23.276 -81.679 47.162  1.00 76.13  ? 1576 GLU A HB3    1 
ATOM   3556  H  HG2    . GLU A 1 214  ? -22.568 -80.052 48.516  1.00 78.44  ? 1576 GLU A HG2    1 
ATOM   3557  H  HG3    . GLU A 1 214  ? -23.980 -79.321 48.506  1.00 78.44  ? 1576 GLU A HG3    1 
ATOM   3558  N  N      . ASP A 1 215  ? -25.715 -80.919 44.443  1.00 89.81  ? 1577 ASP A N      1 
ATOM   3559  C  CA     . ASP A 1 215  ? -26.288 -81.589 43.287  1.00 91.67  ? 1577 ASP A CA     1 
ATOM   3560  C  C      . ASP A 1 215  ? -26.628 -80.517 42.270  1.00 89.65  ? 1577 ASP A C      1 
ATOM   3561  O  O      . ASP A 1 215  ? -26.319 -80.628 41.080  1.00 89.24  ? 1577 ASP A O      1 
ATOM   3562  C  CB     . ASP A 1 215  ? -27.523 -82.395 43.698  1.00 97.44  ? 1577 ASP A CB     1 
ATOM   3563  C  CG     . ASP A 1 215  ? -28.182 -83.115 42.529  1.00 100.31 ? 1577 ASP A CG     1 
ATOM   3564  O  OD1    . ASP A 1 215  ? -27.585 -83.175 41.433  1.00 102.56 ? 1577 ASP A OD1    1 
ATOM   3565  O  OD2    . ASP A 1 215  ? -29.304 -83.636 42.719  1.00 95.92  1 1577 ASP A OD2    1 
ATOM   3566  H  H      . ASP A 1 215  ? -26.268 -80.382 44.825  1.00 107.78 ? 1577 ASP A H      1 
ATOM   3567  H  HA     . ASP A 1 215  ? -25.635 -82.192 42.899  1.00 110.01 ? 1577 ASP A HA     1 
ATOM   3568  H  HB2    . ASP A 1 215  ? -27.261 -83.062 44.351  1.00 116.92 ? 1577 ASP A HB2    1 
ATOM   3569  H  HB3    . ASP A 1 215  ? -28.178 -81.792 44.085  1.00 116.92 ? 1577 ASP A HB3    1 
ATOM   3570  N  N      . PHE A 1 216  ? -27.268 -79.474 42.781  1.00 81.19  ? 1578 PHE A N      1 
ATOM   3571  C  CA     . PHE A 1 216  ? -27.878 -78.436 41.983  1.00 80.14  ? 1578 PHE A CA     1 
ATOM   3572  C  C      . PHE A 1 216  ? -27.117 -77.134 42.276  1.00 79.02  ? 1578 PHE A C      1 
ATOM   3573  O  O      . PHE A 1 216  ? -26.457 -77.025 43.310  1.00 79.26  ? 1578 PHE A O      1 
ATOM   3574  C  CB     . PHE A 1 216  ? -29.356 -78.312 42.364  1.00 80.75  ? 1578 PHE A CB     1 
ATOM   3575  C  CG     . PHE A 1 216  ? -30.160 -79.579 42.143  1.00 84.50  ? 1578 PHE A CG     1 
ATOM   3576  C  CD1    . PHE A 1 216  ? -30.648 -79.921 40.891  1.00 88.51  ? 1578 PHE A CD1    1 
ATOM   3577  C  CD2    . PHE A 1 216  ? -30.425 -80.429 43.212  1.00 87.84  ? 1578 PHE A CD2    1 
ATOM   3578  C  CE1    . PHE A 1 216  ? -31.382 -81.090 40.708  1.00 85.37  ? 1578 PHE A CE1    1 
ATOM   3579  C  CE2    . PHE A 1 216  ? -31.157 -81.595 43.035  1.00 86.29  ? 1578 PHE A CE2    1 
ATOM   3580  C  CZ     . PHE A 1 216  ? -31.636 -81.924 41.782  1.00 85.82  ? 1578 PHE A CZ     1 
ATOM   3581  H  H      . PHE A 1 216  ? -27.362 -79.346 43.626  1.00 97.43  ? 1578 PHE A H      1 
ATOM   3582  H  HA     . PHE A 1 216  ? -27.804 -78.647 41.039  1.00 96.17  ? 1578 PHE A HA     1 
ATOM   3583  H  HB2    . PHE A 1 216  ? -29.417 -78.083 43.305  1.00 96.90  ? 1578 PHE A HB2    1 
ATOM   3584  H  HB3    . PHE A 1 216  ? -29.758 -77.610 41.829  1.00 96.90  ? 1578 PHE A HB3    1 
ATOM   3585  H  HD1    . PHE A 1 216  ? -30.480 -79.365 40.164  1.00 106.22 ? 1578 PHE A HD1    1 
ATOM   3586  H  HD2    . PHE A 1 216  ? -30.105 -80.214 44.059  1.00 105.40 ? 1578 PHE A HD2    1 
ATOM   3587  H  HE1    . PHE A 1 216  ? -31.704 -81.309 39.864  1.00 102.44 ? 1578 PHE A HE1    1 
ATOM   3588  H  HE2    . PHE A 1 216  ? -31.325 -82.153 43.759  1.00 103.54 ? 1578 PHE A HE2    1 
ATOM   3589  H  HZ     . PHE A 1 216  ? -32.127 -82.704 41.661  1.00 102.99 ? 1578 PHE A HZ     1 
ATOM   3590  N  N      . ILE A 1 217  ? -27.194 -76.159 41.376  1.00 35.40  ? 1579 ILE A N      1 
ATOM   3591  C  CA     . ILE A 1 217  ? -26.684 -74.814 41.646  1.00 34.40  ? 1579 ILE A CA     1 
ATOM   3592  C  C      . ILE A 1 217  ? -27.846 -73.929 42.089  1.00 34.39  ? 1579 ILE A C      1 
ATOM   3593  O  O      . ILE A 1 217  ? -28.751 -73.661 41.304  1.00 34.13  ? 1579 ILE A O      1 
ATOM   3594  C  CB     . ILE A 1 217  ? -26.012 -74.192 40.400  1.00 33.19  ? 1579 ILE A CB     1 
ATOM   3595  C  CG1    . ILE A 1 217  ? -24.826 -75.042 39.935  1.00 33.23  ? 1579 ILE A CG1    1 
ATOM   3596  C  CG2    . ILE A 1 217  ? -25.552 -72.767 40.690  1.00 32.26  ? 1579 ILE A CG2    1 
ATOM   3597  C  CD1    . ILE A 1 217  ? -24.270 -74.632 38.575  1.00 32.23  ? 1579 ILE A CD1    1 
ATOM   3598  H  H      . ILE A 1 217  ? -27.540 -76.250 40.594  1.00 42.47  ? 1579 ILE A H      1 
ATOM   3599  H  HA     . ILE A 1 217  ? -26.032 -74.851 42.363  1.00 41.28  ? 1579 ILE A HA     1 
ATOM   3600  H  HB     . ILE A 1 217  ? -26.666 -74.162 39.683  1.00 39.83  ? 1579 ILE A HB     1 
ATOM   3601  H  HG12   . ILE A 1 217  ? -24.110 -74.962 40.584  1.00 39.87  ? 1579 ILE A HG12   1 
ATOM   3602  H  HG13   . ILE A 1 217  ? -25.110 -75.968 39.872  1.00 39.87  ? 1579 ILE A HG13   1 
ATOM   3603  H  HG21   . ILE A 1 217  ? -25.135 -72.402 39.894  1.00 38.71  ? 1579 ILE A HG21   1 
ATOM   3604  H  HG22   . ILE A 1 217  ? -26.322 -72.231 40.937  1.00 38.71  ? 1579 ILE A HG22   1 
ATOM   3605  H  HG23   . ILE A 1 217  ? -24.913 -72.785 41.420  1.00 38.71  ? 1579 ILE A HG23   1 
ATOM   3606  H  HD11   . ILE A 1 217  ? -23.526 -75.213 38.351  1.00 38.68  ? 1579 ILE A HD11   1 
ATOM   3607  H  HD12   . ILE A 1 217  ? -24.970 -74.718 37.909  1.00 38.68  ? 1579 ILE A HD12   1 
ATOM   3608  H  HD13   . ILE A 1 217  ? -23.969 -73.711 38.623  1.00 38.68  ? 1579 ILE A HD13   1 
ATOM   3609  N  N      . THR A 1 218  ? -27.822 -73.466 43.338  1.00 38.09  ? 1580 THR A N      1 
ATOM   3610  C  CA     . THR A 1 218  ? -28.903 -72.617 43.838  1.00 38.17  ? 1580 THR A CA     1 
ATOM   3611  C  C      . THR A 1 218  ? -28.734 -71.171 43.411  1.00 36.99  ? 1580 THR A C      1 
ATOM   3612  O  O      . THR A 1 218  ? -29.716 -70.455 43.228  1.00 36.81  ? 1580 THR A O      1 
ATOM   3613  C  CB     . THR A 1 218  ? -28.987 -72.596 45.373  1.00 39.06  ? 1580 THR A CB     1 
ATOM   3614  O  OG1    . THR A 1 218  ? -27.996 -71.700 45.895  1.00 38.47  ? 1580 THR A OG1    1 
ATOM   3615  C  CG2    . THR A 1 218  ? -28.805 -73.983 45.968  1.00 40.27  ? 1580 THR A CG2    1 
ATOM   3616  H  H      . THR A 1 218  ? -27.200 -73.627 43.909  1.00 45.71  ? 1580 THR A H      1 
ATOM   3617  H  HA     . THR A 1 218  ? -29.750 -72.939 43.492  1.00 45.81  ? 1580 THR A HA     1 
ATOM   3618  H  HB     . THR A 1 218  ? -29.864 -72.276 45.633  1.00 46.87  ? 1580 THR A HB     1 
ATOM   3619  H  HG1    . THR A 1 218  ? -28.036 -71.684 46.734  1.00 46.16  ? 1580 THR A HG1    1 
ATOM   3620  H  HG21   . THR A 1 218  ? -28.863 -73.939 46.936  1.00 48.33  ? 1580 THR A HG21   1 
ATOM   3621  H  HG22   . THR A 1 218  ? -29.497 -74.578 45.639  1.00 48.33  ? 1580 THR A HG22   1 
ATOM   3622  H  HG23   . THR A 1 218  ? -27.938 -74.339 45.720  1.00 48.33  ? 1580 THR A HG23   1 
ATOM   3623  N  N      . GLY A 1 219  ? -27.489 -70.734 43.260  1.00 34.61  ? 1581 GLY A N      1 
ATOM   3624  C  CA     . GLY A 1 219  ? -27.249 -69.347 42.919  1.00 33.58  ? 1581 GLY A CA     1 
ATOM   3625  C  C      . GLY A 1 219  ? -25.804 -68.916 42.810  1.00 32.86  ? 1581 GLY A C      1 
ATOM   3626  O  O      . GLY A 1 219  ? -24.890 -69.728 42.657  1.00 32.96  ? 1581 GLY A O      1 
ATOM   3627  H  H      . GLY A 1 219  ? -26.781 -71.213 43.349  1.00 41.53  ? 1581 GLY A H      1 
ATOM   3628  H  HA2    . GLY A 1 219  ? -27.674 -69.161 42.067  1.00 40.29  ? 1581 GLY A HA2    1 
ATOM   3629  H  HA3    . GLY A 1 219  ? -27.672 -68.787 43.588  1.00 40.29  ? 1581 GLY A HA3    1 
ATOM   3630  N  N      . VAL A 1 220  ? -25.624 -67.602 42.885  1.00 30.43  ? 1582 VAL A N      1 
ATOM   3631  C  CA     . VAL A 1 220  ? -24.315 -66.977 42.848  1.00 29.76  ? 1582 VAL A CA     1 
ATOM   3632  C  C      . VAL A 1 220  ? -24.174 -65.951 43.960  1.00 29.83  ? 1582 VAL A C      1 
ATOM   3633  O  O      . VAL A 1 220  ? -25.159 -65.554 44.578  1.00 30.25  ? 1582 VAL A O      1 
ATOM   3634  C  CB     . VAL A 1 220  ? -24.080 -66.297 41.492  1.00 28.74  ? 1582 VAL A CB     1 
ATOM   3635  C  CG1    . VAL A 1 220  ? -23.952 -67.341 40.400  1.00 28.70  ? 1582 VAL A CG1    1 
ATOM   3636  C  CG2    . VAL A 1 220  ? -25.211 -65.326 41.187  1.00 28.47  ? 1582 VAL A CG2    1 
ATOM   3637  H  H      . VAL A 1 220  ? -26.268 -67.037 42.959  1.00 36.52  ? 1582 VAL A H      1 
ATOM   3638  H  HA     . VAL A 1 220  ? -23.633 -67.656 42.971  1.00 35.71  ? 1582 VAL A HA     1 
ATOM   3639  H  HB     . VAL A 1 220  ? -23.251 -65.794 41.528  1.00 34.49  ? 1582 VAL A HB     1 
ATOM   3640  H  HG11   . VAL A 1 220  ? -23.804 -66.894 39.552  1.00 34.44  ? 1582 VAL A HG11   1 
ATOM   3641  H  HG12   . VAL A 1 220  ? -23.202 -67.921 40.603  1.00 34.44  ? 1582 VAL A HG12   1 
ATOM   3642  H  HG13   . VAL A 1 220  ? -24.771 -67.860 40.362  1.00 34.44  ? 1582 VAL A HG13   1 
ATOM   3643  H  HG21   . VAL A 1 220  ? -25.044 -64.907 40.328  1.00 34.17  ? 1582 VAL A HG21   1 
ATOM   3644  H  HG22   . VAL A 1 220  ? -26.048 -65.815 41.160  1.00 34.17  ? 1582 VAL A HG22   1 
ATOM   3645  H  HG23   . VAL A 1 220  ? -25.244 -64.651 41.883  1.00 34.17  ? 1582 VAL A HG23   1 
ATOM   3646  N  N      . ARG A 1 221  ? -22.938 -65.529 44.203  1.00 39.92  ? 1583 ARG A N      1 
ATOM   3647  C  CA     . ARG A 1 221  ? -22.654 -64.459 45.147  1.00 39.93  ? 1583 ARG A CA     1 
ATOM   3648  C  C      . ARG A 1 221  ? -21.673 -63.490 44.506  1.00 38.99  ? 1583 ARG A C      1 
ATOM   3649  O  O      . ARG A 1 221  ? -20.584 -63.879 44.085  1.00 38.69  ? 1583 ARG A O      1 
ATOM   3650  C  CB     . ARG A 1 221  ? -22.077 -64.995 46.460  1.00 40.77  ? 1583 ARG A CB     1 
ATOM   3651  C  CG     . ARG A 1 221  ? -20.929 -65.978 46.279  1.00 40.83  ? 1583 ARG A CG     1 
ATOM   3652  C  CD     . ARG A 1 221  ? -20.419 -66.527 47.604  1.00 55.80  ? 1583 ARG A CD     1 
ATOM   3653  N  NE     . ARG A 1 221  ? -19.809 -65.472 48.413  1.00 71.14  ? 1583 ARG A NE     1 
ATOM   3654  C  CZ     . ARG A 1 221  ? -19.245 -65.660 49.604  1.00 84.31  ? 1583 ARG A CZ     1 
ATOM   3655  N  NH1    . ARG A 1 221  ? -19.198 -66.872 50.145  1.00 90.13  1 1583 ARG A NH1    1 
ATOM   3656  N  NH2    . ARG A 1 221  ? -18.716 -64.630 50.254  1.00 88.43  ? 1583 ARG A NH2    1 
ATOM   3657  H  H      . ARG A 1 221  ? -22.237 -65.853 43.827  1.00 47.91  ? 1583 ARG A H      1 
ATOM   3658  H  HA     . ARG A 1 221  ? -23.473 -63.979 45.346  1.00 47.92  ? 1583 ARG A HA     1 
ATOM   3659  H  HB2    . ARG A 1 221  ? -21.746 -64.248 46.983  1.00 48.93  ? 1583 ARG A HB2    1 
ATOM   3660  H  HB3    . ARG A 1 221  ? -22.781 -65.450 46.947  1.00 48.93  ? 1583 ARG A HB3    1 
ATOM   3661  H  HG2    . ARG A 1 221  ? -21.234 -66.725 45.741  1.00 49.00  ? 1583 ARG A HG2    1 
ATOM   3662  H  HG3    . ARG A 1 221  ? -20.193 -65.528 45.837  1.00 49.00  ? 1583 ARG A HG3    1 
ATOM   3663  H  HD2    . ARG A 1 221  ? -21.161 -66.903 48.103  1.00 66.96  ? 1583 ARG A HD2    1 
ATOM   3664  H  HD3    . ARG A 1 221  ? -19.749 -67.207 47.434  1.00 66.96  ? 1583 ARG A HD3    1 
ATOM   3665  H  HE     . ARG A 1 221  ? -19.814 -64.673 48.095  1.00 85.37  ? 1583 ARG A HE     1 
ATOM   3666  H  HH11   . ARG A 1 221  ? -19.538 -67.543 49.728  1.00 108.15 ? 1583 ARG A HH11   1 
ATOM   3667  H  HH12   . ARG A 1 221  ? -18.831 -66.985 50.914  1.00 108.15 ? 1583 ARG A HH12   1 
ATOM   3668  H  HH21   . ARG A 1 221  ? -18.743 -63.843 49.908  1.00 106.12 ? 1583 ARG A HH21   1 
ATOM   3669  H  HH22   . ARG A 1 221  ? -18.350 -64.749 51.023  1.00 106.12 ? 1583 ARG A HH22   1 
ATOM   3670  N  N      . SER A 1 222  ? -22.069 -62.228 44.415  1.00 31.21  ? 1584 SER A N      1 
ATOM   3671  C  CA     . SER A 1 222  ? -21.252 -61.213 43.759  1.00 30.38  ? 1584 SER A CA     1 
ATOM   3672  C  C      . SER A 1 222  ? -20.064 -60.771 44.615  1.00 30.47  ? 1584 SER A C      1 
ATOM   3673  O  O      . SER A 1 222  ? -20.047 -60.977 45.830  1.00 31.19  ? 1584 SER A O      1 
ATOM   3674  C  CB     . SER A 1 222  ? -22.111 -60.007 43.381  1.00 30.02  ? 1584 SER A CB     1 
ATOM   3675  O  OG     . SER A 1 222  ? -22.730 -59.433 44.516  1.00 30.60  ? 1584 SER A OG     1 
ATOM   3676  H  H      . SER A 1 222  ? -22.813 -61.930 44.728  1.00 37.45  ? 1584 SER A H      1 
ATOM   3677  H  HA     . SER A 1 222  ? -20.896 -61.587 42.938  1.00 36.45  ? 1584 SER A HA     1 
ATOM   3678  H  HB2    . SER A 1 222  ? -21.547 -59.339 42.961  1.00 36.03  ? 1584 SER A HB2    1 
ATOM   3679  H  HB3    . SER A 1 222  ? -22.800 -60.295 42.761  1.00 36.03  ? 1584 SER A HB3    1 
ATOM   3680  H  HG     . SER A 1 222  ? -23.197 -58.773 44.286  1.00 36.71  ? 1584 SER A HG     1 
ATOM   3681  N  N      . VAL A 1 223  ? -19.078 -60.163 43.958  1.00 26.72  ? 1585 VAL A N      1 
ATOM   3682  C  CA     . VAL A 1 223  ? -17.874 -59.642 44.614  1.00 26.74  ? 1585 VAL A CA     1 
ATOM   3683  C  C      . VAL A 1 223  ? -18.179 -58.713 45.778  1.00 27.20  ? 1585 VAL A C      1 
ATOM   3684  O  O      . VAL A 1 223  ? -17.347 -58.519 46.667  1.00 27.54  ? 1585 VAL A O      1 
ATOM   3685  C  CB     . VAL A 1 223  ? -16.994 -58.870 43.611  1.00 25.92  ? 1585 VAL A CB     1 
ATOM   3686  C  CG1    . VAL A 1 223  ? -16.343 -59.818 42.624  1.00 25.58  ? 1585 VAL A CG1    1 
ATOM   3687  C  CG2    . VAL A 1 223  ? -17.814 -57.808 42.886  1.00 25.46  ? 1585 VAL A CG2    1 
ATOM   3688  H  H      . VAL A 1 223  ? -19.082 -60.035 43.108  1.00 32.06  ? 1585 VAL A H      1 
ATOM   3689  H  HA     . VAL A 1 223  ? -17.356 -60.387 44.955  1.00 32.09  ? 1585 VAL A HA     1 
ATOM   3690  H  HB     . VAL A 1 223  ? -16.287 -58.418 44.098  1.00 31.11  ? 1585 VAL A HB     1 
ATOM   3691  H  HG11   . VAL A 1 223  ? -15.797 -59.306 42.008  1.00 30.70  ? 1585 VAL A HG11   1 
ATOM   3692  H  HG12   . VAL A 1 223  ? -15.790 -60.449 43.110  1.00 30.70  ? 1585 VAL A HG12   1 
ATOM   3693  H  HG13   . VAL A 1 223  ? -17.036 -60.291 42.138  1.00 30.70  ? 1585 VAL A HG13   1 
ATOM   3694  H  HG21   . VAL A 1 223  ? -17.239 -57.337 42.262  1.00 30.55  ? 1585 VAL A HG21   1 
ATOM   3695  H  HG22   . VAL A 1 223  ? -18.538 -58.241 42.407  1.00 30.55  ? 1585 VAL A HG22   1 
ATOM   3696  H  HG23   . VAL A 1 223  ? -18.173 -57.187 43.539  1.00 30.55  ? 1585 VAL A HG23   1 
ATOM   3697  N  N      . GLU A 1 224  ? -19.370 -58.133 45.761  1.00 42.74  ? 1586 GLU A N      1 
ATOM   3698  C  CA     . GLU A 1 224  ? -19.797 -57.248 46.833  1.00 43.79  ? 1586 GLU A CA     1 
ATOM   3699  C  C      . GLU A 1 224  ? -20.188 -58.081 48.044  1.00 44.77  ? 1586 GLU A C      1 
ATOM   3700  O  O      . GLU A 1 224  ? -20.036 -57.647 49.186  1.00 49.38  ? 1586 GLU A O      1 
ATOM   3701  C  CB     . GLU A 1 224  ? -20.987 -56.397 46.399  1.00 42.71  ? 1586 GLU A CB     1 
ATOM   3702  C  CG     . GLU A 1 224  ? -21.034 -56.042 44.924  1.00 43.38  ? 1586 GLU A CG     1 
ATOM   3703  C  CD     . GLU A 1 224  ? -19.961 -55.062 44.504  1.00 47.73  ? 1586 GLU A CD     1 
ATOM   3704  O  OE1    . GLU A 1 224  ? -19.191 -54.602 45.377  1.00 50.12  ? 1586 GLU A OE1    1 
ATOM   3705  O  OE2    . GLU A 1 224  ? -19.900 -54.745 43.296  1.00 48.96  1 1586 GLU A OE2    1 
ATOM   3706  H  H      . GLU A 1 224  ? -19.952 -58.235 45.136  1.00 51.28  ? 1586 GLU A H      1 
ATOM   3707  H  HA     . GLU A 1 224  ? -19.067 -56.660 47.082  1.00 52.54  ? 1586 GLU A HA     1 
ATOM   3708  H  HB2    . GLU A 1 224  ? -21.802 -56.880 46.608  1.00 51.25  ? 1586 GLU A HB2    1 
ATOM   3709  H  HB3    . GLU A 1 224  ? -20.968 -55.565 46.898  1.00 51.25  ? 1586 GLU A HB3    1 
ATOM   3710  H  HG2    . GLU A 1 224  ? -20.917 -56.852 44.403  1.00 52.06  ? 1586 GLU A HG2    1 
ATOM   3711  H  HG3    . GLU A 1 224  ? -21.895 -55.643 44.724  1.00 52.06  ? 1586 GLU A HG3    1 
ATOM   3712  N  N      . GLY A 1 225  ? -20.656 -59.298 47.780  1.00 41.18  ? 1587 GLY A N      1 
ATOM   3713  C  CA     . GLY A 1 225  ? -21.216 -60.153 48.810  1.00 41.98  ? 1587 GLY A CA     1 
ATOM   3714  C  C      . GLY A 1 225  ? -22.731 -60.307 48.730  1.00 41.33  ? 1587 GLY A C      1 
ATOM   3715  O  O      . GLY A 1 225  ? -23.339 -60.897 49.625  1.00 44.28  ? 1587 GLY A O      1 
ATOM   3716  H  H      . GLY A 1 225  ? -20.657 -59.653 46.996  1.00 49.42  ? 1587 GLY A H      1 
ATOM   3717  H  HA2    . GLY A 1 225  ? -20.819 -61.036 48.741  1.00 50.38  ? 1587 GLY A HA2    1 
ATOM   3718  H  HA3    . GLY A 1 225  ? -20.995 -59.788 49.681  1.00 50.38  ? 1587 GLY A HA3    1 
ATOM   3719  N  N      . GLU A 1 226  ? -23.348 -59.785 47.671  1.00 38.45  ? 1588 GLU A N      1 
ATOM   3720  C  CA     . GLU A 1 226  ? -24.781 -59.975 47.467  1.00 38.73  ? 1588 GLU A CA     1 
ATOM   3721  C  C      . GLU A 1 226  ? -25.015 -61.410 47.036  1.00 38.95  ? 1588 GLU A C      1 
ATOM   3722  O  O      . GLU A 1 226  ? -24.156 -61.999 46.388  1.00 38.53  ? 1588 GLU A O      1 
ATOM   3723  C  CB     . GLU A 1 226  ? -25.338 -59.015 46.408  1.00 38.65  ? 1588 GLU A CB     1 
ATOM   3724  C  CG     . GLU A 1 226  ? -26.871 -58.981 46.350  1.00 40.06  ? 1588 GLU A CG     1 
ATOM   3725  C  CD     . GLU A 1 226  ? -27.414 -58.011 45.314  1.00 39.68  ? 1588 GLU A CD     1 
ATOM   3726  O  OE1    . GLU A 1 226  ? -27.022 -58.113 44.130  1.00 37.42  ? 1588 GLU A OE1    1 
ATOM   3727  O  OE2    . GLU A 1 226  ? -28.257 -57.163 45.682  1.00 37.98  1 1588 GLU A OE2    1 
ATOM   3728  H  H      . GLU A 1 226  ? -22.962 -59.318 47.060  1.00 46.14  ? 1588 GLU A H      1 
ATOM   3729  H  HA     . GLU A 1 226  ? -25.252 -59.821 48.301  1.00 46.48  ? 1588 GLU A HA     1 
ATOM   3730  H  HB2    . GLU A 1 226  ? -25.029 -58.117 46.605  1.00 46.38  ? 1588 GLU A HB2    1 
ATOM   3731  H  HB3    . GLU A 1 226  ? -25.015 -59.290 45.536  1.00 46.38  ? 1588 GLU A HB3    1 
ATOM   3732  H  HG2    . GLU A 1 226  ? -27.196 -59.868 46.129  1.00 48.07  ? 1588 GLU A HG2    1 
ATOM   3733  H  HG3    . GLU A 1 226  ? -27.211 -58.712 47.218  1.00 48.07  ? 1588 GLU A HG3    1 
ATOM   3734  N  N      . VAL A 1 227  ? -26.167 -61.969 47.395  1.00 30.81  ? 1589 VAL A N      1 
ATOM   3735  C  CA     . VAL A 1 227  ? -26.540 -63.315 46.956  1.00 31.12  ? 1589 VAL A CA     1 
ATOM   3736  C  C      . VAL A 1 227  ? -27.734 -63.270 46.018  1.00 30.90  ? 1589 VAL A C      1 
ATOM   3737  O  O      . VAL A 1 227  ? -28.795 -62.751 46.358  1.00 31.25  ? 1589 VAL A O      1 
ATOM   3738  C  CB     . VAL A 1 227  ? -26.858 -64.244 48.146  1.00 32.33  ? 1589 VAL A CB     1 
ATOM   3739  C  CG1    . VAL A 1 227  ? -27.745 -63.544 49.171  1.00 33.01  ? 1589 VAL A CG1    1 
ATOM   3740  C  CG2    . VAL A 1 227  ? -27.482 -65.555 47.661  1.00 32.77  ? 1589 VAL A CG2    1 
ATOM   3741  H  H      . VAL A 1 227  ? -26.754 -61.589 47.896  1.00 36.97  ? 1589 VAL A H      1 
ATOM   3742  H  HA     . VAL A 1 227  ? -25.795 -63.702 46.470  1.00 37.35  ? 1589 VAL A HA     1 
ATOM   3743  H  HB     . VAL A 1 227  ? -26.025 -64.467 48.590  1.00 38.80  ? 1589 VAL A HB     1 
ATOM   3744  H  HG11   . VAL A 1 227  ? -27.924 -64.155 49.902  1.00 39.61  ? 1589 VAL A HG11   1 
ATOM   3745  H  HG12   . VAL A 1 227  ? -27.284 -62.757 49.501  1.00 39.61  ? 1589 VAL A HG12   1 
ATOM   3746  H  HG13   . VAL A 1 227  ? -28.577 -63.285 48.744  1.00 39.61  ? 1589 VAL A HG13   1 
ATOM   3747  H  HG21   . VAL A 1 227  ? -27.671 -66.117 48.428  1.00 39.32  ? 1589 VAL A HG21   1 
ATOM   3748  H  HG22   . VAL A 1 227  ? -28.304 -65.356 47.185  1.00 39.32  ? 1589 VAL A HG22   1 
ATOM   3749  H  HG23   . VAL A 1 227  ? -26.857 -66.002 47.069  1.00 39.32  ? 1589 VAL A HG23   1 
ATOM   3750  N  N      . LEU A 1 228  ? -27.542 -63.832 44.832  1.00 30.38  ? 1590 LEU A N      1 
ATOM   3751  C  CA     . LEU A 1 228  ? -28.591 -63.941 43.830  1.00 30.20  ? 1590 LEU A CA     1 
ATOM   3752  C  C      . LEU A 1 228  ? -29.039 -65.388 43.758  1.00 30.91  ? 1590 LEU A C      1 
ATOM   3753  O  O      . LEU A 1 228  ? -28.296 -66.245 43.282  1.00 30.80  ? 1590 LEU A O      1 
ATOM   3754  C  CB     . LEU A 1 228  ? -28.071 -63.455 42.474  1.00 29.16  ? 1590 LEU A CB     1 
ATOM   3755  C  CG     . LEU A 1 228  ? -28.944 -63.559 41.218  1.00 28.88  ? 1590 LEU A CG     1 
ATOM   3756  C  CD1    . LEU A 1 228  ? -30.285 -62.857 41.370  1.00 29.14  ? 1590 LEU A CD1    1 
ATOM   3757  C  CD2    . LEU A 1 228  ? -28.174 -62.996 40.035  1.00 27.92  ? 1590 LEU A CD2    1 
ATOM   3758  H  H      . LEU A 1 228  ? -26.791 -64.166 44.579  1.00 36.45  ? 1590 LEU A H      1 
ATOM   3759  H  HA     . LEU A 1 228  ? -29.349 -63.393 44.088  1.00 36.25  ? 1590 LEU A HA     1 
ATOM   3760  H  HB2    . LEU A 1 228  ? -27.845 -62.517 42.572  1.00 35.00  ? 1590 LEU A HB2    1 
ATOM   3761  H  HB3    . LEU A 1 228  ? -27.259 -63.950 42.283  1.00 35.00  ? 1590 LEU A HB3    1 
ATOM   3762  H  HG     . LEU A 1 228  ? -29.120 -64.495 41.038  1.00 34.66  ? 1590 LEU A HG     1 
ATOM   3763  H  HD11   . LEU A 1 228  ? -30.789 -62.957 40.547  1.00 34.97  ? 1590 LEU A HD11   1 
ATOM   3764  H  HD12   . LEU A 1 228  ? -30.770 -63.260 42.107  1.00 34.97  ? 1590 LEU A HD12   1 
ATOM   3765  H  HD13   . LEU A 1 228  ? -30.130 -61.916 41.551  1.00 34.97  ? 1590 LEU A HD13   1 
ATOM   3766  H  HD21   . LEU A 1 228  ? -28.726 -63.061 39.240  1.00 33.50  ? 1590 LEU A HD21   1 
ATOM   3767  H  HD22   . LEU A 1 228  ? -27.958 -62.067 40.212  1.00 33.50  ? 1590 LEU A HD22   1 
ATOM   3768  H  HD23   . LEU A 1 228  ? -27.360 -63.509 39.916  1.00 33.50  ? 1590 LEU A HD23   1 
ATOM   3769  N  N      . ASN A 1 229  ? -30.253 -65.660 44.222  1.00 52.21  ? 1591 ASN A N      1 
ATOM   3770  C  CA     . ASN A 1 229  ? -30.805 -67.008 44.153  1.00 52.99  ? 1591 ASN A CA     1 
ATOM   3771  C  C      . ASN A 1 229  ? -31.592 -67.229 42.866  1.00 52.71  ? 1591 ASN A C      1 
ATOM   3772  O  O      . ASN A 1 229  ? -32.506 -66.466 42.547  1.00 52.53  ? 1591 ASN A O      1 
ATOM   3773  C  CB     . ASN A 1 229  ? -31.696 -67.276 45.368  1.00 54.53  ? 1591 ASN A CB     1 
ATOM   3774  C  CG     . ASN A 1 229  ? -30.894 -67.595 46.619  1.00 62.05  ? 1591 ASN A CG     1 
ATOM   3775  O  OD1    . ASN A 1 229  ? -30.934 -66.851 47.598  1.00 66.30  ? 1591 ASN A OD1    1 
ATOM   3776  N  ND2    . ASN A 1 229  ? -30.157 -68.701 46.593  1.00 62.48  ? 1591 ASN A ND2    1 
ATOM   3777  H  H      . ASN A 1 229  ? -30.778 -65.081 44.581  1.00 62.65  ? 1591 ASN A H      1 
ATOM   3778  H  HA     . ASN A 1 229  ? -30.076 -67.647 44.170  1.00 63.59  ? 1591 ASN A HA     1 
ATOM   3779  H  HB2    . ASN A 1 229  ? -32.233 -66.489 45.548  1.00 65.44  ? 1591 ASN A HB2    1 
ATOM   3780  H  HB3    . ASN A 1 229  ? -32.271 -68.035 45.178  1.00 65.44  ? 1591 ASN A HB3    1 
ATOM   3781  H  HD21   . ASN A 1 229  ? -29.687 -68.921 47.278  1.00 74.97  ? 1591 ASN A HD21   1 
ATOM   3782  H  HD22   . ASN A 1 229  ? -30.151 -69.197 45.890  1.00 74.97  ? 1591 ASN A HD22   1 
ATOM   3783  N  N      . LEU A 1 230  ? -31.229 -68.273 42.126  1.00 32.21  ? 1592 LEU A N      1 
ATOM   3784  C  CA     . LEU A 1 230  ? -31.893 -68.584 40.864  1.00 32.02  ? 1592 LEU A CA     1 
ATOM   3785  C  C      . LEU A 1 230  ? -33.298 -69.090 41.117  1.00 32.96  ? 1592 LEU A C      1 
ATOM   3786  O  O      . LEU A 1 230  ? -33.593 -69.612 42.191  1.00 33.88  ? 1592 LEU A O      1 
ATOM   3787  C  CB     . LEU A 1 230  ? -31.112 -69.629 40.069  1.00 31.94  ? 1592 LEU A CB     1 
ATOM   3788  C  CG     . LEU A 1 230  ? -29.625 -69.360 39.868  1.00 31.18  ? 1592 LEU A CG     1 
ATOM   3789  C  CD1    . LEU A 1 230  ? -28.993 -70.467 39.044  1.00 31.24  ? 1592 LEU A CD1    1 
ATOM   3790  C  CD2    . LEU A 1 230  ? -29.391 -68.008 39.221  1.00 30.12  ? 1592 LEU A CD2    1 
ATOM   3791  H  H      . LEU A 1 230  ? -30.598 -68.819 42.334  1.00 38.65  ? 1592 LEU A H      1 
ATOM   3792  H  HA     . LEU A 1 230  ? -31.953 -67.777 40.328  1.00 38.43  ? 1592 LEU A HA     1 
ATOM   3793  H  HB2    . LEU A 1 230  ? -31.190 -70.480 40.528  1.00 38.33  ? 1592 LEU A HB2    1 
ATOM   3794  H  HB3    . LEU A 1 230  ? -31.512 -69.701 39.188  1.00 38.33  ? 1592 LEU A HB3    1 
ATOM   3795  H  HG     . LEU A 1 230  ? -29.190 -69.352 40.735  1.00 37.41  ? 1592 LEU A HG     1 
ATOM   3796  H  HD11   . LEU A 1 230  ? -28.049 -70.276 38.930  1.00 37.48  ? 1592 LEU A HD11   1 
ATOM   3797  H  HD12   . LEU A 1 230  ? -29.106 -71.311 39.510  1.00 37.48  ? 1592 LEU A HD12   1 
ATOM   3798  H  HD13   . LEU A 1 230  ? -29.431 -70.506 38.180  1.00 37.48  ? 1592 LEU A HD13   1 
ATOM   3799  H  HD21   . LEU A 1 230  ? -28.437 -67.872 39.110  1.00 36.15  ? 1592 LEU A HD21   1 
ATOM   3800  H  HD22   . LEU A 1 230  ? -29.831 -67.992 38.357  1.00 36.15  ? 1592 LEU A HD22   1 
ATOM   3801  H  HD23   . LEU A 1 230  ? -29.760 -67.317 39.794  1.00 36.15  ? 1592 LEU A HD23   1 
ATOM   3802  N  N      . ASN A 1 231  ? -34.163 -68.947 40.123  1.00 46.12  ? 1593 ASN A N      1 
ATOM   3803  C  CA     . ASN A 1 231  ? -35.485 -69.537 40.205  1.00 47.04  ? 1593 ASN A CA     1 
ATOM   3804  C  C      . ASN A 1 231  ? -35.351 -71.044 40.107  1.00 47.82  ? 1593 ASN A C      1 
ATOM   3805  O  O      . ASN A 1 231  ? -35.546 -71.760 41.085  1.00 48.79  ? 1593 ASN A O      1 
ATOM   3806  C  CB     . ASN A 1 231  ? -36.377 -69.003 39.096  1.00 46.66  ? 1593 ASN A CB     1 
ATOM   3807  C  CG     . ASN A 1 231  ? -36.273 -67.510 38.959  1.00 45.78  ? 1593 ASN A CG     1 
ATOM   3808  O  OD1    . ASN A 1 231  ? -35.545 -67.007 38.102  1.00 44.88  ? 1593 ASN A OD1    1 
ATOM   3809  N  ND2    . ASN A 1 231  ? -36.974 -66.786 39.820  1.00 46.10  ? 1593 ASN A ND2    1 
ATOM   3810  H  H      . ASN A 1 231  ? -34.009 -68.515 39.395  1.00 55.35  ? 1593 ASN A H      1 
ATOM   3811  H  HA     . ASN A 1 231  ? -35.888 -69.317 41.060  1.00 56.45  ? 1593 ASN A HA     1 
ATOM   3812  H  HB2    . ASN A 1 231  ? -36.112 -69.404 38.253  1.00 55.99  ? 1593 ASN A HB2    1 
ATOM   3813  H  HB3    . ASN A 1 231  ? -37.301 -69.225 39.295  1.00 55.99  ? 1593 ASN A HB3    1 
ATOM   3814  H  HD21   . ASN A 1 231  ? -36.947 -65.927 39.781  1.00 55.31  ? 1593 ASN A HD21   1 
ATOM   3815  H  HD22   . ASN A 1 231  ? -37.456 -67.174 40.417  1.00 55.31  ? 1593 ASN A HD22   1 
ATOM   3816  N  N      . GLU A 1 232  ? -34.973 -71.515 38.926  1.00 63.07  ? 1594 GLU A N      1 
ATOM   3817  C  CA     . GLU A 1 232  ? -34.722 -72.929 38.723  1.00 63.78  ? 1594 GLU A CA     1 
ATOM   3818  C  C      . GLU A 1 232  ? -33.271 -73.208 39.081  1.00 63.50  ? 1594 GLU A C      1 
ATOM   3819  O  O      . GLU A 1 232  ? -32.348 -72.636 38.495  1.00 62.53  ? 1594 GLU A O      1 
ATOM   3820  C  CB     . GLU A 1 232  ? -35.013 -73.334 37.279  1.00 64.01  ? 1594 GLU A CB     1 
ATOM   3821  C  CG     . GLU A 1 232  ? -36.491 -73.497 36.972  1.00 66.52  ? 1594 GLU A CG     1 
ATOM   3822  C  CD     . GLU A 1 232  ? -36.881 -72.847 35.655  1.00 68.92  ? 1594 GLU A CD     1 
ATOM   3823  O  OE1    . GLU A 1 232  ? -36.539 -73.403 34.589  1.00 71.96  ? 1594 GLU A OE1    1 
ATOM   3824  O  OE2    . GLU A 1 232  ? -37.522 -71.775 35.685  1.00 68.69  1 1594 GLU A OE2    1 
ATOM   3825  H  H      . GLU A 1 232  ? -34.855 -71.032 38.224  1.00 75.69  ? 1594 GLU A H      1 
ATOM   3826  H  HA     . GLU A 1 232  ? -35.292 -73.449 39.311  1.00 76.53  ? 1594 GLU A HA     1 
ATOM   3827  H  HB2    . GLU A 1 232  ? -34.661 -72.652 36.686  1.00 76.81  ? 1594 GLU A HB2    1 
ATOM   3828  H  HB3    . GLU A 1 232  ? -34.578 -74.182 37.098  1.00 76.81  ? 1594 GLU A HB3    1 
ATOM   3829  H  HG2    . GLU A 1 232  ? -36.701 -74.443 36.915  1.00 79.82  ? 1594 GLU A HG2    1 
ATOM   3830  H  HG3    . GLU A 1 232  ? -37.010 -73.083 37.678  1.00 79.82  ? 1594 GLU A HG3    1 
ATOM   3831  N  N      . LYS A 1 233  ? -33.080 -74.084 40.061  1.00 39.63  ? 1595 LYS A N      1 
ATOM   3832  C  CA     . LYS A 1 233  ? -31.750 -74.569 40.395  1.00 39.59  ? 1595 LYS A CA     1 
ATOM   3833  C  C      . LYS A 1 233  ? -31.221 -75.384 39.213  1.00 39.44  ? 1595 LYS A C      1 
ATOM   3834  O  O      . LYS A 1 233  ? -31.989 -76.085 38.560  1.00 39.98  ? 1595 LYS A O      1 
ATOM   3835  C  CB     . LYS A 1 233  ? -31.785 -75.404 41.681  1.00 40.80  ? 1595 LYS A CB     1 
ATOM   3836  C  CG     . LYS A 1 233  ? -32.878 -76.477 41.721  1.00 42.06  ? 1595 LYS A CG     1 
ATOM   3837  C  CD     . LYS A 1 233  ? -32.857 -77.268 43.029  1.00 43.33  ? 1595 LYS A CD     1 
ATOM   3838  C  CE     . LYS A 1 233  ? -33.834 -78.446 43.004  1.00 44.67  ? 1595 LYS A CE     1 
ATOM   3839  N  NZ     . LYS A 1 233  ? -35.246 -78.047 42.738  1.00 44.83  1 1595 LYS A NZ     1 
ATOM   3840  H  H      . LYS A 1 233  ? -33.707 -74.414 40.548  1.00 47.55  ? 1595 LYS A H      1 
ATOM   3841  H  HA     . LYS A 1 233  ? -31.157 -73.814 40.536  1.00 47.51  ? 1595 LYS A HA     1 
ATOM   3842  H  HB2    . LYS A 1 233  ? -30.931 -75.852 41.783  1.00 48.97  ? 1595 LYS A HB2    1 
ATOM   3843  H  HB3    . LYS A 1 233  ? -31.932 -74.808 42.432  1.00 48.97  ? 1595 LYS A HB3    1 
ATOM   3844  H  HG2    . LYS A 1 233  ? -33.746 -76.051 41.639  1.00 50.47  ? 1595 LYS A HG2    1 
ATOM   3845  H  HG3    . LYS A 1 233  ? -32.741 -77.099 40.990  1.00 50.47  ? 1595 LYS A HG3    1 
ATOM   3846  H  HD2    . LYS A 1 233  ? -31.965 -77.618 43.176  1.00 52.00  ? 1595 LYS A HD2    1 
ATOM   3847  H  HD3    . LYS A 1 233  ? -33.110 -76.682 43.760  1.00 52.00  ? 1595 LYS A HD3    1 
ATOM   3848  H  HE2    . LYS A 1 233  ? -33.562 -79.062 42.305  1.00 53.61  ? 1595 LYS A HE2    1 
ATOM   3849  H  HE3    . LYS A 1 233  ? -33.808 -78.893 43.864  1.00 53.61  ? 1595 LYS A HE3    1 
ATOM   3850  H  HZ1    . LYS A 1 233  ? -35.770 -78.767 42.733  1.00 53.80  ? 1595 LYS A HZ1    1 
ATOM   3851  H  HZ2    . LYS A 1 233  ? -35.528 -77.488 43.370  1.00 53.80  ? 1595 LYS A HZ2    1 
ATOM   3852  H  HZ3    . LYS A 1 233  ? -35.304 -77.642 41.947  1.00 53.80  ? 1595 LYS A HZ3    1 
ATOM   3853  N  N      . ILE A 1 234  ? -29.920 -75.300 38.940  1.00 34.61  ? 1596 ILE A N      1 
ATOM   3854  C  CA     . ILE A 1 234  ? -29.354 -75.943 37.753  1.00 34.40  ? 1596 ILE A CA     1 
ATOM   3855  C  C      . ILE A 1 234  ? -28.813 -77.317 38.104  1.00 35.38  ? 1596 ILE A C      1 
ATOM   3856  O  O      . ILE A 1 234  ? -27.797 -77.456 38.789  1.00 35.42  ? 1596 ILE A O      1 
ATOM   3857  C  CB     . ILE A 1 234  ? -28.225 -75.106 37.122  1.00 33.19  ? 1596 ILE A CB     1 
ATOM   3858  C  CG1    . ILE A 1 234  ? -28.777 -73.778 36.608  1.00 32.29  ? 1596 ILE A CG1    1 
ATOM   3859  C  CG2    . ILE A 1 234  ? -27.563 -75.862 35.973  1.00 33.12  ? 1596 ILE A CG2    1 
ATOM   3860  C  CD1    . ILE A 1 234  ? -27.715 -72.775 36.263  1.00 31.19  ? 1596 ILE A CD1    1 
ATOM   3861  H  H      . ILE A 1 234  ? -29.346 -74.880 39.423  1.00 41.53  ? 1596 ILE A H      1 
ATOM   3862  H  HA     . ILE A 1 234  ? -30.052 -76.054 37.089  1.00 41.28  ? 1596 ILE A HA     1 
ATOM   3863  H  HB     . ILE A 1 234  ? -27.556 -74.923 37.800  1.00 39.83  ? 1596 ILE A HB     1 
ATOM   3864  H  HG12   . ILE A 1 234  ? -29.299 -73.946 35.807  1.00 38.75  ? 1596 ILE A HG12   1 
ATOM   3865  H  HG13   . ILE A 1 234  ? -29.343 -73.388 37.293  1.00 38.75  ? 1596 ILE A HG13   1 
ATOM   3866  H  HG21   . ILE A 1 234  ? -26.859 -75.311 35.597  1.00 39.74  ? 1596 ILE A HG21   1 
ATOM   3867  H  HG22   . ILE A 1 234  ? -27.190 -76.690 36.315  1.00 39.74  ? 1596 ILE A HG22   1 
ATOM   3868  H  HG23   . ILE A 1 234  ? -28.231 -76.054 35.296  1.00 39.74  ? 1596 ILE A HG23   1 
ATOM   3869  H  HD11   . ILE A 1 234  ? -28.140 -71.963 35.946  1.00 37.42  ? 1596 ILE A HD11   1 
ATOM   3870  H  HD12   . ILE A 1 234  ? -27.190 -72.586 37.056  1.00 37.42  ? 1596 ILE A HD12   1 
ATOM   3871  H  HD13   . ILE A 1 234  ? -27.146 -73.144 35.569  1.00 37.42  ? 1596 ILE A HD13   1 
ATOM   3872  N  N      . GLU A 1 235  ? -29.504 -78.327 37.595  1.00 53.18  ? 1597 GLU A N      1 
ATOM   3873  C  CA     . GLU A 1 235  ? -29.186 -79.725 37.879  1.00 54.32  ? 1597 GLU A CA     1 
ATOM   3874  C  C      . GLU A 1 235  ? -27.902 -80.191 37.205  1.00 54.01  ? 1597 GLU A C      1 
ATOM   3875  O  O      . GLU A 1 235  ? -27.674 -79.925 36.026  1.00 53.30  ? 1597 GLU A O      1 
ATOM   3876  C  CB     . GLU A 1 235  ? -30.364 -80.611 37.448  1.00 55.33  ? 1597 GLU A CB     1 
ATOM   3877  C  CG     . GLU A 1 235  ? -30.899 -80.318 36.035  1.00 119.79 ? 1597 GLU A CG     1 
ATOM   3878  C  CD     . GLU A 1 235  ? -32.168 -81.084 35.707  1.00 115.89 ? 1597 GLU A CD     1 
ATOM   3879  O  OE1    . GLU A 1 235  ? -32.492 -82.055 36.429  1.00 114.60 ? 1597 GLU A OE1    1 
ATOM   3880  O  OE2    . GLU A 1 235  ? -32.851 -80.690 34.733  1.00 112.68 1 1597 GLU A OE2    1 
ATOM   3881  H  H      . GLU A 1 235  ? -30.178 -78.229 37.069  1.00 63.82  ? 1597 GLU A H      1 
ATOM   3882  H  HA     . GLU A 1 235  ? -29.072 -79.829 38.836  1.00 65.18  ? 1597 GLU A HA     1 
ATOM   3883  H  HB2    . GLU A 1 235  ? -30.079 -81.538 37.468  1.00 66.40  ? 1597 GLU A HB2    1 
ATOM   3884  H  HB3    . GLU A 1 235  ? -31.096 -80.480 38.072  1.00 66.40  ? 1597 GLU A HB3    1 
ATOM   3885  H  HG2    . GLU A 1 235  ? -31.094 -79.371 35.963  1.00 143.75 ? 1597 GLU A HG2    1 
ATOM   3886  H  HG3    . GLU A 1 235  ? -30.223 -80.567 35.385  1.00 143.75 ? 1597 GLU A HG3    1 
ATOM   3887  N  N      . LEU A 1 236  ? -27.075 -80.896 37.975  1.00 43.51  ? 1598 LEU A N      1 
ATOM   3888  C  CA     . LEU A 1 236  ? -25.811 -81.436 37.484  1.00 43.40  ? 1598 LEU A CA     1 
ATOM   3889  C  C      . LEU A 1 236  ? -25.753 -82.947 37.667  1.00 44.80  ? 1598 LEU A C      1 
ATOM   3890  O  O      . LEU A 1 236  ? -26.232 -83.468 38.674  1.00 54.90  ? 1598 LEU A O      1 
ATOM   3891  C  CB     . LEU A 1 236  ? -24.627 -80.798 38.216  1.00 42.78  ? 1598 LEU A CB     1 
ATOM   3892  C  CG     . LEU A 1 236  ? -24.550 -79.270 38.263  1.00 41.50  ? 1598 LEU A CG     1 
ATOM   3893  C  CD1    . LEU A 1 236  ? -23.373 -78.821 39.114  1.00 41.16  ? 1598 LEU A CD1    1 
ATOM   3894  C  CD2    . LEU A 1 236  ? -24.451 -78.687 36.867  1.00 40.48  ? 1598 LEU A CD2    1 
ATOM   3895  H  H      . LEU A 1 236  ? -27.228 -81.078 38.801  1.00 52.21  ? 1598 LEU A H      1 
ATOM   3896  H  HA     . LEU A 1 236  ? -25.725 -81.241 36.538  1.00 52.08  ? 1598 LEU A HA     1 
ATOM   3897  H  HB2    . LEU A 1 236  ? -24.642 -81.108 39.135  1.00 51.33  ? 1598 LEU A HB2    1 
ATOM   3898  H  HB3    . LEU A 1 236  ? -23.812 -81.108 37.791  1.00 51.33  ? 1598 LEU A HB3    1 
ATOM   3899  H  HG     . LEU A 1 236  ? -25.360 -78.927 38.671  1.00 49.80  ? 1598 LEU A HG     1 
ATOM   3900  H  HD11   . LEU A 1 236  ? -23.345 -77.852 39.128  1.00 49.39  ? 1598 LEU A HD11   1 
ATOM   3901  H  HD12   . LEU A 1 236  ? -23.487 -79.163 40.014  1.00 49.39  ? 1598 LEU A HD12   1 
ATOM   3902  H  HD13   . LEU A 1 236  ? -22.554 -79.170 38.728  1.00 49.39  ? 1598 LEU A HD13   1 
ATOM   3903  H  HD21   . LEU A 1 236  ? -24.404 -77.720 36.932  1.00 48.58  ? 1598 LEU A HD21   1 
ATOM   3904  H  HD22   . LEU A 1 236  ? -23.651 -79.029 36.438  1.00 48.58  ? 1598 LEU A HD22   1 
ATOM   3905  H  HD23   . LEU A 1 236  ? -25.236 -78.947 36.360  1.00 48.58  ? 1598 LEU A HD23   1 
ATOM   3906  N  N      . LYS A 1 237  ? -25.183 -83.643 36.687  1.00 72.62  ? 1599 LYS A N      1 
ATOM   3907  C  CA     . LYS A 1 237  ? -24.912 -85.080 36.796  1.00 86.88  ? 1599 LYS A CA     1 
ATOM   3908  C  C      . LYS A 1 237  ? -23.406 -85.315 36.909  1.00 100.38 ? 1599 LYS A C      1 
ATOM   3909  O  O      . LYS A 1 237  ? -22.614 -84.492 36.446  1.00 115.17 ? 1599 LYS A O      1 
ATOM   3910  C  CB     . LYS A 1 237  ? -25.512 -85.846 35.616  1.00 80.80  ? 1599 LYS A CB     1 
ATOM   3911  C  CG     . LYS A 1 237  ? -24.819 -85.640 34.289  1.00 76.64  ? 1599 LYS A CG     1 
ATOM   3912  C  CD     . LYS A 1 237  ? -25.510 -86.447 33.202  1.00 74.37  ? 1599 LYS A CD     1 
ATOM   3913  C  CE     . LYS A 1 237  ? -24.954 -86.175 31.808  1.00 73.59  ? 1599 LYS A CE     1 
ATOM   3914  N  NZ     . LYS A 1 237  ? -24.970 -84.716 31.476  1.00 72.10  1 1599 LYS A NZ     1 
ATOM   3915  H  H      . LYS A 1 237  ? -24.940 -83.303 35.935  1.00 87.15  ? 1599 LYS A H      1 
ATOM   3916  H  HA     . LYS A 1 237  ? -25.326 -85.414 37.607  1.00 104.26 ? 1599 LYS A HA     1 
ATOM   3917  H  HB2    . LYS A 1 237  ? -25.479 -86.794 35.818  1.00 96.96  ? 1599 LYS A HB2    1 
ATOM   3918  H  HB3    . LYS A 1 237  ? -26.435 -85.570 35.508  1.00 96.96  ? 1599 LYS A HB3    1 
ATOM   3919  H  HG2    . LYS A 1 237  ? -24.856 -84.702 34.047  1.00 91.97  ? 1599 LYS A HG2    1 
ATOM   3920  H  HG3    . LYS A 1 237  ? -23.898 -85.937 34.355  1.00 91.97  ? 1599 LYS A HG3    1 
ATOM   3921  H  HD2    . LYS A 1 237  ? -25.395 -87.392 33.390  1.00 89.25  ? 1599 LYS A HD2    1 
ATOM   3922  H  HD3    . LYS A 1 237  ? -26.454 -86.224 33.196  1.00 89.25  ? 1599 LYS A HD3    1 
ATOM   3923  H  HE2    . LYS A 1 237  ? -24.036 -86.485 31.765  1.00 88.31  ? 1599 LYS A HE2    1 
ATOM   3924  H  HE3    . LYS A 1 237  ? -25.496 -86.641 31.152  1.00 88.31  ? 1599 LYS A HE3    1 
ATOM   3925  H  HZ1    . LYS A 1 237  ? -24.642 -84.586 30.659  1.00 86.52  ? 1599 LYS A HZ1    1 
ATOM   3926  H  HZ2    . LYS A 1 237  ? -25.805 -84.407 31.504  1.00 86.52  ? 1599 LYS A HZ2    1 
ATOM   3927  H  HZ3    . LYS A 1 237  ? -24.475 -84.265 32.062  1.00 86.52  ? 1599 LYS A HZ3    1 
ATOM   3928  N  N      . ASP A 1 238  ? -23.028 -86.422 37.551  1.00 127.49 ? 1600 ASP A N      1 
ATOM   3929  C  CA     . ASP A 1 238  ? -21.633 -86.694 37.914  1.00 128.80 ? 1600 ASP A CA     1 
ATOM   3930  C  C      . ASP A 1 238  ? -20.672 -86.454 36.749  1.00 129.74 ? 1600 ASP A C      1 
ATOM   3931  O  O      . ASP A 1 238  ? -19.602 -85.870 36.937  1.00 130.30 ? 1600 ASP A O      1 
ATOM   3932  C  CB     . ASP A 1 238  ? -21.481 -88.132 38.423  1.00 130.27 ? 1600 ASP A CB     1 
ATOM   3933  C  CG     . ASP A 1 238  ? -22.008 -89.162 37.440  1.00 131.62 ? 1600 ASP A CG     1 
ATOM   3934  O  OD1    . ASP A 1 238  ? -22.954 -88.845 36.687  1.00 131.57 ? 1600 ASP A OD1    1 
ATOM   3935  O  OD2    . ASP A 1 238  ? -21.471 -90.290 37.420  1.00 132.71 1 1600 ASP A OD2    1 
ATOM   3936  H  H      . ASP A 1 238  ? -23.571 -87.044 37.793  1.00 152.99 ? 1600 ASP A H      1 
ATOM   3937  H  HA     . ASP A 1 238  ? -21.377 -86.097 38.635  1.00 154.56 ? 1600 ASP A HA     1 
ATOM   3938  H  HB2    . ASP A 1 238  ? -20.541 -88.317 38.574  1.00 156.32 ? 1600 ASP A HB2    1 
ATOM   3939  H  HB3    . ASP A 1 238  ? -21.976 -88.228 39.252  1.00 156.32 ? 1600 ASP A HB3    1 
ATOM   3940  N  N      . SER A 1 239  ? -21.050 -86.911 35.556  1.00 123.12 ? 1601 SER A N      1 
ATOM   3941  C  CA     . SER A 1 239  ? -20.299 -86.590 34.341  1.00 118.65 ? 1601 SER A CA     1 
ATOM   3942  C  C      . SER A 1 239  ? -21.110 -85.656 33.447  1.00 111.87 ? 1601 SER A C      1 
ATOM   3943  O  O      . SER A 1 239  ? -22.046 -86.093 32.787  1.00 106.28 ? 1601 SER A O      1 
ATOM   3944  C  CB     . SER A 1 239  ? -19.952 -87.870 33.577  1.00 115.17 ? 1601 SER A CB     1 
ATOM   3945  O  OG     . SER A 1 239  ? -19.215 -88.776 34.382  1.00 113.27 ? 1601 SER A OG     1 
ATOM   3946  H  H      . SER A 1 239  ? -21.738 -87.409 35.422  1.00 147.75 ? 1601 SER A H      1 
ATOM   3947  H  HA     . SER A 1 239  ? -19.473 -86.143 34.582  1.00 142.38 ? 1601 SER A HA     1 
ATOM   3948  H  HB2    . SER A 1 239  ? -20.774 -88.300 33.294  1.00 138.21 ? 1601 SER A HB2    1 
ATOM   3949  H  HB3    . SER A 1 239  ? -19.419 -87.637 32.801  1.00 138.21 ? 1601 SER A HB3    1 
ATOM   3950  H  HG     . SER A 1 239  ? -19.036 -89.470 33.944  1.00 135.92 ? 1601 SER A HG     1 
ATOM   3951  N  N      . ILE A 1 240  ? -20.734 -84.379 33.411  1.00 92.84  ? 1602 ILE A N      1 
ATOM   3952  C  CA     . ILE A 1 240  ? -21.400 -83.397 32.551  1.00 91.07  ? 1602 ILE A CA     1 
ATOM   3953  C  C      . ILE A 1 240  ? -20.424 -82.293 32.173  1.00 88.68  ? 1602 ILE A C      1 
ATOM   3954  O  O      . ILE A 1 240  ? -19.590 -81.898 32.987  1.00 88.62  ? 1602 ILE A O      1 
ATOM   3955  C  CB     . ILE A 1 240  ? -22.651 -82.773 33.224  1.00 77.04  ? 1602 ILE A CB     1 
ATOM   3956  C  CG1    . ILE A 1 240  ? -23.441 -81.945 32.203  1.00 76.26  ? 1602 ILE A CG1    1 
ATOM   3957  C  CG2    . ILE A 1 240  ? -22.269 -81.906 34.420  1.00 76.50  ? 1602 ILE A CG2    1 
ATOM   3958  C  CD1    . ILE A 1 240  ? -24.839 -81.579 32.654  1.00 76.43  ? 1602 ILE A CD1    1 
ATOM   3959  H  H      . ILE A 1 240  ? -20.091 -84.052 33.879  1.00 111.41 ? 1602 ILE A H      1 
ATOM   3960  H  HA     . ILE A 1 240  ? -21.687 -83.836 31.735  1.00 109.28 ? 1602 ILE A HA     1 
ATOM   3961  H  HB     . ILE A 1 240  ? -23.219 -83.494 33.538  1.00 92.45  ? 1602 ILE A HB     1 
ATOM   3962  H  HG12   . ILE A 1 240  ? -22.960 -81.120 32.032  1.00 91.52  ? 1602 ILE A HG12   1 
ATOM   3963  H  HG13   . ILE A 1 240  ? -23.519 -82.455 31.382  1.00 91.52  ? 1602 ILE A HG13   1 
ATOM   3964  H  HG21   . ILE A 1 240  ? -23.075 -81.536 34.812  1.00 91.79  ? 1602 ILE A HG21   1 
ATOM   3965  H  HG22   . ILE A 1 240  ? -21.806 -82.455 35.072  1.00 91.79  ? 1602 ILE A HG22   1 
ATOM   3966  H  HG23   . ILE A 1 240  ? -21.688 -81.190 34.118  1.00 91.79  ? 1602 ILE A HG23   1 
ATOM   3967  H  HD11   . ILE A 1 240  ? -25.269 -81.059 31.957  1.00 91.71  ? 1602 ILE A HD11   1 
ATOM   3968  H  HD12   . ILE A 1 240  ? -25.340 -82.393 32.818  1.00 91.71  ? 1602 ILE A HD12   1 
ATOM   3969  H  HD13   . ILE A 1 240  ? -24.780 -81.056 33.469  1.00 91.71  ? 1602 ILE A HD13   1 
ATOM   3970  N  N      . GLN A 1 241  ? -20.516 -81.792 30.946  1.00 72.26  ? 1603 GLN A N      1 
ATOM   3971  C  CA     . GLN A 1 241  ? -19.554 -80.797 30.499  1.00 70.45  ? 1603 GLN A CA     1 
ATOM   3972  C  C      . GLN A 1 241  ? -19.850 -79.453 31.150  1.00 66.72  ? 1603 GLN A C      1 
ATOM   3973  O  O      . GLN A 1 241  ? -21.007 -79.072 31.327  1.00 63.70  ? 1603 GLN A O      1 
ATOM   3974  C  CB     . GLN A 1 241  ? -19.574 -80.656 28.971  1.00 73.18  ? 1603 GLN A CB     1 
ATOM   3975  C  CG     . GLN A 1 241  ? -18.375 -81.287 28.259  1.00 71.26  ? 1603 GLN A CG     1 
ATOM   3976  C  CD     . GLN A 1 241  ? -17.051 -80.636 28.629  1.00 68.73  ? 1603 GLN A CD     1 
ATOM   3977  O  OE1    . GLN A 1 241  ? -16.737 -79.535 28.172  1.00 68.23  ? 1603 GLN A OE1    1 
ATOM   3978  N  NE2    . GLN A 1 241  ? -16.266 -81.318 29.460  1.00 68.41  ? 1603 GLN A NE2    1 
ATOM   3979  H  H      . GLN A 1 241  ? -21.113 -82.007 30.365  1.00 86.71  ? 1603 GLN A H      1 
ATOM   3980  H  HA     . GLN A 1 241  ? -18.663 -81.072 30.766  1.00 84.54  ? 1603 GLN A HA     1 
ATOM   3981  H  HB2    . GLN A 1 241  ? -20.376 -81.082 28.631  1.00 87.81  ? 1603 GLN A HB2    1 
ATOM   3982  H  HB3    . GLN A 1 241  ? -19.586 -79.712 28.747  1.00 87.81  ? 1603 GLN A HB3    1 
ATOM   3983  H  HG2    . GLN A 1 241  ? -18.324 -82.225 28.499  1.00 85.51  ? 1603 GLN A HG2    1 
ATOM   3984  H  HG3    . GLN A 1 241  ? -18.494 -81.197 27.300  1.00 85.51  ? 1603 GLN A HG3    1 
ATOM   3985  H  HE21   . GLN A 1 241  ? -16.518 -82.085 29.757  1.00 82.09  ? 1603 GLN A HE21   1 
ATOM   3986  H  HE22   . GLN A 1 241  ? -15.507 -80.992 29.699  1.00 82.09  ? 1603 GLN A HE22   1 
ATOM   3987  N  N      . ALA A 1 242  ? -18.785 -78.752 31.519  1.00 35.54  ? 1604 ALA A N      1 
ATOM   3988  C  CA     . ALA A 1 242  ? -18.884 -77.399 32.043  1.00 34.64  ? 1604 ALA A CA     1 
ATOM   3989  C  C      . ALA A 1 242  ? -19.501 -76.467 31.019  1.00 33.89  ? 1604 ALA A C      1 
ATOM   3990  O  O      . ALA A 1 242  ? -20.397 -75.693 31.338  1.00 33.58  ? 1604 ALA A O      1 
ATOM   3991  C  CB     . ALA A 1 242  ? -17.520 -76.891 32.465  1.00 34.13  ? 1604 ALA A CB     1 
ATOM   3992  H  H      . ALA A 1 242  ? -17.977 -79.045 31.474  1.00 42.65  ? 1604 ALA A H      1 
ATOM   3993  H  HA     . ALA A 1 242  ? -19.457 -77.405 32.826  1.00 41.57  ? 1604 ALA A HA     1 
ATOM   3994  H  HB1    . ALA A 1 242  ? -17.613 -75.989 32.810  1.00 40.95  ? 1604 ALA A HB1    1 
ATOM   3995  H  HB2    . ALA A 1 242  ? -17.166 -77.475 33.154  1.00 40.95  ? 1604 ALA A HB2    1 
ATOM   3996  H  HB3    . ALA A 1 242  ? -16.931 -76.892 31.695  1.00 40.95  ? 1604 ALA A HB3    1 
ATOM   3997  N  N      . GLN A 1 243  ? -19.022 -76.560 29.782  1.00 45.91  ? 1605 GLN A N      1 
ATOM   3998  C  CA     . GLN A 1 243  ? -19.393 -75.616 28.734  1.00 45.19  ? 1605 GLN A CA     1 
ATOM   3999  C  C      . GLN A 1 243  ? -20.905 -75.571 28.524  1.00 45.43  ? 1605 GLN A C      1 
ATOM   4000  O  O      . GLN A 1 243  ? -21.425 -74.608 27.963  1.00 44.84  ? 1605 GLN A O      1 
ATOM   4001  C  CB     . GLN A 1 243  ? -18.682 -75.961 27.417  1.00 45.18  ? 1605 GLN A CB     1 
ATOM   4002  C  CG     . GLN A 1 243  ? -19.088 -77.294 26.798  1.00 51.74  ? 1605 GLN A CG     1 
ATOM   4003  C  CD     . GLN A 1 243  ? -18.673 -77.422 25.341  1.00 56.48  ? 1605 GLN A CD     1 
ATOM   4004  O  OE1    . GLN A 1 243  ? -17.696 -76.815 24.901  1.00 56.25  ? 1605 GLN A OE1    1 
ATOM   4005  N  NE2    . GLN A 1 243  ? -19.419 -78.221 24.586  1.00 59.70  ? 1605 GLN A NE2    1 
ATOM   4006  H  H      . GLN A 1 243  ? -18.475 -77.170 29.521  1.00 55.09  ? 1605 GLN A H      1 
ATOM   4007  H  HA     . GLN A 1 243  ? -19.106 -74.728 29.000  1.00 54.23  ? 1605 GLN A HA     1 
ATOM   4008  H  HB2    . GLN A 1 243  ? -18.877 -75.266 26.769  1.00 54.22  ? 1605 GLN A HB2    1 
ATOM   4009  H  HB3    . GLN A 1 243  ? -17.726 -75.993 27.581  1.00 54.22  ? 1605 GLN A HB3    1 
ATOM   4010  H  HG2    . GLN A 1 243  ? -18.667 -78.014 27.294  1.00 62.09  ? 1605 GLN A HG2    1 
ATOM   4011  H  HG3    . GLN A 1 243  ? -20.053 -77.382 26.843  1.00 62.09  ? 1605 GLN A HG3    1 
ATOM   4012  H  HE21   . GLN A 1 243  ? -20.094 -78.630 24.928  1.00 71.64  ? 1605 GLN A HE21   1 
ATOM   4013  H  HE22   . GLN A 1 243  ? -19.228 -78.329 23.754  1.00 71.64  ? 1605 GLN A HE22   1 
ATOM   4014  N  N      . GLU A 1 244  ? -21.605 -76.614 28.965  1.00 44.58  ? 1606 GLU A N      1 
ATOM   4015  C  CA     . GLU A 1 244  ? -23.062 -76.634 28.884  1.00 44.91  ? 1606 GLU A CA     1 
ATOM   4016  C  C      . GLU A 1 244  ? -23.733 -75.884 30.032  1.00 44.70  ? 1606 GLU A C      1 
ATOM   4017  O  O      . GLU A 1 244  ? -24.439 -74.907 29.793  1.00 44.18  ? 1606 GLU A O      1 
ATOM   4018  C  CB     . GLU A 1 244  ? -23.588 -78.065 28.842  1.00 46.09  ? 1606 GLU A CB     1 
ATOM   4019  C  CG     . GLU A 1 244  ? -25.055 -78.119 28.458  1.00 46.47  ? 1606 GLU A CG     1 
ATOM   4020  C  CD     . GLU A 1 244  ? -25.589 -79.529 28.385  1.00 47.72  ? 1606 GLU A CD     1 
ATOM   4021  O  OE1    . GLU A 1 244  ? -24.809 -80.476 28.627  1.00 48.30  ? 1606 GLU A OE1    1 
ATOM   4022  O  OE2    . GLU A 1 244  ? -26.787 -79.687 28.066  1.00 48.16  1 1606 GLU A OE2    1 
ATOM   4023  H  H      . GLU A 1 244  ? -21.261 -77.321 29.315  1.00 53.49  ? 1606 GLU A H      1 
ATOM   4024  H  HA     . GLU A 1 244  ? -23.328 -76.201 28.058  1.00 53.90  ? 1606 GLU A HA     1 
ATOM   4025  H  HB2    . GLU A 1 244  ? -23.084 -78.571 28.185  1.00 55.31  ? 1606 GLU A HB2    1 
ATOM   4026  H  HB3    . GLU A 1 244  ? -23.490 -78.466 29.719  1.00 55.31  ? 1606 GLU A HB3    1 
ATOM   4027  H  HG2    . GLU A 1 244  ? -25.573 -77.636 29.121  1.00 55.77  ? 1606 GLU A HG2    1 
ATOM   4028  H  HG3    . GLU A 1 244  ? -25.168 -77.710 27.586  1.00 55.77  ? 1606 GLU A HG3    1 
ATOM   4029  N  N      . TRP A 1 245  ? -23.544 -76.339 31.269  1.00 31.11  ? 1607 TRP A N      1 
ATOM   4030  C  CA     . TRP A 1 245  ? -24.288 -75.752 32.383  1.00 31.11  ? 1607 TRP A CA     1 
ATOM   4031  C  C      . TRP A 1 245  ? -23.850 -74.317 32.647  1.00 30.08  ? 1607 TRP A C      1 
ATOM   4032  O  O      . TRP A 1 245  ? -24.588 -73.540 33.247  1.00 29.91  ? 1607 TRP A O      1 
ATOM   4033  C  CB     . TRP A 1 245  ? -24.159 -76.589 33.666  1.00 31.98  ? 1607 TRP A CB     1 
ATOM   4034  C  CG     . TRP A 1 245  ? -22.776 -76.794 34.232  1.00 31.93  ? 1607 TRP A CG     1 
ATOM   4035  C  CD1    . TRP A 1 245  ? -21.965 -77.877 34.043  1.00 32.50  ? 1607 TRP A CD1    1 
ATOM   4036  C  CD2    . TRP A 1 245  ? -22.064 -75.911 35.113  1.00 31.38  ? 1607 TRP A CD2    1 
ATOM   4037  N  NE1    . TRP A 1 245  ? -20.793 -77.721 34.744  1.00 32.31  ? 1607 TRP A NE1    1 
ATOM   4038  C  CE2    . TRP A 1 245  ? -20.826 -76.520 35.403  1.00 31.62  ? 1607 TRP A CE2    1 
ATOM   4039  C  CE3    . TRP A 1 245  ? -22.350 -74.664 35.676  1.00 30.75  ? 1607 TRP A CE3    1 
ATOM   4040  C  CZ2    . TRP A 1 245  ? -19.876 -75.922 36.229  1.00 31.26  ? 1607 TRP A CZ2    1 
ATOM   4041  C  CZ3    . TRP A 1 245  ? -21.403 -74.071 36.495  1.00 30.41  ? 1607 TRP A CZ3    1 
ATOM   4042  C  CH2    . TRP A 1 245  ? -20.182 -74.701 36.763  1.00 30.66  ? 1607 TRP A CH2    1 
ATOM   4043  H  H      . TRP A 1 245  ? -23.004 -76.972 31.487  1.00 37.34  ? 1607 TRP A H      1 
ATOM   4044  H  HA     . TRP A 1 245  ? -25.228 -75.730 32.145  1.00 37.34  ? 1607 TRP A HA     1 
ATOM   4045  H  HB2    . TRP A 1 245  ? -24.687 -76.161 34.358  1.00 38.38  ? 1607 TRP A HB2    1 
ATOM   4046  H  HB3    . TRP A 1 245  ? -24.525 -77.470 33.487  1.00 38.38  ? 1607 TRP A HB3    1 
ATOM   4047  H  HD1    . TRP A 1 245  ? -22.178 -78.617 33.521  1.00 38.99  ? 1607 TRP A HD1    1 
ATOM   4048  H  HE1    . TRP A 1 245  ? -20.140 -78.280 34.757  1.00 38.77  ? 1607 TRP A HE1    1 
ATOM   4049  H  HE3    . TRP A 1 245  ? -23.158 -74.238 35.501  1.00 36.91  ? 1607 TRP A HE3    1 
ATOM   4050  H  HZ2    . TRP A 1 245  ? -19.063 -76.337 36.409  1.00 37.51  ? 1607 TRP A HZ2    1 
ATOM   4051  H  HZ3    . TRP A 1 245  ? -21.582 -73.241 36.875  1.00 36.49  ? 1607 TRP A HZ3    1 
ATOM   4052  H  HH2    . TRP A 1 245  ? -19.565 -74.281 37.318  1.00 36.79  ? 1607 TRP A HH2    1 
ATOM   4053  N  N      . LEU A 1 246  ? -22.657 -73.962 32.187  1.00 29.47  ? 1608 LEU A N      1 
ATOM   4054  C  CA     . LEU A 1 246  ? -22.187 -72.589 32.298  1.00 28.52  ? 1608 LEU A CA     1 
ATOM   4055  C  C      . LEU A 1 246  ? -23.045 -71.688 31.439  1.00 28.02  ? 1608 LEU A C      1 
ATOM   4056  O  O      . LEU A 1 246  ? -23.349 -70.558 31.810  1.00 27.52  ? 1608 LEU A O      1 
ATOM   4057  C  CB     . LEU A 1 246  ? -20.735 -72.465 31.858  1.00 28.05  ? 1608 LEU A CB     1 
ATOM   4058  C  CG     . LEU A 1 246  ? -19.678 -72.719 32.920  1.00 28.22  ? 1608 LEU A CG     1 
ATOM   4059  C  CD1    . LEU A 1 246  ? -18.332 -72.698 32.239  1.00 27.83  ? 1608 LEU A CD1    1 
ATOM   4060  C  CD2    . LEU A 1 246  ? -19.750 -71.701 34.044  1.00 27.90  ? 1608 LEU A CD2    1 
ATOM   4061  H  H      . LEU A 1 246  ? -22.101 -74.497 31.807  1.00 35.36  ? 1608 LEU A H      1 
ATOM   4062  H  HA     . LEU A 1 246  ? -22.256 -72.295 33.220  1.00 34.23  ? 1608 LEU A HA     1 
ATOM   4063  H  HB2    . LEU A 1 246  ? -20.580 -73.101 31.142  1.00 33.66  ? 1608 LEU A HB2    1 
ATOM   4064  H  HB3    . LEU A 1 246  ? -20.595 -71.566 31.523  1.00 33.66  ? 1608 LEU A HB3    1 
ATOM   4065  H  HG     . LEU A 1 246  ? -19.813 -73.601 33.300  1.00 33.87  ? 1608 LEU A HG     1 
ATOM   4066  H  HD11   . LEU A 1 246  ? -17.642 -72.858 32.901  1.00 33.40  ? 1608 LEU A HD11   1 
ATOM   4067  H  HD12   . LEU A 1 246  ? -18.310 -73.393 31.563  1.00 33.40  ? 1608 LEU A HD12   1 
ATOM   4068  H  HD13   . LEU A 1 246  ? -18.201 -71.830 31.827  1.00 33.40  ? 1608 LEU A HD13   1 
ATOM   4069  H  HD21   . LEU A 1 246  ? -19.060 -71.901 34.695  1.00 33.48  ? 1608 LEU A HD21   1 
ATOM   4070  H  HD22   . LEU A 1 246  ? -19.610 -70.814 33.676  1.00 33.48  ? 1608 LEU A HD22   1 
ATOM   4071  H  HD23   . LEU A 1 246  ? -20.624 -71.752 34.461  1.00 33.48  ? 1608 LEU A HD23   1 
ATOM   4072  N  N      . ASN A 1 247  ? -23.425 -72.198 30.275  1.00 34.68  ? 1609 ASN A N      1 
ATOM   4073  C  CA     . ASN A 1 247  ? -24.318 -71.480 29.390  1.00 34.35  ? 1609 ASN A CA     1 
ATOM   4074  C  C      . ASN A 1 247  ? -25.717 -71.398 29.983  1.00 37.75  ? 1609 ASN A C      1 
ATOM   4075  O  O      . ASN A 1 247  ? -26.386 -70.370 29.873  1.00 39.94  ? 1609 ASN A O      1 
ATOM   4076  C  CB     . ASN A 1 247  ? -24.359 -72.146 28.019  1.00 34.60  ? 1609 ASN A CB     1 
ATOM   4077  C  CG     . ASN A 1 247  ? -25.191 -71.372 27.033  1.00 39.43  ? 1609 ASN A CG     1 
ATOM   4078  O  OD1    . ASN A 1 247  ? -25.042 -70.158 26.880  1.00 41.72  ? 1609 ASN A OD1    1 
ATOM   4079  N  ND2    . ASN A 1 247  ? -26.101 -72.069 26.375  1.00 42.46  ? 1609 ASN A ND2    1 
ATOM   4080  H  H      . ASN A 1 247  ? -23.175 -72.965 29.976  1.00 41.61  ? 1609 ASN A H      1 
ATOM   4081  H  HA     . ASN A 1 247  ? -23.987 -70.575 29.275  1.00 41.22  ? 1609 ASN A HA     1 
ATOM   4082  H  HB2    . ASN A 1 247  ? -23.456 -72.207 27.669  1.00 41.52  ? 1609 ASN A HB2    1 
ATOM   4083  H  HB3    . ASN A 1 247  ? -24.743 -73.032 28.108  1.00 41.52  ? 1609 ASN A HB3    1 
ATOM   4084  H  HD21   . ASN A 1 247  ? -26.606 -71.680 25.798  1.00 50.95  ? 1609 ASN A HD21   1 
ATOM   4085  H  HD22   . ASN A 1 247  ? -26.187 -72.912 26.523  1.00 50.95  ? 1609 ASN A HD22   1 
ATOM   4086  N  N      . ILE A 1 248  ? -26.163 -72.491 30.594  1.00 45.28  ? 1610 ILE A N      1 
ATOM   4087  C  CA     . ILE A 1 248  ? -27.457 -72.512 31.267  1.00 46.59  ? 1610 ILE A CA     1 
ATOM   4088  C  C      . ILE A 1 248  ? -27.462 -71.486 32.396  1.00 47.90  ? 1610 ILE A C      1 
ATOM   4089  O  O      . ILE A 1 248  ? -28.466 -70.815 32.634  1.00 45.38  ? 1610 ILE A O      1 
ATOM   4090  C  CB     . ILE A 1 248  ? -27.790 -73.902 31.846  1.00 46.88  ? 1610 ILE A CB     1 
ATOM   4091  C  CG1    . ILE A 1 248  ? -27.797 -74.965 30.737  1.00 47.38  ? 1610 ILE A CG1    1 
ATOM   4092  C  CG2    . ILE A 1 248  ? -29.110 -73.857 32.629  1.00 47.45  ? 1610 ILE A CG2    1 
ATOM   4093  C  CD1    . ILE A 1 248  ? -28.998 -74.909 29.809  1.00 47.58  ? 1610 ILE A CD1    1 
ATOM   4094  H  H      . ILE A 1 248  ? -25.734 -73.235 30.634  1.00 54.33  ? 1610 ILE A H      1 
ATOM   4095  H  HA     . ILE A 1 248  ? -28.151 -72.271 30.634  1.00 55.91  ? 1610 ILE A HA     1 
ATOM   4096  H  HB     . ILE A 1 248  ? -27.087 -74.136 32.472  1.00 56.26  ? 1610 ILE A HB     1 
ATOM   4097  H  HG12   . ILE A 1 248  ? -27.002 -74.851 30.193  1.00 56.86  ? 1610 ILE A HG12   1 
ATOM   4098  H  HG13   . ILE A 1 248  ? -27.786 -75.843 31.149  1.00 56.86  ? 1610 ILE A HG13   1 
ATOM   4099  H  HG21   . ILE A 1 248  ? -29.298 -74.741 32.982  1.00 56.94  ? 1610 ILE A HG21   1 
ATOM   4100  H  HG22   . ILE A 1 248  ? -29.024 -73.221 33.356  1.00 56.94  ? 1610 ILE A HG22   1 
ATOM   4101  H  HG23   . ILE A 1 248  ? -29.822 -73.581 32.031  1.00 56.94  ? 1610 ILE A HG23   1 
ATOM   4102  H  HD11   . ILE A 1 248  ? -28.917 -75.612 29.146  1.00 57.09  ? 1610 ILE A HD11   1 
ATOM   4103  H  HD12   . ILE A 1 248  ? -29.805 -75.037 30.331  1.00 57.09  ? 1610 ILE A HD12   1 
ATOM   4104  H  HD13   . ILE A 1 248  ? -29.019 -74.043 29.373  1.00 57.09  ? 1610 ILE A HD13   1 
ATOM   4105  N  N      . LEU A 1 249  ? -26.332 -71.387 33.093  1.00 29.04  ? 1611 LEU A N      1 
ATOM   4106  C  CA     . LEU A 1 249  ? -26.191 -70.486 34.231  1.00 28.77  ? 1611 LEU A CA     1 
ATOM   4107  C  C      . LEU A 1 249  ? -26.264 -69.031 33.794  1.00 27.90  ? 1611 LEU A C      1 
ATOM   4108  O  O      . LEU A 1 249  ? -27.045 -68.249 34.330  1.00 27.86  ? 1611 LEU A O      1 
ATOM   4109  C  CB     . LEU A 1 249  ? -24.870 -70.758 34.955  1.00 28.76  ? 1611 LEU A CB     1 
ATOM   4110  C  CG     . LEU A 1 249  ? -24.515 -69.841 36.124  1.00 28.51  ? 1611 LEU A CG     1 
ATOM   4111  C  CD1    . LEU A 1 249  ? -25.644 -69.779 37.132  1.00 29.11  ? 1611 LEU A CD1    1 
ATOM   4112  C  CD2    . LEU A 1 249  ? -23.240 -70.322 36.795  1.00 28.67  ? 1611 LEU A CD2    1 
ATOM   4113  H  H      . LEU A 1 249  ? -25.621 -71.841 32.922  1.00 34.85  ? 1611 LEU A H      1 
ATOM   4114  H  HA     . LEU A 1 249  ? -26.915 -70.649 34.855  1.00 34.52  ? 1611 LEU A HA     1 
ATOM   4115  H  HB2    . LEU A 1 249  ? -24.898 -71.664 35.300  1.00 34.51  ? 1611 LEU A HB2    1 
ATOM   4116  H  HB3    . LEU A 1 249  ? -24.152 -70.685 34.307  1.00 34.51  ? 1611 LEU A HB3    1 
ATOM   4117  H  HG     . LEU A 1 249  ? -24.360 -68.944 35.789  1.00 34.21  ? 1611 LEU A HG     1 
ATOM   4118  H  HD11   . LEU A 1 249  ? -25.386 -69.190 37.859  1.00 34.94  ? 1611 LEU A HD11   1 
ATOM   4119  H  HD12   . LEU A 1 249  ? -26.439 -69.436 36.695  1.00 34.94  ? 1611 LEU A HD12   1 
ATOM   4120  H  HD13   . LEU A 1 249  ? -25.812 -70.671 37.473  1.00 34.94  ? 1611 LEU A HD13   1 
ATOM   4121  H  HD21   . LEU A 1 249  ? -23.030 -69.730 37.534  1.00 34.41  ? 1611 LEU A HD21   1 
ATOM   4122  H  HD22   . LEU A 1 249  ? -23.377 -71.225 37.123  1.00 34.41  ? 1611 LEU A HD22   1 
ATOM   4123  H  HD23   . LEU A 1 249  ? -22.519 -70.311 36.147  1.00 34.41  ? 1611 LEU A HD23   1 
ATOM   4124  N  N      . ASP A 1 250  ? -25.452 -68.687 32.804  1.00 30.43  ? 1612 ASP A N      1 
ATOM   4125  C  CA     . ASP A 1 250  ? -25.374 -67.332 32.277  1.00 29.65  ? 1612 ASP A CA     1 
ATOM   4126  C  C      . ASP A 1 250  ? -26.749 -66.800 31.873  1.00 29.70  ? 1612 ASP A C      1 
ATOM   4127  O  O      . ASP A 1 250  ? -27.034 -65.613 32.032  1.00 29.30  ? 1612 ASP A O      1 
ATOM   4128  C  CB     . ASP A 1 250  ? -24.406 -67.305 31.087  1.00 29.17  ? 1612 ASP A CB     1 
ATOM   4129  C  CG     . ASP A 1 250  ? -24.249 -65.922 30.478  1.00 30.67  ? 1612 ASP A CG     1 
ATOM   4130  O  OD1    . ASP A 1 250  ? -24.524 -64.920 31.180  1.00 33.93  ? 1612 ASP A OD1    1 
ATOM   4131  O  OD2    . ASP A 1 250  ? -23.825 -65.842 29.302  1.00 31.32  1 1612 ASP A OD2    1 
ATOM   4132  H  H      . ASP A 1 250  ? -24.921 -69.237 32.411  1.00 36.52  ? 1612 ASP A H      1 
ATOM   4133  H  HA     . ASP A 1 250  ? -25.018 -66.748 32.965  1.00 35.58  ? 1612 ASP A HA     1 
ATOM   4134  H  HB2    . ASP A 1 250  ? -23.532 -67.601 31.384  1.00 35.01  ? 1612 ASP A HB2    1 
ATOM   4135  H  HB3    . ASP A 1 250  ? -24.740 -67.899 30.396  1.00 35.01  ? 1612 ASP A HB3    1 
ATOM   4136  N  N      . THR A 1 251  ? -27.598 -67.681 31.350  1.00 43.03  ? 1613 THR A N      1 
ATOM   4137  C  CA     . THR A 1 251  ? -28.934 -67.287 30.919  1.00 43.18  ? 1613 THR A CA     1 
ATOM   4138  C  C      . THR A 1 251  ? -29.862 -67.173 32.120  1.00 43.65  ? 1613 THR A C      1 
ATOM   4139  O  O      . THR A 1 251  ? -30.744 -66.319 32.155  1.00 47.57  ? 1613 THR A O      1 
ATOM   4140  C  CB     . THR A 1 251  ? -29.541 -68.301 29.930  1.00 43.71  ? 1613 THR A CB     1 
ATOM   4141  O  OG1    . THR A 1 251  ? -28.660 -68.485 28.819  1.00 43.38  ? 1613 THR A OG1    1 
ATOM   4142  C  CG2    . THR A 1 251  ? -30.928 -67.856 29.453  1.00 43.88  ? 1613 THR A CG2    1 
ATOM   4143  H  H      . THR A 1 251  ? -27.422 -68.515 31.235  1.00 51.64  ? 1613 THR A H      1 
ATOM   4144  H  HA     . THR A 1 251  ? -28.889 -66.422 30.482  1.00 51.82  ? 1613 THR A HA     1 
ATOM   4145  H  HB     . THR A 1 251  ? -29.647 -69.151 30.385  1.00 52.45  ? 1613 THR A HB     1 
ATOM   4146  H  HG1    . THR A 1 251  ? -27.917 -68.774 29.086  1.00 52.05  ? 1613 THR A HG1    1 
ATOM   4147  H  HG21   . THR A 1 251  ? -31.290 -68.508 28.833  1.00 52.66  ? 1613 THR A HG21   1 
ATOM   4148  H  HG22   . THR A 1 251  ? -31.528 -67.774 30.210  1.00 52.66  ? 1613 THR A HG22   1 
ATOM   4149  H  HG23   . THR A 1 251  ? -30.865 -66.997 29.006  1.00 52.66  ? 1613 THR A HG23   1 
ATOM   4150  N  N      . GLU A 1 252  ? -29.664 -68.042 33.106  1.00 31.04  ? 1614 GLU A N      1 
ATOM   4151  C  CA     . GLU A 1 252  ? -30.567 -68.102 34.244  1.00 31.66  ? 1614 GLU A CA     1 
ATOM   4152  C  C      . GLU A 1 252  ? -30.322 -66.960 35.232  1.00 31.30  ? 1614 GLU A C      1 
ATOM   4153  O  O      . GLU A 1 252  ? -31.237 -66.577 35.956  1.00 31.66  ? 1614 GLU A O      1 
ATOM   4154  C  CB     . GLU A 1 252  ? -30.452 -69.458 34.945  1.00 32.51  ? 1614 GLU A CB     1 
ATOM   4155  C  CG     . GLU A 1 252  ? -31.731 -69.908 35.659  1.00 33.43  ? 1614 GLU A CG     1 
ATOM   4156  C  CD     . GLU A 1 252  ? -32.885 -70.194 34.704  1.00 33.74  ? 1614 GLU A CD     1 
ATOM   4157  O  OE1    . GLU A 1 252  ? -32.626 -70.521 33.523  1.00 33.51  ? 1614 GLU A OE1    1 
ATOM   4158  O  OE2    . GLU A 1 252  ? -34.054 -70.108 35.145  1.00 34.29  1 1614 GLU A OE2    1 
ATOM   4159  H  H      . GLU A 1 252  ? -29.016 -68.606 33.138  1.00 37.24  ? 1614 GLU A H      1 
ATOM   4160  H  HA     . GLU A 1 252  ? -31.478 -68.016 33.920  1.00 37.99  ? 1614 GLU A HA     1 
ATOM   4161  H  HB2    . GLU A 1 252  ? -30.231 -70.132 34.283  1.00 39.02  ? 1614 GLU A HB2    1 
ATOM   4162  H  HB3    . GLU A 1 252  ? -29.746 -69.406 35.608  1.00 39.02  ? 1614 GLU A HB3    1 
ATOM   4163  H  HG2    . GLU A 1 252  ? -31.545 -70.721 36.154  1.00 40.12  ? 1614 GLU A HG2    1 
ATOM   4164  H  HG3    . GLU A 1 252  ? -32.014 -69.208 36.268  1.00 40.12  ? 1614 GLU A HG3    1 
ATOM   4165  N  N      . ILE A 1 253  ? -29.108 -66.409 35.272  1.00 27.89  ? 1615 ILE A N      1 
ATOM   4166  C  CA     . ILE A 1 253  ? -28.860 -65.265 36.147  1.00 27.58  ? 1615 ILE A CA     1 
ATOM   4167  C  C      . ILE A 1 253  ? -29.621 -64.059 35.581  1.00 27.17  ? 1615 ILE A C      1 
ATOM   4168  O  O      . ILE A 1 253  ? -30.227 -63.302 36.339  1.00 27.32  ? 1615 ILE A O      1 
ATOM   4169  C  CB     . ILE A 1 253  ? -27.341 -64.948 36.339  1.00 27.05  ? 1615 ILE A CB     1 
ATOM   4170  C  CG1    . ILE A 1 253  ? -26.688 -64.555 35.012  1.00 26.32  ? 1615 ILE A CG1    1 
ATOM   4171  C  CG2    . ILE A 1 253  ? -26.603 -66.156 36.892  1.00 27.53  ? 1615 ILE A CG2    1 
ATOM   4172  C  CD1    . ILE A 1 253  ? -25.213 -64.170 35.113  1.00 25.80  ? 1615 ILE A CD1    1 
ATOM   4173  H  H      . ILE A 1 253  ? -28.428 -66.672 34.815  1.00 33.47  ? 1615 ILE A H      1 
ATOM   4174  H  HA     . ILE A 1 253  ? -29.230 -65.460 37.022  1.00 33.10  ? 1615 ILE A HA     1 
ATOM   4175  H  HB     . ILE A 1 253  ? -27.250 -64.212 36.964  1.00 32.46  ? 1615 ILE A HB     1 
ATOM   4176  H  HG12   . ILE A 1 253  ? -26.754 -65.306 34.401  1.00 31.58  ? 1615 ILE A HG12   1 
ATOM   4177  H  HG13   . ILE A 1 253  ? -27.166 -63.794 34.646  1.00 31.58  ? 1615 ILE A HG13   1 
ATOM   4178  H  HG21   . ILE A 1 253  ? -25.666 -65.931 37.000  1.00 33.03  ? 1615 ILE A HG21   1 
ATOM   4179  H  HG22   . ILE A 1 253  ? -26.988 -66.395 37.749  1.00 33.03  ? 1615 ILE A HG22   1 
ATOM   4180  H  HG23   . ILE A 1 253  ? -26.696 -66.894 36.270  1.00 33.03  ? 1615 ILE A HG23   1 
ATOM   4181  H  HD11   . ILE A 1 253  ? -24.886 -63.938 34.229  1.00 30.96  ? 1615 ILE A HD11   1 
ATOM   4182  H  HD12   . ILE A 1 253  ? -25.126 -63.409 35.709  1.00 30.96  ? 1615 ILE A HD12   1 
ATOM   4183  H  HD13   . ILE A 1 253  ? -24.713 -64.924 35.463  1.00 30.96  ? 1615 ILE A HD13   1 
ATOM   4184  N  N      . LYS A 1 254  ? -29.603 -63.883 34.259  1.00 26.73  ? 1616 LYS A N      1 
ATOM   4185  C  CA     . LYS A 1 254  ? -30.365 -62.803 33.625  1.00 26.44  ? 1616 LYS A CA     1 
ATOM   4186  C  C      . LYS A 1 254  ? -31.860 -62.996 33.852  1.00 27.07  ? 1616 LYS A C      1 
ATOM   4187  O  O      . LYS A 1 254  ? -32.566 -62.065 34.235  1.00 27.11  ? 1616 LYS A O      1 
ATOM   4188  C  CB     . LYS A 1 254  ? -30.103 -62.730 32.122  1.00 26.00  ? 1616 LYS A CB     1 
ATOM   4189  C  CG     . LYS A 1 254  ? -28.678 -62.445 31.706  1.00 25.38  ? 1616 LYS A CG     1 
ATOM   4190  C  CD     . LYS A 1 254  ? -28.603 -62.410 30.188  1.00 25.10  ? 1616 LYS A CD     1 
ATOM   4191  C  CE     . LYS A 1 254  ? -27.226 -62.745 29.652  1.00 24.74  ? 1616 LYS A CE     1 
ATOM   4192  N  NZ     . LYS A 1 254  ? -27.345 -63.310 28.283  1.00 24.83  1 1616 LYS A NZ     1 
ATOM   4193  H  H      . LYS A 1 254  ? -29.160 -64.373 33.708  1.00 32.08  ? 1616 LYS A H      1 
ATOM   4194  H  HA     . LYS A 1 254  ? -30.105 -61.956 34.019  1.00 31.72  ? 1616 LYS A HA     1 
ATOM   4195  H  HB2    . LYS A 1 254  ? -30.354 -63.580 31.728  1.00 31.20  ? 1616 LYS A HB2    1 
ATOM   4196  H  HB3    . LYS A 1 254  ? -30.658 -62.027 31.750  1.00 31.20  ? 1616 LYS A HB3    1 
ATOM   4197  H  HG2    . LYS A 1 254  ? -28.402 -61.581 32.051  1.00 30.45  ? 1616 LYS A HG2    1 
ATOM   4198  H  HG3    . LYS A 1 254  ? -28.094 -63.148 32.031  1.00 30.45  ? 1616 LYS A HG3    1 
ATOM   4199  H  HD2    . LYS A 1 254  ? -29.229 -63.057 29.827  1.00 30.12  ? 1616 LYS A HD2    1 
ATOM   4200  H  HD3    . LYS A 1 254  ? -28.834 -61.519 29.882  1.00 30.12  ? 1616 LYS A HD3    1 
ATOM   4201  H  HE2    . LYS A 1 254  ? -26.688 -61.938 29.609  1.00 29.69  ? 1616 LYS A HE2    1 
ATOM   4202  H  HE3    . LYS A 1 254  ? -26.805 -63.405 30.225  1.00 29.69  ? 1616 LYS A HE3    1 
ATOM   4203  H  HZ1    . LYS A 1 254  ? -26.537 -63.508 27.965  1.00 29.79  ? 1616 LYS A HZ1    1 
ATOM   4204  H  HZ2    . LYS A 1 254  ? -27.838 -64.051 28.302  1.00 29.79  ? 1616 LYS A HZ2    1 
ATOM   4205  H  HZ3    . LYS A 1 254  ? -27.732 -62.718 27.743  1.00 29.79  ? 1616 LYS A HZ3    1 
ATOM   4206  N  N      . LEU A 1 255  ? -32.333 -64.215 33.604  1.00 27.63  ? 1617 LEU A N      1 
ATOM   4207  C  CA     . LEU A 1 255  ? -33.733 -64.560 33.806  1.00 28.34  ? 1617 LEU A CA     1 
ATOM   4208  C  C      . LEU A 1 255  ? -34.130 -64.352 35.254  1.00 28.81  ? 1617 LEU A C      1 
ATOM   4209  O  O      . LEU A 1 255  ? -35.262 -63.976 35.550  1.00 29.21  ? 1617 LEU A O      1 
ATOM   4210  C  CB     . LEU A 1 255  ? -34.003 -66.014 33.416  1.00 28.97  ? 1617 LEU A CB     1 
ATOM   4211  C  CG     . LEU A 1 255  ? -34.509 -66.312 32.007  1.00 28.98  ? 1617 LEU A CG     1 
ATOM   4212  C  CD1    . LEU A 1 255  ? -34.563 -67.821 31.815  1.00 29.68  ? 1617 LEU A CD1    1 
ATOM   4213  C  CD2    . LEU A 1 255  ? -35.870 -65.690 31.759  1.00 29.21  ? 1617 LEU A CD2    1 
ATOM   4214  H  H      . LEU A 1 255  ? -31.854 -64.868 33.314  1.00 33.16  ? 1617 LEU A H      1 
ATOM   4215  H  HA     . LEU A 1 255  ? -34.287 -63.988 33.253  1.00 34.01  ? 1617 LEU A HA     1 
ATOM   4216  H  HB2    . LEU A 1 255  ? -33.176 -66.508 33.527  1.00 34.76  ? 1617 LEU A HB2    1 
ATOM   4217  H  HB3    . LEU A 1 255  ? -34.665 -66.366 34.031  1.00 34.76  ? 1617 LEU A HB3    1 
ATOM   4218  H  HG     . LEU A 1 255  ? -33.886 -65.946 31.360  1.00 34.78  ? 1617 LEU A HG     1 
ATOM   4219  H  HD11   . LEU A 1 255  ? -34.884 -68.013 30.920  1.00 35.61  ? 1617 LEU A HD11   1 
ATOM   4220  H  HD12   . LEU A 1 255  ? -33.671 -68.185 31.933  1.00 35.61  ? 1617 LEU A HD12   1 
ATOM   4221  H  HD13   . LEU A 1 255  ? -35.166 -68.201 32.472  1.00 35.61  ? 1617 LEU A HD13   1 
ATOM   4222  H  HD21   . LEU A 1 255  ? -36.154 -65.902 30.856  1.00 35.06  ? 1617 LEU A HD21   1 
ATOM   4223  H  HD22   . LEU A 1 255  ? -36.504 -66.051 32.399  1.00 35.06  ? 1617 LEU A HD22   1 
ATOM   4224  H  HD23   . LEU A 1 255  ? -35.802 -64.728 31.867  1.00 35.06  ? 1617 LEU A HD23   1 
ATOM   4225  N  N      . SER A 1 256  ? -33.193 -64.611 36.157  1.00 33.43  ? 1618 SER A N      1 
ATOM   4226  C  CA     . SER A 1 256  ? -33.464 -64.481 37.576  1.00 33.96  ? 1618 SER A CA     1 
ATOM   4227  C  C      . SER A 1 256  ? -33.551 -63.011 37.977  1.00 33.58  ? 1618 SER A C      1 
ATOM   4228  O  O      . SER A 1 256  ? -34.488 -62.616 38.669  1.00 34.07  ? 1618 SER A O      1 
ATOM   4229  C  CB     . SER A 1 256  ? -32.399 -65.197 38.401  1.00 34.16  ? 1618 SER A CB     1 
ATOM   4230  O  OG     . SER A 1 256  ? -32.811 -65.315 39.750  1.00 35.08  ? 1618 SER A OG     1 
ATOM   4231  H  H      . SER A 1 256  ? -32.393 -64.865 35.971  1.00 40.12  ? 1618 SER A H      1 
ATOM   4232  H  HA     . SER A 1 256  ? -34.320 -64.894 37.771  1.00 40.76  ? 1618 SER A HA     1 
ATOM   4233  H  HB2    . SER A 1 256  ? -32.258 -66.085 38.035  1.00 41.00  ? 1618 SER A HB2    1 
ATOM   4234  H  HB3    . SER A 1 256  ? -31.574 -64.688 38.365  1.00 41.00  ? 1618 SER A HB3    1 
ATOM   4235  H  HG     . SER A 1 256  ? -32.220 -65.710 40.198  1.00 42.09  ? 1618 SER A HG     1 
ATOM   4236  N  N      . VAL A 1 257  ? -32.582 -62.204 37.548  1.00 28.17  ? 1619 VAL A N      1 
ATOM   4237  C  CA     . VAL A 1 257  ? -32.654 -60.759 37.751  1.00 27.81  ? 1619 VAL A CA     1 
ATOM   4238  C  C      . VAL A 1 257  ? -33.984 -60.208 37.255  1.00 27.98  ? 1619 VAL A C      1 
ATOM   4239  O  O      . VAL A 1 257  ? -34.642 -59.449 37.962  1.00 28.28  ? 1619 VAL A O      1 
ATOM   4240  C  CB     . VAL A 1 257  ? -31.500 -60.016 37.050  1.00 26.95  ? 1619 VAL A CB     1 
ATOM   4241  C  CG1    . VAL A 1 257  ? -31.760 -58.509 37.016  1.00 26.65  ? 1619 VAL A CG1    1 
ATOM   4242  C  CG2    . VAL A 1 257  ? -30.190 -60.297 37.762  1.00 26.82  ? 1619 VAL A CG2    1 
ATOM   4243  H  H      . VAL A 1 257  ? -31.875 -62.468 37.137  1.00 33.81  ? 1619 VAL A H      1 
ATOM   4244  H  HA     . VAL A 1 257  ? -32.592 -60.574 38.701  1.00 33.38  ? 1619 VAL A HA     1 
ATOM   4245  H  HB     . VAL A 1 257  ? -31.424 -60.332 36.137  1.00 32.33  ? 1619 VAL A HB     1 
ATOM   4246  H  HG11   . VAL A 1 257  ? -31.018 -58.071 36.570  1.00 31.98  ? 1619 VAL A HG11   1 
ATOM   4247  H  HG12   . VAL A 1 257  ? -32.583 -58.342 36.531  1.00 31.98  ? 1619 VAL A HG12   1 
ATOM   4248  H  HG13   . VAL A 1 257  ? -31.839 -58.182 37.926  1.00 31.98  ? 1619 VAL A HG13   1 
ATOM   4249  H  HG21   . VAL A 1 257  ? -29.476 -59.822 37.308  1.00 32.19  ? 1619 VAL A HG21   1 
ATOM   4250  H  HG22   . VAL A 1 257  ? -30.258 -59.992 38.680  1.00 32.19  ? 1619 VAL A HG22   1 
ATOM   4251  H  HG23   . VAL A 1 257  ? -30.018 -61.251 37.741  1.00 32.19  ? 1619 VAL A HG23   1 
ATOM   4252  N  N      . PHE A 1 258  ? -34.375 -60.577 36.039  1.00 27.84  ? 1620 PHE A N      1 
ATOM   4253  C  CA     . PHE A 1 258  ? -35.657 -60.136 35.499  1.00 28.06  ? 1620 PHE A CA     1 
ATOM   4254  C  C      . PHE A 1 258  ? -36.829 -60.514 36.389  1.00 28.94  ? 1620 PHE A C      1 
ATOM   4255  O  O      . PHE A 1 258  ? -37.757 -59.729 36.573  1.00 29.18  ? 1620 PHE A O      1 
ATOM   4256  C  CB     . PHE A 1 258  ? -35.911 -60.724 34.116  1.00 27.95  ? 1620 PHE A CB     1 
ATOM   4257  C  CG     . PHE A 1 258  ? -37.356 -60.680 33.723  1.00 28.45  ? 1620 PHE A CG     1 
ATOM   4258  C  CD1    . PHE A 1 258  ? -37.942 -59.499 33.305  1.00 28.28  ? 1620 PHE A CD1    1 
ATOM   4259  C  CD2    . PHE A 1 258  ? -38.142 -61.816 33.816  1.00 29.18  ? 1620 PHE A CD2    1 
ATOM   4260  C  CE1    . PHE A 1 258  ? -39.281 -59.459 32.966  1.00 28.79  ? 1620 PHE A CE1    1 
ATOM   4261  C  CE2    . PHE A 1 258  ? -39.477 -61.783 33.477  1.00 29.70  ? 1620 PHE A CE2    1 
ATOM   4262  C  CZ     . PHE A 1 258  ? -40.051 -60.603 33.059  1.00 29.50  ? 1620 PHE A CZ     1 
ATOM   4263  H  H      . PHE A 1 258  ? -33.920 -61.078 35.509  1.00 33.41  ? 1620 PHE A H      1 
ATOM   4264  H  HA     . PHE A 1 258  ? -35.646 -59.170 35.415  1.00 33.68  ? 1620 PHE A HA     1 
ATOM   4265  H  HB2    . PHE A 1 258  ? -35.407 -60.217 33.460  1.00 33.55  ? 1620 PHE A HB2    1 
ATOM   4266  H  HB3    . PHE A 1 258  ? -35.627 -61.651 34.110  1.00 33.55  ? 1620 PHE A HB3    1 
ATOM   4267  H  HD1    . PHE A 1 258  ? -37.429 -58.726 33.246  1.00 33.93  ? 1620 PHE A HD1    1 
ATOM   4268  H  HD2    . PHE A 1 258  ? -37.761 -62.614 34.103  1.00 35.02  ? 1620 PHE A HD2    1 
ATOM   4269  H  HE1    . PHE A 1 258  ? -39.665 -58.662 32.679  1.00 34.55  ? 1620 PHE A HE1    1 
ATOM   4270  H  HE2    . PHE A 1 258  ? -39.992 -62.555 33.539  1.00 35.64  ? 1620 PHE A HE2    1 
ATOM   4271  H  HZ     . PHE A 1 258  ? -40.951 -60.580 32.825  1.00 35.40  ? 1620 PHE A HZ     1 
ATOM   4272  N  N      . THR A 1 259  ? -36.802 -61.726 36.923  1.00 29.49  ? 1621 THR A N      1 
ATOM   4273  C  CA     . THR A 1 259  ? -37.874 -62.177 37.795  1.00 30.43  ? 1621 THR A CA     1 
ATOM   4274  C  C      . THR A 1 259  ? -37.959 -61.297 39.027  1.00 30.64  ? 1621 THR A C      1 
ATOM   4275  O  O      . THR A 1 259  ? -39.022 -60.778 39.347  1.00 31.10  ? 1621 THR A O      1 
ATOM   4276  C  CB     . THR A 1 259  ? -37.694 -63.632 38.223  1.00 31.05  ? 1621 THR A CB     1 
ATOM   4277  O  OG1    . THR A 1 259  ? -37.693 -64.474 37.063  1.00 30.96  ? 1621 THR A OG1    1 
ATOM   4278  C  CG2    . THR A 1 259  ? -38.831 -64.051 39.139  1.00 32.10  ? 1621 THR A CG2    1 
ATOM   4279  H  H      . THR A 1 259  ? -36.178 -62.304 36.796  1.00 35.39  ? 1621 THR A H      1 
ATOM   4280  H  HA     . THR A 1 259  ? -38.716 -62.107 37.319  1.00 36.51  ? 1621 THR A HA     1 
ATOM   4281  H  HB     . THR A 1 259  ? -36.855 -63.731 38.701  1.00 37.25  ? 1621 THR A HB     1 
ATOM   4282  H  HG1    . THR A 1 259  ? -37.064 -64.256 36.551  1.00 37.15  ? 1621 THR A HG1    1 
ATOM   4283  H  HG21   . THR A 1 259  ? -38.715 -64.976 39.410  1.00 38.52  ? 1621 THR A HG21   1 
ATOM   4284  H  HG22   . THR A 1 259  ? -38.843 -63.490 39.931  1.00 38.52  ? 1621 THR A HG22   1 
ATOM   4285  H  HG23   . THR A 1 259  ? -39.679 -63.963 38.677  1.00 38.52  ? 1621 THR A HG23   1 
ATOM   4286  N  N      . GLN A 1 260  ? -36.841 -61.140 39.724  1.00 30.38  ? 1622 GLN A N      1 
ATOM   4287  C  CA     . GLN A 1 260  ? -36.808 -60.291 40.902  1.00 30.62  ? 1622 GLN A CA     1 
ATOM   4288  C  C      . GLN A 1 260  ? -37.275 -58.897 40.537  1.00 30.27  ? 1622 GLN A C      1 
ATOM   4289  O  O      . GLN A 1 260  ? -37.954 -58.241 41.320  1.00 30.76  ? 1622 GLN A O      1 
ATOM   4290  C  CB     . GLN A 1 260  ? -35.415 -60.249 41.513  1.00 30.29  ? 1622 GLN A CB     1 
ATOM   4291  C  CG     . GLN A 1 260  ? -34.965 -61.597 42.037  1.00 30.78  ? 1622 GLN A CG     1 
ATOM   4292  C  CD     . GLN A 1 260  ? -33.997 -61.496 43.197  1.00 30.94  ? 1622 GLN A CD     1 
ATOM   4293  O  OE1    . GLN A 1 260  ? -33.897 -60.461 43.856  1.00 30.91  ? 1622 GLN A OE1    1 
ATOM   4294  N  NE2    . GLN A 1 260  ? -33.282 -62.584 43.458  1.00 31.17  ? 1622 GLN A NE2    1 
ATOM   4295  H  H      . GLN A 1 260  ? -36.090 -61.514 39.534  1.00 36.46  ? 1622 GLN A H      1 
ATOM   4296  H  HA     . GLN A 1 260  ? -37.417 -60.648 41.566  1.00 36.74  ? 1622 GLN A HA     1 
ATOM   4297  H  HB2    . GLN A 1 260  ? -34.781 -59.963 40.837  1.00 36.35  ? 1622 GLN A HB2    1 
ATOM   4298  H  HB3    . GLN A 1 260  ? -35.414 -59.624 42.255  1.00 36.35  ? 1622 GLN A HB3    1 
ATOM   4299  H  HG2    . GLN A 1 260  ? -35.743 -62.092 42.340  1.00 36.94  ? 1622 GLN A HG2    1 
ATOM   4300  H  HG3    . GLN A 1 260  ? -34.524 -62.081 41.321  1.00 36.94  ? 1622 GLN A HG3    1 
ATOM   4301  H  HE21   . GLN A 1 260  ? -33.384 -63.291 42.980  1.00 37.40  ? 1622 GLN A HE21   1 
ATOM   4302  H  HE22   . GLN A 1 260  ? -32.716 -62.581 44.106  1.00 37.40  ? 1622 GLN A HE22   1 
ATOM   4303  N  N      . PHE A 1 261  ? -36.895 -58.436 39.353  1.00 29.49  ? 1623 PHE A N      1 
ATOM   4304  C  CA     . PHE A 1 261  ? -37.354 -57.142 38.886  1.00 29.21  ? 1623 PHE A CA     1 
ATOM   4305  C  C      . PHE A 1 261  ? -38.884 -57.069 38.844  1.00 29.87  ? 1623 PHE A C      1 
ATOM   4306  O  O      . PHE A 1 261  ? -39.463 -56.181 39.462  1.00 30.21  ? 1623 PHE A O      1 
ATOM   4307  C  CB     . PHE A 1 261  ? -36.765 -56.811 37.516  1.00 28.39  ? 1623 PHE A CB     1 
ATOM   4308  C  CG     . PHE A 1 261  ? -37.506 -55.732 36.795  1.00 28.27  ? 1623 PHE A CG     1 
ATOM   4309  C  CD1    . PHE A 1 261  ? -37.348 -54.407 37.150  1.00 28.13  ? 1623 PHE A CD1    1 
ATOM   4310  C  CD2    . PHE A 1 261  ? -38.358 -56.043 35.755  1.00 28.37  ? 1623 PHE A CD2    1 
ATOM   4311  C  CE1    . PHE A 1 261  ? -38.034 -53.417 36.488  1.00 28.10  ? 1623 PHE A CE1    1 
ATOM   4312  C  CE2    . PHE A 1 261  ? -39.044 -55.058 35.089  1.00 28.33  ? 1623 PHE A CE2    1 
ATOM   4313  C  CZ     . PHE A 1 261  ? -38.881 -53.744 35.453  1.00 28.19  ? 1623 PHE A CZ     1 
ATOM   4314  H  H      . PHE A 1 261  ? -36.376 -58.851 38.807  1.00 35.39  ? 1623 PHE A H      1 
ATOM   4315  H  HA     . PHE A 1 261  ? -37.047 -56.463 39.508  1.00 35.06  ? 1623 PHE A HA     1 
ATOM   4316  H  HB2    . PHE A 1 261  ? -35.848 -56.515 37.632  1.00 34.07  ? 1623 PHE A HB2    1 
ATOM   4317  H  HB3    . PHE A 1 261  ? -36.787 -57.608 36.964  1.00 34.07  ? 1623 PHE A HB3    1 
ATOM   4318  H  HD1    . PHE A 1 261  ? -36.777 -54.184 37.850  1.00 33.76  ? 1623 PHE A HD1    1 
ATOM   4319  H  HD2    . PHE A 1 261  ? -38.473 -56.932 35.506  1.00 34.04  ? 1623 PHE A HD2    1 
ATOM   4320  H  HE1    . PHE A 1 261  ? -37.921 -52.527 36.735  1.00 33.72  ? 1623 PHE A HE1    1 
ATOM   4321  H  HE2    . PHE A 1 261  ? -39.617 -55.280 34.391  1.00 33.99  ? 1623 PHE A HE2    1 
ATOM   4322  H  HZ     . PHE A 1 261  ? -39.344 -53.075 35.003  1.00 33.83  ? 1623 PHE A HZ     1 
ATOM   4323  N  N      . ARG A 1 262  ? -39.548 -57.986 38.140  1.00 40.71  ? 1624 ARG A N      1 
ATOM   4324  C  CA     . ARG A 1 262  ? -41.005 -57.884 38.009  1.00 41.34  ? 1624 ARG A CA     1 
ATOM   4325  C  C      . ARG A 1 262  ? -41.708 -58.112 39.343  1.00 42.27  ? 1624 ARG A C      1 
ATOM   4326  O  O      . ARG A 1 262  ? -42.732 -57.489 39.613  1.00 42.76  ? 1624 ARG A O      1 
ATOM   4327  C  CB     . ARG A 1 262  ? -41.568 -58.857 36.955  1.00 41.48  ? 1624 ARG A CB     1 
ATOM   4328  C  CG     . ARG A 1 262  ? -41.567 -60.341 37.330  1.00 42.03  ? 1624 ARG A CG     1 
ATOM   4329  C  CD     . ARG A 1 262  ? -42.610 -61.117 36.541  1.00 42.54  ? 1624 ARG A CD     1 
ATOM   4330  N  NE     . ARG A 1 262  ? -42.415 -62.562 36.639  1.00 42.97  ? 1624 ARG A NE     1 
ATOM   4331  C  CZ     . ARG A 1 262  ? -42.699 -63.300 37.708  1.00 43.91  ? 1624 ARG A CZ     1 
ATOM   4332  N  NH1    . ARG A 1 262  ? -43.158 -62.735 38.818  1.00 51.23  1 1624 ARG A NH1    1 
ATOM   4333  N  NH2    . ARG A 1 262  ? -42.489 -64.610 37.679  1.00 44.20  ? 1624 ARG A NH2    1 
ATOM   4334  H  H      . ARG A 1 262  ? -39.193 -58.658 37.739  1.00 48.86  ? 1624 ARG A H      1 
ATOM   4335  H  HA     . ARG A 1 262  ? -41.223 -56.985 37.718  1.00 49.61  ? 1624 ARG A HA     1 
ATOM   4336  H  HB2    . ARG A 1 262  ? -42.487 -58.608 36.772  1.00 49.78  ? 1624 ARG A HB2    1 
ATOM   4337  H  HB3    . ARG A 1 262  ? -41.043 -58.765 36.145  1.00 49.78  ? 1624 ARG A HB3    1 
ATOM   4338  H  HG2    . ARG A 1 262  ? -40.695 -60.720 37.135  1.00 50.44  ? 1624 ARG A HG2    1 
ATOM   4339  H  HG3    . ARG A 1 262  ? -41.769 -60.433 38.274  1.00 50.44  ? 1624 ARG A HG3    1 
ATOM   4340  H  HD2    . ARG A 1 262  ? -43.492 -60.908 36.888  1.00 51.04  ? 1624 ARG A HD2    1 
ATOM   4341  H  HD3    . ARG A 1 262  ? -42.552 -60.868 35.605  1.00 51.04  ? 1624 ARG A HD3    1 
ATOM   4342  H  HE     . ARG A 1 262  ? -42.090 -62.966 35.952  1.00 51.56  ? 1624 ARG A HE     1 
ATOM   4343  H  HH11   . ARG A 1 262  ? -43.296 -61.887 38.843  1.00 61.48  ? 1624 ARG A HH11   1 
ATOM   4344  H  HH12   . ARG A 1 262  ? -43.332 -63.220 39.507  1.00 61.48  ? 1624 ARG A HH12   1 
ATOM   4345  H  HH21   . ARG A 1 262  ? -42.183 -64.981 36.966  1.00 53.04  ? 1624 ARG A HH21   1 
ATOM   4346  H  HH22   . ARG A 1 262  ? -42.660 -65.089 38.373  1.00 53.04  ? 1624 ARG A HH22   1 
ATOM   4347  N  N      . ASP A 1 263  ? -41.168 -59.000 40.171  1.00 31.97  ? 1625 ASP A N      1 
ATOM   4348  C  CA     . ASP A 1 263  ? -41.786 -59.303 41.458  1.00 32.95  ? 1625 ASP A CA     1 
ATOM   4349  C  C      . ASP A 1 263  ? -41.801 -58.047 42.309  1.00 33.04  ? 1625 ASP A C      1 
ATOM   4350  O  O      . ASP A 1 263  ? -42.850 -57.598 42.765  1.00 33.70  ? 1625 ASP A O      1 
ATOM   4351  C  CB     . ASP A 1 263  ? -41.034 -60.416 42.196  1.00 33.26  ? 1625 ASP A CB     1 
ATOM   4352  C  CG     . ASP A 1 263  ? -41.339 -61.802 41.657  1.00 33.61  ? 1625 ASP A CG     1 
ATOM   4353  O  OD1    . ASP A 1 263  ? -42.399 -61.992 41.030  1.00 33.93  ? 1625 ASP A OD1    1 
ATOM   4354  O  OD2    . ASP A 1 263  ? -40.526 -62.719 41.886  1.00 33.64  1 1625 ASP A OD2    1 
ATOM   4355  H  H      . ASP A 1 263  ? -40.447 -59.440 40.013  1.00 38.36  ? 1625 ASP A H      1 
ATOM   4356  H  HA     . ASP A 1 263  ? -42.702 -59.591 41.318  1.00 39.54  ? 1625 ASP A HA     1 
ATOM   4357  H  HB2    . ASP A 1 263  ? -40.080 -60.263 42.106  1.00 39.91  ? 1625 ASP A HB2    1 
ATOM   4358  H  HB3    . ASP A 1 263  ? -41.285 -60.397 43.133  1.00 39.91  ? 1625 ASP A HB3    1 
ATOM   4359  N  N      . CYS A 1 264  ? -40.616 -57.484 42.506  1.00 33.56  ? 1626 CYS A N      1 
ATOM   4360  C  CA     . CYS A 1 264  ? -40.435 -56.287 43.313  1.00 33.63  ? 1626 CYS A CA     1 
ATOM   4361  C  C      . CYS A 1 264  ? -41.179 -55.079 42.776  1.00 33.50  ? 1626 CYS A C      1 
ATOM   4362  O  O      . CYS A 1 264  ? -41.757 -54.307 43.538  1.00 41.37  ? 1626 CYS A O      1 
ATOM   4363  C  CB     . CYS A 1 264  ? -38.954 -55.949 43.401  1.00 32.90  ? 1626 CYS A CB     1 
ATOM   4364  S  SG     . CYS A 1 264  ? -38.639 -54.304 44.025  1.00 32.82  ? 1626 CYS A SG     1 
ATOM   4365  H  H      . CYS A 1 264  ? -39.883 -57.787 42.173  1.00 40.27  ? 1626 CYS A H      1 
ATOM   4366  H  HA     . CYS A 1 264  ? -40.756 -56.461 44.211  1.00 40.35  ? 1626 CYS A HA     1 
ATOM   4367  H  HB2    . CYS A 1 264  ? -38.523 -56.582 43.997  1.00 39.48  ? 1626 CYS A HB2    1 
ATOM   4368  H  HB3    . CYS A 1 264  ? -38.565 -56.011 42.515  1.00 39.48  ? 1626 CYS A HB3    1 
ATOM   4369  H  HG     . CYS A 1 264  ? -39.154 -53.504 43.295  1.00 39.39  ? 1626 CYS A HG     1 
ATOM   4370  N  N      . LEU A 1 265  ? -41.131 -54.898 41.463  1.00 42.12  ? 1627 LEU A N      1 
ATOM   4371  C  CA     . LEU A 1 265  ? -41.797 -53.777 40.826  1.00 42.01  ? 1627 LEU A CA     1 
ATOM   4372  C  C      . LEU A 1 265  ? -43.309 -53.877 40.984  1.00 42.86  ? 1627 LEU A C      1 
ATOM   4373  O  O      . LEU A 1 265  ? -43.988 -52.875 41.198  1.00 43.20  ? 1627 LEU A O      1 
ATOM   4374  C  CB     . LEU A 1 265  ? -41.414 -53.703 39.352  1.00 41.18  ? 1627 LEU A CB     1 
ATOM   4375  C  CG     . LEU A 1 265  ? -42.092 -52.603 38.537  1.00 41.09  ? 1627 LEU A CG     1 
ATOM   4376  C  CD1    . LEU A 1 265  ? -41.745 -51.231 39.098  1.00 41.04  ? 1627 LEU A CD1    1 
ATOM   4377  C  CD2    . LEU A 1 265  ? -41.663 -52.711 37.083  1.00 40.36  ? 1627 LEU A CD2    1 
ATOM   4378  H  H      . LEU A 1 265  ? -40.715 -55.417 40.917  1.00 50.54  ? 1627 LEU A H      1 
ATOM   4379  H  HA     . LEU A 1 265  ? -41.506 -52.955 41.251  1.00 50.41  ? 1627 LEU A HA     1 
ATOM   4380  H  HB2    . LEU A 1 265  ? -40.456 -53.558 39.293  1.00 49.42  ? 1627 LEU A HB2    1 
ATOM   4381  H  HB3    . LEU A 1 265  ? -41.637 -54.551 38.936  1.00 49.42  ? 1627 LEU A HB3    1 
ATOM   4382  H  HG     . LEU A 1 265  ? -43.055 -52.717 38.581  1.00 49.31  ? 1627 LEU A HG     1 
ATOM   4383  H  HD11   . LEU A 1 265  ? -42.186 -50.552 38.565  1.00 49.25  ? 1627 LEU A HD11   1 
ATOM   4384  H  HD12   . LEU A 1 265  ? -42.049 -51.180 40.017  1.00 49.25  ? 1627 LEU A HD12   1 
ATOM   4385  H  HD13   . LEU A 1 265  ? -40.783 -51.110 39.060  1.00 49.25  ? 1627 LEU A HD13   1 
ATOM   4386  H  HD21   . LEU A 1 265  ? -42.098 -52.010 36.573  1.00 48.44  ? 1627 LEU A HD21   1 
ATOM   4387  H  HD22   . LEU A 1 265  ? -40.700 -52.610 37.031  1.00 48.44  ? 1627 LEU A HD22   1 
ATOM   4388  H  HD23   . LEU A 1 265  ? -41.924 -53.580 36.741  1.00 48.44  ? 1627 LEU A HD23   1 
ATOM   4389  N  N      . GLY A 1 266  ? -43.834 -55.093 40.874  1.00 42.01  ? 1628 GLY A N      1 
ATOM   4390  C  CA     . GLY A 1 266  ? -45.250 -55.327 41.079  1.00 42.91  ? 1628 GLY A CA     1 
ATOM   4391  C  C      . GLY A 1 266  ? -45.652 -55.073 42.519  1.00 43.79  ? 1628 GLY A C      1 
ATOM   4392  O  O      . GLY A 1 266  ? -46.780 -54.667 42.792  1.00 44.50  ? 1628 GLY A O      1 
ATOM   4393  H  H      . GLY A 1 266  ? -43.385 -55.801 40.680  1.00 50.41  ? 1628 GLY A H      1 
ATOM   4394  H  HA2    . GLY A 1 266  ? -45.764 -54.738 40.505  1.00 51.49  ? 1628 GLY A HA2    1 
ATOM   4395  H  HA3    . GLY A 1 266  ? -45.465 -56.246 40.854  1.00 51.49  ? 1628 GLY A HA3    1 
ATOM   4396  N  N      . GLN A 1 267  ? -44.729 -55.311 43.445  1.00 41.22  ? 1629 GLN A N      1 
ATOM   4397  C  CA     . GLN A 1 267  ? -44.999 -55.067 44.853  1.00 42.10  ? 1629 GLN A CA     1 
ATOM   4398  C  C      . GLN A 1 267  ? -45.152 -53.565 45.050  1.00 42.07  ? 1629 GLN A C      1 
ATOM   4399  O  O      . GLN A 1 267  ? -46.144 -53.104 45.613  1.00 42.90  ? 1629 GLN A O      1 
ATOM   4400  C  CB     . GLN A 1 267  ? -43.883 -55.639 45.742  1.00 42.11  ? 1629 GLN A CB     1 
ATOM   4401  C  CG     . GLN A 1 267  ? -44.393 -56.417 46.965  1.00 43.29  ? 1629 GLN A CG     1 
ATOM   4402  C  CD     . GLN A 1 267  ? -43.316 -57.260 47.635  1.00 43.32  ? 1629 GLN A CD     1 
ATOM   4403  O  OE1    . GLN A 1 267  ? -42.238 -57.467 47.080  1.00 42.44  ? 1629 GLN A OE1    1 
ATOM   4404  N  NE2    . GLN A 1 267  ? -43.611 -57.755 48.835  1.00 44.40  ? 1629 GLN A NE2    1 
ATOM   4405  H  H      . GLN A 1 267  ? -43.940 -55.612 43.282  1.00 49.47  ? 1629 GLN A H      1 
ATOM   4406  H  HA     . GLN A 1 267  ? -45.835 -55.494 45.099  1.00 50.52  ? 1629 GLN A HA     1 
ATOM   4407  H  HB2    . GLN A 1 267  ? -43.341 -56.244 45.211  1.00 50.53  ? 1629 GLN A HB2    1 
ATOM   4408  H  HB3    . GLN A 1 267  ? -43.335 -54.906 46.064  1.00 50.53  ? 1629 GLN A HB3    1 
ATOM   4409  H  HG2    . GLN A 1 267  ? -44.728 -55.786 47.621  1.00 51.95  ? 1629 GLN A HG2    1 
ATOM   4410  H  HG3    . GLN A 1 267  ? -45.106 -57.012 46.684  1.00 51.95  ? 1629 GLN A HG3    1 
ATOM   4411  H  HE21   . GLN A 1 267  ? -44.377 -57.592 49.191  1.00 53.28  ? 1629 GLN A HE21   1 
ATOM   4412  H  HE22   . GLN A 1 267  ? -43.036 -58.238 49.254  1.00 53.28  ? 1629 GLN A HE22   1 
ATOM   4413  N  N      . LEU A 1 268  ? -44.173 -52.805 44.564  1.00 34.54  ? 1630 LEU A N      1 
ATOM   4414  C  CA     . LEU A 1 268  ? -44.190 -51.345 44.666  1.00 34.49  ? 1630 LEU A CA     1 
ATOM   4415  C  C      . LEU A 1 268  ? -45.397 -50.750 43.967  1.00 34.73  ? 1630 LEU A C      1 
ATOM   4416  O  O      . LEU A 1 268  ? -45.921 -49.717 44.383  1.00 35.21  ? 1630 LEU A O      1 
ATOM   4417  C  CB     . LEU A 1 268  ? -42.921 -50.746 44.062  1.00 33.46  ? 1630 LEU A CB     1 
ATOM   4418  C  CG     . LEU A 1 268  ? -41.600 -51.119 44.720  1.00 33.16  ? 1630 LEU A CG     1 
ATOM   4419  C  CD1    . LEU A 1 268  ? -40.457 -50.527 43.933  1.00 32.16  ? 1630 LEU A CD1    1 
ATOM   4420  C  CD2    . LEU A 1 268  ? -41.573 -50.631 46.152  1.00 33.95  ? 1630 LEU A CD2    1 
ATOM   4421  H  H      . LEU A 1 268  ? -43.477 -53.115 44.165  1.00 41.45  ? 1630 LEU A H      1 
ATOM   4422  H  HA     . LEU A 1 268  ? -44.228 -51.093 45.602  1.00 41.38  ? 1630 LEU A HA     1 
ATOM   4423  H  HB2    . LEU A 1 268  ? -42.867 -51.025 43.134  1.00 40.15  ? 1630 LEU A HB2    1 
ATOM   4424  H  HB3    . LEU A 1 268  ? -42.997 -49.779 44.100  1.00 40.15  ? 1630 LEU A HB3    1 
ATOM   4425  H  HG     . LEU A 1 268  ? -41.503 -52.084 44.723  1.00 39.80  ? 1630 LEU A HG     1 
ATOM   4426  H  HD11   . LEU A 1 268  ? -39.621 -50.771 44.360  1.00 38.59  ? 1630 LEU A HD11   1 
ATOM   4427  H  HD12   . LEU A 1 268  ? -40.482 -50.879 43.029  1.00 38.59  ? 1630 LEU A HD12   1 
ATOM   4428  H  HD13   . LEU A 1 268  ? -40.552 -49.562 43.916  1.00 38.59  ? 1630 LEU A HD13   1 
ATOM   4429  H  HD21   . LEU A 1 268  ? -40.725 -50.878 46.553  1.00 40.74  ? 1630 LEU A HD21   1 
ATOM   4430  H  HD22   . LEU A 1 268  ? -41.674 -49.667 46.159  1.00 40.74  ? 1630 LEU A HD22   1 
ATOM   4431  H  HD23   . LEU A 1 268  ? -42.303 -51.044 46.640  1.00 40.74  ? 1630 LEU A HD23   1 
ATOM   4432  N  N      . LYS A 1 269  ? -45.827 -51.399 42.893  1.00 42.80  ? 1631 LYS A N      1 
ATOM   4433  C  CA     . LYS A 1 269  ? -47.039 -50.995 42.206  1.00 43.13  ? 1631 LYS A CA     1 
ATOM   4434  C  C      . LYS A 1 269  ? -48.247 -51.185 43.117  1.00 47.76  ? 1631 LYS A C      1 
ATOM   4435  O  O      . LYS A 1 269  ? -49.133 -50.333 43.167  1.00 49.95  ? 1631 LYS A O      1 
ATOM   4436  C  CB     . LYS A 1 269  ? -47.214 -51.783 40.902  1.00 45.25  ? 1631 LYS A CB     1 
ATOM   4437  C  CG     . LYS A 1 269  ? -46.309 -51.324 39.769  1.00 47.24  ? 1631 LYS A CG     1 
ATOM   4438  C  CD     . LYS A 1 269  ? -46.675 -49.927 39.330  1.00 48.64  ? 1631 LYS A CD     1 
ATOM   4439  C  CE     . LYS A 1 269  ? -45.955 -49.510 38.068  1.00 48.88  ? 1631 LYS A CE     1 
ATOM   4440  N  NZ     . LYS A 1 269  ? -46.481 -50.156 36.826  1.00 48.46  1 1631 LYS A NZ     1 
ATOM   4441  H  H      . LYS A 1 269  ? -45.432 -52.078 42.542  1.00 51.36  ? 1631 LYS A H      1 
ATOM   4442  H  HA     . LYS A 1 269  ? -46.977 -50.053 41.982  1.00 51.75  ? 1631 LYS A HA     1 
ATOM   4443  H  HB2    . LYS A 1 269  ? -47.020 -52.717 41.075  1.00 54.30  ? 1631 LYS A HB2    1 
ATOM   4444  H  HB3    . LYS A 1 269  ? -48.132 -51.689 40.603  1.00 54.30  ? 1631 LYS A HB3    1 
ATOM   4445  H  HG2    . LYS A 1 269  ? -45.388 -51.318 40.073  1.00 56.69  ? 1631 LYS A HG2    1 
ATOM   4446  H  HG3    . LYS A 1 269  ? -46.412 -51.920 39.011  1.00 56.69  ? 1631 LYS A HG3    1 
ATOM   4447  H  HD2    . LYS A 1 269  ? -47.629 -49.888 39.158  1.00 58.36  ? 1631 LYS A HD2    1 
ATOM   4448  H  HD3    . LYS A 1 269  ? -46.438 -49.301 40.032  1.00 58.36  ? 1631 LYS A HD3    1 
ATOM   4449  H  HE2    . LYS A 1 269  ? -46.041 -48.550 37.962  1.00 58.65  ? 1631 LYS A HE2    1 
ATOM   4450  H  HE3    . LYS A 1 269  ? -45.018 -49.748 38.151  1.00 58.65  ? 1631 LYS A HE3    1 
ATOM   4451  H  HZ1    . LYS A 1 269  ? -46.020 -49.875 36.119  1.00 58.15  ? 1631 LYS A HZ1    1 
ATOM   4452  H  HZ2    . LYS A 1 269  ? -46.404 -51.041 36.888  1.00 58.15  ? 1631 LYS A HZ2    1 
ATOM   4453  H  HZ3    . LYS A 1 269  ? -47.339 -49.947 36.715  1.00 58.15  ? 1631 LYS A HZ3    1 
ATOM   4454  N  N      . ASP A 1 270  ? -48.272 -52.294 43.850  1.00 53.04  ? 1632 ASP A N      1 
ATOM   4455  C  CA     . ASP A 1 270  ? -49.345 -52.548 44.808  1.00 54.26  ? 1632 ASP A CA     1 
ATOM   4456  C  C      . ASP A 1 270  ? -49.185 -51.643 46.032  1.00 54.78  ? 1632 ASP A C      1 
ATOM   4457  O  O      . ASP A 1 270  ? -50.034 -51.631 46.922  1.00 55.86  ? 1632 ASP A O      1 
ATOM   4458  C  CB     . ASP A 1 270  ? -49.362 -54.021 45.231  1.00 60.27  ? 1632 ASP A CB     1 
ATOM   4459  C  CG     . ASP A 1 270  ? -50.708 -54.454 45.804  1.00 75.02  ? 1632 ASP A CG     1 
ATOM   4460  O  OD1    . ASP A 1 270  ? -51.747 -53.876 45.416  1.00 79.06  ? 1632 ASP A OD1    1 
ATOM   4461  O  OD2    . ASP A 1 270  ? -50.728 -55.377 46.646  1.00 80.41  1 1632 ASP A OD2    1 
ATOM   4462  H  H      . ASP A 1 270  ? -47.680 -52.917 43.812  1.00 63.65  ? 1632 ASP A H      1 
ATOM   4463  H  HA     . ASP A 1 270  ? -50.197 -52.344 44.391  1.00 65.11  ? 1632 ASP A HA     1 
ATOM   4464  H  HB2    . ASP A 1 270  ? -49.174 -54.575 44.456  1.00 72.32  ? 1632 ASP A HB2    1 
ATOM   4465  H  HB3    . ASP A 1 270  ? -48.686 -54.163 45.912  1.00 72.32  ? 1632 ASP A HB3    1 
ATOM   4466  N  N      . GLY A 1 271  ? -48.090 -50.887 46.064  1.00 58.76  ? 1633 GLY A N      1 
ATOM   4467  C  CA     . GLY A 1 271  ? -47.888 -49.852 47.061  1.00 58.89  ? 1633 GLY A CA     1 
ATOM   4468  C  C      . GLY A 1 271  ? -47.230 -50.257 48.371  1.00 58.66  ? 1633 GLY A C      1 
ATOM   4469  O  O      . GLY A 1 271  ? -47.529 -49.678 49.414  1.00 62.48  ? 1633 GLY A O      1 
ATOM   4470  H  H      . GLY A 1 271  ? -47.440 -50.960 45.506  1.00 70.51  ? 1633 GLY A H      1 
ATOM   4471  H  HA2    . GLY A 1 271  ? -47.344 -49.151 46.668  1.00 70.66  ? 1633 GLY A HA2    1 
ATOM   4472  H  HA3    . GLY A 1 271  ? -48.751 -49.465 47.278  1.00 70.66  ? 1633 GLY A HA3    1 
ATOM   4473  N  N      . THR A 1 272  ? -46.342 -51.248 48.332  1.00 45.89  ? 1634 THR A N      1 
ATOM   4474  C  CA     . THR A 1 272  ? -45.529 -51.571 49.506  1.00 46.24  ? 1634 THR A CA     1 
ATOM   4475  C  C      . THR A 1 272  ? -44.412 -50.536 49.679  1.00 45.68  ? 1634 THR A C      1 
ATOM   4476  O  O      . THR A 1 272  ? -43.906 -49.991 48.698  1.00 44.71  ? 1634 THR A O      1 
ATOM   4477  C  CB     . THR A 1 272  ? -44.895 -52.981 49.416  1.00 45.97  ? 1634 THR A CB     1 
ATOM   4478  O  OG1    . THR A 1 272  ? -44.119 -53.241 50.593  1.00 46.41  ? 1634 THR A OG1    1 
ATOM   4479  C  CG2    . THR A 1 272  ? -44.007 -53.112 48.192  1.00 44.67  ? 1634 THR A CG2    1 
ATOM   4480  H  H      . THR A 1 272  ? -46.191 -51.744 47.647  1.00 55.07  ? 1634 THR A H      1 
ATOM   4481  H  HA     . THR A 1 272  ? -46.090 -51.543 50.297  1.00 55.49  ? 1634 THR A HA     1 
ATOM   4482  H  HB     . THR A 1 272  ? -45.601 -53.643 49.349  1.00 55.16  ? 1634 THR A HB     1 
ATOM   4483  H  HG1    . THR A 1 272  ? -43.774 -54.005 50.546  1.00 55.69  ? 1634 THR A HG1    1 
ATOM   4484  H  HG21   . THR A 1 272  ? -43.622 -54.002 48.157  1.00 53.60  ? 1634 THR A HG21   1 
ATOM   4485  H  HG22   . THR A 1 272  ? -44.527 -52.961 47.388  1.00 53.60  ? 1634 THR A HG22   1 
ATOM   4486  H  HG23   . THR A 1 272  ? -43.290 -52.460 48.232  1.00 53.60  ? 1634 THR A HG23   1 
ATOM   4487  N  N      . ASP A 1 273  ? -44.044 -50.256 50.928  1.00 52.67  ? 1635 ASP A N      1 
ATOM   4488  C  CA     . ASP A 1 273  ? -42.940 -49.339 51.211  1.00 52.26  ? 1635 ASP A CA     1 
ATOM   4489  C  C      . ASP A 1 273  ? -41.634 -49.848 50.648  1.00 51.19  ? 1635 ASP A C      1 
ATOM   4490  O  O      . ASP A 1 273  ? -41.388 -51.049 50.607  1.00 51.09  ? 1635 ASP A O      1 
ATOM   4491  C  CB     . ASP A 1 273  ? -42.760 -49.121 52.714  1.00 62.97  ? 1635 ASP A CB     1 
ATOM   4492  C  CG     . ASP A 1 273  ? -43.530 -47.928 53.234  1.00 71.68  ? 1635 ASP A CG     1 
ATOM   4493  O  OD1    . ASP A 1 273  ? -43.497 -46.867 52.565  1.00 77.37  1 1635 ASP A OD1    1 
ATOM   4494  O  OD2    . ASP A 1 273  ? -44.140 -48.045 54.321  1.00 71.82  ? 1635 ASP A OD2    1 
ATOM   4495  H  H      . ASP A 1 273  ? -44.417 -50.583 51.630  1.00 63.21  ? 1635 ASP A H      1 
ATOM   4496  H  HA     . ASP A 1 273  ? -43.130 -48.480 50.802  1.00 62.72  ? 1635 ASP A HA     1 
ATOM   4497  H  HB2    . ASP A 1 273  ? -43.073 -49.908 53.187  1.00 75.57  ? 1635 ASP A HB2    1 
ATOM   4498  H  HB3    . ASP A 1 273  ? -41.819 -48.975 52.901  1.00 75.57  ? 1635 ASP A HB3    1 
ATOM   4499  N  N      . ILE A 1 274  ? -40.798 -48.922 50.204  1.00 55.78  ? 1636 ILE A N      1 
ATOM   4500  C  CA     . ILE A 1 274  ? -39.528 -49.293 49.620  1.00 54.22  ? 1636 ILE A CA     1 
ATOM   4501  C  C      . ILE A 1 274  ? -38.693 -50.026 50.671  1.00 54.58  ? 1636 ILE A C      1 
ATOM   4502  O  O      . ILE A 1 274  ? -37.992 -50.979 50.344  1.00 54.06  ? 1636 ILE A O      1 
ATOM   4503  C  CB     . ILE A 1 274  ? -38.777 -48.050 49.074  1.00 57.63  ? 1636 ILE A CB     1 
ATOM   4504  C  CG1    . ILE A 1 274  ? -37.605 -48.462 48.183  1.00 56.71  ? 1636 ILE A CG1    1 
ATOM   4505  C  CG2    . ILE A 1 274  ? -38.298 -47.153 50.207  1.00 59.30  ? 1636 ILE A CG2    1 
ATOM   4506  C  CD1    . ILE A 1 274  ? -38.020 -49.186 46.916  1.00 55.94  ? 1636 ILE A CD1    1 
ATOM   4507  H  H      . ILE A 1 274  ? -40.944 -48.075 50.231  1.00 66.93  ? 1636 ILE A H      1 
ATOM   4508  H  HA     . ILE A 1 274  ? -39.683 -49.901 48.880  1.00 65.06  ? 1636 ILE A HA     1 
ATOM   4509  H  HB     . ILE A 1 274  ? -39.400 -47.540 48.533  1.00 69.16  ? 1636 ILE A HB     1 
ATOM   4510  H  HG12   . ILE A 1 274  ? -37.117 -47.665 47.922  1.00 68.05  ? 1636 ILE A HG12   1 
ATOM   4511  H  HG13   . ILE A 1 274  ? -37.024 -49.053 48.685  1.00 68.05  ? 1636 ILE A HG13   1 
ATOM   4512  H  HG21   . ILE A 1 274  ? -37.835 -46.389 49.830  1.00 71.16  ? 1636 ILE A HG21   1 
ATOM   4513  H  HG22   . ILE A 1 274  ? -39.065 -46.856 50.720  1.00 71.16  ? 1636 ILE A HG22   1 
ATOM   4514  H  HG23   . ILE A 1 274  ? -37.695 -47.658 50.776  1.00 71.16  ? 1636 ILE A HG23   1 
ATOM   4515  H  HD11   . ILE A 1 274  ? -37.225 -49.412 46.407  1.00 67.12  ? 1636 ILE A HD11   1 
ATOM   4516  H  HD12   . ILE A 1 274  ? -38.500 -49.993 47.157  1.00 67.12  ? 1636 ILE A HD12   1 
ATOM   4517  H  HD13   . ILE A 1 274  ? -38.593 -48.603 46.393  1.00 67.12  ? 1636 ILE A HD13   1 
ATOM   4518  N  N      . GLU A 1 275  ? -38.816 -49.617 51.935  1.00 48.86  ? 1637 GLU A N      1 
ATOM   4519  C  CA     . GLU A 1 275  ? -38.060 -50.244 53.020  1.00 49.36  ? 1637 GLU A CA     1 
ATOM   4520  C  C      . GLU A 1 275  ? -38.402 -51.723 53.142  1.00 49.69  ? 1637 GLU A C      1 
ATOM   4521  O  O      . GLU A 1 275  ? -37.534 -52.546 53.445  1.00 49.61  ? 1637 GLU A O      1 
ATOM   4522  C  CB     . GLU A 1 275  ? -38.330 -49.560 54.366  1.00 50.54  ? 1637 GLU A CB     1 
ATOM   4523  C  CG     . GLU A 1 275  ? -37.865 -48.116 54.481  1.00 51.76  ? 1637 GLU A CG     1 
ATOM   4524  C  CD     . GLU A 1 275  ? -39.003 -47.117 54.364  1.00 61.04  ? 1637 GLU A CD     1 
ATOM   4525  O  OE1    . GLU A 1 275  ? -39.935 -47.357 53.567  1.00 64.73  ? 1637 GLU A OE1    1 
ATOM   4526  O  OE2    . GLU A 1 275  ? -38.969 -46.096 55.085  1.00 66.21  1 1637 GLU A OE2    1 
ATOM   4527  H  H      . GLU A 1 275  ? -39.332 -48.978 52.190  1.00 58.63  ? 1637 GLU A H      1 
ATOM   4528  H  HA     . GLU A 1 275  ? -37.112 -50.169 52.830  1.00 59.23  ? 1637 GLU A HA     1 
ATOM   4529  H  HB2    . GLU A 1 275  ? -39.286 -49.570 54.527  1.00 60.64  ? 1637 GLU A HB2    1 
ATOM   4530  H  HB3    . GLU A 1 275  ? -37.880 -50.065 55.061  1.00 60.64  ? 1637 GLU A HB3    1 
ATOM   4531  H  HG2    . GLU A 1 275  ? -37.442 -47.989 55.345  1.00 62.11  ? 1637 GLU A HG2    1 
ATOM   4532  H  HG3    . GLU A 1 275  ? -37.230 -47.932 53.771  1.00 62.11  ? 1637 GLU A HG3    1 
ATOM   4533  N  N      . VAL A 1 276  ? -39.671 -52.052 52.909  1.00 48.14  ? 1638 VAL A N      1 
ATOM   4534  C  CA     . VAL A 1 276  ? -40.130 -53.436 52.963  1.00 48.55  ? 1638 VAL A CA     1 
ATOM   4535  C  C      . VAL A 1 276  ? -39.328 -54.250 51.987  1.00 47.52  ? 1638 VAL A C      1 
ATOM   4536  O  O      . VAL A 1 276  ? -38.848 -55.342 52.287  1.00 47.70  ? 1638 VAL A O      1 
ATOM   4537  C  CB     . VAL A 1 276  ? -41.623 -53.571 52.585  1.00 49.03  ? 1638 VAL A CB     1 
ATOM   4538  C  CG1    . VAL A 1 276  ? -42.020 -55.038 52.411  1.00 49.33  ? 1638 VAL A CG1    1 
ATOM   4539  C  CG2    . VAL A 1 276  ? -42.507 -52.865 53.597  1.00 50.20  ? 1638 VAL A CG2    1 
ATOM   4540  H  H      . VAL A 1 276  ? -40.290 -51.486 52.717  1.00 57.76  ? 1638 VAL A H      1 
ATOM   4541  H  HA     . VAL A 1 276  ? -39.998 -53.794 53.855  1.00 58.26  ? 1638 VAL A HA     1 
ATOM   4542  H  HB     . VAL A 1 276  ? -41.759 -53.133 51.730  1.00 58.83  ? 1638 VAL A HB     1 
ATOM   4543  H  HG11   . VAL A 1 276  ? -42.960 -55.084 52.175  1.00 59.19  ? 1638 VAL A HG11   1 
ATOM   4544  H  HG12   . VAL A 1 276  ? -41.481 -55.429 51.706  1.00 59.19  ? 1638 VAL A HG12   1 
ATOM   4545  H  HG13   . VAL A 1 276  ? -41.865 -55.507 53.246  1.00 59.19  ? 1638 VAL A HG13   1 
ATOM   4546  H  HG21   . VAL A 1 276  ? -43.434 -52.968 53.332  1.00 60.24  ? 1638 VAL A HG21   1 
ATOM   4547  H  HG22   . VAL A 1 276  ? -42.366 -53.263 54.471  1.00 60.24  ? 1638 VAL A HG22   1 
ATOM   4548  H  HG23   . VAL A 1 276  ? -42.271 -51.924 53.620  1.00 60.24  ? 1638 VAL A HG23   1 
ATOM   4549  N  N      . VAL A 1 277  ? -39.196 -53.679 50.800  1.00 36.11  ? 1639 VAL A N      1 
ATOM   4550  C  CA     . VAL A 1 277  ? -38.626 -54.364 49.665  1.00 35.14  ? 1639 VAL A CA     1 
ATOM   4551  C  C      . VAL A 1 277  ? -37.130 -54.548 49.815  1.00 34.59  ? 1639 VAL A C      1 
ATOM   4552  O  O      . VAL A 1 277  ? -36.590 -55.604 49.493  1.00 34.30  ? 1639 VAL A O      1 
ATOM   4553  C  CB     . VAL A 1 277  ? -38.887 -53.586 48.387  1.00 34.29  ? 1639 VAL A CB     1 
ATOM   4554  C  CG1    . VAL A 1 277  ? -38.406 -54.354 47.215  1.00 33.42  ? 1639 VAL A CG1    1 
ATOM   4555  C  CG2    . VAL A 1 277  ? -40.373 -53.314 48.214  1.00 34.85  ? 1639 VAL A CG2    1 
ATOM   4556  H  H      . VAL A 1 277  ? -39.438 -52.872 50.628  1.00 43.34  ? 1639 VAL A H      1 
ATOM   4557  H  HA     . VAL A 1 277  ? -39.035 -55.240 49.579  1.00 42.16  ? 1639 VAL A HA     1 
ATOM   4558  H  HB     . VAL A 1 277  ? -38.417 -52.738 48.418  1.00 41.15  ? 1639 VAL A HB     1 
ATOM   4559  H  HG11   . VAL A 1 277  ? -38.581 -53.842 46.410  1.00 40.10  ? 1639 VAL A HG11   1 
ATOM   4560  H  HG12   . VAL A 1 277  ? -37.453 -54.508 47.309  1.00 40.10  ? 1639 VAL A HG12   1 
ATOM   4561  H  HG13   . VAL A 1 277  ? -38.877 -55.201 47.178  1.00 40.10  ? 1639 VAL A HG13   1 
ATOM   4562  H  HG21   . VAL A 1 277  ? -40.509 -52.817 47.392  1.00 41.82  ? 1639 VAL A HG21   1 
ATOM   4563  H  HG22   . VAL A 1 277  ? -40.846 -54.160 48.172  1.00 41.82  ? 1639 VAL A HG22   1 
ATOM   4564  H  HG23   . VAL A 1 277  ? -40.689 -52.795 48.971  1.00 41.82  ? 1639 VAL A HG23   1 
ATOM   4565  N  N      . VAL A 1 278  ? -36.475 -53.502 50.311  1.00 44.98  ? 1640 VAL A N      1 
ATOM   4566  C  CA     . VAL A 1 278  ? -35.020 -53.441 50.364  1.00 44.40  ? 1640 VAL A CA     1 
ATOM   4567  C  C      . VAL A 1 278  ? -34.415 -54.700 50.966  1.00 44.75  ? 1640 VAL A C      1 
ATOM   4568  O  O      . VAL A 1 278  ? -33.326 -55.124 50.575  1.00 44.11  ? 1640 VAL A O      1 
ATOM   4569  C  CB     . VAL A 1 278  ? -34.565 -52.195 51.164  1.00 44.67  ? 1640 VAL A CB     1 
ATOM   4570  C  CG1    . VAL A 1 278  ? -33.110 -52.298 51.608  1.00 44.43  ? 1640 VAL A CG1    1 
ATOM   4571  C  CG2    . VAL A 1 278  ? -34.801 -50.929 50.347  1.00 44.10  ? 1640 VAL A CG2    1 
ATOM   4572  H  H      . VAL A 1 278  ? -36.861 -52.802 50.629  1.00 53.98  ? 1640 VAL A H      1 
ATOM   4573  H  HA     . VAL A 1 278  ? -34.679 -53.352 49.460  1.00 53.28  ? 1640 VAL A HA     1 
ATOM   4574  H  HB     . VAL A 1 278  ? -35.109 -52.129 51.965  1.00 53.60  ? 1640 VAL A HB     1 
ATOM   4575  H  HG11   . VAL A 1 278  ? -32.874 -51.498 52.102  1.00 53.32  ? 1640 VAL A HG11   1 
ATOM   4576  H  HG12   . VAL A 1 278  ? -33.008 -53.080 52.173  1.00 53.32  ? 1640 VAL A HG12   1 
ATOM   4577  H  HG13   . VAL A 1 278  ? -32.546 -52.381 50.823  1.00 53.32  ? 1640 VAL A HG13   1 
ATOM   4578  H  HG21   . VAL A 1 278  ? -34.510 -50.161 50.864  1.00 52.92  ? 1640 VAL A HG21   1 
ATOM   4579  H  HG22   . VAL A 1 278  ? -34.292 -50.986 49.523  1.00 52.92  ? 1640 VAL A HG22   1 
ATOM   4580  H  HG23   . VAL A 1 278  ? -35.747 -50.855 50.147  1.00 52.92  ? 1640 VAL A HG23   1 
ATOM   4581  N  N      . SER A 1 279  ? -35.129 -55.301 51.907  1.00 52.03  ? 1641 SER A N      1 
ATOM   4582  C  CA     . SER A 1 279  ? -34.671 -56.521 52.552  1.00 52.57  ? 1641 SER A CA     1 
ATOM   4583  C  C      . SER A 1 279  ? -34.818 -57.747 51.641  1.00 52.21  ? 1641 SER A C      1 
ATOM   4584  O  O      . SER A 1 279  ? -33.945 -58.615 51.614  1.00 52.05  ? 1641 SER A O      1 
ATOM   4585  C  CB     . SER A 1 279  ? -35.438 -56.734 53.854  1.00 53.96  ? 1641 SER A CB     1 
ATOM   4586  O  OG     . SER A 1 279  ? -35.493 -55.531 54.606  1.00 54.36  ? 1641 SER A OG     1 
ATOM   4587  H  H      . SER A 1 279  ? -35.889 -55.019 52.193  1.00 62.44  ? 1641 SER A H      1 
ATOM   4588  H  HA     . SER A 1 279  ? -33.732 -56.426 52.773  1.00 63.08  ? 1641 SER A HA     1 
ATOM   4589  H  HB2    . SER A 1 279  ? -36.342 -57.018 53.645  1.00 64.76  ? 1641 SER A HB2    1 
ATOM   4590  H  HB3    . SER A 1 279  ? -34.989 -57.415 54.378  1.00 64.76  ? 1641 SER A HB3    1 
ATOM   4591  H  HG     . SER A 1 279  ? -35.917 -55.658 55.320  1.00 65.24  ? 1641 SER A HG     1 
ATOM   4592  N  N      . LYS A 1 280  ? -35.919 -57.801 50.892  1.00 45.01  ? 1642 LYS A N      1 
ATOM   4593  C  CA     . LYS A 1 280  ? -36.367 -59.040 50.249  1.00 45.06  ? 1642 LYS A CA     1 
ATOM   4594  C  C      . LYS A 1 280  ? -35.856 -59.317 48.830  1.00 43.93  ? 1642 LYS A C      1 
ATOM   4595  O  O      . LYS A 1 280  ? -36.076 -60.409 48.312  1.00 44.01  ? 1642 LYS A O      1 
ATOM   4596  C  CB     . LYS A 1 280  ? -37.899 -59.069 50.234  1.00 45.75  ? 1642 LYS A CB     1 
ATOM   4597  C  CG     . LYS A 1 280  ? -38.514 -58.950 51.631  1.00 47.50  ? 1642 LYS A CG     1 
ATOM   4598  C  CD     . LYS A 1 280  ? -39.776 -59.804 51.804  1.00 50.01  ? 1642 LYS A CD     1 
ATOM   4599  C  CE     . LYS A 1 280  ? -40.110 -60.001 53.285  1.00 49.43  ? 1642 LYS A CE     1 
ATOM   4600  N  NZ     . LYS A 1 280  ? -40.929 -61.219 53.531  1.00 50.47  1 1642 LYS A NZ     1 
ATOM   4601  H  H      . LYS A 1 280  ? -36.430 -57.127 50.738  1.00 54.01  ? 1642 LYS A H      1 
ATOM   4602  H  HA     . LYS A 1 280  ? -36.075 -59.782 50.802  1.00 54.08  ? 1642 LYS A HA     1 
ATOM   4603  H  HB2    . LYS A 1 280  ? -38.222 -58.327 49.701  1.00 54.90  ? 1642 LYS A HB2    1 
ATOM   4604  H  HB3    . LYS A 1 280  ? -38.194 -59.908 49.848  1.00 54.90  ? 1642 LYS A HB3    1 
ATOM   4605  H  HG2    . LYS A 1 280  ? -37.863 -59.242 52.288  1.00 57.00  ? 1642 LYS A HG2    1 
ATOM   4606  H  HG3    . LYS A 1 280  ? -38.755 -58.025 51.792  1.00 57.00  ? 1642 LYS A HG3    1 
ATOM   4607  H  HD2    . LYS A 1 280  ? -40.525 -59.360 51.378  1.00 60.01  ? 1642 LYS A HD2    1 
ATOM   4608  H  HD3    . LYS A 1 280  ? -39.630 -60.676 51.406  1.00 60.01  ? 1642 LYS A HD3    1 
ATOM   4609  H  HE2    . LYS A 1 280  ? -39.285 -60.087 53.787  1.00 59.32  ? 1642 LYS A HE2    1 
ATOM   4610  H  HE3    . LYS A 1 280  ? -40.612 -59.233 53.600  1.00 59.32  ? 1642 LYS A HE3    1 
ATOM   4611  H  HZ1    . LYS A 1 280  ? -41.102 -61.299 54.401  1.00 60.56  ? 1642 LYS A HZ1    1 
ATOM   4612  H  HZ2    . LYS A 1 280  ? -41.698 -61.164 53.087  1.00 60.56  ? 1642 LYS A HZ2    1 
ATOM   4613  H  HZ3    . LYS A 1 280  ? -40.489 -61.942 53.257  1.00 60.56  ? 1642 LYS A HZ3    1 
ATOM   4614  N  N      . TYR A 1 281  ? -35.205 -58.351 48.192  1.00 52.70  ? 1643 TYR A N      1 
ATOM   4615  C  CA     . TYR A 1 281  ? -34.703 -58.542 46.827  1.00 51.67  ? 1643 TYR A CA     1 
ATOM   4616  C  C      . TYR A 1 281  ? -33.248 -58.109 46.730  1.00 50.93  ? 1643 TYR A C      1 
ATOM   4617  O  O      . TYR A 1 281  ? -32.740 -57.398 47.600  1.00 51.11  ? 1643 TYR A O      1 
ATOM   4618  C  CB     . TYR A 1 281  ? -35.510 -57.746 45.807  1.00 51.20  ? 1643 TYR A CB     1 
ATOM   4619  C  CG     . TYR A 1 281  ? -36.968 -58.109 45.705  1.00 51.85  ? 1643 TYR A CG     1 
ATOM   4620  C  CD1    . TYR A 1 281  ? -37.891 -57.542 46.562  1.00 52.64  ? 1643 TYR A CD1    1 
ATOM   4621  C  CD2    . TYR A 1 281  ? -37.426 -58.995 44.738  1.00 51.73  ? 1643 TYR A CD2    1 
ATOM   4622  C  CE1    . TYR A 1 281  ? -39.228 -57.845 46.476  1.00 53.29  ? 1643 TYR A CE1    1 
ATOM   4623  C  CE2    . TYR A 1 281  ? -38.771 -59.309 44.641  1.00 52.38  ? 1643 TYR A CE2    1 
ATOM   4624  C  CZ     . TYR A 1 281  ? -39.665 -58.727 45.516  1.00 53.15  ? 1643 TYR A CZ     1 
ATOM   4625  O  OH     . TYR A 1 281  ? -41.002 -59.025 45.439  1.00 53.85  ? 1643 TYR A OH     1 
ATOM   4626  H  H      . TYR A 1 281  ? -35.040 -57.575 48.523  1.00 63.24  ? 1643 TYR A H      1 
ATOM   4627  H  HA     . TYR A 1 281  ? -34.758 -59.482 46.594  1.00 62.01  ? 1643 TYR A HA     1 
ATOM   4628  H  HB2    . TYR A 1 281  ? -35.461 -56.807 46.043  1.00 61.44  ? 1643 TYR A HB2    1 
ATOM   4629  H  HB3    . TYR A 1 281  ? -35.115 -57.881 44.931  1.00 61.44  ? 1643 TYR A HB3    1 
ATOM   4630  H  HD1    . TYR A 1 281  ? -37.601 -56.943 47.212  1.00 63.17  ? 1643 TYR A HD1    1 
ATOM   4631  H  HD2    . TYR A 1 281  ? -36.821 -59.383 44.148  1.00 62.08  ? 1643 TYR A HD2    1 
ATOM   4632  H  HE1    . TYR A 1 281  ? -39.834 -57.456 47.064  1.00 63.95  ? 1643 TYR A HE1    1 
ATOM   4633  H  HE2    . TYR A 1 281  ? -39.069 -59.905 43.993  1.00 62.86  ? 1643 TYR A HE2    1 
ATOM   4634  H  HH     . TYR A 1 281  ? -41.425 -58.603 46.030  1.00 64.62  ? 1643 TYR A HH     1 
ATOM   4635  N  N      . ILE A 1 282  ? -32.586 -58.519 45.652  1.00 37.01  ? 1644 ILE A N      1 
ATOM   4636  C  CA     . ILE A 1 282  ? -31.245 -58.032 45.369  1.00 36.24  ? 1644 ILE A CA     1 
ATOM   4637  C  C      . ILE A 1 282  ? -31.331 -56.597 44.892  1.00 35.71  ? 1644 ILE A C      1 
ATOM   4638  O  O      . ILE A 1 282  ? -32.394 -56.136 44.487  1.00 35.78  ? 1644 ILE A O      1 
ATOM   4639  C  CB     . ILE A 1 282  ? -30.520 -58.880 44.312  1.00 35.61  ? 1644 ILE A CB     1 
ATOM   4640  C  CG1    . ILE A 1 282  ? -31.207 -58.783 42.945  1.00 35.12  ? 1644 ILE A CG1    1 
ATOM   4641  C  CG2    . ILE A 1 282  ? -30.451 -60.329 44.771  1.00 36.23  ? 1644 ILE A CG2    1 
ATOM   4642  C  CD1    . ILE A 1 282  ? -30.241 -58.905 41.804  1.00 34.27  ? 1644 ILE A CD1    1 
ATOM   4643  H  H      . ILE A 1 282  ? -32.891 -59.076 45.072  1.00 44.41  ? 1644 ILE A H      1 
ATOM   4644  H  HA     . ILE A 1 282  ? -30.720 -58.050 46.185  1.00 43.49  ? 1644 ILE A HA     1 
ATOM   4645  H  HB     . ILE A 1 282  ? -29.614 -58.546 44.222  1.00 42.73  ? 1644 ILE A HB     1 
ATOM   4646  H  HG12   . ILE A 1 282  ? -31.858 -59.498 42.866  1.00 42.14  ? 1644 ILE A HG12   1 
ATOM   4647  H  HG13   . ILE A 1 282  ? -31.649 -57.922 42.874  1.00 42.14  ? 1644 ILE A HG13   1 
ATOM   4648  H  HG21   . ILE A 1 282  ? -29.992 -60.852 44.096  1.00 43.48  ? 1644 ILE A HG21   1 
ATOM   4649  H  HG22   . ILE A 1 282  ? -29.965 -60.371 45.610  1.00 43.48  ? 1644 ILE A HG22   1 
ATOM   4650  H  HG23   . ILE A 1 282  ? -31.353 -60.664 44.893  1.00 43.48  ? 1644 ILE A HG23   1 
ATOM   4651  H  HD11   . ILE A 1 282  ? -30.729 -58.836 40.969  1.00 41.12  ? 1644 ILE A HD11   1 
ATOM   4652  H  HD12   . ILE A 1 282  ? -29.588 -58.190 41.866  1.00 41.12  ? 1644 ILE A HD12   1 
ATOM   4653  H  HD13   . ILE A 1 282  ? -29.796 -59.766 41.858  1.00 41.12  ? 1644 ILE A HD13   1 
ATOM   4654  N  N      . PHE A 1 283  ? -30.208 -55.896 44.947  1.00 29.09  ? 1645 PHE A N      1 
ATOM   4655  C  CA     . PHE A 1 283  ? -30.160 -54.488 44.580  1.00 28.67  ? 1645 PHE A CA     1 
ATOM   4656  C  C      . PHE A 1 283  ? -30.690 -54.182 43.190  1.00 28.09  ? 1645 PHE A C      1 
ATOM   4657  O  O      . PHE A 1 283  ? -31.587 -53.357 43.035  1.00 28.23  ? 1645 PHE A O      1 
ATOM   4658  C  CB     . PHE A 1 283  ? -28.732 -53.983 44.661  1.00 28.21  ? 1645 PHE A CB     1 
ATOM   4659  C  CG     . PHE A 1 283  ? -28.563 -52.586 44.156  1.00 27.77  ? 1645 PHE A CG     1 
ATOM   4660  C  CD1    . PHE A 1 283  ? -29.226 -51.538 44.763  1.00 28.24  ? 1645 PHE A CD1    1 
ATOM   4661  C  CD2    . PHE A 1 283  ? -27.751 -52.319 43.069  1.00 26.97  ? 1645 PHE A CD2    1 
ATOM   4662  C  CE1    . PHE A 1 283  ? -29.076 -50.249 44.303  1.00 27.92  ? 1645 PHE A CE1    1 
ATOM   4663  C  CE2    . PHE A 1 283  ? -27.600 -51.031 42.603  1.00 26.66  ? 1645 PHE A CE2    1 
ATOM   4664  C  CZ     . PHE A 1 283  ? -28.264 -49.997 43.220  1.00 27.14  ? 1645 PHE A CZ     1 
ATOM   4665  H  H      . PHE A 1 283  ? -29.450 -56.216 45.198  1.00 34.91  ? 1645 PHE A H      1 
ATOM   4666  H  HA     . PHE A 1 283  ? -30.690 -53.982 45.216  1.00 34.41  ? 1645 PHE A HA     1 
ATOM   4667  H  HB2    . PHE A 1 283  ? -28.445 -54.001 45.588  1.00 33.85  ? 1645 PHE A HB2    1 
ATOM   4668  H  HB3    . PHE A 1 283  ? -28.164 -54.562 44.129  1.00 33.85  ? 1645 PHE A HB3    1 
ATOM   4669  H  HD1    . PHE A 1 283  ? -29.775 -51.704 45.495  1.00 33.88  ? 1645 PHE A HD1    1 
ATOM   4670  H  HD2    . PHE A 1 283  ? -27.301 -53.016 42.649  1.00 32.37  ? 1645 PHE A HD2    1 
ATOM   4671  H  HE1    . PHE A 1 283  ? -29.526 -49.550 44.721  1.00 33.51  ? 1645 PHE A HE1    1 
ATOM   4672  H  HE2    . PHE A 1 283  ? -27.051 -50.862 41.872  1.00 31.99  ? 1645 PHE A HE2    1 
ATOM   4673  H  HZ     . PHE A 1 283  ? -28.163 -49.127 42.908  1.00 32.57  ? 1645 PHE A HZ     1 
ATOM   4674  N  N      . GLN A 1 284  ? -30.117 -54.827 42.183  1.00 27.50  ? 1646 GLN A N      1 
ATOM   4675  C  CA     . GLN A 1 284  ? -30.449 -54.520 40.799  1.00 26.95  ? 1646 GLN A CA     1 
ATOM   4676  C  C      . GLN A 1 284  ? -31.950 -54.508 40.521  1.00 27.33  ? 1646 GLN A C      1 
ATOM   4677  O  O      . GLN A 1 284  ? -32.438 -53.650 39.794  1.00 27.11  ? 1646 GLN A O      1 
ATOM   4678  C  CB     . GLN A 1 284  ? -29.773 -55.503 39.850  1.00 26.46  ? 1646 GLN A CB     1 
ATOM   4679  C  CG     . GLN A 1 284  ? -30.063 -55.170 38.400  1.00 25.95  ? 1646 GLN A CG     1 
ATOM   4680  C  CD     . GLN A 1 284  ? -29.146 -55.866 37.427  1.00 25.43  ? 1646 GLN A CD     1 
ATOM   4681  O  OE1    . GLN A 1 284  ? -28.079 -56.359 37.794  1.00 25.32  ? 1646 GLN A OE1    1 
ATOM   4682  N  NE2    . GLN A 1 284  ? -29.589 -55.956 36.179  1.00 25.18  ? 1646 GLN A NE2    1 
ATOM   4683  H  H      . GLN A 1 284  ? -29.530 -55.449 42.275  1.00 33.00  ? 1646 GLN A H      1 
ATOM   4684  H  HA     . GLN A 1 284  ? -30.109 -53.636 40.592  1.00 32.33  ? 1646 GLN A HA     1 
ATOM   4685  H  HB2    . GLN A 1 284  ? -28.813 -55.467 39.984  1.00 31.76  ? 1646 GLN A HB2    1 
ATOM   4686  H  HB3    . GLN A 1 284  ? -30.103 -56.397 40.029  1.00 31.76  ? 1646 GLN A HB3    1 
ATOM   4687  H  HG2    . GLN A 1 284  ? -30.972 -55.436 38.194  1.00 31.15  ? 1646 GLN A HG2    1 
ATOM   4688  H  HG3    . GLN A 1 284  ? -29.962 -54.214 38.272  1.00 31.15  ? 1646 GLN A HG3    1 
ATOM   4689  H  HE21   . GLN A 1 284  ? -30.355 -55.628 35.970  1.00 30.22  ? 1646 GLN A HE21   1 
ATOM   4690  H  HE22   . GLN A 1 284  ? -29.108 -56.343 35.580  1.00 30.22  ? 1646 GLN A HE22   1 
ATOM   4691  N  N      . ALA A 1 285  ? -32.677 -55.465 41.086  1.00 36.48  ? 1647 ALA A N      1 
ATOM   4692  C  CA     . ALA A 1 285  ? -34.114 -55.580 40.840  1.00 36.92  ? 1647 ALA A CA     1 
ATOM   4693  C  C      . ALA A 1 285  ? -34.910 -54.398 41.402  1.00 37.31  ? 1647 ALA A C      1 
ATOM   4694  O  O      . ALA A 1 285  ? -35.724 -53.798 40.700  1.00 37.26  ? 1647 ALA A O      1 
ATOM   4695  C  CB     . ALA A 1 285  ? -34.637 -56.880 41.421  1.00 37.62  ? 1647 ALA A CB     1 
ATOM   4696  H  H      . ALA A 1 285  ? -32.362 -56.064 41.618  1.00 43.77  ? 1647 ALA A H      1 
ATOM   4697  H  HA     . ALA A 1 285  ? -34.263 -55.605 39.881  1.00 44.31  ? 1647 ALA A HA     1 
ATOM   4698  H  HB1    . ALA A 1 285  ? -35.590 -56.941 41.250  1.00 45.14  ? 1647 ALA A HB1    1 
ATOM   4699  H  HB2    . ALA A 1 285  ? -34.176 -57.622 40.999  1.00 45.14  ? 1647 ALA A HB2    1 
ATOM   4700  H  HB3    . ALA A 1 285  ? -34.471 -56.887 42.377  1.00 45.14  ? 1647 ALA A HB3    1 
ATOM   4701  N  N      . ILE A 1 286  ? -34.677 -54.075 42.669  1.00 34.02  ? 1648 ILE A N      1 
ATOM   4702  C  CA     . ILE A 1 286  ? -35.384 -52.984 43.344  1.00 34.52  ? 1648 ILE A CA     1 
ATOM   4703  C  C      . ILE A 1 286  ? -34.981 -51.616 42.787  1.00 33.99  ? 1648 ILE A C      1 
ATOM   4704  O  O      . ILE A 1 286  ? -35.742 -50.651 42.877  1.00 34.30  ? 1648 ILE A O      1 
ATOM   4705  C  CB     . ILE A 1 286  ? -35.145 -53.040 44.888  1.00 38.80  ? 1648 ILE A CB     1 
ATOM   4706  C  CG1    . ILE A 1 286  ? -35.797 -51.838 45.592  1.00 48.70  ? 1648 ILE A CG1    1 
ATOM   4707  C  CG2    . ILE A 1 286  ? -33.655 -53.066 45.208  1.00 35.05  ? 1648 ILE A CG2    1 
ATOM   4708  C  CD1    . ILE A 1 286  ? -35.560 -51.779 47.097  1.00 57.13  ? 1648 ILE A CD1    1 
ATOM   4709  H  H      . ILE A 1 286  ? -34.106 -54.478 43.170  1.00 40.82  ? 1648 ILE A H      1 
ATOM   4710  H  HA     . ILE A 1 286  ? -36.336 -53.092 43.191  1.00 41.43  ? 1648 ILE A HA     1 
ATOM   4711  H  HB     . ILE A 1 286  ? -35.547 -53.853 45.231  1.00 46.56  ? 1648 ILE A HB     1 
ATOM   4712  H  HG12   . ILE A 1 286  ? -35.441 -51.023 45.206  1.00 58.44  ? 1648 ILE A HG12   1 
ATOM   4713  H  HG13   . ILE A 1 286  ? -36.755 -51.877 45.447  1.00 58.44  ? 1648 ILE A HG13   1 
ATOM   4714  H  HG21   . ILE A 1 286  ? -33.541 -53.101 46.171  1.00 42.05  ? 1648 ILE A HG21   1 
ATOM   4715  H  HG22   . ILE A 1 286  ? -33.259 -53.851 44.799  1.00 42.05  ? 1648 ILE A HG22   1 
ATOM   4716  H  HG23   . ILE A 1 286  ? -33.242 -52.263 44.854  1.00 42.05  ? 1648 ILE A HG23   1 
ATOM   4717  H  HD11   . ILE A 1 286  ? -36.004 -50.995 47.455  1.00 68.55  ? 1648 ILE A HD11   1 
ATOM   4718  H  HD12   . ILE A 1 286  ? -35.923 -52.581 47.505  1.00 68.55  ? 1648 ILE A HD12   1 
ATOM   4719  H  HD13   . ILE A 1 286  ? -34.606 -51.725 47.264  1.00 68.55  ? 1648 ILE A HD13   1 
ATOM   4720  N  N      . LEU A 1 287  ? -33.794 -51.542 42.194  1.00 28.50  ? 1649 LEU A N      1 
ATOM   4721  C  CA     . LEU A 1 287  ? -33.342 -50.329 41.524  1.00 28.00  ? 1649 LEU A CA     1 
ATOM   4722  C  C      . LEU A 1 287  ? -34.107 -50.050 40.238  1.00 27.72  ? 1649 LEU A C      1 
ATOM   4723  O  O      . LEU A 1 287  ? -34.706 -48.990 40.084  1.00 27.90  ? 1649 LEU A O      1 
ATOM   4724  C  CB     . LEU A 1 287  ? -31.855 -50.437 41.219  1.00 27.34  ? 1649 LEU A CB     1 
ATOM   4725  C  CG     . LEU A 1 287  ? -31.292 -49.490 40.163  1.00 26.72  ? 1649 LEU A CG     1 
ATOM   4726  C  CD1    . LEU A 1 287  ? -31.559 -48.047 40.522  1.00 27.01  ? 1649 LEU A CD1    1 
ATOM   4727  C  CD2    . LEU A 1 287  ? -29.817 -49.756 40.030  1.00 26.19  ? 1649 LEU A CD2    1 
ATOM   4728  H  H      . LEU A 1 287  ? -33.226 -52.188 42.167  1.00 34.20  ? 1649 LEU A H      1 
ATOM   4729  H  HA     . LEU A 1 287  ? -33.472 -49.574 42.119  1.00 33.59  ? 1649 LEU A HA     1 
ATOM   4730  H  HB2    . LEU A 1 287  ? -31.366 -50.273 42.040  1.00 32.81  ? 1649 LEU A HB2    1 
ATOM   4731  H  HB3    . LEU A 1 287  ? -31.674 -51.341 40.916  1.00 32.81  ? 1649 LEU A HB3    1 
ATOM   4732  H  HG     . LEU A 1 287  ? -31.713 -49.675 39.309  1.00 32.06  ? 1649 LEU A HG     1 
ATOM   4733  H  HD11   . LEU A 1 287  ? -31.188 -47.476 39.831  1.00 32.42  ? 1649 LEU A HD11   1 
ATOM   4734  H  HD12   . LEU A 1 287  ? -32.517 -47.910 40.586  1.00 32.42  ? 1649 LEU A HD12   1 
ATOM   4735  H  HD13   . LEU A 1 287  ? -31.139 -47.851 41.374  1.00 32.42  ? 1649 LEU A HD13   1 
ATOM   4736  H  HD21   . LEU A 1 287  ? -29.448 -49.159 39.360  1.00 31.43  ? 1649 LEU A HD21   1 
ATOM   4737  H  HD22   . LEU A 1 287  ? -29.389 -49.599 40.886  1.00 31.43  ? 1649 LEU A HD22   1 
ATOM   4738  H  HD23   . LEU A 1 287  ? -29.686 -50.678 39.759  1.00 31.43  ? 1649 LEU A HD23   1 
ATOM   4739  N  N      . LEU A 1 288  ? -34.089 -51.006 39.316  1.00 27.36  ? 1650 LEU A N      1 
ATOM   4740  C  CA     . LEU A 1 288  ? -34.791 -50.846 38.054  1.00 27.16  ? 1650 LEU A CA     1 
ATOM   4741  C  C      . LEU A 1 288  ? -36.257 -50.650 38.334  1.00 27.83  ? 1650 LEU A C      1 
ATOM   4742  O  O      . LEU A 1 288  ? -36.956 -49.959 37.606  1.00 27.85  ? 1650 LEU A O      1 
ATOM   4743  C  CB     . LEU A 1 288  ? -34.598 -52.056 37.145  1.00 26.82  ? 1650 LEU A CB     1 
ATOM   4744  C  CG     . LEU A 1 288  ? -35.044 -51.859 35.696  1.00 26.53  ? 1650 LEU A CG     1 
ATOM   4745  C  CD1    . LEU A 1 288  ? -34.291 -50.721 35.026  1.00 26.04  ? 1650 LEU A CD1    1 
ATOM   4746  C  CD2    . LEU A 1 288  ? -34.861 -53.153 34.923  1.00 26.33  ? 1650 LEU A CD2    1 
ATOM   4747  H  H      . LEU A 1 288  ? -33.676 -51.756 39.398  1.00 32.83  ? 1650 LEU A H      1 
ATOM   4748  H  HA     . LEU A 1 288  ? -34.457 -50.059 37.595  1.00 32.59  ? 1650 LEU A HA     1 
ATOM   4749  H  HB2    . LEU A 1 288  ? -33.655 -52.283 37.131  1.00 32.18  ? 1650 LEU A HB2    1 
ATOM   4750  H  HB3    . LEU A 1 288  ? -35.105 -52.798 37.508  1.00 32.18  ? 1650 LEU A HB3    1 
ATOM   4751  H  HG     . LEU A 1 288  ? -35.988 -51.637 35.687  1.00 31.84  ? 1650 LEU A HG     1 
ATOM   4752  H  HD11   . LEU A 1 288  ? -34.604 -50.631 34.112  1.00 31.24  ? 1650 LEU A HD11   1 
ATOM   4753  H  HD12   . LEU A 1 288  ? -34.459 -49.900 35.516  1.00 31.24  ? 1650 LEU A HD12   1 
ATOM   4754  H  HD13   . LEU A 1 288  ? -33.343 -50.923 35.033  1.00 31.24  ? 1650 LEU A HD13   1 
ATOM   4755  H  HD21   . LEU A 1 288  ? -35.148 -53.015 34.007  1.00 31.59  ? 1650 LEU A HD21   1 
ATOM   4756  H  HD22   . LEU A 1 288  ? -33.924 -53.402 34.944  1.00 31.59  ? 1650 LEU A HD22   1 
ATOM   4757  H  HD23   . LEU A 1 288  ? -35.398 -53.846 35.338  1.00 31.59  ? 1650 LEU A HD23   1 
ATOM   4758  N  N      . SER A 1 289  ? -36.715 -51.276 39.406  1.00 28.44  ? 1651 SER A N      1 
ATOM   4759  C  CA     . SER A 1 289  ? -38.083 -51.121 39.835  1.00 29.18  ? 1651 SER A CA     1 
ATOM   4760  C  C      . SER A 1 289  ? -38.348 -49.654 40.092  1.00 29.38  ? 1651 SER A C      1 
ATOM   4761  O  O      . SER A 1 289  ? -39.241 -49.058 39.495  1.00 29.54  ? 1651 SER A O      1 
ATOM   4762  C  CB     . SER A 1 289  ? -38.342 -51.928 41.104  1.00 29.88  ? 1651 SER A CB     1 
ATOM   4763  O  OG     . SER A 1 289  ? -37.829 -53.241 40.984  1.00 29.70  ? 1651 SER A OG     1 
ATOM   4764  H  H      . SER A 1 289  ? -36.247 -51.799 39.903  1.00 34.12  ? 1651 SER A H      1 
ATOM   4765  H  HA     . SER A 1 289  ? -38.684 -51.431 39.139  1.00 35.02  ? 1651 SER A HA     1 
ATOM   4766  H  HB2    . SER A 1 289  ? -37.909 -51.487 41.851  1.00 35.85  ? 1651 SER A HB2    1 
ATOM   4767  H  HB3    . SER A 1 289  ? -39.299 -51.976 41.256  1.00 35.85  ? 1651 SER A HB3    1 
ATOM   4768  H  HG     . SER A 1 289  ? -37.978 -53.673 41.688  1.00 35.64  ? 1651 SER A HG     1 
ATOM   4769  N  N      . ALA A 1 290  ? -37.544 -49.077 40.977  1.00 29.42  ? 1652 ALA A N      1 
ATOM   4770  C  CA     . ALA A 1 290  ? -37.713 -47.692 41.376  1.00 29.72  ? 1652 ALA A CA     1 
ATOM   4771  C  C      . ALA A 1 290  ? -37.641 -46.807 40.148  1.00 29.23  ? 1652 ALA A C      1 
ATOM   4772  O  O      . ALA A 1 290  ? -38.439 -45.892 39.987  1.00 29.60  ? 1652 ALA A O      1 
ATOM   4773  C  CB     . ALA A 1 290  ? -36.652 -47.295 42.387  1.00 29.77  ? 1652 ALA A CB     1 
ATOM   4774  H  H      . ALA A 1 290  ? -36.886 -49.473 41.363  1.00 35.30  ? 1652 ALA A H      1 
ATOM   4775  H  HA     . ALA A 1 290  ? -38.584 -47.578 41.786  1.00 35.66  ? 1652 ALA A HA     1 
ATOM   4776  H  HB1    . ALA A 1 290  ? -36.787 -46.367 42.637  1.00 35.72  ? 1652 ALA A HB1    1 
ATOM   4777  H  HB2    . ALA A 1 290  ? -36.733 -47.863 43.168  1.00 35.72  ? 1652 ALA A HB2    1 
ATOM   4778  H  HB3    . ALA A 1 290  ? -35.776 -47.406 41.985  1.00 35.72  ? 1652 ALA A HB3    1 
ATOM   4779  N  N      . GLN A 1 291  ? -36.700 -47.113 39.266  1.00 28.47  ? 1653 GLN A N      1 
ATOM   4780  C  CA     . GLN A 1 291  ? -36.474 -46.305 38.080  1.00 28.03  ? 1653 GLN A CA     1 
ATOM   4781  C  C      . GLN A 1 291  ? -37.676 -46.295 37.152  1.00 28.20  ? 1653 GLN A C      1 
ATOM   4782  O  O      . GLN A 1 291  ? -38.130 -45.235 36.728  1.00 28.39  ? 1653 GLN A O      1 
ATOM   4783  C  CB     . GLN A 1 291  ? -35.253 -46.815 37.322  1.00 27.24  ? 1653 GLN A CB     1 
ATOM   4784  C  CG     . GLN A 1 291  ? -33.932 -46.517 37.993  1.00 27.01  ? 1653 GLN A CG     1 
ATOM   4785  C  CD     . GLN A 1 291  ? -32.756 -47.072 37.217  1.00 26.29  ? 1653 GLN A CD     1 
ATOM   4786  O  OE1    . GLN A 1 291  ? -32.821 -48.171 36.663  1.00 26.05  ? 1653 GLN A OE1    1 
ATOM   4787  N  NE2    . GLN A 1 291  ? -31.681 -46.300 37.148  1.00 25.99  ? 1653 GLN A NE2    1 
ATOM   4788  H  H      . GLN A 1 291  ? -36.174 -47.791 39.334  1.00 34.16  ? 1653 GLN A H      1 
ATOM   4789  H  HA     . GLN A 1 291  ? -36.297 -45.391 38.352  1.00 33.63  ? 1653 GLN A HA     1 
ATOM   4790  H  HB2    . GLN A 1 291  ? -35.325 -47.778 37.228  1.00 32.69  ? 1653 GLN A HB2    1 
ATOM   4791  H  HB3    . GLN A 1 291  ? -35.237 -46.402 36.445  1.00 32.69  ? 1653 GLN A HB3    1 
ATOM   4792  H  HG2    . GLN A 1 291  ? -33.820 -45.556 38.062  1.00 32.41  ? 1653 GLN A HG2    1 
ATOM   4793  H  HG3    . GLN A 1 291  ? -33.926 -46.918 38.876  1.00 32.41  ? 1653 GLN A HG3    1 
ATOM   4794  H  HE21   . GLN A 1 291  ? -31.679 -45.531 37.533  1.00 31.19  ? 1653 GLN A HE21   1 
ATOM   4795  H  HE22   . GLN A 1 291  ? -30.986 -46.568 36.719  1.00 31.19  ? 1653 GLN A HE22   1 
ATOM   4796  N  N      . VAL A 1 292  ? -38.193 -47.476 36.837  1.00 28.21  ? 1654 VAL A N      1 
ATOM   4797  C  CA     . VAL A 1 292  ? -39.323 -47.580 35.930  1.00 28.42  ? 1654 VAL A CA     1 
ATOM   4798  C  C      . VAL A 1 292  ? -40.564 -46.951 36.543  1.00 29.21  ? 1654 VAL A C      1 
ATOM   4799  O  O      . VAL A 1 292  ? -41.266 -46.185 35.888  1.00 31.35  ? 1654 VAL A O      1 
ATOM   4800  C  CB     . VAL A 1 292  ? -39.610 -49.043 35.546  1.00 28.37  ? 1654 VAL A CB     1 
ATOM   4801  C  CG1    . VAL A 1 292  ? -40.841 -49.135 34.649  1.00 28.68  ? 1654 VAL A CG1    1 
ATOM   4802  C  CG2    . VAL A 1 292  ? -38.411 -49.632 34.819  1.00 27.63  ? 1654 VAL A CG2    1 
ATOM   4803  H  H      . VAL A 1 292  ? -37.907 -48.231 37.135  1.00 33.86  ? 1654 VAL A H      1 
ATOM   4804  H  HA     . VAL A 1 292  ? -39.116 -47.095 35.116  1.00 34.10  ? 1654 VAL A HA     1 
ATOM   4805  H  HB     . VAL A 1 292  ? -39.772 -49.565 36.348  1.00 34.04  ? 1654 VAL A HB     1 
ATOM   4806  H  HG11   . VAL A 1 292  ? -40.998 -50.065 34.423  1.00 34.42  ? 1654 VAL A HG11   1 
ATOM   4807  H  HG12   . VAL A 1 292  ? -41.606 -48.776 35.125  1.00 34.42  ? 1654 VAL A HG12   1 
ATOM   4808  H  HG13   . VAL A 1 292  ? -40.682 -48.621 33.842  1.00 34.42  ? 1654 VAL A HG13   1 
ATOM   4809  H  HG21   . VAL A 1 292  ? -38.606 -50.553 34.584  1.00 33.15  ? 1654 VAL A HG21   1 
ATOM   4810  H  HG22   . VAL A 1 292  ? -38.244 -49.114 34.017  1.00 33.15  ? 1654 VAL A HG22   1 
ATOM   4811  H  HG23   . VAL A 1 292  ? -37.639 -49.596 35.404  1.00 33.15  ? 1654 VAL A HG23   1 
ATOM   4812  N  N      . MET A 1 293  ? -40.843 -47.288 37.796  1.00 32.41  ? 1655 MET A N      1 
ATOM   4813  C  CA     . MET A 1 293  ? -42.035 -46.786 38.468  1.00 33.26  ? 1655 MET A CA     1 
ATOM   4814  C  C      . MET A 1 293  ? -41.964 -45.275 38.597  1.00 33.43  ? 1655 MET A C      1 
ATOM   4815  O  O      . MET A 1 293  ? -42.940 -44.572 38.338  1.00 33.90  ? 1655 MET A O      1 
ATOM   4816  C  CB     . MET A 1 293  ? -42.168 -47.408 39.851  1.00 33.81  ? 1655 MET A CB     1 
ATOM   4817  C  CG     . MET A 1 293  ? -43.524 -47.190 40.499  1.00 34.78  ? 1655 MET A CG     1 
ATOM   4818  S  SD     . MET A 1 293  ? -43.459 -47.334 42.293  1.00 56.32  ? 1655 MET A SD     1 
ATOM   4819  C  CE     . MET A 1 293  ? -42.330 -45.993 42.717  1.00 35.28  ? 1655 MET A CE     1 
ATOM   4820  H  H      . MET A 1 293  ? -40.358 -47.807 38.280  1.00 38.89  ? 1655 MET A H      1 
ATOM   4821  H  HA     . MET A 1 293  ? -42.819 -47.026 37.951  1.00 39.91  ? 1655 MET A HA     1 
ATOM   4822  H  HB2    . MET A 1 293  ? -42.026 -48.365 39.778  1.00 40.57  ? 1655 MET A HB2    1 
ATOM   4823  H  HB3    . MET A 1 293  ? -41.497 -47.021 40.434  1.00 40.57  ? 1655 MET A HB3    1 
ATOM   4824  H  HG2    . MET A 1 293  ? -43.841 -46.300 40.280  1.00 41.73  ? 1655 MET A HG2    1 
ATOM   4825  H  HG3    . MET A 1 293  ? -44.146 -47.857 40.166  1.00 41.73  ? 1655 MET A HG3    1 
ATOM   4826  H  HE1    . MET A 1 293  ? -42.214 -45.970 43.680  1.00 42.34  ? 1655 MET A HE1    1 
ATOM   4827  H  HE2    . MET A 1 293  ? -41.476 -46.151 42.284  1.00 42.34  ? 1655 MET A HE2    1 
ATOM   4828  H  HE3    . MET A 1 293  ? -42.707 -45.154 42.409  1.00 42.34  ? 1655 MET A HE3    1 
ATOM   4829  N  N      . TRP A 1 294  ? -40.798 -44.791 39.010  1.00 30.41  ? 1656 TRP A N      1 
ATOM   4830  C  CA     . TRP A 1 294  ? -40.551 -43.363 39.146  1.00 30.58  ? 1656 TRP A CA     1 
ATOM   4831  C  C      . TRP A 1 294  ? -40.937 -42.665 37.864  1.00 30.43  ? 1656 TRP A C      1 
ATOM   4832  O  O      . TRP A 1 294  ? -41.811 -41.801 37.856  1.00 31.02  ? 1656 TRP A O      1 
ATOM   4833  C  CB     . TRP A 1 294  ? -39.083 -43.095 39.454  1.00 30.09  ? 1656 TRP A CB     1 
ATOM   4834  C  CG     . TRP A 1 294  ? -38.702 -41.660 39.322  1.00 30.19  ? 1656 TRP A CG     1 
ATOM   4835  C  CD1    . TRP A 1 294  ? -39.186 -40.608 40.046  1.00 30.94  ? 1656 TRP A CD1    1 
ATOM   4836  C  CD2    . TRP A 1 294  ? -37.758 -41.110 38.395  1.00 29.59  ? 1656 TRP A CD2    1 
ATOM   4837  N  NE1    . TRP A 1 294  ? -38.597 -39.438 39.629  1.00 30.85  ? 1656 TRP A NE1    1 
ATOM   4838  C  CE2    . TRP A 1 294  ? -37.716 -39.719 38.617  1.00 30.04  ? 1656 TRP A CE2    1 
ATOM   4839  C  CE3    . TRP A 1 294  ? -36.945 -41.659 37.401  1.00 28.80  ? 1656 TRP A CE3    1 
ATOM   4840  C  CZ2    . TRP A 1 294  ? -36.892 -38.872 37.883  1.00 29.72  ? 1656 TRP A CZ2    1 
ATOM   4841  C  CZ3    . TRP A 1 294  ? -36.128 -40.818 36.675  1.00 28.48  ? 1656 TRP A CZ3    1 
ATOM   4842  C  CH2    . TRP A 1 294  ? -36.107 -39.440 36.919  1.00 28.94  ? 1656 TRP A CH2    1 
ATOM   4843  H  H      . TRP A 1 294  ? -40.123 -45.280 39.221  1.00 36.49  ? 1656 TRP A H      1 
ATOM   4844  H  HA     . TRP A 1 294  ? -41.090 -43.006 39.869  1.00 36.70  ? 1656 TRP A HA     1 
ATOM   4845  H  HB2    . TRP A 1 294  ? -38.898 -43.369 40.366  1.00 36.11  ? 1656 TRP A HB2    1 
ATOM   4846  H  HB3    . TRP A 1 294  ? -38.534 -43.606 38.839  1.00 36.11  ? 1656 TRP A HB3    1 
ATOM   4847  H  HD1    . TRP A 1 294  ? -39.820 -40.675 40.723  1.00 37.12  ? 1656 TRP A HD1    1 
ATOM   4848  H  HE1    . TRP A 1 294  ? -38.755 -38.656 39.952  1.00 37.02  ? 1656 TRP A HE1    1 
ATOM   4849  H  HE3    . TRP A 1 294  ? -36.951 -42.574 37.235  1.00 34.56  ? 1656 TRP A HE3    1 
ATOM   4850  H  HZ2    . TRP A 1 294  ? -36.876 -37.956 38.042  1.00 35.66  ? 1656 TRP A HZ2    1 
ATOM   4851  H  HZ3    . TRP A 1 294  ? -35.581 -41.172 36.012  1.00 34.17  ? 1656 TRP A HZ3    1 
ATOM   4852  H  HH2    . TRP A 1 294  ? -35.546 -38.897 36.412  1.00 34.73  ? 1656 TRP A HH2    1 
ATOM   4853  N  N      . THR A 1 295  ? -40.294 -43.096 36.783  1.00 29.70  ? 1657 THR A N      1 
ATOM   4854  C  CA     . THR A 1 295  ? -40.510 -42.551 35.454  1.00 29.52  ? 1657 THR A CA     1 
ATOM   4855  C  C      . THR A 1 295  ? -42.000 -42.413 35.189  1.00 30.17  ? 1657 THR A C      1 
ATOM   4856  O  O      . THR A 1 295  ? -42.468 -41.356 34.780  1.00 30.53  ? 1657 THR A O      1 
ATOM   4857  C  CB     . THR A 1 295  ? -39.848 -43.463 34.389  1.00 28.78  ? 1657 THR A CB     1 
ATOM   4858  O  OG1    . THR A 1 295  ? -38.462 -43.127 34.266  1.00 28.22  ? 1657 THR A OG1    1 
ATOM   4859  C  CG2    . THR A 1 295  ? -40.511 -43.341 33.023  1.00 28.79  ? 1657 THR A CG2    1 
ATOM   4860  H  H      . THR A 1 295  ? -39.709 -43.726 36.799  1.00 35.64  ? 1657 THR A H      1 
ATOM   4861  H  HA     . THR A 1 295  ? -40.107 -41.671 35.397  1.00 35.43  ? 1657 THR A HA     1 
ATOM   4862  H  HB     . THR A 1 295  ? -39.923 -44.387 34.676  1.00 34.53  ? 1657 THR A HB     1 
ATOM   4863  H  HG1    . THR A 1 295  ? -38.073 -43.236 35.002  1.00 33.86  ? 1657 THR A HG1    1 
ATOM   4864  H  HG21   . THR A 1 295  ? -40.070 -43.925 32.387  1.00 34.55  ? 1657 THR A HG21   1 
ATOM   4865  H  HG22   . THR A 1 295  ? -41.446 -43.592 33.085  1.00 34.55  ? 1657 THR A HG22   1 
ATOM   4866  H  HG23   . THR A 1 295  ? -40.450 -42.426 32.706  1.00 34.55  ? 1657 THR A HG23   1 
ATOM   4867  N  N      . GLU A 1 296  ? -42.744 -43.483 35.441  1.00 40.99  ? 1658 GLU A N      1 
ATOM   4868  C  CA     . GLU A 1 296  ? -44.187 -43.468 35.248  1.00 41.94  ? 1658 GLU A CA     1 
ATOM   4869  C  C      . GLU A 1 296  ? -44.874 -42.410 36.102  1.00 42.43  ? 1658 GLU A C      1 
ATOM   4870  O  O      . GLU A 1 296  ? -45.795 -41.735 35.643  1.00 42.93  ? 1658 GLU A O      1 
ATOM   4871  C  CB     . GLU A 1 296  ? -44.789 -44.826 35.589  1.00 43.70  ? 1658 GLU A CB     1 
ATOM   4872  C  CG     . GLU A 1 296  ? -46.290 -44.903 35.332  1.00 48.14  ? 1658 GLU A CG     1 
ATOM   4873  C  CD     . GLU A 1 296  ? -46.871 -46.222 35.761  1.00 48.26  ? 1658 GLU A CD     1 
ATOM   4874  O  OE1    . GLU A 1 296  ? -46.369 -46.758 36.764  1.00 45.89  ? 1658 GLU A OE1    1 
ATOM   4875  O  OE2    . GLU A 1 296  ? -47.823 -46.710 35.112  1.00 49.97  1 1658 GLU A OE2    1 
ATOM   4876  H  H      . GLU A 1 296  ? -42.436 -44.233 35.727  1.00 49.19  ? 1658 GLU A H      1 
ATOM   4877  H  HA     . GLU A 1 296  ? -44.380 -43.276 34.317  1.00 50.33  ? 1658 GLU A HA     1 
ATOM   4878  H  HB2    . GLU A 1 296  ? -44.359 -45.505 35.046  1.00 52.44  ? 1658 GLU A HB2    1 
ATOM   4879  H  HB3    . GLU A 1 296  ? -44.638 -45.010 36.529  1.00 52.44  ? 1658 GLU A HB3    1 
ATOM   4880  H  HG2    . GLU A 1 296  ? -46.734 -44.200 35.832  1.00 57.76  ? 1658 GLU A HG2    1 
ATOM   4881  H  HG3    . GLU A 1 296  ? -46.456 -44.794 34.383  1.00 57.76  ? 1658 GLU A HG3    1 
ATOM   4882  N  N      . LEU A 1 297  ? -44.434 -42.274 37.350  1.00 32.04  ? 1659 LEU A N      1 
ATOM   4883  C  CA     . LEU A 1 297  ? -45.079 -41.346 38.270  1.00 32.89  ? 1659 LEU A CA     1 
ATOM   4884  C  C      . LEU A 1 297  ? -44.818 -39.906 37.903  1.00 32.99  ? 1659 LEU A C      1 
ATOM   4885  O  O      . LEU A 1 297  ? -45.745 -39.109 37.796  1.00 33.66  ? 1659 LEU A O      1 
ATOM   4886  C  CB     . LEU A 1 297  ? -44.622 -41.590 39.711  1.00 33.14  ? 1659 LEU A CB     1 
ATOM   4887  C  CG     . LEU A 1 297  ? -45.242 -42.770 40.459  1.00 33.53  ? 1659 LEU A CG     1 
ATOM   4888  C  CD1    . LEU A 1 297  ? -44.650 -42.859 41.858  1.00 33.81  ? 1659 LEU A CD1    1 
ATOM   4889  C  CD2    . LEU A 1 297  ? -46.761 -42.650 40.522  1.00 34.40  ? 1659 LEU A CD2    1 
ATOM   4890  H  H      . LEU A 1 297  ? -43.770 -42.705 37.685  1.00 38.44  ? 1659 LEU A H      1 
ATOM   4891  H  HA     . LEU A 1 297  ? -46.038 -41.490 38.236  1.00 39.47  ? 1659 LEU A HA     1 
ATOM   4892  H  HB2    . LEU A 1 297  ? -43.662 -41.734 39.700  1.00 39.77  ? 1659 LEU A HB2    1 
ATOM   4893  H  HB3    . LEU A 1 297  ? -44.818 -40.792 40.227  1.00 39.77  ? 1659 LEU A HB3    1 
ATOM   4894  H  HG     . LEU A 1 297  ? -45.026 -43.591 39.989  1.00 40.23  ? 1659 LEU A HG     1 
ATOM   4895  H  HD11   . LEU A 1 297  ? -45.051 -43.610 42.323  1.00 40.58  ? 1659 LEU A HD11   1 
ATOM   4896  H  HD12   . LEU A 1 297  ? -43.691 -42.986 41.787  1.00 40.58  ? 1659 LEU A HD12   1 
ATOM   4897  H  HD13   . LEU A 1 297  ? -44.841 -42.035 42.333  1.00 40.58  ? 1659 LEU A HD13   1 
ATOM   4898  H  HD21   . LEU A 1 297  ? -47.118 -43.413 41.002  1.00 41.28  ? 1659 LEU A HD21   1 
ATOM   4899  H  HD22   . LEU A 1 297  ? -46.994 -41.830 40.984  1.00 41.28  ? 1659 LEU A HD22   1 
ATOM   4900  H  HD23   . LEU A 1 297  ? -47.114 -42.632 39.618  1.00 41.28  ? 1659 LEU A HD23   1 
ATOM   4901  N  N      . VAL A 1 298  ? -43.553 -39.568 37.709  1.00 32.63  ? 1660 VAL A N      1 
ATOM   4902  C  CA     . VAL A 1 298  ? -43.215 -38.194 37.393  1.00 32.78  ? 1660 VAL A CA     1 
ATOM   4903  C  C      . VAL A 1 298  ? -43.759 -37.882 35.989  1.00 32.73  ? 1660 VAL A C      1 
ATOM   4904  O  O      . VAL A 1 298  ? -43.906 -36.723 35.624  1.00 33.11  ? 1660 VAL A O      1 
ATOM   4905  C  CB     . VAL A 1 298  ? -41.689 -37.935 37.501  1.00 32.19  ? 1660 VAL A CB     1 
ATOM   4906  C  CG1    . VAL A 1 298  ? -40.913 -38.921 36.689  1.00 31.26  ? 1660 VAL A CG1    1 
ATOM   4907  C  CG2    . VAL A 1 298  ? -41.333 -36.512 37.079  1.00 32.40  ? 1660 VAL A CG2    1 
ATOM   4908  H  H      . VAL A 1 298  ? -42.883 -40.105 37.755  1.00 39.16  ? 1660 VAL A H      1 
ATOM   4909  H  HA     . VAL A 1 298  ? -43.661 -37.608 38.023  1.00 39.34  ? 1660 VAL A HA     1 
ATOM   4910  H  HB     . VAL A 1 298  ? -41.422 -38.042 38.428  1.00 38.62  ? 1660 VAL A HB     1 
ATOM   4911  H  HG11   . VAL A 1 298  ? -39.966 -38.729 36.781  1.00 37.51  ? 1660 VAL A HG11   1 
ATOM   4912  H  HG12   . VAL A 1 298  ? -41.102 -39.815 37.014  1.00 37.51  ? 1660 VAL A HG12   1 
ATOM   4913  H  HG13   . VAL A 1 298  ? -41.178 -38.842 35.760  1.00 37.51  ? 1660 VAL A HG13   1 
ATOM   4914  H  HG21   . VAL A 1 298  ? -40.374 -36.389 37.161  1.00 38.88  ? 1660 VAL A HG21   1 
ATOM   4915  H  HG22   . VAL A 1 298  ? -41.606 -36.379 36.158  1.00 38.88  ? 1660 VAL A HG22   1 
ATOM   4916  H  HG23   . VAL A 1 298  ? -41.797 -35.886 37.656  1.00 38.88  ? 1660 VAL A HG23   1 
ATOM   4917  N  N      . GLU A 1 299  ? -44.093 -38.914 35.217  1.00 37.69  ? 1661 GLU A N      1 
ATOM   4918  C  CA     . GLU A 1 299  ? -44.736 -38.704 33.921  1.00 37.75  ? 1661 GLU A CA     1 
ATOM   4919  C  C      . GLU A 1 299  ? -46.158 -38.174 34.049  1.00 38.69  ? 1661 GLU A C      1 
ATOM   4920  O  O      . GLU A 1 299  ? -46.531 -37.231 33.357  1.00 39.05  ? 1661 GLU A O      1 
ATOM   4921  C  CB     . GLU A 1 299  ? -44.755 -39.998 33.098  1.00 37.20  ? 1661 GLU A CB     1 
ATOM   4922  C  CG     . GLU A 1 299  ? -43.528 -40.214 32.231  1.00 36.36  ? 1661 GLU A CG     1 
ATOM   4923  C  CD     . GLU A 1 299  ? -43.826 -39.961 30.765  1.00 36.35  ? 1661 GLU A CD     1 
ATOM   4924  O  OE1    . GLU A 1 299  ? -43.546 -40.861 29.943  1.00 35.86  ? 1661 GLU A OE1    1 
ATOM   4925  O  OE2    . GLU A 1 299  ? -44.338 -38.862 30.444  1.00 36.89  1 1661 GLU A OE2    1 
ATOM   4926  H  H      . GLU A 1 299  ? -43.960 -39.739 35.419  1.00 45.22  ? 1661 GLU A H      1 
ATOM   4927  H  HA     . GLU A 1 299  ? -44.223 -38.048 33.424  1.00 45.31  ? 1661 GLU A HA     1 
ATOM   4928  H  HB2    . GLU A 1 299  ? -44.820 -40.751 33.706  1.00 44.64  ? 1661 GLU A HB2    1 
ATOM   4929  H  HB3    . GLU A 1 299  ? -45.529 -39.983 32.514  1.00 44.64  ? 1661 GLU A HB3    1 
ATOM   4930  H  HG2    . GLU A 1 299  ? -42.829 -39.602 32.508  1.00 43.64  ? 1661 GLU A HG2    1 
ATOM   4931  H  HG3    . GLU A 1 299  ? -43.228 -41.131 32.325  1.00 43.64  ? 1661 GLU A HG3    1 
ATOM   4932  N  N      . LYS A 1 300  ? -46.960 -38.773 34.922  1.00 44.48  ? 1662 LYS A N      1 
ATOM   4933  C  CA     . LYS A 1 300  ? -48.328 -38.302 35.109  1.00 45.43  ? 1662 LYS A CA     1 
ATOM   4934  C  C      . LYS A 1 300  ? -48.276 -37.060 35.981  1.00 46.06  ? 1662 LYS A C      1 
ATOM   4935  O  O      . LYS A 1 300  ? -49.112 -36.171 35.862  1.00 46.82  ? 1662 LYS A O      1 
ATOM   4936  C  CB     . LYS A 1 300  ? -49.203 -39.389 35.725  1.00 45.77  ? 1662 LYS A CB     1 
ATOM   4937  C  CG     . LYS A 1 300  ? -48.826 -39.789 37.141  1.00 46.20  ? 1662 LYS A CG     1 
ATOM   4938  C  CD     . LYS A 1 300  ? -49.701 -40.926 37.673  1.00 46.27  ? 1662 LYS A CD     1 
ATOM   4939  C  CE     . LYS A 1 300  ? -49.564 -42.180 36.803  1.00 45.63  ? 1662 LYS A CE     1 
ATOM   4940  N  NZ     . LYS A 1 300  ? -50.275 -43.366 37.345  1.00 46.01  1 1662 LYS A NZ     1 
ATOM   4941  H  H      . LYS A 1 300  ? -46.741 -39.445 35.413  1.00 53.37  ? 1662 LYS A H      1 
ATOM   4942  H  HA     . LYS A 1 300  ? -48.704 -38.057 34.249  1.00 54.51  ? 1662 LYS A HA     1 
ATOM   4943  H  HB2    . LYS A 1 300  ? -50.120 -39.073 35.744  1.00 54.92  ? 1662 LYS A HB2    1 
ATOM   4944  H  HB3    . LYS A 1 300  ? -49.145 -40.183 35.171  1.00 54.92  ? 1662 LYS A HB3    1 
ATOM   4945  H  HG2    . LYS A 1 300  ? -47.903 -40.088 37.152  1.00 55.44  ? 1662 LYS A HG2    1 
ATOM   4946  H  HG3    . LYS A 1 300  ? -48.936 -39.024 37.728  1.00 55.44  ? 1662 LYS A HG3    1 
ATOM   4947  H  HD2    . LYS A 1 300  ? -49.426 -41.148 38.576  1.00 55.53  ? 1662 LYS A HD2    1 
ATOM   4948  H  HD3    . LYS A 1 300  ? -50.631 -40.648 37.663  1.00 55.53  ? 1662 LYS A HD3    1 
ATOM   4949  H  HE2    . LYS A 1 300  ? -49.928 -41.992 35.924  1.00 54.75  ? 1662 LYS A HE2    1 
ATOM   4950  H  HE3    . LYS A 1 300  ? -48.624 -42.406 36.728  1.00 54.75  ? 1662 LYS A HE3    1 
ATOM   4951  H  HZ1    . LYS A 1 300  ? -50.161 -44.062 36.802  1.00 55.21  ? 1662 LYS A HZ1    1 
ATOM   4952  H  HZ2    . LYS A 1 300  ? -49.955 -43.572 38.149  1.00 55.21  ? 1662 LYS A HZ2    1 
ATOM   4953  H  HZ3    . LYS A 1 300  ? -51.145 -43.193 37.415  1.00 55.21  ? 1662 LYS A HZ3    1 
ATOM   4954  N  N      . CYS A 1 301  ? -47.275 -37.012 36.853  1.00 49.03  ? 1663 CYS A N      1 
ATOM   4955  C  CA     . CYS A 1 301  ? -47.033 -35.851 37.698  1.00 49.60  ? 1663 CYS A CA     1 
ATOM   4956  C  C      . CYS A 1 301  ? -46.684 -34.629 36.849  1.00 49.64  ? 1663 CYS A C      1 
ATOM   4957  O  O      . CYS A 1 301  ? -46.822 -33.495 37.300  1.00 53.52  ? 1663 CYS A O      1 
ATOM   4958  C  CB     . CYS A 1 301  ? -45.904 -36.148 38.685  1.00 49.23  ? 1663 CYS A CB     1 
ATOM   4959  S  SG     . CYS A 1 301  ? -45.727 -34.977 40.037  1.00 87.25  ? 1663 CYS A SG     1 
ATOM   4960  H  H      . CYS A 1 301  ? -46.713 -37.651 36.975  1.00 58.84  ? 1663 CYS A H      1 
ATOM   4961  H  HA     . CYS A 1 301  ? -47.836 -35.651 38.205  1.00 59.52  ? 1663 CYS A HA     1 
ATOM   4962  H  HB2    . CYS A 1 301  ? -46.061 -37.022 39.076  1.00 59.08  ? 1663 CYS A HB2    1 
ATOM   4963  H  HB3    . CYS A 1 301  ? -45.066 -36.158 38.198  1.00 59.08  ? 1663 CYS A HB3    1 
ATOM   4964  H  HG     . CYS A 1 301  ? -44.813 -35.321 40.734  1.00 104.70 ? 1663 CYS A HG     1 
ATOM   4965  N  N      . LEU A 1 302  ? -46.230 -34.866 35.620  1.00 45.61  ? 1664 LEU A N      1 
ATOM   4966  C  CA     . LEU A 1 302  ? -45.943 -33.787 34.675  1.00 45.69  ? 1664 LEU A CA     1 
ATOM   4967  C  C      . LEU A 1 302  ? -47.227 -33.204 34.109  1.00 46.50  ? 1664 LEU A C      1 
ATOM   4968  O  O      . LEU A 1 302  ? -47.371 -31.988 34.000  1.00 49.56  ? 1664 LEU A O      1 
ATOM   4969  C  CB     . LEU A 1 302  ? -45.047 -34.273 33.531  1.00 44.76  ? 1664 LEU A CB     1 
ATOM   4970  C  CG     . LEU A 1 302  ? -43.528 -34.245 33.717  1.00 44.07  ? 1664 LEU A CG     1 
ATOM   4971  C  CD1    . LEU A 1 302  ? -42.841 -34.905 32.545  1.00 43.23  ? 1664 LEU A CD1    1 
ATOM   4972  C  CD2    . LEU A 1 302  ? -43.036 -32.822 33.836  1.00 44.53  ? 1664 LEU A CD2    1 
ATOM   4973  H  H      . LEU A 1 302  ? -46.078 -35.651 35.305  1.00 54.73  ? 1664 LEU A H      1 
ATOM   4974  H  HA     . LEU A 1 302  ? -45.474 -33.077 35.142  1.00 54.83  ? 1664 LEU A HA     1 
ATOM   4975  H  HB2    . LEU A 1 302  ? -45.287 -35.193 33.339  1.00 53.71  ? 1664 LEU A HB2    1 
ATOM   4976  H  HB3    . LEU A 1 302  ? -45.242 -33.729 32.752  1.00 53.71  ? 1664 LEU A HB3    1 
ATOM   4977  H  HG     . LEU A 1 302  ? -43.290 -34.724 34.526  1.00 52.89  ? 1664 LEU A HG     1 
ATOM   4978  H  HD11   . LEU A 1 302  ? -41.882 -34.875 32.685  1.00 51.88  ? 1664 LEU A HD11   1 
ATOM   4979  H  HD12   . LEU A 1 302  ? -43.139 -35.826 32.483  1.00 51.88  ? 1664 LEU A HD12   1 
ATOM   4980  H  HD13   . LEU A 1 302  ? -43.073 -34.427 31.734  1.00 51.88  ? 1664 LEU A HD13   1 
ATOM   4981  H  HD21   . LEU A 1 302  ? -42.073 -32.830 33.953  1.00 53.44  ? 1664 LEU A HD21   1 
ATOM   4982  H  HD22   . LEU A 1 302  ? -43.267 -32.340 33.027  1.00 53.44  ? 1664 LEU A HD22   1 
ATOM   4983  H  HD23   . LEU A 1 302  ? -43.459 -32.404 34.603  1.00 53.44  ? 1664 LEU A HD23   1 
ATOM   4984  N  N      . GLN A 1 303  ? -48.156 -34.075 33.735  1.00 59.71  ? 1665 GLN A N      1 
ATOM   4985  C  CA     . GLN A 1 303  ? -49.421 -33.627 33.176  1.00 60.50  ? 1665 GLN A CA     1 
ATOM   4986  C  C      . GLN A 1 303  ? -50.254 -32.890 34.227  1.00 63.93  ? 1665 GLN A C      1 
ATOM   4987  O  O      . GLN A 1 303  ? -50.862 -31.861 33.934  1.00 70.15  ? 1665 GLN A O      1 
ATOM   4988  C  CB     . GLN A 1 303  ? -50.196 -34.827 32.619  1.00 61.82  ? 1665 GLN A CB     1 
ATOM   4989  C  CG     . GLN A 1 303  ? -51.681 -34.576 32.329  1.00 70.00  ? 1665 GLN A CG     1 
ATOM   4990  C  CD     . GLN A 1 303  ? -52.032 -34.718 30.865  1.00 80.02  ? 1665 GLN A CD     1 
ATOM   4991  O  OE1    . GLN A 1 303  ? -51.481 -35.560 30.151  1.00 82.12  ? 1665 GLN A OE1    1 
ATOM   4992  N  NE2    . GLN A 1 303  ? -52.950 -33.876 30.404  1.00 83.31  ? 1665 GLN A NE2    1 
ATOM   4993  H  H      . GLN A 1 303  ? -48.077 -34.930 33.796  1.00 71.65  ? 1665 GLN A H      1 
ATOM   4994  H  HA     . GLN A 1 303  ? -49.247 -33.014 32.445  1.00 72.60  ? 1665 GLN A HA     1 
ATOM   4995  H  HB2    . GLN A 1 303  ? -49.780 -35.102 31.787  1.00 74.18  ? 1665 GLN A HB2    1 
ATOM   4996  H  HB3    . GLN A 1 303  ? -50.144 -35.552 33.261  1.00 74.18  ? 1665 GLN A HB3    1 
ATOM   4997  H  HG2    . GLN A 1 303  ? -52.212 -35.217 32.827  1.00 84.00  ? 1665 GLN A HG2    1 
ATOM   4998  H  HG3    . GLN A 1 303  ? -51.908 -33.674 32.604  1.00 84.00  ? 1665 GLN A HG3    1 
ATOM   4999  H  HE21   . GLN A 1 303  ? -53.305 -33.296 30.931  1.00 99.97  ? 1665 GLN A HE21   1 
ATOM   5000  H  HE22   . GLN A 1 303  ? -53.189 -33.910 29.579  1.00 99.97  ? 1665 GLN A HE22   1 
ATOM   5001  N  N      . THR A 1 304  ? -50.279 -33.420 35.446  1.00 68.54  ? 1666 THR A N      1 
ATOM   5002  C  CA     . THR A 1 304  ? -51.044 -32.822 36.537  1.00 68.48  ? 1666 THR A CA     1 
ATOM   5003  C  C      . THR A 1 304  ? -50.302 -31.686 37.239  1.00 67.96  ? 1666 THR A C      1 
ATOM   5004  O  O      . THR A 1 304  ? -50.928 -30.770 37.772  1.00 75.09  ? 1666 THR A O      1 
ATOM   5005  C  CB     . THR A 1 304  ? -51.414 -33.867 37.591  1.00 69.65  ? 1666 THR A CB     1 
ATOM   5006  O  OG1    . THR A 1 304  ? -50.219 -34.386 38.186  1.00 70.01  ? 1666 THR A OG1    1 
ATOM   5007  C  CG2    . THR A 1 304  ? -52.217 -35.003 36.965  1.00 70.38  ? 1666 THR A CG2    1 
ATOM   5008  H  H      . THR A 1 304  ? -49.856 -34.134 35.669  1.00 82.24  ? 1666 THR A H      1 
ATOM   5009  H  HA     . THR A 1 304  ? -51.868 -32.459 36.177  1.00 82.17  ? 1666 THR A HA     1 
ATOM   5010  H  HB     . THR A 1 304  ? -51.959 -33.451 38.277  1.00 83.58  ? 1666 THR A HB     1 
ATOM   5011  H  HG1    . THR A 1 304  ? -50.414 -34.961 38.767  1.00 84.02  ? 1666 THR A HG1    1 
ATOM   5012  H  HG21   . THR A 1 304  ? -52.446 -35.659 37.641  1.00 84.46  ? 1666 THR A HG21   1 
ATOM   5013  H  HG22   . THR A 1 304  ? -53.034 -34.655 36.574  1.00 84.46  ? 1666 THR A HG22   1 
ATOM   5014  H  HG23   . THR A 1 304  ? -51.695 -35.435 36.271  1.00 84.46  ? 1666 THR A HG23   1 
ATOM   5015  N  N      . ASN A 1 305  ? -48.972 -31.756 37.225  1.00 38.16  ? 1667 ASN A N      1 
ATOM   5016  C  CA     . ASN A 1 305  ? -48.116 -30.896 38.043  1.00 38.40  ? 1667 ASN A CA     1 
ATOM   5017  C  C      . ASN A 1 305  ? -48.259 -31.124 39.552  1.00 38.90  ? 1667 ASN A C      1 
ATOM   5018  O  O      . ASN A 1 305  ? -48.415 -30.172 40.319  1.00 39.78  ? 1667 ASN A O      1 
ATOM   5019  C  CB     . ASN A 1 305  ? -48.368 -29.418 37.733  1.00 39.24  ? 1667 ASN A CB     1 
ATOM   5020  C  CG     . ASN A 1 305  ? -48.299 -29.112 36.254  1.00 38.93  ? 1667 ASN A CG     1 
ATOM   5021  O  OD1    . ASN A 1 305  ? -49.123 -29.580 35.473  1.00 38.90  ? 1667 ASN A OD1    1 
ATOM   5022  N  ND2    . ASN A 1 305  ? -47.320 -28.309 35.862  1.00 38.78  ? 1667 ASN A ND2    1 
ATOM   5023  H  H      . ASN A 1 305  ? -48.530 -32.308 36.735  1.00 45.79  ? 1667 ASN A H      1 
ATOM   5024  H  HA     . ASN A 1 305  ? -47.193 -31.084 37.812  1.00 46.08  ? 1667 ASN A HA     1 
ATOM   5025  H  HB2    . ASN A 1 305  ? -49.253 -29.175 38.048  1.00 47.09  ? 1667 ASN A HB2    1 
ATOM   5026  H  HB3    . ASN A 1 305  ? -47.696 -28.881 38.182  1.00 47.09  ? 1667 ASN A HB3    1 
ATOM   5027  H  HD21   . ASN A 1 305  ? -47.238 -28.105 35.031  1.00 46.54  ? 1667 ASN A HD21   1 
ATOM   5028  H  HD22   . ASN A 1 305  ? -46.767 -27.993 36.439  1.00 46.54  ? 1667 ASN A HD22   1 
ATOM   5029  N  N      . GLN A 1 306  ? -48.170 -32.384 39.977  1.00 78.63  ? 1668 GLN A N      1 
ATOM   5030  C  CA     . GLN A 1 306  ? -48.348 -32.742 41.385  1.00 86.70  ? 1668 GLN A CA     1 
ATOM   5031  C  C      . GLN A 1 306  ? -47.084 -32.455 42.177  1.00 80.72  ? 1668 GLN A C      1 
ATOM   5032  O  O      . GLN A 1 306  ? -47.040 -32.713 43.379  1.00 85.68  ? 1668 GLN A O      1 
ATOM   5033  C  CB     . GLN A 1 306  ? -48.662 -34.239 41.565  1.00 83.34  ? 1668 GLN A CB     1 
ATOM   5034  C  CG     . GLN A 1 306  ? -50.107 -34.677 41.554  1.00 88.11  ? 1668 GLN A CG     1 
ATOM   5035  C  CD     . GLN A 1 306  ? -50.223 -36.171 41.825  1.00 85.36  ? 1668 GLN A CD     1 
ATOM   5036  O  OE1    . GLN A 1 306  ? -50.045 -36.996 40.927  1.00 83.54  ? 1668 GLN A OE1    1 
ATOM   5037  N  NE2    . GLN A 1 306  ? -50.490 -36.523 43.080  1.00 84.86  ? 1668 GLN A NE2    1 
ATOM   5038  H  H      . GLN A 1 306  ? -48.006 -33.056 39.465  1.00 94.36  ? 1668 GLN A H      1 
ATOM   5039  H  HA     . GLN A 1 306  ? -49.076 -32.225 41.764  1.00 104.04 ? 1668 GLN A HA     1 
ATOM   5040  H  HB2    . GLN A 1 306  ? -48.216 -34.723 40.852  1.00 100.01 ? 1668 GLN A HB2    1 
ATOM   5041  H  HB3    . GLN A 1 306  ? -48.290 -34.519 42.416  1.00 100.01 ? 1668 GLN A HB3    1 
ATOM   5042  H  HG2    . GLN A 1 306  ? -50.593 -34.202 42.247  1.00 105.73 ? 1668 GLN A HG2    1 
ATOM   5043  H  HG3    . GLN A 1 306  ? -50.493 -34.493 40.684  1.00 105.73 ? 1668 GLN A HG3    1 
ATOM   5044  H  HE21   . GLN A 1 306  ? -50.586 -35.919 43.684  1.00 101.83 ? 1668 GLN A HE21   1 
ATOM   5045  H  HE22   . GLN A 1 306  ? -50.566 -37.354 43.286  1.00 101.83 ? 1668 GLN A HE22   1 
ATOM   5046  N  N      . PHE A 1 307  ? -46.082 -31.885 41.511  1.00 59.41  ? 1669 PHE A N      1 
ATOM   5047  C  CA     . PHE A 1 307  ? -44.689 -32.005 41.936  1.00 68.10  ? 1669 PHE A CA     1 
ATOM   5048  C  C      . PHE A 1 307  ? -44.487 -31.825 43.440  1.00 71.72  ? 1669 PHE A C      1 
ATOM   5049  O  O      . PHE A 1 307  ? -43.696 -32.549 44.041  1.00 84.33  ? 1669 PHE A O      1 
ATOM   5050  C  CB     . PHE A 1 307  ? -43.820 -30.991 41.188  1.00 61.88  ? 1669 PHE A CB     1 
ATOM   5051  C  CG     . PHE A 1 307  ? -43.884 -31.120 39.693  1.00 54.37  ? 1669 PHE A CG     1 
ATOM   5052  C  CD1    . PHE A 1 307  ? -43.090 -32.039 39.024  1.00 53.11  ? 1669 PHE A CD1    1 
ATOM   5053  C  CD2    . PHE A 1 307  ? -44.726 -30.305 38.953  1.00 54.79  ? 1669 PHE A CD2    1 
ATOM   5054  C  CE1    . PHE A 1 307  ? -43.152 -32.150 37.648  1.00 52.62  ? 1669 PHE A CE1    1 
ATOM   5055  C  CE2    . PHE A 1 307  ? -44.781 -30.408 37.583  1.00 54.30  ? 1669 PHE A CE2    1 
ATOM   5056  C  CZ     . PHE A 1 307  ? -44.003 -31.328 36.932  1.00 53.22  ? 1669 PHE A CZ     1 
ATOM   5057  H  H      . PHE A 1 307  ? -46.186 -31.416 40.798  1.00 71.30  ? 1669 PHE A H      1 
ATOM   5058  H  HA     . PHE A 1 307  ? -44.372 -32.892 41.703  1.00 81.72  ? 1669 PHE A HA     1 
ATOM   5059  H  HB2    . PHE A 1 307  ? -44.114 -30.096 41.420  1.00 74.25  ? 1669 PHE A HB2    1 
ATOM   5060  H  HB3    . PHE A 1 307  ? -42.896 -31.113 41.456  1.00 74.25  ? 1669 PHE A HB3    1 
ATOM   5061  H  HD1    . PHE A 1 307  ? -42.520 -32.594 39.506  1.00 63.73  ? 1669 PHE A HD1    1 
ATOM   5062  H  HD2    . PHE A 1 307  ? -45.259 -29.679 39.389  1.00 65.74  ? 1669 PHE A HD2    1 
ATOM   5063  H  HE1    . PHE A 1 307  ? -42.620 -32.771 37.204  1.00 63.14  ? 1669 PHE A HE1    1 
ATOM   5064  H  HE2    . PHE A 1 307  ? -45.355 -29.860 37.098  1.00 65.16  ? 1669 PHE A HE2    1 
ATOM   5065  H  HZ     . PHE A 1 307  ? -44.044 -31.398 36.006  1.00 63.87  ? 1669 PHE A HZ     1 
ATOM   5066  N  N      . SER A 1 308  ? -45.207 -30.883 44.048  1.00 88.73  ? 1670 SER A N      1 
ATOM   5067  C  CA     . SER A 1 308  ? -45.099 -30.656 45.489  1.00 88.43  ? 1670 SER A CA     1 
ATOM   5068  C  C      . SER A 1 308  ? -45.382 -31.933 46.283  1.00 88.15  ? 1670 SER A C      1 
ATOM   5069  O  O      . SER A 1 308  ? -44.608 -32.302 47.165  1.00 88.15  ? 1670 SER A O      1 
ATOM   5070  C  CB     . SER A 1 308  ? -46.044 -29.545 45.945  1.00 88.40  ? 1670 SER A CB     1 
ATOM   5071  O  OG     . SER A 1 308  ? -45.970 -29.382 47.353  1.00 88.66  ? 1670 SER A OG     1 
ATOM   5072  H  H      . SER A 1 308  ? -45.764 -30.362 43.649  1.00 106.48 ? 1670 SER A H      1 
ATOM   5073  H  HA     . SER A 1 308  ? -44.193 -30.376 45.693  1.00 106.12 ? 1670 SER A HA     1 
ATOM   5074  H  HB2    . SER A 1 308  ? -45.788 -28.714 45.515  1.00 106.08 ? 1670 SER A HB2    1 
ATOM   5075  H  HB3    . SER A 1 308  ? -46.953 -29.781 45.700  1.00 106.08 ? 1670 SER A HB3    1 
ATOM   5076  H  HG     . SER A 1 308  ? -46.491 -28.770 47.599  1.00 106.40 ? 1670 SER A HG     1 
ATOM   5077  N  N      . LYS A 1 309  ? -46.489 -32.604 45.977  1.00 81.95  ? 1671 LYS A N      1 
ATOM   5078  C  CA     . LYS A 1 309  ? -46.880 -33.787 46.736  1.00 83.05  ? 1671 LYS A CA     1 
ATOM   5079  C  C      . LYS A 1 309  ? -45.895 -34.919 46.540  1.00 73.95  ? 1671 LYS A C      1 
ATOM   5080  O  O      . LYS A 1 309  ? -45.509 -35.585 47.499  1.00 74.32  ? 1671 LYS A O      1 
ATOM   5081  C  CB     . LYS A 1 309  ? -48.271 -34.271 46.308  1.00 83.15  ? 1671 LYS A CB     1 
ATOM   5082  C  CG     . LYS A 1 309  ? -49.400 -33.261 46.448  1.00 88.80  ? 1671 LYS A CG     1 
ATOM   5083  C  CD     . LYS A 1 309  ? -49.422 -32.590 47.813  1.00 89.04  ? 1671 LYS A CD     1 
ATOM   5084  C  CE     . LYS A 1 309  ? -50.404 -31.439 47.843  1.00 84.61  ? 1671 LYS A CE     1 
ATOM   5085  N  NZ     . LYS A 1 309  ? -50.063 -30.490 48.927  1.00 84.96  1 1671 LYS A NZ     1 
ATOM   5086  H  H      . LYS A 1 309  ? -47.027 -32.397 45.338  1.00 98.33  ? 1671 LYS A H      1 
ATOM   5087  H  HA     . LYS A 1 309  ? -46.909 -33.567 47.680  1.00 99.66  ? 1671 LYS A HA     1 
ATOM   5088  H  HB2    . LYS A 1 309  ? -48.230 -34.531 45.374  1.00 99.78  ? 1671 LYS A HB2    1 
ATOM   5089  H  HB3    . LYS A 1 309  ? -48.504 -35.043 46.847  1.00 99.78  ? 1671 LYS A HB3    1 
ATOM   5090  H  HG2    . LYS A 1 309  ? -49.291 -32.570 45.776  1.00 106.56 ? 1671 LYS A HG2    1 
ATOM   5091  H  HG3    . LYS A 1 309  ? -50.248 -33.715 46.324  1.00 106.56 ? 1671 LYS A HG3    1 
ATOM   5092  H  HD2    . LYS A 1 309  ? -49.690 -33.236 48.485  1.00 106.85 ? 1671 LYS A HD2    1 
ATOM   5093  H  HD3    . LYS A 1 309  ? -48.539 -32.242 48.014  1.00 106.85 ? 1671 LYS A HD3    1 
ATOM   5094  H  HE2    . LYS A 1 309  ? -50.370 -30.964 46.998  1.00 101.53 ? 1671 LYS A HE2    1 
ATOM   5095  H  HE3    . LYS A 1 309  ? -51.297 -31.781 48.004  1.00 101.53 ? 1671 LYS A HE3    1 
ATOM   5096  H  HZ1    . LYS A 1 309  ? -50.646 -29.817 48.937  1.00 101.95 ? 1671 LYS A HZ1    1 
ATOM   5097  H  HZ2    . LYS A 1 309  ? -50.089 -30.905 49.714  1.00 101.95 ? 1671 LYS A HZ2    1 
ATOM   5098  H  HZ3    . LYS A 1 309  ? -49.246 -30.163 48.799  1.00 101.95 ? 1671 LYS A HZ3    1 
ATOM   5099  N  N      . TYR A 1 310  ? -45.467 -35.119 45.298  1.00 38.22  ? 1672 TYR A N      1 
ATOM   5100  C  CA     . TYR A 1 310  ? -44.531 -36.190 45.002  1.00 37.16  ? 1672 TYR A CA     1 
ATOM   5101  C  C      . TYR A 1 310  ? -43.124 -35.849 45.488  1.00 36.85  ? 1672 TYR A C      1 
ATOM   5102  O  O      . TYR A 1 310  ? -42.359 -36.742 45.840  1.00 36.34  ? 1672 TYR A O      1 
ATOM   5103  C  CB     . TYR A 1 310  ? -44.520 -36.512 43.499  1.00 36.26  ? 1672 TYR A CB     1 
ATOM   5104  C  CG     . TYR A 1 310  ? -43.821 -37.817 43.155  1.00 35.29  ? 1672 TYR A CG     1 
ATOM   5105  C  CD1    . TYR A 1 310  ? -43.625 -38.804 44.115  1.00 35.37  ? 1672 TYR A CD1    1 
ATOM   5106  C  CD2    . TYR A 1 310  ? -43.341 -38.057 41.874  1.00 34.38  ? 1672 TYR A CD2    1 
ATOM   5107  C  CE1    . TYR A 1 310  ? -42.984 -39.987 43.809  1.00 34.56  ? 1672 TYR A CE1    1 
ATOM   5108  C  CE2    . TYR A 1 310  ? -42.693 -39.245 41.560  1.00 33.55  ? 1672 TYR A CE2    1 
ATOM   5109  C  CZ     . TYR A 1 310  ? -42.519 -40.203 42.534  1.00 33.65  ? 1672 TYR A CZ     1 
ATOM   5110  O  OH     . TYR A 1 310  ? -41.880 -41.384 42.244  1.00 32.91  ? 1672 TYR A OH     1 
ATOM   5111  H  H      . TYR A 1 310  ? -45.702 -34.651 44.616  1.00 45.86  ? 1672 TYR A H      1 
ATOM   5112  H  HA     . TYR A 1 310  ? -44.818 -36.989 45.471  1.00 44.60  ? 1672 TYR A HA     1 
ATOM   5113  H  HB2    . TYR A 1 310  ? -45.436 -36.575 43.186  1.00 43.52  ? 1672 TYR A HB2    1 
ATOM   5114  H  HB3    . TYR A 1 310  ? -44.061 -35.798 43.030  1.00 43.52  ? 1672 TYR A HB3    1 
ATOM   5115  H  HD1    . TYR A 1 310  ? -43.936 -38.665 44.980  1.00 42.44  ? 1672 TYR A HD1    1 
ATOM   5116  H  HD2    . TYR A 1 310  ? -43.456 -37.411 41.214  1.00 41.25  ? 1672 TYR A HD2    1 
ATOM   5117  H  HE1    . TYR A 1 310  ? -42.864 -40.636 44.464  1.00 41.47  ? 1672 TYR A HE1    1 
ATOM   5118  H  HE2    . TYR A 1 310  ? -42.379 -39.392 40.697  1.00 40.26  ? 1672 TYR A HE2    1 
ATOM   5119  H  HH     . TYR A 1 310  ? -41.645 -41.394 41.438  1.00 39.50  ? 1672 TYR A HH     1 
ATOM   5120  N  N      . TRP A 1 311  ? -42.778 -34.565 45.502  1.00 55.10  ? 1673 TRP A N      1 
ATOM   5121  C  CA     . TRP A 1 311  ? -41.457 -34.151 45.970  1.00 55.13  ? 1673 TRP A CA     1 
ATOM   5122  C  C      . TRP A 1 311  ? -41.326 -34.428 47.461  1.00 62.68  ? 1673 TRP A C      1 
ATOM   5123  O  O      . TRP A 1 311  ? -40.318 -34.968 47.917  1.00 68.04  ? 1673 TRP A O      1 
ATOM   5124  C  CB     . TRP A 1 311  ? -41.206 -32.665 45.706  1.00 55.33  ? 1673 TRP A CB     1 
ATOM   5125  C  CG     . TRP A 1 311  ? -39.782 -32.251 45.899  1.00 55.00  ? 1673 TRP A CG     1 
ATOM   5126  C  CD1    . TRP A 1 311  ? -38.836 -32.111 44.928  1.00 54.15  ? 1673 TRP A CD1    1 
ATOM   5127  C  CD2    . TRP A 1 311  ? -39.139 -31.917 47.137  1.00 58.57  ? 1673 TRP A CD2    1 
ATOM   5128  N  NE1    . TRP A 1 311  ? -37.644 -31.712 45.481  1.00 54.71  ? 1673 TRP A NE1    1 
ATOM   5129  C  CE2    . TRP A 1 311  ? -37.803 -31.586 46.835  1.00 60.91  ? 1673 TRP A CE2    1 
ATOM   5130  C  CE3    . TRP A 1 311  ? -39.562 -31.867 48.470  1.00 63.62  ? 1673 TRP A CE3    1 
ATOM   5131  C  CZ2    . TRP A 1 311  ? -36.886 -31.211 47.816  1.00 64.80  ? 1673 TRP A CZ2    1 
ATOM   5132  C  CZ3    . TRP A 1 311  ? -38.650 -31.493 49.441  1.00 64.95  ? 1673 TRP A CZ3    1 
ATOM   5133  C  CH2    . TRP A 1 311  ? -37.328 -31.171 49.109  1.00 66.86  ? 1673 TRP A CH2    1 
ATOM   5134  H  H      . TRP A 1 311  ? -43.285 -33.918 45.247  1.00 66.12  ? 1673 TRP A H      1 
ATOM   5135  H  HA     . TRP A 1 311  ? -40.776 -34.662 45.505  1.00 66.15  ? 1673 TRP A HA     1 
ATOM   5136  H  HB2    . TRP A 1 311  ? -41.451 -32.466 44.789  1.00 66.39  ? 1673 TRP A HB2    1 
ATOM   5137  H  HB3    . TRP A 1 311  ? -41.752 -32.143 46.314  1.00 66.39  ? 1673 TRP A HB3    1 
ATOM   5138  H  HD1    . TRP A 1 311  ? -38.977 -32.263 44.022  1.00 64.98  ? 1673 TRP A HD1    1 
ATOM   5139  H  HE1    . TRP A 1 311  ? -36.916 -31.566 45.047  1.00 65.66  ? 1673 TRP A HE1    1 
ATOM   5140  H  HE3    . TRP A 1 311  ? -40.438 -32.080 48.698  1.00 76.34  ? 1673 TRP A HE3    1 
ATOM   5141  H  HZ2    . TRP A 1 311  ? -36.008 -30.996 47.599  1.00 77.76  ? 1673 TRP A HZ2    1 
ATOM   5142  H  HZ3    . TRP A 1 311  ? -38.920 -31.456 50.331  1.00 77.94  ? 1673 TRP A HZ3    1 
ATOM   5143  H  HH2    . TRP A 1 311  ? -36.738 -30.923 49.784  1.00 80.23  ? 1673 TRP A HH2    1 
ATOM   5144  N  N      . LYS A 1 312  ? -42.358 -34.056 48.213  1.00 59.25  ? 1674 LYS A N      1 
ATOM   5145  C  CA     . LYS A 1 312  ? -42.357 -34.230 49.660  1.00 56.07  ? 1674 LYS A CA     1 
ATOM   5146  C  C      . LYS A 1 312  ? -42.382 -35.712 49.995  1.00 53.76  ? 1674 LYS A C      1 
ATOM   5147  O  O      . LYS A 1 312  ? -41.704 -36.168 50.915  1.00 56.05  ? 1674 LYS A O      1 
ATOM   5148  C  CB     . LYS A 1 312  ? -43.541 -33.500 50.301  1.00 56.60  ? 1674 LYS A CB     1 
ATOM   5149  C  CG     . LYS A 1 312  ? -43.452 -31.980 50.164  1.00 58.17  ? 1674 LYS A CG     1 
ATOM   5150  C  CD     . LYS A 1 312  ? -44.700 -31.252 50.651  1.00 56.11  ? 1674 LYS A CD     1 
ATOM   5151  C  CE     . LYS A 1 312  ? -44.505 -29.744 50.553  1.00 53.86  ? 1674 LYS A CE     1 
ATOM   5152  N  NZ     . LYS A 1 312  ? -45.707 -28.971 50.962  1.00 53.71  1 1674 LYS A NZ     1 
ATOM   5153  H  H      . LYS A 1 312  ? -43.076 -33.696 47.906  1.00 71.10  ? 1674 LYS A H      1 
ATOM   5154  H  HA     . LYS A 1 312  ? -41.540 -33.853 50.023  1.00 67.28  ? 1674 LYS A HA     1 
ATOM   5155  H  HB2    . LYS A 1 312  ? -44.361 -33.791 49.871  1.00 67.92  ? 1674 LYS A HB2    1 
ATOM   5156  H  HB3    . LYS A 1 312  ? -43.570 -33.714 51.246  1.00 67.92  ? 1674 LYS A HB3    1 
ATOM   5157  H  HG2    . LYS A 1 312  ? -42.699 -31.662 50.686  1.00 69.80  ? 1674 LYS A HG2    1 
ATOM   5158  H  HG3    . LYS A 1 312  ? -43.322 -31.757 49.229  1.00 69.80  ? 1674 LYS A HG3    1 
ATOM   5159  H  HD2    . LYS A 1 312  ? -45.457 -31.502 50.098  1.00 67.33  ? 1674 LYS A HD2    1 
ATOM   5160  H  HD3    . LYS A 1 312  ? -44.867 -31.481 51.578  1.00 67.33  ? 1674 LYS A HD3    1 
ATOM   5161  H  HE2    . LYS A 1 312  ? -43.771 -29.483 51.131  1.00 64.63  ? 1674 LYS A HE2    1 
ATOM   5162  H  HE3    . LYS A 1 312  ? -44.300 -29.512 49.633  1.00 64.63  ? 1674 LYS A HE3    1 
ATOM   5163  H  HZ1    . LYS A 1 312  ? -45.547 -28.098 50.889  1.00 64.46  ? 1674 LYS A HZ1    1 
ATOM   5164  H  HZ2    . LYS A 1 312  ? -46.396 -29.183 50.442  1.00 64.46  ? 1674 LYS A HZ2    1 
ATOM   5165  H  HZ3    . LYS A 1 312  ? -45.914 -29.157 51.807  1.00 64.46  ? 1674 LYS A HZ3    1 
ATOM   5166  N  N      . GLU A 1 313  ? -43.181 -36.455 49.242  1.00 64.66  ? 1675 GLU A N      1 
ATOM   5167  C  CA     . GLU A 1 313  ? -43.269 -37.900 49.386  1.00 63.77  ? 1675 GLU A CA     1 
ATOM   5168  C  C      . GLU A 1 313  ? -41.910 -38.576 49.215  1.00 62.52  ? 1675 GLU A C      1 
ATOM   5169  O  O      . GLU A 1 313  ? -41.510 -39.388 50.049  1.00 63.01  ? 1675 GLU A O      1 
ATOM   5170  C  CB     . GLU A 1 313  ? -44.265 -38.456 48.372  1.00 63.84  ? 1675 GLU A CB     1 
ATOM   5171  C  CG     . GLU A 1 313  ? -44.607 -39.922 48.561  1.00 71.62  ? 1675 GLU A CG     1 
ATOM   5172  C  CD     . GLU A 1 313  ? -45.816 -40.347 47.741  1.00 77.98  ? 1675 GLU A CD     1 
ATOM   5173  O  OE1    . GLU A 1 313  ? -46.658 -39.476 47.418  1.00 76.91  ? 1675 GLU A OE1    1 
ATOM   5174  O  OE2    . GLU A 1 313  ? -45.917 -41.551 47.413  1.00 83.36  1 1675 GLU A OE2    1 
ATOM   5175  H  H      . GLU A 1 313  ? -43.693 -36.138 48.628  1.00 77.59  ? 1675 GLU A H      1 
ATOM   5176  H  HA     . GLU A 1 313  ? -43.597 -38.109 50.275  1.00 76.52  ? 1675 GLU A HA     1 
ATOM   5177  H  HB2    . GLU A 1 313  ? -45.090 -37.950 48.439  1.00 76.61  ? 1675 GLU A HB2    1 
ATOM   5178  H  HB3    . GLU A 1 313  ? -43.891 -38.354 47.483  1.00 76.61  ? 1675 GLU A HB3    1 
ATOM   5179  H  HG2    . GLU A 1 313  ? -43.851 -40.462 48.284  1.00 85.94  ? 1675 GLU A HG2    1 
ATOM   5180  H  HG3    . GLU A 1 313  ? -44.807 -40.082 49.497  1.00 85.94  ? 1675 GLU A HG3    1 
ATOM   5181  N  N      . VAL A 1 314  ? -41.200 -38.242 48.140  1.00 36.65  ? 1676 VAL A N      1 
ATOM   5182  C  CA     . VAL A 1 314  ? -39.894 -38.843 47.887  1.00 35.71  ? 1676 VAL A CA     1 
ATOM   5183  C  C      . VAL A 1 314  ? -38.917 -38.426 48.971  1.00 36.09  ? 1676 VAL A C      1 
ATOM   5184  O  O      . VAL A 1 314  ? -38.069 -39.212 49.377  1.00 35.76  ? 1676 VAL A O      1 
ATOM   5185  C  CB     . VAL A 1 314  ? -39.325 -38.449 46.498  1.00 34.75  ? 1676 VAL A CB     1 
ATOM   5186  C  CG1    . VAL A 1 314  ? -37.817 -38.725 46.414  1.00 33.98  ? 1676 VAL A CG1    1 
ATOM   5187  C  CG2    . VAL A 1 314  ? -40.058 -39.190 45.385  1.00 34.23  ? 1676 VAL A CG2    1 
ATOM   5188  H  H      . VAL A 1 314  ? -41.450 -37.674 47.546  1.00 43.99  ? 1676 VAL A H      1 
ATOM   5189  H  HA     . VAL A 1 314  ? -39.979 -39.809 47.914  1.00 42.86  ? 1676 VAL A HA     1 
ATOM   5190  H  HB     . VAL A 1 314  ? -39.461 -37.498 46.362  1.00 41.70  ? 1676 VAL A HB     1 
ATOM   5191  H  HG11   . VAL A 1 314  ? -37.498 -38.467 45.535  1.00 40.77  ? 1676 VAL A HG11   1 
ATOM   5192  H  HG12   . VAL A 1 314  ? -37.363 -38.206 47.096  1.00 40.77  ? 1676 VAL A HG12   1 
ATOM   5193  H  HG13   . VAL A 1 314  ? -37.661 -39.671 46.558  1.00 40.77  ? 1676 VAL A HG13   1 
ATOM   5194  H  HG21   . VAL A 1 314  ? -39.683 -38.926 44.531  1.00 41.08  ? 1676 VAL A HG21   1 
ATOM   5195  H  HG22   . VAL A 1 314  ? -39.946 -40.145 45.515  1.00 41.08  ? 1676 VAL A HG22   1 
ATOM   5196  H  HG23   . VAL A 1 314  ? -41.000 -38.959 45.420  1.00 41.08  ? 1676 VAL A HG23   1 
ATOM   5197  N  N      . ASP A 1 315  ? -39.027 -37.188 49.437  1.00 68.11  ? 1677 ASP A N      1 
ATOM   5198  C  CA     . ASP A 1 315  ? -38.147 -36.714 50.497  1.00 69.74  ? 1677 ASP A CA     1 
ATOM   5199  C  C      . ASP A 1 315  ? -38.264 -37.634 51.708  1.00 71.00  ? 1677 ASP A C      1 
ATOM   5200  O  O      . ASP A 1 315  ? -37.262 -37.983 52.327  1.00 74.64  ? 1677 ASP A O      1 
ATOM   5201  C  CB     . ASP A 1 315  ? -38.466 -35.270 50.880  1.00 70.44  ? 1677 ASP A CB     1 
ATOM   5202  C  CG     . ASP A 1 315  ? -37.462 -34.695 51.856  1.00 71.24  ? 1677 ASP A CG     1 
ATOM   5203  O  OD1    . ASP A 1 315  ? -36.327 -34.383 51.431  1.00 72.12  ? 1677 ASP A OD1    1 
ATOM   5204  O  OD2    . ASP A 1 315  ? -37.812 -34.555 53.045  1.00 70.89  1 1677 ASP A OD2    1 
ATOM   5205  H  H      . ASP A 1 315  ? -39.597 -36.607 49.159  1.00 81.73  ? 1677 ASP A H      1 
ATOM   5206  H  HA     . ASP A 1 315  ? -37.229 -36.746 50.183  1.00 83.69  ? 1677 ASP A HA     1 
ATOM   5207  H  HB2    . ASP A 1 315  ? -38.457 -34.720 50.080  1.00 84.53  ? 1677 ASP A HB2    1 
ATOM   5208  H  HB3    . ASP A 1 315  ? -39.342 -35.238 51.296  1.00 84.53  ? 1677 ASP A HB3    1 
ATOM   5209  N  N      . MET A 1 316  ? -39.490 -38.034 52.036  1.00 47.36  ? 1678 MET A N      1 
ATOM   5210  C  CA     . MET A 1 316  ? -39.715 -38.951 53.148  1.00 46.91  ? 1678 MET A CA     1 
ATOM   5211  C  C      . MET A 1 316  ? -39.082 -40.297 52.849  1.00 46.04  ? 1678 MET A C      1 
ATOM   5212  O  O      . MET A 1 316  ? -38.432 -40.885 53.712  1.00 46.28  ? 1678 MET A O      1 
ATOM   5213  C  CB     . MET A 1 316  ? -41.210 -39.130 53.424  1.00 47.78  ? 1678 MET A CB     1 
ATOM   5214  C  CG     . MET A 1 316  ? -41.877 -37.944 54.103  1.00 48.98  ? 1678 MET A CG     1 
ATOM   5215  S  SD     . MET A 1 316  ? -41.106 -37.500 55.677  1.00 55.65  ? 1678 MET A SD     1 
ATOM   5216  C  CE     . MET A 1 316  ? -41.244 -39.049 56.576  1.00 50.41  ? 1678 MET A CE     1 
ATOM   5217  H  H      . MET A 1 316  ? -40.207 -37.789 51.630  1.00 56.84  ? 1678 MET A H      1 
ATOM   5218  H  HA     . MET A 1 316  ? -39.306 -38.582 53.946  1.00 56.30  ? 1678 MET A HA     1 
ATOM   5219  H  HB2    . MET A 1 316  ? -41.665 -39.279 52.581  1.00 57.33  ? 1678 MET A HB2    1 
ATOM   5220  H  HB3    . MET A 1 316  ? -41.328 -39.902 53.999  1.00 57.33  ? 1678 MET A HB3    1 
ATOM   5221  H  HG2    . MET A 1 316  ? -41.823 -37.173 53.516  1.00 58.78  ? 1678 MET A HG2    1 
ATOM   5222  H  HG3    . MET A 1 316  ? -42.806 -38.162 54.277  1.00 58.78  ? 1678 MET A HG3    1 
ATOM   5223  H  HE1    . MET A 1 316  ? -40.856 -38.937 57.458  1.00 60.49  ? 1678 MET A HE1    1 
ATOM   5224  H  HE2    . MET A 1 316  ? -42.182 -39.286 56.655  1.00 60.49  ? 1678 MET A HE2    1 
ATOM   5225  H  HE3    . MET A 1 316  ? -40.768 -39.740 56.090  1.00 60.49  ? 1678 MET A HE3    1 
ATOM   5226  N  N      . LYS A 1 317  ? -39.297 -40.787 51.631  1.00 37.44  ? 1679 LYS A N      1 
ATOM   5227  C  CA     . LYS A 1 317  ? -38.717 -42.052 51.201  1.00 36.59  ? 1679 LYS A CA     1 
ATOM   5228  C  C      . LYS A 1 317  ? -37.222 -42.064 51.518  1.00 36.17  ? 1679 LYS A C      1 
ATOM   5229  O  O      . LYS A 1 317  ? -36.710 -43.018 52.102  1.00 36.20  ? 1679 LYS A O      1 
ATOM   5230  C  CB     . LYS A 1 317  ? -38.944 -42.280 49.695  1.00 35.60  ? 1679 LYS A CB     1 
ATOM   5231  C  CG     . LYS A 1 317  ? -40.377 -42.637 49.271  1.00 35.90  ? 1679 LYS A CG     1 
ATOM   5232  C  CD     . LYS A 1 317  ? -40.571 -44.144 49.136  1.00 35.66  ? 1679 LYS A CD     1 
ATOM   5233  C  CE     . LYS A 1 317  ? -41.695 -44.502 48.166  1.00 35.52  ? 1679 LYS A CE     1 
ATOM   5234  N  NZ     . LYS A 1 317  ? -41.360 -44.224 46.734  1.00 34.51  1 1679 LYS A NZ     1 
ATOM   5235  H  H      . LYS A 1 317  ? -39.778 -40.402 51.032  1.00 44.93  ? 1679 LYS A H      1 
ATOM   5236  H  HA     . LYS A 1 317  ? -39.137 -42.780 51.687  1.00 43.91  ? 1679 LYS A HA     1 
ATOM   5237  H  HB2    . LYS A 1 317  ? -38.698 -41.468 49.224  1.00 42.72  ? 1679 LYS A HB2    1 
ATOM   5238  H  HB3    . LYS A 1 317  ? -38.369 -43.006 49.407  1.00 42.72  ? 1679 LYS A HB3    1 
ATOM   5239  H  HG2    . LYS A 1 317  ? -40.999 -42.310 49.940  1.00 43.09  ? 1679 LYS A HG2    1 
ATOM   5240  H  HG3    . LYS A 1 317  ? -40.566 -42.229 48.411  1.00 43.09  ? 1679 LYS A HG3    1 
ATOM   5241  H  HD2    . LYS A 1 317  ? -39.750 -44.542 48.807  1.00 42.79  ? 1679 LYS A HD2    1 
ATOM   5242  H  HD3    . LYS A 1 317  ? -40.795 -44.514 50.005  1.00 42.79  ? 1679 LYS A HD3    1 
ATOM   5243  H  HE2    . LYS A 1 317  ? -41.890 -45.448 48.247  1.00 42.62  ? 1679 LYS A HE2    1 
ATOM   5244  H  HE3    . LYS A 1 317  ? -42.482 -43.982 48.393  1.00 42.62  ? 1679 LYS A HE3    1 
ATOM   5245  H  HZ1    . LYS A 1 317  ? -40.645 -44.696 46.492  1.00 41.42  ? 1679 LYS A HZ1    1 
ATOM   5246  H  HZ2    . LYS A 1 317  ? -42.045 -44.449 46.213  1.00 41.42  ? 1679 LYS A HZ2    1 
ATOM   5247  H  HZ3    . LYS A 1 317  ? -41.185 -43.359 46.625  1.00 41.42  ? 1679 LYS A HZ3    1 
ATOM   5248  N  N      . ILE A 1 318  ? -36.540 -40.982 51.149  1.00 35.87  ? 1680 ILE A N      1 
ATOM   5249  C  CA     . ILE A 1 318  ? -35.099 -40.847 51.366  1.00 35.48  ? 1680 ILE A CA     1 
ATOM   5250  C  C      . ILE A 1 318  ? -34.771 -40.803 52.852  1.00 36.46  ? 1680 ILE A C      1 
ATOM   5251  O  O      . ILE A 1 318  ? -33.764 -41.363 53.289  1.00 36.28  ? 1680 ILE A O      1 
ATOM   5252  C  CB     . ILE A 1 318  ? -34.548 -39.588 50.678  1.00 35.12  ? 1680 ILE A CB     1 
ATOM   5253  C  CG1    . ILE A 1 318  ? -34.805 -39.682 49.172  1.00 34.18  ? 1680 ILE A CG1    1 
ATOM   5254  C  CG2    . ILE A 1 318  ? -33.056 -39.449 50.924  1.00 34.79  ? 1680 ILE A CG2    1 
ATOM   5255  C  CD1    . ILE A 1 318  ? -34.529 -38.414 48.417  1.00 33.98  ? 1680 ILE A CD1    1 
ATOM   5256  H  H      . ILE A 1 318  ? -36.895 -40.300 50.764  1.00 43.04  ? 1680 ILE A H      1 
ATOM   5257  H  HA     . ILE A 1 318  ? -34.650 -41.617 50.984  1.00 42.58  ? 1680 ILE A HA     1 
ATOM   5258  H  HB     . ILE A 1 318  ? -35.003 -38.807 51.030  1.00 42.15  ? 1680 ILE A HB     1 
ATOM   5259  H  HG12   . ILE A 1 318  ? -34.235 -40.375 48.803  1.00 41.02  ? 1680 ILE A HG12   1 
ATOM   5260  H  HG13   . ILE A 1 318  ? -35.736 -39.913 49.030  1.00 41.02  ? 1680 ILE A HG13   1 
ATOM   5261  H  HG21   . ILE A 1 318  ? -32.736 -38.648 50.479  1.00 41.75  ? 1680 ILE A HG21   1 
ATOM   5262  H  HG22   . ILE A 1 318  ? -32.898 -39.382 51.879  1.00 41.75  ? 1680 ILE A HG22   1 
ATOM   5263  H  HG23   . ILE A 1 318  ? -32.603 -40.229 50.567  1.00 41.75  ? 1680 ILE A HG23   1 
ATOM   5264  H  HD11   . ILE A 1 318  ? -35.100 -37.710 48.763  1.00 40.78  ? 1680 ILE A HD11   1 
ATOM   5265  H  HD12   . ILE A 1 318  ? -33.597 -38.173 48.536  1.00 40.78  ? 1680 ILE A HD12   1 
ATOM   5266  H  HD13   . ILE A 1 318  ? -34.716 -38.560 47.476  1.00 40.78  ? 1680 ILE A HD13   1 
ATOM   5267  N  N      . LYS A 1 319  ? -35.600 -40.108 53.621  1.00 48.93  ? 1681 LYS A N      1 
ATOM   5268  C  CA     . LYS A 1 319  ? -35.436 -40.065 55.069  1.00 50.03  ? 1681 LYS A CA     1 
ATOM   5269  C  C      . LYS A 1 319  ? -35.594 -41.470 55.638  1.00 50.23  ? 1681 LYS A C      1 
ATOM   5270  O  O      . LYS A 1 319  ? -34.827 -41.893 56.505  1.00 50.57  ? 1681 LYS A O      1 
ATOM   5271  C  CB     . LYS A 1 319  ? -36.438 -39.100 55.701  1.00 51.22  ? 1681 LYS A CB     1 
ATOM   5272  C  CG     . LYS A 1 319  ? -36.135 -37.642 55.399  1.00 51.29  ? 1681 LYS A CG     1 
ATOM   5273  C  CD     . LYS A 1 319  ? -37.128 -36.698 56.049  1.00 52.55  ? 1681 LYS A CD     1 
ATOM   5274  C  CE     . LYS A 1 319  ? -36.757 -35.255 55.756  1.00 55.55  ? 1681 LYS A CE     1 
ATOM   5275  N  NZ     . LYS A 1 319  ? -37.746 -34.290 56.311  1.00 60.35  1 1681 LYS A NZ     1 
ATOM   5276  H  H      . LYS A 1 319  ? -36.267 -39.651 53.329  1.00 58.72  ? 1681 LYS A H      1 
ATOM   5277  H  HA     . LYS A 1 319  ? -34.542 -39.753 55.280  1.00 60.04  ? 1681 LYS A HA     1 
ATOM   5278  H  HB2    . LYS A 1 319  ? -37.324 -39.298 55.359  1.00 61.46  ? 1681 LYS A HB2    1 
ATOM   5279  H  HB3    . LYS A 1 319  ? -36.422 -39.215 56.664  1.00 61.46  ? 1681 LYS A HB3    1 
ATOM   5280  H  HG2    . LYS A 1 319  ? -35.250 -37.426 55.734  1.00 61.55  ? 1681 LYS A HG2    1 
ATOM   5281  H  HG3    . LYS A 1 319  ? -36.171 -37.502 54.440  1.00 61.55  ? 1681 LYS A HG3    1 
ATOM   5282  H  HD2    . LYS A 1 319  ? -38.015 -36.865 55.693  1.00 63.06  ? 1681 LYS A HD2    1 
ATOM   5283  H  HD3    . LYS A 1 319  ? -37.117 -36.829 57.010  1.00 63.06  ? 1681 LYS A HD3    1 
ATOM   5284  H  HE2    . LYS A 1 319  ? -35.893 -35.062 56.153  1.00 66.66  ? 1681 LYS A HE2    1 
ATOM   5285  H  HE3    . LYS A 1 319  ? -36.718 -35.126 54.795  1.00 66.66  ? 1681 LYS A HE3    1 
ATOM   5286  H  HZ1    . LYS A 1 319  ? -37.497 -33.457 56.120  1.00 72.42  ? 1681 LYS A HZ1    1 
ATOM   5287  H  HZ2    . LYS A 1 319  ? -38.548 -34.440 55.957  1.00 72.42  ? 1681 LYS A HZ2    1 
ATOM   5288  H  HZ3    . LYS A 1 319  ? -37.797 -34.382 57.194  1.00 72.42  ? 1681 LYS A HZ3    1 
ATOM   5289  N  N      . GLY A 1 320  ? -36.597 -42.186 55.136  1.00 41.83  ? 1682 GLY A N      1 
ATOM   5290  C  CA     . GLY A 1 320  ? -36.827 -43.567 55.513  1.00 42.00  ? 1682 GLY A CA     1 
ATOM   5291  C  C      . GLY A 1 320  ? -35.596 -44.414 55.253  1.00 41.15  ? 1682 GLY A C      1 
ATOM   5292  O  O      . GLY A 1 320  ? -35.086 -45.084 56.149  1.00 41.61  ? 1682 GLY A O      1 
ATOM   5293  H  H      . GLY A 1 320  ? -37.165 -41.883 54.565  1.00 50.19  ? 1682 GLY A H      1 
ATOM   5294  H  HA2    . GLY A 1 320  ? -37.047 -43.618 56.456  1.00 50.39  ? 1682 GLY A HA2    1 
ATOM   5295  H  HA3    . GLY A 1 320  ? -37.568 -43.928 55.000  1.00 50.39  ? 1682 GLY A HA3    1 
ATOM   5296  N  N      . LEU A 1 321  ? -35.125 -44.383 54.012  1.00 36.81  ? 1683 LEU A N      1 
ATOM   5297  C  CA     . LEU A 1 321  ? -33.974 -45.172 53.597  1.00 35.93  ? 1683 LEU A CA     1 
ATOM   5298  C  C      . LEU A 1 321  ? -32.740 -44.847 54.432  1.00 36.18  ? 1683 LEU A C      1 
ATOM   5299  O  O      . LEU A 1 321  ? -31.931 -45.727 54.707  1.00 36.01  ? 1683 LEU A O      1 
ATOM   5300  C  CB     . LEU A 1 321  ? -33.703 -44.930 52.108  1.00 34.73  ? 1683 LEU A CB     1 
ATOM   5301  C  CG     . LEU A 1 321  ? -34.793 -45.472 51.180  1.00 34.41  ? 1683 LEU A CG     1 
ATOM   5302  C  CD1    . LEU A 1 321  ? -34.590 -45.029 49.739  1.00 33.38  ? 1683 LEU A CD1    1 
ATOM   5303  C  CD2    . LEU A 1 321  ? -34.832 -46.989 51.250  1.00 34.33  ? 1683 LEU A CD2    1 
ATOM   5304  H  H      . LEU A 1 321  ? -35.461 -43.904 53.381  1.00 44.17  ? 1683 LEU A H      1 
ATOM   5305  H  HA     . LEU A 1 321  ? -34.177 -46.113 53.716  1.00 43.12  ? 1683 LEU A HA     1 
ATOM   5306  H  HB2    . LEU A 1 321  ? -33.632 -43.974 51.955  1.00 41.68  ? 1683 LEU A HB2    1 
ATOM   5307  H  HB3    . LEU A 1 321  ? -32.868 -45.363 51.869  1.00 41.68  ? 1683 LEU A HB3    1 
ATOM   5308  H  HG     . LEU A 1 321  ? -35.653 -45.138 51.477  1.00 41.29  ? 1683 LEU A HG     1 
ATOM   5309  H  HD11   . LEU A 1 321  ? -35.303 -45.397 49.193  1.00 40.06  ? 1683 LEU A HD11   1 
ATOM   5310  H  HD12   . LEU A 1 321  ? -34.611 -44.060 49.702  1.00 40.06  ? 1683 LEU A HD12   1 
ATOM   5311  H  HD13   . LEU A 1 321  ? -33.732 -45.355 49.427  1.00 40.06  ? 1683 LEU A HD13   1 
ATOM   5312  H  HD21   . LEU A 1 321  ? -35.527 -47.314 50.658  1.00 41.20  ? 1683 LEU A HD21   1 
ATOM   5313  H  HD22   . LEU A 1 321  ? -33.970 -47.339 50.975  1.00 41.20  ? 1683 LEU A HD22   1 
ATOM   5314  H  HD23   . LEU A 1 321  ? -35.022 -47.257 52.163  1.00 41.20  ? 1683 LEU A HD23   1 
ATOM   5315  N  N      . LEU A 1 322  ? -32.606 -43.590 54.843  1.00 56.51  ? 1684 LEU A N      1 
ATOM   5316  C  CA     . LEU A 1 322  ? -31.454 -43.151 55.631  1.00 51.45  ? 1684 LEU A CA     1 
ATOM   5317  C  C      . LEU A 1 322  ? -31.533 -43.614 57.089  1.00 48.40  ? 1684 LEU A C      1 
ATOM   5318  O  O      . LEU A 1 322  ? -30.522 -44.001 57.676  1.00 52.02  ? 1684 LEU A O      1 
ATOM   5319  C  CB     . LEU A 1 322  ? -31.318 -41.630 55.591  1.00 47.43  ? 1684 LEU A CB     1 
ATOM   5320  C  CG     . LEU A 1 322  ? -30.567 -41.035 54.398  1.00 46.36  ? 1684 LEU A CG     1 
ATOM   5321  C  CD1    . LEU A 1 322  ? -30.907 -39.563 54.286  1.00 46.77  ? 1684 LEU A CD1    1 
ATOM   5322  C  CD2    . LEU A 1 322  ? -29.061 -41.239 54.501  1.00 45.93  ? 1684 LEU A CD2    1 
ATOM   5323  H  H      . LEU A 1 322  ? -33.173 -42.965 54.678  1.00 67.81  ? 1684 LEU A H      1 
ATOM   5324  H  HA     . LEU A 1 322  ? -30.649 -43.530 55.244  1.00 61.74  ? 1684 LEU A HA     1 
ATOM   5325  H  HB2    . LEU A 1 322  ? -32.210 -41.248 55.588  1.00 56.92  ? 1684 LEU A HB2    1 
ATOM   5326  H  HB3    . LEU A 1 322  ? -30.852 -41.347 56.393  1.00 56.92  ? 1684 LEU A HB3    1 
ATOM   5327  H  HG     . LEU A 1 322  ? -30.871 -41.473 53.587  1.00 55.63  ? 1684 LEU A HG     1 
ATOM   5328  H  HD11   . LEU A 1 322  ? -30.431 -39.186 53.529  1.00 56.12  ? 1684 LEU A HD11   1 
ATOM   5329  H  HD12   . LEU A 1 322  ? -31.864 -39.469 54.155  1.00 56.12  ? 1684 LEU A HD12   1 
ATOM   5330  H  HD13   . LEU A 1 322  ? -30.639 -39.114 55.103  1.00 56.12  ? 1684 LEU A HD13   1 
ATOM   5331  H  HD21   . LEU A 1 322  ? -28.636 -40.844 53.724  1.00 55.11  ? 1684 LEU A HD21   1 
ATOM   5332  H  HD22   . LEU A 1 322  ? -28.739 -40.808 55.309  1.00 55.11  ? 1684 LEU A HD22   1 
ATOM   5333  H  HD23   . LEU A 1 322  ? -28.873 -42.189 54.536  1.00 55.11  ? 1684 LEU A HD23   1 
ATOM   5334  N  N      . ASP A 1 323  ? -32.717 -43.521 57.689  1.00 42.64  ? 1685 ASP A N      1 
ATOM   5335  C  CA     . ASP A 1 323  ? -32.911 -44.011 59.050  1.00 43.88  ? 1685 ASP A CA     1 
ATOM   5336  C  C      . ASP A 1 323  ? -32.577 -45.502 59.086  1.00 43.61  ? 1685 ASP A C      1 
ATOM   5337  O  O      . ASP A 1 323  ? -31.827 -45.958 59.950  1.00 44.11  ? 1685 ASP A O      1 
ATOM   5338  C  CB     . ASP A 1 323  ? -34.349 -43.745 59.519  1.00 71.95  ? 1685 ASP A CB     1 
ATOM   5339  C  CG     . ASP A 1 323  ? -34.581 -44.101 60.987  1.00 69.45  ? 1685 ASP A CG     1 
ATOM   5340  O  OD1    . ASP A 1 323  ? -33.741 -44.794 61.596  1.00 65.57  ? 1685 ASP A OD1    1 
ATOM   5341  O  OD2    . ASP A 1 323  ? -35.616 -43.671 61.541  1.00 70.08  1 1685 ASP A OD2    1 
ATOM   5342  H  H      . ASP A 1 323  ? -33.421 -43.179 57.331  1.00 51.17  ? 1685 ASP A H      1 
ATOM   5343  H  HA     . ASP A 1 323  ? -32.305 -43.547 59.648  1.00 52.66  ? 1685 ASP A HA     1 
ATOM   5344  H  HB2    . ASP A 1 323  ? -34.547 -42.802 59.406  1.00 86.34  ? 1685 ASP A HB2    1 
ATOM   5345  H  HB3    . ASP A 1 323  ? -34.958 -44.277 58.983  1.00 86.34  ? 1685 ASP A HB3    1 
ATOM   5346  N  N      . LYS A 1 324  ? -33.131 -46.256 58.139  1.00 42.74  ? 1686 LYS A N      1 
ATOM   5347  C  CA     . LYS A 1 324  ? -32.879 -47.694 58.059  1.00 42.48  ? 1686 LYS A CA     1 
ATOM   5348  C  C      . LYS A 1 324  ? -31.432 -47.980 57.650  1.00 41.58  ? 1686 LYS A C      1 
ATOM   5349  O  O      . LYS A 1 324  ? -30.919 -49.073 57.887  1.00 41.59  ? 1686 LYS A O      1 
ATOM   5350  C  CB     . LYS A 1 324  ? -33.852 -48.364 57.084  1.00 41.96  ? 1686 LYS A CB     1 
ATOM   5351  C  CG     . LYS A 1 324  ? -33.521 -49.825 56.797  1.00 41.58  ? 1686 LYS A CG     1 
ATOM   5352  C  CD     . LYS A 1 324  ? -34.746 -50.615 56.357  1.00 41.70  ? 1686 LYS A CD     1 
ATOM   5353  C  CE     . LYS A 1 324  ? -34.403 -52.078 56.134  1.00 41.47  ? 1686 LYS A CE     1 
ATOM   5354  N  NZ     . LYS A 1 324  ? -33.720 -52.672 57.319  1.00 42.30  1 1686 LYS A NZ     1 
ATOM   5355  H  H      . LYS A 1 324  ? -33.658 -45.958 57.529  1.00 51.29  ? 1686 LYS A H      1 
ATOM   5356  H  HA     . LYS A 1 324  ? -33.022 -48.084 58.935  1.00 50.98  ? 1686 LYS A HA     1 
ATOM   5357  H  HB2    . LYS A 1 324  ? -34.745 -48.331 57.461  1.00 50.35  ? 1686 LYS A HB2    1 
ATOM   5358  H  HB3    . LYS A 1 324  ? -33.832 -47.884 56.242  1.00 50.35  ? 1686 LYS A HB3    1 
ATOM   5359  H  HG2    . LYS A 1 324  ? -32.863 -49.867 56.085  1.00 49.89  ? 1686 LYS A HG2    1 
ATOM   5360  H  HG3    . LYS A 1 324  ? -33.170 -50.235 57.602  1.00 49.89  ? 1686 LYS A HG3    1 
ATOM   5361  H  HD2    . LYS A 1 324  ? -35.426 -50.562 57.046  1.00 50.04  ? 1686 LYS A HD2    1 
ATOM   5362  H  HD3    . LYS A 1 324  ? -35.081 -50.250 55.524  1.00 50.04  ? 1686 LYS A HD3    1 
ATOM   5363  H  HE2    . LYS A 1 324  ? -35.220 -52.576 55.974  1.00 49.76  ? 1686 LYS A HE2    1 
ATOM   5364  H  HE3    . LYS A 1 324  ? -33.809 -52.155 55.372  1.00 49.76  ? 1686 LYS A HE3    1 
ATOM   5365  H  HZ1    . LYS A 1 324  ? -33.531 -53.527 57.164  1.00 50.75  ? 1686 LYS A HZ1    1 
ATOM   5366  H  HZ2    . LYS A 1 324  ? -32.964 -52.233 57.485  1.00 50.75  ? 1686 LYS A HZ2    1 
ATOM   5367  H  HZ3    . LYS A 1 324  ? -34.249 -52.617 58.033  1.00 50.75  ? 1686 LYS A HZ3    1 
ATOM   5368  N  N      . LEU A 1 325  ? -30.780 -46.999 57.029  1.00 47.03  ? 1687 LEU A N      1 
ATOM   5369  C  CA     . LEU A 1 325  ? -29.391 -47.155 56.599  1.00 48.13  ? 1687 LEU A CA     1 
ATOM   5370  C  C      . LEU A 1 325  ? -28.500 -47.264 57.826  1.00 53.37  ? 1687 LEU A C      1 
ATOM   5371  O  O      . LEU A 1 325  ? -27.580 -48.081 57.887  1.00 53.65  ? 1687 LEU A O      1 
ATOM   5372  C  CB     . LEU A 1 325  ? -28.945 -45.971 55.732  1.00 41.83  ? 1687 LEU A CB     1 
ATOM   5373  C  CG     . LEU A 1 325  ? -27.475 -45.969 55.322  1.00 41.06  ? 1687 LEU A CG     1 
ATOM   5374  C  CD1    . LEU A 1 325  ? -27.132 -47.223 54.550  1.00 40.22  ? 1687 LEU A CD1    1 
ATOM   5375  C  CD2    . LEU A 1 325  ? -27.137 -44.710 54.530  1.00 40.48  ? 1687 LEU A CD2    1 
ATOM   5376  H  H      . LEU A 1 325  ? -31.119 -46.230 56.845  1.00 56.44  ? 1687 LEU A H      1 
ATOM   5377  H  HA     . LEU A 1 325  ? -29.302 -47.969 56.080  1.00 57.76  ? 1687 LEU A HA     1 
ATOM   5378  H  HB2    . LEU A 1 325  ? -29.474 -45.971 54.919  1.00 50.20  ? 1687 LEU A HB2    1 
ATOM   5379  H  HB3    . LEU A 1 325  ? -29.110 -45.151 56.225  1.00 50.20  ? 1687 LEU A HB3    1 
ATOM   5380  H  HG     . LEU A 1 325  ? -26.931 -45.963 56.125  1.00 49.27  ? 1687 LEU A HG     1 
ATOM   5381  H  HD11   . LEU A 1 325  ? -26.194 -47.194 54.303  1.00 48.27  ? 1687 LEU A HD11   1 
ATOM   5382  H  HD12   . LEU A 1 325  ? -27.303 -47.995 55.111  1.00 48.27  ? 1687 LEU A HD12   1 
ATOM   5383  H  HD13   . LEU A 1 325  ? -27.683 -47.263 53.753  1.00 48.27  ? 1687 LEU A HD13   1 
ATOM   5384  H  HD21   . LEU A 1 325  ? -26.199 -44.735 54.283  1.00 48.58  ? 1687 LEU A HD21   1 
ATOM   5385  H  HD22   . LEU A 1 325  ? -27.689 -44.681 53.733  1.00 48.58  ? 1687 LEU A HD22   1 
ATOM   5386  H  HD23   . LEU A 1 325  ? -27.313 -43.932 55.083  1.00 48.58  ? 1687 LEU A HD23   1 
ATOM   5387  N  N      . ASN A 1 326  ? -28.806 -46.421 58.805  1.00 89.96  ? 1688 ASN A N      1 
ATOM   5388  C  CA     . ASN A 1 326  ? -28.038 -46.304 60.032  1.00 91.38  ? 1688 ASN A CA     1 
ATOM   5389  C  C      . ASN A 1 326  ? -28.148 -47.567 60.883  1.00 90.84  ? 1688 ASN A C      1 
ATOM   5390  O  O      . ASN A 1 326  ? -27.203 -47.961 61.568  1.00 90.67  ? 1688 ASN A O      1 
ATOM   5391  C  CB     . ASN A 1 326  ? -28.544 -45.084 60.809  1.00 93.03  ? 1688 ASN A CB     1 
ATOM   5392  C  CG     . ASN A 1 326  ? -27.594 -44.632 61.897  1.00 95.53  ? 1688 ASN A CG     1 
ATOM   5393  O  OD1    . ASN A 1 326  ? -26.540 -45.230 62.118  1.00 96.09  ? 1688 ASN A OD1    1 
ATOM   5394  N  ND2    . ASN A 1 326  ? -27.962 -43.548 62.576  1.00 96.76  ? 1688 ASN A ND2    1 
ATOM   5395  H  H      . ASN A 1 326  ? -29.481 -45.888 58.777  1.00 107.96 ? 1688 ASN A H      1 
ATOM   5396  H  HA     . ASN A 1 326  ? -27.104 -46.162 59.814  1.00 109.66 ? 1688 ASN A HA     1 
ATOM   5397  H  HB2    . ASN A 1 326  ? -28.664 -44.346 60.192  1.00 111.64 ? 1688 ASN A HB2    1 
ATOM   5398  H  HB3    . ASN A 1 326  ? -29.391 -45.306 61.227  1.00 111.64 ? 1688 ASN A HB3    1 
ATOM   5399  H  HD21   . ASN A 1 326  ? -27.461 -43.245 63.206  1.00 116.11 ? 1688 ASN A HD21   1 
ATOM   5400  H  HD22   . ASN A 1 326  ? -28.701 -43.152 62.385  1.00 116.11 ? 1688 ASN A HD22   1 
ATOM   5401  N  N      . LYS A 1 327  ? -29.318 -48.196 60.816  1.00 71.42  ? 1689 LYS A N      1 
ATOM   5402  C  CA     . LYS A 1 327  ? -29.679 -49.302 61.696  1.00 66.93  ? 1689 LYS A CA     1 
ATOM   5403  C  C      . LYS A 1 327  ? -29.408 -50.692 61.092  1.00 65.62  ? 1689 LYS A C      1 
ATOM   5404  O  O      . LYS A 1 327  ? -29.746 -51.705 61.707  1.00 66.42  ? 1689 LYS A O      1 
ATOM   5405  C  CB     . LYS A 1 327  ? -31.169 -49.173 62.041  1.00 67.15  ? 1689 LYS A CB     1 
ATOM   5406  C  CG     . LYS A 1 327  ? -31.597 -49.672 63.416  1.00 73.10  ? 1689 LYS A CG     1 
ATOM   5407  C  CD     . LYS A 1 327  ? -31.127 -48.709 64.507  1.00 79.21  ? 1689 LYS A CD     1 
ATOM   5408  C  CE     . LYS A 1 327  ? -31.578 -49.144 65.898  1.00 82.18  ? 1689 LYS A CE     1 
ATOM   5409  N  NZ     . LYS A 1 327  ? -31.098 -48.208 66.959  1.00 85.13  1 1689 LYS A NZ     1 
ATOM   5410  H  H      . LYS A 1 327  ? -29.935 -47.993 60.253  1.00 85.71  ? 1689 LYS A H      1 
ATOM   5411  H  HA     . LYS A 1 327  ? -29.172 -49.228 62.520  1.00 80.32  ? 1689 LYS A HA     1 
ATOM   5412  H  HB2    . LYS A 1 327  ? -31.413 -48.236 61.988  1.00 80.58  ? 1689 LYS A HB2    1 
ATOM   5413  H  HB3    . LYS A 1 327  ? -31.677 -49.674 61.383  1.00 80.58  ? 1689 LYS A HB3    1 
ATOM   5414  H  HG2    . LYS A 1 327  ? -32.565 -49.728 63.452  1.00 87.72  ? 1689 LYS A HG2    1 
ATOM   5415  H  HG3    . LYS A 1 327  ? -31.201 -50.542 63.582  1.00 87.72  ? 1689 LYS A HG3    1 
ATOM   5416  H  HD2    . LYS A 1 327  ? -30.157 -48.674 64.502  1.00 95.05  ? 1689 LYS A HD2    1 
ATOM   5417  H  HD3    . LYS A 1 327  ? -31.494 -47.828 64.333  1.00 95.05  ? 1689 LYS A HD3    1 
ATOM   5418  H  HE2    . LYS A 1 327  ? -32.547 -49.163 65.927  1.00 98.62  ? 1689 LYS A HE2    1 
ATOM   5419  H  HE3    . LYS A 1 327  ? -31.220 -50.025 66.088  1.00 98.62  ? 1689 LYS A HE3    1 
ATOM   5420  H  HZ1    . LYS A 1 327  ? -31.376 -48.486 67.758  1.00 102.16 ? 1689 LYS A HZ1    1 
ATOM   5421  H  HZ2    . LYS A 1 327  ? -30.209 -48.176 66.957  1.00 102.16 ? 1689 LYS A HZ2    1 
ATOM   5422  H  HZ3    . LYS A 1 327  ? -31.417 -47.390 66.810  1.00 102.16 ? 1689 LYS A HZ3    1 
ATOM   5423  N  N      . SER A 1 328  ? -28.807 -50.745 59.903  1.00 55.64  ? 1690 SER A N      1 
ATOM   5424  C  CA     . SER A 1 328  ? -28.737 -51.989 59.116  1.00 57.41  ? 1690 SER A CA     1 
ATOM   5425  C  C      . SER A 1 328  ? -27.334 -52.557 58.909  1.00 54.36  ? 1690 SER A C      1 
ATOM   5426  O  O      . SER A 1 328  ? -26.340 -51.833 58.959  1.00 54.06  ? 1690 SER A O      1 
ATOM   5427  C  CB     . SER A 1 328  ? -29.383 -51.778 57.750  1.00 61.82  ? 1690 SER A CB     1 
ATOM   5428  O  OG     . SER A 1 328  ? -30.776 -52.047 57.796  1.00 66.65  ? 1690 SER A OG     1 
ATOM   5429  H  H      . SER A 1 328  ? -28.429 -50.073 59.523  1.00 66.77  ? 1690 SER A H      1 
ATOM   5430  H  HA     . SER A 1 328  ? -29.255 -52.667 59.577  1.00 68.89  ? 1690 SER A HA     1 
ATOM   5431  H  HB2    . SER A 1 328  ? -29.250 -50.857 57.477  1.00 74.18  ? 1690 SER A HB2    1 
ATOM   5432  H  HB3    . SER A 1 328  ? -28.968 -52.376 57.109  1.00 74.18  ? 1690 SER A HB3    1 
ATOM   5433  H  HG     . SER A 1 328  ? -30.907 -52.843 58.030  1.00 79.98  ? 1690 SER A HG     1 
ATOM   5434  N  N      . SER A 1 329  ? -27.281 -53.863 58.648  1.00 88.07  ? 1691 SER A N      1 
ATOM   5435  C  CA     . SER A 1 329  ? -26.024 -54.601 58.510  1.00 89.21  ? 1691 SER A CA     1 
ATOM   5436  C  C      . SER A 1 329  ? -25.205 -54.103 57.327  1.00 90.27  ? 1691 SER A C      1 
ATOM   5437  O  O      . SER A 1 329  ? -25.735 -53.474 56.412  1.00 95.08  ? 1691 SER A O      1 
ATOM   5438  C  CB     . SER A 1 329  ? -26.289 -56.103 58.343  1.00 88.09  ? 1691 SER A CB     1 
ATOM   5439  O  OG     . SER A 1 329  ? -26.867 -56.389 57.080  1.00 87.18  ? 1691 SER A OG     1 
ATOM   5440  H  H      . SER A 1 329  ? -27.978 -54.356 58.544  1.00 105.68 ? 1691 SER A H      1 
ATOM   5441  H  HA     . SER A 1 329  ? -25.496 -54.477 59.314  1.00 107.06 ? 1691 SER A HA     1 
ATOM   5442  H  HB2    . SER A 1 329  ? -25.449 -56.580 58.419  1.00 105.71 ? 1691 SER A HB2    1 
ATOM   5443  H  HB3    . SER A 1 329  ? -26.899 -56.393 59.040  1.00 105.71 ? 1691 SER A HB3    1 
ATOM   5444  H  HG     . SER A 1 329  ? -27.004 -57.214 57.007  1.00 104.62 ? 1691 SER A HG     1 
ATOM   5445  N  N      . ASP A 1 330  ? -23.910 -54.401 57.353  1.00 84.62  ? 1692 ASP A N      1 
ATOM   5446  C  CA     . ASP A 1 330  ? -22.964 -53.848 56.391  1.00 87.09  ? 1692 ASP A CA     1 
ATOM   5447  C  C      . ASP A 1 330  ? -23.170 -54.397 54.984  1.00 82.30  ? 1692 ASP A C      1 
ATOM   5448  O  O      . ASP A 1 330  ? -22.741 -53.781 54.009  1.00 80.95  ? 1692 ASP A O      1 
ATOM   5449  C  CB     . ASP A 1 330  ? -21.526 -54.123 56.836  1.00 90.74  ? 1692 ASP A CB     1 
ATOM   5450  C  CG     . ASP A 1 330  ? -21.195 -53.486 58.174  1.00 93.92  ? 1692 ASP A CG     1 
ATOM   5451  O  OD1    . ASP A 1 330  ? -21.616 -52.330 58.404  1.00 97.77  ? 1692 ASP A OD1    1 
ATOM   5452  O  OD2    . ASP A 1 330  ? -20.506 -54.138 58.990  1.00 94.18  1 1692 ASP A OD2    1 
ATOM   5453  H  H      . ASP A 1 330  ? -23.549 -54.929 57.928  1.00 101.54 ? 1692 ASP A H      1 
ATOM   5454  H  HA     . ASP A 1 330  ? -23.084 -52.886 56.354  1.00 104.51 ? 1692 ASP A HA     1 
ATOM   5455  H  HB2    . ASP A 1 330  ? -21.399 -55.080 56.920  1.00 108.88 ? 1692 ASP A HB2    1 
ATOM   5456  H  HB3    . ASP A 1 330  ? -20.916 -53.763 56.174  1.00 108.88 ? 1692 ASP A HB3    1 
ATOM   5457  N  N      . ASN A 1 331  ? -23.830 -55.544 54.870  1.00 91.22  ? 1693 ASN A N      1 
ATOM   5458  C  CA     . ASN A 1 331  ? -24.106 -56.108 53.555  1.00 90.69  ? 1693 ASN A CA     1 
ATOM   5459  C  C      . ASN A 1 331  ? -25.272 -55.403 52.878  1.00 89.24  ? 1693 ASN A C      1 
ATOM   5460  O  O      . ASN A 1 331  ? -25.230 -55.135 51.678  1.00 88.91  ? 1693 ASN A O      1 
ATOM   5461  C  CB     . ASN A 1 331  ? -24.413 -57.603 53.663  1.00 92.96  ? 1693 ASN A CB     1 
ATOM   5462  C  CG     . ASN A 1 331  ? -23.163 -58.454 53.744  1.00 95.08  ? 1693 ASN A CG     1 
ATOM   5463  O  OD1    . ASN A 1 331  ? -22.784 -58.925 54.817  1.00 94.72  ? 1693 ASN A OD1    1 
ATOM   5464  N  ND2    . ASN A 1 331  ? -22.515 -58.658 52.604  1.00 93.20  ? 1693 ASN A ND2    1 
ATOM   5465  H  H      . ASN A 1 331  ? -24.125 -56.011 55.529  1.00 109.46 ? 1693 ASN A H      1 
ATOM   5466  H  HA     . ASN A 1 331  ? -23.322 -56.001 52.993  1.00 108.83 ? 1693 ASN A HA     1 
ATOM   5467  H  HB2    . ASN A 1 331  ? -24.936 -57.760 54.465  1.00 111.55 ? 1693 ASN A HB2    1 
ATOM   5468  H  HB3    . ASN A 1 331  ? -24.915 -57.880 52.881  1.00 111.55 ? 1693 ASN A HB3    1 
ATOM   5469  H  HD21   . ASN A 1 331  ? -21.799 -59.135 52.595  1.00 111.84 ? 1693 ASN A HD21   1 
ATOM   5470  H  HD22   . ASN A 1 331  ? -22.812 -58.314 51.873  1.00 111.84 ? 1693 ASN A HD22   1 
ATOM   5471  N  N      . VAL A 1 332  ? -26.311 -55.102 53.652  1.00 39.02  ? 1694 VAL A N      1 
ATOM   5472  C  CA     . VAL A 1 332  ? -27.456 -54.365 53.133  1.00 38.84  ? 1694 VAL A CA     1 
ATOM   5473  C  C      . VAL A 1 332  ? -27.204 -52.859 53.241  1.00 38.69  ? 1694 VAL A C      1 
ATOM   5474  O  O      . VAL A 1 332  ? -27.936 -52.058 52.663  1.00 46.44  ? 1694 VAL A O      1 
ATOM   5475  C  CB     . VAL A 1 332  ? -28.755 -54.753 53.884  1.00 39.89  ? 1694 VAL A CB     1 
ATOM   5476  C  CG1    . VAL A 1 332  ? -28.715 -54.271 55.315  1.00 40.98  ? 1694 VAL A CG1    1 
ATOM   5477  C  CG2    . VAL A 1 332  ? -29.988 -54.199 53.177  1.00 39.66  ? 1694 VAL A CG2    1 
ATOM   5478  H  H      . VAL A 1 332  ? -26.376 -55.313 54.483  1.00 46.83  ? 1694 VAL A H      1 
ATOM   5479  H  HA     . VAL A 1 332  ? -27.575 -54.583 52.195  1.00 46.61  ? 1694 VAL A HA     1 
ATOM   5480  H  HB     . VAL A 1 332  ? -28.830 -55.720 53.898  1.00 47.87  ? 1694 VAL A HB     1 
ATOM   5481  H  HG11   . VAL A 1 332  ? -29.539 -54.529 55.757  1.00 49.18  ? 1694 VAL A HG11   1 
ATOM   5482  H  HG12   . VAL A 1 332  ? -27.958 -54.678 55.764  1.00 49.18  ? 1694 VAL A HG12   1 
ATOM   5483  H  HG13   . VAL A 1 332  ? -28.625 -53.305 55.320  1.00 49.18  ? 1694 VAL A HG13   1 
ATOM   5484  H  HG21   . VAL A 1 332  ? -30.779 -54.460 53.673  1.00 47.59  ? 1694 VAL A HG21   1 
ATOM   5485  H  HG22   . VAL A 1 332  ? -29.923 -53.231 53.143  1.00 47.59  ? 1694 VAL A HG22   1 
ATOM   5486  H  HG23   . VAL A 1 332  ? -30.025 -54.561 52.278  1.00 47.59  ? 1694 VAL A HG23   1 
ATOM   5487  N  N      . LYS A 1 333  ? -26.156 -52.476 53.967  1.00 98.17  ? 1695 LYS A N      1 
ATOM   5488  C  CA     . LYS A 1 333  ? -25.772 -51.072 54.051  1.00 100.52 ? 1695 LYS A CA     1 
ATOM   5489  C  C      . LYS A 1 333  ? -25.392 -50.611 52.646  1.00 98.15  ? 1695 LYS A C      1 
ATOM   5490  O  O      . LYS A 1 333  ? -25.893 -49.595 52.164  1.00 98.65  ? 1695 LYS A O      1 
ATOM   5491  C  CB     . LYS A 1 333  ? -24.623 -50.866 55.047  1.00 103.72 ? 1695 LYS A CB     1 
ATOM   5492  C  CG     . LYS A 1 333  ? -24.258 -49.405 55.302  1.00 107.29 ? 1695 LYS A CG     1 
ATOM   5493  C  CD     . LYS A 1 333  ? -23.094 -49.271 56.281  1.00 110.51 ? 1695 LYS A CD     1 
ATOM   5494  C  CE     . LYS A 1 333  ? -21.782 -49.752 55.683  1.00 112.39 ? 1695 LYS A CE     1 
ATOM   5495  N  NZ     . LYS A 1 333  ? -21.414 -48.973 54.467  1.00 113.00 1 1695 LYS A NZ     1 
ATOM   5496  H  H      . LYS A 1 333  ? -25.654 -53.009 54.419  1.00 117.80 ? 1695 LYS A H      1 
ATOM   5497  H  HA     . LYS A 1 333  ? -26.531 -50.548 54.349  1.00 120.63 ? 1695 LYS A HA     1 
ATOM   5498  H  HB2    . LYS A 1 333  ? -24.876 -51.259 55.897  1.00 124.46 ? 1695 LYS A HB2    1 
ATOM   5499  H  HB3    . LYS A 1 333  ? -23.832 -51.311 54.704  1.00 124.46 ? 1695 LYS A HB3    1 
ATOM   5500  H  HG2    . LYS A 1 333  ? -23.999 -48.990 54.464  1.00 128.75 ? 1695 LYS A HG2    1 
ATOM   5501  H  HG3    . LYS A 1 333  ? -25.025 -48.946 55.679  1.00 128.75 ? 1695 LYS A HG3    1 
ATOM   5502  H  HD2    . LYS A 1 333  ? -22.990 -48.338 56.525  1.00 132.61 ? 1695 LYS A HD2    1 
ATOM   5503  H  HD3    . LYS A 1 333  ? -23.280 -49.803 57.070  1.00 132.61 ? 1695 LYS A HD3    1 
ATOM   5504  H  HE2    . LYS A 1 333  ? -21.075 -49.644 56.338  1.00 134.87 ? 1695 LYS A HE2    1 
ATOM   5505  H  HE3    . LYS A 1 333  ? -21.868 -50.685 55.432  1.00 134.87 ? 1695 LYS A HE3    1 
ATOM   5506  H  HZ1    . LYS A 1 333  ? -20.644 -49.273 54.136  1.00 135.60 ? 1695 LYS A HZ1    1 
ATOM   5507  H  HZ2    . LYS A 1 333  ? -22.048 -49.059 53.848  1.00 135.60 ? 1695 LYS A HZ2    1 
ATOM   5508  H  HZ3    . LYS A 1 333  ? -21.325 -48.112 54.672  1.00 135.60 ? 1695 LYS A HZ3    1 
ATOM   5509  N  N      . LYS A 1 334  ? -24.512 -51.370 51.996  1.00 57.71  ? 1696 LYS A N      1 
ATOM   5510  C  CA     . LYS A 1 334  ? -24.102 -51.072 50.626  1.00 48.27  ? 1696 LYS A CA     1 
ATOM   5511  C  C      . LYS A 1 334  ? -25.293 -50.975 49.678  1.00 47.61  ? 1696 LYS A C      1 
ATOM   5512  O  O      . LYS A 1 334  ? -25.337 -50.099 48.817  1.00 47.05  ? 1696 LYS A O      1 
ATOM   5513  C  CB     . LYS A 1 334  ? -23.150 -52.138 50.085  1.00 47.42  ? 1696 LYS A CB     1 
ATOM   5514  C  CG     . LYS A 1 334  ? -21.911 -52.415 50.906  1.00 48.63  ? 1696 LYS A CG     1 
ATOM   5515  C  CD     . LYS A 1 334  ? -21.062 -53.445 50.167  1.00 48.29  ? 1696 LYS A CD     1 
ATOM   5516  C  CE     . LYS A 1 334  ? -19.750 -53.763 50.867  1.00 49.35  ? 1696 LYS A CE     1 
ATOM   5517  N  NZ     . LYS A 1 334  ? -18.845 -54.562 49.985  1.00 47.70  1 1696 LYS A NZ     1 
ATOM   5518  H  H      . LYS A 1 334  ? -24.135 -52.067 52.329  1.00 69.25  ? 1696 LYS A H      1 
ATOM   5519  H  HA     . LYS A 1 334  ? -23.639 -50.220 50.613  1.00 57.92  ? 1696 LYS A HA     1 
ATOM   5520  H  HB2    . LYS A 1 334  ? -23.639 -52.972 50.012  1.00 56.91  ? 1696 LYS A HB2    1 
ATOM   5521  H  HB3    . LYS A 1 334  ? -22.854 -51.861 49.204  1.00 56.91  ? 1696 LYS A HB3    1 
ATOM   5522  H  HG2    . LYS A 1 334  ? -21.395 -51.600 51.010  1.00 58.36  ? 1696 LYS A HG2    1 
ATOM   5523  H  HG3    . LYS A 1 334  ? -22.162 -52.778 51.770  1.00 58.36  ? 1696 LYS A HG3    1 
ATOM   5524  H  HD2    . LYS A 1 334  ? -21.566 -54.270 50.091  1.00 57.95  ? 1696 LYS A HD2    1 
ATOM   5525  H  HD3    . LYS A 1 334  ? -20.852 -53.104 49.284  1.00 57.95  ? 1696 LYS A HD3    1 
ATOM   5526  H  HE2    . LYS A 1 334  ? -19.300 -52.935 51.096  1.00 59.22  ? 1696 LYS A HE2    1 
ATOM   5527  H  HE3    . LYS A 1 334  ? -19.931 -54.281 51.667  1.00 59.22  ? 1696 LYS A HE3    1 
ATOM   5528  H  HZ1    . LYS A 1 334  ? -18.084 -54.739 50.411  1.00 57.24  ? 1696 LYS A HZ1    1 
ATOM   5529  H  HZ2    . LYS A 1 334  ? -19.237 -55.330 49.763  1.00 57.24  ? 1696 LYS A HZ2    1 
ATOM   5530  H  HZ3    . LYS A 1 334  ? -18.662 -54.106 49.244  1.00 57.24  ? 1696 LYS A HZ3    1 
ATOM   5531  N  N      . LYS A 1 335  ? -26.255 -51.880 49.835  1.00 30.46  ? 1697 LYS A N      1 
ATOM   5532  C  CA     . LYS A 1 335  ? -27.431 -51.878 48.976  1.00 30.22  ? 1697 LYS A CA     1 
ATOM   5533  C  C      . LYS A 1 335  ? -28.216 -50.599 49.216  1.00 30.56  ? 1697 LYS A C      1 
ATOM   5534  O  O      . LYS A 1 335  ? -28.716 -49.983 48.278  1.00 30.10  ? 1697 LYS A O      1 
ATOM   5535  C  CB     . LYS A 1 335  ? -28.318 -53.107 49.229  1.00 30.74  ? 1697 LYS A CB     1 
ATOM   5536  C  CG     . LYS A 1 335  ? -29.713 -53.011 48.596  1.00 30.75  ? 1697 LYS A CG     1 
ATOM   5537  C  CD     . LYS A 1 335  ? -30.358 -54.380 48.353  1.00 30.95  ? 1697 LYS A CD     1 
ATOM   5538  C  CE     . LYS A 1 335  ? -30.330 -55.270 49.578  1.00 31.88  ? 1697 LYS A CE     1 
ATOM   5539  N  NZ     . LYS A 1 335  ? -30.817 -56.632 49.259  1.00 32.07  1 1697 LYS A NZ     1 
ATOM   5540  H  H      . LYS A 1 335  ? -26.250 -52.502 50.428  1.00 36.56  ? 1697 LYS A H      1 
ATOM   5541  H  HA     . LYS A 1 335  ? -27.150 -51.892 48.048  1.00 36.26  ? 1697 LYS A HA     1 
ATOM   5542  H  HB2    . LYS A 1 335  ? -27.879 -53.889 48.861  1.00 36.88  ? 1697 LYS A HB2    1 
ATOM   5543  H  HB3    . LYS A 1 335  ? -28.435 -53.216 50.186  1.00 36.88  ? 1697 LYS A HB3    1 
ATOM   5544  H  HG2    . LYS A 1 335  ? -30.294 -52.508 49.188  1.00 36.90  ? 1697 LYS A HG2    1 
ATOM   5545  H  HG3    . LYS A 1 335  ? -29.640 -52.559 47.741  1.00 36.90  ? 1697 LYS A HG3    1 
ATOM   5546  H  HD2    . LYS A 1 335  ? -31.285 -54.251 48.097  1.00 37.14  ? 1697 LYS A HD2    1 
ATOM   5547  H  HD3    . LYS A 1 335  ? -29.878 -54.833 47.642  1.00 37.14  ? 1697 LYS A HD3    1 
ATOM   5548  H  HE2    . LYS A 1 335  ? -29.419 -55.340 49.904  1.00 38.26  ? 1697 LYS A HE2    1 
ATOM   5549  H  HE3    . LYS A 1 335  ? -30.905 -54.893 50.263  1.00 38.26  ? 1697 LYS A HE3    1 
ATOM   5550  H  HZ1    . LYS A 1 335  ? -30.794 -57.141 49.989  1.00 38.49  ? 1697 LYS A HZ1    1 
ATOM   5551  H  HZ2    . LYS A 1 335  ? -31.654 -56.593 48.960  1.00 38.49  ? 1697 LYS A HZ2    1 
ATOM   5552  H  HZ3    . LYS A 1 335  ? -30.302 -57.000 48.634  1.00 38.49  ? 1697 LYS A HZ3    1 
ATOM   5553  N  N      . ILE A 1 336  ? -28.322 -50.197 50.477  1.00 36.35  ? 1698 ILE A N      1 
ATOM   5554  C  CA     . ILE A 1 336  ? -29.145 -49.048 50.820  1.00 36.85  ? 1698 ILE A CA     1 
ATOM   5555  C  C      . ILE A 1 336  ? -28.487 -47.734 50.407  1.00 36.42  ? 1698 ILE A C      1 
ATOM   5556  O  O      . ILE A 1 336  ? -29.179 -46.820 49.968  1.00 36.40  ? 1698 ILE A O      1 
ATOM   5557  C  CB     . ILE A 1 336  ? -29.481 -49.029 52.324  1.00 38.05  ? 1698 ILE A CB     1 
ATOM   5558  C  CG1    . ILE A 1 336  ? -30.495 -50.140 52.611  1.00 38.59  ? 1698 ILE A CG1    1 
ATOM   5559  C  CG2    . ILE A 1 336  ? -30.078 -47.683 52.730  1.00 38.59  ? 1698 ILE A CG2    1 
ATOM   5560  C  CD1    . ILE A 1 336  ? -30.906 -50.290 54.059  1.00 39.86  ? 1698 ILE A CD1    1 
ATOM   5561  H  H      . ILE A 1 336  ? -27.931 -50.570 51.146  1.00 43.63  ? 1698 ILE A H      1 
ATOM   5562  H  HA     . ILE A 1 336  ? -29.984 -49.117 50.337  1.00 44.22  ? 1698 ILE A HA     1 
ATOM   5563  H  HB     . ILE A 1 336  ? -28.673 -49.190 52.836  1.00 45.65  ? 1698 ILE A HB     1 
ATOM   5564  H  HG12   . ILE A 1 336  ? -31.299 -49.962 52.098  1.00 46.31  ? 1698 ILE A HG12   1 
ATOM   5565  H  HG13   . ILE A 1 336  ? -30.112 -50.986 52.329  1.00 46.31  ? 1698 ILE A HG13   1 
ATOM   5566  H  HG21   . ILE A 1 336  ? -30.278 -47.701 53.679  1.00 46.31  ? 1698 ILE A HG21   1 
ATOM   5567  H  HG22   . ILE A 1 336  ? -29.435 -46.982 52.540  1.00 46.31  ? 1698 ILE A HG22   1 
ATOM   5568  H  HG23   . ILE A 1 336  ? -30.891 -47.533 52.223  1.00 46.31  ? 1698 ILE A HG23   1 
ATOM   5569  H  HD11   . ILE A 1 336  ? -31.545 -51.016 54.132  1.00 47.83  ? 1698 ILE A HD11   1 
ATOM   5570  H  HD12   . ILE A 1 336  ? -30.119 -50.488 54.591  1.00 47.83  ? 1698 ILE A HD12   1 
ATOM   5571  H  HD13   . ILE A 1 336  ? -31.310 -49.461 54.360  1.00 47.83  ? 1698 ILE A HD13   1 
ATOM   5572  N  N      . GLU A 1 337  ? -27.168 -47.623 50.543  1.00 33.94  ? 1699 GLU A N      1 
ATOM   5573  C  CA     . GLU A 1 337  ? -26.483 -46.409 50.107  1.00 33.56  ? 1699 GLU A CA     1 
ATOM   5574  C  C      . GLU A 1 337  ? -26.620 -46.313 48.596  1.00 32.62  ? 1699 GLU A C      1 
ATOM   5575  O  O      . GLU A 1 337  ? -26.873 -45.245 48.054  1.00 32.48  ? 1699 GLU A O      1 
ATOM   5576  C  CB     . GLU A 1 337  ? -25.013 -46.396 50.533  1.00 33.48  ? 1699 GLU A CB     1 
ATOM   5577  C  CG     . GLU A 1 337  ? -24.836 -46.210 52.034  1.00 34.52  ? 1699 GLU A CG     1 
ATOM   5578  C  CD     . GLU A 1 337  ? -23.395 -46.316 52.509  1.00 34.53  ? 1699 GLU A CD     1 
ATOM   5579  O  OE1    . GLU A 1 337  ? -22.539 -46.812 51.742  1.00 33.74  ? 1699 GLU A OE1    1 
ATOM   5580  O  OE2    . GLU A 1 337  ? -23.128 -45.911 53.666  1.00 35.39  1 1699 GLU A OE2    1 
ATOM   5581  H  H      . GLU A 1 337  ? -26.655 -48.225 50.879  1.00 40.72  ? 1699 GLU A H      1 
ATOM   5582  H  HA     . GLU A 1 337  ? -26.918 -45.637 50.501  1.00 40.27  ? 1699 GLU A HA     1 
ATOM   5583  H  HB2    . GLU A 1 337  ? -24.604 -47.241 50.285  1.00 40.18  ? 1699 GLU A HB2    1 
ATOM   5584  H  HB3    . GLU A 1 337  ? -24.560 -45.665 50.084  1.00 40.18  ? 1699 GLU A HB3    1 
ATOM   5585  H  HG2    . GLU A 1 337  ? -25.165 -45.331 52.279  1.00 41.42  ? 1699 GLU A HG2    1 
ATOM   5586  H  HG3    . GLU A 1 337  ? -25.350 -46.892 52.495  1.00 41.42  ? 1699 GLU A HG3    1 
ATOM   5587  N  N      . ALA A 1 338  ? -26.449 -47.450 47.931  1.00 34.89  ? 1700 ALA A N      1 
ATOM   5588  C  CA     . ALA A 1 338  ? -26.619 -47.553 46.486  1.00 34.07  ? 1700 ALA A CA     1 
ATOM   5589  C  C      . ALA A 1 338  ? -27.980 -47.058 45.989  1.00 34.20  ? 1700 ALA A C      1 
ATOM   5590  O  O      . ALA A 1 338  ? -28.060 -46.361 44.980  1.00 33.74  ? 1700 ALA A O      1 
ATOM   5591  C  CB     . ALA A 1 338  ? -26.417 -48.999 46.057  1.00 33.69  ? 1700 ALA A CB     1 
ATOM   5592  H  H      . ALA A 1 338  ? -26.230 -48.193 48.303  1.00 41.87  ? 1700 ALA A H      1 
ATOM   5593  H  HA     . ALA A 1 338  ? -25.935 -47.018 46.054  1.00 40.88  ? 1700 ALA A HA     1 
ATOM   5594  H  HB1    . ALA A 1 338  ? -26.531 -49.061 45.096  1.00 40.43  ? 1700 ALA A HB1    1 
ATOM   5595  H  HB2    . ALA A 1 338  ? -25.522 -49.279 46.303  1.00 40.43  ? 1700 ALA A HB2    1 
ATOM   5596  H  HB3    . ALA A 1 338  ? -27.073 -49.555 46.505  1.00 40.43  ? 1700 ALA A HB3    1 
ATOM   5597  N  N      . LEU A 1 339  ? -29.044 -47.421 46.696  1.00 29.34  ? 1701 LEU A N      1 
ATOM   5598  C  CA     . LEU A 1 339  ? -30.394 -47.013 46.321  1.00 29.57  ? 1701 LEU A CA     1 
ATOM   5599  C  C      . LEU A 1 339  ? -30.635 -45.520 46.532  1.00 29.93  ? 1701 LEU A C      1 
ATOM   5600  O  O      . LEU A 1 339  ? -31.449 -44.907 45.841  1.00 29.88  ? 1701 LEU A O      1 
ATOM   5601  C  CB     . LEU A 1 339  ? -31.421 -47.811 47.122  1.00 30.32  ? 1701 LEU A CB     1 
ATOM   5602  C  CG     . LEU A 1 339  ? -31.623 -49.256 46.670  1.00 30.06  ? 1701 LEU A CG     1 
ATOM   5603  C  CD1    . LEU A 1 339  ? -32.391 -50.027 47.734  1.00 30.97  ? 1701 LEU A CD1    1 
ATOM   5604  C  CD2    . LEU A 1 339  ? -32.336 -49.320 45.328  1.00 29.54  ? 1701 LEU A CD2    1 
ATOM   5605  H  H      . LEU A 1 339  ? -29.011 -47.908 47.404  1.00 35.21  ? 1701 LEU A H      1 
ATOM   5606  H  HA     . LEU A 1 339  ? -30.532 -47.208 45.381  1.00 35.48  ? 1701 LEU A HA     1 
ATOM   5607  H  HB2    . LEU A 1 339  ? -31.137 -47.833 48.049  1.00 36.38  ? 1701 LEU A HB2    1 
ATOM   5608  H  HB3    . LEU A 1 339  ? -32.278 -47.362 47.056  1.00 36.38  ? 1701 LEU A HB3    1 
ATOM   5609  H  HG     . LEU A 1 339  ? -30.755 -49.676 46.566  1.00 36.07  ? 1701 LEU A HG     1 
ATOM   5610  H  HD11   . LEU A 1 339  ? -32.513 -50.942 47.435  1.00 37.16  ? 1701 LEU A HD11   1 
ATOM   5611  H  HD12   . LEU A 1 339  ? -31.884 -50.014 48.561  1.00 37.16  ? 1701 LEU A HD12   1 
ATOM   5612  H  HD13   . LEU A 1 339  ? -33.254 -49.605 47.868  1.00 37.16  ? 1701 LEU A HD13   1 
ATOM   5613  H  HD21   . LEU A 1 339  ? -32.446 -50.249 45.073  1.00 35.45  ? 1701 LEU A HD21   1 
ATOM   5614  H  HD22   . LEU A 1 339  ? -33.203 -48.894 45.410  1.00 35.45  ? 1701 LEU A HD22   1 
ATOM   5615  H  HD23   . LEU A 1 339  ? -31.801 -48.857 44.664  1.00 35.45  ? 1701 LEU A HD23   1 
ATOM   5616  N  N      . LEU A 1 340  ? -29.927 -44.946 47.497  1.00 31.44  ? 1702 LEU A N      1 
ATOM   5617  C  CA     . LEU A 1 340  ? -30.069 -43.533 47.837  1.00 31.92  ? 1702 LEU A CA     1 
ATOM   5618  C  C      . LEU A 1 340  ? -29.491 -42.637 46.761  1.00 31.29  ? 1702 LEU A C      1 
ATOM   5619  O  O      . LEU A 1 340  ? -30.023 -41.561 46.480  1.00 31.53  ? 1702 LEU A O      1 
ATOM   5620  C  CB     . LEU A 1 340  ? -29.367 -43.233 49.164  1.00 32.60  ? 1702 LEU A CB     1 
ATOM   5621  C  CG     . LEU A 1 340  ? -30.087 -43.540 50.470  1.00 33.63  ? 1702 LEU A CG     1 
ATOM   5622  C  CD1    . LEU A 1 340  ? -29.166 -43.242 51.634  1.00 34.21  ? 1702 LEU A CD1    1 
ATOM   5623  C  CD2    . LEU A 1 340  ? -31.333 -42.700 50.561  1.00 34.25  ? 1702 LEU A CD2    1 
ATOM   5624  H  H      . LEU A 1 340  ? -29.347 -45.360 47.979  1.00 37.73  ? 1702 LEU A H      1 
ATOM   5625  H  HA     . LEU A 1 340  ? -31.011 -43.321 47.936  1.00 38.30  ? 1702 LEU A HA     1 
ATOM   5626  H  HB2    . LEU A 1 340  ? -28.538 -43.736 49.178  1.00 39.12  ? 1702 LEU A HB2    1 
ATOM   5627  H  HB3    . LEU A 1 340  ? -29.158 -42.286 49.178  1.00 39.12  ? 1702 LEU A HB3    1 
ATOM   5628  H  HG     . LEU A 1 340  ? -30.336 -44.477 50.497  1.00 40.35  ? 1702 LEU A HG     1 
ATOM   5629  H  HD11   . LEU A 1 340  ? -29.631 -43.440 52.462  1.00 41.06  ? 1702 LEU A HD11   1 
ATOM   5630  H  HD12   . LEU A 1 340  ? -28.374 -43.796 51.559  1.00 41.06  ? 1702 LEU A HD12   1 
ATOM   5631  H  HD13   . LEU A 1 340  ? -28.919 -42.305 51.609  1.00 41.06  ? 1702 LEU A HD13   1 
ATOM   5632  H  HD21   . LEU A 1 340  ? -31.787 -42.899 51.394  1.00 41.10  ? 1702 LEU A HD21   1 
ATOM   5633  H  HD22   . LEU A 1 340  ? -31.084 -41.763 50.535  1.00 41.10  ? 1702 LEU A HD22   1 
ATOM   5634  H  HD23   . LEU A 1 340  ? -31.910 -42.910 49.810  1.00 41.10  ? 1702 LEU A HD23   1 
ATOM   5635  N  N      . VAL A 1 341  ? -28.386 -43.089 46.177  1.00 29.46  ? 1703 VAL A N      1 
ATOM   5636  C  CA     . VAL A 1 341  ? -27.739 -42.375 45.090  1.00 28.85  ? 1703 VAL A CA     1 
ATOM   5637  C  C      . VAL A 1 341  ? -28.764 -42.158 43.987  1.00 28.61  ? 1703 VAL A C      1 
ATOM   5638  O  O      . VAL A 1 341  ? -28.815 -41.096 43.368  1.00 28.59  ? 1703 VAL A O      1 
ATOM   5639  C  CB     . VAL A 1 341  ? -26.531 -43.152 44.557  1.00 28.09  ? 1703 VAL A CB     1 
ATOM   5640  C  CG1    . VAL A 1 341  ? -25.886 -42.414 43.410  1.00 27.54  ? 1703 VAL A CG1    1 
ATOM   5641  C  CG2    . VAL A 1 341  ? -25.516 -43.344 45.663  1.00 28.39  ? 1703 VAL A CG2    1 
ATOM   5642  H  H      . VAL A 1 341  ? -27.988 -43.818 46.398  1.00 35.35  ? 1703 VAL A H      1 
ATOM   5643  H  HA     . VAL A 1 341  ? -27.435 -41.509 45.405  1.00 34.62  ? 1703 VAL A HA     1 
ATOM   5644  H  HB     . VAL A 1 341  ? -26.816 -44.025 44.244  1.00 33.71  ? 1703 VAL A HB     1 
ATOM   5645  H  HG11   . VAL A 1 341  ? -25.126 -42.926 43.093  1.00 33.04  ? 1703 VAL A HG11   1 
ATOM   5646  H  HG12   . VAL A 1 341  ? -26.536 -42.309 42.698  1.00 33.04  ? 1703 VAL A HG12   1 
ATOM   5647  H  HG13   . VAL A 1 341  ? -25.592 -41.543 43.721  1.00 33.04  ? 1703 VAL A HG13   1 
ATOM   5648  H  HG21   . VAL A 1 341  ? -24.757 -43.837 45.314  1.00 34.07  ? 1703 VAL A HG21   1 
ATOM   5649  H  HG22   . VAL A 1 341  ? -25.228 -42.473 45.981  1.00 34.07  ? 1703 VAL A HG22   1 
ATOM   5650  H  HG23   . VAL A 1 341  ? -25.928 -43.840 46.387  1.00 34.07  ? 1703 VAL A HG23   1 
ATOM   5651  N  N      . GLU A 1 342  ? -29.579 -43.182 43.756  1.00 28.51  ? 1704 GLU A N      1 
ATOM   5652  C  CA     . GLU A 1 342  ? -30.623 -43.139 42.738  1.00 28.34  ? 1704 GLU A CA     1 
ATOM   5653  C  C      . GLU A 1 342  ? -31.893 -42.438 43.202  1.00 29.11  ? 1704 GLU A C      1 
ATOM   5654  O  O      . GLU A 1 342  ? -32.534 -41.751 42.413  1.00 29.11  ? 1704 GLU A O      1 
ATOM   5655  C  CB     . GLU A 1 342  ? -30.955 -44.558 42.269  1.00 27.97  ? 1704 GLU A CB     1 
ATOM   5656  C  CG     . GLU A 1 342  ? -30.161 -44.984 41.046  1.00 27.13  ? 1704 GLU A CG     1 
ATOM   5657  C  CD     . GLU A 1 342  ? -30.795 -44.492 39.755  1.00 26.88  ? 1704 GLU A CD     1 
ATOM   5658  O  OE1    . GLU A 1 342  ? -32.033 -44.588 39.622  1.00 27.21  ? 1704 GLU A OE1    1 
ATOM   5659  O  OE2    . GLU A 1 342  ? -30.059 -43.995 38.879  1.00 26.43  1 1704 GLU A OE2    1 
ATOM   5660  H  H      . GLU A 1 342  ? -29.545 -43.928 44.184  1.00 34.21  ? 1704 GLU A H      1 
ATOM   5661  H  HA     . GLU A 1 342  ? -30.284 -42.651 41.971  1.00 34.01  ? 1704 GLU A HA     1 
ATOM   5662  H  HB2    . GLU A 1 342  ? -30.757 -45.181 42.986  1.00 33.57  ? 1704 GLU A HB2    1 
ATOM   5663  H  HB3    . GLU A 1 342  ? -31.898 -44.602 42.044  1.00 33.57  ? 1704 GLU A HB3    1 
ATOM   5664  H  HG2    . GLU A 1 342  ? -29.266 -44.615 41.103  1.00 32.55  ? 1704 GLU A HG2    1 
ATOM   5665  H  HG3    . GLU A 1 342  ? -30.121 -45.953 41.013  1.00 32.55  ? 1704 GLU A HG3    1 
ATOM   5666  N  N      . TYR A 1 343  ? -32.270 -42.606 44.462  1.00 32.91  ? 1705 TYR A N      1 
ATOM   5667  C  CA     . TYR A 1 343  ? -33.473 -41.945 44.957  1.00 33.73  ? 1705 TYR A CA     1 
ATOM   5668  C  C      . TYR A 1 343  ? -33.246 -40.451 45.126  1.00 34.11  ? 1705 TYR A C      1 
ATOM   5669  O  O      . TYR A 1 343  ? -34.173 -39.652 44.970  1.00 34.58  ? 1705 TYR A O      1 
ATOM   5670  C  CB     . TYR A 1 343  ? -33.955 -42.557 46.270  1.00 34.49  ? 1705 TYR A CB     1 
ATOM   5671  C  CG     . TYR A 1 343  ? -35.192 -43.384 46.065  1.00 34.67  ? 1705 TYR A CG     1 
ATOM   5672  C  CD1    . TYR A 1 343  ? -36.439 -42.784 46.052  1.00 35.27  ? 1705 TYR A CD1    1 
ATOM   5673  C  CD2    . TYR A 1 343  ? -35.120 -44.753 45.864  1.00 34.31  ? 1705 TYR A CD2    1 
ATOM   5674  C  CE1    . TYR A 1 343  ? -37.583 -43.517 45.849  1.00 35.49  ? 1705 TYR A CE1    1 
ATOM   5675  C  CE2    . TYR A 1 343  ? -36.263 -45.502 45.663  1.00 34.55  ? 1705 TYR A CE2    1 
ATOM   5676  C  CZ     . TYR A 1 343  ? -37.496 -44.876 45.657  1.00 35.14  ? 1705 TYR A CZ     1 
ATOM   5677  O  OH     . TYR A 1 343  ? -38.653 -45.596 45.458  1.00 35.44  ? 1705 TYR A OH     1 
ATOM   5678  H  H      . TYR A 1 343  ? -31.857 -43.088 45.043  1.00 39.49  ? 1705 TYR A H      1 
ATOM   5679  H  HA     . TYR A 1 343  ? -34.179 -42.062 44.303  1.00 40.47  ? 1705 TYR A HA     1 
ATOM   5680  H  HB2    . TYR A 1 343  ? -33.261 -43.131 46.630  1.00 41.39  ? 1705 TYR A HB2    1 
ATOM   5681  H  HB3    . TYR A 1 343  ? -34.163 -41.847 46.897  1.00 41.39  ? 1705 TYR A HB3    1 
ATOM   5682  H  HD1    . TYR A 1 343  ? -36.503 -41.865 46.179  1.00 42.32  ? 1705 TYR A HD1    1 
ATOM   5683  H  HD2    . TYR A 1 343  ? -34.291 -45.174 45.867  1.00 41.17  ? 1705 TYR A HD2    1 
ATOM   5684  H  HE1    . TYR A 1 343  ? -38.413 -43.098 45.846  1.00 42.59  ? 1705 TYR A HE1    1 
ATOM   5685  H  HE2    . TYR A 1 343  ? -36.204 -46.421 45.532  1.00 41.46  ? 1705 TYR A HE2    1 
ATOM   5686  H  HH     . TYR A 1 343  ? -38.471 -46.409 45.354  1.00 42.52  ? 1705 TYR A HH     1 
ATOM   5687  N  N      . LEU A 1 344  ? -32.018 -40.078 45.471  1.00 31.69  ? 1706 LEU A N      1 
ATOM   5688  C  CA     . LEU A 1 344  ? -31.651 -38.673 45.549  1.00 32.04  ? 1706 LEU A CA     1 
ATOM   5689  C  C      . LEU A 1 344  ? -31.858 -38.016 44.186  1.00 31.62  ? 1706 LEU A C      1 
ATOM   5690  O  O      . LEU A 1 344  ? -32.412 -36.922 44.105  1.00 32.15  ? 1706 LEU A O      1 
ATOM   5691  C  CB     . LEU A 1 344  ? -30.208 -38.506 46.032  1.00 31.91  ? 1706 LEU A CB     1 
ATOM   5692  C  CG     . LEU A 1 344  ? -29.967 -38.615 47.545  1.00 32.67  ? 1706 LEU A CG     1 
ATOM   5693  C  CD1    . LEU A 1 344  ? -28.491 -38.479 47.852  1.00 32.48  ? 1706 LEU A CD1    1 
ATOM   5694  C  CD2    . LEU A 1 344  ? -30.738 -37.561 48.323  1.00 33.73  ? 1706 LEU A CD2    1 
ATOM   5695  H  H      . LEU A 1 344  ? -31.380 -40.621 45.664  1.00 38.03  ? 1706 LEU A H      1 
ATOM   5696  H  HA     . LEU A 1 344  ? -32.233 -38.230 46.186  1.00 38.45  ? 1706 LEU A HA     1 
ATOM   5697  H  HB2    . LEU A 1 344  ? -29.666 -39.189 45.606  1.00 38.30  ? 1706 LEU A HB2    1 
ATOM   5698  H  HB3    . LEU A 1 344  ? -29.895 -37.631 45.755  1.00 38.30  ? 1706 LEU A HB3    1 
ATOM   5699  H  HG     . LEU A 1 344  ? -30.258 -39.488 47.851  1.00 39.20  ? 1706 LEU A HG     1 
ATOM   5700  H  HD11   . LEU A 1 344  ? -28.360 -38.550 48.810  1.00 38.97  ? 1706 LEU A HD11   1 
ATOM   5701  H  HD12   . LEU A 1 344  ? -28.009 -39.187 47.398  1.00 38.97  ? 1706 LEU A HD12   1 
ATOM   5702  H  HD13   . LEU A 1 344  ? -28.183 -37.614 47.538  1.00 38.97  ? 1706 LEU A HD13   1 
ATOM   5703  H  HD21   . LEU A 1 344  ? -31.686 -37.676 48.155  1.00 40.47  ? 1706 LEU A HD21   1 
ATOM   5704  H  HD22   . LEU A 1 344  ? -30.554 -37.670 49.269  1.00 40.47  ? 1706 LEU A HD22   1 
ATOM   5705  H  HD23   . LEU A 1 344  ? -30.453 -36.682 48.030  1.00 40.47  ? 1706 LEU A HD23   1 
ATOM   5706  N  N      . HIS A 1 345  ? -31.400 -38.669 43.121  1.00 29.95  ? 1707 HIS A N      1 
ATOM   5707  C  CA     . HIS A 1 345  ? -31.565 -38.117 41.779  1.00 29.59  ? 1707 HIS A CA     1 
ATOM   5708  C  C      . HIS A 1 345  ? -33.046 -37.955 41.436  1.00 29.97  ? 1707 HIS A C      1 
ATOM   5709  O  O      . HIS A 1 345  ? -33.409 -37.035 40.706  1.00 30.13  ? 1707 HIS A O      1 
ATOM   5710  C  CB     . HIS A 1 345  ? -30.866 -38.988 40.725  1.00 28.65  ? 1707 HIS A CB     1 
ATOM   5711  C  CG     . HIS A 1 345  ? -31.212 -38.622 39.313  1.00 28.33  ? 1707 HIS A CG     1 
ATOM   5712  N  ND1    . HIS A 1 345  ? -31.848 -39.494 38.455  1.00 27.95  ? 1707 HIS A ND1    1 
ATOM   5713  C  CD2    . HIS A 1 345  ? -31.037 -37.473 38.618  1.00 28.45  ? 1707 HIS A CD2    1 
ATOM   5714  C  CE1    . HIS A 1 345  ? -32.033 -38.904 37.288  1.00 27.82  ? 1707 HIS A CE1    1 
ATOM   5715  N  NE2    . HIS A 1 345  ? -31.551 -37.677 37.361  1.00 28.12  ? 1707 HIS A NE2    1 
ATOM   5716  H  H      . HIS A 1 345  ? -30.993 -39.426 43.147  1.00 35.94  ? 1707 HIS A H      1 
ATOM   5717  H  HA     . HIS A 1 345  ? -31.158 -37.237 41.752  1.00 35.51  ? 1707 HIS A HA     1 
ATOM   5718  H  HB2    . HIS A 1 345  ? -29.906 -38.894 40.829  1.00 34.37  ? 1707 HIS A HB2    1 
ATOM   5719  H  HB3    . HIS A 1 345  ? -31.123 -39.913 40.863  1.00 34.37  ? 1707 HIS A HB3    1 
ATOM   5720  H  HD2    . HIS A 1 345  ? -30.635 -36.695 38.931  1.00 34.14  ? 1707 HIS A HD2    1 
ATOM   5721  H  HE1    . HIS A 1 345  ? -32.437 -39.286 36.543  1.00 33.38  ? 1707 HIS A HE1    1 
ATOM   5722  H  HE2    . HIS A 1 345  ? -31.558 -37.099 36.724  1.00 33.75  ? 1707 HIS A HE2    1 
ATOM   5723  N  N      . PHE A 1 346  ? -33.903 -38.838 41.946  1.00 30.19  ? 1708 PHE A N      1 
ATOM   5724  C  CA     . PHE A 1 346  ? -35.334 -38.680 41.713  1.00 30.65  ? 1708 PHE A CA     1 
ATOM   5725  C  C      . PHE A 1 346  ? -35.752 -37.370 42.343  1.00 31.53  ? 1708 PHE A C      1 
ATOM   5726  O  O      . PHE A 1 346  ? -36.459 -36.573 41.739  1.00 31.83  ? 1708 PHE A O      1 
ATOM   5727  C  CB     . PHE A 1 346  ? -36.171 -39.813 42.309  1.00 30.89  ? 1708 PHE A CB     1 
ATOM   5728  C  CG     . PHE A 1 346  ? -35.877 -41.169 41.743  1.00 30.15  ? 1708 PHE A CG     1 
ATOM   5729  C  CD1    . PHE A 1 346  ? -35.094 -41.323 40.614  1.00 29.34  ? 1708 PHE A CD1    1 
ATOM   5730  C  CD2    . PHE A 1 346  ? -36.427 -42.293 42.327  1.00 30.37  ? 1708 PHE A CD2    1 
ATOM   5731  C  CE1    . PHE A 1 346  ? -34.837 -42.576 40.105  1.00 30.24  ? 1708 PHE A CE1    1 
ATOM   5732  C  CE2    . PHE A 1 346  ? -36.178 -43.545 41.822  1.00 29.79  ? 1708 PHE A CE2    1 
ATOM   5733  C  CZ     . PHE A 1 346  ? -35.387 -43.689 40.706  1.00 34.40  ? 1708 PHE A CZ     1 
ATOM   5734  H  H      . PHE A 1 346  ? -33.687 -39.522 42.421  1.00 36.23  ? 1708 PHE A H      1 
ATOM   5735  H  HA     . PHE A 1 346  ? -35.507 -38.636 40.759  1.00 36.78  ? 1708 PHE A HA     1 
ATOM   5736  H  HB2    . PHE A 1 346  ? -36.006 -39.852 43.264  1.00 37.06  ? 1708 PHE A HB2    1 
ATOM   5737  H  HB3    . PHE A 1 346  ? -37.109 -39.625 42.147  1.00 37.06  ? 1708 PHE A HB3    1 
ATOM   5738  H  HD1    . PHE A 1 346  ? -34.720 -40.575 40.207  1.00 35.21  ? 1708 PHE A HD1    1 
ATOM   5739  H  HD2    . PHE A 1 346  ? -36.960 -42.202 43.083  1.00 36.44  ? 1708 PHE A HD2    1 
ATOM   5740  H  HE1    . PHE A 1 346  ? -34.304 -42.671 39.349  1.00 36.29  ? 1708 PHE A HE1    1 
ATOM   5741  H  HE2    . PHE A 1 346  ? -36.548 -44.294 42.230  1.00 35.75  ? 1708 PHE A HE2    1 
ATOM   5742  H  HZ     . PHE A 1 346  ? -35.218 -44.537 40.362  1.00 41.28  ? 1708 PHE A HZ     1 
ATOM   5743  N  N      . ASN A 1 347  ? -35.291 -37.158 43.569  1.00 55.98  ? 1709 ASN A N      1 
ATOM   5744  C  CA     . ASN A 1 347  ? -35.648 -35.974 44.329  1.00 59.26  ? 1709 ASN A CA     1 
ATOM   5745  C  C      . ASN A 1 347  ? -35.176 -34.731 43.598  1.00 60.27  ? 1709 ASN A C      1 
ATOM   5746  O  O      . ASN A 1 347  ? -35.902 -33.745 43.488  1.00 66.83  ? 1709 ASN A O      1 
ATOM   5747  C  CB     . ASN A 1 347  ? -35.020 -36.028 45.727  1.00 58.95  ? 1709 ASN A CB     1 
ATOM   5748  C  CG     . ASN A 1 347  ? -35.715 -35.113 46.724  1.00 62.51  ? 1709 ASN A CG     1 
ATOM   5749  O  OD1    . ASN A 1 347  ? -36.930 -34.925 46.673  1.00 66.62  ? 1709 ASN A OD1    1 
ATOM   5750  N  ND2    . ASN A 1 347  ? -34.937 -34.529 47.633  1.00 61.09  ? 1709 ASN A ND2    1 
ATOM   5751  H  H      . ASN A 1 347  ? -34.763 -37.693 43.987  1.00 67.17  ? 1709 ASN A H      1 
ATOM   5752  H  HA     . ASN A 1 347  ? -36.612 -35.928 44.426  1.00 71.11  ? 1709 ASN A HA     1 
ATOM   5753  H  HB2    . ASN A 1 347  ? -35.077 -36.936 46.063  1.00 70.74  ? 1709 ASN A HB2    1 
ATOM   5754  H  HB3    . ASN A 1 347  ? -34.092 -35.754 45.666  1.00 70.74  ? 1709 ASN A HB3    1 
ATOM   5755  H  HD21   . ASN A 1 347  ? -35.282 -34.002 48.220  1.00 73.31  ? 1709 ASN A HD21   1 
ATOM   5756  H  HD22   . ASN A 1 347  ? -34.090 -34.677 47.634  1.00 73.31  ? 1709 ASN A HD22   1 
ATOM   5757  N  N      . ASN A 1 348  ? -33.953 -34.801 43.086  1.00 48.47  ? 1710 ASN A N      1 
ATOM   5758  C  CA     . ASN A 1 348  ? -33.328 -33.679 42.402  1.00 46.31  ? 1710 ASN A CA     1 
ATOM   5759  C  C      . ASN A 1 348  ? -34.085 -33.268 41.138  1.00 43.36  ? 1710 ASN A C      1 
ATOM   5760  O  O      . ASN A 1 348  ? -34.315 -32.084 40.911  1.00 42.50  ? 1710 ASN A O      1 
ATOM   5761  C  CB     . ASN A 1 348  ? -31.876 -34.041 42.065  1.00 54.47  ? 1710 ASN A CB     1 
ATOM   5762  C  CG     . ASN A 1 348  ? -31.170 -32.969 41.259  1.00 60.54  ? 1710 ASN A CG     1 
ATOM   5763  O  OD1    . ASN A 1 348  ? -31.454 -31.778 41.398  1.00 61.63  ? 1710 ASN A OD1    1 
ATOM   5764  N  ND2    . ASN A 1 348  ? -30.226 -33.388 40.421  1.00 63.38  ? 1710 ASN A ND2    1 
ATOM   5765  H  H      . ASN A 1 348  ? -33.456 -35.502 43.124  1.00 58.17  ? 1710 ASN A H      1 
ATOM   5766  H  HA     . ASN A 1 348  ? -33.313 -32.916 43.000  1.00 55.58  ? 1710 ASN A HA     1 
ATOM   5767  H  HB2    . ASN A 1 348  ? -31.383 -34.167 42.891  1.00 65.36  ? 1710 ASN A HB2    1 
ATOM   5768  H  HB3    . ASN A 1 348  ? -31.868 -34.860 41.546  1.00 65.36  ? 1710 ASN A HB3    1 
ATOM   5769  H  HD21   . ASN A 1 348  ? -29.794 -32.821 39.940  1.00 76.06  ? 1710 ASN A HD21   1 
ATOM   5770  H  HD22   . ASN A 1 348  ? -30.047 -34.227 40.360  1.00 76.06  ? 1710 ASN A HD22   1 
ATOM   5771  N  N      . VAL A 1 349  ? -34.485 -34.249 40.334  1.00 31.51  ? 1711 VAL A N      1 
ATOM   5772  C  CA     . VAL A 1 349  ? -35.222 -33.987 39.097  1.00 31.43  ? 1711 VAL A CA     1 
ATOM   5773  C  C      . VAL A 1 349  ? -36.622 -33.447 39.352  1.00 32.28  ? 1711 VAL A C      1 
ATOM   5774  O  O      . VAL A 1 349  ? -37.018 -32.452 38.753  1.00 32.71  ? 1711 VAL A O      1 
ATOM   5775  C  CB     . VAL A 1 349  ? -35.325 -35.253 38.223  1.00 30.60  ? 1711 VAL A CB     1 
ATOM   5776  C  CG1    . VAL A 1 349  ? -36.289 -35.041 37.051  1.00 30.68  ? 1711 VAL A CG1    1 
ATOM   5777  C  CG2    . VAL A 1 349  ? -33.947 -35.631 37.703  1.00 29.80  ? 1711 VAL A CG2    1 
ATOM   5778  H  H      . VAL A 1 349  ? -34.341 -35.084 40.482  1.00 37.81  ? 1711 VAL A H      1 
ATOM   5779  H  HA     . VAL A 1 349  ? -34.739 -33.317 38.587  1.00 37.71  ? 1711 VAL A HA     1 
ATOM   5780  H  HB     . VAL A 1 349  ? -35.658 -35.987 38.762  1.00 36.72  ? 1711 VAL A HB     1 
ATOM   5781  H  HG11   . VAL A 1 349  ? -36.328 -35.855 36.524  1.00 36.81  ? 1711 VAL A HG11   1 
ATOM   5782  H  HG12   . VAL A 1 349  ? -37.168 -34.830 37.400  1.00 36.81  ? 1711 VAL A HG12   1 
ATOM   5783  H  HG13   . VAL A 1 349  ? -35.965 -34.309 36.504  1.00 36.81  ? 1711 VAL A HG13   1 
ATOM   5784  H  HG21   . VAL A 1 349  ? -34.025 -36.428 37.156  1.00 35.76  ? 1711 VAL A HG21   1 
ATOM   5785  H  HG22   . VAL A 1 349  ? -33.598 -34.897 37.174  1.00 35.76  ? 1711 VAL A HG22   1 
ATOM   5786  H  HG23   . VAL A 1 349  ? -33.362 -35.803 38.458  1.00 35.76  ? 1711 VAL A HG23   1 
ATOM   5787  N  N      . ILE A 1 350  ? -37.384 -34.117 40.209  1.00 32.58  ? 1712 ILE A N      1 
ATOM   5788  C  CA     . ILE A 1 350  ? -38.709 -33.629 40.565  1.00 33.48  ? 1712 ILE A CA     1 
ATOM   5789  C  C      . ILE A 1 350  ? -38.569 -32.217 41.113  1.00 34.32  ? 1712 ILE A C      1 
ATOM   5790  O  O      . ILE A 1 350  ? -39.417 -31.357 40.881  1.00 35.02  ? 1712 ILE A O      1 
ATOM   5791  C  CB     . ILE A 1 350  ? -39.400 -34.510 41.625  1.00 33.81  ? 1712 ILE A CB     1 
ATOM   5792  C  CG1    . ILE A 1 350  ? -39.529 -35.958 41.144  1.00 33.06  ? 1712 ILE A CG1    1 
ATOM   5793  C  CG2    . ILE A 1 350  ? -40.776 -33.939 41.967  1.00 34.80  ? 1712 ILE A CG2    1 
ATOM   5794  C  CD1    . ILE A 1 350  ? -39.944 -36.920 42.240  1.00 33.35  ? 1712 ILE A CD1    1 
ATOM   5795  H  H      . ILE A 1 350  ? -37.159 -34.852 40.596  1.00 39.10  ? 1712 ILE A H      1 
ATOM   5796  H  HA     . ILE A 1 350  ? -39.269 -33.600 39.774  1.00 40.17  ? 1712 ILE A HA     1 
ATOM   5797  H  HB     . ILE A 1 350  ? -38.858 -34.503 42.429  1.00 40.57  ? 1712 ILE A HB     1 
ATOM   5798  H  HG12   . ILE A 1 350  ? -40.199 -35.998 40.443  1.00 39.67  ? 1712 ILE A HG12   1 
ATOM   5799  H  HG13   . ILE A 1 350  ? -38.672 -36.252 40.798  1.00 39.67  ? 1712 ILE A HG13   1 
ATOM   5800  H  HG21   . ILE A 1 350  ? -41.195 -34.504 42.634  1.00 41.76  ? 1712 ILE A HG21   1 
ATOM   5801  H  HG22   . ILE A 1 350  ? -40.666 -33.040 42.316  1.00 41.76  ? 1712 ILE A HG22   1 
ATOM   5802  H  HG23   . ILE A 1 350  ? -41.317 -33.917 41.162  1.00 41.76  ? 1712 ILE A HG23   1 
ATOM   5803  H  HD11   . ILE A 1 350  ? -40.006 -37.814 41.868  1.00 40.02  ? 1712 ILE A HD11   1 
ATOM   5804  H  HD12   . ILE A 1 350  ? -39.278 -36.901 42.945  1.00 40.02  ? 1712 ILE A HD12   1 
ATOM   5805  H  HD13   . ILE A 1 350  ? -40.806 -36.647 42.590  1.00 40.02  ? 1712 ILE A HD13   1 
ATOM   5806  N  N      . GLY A 1 351  ? -37.478 -31.992 41.839  1.00 44.36  ? 1713 GLY A N      1 
ATOM   5807  C  CA     . GLY A 1 351  ? -37.157 -30.679 42.365  1.00 45.16  ? 1713 GLY A CA     1 
ATOM   5808  C  C      . GLY A 1 351  ? -36.883 -29.687 41.255  1.00 45.14  ? 1713 GLY A C      1 
ATOM   5809  O  O      . GLY A 1 351  ? -37.367 -28.556 41.298  1.00 46.02  ? 1713 GLY A O      1 
ATOM   5810  H  H      . GLY A 1 351  ? -36.902 -32.597 42.042  1.00 53.23  ? 1713 GLY A H      1 
ATOM   5811  H  HA2    . GLY A 1 351  ? -37.897 -30.351 42.898  1.00 54.19  ? 1713 GLY A HA2    1 
ATOM   5812  H  HA3    . GLY A 1 351  ? -36.370 -30.738 42.929  1.00 54.19  ? 1713 GLY A HA3    1 
ATOM   5813  N  N      . GLN A 1 352  ? -36.104 -30.107 40.260  1.00 47.45  ? 1714 GLN A N      1 
ATOM   5814  C  CA     . GLN A 1 352  ? -35.825 -29.247 39.121  1.00 47.44  ? 1714 GLN A CA     1 
ATOM   5815  C  C      . GLN A 1 352  ? -37.142 -28.966 38.402  1.00 47.85  ? 1714 GLN A C      1 
ATOM   5816  O  O      . GLN A 1 352  ? -37.447 -27.819 38.096  1.00 48.57  ? 1714 GLN A O      1 
ATOM   5817  C  CB     . GLN A 1 352  ? -34.805 -29.880 38.157  1.00 46.40  ? 1714 GLN A CB     1 
ATOM   5818  C  CG     . GLN A 1 352  ? -33.372 -30.004 38.698  1.00 46.03  ? 1714 GLN A CG     1 
ATOM   5819  C  CD     . GLN A 1 352  ? -32.316 -29.963 37.600  1.00 45.39  ? 1714 GLN A CD     1 
ATOM   5820  O  OE1    . GLN A 1 352  ? -32.226 -28.992 36.844  1.00 45.73  ? 1714 GLN A OE1    1 
ATOM   5821  N  NE2    . GLN A 1 352  ? -31.521 -31.027 37.497  1.00 47.51  ? 1714 GLN A NE2    1 
ATOM   5822  H  H      . GLN A 1 352  ? -35.729 -30.880 40.223  1.00 56.94  ? 1714 GLN A H      1 
ATOM   5823  H  HA     . GLN A 1 352  ? -35.464 -28.404 39.436  1.00 56.93  ? 1714 GLN A HA     1 
ATOM   5824  H  HB2    . GLN A 1 352  ? -35.109 -30.773 37.931  1.00 55.68  ? 1714 GLN A HB2    1 
ATOM   5825  H  HB3    . GLN A 1 352  ? -34.766 -29.339 37.353  1.00 55.68  ? 1714 GLN A HB3    1 
ATOM   5826  H  HG2    . GLN A 1 352  ? -33.200 -29.269 39.306  1.00 55.24  ? 1714 GLN A HG2    1 
ATOM   5827  H  HG3    . GLN A 1 352  ? -33.284 -30.849 39.166  1.00 55.24  ? 1714 GLN A HG3    1 
ATOM   5828  H  HE21   . GLN A 1 352  ? -31.619 -31.691 38.034  1.00 57.02  ? 1714 GLN A HE21   1 
ATOM   5829  H  HE22   . GLN A 1 352  ? -30.910 -31.050 36.892  1.00 57.02  ? 1714 GLN A HE22   1 
ATOM   5830  N  N      . LEU A 1 353  ? -37.935 -30.009 38.174  1.00 34.18  ? 1715 LEU A N      1 
ATOM   5831  C  CA     . LEU A 1 353  ? -39.187 -29.874 37.433  1.00 34.52  ? 1715 LEU A CA     1 
ATOM   5832  C  C      . LEU A 1 353  ? -40.183 -28.950 38.127  1.00 35.69  ? 1715 LEU A C      1 
ATOM   5833  O  O      . LEU A 1 353  ? -40.922 -28.225 37.463  1.00 36.24  ? 1715 LEU A O      1 
ATOM   5834  C  CB     . LEU A 1 353  ? -39.839 -31.244 37.213  1.00 33.96  ? 1715 LEU A CB     1 
ATOM   5835  C  CG     . LEU A 1 353  ? -39.221 -32.143 36.140  1.00 32.93  ? 1715 LEU A CG     1 
ATOM   5836  C  CD1    . LEU A 1 353  ? -39.890 -33.507 36.127  1.00 32.53  ? 1715 LEU A CD1    1 
ATOM   5837  C  CD2    . LEU A 1 353  ? -39.294 -31.498 34.766  1.00 32.96  ? 1715 LEU A CD2    1 
ATOM   5838  H  H      . LEU A 1 353  ? -37.770 -30.810 38.439  1.00 41.02  ? 1715 LEU A H      1 
ATOM   5839  H  HA     . LEU A 1 353  ? -38.992 -29.496 36.561  1.00 41.43  ? 1715 LEU A HA     1 
ATOM   5840  H  HB2    . LEU A 1 353  ? -39.804 -31.733 38.050  1.00 40.76  ? 1715 LEU A HB2    1 
ATOM   5841  H  HB3    . LEU A 1 353  ? -40.766 -31.101 36.966  1.00 40.76  ? 1715 LEU A HB3    1 
ATOM   5842  H  HG     . LEU A 1 353  ? -38.284 -32.277 36.351  1.00 39.52  ? 1715 LEU A HG     1 
ATOM   5843  H  HD11   . LEU A 1 353  ? -39.478 -34.053 35.439  1.00 39.04  ? 1715 LEU A HD11   1 
ATOM   5844  H  HD12   . LEU A 1 353  ? -39.772 -33.924 36.995  1.00 39.04  ? 1715 LEU A HD12   1 
ATOM   5845  H  HD13   . LEU A 1 353  ? -40.834 -33.393 35.939  1.00 39.04  ? 1715 LEU A HD13   1 
ATOM   5846  H  HD21   . LEU A 1 353  ? -38.894 -32.096 34.116  1.00 39.55  ? 1715 LEU A HD21   1 
ATOM   5847  H  HD22   . LEU A 1 353  ? -40.225 -31.339 34.542  1.00 39.55  ? 1715 LEU A HD22   1 
ATOM   5848  H  HD23   . LEU A 1 353  ? -38.810 -30.658 34.786  1.00 39.55  ? 1715 LEU A HD23   1 
ATOM   5849  N  N      . LYS A 1 354  ? -40.214 -28.988 39.457  1.00 39.62  ? 1716 LYS A N      1 
ATOM   5850  C  CA     . LYS A 1 354  ? -41.116 -28.139 40.230  1.00 40.81  ? 1716 LYS A CA     1 
ATOM   5851  C  C      . LYS A 1 354  ? -40.852 -26.674 39.891  1.00 41.50  ? 1716 LYS A C      1 
ATOM   5852  O  O      . LYS A 1 354  ? -41.749 -25.946 39.464  1.00 42.22  ? 1716 LYS A O      1 
ATOM   5853  C  CB     . LYS A 1 354  ? -40.909 -28.372 41.727  1.00 41.18  ? 1716 LYS A CB     1 
ATOM   5854  C  CG     . LYS A 1 354  ? -41.830 -27.589 42.658  1.00 42.47  ? 1716 LYS A CG     1 
ATOM   5855  C  CD     . LYS A 1 354  ? -41.079 -27.196 43.936  1.00 42.99  ? 1716 LYS A CD     1 
ATOM   5856  C  CE     . LYS A 1 354  ? -40.440 -28.389 44.655  1.00 42.33  ? 1716 LYS A CE     1 
ATOM   5857  N  NZ     . LYS A 1 354  ? -39.530 -27.957 45.756  1.00 42.78  1 1716 LYS A NZ     1 
ATOM   5858  H  H      . LYS A 1 354  ? -39.719 -29.502 39.938  1.00 47.54  ? 1716 LYS A H      1 
ATOM   5859  H  HA     . LYS A 1 354  ? -42.036 -28.350 40.007  1.00 48.97  ? 1716 LYS A HA     1 
ATOM   5860  H  HB2    . LYS A 1 354  ? -41.045 -29.315 41.910  1.00 49.41  ? 1716 LYS A HB2    1 
ATOM   5861  H  HB3    . LYS A 1 354  ? -39.997 -28.129 41.950  1.00 49.41  ? 1716 LYS A HB3    1 
ATOM   5862  H  HG2    . LYS A 1 354  ? -42.128 -26.780 42.215  1.00 50.97  ? 1716 LYS A HG2    1 
ATOM   5863  H  HG3    . LYS A 1 354  ? -42.588 -28.142 42.904  1.00 50.97  ? 1716 LYS A HG3    1 
ATOM   5864  H  HD2    . LYS A 1 354  ? -40.372 -26.573 43.706  1.00 51.58  ? 1716 LYS A HD2    1 
ATOM   5865  H  HD3    . LYS A 1 354  ? -41.702 -26.777 44.550  1.00 51.58  ? 1716 LYS A HD3    1 
ATOM   5866  H  HE2    . LYS A 1 354  ? -41.139 -28.941 45.039  1.00 50.79  ? 1716 LYS A HE2    1 
ATOM   5867  H  HE3    . LYS A 1 354  ? -39.920 -28.904 44.018  1.00 50.79  ? 1716 LYS A HE3    1 
ATOM   5868  H  HZ1    . LYS A 1 354  ? -39.175 -28.670 46.154  1.00 51.33  ? 1716 LYS A HZ1    1 
ATOM   5869  H  HZ2    . LYS A 1 354  ? -38.875 -27.452 45.428  1.00 51.33  ? 1716 LYS A HZ2    1 
ATOM   5870  H  HZ3    . LYS A 1 354  ? -39.985 -27.486 46.359  1.00 51.33  ? 1716 LYS A HZ3    1 
ATOM   5871  N  N      . ASN A 1 355  ? -39.599 -26.266 40.076  1.00 53.56  ? 1717 ASN A N      1 
ATOM   5872  C  CA     . ASN A 1 355  ? -39.184 -24.871 39.933  1.00 54.31  ? 1717 ASN A CA     1 
ATOM   5873  C  C      . ASN A 1 355  ? -39.126 -24.347 38.495  1.00 54.17  ? 1717 ASN A C      1 
ATOM   5874  O  O      . ASN A 1 355  ? -38.847 -23.167 38.286  1.00 54.88  ? 1717 ASN A O      1 
ATOM   5875  C  CB     . ASN A 1 355  ? -37.810 -24.674 40.582  1.00 54.16  ? 1717 ASN A CB     1 
ATOM   5876  C  CG     . ASN A 1 355  ? -37.798 -25.039 42.054  1.00 54.49  ? 1717 ASN A CG     1 
ATOM   5877  O  OD1    . ASN A 1 355  ? -37.059 -25.929 42.473  1.00 57.41  ? 1717 ASN A OD1    1 
ATOM   5878  N  ND2    . ASN A 1 355  ? -38.600 -24.340 42.850  1.00 55.64  ? 1717 ASN A ND2    1 
ATOM   5879  H  H      . ASN A 1 355  ? -38.954 -26.793 40.290  1.00 64.27  ? 1717 ASN A H      1 
ATOM   5880  H  HA     . ASN A 1 355  ? -39.816 -24.316 40.417  1.00 65.17  ? 1717 ASN A HA     1 
ATOM   5881  H  HB2    . ASN A 1 355  ? -37.163 -25.236 40.128  1.00 64.99  ? 1717 ASN A HB2    1 
ATOM   5882  H  HB3    . ASN A 1 355  ? -37.554 -23.742 40.502  1.00 64.99  ? 1717 ASN A HB3    1 
ATOM   5883  H  HD21   . ASN A 1 355  ? -38.626 -24.512 43.692  1.00 66.77  ? 1717 ASN A HD21   1 
ATOM   5884  H  HD22   . ASN A 1 355  ? -39.093 -23.716 42.523  1.00 66.77  ? 1717 ASN A HD22   1 
ATOM   5885  N  N      . CYS A 1 356  ? -39.364 -25.208 37.509  1.00 66.60  ? 1718 CYS A N      1 
ATOM   5886  C  CA     . CYS A 1 356  ? -39.413 -24.766 36.115  1.00 68.97  ? 1718 CYS A CA     1 
ATOM   5887  C  C      . CYS A 1 356  ? -40.462 -23.674 35.933  1.00 61.99  ? 1718 CYS A C      1 
ATOM   5888  O  O      . CYS A 1 356  ? -41.534 -23.727 36.536  1.00 62.55  ? 1718 CYS A O      1 
ATOM   5889  C  CB     . CYS A 1 356  ? -39.710 -25.934 35.167  1.00 72.86  ? 1718 CYS A CB     1 
ATOM   5890  S  SG     . CYS A 1 356  ? -38.307 -27.024 34.825  1.00 61.55  ? 1718 CYS A SG     1 
ATOM   5891  H  H      . CYS A 1 356  ? -39.500 -26.051 37.619  1.00 79.92  ? 1718 CYS A H      1 
ATOM   5892  H  HA     . CYS A 1 356  ? -38.550 -24.396 35.871  1.00 82.77  ? 1718 CYS A HA     1 
ATOM   5893  H  HB2    . CYS A 1 356  ? -40.412 -26.476 35.558  1.00 87.43  ? 1718 CYS A HB2    1 
ATOM   5894  H  HB3    . CYS A 1 356  ? -40.013 -25.573 34.319  1.00 87.43  ? 1718 CYS A HB3    1 
ATOM   5895  H  HG     . CYS A 1 356  ? -37.924 -27.503 35.856  1.00 73.86  ? 1718 CYS A HG     1 
ATOM   5896  N  N      . SER A 1 357  ? -40.156 -22.691 35.094  1.00 39.65  ? 1719 SER A N      1 
ATOM   5897  C  CA     . SER A 1 357  ? -41.067 -21.577 34.879  1.00 40.87  ? 1719 SER A CA     1 
ATOM   5898  C  C      . SER A 1 357  ? -42.302 -22.059 34.159  1.00 40.85  ? 1719 SER A C      1 
ATOM   5899  O  O      . SER A 1 357  ? -43.426 -21.852 34.616  1.00 41.60  ? 1719 SER A O      1 
ATOM   5900  C  CB     . SER A 1 357  ? -40.411 -20.476 34.041  1.00 41.35  ? 1719 SER A CB     1 
ATOM   5901  O  OG     . SER A 1 357  ? -39.306 -19.882 34.692  1.00 41.55  ? 1719 SER A OG     1 
ATOM   5902  H  H      . SER A 1 357  ? -39.428 -22.646 34.638  1.00 47.59  ? 1719 SER A H      1 
ATOM   5903  H  HA     . SER A 1 357  ? -41.331 -21.202 35.734  1.00 49.04  ? 1719 SER A HA     1 
ATOM   5904  H  HB2    . SER A 1 357  ? -40.108 -20.862 33.205  1.00 49.62  ? 1719 SER A HB2    1 
ATOM   5905  H  HB3    . SER A 1 357  ? -41.072 -19.788 33.863  1.00 49.62  ? 1719 SER A HB3    1 
ATOM   5906  H  HG     . SER A 1 357  ? -38.972 -19.285 34.205  1.00 49.86  ? 1719 SER A HG     1 
ATOM   5907  N  N      . THR A 1 358  ? -42.071 -22.732 33.040  1.00 45.57  ? 1720 THR A N      1 
ATOM   5908  C  CA     . THR A 1 358  ? -43.140 -23.099 32.126  1.00 45.61  ? 1720 THR A CA     1 
ATOM   5909  C  C      . THR A 1 358  ? -43.198 -24.597 31.869  1.00 44.47  ? 1720 THR A C      1 
ATOM   5910  O  O      . THR A 1 358  ? -42.201 -25.299 32.018  1.00 43.55  ? 1720 THR A O      1 
ATOM   5911  C  CB     . THR A 1 358  ? -42.959 -22.353 30.807  1.00 45.95  ? 1720 THR A CB     1 
ATOM   5912  O  OG1    . THR A 1 358  ? -41.597 -22.471 30.383  1.00 45.23  ? 1720 THR A OG1    1 
ATOM   5913  C  CG2    . THR A 1 358  ? -43.278 -20.881 31.006  1.00 47.31  ? 1720 THR A CG2    1 
ATOM   5914  H  H      . THR A 1 358  ? -41.292 -22.992 32.785  1.00 54.68  ? 1720 THR A H      1 
ATOM   5915  H  HA     . THR A 1 358  ? -43.989 -22.828 32.509  1.00 54.73  ? 1720 THR A HA     1 
ATOM   5916  H  HB     . THR A 1 358  ? -43.552 -22.719 30.132  1.00 55.14  ? 1720 THR A HB     1 
ATOM   5917  H  HG1    . THR A 1 358  ? -41.486 -22.063 29.657  1.00 54.28  ? 1720 THR A HG1    1 
ATOM   5918  H  HG21   . THR A 1 358  ? -43.165 -20.401 30.170  1.00 56.77  ? 1720 THR A HG21   1 
ATOM   5919  H  HG22   . THR A 1 358  ? -44.195 -20.778 31.306  1.00 56.77  ? 1720 THR A HG22   1 
ATOM   5920  H  HG23   . THR A 1 358  ? -42.685 -20.500 31.671  1.00 56.77  ? 1720 THR A HG23   1 
ATOM   5921  N  N      . LYS A 1 359  ? -44.375 -25.074 31.476  1.00 63.64  ? 1721 LYS A N      1 
ATOM   5922  C  CA     . LYS A 1 359  ? -44.584 -26.493 31.202  1.00 64.00  ? 1721 LYS A CA     1 
ATOM   5923  C  C      . LYS A 1 359  ? -43.695 -26.995 30.065  1.00 63.20  ? 1721 LYS A C      1 
ATOM   5924  O  O      . LYS A 1 359  ? -43.367 -28.179 29.994  1.00 66.63  ? 1721 LYS A O      1 
ATOM   5925  C  CB     . LYS A 1 359  ? -46.057 -26.756 30.882  1.00 65.10  ? 1721 LYS A CB     1 
ATOM   5926  C  CG     . LYS A 1 359  ? -46.567 -28.025 31.529  1.00 68.71  ? 1721 LYS A CG     1 
ATOM   5927  C  CD     . LYS A 1 359  ? -48.060 -28.229 31.362  1.00 71.43  ? 1721 LYS A CD     1 
ATOM   5928  C  CE     . LYS A 1 359  ? -48.427 -29.647 31.786  1.00 71.72  ? 1721 LYS A CE     1 
ATOM   5929  N  NZ     . LYS A 1 359  ? -49.834 -30.041 31.493  1.00 73.02  1 1721 LYS A NZ     1 
ATOM   5930  H  H      . LYS A 1 359  ? -45.077 -24.591 31.360  1.00 76.36  ? 1721 LYS A H      1 
ATOM   5931  H  HA     . LYS A 1 359  ? -44.359 -27.000 31.998  1.00 76.80  ? 1721 LYS A HA     1 
ATOM   5932  H  HB2    . LYS A 1 359  ? -46.590 -26.015 31.210  1.00 78.12  ? 1721 LYS A HB2    1 
ATOM   5933  H  HB3    . LYS A 1 359  ? -46.162 -26.844 29.922  1.00 78.12  ? 1721 LYS A HB3    1 
ATOM   5934  H  HG2    . LYS A 1 359  ? -46.116 -28.785 31.129  1.00 82.45  ? 1721 LYS A HG2    1 
ATOM   5935  H  HG3    . LYS A 1 359  ? -46.376 -27.991 32.480  1.00 82.45  ? 1721 LYS A HG3    1 
ATOM   5936  H  HD2    . LYS A 1 359  ? -48.541 -27.602 31.925  1.00 85.71  ? 1721 LYS A HD2    1 
ATOM   5937  H  HD3    . LYS A 1 359  ? -48.304 -28.111 30.431  1.00 85.71  ? 1721 LYS A HD3    1 
ATOM   5938  H  HE2    . LYS A 1 359  ? -47.846 -30.269 31.322  1.00 86.07  ? 1721 LYS A HE2    1 
ATOM   5939  H  HE3    . LYS A 1 359  ? -48.293 -29.728 32.744  1.00 86.07  ? 1721 LYS A HE3    1 
ATOM   5940  H  HZ1    . LYS A 1 359  ? -49.979 -30.876 31.765  1.00 87.63  ? 1721 LYS A HZ1    1 
ATOM   5941  H  HZ2    . LYS A 1 359  ? -50.397 -29.497 31.917  1.00 87.63  ? 1721 LYS A HZ2    1 
ATOM   5942  H  HZ3    . LYS A 1 359  ? -49.987 -29.991 30.618  1.00 87.63  ? 1721 LYS A HZ3    1 
ATOM   5943  N  N      . GLU A 1 360  ? -43.311 -26.081 29.185  1.00 61.07  ? 1722 GLU A N      1 
ATOM   5944  C  CA     . GLU A 1 360  ? -42.375 -26.371 28.109  1.00 60.40  ? 1722 GLU A CA     1 
ATOM   5945  C  C      . GLU A 1 360  ? -40.986 -26.660 28.676  1.00 59.64  ? 1722 GLU A C      1 
ATOM   5946  O  O      . GLU A 1 360  ? -40.367 -27.660 28.327  1.00 58.71  ? 1722 GLU A O      1 
ATOM   5947  C  CB     . GLU A 1 360  ? -42.366 -25.202 27.124  1.00 61.20  ? 1722 GLU A CB     1 
ATOM   5948  C  CG     . GLU A 1 360  ? -43.722 -25.030 26.410  1.00 61.92  ? 1722 GLU A CG     1 
ATOM   5949  C  CD     . GLU A 1 360  ? -44.190 -23.583 26.308  1.00 72.58  ? 1722 GLU A CD     1 
ATOM   5950  O  OE1    . GLU A 1 360  ? -44.165 -22.872 27.337  1.00 78.25  ? 1722 GLU A OE1    1 
ATOM   5951  O  OE2    . GLU A 1 360  ? -44.601 -23.167 25.201  1.00 76.71  1 1722 GLU A OE2    1 
ATOM   5952  H  H      . GLU A 1 360  ? -43.585 -25.266 29.190  1.00 73.28  ? 1722 GLU A H      1 
ATOM   5953  H  HA     . GLU A 1 360  ? -42.674 -27.162 27.634  1.00 72.48  ? 1722 GLU A HA     1 
ATOM   5954  H  HB2    . GLU A 1 360  ? -42.172 -24.383 27.606  1.00 73.44  ? 1722 GLU A HB2    1 
ATOM   5955  H  HB3    . GLU A 1 360  ? -41.687 -25.361 26.450  1.00 73.44  ? 1722 GLU A HB3    1 
ATOM   5956  H  HG2    . GLU A 1 360  ? -43.647 -25.381 25.509  1.00 74.31  ? 1722 GLU A HG2    1 
ATOM   5957  H  HG3    . GLU A 1 360  ? -44.398 -25.526 26.899  1.00 74.31  ? 1722 GLU A HG3    1 
ATOM   5958  N  N      . GLU A 1 361  ? -40.509 -25.779 29.553  1.00 68.66  ? 1723 GLU A N      1 
ATOM   5959  C  CA     . GLU A 1 361  ? -39.223 -25.960 30.231  1.00 68.08  ? 1723 GLU A CA     1 
ATOM   5960  C  C      . GLU A 1 361  ? -39.117 -27.309 30.935  1.00 67.19  ? 1723 GLU A C      1 
ATOM   5961  O  O      . GLU A 1 361  ? -38.050 -27.921 30.957  1.00 66.39  ? 1723 GLU A O      1 
ATOM   5962  C  CB     . GLU A 1 361  ? -38.987 -24.843 31.248  1.00 68.89  ? 1723 GLU A CB     1 
ATOM   5963  C  CG     . GLU A 1 361  ? -38.935 -23.463 30.631  1.00 73.59  ? 1723 GLU A CG     1 
ATOM   5964  C  CD     . GLU A 1 361  ? -37.530 -23.050 30.232  1.00 81.22  ? 1723 GLU A CD     1 
ATOM   5965  O  OE1    . GLU A 1 361  ? -37.330 -22.703 29.045  1.00 82.74  ? 1723 GLU A OE1    1 
ATOM   5966  O  OE2    . GLU A 1 361  ? -36.629 -23.070 31.100  1.00 84.87  1 1723 GLU A OE2    1 
ATOM   5967  H  H      . GLU A 1 361  ? -40.917 -25.055 29.776  1.00 82.39  ? 1723 GLU A H      1 
ATOM   5968  H  HA     . GLU A 1 361  ? -38.514 -25.914 29.570  1.00 81.69  ? 1723 GLU A HA     1 
ATOM   5969  H  HB2    . GLU A 1 361  ? -39.709 -24.851 31.896  1.00 82.67  ? 1723 GLU A HB2    1 
ATOM   5970  H  HB3    . GLU A 1 361  ? -38.141 -25.001 31.696  1.00 82.67  ? 1723 GLU A HB3    1 
ATOM   5971  H  HG2    . GLU A 1 361  ? -39.488 -23.451 29.835  1.00 88.30  ? 1723 GLU A HG2    1 
ATOM   5972  H  HG3    . GLU A 1 361  ? -39.266 -22.816 31.274  1.00 88.30  ? 1723 GLU A HG3    1 
ATOM   5973  N  N      . ALA A 1 362  ? -40.220 -27.756 31.525  1.00 41.62  ? 1724 ALA A N      1 
ATOM   5974  C  CA     . ALA A 1 362  ? -40.243 -29.023 32.246  1.00 40.94  ? 1724 ALA A CA     1 
ATOM   5975  C  C      . ALA A 1 362  ? -40.005 -30.176 31.276  1.00 40.02  ? 1724 ALA A C      1 
ATOM   5976  O  O      . ALA A 1 362  ? -39.250 -31.103 31.570  1.00 39.24  ? 1724 ALA A O      1 
ATOM   5977  C  CB     . ALA A 1 362  ? -41.561 -29.198 32.977  1.00 41.51  ? 1724 ALA A CB     1 
ATOM   5978  H  H      . ALA A 1 362  ? -40.973 -27.342 31.522  1.00 49.94  ? 1724 ALA A H      1 
ATOM   5979  H  HA     . ALA A 1 362  ? -39.529 -29.028 32.904  1.00 49.13  ? 1724 ALA A HA     1 
ATOM   5980  H  HB1    . ALA A 1 362  ? -41.550 -30.046 33.448  1.00 49.82  ? 1724 ALA A HB1    1 
ATOM   5981  H  HB2    . ALA A 1 362  ? -41.671 -28.470 33.609  1.00 49.82  ? 1724 ALA A HB2    1 
ATOM   5982  H  HB3    . ALA A 1 362  ? -42.284 -29.187 32.330  1.00 49.82  ? 1724 ALA A HB3    1 
ATOM   5983  N  N      . ARG A 1 363  ? -40.661 -30.113 30.121  1.00 58.54  ? 1725 ARG A N      1 
ATOM   5984  C  CA     . ARG A 1 363  ? -40.545 -31.163 29.115  1.00 57.82  ? 1725 ARG A CA     1 
ATOM   5985  C  C      . ARG A 1 363  ? -39.120 -31.269 28.583  1.00 57.15  ? 1725 ARG A C      1 
ATOM   5986  O  O      . ARG A 1 363  ? -38.602 -32.371 28.414  1.00 56.35  ? 1725 ARG A O      1 
ATOM   5987  C  CB     . ARG A 1 363  ? -41.526 -30.916 27.964  1.00 58.30  ? 1725 ARG A CB     1 
ATOM   5988  C  CG     . ARG A 1 363  ? -42.975 -31.246 28.317  1.00 63.30  ? 1725 ARG A CG     1 
ATOM   5989  C  CD     . ARG A 1 363  ? -43.890 -31.324 27.092  1.00 73.45  ? 1725 ARG A CD     1 
ATOM   5990  N  NE     . ARG A 1 363  ? -44.321 -30.016 26.597  1.00 81.85  ? 1725 ARG A NE     1 
ATOM   5991  C  CZ     . ARG A 1 363  ? -43.779 -29.368 25.568  1.00 88.77  ? 1725 ARG A CZ     1 
ATOM   5992  N  NH1    . ARG A 1 363  ? -42.762 -29.887 24.891  1.00 91.00  1 1725 ARG A NH1    1 
ATOM   5993  N  NH2    . ARG A 1 363  ? -44.267 -28.186 25.209  1.00 91.96  ? 1725 ARG A NH2    1 
ATOM   5994  H  H      . ARG A 1 363  ? -41.182 -29.468 29.894  1.00 70.25  ? 1725 ARG A H      1 
ATOM   5995  H  HA     . ARG A 1 363  ? -40.773 -32.013 29.523  1.00 69.38  ? 1725 ARG A HA     1 
ATOM   5996  H  HB2    . ARG A 1 363  ? -41.487 -29.980 27.714  1.00 69.96  ? 1725 ARG A HB2    1 
ATOM   5997  H  HB3    . ARG A 1 363  ? -41.271 -31.470 27.209  1.00 69.96  ? 1725 ARG A HB3    1 
ATOM   5998  H  HG2    . ARG A 1 363  ? -43.002 -32.106 28.765  1.00 75.96  ? 1725 ARG A HG2    1 
ATOM   5999  H  HG3    . ARG A 1 363  ? -43.320 -30.556 28.905  1.00 75.96  ? 1725 ARG A HG3    1 
ATOM   6000  H  HD2    . ARG A 1 363  ? -43.416 -31.771 26.375  1.00 88.14  ? 1725 ARG A HD2    1 
ATOM   6001  H  HD3    . ARG A 1 363  ? -44.685 -31.829 27.327  1.00 88.14  ? 1725 ARG A HD3    1 
ATOM   6002  H  HE     . ARG A 1 363  ? -44.977 -29.636 27.003  1.00 98.22  ? 1725 ARG A HE     1 
ATOM   6003  H  HH11   . ARG A 1 363  ? -42.443 -30.653 25.116  1.00 109.20 ? 1725 ARG A HH11   1 
ATOM   6004  H  HH12   . ARG A 1 363  ? -42.422 -29.457 24.228  1.00 109.20 ? 1725 ARG A HH12   1 
ATOM   6005  H  HH21   . ARG A 1 363  ? -44.925 -27.843 25.643  1.00 110.35 ? 1725 ARG A HH21   1 
ATOM   6006  H  HH22   . ARG A 1 363  ? -43.920 -27.761 24.546  1.00 110.35 ? 1725 ARG A HH22   1 
ATOM   6007  N  N      . LEU A 1 364  ? -38.496 -30.125 28.316  1.00 38.33  ? 1726 LEU A N      1 
ATOM   6008  C  CA     . LEU A 1 364  ? -37.095 -30.093 27.904  1.00 37.81  ? 1726 LEU A CA     1 
ATOM   6009  C  C      . LEU A 1 364  ? -36.233 -30.774 28.952  1.00 37.16  ? 1726 LEU A C      1 
ATOM   6010  O  O      . LEU A 1 364  ? -35.450 -31.671 28.645  1.00 36.37  ? 1726 LEU A O      1 
ATOM   6011  C  CB     . LEU A 1 364  ? -36.626 -28.648 27.686  1.00 38.53  ? 1726 LEU A CB     1 
ATOM   6012  C  CG     . LEU A 1 364  ? -35.117 -28.354 27.733  1.00 38.21  ? 1726 LEU A CG     1 
ATOM   6013  C  CD1    . LEU A 1 364  ? -34.410 -28.819 26.470  1.00 39.88  ? 1726 LEU A CD1    1 
ATOM   6014  C  CD2    . LEU A 1 364  ? -34.873 -26.875 27.958  1.00 39.12  ? 1726 LEU A CD2    1 
ATOM   6015  H  H      . LEU A 1 364  ? -38.863 -29.349 28.367  1.00 45.99  ? 1726 LEU A H      1 
ATOM   6016  H  HA     . LEU A 1 364  ? -36.996 -30.575 27.068  1.00 45.37  ? 1726 LEU A HA     1 
ATOM   6017  H  HB2    . LEU A 1 364  ? -36.940 -28.362 26.814  1.00 46.23  ? 1726 LEU A HB2    1 
ATOM   6018  H  HB3    . LEU A 1 364  ? -37.041 -28.095 28.367  1.00 46.23  ? 1726 LEU A HB3    1 
ATOM   6019  H  HG     . LEU A 1 364  ? -34.730 -28.834 28.482  1.00 45.85  ? 1726 LEU A HG     1 
ATOM   6020  H  HD11   . LEU A 1 364  ? -33.465 -28.614 26.544  1.00 47.85  ? 1726 LEU A HD11   1 
ATOM   6021  H  HD12   . LEU A 1 364  ? -34.535 -29.776 26.373  1.00 47.85  ? 1726 LEU A HD12   1 
ATOM   6022  H  HD13   . LEU A 1 364  ? -34.790 -28.356 25.707  1.00 47.85  ? 1726 LEU A HD13   1 
ATOM   6023  H  HD21   . LEU A 1 364  ? -33.916 -26.714 27.984  1.00 46.94  ? 1726 LEU A HD21   1 
ATOM   6024  H  HD22   . LEU A 1 364  ? -35.273 -26.375 27.229  1.00 46.94  ? 1726 LEU A HD22   1 
ATOM   6025  H  HD23   . LEU A 1 364  ? -35.276 -26.613 28.800  1.00 46.94  ? 1726 LEU A HD23   1 
ATOM   6026  N  N      . LEU A 1 365  ? -36.394 -30.340 30.196  1.00 45.45  ? 1727 LEU A N      1 
ATOM   6027  C  CA     . LEU A 1 365  ? -35.567 -30.820 31.293  1.00 49.34  ? 1727 LEU A CA     1 
ATOM   6028  C  C      . LEU A 1 365  ? -35.836 -32.298 31.555  1.00 52.95  ? 1727 LEU A C      1 
ATOM   6029  O  O      . LEU A 1 365  ? -34.949 -33.037 31.988  1.00 42.73  ? 1727 LEU A O      1 
ATOM   6030  C  CB     . LEU A 1 365  ? -35.836 -29.997 32.554  1.00 53.16  ? 1727 LEU A CB     1 
ATOM   6031  C  CG     . LEU A 1 365  ? -34.851 -30.207 33.701  1.00 51.46  ? 1727 LEU A CG     1 
ATOM   6032  C  CD1    . LEU A 1 365  ? -34.630 -28.900 34.446  1.00 48.88  ? 1727 LEU A CD1    1 
ATOM   6033  C  CD2    . LEU A 1 365  ? -35.356 -31.286 34.649  1.00 47.75  ? 1727 LEU A CD2    1 
ATOM   6034  H  H      . LEU A 1 365  ? -36.984 -29.761 30.433  1.00 54.54  ? 1727 LEU A H      1 
ATOM   6035  H  HA     . LEU A 1 365  ? -34.632 -30.718 31.057  1.00 59.21  ? 1727 LEU A HA     1 
ATOM   6036  H  HB2    . LEU A 1 365  ? -35.810 -29.057 32.317  1.00 63.79  ? 1727 LEU A HB2    1 
ATOM   6037  H  HB3    . LEU A 1 365  ? -36.719 -30.224 32.885  1.00 63.79  ? 1727 LEU A HB3    1 
ATOM   6038  H  HG     . LEU A 1 365  ? -33.999 -30.496 33.340  1.00 61.75  ? 1727 LEU A HG     1 
ATOM   6039  H  HD11   . LEU A 1 365  ? -34.003 -29.052 35.170  1.00 58.66  ? 1727 LEU A HD11   1 
ATOM   6040  H  HD12   . LEU A 1 365  ? -34.271 -28.242 33.830  1.00 58.66  ? 1727 LEU A HD12   1 
ATOM   6041  H  HD13   . LEU A 1 365  ? -35.479 -28.592 34.802  1.00 58.66  ? 1727 LEU A HD13   1 
ATOM   6042  H  HD21   . LEU A 1 365  ? -34.714 -31.400 35.368  1.00 57.30  ? 1727 LEU A HD21   1 
ATOM   6043  H  HD22   . LEU A 1 365  ? -36.213 -31.013 35.011  1.00 57.30  ? 1727 LEU A HD22   1 
ATOM   6044  H  HD23   . LEU A 1 365  ? -35.454 -32.117 34.158  1.00 57.30  ? 1727 LEU A HD23   1 
ATOM   6045  N  N      . TRP A 1 366  ? -37.057 -32.726 31.252  1.00 34.49  ? 1728 TRP A N      1 
ATOM   6046  C  CA     . TRP A 1 366  ? -37.455 -34.116 31.429  1.00 42.66  ? 1728 TRP A CA     1 
ATOM   6047  C  C      . TRP A 1 366  ? -36.809 -34.969 30.348  1.00 33.69  ? 1728 TRP A C      1 
ATOM   6048  O  O      . TRP A 1 366  ? -36.475 -36.136 30.569  1.00 32.62  ? 1728 TRP A O      1 
ATOM   6049  C  CB     . TRP A 1 366  ? -38.980 -34.240 31.358  1.00 49.71  ? 1728 TRP A CB     1 
ATOM   6050  C  CG     . TRP A 1 366  ? -39.482 -35.631 31.541  1.00 34.13  ? 1728 TRP A CG     1 
ATOM   6051  C  CD1    . TRP A 1 366  ? -40.325 -36.313 30.713  1.00 34.09  ? 1728 TRP A CD1    1 
ATOM   6052  C  CD2    . TRP A 1 366  ? -39.184 -36.510 32.625  1.00 33.82  ? 1728 TRP A CD2    1 
ATOM   6053  N  NE1    . TRP A 1 366  ? -40.566 -37.568 31.216  1.00 33.78  ? 1728 TRP A NE1    1 
ATOM   6054  C  CE2    . TRP A 1 366  ? -39.876 -37.713 32.390  1.00 33.62  ? 1728 TRP A CE2    1 
ATOM   6055  C  CE3    . TRP A 1 366  ? -38.394 -36.398 33.772  1.00 33.77  ? 1728 TRP A CE3    1 
ATOM   6056  C  CZ2    . TRP A 1 366  ? -39.801 -38.793 33.259  1.00 33.38  ? 1728 TRP A CZ2    1 
ATOM   6057  C  CZ3    . TRP A 1 366  ? -38.323 -37.470 34.632  1.00 33.52  ? 1728 TRP A CZ3    1 
ATOM   6058  C  CH2    . TRP A 1 366  ? -39.012 -38.655 34.366  1.00 33.33  ? 1728 TRP A CH2    1 
ATOM   6059  H  H      . TRP A 1 366  ? -37.680 -32.223 30.937  1.00 41.39  ? 1728 TRP A H      1 
ATOM   6060  H  HA     . TRP A 1 366  ? -37.158 -34.433 32.295  1.00 51.19  ? 1728 TRP A HA     1 
ATOM   6061  H  HB2    . TRP A 1 366  ? -39.371 -33.690 32.055  1.00 59.65  ? 1728 TRP A HB2    1 
ATOM   6062  H  HB3    . TRP A 1 366  ? -39.279 -33.930 30.489  1.00 59.65  ? 1728 TRP A HB3    1 
ATOM   6063  H  HD1    . TRP A 1 366  ? -40.685 -35.978 29.924  1.00 40.91  ? 1728 TRP A HD1    1 
ATOM   6064  H  HE1    . TRP A 1 366  ? -41.067 -38.165 30.853  1.00 40.54  ? 1728 TRP A HE1    1 
ATOM   6065  H  HE3    . TRP A 1 366  ? -37.926 -35.615 33.951  1.00 40.52  ? 1728 TRP A HE3    1 
ATOM   6066  H  HZ2    . TRP A 1 366  ? -40.262 -39.583 33.089  1.00 40.06  ? 1728 TRP A HZ2    1 
ATOM   6067  H  HZ3    . TRP A 1 366  ? -37.798 -37.408 35.397  1.00 40.23  ? 1728 TRP A HZ3    1 
ATOM   6068  H  HH2    . TRP A 1 366  ? -38.950 -39.361 34.969  1.00 40.00  ? 1728 TRP A HH2    1 
ATOM   6069  N  N      . ALA A 1 367  ? -36.628 -34.361 29.181  1.00 29.66  ? 1729 ALA A N      1 
ATOM   6070  C  CA     . ALA A 1 367  ? -36.095 -35.046 28.019  1.00 29.09  ? 1729 ALA A CA     1 
ATOM   6071  C  C      . ALA A 1 367  ? -34.588 -35.234 28.077  1.00 28.49  ? 1729 ALA A C      1 
ATOM   6072  O  O      . ALA A 1 367  ? -34.044 -36.038 27.330  1.00 27.94  ? 1729 ALA A O      1 
ATOM   6073  C  CB     . ALA A 1 367  ? -36.471 -34.285 26.764  1.00 29.55  ? 1729 ALA A CB     1 
ATOM   6074  H  H      . ALA A 1 367  ? -36.811 -33.533 29.039  1.00 35.59  ? 1729 ALA A H      1 
ATOM   6075  H  HA     . ALA A 1 367  ? -36.500 -35.926 27.964  1.00 34.91  ? 1729 ALA A HA     1 
ATOM   6076  H  HB1    . ALA A 1 367  ? -36.111 -34.750 25.993  1.00 35.46  ? 1729 ALA A HB1    1 
ATOM   6077  H  HB2    . ALA A 1 367  ? -37.438 -34.238 26.701  1.00 35.46  ? 1729 ALA A HB2    1 
ATOM   6078  H  HB3    . ALA A 1 367  ? -36.099 -33.390 26.814  1.00 35.46  ? 1729 ALA A HB3    1 
ATOM   6079  N  N      . LYS A 1 368  ? -33.905 -34.503 28.951  1.00 55.22  ? 1730 LYS A N      1 
ATOM   6080  C  CA     . LYS A 1 368  ? -32.453 -34.612 29.012  1.00 54.72  ? 1730 LYS A CA     1 
ATOM   6081  C  C      . LYS A 1 368  ? -32.033 -35.744 29.966  1.00 54.16  ? 1730 LYS A C      1 
ATOM   6082  O  O      . LYS A 1 368  ? -30.850 -36.084 30.036  1.00 54.13  ? 1730 LYS A O      1 
ATOM   6083  C  CB     . LYS A 1 368  ? -31.809 -33.287 29.451  1.00 55.21  ? 1730 LYS A CB     1 
ATOM   6084  C  CG     . LYS A 1 368  ? -32.080 -32.084 28.538  1.00 55.87  ? 1730 LYS A CG     1 
ATOM   6085  C  CD     . LYS A 1 368  ? -31.146 -30.917 28.875  1.00 56.28  ? 1730 LYS A CD     1 
ATOM   6086  C  CE     . LYS A 1 368  ? -31.836 -29.559 28.815  1.00 59.69  ? 1730 LYS A CE     1 
ATOM   6087  N  NZ     . LYS A 1 368  ? -32.062 -29.056 30.207  1.00 64.05  1 1730 LYS A NZ     1 
ATOM   6088  H  H      . LYS A 1 368  ? -34.250 -33.947 29.508  1.00 66.26  ? 1730 LYS A H      1 
ATOM   6089  H  HA     . LYS A 1 368  ? -32.117 -34.828 28.128  1.00 65.66  ? 1730 LYS A HA     1 
ATOM   6090  H  HB2    . LYS A 1 368  ? -32.141 -33.063 30.334  1.00 66.25  ? 1730 LYS A HB2    1 
ATOM   6091  H  HB3    . LYS A 1 368  ? -30.847 -33.412 29.489  1.00 66.25  ? 1730 LYS A HB3    1 
ATOM   6092  H  HG2    . LYS A 1 368  ? -31.928 -32.340 27.615  1.00 67.04  ? 1730 LYS A HG2    1 
ATOM   6093  H  HG3    . LYS A 1 368  ? -32.996 -31.787 28.660  1.00 67.04  ? 1730 LYS A HG3    1 
ATOM   6094  H  HD2    . LYS A 1 368  ? -30.803 -31.039 29.774  1.00 67.53  ? 1730 LYS A HD2    1 
ATOM   6095  H  HD3    . LYS A 1 368  ? -30.413 -30.908 28.240  1.00 67.53  ? 1730 LYS A HD3    1 
ATOM   6096  H  HE2    . LYS A 1 368  ? -31.272 -28.926 28.344  1.00 71.63  ? 1730 LYS A HE2    1 
ATOM   6097  H  HE3    . LYS A 1 368  ? -32.695 -29.647 28.373  1.00 71.63  ? 1730 LYS A HE3    1 
ATOM   6098  H  HZ1    . LYS A 1 368  ? -32.465 -28.262 30.182  1.00 76.87  ? 1730 LYS A HZ1    1 
ATOM   6099  H  HZ2    . LYS A 1 368  ? -32.576 -29.626 30.657  1.00 76.87  ? 1730 LYS A HZ2    1 
ATOM   6100  H  HZ3    . LYS A 1 368  ? -31.284 -28.972 30.630  1.00 76.87  ? 1730 LYS A HZ3    1 
ATOM   6101  N  N      . VAL A 1 369  ? -32.996 -36.324 30.692  1.00 27.71  ? 1731 VAL A N      1 
ATOM   6102  C  CA     . VAL A 1 369  ? -32.706 -37.385 31.670  1.00 27.32  ? 1731 VAL A CA     1 
ATOM   6103  C  C      . VAL A 1 369  ? -33.139 -38.757 31.175  1.00 26.89  ? 1731 VAL A C      1 
ATOM   6104  O  O      . VAL A 1 369  ? -34.146 -38.889 30.480  1.00 27.09  ? 1731 VAL A O      1 
ATOM   6105  C  CB     . VAL A 1 369  ? -33.401 -37.139 33.029  1.00 27.86  ? 1731 VAL A CB     1 
ATOM   6106  C  CG1    . VAL A 1 369  ? -32.982 -38.205 34.055  1.00 27.53  ? 1731 VAL A CG1    1 
ATOM   6107  C  CG2    . VAL A 1 369  ? -33.066 -35.767 33.553  1.00 28.41  ? 1731 VAL A CG2    1 
ATOM   6108  H  H      . VAL A 1 369  ? -33.830 -36.122 30.636  1.00 33.25  ? 1731 VAL A H      1 
ATOM   6109  H  HA     . VAL A 1 369  ? -31.749 -37.413 31.825  1.00 32.79  ? 1731 VAL A HA     1 
ATOM   6110  H  HB     . VAL A 1 369  ? -34.362 -37.192 32.911  1.00 33.43  ? 1731 VAL A HB     1 
ATOM   6111  H  HG11   . VAL A 1 369  ? -33.431 -38.027 34.896  1.00 33.03  ? 1731 VAL A HG11   1 
ATOM   6112  H  HG12   . VAL A 1 369  ? -33.236 -39.080 33.722  1.00 33.03  ? 1731 VAL A HG12   1 
ATOM   6113  H  HG13   . VAL A 1 369  ? -32.020 -38.164 34.177  1.00 33.03  ? 1731 VAL A HG13   1 
ATOM   6114  H  HG21   . VAL A 1 369  ? -33.512 -35.637 34.404  1.00 34.09  ? 1731 VAL A HG21   1 
ATOM   6115  H  HG22   . VAL A 1 369  ? -32.105 -35.700 33.669  1.00 34.09  ? 1731 VAL A HG22   1 
ATOM   6116  H  HG23   . VAL A 1 369  ? -33.370 -35.103 32.915  1.00 34.09  ? 1731 VAL A HG23   1 
ATOM   6117  N  N      . GLN A 1 370  ? -32.362 -39.774 31.534  1.00 30.11  ? 1732 GLN A N      1 
ATOM   6118  C  CA     . GLN A 1 370  ? -32.752 -41.154 31.297  1.00 29.79  ? 1732 GLN A CA     1 
ATOM   6119  C  C      . GLN A 1 370  ? -34.057 -41.490 32.004  1.00 30.23  ? 1732 GLN A C      1 
ATOM   6120  O  O      . GLN A 1 370  ? -34.206 -41.286 33.213  1.00 30.56  ? 1732 GLN A O      1 
ATOM   6121  C  CB     . GLN A 1 370  ? -31.648 -42.104 31.763  1.00 29.26  ? 1732 GLN A CB     1 
ATOM   6122  C  CG     . GLN A 1 370  ? -30.557 -42.297 30.740  1.00 28.75  ? 1732 GLN A CG     1 
ATOM   6123  C  CD     . GLN A 1 370  ? -29.563 -43.362 31.139  1.00 28.27  ? 1732 GLN A CD     1 
ATOM   6124  O  OE1    . GLN A 1 370  ? -29.580 -43.854 32.265  1.00 28.34  ? 1732 GLN A OE1    1 
ATOM   6125  N  NE2    . GLN A 1 370  ? -28.696 -43.731 30.208  1.00 27.85  ? 1732 GLN A NE2    1 
ATOM   6126  H  H      . GLN A 1 370  ? -31.598 -39.687 31.920  1.00 36.13  ? 1732 GLN A H      1 
ATOM   6127  H  HA     . GLN A 1 370  ? -32.882 -41.287 30.346  1.00 35.75  ? 1732 GLN A HA     1 
ATOM   6128  H  HB2    . GLN A 1 370  ? -31.243 -41.745 32.567  1.00 35.11  ? 1732 GLN A HB2    1 
ATOM   6129  H  HB3    . GLN A 1 370  ? -32.039 -42.972 31.949  1.00 35.11  ? 1732 GLN A HB3    1 
ATOM   6130  H  HG2    . GLN A 1 370  ? -30.957 -42.561 29.897  1.00 34.50  ? 1732 GLN A HG2    1 
ATOM   6131  H  HG3    . GLN A 1 370  ? -30.075 -41.462 30.632  1.00 34.50  ? 1732 GLN A HG3    1 
ATOM   6132  H  HE21   . GLN A 1 370  ? -28.720 -43.368 29.429  1.00 33.42  ? 1732 GLN A HE21   1 
ATOM   6133  H  HE22   . GLN A 1 370  ? -28.108 -44.334 30.383  1.00 33.42  ? 1732 GLN A HE22   1 
ATOM   6134  N  N      . LYS A 1 371  ? -34.991 -42.020 31.224  1.00 36.11  ? 1733 LYS A N      1 
ATOM   6135  C  CA     . LYS A 1 371  ? -36.286 -42.475 31.715  1.00 36.55  ? 1733 LYS A CA     1 
ATOM   6136  C  C      . LYS A 1 371  ? -36.354 -43.969 31.478  1.00 36.22  ? 1733 LYS A C      1 
ATOM   6137  O  O      . LYS A 1 371  ? -35.880 -44.457 30.455  1.00 35.81  ? 1733 LYS A O      1 
ATOM   6138  C  CB     . LYS A 1 371  ? -37.424 -41.761 31.002  1.00 37.05  ? 1733 LYS A CB     1 
ATOM   6139  C  CG     . LYS A 1 371  ? -37.345 -40.250 31.073  1.00 37.44  ? 1733 LYS A CG     1 
ATOM   6140  C  CD     . LYS A 1 371  ? -38.197 -39.598 30.001  1.00 37.84  ? 1733 LYS A CD     1 
ATOM   6141  C  CE     . LYS A 1 371  ? -37.544 -39.708 28.627  1.00 37.43  ? 1733 LYS A CE     1 
ATOM   6142  N  NZ     . LYS A 1 371  ? -36.260 -38.950 28.549  1.00 37.19  1 1733 LYS A NZ     1 
ATOM   6143  H  H      . LYS A 1 371  ? -34.894 -42.129 30.377  1.00 43.33  ? 1733 LYS A H      1 
ATOM   6144  H  HA     . LYS A 1 371  ? -36.356 -42.305 32.667  1.00 43.86  ? 1733 LYS A HA     1 
ATOM   6145  H  HB2    . LYS A 1 371  ? -37.412 -42.014 30.065  1.00 44.46  ? 1733 LYS A HB2    1 
ATOM   6146  H  HB3    . LYS A 1 371  ? -38.263 -42.032 31.404  1.00 44.46  ? 1733 LYS A HB3    1 
ATOM   6147  H  HG2    . LYS A 1 371  ? -37.666 -39.953 31.939  1.00 44.93  ? 1733 LYS A HG2    1 
ATOM   6148  H  HG3    . LYS A 1 371  ? -36.425 -39.971 30.942  1.00 44.93  ? 1733 LYS A HG3    1 
ATOM   6149  H  HD2    . LYS A 1 371  ? -39.060 -40.040 29.965  1.00 45.41  ? 1733 LYS A HD2    1 
ATOM   6150  H  HD3    . LYS A 1 371  ? -38.310 -38.657 30.210  1.00 45.41  ? 1733 LYS A HD3    1 
ATOM   6151  H  HE2    . LYS A 1 371  ? -37.356 -40.641 28.439  1.00 44.92  ? 1733 LYS A HE2    1 
ATOM   6152  H  HE3    . LYS A 1 371  ? -38.148 -39.348 27.958  1.00 44.92  ? 1733 LYS A HE3    1 
ATOM   6153  H  HZ1    . LYS A 1 371  ? -35.905 -39.035 27.737  1.00 44.63  ? 1733 LYS A HZ1    1 
ATOM   6154  H  HZ2    . LYS A 1 371  ? -36.405 -38.088 28.713  1.00 44.63  ? 1733 LYS A HZ2    1 
ATOM   6155  H  HZ3    . LYS A 1 371  ? -35.684 -39.265 29.150  1.00 44.63  ? 1733 LYS A HZ3    1 
ATOM   6156  N  N      . PHE A 1 372  ? -36.931 -44.696 32.420  1.00 26.93  ? 1734 PHE A N      1 
ATOM   6157  C  CA     . PHE A 1 372  ? -36.970 -46.149 32.338  1.00 26.72  ? 1734 PHE A CA     1 
ATOM   6158  C  C      . PHE A 1 372  ? -38.400 -46.642 32.092  1.00 27.20  ? 1734 PHE A C      1 
ATOM   6159  O  O      . PHE A 1 372  ? -39.296 -46.443 32.912  1.00 27.76  ? 1734 PHE A O      1 
ATOM   6160  C  CB     . PHE A 1 372  ? -36.361 -46.745 33.607  1.00 26.67  ? 1734 PHE A CB     1 
ATOM   6161  C  CG     . PHE A 1 372  ? -34.903 -46.397 33.792  1.00 26.20  ? 1734 PHE A CG     1 
ATOM   6162  C  CD1    . PHE A 1 372  ? -34.522 -45.118 34.169  1.00 26.32  ? 1734 PHE A CD1    1 
ATOM   6163  C  CD2    . PHE A 1 372  ? -33.916 -47.345 33.583  1.00 25.70  ? 1734 PHE A CD2    1 
ATOM   6164  C  CE1    . PHE A 1 372  ? -33.187 -44.796 34.335  1.00 25.94  ? 1734 PHE A CE1    1 
ATOM   6165  C  CE2    . PHE A 1 372  ? -32.581 -47.026 33.753  1.00 25.31  ? 1734 PHE A CE2    1 
ATOM   6166  C  CZ     . PHE A 1 372  ? -32.218 -45.751 34.127  1.00 25.43  ? 1734 PHE A CZ     1 
ATOM   6167  H  H      . PHE A 1 372  ? -37.311 -44.373 33.120  1.00 32.31  ? 1734 PHE A H      1 
ATOM   6168  H  HA     . PHE A 1 372  ? -36.426 -46.434 31.587  1.00 32.06  ? 1734 PHE A HA     1 
ATOM   6169  H  HB2    . PHE A 1 372  ? -36.848 -46.409 34.376  1.00 32.00  ? 1734 PHE A HB2    1 
ATOM   6170  H  HB3    . PHE A 1 372  ? -36.434 -47.711 33.567  1.00 32.00  ? 1734 PHE A HB3    1 
ATOM   6171  H  HD1    . PHE A 1 372  ? -35.172 -44.469 34.311  1.00 31.58  ? 1734 PHE A HD1    1 
ATOM   6172  H  HD2    . PHE A 1 372  ? -34.154 -48.208 33.331  1.00 30.83  ? 1734 PHE A HD2    1 
ATOM   6173  H  HE1    . PHE A 1 372  ? -32.945 -43.935 34.590  1.00 31.13  ? 1734 PHE A HE1    1 
ATOM   6174  H  HE2    . PHE A 1 372  ? -31.927 -47.672 33.610  1.00 30.37  ? 1734 PHE A HE2    1 
ATOM   6175  H  HZ     . PHE A 1 372  ? -31.321 -45.536 34.240  1.00 30.51  ? 1734 PHE A HZ     1 
ATOM   6176  N  N      . TYR A 1 373  ? -38.600 -47.255 30.926  1.00 32.50  ? 1735 TYR A N      1 
ATOM   6177  C  CA     . TYR A 1 373  ? -39.914 -47.725 30.488  1.00 32.97  ? 1735 TYR A CA     1 
ATOM   6178  C  C      . TYR A 1 373  ? -40.001 -49.240 30.342  1.00 32.91  ? 1735 TYR A C      1 
ATOM   6179  O  O      . TYR A 1 373  ? -39.016 -49.910 30.025  1.00 32.42  ? 1735 TYR A O      1 
ATOM   6180  C  CB     . TYR A 1 373  ? -40.294 -47.086 29.153  1.00 33.04  ? 1735 TYR A CB     1 
ATOM   6181  C  CG     . TYR A 1 373  ? -40.497 -45.594 29.199  1.00 33.30  ? 1735 TYR A CG     1 
ATOM   6182  C  CD1    . TYR A 1 373  ? -39.446 -44.715 28.989  1.00 32.96  ? 1735 TYR A CD1    1 
ATOM   6183  C  CD2    . TYR A 1 373  ? -41.755 -45.066 29.439  1.00 33.97  ? 1735 TYR A CD2    1 
ATOM   6184  C  CE1    . TYR A 1 373  ? -39.645 -43.349 29.028  1.00 33.30  ? 1735 TYR A CE1    1 
ATOM   6185  C  CE2    . TYR A 1 373  ? -41.964 -43.709 29.479  1.00 34.30  ? 1735 TYR A CE2    1 
ATOM   6186  C  CZ     . TYR A 1 373  ? -40.907 -42.854 29.274  1.00 33.97  ? 1735 TYR A CZ     1 
ATOM   6187  O  OH     . TYR A 1 373  ? -41.120 -41.497 29.316  1.00 34.39  ? 1735 TYR A OH     1 
ATOM   6188  H  H      . TYR A 1 373  ? -37.974 -47.413 30.358  1.00 39.01  ? 1735 TYR A H      1 
ATOM   6189  H  HA     . TYR A 1 373  ? -40.575 -47.454 31.145  1.00 39.57  ? 1735 TYR A HA     1 
ATOM   6190  H  HB2    . TYR A 1 373  ? -39.588 -47.265 28.512  1.00 39.64  ? 1735 TYR A HB2    1 
ATOM   6191  H  HB3    . TYR A 1 373  ? -41.123 -47.485 28.844  1.00 39.64  ? 1735 TYR A HB3    1 
ATOM   6192  H  HD1    . TYR A 1 373  ? -38.595 -45.050 28.824  1.00 39.55  ? 1735 TYR A HD1    1 
ATOM   6193  H  HD2    . TYR A 1 373  ? -42.472 -45.642 29.579  1.00 40.77  ? 1735 TYR A HD2    1 
ATOM   6194  H  HE1    . TYR A 1 373  ? -38.932 -42.768 28.889  1.00 39.96  ? 1735 TYR A HE1    1 
ATOM   6195  H  HE2    . TYR A 1 373  ? -42.814 -43.371 29.645  1.00 41.16  ? 1735 TYR A HE2    1 
ATOM   6196  H  HH     . TYR A 1 373  ? -41.930 -41.339 29.474  1.00 41.27  ? 1735 TYR A HH     1 
ATOM   6197  N  N      . GLN A 1 374  ? -41.202 -49.763 30.585  1.00 34.89  ? 1736 GLN A N      1 
ATOM   6198  C  CA     . GLN A 1 374  ? -41.484 -51.189 30.457  1.00 35.01  ? 1736 GLN A CA     1 
ATOM   6199  C  C      . GLN A 1 374  ? -42.667 -51.476 29.533  1.00 35.47  ? 1736 GLN A C      1 
ATOM   6200  O  O      . GLN A 1 374  ? -43.783 -51.029 29.790  1.00 36.05  ? 1736 GLN A O      1 
ATOM   6201  C  CB     . GLN A 1 374  ? -41.764 -51.783 31.828  1.00 35.40  ? 1736 GLN A CB     1 
ATOM   6202  C  CG     . GLN A 1 374  ? -41.977 -53.278 31.809  1.00 35.60  ? 1736 GLN A CG     1 
ATOM   6203  C  CD     . GLN A 1 374  ? -42.495 -53.800 33.125  1.00 36.19  ? 1736 GLN A CD     1 
ATOM   6204  O  OE1    . GLN A 1 374  ? -43.234 -53.115 33.836  1.00 36.66  ? 1736 GLN A OE1    1 
ATOM   6205  N  NE2    . GLN A 1 374  ? -42.087 -55.013 33.473  1.00 37.87  ? 1736 GLN A NE2    1 
ATOM   6206  H  H      . GLN A 1 374  ? -41.884 -49.300 30.830  1.00 41.87  ? 1736 GLN A H      1 
ATOM   6207  H  HA     . GLN A 1 374  ? -40.703 -51.634 30.091  1.00 42.02  ? 1736 GLN A HA     1 
ATOM   6208  H  HB2    . GLN A 1 374  ? -41.010 -51.597 32.410  1.00 42.48  ? 1736 GLN A HB2    1 
ATOM   6209  H  HB3    . GLN A 1 374  ? -42.566 -51.373 32.188  1.00 42.48  ? 1736 GLN A HB3    1 
ATOM   6210  H  HG2    . GLN A 1 374  ? -42.625 -53.497 31.121  1.00 42.72  ? 1736 GLN A HG2    1 
ATOM   6211  H  HG3    . GLN A 1 374  ? -41.132 -53.716 31.623  1.00 42.72  ? 1736 GLN A HG3    1 
ATOM   6212  H  HE21   . GLN A 1 374  ? -41.558 -55.453 32.958  1.00 45.44  ? 1736 GLN A HE21   1 
ATOM   6213  H  HE22   . GLN A 1 374  ? -42.353 -55.360 34.214  1.00 45.44  ? 1736 GLN A HE22   1 
ATOM   6214  N  N      . LYS A 1 375  ? -42.419 -52.220 28.461  1.00 39.74  ? 1737 LYS A N      1 
ATOM   6215  C  CA     . LYS A 1 375  ? -43.474 -52.590 27.526  1.00 40.22  ? 1737 LYS A CA     1 
ATOM   6216  C  C      . LYS A 1 375  ? -44.386 -53.611 28.172  1.00 60.21  ? 1737 LYS A C      1 
ATOM   6217  O  O      . LYS A 1 375  ? -43.891 -54.639 28.633  1.00 85.76  ? 1737 LYS A O      1 
ATOM   6218  C  CB     . LYS A 1 375  ? -42.892 -53.230 26.262  1.00 39.91  ? 1737 LYS A CB     1 
ATOM   6219  C  CG     . LYS A 1 375  ? -41.656 -52.559 25.701  1.00 39.25  ? 1737 LYS A CG     1 
ATOM   6220  C  CD     . LYS A 1 375  ? -40.963 -53.443 24.666  1.00 38.99  ? 1737 LYS A CD     1 
ATOM   6221  C  CE     . LYS A 1 375  ? -39.624 -52.841 24.259  1.00 38.36  ? 1737 LYS A CE     1 
ATOM   6222  N  NZ     . LYS A 1 375  ? -38.815 -53.738 23.390  1.00 38.11  1 1737 LYS A NZ     1 
ATOM   6223  H  H      . LYS A 1 375  ? -41.642 -52.525 28.252  1.00 47.69  ? 1737 LYS A H      1 
ATOM   6224  H  HA     . LYS A 1 375  ? -43.993 -51.809 27.279  1.00 48.26  ? 1737 LYS A HA     1 
ATOM   6225  H  HB2    . LYS A 1 375  ? -42.658 -54.150 26.464  1.00 47.89  ? 1737 LYS A HB2    1 
ATOM   6226  H  HB3    . LYS A 1 375  ? -43.571 -53.214 25.570  1.00 47.89  ? 1737 LYS A HB3    1 
ATOM   6227  H  HG2    . LYS A 1 375  ? -41.910 -51.728 25.270  1.00 47.10  ? 1737 LYS A HG2    1 
ATOM   6228  H  HG3    . LYS A 1 375  ? -41.030 -52.387 26.422  1.00 47.10  ? 1737 LYS A HG3    1 
ATOM   6229  H  HD2    . LYS A 1 375  ? -40.802 -54.320 25.046  1.00 46.79  ? 1737 LYS A HD2    1 
ATOM   6230  H  HD3    . LYS A 1 375  ? -41.520 -53.513 23.876  1.00 46.79  ? 1737 LYS A HD3    1 
ATOM   6231  H  HE2    . LYS A 1 375  ? -39.785 -52.019 23.772  1.00 46.03  ? 1737 LYS A HE2    1 
ATOM   6232  H  HE3    . LYS A 1 375  ? -39.108 -52.656 25.059  1.00 46.03  ? 1737 LYS A HE3    1 
ATOM   6233  H  HZ1    . LYS A 1 375  ? -38.045 -53.343 23.180  1.00 45.73  ? 1737 LYS A HZ1    1 
ATOM   6234  H  HZ2    . LYS A 1 375  ? -38.643 -54.500 23.816  1.00 45.73  ? 1737 LYS A HZ2    1 
ATOM   6235  H  HZ3    . LYS A 1 375  ? -39.261 -53.919 22.641  1.00 45.73  ? 1737 LYS A HZ3    1 
ATOM   6236  N  N      . ASN A 1 376  ? -45.691 -53.368 28.233  1.00 103.06 ? 1738 ASN A N      1 
ATOM   6237  C  CA     . ASN A 1 376  ? -46.594 -54.475 28.519  1.00 105.31 ? 1738 ASN A CA     1 
ATOM   6238  C  C      . ASN A 1 376  ? -47.103 -54.858 27.145  1.00 106.33 ? 1738 ASN A C      1 
ATOM   6239  O  O      . ASN A 1 376  ? -48.011 -54.222 26.613  1.00 106.60 ? 1738 ASN A O      1 
ATOM   6240  C  CB     . ASN A 1 376  ? -47.714 -54.080 29.475  1.00 106.75 ? 1738 ASN A CB     1 
ATOM   6241  C  CG     . ASN A 1 376  ? -47.192 -53.625 30.825  1.00 108.15 ? 1738 ASN A CG     1 
ATOM   6242  O  OD1    . ASN A 1 376  ? -47.141 -54.402 31.781  1.00 108.55 ? 1738 ASN A OD1    1 
ATOM   6243  N  ND2    . ASN A 1 376  ? -46.795 -52.362 30.909  1.00 108.85 ? 1738 ASN A ND2    1 
ATOM   6244  H  H      . ASN A 1 376  ? -46.067 -52.603 28.118  1.00 123.67 ? 1738 ASN A H      1 
ATOM   6245  H  HA     . ASN A 1 376  ? -46.101 -55.221 28.896  1.00 126.37 ? 1738 ASN A HA     1 
ATOM   6246  H  HB2    . ASN A 1 376  ? -48.220 -53.349 29.086  1.00 128.09 ? 1738 ASN A HB2    1 
ATOM   6247  H  HB3    . ASN A 1 376  ? -48.293 -54.845 29.619  1.00 128.09 ? 1738 ASN A HB3    1 
ATOM   6248  H  HD21   . ASN A 1 376  ? -46.490 -52.055 31.652  1.00 130.62 ? 1738 ASN A HD21   1 
ATOM   6249  H  HD22   . ASN A 1 376  ? -46.842 -51.851 30.219  1.00 130.62 ? 1738 ASN A HD22   1 
ATOM   6250  N  N      . ASP A 1 377  ? -46.511 -55.898 26.575  1.00 99.79  ? 1739 ASP A N      1 
ATOM   6251  C  CA     . ASP A 1 377  ? -46.913 -56.383 25.264  1.00 103.18 ? 1739 ASP A CA     1 
ATOM   6252  C  C      . ASP A 1 377  ? -46.938 -57.890 25.152  1.00 102.56 ? 1739 ASP A C      1 
ATOM   6253  O  O      . ASP A 1 377  ? -47.989 -58.517 25.009  1.00 112.63 ? 1739 ASP A O      1 
ATOM   6254  C  CB     . ASP A 1 377  ? -45.967 -55.833 24.189  1.00 102.80 ? 1739 ASP A CB     1 
ATOM   6255  C  CG     . ASP A 1 377  ? -46.194 -54.359 23.900  1.00 98.22  ? 1739 ASP A CG     1 
ATOM   6256  O  OD1    . ASP A 1 377  ? -47.368 -53.938 23.809  1.00 102.95 ? 1739 ASP A OD1    1 
ATOM   6257  O  OD2    . ASP A 1 377  ? -45.192 -53.622 23.759  1.00 88.11  1 1739 ASP A OD2    1 
ATOM   6258  H  H      . ASP A 1 377  ? -45.868 -56.345 26.931  1.00 119.75 ? 1739 ASP A H      1 
ATOM   6259  H  HA     . ASP A 1 377  ? -47.805 -56.057 25.070  1.00 123.82 ? 1739 ASP A HA     1 
ATOM   6260  H  HB2    . ASP A 1 377  ? -45.051 -55.942 24.489  1.00 123.36 ? 1739 ASP A HB2    1 
ATOM   6261  H  HB3    . ASP A 1 377  ? -46.107 -56.324 23.364  1.00 123.36 ? 1739 ASP A HB3    1 
ATOM   6262  N  N      . THR A 1 378  ? -45.735 -58.447 25.229  1.00 108.33 ? 1740 THR A N      1 
ATOM   6263  C  CA     . THR A 1 378  ? -45.480 -59.822 24.844  1.00 110.40 ? 1740 THR A CA     1 
ATOM   6264  C  C      . THR A 1 378  ? -44.551 -60.613 25.752  1.00 111.67 ? 1740 THR A C      1 
ATOM   6265  O  O      . THR A 1 378  ? -44.148 -60.176 26.832  1.00 104.50 ? 1740 THR A O      1 
ATOM   6266  C  CB     . THR A 1 378  ? -44.872 -59.848 23.415  1.00 118.62 ? 1740 THR A CB     1 
ATOM   6267  O  OG1    . THR A 1 378  ? -44.447 -61.177 23.087  1.00 120.02 ? 1740 THR A OG1    1 
ATOM   6268  C  CG2    . THR A 1 378  ? -43.674 -58.893 23.314  1.00 115.92 ? 1740 THR A CG2    1 
ATOM   6269  H  H      . THR A 1 378  ? -45.034 -58.034 25.509  1.00 130.00 ? 1740 THR A H      1 
ATOM   6270  H  HA     . THR A 1 378  ? -46.327 -60.293 24.812  1.00 132.48 ? 1740 THR A HA     1 
ATOM   6271  H  HB     . THR A 1 378  ? -45.543 -59.560 22.776  1.00 142.35 ? 1740 THR A HB     1 
ATOM   6272  H  HG1    . THR A 1 378  ? -44.118 -61.191 22.314  1.00 144.03 ? 1740 THR A HG1    1 
ATOM   6273  H  HG21   . THR A 1 378  ? -43.304 -58.919 22.418  1.00 139.10 ? 1740 THR A HG21   1 
ATOM   6274  H  HG22   . THR A 1 378  ? -43.955 -57.987 23.513  1.00 139.10 ? 1740 THR A HG22   1 
ATOM   6275  H  HG23   . THR A 1 378  ? -42.987 -59.156 23.946  1.00 139.10 ? 1740 THR A HG23   1 
ATOM   6276  N  N      . LEU A 1 379  ? -44.228 -61.799 25.251  1.00 102.82 ? 1741 LEU A N      1 
ATOM   6277  C  CA     . LEU A 1 379  ? -43.259 -62.718 25.820  1.00 105.76 ? 1741 LEU A CA     1 
ATOM   6278  C  C      . LEU A 1 379  ? -41.890 -62.173 25.411  1.00 111.47 ? 1741 LEU A C      1 
ATOM   6279  O  O      . LEU A 1 379  ? -41.798 -61.016 24.993  1.00 123.61 ? 1741 LEU A O      1 
ATOM   6280  C  CB     . LEU A 1 379  ? -43.525 -64.137 25.298  1.00 96.28  ? 1741 LEU A CB     1 
ATOM   6281  C  CG     . LEU A 1 379  ? -42.767 -65.381 25.774  1.00 80.24  ? 1741 LEU A CG     1 
ATOM   6282  C  CD1    . LEU A 1 379  ? -42.956 -65.683 27.257  1.00 73.41  ? 1741 LEU A CD1    1 
ATOM   6283  C  CD2    . LEU A 1 379  ? -43.214 -66.544 24.946  1.00 74.18  ? 1741 LEU A CD2    1 
ATOM   6284  H  H      . LEU A 1 379  ? -44.585 -62.108 24.532  1.00 123.39 ? 1741 LEU A H      1 
ATOM   6285  H  HA     . LEU A 1 379  ? -43.326 -62.717 26.788  1.00 126.91 ? 1741 LEU A HA     1 
ATOM   6286  H  HB2    . LEU A 1 379  ? -44.462 -64.323 25.468  1.00 115.54 ? 1741 LEU A HB2    1 
ATOM   6287  H  HB3    . LEU A 1 379  ? -43.395 -64.106 24.337  1.00 115.54 ? 1741 LEU A HB3    1 
ATOM   6288  H  HG     . LEU A 1 379  ? -41.819 -65.250 25.616  1.00 96.28  ? 1741 LEU A HG     1 
ATOM   6289  H  HD11   . LEU A 1 379  ? -42.450 -66.479 27.483  1.00 88.10  ? 1741 LEU A HD11   1 
ATOM   6290  H  HD12   . LEU A 1 379  ? -42.636 -64.928 27.775  1.00 88.10  ? 1741 LEU A HD12   1 
ATOM   6291  H  HD13   . LEU A 1 379  ? -43.899 -65.829 27.431  1.00 88.10  ? 1741 LEU A HD13   1 
ATOM   6292  H  HD21   . LEU A 1 379  ? -42.741 -67.339 25.238  1.00 89.01  ? 1741 LEU A HD21   1 
ATOM   6293  H  HD22   . LEU A 1 379  ? -44.169 -66.665 25.063  1.00 89.01  ? 1741 LEU A HD22   1 
ATOM   6294  H  HD23   . LEU A 1 379  ? -43.014 -66.363 24.015  1.00 89.01  ? 1741 LEU A HD23   1 
ATOM   6295  N  N      . ASP A 1 380  ? -40.834 -62.970 25.551  1.00 112.71 ? 1742 ASP A N      1 
ATOM   6296  C  CA     . ASP A 1 380  ? -39.477 -62.509 25.284  1.00 112.35 ? 1742 ASP A CA     1 
ATOM   6297  C  C      . ASP A 1 380  ? -39.170 -61.398 26.276  1.00 107.69 ? 1742 ASP A C      1 
ATOM   6298  O  O      . ASP A 1 380  ? -38.793 -60.287 25.910  1.00 107.03 ? 1742 ASP A O      1 
ATOM   6299  C  CB     . ASP A 1 380  ? -39.327 -62.020 23.832  1.00 114.69 ? 1742 ASP A CB     1 
ATOM   6300  C  CG     . ASP A 1 380  ? -39.669 -63.099 22.815  1.00 118.00 ? 1742 ASP A CG     1 
ATOM   6301  O  OD1    . ASP A 1 380  ? -39.564 -64.299 23.152  1.00 118.58 ? 1742 ASP A OD1    1 
ATOM   6302  O  OD2    . ASP A 1 380  ? -40.052 -62.746 21.679  1.00 119.70 1 1742 ASP A OD2    1 
ATOM   6303  H  H      . ASP A 1 380  ? -40.879 -63.792 25.801  1.00 135.25 ? 1742 ASP A H      1 
ATOM   6304  H  HA     . ASP A 1 380  ? -38.852 -63.236 25.431  1.00 134.82 ? 1742 ASP A HA     1 
ATOM   6305  H  HB2    . ASP A 1 380  ? -39.925 -61.271 23.687  1.00 137.63 ? 1742 ASP A HB2    1 
ATOM   6306  H  HB3    . ASP A 1 380  ? -38.409 -61.747 23.683  1.00 137.63 ? 1742 ASP A HB3    1 
ATOM   6307  N  N      . ASP A 1 381  ? -39.346 -61.749 27.548  1.00 59.14  ? 1743 ASP A N      1 
ATOM   6308  C  CA     . ASP A 1 381  ? -39.293 -60.823 28.674  1.00 63.14  ? 1743 ASP A CA     1 
ATOM   6309  C  C      . ASP A 1 381  ? -38.011 -60.014 28.793  1.00 57.34  ? 1743 ASP A C      1 
ATOM   6310  O  O      . ASP A 1 381  ? -38.031 -58.856 29.200  1.00 61.14  ? 1743 ASP A O      1 
ATOM   6311  C  CB     . ASP A 1 381  ? -39.464 -61.601 29.976  1.00 55.53  ? 1743 ASP A CB     1 
ATOM   6312  C  CG     . ASP A 1 381  ? -40.891 -62.068 30.205  1.00 39.90  ? 1743 ASP A CG     1 
ATOM   6313  O  OD1    . ASP A 1 381  ? -41.821 -61.240 30.092  1.00 40.07  ? 1743 ASP A OD1    1 
ATOM   6314  O  OD2    . ASP A 1 381  ? -41.080 -63.268 30.509  1.00 48.45  1 1743 ASP A OD2    1 
ATOM   6315  H  H      . ASP A 1 381  ? -39.504 -62.558 27.792  1.00 70.97  ? 1743 ASP A H      1 
ATOM   6316  H  HA     . ASP A 1 381  ? -40.032 -60.198 28.600  1.00 75.77  ? 1743 ASP A HA     1 
ATOM   6317  H  HB2    . ASP A 1 381  ? -38.893 -62.385 29.952  1.00 66.64  ? 1743 ASP A HB2    1 
ATOM   6318  H  HB3    . ASP A 1 381  ? -39.213 -61.031 30.719  1.00 66.64  ? 1743 ASP A HB3    1 
ATOM   6319  N  N      . LEU A 1 382  ? -36.890 -60.641 28.475  1.00 27.33  ? 1744 LEU A N      1 
ATOM   6320  C  CA     . LEU A 1 382  ? -35.597 -60.004 28.672  1.00 26.64  ? 1744 LEU A CA     1 
ATOM   6321  C  C      . LEU A 1 382  ? -35.401 -58.812 27.740  1.00 26.19  ? 1744 LEU A C      1 
ATOM   6322  O  O      . LEU A 1 382  ? -34.501 -57.997 27.940  1.00 25.68  ? 1744 LEU A O      1 
ATOM   6323  C  CB     . LEU A 1 382  ? -34.485 -61.032 28.467  1.00 26.47  ? 1744 LEU A CB     1 
ATOM   6324  C  CG     . LEU A 1 382  ? -34.375 -62.129 29.528  1.00 26.89  ? 1744 LEU A CG     1 
ATOM   6325  C  CD1    . LEU A 1 382  ? -33.108 -62.923 29.302  1.00 26.65  ? 1744 LEU A CD1    1 
ATOM   6326  C  CD2    . LEU A 1 382  ? -34.390 -61.574 30.946  1.00 26.93  ? 1744 LEU A CD2    1 
ATOM   6327  H  H      . LEU A 1 382  ? -36.849 -61.433 28.144  1.00 32.79  ? 1744 LEU A H      1 
ATOM   6328  H  HA     . LEU A 1 382  ? -35.541 -59.682 29.585  1.00 31.97  ? 1744 LEU A HA     1 
ATOM   6329  H  HB2    . LEU A 1 382  ? -34.628 -61.469 27.613  1.00 31.77  ? 1744 LEU A HB2    1 
ATOM   6330  H  HB3    . LEU A 1 382  ? -33.636 -60.562 28.449  1.00 31.77  ? 1744 LEU A HB3    1 
ATOM   6331  H  HG     . LEU A 1 382  ? -35.128 -62.733 29.435  1.00 32.27  ? 1744 LEU A HG     1 
ATOM   6332  H  HD11   . LEU A 1 382  ? -33.046 -63.617 29.977  1.00 31.98  ? 1744 LEU A HD11   1 
ATOM   6333  H  HD12   . LEU A 1 382  ? -33.140 -63.324 28.418  1.00 31.98  ? 1744 LEU A HD12   1 
ATOM   6334  H  HD13   . LEU A 1 382  ? -32.346 -62.327 29.367  1.00 31.98  ? 1744 LEU A HD13   1 
ATOM   6335  H  HD21   . LEU A 1 382  ? -34.318 -62.311 31.573  1.00 32.32  ? 1744 LEU A HD21   1 
ATOM   6336  H  HD22   . LEU A 1 382  ? -33.638 -60.971 31.056  1.00 32.32  ? 1744 LEU A HD22   1 
ATOM   6337  H  HD23   . LEU A 1 382  ? -35.222 -61.097 31.090  1.00 32.32  ? 1744 LEU A HD23   1 
ATOM   6338  N  N      . ASN A 1 383  ? -36.254 -58.720 26.726  1.00 54.38  ? 1745 ASN A N      1 
ATOM   6339  C  CA     . ASN A 1 383  ? -36.273 -57.586 25.811  1.00 36.90  ? 1745 ASN A CA     1 
ATOM   6340  C  C      . ASN A 1 383  ? -37.368 -56.577 26.179  1.00 36.17  ? 1745 ASN A C      1 
ATOM   6341  O  O      . ASN A 1 383  ? -37.621 -55.627 25.436  1.00 36.12  ? 1745 ASN A O      1 
ATOM   6342  C  CB     . ASN A 1 383  ? -36.451 -58.088 24.380  1.00 41.17  ? 1745 ASN A CB     1 
ATOM   6343  C  CG     . ASN A 1 383  ? -35.659 -59.358 24.110  1.00 46.51  ? 1745 ASN A CG     1 
ATOM   6344  O  OD1    . ASN A 1 383  ? -36.130 -60.467 24.380  1.00 50.46  ? 1745 ASN A OD1    1 
ATOM   6345  N  ND2    . ASN A 1 383  ? -34.449 -59.203 23.583  1.00 46.92  ? 1745 ASN A ND2    1 
ATOM   6346  H  H      . ASN A 1 383  ? -36.845 -59.317 26.544  1.00 65.25  ? 1745 ASN A H      1 
ATOM   6347  H  HA     . ASN A 1 383  ? -35.419 -57.129 25.862  1.00 44.27  ? 1745 ASN A HA     1 
ATOM   6348  H  HB2    . ASN A 1 383  ? -37.389 -58.279 24.225  1.00 49.40  ? 1745 ASN A HB2    1 
ATOM   6349  H  HB3    . ASN A 1 383  ? -36.143 -57.405 23.764  1.00 49.40  ? 1745 ASN A HB3    1 
ATOM   6350  H  HD21   . ASN A 1 383  ? -33.962 -59.892 23.412  1.00 56.30  ? 1745 ASN A HD21   1 
ATOM   6351  H  HD22   . ASN A 1 383  ? -34.151 -58.414 23.413  1.00 56.30  ? 1745 ASN A HD22   1 
ATOM   6352  N  N      . SER A 1 384  ? -38.027 -56.803 27.317  1.00 26.83  ? 1746 SER A N      1 
ATOM   6353  C  CA     . SER A 1 384  ? -39.227 -56.047 27.682  1.00 27.25  ? 1746 SER A CA     1 
ATOM   6354  C  C      . SER A 1 384  ? -38.963 -54.703 28.356  1.00 27.00  ? 1746 SER A C      1 
ATOM   6355  O  O      . SER A 1 384  ? -39.891 -53.914 28.524  1.00 27.34  ? 1746 SER A O      1 
ATOM   6356  C  CB     . SER A 1 384  ? -40.102 -56.875 28.624  1.00 27.87  ? 1746 SER A CB     1 
ATOM   6357  O  OG     . SER A 1 384  ? -39.712 -56.686 29.979  1.00 27.82  ? 1746 SER A OG     1 
ATOM   6358  H  H      . SER A 1 384  ? -37.797 -57.393 27.899  1.00 32.19  ? 1746 SER A H      1 
ATOM   6359  H  HA     . SER A 1 384  ? -39.741 -55.875 26.877  1.00 32.70  ? 1746 SER A HA     1 
ATOM   6360  H  HB2    . SER A 1 384  ? -41.026 -56.599 28.520  1.00 33.44  ? 1746 SER A HB2    1 
ATOM   6361  H  HB3    . SER A 1 384  ? -40.009 -57.813 28.397  1.00 33.44  ? 1746 SER A HB3    1 
ATOM   6362  H  HG     . SER A 1 384  ? -38.913 -56.921 30.084  1.00 33.38  ? 1746 SER A HG     1 
ATOM   6363  N  N      . VAL A 1 385  ? -37.719 -54.443 28.745  1.00 27.55  ? 1747 VAL A N      1 
ATOM   6364  C  CA     . VAL A 1 385  ? -37.375 -53.201 29.435  1.00 27.36  ? 1747 VAL A CA     1 
ATOM   6365  C  C      . VAL A 1 385  ? -36.436 -52.360 28.587  1.00 26.85  ? 1747 VAL A C      1 
ATOM   6366  O  O      . VAL A 1 385  ? -35.402 -52.848 28.140  1.00 26.44  ? 1747 VAL A O      1 
ATOM   6367  C  CB     . VAL A 1 385  ? -36.723 -53.474 30.792  1.00 27.30  ? 1747 VAL A CB     1 
ATOM   6368  C  CG1    . VAL A 1 385  ? -36.263 -52.163 31.427  1.00 27.13  ? 1747 VAL A CG1    1 
ATOM   6369  C  CG2    . VAL A 1 385  ? -37.710 -54.195 31.707  1.00 27.93  ? 1747 VAL A CG2    1 
ATOM   6370  H  H      . VAL A 1 385  ? -37.052 -54.972 28.622  1.00 33.06  ? 1747 VAL A H      1 
ATOM   6371  H  HA     . VAL A 1 385  ? -38.184 -52.688 29.587  1.00 32.84  ? 1747 VAL A HA     1 
ATOM   6372  H  HB     . VAL A 1 385  ? -35.947 -54.043 30.669  1.00 32.76  ? 1747 VAL A HB     1 
ATOM   6373  H  HG11   . VAL A 1 385  ? -35.853 -52.354 32.285  1.00 32.56  ? 1747 VAL A HG11   1 
ATOM   6374  H  HG12   . VAL A 1 385  ? -35.619 -51.737 30.840  1.00 32.56  ? 1747 VAL A HG12   1 
ATOM   6375  H  HG13   . VAL A 1 385  ? -37.032 -51.585 31.549  1.00 32.56  ? 1747 VAL A HG13   1 
ATOM   6376  H  HG21   . VAL A 1 385  ? -37.283 -54.361 32.562  1.00 33.52  ? 1747 VAL A HG21   1 
ATOM   6377  H  HG22   . VAL A 1 385  ? -38.492 -53.635 31.830  1.00 33.52  ? 1747 VAL A HG22   1 
ATOM   6378  H  HG23   . VAL A 1 385  ? -37.965 -55.035 31.295  1.00 33.52  ? 1747 VAL A HG23   1 
ATOM   6379  N  N      . PHE A 1 386  ? -36.799 -51.100 28.366  1.00 32.93  ? 1748 PHE A N      1 
ATOM   6380  C  CA     . PHE A 1 386  ? -35.963 -50.191 27.587  1.00 32.56  ? 1748 PHE A CA     1 
ATOM   6381  C  C      . PHE A 1 386  ? -35.854 -48.806 28.219  1.00 32.61  ? 1748 PHE A C      1 
ATOM   6382  O  O      . PHE A 1 386  ? -36.564 -48.486 29.171  1.00 32.98  ? 1748 PHE A O      1 
ATOM   6383  C  CB     . PHE A 1 386  ? -36.511 -50.072 26.169  1.00 32.72  ? 1748 PHE A CB     1 
ATOM   6384  C  CG     . PHE A 1 386  ? -37.823 -49.356 26.094  1.00 33.27  ? 1748 PHE A CG     1 
ATOM   6385  C  CD1    . PHE A 1 386  ? -39.012 -50.039 26.280  1.00 33.74  ? 1748 PHE A CD1    1 
ATOM   6386  C  CD2    . PHE A 1 386  ? -37.868 -47.997 25.844  1.00 33.36  ? 1748 PHE A CD2    1 
ATOM   6387  C  CE1    . PHE A 1 386  ? -40.222 -49.378 26.214  1.00 34.29  ? 1748 PHE A CE1    1 
ATOM   6388  C  CE2    . PHE A 1 386  ? -39.073 -47.332 25.779  1.00 33.92  ? 1748 PHE A CE2    1 
ATOM   6389  C  CZ     . PHE A 1 386  ? -40.252 -48.023 25.964  1.00 34.37  ? 1748 PHE A CZ     1 
ATOM   6390  H  H      . PHE A 1 386  ? -37.527 -50.746 28.657  1.00 39.52  ? 1748 PHE A H      1 
ATOM   6391  H  HA     . PHE A 1 386  ? -35.069 -50.562 27.529  1.00 39.07  ? 1748 PHE A HA     1 
ATOM   6392  H  HB2    . PHE A 1 386  ? -35.873 -49.581 25.627  1.00 39.27  ? 1748 PHE A HB2    1 
ATOM   6393  H  HB3    . PHE A 1 386  ? -36.636 -50.962 25.805  1.00 39.27  ? 1748 PHE A HB3    1 
ATOM   6394  H  HD1    . PHE A 1 386  ? -38.995 -50.953 26.450  1.00 40.49  ? 1748 PHE A HD1    1 
ATOM   6395  H  HD2    . PHE A 1 386  ? -37.076 -47.527 25.719  1.00 40.03  ? 1748 PHE A HD2    1 
ATOM   6396  H  HE1    . PHE A 1 386  ? -41.016 -49.846 26.340  1.00 41.14  ? 1748 PHE A HE1    1 
ATOM   6397  H  HE2    . PHE A 1 386  ? -39.091 -46.418 25.609  1.00 40.70  ? 1748 PHE A HE2    1 
ATOM   6398  H  HZ     . PHE A 1 386  ? -41.066 -47.576 25.919  1.00 41.24  ? 1748 PHE A HZ     1 
ATOM   6399  N  N      . ILE A 1 387  ? -34.956 -47.996 27.668  1.00 25.22  ? 1749 ILE A N      1 
ATOM   6400  C  CA     . ILE A 1 387  ? -34.579 -46.699 28.231  1.00 25.25  ? 1749 ILE A CA     1 
ATOM   6401  C  C      . ILE A 1 387  ? -34.770 -45.619 27.183  1.00 25.41  ? 1749 ILE A C      1 
ATOM   6402  O  O      . ILE A 1 387  ? -34.364 -45.798 26.040  1.00 25.22  ? 1749 ILE A O      1 
ATOM   6403  C  CB     . ILE A 1 387  ? -33.106 -46.693 28.713  1.00 24.78  ? 1749 ILE A CB     1 
ATOM   6404  C  CG1    . ILE A 1 387  ? -33.006 -47.238 30.135  1.00 24.82  ? 1749 ILE A CG1    1 
ATOM   6405  C  CG2    . ILE A 1 387  ? -32.496 -45.286 28.679  1.00 24.77  ? 1749 ILE A CG2    1 
ATOM   6406  C  CD1    . ILE A 1 387  ? -33.118 -48.743 30.221  1.00 24.74  ? 1749 ILE A CD1    1 
ATOM   6407  H  H      . ILE A 1 387  ? -34.535 -48.181 26.942  1.00 30.26  ? 1749 ILE A H      1 
ATOM   6408  H  HA     . ILE A 1 387  ? -35.151 -46.497 28.988  1.00 30.30  ? 1749 ILE A HA     1 
ATOM   6409  H  HB     . ILE A 1 387  ? -32.589 -47.267 28.126  1.00 29.73  ? 1749 ILE A HB     1 
ATOM   6410  H  HG12   . ILE A 1 387  ? -32.148 -46.983 30.508  1.00 29.78  ? 1749 ILE A HG12   1 
ATOM   6411  H  HG13   . ILE A 1 387  ? -33.722 -46.856 30.667  1.00 29.78  ? 1749 ILE A HG13   1 
ATOM   6412  H  HG21   . ILE A 1 387  ? -31.577 -45.333 28.988  1.00 29.73  ? 1749 ILE A HG21   1 
ATOM   6413  H  HG22   . ILE A 1 387  ? -32.522 -44.952 27.768  1.00 29.73  ? 1749 ILE A HG22   1 
ATOM   6414  H  HG23   . ILE A 1 387  ? -33.011 -44.705 29.260  1.00 29.73  ? 1749 ILE A HG23   1 
ATOM   6415  H  HD11   . ILE A 1 387  ? -33.046 -49.012 31.150  1.00 29.69  ? 1749 ILE A HD11   1 
ATOM   6416  H  HD12   . ILE A 1 387  ? -33.978 -49.016 29.862  1.00 29.69  ? 1749 ILE A HD12   1 
ATOM   6417  H  HD13   . ILE A 1 387  ? -32.402 -49.143 29.703  1.00 29.69  ? 1749 ILE A HD13   1 
ATOM   6418  N  N      . SER A 1 388  ? -35.403 -44.515 27.558  1.00 28.23  ? 1750 SER A N      1 
ATOM   6419  C  CA     . SER A 1 388  ? -35.571 -43.379 26.649  1.00 28.49  ? 1750 SER A CA     1 
ATOM   6420  C  C      . SER A 1 388  ? -34.770 -42.166 27.097  1.00 28.50  ? 1750 SER A C      1 
ATOM   6421  O  O      . SER A 1 388  ? -34.912 -41.705 28.230  1.00 28.71  ? 1750 SER A O      1 
ATOM   6422  C  CB     . SER A 1 388  ? -37.041 -42.987 26.534  1.00 29.12  ? 1750 SER A CB     1 
ATOM   6423  O  OG     . SER A 1 388  ? -37.170 -41.773 25.818  1.00 29.46  ? 1750 SER A OG     1 
ATOM   6424  H  H      . SER A 1 388  ? -35.748 -44.394 28.337  1.00 33.88  ? 1750 SER A H      1 
ATOM   6425  H  HA     . SER A 1 388  ? -35.259 -43.633 25.766  1.00 34.19  ? 1750 SER A HA     1 
ATOM   6426  H  HB2    . SER A 1 388  ? -37.519 -43.687 26.062  1.00 34.94  ? 1750 SER A HB2    1 
ATOM   6427  H  HB3    . SER A 1 388  ? -37.409 -42.873 27.424  1.00 34.94  ? 1750 SER A HB3    1 
ATOM   6428  H  HG     . SER A 1 388  ? -37.980 -41.560 25.757  1.00 35.35  ? 1750 SER A HG     1 
ATOM   6429  N  N      . GLN A 1 389  ? -33.911 -41.663 26.219  1.00 25.93  ? 1751 GLN A N      1 
ATOM   6430  C  CA     . GLN A 1 389  ? -33.237 -40.400 26.483  1.00 26.08  ? 1751 GLN A CA     1 
ATOM   6431  C  C      . GLN A 1 389  ? -33.032 -39.637 25.186  1.00 26.28  ? 1751 GLN A C      1 
ATOM   6432  O  O      . GLN A 1 389  ? -32.635 -40.212 24.176  1.00 26.02  ? 1751 GLN A O      1 
ATOM   6433  C  CB     . GLN A 1 389  ? -31.905 -40.621 27.193  1.00 25.61  ? 1751 GLN A CB     1 
ATOM   6434  C  CG     . GLN A 1 389  ? -31.304 -39.327 27.711  1.00 25.86  ? 1751 GLN A CG     1 
ATOM   6435  C  CD     . GLN A 1 389  ? -29.942 -39.512 28.335  1.00 25.44  ? 1751 GLN A CD     1 
ATOM   6436  O  OE1    . GLN A 1 389  ? -29.287 -40.538 28.143  1.00 24.93  ? 1751 GLN A OE1    1 
ATOM   6437  N  NE2    . GLN A 1 389  ? -29.522 -38.528 29.122  1.00 25.72  ? 1751 GLN A NE2    1 
ATOM   6438  H  H      . GLN A 1 389  ? -33.702 -42.030 25.470  1.00 31.12  ? 1751 GLN A H      1 
ATOM   6439  H  HA     . GLN A 1 389  ? -33.798 -39.860 27.061  1.00 31.29  ? 1751 GLN A HA     1 
ATOM   6440  H  HB2    . GLN A 1 389  ? -32.043 -41.213 27.949  1.00 30.73  ? 1751 GLN A HB2    1 
ATOM   6441  H  HB3    . GLN A 1 389  ? -31.276 -41.018 26.571  1.00 30.73  ? 1751 GLN A HB3    1 
ATOM   6442  H  HG2    . GLN A 1 389  ? -31.212 -38.705 26.973  1.00 31.03  ? 1751 GLN A HG2    1 
ATOM   6443  H  HG3    . GLN A 1 389  ? -31.893 -38.955 28.386  1.00 31.03  ? 1751 GLN A HG3    1 
ATOM   6444  H  HE21   . GLN A 1 389  ? -30.018 -37.838 29.250  1.00 30.86  ? 1751 GLN A HE21   1 
ATOM   6445  H  HE22   . GLN A 1 389  ? -28.752 -38.581 29.503  1.00 30.86  ? 1751 GLN A HE22   1 
ATOM   6446  N  N      . SER A 1 390  ? -33.318 -38.342 25.225  1.00 26.82  ? 1752 SER A N      1 
ATOM   6447  C  CA     . SER A 1 390  ? -33.193 -37.476 24.059  1.00 27.17  ? 1752 SER A CA     1 
ATOM   6448  C  C      . SER A 1 390  ? -34.055 -37.982 22.905  1.00 27.35  ? 1752 SER A C      1 
ATOM   6449  O  O      . SER A 1 390  ? -33.816 -37.646 21.746  1.00 27.55  ? 1752 SER A O      1 
ATOM   6450  C  CB     . SER A 1 390  ? -31.730 -37.371 23.626  1.00 26.82  ? 1752 SER A CB     1 
ATOM   6451  O  OG     . SER A 1 390  ? -30.966 -36.709 24.615  1.00 26.80  ? 1752 SER A OG     1 
ATOM   6452  H  H      . SER A 1 390  ? -33.593 -37.933 25.929  1.00 32.18  ? 1752 SER A H      1 
ATOM   6453  H  HA     . SER A 1 390  ? -33.499 -36.587 24.294  1.00 32.61  ? 1752 SER A HA     1 
ATOM   6454  H  HB2    . SER A 1 390  ? -31.374 -38.264 23.495  1.00 32.18  ? 1752 SER A HB2    1 
ATOM   6455  H  HB3    . SER A 1 390  ? -31.681 -36.868 22.798  1.00 32.18  ? 1752 SER A HB3    1 
ATOM   6456  H  HG     . SER A 1 390  ? -30.164 -36.655 24.370  1.00 32.16  ? 1752 SER A HG     1 
ATOM   6457  N  N      . GLY A 1 391  ? -35.072 -38.776 23.229  1.00 37.23  ? 1753 GLY A N      1 
ATOM   6458  C  CA     . GLY A 1 391  ? -35.951 -39.335 22.219  1.00 37.45  ? 1753 GLY A CA     1 
ATOM   6459  C  C      . GLY A 1 391  ? -35.340 -40.523 21.496  1.00 36.94  ? 1753 GLY A C      1 
ATOM   6460  O  O      . GLY A 1 391  ? -35.872 -40.985 20.491  1.00 37.14  ? 1753 GLY A O      1 
ATOM   6461  H  H      . GLY A 1 391  ? -35.271 -39.004 24.034  1.00 44.68  ? 1753 GLY A H      1 
ATOM   6462  H  HA2    . GLY A 1 391  ? -36.777 -39.623 22.637  1.00 44.93  ? 1753 GLY A HA2    1 
ATOM   6463  H  HA3    . GLY A 1 391  ? -36.161 -38.653 21.563  1.00 44.93  ? 1753 GLY A HA3    1 
ATOM   6464  N  N      . TYR A 1 392  ? -34.221 -41.018 22.014  1.00 32.60  ? 1754 TYR A N      1 
ATOM   6465  C  CA     . TYR A 1 392  ? -33.558 -42.193 21.459  1.00 32.13  ? 1754 TYR A CA     1 
ATOM   6466  C  C      . TYR A 1 392  ? -33.815 -43.348 22.411  1.00 31.81  ? 1754 TYR A C      1 
ATOM   6467  O  O      . TYR A 1 392  ? -33.837 -43.146 23.625  1.00 31.76  ? 1754 TYR A O      1 
ATOM   6468  C  CB     . TYR A 1 392  ? -32.045 -41.985 21.308  1.00 31.74  ? 1754 TYR A CB     1 
ATOM   6469  C  CG     . TYR A 1 392  ? -31.564 -41.124 20.147  1.00 37.35  ? 1754 TYR A CG     1 
ATOM   6470  C  CD1    . TYR A 1 392  ? -32.368 -40.843 19.047  1.00 32.57  ? 1754 TYR A CD1    1 
ATOM   6471  C  CD2    . TYR A 1 392  ? -30.273 -40.613 20.153  1.00 31.84  ? 1754 TYR A CD2    1 
ATOM   6472  C  CE1    . TYR A 1 392  ? -31.892 -40.061 17.997  1.00 32.92  ? 1754 TYR A CE1    1 
ATOM   6473  C  CE2    . TYR A 1 392  ? -29.799 -39.840 19.116  1.00 32.18  ? 1754 TYR A CE2    1 
ATOM   6474  C  CZ     . TYR A 1 392  ? -30.603 -39.569 18.042  1.00 32.73  ? 1754 TYR A CZ     1 
ATOM   6475  O  OH     . TYR A 1 392  ? -30.097 -38.796 17.023  1.00 33.15  ? 1754 TYR A OH     1 
ATOM   6476  H  H      . TYR A 1 392  ? -33.819 -40.686 22.698  1.00 39.12  ? 1754 TYR A H      1 
ATOM   6477  H  HA     . TYR A 1 392  ? -33.936 -42.408 20.591  1.00 38.56  ? 1754 TYR A HA     1 
ATOM   6478  H  HB2    . TYR A 1 392  ? -31.717 -41.572 22.122  1.00 38.09  ? 1754 TYR A HB2    1 
ATOM   6479  H  HB3    . TYR A 1 392  ? -31.632 -42.856 21.205  1.00 38.09  ? 1754 TYR A HB3    1 
ATOM   6480  H  HD1    . TYR A 1 392  ? -33.235 -41.176 19.015  1.00 39.09  ? 1754 TYR A HD1    1 
ATOM   6481  H  HD2    . TYR A 1 392  ? -29.717 -40.793 20.877  1.00 38.21  ? 1754 TYR A HD2    1 
ATOM   6482  H  HE1    . TYR A 1 392  ? -32.438 -39.876 17.266  1.00 39.51  ? 1754 TYR A HE1    1 
ATOM   6483  H  HE2    . TYR A 1 392  ? -28.932 -39.507 19.143  1.00 38.62  ? 1754 TYR A HE2    1 
ATOM   6484  H  HH     . TYR A 1 392  ? -29.305 -38.575 17.195  1.00 39.78  ? 1754 TYR A HH     1 
ATOM   6485  N  N      . LEU A 1 393  ? -34.021 -44.548 21.873  1.00 33.12  ? 1755 LEU A N      1 
ATOM   6486  C  CA     . LEU A 1 393  ? -34.295 -45.715 22.711  1.00 32.91  ? 1755 LEU A CA     1 
ATOM   6487  C  C      . LEU A 1 393  ? -33.167 -46.728 22.747  1.00 32.39  ? 1755 LEU A C      1 
ATOM   6488  O  O      . LEU A 1 393  ? -32.526 -47.008 21.732  1.00 32.26  ? 1755 LEU A O      1 
ATOM   6489  C  CB     . LEU A 1 393  ? -35.583 -46.396 22.260  1.00 33.31  ? 1755 LEU A CB     1 
ATOM   6490  C  CG     . LEU A 1 393  ? -36.813 -45.490 22.328  1.00 33.89  ? 1755 LEU A CG     1 
ATOM   6491  C  CD1    . LEU A 1 393  ? -38.050 -46.206 21.822  1.00 34.32  ? 1755 LEU A CD1    1 
ATOM   6492  C  CD2    . LEU A 1 393  ? -37.030 -45.008 23.755  1.00 33.93  ? 1755 LEU A CD2    1 
ATOM   6493  H  H      . LEU A 1 393  ? -34.008 -44.713 21.029  1.00 39.74  ? 1755 LEU A H      1 
ATOM   6494  H  HA     . LEU A 1 393  ? -34.435 -45.409 23.621  1.00 39.49  ? 1755 LEU A HA     1 
ATOM   6495  H  HB2    . LEU A 1 393  ? -35.478 -46.685 21.340  1.00 39.97  ? 1755 LEU A HB2    1 
ATOM   6496  H  HB3    . LEU A 1 393  ? -35.748 -47.164 22.829  1.00 39.97  ? 1755 LEU A HB3    1 
ATOM   6497  H  HG     . LEU A 1 393  ? -36.665 -44.713 21.767  1.00 40.67  ? 1755 LEU A HG     1 
ATOM   6498  H  HD11   . LEU A 1 393  ? -38.808 -45.603 21.880  1.00 41.18  ? 1755 LEU A HD11   1 
ATOM   6499  H  HD12   . LEU A 1 393  ? -37.906 -46.470 20.900  1.00 41.18  ? 1755 LEU A HD12   1 
ATOM   6500  H  HD13   . LEU A 1 393  ? -38.208 -46.990 22.371  1.00 41.18  ? 1755 LEU A HD13   1 
ATOM   6501  H  HD21   . LEU A 1 393  ? -37.813 -44.436 23.779  1.00 40.72  ? 1755 LEU A HD21   1 
ATOM   6502  H  HD22   . LEU A 1 393  ? -37.164 -45.777 24.331  1.00 40.72  ? 1755 LEU A HD22   1 
ATOM   6503  H  HD23   . LEU A 1 393  ? -36.248 -44.512 24.043  1.00 40.72  ? 1755 LEU A HD23   1 
ATOM   6504  N  N      . LEU A 1 394  ? -32.959 -47.265 23.947  1.00 24.62  ? 1756 LEU A N      1 
ATOM   6505  C  CA     . LEU A 1 394  ? -31.957 -48.285 24.219  1.00 24.19  ? 1756 LEU A CA     1 
ATOM   6506  C  C      . LEU A 1 394  ? -32.563 -49.364 25.109  1.00 24.27  ? 1756 LEU A C      1 
ATOM   6507  O  O      . LEU A 1 394  ? -33.189 -49.057 26.122  1.00 24.49  ? 1756 LEU A O      1 
ATOM   6508  C  CB     . LEU A 1 394  ? -30.741 -47.665 24.901  1.00 23.85  ? 1756 LEU A CB     1 
ATOM   6509  C  CG     . LEU A 1 394  ? -29.900 -46.668 24.103  1.00 23.77  ? 1756 LEU A CG     1 
ATOM   6510  C  CD1    . LEU A 1 394  ? -28.674 -46.293 24.918  1.00 23.46  ? 1756 LEU A CD1    1 
ATOM   6511  C  CD2    . LEU A 1 394  ? -29.480 -47.212 22.736  1.00 23.69  ? 1756 LEU A CD2    1 
ATOM   6512  H  H      . LEU A 1 394  ? -33.408 -47.043 24.646  1.00 29.55  ? 1756 LEU A H      1 
ATOM   6513  H  HA     . LEU A 1 394  ? -31.672 -48.693 23.386  1.00 29.02  ? 1756 LEU A HA     1 
ATOM   6514  H  HB2    . LEU A 1 394  ? -31.049 -47.201 25.695  1.00 28.62  ? 1756 LEU A HB2    1 
ATOM   6515  H  HB3    . LEU A 1 394  ? -30.148 -48.385 25.166  1.00 28.62  ? 1756 LEU A HB3    1 
ATOM   6516  H  HG     . LEU A 1 394  ? -30.420 -45.862 23.957  1.00 28.53  ? 1756 LEU A HG     1 
ATOM   6517  H  HD11   . LEU A 1 394  ? -28.140 -45.660 24.412  1.00 28.15  ? 1756 LEU A HD11   1 
ATOM   6518  H  HD12   . LEU A 1 394  ? -28.961 -45.891 25.752  1.00 28.15  ? 1756 LEU A HD12   1 
ATOM   6519  H  HD13   . LEU A 1 394  ? -28.157 -47.094 25.097  1.00 28.15  ? 1756 LEU A HD13   1 
ATOM   6520  H  HD21   . LEU A 1 394  ? -28.952 -46.539 22.278  1.00 28.43  ? 1756 LEU A HD21   1 
ATOM   6521  H  HD22   . LEU A 1 394  ? -28.953 -48.016 22.865  1.00 28.43  ? 1756 LEU A HD22   1 
ATOM   6522  H  HD23   . LEU A 1 394  ? -30.276 -47.417 22.220  1.00 28.43  ? 1756 LEU A HD23   1 
ATOM   6523  N  N      . GLN A 1 395  ? -32.383 -50.622 24.730  1.00 29.01  ? 1757 GLN A N      1 
ATOM   6524  C  CA     . GLN A 1 395  ? -32.906 -51.744 25.502  1.00 29.17  ? 1757 GLN A CA     1 
ATOM   6525  C  C      . GLN A 1 395  ? -32.034 -52.140 26.686  1.00 28.90  ? 1757 GLN A C      1 
ATOM   6526  O  O      . GLN A 1 395  ? -30.834 -51.880 26.705  1.00 28.52  ? 1757 GLN A O      1 
ATOM   6527  C  CB     . GLN A 1 395  ? -33.119 -52.954 24.607  1.00 29.30  ? 1757 GLN A CB     1 
ATOM   6528  C  CG     . GLN A 1 395  ? -34.490 -52.973 23.960  1.00 29.80  ? 1757 GLN A CG     1 
ATOM   6529  C  CD     . GLN A 1 395  ? -34.846 -54.328 23.392  1.00 30.06  ? 1757 GLN A CD     1 
ATOM   6530  O  OE1    . GLN A 1 395  ? -34.173 -55.327 23.657  1.00 29.91  ? 1757 GLN A OE1    1 
ATOM   6531  N  NE2    . GLN A 1 395  ? -35.914 -54.372 22.606  1.00 31.28  ? 1757 GLN A NE2    1 
ATOM   6532  H  H      . GLN A 1 395  ? -31.957 -50.856 24.021  1.00 34.82  ? 1757 GLN A H      1 
ATOM   6533  H  HA     . GLN A 1 395  ? -33.773 -51.491 25.856  1.00 35.00  ? 1757 GLN A HA     1 
ATOM   6534  H  HB2    . GLN A 1 395  ? -32.454 -52.945 23.900  1.00 35.16  ? 1757 GLN A HB2    1 
ATOM   6535  H  HB3    . GLN A 1 395  ? -33.027 -53.760 25.138  1.00 35.16  ? 1757 GLN A HB3    1 
ATOM   6536  H  HG2    . GLN A 1 395  ? -35.156 -52.741 24.625  1.00 35.76  ? 1757 GLN A HG2    1 
ATOM   6537  H  HG3    . GLN A 1 395  ? -34.506 -52.329 23.235  1.00 35.76  ? 1757 GLN A HG3    1 
ATOM   6538  H  HE21   . GLN A 1 395  ? -36.360 -53.654 22.446  1.00 37.53  ? 1757 GLN A HE21   1 
ATOM   6539  H  HE22   . GLN A 1 395  ? -36.161 -55.118 22.257  1.00 37.53  ? 1757 GLN A HE22   1 
ATOM   6540  N  N      . TYR A 1 396  ? -32.662 -52.789 27.661  1.00 39.75  ? 1758 TYR A N      1 
ATOM   6541  C  CA     . TYR A 1 396  ? -32.004 -53.212 28.893  1.00 39.65  ? 1758 TYR A CA     1 
ATOM   6542  C  C      . TYR A 1 396  ? -31.629 -54.687 28.812  1.00 39.64  ? 1758 TYR A C      1 
ATOM   6543  O  O      . TYR A 1 396  ? -32.492 -55.564 28.890  1.00 42.14  ? 1758 TYR A O      1 
ATOM   6544  C  CB     . TYR A 1 396  ? -32.938 -52.969 30.094  1.00 40.08  ? 1758 TYR A CB     1 
ATOM   6545  C  CG     . TYR A 1 396  ? -32.325 -53.119 31.481  1.00 40.08  ? 1758 TYR A CG     1 
ATOM   6546  C  CD1    . TYR A 1 396  ? -31.689 -52.052 32.106  1.00 39.92  ? 1758 TYR A CD1    1 
ATOM   6547  C  CD2    . TYR A 1 396  ? -32.412 -54.321 32.176  1.00 40.33  ? 1758 TYR A CD2    1 
ATOM   6548  C  CE1    . TYR A 1 396  ? -31.142 -52.183 33.374  1.00 40.00  ? 1758 TYR A CE1    1 
ATOM   6549  C  CE2    . TYR A 1 396  ? -31.866 -54.457 33.444  1.00 40.42  ? 1758 TYR A CE2    1 
ATOM   6550  C  CZ     . TYR A 1 396  ? -31.237 -53.383 34.035  1.00 40.25  ? 1758 TYR A CZ     1 
ATOM   6551  O  OH     . TYR A 1 396  ? -30.693 -53.502 35.290  1.00 40.40  ? 1758 TYR A OH     1 
ATOM   6552  H  H      . TYR A 1 396  ? -33.495 -53.002 27.631  1.00 47.70  ? 1758 TYR A H      1 
ATOM   6553  H  HA     . TYR A 1 396  ? -31.194 -52.694 29.022  1.00 47.58  ? 1758 TYR A HA     1 
ATOM   6554  H  HB2    . TYR A 1 396  ? -33.284 -52.065 30.030  1.00 48.09  ? 1758 TYR A HB2    1 
ATOM   6555  H  HB3    . TYR A 1 396  ? -33.675 -53.598 30.036  1.00 48.09  ? 1758 TYR A HB3    1 
ATOM   6556  H  HD1    . TYR A 1 396  ? -31.623 -51.237 31.663  1.00 47.91  ? 1758 TYR A HD1    1 
ATOM   6557  H  HD2    . TYR A 1 396  ? -32.837 -55.048 31.781  1.00 48.40  ? 1758 TYR A HD2    1 
ATOM   6558  H  HE1    . TYR A 1 396  ? -30.716 -51.461 33.777  1.00 48.00  ? 1758 TYR A HE1    1 
ATOM   6559  H  HE2    . TYR A 1 396  ? -31.928 -55.268 33.895  1.00 48.50  ? 1758 TYR A HE2    1 
ATOM   6560  H  HH     . TYR A 1 396  ? -30.341 -52.775 35.522  1.00 48.48  ? 1758 TYR A HH     1 
ATOM   6561  N  N      . LYS A 1 397  ? -30.333 -54.947 28.655  1.00 35.95  ? 1759 LYS A N      1 
ATOM   6562  C  CA     . LYS A 1 397  ? -29.795 -56.291 28.792  1.00 35.97  ? 1759 LYS A CA     1 
ATOM   6563  C  C      . LYS A 1 397  ? -29.742 -56.566 30.281  1.00 36.16  ? 1759 LYS A C      1 
ATOM   6564  O  O      . LYS A 1 397  ? -29.458 -55.665 31.065  1.00 38.59  ? 1759 LYS A O      1 
ATOM   6565  C  CB     . LYS A 1 397  ? -28.415 -56.406 28.145  1.00 35.54  ? 1759 LYS A CB     1 
ATOM   6566  C  CG     . LYS A 1 397  ? -28.385 -55.985 26.690  1.00 35.40  ? 1759 LYS A CG     1 
ATOM   6567  C  CD     . LYS A 1 397  ? -29.230 -56.927 25.864  1.00 35.76  ? 1759 LYS A CD     1 
ATOM   6568  C  CE     . LYS A 1 397  ? -29.266 -56.542 24.406  1.00 36.83  ? 1759 LYS A CE     1 
ATOM   6569  N  NZ     . LYS A 1 397  ? -30.200 -57.446 23.685  1.00 38.02  1 1759 LYS A NZ     1 
ATOM   6570  H  H      . LYS A 1 397  ? -29.741 -54.353 28.467  1.00 43.14  ? 1759 LYS A H      1 
ATOM   6571  H  HA     . LYS A 1 397  ? -30.392 -56.931 28.374  1.00 43.17  ? 1759 LYS A HA     1 
ATOM   6572  H  HB2    . LYS A 1 397  ? -27.795 -55.839 28.631  1.00 42.64  ? 1759 LYS A HB2    1 
ATOM   6573  H  HB3    . LYS A 1 397  ? -28.123 -57.329 28.193  1.00 42.64  ? 1759 LYS A HB3    1 
ATOM   6574  H  HG2    . LYS A 1 397  ? -28.747 -55.089 26.603  1.00 42.48  ? 1759 LYS A HG2    1 
ATOM   6575  H  HG3    . LYS A 1 397  ? -27.474 -56.018 26.361  1.00 42.48  ? 1759 LYS A HG3    1 
ATOM   6576  H  HD2    . LYS A 1 397  ? -28.862 -57.822 25.930  1.00 42.91  ? 1759 LYS A HD2    1 
ATOM   6577  H  HD3    . LYS A 1 397  ? -30.139 -56.915 26.201  1.00 42.91  ? 1759 LYS A HD3    1 
ATOM   6578  H  HE2    . LYS A 1 397  ? -29.584 -55.630 24.316  1.00 44.20  ? 1759 LYS A HE2    1 
ATOM   6579  H  HE3    . LYS A 1 397  ? -28.381 -56.637 24.020  1.00 44.20  ? 1759 LYS A HE3    1 
ATOM   6580  H  HZ1    . LYS A 1 397  ? -30.230 -57.228 22.823  1.00 45.63  ? 1759 LYS A HZ1    1 
ATOM   6581  H  HZ2    . LYS A 1 397  ? -29.926 -58.290 23.761  1.00 45.63  ? 1759 LYS A HZ2    1 
ATOM   6582  H  HZ3    . LYS A 1 397  ? -31.018 -57.376 24.029  1.00 45.63  ? 1759 LYS A HZ3    1 
ATOM   6583  N  N      . PHE A 1 398  ? -30.046 -57.793 30.674  1.00 24.42  ? 1760 PHE A N      1 
ATOM   6584  C  CA     . PHE A 1 398  ? -30.277 -58.105 32.081  1.00 24.79  ? 1760 PHE A CA     1 
ATOM   6585  C  C      . PHE A 1 398  ? -29.062 -58.644 32.848  1.00 24.68  ? 1760 PHE A C      1 
ATOM   6586  O  O      . PHE A 1 398  ? -29.224 -59.214 33.926  1.00 25.10  ? 1760 PHE A O      1 
ATOM   6587  C  CB     . PHE A 1 398  ? -31.466 -59.054 32.199  1.00 25.41  ? 1760 PHE A CB     1 
ATOM   6588  C  CG     . PHE A 1 398  ? -32.781 -58.333 32.244  1.00 25.71  ? 1760 PHE A CG     1 
ATOM   6589  C  CD1    . PHE A 1 398  ? -33.239 -57.768 33.424  1.00 26.01  ? 1760 PHE A CD1    1 
ATOM   6590  C  CD2    . PHE A 1 398  ? -33.546 -58.194 31.104  1.00 25.75  ? 1760 PHE A CD2    1 
ATOM   6591  C  CE1    . PHE A 1 398  ? -34.446 -57.092 33.464  1.00 26.33  ? 1760 PHE A CE1    1 
ATOM   6592  C  CE2    . PHE A 1 398  ? -34.752 -57.520 31.139  1.00 26.07  ? 1760 PHE A CE2    1 
ATOM   6593  C  CZ     . PHE A 1 398  ? -35.201 -56.968 32.321  1.00 26.36  ? 1760 PHE A CZ     1 
ATOM   6594  H  H      . PHE A 1 398  ? -30.126 -58.468 30.146  1.00 29.30  ? 1760 PHE A H      1 
ATOM   6595  H  HA     . PHE A 1 398  ? -30.536 -57.281 32.523  1.00 29.75  ? 1760 PHE A HA     1 
ATOM   6596  H  HB2    . PHE A 1 398  ? -31.475 -59.646 31.432  1.00 30.49  ? 1760 PHE A HB2    1 
ATOM   6597  H  HB3    . PHE A 1 398  ? -31.378 -59.570 33.016  1.00 30.49  ? 1760 PHE A HB3    1 
ATOM   6598  H  HD1    . PHE A 1 398  ? -32.732 -57.849 34.199  1.00 31.21  ? 1760 PHE A HD1    1 
ATOM   6599  H  HD2    . PHE A 1 398  ? -33.250 -58.563 30.303  1.00 30.90  ? 1760 PHE A HD2    1 
ATOM   6600  H  HE1    . PHE A 1 398  ? -34.746 -56.722 34.262  1.00 31.60  ? 1760 PHE A HE1    1 
ATOM   6601  H  HE2    . PHE A 1 398  ? -35.261 -57.437 30.365  1.00 31.29  ? 1760 PHE A HE2    1 
ATOM   6602  H  HZ     . PHE A 1 398  ? -36.013 -56.515 32.345  1.00 31.63  ? 1760 PHE A HZ     1 
ATOM   6603  N  N      . GLU A 1 399  ? -27.859 -58.503 32.293  1.00 34.12  ? 1761 GLU A N      1 
ATOM   6604  C  CA     . GLU A 1 399  ? -26.658 -58.953 32.999  1.00 34.03  ? 1761 GLU A CA     1 
ATOM   6605  C  C      . GLU A 1 399  ? -26.691 -58.473 34.446  1.00 34.27  ? 1761 GLU A C      1 
ATOM   6606  O  O      . GLU A 1 399  ? -27.044 -57.330 34.721  1.00 34.21  ? 1761 GLU A O      1 
ATOM   6607  C  CB     . GLU A 1 399  ? -25.382 -58.425 32.332  1.00 33.46  ? 1761 GLU A CB     1 
ATOM   6608  C  CG     . GLU A 1 399  ? -25.290 -58.608 30.820  1.00 33.23  ? 1761 GLU A CG     1 
ATOM   6609  C  CD     . GLU A 1 399  ? -23.888 -58.335 30.281  1.00 32.78  ? 1761 GLU A CD     1 
ATOM   6610  O  OE1    . GLU A 1 399  ? -22.972 -58.064 31.090  1.00 36.35  ? 1761 GLU A OE1    1 
ATOM   6611  O  OE2    . GLU A 1 399  ? -23.705 -58.399 29.044  1.00 35.54  1 1761 GLU A OE2    1 
ATOM   6612  H  H      . GLU A 1 399  ? -27.711 -58.154 31.521  1.00 40.94  ? 1761 GLU A H      1 
ATOM   6613  H  HA     . GLU A 1 399  ? -26.627 -59.923 32.998  1.00 40.84  ? 1761 GLU A HA     1 
ATOM   6614  H  HB2    . GLU A 1 399  ? -25.316 -57.474 32.512  1.00 40.15  ? 1761 GLU A HB2    1 
ATOM   6615  H  HB3    . GLU A 1 399  ? -24.621 -58.880 32.725  1.00 40.15  ? 1761 GLU A HB3    1 
ATOM   6616  H  HG2    . GLU A 1 399  ? -25.525 -59.522 30.597  1.00 39.87  ? 1761 GLU A HG2    1 
ATOM   6617  H  HG3    . GLU A 1 399  ? -25.903 -57.992 30.389  1.00 39.87  ? 1761 GLU A HG3    1 
ATOM   6618  N  N      . TYR A 1 400  ? -26.318 -59.357 35.362  1.00 31.52  ? 1762 TYR A N      1 
ATOM   6619  C  CA     . TYR A 1 400  ? -26.377 -59.081 36.794  1.00 31.89  ? 1762 TYR A CA     1 
ATOM   6620  C  C      . TYR A 1 400  ? -25.245 -58.173 37.251  1.00 31.55  ? 1762 TYR A C      1 
ATOM   6621  O  O      . TYR A 1 400  ? -24.081 -58.471 37.020  1.00 31.26  ? 1762 TYR A O      1 
ATOM   6622  C  CB     . TYR A 1 400  ? -26.374 -60.406 37.565  1.00 32.48  ? 1762 TYR A CB     1 
ATOM   6623  C  CG     . TYR A 1 400  ? -26.081 -60.292 39.041  1.00 32.91  ? 1762 TYR A CG     1 
ATOM   6624  C  CD1    . TYR A 1 400  ? -26.957 -59.650 39.904  1.00 33.32  ? 1762 TYR A CD1    1 
ATOM   6625  C  CD2    . TYR A 1 400  ? -24.949 -60.887 39.579  1.00 32.99  ? 1762 TYR A CD2    1 
ATOM   6626  C  CE1    . TYR A 1 400  ? -26.687 -59.566 41.257  1.00 33.80  ? 1762 TYR A CE1    1 
ATOM   6627  C  CE2    . TYR A 1 400  ? -24.675 -60.812 40.923  1.00 33.46  ? 1762 TYR A CE2    1 
ATOM   6628  C  CZ     . TYR A 1 400  ? -25.547 -60.155 41.760  1.00 33.88  ? 1762 TYR A CZ     1 
ATOM   6629  O  OH     . TYR A 1 400  ? -25.276 -60.077 43.107  1.00 34.43  ? 1762 TYR A OH     1 
ATOM   6630  H  H      . TYR A 1 400  ? -26.019 -60.142 35.176  1.00 37.82  ? 1762 TYR A H      1 
ATOM   6631  H  HA     . TYR A 1 400  ? -27.213 -58.629 36.988  1.00 38.27  ? 1762 TYR A HA     1 
ATOM   6632  H  HB2    . TYR A 1 400  ? -27.248 -60.818 37.472  1.00 38.98  ? 1762 TYR A HB2    1 
ATOM   6633  H  HB3    . TYR A 1 400  ? -25.700 -60.986 37.177  1.00 38.98  ? 1762 TYR A HB3    1 
ATOM   6634  H  HD1    . TYR A 1 400  ? -27.725 -59.252 39.564  1.00 39.98  ? 1762 TYR A HD1    1 
ATOM   6635  H  HD2    . TYR A 1 400  ? -24.356 -61.331 39.017  1.00 39.59  ? 1762 TYR A HD2    1 
ATOM   6636  H  HE1    . TYR A 1 400  ? -27.276 -59.124 41.825  1.00 40.56  ? 1762 TYR A HE1    1 
ATOM   6637  H  HE2    . TYR A 1 400  ? -23.905 -61.206 41.265  1.00 40.15  ? 1762 TYR A HE2    1 
ATOM   6638  H  HH     . TYR A 1 400  ? -25.883 -59.647 43.498  1.00 41.31  ? 1762 TYR A HH     1 
ATOM   6639  N  N      . ILE A 1 401  ? -25.602 -57.045 37.862  1.00 24.79  ? 1763 ILE A N      1 
ATOM   6640  C  CA     . ILE A 1 401  ? -24.618 -56.059 38.317  1.00 24.55  ? 1763 ILE A CA     1 
ATOM   6641  C  C      . ILE A 1 401  ? -24.150 -56.169 39.780  1.00 25.00  ? 1763 ILE A C      1 
ATOM   6642  O  O      . ILE A 1 401  ? -23.086 -55.653 40.132  1.00 24.83  ? 1763 ILE A O      1 
ATOM   6643  C  CB     . ILE A 1 401  ? -25.197 -54.641 38.132  1.00 24.44  ? 1763 ILE A CB     1 
ATOM   6644  C  CG1    . ILE A 1 401  ? -25.650 -54.441 36.693  1.00 24.06  ? 1763 ILE A CG1    1 
ATOM   6645  C  CG2    . ILE A 1 401  ? -24.181 -53.564 38.487  1.00 24.23  ? 1763 ILE A CG2    1 
ATOM   6646  C  CD1    . ILE A 1 401  ? -26.353 -53.137 36.475  1.00 24.06  ? 1763 ILE A CD1    1 
ATOM   6647  H  H      . ILE A 1 401  ? -26.416 -56.824 38.028  1.00 29.74  ? 1763 ILE A H      1 
ATOM   6648  H  HA     . ILE A 1 401  ? -23.831 -56.130 37.755  1.00 29.46  ? 1763 ILE A HA     1 
ATOM   6649  H  HB     . ILE A 1 401  ? -25.967 -54.544 38.714  1.00 29.33  ? 1763 ILE A HB     1 
ATOM   6650  H  HG12   . ILE A 1 401  ? -24.873 -54.463 36.113  1.00 28.87  ? 1763 ILE A HG12   1 
ATOM   6651  H  HG13   . ILE A 1 401  ? -26.262 -55.155 36.454  1.00 28.87  ? 1763 ILE A HG13   1 
ATOM   6652  H  HG21   . ILE A 1 401  ? -24.586 -52.693 38.356  1.00 29.08  ? 1763 ILE A HG21   1 
ATOM   6653  H  HG22   . ILE A 1 401  ? -23.919 -53.671 39.415  1.00 29.08  ? 1763 ILE A HG22   1 
ATOM   6654  H  HG23   . ILE A 1 401  ? -23.406 -53.659 37.911  1.00 29.08  ? 1763 ILE A HG23   1 
ATOM   6655  H  HD11   . ILE A 1 401  ? -26.615 -53.072 35.544  1.00 28.88  ? 1763 ILE A HD11   1 
ATOM   6656  H  HD12   . ILE A 1 401  ? -27.139 -53.104 37.043  1.00 28.88  ? 1763 ILE A HD12   1 
ATOM   6657  H  HD13   . ILE A 1 401  ? -25.750 -52.412 36.702  1.00 28.88  ? 1763 ILE A HD13   1 
ATOM   6658  N  N      . GLY A 1 402  ? -24.879 -56.892 40.621  1.00 68.17  ? 1764 GLY A N      1 
ATOM   6659  C  CA     . GLY A 1 402  ? -24.551 -56.890 42.037  1.00 69.48  ? 1764 GLY A CA     1 
ATOM   6660  C  C      . GLY A 1 402  ? -24.900 -55.571 42.708  1.00 71.00  ? 1764 GLY A C      1 
ATOM   6661  O  O      . GLY A 1 402  ? -26.003 -55.037 42.543  1.00 71.94  ? 1764 GLY A O      1 
ATOM   6662  H  H      . GLY A 1 402  ? -25.552 -57.380 40.404  1.00 81.80  ? 1764 GLY A H      1 
ATOM   6663  H  HA2    . GLY A 1 402  ? -25.039 -57.601 42.483  1.00 83.37  ? 1764 GLY A HA2    1 
ATOM   6664  H  HA3    . GLY A 1 402  ? -23.601 -57.051 42.150  1.00 83.37  ? 1764 GLY A HA3    1 
ATOM   6665  N  N      . ILE A 1 403  ? -23.938 -55.057 43.473  1.00 26.44  ? 1765 ILE A N      1 
ATOM   6666  C  CA     . ILE A 1 403  ? -24.054 -53.778 44.183  1.00 26.69  ? 1765 ILE A CA     1 
ATOM   6667  C  C      . ILE A 1 403  ? -22.771 -52.987 43.979  1.00 26.24  ? 1765 ILE A C      1 
ATOM   6668  O  O      . ILE A 1 403  ? -21.911 -52.944 44.855  1.00 26.52  ? 1765 ILE A O      1 
ATOM   6669  C  CB     . ILE A 1 403  ? -24.314 -53.965 45.685  1.00 27.57  ? 1765 ILE A CB     1 
ATOM   6670  C  CG1    . ILE A 1 403  ? -25.655 -54.666 45.883  1.00 28.09  ? 1765 ILE A CG1    1 
ATOM   6671  C  CG2    . ILE A 1 403  ? -24.358 -52.606 46.422  1.00 27.89  ? 1765 ILE A CG2    1 
ATOM   6672  C  CD1    . ILE A 1 403  ? -25.900 -55.156 47.287  1.00 29.05  ? 1765 ILE A CD1    1 
ATOM   6673  H  H      . ILE A 1 403  ? -23.181 -55.444 43.601  1.00 31.73  ? 1765 ILE A H      1 
ATOM   6674  H  HA     . ILE A 1 403  ? -24.789 -53.268 43.808  1.00 32.03  ? 1765 ILE A HA     1 
ATOM   6675  H  HB     . ILE A 1 403  ? -23.608 -54.511 46.065  1.00 33.09  ? 1765 ILE A HB     1 
ATOM   6676  H  HG12   . ILE A 1 403  ? -26.366 -54.046 45.660  1.00 33.71  ? 1765 ILE A HG12   1 
ATOM   6677  H  HG13   . ILE A 1 403  ? -25.693 -55.434 45.292  1.00 33.71  ? 1765 ILE A HG13   1 
ATOM   6678  H  HG21   . ILE A 1 403  ? -24.524 -52.764 47.365  1.00 33.47  ? 1765 ILE A HG21   1 
ATOM   6679  H  HG22   . ILE A 1 403  ? -23.506 -52.157 46.306  1.00 33.47  ? 1765 ILE A HG22   1 
ATOM   6680  H  HG23   . ILE A 1 403  ? -25.071 -52.067 46.046  1.00 33.47  ? 1765 ILE A HG23   1 
ATOM   6681  H  HD11   . ILE A 1 403  ? -26.768 -55.587 47.324  1.00 34.86  ? 1765 ILE A HD11   1 
ATOM   6682  H  HD12   . ILE A 1 403  ? -25.205 -55.791 47.525  1.00 34.86  ? 1765 ILE A HD12   1 
ATOM   6683  H  HD13   . ILE A 1 403  ? -25.879 -54.399 47.894  1.00 34.86  ? 1765 ILE A HD13   1 
ATOM   6684  N  N      . PRO A 1 404  ? -22.625 -52.387 42.797  1.00 25.60  ? 1766 PRO A N      1 
ATOM   6685  C  CA     . PRO A 1 404  ? -21.446 -51.586 42.470  1.00 25.20  ? 1766 PRO A CA     1 
ATOM   6686  C  C      . PRO A 1 404  ? -21.480 -50.273 43.232  1.00 25.56  ? 1766 PRO A C      1 
ATOM   6687  O  O      . PRO A 1 404  ? -22.549 -49.926 43.731  1.00 26.01  ? 1766 PRO A O      1 
ATOM   6688  C  CB     . PRO A 1 404  ? -21.596 -51.356 40.968  1.00 24.56  ? 1766 PRO A CB     1 
ATOM   6689  C  CG     . PRO A 1 404  ? -23.080 -51.333 40.761  1.00 24.77  ? 1766 PRO A CG     1 
ATOM   6690  C  CD     . PRO A 1 404  ? -23.646 -52.328 41.738  1.00 25.33  ? 1766 PRO A CD     1 
ATOM   6691  H  HA     . PRO A 1 404  ? -20.626 -52.069 42.659  1.00 30.24  ? 1766 PRO A HA     1 
ATOM   6692  H  HB2    . PRO A 1 404  ? -21.198 -50.506 40.722  1.00 29.48  ? 1766 PRO A HB2    1 
ATOM   6693  H  HB3    . PRO A 1 404  ? -21.188 -52.087 40.478  1.00 29.48  ? 1766 PRO A HB3    1 
ATOM   6694  H  HG2    . PRO A 1 404  ? -23.420 -50.444 40.944  1.00 29.72  ? 1766 PRO A HG2    1 
ATOM   6695  H  HG3    . PRO A 1 404  ? -23.284 -51.596 39.850  1.00 29.72  ? 1766 PRO A HG3    1 
ATOM   6696  H  HD2    . PRO A 1 404  ? -24.488 -52.007 42.098  1.00 30.40  ? 1766 PRO A HD2    1 
ATOM   6697  H  HD3    . PRO A 1 404  ? -23.747 -53.196 41.317  1.00 30.40  ? 1766 PRO A HD3    1 
ATOM   6698  N  N      . GLU A 1 405  ? -20.367 -49.555 43.342  1.00 38.34  ? 1767 GLU A N      1 
ATOM   6699  C  CA     . GLU A 1 405  ? -20.456 -48.237 43.945  1.00 38.73  ? 1767 GLU A CA     1 
ATOM   6700  C  C      . GLU A 1 405  ? -21.012 -47.307 42.881  1.00 38.39  ? 1767 GLU A C      1 
ATOM   6701  O  O      . GLU A 1 405  ? -20.374 -47.037 41.861  1.00 37.87  ? 1767 GLU A O      1 
ATOM   6702  C  CB     . GLU A 1 405  ? -19.113 -47.741 44.476  1.00 38.83  ? 1767 GLU A CB     1 
ATOM   6703  C  CG     . GLU A 1 405  ? -18.578 -48.550 45.650  1.00 39.30  ? 1767 GLU A CG     1 
ATOM   6704  C  CD     . GLU A 1 405  ? -17.612 -47.760 46.527  1.00 40.87  ? 1767 GLU A CD     1 
ATOM   6705  O  OE1    . GLU A 1 405  ? -17.752 -46.517 46.612  1.00 43.87  ? 1767 GLU A OE1    1 
ATOM   6706  O  OE2    . GLU A 1 405  ? -16.722 -48.388 47.146  1.00 41.55  1 1767 GLU A OE2    1 
ATOM   6707  H  H      . GLU A 1 405  ? -19.583 -49.797 43.086  1.00 46.01  ? 1767 GLU A H      1 
ATOM   6708  H  HA     . GLU A 1 405  ? -21.084 -48.265 44.684  1.00 46.47  ? 1767 GLU A HA     1 
ATOM   6709  H  HB2    . GLU A 1 405  ? -18.458 -47.786 43.762  1.00 46.59  ? 1767 GLU A HB2    1 
ATOM   6710  H  HB3    . GLU A 1 405  ? -19.214 -46.822 44.771  1.00 46.59  ? 1767 GLU A HB3    1 
ATOM   6711  H  HG2    . GLU A 1 405  ? -19.323 -48.832 46.204  1.00 47.16  ? 1767 GLU A HG2    1 
ATOM   6712  H  HG3    . GLU A 1 405  ? -18.106 -49.326 45.309  1.00 47.16  ? 1767 GLU A HG3    1 
ATOM   6713  N  N      . ARG A 1 406  ? -22.207 -46.805 43.159  1.00 28.10  ? 1768 ARG A N      1 
ATOM   6714  C  CA     . ARG A 1 406  ? -22.997 -46.068 42.186  1.00 27.90  ? 1768 ARG A CA     1 
ATOM   6715  C  C      . ARG A 1 406  ? -22.586 -44.601 42.118  1.00 28.02  ? 1768 ARG A C      1 
ATOM   6716  O  O      . ARG A 1 406  ? -22.430 -43.947 43.148  1.00 28.58  ? 1768 ARG A O      1 
ATOM   6717  C  CB     . ARG A 1 406  ? -24.479 -46.200 42.545  1.00 28.35  ? 1768 ARG A CB     1 
ATOM   6718  C  CG     . ARG A 1 406  ? -25.041 -47.603 42.334  1.00 28.23  ? 1768 ARG A CG     1 
ATOM   6719  C  CD     . ARG A 1 406  ? -26.051 -47.593 41.215  1.00 27.98  ? 1768 ARG A CD     1 
ATOM   6720  N  NE     . ARG A 1 406  ? -25.499 -46.970 40.021  1.00 27.43  ? 1768 ARG A NE     1 
ATOM   6721  C  CZ     . ARG A 1 406  ? -26.210 -46.646 38.949  1.00 27.23  ? 1768 ARG A CZ     1 
ATOM   6722  N  NH1    . ARG A 1 406  ? -27.512 -46.875 38.917  1.00 27.52  1 1768 ARG A NH1    1 
ATOM   6723  N  NH2    . ARG A 1 406  ? -25.613 -46.074 37.914  1.00 26.82  ? 1768 ARG A NH2    1 
ATOM   6724  H  H      . ARG A 1 406  ? -22.591 -46.881 43.924  1.00 33.72  ? 1768 ARG A H      1 
ATOM   6725  H  HA     . ARG A 1 406  ? -22.864 -46.459 41.308  1.00 33.48  ? 1768 ARG A HA     1 
ATOM   6726  H  HB2    . ARG A 1 406  ? -24.596 -45.971 43.480  1.00 34.02  ? 1768 ARG A HB2    1 
ATOM   6727  H  HB3    . ARG A 1 406  ? -24.991 -45.590 41.991  1.00 34.02  ? 1768 ARG A HB3    1 
ATOM   6728  H  HG2    . ARG A 1 406  ? -24.321 -48.208 42.094  1.00 33.88  ? 1768 ARG A HG2    1 
ATOM   6729  H  HG3    . ARG A 1 406  ? -25.481 -47.902 43.145  1.00 33.88  ? 1768 ARG A HG3    1 
ATOM   6730  H  HD2    . ARG A 1 406  ? -26.300 -48.505 40.997  1.00 33.58  ? 1768 ARG A HD2    1 
ATOM   6731  H  HD3    . ARG A 1 406  ? -26.832 -47.087 41.491  1.00 33.58  ? 1768 ARG A HD3    1 
ATOM   6732  H  HE     . ARG A 1 406  ? -24.656 -46.801 40.010  1.00 32.91  ? 1768 ARG A HE     1 
ATOM   6733  H  HH11   . ARG A 1 406  ? -27.901 -47.243 39.590  1.00 33.03  ? 1768 ARG A HH11   1 
ATOM   6734  H  HH12   . ARG A 1 406  ? -27.969 -46.662 38.220  1.00 33.03  ? 1768 ARG A HH12   1 
ATOM   6735  H  HH21   . ARG A 1 406  ? -24.767 -45.923 37.935  1.00 32.18  ? 1768 ARG A HH21   1 
ATOM   6736  H  HH22   . ARG A 1 406  ? -26.071 -45.862 37.217  1.00 32.18  ? 1768 ARG A HH22   1 
ATOM   6737  N  N      . LEU A 1 407  ? -22.414 -44.085 40.904  1.00 25.36  ? 1769 LEU A N      1 
ATOM   6738  C  CA     . LEU A 1 407  ? -21.972 -42.702 40.733  1.00 25.52  ? 1769 LEU A CA     1 
ATOM   6739  C  C      . LEU A 1 407  ? -23.063 -41.691 41.056  1.00 26.09  ? 1769 LEU A C      1 
ATOM   6740  O  O      . LEU A 1 407  ? -24.234 -41.899 40.746  1.00 26.14  ? 1769 LEU A O      1 
ATOM   6741  C  CB     . LEU A 1 407  ? -21.454 -42.479 39.306  1.00 24.96  ? 1769 LEU A CB     1 
ATOM   6742  C  CG     . LEU A 1 407  ? -19.965 -42.782 39.107  1.00 24.59  ? 1769 LEU A CG     1 
ATOM   6743  C  CD1    . LEU A 1 407  ? -19.628 -44.258 39.266  1.00 24.28  ? 1769 LEU A CD1    1 
ATOM   6744  C  CD2    . LEU A 1 407  ? -19.536 -42.290 37.739  1.00 24.22  ? 1769 LEU A CD2    1 
ATOM   6745  H  H      . LEU A 1 407  ? -22.546 -44.509 40.168  1.00 30.44  ? 1769 LEU A H      1 
ATOM   6746  H  HA     . LEU A 1 407  ? -21.234 -42.538 41.340  1.00 30.62  ? 1769 LEU A HA     1 
ATOM   6747  H  HB2    . LEU A 1 407  ? -21.953 -43.051 38.703  1.00 29.95  ? 1769 LEU A HB2    1 
ATOM   6748  H  HB3    . LEU A 1 407  ? -21.599 -41.550 39.068  1.00 29.95  ? 1769 LEU A HB3    1 
ATOM   6749  H  HG     . LEU A 1 407  ? -19.456 -42.290 39.771  1.00 29.51  ? 1769 LEU A HG     1 
ATOM   6750  H  HD11   . LEU A 1 407  ? -18.676 -44.381 39.128  1.00 29.13  ? 1769 LEU A HD11   1 
ATOM   6751  H  HD12   . LEU A 1 407  ? -19.873 -44.543 40.160  1.00 29.13  ? 1769 LEU A HD12   1 
ATOM   6752  H  HD13   . LEU A 1 407  ? -20.126 -44.768 38.607  1.00 29.13  ? 1769 LEU A HD13   1 
ATOM   6753  H  HD21   . LEU A 1 407  ? -18.593 -42.484 37.616  1.00 29.06  ? 1769 LEU A HD21   1 
ATOM   6754  H  HD22   . LEU A 1 407  ? -20.059 -42.747 37.062  1.00 29.06  ? 1769 LEU A HD22   1 
ATOM   6755  H  HD23   . LEU A 1 407  ? -19.687 -41.334 37.686  1.00 29.06  ? 1769 LEU A HD23   1 
ATOM   6756  N  N      . ILE A 1 408  ? -22.657 -40.605 41.708  1.00 26.59  ? 1770 ILE A N      1 
ATOM   6757  C  CA     . ILE A 1 408  ? -23.552 -39.499 42.016  1.00 27.23  ? 1770 ILE A CA     1 
ATOM   6758  C  C      . ILE A 1 408  ? -24.057 -38.912 40.720  1.00 26.99  ? 1770 ILE A C      1 
ATOM   6759  O  O      . ILE A 1 408  ? -23.299 -38.782 39.765  1.00 26.53  ? 1770 ILE A O      1 
ATOM   6760  C  CB     . ILE A 1 408  ? -22.855 -38.384 42.826  1.00 27.83  ? 1770 ILE A CB     1 
ATOM   6761  C  CG1    . ILE A 1 408  ? -22.296 -38.915 44.150  1.00 28.16  ? 1770 ILE A CG1    1 
ATOM   6762  C  CG2    . ILE A 1 408  ? -23.817 -37.220 43.068  1.00 28.55  ? 1770 ILE A CG2    1 
ATOM   6763  C  CD1    . ILE A 1 408  ? -23.299 -39.637 45.013  1.00 28.54  ? 1770 ILE A CD1    1 
ATOM   6764  H  H      . ILE A 1 408  ? -21.852 -40.485 41.987  1.00 31.91  ? 1770 ILE A H      1 
ATOM   6765  H  HA     . ILE A 1 408  ? -24.310 -39.825 42.525  1.00 32.67  ? 1770 ILE A HA     1 
ATOM   6766  H  HB     . ILE A 1 408  ? -22.111 -38.052 42.299  1.00 33.40  ? 1770 ILE A HB     1 
ATOM   6767  H  HG12   . ILE A 1 408  ? -21.576 -39.536 43.955  1.00 33.80  ? 1770 ILE A HG12   1 
ATOM   6768  H  HG13   . ILE A 1 408  ? -21.951 -38.168 44.663  1.00 33.80  ? 1770 ILE A HG13   1 
ATOM   6769  H  HG21   . ILE A 1 408  ? -23.359 -36.533 43.577  1.00 34.26  ? 1770 ILE A HG21   1 
ATOM   6770  H  HG22   . ILE A 1 408  ? -24.102 -36.864 42.212  1.00 34.26  ? 1770 ILE A HG22   1 
ATOM   6771  H  HG23   . ILE A 1 408  ? -24.585 -37.544 43.564  1.00 34.26  ? 1770 ILE A HG23   1 
ATOM   6772  H  HD11   . ILE A 1 408  ? -22.860 -39.937 45.824  1.00 34.25  ? 1770 ILE A HD11   1 
ATOM   6773  H  HD12   . ILE A 1 408  ? -24.022 -39.028 45.232  1.00 34.25  ? 1770 ILE A HD12   1 
ATOM   6774  H  HD13   . ILE A 1 408  ? -23.646 -40.399 44.523  1.00 34.25  ? 1770 ILE A HD13   1 
ATOM   6775  N  N      . TYR A 1 409  ? -25.332 -38.562 40.676  1.00 27.35  ? 1771 TYR A N      1 
ATOM   6776  C  CA     . TYR A 1 409  ? -25.879 -37.970 39.476  1.00 27.24  ? 1771 TYR A CA     1 
ATOM   6777  C  C      . TYR A 1 409  ? -25.481 -36.505 39.387  1.00 27.69  ? 1771 TYR A C      1 
ATOM   6778  O  O      . TYR A 1 409  ? -25.785 -35.711 40.276  1.00 28.41  ? 1771 TYR A O      1 
ATOM   6779  C  CB     . TYR A 1 409  ? -27.396 -38.122 39.453  1.00 27.52  ? 1771 TYR A CB     1 
ATOM   6780  C  CG     . TYR A 1 409  ? -27.830 -39.420 38.825  1.00 26.97  ? 1771 TYR A CG     1 
ATOM   6781  C  CD1    . TYR A 1 409  ? -27.672 -40.617 39.502  1.00 26.80  ? 1771 TYR A CD1    1 
ATOM   6782  C  CD2    . TYR A 1 409  ? -28.388 -39.454 37.555  1.00 26.68  ? 1771 TYR A CD2    1 
ATOM   6783  C  CE1    . TYR A 1 409  ? -28.057 -41.815 38.938  1.00 26.37  ? 1771 TYR A CE1    1 
ATOM   6784  C  CE2    . TYR A 1 409  ? -28.780 -40.650 36.981  1.00 26.25  ? 1771 TYR A CE2    1 
ATOM   6785  C  CZ     . TYR A 1 409  ? -28.610 -41.826 37.678  1.00 26.10  ? 1771 TYR A CZ     1 
ATOM   6786  O  OH     . TYR A 1 409  ? -28.996 -43.023 37.124  1.00 25.75  ? 1771 TYR A OH     1 
ATOM   6787  H  H      . TYR A 1 409  ? -25.894 -38.656 41.321  1.00 32.82  ? 1771 TYR A H      1 
ATOM   6788  H  HA     . TYR A 1 409  ? -25.517 -38.428 38.701  1.00 32.68  ? 1771 TYR A HA     1 
ATOM   6789  H  HB2    . TYR A 1 409  ? -27.732 -38.101 40.363  1.00 33.03  ? 1771 TYR A HB2    1 
ATOM   6790  H  HB3    . TYR A 1 409  ? -27.781 -37.395 38.939  1.00 33.03  ? 1771 TYR A HB3    1 
ATOM   6791  H  HD1    . TYR A 1 409  ? -27.297 -40.614 40.353  1.00 32.16  ? 1771 TYR A HD1    1 
ATOM   6792  H  HD2    . TYR A 1 409  ? -28.502 -38.661 37.084  1.00 32.02  ? 1771 TYR A HD2    1 
ATOM   6793  H  HE1    . TYR A 1 409  ? -27.945 -42.610 39.407  1.00 31.65  ? 1771 TYR A HE1    1 
ATOM   6794  H  HE2    . TYR A 1 409  ? -29.154 -40.660 36.130  1.00 31.50  ? 1771 TYR A HE2    1 
ATOM   6795  H  HH     . TYR A 1 409  ? -28.838 -43.652 37.658  1.00 30.89  ? 1771 TYR A HH     1 
ATOM   6796  N  N      . THR A 1 410  ? -24.799 -36.158 38.301  1.00 34.93  ? 1772 THR A N      1 
ATOM   6797  C  CA     . THR A 1 410  ? -24.498 -34.769 37.995  1.00 35.40  ? 1772 THR A CA     1 
ATOM   6798  C  C      . THR A 1 410  ? -24.854 -34.551 36.529  1.00 35.15  ? 1772 THR A C      1 
ATOM   6799  O  O      . THR A 1 410  ? -24.854 -35.501 35.743  1.00 34.51  ? 1772 THR A O      1 
ATOM   6800  C  CB     . THR A 1 410  ? -23.008 -34.397 38.227  1.00 35.38  ? 1772 THR A CB     1 
ATOM   6801  O  OG1    . THR A 1 410  ? -22.215 -34.808 37.107  1.00 34.73  ? 1772 THR A OG1    1 
ATOM   6802  C  CG2    . THR A 1 410  ? -22.468 -35.026 39.501  1.00 35.42  ? 1772 THR A CG2    1 
ATOM   6803  H  H      . THR A 1 410  ? -24.496 -36.717 37.721  1.00 41.92  ? 1772 THR A H      1 
ATOM   6804  H  HA     . THR A 1 410  ? -25.051 -34.188 38.540  1.00 42.48  ? 1772 THR A HA     1 
ATOM   6805  H  HB     . THR A 1 410  ? -22.939 -33.434 38.321  1.00 42.46  ? 1772 THR A HB     1 
ATOM   6806  H  HG1    . THR A 1 410  ? -21.410 -34.606 37.235  1.00 41.68  ? 1772 THR A HG1    1 
ATOM   6807  H  HG21   . THR A 1 410  ? -21.538 -34.780 39.624  1.00 42.50  ? 1772 THR A HG21   1 
ATOM   6808  H  HG22   . THR A 1 410  ? -22.980 -34.718 40.265  1.00 42.50  ? 1772 THR A HG22   1 
ATOM   6809  H  HG23   . THR A 1 410  ? -22.534 -35.993 39.447  1.00 42.50  ? 1772 THR A HG23   1 
ATOM   6810  N  N      . PRO A 1 411  ? -25.160 -33.303 36.151  1.00 34.61  ? 1773 PRO A N      1 
ATOM   6811  C  CA     . PRO A 1 411  ? -25.512 -32.979 34.765  1.00 34.52  ? 1773 PRO A CA     1 
ATOM   6812  C  C      . PRO A 1 411  ? -24.445 -33.398 33.748  1.00 33.90  ? 1773 PRO A C      1 
ATOM   6813  O  O      . PRO A 1 411  ? -24.795 -33.702 32.608  1.00 33.62  ? 1773 PRO A O      1 
ATOM   6814  C  CB     . PRO A 1 411  ? -25.678 -31.459 34.800  1.00 35.38  ? 1773 PRO A CB     1 
ATOM   6815  C  CG     . PRO A 1 411  ? -26.110 -31.177 36.187  1.00 35.95  ? 1773 PRO A CG     1 
ATOM   6816  C  CD     . PRO A 1 411  ? -25.389 -32.161 37.051  1.00 35.48  ? 1773 PRO A CD     1 
ATOM   6817  H  HA     . PRO A 1 411  ? -26.359 -33.389 34.528  1.00 41.42  ? 1773 PRO A HA     1 
ATOM   6818  H  HB2    . PRO A 1 411  ? -24.829 -31.030 34.608  1.00 42.46  ? 1773 PRO A HB2    1 
ATOM   6819  H  HB3    . PRO A 1 411  ? -26.357 -31.186 34.163  1.00 42.46  ? 1773 PRO A HB3    1 
ATOM   6820  H  HG2    . PRO A 1 411  ? -25.863 -30.269 36.425  1.00 43.13  ? 1773 PRO A HG2    1 
ATOM   6821  H  HG3    . PRO A 1 411  ? -27.069 -31.299 36.259  1.00 43.13  ? 1773 PRO A HG3    1 
ATOM   6822  H  HD2    . PRO A 1 411  ? -24.543 -31.792 37.351  1.00 42.58  ? 1773 PRO A HD2    1 
ATOM   6823  H  HD3    . PRO A 1 411  ? -25.946 -32.427 37.799  1.00 42.58  ? 1773 PRO A HD3    1 
ATOM   6824  N  N      . LEU A 1 412  ? -23.175 -33.425 34.148  1.00 43.36  ? 1774 LEU A N      1 
ATOM   6825  C  CA     . LEU A 1 412  ? -22.120 -33.874 33.241  1.00 42.81  ? 1774 LEU A CA     1 
ATOM   6826  C  C      . LEU A 1 412  ? -22.279 -35.348 32.917  1.00 42.07  ? 1774 LEU A C      1 
ATOM   6827  O  O      . LEU A 1 412  ? -22.138 -35.756 31.764  1.00 41.70  ? 1774 LEU A O      1 
ATOM   6828  C  CB     . LEU A 1 412  ? -20.730 -33.616 33.826  1.00 42.86  ? 1774 LEU A CB     1 
ATOM   6829  C  CG     . LEU A 1 412  ? -19.600 -34.406 33.146  1.00 42.22  ? 1774 LEU A CG     1 
ATOM   6830  C  CD1    . LEU A 1 412  ? -19.312 -33.872 31.756  1.00 42.27  ? 1774 LEU A CD1    1 
ATOM   6831  C  CD2    . LEU A 1 412  ? -18.355 -34.326 33.996  1.00 42.28  ? 1774 LEU A CD2    1 
ATOM   6832  H  H      . LEU A 1 412  ? -22.900 -33.192 34.929  1.00 52.03  ? 1774 LEU A H      1 
ATOM   6833  H  HA     . LEU A 1 412  ? -22.190 -33.378 32.411  1.00 51.37  ? 1774 LEU A HA     1 
ATOM   6834  H  HB2    . LEU A 1 412  ? -20.526 -32.672 33.736  1.00 51.43  ? 1774 LEU A HB2    1 
ATOM   6835  H  HB3    . LEU A 1 412  ? -20.738 -33.860 34.765  1.00 51.43  ? 1774 LEU A HB3    1 
ATOM   6836  H  HG     . LEU A 1 412  ? -19.859 -35.338 33.069  1.00 50.66  ? 1774 LEU A HG     1 
ATOM   6837  H  HD11   . LEU A 1 412  ? -18.596 -34.394 31.360  1.00 50.72  ? 1774 LEU A HD11   1 
ATOM   6838  H  HD12   . LEU A 1 412  ? -20.114 -33.948 31.217  1.00 50.72  ? 1774 LEU A HD12   1 
ATOM   6839  H  HD13   . LEU A 1 412  ? -19.045 -32.942 31.824  1.00 50.72  ? 1774 LEU A HD13   1 
ATOM   6840  H  HD21   . LEU A 1 412  ? -17.645 -34.825 33.564  1.00 50.74  ? 1774 LEU A HD21   1 
ATOM   6841  H  HD22   . LEU A 1 412  ? -18.096 -33.396 34.089  1.00 50.74  ? 1774 LEU A HD22   1 
ATOM   6842  H  HD23   . LEU A 1 412  ? -18.543 -34.706 34.869  1.00 50.74  ? 1774 LEU A HD23   1 
ATOM   6843  N  N      . LEU A 1 413  ? -22.544 -36.148 33.937  1.00 25.84  ? 1775 LEU A N      1 
ATOM   6844  C  CA     . LEU A 1 413  ? -22.762 -37.565 33.738  1.00 25.25  ? 1775 LEU A CA     1 
ATOM   6845  C  C      . LEU A 1 413  ? -24.002 -37.813 32.877  1.00 25.21  ? 1775 LEU A C      1 
ATOM   6846  O  O      . LEU A 1 413  ? -24.019 -38.734 32.058  1.00 24.74  ? 1775 LEU A O      1 
ATOM   6847  C  CB     . LEU A 1 413  ? -22.879 -38.266 35.083  1.00 25.27  ? 1775 LEU A CB     1 
ATOM   6848  C  CG     . LEU A 1 413  ? -23.157 -39.761 35.009  1.00 24.78  ? 1775 LEU A CG     1 
ATOM   6849  C  CD1    . LEU A 1 413  ? -22.227 -40.524 35.927  1.00 24.60  ? 1775 LEU A CD1    1 
ATOM   6850  C  CD2    . LEU A 1 413  ? -24.606 -40.001 35.384  1.00 25.06  ? 1775 LEU A CD2    1 
ATOM   6851  H  H      . LEU A 1 413  ? -22.603 -35.892 34.756  1.00 31.01  ? 1775 LEU A H      1 
ATOM   6852  H  HA     . LEU A 1 413  ? -21.997 -37.938 33.273  1.00 30.30  ? 1775 LEU A HA     1 
ATOM   6853  H  HB2    . LEU A 1 413  ? -22.046 -38.147 35.566  1.00 30.33  ? 1775 LEU A HB2    1 
ATOM   6854  H  HB3    . LEU A 1 413  ? -23.604 -37.858 35.581  1.00 30.33  ? 1775 LEU A HB3    1 
ATOM   6855  H  HG     . LEU A 1 413  ? -23.018 -40.073 34.101  1.00 29.73  ? 1775 LEU A HG     1 
ATOM   6856  H  HD11   . LEU A 1 413  ? -22.425 -41.471 35.860  1.00 29.52  ? 1775 LEU A HD11   1 
ATOM   6857  H  HD12   . LEU A 1 413  ? -21.310 -40.358 35.656  1.00 29.52  ? 1775 LEU A HD12   1 
ATOM   6858  H  HD13   . LEU A 1 413  ? -22.363 -40.220 36.838  1.00 29.52  ? 1775 LEU A HD13   1 
ATOM   6859  H  HD21   . LEU A 1 413  ? -24.790 -40.953 35.339  1.00 30.07  ? 1775 LEU A HD21   1 
ATOM   6860  H  HD22   . LEU A 1 413  ? -24.757 -39.677 36.286  1.00 30.07  ? 1775 LEU A HD22   1 
ATOM   6861  H  HD23   . LEU A 1 413  ? -25.176 -39.524 34.761  1.00 30.07  ? 1775 LEU A HD23   1 
ATOM   6862  N  N      . LEU A 1 414  ? -25.036 -36.990 33.051  1.00 25.76  ? 1776 LEU A N      1 
ATOM   6863  C  CA     . LEU A 1 414  ? -26.226 -37.090 32.205  1.00 25.82  ? 1776 LEU A CA     1 
ATOM   6864  C  C      . LEU A 1 414  ? -25.982 -36.701 30.756  1.00 25.75  ? 1776 LEU A C      1 
ATOM   6865  O  O      . LEU A 1 414  ? -26.532 -37.322 29.849  1.00 25.53  ? 1776 LEU A O      1 
ATOM   6866  C  CB     . LEU A 1 414  ? -27.366 -36.223 32.751  1.00 26.52  ? 1776 LEU A CB     1 
ATOM   6867  C  CG     . LEU A 1 414  ? -28.045 -36.676 34.041  1.00 26.72  ? 1776 LEU A CG     1 
ATOM   6868  C  CD1    . LEU A 1 414  ? -29.131 -35.691 34.440  1.00 27.49  ? 1776 LEU A CD1    1 
ATOM   6869  C  CD2    . LEU A 1 414  ? -28.633 -38.063 33.873  1.00 26.29  ? 1776 LEU A CD2    1 
ATOM   6870  H  H      . LEU A 1 414  ? -25.075 -36.371 33.647  1.00 30.91  ? 1776 LEU A H      1 
ATOM   6871  H  HA     . LEU A 1 414  ? -26.530 -38.010 32.212  1.00 30.99  ? 1776 LEU A HA     1 
ATOM   6872  H  HB2    . LEU A 1 414  ? -27.014 -35.334 32.913  1.00 31.82  ? 1776 LEU A HB2    1 
ATOM   6873  H  HB3    . LEU A 1 414  ? -28.055 -36.172 32.071  1.00 31.82  ? 1776 LEU A HB3    1 
ATOM   6874  H  HG     . LEU A 1 414  ? -27.388 -36.709 34.754  1.00 32.07  ? 1776 LEU A HG     1 
ATOM   6875  H  HD11   . LEU A 1 414  ? -29.549 -35.997 35.260  1.00 32.99  ? 1776 LEU A HD11   1 
ATOM   6876  H  HD12   . LEU A 1 414  ? -28.730 -34.819 34.578  1.00 32.99  ? 1776 LEU A HD12   1 
ATOM   6877  H  HD13   . LEU A 1 414  ? -29.790 -35.643 33.730  1.00 32.99  ? 1776 LEU A HD13   1 
ATOM   6878  H  HD21   . LEU A 1 414  ? -29.058 -38.328 34.703  1.00 31.55  ? 1776 LEU A HD21   1 
ATOM   6879  H  HD22   . LEU A 1 414  ? -29.287 -38.043 33.157  1.00 31.55  ? 1776 LEU A HD22   1 
ATOM   6880  H  HD23   . LEU A 1 414  ? -27.920 -38.683 33.653  1.00 31.55  ? 1776 LEU A HD23   1 
ATOM   6881  N  N      . ILE A 1 415  ? -25.152 -35.691 30.525  1.00 35.01  ? 1777 ILE A N      1 
ATOM   6882  C  CA     . ILE A 1 415  ? -24.830 -35.309 29.159  1.00 35.02  ? 1777 ILE A CA     1 
ATOM   6883  C  C      . ILE A 1 415  ? -24.006 -36.421 28.540  1.00 34.35  ? 1777 ILE A C      1 
ATOM   6884  O  O      . ILE A 1 415  ? -24.219 -36.785 27.391  1.00 36.23  ? 1777 ILE A O      1 
ATOM   6885  C  CB     . ILE A 1 415  ? -24.063 -33.971 29.087  1.00 35.54  ? 1777 ILE A CB     1 
ATOM   6886  C  CG1    . ILE A 1 415  ? -25.017 -32.810 29.390  1.00 39.40  ? 1777 ILE A CG1    1 
ATOM   6887  C  CG2    . ILE A 1 415  ? -23.409 -33.792 27.711  1.00 35.48  ? 1777 ILE A CG2    1 
ATOM   6888  C  CD1    . ILE A 1 415  ? -24.354 -31.442 29.455  1.00 43.30  ? 1777 ILE A CD1    1 
ATOM   6889  H  H      . ILE A 1 415  ? -24.768 -35.218 31.132  1.00 42.01  ? 1777 ILE A H      1 
ATOM   6890  H  HA     . ILE A 1 415  ? -25.650 -35.218 28.650  1.00 42.03  ? 1777 ILE A HA     1 
ATOM   6891  H  HB     . ILE A 1 415  ? -23.365 -33.979 29.760  1.00 42.64  ? 1777 ILE A HB     1 
ATOM   6892  H  HG12   . ILE A 1 415  ? -25.693 -32.775 28.695  1.00 47.28  ? 1777 ILE A HG12   1 
ATOM   6893  H  HG13   . ILE A 1 415  ? -25.440 -32.972 30.247  1.00 47.28  ? 1777 ILE A HG13   1 
ATOM   6894  H  HG21   . ILE A 1 415  ? -22.936 -32.946 27.694  1.00 42.58  ? 1777 ILE A HG21   1 
ATOM   6895  H  HG22   . ILE A 1 415  ? -22.788 -34.522 27.559  1.00 42.58  ? 1777 ILE A HG22   1 
ATOM   6896  H  HG23   . ILE A 1 415  ? -24.100 -33.799 27.030  1.00 42.58  ? 1777 ILE A HG23   1 
ATOM   6897  H  HD11   . ILE A 1 415  ? -25.029 -30.773 29.650  1.00 51.96  ? 1777 ILE A HD11   1 
ATOM   6898  H  HD12   . ILE A 1 415  ? -23.684 -31.450 30.156  1.00 51.96  ? 1777 ILE A HD12   1 
ATOM   6899  H  HD13   . ILE A 1 415  ? -23.937 -31.252 28.600  1.00 51.96  ? 1777 ILE A HD13   1 
ATOM   6900  N  N      . GLY A 1 416  ? -23.089 -36.982 29.322  1.00 31.26  ? 1778 GLY A N      1 
ATOM   6901  C  CA     . GLY A 1 416  ? -22.278 -38.095 28.866  1.00 30.66  ? 1778 GLY A CA     1 
ATOM   6902  C  C      . GLY A 1 416  ? -23.152 -39.259 28.450  1.00 30.35  ? 1778 GLY A C      1 
ATOM   6903  O  O      . GLY A 1 416  ? -22.898 -39.913 27.436  1.00 30.05  ? 1778 GLY A O      1 
ATOM   6904  H  H      . GLY A 1 416  ? -22.919 -36.731 30.127  1.00 37.51  ? 1778 GLY A H      1 
ATOM   6905  H  HA2    . GLY A 1 416  ? -21.740 -37.820 28.107  1.00 36.80  ? 1778 GLY A HA2    1 
ATOM   6906  H  HA3    . GLY A 1 416  ? -21.688 -38.386 29.579  1.00 36.80  ? 1778 GLY A HA3    1 
ATOM   6907  N  N      . PHE A 1 417  ? -24.187 -39.518 29.238  1.00 27.28  ? 1779 PHE A N      1 
ATOM   6908  C  CA     . PHE A 1 417  ? -25.165 -40.531 28.883  1.00 27.11  ? 1779 PHE A CA     1 
ATOM   6909  C  C      . PHE A 1 417  ? -25.856 -40.175 27.576  1.00 27.31  ? 1779 PHE A C      1 
ATOM   6910  O  O      . PHE A 1 417  ? -26.229 -41.059 26.807  1.00 27.11  ? 1779 PHE A O      1 
ATOM   6911  C  CB     . PHE A 1 417  ? -26.202 -40.699 29.998  1.00 27.36  ? 1779 PHE A CB     1 
ATOM   6912  C  CG     . PHE A 1 417  ? -25.688 -41.417 31.219  1.00 27.17  ? 1779 PHE A CG     1 
ATOM   6913  C  CD1    . PHE A 1 417  ? -24.365 -41.831 31.305  1.00 26.80  ? 1779 PHE A CD1    1 
ATOM   6914  C  CD2    . PHE A 1 417  ? -26.543 -41.703 32.270  1.00 27.42  ? 1779 PHE A CD2    1 
ATOM   6915  C  CE1    . PHE A 1 417  ? -23.903 -42.499 32.421  1.00 26.70  ? 1779 PHE A CE1    1 
ATOM   6916  C  CE2    . PHE A 1 417  ? -26.087 -42.371 33.387  1.00 27.34  ? 1779 PHE A CE2    1 
ATOM   6917  C  CZ     . PHE A 1 417  ? -24.764 -42.773 33.460  1.00 26.98  ? 1779 PHE A CZ     1 
ATOM   6918  H  H      . PHE A 1 417  ? -24.345 -39.120 29.983  1.00 32.74  ? 1779 PHE A H      1 
ATOM   6919  H  HA     . PHE A 1 417  ? -24.712 -41.380 28.763  1.00 32.54  ? 1779 PHE A HA     1 
ATOM   6920  H  HB2    . PHE A 1 417  ? -26.502 -39.820 30.278  1.00 32.83  ? 1779 PHE A HB2    1 
ATOM   6921  H  HB3    . PHE A 1 417  ? -26.952 -41.206 29.651  1.00 32.83  ? 1779 PHE A HB3    1 
ATOM   6922  H  HD1    . PHE A 1 417  ? -23.781 -41.649 30.604  1.00 32.16  ? 1779 PHE A HD1    1 
ATOM   6923  H  HD2    . PHE A 1 417  ? -27.433 -41.437 32.225  1.00 32.91  ? 1779 PHE A HD2    1 
ATOM   6924  H  HE1    . PHE A 1 417  ? -23.014 -42.767 32.470  1.00 32.03  ? 1779 PHE A HE1    1 
ATOM   6925  H  HE2    . PHE A 1 417  ? -26.669 -42.554 34.089  1.00 32.81  ? 1779 PHE A HE2    1 
ATOM   6926  H  HZ     . PHE A 1 417  ? -24.455 -43.221 34.215  1.00 32.37  ? 1779 PHE A HZ     1 
ATOM   6927  N  N      . ALA A 1 418  ? -26.020 -38.882 27.329  1.00 24.71  ? 1780 ALA A N      1 
ATOM   6928  C  CA     . ALA A 1 418  ? -26.735 -38.417 26.147  1.00 25.03  ? 1780 ALA A CA     1 
ATOM   6929  C  C      . ALA A 1 418  ? -25.890 -38.554 24.884  1.00 24.86  ? 1780 ALA A C      1 
ATOM   6930  O  O      . ALA A 1 418  ? -26.409 -38.874 23.821  1.00 24.92  ? 1780 ALA A O      1 
ATOM   6931  C  CB     . ALA A 1 418  ? -27.187 -36.989 26.319  1.00 25.69  ? 1780 ALA A CB     1 
ATOM   6932  H  H      . ALA A 1 418  ? -25.726 -38.249 27.832  1.00 29.65  ? 1780 ALA A H      1 
ATOM   6933  H  HA     . ALA A 1 418  ? -27.528 -38.964 26.030  1.00 30.04  ? 1780 ALA A HA     1 
ATOM   6934  H  HB1    . ALA A 1 418  ? -27.658 -36.709 25.518  1.00 30.83  ? 1780 ALA A HB1    1 
ATOM   6935  H  HB2    . ALA A 1 418  ? -27.777 -36.935 27.087  1.00 30.83  ? 1780 ALA A HB2    1 
ATOM   6936  H  HB3    . ALA A 1 418  ? -26.409 -36.426 26.459  1.00 30.83  ? 1780 ALA A HB3    1 
ATOM   6937  N  N      . THR A 1 419  ? -24.589 -38.294 24.986  1.00 40.78  ? 1781 THR A N      1 
ATOM   6938  C  CA     . THR A 1 419  ? -23.728 -38.382 23.810  1.00 40.69  ? 1781 THR A CA     1 
ATOM   6939  C  C      . THR A 1 419  ? -23.521 -39.836 23.451  1.00 40.16  ? 1781 THR A C      1 
ATOM   6940  O  O      . THR A 1 419  ? -23.440 -40.195 22.278  1.00 40.16  ? 1781 THR A O      1 
ATOM   6941  C  CB     . THR A 1 419  ? -22.342 -37.739 24.028  1.00 40.72  ? 1781 THR A CB     1 
ATOM   6942  O  OG1    . THR A 1 419  ? -21.522 -38.607 24.820  1.00 40.20  ? 1781 THR A OG1    1 
ATOM   6943  C  CG2    . THR A 1 419  ? -22.466 -36.390 24.707  1.00 41.36  ? 1781 THR A CG2    1 
ATOM   6944  H  H      . THR A 1 419  ? -24.185 -38.069 25.712  1.00 48.94  ? 1781 THR A H      1 
ATOM   6945  H  HA     . THR A 1 419  ? -24.158 -37.939 23.062  1.00 48.83  ? 1781 THR A HA     1 
ATOM   6946  H  HB     . THR A 1 419  ? -21.918 -37.603 23.166  1.00 48.86  ? 1781 THR A HB     1 
ATOM   6947  H  HG1    . THR A 1 419  ? -21.882 -38.740 25.567  1.00 48.24  ? 1781 THR A HG1    1 
ATOM   6948  H  HG21   . THR A 1 419  ? -21.586 -36.002 24.835  1.00 49.63  ? 1781 THR A HG21   1 
ATOM   6949  H  HG22   . THR A 1 419  ? -22.998 -35.791 24.160  1.00 49.63  ? 1781 THR A HG22   1 
ATOM   6950  H  HG23   . THR A 1 419  ? -22.895 -36.492 25.571  1.00 49.63  ? 1781 THR A HG23   1 
ATOM   6951  N  N      . LEU A 1 420  ? -23.442 -40.672 24.477  1.00 23.94  ? 1782 LEU A N      1 
ATOM   6952  C  CA     . LEU A 1 420  ? -23.247 -42.095 24.276  1.00 23.49  ? 1782 LEU A CA     1 
ATOM   6953  C  C      . LEU A 1 420  ? -24.503 -42.713 23.679  1.00 23.59  ? 1782 LEU A C      1 
ATOM   6954  O  O      . LEU A 1 420  ? -24.416 -43.501 22.741  1.00 23.47  ? 1782 LEU A O      1 
ATOM   6955  C  CB     . LEU A 1 420  ? -22.849 -42.768 25.598  1.00 23.17  ? 1782 LEU A CB     1 
ATOM   6956  C  CG     . LEU A 1 420  ? -21.377 -42.575 25.980  1.00 22.99  ? 1782 LEU A CG     1 
ATOM   6957  C  CD1    . LEU A 1 420  ? -21.083 -43.145 27.345  1.00 22.79  ? 1782 LEU A CD1    1 
ATOM   6958  C  CD2    . LEU A 1 420  ? -20.475 -43.246 24.970  1.00 22.74  ? 1782 LEU A CD2    1 
ATOM   6959  H  H      . LEU A 1 420  ? -23.498 -40.438 25.302  1.00 28.72  ? 1782 LEU A H      1 
ATOM   6960  H  HA     . LEU A 1 420  ? -22.522 -42.227 23.645  1.00 28.19  ? 1782 LEU A HA     1 
ATOM   6961  H  HB2    . LEU A 1 420  ? -23.391 -42.397 26.312  1.00 27.80  ? 1782 LEU A HB2    1 
ATOM   6962  H  HB3    . LEU A 1 420  ? -23.013 -43.721 25.525  1.00 27.80  ? 1782 LEU A HB3    1 
ATOM   6963  H  HG     . LEU A 1 420  ? -21.170 -41.628 25.993  1.00 27.59  ? 1782 LEU A HG     1 
ATOM   6964  H  HD11   . LEU A 1 420  ? -20.145 -43.004 27.550  1.00 27.35  ? 1782 LEU A HD11   1 
ATOM   6965  H  HD12   . LEU A 1 420  ? -21.637 -42.694 28.001  1.00 27.35  ? 1782 LEU A HD12   1 
ATOM   6966  H  HD13   . LEU A 1 420  ? -21.282 -44.094 27.340  1.00 27.35  ? 1782 LEU A HD13   1 
ATOM   6967  H  HD21   . LEU A 1 420  ? -19.551 -43.110 25.234  1.00 27.29  ? 1782 LEU A HD21   1 
ATOM   6968  H  HD22   . LEU A 1 420  ? -20.676 -44.195 24.948  1.00 27.29  ? 1782 LEU A HD22   1 
ATOM   6969  H  HD23   . LEU A 1 420  ? -20.632 -42.854 24.097  1.00 27.29  ? 1782 LEU A HD23   1 
ATOM   6970  N  N      . THR A 1 421  ? -25.670 -42.362 24.211  1.00 23.63  ? 1783 THR A N      1 
ATOM   6971  C  CA     . THR A 1 421  ? -26.912 -42.880 23.652  1.00 23.80  ? 1783 THR A CA     1 
ATOM   6972  C  C      . THR A 1 421  ? -27.085 -42.321 22.240  1.00 24.13  ? 1783 THR A C      1 
ATOM   6973  O  O      . THR A 1 421  ? -27.634 -42.987 21.368  1.00 24.20  ? 1783 THR A O      1 
ATOM   6974  C  CB     . THR A 1 421  ? -28.148 -42.545 24.521  1.00 24.11  ? 1783 THR A CB     1 
ATOM   6975  O  OG1    . THR A 1 421  ? -29.294 -43.258 24.036  1.00 24.25  ? 1783 THR A OG1    1 
ATOM   6976  C  CG2    . THR A 1 421  ? -28.448 -41.063 24.509  1.00 24.60  ? 1783 THR A CG2    1 
ATOM   6977  H  H      . THR A 1 421  ? -25.768 -41.834 24.883  1.00 28.36  ? 1783 THR A H      1 
ATOM   6978  H  HA     . THR A 1 421  ? -26.847 -43.846 23.585  1.00 28.56  ? 1783 THR A HA     1 
ATOM   6979  H  HB     . THR A 1 421  ? -27.974 -42.810 25.438  1.00 28.93  ? 1783 THR A HB     1 
ATOM   6980  H  HG1    . THR A 1 421  ? -29.965 -43.077 24.506  1.00 29.10  ? 1783 THR A HG1    1 
ATOM   6981  H  HG21   . THR A 1 421  ? -29.225 -40.878 25.059  1.00 29.52  ? 1783 THR A HG21   1 
ATOM   6982  H  HG22   . THR A 1 421  ? -27.690 -40.569 24.858  1.00 29.52  ? 1783 THR A HG22   1 
ATOM   6983  H  HG23   . THR A 1 421  ? -28.626 -40.769 23.602  1.00 29.52  ? 1783 THR A HG23   1 
ATOM   6984  N  N      . ASP A 1 422  ? -26.622 -41.093 22.018  1.00 44.47  ? 1784 ASP A N      1 
ATOM   6985  C  CA     . ASP A 1 422  ? -26.727 -40.471 20.702  1.00 44.89  ? 1784 ASP A CA     1 
ATOM   6986  C  C      . ASP A 1 422  ? -25.906 -41.238 19.680  1.00 44.68  ? 1784 ASP A C      1 
ATOM   6987  O  O      . ASP A 1 422  ? -26.321 -41.415 18.537  1.00 45.78  ? 1784 ASP A O      1 
ATOM   6988  C  CB     . ASP A 1 422  ? -26.275 -39.001 20.747  1.00 52.10  ? 1784 ASP A CB     1 
ATOM   6989  C  CG     . ASP A 1 422  ? -26.335 -38.325 19.381  1.00 48.13  ? 1784 ASP A CG     1 
ATOM   6990  O  OD1    . ASP A 1 422  ? -25.384 -38.494 18.588  1.00 47.04  ? 1784 ASP A OD1    1 
ATOM   6991  O  OD2    . ASP A 1 422  ? -27.336 -37.633 19.094  1.00 46.39  1 1784 ASP A OD2    1 
ATOM   6992  H  H      . ASP A 1 422  ? -26.243 -40.601 22.612  1.00 53.37  ? 1784 ASP A H      1 
ATOM   6993  H  HA     . ASP A 1 422  ? -27.654 -40.490 20.417  1.00 53.87  ? 1784 ASP A HA     1 
ATOM   6994  H  HB2    . ASP A 1 422  ? -26.855 -38.510 21.350  1.00 62.52  ? 1784 ASP A HB2    1 
ATOM   6995  H  HB3    . ASP A 1 422  ? -25.358 -38.961 21.062  1.00 62.52  ? 1784 ASP A HB3    1 
ATOM   6996  N  N      . SER A 1 423  ? -24.733 -41.687 20.101  1.00 24.18  ? 1785 SER A N      1 
ATOM   6997  C  CA     . SER A 1 423  ? -23.842 -42.441 19.234  1.00 23.99  ? 1785 SER A CA     1 
ATOM   6998  C  C      . SER A 1 423  ? -24.377 -43.837 18.934  1.00 23.78  ? 1785 SER A C      1 
ATOM   6999  O  O      . SER A 1 423  ? -24.482 -44.237 17.775  1.00 23.98  ? 1785 SER A O      1 
ATOM   7000  C  CB     . SER A 1 423  ? -22.460 -42.547 19.877  1.00 23.61  ? 1785 SER A CB     1 
ATOM   7001  O  OG     . SER A 1 423  ? -21.951 -41.263 20.203  1.00 23.86  ? 1785 SER A OG     1 
ATOM   7002  H  H      . SER A 1 423  ? -24.426 -41.566 20.895  1.00 29.02  ? 1785 SER A H      1 
ATOM   7003  H  HA     . SER A 1 423  ? -23.746 -41.969 18.392  1.00 28.79  ? 1785 SER A HA     1 
ATOM   7004  H  HB2    . SER A 1 423  ? -22.530 -43.074 20.689  1.00 28.33  ? 1785 SER A HB2    1 
ATOM   7005  H  HB3    . SER A 1 423  ? -21.854 -42.978 19.254  1.00 28.33  ? 1785 SER A HB3    1 
ATOM   7006  H  HG     . SER A 1 423  ? -22.466 -40.879 20.744  1.00 28.63  ? 1785 SER A HG     1 
ATOM   7007  N  N      . LEU A 1 424  ? -24.720 -44.569 19.990  1.00 23.46  ? 1786 LEU A N      1 
ATOM   7008  C  CA     . LEU A 1 424  ? -25.122 -45.967 19.866  1.00 23.29  ? 1786 LEU A CA     1 
ATOM   7009  C  C      . LEU A 1 424  ? -26.360 -46.116 19.021  1.00 23.68  ? 1786 LEU A C      1 
ATOM   7010  O  O      . LEU A 1 424  ? -26.597 -47.168 18.428  1.00 23.70  ? 1786 LEU A O      1 
ATOM   7011  C  CB     . LEU A 1 424  ? -25.384 -46.578 21.242  1.00 23.01  ? 1786 LEU A CB     1 
ATOM   7012  C  CG     . LEU A 1 424  ? -24.190 -46.735 22.178  1.00 22.63  ? 1786 LEU A CG     1 
ATOM   7013  C  CD1    . LEU A 1 424  ? -24.591 -47.599 23.356  1.00 22.46  ? 1786 LEU A CD1    1 
ATOM   7014  C  CD2    . LEU A 1 424  ? -22.987 -47.314 21.455  1.00 22.43  ? 1786 LEU A CD2    1 
ATOM   7015  H  H      . LEU A 1 424  ? -24.727 -44.275 20.798  1.00 28.16  ? 1786 LEU A H      1 
ATOM   7016  H  HA     . LEU A 1 424  ? -24.406 -46.467 19.445  1.00 27.95  ? 1786 LEU A HA     1 
ATOM   7017  H  HB2    . LEU A 1 424  ? -26.032 -46.020 21.700  1.00 27.61  ? 1786 LEU A HB2    1 
ATOM   7018  H  HB3    . LEU A 1 424  ? -25.761 -47.462 21.111  1.00 27.61  ? 1786 LEU A HB3    1 
ATOM   7019  H  HG     . LEU A 1 424  ? -23.941 -45.862 22.519  1.00 27.15  ? 1786 LEU A HG     1 
ATOM   7020  H  HD11   . LEU A 1 424  ? -23.829 -47.696 23.949  1.00 26.95  ? 1786 LEU A HD11   1 
ATOM   7021  H  HD12   . LEU A 1 424  ? -25.323 -47.170 23.826  1.00 26.95  ? 1786 LEU A HD12   1 
ATOM   7022  H  HD13   . LEU A 1 424  ? -24.870 -48.468 23.029  1.00 26.95  ? 1786 LEU A HD13   1 
ATOM   7023  H  HD21   . LEU A 1 424  ? -22.252 -47.398 22.082  1.00 26.92  ? 1786 LEU A HD21   1 
ATOM   7024  H  HD22   . LEU A 1 424  ? -23.221 -48.186 21.100  1.00 26.92  ? 1786 LEU A HD22   1 
ATOM   7025  H  HD23   . LEU A 1 424  ? -22.738 -46.719 20.731  1.00 26.92  ? 1786 LEU A HD23   1 
ATOM   7026  N  N      . HIS A 1 425  ? -27.161 -45.064 18.999  1.00 24.06  ? 1787 HIS A N      1 
ATOM   7027  C  CA     . HIS A 1 425  ? -28.405 -45.062 18.260  1.00 24.51  ? 1787 HIS A CA     1 
ATOM   7028  C  C      . HIS A 1 425  ? -28.127 -45.391 16.792  1.00 24.75  ? 1787 HIS A C      1 
ATOM   7029  O  O      . HIS A 1 425  ? -28.885 -46.125 16.158  1.00 24.98  ? 1787 HIS A O      1 
ATOM   7030  C  CB     . HIS A 1 425  ? -29.082 -43.703 18.401  1.00 24.93  ? 1787 HIS A CB     1 
ATOM   7031  C  CG     . HIS A 1 425  ? -30.353 -43.584 17.631  1.00 25.47  ? 1787 HIS A CG     1 
ATOM   7032  N  ND1    . HIS A 1 425  ? -30.473 -42.807 16.501  1.00 26.00  ? 1787 HIS A ND1    1 
ATOM   7033  C  CD2    . HIS A 1 425  ? -31.569 -44.139 17.841  1.00 25.63  ? 1787 HIS A CD2    1 
ATOM   7034  C  CE1    . HIS A 1 425  ? -31.709 -42.894 16.041  1.00 26.45  ? 1787 HIS A CE1    1 
ATOM   7035  N  NE2    . HIS A 1 425  ? -32.394 -43.696 16.836  1.00 26.23  ? 1787 HIS A NE2    1 
ATOM   7036  H  H      . HIS A 1 425  ? -27.001 -44.327 19.412  1.00 28.87  ? 1787 HIS A H      1 
ATOM   7037  H  HA     . HIS A 1 425  ? -28.997 -45.740 18.620  1.00 29.41  ? 1787 HIS A HA     1 
ATOM   7038  H  HB2    . HIS A 1 425  ? -29.287 -43.551 19.337  1.00 29.92  ? 1787 HIS A HB2    1 
ATOM   7039  H  HB3    . HIS A 1 425  ? -28.476 -43.017 18.081  1.00 29.92  ? 1787 HIS A HB3    1 
ATOM   7040  H  HD2    . HIS A 1 425  ? -31.801 -44.715 18.533  1.00 30.76  ? 1787 HIS A HD2    1 
ATOM   7041  H  HE1    . HIS A 1 425  ? -32.040 -42.464 15.286  1.00 31.74  ? 1787 HIS A HE1    1 
ATOM   7042  H  HE2    . HIS A 1 425  ? -33.223 -43.907 16.741  1.00 31.47  ? 1787 HIS A HE2    1 
ATOM   7043  N  N      . GLN A 1 426  ? -27.039 -44.825 16.264  1.00 38.53  ? 1788 GLN A N      1 
ATOM   7044  C  CA     . GLN A 1 426  ? -26.559 -45.125 14.912  1.00 38.78  ? 1788 GLN A CA     1 
ATOM   7045  C  C      . GLN A 1 426  ? -25.421 -46.143 14.875  1.00 38.37  ? 1788 GLN A C      1 
ATOM   7046  O  O      . GLN A 1 426  ? -24.818 -46.358 13.824  1.00 38.59  ? 1788 GLN A O      1 
ATOM   7047  C  CB     . GLN A 1 426  ? -26.119 -43.852 14.199  1.00 39.22  ? 1788 GLN A CB     1 
ATOM   7048  C  CG     . GLN A 1 426  ? -27.261 -42.915 13.911  1.00 39.80  ? 1788 GLN A CG     1 
ATOM   7049  C  CD     . GLN A 1 426  ? -27.095 -42.232 12.576  1.00 40.46  ? 1788 GLN A CD     1 
ATOM   7050  O  OE1    . GLN A 1 426  ? -27.948 -42.354 11.694  1.00 40.97  ? 1788 GLN A OE1    1 
ATOM   7051  N  NE2    . GLN A 1 426  ? -25.980 -41.541 12.406  1.00 40.52  ? 1788 GLN A NE2    1 
ATOM   7052  H  H      . GLN A 1 426  ? -26.552 -44.251 16.679  1.00 46.23  ? 1788 GLN A H      1 
ATOM   7053  H  HA     . GLN A 1 426  ? -27.296 -45.500 14.406  1.00 46.54  ? 1788 GLN A HA     1 
ATOM   7054  H  HB2    . GLN A 1 426  ? -25.481 -43.382 14.757  1.00 47.07  ? 1788 GLN A HB2    1 
ATOM   7055  H  HB3    . GLN A 1 426  ? -25.708 -44.090 13.353  1.00 47.07  ? 1788 GLN A HB3    1 
ATOM   7056  H  HG2    . GLN A 1 426  ? -28.091 -43.417 13.894  1.00 47.76  ? 1788 GLN A HG2    1 
ATOM   7057  H  HG3    . GLN A 1 426  ? -27.296 -42.232 14.599  1.00 47.76  ? 1788 GLN A HG3    1 
ATOM   7058  H  HE21   . GLN A 1 426  ? -25.399 -41.500 13.039  1.00 48.63  ? 1788 GLN A HE21   1 
ATOM   7059  H  HE22   . GLN A 1 426  ? -25.836 -41.132 11.663  1.00 48.63  ? 1788 GLN A HE22   1 
ATOM   7060  N  N      . LYS A 1 427  ? -25.104 -46.733 16.023  1.00 31.13  ? 1789 LYS A N      1 
ATOM   7061  C  CA     . LYS A 1 427  ? -24.079 -47.774 16.107  1.00 30.77  ? 1789 LYS A CA     1 
ATOM   7062  C  C      . LYS A 1 427  ? -22.685 -47.281 15.720  1.00 30.72  ? 1789 LYS A C      1 
ATOM   7063  O  O      . LYS A 1 427  ? -21.945 -47.960 15.008  1.00 30.75  ? 1789 LYS A O      1 
ATOM   7064  C  CB     . LYS A 1 427  ? -24.462 -48.974 15.240  1.00 30.96  ? 1789 LYS A CB     1 
ATOM   7065  C  CG     . LYS A 1 427  ? -25.800 -49.598 15.606  1.00 33.04  ? 1789 LYS A CG     1 
ATOM   7066  C  CD     . LYS A 1 427  ? -26.065 -50.840 14.767  1.00 42.36  ? 1789 LYS A CD     1 
ATOM   7067  C  CE     . LYS A 1 427  ? -27.020 -51.807 15.452  1.00 49.65  ? 1789 LYS A CE     1 
ATOM   7068  N  NZ     . LYS A 1 427  ? -27.020 -53.131 14.768  1.00 54.42  1 1789 LYS A NZ     1 
ATOM   7069  H  H      . LYS A 1 427  ? -25.473 -46.548 16.778  1.00 37.36  ? 1789 LYS A H      1 
ATOM   7070  H  HA     . LYS A 1 427  ? -24.032 -48.082 17.025  1.00 36.92  ? 1789 LYS A HA     1 
ATOM   7071  H  HB2    . LYS A 1 427  ? -24.513 -48.687 14.315  1.00 37.16  ? 1789 LYS A HB2    1 
ATOM   7072  H  HB3    . LYS A 1 427  ? -23.781 -49.658 15.335  1.00 37.16  ? 1789 LYS A HB3    1 
ATOM   7073  H  HG2    . LYS A 1 427  ? -25.791 -49.857 16.541  1.00 39.65  ? 1789 LYS A HG2    1 
ATOM   7074  H  HG3    . LYS A 1 427  ? -26.511 -48.959 15.439  1.00 39.65  ? 1789 LYS A HG3    1 
ATOM   7075  H  HD2    . LYS A 1 427  ? -26.460 -50.574 13.922  1.00 50.83  ? 1789 LYS A HD2    1 
ATOM   7076  H  HD3    . LYS A 1 427  ? -25.227 -51.303 14.613  1.00 50.83  ? 1789 LYS A HD3    1 
ATOM   7077  H  HE2    . LYS A 1 427  ? -26.740 -51.938 16.372  1.00 59.58  ? 1789 LYS A HE2    1 
ATOM   7078  H  HE3    . LYS A 1 427  ? -27.920 -51.446 15.421  1.00 59.58  ? 1789 LYS A HE3    1 
ATOM   7079  H  HZ1    . LYS A 1 427  ? -27.582 -53.686 15.178  1.00 65.30  ? 1789 LYS A HZ1    1 
ATOM   7080  H  HZ2    . LYS A 1 427  ? -27.275 -53.035 13.920  1.00 65.30  ? 1789 LYS A HZ2    1 
ATOM   7081  H  HZ3    . LYS A 1 427  ? -26.202 -53.482 14.785  1.00 65.30  ? 1789 LYS A HZ3    1 
ATOM   7082  N  N      . TYR A 1 428  ? -22.349 -46.086 16.191  1.00 28.15  ? 1790 TYR A N      1 
ATOM   7083  C  CA     . TYR A 1 428  ? -20.975 -45.607 16.218  1.00 28.05  ? 1790 TYR A CA     1 
ATOM   7084  C  C      . TYR A 1 428  ? -20.478 -45.815 17.636  1.00 27.55  ? 1790 TYR A C      1 
ATOM   7085  O  O      . TYR A 1 428  ? -21.262 -45.761 18.582  1.00 27.42  ? 1790 TYR A O      1 
ATOM   7086  C  CB     . TYR A 1 428  ? -20.872 -44.132 15.835  1.00 28.48  ? 1790 TYR A CB     1 
ATOM   7087  C  CG     . TYR A 1 428  ? -20.982 -43.845 14.356  1.00 29.06  ? 1790 TYR A CG     1 
ATOM   7088  C  CD1    . TYR A 1 428  ? -22.195 -43.957 13.696  1.00 29.42  ? 1790 TYR A CD1    1 
ATOM   7089  C  CD2    . TYR A 1 428  ? -19.880 -43.421 13.623  1.00 29.32  ? 1790 TYR A CD2    1 
ATOM   7090  C  CE1    . TYR A 1 428  ? -22.305 -43.681 12.344  1.00 30.04  ? 1790 TYR A CE1    1 
ATOM   7091  C  CE2    . TYR A 1 428  ? -19.984 -43.142 12.270  1.00 29.95  ? 1790 TYR A CE2    1 
ATOM   7092  C  CZ     . TYR A 1 428  ? -21.196 -43.272 11.639  1.00 30.31  ? 1790 TYR A CZ     1 
ATOM   7093  O  OH     . TYR A 1 428  ? -21.295 -42.995 10.296  1.00 31.01  ? 1790 TYR A OH     1 
ATOM   7094  H  H      . TYR A 1 428  ? -22.915 -45.521 16.509  1.00 33.78  ? 1790 TYR A H      1 
ATOM   7095  H  HA     . TYR A 1 428  ? -20.428 -46.130 15.611  1.00 33.66  ? 1790 TYR A HA     1 
ATOM   7096  H  HB2    . TYR A 1 428  ? -21.586 -43.648 16.280  1.00 34.18  ? 1790 TYR A HB2    1 
ATOM   7097  H  HB3    . TYR A 1 428  ? -20.014 -43.795 16.136  1.00 34.18  ? 1790 TYR A HB3    1 
ATOM   7098  H  HD1    . TYR A 1 428  ? -22.947 -44.233 14.168  1.00 35.31  ? 1790 TYR A HD1    1 
ATOM   7099  H  HD2    . TYR A 1 428  ? -19.056 -43.332 14.046  1.00 35.19  ? 1790 TYR A HD2    1 
ATOM   7100  H  HE1    . TYR A 1 428  ? -23.125 -43.768 11.915  1.00 36.05  ? 1790 TYR A HE1    1 
ATOM   7101  H  HE2    . TYR A 1 428  ? -19.235 -42.866 11.792  1.00 35.94  ? 1790 TYR A HE2    1 
ATOM   7102  H  HH     . TYR A 1 428  ? -20.548 -42.758 9.996   1.00 37.21  ? 1790 TYR A HH     1 
ATOM   7103  N  N      . GLY A 1 429  ? -19.190 -46.078 17.793  1.00 22.87  ? 1791 GLY A N      1 
ATOM   7104  C  CA     . GLY A 1 429  ? -18.616 -46.141 19.122  1.00 22.48  ? 1791 GLY A CA     1 
ATOM   7105  C  C      . GLY A 1 429  ? -18.574 -44.738 19.695  1.00 22.64  ? 1791 GLY A C      1 
ATOM   7106  O  O      . GLY A 1 429  ? -18.399 -43.773 18.959  1.00 23.02  ? 1791 GLY A O      1 
ATOM   7107  H  H      . GLY A 1 429  ? -18.634 -46.223 17.154  1.00 27.44  ? 1791 GLY A H      1 
ATOM   7108  H  HA2    . GLY A 1 429  ? -19.157 -46.705 19.696  1.00 26.98  ? 1791 GLY A HA2    1 
ATOM   7109  H  HA3    . GLY A 1 429  ? -17.714 -46.497 19.081  1.00 26.98  ? 1791 GLY A HA3    1 
ATOM   7110  N  N      . GLY A 1 430  ? -18.775 -44.618 21.000  1.00 22.44  ? 1792 GLY A N      1 
ATOM   7111  C  CA     . GLY A 1 430  ? -18.570 -43.353 21.680  1.00 22.62  ? 1792 GLY A CA     1 
ATOM   7112  C  C      . GLY A 1 430  ? -17.154 -43.246 22.207  1.00 22.46  ? 1792 GLY A C      1 
ATOM   7113  O  O      . GLY A 1 430  ? -16.554 -44.247 22.589  1.00 22.12  ? 1792 GLY A O      1 
ATOM   7114  H  H      . GLY A 1 430  ? -19.032 -45.257 21.515  1.00 26.93  ? 1792 GLY A H      1 
ATOM   7115  H  HA2    . GLY A 1 430  ? -18.730 -42.620 21.065  1.00 27.14  ? 1792 GLY A HA2    1 
ATOM   7116  H  HA3    . GLY A 1 430  ? -19.186 -43.277 22.425  1.00 27.14  ? 1792 GLY A HA3    1 
ATOM   7117  N  N      . CYS A 1 431  ? -16.627 -42.028 22.253  1.00 22.77  ? 1793 CYS A N      1 
ATOM   7118  C  CA     . CYS A 1 431  ? -15.275 -41.798 22.736  1.00 22.71  ? 1793 CYS A CA     1 
ATOM   7119  C  C      . CYS A 1 431  ? -15.182 -40.534 23.584  1.00 23.02  ? 1793 CYS A C      1 
ATOM   7120  O  O      . CYS A 1 431  ? -15.692 -39.483 23.201  1.00 23.46  ? 1793 CYS A O      1 
ATOM   7121  C  CB     . CYS A 1 431  ? -14.300 -41.716 21.558  1.00 22.88  ? 1793 CYS A CB     1 
ATOM   7122  S  SG     . CYS A 1 431  ? -12.745 -40.877 21.928  1.00 23.09  ? 1793 CYS A SG     1 
ATOM   7123  H  H      . CYS A 1 431  ? -17.037 -41.313 22.008  1.00 27.32  ? 1793 CYS A H      1 
ATOM   7124  H  HA     . CYS A 1 431  ? -15.009 -42.548 23.291  1.00 27.25  ? 1793 CYS A HA     1 
ATOM   7125  H  HB2    . CYS A 1 431  ? -14.086 -42.617 21.270  1.00 27.46  ? 1793 CYS A HB2    1 
ATOM   7126  H  HB3    . CYS A 1 431  ? -14.729 -41.234 20.834  1.00 27.46  ? 1793 CYS A HB3    1 
ATOM   7127  H  HG     . CYS A 1 431  ? -12.184 -41.464 22.811  1.00 27.70  ? 1793 CYS A HG     1 
ATOM   7128  N  N      . PHE A 1 432  ? -14.535 -40.647 24.736  1.00 22.85  ? 1794 PHE A N      1 
ATOM   7129  C  CA     . PHE A 1 432  ? -14.344 -39.515 25.636  1.00 23.19  ? 1794 PHE A CA     1 
ATOM   7130  C  C      . PHE A 1 432  ? -12.906 -39.054 25.659  1.00 23.35  ? 1794 PHE A C      1 
ATOM   7131  O  O      . PHE A 1 432  ? -11.986 -39.867 25.671  1.00 23.05  ? 1794 PHE A O      1 
ATOM   7132  C  CB     . PHE A 1 432  ? -14.746 -39.872 27.071  1.00 23.03  ? 1794 PHE A CB     1 
ATOM   7133  C  CG     . PHE A 1 432  ? -16.219 -40.039 27.279  1.00 23.03  ? 1794 PHE A CG     1 
ATOM   7134  C  CD1    . PHE A 1 432  ? -17.132 -39.473 26.408  1.00 23.30  ? 1794 PHE A CD1    1 
ATOM   7135  C  CD2    . PHE A 1 432  ? -16.690 -40.762 28.361  1.00 22.83  ? 1794 PHE A CD2    1 
ATOM   7136  C  CE1    . PHE A 1 432  ? -18.481 -39.626 26.608  1.00 23.34  ? 1794 PHE A CE1    1 
ATOM   7137  C  CE2    . PHE A 1 432  ? -18.041 -40.924 28.563  1.00 22.88  ? 1794 PHE A CE2    1 
ATOM   7138  C  CZ     . PHE A 1 432  ? -18.939 -40.354 27.686  1.00 23.13  ? 1794 PHE A CZ     1 
ATOM   7139  H  H      . PHE A 1 432  ? -14.190 -41.380 25.024  1.00 27.42  ? 1794 PHE A H      1 
ATOM   7140  H  HA     . PHE A 1 432  ? -14.896 -38.774 25.340  1.00 27.83  ? 1794 PHE A HA     1 
ATOM   7141  H  HB2    . PHE A 1 432  ? -14.317 -40.708 27.315  1.00 27.63  ? 1794 PHE A HB2    1 
ATOM   7142  H  HB3    . PHE A 1 432  ? -14.443 -39.166 27.663  1.00 27.63  ? 1794 PHE A HB3    1 
ATOM   7143  H  HD1    . PHE A 1 432  ? -16.829 -38.982 25.679  1.00 27.96  ? 1794 PHE A HD1    1 
ATOM   7144  H  HD2    . PHE A 1 432  ? -16.087 -41.149 28.953  1.00 27.39  ? 1794 PHE A HD2    1 
ATOM   7145  H  HE1    . PHE A 1 432  ? -19.086 -39.243 26.014  1.00 28.01  ? 1794 PHE A HE1    1 
ATOM   7146  H  HE2    . PHE A 1 432  ? -18.348 -41.413 29.292  1.00 27.46  ? 1794 PHE A HE2    1 
ATOM   7147  H  HZ     . PHE A 1 432  ? -19.853 -40.459 27.821  1.00 27.76  ? 1794 PHE A HZ     1 
ATOM   7148  N  N      . PHE A 1 433  ? -12.712 -37.744 25.644  1.00 23.89  ? 1795 PHE A N      1 
ATOM   7149  C  CA     . PHE A 1 433  ? -11.405 -37.192 25.949  1.00 24.13  ? 1795 PHE A CA     1 
ATOM   7150  C  C      . PHE A 1 433  ? -11.571 -36.096 26.972  1.00 24.59  ? 1795 PHE A C      1 
ATOM   7151  O  O      . PHE A 1 433  ? -12.610 -35.451 27.061  1.00 24.88  ? 1795 PHE A O      1 
ATOM   7152  C  CB     . PHE A 1 433  ? -10.690 -36.661 24.704  1.00 24.49  ? 1795 PHE A CB     1 
ATOM   7153  C  CG     . PHE A 1 433  ? -11.413 -35.551 24.009  1.00 25.06  ? 1795 PHE A CG     1 
ATOM   7154  C  CD1    . PHE A 1 433  ? -11.362 -34.262 24.500  1.00 25.67  ? 1795 PHE A CD1    1 
ATOM   7155  C  CD2    . PHE A 1 433  ? -12.106 -35.786 22.841  1.00 25.07  ? 1795 PHE A CD2    1 
ATOM   7156  C  CE1    . PHE A 1 433  ? -12.025 -33.234 23.865  1.00 26.28  ? 1795 PHE A CE1    1 
ATOM   7157  C  CE2    . PHE A 1 433  ? -12.765 -34.763 22.195  1.00 25.67  ? 1795 PHE A CE2    1 
ATOM   7158  C  CZ     . PHE A 1 433  ? -12.722 -33.484 22.706  1.00 26.28  ? 1795 PHE A CZ     1 
ATOM   7159  H  H      . PHE A 1 433  ? -13.315 -37.159 25.463  1.00 28.66  ? 1795 PHE A H      1 
ATOM   7160  H  HA     . PHE A 1 433  ? -10.852 -37.887 26.339  1.00 28.96  ? 1795 PHE A HA     1 
ATOM   7161  H  HB2    . PHE A 1 433  ? -9.817  -36.328 24.965  1.00 29.39  ? 1795 PHE A HB2    1 
ATOM   7162  H  HB3    . PHE A 1 433  ? -10.587 -37.388 24.070  1.00 29.39  ? 1795 PHE A HB3    1 
ATOM   7163  H  HD1    . PHE A 1 433  ? -10.896 -34.089 25.287  1.00 30.81  ? 1795 PHE A HD1    1 
ATOM   7164  H  HD2    . PHE A 1 433  ? -12.143 -36.648 22.494  1.00 30.09  ? 1795 PHE A HD2    1 
ATOM   7165  H  HE1    . PHE A 1 433  ? -11.989 -32.371 24.211  1.00 31.54  ? 1795 PHE A HE1    1 
ATOM   7166  H  HE2    . PHE A 1 433  ? -13.238 -34.936 21.412  1.00 30.81  ? 1795 PHE A HE2    1 
ATOM   7167  H  HZ     . PHE A 1 433  ? -13.165 -32.792 22.270  1.00 31.54  ? 1795 PHE A HZ     1 
ATOM   7168  N  N      . GLY A 1 434  ? -10.530 -35.902 27.759  1.00 24.71  ? 1796 GLY A N      1 
ATOM   7169  C  CA     . GLY A 1 434  ? -10.492 -34.825 28.719  1.00 25.25  ? 1796 GLY A CA     1 
ATOM   7170  C  C      . GLY A 1 434  ? -9.411  -35.153 29.715  1.00 25.17  ? 1796 GLY A C      1 
ATOM   7171  O  O      . GLY A 1 434  ? -8.966  -36.299 29.794  1.00 24.65  ? 1796 GLY A O      1 
ATOM   7172  H  H      . GLY A 1 434  ? -9.822  -36.390 27.754  1.00 29.65  ? 1796 GLY A H      1 
ATOM   7173  H  HA2    . GLY A 1 434  ? -10.285 -33.985 28.280  1.00 30.30  ? 1796 GLY A HA2    1 
ATOM   7174  H  HA3    . GLY A 1 434  ? -11.343 -34.749 29.178  1.00 30.30  ? 1796 GLY A HA3    1 
ATOM   7175  N  N      . PRO A 1 435  ? -9.009  -34.158 30.509  1.00 25.75  ? 1797 PRO A N      1 
ATOM   7176  C  CA     . PRO A 1 435  ? -7.833  -34.289 31.372  1.00 25.84  ? 1797 PRO A CA     1 
ATOM   7177  C  C      . PRO A 1 435  ? -7.982  -35.381 32.410  1.00 25.38  ? 1797 PRO A C      1 
ATOM   7178  O  O      . PRO A 1 435  ? -9.095  -35.828 32.663  1.00 25.12  ? 1797 PRO A O      1 
ATOM   7179  C  CB     . PRO A 1 435  ? -7.730  -32.915 32.045  1.00 26.66  ? 1797 PRO A CB     1 
ATOM   7180  C  CG     . PRO A 1 435  ? -8.633  -32.010 31.255  1.00 27.03  ? 1797 PRO A CG     1 
ATOM   7181  C  CD     . PRO A 1 435  ? -9.709  -32.884 30.729  1.00 26.42  ? 1797 PRO A CD     1 
ATOM   7182  H  HA     . PRO A 1 435  ? -7.037  -34.451 30.841  1.00 31.00  ? 1797 PRO A HA     1 
ATOM   7183  H  HB2    . PRO A 1 435  ? -8.032  -32.979 32.965  1.00 31.99  ? 1797 PRO A HB2    1 
ATOM   7184  H  HB3    . PRO A 1 435  ? -6.813  -32.601 32.007  1.00 31.99  ? 1797 PRO A HB3    1 
ATOM   7185  H  HG2    . PRO A 1 435  ? -9.001  -31.327 31.838  1.00 32.44  ? 1797 PRO A HG2    1 
ATOM   7186  H  HG3    . PRO A 1 435  ? -8.134  -31.606 30.528  1.00 32.44  ? 1797 PRO A HG3    1 
ATOM   7187  H  HD2    . PRO A 1 435  ? -10.412 -32.992 31.388  1.00 31.70  ? 1797 PRO A HD2    1 
ATOM   7188  H  HD3    . PRO A 1 435  ? -10.052 -32.535 29.892  1.00 31.70  ? 1797 PRO A HD3    1 
ATOM   7189  N  N      . ALA A 1 436  ? -6.870  -35.829 32.978  1.00 35.59  ? 1798 ALA A N      1 
ATOM   7190  C  CA     . ALA A 1 436  ? -6.941  -36.756 34.089  1.00 44.73  ? 1798 ALA A CA     1 
ATOM   7191  C  C      . ALA A 1 436  ? -7.671  -36.051 35.232  1.00 47.47  ? 1798 ALA A C      1 
ATOM   7192  O  O      . ALA A 1 436  ? -7.566  -34.834 35.384  1.00 50.32  ? 1798 ALA A O      1 
ATOM   7193  C  CB     . ALA A 1 436  ? -5.552  -37.203 34.519  1.00 45.39  ? 1798 ALA A CB     1 
ATOM   7194  H  H      . ALA A 1 436  ? -6.072  -35.613 32.740  1.00 42.71  ? 1798 ALA A H      1 
ATOM   7195  H  HA     . ALA A 1 436  ? -7.453  -37.538 33.829  1.00 53.67  ? 1798 ALA A HA     1 
ATOM   7196  H  HB1    . ALA A 1 436  ? -5.635  -37.821 35.262  1.00 54.47  ? 1798 ALA A HB1    1 
ATOM   7197  H  HB2    . ALA A 1 436  ? -5.116  -37.642 33.771  1.00 54.47  ? 1798 ALA A HB2    1 
ATOM   7198  H  HB3    . ALA A 1 436  ? -5.040  -36.425 34.791  1.00 54.47  ? 1798 ALA A HB3    1 
ATOM   7199  N  N      . GLY A 1 437  ? -8.408  -36.816 36.028  1.00 71.13  ? 1799 GLY A N      1 
ATOM   7200  C  CA     . GLY A 1 437  ? -9.063  -36.297 37.219  1.00 73.27  ? 1799 GLY A CA     1 
ATOM   7201  C  C      . GLY A 1 437  ? -10.539 -35.944 37.087  1.00 73.38  ? 1799 GLY A C      1 
ATOM   7202  O  O      . GLY A 1 437  ? -11.173 -35.570 38.074  1.00 75.09  ? 1799 GLY A O      1 
ATOM   7203  H  H      . GLY A 1 437  ? -8.545  -37.654 35.896  1.00 85.36  ? 1799 GLY A H      1 
ATOM   7204  H  HA2    . GLY A 1 437  ? -8.982  -36.954 37.928  1.00 87.93  ? 1799 GLY A HA2    1 
ATOM   7205  H  HA3    . GLY A 1 437  ? -8.595  -35.496 37.505  1.00 87.93  ? 1799 GLY A HA3    1 
ATOM   7206  N  N      . THR A 1 438  ? -11.085 -36.052 35.879  1.00 46.72  ? 1800 THR A N      1 
ATOM   7207  C  CA     . THR A 1 438  ? -12.538 -36.090 35.685  1.00 41.12  ? 1800 THR A CA     1 
ATOM   7208  C  C      . THR A 1 438  ? -12.787 -37.572 35.705  1.00 47.76  ? 1800 THR A C      1 
ATOM   7209  O  O      . THR A 1 438  ? -11.954 -38.320 36.211  1.00 60.64  ? 1800 THR A O      1 
ATOM   7210  C  CB     . THR A 1 438  ? -13.065 -35.463 34.375  1.00 41.15  ? 1800 THR A CB     1 
ATOM   7211  O  OG1    . THR A 1 438  ? -14.452 -35.788 34.230  1.00 40.99  ? 1800 THR A OG1    1 
ATOM   7212  C  CG2    . THR A 1 438  ? -12.315 -35.982 33.161  1.00 40.70  ? 1800 THR A CG2    1 
ATOM   7213  H  H      . THR A 1 438  ? -10.635 -36.104 35.148  1.00 56.06  ? 1800 THR A H      1 
ATOM   7214  H  HA     . THR A 1 438  ? -12.988 -35.680 36.440  1.00 49.35  ? 1800 THR A HA     1 
ATOM   7215  H  HB     . THR A 1 438  ? -12.960 -34.499 34.412  1.00 49.38  ? 1800 THR A HB     1 
ATOM   7216  H  HG1    . THR A 1 438  ? -14.753 -35.453 33.521  1.00 49.19  ? 1800 THR A HG1    1 
ATOM   7217  H  HG21   . THR A 1 438  ? -12.666 -35.573 32.355  1.00 48.84  ? 1800 THR A HG21   1 
ATOM   7218  H  HG22   . THR A 1 438  ? -11.372 -35.770 33.239  1.00 48.84  ? 1800 THR A HG22   1 
ATOM   7219  H  HG23   . THR A 1 438  ? -12.417 -36.945 33.096  1.00 48.84  ? 1800 THR A HG23   1 
ATOM   7220  N  N      . GLY A 1 439  ? -13.911 -38.016 35.166  1.00 52.38  ? 1801 GLY A N      1 
ATOM   7221  C  CA     . GLY A 1 439  ? -14.039 -39.439 34.946  1.00 40.50  ? 1801 GLY A CA     1 
ATOM   7222  C  C      . GLY A 1 439  ? -14.729 -39.713 33.639  1.00 39.25  ? 1801 GLY A C      1 
ATOM   7223  O  O      . GLY A 1 439  ? -15.634 -39.005 33.206  1.00 40.56  ? 1801 GLY A O      1 
ATOM   7224  H  H      . GLY A 1 439  ? -14.585 -37.537 34.928  1.00 62.86  ? 1801 GLY A H      1 
ATOM   7225  H  HA2    . GLY A 1 439  ? -13.161 -39.850 34.929  1.00 48.60  ? 1801 GLY A HA2    1 
ATOM   7226  H  HA3    . GLY A 1 439  ? -14.557 -39.837 35.663  1.00 48.60  ? 1801 GLY A HA3    1 
ATOM   7227  N  N      . LYS A 1 440  ? -14.248 -40.780 33.017  1.00 41.52  ? 1802 LYS A N      1 
ATOM   7228  C  CA     . LYS A 1 440  ? -14.669 -41.198 31.693  1.00 41.21  ? 1802 LYS A CA     1 
ATOM   7229  C  C      . LYS A 1 440  ? -14.955 -42.672 31.699  1.00 40.80  ? 1802 LYS A C      1 
ATOM   7230  O  O      . LYS A 1 440  ? -16.071 -43.103 31.449  1.00 40.72  ? 1802 LYS A O      1 
ATOM   7231  C  CB     . LYS A 1 440  ? -13.588 -40.862 30.660  1.00 41.18  ? 1802 LYS A CB     1 
ATOM   7232  C  CG     . LYS A 1 440  ? -13.296 -39.377 30.530  1.00 41.68  ? 1802 LYS A CG     1 
ATOM   7233  C  CD     . LYS A 1 440  ? -12.084 -39.071 29.672  1.00 41.73  ? 1802 LYS A CD     1 
ATOM   7234  C  CE     . LYS A 1 440  ? -10.833 -39.549 30.358  1.00 41.62  ? 1802 LYS A CE     1 
ATOM   7235  N  NZ     . LYS A 1 440  ? -9.613  -38.783 30.012  1.00 41.93  1 1802 LYS A NZ     1 
ATOM   7236  H  H      . LYS A 1 440  ? -13.651 -41.297 33.359  1.00 49.82  ? 1802 LYS A H      1 
ATOM   7237  H  HA     . LYS A 1 440  ? -15.482 -40.729 31.450  1.00 49.45  ? 1802 LYS A HA     1 
ATOM   7238  H  HB2    . LYS A 1 440  ? -12.764 -41.304 30.917  1.00 49.41  ? 1802 LYS A HB2    1 
ATOM   7239  H  HB3    . LYS A 1 440  ? -13.876 -41.184 29.792  1.00 49.41  ? 1802 LYS A HB3    1 
ATOM   7240  H  HG2    . LYS A 1 440  ? -14.064 -38.940 30.128  1.00 50.01  ? 1802 LYS A HG2    1 
ATOM   7241  H  HG3    . LYS A 1 440  ? -13.135 -39.011 31.414  1.00 50.01  ? 1802 LYS A HG3    1 
ATOM   7242  H  HD2    . LYS A 1 440  ? -12.165 -39.531 28.821  1.00 50.07  ? 1802 LYS A HD2    1 
ATOM   7243  H  HD3    . LYS A 1 440  ? -12.015 -38.113 29.536  1.00 50.07  ? 1802 LYS A HD3    1 
ATOM   7244  H  HE2    . LYS A 1 440  ? -10.960 -39.483 31.317  1.00 49.94  ? 1802 LYS A HE2    1 
ATOM   7245  H  HE3    . LYS A 1 440  ? -10.679 -40.475 30.112  1.00 49.94  ? 1802 LYS A HE3    1 
ATOM   7246  H  HZ1    . LYS A 1 440  ? -8.912  -39.115 30.449  1.00 50.31  ? 1802 LYS A HZ1    1 
ATOM   7247  H  HZ2    . LYS A 1 440  ? -9.460  -38.835 29.137  1.00 50.31  ? 1802 LYS A HZ2    1 
ATOM   7248  H  HZ3    . LYS A 1 440  ? -9.717  -37.929 30.238  1.00 50.31  ? 1802 LYS A HZ3    1 
ATOM   7249  N  N      . THR A 1 441  ? -13.925 -43.440 32.009  1.00 42.40  ? 1803 THR A N      1 
ATOM   7250  C  CA     . THR A 1 441  ? -14.034 -44.881 32.034  1.00 42.66  ? 1803 THR A CA     1 
ATOM   7251  C  C      . THR A 1 441  ? -15.098 -45.246 33.041  1.00 42.59  ? 1803 THR A C      1 
ATOM   7252  O  O      . THR A 1 441  ? -15.927 -46.117 32.798  1.00 42.79  ? 1803 THR A O      1 
ATOM   7253  C  CB     . THR A 1 441  ? -12.702 -45.553 32.376  1.00 41.32  ? 1803 THR A CB     1 
ATOM   7254  O  OG1    . THR A 1 441  ? -12.085 -44.868 33.477  1.00 43.90  ? 1803 THR A OG1    1 
ATOM   7255  C  CG2    . THR A 1 441  ? -11.787 -45.481 31.188  1.00 40.17  ? 1803 THR A CG2    1 
ATOM   7256  H  H      . THR A 1 441  ? -13.143 -43.144 32.211  1.00 50.88  ? 1803 THR A H      1 
ATOM   7257  H  HA     . THR A 1 441  ? -14.319 -45.196 31.162  1.00 51.19  ? 1803 THR A HA     1 
ATOM   7258  H  HB     . THR A 1 441  ? -12.850 -46.483 32.606  1.00 49.58  ? 1803 THR A HB     1 
ATOM   7259  H  HG1    . THR A 1 441  ? -11.944 -44.065 33.273  1.00 52.68  ? 1803 THR A HG1    1 
ATOM   7260  H  HG21   . THR A 1 441  ? -10.940 -45.905 31.397  1.00 48.20  ? 1803 THR A HG21   1 
ATOM   7261  H  HG22   . THR A 1 441  ? -12.190 -45.937 30.432  1.00 48.20  ? 1803 THR A HG22   1 
ATOM   7262  H  HG23   . THR A 1 441  ? -11.626 -44.555 30.949  1.00 48.20  ? 1803 THR A HG23   1 
ATOM   7263  N  N      . GLU A 1 442  ? -15.069 -44.570 34.183  1.00 36.10  ? 1804 GLU A N      1 
ATOM   7264  C  CA     . GLU A 1 442  ? -16.009 -44.867 35.245  1.00 36.33  ? 1804 GLU A CA     1 
ATOM   7265  C  C      . GLU A 1 442  ? -17.423 -44.371 34.907  1.00 36.47  ? 1804 GLU A C      1 
ATOM   7266  O  O      . GLU A 1 442  ? -18.405 -44.887 35.442  1.00 36.59  ? 1804 GLU A O      1 
ATOM   7267  C  CB     . GLU A 1 442  ? -15.522 -44.252 36.559  1.00 37.11  ? 1804 GLU A CB     1 
ATOM   7268  C  CG     . GLU A 1 442  ? -16.349 -44.662 37.755  1.00 39.71  ? 1804 GLU A CG     1 
ATOM   7269  C  CD     . GLU A 1 442  ? -16.356 -46.165 37.965  1.00 42.73  ? 1804 GLU A CD     1 
ATOM   7270  O  OE1    . GLU A 1 442  ? -15.276 -46.783 37.825  1.00 43.85  ? 1804 GLU A OE1    1 
ATOM   7271  O  OE2    . GLU A 1 442  ? -17.440 -46.721 38.259  1.00 45.27  1 1804 GLU A OE2    1 
ATOM   7272  H  H      . GLU A 1 442  ? -14.515 -43.937 34.364  1.00 43.32  ? 1804 GLU A H      1 
ATOM   7273  H  HA     . GLU A 1 442  ? -16.053 -45.829 35.365  1.00 43.59  ? 1804 GLU A HA     1 
ATOM   7274  H  HB2    . GLU A 1 442  ? -14.608 -44.535 36.718  1.00 44.53  ? 1804 GLU A HB2    1 
ATOM   7275  H  HB3    . GLU A 1 442  ? -15.560 -43.286 36.487  1.00 44.53  ? 1804 GLU A HB3    1 
ATOM   7276  H  HG2    . GLU A 1 442  ? -15.981 -44.248 38.552  1.00 47.66  ? 1804 GLU A HG2    1 
ATOM   7277  H  HG3    . GLU A 1 442  ? -17.265 -44.372 37.621  1.00 47.66  ? 1804 GLU A HG3    1 
ATOM   7278  N  N      . THR A 1 443  ? -17.525 -43.389 34.013  1.00 22.79  ? 1805 THR A N      1 
ATOM   7279  C  CA     . THR A 1 443  ? -18.826 -42.931 33.515  1.00 22.94  ? 1805 THR A CA     1 
ATOM   7280  C  C      . THR A 1 443  ? -19.445 -43.943 32.550  1.00 22.61  ? 1805 THR A C      1 
ATOM   7281  O  O      . THR A 1 443  ? -20.659 -44.154 32.556  1.00 22.72  ? 1805 THR A O      1 
ATOM   7282  C  CB     . THR A 1 443  ? -18.721 -41.566 32.803  1.00 23.17  ? 1805 THR A CB     1 
ATOM   7283  O  OG1    . THR A 1 443  ? -18.099 -40.618 33.675  1.00 23.55  ? 1805 THR A OG1    1 
ATOM   7284  C  CG2    . THR A 1 443  ? -20.102 -41.050 32.390  1.00 23.42  ? 1805 THR A CG2    1 
ATOM   7285  H  H      . THR A 1 443  ? -16.855 -42.968 33.677  1.00 27.35  ? 1805 THR A H      1 
ATOM   7286  H  HA     . THR A 1 443  ? -19.430 -42.829 34.267  1.00 27.53  ? 1805 THR A HA     1 
ATOM   7287  H  HB     . THR A 1 443  ? -18.182 -41.664 32.002  1.00 27.81  ? 1805 THR A HB     1 
ATOM   7288  H  HG1    . THR A 1 443  ? -18.040 -39.872 33.293  1.00 28.26  ? 1805 THR A HG1    1 
ATOM   7289  H  HG21   . THR A 1 443  ? -20.016 -40.193 31.945  1.00 28.11  ? 1805 THR A HG21   1 
ATOM   7290  H  HG22   . THR A 1 443  ? -20.523 -41.679 31.784  1.00 28.11  ? 1805 THR A HG22   1 
ATOM   7291  H  HG23   . THR A 1 443  ? -20.664 -40.944 33.174  1.00 28.11  ? 1805 THR A HG23   1 
ATOM   7292  N  N      . VAL A 1 444  ? -18.604 -44.550 31.714  1.00 23.52  ? 1806 VAL A N      1 
ATOM   7293  C  CA     . VAL A 1 444  ? -19.042 -45.570 30.760  1.00 23.25  ? 1806 VAL A CA     1 
ATOM   7294  C  C      . VAL A 1 444  ? -19.525 -46.799 31.518  1.00 23.21  ? 1806 VAL A C      1 
ATOM   7295  O  O      . VAL A 1 444  ? -20.532 -47.405 31.164  1.00 23.21  ? 1806 VAL A O      1 
ATOM   7296  C  CB     . VAL A 1 444  ? -17.914 -45.969 29.795  1.00 22.97  ? 1806 VAL A CB     1 
ATOM   7297  C  CG1    . VAL A 1 444  ? -18.364 -47.084 28.871  1.00 22.78  ? 1806 VAL A CG1    1 
ATOM   7298  C  CG2    . VAL A 1 444  ? -17.478 -44.770 28.964  1.00 23.10  ? 1806 VAL A CG2    1 
ATOM   7299  H  H      . VAL A 1 444  ? -17.760 -44.386 31.679  1.00 28.22  ? 1806 VAL A H      1 
ATOM   7300  H  HA     . VAL A 1 444  ? -19.782 -45.223 30.237  1.00 27.90  ? 1806 VAL A HA     1 
ATOM   7301  H  HB     . VAL A 1 444  ? -17.150 -46.282 30.305  1.00 27.56  ? 1806 VAL A HB     1 
ATOM   7302  H  HG11   . VAL A 1 444  ? -17.633 -47.314 28.276  1.00 27.33  ? 1806 VAL A HG11   1 
ATOM   7303  H  HG12   . VAL A 1 444  ? -18.612 -47.855 29.404  1.00 27.33  ? 1806 VAL A HG12   1 
ATOM   7304  H  HG13   . VAL A 1 444  ? -19.127 -46.778 28.356  1.00 27.33  ? 1806 VAL A HG13   1 
ATOM   7305  H  HG21   . VAL A 1 444  ? -16.767 -45.043 28.364  1.00 27.72  ? 1806 VAL A HG21   1 
ATOM   7306  H  HG22   . VAL A 1 444  ? -18.238 -44.448 28.454  1.00 27.72  ? 1806 VAL A HG22   1 
ATOM   7307  H  HG23   . VAL A 1 444  ? -17.160 -44.073 29.559  1.00 27.72  ? 1806 VAL A HG23   1 
ATOM   7308  N  N      . LYS A 1 445  ? -18.772 -47.183 32.542  1.00 34.80  ? 1807 LYS A N      1 
ATOM   7309  C  CA     . LYS A 1 445  ? -19.162 -48.269 33.429  1.00 34.88  ? 1807 LYS A CA     1 
ATOM   7310  C  C      . LYS A 1 445  ? -20.566 -48.063 34.005  1.00 35.21  ? 1807 LYS A C      1 
ATOM   7311  O  O      . LYS A 1 445  ? -21.390 -48.972 33.942  1.00 35.25  ? 1807 LYS A O      1 
ATOM   7312  C  CB     . LYS A 1 445  ? -18.117 -48.415 34.536  1.00 34.97  ? 1807 LYS A CB     1 
ATOM   7313  C  CG     . LYS A 1 445  ? -16.933 -49.267 34.092  1.00 34.68  ? 1807 LYS A CG     1 
ATOM   7314  C  CD     . LYS A 1 445  ? -15.743 -49.274 35.057  1.00 34.80  ? 1807 LYS A CD     1 
ATOM   7315  C  CE     . LYS A 1 445  ? -16.092 -49.424 36.530  1.00 35.19  ? 1807 LYS A CE     1 
ATOM   7316  N  NZ     . LYS A 1 445  ? -14.889 -49.088 37.356  1.00 35.36  1 1807 LYS A NZ     1 
ATOM   7317  H  H      . LYS A 1 445  ? -18.019 -46.823 32.747  1.00 41.76  ? 1807 LYS A H      1 
ATOM   7318  H  HA     . LYS A 1 445  ? -19.172 -49.096 32.922  1.00 41.86  ? 1807 LYS A HA     1 
ATOM   7319  H  HB2    . LYS A 1 445  ? -17.785 -47.537 34.779  1.00 41.97  ? 1807 LYS A HB2    1 
ATOM   7320  H  HB3    . LYS A 1 445  ? -18.526 -48.842 35.306  1.00 41.97  ? 1807 LYS A HB3    1 
ATOM   7321  H  HG2    . LYS A 1 445  ? -17.233 -50.183 33.990  1.00 41.62  ? 1807 LYS A HG2    1 
ATOM   7322  H  HG3    . LYS A 1 445  ? -16.615 -48.932 33.239  1.00 41.62  ? 1807 LYS A HG3    1 
ATOM   7323  H  HD2    . LYS A 1 445  ? -15.161 -50.013 34.820  1.00 41.75  ? 1807 LYS A HD2    1 
ATOM   7324  H  HD3    . LYS A 1 445  ? -15.261 -48.438 34.956  1.00 41.75  ? 1807 LYS A HD3    1 
ATOM   7325  H  HE2    . LYS A 1 445  ? -16.809 -48.812 36.761  1.00 42.23  ? 1807 LYS A HE2    1 
ATOM   7326  H  HE3    . LYS A 1 445  ? -16.350 -50.340 36.714  1.00 42.23  ? 1807 LYS A HE3    1 
ATOM   7327  H  HZ1    . LYS A 1 445  ? -15.081 -49.172 38.221  1.00 42.43  ? 1807 LYS A HZ1    1 
ATOM   7328  H  HZ2    . LYS A 1 445  ? -14.219 -49.638 37.154  1.00 42.43  ? 1807 LYS A HZ2    1 
ATOM   7329  H  HZ3    . LYS A 1 445  ? -14.635 -48.251 37.196  1.00 42.43  ? 1807 LYS A HZ3    1 
ATOM   7330  N  N      . ALA A 1 446  ? -20.854 -46.872 34.534  1.00 25.37  ? 1808 ALA A N      1 
ATOM   7331  C  CA     . ALA A 1 446  ? -22.174 -46.601 35.114  1.00 25.75  ? 1808 ALA A CA     1 
ATOM   7332  C  C      . ALA A 1 446  ? -23.248 -46.606 34.032  1.00 25.70  ? 1808 ALA A C      1 
ATOM   7333  O  O      . ALA A 1 446  ? -24.378 -47.024 34.272  1.00 25.92  ? 1808 ALA A O      1 
ATOM   7334  C  CB     . ALA A 1 446  ? -22.179 -45.280 35.856  1.00 26.14  ? 1808 ALA A CB     1 
ATOM   7335  H  H      . ALA A 1 446  ? -20.309 -46.208 34.570  1.00 30.44  ? 1808 ALA A H      1 
ATOM   7336  H  HA     . ALA A 1 446  ? -22.387 -47.302 35.750  1.00 30.90  ? 1808 ALA A HA     1 
ATOM   7337  H  HB1    . ALA A 1 446  ? -23.063 -45.131 36.227  1.00 31.37  ? 1808 ALA A HB1    1 
ATOM   7338  H  HB2    . ALA A 1 446  ? -21.523 -45.316 36.569  1.00 31.37  ? 1808 ALA A HB2    1 
ATOM   7339  H  HB3    . ALA A 1 446  ? -21.956 -44.569 35.236  1.00 31.37  ? 1808 ALA A HB3    1 
ATOM   7340  N  N      . PHE A 1 447  ? -22.894 -46.136 32.842  1.00 27.37  ? 1809 PHE A N      1 
ATOM   7341  C  CA     . PHE A 1 447  ? -23.797 -46.190 31.698  1.00 27.34  ? 1809 PHE A CA     1 
ATOM   7342  C  C      . PHE A 1 447  ? -24.168 -47.628 31.351  1.00 27.18  ? 1809 PHE A C      1 
ATOM   7343  O  O      . PHE A 1 447  ? -25.323 -47.921 31.042  1.00 27.35  ? 1809 PHE A O      1 
ATOM   7344  C  CB     . PHE A 1 447  ? -23.157 -45.509 30.490  1.00 27.18  ? 1809 PHE A CB     1 
ATOM   7345  C  CG     . PHE A 1 447  ? -24.038 -45.463 29.273  1.00 27.24  ? 1809 PHE A CG     1 
ATOM   7346  C  CD1    . PHE A 1 447  ? -25.231 -44.763 29.281  1.00 27.60  ? 1809 PHE A CD1    1 
ATOM   7347  C  CD2    . PHE A 1 447  ? -23.656 -46.110 28.112  1.00 26.99  ? 1809 PHE A CD2    1 
ATOM   7348  C  CE1    . PHE A 1 447  ? -26.028 -44.723 28.156  1.00 27.71  ? 1809 PHE A CE1    1 
ATOM   7349  C  CE2    . PHE A 1 447  ? -24.448 -46.073 26.990  1.00 27.11  ? 1809 PHE A CE2    1 
ATOM   7350  C  CZ     . PHE A 1 447  ? -25.635 -45.380 27.010  1.00 27.47  ? 1809 PHE A CZ     1 
ATOM   7351  H  H      . PHE A 1 447  ? -22.131 -45.779 32.669  1.00 32.84  ? 1809 PHE A H      1 
ATOM   7352  H  HA     . PHE A 1 447  ? -24.613 -45.712 31.915  1.00 32.81  ? 1809 PHE A HA     1 
ATOM   7353  H  HB2    . PHE A 1 447  ? -22.935 -44.595 30.728  1.00 32.62  ? 1809 PHE A HB2    1 
ATOM   7354  H  HB3    . PHE A 1 447  ? -22.349 -45.991 30.252  1.00 32.62  ? 1809 PHE A HB3    1 
ATOM   7355  H  HD1    . PHE A 1 447  ? -25.500 -44.321 30.053  1.00 33.12  ? 1809 PHE A HD1    1 
ATOM   7356  H  HD2    . PHE A 1 447  ? -22.855 -46.582 28.092  1.00 32.39  ? 1809 PHE A HD2    1 
ATOM   7357  H  HE1    . PHE A 1 447  ? -26.831 -44.254 28.171  1.00 33.26  ? 1809 PHE A HE1    1 
ATOM   7358  H  HE2    . PHE A 1 447  ? -24.181 -46.516 26.217  1.00 32.54  ? 1809 PHE A HE2    1 
ATOM   7359  H  HZ     . PHE A 1 447  ? -26.172 -45.353 26.251  1.00 32.97  ? 1809 PHE A HZ     1 
ATOM   7360  N  N      . GLY A 1 448  ? -23.185 -48.520 31.404  1.00 40.56  ? 1810 GLY A N      1 
ATOM   7361  C  CA     . GLY A 1 448  ? -23.434 -49.935 31.220  1.00 40.49  ? 1810 GLY A CA     1 
ATOM   7362  C  C      . GLY A 1 448  ? -24.367 -50.459 32.295  1.00 41.43  ? 1810 GLY A C      1 
ATOM   7363  O  O      . GLY A 1 448  ? -25.356 -51.131 31.993  1.00 41.38  ? 1810 GLY A O      1 
ATOM   7364  H  H      . GLY A 1 448  ? -22.360 -48.325 31.547  1.00 48.68  ? 1810 GLY A H      1 
ATOM   7365  H  HA2    . GLY A 1 448  ? -23.840 -50.088 30.352  1.00 48.59  ? 1810 GLY A HA2    1 
ATOM   7366  H  HA3    . GLY A 1 448  ? -22.598 -50.425 31.265  1.00 48.59  ? 1810 GLY A HA3    1 
ATOM   7367  N  N      . GLN A 1 449  ? -24.047 -50.142 33.551  1.00 22.75  ? 1811 GLN A N      1 
ATOM   7368  C  CA     . GLN A 1 449  ? -24.860 -50.553 34.698  1.00 23.17  ? 1811 GLN A CA     1 
ATOM   7369  C  C      . GLN A 1 449  ? -26.326 -50.182 34.510  1.00 23.48  ? 1811 GLN A C      1 
ATOM   7370  O  O      . GLN A 1 449  ? -27.226 -50.976 34.778  1.00 23.76  ? 1811 GLN A O      1 
ATOM   7371  C  CB     . GLN A 1 449  ? -24.374 -49.898 35.995  1.00 23.42  ? 1811 GLN A CB     1 
ATOM   7372  C  CG     . GLN A 1 449  ? -22.981 -50.244 36.484  1.00 23.26  ? 1811 GLN A CG     1 
ATOM   7373  C  CD     . GLN A 1 449  ? -22.608 -49.391 37.682  1.00 23.58  ? 1811 GLN A CD     1 
ATOM   7374  O  OE1    . GLN A 1 449  ? -23.476 -48.789 38.314  1.00 23.99  ? 1811 GLN A OE1    1 
ATOM   7375  N  NE2    . GLN A 1 449  ? -21.325 -49.320 37.991  1.00 23.46  ? 1811 GLN A NE2    1 
ATOM   7376  H  H      . GLN A 1 449  ? -23.353 -49.682 33.768  1.00 27.30  ? 1811 GLN A H      1 
ATOM   7377  H  HA     . GLN A 1 449  ? -24.801 -51.515 34.802  1.00 27.81  ? 1811 GLN A HA     1 
ATOM   7378  H  HB2    . GLN A 1 449  ? -24.400 -48.936 35.871  1.00 28.10  ? 1811 GLN A HB2    1 
ATOM   7379  H  HB3    . GLN A 1 449  ? -24.991 -50.144 36.702  1.00 28.10  ? 1811 GLN A HB3    1 
ATOM   7380  H  HG2    . GLN A 1 449  ? -22.954 -51.176 36.751  1.00 27.91  ? 1811 GLN A HG2    1 
ATOM   7381  H  HG3    . GLN A 1 449  ? -22.339 -50.075 35.776  1.00 27.91  ? 1811 GLN A HG3    1 
ATOM   7382  H  HE21   . GLN A 1 449  ? -20.745 -49.746 37.521  1.00 28.15  ? 1811 GLN A HE21   1 
ATOM   7383  H  HE22   . GLN A 1 449  ? -21.070 -48.847 38.663  1.00 28.15  ? 1811 GLN A HE22   1 
ATOM   7384  N  N      . ASN A 1 450  ? -26.565 -48.955 34.068  1.00 23.48  ? 1812 ASN A N      1 
ATOM   7385  C  CA     . ASN A 1 450  ? -27.921 -48.436 34.005  1.00 23.85  ? 1812 ASN A CA     1 
ATOM   7386  C  C      . ASN A 1 450  ? -28.760 -49.212 33.002  1.00 23.82  ? 1812 ASN A C      1 
ATOM   7387  O  O      . ASN A 1 450  ? -29.975 -49.339 33.159  1.00 24.19  ? 1812 ASN A O      1 
ATOM   7388  C  CB     . ASN A 1 450  ? -27.898 -46.949 33.659  1.00 23.91  ? 1812 ASN A CB     1 
ATOM   7389  C  CG     . ASN A 1 450  ? -27.722 -46.072 34.883  1.00 24.25  ? 1812 ASN A CG     1 
ATOM   7390  O  OD1    . ASN A 1 450  ? -27.348 -46.548 35.954  1.00 24.37  ? 1812 ASN A OD1    1 
ATOM   7391  N  ND2    . ASN A 1 450  ? -27.972 -44.780 34.726  1.00 24.48  ? 1812 ASN A ND2    1 
ATOM   7392  H  H      . ASN A 1 450  ? -25.961 -48.405 33.799  1.00 28.18  ? 1812 ASN A H      1 
ATOM   7393  H  HA     . ASN A 1 450  ? -28.335 -48.533 34.877  1.00 28.62  ? 1812 ASN A HA     1 
ATOM   7394  H  HB2    . ASN A 1 450  ? -27.159 -46.775 33.056  1.00 28.69  ? 1812 ASN A HB2    1 
ATOM   7395  H  HB3    . ASN A 1 450  ? -28.737 -46.709 33.236  1.00 28.69  ? 1812 ASN A HB3    1 
ATOM   7396  H  HD21   . ASN A 1 450  ? -27.887 -44.242 35.391  1.00 29.38  ? 1812 ASN A HD21   1 
ATOM   7397  H  HD22   . ASN A 1 450  ? -28.220 -44.480 33.959  1.00 29.38  ? 1812 ASN A HD22   1 
ATOM   7398  N  N      . LEU A 1 451  ? -28.097 -49.742 31.981  1.00 23.43  ? 1813 LEU A N      1 
ATOM   7399  C  CA     . LEU A 1 451  ? -28.750 -50.587 30.992  1.00 23.43  ? 1813 LEU A CA     1 
ATOM   7400  C  C      . LEU A 1 451  ? -28.593 -52.061 31.332  1.00 23.45  ? 1813 LEU A C      1 
ATOM   7401  O  O      . LEU A 1 451  ? -28.993 -52.927 30.562  1.00 23.49  ? 1813 LEU A O      1 
ATOM   7402  C  CB     . LEU A 1 451  ? -28.196 -50.287 29.604  1.00 23.12  ? 1813 LEU A CB     1 
ATOM   7403  C  CG     . LEU A 1 451  ? -28.483 -48.853 29.165  1.00 23.23  ? 1813 LEU A CG     1 
ATOM   7404  C  CD1    . LEU A 1 451  ? -27.767 -48.501 27.894  1.00 29.42  ? 1813 LEU A CD1    1 
ATOM   7405  C  CD2    . LEU A 1 451  ? -29.965 -48.660 28.987  1.00 23.63  ? 1813 LEU A CD2    1 
ATOM   7406  H  H      . LEU A 1 451  ? -27.257 -49.624 31.837  1.00 28.12  ? 1813 LEU A H      1 
ATOM   7407  H  HA     . LEU A 1 451  ? -29.698 -50.384 30.984  1.00 28.12  ? 1813 LEU A HA     1 
ATOM   7408  H  HB2    . LEU A 1 451  ? -27.234 -50.414 29.611  1.00 27.75  ? 1813 LEU A HB2    1 
ATOM   7409  H  HB3    . LEU A 1 451  ? -28.606 -50.887 28.961  1.00 27.75  ? 1813 LEU A HB3    1 
ATOM   7410  H  HG     . LEU A 1 451  ? -28.182 -48.244 29.858  1.00 27.87  ? 1813 LEU A HG     1 
ATOM   7411  H  HD11   . LEU A 1 451  ? -27.978 -47.585 27.656  1.00 35.31  ? 1813 LEU A HD11   1 
ATOM   7412  H  HD12   . LEU A 1 451  ? -26.811 -48.595 28.034  1.00 35.31  ? 1813 LEU A HD12   1 
ATOM   7413  H  HD13   . LEU A 1 451  ? -28.059 -49.103 27.191  1.00 35.31  ? 1813 LEU A HD13   1 
ATOM   7414  H  HD21   . LEU A 1 451  ? -30.133 -47.746 28.709  1.00 28.36  ? 1813 LEU A HD21   1 
ATOM   7415  H  HD22   . LEU A 1 451  ? -30.284 -49.277 28.309  1.00 28.36  ? 1813 LEU A HD22   1 
ATOM   7416  H  HD23   . LEU A 1 451  ? -30.410 -48.837 29.831  1.00 28.36  ? 1813 LEU A HD23   1 
ATOM   7417  N  N      . GLY A 1 452  ? -28.002 -52.344 32.486  1.00 23.49  ? 1814 GLY A N      1 
ATOM   7418  C  CA     . GLY A 1 452  ? -27.916 -53.705 32.969  1.00 23.64  ? 1814 GLY A CA     1 
ATOM   7419  C  C      . GLY A 1 452  ? -26.820 -54.475 32.270  1.00 23.28  ? 1814 GLY A C      1 
ATOM   7420  O  O      . GLY A 1 452  ? -26.955 -55.671 32.033  1.00 23.41  ? 1814 GLY A O      1 
ATOM   7421  H  H      . GLY A 1 452  ? -27.643 -51.761 33.006  1.00 28.19  ? 1814 GLY A H      1 
ATOM   7422  H  HA2    . GLY A 1 452  ? -27.733 -53.701 33.922  1.00 28.37  ? 1814 GLY A HA2    1 
ATOM   7423  H  HA3    . GLY A 1 452  ? -28.759 -54.159 32.818  1.00 28.37  ? 1814 GLY A HA3    1 
ATOM   7424  N  N      . ARG A 1 453  ? -25.724 -53.796 31.954  1.00 30.79  ? 1815 ARG A N      1 
ATOM   7425  C  CA     . ARG A 1 453  ? -24.573 -54.446 31.338  1.00 30.48  ? 1815 ARG A CA     1 
ATOM   7426  C  C      . ARG A 1 453  ? -23.315 -54.238 32.155  1.00 30.33  ? 1815 ARG A C      1 
ATOM   7427  O  O      . ARG A 1 453  ? -23.043 -53.139 32.639  1.00 30.29  ? 1815 ARG A O      1 
ATOM   7428  C  CB     . ARG A 1 453  ? -24.328 -53.921 29.924  1.00 30.20  ? 1815 ARG A CB     1 
ATOM   7429  C  CG     . ARG A 1 453  ? -25.527 -53.938 29.006  1.00 30.38  ? 1815 ARG A CG     1 
ATOM   7430  C  CD     . ARG A 1 453  ? -25.081 -53.825 27.557  1.00 30.17  ? 1815 ARG A CD     1 
ATOM   7431  N  NE     . ARG A 1 453  ? -26.116 -53.249 26.703  1.00 30.35  ? 1815 ARG A NE     1 
ATOM   7432  C  CZ     . ARG A 1 453  ? -26.258 -53.508 25.408  1.00 30.39  ? 1815 ARG A CZ     1 
ATOM   7433  N  NH1    . ARG A 1 453  ? -25.429 -54.343 24.790  1.00 30.27  1 1815 ARG A NH1    1 
ATOM   7434  N  NH2    . ARG A 1 453  ? -27.235 -52.925 24.725  1.00 30.62  ? 1815 ARG A NH2    1 
ATOM   7435  H  H      . ARG A 1 453  ? -25.621 -52.953 32.087  1.00 36.94  ? 1815 ARG A H      1 
ATOM   7436  H  HA     . ARG A 1 453  ? -24.741 -55.399 31.281  1.00 36.57  ? 1815 ARG A HA     1 
ATOM   7437  H  HB2    . ARG A 1 453  ? -24.023 -53.002 29.986  1.00 36.24  ? 1815 ARG A HB2    1 
ATOM   7438  H  HB3    . ARG A 1 453  ? -23.639 -54.464 29.510  1.00 36.24  ? 1815 ARG A HB3    1 
ATOM   7439  H  HG2    . ARG A 1 453  ? -26.008 -54.772 29.117  1.00 36.45  ? 1815 ARG A HG2    1 
ATOM   7440  H  HG3    . ARG A 1 453  ? -26.102 -53.184 29.211  1.00 36.45  ? 1815 ARG A HG3    1 
ATOM   7441  H  HD2    . ARG A 1 453  ? -24.299 -53.254 27.508  1.00 36.21  ? 1815 ARG A HD2    1 
ATOM   7442  H  HD3    . ARG A 1 453  ? -24.870 -54.710 27.220  1.00 36.21  ? 1815 ARG A HD3    1 
ATOM   7443  H  HE     . ARG A 1 453  ? -26.675 -52.704 27.065  1.00 36.42  ? 1815 ARG A HE     1 
ATOM   7444  H  HH11   . ARG A 1 453  ? -24.794 -54.721 25.229  1.00 36.33  ? 1815 ARG A HH11   1 
ATOM   7445  H  HH12   . ARG A 1 453  ? -25.527 -54.504 23.951  1.00 36.33  ? 1815 ARG A HH12   1 
ATOM   7446  H  HH21   . ARG A 1 453  ? -27.773 -52.384 25.121  1.00 36.75  ? 1815 ARG A HH21   1 
ATOM   7447  H  HH22   . ARG A 1 453  ? -27.331 -53.090 23.886  1.00 36.75  ? 1815 ARG A HH22   1 
ATOM   7448  N  N      . VAL A 1 454  ? -22.548 -55.310 32.297  1.00 29.82  ? 1816 VAL A N      1 
ATOM   7449  C  CA     . VAL A 1 454  ? -21.219 -55.210 32.868  1.00 29.67  ? 1816 VAL A CA     1 
ATOM   7450  C  C      . VAL A 1 454  ? -20.218 -54.919 31.760  1.00 29.28  ? 1816 VAL A C      1 
ATOM   7451  O  O      . VAL A 1 454  ? -19.987 -55.746 30.876  1.00 29.21  ? 1816 VAL A O      1 
ATOM   7452  C  CB     . VAL A 1 454  ? -20.829 -56.495 33.602  1.00 29.91  ? 1816 VAL A CB     1 
ATOM   7453  C  CG1    . VAL A 1 454  ? -19.416 -56.390 34.154  1.00 29.79  ? 1816 VAL A CG1    1 
ATOM   7454  C  CG2    . VAL A 1 454  ? -21.812 -56.768 34.722  1.00 30.39  ? 1816 VAL A CG2    1 
ATOM   7455  H  H      . VAL A 1 454  ? -22.775 -56.107 32.069  1.00 35.78  ? 1816 VAL A H      1 
ATOM   7456  H  HA     . VAL A 1 454  ? -21.196 -54.476 33.502  1.00 35.60  ? 1816 VAL A HA     1 
ATOM   7457  H  HB     . VAL A 1 454  ? -20.860 -57.241 32.982  1.00 35.89  ? 1816 VAL A HB     1 
ATOM   7458  H  HG11   . VAL A 1 454  ? -19.194 -57.216 34.613  1.00 35.75  ? 1816 VAL A HG11   1 
ATOM   7459  H  HG12   . VAL A 1 454  ? -18.800 -56.245 33.419  1.00 35.75  ? 1816 VAL A HG12   1 
ATOM   7460  H  HG13   . VAL A 1 454  ? -19.374 -55.645 34.774  1.00 35.75  ? 1816 VAL A HG13   1 
ATOM   7461  H  HG21   . VAL A 1 454  ? -21.552 -57.585 35.177  1.00 36.46  ? 1816 VAL A HG21   1 
ATOM   7462  H  HG22   . VAL A 1 454  ? -21.796 -56.024 35.344  1.00 36.46  ? 1816 VAL A HG22   1 
ATOM   7463  H  HG23   . VAL A 1 454  ? -22.700 -56.867 34.346  1.00 36.46  ? 1816 VAL A HG23   1 
ATOM   7464  N  N      . VAL A 1 455  ? -19.628 -53.732 31.824  1.00 21.71  ? 1817 VAL A N      1 
ATOM   7465  C  CA     . VAL A 1 455  ? -18.684 -53.273 30.820  1.00 21.42  ? 1817 VAL A CA     1 
ATOM   7466  C  C      . VAL A 1 455  ? -17.321 -53.901 31.114  1.00 21.33  ? 1817 VAL A C      1 
ATOM   7467  O  O      . VAL A 1 455  ? -16.823 -53.767 32.229  1.00 21.44  ? 1817 VAL A O      1 
ATOM   7468  C  CB     . VAL A 1 455  ? -18.609 -51.707 30.823  1.00 21.39  ? 1817 VAL A CB     1 
ATOM   7469  C  CG1    . VAL A 1 455  ? -17.393 -51.173 30.065  1.00 21.17  ? 1817 VAL A CG1    1 
ATOM   7470  C  CG2    . VAL A 1 455  ? -19.900 -51.100 30.263  1.00 21.50  ? 1817 VAL A CG2    1 
ATOM   7471  H  H      . VAL A 1 455  ? -19.763 -53.163 32.455  1.00 26.06  ? 1817 VAL A H      1 
ATOM   7472  H  HA     . VAL A 1 455  ? -18.975 -53.566 29.943  1.00 25.71  ? 1817 VAL A HA     1 
ATOM   7473  H  HB     . VAL A 1 455  ? -18.527 -51.410 31.743  1.00 25.66  ? 1817 VAL A HB     1 
ATOM   7474  H  HG11   . VAL A 1 455  ? -17.400 -50.204 30.100  1.00 25.41  ? 1817 VAL A HG11   1 
ATOM   7475  H  HG12   . VAL A 1 455  ? -16.587 -51.514 30.482  1.00 25.41  ? 1817 VAL A HG12   1 
ATOM   7476  H  HG13   . VAL A 1 455  ? -17.441 -51.471 29.143  1.00 25.41  ? 1817 VAL A HG13   1 
ATOM   7477  H  HG21   . VAL A 1 455  ? -19.825 -50.133 30.277  1.00 25.80  ? 1817 VAL A HG21   1 
ATOM   7478  H  HG22   . VAL A 1 455  ? -20.024 -51.409 29.352  1.00 25.80  ? 1817 VAL A HG22   1 
ATOM   7479  H  HG23   . VAL A 1 455  ? -20.647 -51.382 30.814  1.00 25.80  ? 1817 VAL A HG23   1 
ATOM   7480  N  N      . VAL A 1 456  ? -16.728 -54.599 30.141  1.00 21.20  ? 1818 VAL A N      1 
ATOM   7481  C  CA     . VAL A 1 456  ? -15.356 -55.096 30.309  1.00 21.14  ? 1818 VAL A CA     1 
ATOM   7482  C  C      . VAL A 1 456  ? -14.401 -53.974 29.952  1.00 20.96  ? 1818 VAL A C      1 
ATOM   7483  O  O      . VAL A 1 456  ? -14.643 -53.205 29.024  1.00 20.87  ? 1818 VAL A O      1 
ATOM   7484  C  CB     . VAL A 1 456  ? -15.024 -56.351 29.451  1.00 21.16  ? 1818 VAL A CB     1 
ATOM   7485  C  CG1    . VAL A 1 456  ? -16.181 -57.332 29.433  1.00 21.39  ? 1818 VAL A CG1    1 
ATOM   7486  C  CG2    . VAL A 1 456  ? -14.602 -55.982 28.038  1.00 21.00  ? 1818 VAL A CG2    1 
ATOM   7487  H  H      . VAL A 1 456  ? -17.090 -54.797 29.386  1.00 25.44  ? 1818 VAL A H      1 
ATOM   7488  H  HA     . VAL A 1 456  ? -15.215 -55.325 31.241  1.00 25.37  ? 1818 VAL A HA     1 
ATOM   7489  H  HB     . VAL A 1 456  ? -14.272 -56.805 29.862  1.00 25.39  ? 1818 VAL A HB     1 
ATOM   7490  H  HG11   . VAL A 1 456  ? -15.936 -58.098 28.890  1.00 25.67  ? 1818 VAL A HG11   1 
ATOM   7491  H  HG12   . VAL A 1 456  ? -16.367 -57.617 30.342  1.00 25.67  ? 1818 VAL A HG12   1 
ATOM   7492  H  HG13   . VAL A 1 456  ? -16.960 -56.895 29.057  1.00 25.67  ? 1818 VAL A HG13   1 
ATOM   7493  H  HG21   . VAL A 1 456  ? -14.407 -56.794 27.545  1.00 25.20  ? 1818 VAL A HG21   1 
ATOM   7494  H  HG22   . VAL A 1 456  ? -15.326 -55.499 27.608  1.00 25.20  ? 1818 VAL A HG22   1 
ATOM   7495  H  HG23   . VAL A 1 456  ? -13.811 -55.422 28.081  1.00 25.20  ? 1818 VAL A HG23   1 
ATOM   7496  N  N      . VAL A 1 457  ? -13.311 -53.888 30.695  1.00 22.64  ? 1819 VAL A N      1 
ATOM   7497  C  CA     . VAL A 1 457  ? -12.418 -52.749 30.595  1.00 22.57  ? 1819 VAL A CA     1 
ATOM   7498  C  C      . VAL A 1 457  ? -10.983 -53.189 30.327  1.00 22.52  ? 1819 VAL A C      1 
ATOM   7499  O  O      . VAL A 1 457  ? -10.474 -54.096 30.988  1.00 22.63  ? 1819 VAL A O      1 
ATOM   7500  C  CB     . VAL A 1 457  ? -12.505 -51.920 31.886  1.00 22.73  ? 1819 VAL A CB     1 
ATOM   7501  C  CG1    . VAL A 1 457  ? -11.399 -50.880 31.962  1.00 22.75  ? 1819 VAL A CG1    1 
ATOM   7502  C  CG2    . VAL A 1 457  ? -13.873 -51.270 31.975  1.00 22.81  ? 1819 VAL A CG2    1 
ATOM   7503  H  H      . VAL A 1 457  ? -13.064 -54.480 31.268  1.00 27.17  ? 1819 VAL A H      1 
ATOM   7504  H  HA     . VAL A 1 457  ? -12.702 -52.187 29.857  1.00 27.08  ? 1819 VAL A HA     1 
ATOM   7505  H  HB     . VAL A 1 457  ? -12.408 -52.514 32.647  1.00 27.28  ? 1819 VAL A HB     1 
ATOM   7506  H  HG11   . VAL A 1 457  ? -11.491 -50.381 32.789  1.00 27.30  ? 1819 VAL A HG11   1 
ATOM   7507  H  HG12   . VAL A 1 457  ? -10.540 -51.331 31.940  1.00 27.30  ? 1819 VAL A HG12   1 
ATOM   7508  H  HG13   . VAL A 1 457  ? -11.477 -50.280 31.203  1.00 27.30  ? 1819 VAL A HG13   1 
ATOM   7509  H  HG21   . VAL A 1 457  ? -13.922 -50.749 32.791  1.00 27.37  ? 1819 VAL A HG21   1 
ATOM   7510  H  HG22   . VAL A 1 457  ? -13.998 -50.693 31.205  1.00 27.37  ? 1819 VAL A HG22   1 
ATOM   7511  H  HG23   . VAL A 1 457  ? -14.551 -51.964 31.983  1.00 27.37  ? 1819 VAL A HG23   1 
ATOM   7512  N  N      . PHE A 1 458  ? -10.334 -52.540 29.361  1.00 22.95  ? 1820 PHE A N      1 
ATOM   7513  C  CA     . PHE A 1 458  ? -8.919  -52.791 29.094  1.00 22.96  ? 1820 PHE A CA     1 
ATOM   7514  C  C      . PHE A 1 458  ? -8.103  -51.573 29.496  1.00 23.04  ? 1820 PHE A C      1 
ATOM   7515  O  O      . PHE A 1 458  ? -8.168  -50.524 28.853  1.00 23.04  ? 1820 PHE A O      1 
ATOM   7516  C  CB     . PHE A 1 458  ? -8.643  -53.130 27.619  1.00 22.91  ? 1820 PHE A CB     1 
ATOM   7517  C  CG     . PHE A 1 458  ? -9.680  -54.005 26.968  1.00 22.90  ? 1820 PHE A CG     1 
ATOM   7518  C  CD1    . PHE A 1 458  ? -9.963  -55.262 27.466  1.00 22.97  ? 1820 PHE A CD1    1 
ATOM   7519  C  CD2    . PHE A 1 458  ? -10.292 -53.613 25.788  1.00 22.89  ? 1820 PHE A CD2    1 
ATOM   7520  C  CE1    . PHE A 1 458  ? -10.897 -56.074 26.848  1.00 23.03  ? 1820 PHE A CE1    1 
ATOM   7521  C  CE2    . PHE A 1 458  ? -11.218 -54.428 25.161  1.00 22.94  ? 1820 PHE A CE2    1 
ATOM   7522  C  CZ     . PHE A 1 458  ? -11.512 -55.662 25.687  1.00 23.01  ? 1820 PHE A CZ     1 
ATOM   7523  H  H      . PHE A 1 458  ? -10.690 -51.950 28.846  1.00 27.54  ? 1820 PHE A H      1 
ATOM   7524  H  HA     . PHE A 1 458  ? -8.625  -53.542 29.634  1.00 27.55  ? 1820 PHE A HA     1 
ATOM   7525  H  HB2    . PHE A 1 458  ? -8.599  -52.302 27.115  1.00 27.50  ? 1820 PHE A HB2    1 
ATOM   7526  H  HB3    . PHE A 1 458  ? -7.792  -53.592 27.562  1.00 27.50  ? 1820 PHE A HB3    1 
ATOM   7527  H  HD1    . PHE A 1 458  ? -9.553  -55.548 28.251  1.00 27.57  ? 1820 PHE A HD1    1 
ATOM   7528  H  HD2    . PHE A 1 458  ? -10.098 -52.778 25.427  1.00 27.47  ? 1820 PHE A HD2    1 
ATOM   7529  H  HE1    . PHE A 1 458  ? -11.092 -56.911 27.204  1.00 27.64  ? 1820 PHE A HE1    1 
ATOM   7530  H  HE2    . PHE A 1 458  ? -11.636 -54.143 24.380  1.00 27.53  ? 1820 PHE A HE2    1 
ATOM   7531  H  HZ     . PHE A 1 458  ? -12.137 -56.209 25.271  1.00 27.61  ? 1820 PHE A HZ     1 
ATOM   7532  N  N      . ASN A 1 459  ? -7.338  -51.720 30.573  1.00 33.12  ? 1821 ASN A N      1 
ATOM   7533  C  CA     . ASN A 1 459  ? -6.383  -50.699 30.983  1.00 33.26  ? 1821 ASN A CA     1 
ATOM   7534  C  C      . ASN A 1 459  ? -5.124  -50.784 30.131  1.00 33.28  ? 1821 ASN A C      1 
ATOM   7535  O  O      . ASN A 1 459  ? -4.511  -51.842 30.027  1.00 33.28  ? 1821 ASN A O      1 
ATOM   7536  C  CB     . ASN A 1 459  ? -6.038  -50.850 32.460  1.00 36.08  ? 1821 ASN A CB     1 
ATOM   7537  C  CG     . ASN A 1 459  ? -7.240  -50.649 33.365  1.00 47.10  ? 1821 ASN A CG     1 
ATOM   7538  O  OD1    . ASN A 1 459  ? -8.039  -51.567 33.577  1.00 49.92  ? 1821 ASN A OD1    1 
ATOM   7539  N  ND2    . ASN A 1 459  ? -7.370  -49.442 33.910  1.00 52.00  ? 1821 ASN A ND2    1 
ATOM   7540  H  H      . ASN A 1 459  ? -7.354  -52.409 31.087  1.00 39.74  ? 1821 ASN A H      1 
ATOM   7541  H  HA     . ASN A 1 459  ? -6.778  -49.823 30.852  1.00 39.91  ? 1821 ASN A HA     1 
ATOM   7542  H  HB2    . ASN A 1 459  ? -5.692  -51.743 32.615  1.00 43.29  ? 1821 ASN A HB2    1 
ATOM   7543  H  HB3    . ASN A 1 459  ? -5.369  -50.189 32.698  1.00 43.29  ? 1821 ASN A HB3    1 
ATOM   7544  H  HD21   . ASN A 1 459  ? -8.033  -49.275 34.431  1.00 62.39  ? 1821 ASN A HD21   1 
ATOM   7545  H  HD22   . ASN A 1 459  ? -6.790  -48.830 33.743  1.00 62.39  ? 1821 ASN A HD22   1 
ATOM   7546  N  N      . CYS A 1 460  ? -4.736  -49.662 29.539  1.00 23.55  ? 1822 CYS A N      1 
ATOM   7547  C  CA     . CYS A 1 460  ? -3.732  -49.651 28.480  1.00 33.49  ? 1822 CYS A CA     1 
ATOM   7548  C  C      . CYS A 1 460  ? -2.359  -49.223 29.005  1.00 47.14  ? 1822 CYS A C      1 
ATOM   7549  O  O      . CYS A 1 460  ? -2.261  -48.437 29.950  1.00 68.73  ? 1822 CYS A O      1 
ATOM   7550  C  CB     . CYS A 1 460  ? -4.186  -48.737 27.340  1.00 29.96  ? 1822 CYS A CB     1 
ATOM   7551  S  SG     . CYS A 1 460  ? -5.690  -49.301 26.489  1.00 23.44  ? 1822 CYS A SG     1 
ATOM   7552  H  H      . CYS A 1 460  ? -5.043  -48.882 29.735  1.00 28.26  ? 1822 CYS A H      1 
ATOM   7553  H  HA     . CYS A 1 460  ? -3.645  -50.549 28.123  1.00 40.19  ? 1822 CYS A HA     1 
ATOM   7554  H  HB2    . CYS A 1 460  ? -4.364  -47.854 27.701  1.00 35.95  ? 1822 CYS A HB2    1 
ATOM   7555  H  HB3    . CYS A 1 460  ? -3.476  -48.684 26.682  1.00 35.95  ? 1822 CYS A HB3    1 
ATOM   7556  H  HG     . CYS A 1 460  ? -6.589  -49.359 27.282  1.00 28.12  ? 1822 CYS A HG     1 
ATOM   7557  N  N      . ASP A 1 461  ? -1.308  -49.751 28.378  1.00 96.52  ? 1823 ASP A N      1 
ATOM   7558  C  CA     . ASP A 1 461  ? 0.073   -49.542 28.818  1.00 99.96  ? 1823 ASP A CA     1 
ATOM   7559  C  C      . ASP A 1 461  ? 0.252   -50.024 30.253  1.00 101.42 ? 1823 ASP A C      1 
ATOM   7560  O  O      . ASP A 1 461  ? 0.975   -49.427 31.052  1.00 101.54 ? 1823 ASP A O      1 
ATOM   7561  C  CB     . ASP A 1 461  ? 0.460   -48.064 28.704  1.00 102.81 ? 1823 ASP A CB     1 
ATOM   7562  C  CG     . ASP A 1 461  ? 1.969   -47.844 28.700  1.00 106.85 ? 1823 ASP A CG     1 
ATOM   7563  O  OD1    . ASP A 1 461  ? 2.719   -48.801 28.403  1.00 107.24 ? 1823 ASP A OD1    1 
ATOM   7564  O  OD2    . ASP A 1 461  ? 2.400   -46.707 29.000  1.00 106.98 1 1823 ASP A OD2    1 
ATOM   7565  H  H      . ASP A 1 461  ? -1.371  -50.246 27.678  1.00 115.83 ? 1823 ASP A H      1 
ATOM   7566  H  HA     . ASP A 1 461  ? 0.669   -50.055 28.250  1.00 119.95 ? 1823 ASP A HA     1 
ATOM   7567  H  HB2    . ASP A 1 461  ? 0.103   -47.707 27.876  1.00 123.37 ? 1823 ASP A HB2    1 
ATOM   7568  H  HB3    . ASP A 1 461  ? 0.090   -47.582 29.460  1.00 123.37 ? 1823 ASP A HB3    1 
ATOM   7569  N  N      . ASP A 1 462  ? -0.433  -51.118 30.557  1.00 96.48  ? 1824 ASP A N      1 
ATOM   7570  C  CA     . ASP A 1 462  ? -0.286  -51.841 31.811  1.00 97.93  ? 1824 ASP A CA     1 
ATOM   7571  C  C      . ASP A 1 462  ? 0.736   -52.969 31.667  1.00 96.02  ? 1824 ASP A C      1 
ATOM   7572  O  O      . ASP A 1 462  ? 0.844   -53.822 32.548  1.00 100.01 ? 1824 ASP A O      1 
ATOM   7573  C  CB     . ASP A 1 462  ? -1.638  -52.393 32.257  1.00 95.45  ? 1824 ASP A CB     1 
ATOM   7574  C  CG     . ASP A 1 462  ? -2.552  -51.315 32.803  1.00 87.82  ? 1824 ASP A CG     1 
ATOM   7575  O  OD1    . ASP A 1 462  ? -2.355  -50.132 32.447  1.00 84.43  ? 1824 ASP A OD1    1 
ATOM   7576  O  OD2    . ASP A 1 462  ? -3.471  -51.651 33.581  1.00 87.65  1 1824 ASP A OD2    1 
ATOM   7577  H  H      . ASP A 1 462  ? -1.011  -51.474 30.030  1.00 115.78 ? 1824 ASP A H      1 
ATOM   7578  H  HA     . ASP A 1 462  ? 0.032   -51.231 32.494  1.00 117.51 ? 1824 ASP A HA     1 
ATOM   7579  H  HB2    . ASP A 1 462  ? -2.079  -52.805 31.497  1.00 114.54 ? 1824 ASP A HB2    1 
ATOM   7580  H  HB3    . ASP A 1 462  ? -1.497  -53.050 32.956  1.00 114.54 ? 1824 ASP A HB3    1 
ATOM   7581  N  N      . SER A 1 463  ? 1.463   -52.965 30.547  1.00 97.56  ? 1825 SER A N      1 
ATOM   7582  C  CA     . SER A 1 463  ? 2.401   -54.031 30.185  1.00 97.35  ? 1825 SER A CA     1 
ATOM   7583  C  C      . SER A 1 463  ? 1.626   -55.269 29.725  1.00 97.55  ? 1825 SER A C      1 
ATOM   7584  O  O      . SER A 1 463  ? 2.142   -56.389 29.754  1.00 98.15  ? 1825 SER A O      1 
ATOM   7585  C  CB     . SER A 1 463  ? 3.335   -54.386 31.352  1.00 97.30  ? 1825 SER A CB     1 
ATOM   7586  O  OG     . SER A 1 463  ? 3.861   -53.219 31.961  1.00 96.51  ? 1825 SER A OG     1 
ATOM   7587  H  H      . SER A 1 463  ? 1.429   -52.334 29.964  1.00 117.08 ? 1825 SER A H      1 
ATOM   7588  H  HA     . SER A 1 463  ? 2.950   -53.729 29.444  1.00 116.82 ? 1825 SER A HA     1 
ATOM   7589  H  HB2    . SER A 1 463  ? 2.834   -54.888 32.014  1.00 116.77 ? 1825 SER A HB2    1 
ATOM   7590  H  HB3    . SER A 1 463  ? 4.069   -54.924 31.016  1.00 116.77 ? 1825 SER A HB3    1 
ATOM   7591  H  HG     . SER A 1 463  ? 4.368   -53.429 32.596  1.00 115.81 ? 1825 SER A HG     1 
ATOM   7592  N  N      . PHE A 1 464  ? 0.379   -55.050 29.310  1.00 96.25  ? 1826 PHE A N      1 
ATOM   7593  C  CA     . PHE A 1 464  ? -0.490  -56.118 28.815  1.00 91.26  ? 1826 PHE A CA     1 
ATOM   7594  C  C      . PHE A 1 464  ? 0.011   -56.739 27.502  1.00 77.27  ? 1826 PHE A C      1 
ATOM   7595  O  O      . PHE A 1 464  ? 0.598   -56.056 26.655  1.00 67.15  ? 1826 PHE A O      1 
ATOM   7596  C  CB     . PHE A 1 464  ? -1.906  -55.598 28.570  1.00 90.80  ? 1826 PHE A CB     1 
ATOM   7597  C  CG     . PHE A 1 464  ? -2.017  -54.716 27.362  1.00 78.59  ? 1826 PHE A CG     1 
ATOM   7598  C  CD1    . PHE A 1 464  ? -1.178  -53.630 27.179  1.00 71.85  ? 1826 PHE A CD1    1 
ATOM   7599  C  CD2    . PHE A 1 464  ? -2.945  -55.009 26.382  1.00 78.30  ? 1826 PHE A CD2    1 
ATOM   7600  C  CE1    . PHE A 1 464  ? -1.283  -52.844 26.053  1.00 69.61  ? 1826 PHE A CE1    1 
ATOM   7601  C  CE2    . PHE A 1 464  ? -3.051  -54.229 25.259  1.00 74.98  ? 1826 PHE A CE2    1 
ATOM   7602  C  CZ     . PHE A 1 464  ? -2.220  -53.151 25.089  1.00 73.14  ? 1826 PHE A CZ     1 
ATOM   7603  H  H      . PHE A 1 464  ? 0.006   -54.275 29.306  1.00 115.50 ? 1826 PHE A H      1 
ATOM   7604  H  HA     . PHE A 1 464  ? -0.538  -56.821 29.481  1.00 109.52 ? 1826 PHE A HA     1 
ATOM   7605  H  HB2    . PHE A 1 464  ? -2.501  -56.354 28.442  1.00 108.96 ? 1826 PHE A HB2    1 
ATOM   7606  H  HB3    . PHE A 1 464  ? -2.189  -55.082 29.341  1.00 108.96 ? 1826 PHE A HB3    1 
ATOM   7607  H  HD1    . PHE A 1 464  ? -0.543  -53.423 27.826  1.00 86.21  ? 1826 PHE A HD1    1 
ATOM   7608  H  HD2    . PHE A 1 464  ? -3.510  -55.740 26.487  1.00 93.96  ? 1826 PHE A HD2    1 
ATOM   7609  H  HE1    . PHE A 1 464  ? -0.721  -52.113 25.940  1.00 83.53  ? 1826 PHE A HE1    1 
ATOM   7610  H  HE2    . PHE A 1 464  ? -3.685  -54.433 24.610  1.00 89.97  ? 1826 PHE A HE2    1 
ATOM   7611  H  HZ     . PHE A 1 464  ? -2.297  -52.620 24.329  1.00 87.77  ? 1826 PHE A HZ     1 
ATOM   7612  N  N      . ASP A 1 465  ? -0.234  -58.037 27.348  1.00 80.43  ? 1827 ASP A N      1 
ATOM   7613  C  CA     . ASP A 1 465  ? 0.087   -58.758 26.119  1.00 79.71  ? 1827 ASP A CA     1 
ATOM   7614  C  C      . ASP A 1 465  ? -0.959  -58.445 25.047  1.00 77.89  ? 1827 ASP A C      1 
ATOM   7615  O  O      . ASP A 1 465  ? -2.129  -58.241 25.363  1.00 77.74  ? 1827 ASP A O      1 
ATOM   7616  C  CB     . ASP A 1 465  ? 0.149   -60.264 26.395  1.00 80.95  ? 1827 ASP A CB     1 
ATOM   7617  C  CG     . ASP A 1 465  ? 0.897   -61.030 25.325  1.00 90.63  ? 1827 ASP A CG     1 
ATOM   7618  O  OD1    . ASP A 1 465  ? 1.084   -60.494 24.209  1.00 90.25  ? 1827 ASP A OD1    1 
ATOM   7619  O  OD2    . ASP A 1 465  ? 1.285   -62.183 25.605  1.00 96.03  1 1827 ASP A OD2    1 
ATOM   7620  H  H      . ASP A 1 465  ? -0.593  -58.532 27.952  1.00 96.52  ? 1827 ASP A H      1 
ATOM   7621  H  HA     . ASP A 1 465  ? 0.954   -58.471 25.793  1.00 95.66  ? 1827 ASP A HA     1 
ATOM   7622  H  HB2    . ASP A 1 465  ? 0.602   -60.410 27.240  1.00 97.14  ? 1827 ASP A HB2    1 
ATOM   7623  H  HB3    . ASP A 1 465  ? -0.754  -60.614 26.438  1.00 97.14  ? 1827 ASP A HB3    1 
ATOM   7624  N  N      . TYR A 1 466  ? -0.546  -58.370 23.786  1.00 22.03  ? 1828 TYR A N      1 
ATOM   7625  C  CA     . TYR A 1 466  ? -1.503  -58.116 22.713  1.00 21.97  ? 1828 TYR A CA     1 
ATOM   7626  C  C      . TYR A 1 466  ? -2.445  -59.304 22.555  1.00 22.04  ? 1828 TYR A C      1 
ATOM   7627  O  O      . TYR A 1 466  ? -3.606  -59.135 22.189  1.00 21.92  ? 1828 TYR A O      1 
ATOM   7628  C  CB     . TYR A 1 466  ? -0.784  -57.830 21.398  1.00 22.23  ? 1828 TYR A CB     1 
ATOM   7629  C  CG     . TYR A 1 466  ? -1.695  -57.782 20.195  1.00 22.30  ? 1828 TYR A CG     1 
ATOM   7630  C  CD1    . TYR A 1 466  ? -2.584  -56.734 20.016  1.00 22.11  ? 1828 TYR A CD1    1 
ATOM   7631  C  CD2    . TYR A 1 466  ? -1.645  -58.772 19.225  1.00 22.64  ? 1828 TYR A CD2    1 
ATOM   7632  C  CE1    . TYR A 1 466  ? -3.408  -56.683 18.917  1.00 22.23  ? 1828 TYR A CE1    1 
ATOM   7633  C  CE2    . TYR A 1 466  ? -2.464  -58.725 18.120  1.00 22.78  ? 1828 TYR A CE2    1 
ATOM   7634  C  CZ     . TYR A 1 466  ? -3.342  -57.679 17.973  1.00 22.57  ? 1828 TYR A CZ     1 
ATOM   7635  O  OH     . TYR A 1 466  ? -4.161  -57.620 16.874  1.00 22.76  ? 1828 TYR A OH     1 
ATOM   7636  H  H      . TYR A 1 466  ? 0.269   -58.460 23.528  1.00 26.44  ? 1828 TYR A H      1 
ATOM   7637  H  HA     . TYR A 1 466  ? -2.036  -57.338 22.941  1.00 26.36  ? 1828 TYR A HA     1 
ATOM   7638  H  HB2    . TYR A 1 466  ? -0.340  -56.970 21.467  1.00 26.68  ? 1828 TYR A HB2    1 
ATOM   7639  H  HB3    . TYR A 1 466  ? -0.127  -58.526 21.244  1.00 26.68  ? 1828 TYR A HB3    1 
ATOM   7640  H  HD1    . TYR A 1 466  ? -2.630  -56.059 20.654  1.00 26.53  ? 1828 TYR A HD1    1 
ATOM   7641  H  HD2    . TYR A 1 466  ? -1.051  -59.480 19.324  1.00 27.16  ? 1828 TYR A HD2    1 
ATOM   7642  H  HE1    . TYR A 1 466  ? -4.002  -55.976 18.810  1.00 26.68  ? 1828 TYR A HE1    1 
ATOM   7643  H  HE2    . TYR A 1 466  ? -2.424  -59.397 17.478  1.00 27.33  ? 1828 TYR A HE2    1 
ATOM   7644  H  HH     . TYR A 1 466  ? -4.023  -58.284 16.378  1.00 27.32  ? 1828 TYR A HH     1 
ATOM   7645  N  N      . GLN A 1 467  ? -1.939  -60.500 22.845  1.00 47.33  ? 1829 GLN A N      1 
ATOM   7646  C  CA     . GLN A 1 467  ? -2.731  -61.722 22.743  1.00 47.34  ? 1829 GLN A CA     1 
ATOM   7647  C  C      . GLN A 1 467  ? -3.957  -61.638 23.622  1.00 46.06  ? 1829 GLN A C      1 
ATOM   7648  O  O      . GLN A 1 467  ? -5.074  -61.900 23.179  1.00 45.63  ? 1829 GLN A O      1 
ATOM   7649  C  CB     . GLN A 1 467  ? -1.905  -62.943 23.147  1.00 48.73  ? 1829 GLN A CB     1 
ATOM   7650  C  CG     . GLN A 1 467  ? -0.642  -63.120 22.341  1.00 60.22  ? 1829 GLN A CG     1 
ATOM   7651  C  CD     . GLN A 1 467  ? -0.927  -63.243 20.860  1.00 69.31  ? 1829 GLN A CD     1 
ATOM   7652  O  OE1    . GLN A 1 467  ? -1.597  -64.178 20.423  1.00 74.07  ? 1829 GLN A OE1    1 
ATOM   7653  N  NE2    . GLN A 1 467  ? -0.438  -62.288 20.080  1.00 68.49  ? 1829 GLN A NE2    1 
ATOM   7654  H  H      . GLN A 1 467  ? -1.130  -60.631 23.105  1.00 56.80  ? 1829 GLN A H      1 
ATOM   7655  H  HA     . GLN A 1 467  ? -3.021  -61.840 21.825  1.00 56.80  ? 1829 GLN A HA     1 
ATOM   7656  H  HB2    . GLN A 1 467  ? -1.652  -62.855 24.079  1.00 58.48  ? 1829 GLN A HB2    1 
ATOM   7657  H  HB3    . GLN A 1 467  ? -2.447  -63.739 23.027  1.00 58.48  ? 1829 GLN A HB3    1 
ATOM   7658  H  HG2    . GLN A 1 467  ? -0.068  -62.350 22.476  1.00 72.26  ? 1829 GLN A HG2    1 
ATOM   7659  H  HG3    . GLN A 1 467  ? -0.191  -63.929 22.631  1.00 72.26  ? 1829 GLN A HG3    1 
ATOM   7660  H  HE21   . GLN A 1 467  ? 0.015   -61.642 20.423  1.00 82.19  ? 1829 GLN A HE21   1 
ATOM   7661  H  HE22   . GLN A 1 467  ? -0.573  -62.314 19.231  1.00 82.19  ? 1829 GLN A HE22   1 
ATOM   7662  N  N      . VAL A 1 468  ? -3.745  -61.253 24.871  1.00 22.07  ? 1830 VAL A N      1 
ATOM   7663  C  CA     . VAL A 1 468  ? -4.840  -61.214 25.815  1.00 21.93  ? 1830 VAL A CA     1 
ATOM   7664  C  C      . VAL A 1 468  ? -5.774  -60.089 25.402  1.00 21.63  ? 1830 VAL A C      1 
ATOM   7665  O  O      . VAL A 1 468  ? -6.974  -60.195 25.591  1.00 21.58  ? 1830 VAL A O      1 
ATOM   7666  C  CB     . VAL A 1 468  ? -4.351  -61.036 27.281  1.00 21.93  ? 1830 VAL A CB     1 
ATOM   7667  C  CG1    . VAL A 1 468  ? -3.420  -59.852 27.419  1.00 21.77  ? 1830 VAL A CG1    1 
ATOM   7668  C  CG2    . VAL A 1 468  ? -5.527  -60.901 28.239  1.00 21.84  ? 1830 VAL A CG2    1 
ATOM   7669  H  H      . VAL A 1 468  ? -2.985  -61.012 25.191  1.00 26.49  ? 1830 VAL A H      1 
ATOM   7670  H  HA     . VAL A 1 468  ? -5.332  -62.048 25.763  1.00 26.32  ? 1830 VAL A HA     1 
ATOM   7671  H  HB     . VAL A 1 468  ? -3.854  -61.829 27.538  1.00 26.31  ? 1830 VAL A HB     1 
ATOM   7672  H  HG11   . VAL A 1 468  ? -3.140  -59.777 28.345  1.00 26.12  ? 1830 VAL A HG11   1 
ATOM   7673  H  HG12   . VAL A 1 468  ? -2.647  -59.990 26.849  1.00 26.12  ? 1830 VAL A HG12   1 
ATOM   7674  H  HG13   . VAL A 1 468  ? -3.891  -59.048 27.150  1.00 26.12  ? 1830 VAL A HG13   1 
ATOM   7675  H  HG21   . VAL A 1 468  ? -5.188  -60.792 29.141  1.00 26.21  ? 1830 VAL A HG21   1 
ATOM   7676  H  HG22   . VAL A 1 468  ? -6.052  -60.126 27.986  1.00 26.21  ? 1830 VAL A HG22   1 
ATOM   7677  H  HG23   . VAL A 1 468  ? -6.072  -61.702 28.184  1.00 26.21  ? 1830 VAL A HG23   1 
ATOM   7678  N  N      . LEU A 1 469  ? -5.244  -59.032 24.795  1.00 22.38  ? 1831 LEU A N      1 
ATOM   7679  C  CA     . LEU A 1 469  ? -6.110  -57.958 24.327  1.00 22.18  ? 1831 LEU A CA     1 
ATOM   7680  C  C      . LEU A 1 469  ? -6.931  -58.432 23.128  1.00 22.30  ? 1831 LEU A C      1 
ATOM   7681  O  O      . LEU A 1 469  ? -8.137  -58.181 23.063  1.00 22.21  ? 1831 LEU A O      1 
ATOM   7682  C  CB     . LEU A 1 469  ? -5.302  -56.709 23.952  1.00 22.12  ? 1831 LEU A CB     1 
ATOM   7683  C  CG     . LEU A 1 469  ? -6.046  -55.365 23.835  1.00 21.96  ? 1831 LEU A CG     1 
ATOM   7684  C  CD1    . LEU A 1 469  ? -6.787  -55.237 22.515  1.00 22.04  ? 1831 LEU A CD1    1 
ATOM   7685  C  CD2    . LEU A 1 469  ? -6.989  -55.116 25.006  1.00 21.80  ? 1831 LEU A CD2    1 
ATOM   7686  H  H      . LEU A 1 469  ? -4.405  -58.914 24.646  1.00 26.85  ? 1831 LEU A H      1 
ATOM   7687  H  HA     . LEU A 1 469  ? -6.726  -57.715 25.036  1.00 26.62  ? 1831 LEU A HA     1 
ATOM   7688  H  HB2    . LEU A 1 469  ? -4.611  -56.591 24.622  1.00 26.55  ? 1831 LEU A HB2    1 
ATOM   7689  H  HB3    . LEU A 1 469  ? -4.884  -56.874 23.092  1.00 26.55  ? 1831 LEU A HB3    1 
ATOM   7690  H  HG     . LEU A 1 469  ? -5.383  -54.657 23.854  1.00 26.36  ? 1831 LEU A HG     1 
ATOM   7691  H  HD11   . LEU A 1 469  ? -7.238  -54.379 22.488  1.00 26.45  ? 1831 LEU A HD11   1 
ATOM   7692  H  HD12   . LEU A 1 469  ? -6.149  -55.299 21.788  1.00 26.45  ? 1831 LEU A HD12   1 
ATOM   7693  H  HD13   . LEU A 1 469  ? -7.437  -55.954 22.448  1.00 26.45  ? 1831 LEU A HD13   1 
ATOM   7694  H  HD21   . LEU A 1 469  ? -7.428  -54.261 24.882  1.00 26.16  ? 1831 LEU A HD21   1 
ATOM   7695  H  HD22   . LEU A 1 469  ? -7.649  -55.826 25.036  1.00 26.16  ? 1831 LEU A HD22   1 
ATOM   7696  H  HD23   . LEU A 1 469  ? -6.475  -55.108 25.829  1.00 26.16  ? 1831 LEU A HD23   1 
ATOM   7697  N  N      . SER A 1 470  ? -6.281  -59.119 22.187  1.00 53.77  ? 1832 SER A N      1 
ATOM   7698  C  CA     . SER A 1 470  ? -6.977  -59.656 21.018  1.00 54.53  ? 1832 SER A CA     1 
ATOM   7699  C  C      . SER A 1 470  ? -8.085  -60.569 21.494  1.00 55.20  ? 1832 SER A C      1 
ATOM   7700  O  O      . SER A 1 470  ? -9.228  -60.461 21.059  1.00 56.06  ? 1832 SER A O      1 
ATOM   7701  C  CB     . SER A 1 470  ? -6.033  -60.425 20.089  1.00 55.01  ? 1832 SER A CB     1 
ATOM   7702  O  OG     . SER A 1 470  ? -4.851  -59.693 19.820  1.00 55.07  ? 1832 SER A OG     1 
ATOM   7703  H  H      . SER A 1 470  ? -5.438  -59.286 22.203  1.00 64.52  ? 1832 SER A H      1 
ATOM   7704  H  HA     . SER A 1 470  ? -7.375  -58.927 20.516  1.00 65.44  ? 1832 SER A HA     1 
ATOM   7705  H  HB2    . SER A 1 470  ? -5.792  -61.264 20.512  1.00 66.01  ? 1832 SER A HB2    1 
ATOM   7706  H  HB3    . SER A 1 470  ? -6.490  -60.598 19.251  1.00 66.01  ? 1832 SER A HB3    1 
ATOM   7707  H  HG     . SER A 1 470  ? -4.441  -59.536 20.536  1.00 66.09  ? 1832 SER A HG     1 
ATOM   7708  N  N      . ARG A 1 471  ? -7.730  -61.463 22.407  1.00 39.16  ? 1833 ARG A N      1 
ATOM   7709  C  CA     . ARG A 1 471  ? -8.644  -62.488 22.873  1.00 40.12  ? 1833 ARG A CA     1 
ATOM   7710  C  C      . ARG A 1 471  ? -9.875  -61.881 23.544  1.00 40.34  ? 1833 ARG A C      1 
ATOM   7711  O  O      . ARG A 1 471  ? -10.996 -62.330 23.311  1.00 40.02  ? 1833 ARG A O      1 
ATOM   7712  C  CB     . ARG A 1 471  ? -7.938  -63.422 23.850  1.00 40.99  ? 1833 ARG A CB     1 
ATOM   7713  C  CG     . ARG A 1 471  ? -8.610  -64.770 23.997  1.00 47.55  ? 1833 ARG A CG     1 
ATOM   7714  C  CD     . ARG A 1 471  ? -7.909  -65.621 25.042  1.00 56.26  ? 1833 ARG A CD     1 
ATOM   7715  N  NE     . ARG A 1 471  ? -7.996  -64.998 26.365  1.00 57.73  ? 1833 ARG A NE     1 
ATOM   7716  C  CZ     . ARG A 1 471  ? -6.971  -64.501 27.050  1.00 54.96  ? 1833 ARG A CZ     1 
ATOM   7717  N  NH1    . ARG A 1 471  ? -5.735  -64.547 26.562  1.00 59.81  1 1833 ARG A NH1    1 
ATOM   7718  N  NH2    . ARG A 1 471  ? -7.185  -63.955 28.243  1.00 44.70  ? 1833 ARG A NH2    1 
ATOM   7719  H  H      . ARG A 1 471  ? -6.954  -61.495 22.775  1.00 47.00  ? 1833 ARG A H      1 
ATOM   7720  H  HA     . ARG A 1 471  ? -8.943  -63.015 22.116  1.00 48.14  ? 1833 ARG A HA     1 
ATOM   7721  H  HB2    . ARG A 1 471  ? -7.032  -63.574 23.539  1.00 49.19  ? 1833 ARG A HB2    1 
ATOM   7722  H  HB3    . ARG A 1 471  ? -7.919  -63.003 24.725  1.00 49.19  ? 1833 ARG A HB3    1 
ATOM   7723  H  HG2    . ARG A 1 471  ? -9.530  -64.642 24.275  1.00 57.06  ? 1833 ARG A HG2    1 
ATOM   7724  H  HG3    . ARG A 1 471  ? -8.576  -65.239 23.149  1.00 57.06  ? 1833 ARG A HG3    1 
ATOM   7725  H  HD2    . ARG A 1 471  ? -8.333  -66.493 25.085  1.00 67.51  ? 1833 ARG A HD2    1 
ATOM   7726  H  HD3    . ARG A 1 471  ? -6.972  -65.712 24.808  1.00 67.51  ? 1833 ARG A HD3    1 
ATOM   7727  H  HE     . ARG A 1 471  ? -8.774  -64.951 26.728  1.00 69.27  ? 1833 ARG A HE     1 
ATOM   7728  H  HH11   . ARG A 1 471  ? -5.590  -64.897 25.790  1.00 71.77  ? 1833 ARG A HH11   1 
ATOM   7729  H  HH12   . ARG A 1 471  ? -5.081  -64.222 27.017  1.00 71.77  ? 1833 ARG A HH12   1 
ATOM   7730  H  HH21   . ARG A 1 471  ? -7.982  -63.924 28.565  1.00 53.64  ? 1833 ARG A HH21   1 
ATOM   7731  H  HH22   . ARG A 1 471  ? -6.526  -63.634 28.694  1.00 53.64  ? 1833 ARG A HH22   1 
ATOM   7732  N  N      . LEU A 1 472  ? -9.672  -60.858 24.370  1.00 26.56  ? 1834 LEU A N      1 
ATOM   7733  C  CA     . LEU A 1 472  ? -10.789 -60.210 25.051  1.00 26.39  ? 1834 LEU A CA     1 
ATOM   7734  C  C      . LEU A 1 472  ? -11.711 -59.539 24.068  1.00 26.31  ? 1834 LEU A C      1 
ATOM   7735  O  O      . LEU A 1 472  ? -12.922 -59.497 24.273  1.00 26.33  ? 1834 LEU A O      1 
ATOM   7736  C  CB     . LEU A 1 472  ? -10.304 -59.178 26.063  1.00 26.15  ? 1834 LEU A CB     1 
ATOM   7737  C  CG     . LEU A 1 472  ? -9.503  -59.702 27.253  1.00 26.26  ? 1834 LEU A CG     1 
ATOM   7738  C  CD1    . LEU A 1 472  ? -8.940  -58.553 28.061  1.00 26.09  ? 1834 LEU A CD1    1 
ATOM   7739  C  CD2    . LEU A 1 472  ? -10.361 -60.580 28.113  1.00 26.48  ? 1834 LEU A CD2    1 
ATOM   7740  H  H      . LEU A 1 472  ? -8.902  -60.522 24.553  1.00 31.87  ? 1834 LEU A H      1 
ATOM   7741  H  HA     . LEU A 1 472  ? -11.298 -60.883 25.530  1.00 31.66  ? 1834 LEU A HA     1 
ATOM   7742  H  HB2    . LEU A 1 472  ? -9.740  -58.541 25.597  1.00 31.38  ? 1834 LEU A HB2    1 
ATOM   7743  H  HB3    . LEU A 1 472  ? -11.079 -58.717 26.420  1.00 31.38  ? 1834 LEU A HB3    1 
ATOM   7744  H  HG     . LEU A 1 472  ? -8.761  -60.233 26.927  1.00 31.52  ? 1834 LEU A HG     1 
ATOM   7745  H  HD11   . LEU A 1 472  ? -8.437  -58.911 28.810  1.00 31.30  ? 1834 LEU A HD11   1 
ATOM   7746  H  HD12   . LEU A 1 472  ? -8.358  -58.024 27.494  1.00 31.30  ? 1834 LEU A HD12   1 
ATOM   7747  H  HD13   . LEU A 1 472  ? -9.673  -58.007 28.386  1.00 31.30  ? 1834 LEU A HD13   1 
ATOM   7748  H  HD21   . LEU A 1 472  ? -9.834  -60.900 28.861  1.00 31.78  ? 1834 LEU A HD21   1 
ATOM   7749  H  HD22   . LEU A 1 472  ? -11.116 -60.063 28.437  1.00 31.78  ? 1834 LEU A HD22   1 
ATOM   7750  H  HD23   . LEU A 1 472  ? -10.675 -61.329 27.583  1.00 31.78  ? 1834 LEU A HD23   1 
ATOM   7751  N  N      . LEU A 1 473  ? -11.138 -58.998 23.003  1.00 21.43  ? 1835 LEU A N      1 
ATOM   7752  C  CA     . LEU A 1 473  ? -11.946 -58.365 21.988  1.00 21.45  ? 1835 LEU A CA     1 
ATOM   7753  C  C      . LEU A 1 473  ? -12.783 -59.411 21.284  1.00 21.75  ? 1835 LEU A C      1 
ATOM   7754  O  O      . LEU A 1 473  ? -13.937 -59.168 20.953  1.00 21.80  ? 1835 LEU A O      1 
ATOM   7755  C  CB     . LEU A 1 473  ? -11.094 -57.604 20.982  1.00 21.47  ? 1835 LEU A CB     1 
ATOM   7756  C  CG     . LEU A 1 473  ? -11.308 -56.091 20.934  1.00 21.31  ? 1835 LEU A CG     1 
ATOM   7757  C  CD1    . LEU A 1 473  ? -10.531 -55.537 19.761  1.00 21.48  ? 1835 LEU A CD1    1 
ATOM   7758  C  CD2    . LEU A 1 473  ? -12.777 -55.693 20.825  1.00 21.32  ? 1835 LEU A CD2    1 
ATOM   7759  H  H      . LEU A 1 473  ? -10.292 -58.987 22.850  1.00 25.71  ? 1835 LEU A H      1 
ATOM   7760  H  HA     . LEU A 1 473  ? -12.548 -57.733 22.411  1.00 25.74  ? 1835 LEU A HA     1 
ATOM   7761  H  HB2    . LEU A 1 473  ? -10.160 -57.758 21.195  1.00 25.77  ? 1835 LEU A HB2    1 
ATOM   7762  H  HB3    . LEU A 1 473  ? -11.283 -57.952 20.097  1.00 25.77  ? 1835 LEU A HB3    1 
ATOM   7763  H  HG     . LEU A 1 473  ? -10.950 -55.696 21.744  1.00 25.58  ? 1835 LEU A HG     1 
ATOM   7764  H  HD11   . LEU A 1 473  ? -10.662 -54.576 19.723  1.00 25.78  ? 1835 LEU A HD11   1 
ATOM   7765  H  HD12   . LEU A 1 473  ? -9.591  -55.739 19.882  1.00 25.78  ? 1835 LEU A HD12   1 
ATOM   7766  H  HD13   . LEU A 1 473  ? -10.856 -55.948 18.945  1.00 25.78  ? 1835 LEU A HD13   1 
ATOM   7767  H  HD21   . LEU A 1 473  ? -12.840 -54.725 20.799  1.00 25.58  ? 1835 LEU A HD21   1 
ATOM   7768  H  HD22   . LEU A 1 473  ? -13.147 -56.071 20.012  1.00 25.58  ? 1835 LEU A HD22   1 
ATOM   7769  H  HD23   . LEU A 1 473  ? -13.255 -56.035 21.597  1.00 25.58  ? 1835 LEU A HD23   1 
ATOM   7770  N  N      . VAL A 1 474  ? -12.197 -60.572 21.022  1.00 22.00  ? 1836 VAL A N      1 
ATOM   7771  C  CA     . VAL A 1 474  ? -12.945 -61.616 20.344  1.00 22.38  ? 1836 VAL A CA     1 
ATOM   7772  C  C      . VAL A 1 474  ? -14.092 -62.070 21.234  1.00 22.42  ? 1836 VAL A C      1 
ATOM   7773  O  O      . VAL A 1 474  ? -15.188 -62.346 20.753  1.00 22.63  ? 1836 VAL A O      1 
ATOM   7774  C  CB     . VAL A 1 474  ? -12.070 -62.826 19.966  1.00 22.74  ? 1836 VAL A CB     1 
ATOM   7775  C  CG1    . VAL A 1 474  ? -12.935 -63.947 19.409  1.00 23.20  ? 1836 VAL A CG1    1 
ATOM   7776  C  CG2    . VAL A 1 474  ? -10.988 -62.420 18.970  1.00 22.80  ? 1836 VAL A CG2    1 
ATOM   7777  H  H      . VAL A 1 474  ? -11.386 -60.777 21.222  1.00 26.40  ? 1836 VAL A H      1 
ATOM   7778  H  HA     . VAL A 1 474  ? -13.324 -61.253 19.527  1.00 26.85  ? 1836 VAL A HA     1 
ATOM   7779  H  HB     . VAL A 1 474  ? -11.630 -63.157 20.764  1.00 27.28  ? 1836 VAL A HB     1 
ATOM   7780  H  HG11   . VAL A 1 474  ? -12.367 -64.699 19.177  1.00 27.84  ? 1836 VAL A HG11   1 
ATOM   7781  H  HG12   . VAL A 1 474  ? -13.578 -64.214 20.085  1.00 27.84  ? 1836 VAL A HG12   1 
ATOM   7782  H  HG13   . VAL A 1 474  ? -13.398 -63.626 18.620  1.00 27.84  ? 1836 VAL A HG13   1 
ATOM   7783  H  HG21   . VAL A 1 474  ? -10.453 -63.199 18.751  1.00 27.36  ? 1836 VAL A HG21   1 
ATOM   7784  H  HG22   . VAL A 1 474  ? -11.411 -62.072 18.170  1.00 27.36  ? 1836 VAL A HG22   1 
ATOM   7785  H  HG23   . VAL A 1 474  ? -10.429 -61.737 19.373  1.00 27.36  ? 1836 VAL A HG23   1 
ATOM   7786  N  N      . GLY A 1 475  ? -13.844 -62.122 22.537  1.00 22.26  ? 1837 GLY A N      1 
ATOM   7787  C  CA     . GLY A 1 475  ? -14.865 -62.532 23.479  1.00 22.36  ? 1837 GLY A CA     1 
ATOM   7788  C  C      . GLY A 1 475  ? -15.996 -61.534 23.437  1.00 22.18  ? 1837 GLY A C      1 
ATOM   7789  O  O      . GLY A 1 475  ? -17.159 -61.896 23.328  1.00 22.40  ? 1837 GLY A O      1 
ATOM   7790  H  H      . GLY A 1 475  ? -13.090 -61.924 22.898  1.00 26.71  ? 1837 GLY A H      1 
ATOM   7791  H  HA2    . GLY A 1 475  ? -15.205 -63.409 23.245  1.00 26.83  ? 1837 GLY A HA2    1 
ATOM   7792  H  HA3    . GLY A 1 475  ? -14.499 -62.561 24.377  1.00 26.83  ? 1837 GLY A HA3    1 
ATOM   7793  N  N      . ILE A 1 476  ? -15.641 -60.260 23.481  1.00 33.80  ? 1838 ILE A N      1 
ATOM   7794  C  CA     . ILE A 1 476  ? -16.630 -59.208 23.594  1.00 33.66  ? 1838 ILE A CA     1 
ATOM   7795  C  C      . ILE A 1 476  ? -17.531 -59.121 22.370  1.00 33.84  ? 1838 ILE A C      1 
ATOM   7796  O  O      . ILE A 1 476  ? -18.703 -58.767 22.486  1.00 34.43  ? 1838 ILE A O      1 
ATOM   7797  C  CB     . ILE A 1 476  ? -15.935 -57.852 23.807  1.00 33.35  ? 1838 ILE A CB     1 
ATOM   7798  C  CG1    . ILE A 1 476  ? -16.660 -57.085 24.891  1.00 37.79  ? 1838 ILE A CG1    1 
ATOM   7799  C  CG2    . ILE A 1 476  ? -15.851 -57.013 22.501  1.00 33.34  ? 1838 ILE A CG2    1 
ATOM   7800  C  CD1    . ILE A 1 476  ? -16.086 -55.759 25.153  1.00 45.96  ? 1838 ILE A CD1    1 
ATOM   7801  H  H      . ILE A 1 476  ? -14.829 -59.979 23.446  1.00 40.56  ? 1838 ILE A H      1 
ATOM   7802  H  HA     . ILE A 1 476  ? -17.190 -59.383 24.367  1.00 40.39  ? 1838 ILE A HA     1 
ATOM   7803  H  HB     . ILE A 1 476  ? -15.030 -58.022 24.113  1.00 40.02  ? 1838 ILE A HB     1 
ATOM   7804  H  HG12   . ILE A 1 476  ? -17.584 -56.962 24.624  1.00 45.35  ? 1838 ILE A HG12   1 
ATOM   7805  H  HG13   . ILE A 1 476  ? -16.620 -57.595 25.716  1.00 45.35  ? 1838 ILE A HG13   1 
ATOM   7806  H  HG21   . ILE A 1 476  ? -15.406 -56.173 22.693  1.00 40.01  ? 1838 ILE A HG21   1 
ATOM   7807  H  HG22   . ILE A 1 476  ? -15.347 -57.511 21.838  1.00 40.01  ? 1838 ILE A HG22   1 
ATOM   7808  H  HG23   . ILE A 1 476  ? -16.750 -56.846 22.176  1.00 40.01  ? 1838 ILE A HG23   1 
ATOM   7809  H  HD11   . ILE A 1 476  ? -16.597 -55.327 25.855  1.00 55.15  ? 1838 ILE A HD11   1 
ATOM   7810  H  HD12   . ILE A 1 476  ? -15.163 -55.864 25.433  1.00 55.15  ? 1838 ILE A HD12   1 
ATOM   7811  H  HD13   . ILE A 1 476  ? -16.127 -55.231 24.341  1.00 55.15  ? 1838 ILE A HD13   1 
ATOM   7812  N  N      . THR A 1 477  ? -16.996 -59.454 21.203  1.00 22.04  ? 1839 THR A N      1 
ATOM   7813  C  CA     . THR A 1 477  ? -17.802 -59.466 19.992  1.00 22.31  ? 1839 THR A CA     1 
ATOM   7814  C  C      . THR A 1 477  ? -18.726 -60.682 19.935  1.00 22.69  ? 1839 THR A C      1 
ATOM   7815  O  O      . THR A 1 477  ? -19.856 -60.581 19.463  1.00 22.90  ? 1839 THR A O      1 
ATOM   7816  C  CB     . THR A 1 477  ? -16.930 -59.426 18.730  1.00 22.46  ? 1839 THR A CB     1 
ATOM   7817  O  OG1    . THR A 1 477  ? -16.005 -60.519 18.744  1.00 22.60  ? 1839 THR A OG1    1 
ATOM   7818  C  CG2    . THR A 1 477  ? -16.166 -58.121 18.661  1.00 22.18  ? 1839 THR A CG2    1 
ATOM   7819  H  H      . THR A 1 477  ? -16.173 -59.676 21.086  1.00 26.45  ? 1839 THR A H      1 
ATOM   7820  H  HA     . THR A 1 477  ? -18.361 -58.673 19.986  1.00 26.78  ? 1839 THR A HA     1 
ATOM   7821  H  HB     . THR A 1 477  ? -17.496 -59.492 17.945  1.00 26.95  ? 1839 THR A HB     1 
ATOM   7822  H  HG1    . THR A 1 477  ? -16.422 -61.248 18.766  1.00 27.12  ? 1839 THR A HG1    1 
ATOM   7823  H  HG21   . THR A 1 477  ? -15.617 -58.101 17.862  1.00 26.62  ? 1839 THR A HG21   1 
ATOM   7824  H  HG22   . THR A 1 477  ? -16.786 -57.376 18.637  1.00 26.62  ? 1839 THR A HG22   1 
ATOM   7825  H  HG23   . THR A 1 477  ? -15.595 -58.031 19.439  1.00 26.62  ? 1839 THR A HG23   1 
ATOM   7826  N  N      . GLN A 1 478  ? -18.254 -61.828 20.411  1.00 27.22  ? 1840 GLN A N      1 
ATOM   7827  C  CA     . GLN A 1 478  ? -19.065 -63.040 20.383  1.00 27.67  ? 1840 GLN A CA     1 
ATOM   7828  C  C      . GLN A 1 478  ? -20.112 -63.006 21.485  1.00 27.66  ? 1840 GLN A C      1 
ATOM   7829  O  O      . GLN A 1 478  ? -21.284 -63.284 21.251  1.00 27.97  ? 1840 GLN A O      1 
ATOM   7830  C  CB     . GLN A 1 478  ? -18.196 -64.283 20.524  1.00 27.93  ? 1840 GLN A CB     1 
ATOM   7831  C  CG     . GLN A 1 478  ? -17.322 -64.538 19.313  1.00 28.12  ? 1840 GLN A CG     1 
ATOM   7832  C  CD     . GLN A 1 478  ? -16.676 -65.903 19.343  1.00 28.53  ? 1840 GLN A CD     1 
ATOM   7833  O  OE1    . GLN A 1 478  ? -17.278 -66.879 19.795  1.00 28.91  ? 1840 GLN A OE1    1 
ATOM   7834  N  NE2    . GLN A 1 478  ? -15.443 -65.981 18.865  1.00 28.54  ? 1840 GLN A NE2    1 
ATOM   7835  H  H      . GLN A 1 478  ? -17.472 -61.931 20.753  1.00 32.66  ? 1840 GLN A H      1 
ATOM   7836  H  HA     . GLN A 1 478  ? -19.527 -63.092 19.532  1.00 33.20  ? 1840 GLN A HA     1 
ATOM   7837  H  HB2    . GLN A 1 478  ? -17.615 -64.176 21.294  1.00 33.52  ? 1840 GLN A HB2    1 
ATOM   7838  H  HB3    . GLN A 1 478  ? -18.769 -65.056 20.647  1.00 33.52  ? 1840 GLN A HB3    1 
ATOM   7839  H  HG2    . GLN A 1 478  ? -17.867 -64.481 18.512  1.00 33.74  ? 1840 GLN A HG2    1 
ATOM   7840  H  HG3    . GLN A 1 478  ? -16.618 -63.873 19.285  1.00 33.74  ? 1840 GLN A HG3    1 
ATOM   7841  H  HE21   . GLN A 1 478  ? -15.055 -65.276 18.560  1.00 34.25  ? 1840 GLN A HE21   1 
ATOM   7842  H  HE22   . GLN A 1 478  ? -15.031 -66.735 18.859  1.00 34.25  ? 1840 GLN A HE22   1 
ATOM   7843  N  N      . ILE A 1 479  ? -19.677 -62.682 22.695  1.00 26.93  ? 1841 ILE A N      1 
ATOM   7844  C  CA     . ILE A 1 479  ? -20.603 -62.468 23.795  1.00 26.94  ? 1841 ILE A CA     1 
ATOM   7845  C  C      . ILE A 1 479  ? -21.556 -61.351 23.421  1.00 26.81  ? 1841 ILE A C      1 
ATOM   7846  O  O      . ILE A 1 479  ? -22.769 -61.493 23.534  1.00 27.06  ? 1841 ILE A O      1 
ATOM   7847  C  CB     . ILE A 1 479  ? -19.883 -62.084 25.093  1.00 26.66  ? 1841 ILE A CB     1 
ATOM   7848  C  CG1    . ILE A 1 479  ? -18.848 -63.141 25.477  1.00 26.82  ? 1841 ILE A CG1    1 
ATOM   7849  C  CG2    . ILE A 1 479  ? -20.895 -61.918 26.225  1.00 26.77  ? 1841 ILE A CG2    1 
ATOM   7850  C  CD1    . ILE A 1 479  ? -17.905 -62.677 26.554  1.00 26.56  ? 1841 ILE A CD1    1 
ATOM   7851  H  H      . ILE A 1 479  ? -18.850 -62.580 22.906  1.00 32.32  ? 1841 ILE A H      1 
ATOM   7852  H  HA     . ILE A 1 479  ? -21.117 -63.276 23.951  1.00 32.32  ? 1841 ILE A HA     1 
ATOM   7853  H  HB     . ILE A 1 479  ? -19.428 -61.239 24.957  1.00 31.99  ? 1841 ILE A HB     1 
ATOM   7854  H  HG12   . ILE A 1 479  ? -19.309 -63.930 25.802  1.00 32.18  ? 1841 ILE A HG12   1 
ATOM   7855  H  HG13   . ILE A 1 479  ? -18.321 -63.364 24.694  1.00 32.18  ? 1841 ILE A HG13   1 
ATOM   7856  H  HG21   . ILE A 1 479  ? -20.424 -61.676 27.037  1.00 32.13  ? 1841 ILE A HG21   1 
ATOM   7857  H  HG22   . ILE A 1 479  ? -21.524 -61.219 25.986  1.00 32.13  ? 1841 ILE A HG22   1 
ATOM   7858  H  HG23   . ILE A 1 479  ? -21.366 -62.757 26.353  1.00 32.13  ? 1841 ILE A HG23   1 
ATOM   7859  H  HD11   . ILE A 1 479  ? -17.277 -63.389 26.751  1.00 31.87  ? 1841 ILE A HD11   1 
ATOM   7860  H  HD12   . ILE A 1 479  ? -17.429 -61.892 26.240  1.00 31.87  ? 1841 ILE A HD12   1 
ATOM   7861  H  HD13   . ILE A 1 479  ? -18.417 -62.458 27.349  1.00 31.87  ? 1841 ILE A HD13   1 
ATOM   7862  N  N      . GLY A 1 480  ? -20.990 -60.241 22.959  1.00 23.64  ? 1842 GLY A N      1 
ATOM   7863  C  CA     . GLY A 1 480  ? -21.756 -59.033 22.729  1.00 23.53  ? 1842 GLY A CA     1 
ATOM   7864  C  C      . GLY A 1 480  ? -21.711 -58.032 23.870  1.00 23.25  ? 1842 GLY A C      1 
ATOM   7865  O  O      . GLY A 1 480  ? -22.620 -57.213 24.006  1.00 23.27  ? 1842 GLY A O      1 
ATOM   7866  H  H      . GLY A 1 480  ? -20.154 -60.166 22.771  1.00 28.37  ? 1842 GLY A H      1 
ATOM   7867  H  HA2    . GLY A 1 480  ? -21.421 -58.594 21.931  1.00 28.24  ? 1842 GLY A HA2    1 
ATOM   7868  H  HA3    . GLY A 1 480  ? -22.684 -59.271 22.575  1.00 28.24  ? 1842 GLY A HA3    1 
ATOM   7869  N  N      . ALA A 1 481  ? -20.674 -58.094 24.700  1.00 21.95  ? 1843 ALA A N      1 
ATOM   7870  C  CA     . ALA A 1 481  ? -20.531 -57.143 25.801  1.00 21.75  ? 1843 ALA A CA     1 
ATOM   7871  C  C      . ALA A 1 481  ? -20.067 -55.780 25.292  1.00 21.52  ? 1843 ALA A C      1 
ATOM   7872  O  O      . ALA A 1 481  ? -19.821 -55.597 24.100  1.00 21.51  ? 1843 ALA A O      1 
ATOM   7873  C  CB     . ALA A 1 481  ? -19.560 -57.669 26.846  1.00 21.69  ? 1843 ALA A CB     1 
ATOM   7874  H  H      . ALA A 1 481  ? -20.041 -58.674 24.649  1.00 26.34  ? 1843 ALA A H      1 
ATOM   7875  H  HA     . ALA A 1 481  ? -21.394 -57.024 26.227  1.00 26.10  ? 1843 ALA A HA     1 
ATOM   7876  H  HB1    . ALA A 1 481  ? -19.485 -57.019 27.563  1.00 26.03  ? 1843 ALA A HB1    1 
ATOM   7877  H  HB2    . ALA A 1 481  ? -19.897 -58.509 27.195  1.00 26.03  ? 1843 ALA A HB2    1 
ATOM   7878  H  HB3    . ALA A 1 481  ? -18.694 -57.807 26.432  1.00 26.03  ? 1843 ALA A HB3    1 
ATOM   7879  N  N      . TRP A 1 482  ? -19.964 -54.830 26.214  1.00 34.10  ? 1844 TRP A N      1 
ATOM   7880  C  CA     . TRP A 1 482  ? -19.474 -53.488 25.918  1.00 33.96  ? 1844 TRP A CA     1 
ATOM   7881  C  C      . TRP A 1 482  ? -18.049 -53.324 26.398  1.00 33.78  ? 1844 TRP A C      1 
ATOM   7882  O  O      . TRP A 1 482  ? -17.777 -53.455 27.590  1.00 33.77  ? 1844 TRP A O      1 
ATOM   7883  C  CB     . TRP A 1 482  ? -20.354 -52.435 26.590  1.00 34.05  ? 1844 TRP A CB     1 
ATOM   7884  C  CG     . TRP A 1 482  ? -21.692 -52.243 25.972  1.00 34.25  ? 1844 TRP A CG     1 
ATOM   7885  C  CD1    . TRP A 1 482  ? -22.262 -52.986 24.982  1.00 34.38  ? 1844 TRP A CD1    1 
ATOM   7886  C  CD2    . TRP A 1 482  ? -22.644 -51.235 26.319  1.00 34.41  ? 1844 TRP A CD2    1 
ATOM   7887  N  NE1    . TRP A 1 482  ? -23.513 -52.495 24.682  1.00 34.61  ? 1844 TRP A NE1    1 
ATOM   7888  C  CE2    . TRP A 1 482  ? -23.770 -51.420 25.492  1.00 34.63  ? 1844 TRP A CE2    1 
ATOM   7889  C  CE3    . TRP A 1 482  ? -22.651 -50.192 27.248  1.00 34.46  ? 1844 TRP A CE3    1 
ATOM   7890  C  CZ2    . TRP A 1 482  ? -24.890 -50.600 25.567  1.00 34.87  ? 1844 TRP A CZ2    1 
ATOM   7891  C  CZ3    . TRP A 1 482  ? -23.757 -49.381 27.320  1.00 34.71  ? 1844 TRP A CZ3    1 
ATOM   7892  C  CH2    . TRP A 1 482  ? -24.863 -49.588 26.485  1.00 34.90  ? 1844 TRP A CH2    1 
ATOM   7893  H  H      . TRP A 1 482  ? -20.176 -54.941 27.040  1.00 40.92  ? 1844 TRP A H      1 
ATOM   7894  H  HA     . TRP A 1 482  ? -19.495 -53.340 24.959  1.00 40.75  ? 1844 TRP A HA     1 
ATOM   7895  H  HB2    . TRP A 1 482  ? -20.493 -52.695 27.514  1.00 40.86  ? 1844 TRP A HB2    1 
ATOM   7896  H  HB3    . TRP A 1 482  ? -19.892 -51.583 26.559  1.00 40.86  ? 1844 TRP A HB3    1 
ATOM   7897  H  HD1    . TRP A 1 482  ? -21.862 -53.715 24.565  1.00 41.26  ? 1844 TRP A HD1    1 
ATOM   7898  H  HE1    . TRP A 1 482  ? -24.046 -52.812 24.087  1.00 41.53  ? 1844 TRP A HE1    1 
ATOM   7899  H  HE3    . TRP A 1 482  ? -21.920 -50.047 27.804  1.00 41.35  ? 1844 TRP A HE3    1 
ATOM   7900  H  HZ2    . TRP A 1 482  ? -25.626 -50.734 25.015  1.00 41.84  ? 1844 TRP A HZ2    1 
ATOM   7901  H  HZ3    . TRP A 1 482  ? -23.773 -48.683 27.934  1.00 41.65  ? 1844 TRP A HZ3    1 
ATOM   7902  H  HH2    . TRP A 1 482  ? -25.599 -49.023 26.558  1.00 41.88  ? 1844 TRP A HH2    1 
ATOM   7903  N  N      . GLY A 1 483  ? -17.136 -53.050 25.471  1.00 20.99  ? 1845 GLY A N      1 
ATOM   7904  C  CA     . GLY A 1 483  ? -15.747 -52.841 25.828  1.00 20.86  ? 1845 GLY A CA     1 
ATOM   7905  C  C      . GLY A 1 483  ? -15.438 -51.380 26.039  1.00 20.85  ? 1845 GLY A C      1 
ATOM   7906  O  O      . GLY A 1 483  ? -16.031 -50.511 25.402  1.00 20.94  ? 1845 GLY A O      1 
ATOM   7907  H  H      . GLY A 1 483  ? -17.300 -52.980 24.630  1.00 25.19  ? 1845 GLY A H      1 
ATOM   7908  H  HA2    . GLY A 1 483  ? -15.546 -53.321 26.647  1.00 25.04  ? 1845 GLY A HA2    1 
ATOM   7909  H  HA3    . GLY A 1 483  ? -15.175 -53.179 25.122  1.00 25.04  ? 1845 GLY A HA3    1 
ATOM   7910  N  N      . CYS A 1 484  ? -14.476 -51.115 26.912  1.00 20.80  ? 1846 CYS A N      1 
ATOM   7911  C  CA     . CYS A 1 484  ? -13.994 -49.764 27.130  1.00 20.85  ? 1846 CYS A CA     1 
ATOM   7912  C  C      . CYS A 1 484  ? -12.477 -49.831 27.206  1.00 20.80  ? 1846 CYS A C      1 
ATOM   7913  O  O      . CYS A 1 484  ? -11.921 -50.640 27.948  1.00 20.76  ? 1846 CYS A O      1 
ATOM   7914  C  CB     . CYS A 1 484  ? -14.600 -49.160 28.401  1.00 20.96  ? 1846 CYS A CB     1 
ATOM   7915  S  SG     . CYS A 1 484  ? -14.587 -47.347 28.454  1.00 21.17  ? 1846 CYS A SG     1 
ATOM   7916  H  H      . CYS A 1 484  ? -14.083 -51.709 27.395  1.00 24.95  ? 1846 CYS A H      1 
ATOM   7917  H  HA     . CYS A 1 484  ? -14.241 -49.206 26.376  1.00 25.02  ? 1846 CYS A HA     1 
ATOM   7918  H  HB2    . CYS A 1 484  ? -15.523 -49.450 28.472  1.00 25.15  ? 1846 CYS A HB2    1 
ATOM   7919  H  HB3    . CYS A 1 484  ? -14.097 -49.480 29.166  1.00 25.15  ? 1846 CYS A HB3    1 
ATOM   7920  H  HG     . CYS A 1 484  ? -15.081 -46.983 29.485  1.00 25.41  ? 1846 CYS A HG     1 
ATOM   7921  N  N      . PHE A 1 485  ? -11.813 -48.996 26.415  1.00 20.88  ? 1847 PHE A N      1 
ATOM   7922  C  CA     . PHE A 1 485  ? -10.362 -48.896 26.458  1.00 20.90  ? 1847 PHE A CA     1 
ATOM   7923  C  C      . PHE A 1 485  ? -9.975  -47.690 27.311  1.00 21.05  ? 1847 PHE A C      1 
ATOM   7924  O  O      . PHE A 1 485  ? -10.172 -46.540 26.912  1.00 21.23  ? 1847 PHE A O      1 
ATOM   7925  C  CB     . PHE A 1 485  ? -9.787  -48.772 25.045  1.00 20.98  ? 1847 PHE A CB     1 
ATOM   7926  C  CG     . PHE A 1 485  ? -9.921  -50.023 24.214  1.00 20.91  ? 1847 PHE A CG     1 
ATOM   7927  C  CD1    . PHE A 1 485  ? -11.114 -50.323 23.577  1.00 20.92  ? 1847 PHE A CD1    1 
ATOM   7928  C  CD2    . PHE A 1 485  ? -8.849  -50.888 24.050  1.00 20.90  ? 1847 PHE A CD2    1 
ATOM   7929  C  CE1    . PHE A 1 485  ? -11.240 -51.467 22.803  1.00 20.94  ? 1847 PHE A CE1    1 
ATOM   7930  C  CE2    . PHE A 1 485  ? -8.971  -52.034 23.273  1.00 20.92  ? 1847 PHE A CE2    1 
ATOM   7931  C  CZ     . PHE A 1 485  ? -10.170 -52.322 22.654  1.00 20.95  ? 1847 PHE A CZ     1 
ATOM   7932  H  H      . PHE A 1 485  ? -12.183 -48.474 25.841  1.00 25.05  ? 1847 PHE A H      1 
ATOM   7933  H  HA     . PHE A 1 485  ? -9.995  -49.693 26.870  1.00 25.08  ? 1847 PHE A HA     1 
ATOM   7934  H  HB2    . PHE A 1 485  ? -10.251 -48.057 24.581  1.00 25.18  ? 1847 PHE A HB2    1 
ATOM   7935  H  HB3    . PHE A 1 485  ? -8.842  -48.561 25.111  1.00 25.18  ? 1847 PHE A HB3    1 
ATOM   7936  H  HD1    . PHE A 1 485  ? -11.842 -49.753 23.674  1.00 25.11  ? 1847 PHE A HD1    1 
ATOM   7937  H  HD2    . PHE A 1 485  ? -8.039  -50.699 24.466  1.00 25.08  ? 1847 PHE A HD2    1 
ATOM   7938  H  HE1    . PHE A 1 485  ? -12.049 -51.658 22.386  1.00 25.13  ? 1847 PHE A HE1    1 
ATOM   7939  H  HE2    . PHE A 1 485  ? -8.246  -52.609 23.175  1.00 25.10  ? 1847 PHE A HE2    1 
ATOM   7940  H  HZ     . PHE A 1 485  ? -10.255 -53.089 22.134  1.00 25.14  ? 1847 PHE A HZ     1 
ATOM   7941  N  N      . ASP A 1 486  ? -9.420  -47.964 28.488  1.00 40.04  ? 1848 ASP A N      1 
ATOM   7942  C  CA     . ASP A 1 486  ? -9.010  -46.922 29.421  1.00 40.26  ? 1848 ASP A CA     1 
ATOM   7943  C  C      . ASP A 1 486  ? -7.647  -46.396 28.986  1.00 40.39  ? 1848 ASP A C      1 
ATOM   7944  O  O      . ASP A 1 486  ? -6.677  -47.148 28.931  1.00 40.33  ? 1848 ASP A O      1 
ATOM   7945  C  CB     . ASP A 1 486  ? -8.967  -47.487 30.852  1.00 40.29  ? 1848 ASP A CB     1 
ATOM   7946  C  CG     . ASP A 1 486  ? -8.295  -46.547 31.852  1.00 44.55  ? 1848 ASP A CG     1 
ATOM   7947  O  OD1    . ASP A 1 486  ? -7.047  -46.579 31.943  1.00 46.48  1 1848 ASP A OD1    1 
ATOM   7948  O  OD2    . ASP A 1 486  ? -9.002  -45.800 32.565  1.00 48.49  ? 1848 ASP A OD2    1 
ATOM   7949  H  H      . ASP A 1 486  ? -9.267  -48.761 28.773  1.00 48.05  ? 1848 ASP A H      1 
ATOM   7950  H  HA     . ASP A 1 486  ? -9.648  -46.191 29.395  1.00 48.31  ? 1848 ASP A HA     1 
ATOM   7951  H  HB2    . ASP A 1 486  ? -9.875  -47.645 31.156  1.00 48.34  ? 1848 ASP A HB2    1 
ATOM   7952  H  HB3    . ASP A 1 486  ? -8.471  -48.320 30.846  1.00 48.34  ? 1848 ASP A HB3    1 
ATOM   7953  N  N      . GLN A 1 487  ? -7.582  -45.105 28.670  1.00 32.15  ? 1849 GLN A N      1 
ATOM   7954  C  CA     . GLN A 1 487  ? -6.344  -44.477 28.203  1.00 32.38  ? 1849 GLN A CA     1 
ATOM   7955  C  C      . GLN A 1 487  ? -5.828  -45.122 26.917  1.00 32.28  ? 1849 GLN A C      1 
ATOM   7956  O  O      . GLN A 1 487  ? -4.659  -45.483 26.808  1.00 32.32  ? 1849 GLN A O      1 
ATOM   7957  C  CB     . GLN A 1 487  ? -5.265  -44.516 29.290  1.00 32.51  ? 1849 GLN A CB     1 
ATOM   7958  C  CG     . GLN A 1 487  ? -5.515  -43.551 30.434  1.00 32.80  ? 1849 GLN A CG     1 
ATOM   7959  C  CD     . GLN A 1 487  ? -4.637  -43.836 31.634  1.00 32.93  ? 1849 GLN A CD     1 
ATOM   7960  O  OE1    . GLN A 1 487  ? -4.357  -44.992 31.954  1.00 35.16  ? 1849 GLN A OE1    1 
ATOM   7961  N  NE2    . GLN A 1 487  ? -4.170  -42.779 32.289  1.00 33.35  ? 1849 GLN A NE2    1 
ATOM   7962  H  H      . GLN A 1 487  ? -8.248  -44.564 28.717  1.00 38.58  ? 1849 GLN A H      1 
ATOM   7963  H  HA     . GLN A 1 487  ? -6.528  -43.545 28.007  1.00 38.86  ? 1849 GLN A HA     1 
ATOM   7964  H  HB2    . GLN A 1 487  ? -5.225  -45.411 29.660  1.00 39.01  ? 1849 GLN A HB2    1 
ATOM   7965  H  HB3    . GLN A 1 487  ? -4.411  -44.287 28.891  1.00 39.01  ? 1849 GLN A HB3    1 
ATOM   7966  H  HG2    . GLN A 1 487  ? -5.330  -42.648 30.134  1.00 39.36  ? 1849 GLN A HG2    1 
ATOM   7967  H  HG3    . GLN A 1 487  ? -6.441  -43.626 30.715  1.00 39.36  ? 1849 GLN A HG3    1 
ATOM   7968  H  HE21   . GLN A 1 487  ? -4.372  -41.986 32.024  1.00 40.02  ? 1849 GLN A HE21   1 
ATOM   7969  H  HE22   . GLN A 1 487  ? -3.667  -42.888 32.978  1.00 40.02  ? 1849 GLN A HE22   1 
ATOM   7970  N  N      . PHE A 1 488  ? -6.726  -45.268 25.953  1.00 21.70  ? 1850 PHE A N      1 
ATOM   7971  C  CA     . PHE A 1 488  ? -6.399  -45.772 24.627  1.00 21.71  ? 1850 PHE A CA     1 
ATOM   7972  C  C      . PHE A 1 488  ? -5.290  -44.953 23.984  1.00 22.06  ? 1850 PHE A C      1 
ATOM   7973  O  O      . PHE A 1 488  ? -4.551  -45.456 23.142  1.00 22.13  ? 1850 PHE A O      1 
ATOM   7974  C  CB     . PHE A 1 488  ? -7.646  -45.739 23.746  1.00 21.70  ? 1850 PHE A CB     1 
ATOM   7975  C  CG     . PHE A 1 488  ? -7.497  -46.455 22.440  1.00 21.72  ? 1850 PHE A CG     1 
ATOM   7976  C  CD1    . PHE A 1 488  ? -7.648  -47.828 22.369  1.00 21.49  ? 1850 PHE A CD1    1 
ATOM   7977  C  CD2    . PHE A 1 488  ? -7.228  -45.753 21.282  1.00 22.07  ? 1850 PHE A CD2    1 
ATOM   7978  C  CE1    . PHE A 1 488  ? -7.518  -48.490 21.168  1.00 21.59  ? 1850 PHE A CE1    1 
ATOM   7979  C  CE2    . PHE A 1 488  ? -7.105  -46.405 20.081  1.00 22.18  ? 1850 PHE A CE2    1 
ATOM   7980  C  CZ     . PHE A 1 488  ? -7.248  -47.779 20.021  1.00 21.93  ? 1850 PHE A CZ     1 
ATOM   7981  H  H      . PHE A 1 488  ? -7.559  -45.076 26.047  1.00 26.04  ? 1850 PHE A H      1 
ATOM   7982  H  HA     . PHE A 1 488  ? -6.098  -46.692 24.697  1.00 26.05  ? 1850 PHE A HA     1 
ATOM   7983  H  HB2    . PHE A 1 488  ? -8.378  -46.155 24.228  1.00 26.04  ? 1850 PHE A HB2    1 
ATOM   7984  H  HB3    . PHE A 1 488  ? -7.865  -44.815 23.552  1.00 26.04  ? 1850 PHE A HB3    1 
ATOM   7985  H  HD1    . PHE A 1 488  ? -7.830  -48.311 23.143  1.00 25.78  ? 1850 PHE A HD1    1 
ATOM   7986  H  HD2    . PHE A 1 488  ? -7.131  -44.828 21.316  1.00 26.49  ? 1850 PHE A HD2    1 
ATOM   7987  H  HE1    . PHE A 1 488  ? -7.618  -49.414 21.131  1.00 25.91  ? 1850 PHE A HE1    1 
ATOM   7988  H  HE2    . PHE A 1 488  ? -6.919  -45.923 19.308  1.00 26.62  ? 1850 PHE A HE2    1 
ATOM   7989  H  HZ     . PHE A 1 488  ? -7.160  -48.221 19.208  1.00 26.32  ? 1850 PHE A HZ     1 
ATOM   7990  N  N      . ASN A 1 489  ? -5.207  -43.680 24.366  1.00 72.00  ? 1851 ASN A N      1 
ATOM   7991  C  CA     . ASN A 1 489  ? -4.261  -42.745 23.764  1.00 72.92  ? 1851 ASN A CA     1 
ATOM   7992  C  C      . ASN A 1 489  ? -2.833  -43.256 23.854  1.00 72.56  ? 1851 ASN A C      1 
ATOM   7993  O  O      . ASN A 1 489  ? -2.034  -43.020 22.949  1.00 72.65  ? 1851 ASN A O      1 
ATOM   7994  C  CB     . ASN A 1 489  ? -4.350  -41.371 24.427  1.00 73.61  ? 1851 ASN A CB     1 
ATOM   7995  C  CG     . ASN A 1 489  ? -4.218  -41.440 25.935  1.00 74.43  ? 1851 ASN A CG     1 
ATOM   7996  O  OD1    . ASN A 1 489  ? -5.207  -41.572 26.654  1.00 74.44  ? 1851 ASN A OD1    1 
ATOM   7997  N  ND2    . ASN A 1 489  ? -2.986  -41.320 26.423  1.00 74.84  ? 1851 ASN A ND2    1 
ATOM   7998  H  H      . ASN A 1 489  ? -5.695  -43.330 24.981  1.00 86.40  ? 1851 ASN A H      1 
ATOM   7999  H  HA     . ASN A 1 489  ? -4.480  -42.638 22.825  1.00 87.50  ? 1851 ASN A HA     1 
ATOM   8000  H  HB2    . ASN A 1 489  ? -3.635  -40.809 24.088  1.00 88.33  ? 1851 ASN A HB2    1 
ATOM   8001  H  HB3    . ASN A 1 489  ? -5.210  -40.975 24.219  1.00 88.33  ? 1851 ASN A HB3    1 
ATOM   8002  H  HD21   . ASN A 1 489  ? -2.854  -41.352 27.272  1.00 89.81  ? 1851 ASN A HD21   1 
ATOM   8003  H  HD22   . ASN A 1 489  ? -2.321  -41.211 25.888  1.00 89.81  ? 1851 ASN A HD22   1 
ATOM   8004  N  N      . ARG A 1 490  ? -2.509  -43.950 24.943  1.00 55.04  ? 1852 ARG A N      1 
ATOM   8005  C  CA     . ARG A 1 490  ? -1.179  -44.530 25.072  1.00 56.57  ? 1852 ARG A CA     1 
ATOM   8006  C  C      . ARG A 1 490  ? -1.211  -46.021 24.769  1.00 56.02  ? 1852 ARG A C      1 
ATOM   8007  O  O      . ARG A 1 490  ? -1.662  -46.835 25.573  1.00 55.50  ? 1852 ARG A O      1 
ATOM   8008  C  CB     . ARG A 1 490  ? -0.594  -44.303 26.469  1.00 58.37  ? 1852 ARG A CB     1 
ATOM   8009  C  CG     . ARG A 1 490  ? -1.515  -44.611 27.642  1.00 62.04  ? 1852 ARG A CG     1 
ATOM   8010  C  CD     . ARG A 1 490  ? -0.702  -44.817 28.916  1.00 67.37  ? 1852 ARG A CD     1 
ATOM   8011  N  NE     . ARG A 1 490  ? -1.048  -43.901 29.994  1.00 74.80  ? 1852 ARG A NE     1 
ATOM   8012  C  CZ     . ARG A 1 490  ? -0.467  -43.918 31.190  1.00 81.25  ? 1852 ARG A CZ     1 
ATOM   8013  N  NH1    . ARG A 1 490  ? 0.483   -44.811 31.459  1.00 79.79  1 1852 ARG A NH1    1 
ATOM   8014  N  NH2    . ARG A 1 490  ? -0.838  -43.049 32.121  1.00 86.72  ? 1852 ARG A NH2    1 
ATOM   8015  H  H      . ARG A 1 490  ? -3.032  -44.097 25.610  1.00 66.05  ? 1852 ARG A H      1 
ATOM   8016  H  HA     . ARG A 1 490  ? -0.588  -44.108 24.429  1.00 67.88  ? 1852 ARG A HA     1 
ATOM   8017  H  HB2    . ARG A 1 490  ? 0.192   -44.864 26.565  1.00 70.04  ? 1852 ARG A HB2    1 
ATOM   8018  H  HB3    . ARG A 1 490  ? -0.335  -43.371 26.543  1.00 70.04  ? 1852 ARG A HB3    1 
ATOM   8019  H  HG2    . ARG A 1 490  ? -2.122  -43.866 27.782  1.00 74.45  ? 1852 ARG A HG2    1 
ATOM   8020  H  HG3    . ARG A 1 490  ? -2.012  -45.423 27.459  1.00 74.45  ? 1852 ARG A HG3    1 
ATOM   8021  H  HD2    . ARG A 1 490  ? -0.849  -45.720 29.237  1.00 80.84  ? 1852 ARG A HD2    1 
ATOM   8022  H  HD3    . ARG A 1 490  ? 0.237   -44.691 28.710  1.00 80.84  ? 1852 ARG A HD3    1 
ATOM   8023  H  HE     . ARG A 1 490  ? -1.575  -43.246 29.812  1.00 89.77  ? 1852 ARG A HE     1 
ATOM   8024  H  HH11   . ARG A 1 490  ? 0.724   -45.376 30.857  1.00 95.75  ? 1852 ARG A HH11   1 
ATOM   8025  H  HH12   . ARG A 1 490  ? 0.856   -44.822 32.233  1.00 95.75  ? 1852 ARG A HH12   1 
ATOM   8026  H  HH21   . ARG A 1 490  ? -1.452  -42.471 31.950  1.00 104.07 ? 1852 ARG A HH21   1 
ATOM   8027  H  HH22   . ARG A 1 490  ? -0.463  -43.061 32.895  1.00 104.07 ? 1852 ARG A HH22   1 
ATOM   8028  N  N      . LEU A 1 491  ? -0.706  -46.356 23.589  1.00 24.06  ? 1853 LEU A N      1 
ATOM   8029  C  CA     . LEU A 1 491  ? -0.481  -47.733 23.184  1.00 23.89  ? 1853 LEU A CA     1 
ATOM   8030  C  C      . LEU A 1 491  ? 0.636   -47.662 22.155  1.00 24.27  ? 1853 LEU A C      1 
ATOM   8031  O  O      . LEU A 1 491  ? 0.793   -46.639 21.488  1.00 27.41  ? 1853 LEU A O      1 
ATOM   8032  C  CB     . LEU A 1 491  ? -1.750  -48.379 22.604  1.00 23.65  ? 1853 LEU A CB     1 
ATOM   8033  C  CG     . LEU A 1 491  ? -2.818  -48.918 23.573  1.00 23.30  ? 1853 LEU A CG     1 
ATOM   8034  C  CD1    . LEU A 1 491  ? -4.040  -49.448 22.828  1.00 23.16  ? 1853 LEU A CD1    1 
ATOM   8035  C  CD2    . LEU A 1 491  ? -2.238  -50.004 24.454  1.00 23.17  ? 1853 LEU A CD2    1 
ATOM   8036  H  H      . LEU A 1 491  ? -0.479  -45.783 22.989  1.00 28.88  ? 1853 LEU A H      1 
ATOM   8037  H  HA     . LEU A 1 491  ? -0.179  -48.256 23.942  1.00 28.67  ? 1853 LEU A HA     1 
ATOM   8038  H  HB2    . LEU A 1 491  ? -2.189  -47.718 22.046  1.00 28.39  ? 1853 LEU A HB2    1 
ATOM   8039  H  HB3    . LEU A 1 491  ? -1.475  -49.125 22.050  1.00 28.39  ? 1853 LEU A HB3    1 
ATOM   8040  H  HG     . LEU A 1 491  ? -3.112  -48.195 24.149  1.00 27.96  ? 1853 LEU A HG     1 
ATOM   8041  H  HD11   . LEU A 1 491  ? -4.685  -49.777 23.474  1.00 27.79  ? 1853 LEU A HD11   1 
ATOM   8042  H  HD12   . LEU A 1 491  ? -4.429  -48.727 22.309  1.00 27.79  ? 1853 LEU A HD12   1 
ATOM   8043  H  HD13   . LEU A 1 491  ? -3.763  -50.168 22.240  1.00 27.79  ? 1853 LEU A HD13   1 
ATOM   8044  H  HD21   . LEU A 1 491  ? -2.929  -50.326 25.054  1.00 27.80  ? 1853 LEU A HD21   1 
ATOM   8045  H  HD22   . LEU A 1 491  ? -1.922  -50.730 23.893  1.00 27.80  ? 1853 LEU A HD22   1 
ATOM   8046  H  HD23   . LEU A 1 491  ? -1.501  -49.636 24.966  1.00 27.80  ? 1853 LEU A HD23   1 
ATOM   8047  N  N      . ASP A 1 492  ? 1.403   -48.737 22.016  1.00 68.93  ? 1854 ASP A N      1 
ATOM   8048  C  CA     . ASP A 1 492  ? 2.554   -48.728 21.117  1.00 73.00  ? 1854 ASP A CA     1 
ATOM   8049  C  C      . ASP A 1 492  ? 2.104   -48.661 19.666  1.00 71.08  ? 1854 ASP A C      1 
ATOM   8050  O  O      . ASP A 1 492  ? 0.963   -48.996 19.351  1.00 76.88  ? 1854 ASP A O      1 
ATOM   8051  C  CB     . ASP A 1 492  ? 3.428   -49.960 21.343  1.00 69.28  ? 1854 ASP A CB     1 
ATOM   8052  C  CG     . ASP A 1 492  ? 3.929   -50.065 22.770  1.00 70.61  ? 1854 ASP A CG     1 
ATOM   8053  O  OD1    . ASP A 1 492  ? 3.139   -50.458 23.657  1.00 71.37  1 1854 ASP A OD1    1 
ATOM   8054  O  OD2    . ASP A 1 492  ? 5.118   -49.760 23.003  1.00 70.08  ? 1854 ASP A OD2    1 
ATOM   8055  H  H      . ASP A 1 492  ? 1.281   -49.482 22.429  1.00 82.71  ? 1854 ASP A H      1 
ATOM   8056  H  HA     . ASP A 1 492  ? 3.091   -47.942 21.301  1.00 87.60  ? 1854 ASP A HA     1 
ATOM   8057  H  HB2    . ASP A 1 492  ? 2.911   -50.756 21.147  1.00 83.14  ? 1854 ASP A HB2    1 
ATOM   8058  H  HB3    . ASP A 1 492  ? 4.200   -49.912 20.757  1.00 83.14  ? 1854 ASP A HB3    1 
ATOM   8059  N  N      . GLU A 1 493  ? 3.003   -48.210 18.796  1.00 89.61  ? 1855 GLU A N      1 
ATOM   8060  C  CA     . GLU A 1 493  ? 2.696   -48.035 17.382  1.00 90.49  ? 1855 GLU A CA     1 
ATOM   8061  C  C      . GLU A 1 493  ? 2.041   -49.285 16.840  1.00 90.24  ? 1855 GLU A C      1 
ATOM   8062  O  O      . GLU A 1 493  ? 0.937   -49.237 16.304  1.00 90.50  ? 1855 GLU A O      1 
ATOM   8063  C  CB     . GLU A 1 493  ? 3.965   -47.743 16.576  1.00 92.22  ? 1855 GLU A CB     1 
ATOM   8064  C  CG     . GLU A 1 493  ? 4.389   -46.288 16.544  1.00 93.36  ? 1855 GLU A CG     1 
ATOM   8065  C  CD     . GLU A 1 493  ? 3.676   -45.503 15.461  1.00 94.47  ? 1855 GLU A CD     1 
ATOM   8066  O  OE1    . GLU A 1 493  ? 2.486   -45.169 15.650  1.00 94.93  ? 1855 GLU A OE1    1 
ATOM   8067  O  OE2    . GLU A 1 493  ? 4.310   -45.227 14.419  1.00 94.84  1 1855 GLU A OE2    1 
ATOM   8068  H  H      . GLU A 1 493  ? 3.810   -47.995 19.004  1.00 107.53 ? 1855 GLU A H      1 
ATOM   8069  H  HA     . GLU A 1 493  ? 2.082   -47.292 17.273  1.00 108.59 ? 1855 GLU A HA     1 
ATOM   8070  H  HB2    . GLU A 1 493  ? 4.697   -48.251 16.959  1.00 110.67 ? 1855 GLU A HB2    1 
ATOM   8071  H  HB3    . GLU A 1 493  ? 3.819   -48.024 15.659  1.00 110.67 ? 1855 GLU A HB3    1 
ATOM   8072  H  HG2    . GLU A 1 493  ? 4.182   -45.879 17.399  1.00 112.03 ? 1855 GLU A HG2    1 
ATOM   8073  H  HG3    . GLU A 1 493  ? 5.343   -46.239 16.374  1.00 112.03 ? 1855 GLU A HG3    1 
ATOM   8074  N  N      . LYS A 1 494  ? 2.728   -50.410 16.987  1.00 73.05  ? 1856 LYS A N      1 
ATOM   8075  C  CA     . LYS A 1 494  ? 2.250   -51.647 16.404  1.00 73.80  ? 1856 LYS A CA     1 
ATOM   8076  C  C      . LYS A 1 494  ? 1.023   -52.166 17.156  1.00 72.96  ? 1856 LYS A C      1 
ATOM   8077  O  O      . LYS A 1 494  ? 0.112   -52.728 16.547  1.00 79.84  ? 1856 LYS A O      1 
ATOM   8078  C  CB     . LYS A 1 494  ? 3.358   -52.703 16.390  1.00 76.46  ? 1856 LYS A CB     1 
ATOM   8079  C  CG     . LYS A 1 494  ? 3.907   -53.092 17.757  1.00 79.67  ? 1856 LYS A CG     1 
ATOM   8080  C  CD     . LYS A 1 494  ? 4.322   -54.556 17.755  1.00 80.35  ? 1856 LYS A CD     1 
ATOM   8081  C  CE     . LYS A 1 494  ? 4.564   -55.085 19.156  1.00 80.13  ? 1856 LYS A CE     1 
ATOM   8082  N  NZ     . LYS A 1 494  ? 4.680   -56.567 19.147  1.00 80.17  1 1856 LYS A NZ     1 
ATOM   8083  H  H      . LYS A 1 494  ? 3.469   -50.480 17.418  1.00 87.66  ? 1856 LYS A H      1 
ATOM   8084  H  HA     . LYS A 1 494  ? 1.987   -51.480 15.486  1.00 88.56  ? 1856 LYS A HA     1 
ATOM   8085  H  HB2    . LYS A 1 494  ? 3.010   -53.508 15.976  1.00 91.75  ? 1856 LYS A HB2    1 
ATOM   8086  H  HB3    . LYS A 1 494  ? 4.100   -52.363 15.864  1.00 91.75  ? 1856 LYS A HB3    1 
ATOM   8087  H  HG2    . LYS A 1 494  ? 4.686   -52.551 17.960  1.00 95.60  ? 1856 LYS A HG2    1 
ATOM   8088  H  HG3    . LYS A 1 494  ? 3.220   -52.967 18.430  1.00 95.60  ? 1856 LYS A HG3    1 
ATOM   8089  H  HD2    . LYS A 1 494  ? 3.617   -55.086 17.350  1.00 96.42  ? 1856 LYS A HD2    1 
ATOM   8090  H  HD3    . LYS A 1 494  ? 5.145   -54.653 17.250  1.00 96.42  ? 1856 LYS A HD3    1 
ATOM   8091  H  HE2    . LYS A 1 494  ? 5.391   -54.715 19.502  1.00 96.15  ? 1856 LYS A HE2    1 
ATOM   8092  H  HE3    . LYS A 1 494  ? 3.819   -54.839 19.727  1.00 96.15  ? 1856 LYS A HE3    1 
ATOM   8093  H  HZ1    . LYS A 1 494  ? 4.822   -56.866 19.973  1.00 96.20  ? 1856 LYS A HZ1    1 
ATOM   8094  H  HZ2    . LYS A 1 494  ? 3.930   -56.929 18.833  1.00 96.20  ? 1856 LYS A HZ2    1 
ATOM   8095  H  HZ3    . LYS A 1 494  ? 5.360   -56.816 18.629  1.00 96.20  ? 1856 LYS A HZ3    1 
ATOM   8096  N  N      . VAL A 1 495  ? 0.995   -51.977 18.474  1.00 39.48  ? 1857 VAL A N      1 
ATOM   8097  C  CA     . VAL A 1 495  ? -0.117  -52.473 19.281  1.00 39.04  ? 1857 VAL A CA     1 
ATOM   8098  C  C      . VAL A 1 495  ? -1.383  -51.692 18.945  1.00 38.94  ? 1857 VAL A C      1 
ATOM   8099  O  O      . VAL A 1 495  ? -2.416  -52.275 18.618  1.00 38.83  ? 1857 VAL A O      1 
ATOM   8100  C  CB     . VAL A 1 495  ? 0.174   -52.365 20.795  1.00 38.78  ? 1857 VAL A CB     1 
ATOM   8101  C  CG1    . VAL A 1 495  ? -0.990  -52.948 21.605  1.00 38.42  ? 1857 VAL A CG1    1 
ATOM   8102  C  CG2    . VAL A 1 495  ? 1.480   -53.081 21.143  1.00 38.94  ? 1857 VAL A CG2    1 
ATOM   8103  H  H      . VAL A 1 495  ? 1.604   -51.567 18.922  1.00 47.37  ? 1857 VAL A H      1 
ATOM   8104  H  HA     . VAL A 1 495  ? -0.273  -53.407 19.069  1.00 46.85  ? 1857 VAL A HA     1 
ATOM   8105  H  HB     . VAL A 1 495  ? 0.269   -51.429 21.034  1.00 46.54  ? 1857 VAL A HB     1 
ATOM   8106  H  HG11   . VAL A 1 495  ? -0.787  -52.869 22.550  1.00 46.10  ? 1857 VAL A HG11   1 
ATOM   8107  H  HG12   . VAL A 1 495  ? -1.798  -52.452 21.398  1.00 46.10  ? 1857 VAL A HG12   1 
ATOM   8108  H  HG13   . VAL A 1 495  ? -1.104  -53.881 21.367  1.00 46.10  ? 1857 VAL A HG13   1 
ATOM   8109  H  HG21   . VAL A 1 495  ? 1.641   -52.999 22.096  1.00 46.73  ? 1857 VAL A HG21   1 
ATOM   8110  H  HG22   . VAL A 1 495  ? 1.401   -54.017 20.900  1.00 46.73  ? 1857 VAL A HG22   1 
ATOM   8111  H  HG23   . VAL A 1 495  ? 2.207   -52.671 20.648  1.00 46.73  ? 1857 VAL A HG23   1 
ATOM   8112  N  N      . LEU A 1 496  ? -1.276  -50.366 19.011  1.00 22.56  ? 1858 LEU A N      1 
ATOM   8113  C  CA     . LEU A 1 496  ? -2.382  -49.469 18.688  1.00 22.57  ? 1858 LEU A CA     1 
ATOM   8114  C  C      . LEU A 1 496  ? -2.875  -49.642 17.265  1.00 22.86  ? 1858 LEU A C      1 
ATOM   8115  O  O      . LEU A 1 496  ? -4.073  -49.600 16.997  1.00 22.77  ? 1858 LEU A O      1 
ATOM   8116  C  CB     . LEU A 1 496  ? -1.949  -48.017 18.877  1.00 22.80  ? 1858 LEU A CB     1 
ATOM   8117  C  CG     . LEU A 1 496  ? -2.972  -46.975 18.440  1.00 22.94  ? 1858 LEU A CG     1 
ATOM   8118  C  CD1    . LEU A 1 496  ? -4.216  -47.113 19.248  1.00 22.54  ? 1858 LEU A CD1    1 
ATOM   8119  C  CD2    . LEU A 1 496  ? -2.417  -45.583 18.583  1.00 39.36  ? 1858 LEU A CD2    1 
ATOM   8120  H  H      . LEU A 1 496  ? -0.558  -49.955 19.246  1.00 27.08  ? 1858 LEU A H      1 
ATOM   8121  H  HA     . LEU A 1 496  ? -3.123  -49.646 19.289  1.00 27.08  ? 1858 LEU A HA     1 
ATOM   8122  H  HB2    . LEU A 1 496  ? -1.767  -47.870 19.819  1.00 27.36  ? 1858 LEU A HB2    1 
ATOM   8123  H  HB3    . LEU A 1 496  ? -1.141  -47.867 18.363  1.00 27.36  ? 1858 LEU A HB3    1 
ATOM   8124  H  HG     . LEU A 1 496  ? -3.197  -47.119 17.507  1.00 27.53  ? 1858 LEU A HG     1 
ATOM   8125  H  HD11   . LEU A 1 496  ? -4.582  -48.001 19.115  1.00 27.05  ? 1858 LEU A HD11   1 
ATOM   8126  H  HD12   . LEU A 1 496  ? -4.000  -46.981 20.184  1.00 27.05  ? 1858 LEU A HD12   1 
ATOM   8127  H  HD13   . LEU A 1 496  ? -4.856  -46.444 18.958  1.00 27.05  ? 1858 LEU A HD13   1 
ATOM   8128  H  HD21   . LEU A 1 496  ? -3.089  -44.944 18.298  1.00 47.23  ? 1858 LEU A HD21   1 
ATOM   8129  H  HD22   . LEU A 1 496  ? -2.188  -45.429 19.513  1.00 47.23  ? 1858 LEU A HD22   1 
ATOM   8130  H  HD23   . LEU A 1 496  ? -1.625  -45.500 18.029  1.00 47.23  ? 1858 LEU A HD23   1 
ATOM   8131  N  N      . SER A 1 497  ? -1.930  -49.818 16.355  1.00 31.45  ? 1859 SER A N      1 
ATOM   8132  C  CA     . SER A 1 497  ? -2.241  -50.014 14.955  1.00 31.85  ? 1859 SER A CA     1 
ATOM   8133  C  C      . SER A 1 497  ? -3.160  -51.206 14.795  1.00 31.65  ? 1859 SER A C      1 
ATOM   8134  O  O      . SER A 1 497  ? -4.223  -51.107 14.191  1.00 31.73  ? 1859 SER A O      1 
ATOM   8135  C  CB     . SER A 1 497  ? -0.962  -50.220 14.148  1.00 32.34  ? 1859 SER A CB     1 
ATOM   8136  O  OG     . SER A 1 497  ? -1.256  -50.554 12.805  1.00 32.79  ? 1859 SER A OG     1 
ATOM   8137  H  H      . SER A 1 497  ? -1.088  -49.828 16.530  1.00 37.74  ? 1859 SER A H      1 
ATOM   8138  H  HA     . SER A 1 497  ? -2.695  -49.229 14.613  1.00 38.22  ? 1859 SER A HA     1 
ATOM   8139  H  HB2    . SER A 1 497  ? -0.445  -49.399 14.162  1.00 38.81  ? 1859 SER A HB2    1 
ATOM   8140  H  HB3    . SER A 1 497  ? -0.450  -50.941 14.547  1.00 38.81  ? 1859 SER A HB3    1 
ATOM   8141  H  HG     . SER A 1 497  ? -0.544  -50.665 12.373  1.00 39.34  ? 1859 SER A HG     1 
ATOM   8142  N  N      . ALA A 1 498  ? -2.736  -52.333 15.350  1.00 23.26  ? 1860 ALA A N      1 
ATOM   8143  C  CA     . ALA A 1 498  ? -3.467  -53.582 15.214  1.00 23.16  ? 1860 ALA A CA     1 
ATOM   8144  C  C      . ALA A 1 498  ? -4.798  -53.560 15.950  1.00 22.76  ? 1860 ALA A C      1 
ATOM   8145  O  O      . ALA A 1 498  ? -5.807  -54.006 15.414  1.00 22.83  ? 1860 ALA A O      1 
ATOM   8146  C  CB     . ALA A 1 498  ? -2.623  -54.725 15.706  1.00 23.12  ? 1860 ALA A CB     1 
ATOM   8147  H  H      . ALA A 1 498  ? -2.016  -52.400 15.816  1.00 27.91  ? 1860 ALA A H      1 
ATOM   8148  H  HA     . ALA A 1 498  ? -3.652  -53.734 14.274  1.00 27.80  ? 1860 ALA A HA     1 
ATOM   8149  H  HB1    . ALA A 1 498  ? -3.124  -55.550 15.609  1.00 27.75  ? 1860 ALA A HB1    1 
ATOM   8150  H  HB2    . ALA A 1 498  ? -1.811  -54.767 15.178  1.00 27.75  ? 1860 ALA A HB2    1 
ATOM   8151  H  HB3    . ALA A 1 498  ? -2.405  -54.577 16.639  1.00 27.75  ? 1860 ALA A HB3    1 
ATOM   8152  N  N      . VAL A 1 499  ? -4.801  -53.070 17.186  1.00 22.39  ? 1861 VAL A N      1 
ATOM   8153  C  CA     . VAL A 1 499  ? -6.037  -53.025 17.954  1.00 22.06  ? 1861 VAL A CA     1 
ATOM   8154  C  C      . VAL A 1 499  ? -7.029  -52.149 17.212  1.00 22.20  ? 1861 VAL A C      1 
ATOM   8155  O  O      . VAL A 1 499  ? -8.179  -52.527 17.021  1.00 22.17  ? 1861 VAL A O      1 
ATOM   8156  C  CB     . VAL A 1 499  ? -5.826  -52.484 19.382  1.00 21.75  ? 1861 VAL A CB     1 
ATOM   8157  C  CG1    . VAL A 1 499  ? -7.167  -52.278 20.086  1.00 21.50  ? 1861 VAL A CG1    1 
ATOM   8158  C  CG2    . VAL A 1 499  ? -4.977  -53.455 20.175  1.00 21.65  ? 1861 VAL A CG2    1 
ATOM   8159  H  H      . VAL A 1 499  ? -4.111  -52.762 17.597  1.00 26.87  ? 1861 VAL A H      1 
ATOM   8160  H  HA     . VAL A 1 499  ? -6.408  -53.919 18.018  1.00 26.47  ? 1861 VAL A HA     1 
ATOM   8161  H  HB     . VAL A 1 499  ? -5.364  -51.632 19.342  1.00 26.10  ? 1861 VAL A HB     1 
ATOM   8162  H  HG11   . VAL A 1 499  ? -7.006  -51.938 20.980  1.00 25.80  ? 1861 VAL A HG11   1 
ATOM   8163  H  HG12   . VAL A 1 499  ? -7.694  -51.640 19.579  1.00 25.80  ? 1861 VAL A HG12   1 
ATOM   8164  H  HG13   . VAL A 1 499  ? -7.633  -53.127 20.133  1.00 25.80  ? 1861 VAL A HG13   1 
ATOM   8165  H  HG21   . VAL A 1 499  ? -4.851  -53.105 21.071  1.00 25.98  ? 1861 VAL A HG21   1 
ATOM   8166  H  HG22   . VAL A 1 499  ? -5.431  -54.311 20.215  1.00 25.98  ? 1861 VAL A HG22   1 
ATOM   8167  H  HG23   . VAL A 1 499  ? -4.119  -53.556 19.735  1.00 25.98  ? 1861 VAL A HG23   1 
ATOM   8168  N  N      . SER A 1 500  ? -6.564  -50.980 16.787  1.00 22.43  ? 1862 SER A N      1 
ATOM   8169  C  CA     . SER A 1 500  ? -7.395  -50.043 16.047  1.00 22.67  ? 1862 SER A CA     1 
ATOM   8170  C  C      . SER A 1 500  ? -8.053  -50.690 14.834  1.00 22.97  ? 1862 SER A C      1 
ATOM   8171  O  O      . SER A 1 500  ? -9.266  -50.615 14.673  1.00 22.96  ? 1862 SER A O      1 
ATOM   8172  C  CB     . SER A 1 500  ? -6.572  -48.847 15.594  1.00 23.03  ? 1862 SER A CB     1 
ATOM   8173  O  OG     . SER A 1 500  ? -7.316  -48.063 14.691  1.00 23.40  ? 1862 SER A OG     1 
ATOM   8174  H  H      . SER A 1 500  ? -5.760  -50.704 16.916  1.00 26.92  ? 1862 SER A H      1 
ATOM   8175  H  HA     . SER A 1 500  ? -8.099  -49.719 16.630  1.00 27.21  ? 1862 SER A HA     1 
ATOM   8176  H  HB2    . SER A 1 500  ? -6.342  -48.308 16.367  1.00 27.64  ? 1862 SER A HB2    1 
ATOM   8177  H  HB3    . SER A 1 500  ? -5.768  -49.162 15.154  1.00 27.64  ? 1862 SER A HB3    1 
ATOM   8178  H  HG     . SER A 1 500  ? -6.862  -47.403 14.441  1.00 28.08  ? 1862 SER A HG     1 
ATOM   8179  N  N      . ALA A 1 501  ? -7.252  -51.306 13.975  1.00 23.29  ? 1863 ALA A N      1 
ATOM   8180  C  CA     . ALA A 1 501  ? -7.764  -51.942 12.768  1.00 23.69  ? 1863 ALA A CA     1 
ATOM   8181  C  C      . ALA A 1 501  ? -8.860  -52.941 13.096  1.00 23.45  ? 1863 ALA A C      1 
ATOM   8182  O  O      . ALA A 1 501  ? -9.872  -52.993 12.407  1.00 23.68  ? 1863 ALA A O      1 
ATOM   8183  C  CB     . ALA A 1 501  ? -6.647  -52.619 12.008  1.00 24.06  ? 1863 ALA A CB     1 
ATOM   8184  H  H      . ALA A 1 501  ? -6.399  -51.370 14.069  1.00 27.95  ? 1863 ALA A H      1 
ATOM   8185  H  HA     . ALA A 1 501  ? -8.145  -51.261 12.192  1.00 28.42  ? 1863 ALA A HA     1 
ATOM   8186  H  HB1    . ALA A 1 501  ? -7.013  -53.034 11.212  1.00 28.88  ? 1863 ALA A HB1    1 
ATOM   8187  H  HB2    . ALA A 1 501  ? -5.985  -51.954 11.761  1.00 28.88  ? 1863 ALA A HB2    1 
ATOM   8188  H  HB3    . ALA A 1 501  ? -6.242  -53.293 12.576  1.00 28.88  ? 1863 ALA A HB3    1 
ATOM   8189  N  N      . ASN A 1 502  ? -8.652  -53.729 14.148  1.00 23.05  ? 1864 ASN A N      1 
ATOM   8190  C  CA     . ASN A 1 502  ? -9.660  -54.684 14.600  1.00 22.87  ? 1864 ASN A CA     1 
ATOM   8191  C  C      . ASN A 1 502  ? -10.914 -53.960 15.068  1.00 22.66  ? 1864 ASN A C      1 
ATOM   8192  O  O      . ASN A 1 502  ? -12.024 -54.398 14.791  1.00 22.75  ? 1864 ASN A O      1 
ATOM   8193  C  CB     . ASN A 1 502  ? -9.139  -55.563 15.737  1.00 22.55  ? 1864 ASN A CB     1 
ATOM   8194  C  CG     . ASN A 1 502  ? -8.133  -56.596 15.278  1.00 22.82  ? 1864 ASN A CG     1 
ATOM   8195  O  OD1    . ASN A 1 502  ? -8.064  -56.943 14.104  1.00 23.26  ? 1864 ASN A OD1    1 
ATOM   8196  N  ND2    . ASN A 1 502  ? -7.367  -57.124 16.220  1.00 22.62  ? 1864 ASN A ND2    1 
ATOM   8197  H  H      . ASN A 1 502  ? -7.933  -53.730 14.620  1.00 27.66  ? 1864 ASN A H      1 
ATOM   8198  H  HA     . ASN A 1 502  ? -9.904  -55.261 13.860  1.00 27.44  ? 1864 ASN A HA     1 
ATOM   8199  H  HB2    . ASN A 1 502  ? -8.708  -55.000 16.398  1.00 27.06  ? 1864 ASN A HB2    1 
ATOM   8200  H  HB3    . ASN A 1 502  ? -9.886  -56.033 16.139  1.00 27.06  ? 1864 ASN A HB3    1 
ATOM   8201  H  HD21   . ASN A 1 502  ? -6.778  -57.716 16.014  1.00 27.15  ? 1864 ASN A HD21   1 
ATOM   8202  H  HD22   . ASN A 1 502  ? -7.459  -56.875 17.038  1.00 27.15  ? 1864 ASN A HD22   1 
ATOM   8203  N  N      . ILE A 1 503  ? -10.741 -52.865 15.802  1.00 22.42  ? 1865 ILE A N      1 
ATOM   8204  C  CA     . ILE A 1 503  ? -11.886 -52.098 16.271  1.00 22.28  ? 1865 ILE A CA     1 
ATOM   8205  C  C      . ILE A 1 503  ? -12.688 -51.542 15.110  1.00 22.67  ? 1865 ILE A C      1 
ATOM   8206  O  O      . ILE A 1 503  ? -13.898 -51.395 15.220  1.00 22.66  ? 1865 ILE A O      1 
ATOM   8207  C  CB     . ILE A 1 503  ? -11.471 -50.946 17.209  1.00 22.07  ? 1865 ILE A CB     1 
ATOM   8208  C  CG1    . ILE A 1 503  ? -10.929 -51.529 18.510  1.00 21.71  ? 1865 ILE A CG1    1 
ATOM   8209  C  CG2    . ILE A 1 503  ? -12.662 -50.055 17.560  1.00 22.04  ? 1865 ILE A CG2    1 
ATOM   8210  C  CD1    . ILE A 1 503  ? -10.349 -50.512 19.457  1.00 21.57  ? 1865 ILE A CD1    1 
ATOM   8211  H  H      . ILE A 1 503  ? -9.977  -52.549 16.038  1.00 26.90  ? 1865 ILE A H      1 
ATOM   8212  H  HA     . ILE A 1 503  ? -12.469 -52.689 16.774  1.00 26.74  ? 1865 ILE A HA     1 
ATOM   8213  H  HB     . ILE A 1 503  ? -10.782 -50.412 16.782  1.00 26.48  ? 1865 ILE A HB     1 
ATOM   8214  H  HG12   . ILE A 1 503  ? -11.652 -51.982 18.971  1.00 26.05  ? 1865 ILE A HG12   1 
ATOM   8215  H  HG13   . ILE A 1 503  ? -10.229 -52.166 18.296  1.00 26.05  ? 1865 ILE A HG13   1 
ATOM   8216  H  HG21   . ILE A 1 503  ? -12.363 -49.345 18.149  1.00 26.45  ? 1865 ILE A HG21   1 
ATOM   8217  H  HG22   . ILE A 1 503  ? -13.025 -49.678 16.744  1.00 26.45  ? 1865 ILE A HG22   1 
ATOM   8218  H  HG23   . ILE A 1 503  ? -13.337 -50.592 18.005  1.00 26.45  ? 1865 ILE A HG23   1 
ATOM   8219  H  HD11   . ILE A 1 503  ? -10.030 -50.967 20.252  1.00 25.88  ? 1865 ILE A HD11   1 
ATOM   8220  H  HD12   . ILE A 1 503  ? -9.612  -50.057 19.019  1.00 25.88  ? 1865 ILE A HD12   1 
ATOM   8221  H  HD13   . ILE A 1 503  ? -11.038 -49.873 19.695  1.00 25.88  ? 1865 ILE A HD13   1 
ATOM   8222  N  N      . GLN A 1 504  ? -12.044 -51.245 13.989  1.00 43.20  ? 1866 GLN A N      1 
ATOM   8223  C  CA     . GLN A 1 504  ? -12.808 -50.749 12.857  1.00 43.67  ? 1866 GLN A CA     1 
ATOM   8224  C  C      . GLN A 1 504  ? -13.528 -51.918 12.210  1.00 43.87  ? 1866 GLN A C      1 
ATOM   8225  O  O      . GLN A 1 504  ? -14.659 -51.763 11.770  1.00 48.84  ? 1866 GLN A O      1 
ATOM   8226  C  CB     . GLN A 1 504  ? -11.948 -50.019 11.833  1.00 44.16  ? 1866 GLN A CB     1 
ATOM   8227  C  CG     . GLN A 1 504  ? -12.817 -49.337 10.784  1.00 44.70  ? 1866 GLN A CG     1 
ATOM   8228  C  CD     . GLN A 1 504  ? -12.022 -48.546 9.778   1.00 50.68  ? 1866 GLN A CD     1 
ATOM   8229  O  OE1    . GLN A 1 504  ? -10.793 -48.485 9.848   1.00 51.79  ? 1866 GLN A OE1    1 
ATOM   8230  N  NE2    . GLN A 1 504  ? -12.722 -47.921 8.834   1.00 56.71  ? 1866 GLN A NE2    1 
ATOM   8231  H  H      . GLN A 1 504  ? -11.197 -51.317 13.861  1.00 51.85  ? 1866 GLN A H      1 
ATOM   8232  H  HA     . GLN A 1 504  ? -13.478 -50.127 13.179  1.00 52.40  ? 1866 GLN A HA     1 
ATOM   8233  H  HB2    . GLN A 1 504  ? -11.419 -49.340 12.281  1.00 53.00  ? 1866 GLN A HB2    1 
ATOM   8234  H  HB3    . GLN A 1 504  ? -11.370 -50.656 11.384  1.00 53.00  ? 1866 GLN A HB3    1 
ATOM   8235  H  HG2    . GLN A 1 504  ? -13.319 -50.013 10.303  1.00 53.64  ? 1866 GLN A HG2    1 
ATOM   8236  H  HG3    . GLN A 1 504  ? -13.426 -48.727 11.229  1.00 53.64  ? 1866 GLN A HG3    1 
ATOM   8237  H  HE21   . GLN A 1 504  ? -13.580 -47.983 8.822   1.00 68.05  ? 1866 GLN A HE21   1 
ATOM   8238  H  HE22   . GLN A 1 504  ? -12.316 -47.456 8.235   1.00 68.05  ? 1866 GLN A HE22   1 
ATOM   8239  N  N      . GLN A 1 505  ? -12.888 -53.085 12.158  1.00 23.73  ? 1867 GLN A N      1 
ATOM   8240  C  CA     . GLN A 1 505  ? -13.552 -54.268 11.625  1.00 23.97  ? 1867 GLN A CA     1 
ATOM   8241  C  C      . GLN A 1 505  ? -14.845 -54.493 12.382  1.00 23.70  ? 1867 GLN A C      1 
ATOM   8242  O  O      . GLN A 1 505  ? -15.890 -54.760 11.793  1.00 24.01  ? 1867 GLN A O      1 
ATOM   8243  C  CB     . GLN A 1 505  ? -12.674 -55.513 11.747  1.00 23.96  ? 1867 GLN A CB     1 
ATOM   8244  C  CG     . GLN A 1 505  ? -11.402 -55.469 10.945  1.00 24.31  ? 1867 GLN A CG     1 
ATOM   8245  C  CD     . GLN A 1 505  ? -11.654 -55.187 9.489   1.00 24.97  ? 1867 GLN A CD     1 
ATOM   8246  O  OE1    . GLN A 1 505  ? -11.177 -54.190 8.952   1.00 25.22  ? 1867 GLN A OE1    1 
ATOM   8247  N  NE2    . GLN A 1 505  ? -12.420 -56.054 8.841   1.00 25.34  ? 1867 GLN A NE2    1 
ATOM   8248  H  H      . GLN A 1 505  ? -12.080 -53.215 12.422  1.00 28.48  ? 1867 GLN A H      1 
ATOM   8249  H  HA     . GLN A 1 505  ? -13.762 -54.128 10.688  1.00 28.77  ? 1867 GLN A HA     1 
ATOM   8250  H  HB2    . GLN A 1 505  ? -12.429 -55.628 12.679  1.00 28.75  ? 1867 GLN A HB2    1 
ATOM   8251  H  HB3    . GLN A 1 505  ? -13.184 -56.281 11.447  1.00 28.75  ? 1867 GLN A HB3    1 
ATOM   8252  H  HG2    . GLN A 1 505  ? -10.831 -54.767 11.294  1.00 29.17  ? 1867 GLN A HG2    1 
ATOM   8253  H  HG3    . GLN A 1 505  ? -10.955 -56.327 11.013  1.00 29.17  ? 1867 GLN A HG3    1 
ATOM   8254  H  HE21   . GLN A 1 505  ? -12.745 -56.734 9.255   1.00 30.41  ? 1867 GLN A HE21   1 
ATOM   8255  H  HE22   . GLN A 1 505  ? -12.593 -55.935 8.007   1.00 30.41  ? 1867 GLN A HE22   1 
ATOM   8256  N  N      . ILE A 1 506  ? -14.768 -54.359 13.698  1.00 23.19  ? 1868 ILE A N      1 
ATOM   8257  C  CA     . ILE A 1 506  ? -15.929 -54.561 14.541  1.00 22.96  ? 1868 ILE A CA     1 
ATOM   8258  C  C      . ILE A 1 506  ? -16.954 -53.464 14.301  1.00 23.08  ? 1868 ILE A C      1 
ATOM   8259  O  O      . ILE A 1 506  ? -18.083 -53.747 13.922  1.00 23.31  ? 1868 ILE A O      1 
ATOM   8260  C  CB     . ILE A 1 506  ? -15.539 -54.600 16.028  1.00 22.47  ? 1868 ILE A CB     1 
ATOM   8261  C  CG1    . ILE A 1 506  ? -14.541 -55.730 16.284  1.00 22.41  ? 1868 ILE A CG1    1 
ATOM   8262  C  CG2    . ILE A 1 506  ? -16.746 -54.868 16.888  1.00 22.32  ? 1868 ILE A CG2    1 
ATOM   8263  C  CD1    . ILE A 1 506  ? -13.764 -55.572 17.560  1.00 22.02  ? 1868 ILE A CD1    1 
ATOM   8264  H  H      . ILE A 1 506  ? -14.052 -54.152 14.127  1.00 27.83  ? 1868 ILE A H      1 
ATOM   8265  H  HA     . ILE A 1 506  ? -16.340 -55.410 14.315  1.00 27.55  ? 1868 ILE A HA     1 
ATOM   8266  H  HB     . ILE A 1 506  ? -15.141 -53.753 16.282  1.00 26.96  ? 1868 ILE A HB     1 
ATOM   8267  H  HG12   . ILE A 1 506  ? -15.024 -56.569 16.332  1.00 26.89  ? 1868 ILE A HG12   1 
ATOM   8268  H  HG13   . ILE A 1 506  ? -13.905 -55.757 15.551  1.00 26.89  ? 1868 ILE A HG13   1 
ATOM   8269  H  HG21   . ILE A 1 506  ? -16.472 -54.887 17.818  1.00 26.78  ? 1868 ILE A HG21   1 
ATOM   8270  H  HG22   . ILE A 1 506  ? -17.395 -54.160 16.749  1.00 26.78  ? 1868 ILE A HG22   1 
ATOM   8271  H  HG23   . ILE A 1 506  ? -17.128 -55.723 16.637  1.00 26.78  ? 1868 ILE A HG23   1 
ATOM   8272  H  HD11   . ILE A 1 506  ? -13.155 -56.321 17.653  1.00 26.42  ? 1868 ILE A HD11   1 
ATOM   8273  H  HD12   . ILE A 1 506  ? -13.264 -54.741 17.524  1.00 26.42  ? 1868 ILE A HD12   1 
ATOM   8274  H  HD13   . ILE A 1 506  ? -14.383 -55.554 18.306  1.00 26.42  ? 1868 ILE A HD13   1 
ATOM   8275  N  N      . GLN A 1 507  ? -16.544 -52.213 14.475  1.00 32.12  ? 1869 GLN A N      1 
ATOM   8276  C  CA     . GLN A 1 507  ? -17.463 -51.084 14.367  1.00 32.27  ? 1869 GLN A CA     1 
ATOM   8277  C  C      . GLN A 1 507  ? -18.088 -50.989 12.978  1.00 32.84  ? 1869 GLN A C      1 
ATOM   8278  O  O      . GLN A 1 507  ? -19.270 -50.678 12.850  1.00 33.02  ? 1869 GLN A O      1 
ATOM   8279  C  CB     . GLN A 1 507  ? -16.750 -49.774 14.721  1.00 32.19  ? 1869 GLN A CB     1 
ATOM   8280  C  CG     . GLN A 1 507  ? -16.982 -49.326 16.160  1.00 31.79  ? 1869 GLN A CG     1 
ATOM   8281  C  CD     . GLN A 1 507  ? -18.449 -49.059 16.462  1.00 37.80  ? 1869 GLN A CD     1 
ATOM   8282  O  OE1    . GLN A 1 507  ? -19.231 -48.746 15.563  1.00 41.43  ? 1869 GLN A OE1    1 
ATOM   8283  N  NE2    . GLN A 1 507  ? -18.834 -49.205 17.727  1.00 41.21  ? 1869 GLN A NE2    1 
ATOM   8284  H  H      . GLN A 1 507  ? -15.734 -51.988 14.657  1.00 38.55  ? 1869 GLN A H      1 
ATOM   8285  H  HA     . GLN A 1 507  ? -18.183 -51.209 15.005  1.00 38.72  ? 1869 GLN A HA     1 
ATOM   8286  H  HB2    . GLN A 1 507  ? -15.795 -49.893 14.596  1.00 38.63  ? 1869 GLN A HB2    1 
ATOM   8287  H  HB3    . GLN A 1 507  ? -17.074 -49.072 14.135  1.00 38.63  ? 1869 GLN A HB3    1 
ATOM   8288  H  HG2    . GLN A 1 507  ? -16.674 -50.023 16.761  1.00 38.15  ? 1869 GLN A HG2    1 
ATOM   8289  H  HG3    . GLN A 1 507  ? -16.488 -48.507 16.320  1.00 38.15  ? 1869 GLN A HG3    1 
ATOM   8290  H  HE21   . GLN A 1 507  ? -18.264 -49.441 18.326  1.00 49.45  ? 1869 GLN A HE21   1 
ATOM   8291  H  HE22   . GLN A 1 507  ? -19.654 -49.065 17.946  1.00 49.45  ? 1869 GLN A HE22   1 
ATOM   8292  N  N      . ASN A 1 508  ? -17.292 -51.230 11.941  1.00 35.92  ? 1870 ASN A N      1 
ATOM   8293  C  CA     . ASN A 1 508  ? -17.813 -51.256 10.580  1.00 36.55  ? 1870 ASN A CA     1 
ATOM   8294  C  C      . ASN A 1 508  ? -18.858 -52.350 10.429  1.00 36.67  ? 1870 ASN A C      1 
ATOM   8295  O  O      . ASN A 1 508  ? -19.941 -52.121 9.902   1.00 37.03  ? 1870 ASN A O      1 
ATOM   8296  C  CB     . ASN A 1 508  ? -16.694 -51.473 9.569   1.00 36.94  ? 1870 ASN A CB     1 
ATOM   8297  C  CG     . ASN A 1 508  ? -16.929 -50.731 8.284   1.00 40.61  ? 1870 ASN A CG     1 
ATOM   8298  O  OD1    . ASN A 1 508  ? -17.632 -51.203 7.389   1.00 45.01  ? 1870 ASN A OD1    1 
ATOM   8299  N  ND2    . ASN A 1 508  ? -16.327 -49.547 8.182   1.00 39.20  ? 1870 ASN A ND2    1 
ATOM   8300  H  H      . ASN A 1 508  ? -16.448 -51.382 11.999  1.00 43.10  ? 1870 ASN A H      1 
ATOM   8301  H  HA     . ASN A 1 508  ? -18.236 -50.405 10.385  1.00 43.86  ? 1870 ASN A HA     1 
ATOM   8302  H  HB2    . ASN A 1 508  ? -15.859 -51.160 9.949   1.00 44.33  ? 1870 ASN A HB2    1 
ATOM   8303  H  HB3    . ASN A 1 508  ? -16.633 -52.419 9.363   1.00 44.33  ? 1870 ASN A HB3    1 
ATOM   8304  H  HD21   . ASN A 1 508  ? -16.424 -49.075 7.469   1.00 47.04  ? 1870 ASN A HD21   1 
ATOM   8305  H  HD22   . ASN A 1 508  ? -15.841 -49.254 8.828   1.00 47.04  ? 1870 ASN A HD22   1 
ATOM   8306  N  N      . GLY A 1 509  ? -18.513 -53.545 10.895  1.00 24.55  ? 1871 GLY A N      1 
ATOM   8307  C  CA     . GLY A 1 509  ? -19.408 -54.686 10.840  1.00 24.70  ? 1871 GLY A CA     1 
ATOM   8308  C  C      . GLY A 1 509  ? -20.706 -54.470 11.597  1.00 24.53  ? 1871 GLY A C      1 
ATOM   8309  O  O      . GLY A 1 509  ? -21.730 -55.057 11.255  1.00 24.84  ? 1871 GLY A O      1 
ATOM   8310  H  H      . GLY A 1 509  ? -17.751 -53.720 11.253  1.00 29.47  ? 1871 GLY A H      1 
ATOM   8311  H  HA2    . GLY A 1 509  ? -19.624 -54.879 9.914   1.00 29.64  ? 1871 GLY A HA2    1 
ATOM   8312  H  HA3    . GLY A 1 509  ? -18.962 -55.460 11.217  1.00 29.64  ? 1871 GLY A HA3    1 
ATOM   8313  N  N      . LEU A 1 510  ? -20.671 -53.628 12.622  1.00 24.08  ? 1872 LEU A N      1 
ATOM   8314  C  CA     . LEU A 1 510  ? -21.864 -53.343 13.404  1.00 23.95  ? 1872 LEU A CA     1 
ATOM   8315  C  C      . LEU A 1 510  ? -22.783 -52.412 12.624  1.00 24.38  ? 1872 LEU A C      1 
ATOM   8316  O  O      . LEU A 1 510  ? -24.001 -52.574 12.638  1.00 24.58  ? 1872 LEU A O      1 
ATOM   8317  C  CB     . LEU A 1 510  ? -21.504 -52.716 14.749  1.00 23.42  ? 1872 LEU A CB     1 
ATOM   8318  C  CG     . LEU A 1 510  ? -20.806 -53.624 15.761  1.00 23.02  ? 1872 LEU A CG     1 
ATOM   8319  C  CD1    . LEU A 1 510  ? -20.382 -52.821 16.969  1.00 22.61  ? 1872 LEU A CD1    1 
ATOM   8320  C  CD2    . LEU A 1 510  ? -21.671 -54.784 16.178  1.00 23.08  ? 1872 LEU A CD2    1 
ATOM   8321  H  H      . LEU A 1 510  ? -19.968 -53.209 12.885  1.00 28.90  ? 1872 LEU A H      1 
ATOM   8322  H  HA     . LEU A 1 510  ? -22.342 -54.170 13.572  1.00 28.74  ? 1872 LEU A HA     1 
ATOM   8323  H  HB2    . LEU A 1 510  ? -20.915 -51.963 14.584  1.00 28.11  ? 1872 LEU A HB2    1 
ATOM   8324  H  HB3    . LEU A 1 510  ? -22.321 -52.398 15.164  1.00 28.11  ? 1872 LEU A HB3    1 
ATOM   8325  H  HG     . LEU A 1 510  ? -20.005 -53.986 15.352  1.00 27.62  ? 1872 LEU A HG     1 
ATOM   8326  H  HD11   . LEU A 1 510  ? -19.941 -53.411 17.601  1.00 27.13  ? 1872 LEU A HD11   1 
ATOM   8327  H  HD12   . LEU A 1 510  ? -19.771 -52.123 16.685  1.00 27.13  ? 1872 LEU A HD12   1 
ATOM   8328  H  HD13   . LEU A 1 510  ? -21.168 -52.426 17.377  1.00 27.13  ? 1872 LEU A HD13   1 
ATOM   8329  H  HD21   . LEU A 1 510  ? -21.184 -55.326 16.818  1.00 27.69  ? 1872 LEU A HD21   1 
ATOM   8330  H  HD22   . LEU A 1 510  ? -22.483 -54.441 16.584  1.00 27.69  ? 1872 LEU A HD22   1 
ATOM   8331  H  HD23   . LEU A 1 510  ? -21.890 -55.312 15.394  1.00 27.69  ? 1872 LEU A HD23   1 
ATOM   8332  N  N      . GLN A 1 511  ? -22.194 -51.428 11.952  1.00 36.82  ? 1873 GLN A N      1 
ATOM   8333  C  CA     . GLN A 1 511  ? -22.964 -50.461 11.176  1.00 37.31  ? 1873 GLN A CA     1 
ATOM   8334  C  C      . GLN A 1 511  ? -23.604 -51.149 9.968   1.00 37.92  ? 1873 GLN A C      1 
ATOM   8335  O  O      . GLN A 1 511  ? -24.759 -50.892 9.629   1.00 38.29  ? 1873 GLN A O      1 
ATOM   8336  C  CB     . GLN A 1 511  ? -22.079 -49.299 10.705  1.00 37.49  ? 1873 GLN A CB     1 
ATOM   8337  C  CG     . GLN A 1 511  ? -21.519 -48.393 11.806  1.00 37.36  ? 1873 GLN A CG     1 
ATOM   8338  C  CD     . GLN A 1 511  ? -20.518 -47.384 11.260  1.00 43.26  ? 1873 GLN A CD     1 
ATOM   8339  O  OE1    . GLN A 1 511  ? -20.610 -46.966 10.105  1.00 44.40  ? 1873 GLN A OE1    1 
ATOM   8340  N  NE2    . GLN A 1 511  ? -19.555 -46.989 12.087  1.00 46.36  ? 1873 GLN A NE2    1 
ATOM   8341  H  H      . GLN A 1 511  ? -21.345 -51.297 11.930  1.00 44.18  ? 1873 GLN A H      1 
ATOM   8342  H  HA     . GLN A 1 511  ? -23.673 -50.098 11.730  1.00 44.78  ? 1873 GLN A HA     1 
ATOM   8343  H  HB2    . GLN A 1 511  ? -21.323 -49.668 10.222  1.00 44.99  ? 1873 GLN A HB2    1 
ATOM   8344  H  HB3    . GLN A 1 511  ? -22.601 -48.741 10.108  1.00 44.99  ? 1873 GLN A HB3    1 
ATOM   8345  H  HG2    . GLN A 1 511  ? -22.249 -47.903 12.217  1.00 44.83  ? 1873 GLN A HG2    1 
ATOM   8346  H  HG3    . GLN A 1 511  ? -21.068 -48.939 12.469  1.00 44.83  ? 1873 GLN A HG3    1 
ATOM   8347  H  HE21   . GLN A 1 511  ? -19.521 -47.302 12.888  1.00 55.63  ? 1873 GLN A HE21   1 
ATOM   8348  H  HE22   . GLN A 1 511  ? -18.967 -46.420 11.822  1.00 55.63  ? 1873 GLN A HE22   1 
ATOM   8349  N  N      . VAL A 1 512  ? -22.828 -52.018 9.324   1.00 25.82  ? 1874 VAL A N      1 
ATOM   8350  C  CA     . VAL A 1 512  ? -23.248 -52.728 8.117   1.00 26.48  ? 1874 VAL A CA     1 
ATOM   8351  C  C      . VAL A 1 512  ? -24.307 -53.779 8.418   1.00 26.52  ? 1874 VAL A C      1 
ATOM   8352  O  O      . VAL A 1 512  ? -25.220 -54.000 7.619   1.00 27.11  ? 1874 VAL A O      1 
ATOM   8353  C  CB     . VAL A 1 512  ? -22.039 -53.417 7.434   1.00 26.66  ? 1874 VAL A CB     1 
ATOM   8354  C  CG1    . VAL A 1 512  ? -22.485 -54.470 6.407   1.00 27.31  ? 1874 VAL A CG1    1 
ATOM   8355  C  CG2    . VAL A 1 512  ? -21.124 -52.378 6.788   1.00 26.89  ? 1874 VAL A CG2    1 
ATOM   8356  H  H      . VAL A 1 512  ? -22.030 -52.218 9.574   1.00 30.99  ? 1874 VAL A H      1 
ATOM   8357  H  HA     . VAL A 1 512  ? -23.626 -52.091 7.490   1.00 31.78  ? 1874 VAL A HA     1 
ATOM   8358  H  HB     . VAL A 1 512  ? -21.523 -53.875 8.115   1.00 31.99  ? 1874 VAL A HB     1 
ATOM   8359  H  HG11   . VAL A 1 512  ? -21.699 -54.873 6.007   1.00 32.77  ? 1874 VAL A HG11   1 
ATOM   8360  H  HG12   . VAL A 1 512  ? -23.011 -55.148 6.860   1.00 32.77  ? 1874 VAL A HG12   1 
ATOM   8361  H  HG13   . VAL A 1 512  ? -23.020 -54.038 5.724   1.00 32.77  ? 1874 VAL A HG13   1 
ATOM   8362  H  HG21   . VAL A 1 512  ? -20.377 -52.833 6.368   1.00 32.27  ? 1874 VAL A HG21   1 
ATOM   8363  H  HG22   . VAL A 1 512  ? -21.627 -51.885 6.122   1.00 32.27  ? 1874 VAL A HG22   1 
ATOM   8364  H  HG23   . VAL A 1 512  ? -20.800 -51.773 7.474   1.00 32.27  ? 1874 VAL A HG23   1 
ATOM   8365  N  N      . GLY A 1 513  ? -24.172 -54.430 9.570   1.00 39.25  ? 1875 GLY A N      1 
ATOM   8366  C  CA     . GLY A 1 513  ? -25.042 -55.538 9.927   1.00 39.32  ? 1875 GLY A CA     1 
ATOM   8367  C  C      . GLY A 1 513  ? -24.460 -56.903 9.605   1.00 39.49  ? 1875 GLY A C      1 
ATOM   8368  O  O      . GLY A 1 513  ? -25.210 -57.862 9.443   1.00 40.72  ? 1875 GLY A O      1 
ATOM   8369  H  H      . GLY A 1 513  ? -23.579 -54.245 10.165  1.00 47.10  ? 1875 GLY A H      1 
ATOM   8370  H  HA2    . GLY A 1 513  ? -25.225 -55.504 10.879  1.00 47.18  ? 1875 GLY A HA2    1 
ATOM   8371  H  HA3    . GLY A 1 513  ? -25.883 -55.448 9.453   1.00 47.18  ? 1875 GLY A HA3    1 
ATOM   8372  N  N      . LYS A 1 514  ? -23.134 -57.008 9.518   1.00 29.61  ? 1876 LYS A N      1 
ATOM   8373  C  CA     . LYS A 1 514  ? -22.510 -58.288 9.191   1.00 29.84  ? 1876 LYS A CA     1 
ATOM   8374  C  C      . LYS A 1 514  ? -22.723 -59.286 10.326  1.00 29.52  ? 1876 LYS A C      1 
ATOM   8375  O  O      . LYS A 1 514  ? -22.653 -58.936 11.503  1.00 28.95  ? 1876 LYS A O      1 
ATOM   8376  C  CB     . LYS A 1 514  ? -21.005 -58.130 8.898   1.00 29.73  ? 1876 LYS A CB     1 
ATOM   8377  C  CG     . LYS A 1 514  ? -20.678 -57.611 7.478   1.00 30.33  ? 1876 LYS A CG     1 
ATOM   8378  C  CD     . LYS A 1 514  ? -19.216 -57.871 7.023   1.00 45.43  ? 1876 LYS A CD     1 
ATOM   8379  C  CE     . LYS A 1 514  ? -18.147 -57.057 7.765   1.00 44.76  ? 1876 LYS A CE     1 
ATOM   8380  N  NZ     . LYS A 1 514  ? -18.241 -55.574 7.603   1.00 44.18  1 1876 LYS A NZ     1 
ATOM   8381  H  H      . LYS A 1 514  ? -22.581 -56.361 9.642   1.00 35.53  ? 1876 LYS A H      1 
ATOM   8382  H  HA     . LYS A 1 514  ? -22.932 -58.647 8.395   1.00 35.80  ? 1876 LYS A HA     1 
ATOM   8383  H  HB2    . LYS A 1 514  ? -20.628 -57.502 9.534   1.00 35.67  ? 1876 LYS A HB2    1 
ATOM   8384  H  HB3    . LYS A 1 514  ? -20.577 -58.995 9.001   1.00 35.67  ? 1876 LYS A HB3    1 
ATOM   8385  H  HG2    . LYS A 1 514  ? -21.267 -58.050 6.844   1.00 36.40  ? 1876 LYS A HG2    1 
ATOM   8386  H  HG3    . LYS A 1 514  ? -20.828 -56.653 7.455   1.00 36.40  ? 1876 LYS A HG3    1 
ATOM   8387  H  HD2    . LYS A 1 514  ? -19.013 -58.810 7.158   1.00 54.52  ? 1876 LYS A HD2    1 
ATOM   8388  H  HD3    . LYS A 1 514  ? -19.144 -57.657 6.079   1.00 54.52  ? 1876 LYS A HD3    1 
ATOM   8389  H  HE2    . LYS A 1 514  ? -18.217 -57.251 8.712   1.00 53.72  ? 1876 LYS A HE2    1 
ATOM   8390  H  HE3    . LYS A 1 514  ? -17.274 -57.330 7.442   1.00 53.72  ? 1876 LYS A HE3    1 
ATOM   8391  H  HZ1    . LYS A 1 514  ? -17.589 -55.177 8.061   1.00 53.01  ? 1876 LYS A HZ1    1 
ATOM   8392  H  HZ2    . LYS A 1 514  ? -18.163 -55.356 6.743   1.00 53.01  ? 1876 LYS A HZ2    1 
ATOM   8393  H  HZ3    . LYS A 1 514  ? -19.026 -55.284 7.905   1.00 53.01  ? 1876 LYS A HZ3    1 
ATOM   8394  N  N      . SER A 1 515  ? -23.007 -60.529 9.944   1.00 26.40  ? 1877 SER A N      1 
ATOM   8395  C  CA     . SER A 1 515  ? -23.202 -61.621 10.888  1.00 26.28  ? 1877 SER A CA     1 
ATOM   8396  C  C      . SER A 1 515  ? -21.858 -62.137 11.387  1.00 25.98  ? 1877 SER A C      1 
ATOM   8397  O  O      . SER A 1 515  ? -21.696 -62.460 12.564  1.00 25.58  ? 1877 SER A O      1 
ATOM   8398  C  CB     . SER A 1 515  ? -23.989 -62.748 10.217  1.00 30.07  ? 1877 SER A CB     1 
ATOM   8399  O  OG     . SER A 1 515  ? -24.121 -63.870 11.071  1.00 33.01  ? 1877 SER A OG     1 
ATOM   8400  H  H      . SER A 1 515  ? -23.093 -60.768 9.122   1.00 31.68  ? 1877 SER A H      1 
ATOM   8401  H  HA     . SER A 1 515  ? -23.710 -61.303 11.650  1.00 31.54  ? 1877 SER A HA     1 
ATOM   8402  H  HB2    . SER A 1 515  ? -24.873 -62.420 9.991   1.00 36.09  ? 1877 SER A HB2    1 
ATOM   8403  H  HB3    . SER A 1 515  ? -23.522 -63.020 9.412   1.00 36.09  ? 1877 SER A HB3    1 
ATOM   8404  H  HG     . SER A 1 515  ? -23.362 -64.167 11.275  1.00 39.61  ? 1877 SER A HG     1 
ATOM   8405  N  N      . HIS A 1 516  ? -20.897 -62.192 10.470  1.00 54.97  ? 1878 HIS A N      1 
ATOM   8406  C  CA     . HIS A 1 516  ? -19.517 -62.554 10.777  1.00 54.98  ? 1878 HIS A CA     1 
ATOM   8407  C  C      . HIS A 1 516  ? -18.615 -61.450 10.238  1.00 54.61  ? 1878 HIS A C      1 
ATOM   8408  O  O      . HIS A 1 516  ? -18.934 -60.825 9.226   1.00 55.48  ? 1878 HIS A O      1 
ATOM   8409  C  CB     . HIS A 1 516  ? -19.121 -63.907 10.167  1.00 57.31  ? 1878 HIS A CB     1 
ATOM   8410  C  CG     . HIS A 1 516  ? -19.967 -65.059 10.615  1.00 60.47  ? 1878 HIS A CG     1 
ATOM   8411  N  ND1    . HIS A 1 516  ? -21.297 -65.189 10.279  1.00 62.52  ? 1878 HIS A ND1    1 
ATOM   8412  C  CD2    . HIS A 1 516  ? -19.659 -66.148 11.360  1.00 60.42  ? 1878 HIS A CD2    1 
ATOM   8413  C  CE1    . HIS A 1 516  ? -21.776 -66.303 10.806  1.00 60.40  ? 1878 HIS A CE1    1 
ATOM   8414  N  NE2    . HIS A 1 516  ? -20.802 -66.903 11.467  1.00 59.39  ? 1878 HIS A NE2    1 
ATOM   8415  H  H      . HIS A 1 516  ? -21.024 -62.019 9.638   1.00 65.96  ? 1878 HIS A H      1 
ATOM   8416  H  HA     . HIS A 1 516  ? -19.401 -62.604 11.738  1.00 65.97  ? 1878 HIS A HA     1 
ATOM   8417  H  HB2    . HIS A 1 516  ? -19.194 -63.845 9.202   1.00 68.78  ? 1878 HIS A HB2    1 
ATOM   8418  H  HB3    . HIS A 1 516  ? -18.203 -64.102 10.413  1.00 68.78  ? 1878 HIS A HB3    1 
ATOM   8419  H  HD2    . HIS A 1 516  ? -18.831 -66.344 11.734  1.00 72.50  ? 1878 HIS A HD2    1 
ATOM   8420  H  HE1    . HIS A 1 516  ? -22.649 -66.612 10.726  1.00 72.48  ? 1878 HIS A HE1    1 
ATOM   8421  H  HE2    . HIS A 1 516  ? -20.872 -67.646 11.895  1.00 71.27  ? 1878 HIS A HE2    1 
ATOM   8422  N  N      . ILE A 1 517  ? -17.492 -61.214 10.908  1.00 32.15  ? 1879 ILE A N      1 
ATOM   8423  C  CA     . ILE A 1 517  ? -16.510 -60.243 10.438  1.00 32.06  ? 1879 ILE A CA     1 
ATOM   8424  C  C      . ILE A 1 517  ? -15.134 -60.885 10.401  1.00 32.12  ? 1879 ILE A C      1 
ATOM   8425  O  O      . ILE A 1 517  ? -14.959 -62.007 10.874  1.00 32.16  ? 1879 ILE A O      1 
ATOM   8426  C  CB     . ILE A 1 517  ? -16.480 -58.986 11.336  1.00 31.44  ? 1879 ILE A CB     1 
ATOM   8427  C  CG1    . ILE A 1 517  ? -15.986 -59.338 12.744  1.00 30.90  ? 1879 ILE A CG1    1 
ATOM   8428  C  CG2    . ILE A 1 517  ? -17.864 -58.360 11.402  1.00 31.43  ? 1879 ILE A CG2    1 
ATOM   8429  C  CD1    . ILE A 1 517  ? -15.999 -58.172 13.725  1.00 30.35  ? 1879 ILE A CD1    1 
ATOM   8430  H  H      . ILE A 1 517  ? -17.274 -61.606 11.642  1.00 38.58  ? 1879 ILE A H      1 
ATOM   8431  H  HA     . ILE A 1 517  ? -16.741 -59.967 9.537   1.00 38.47  ? 1879 ILE A HA     1 
ATOM   8432  H  HB     . ILE A 1 517  ? -15.868 -58.342 10.946  1.00 37.73  ? 1879 ILE A HB     1 
ATOM   8433  H  HG12   . ILE A 1 517  ? -16.555 -60.034 13.107  1.00 37.08  ? 1879 ILE A HG12   1 
ATOM   8434  H  HG13   . ILE A 1 517  ? -15.074 -59.660 12.682  1.00 37.08  ? 1879 ILE A HG13   1 
ATOM   8435  H  HG21   . ILE A 1 517  ? -17.827 -57.573 11.969  1.00 37.72  ? 1879 ILE A HG21   1 
ATOM   8436  H  HG22   . ILE A 1 517  ? -18.141 -58.111 10.507  1.00 37.72  ? 1879 ILE A HG22   1 
ATOM   8437  H  HG23   . ILE A 1 517  ? -18.485 -59.006 11.773  1.00 37.72  ? 1879 ILE A HG23   1 
ATOM   8438  H  HD11   . ILE A 1 517  ? -15.675 -58.480 14.586  1.00 36.42  ? 1879 ILE A HD11   1 
ATOM   8439  H  HD12   . ILE A 1 517  ? -15.424 -57.468 13.387  1.00 36.42  ? 1879 ILE A HD12   1 
ATOM   8440  H  HD13   . ILE A 1 517  ? -16.908 -57.843 13.813  1.00 36.42  ? 1879 ILE A HD13   1 
ATOM   8441  N  N      . THR A 1 518  ? -14.170 -60.179 9.817   1.00 41.93  ? 1880 THR A N      1 
ATOM   8442  C  CA     . THR A 1 518  ? -12.789 -60.657 9.744   1.00 47.46  ? 1880 THR A CA     1 
ATOM   8443  C  C      . THR A 1 518  ? -11.819 -59.625 10.288  1.00 40.74  ? 1880 THR A C      1 
ATOM   8444  O  O      . THR A 1 518  ? -11.896 -58.446 9.949   1.00 45.53  ? 1880 THR A O      1 
ATOM   8445  C  CB     . THR A 1 518  ? -12.397 -61.008 8.310   1.00 41.31  ? 1880 THR A CB     1 
ATOM   8446  O  OG1    . THR A 1 518  ? -12.510 -59.846 7.480   1.00 41.04  ? 1880 THR A OG1    1 
ATOM   8447  C  CG2    . THR A 1 518  ? -13.308 -62.096 7.772   1.00 41.59  ? 1880 THR A CG2    1 
ATOM   8448  H  H      . THR A 1 518  ? -14.290 -59.411 9.450   1.00 50.32  ? 1880 THR A H      1 
ATOM   8449  H  HA     . THR A 1 518  ? -12.706 -61.460 10.282  1.00 56.95  ? 1880 THR A HA     1 
ATOM   8450  H  HB     . THR A 1 518  ? -11.484 -61.333 8.292   1.00 49.57  ? 1880 THR A HB     1 
ATOM   8451  H  HG1    . THR A 1 518  ? -13.302 -59.563 7.488   1.00 49.25  ? 1880 THR A HG1    1 
ATOM   8452  H  HG21   . THR A 1 518  ? -13.057 -62.317 6.862   1.00 49.91  ? 1880 THR A HG21   1 
ATOM   8453  H  HG22   . THR A 1 518  ? -13.234 -62.891 8.322   1.00 49.91  ? 1880 THR A HG22   1 
ATOM   8454  H  HG23   . THR A 1 518  ? -14.229 -61.791 7.781   1.00 49.91  ? 1880 THR A HG23   1 
ATOM   8455  N  N      . LEU A 1 519  ? -10.928 -60.079 11.158  1.00 24.77  ? 1881 LEU A N      1 
ATOM   8456  C  CA     . LEU A 1 519  ? -9.971  -59.202 11.812  1.00 30.83  ? 1881 LEU A CA     1 
ATOM   8457  C  C      . LEU A 1 519  ? -8.641  -59.912 12.072  1.00 24.42  ? 1881 LEU A C      1 
ATOM   8458  O  O      . LEU A 1 519  ? -8.615  -61.127 12.192  1.00 27.64  ? 1881 LEU A O      1 
ATOM   8459  C  CB     . LEU A 1 519  ? -10.581 -58.670 13.109  1.00 35.38  ? 1881 LEU A CB     1 
ATOM   8460  C  CG     . LEU A 1 519  ? -11.085 -59.699 14.120  1.00 23.54  ? 1881 LEU A CG     1 
ATOM   8461  C  CD1    . LEU A 1 519  ? -9.964  -60.112 15.060  1.00 23.31  ? 1881 LEU A CD1    1 
ATOM   8462  C  CD2    . LEU A 1 519  ? -12.265 -59.147 14.896  1.00 23.19  ? 1881 LEU A CD2    1 
ATOM   8463  H  H      . LEU A 1 519  ? -10.857 -60.904 11.390  1.00 29.72  ? 1881 LEU A H      1 
ATOM   8464  H  HA     . LEU A 1 519  ? -9.794  -58.444 11.233  1.00 37.00  ? 1881 LEU A HA     1 
ATOM   8465  H  HB2    . LEU A 1 519  ? -9.909  -58.134 13.559  1.00 42.46  ? 1881 LEU A HB2    1 
ATOM   8466  H  HB3    . LEU A 1 519  ? -11.335 -58.106 12.876  1.00 42.46  ? 1881 LEU A HB3    1 
ATOM   8467  H  HG     . LEU A 1 519  ? -11.383 -60.490 13.644  1.00 28.25  ? 1881 LEU A HG     1 
ATOM   8468  H  HD11   . LEU A 1 519  ? -10.306 -60.764 15.691  1.00 27.98  ? 1881 LEU A HD11   1 
ATOM   8469  H  HD12   . LEU A 1 519  ? -9.244  -60.501 14.539  1.00 27.98  ? 1881 LEU A HD12   1 
ATOM   8470  H  HD13   . LEU A 1 519  ? -9.644  -59.328 15.533  1.00 27.98  ? 1881 LEU A HD13   1 
ATOM   8471  H  HD21   . LEU A 1 519  ? -12.567 -59.816 15.530  1.00 27.82  ? 1881 LEU A HD21   1 
ATOM   8472  H  HD22   . LEU A 1 519  ? -11.986 -58.346 15.367  1.00 27.82  ? 1881 LEU A HD22   1 
ATOM   8473  H  HD23   . LEU A 1 519  ? -12.979 -58.933 14.275  1.00 27.82  ? 1881 LEU A HD23   1 
ATOM   8474  N  N      . LEU A 1 520  ? -7.540  -59.161 12.105  1.00 50.10  ? 1882 LEU A N      1 
ATOM   8475  C  CA     . LEU A 1 520  ? -6.257  -59.639 12.647  1.00 51.11  ? 1882 LEU A CA     1 
ATOM   8476  C  C      . LEU A 1 520  ? -5.776  -60.947 12.081  1.00 50.61  ? 1882 LEU A C      1 
ATOM   8477  O  O      . LEU A 1 520  ? -4.787  -61.451 12.574  1.00 49.10  ? 1882 LEU A O      1 
ATOM   8478  C  CB     . LEU A 1 520  ? -6.380  -59.826 14.184  1.00 119.31 ? 1882 LEU A CB     1 
ATOM   8479  C  CG     . LEU A 1 520  ? -5.383  -60.506 15.170  1.00 53.42  ? 1882 LEU A CG     1 
ATOM   8480  C  CD1    . LEU A 1 520  ? -5.830  -60.146 16.581  1.00 52.99  ? 1882 LEU A CD1    1 
ATOM   8481  C  CD2    . LEU A 1 520  ? -5.220  -62.070 15.212  1.00 53.76  ? 1882 LEU A CD2    1 
ATOM   8482  H  H      . LEU A 1 520  ? -7.507  -58.352 11.815  1.00 60.12  ? 1882 LEU A H      1 
ATOM   8483  H  HA     . LEU A 1 520  ? -5.575  -58.971 12.479  1.00 61.33  ? 1882 LEU A HA     1 
ATOM   8484  H  HB2    . LEU A 1 520  ? -6.498  -58.932 14.541  1.00 143.17 ? 1882 LEU A HB2    1 
ATOM   8485  H  HB3    . LEU A 1 520  ? -7.213  -60.304 14.318  1.00 143.17 ? 1882 LEU A HB3    1 
ATOM   8486  H  HG     . LEU A 1 520  ? -4.502  -60.123 15.033  1.00 64.11  ? 1882 LEU A HG     1 
ATOM   8487  H  HD11   . LEU A 1 520  ? -5.225  -60.558 17.217  1.00 63.59  ? 1882 LEU A HD11   1 
ATOM   8488  H  HD12   . LEU A 1 520  ? -5.811  -59.182 16.681  1.00 63.59  ? 1882 LEU A HD12   1 
ATOM   8489  H  HD13   . LEU A 1 520  ? -6.731  -60.476 16.719  1.00 63.59  ? 1882 LEU A HD13   1 
ATOM   8490  H  HD21   . LEU A 1 520  ? -4.559  -62.301 15.884  1.00 64.51  ? 1882 LEU A HD21   1 
ATOM   8491  H  HD22   . LEU A 1 520  ? -6.075  -62.470 15.437  1.00 64.51  ? 1882 LEU A HD22   1 
ATOM   8492  H  HD23   . LEU A 1 520  ? -4.929  -62.381 14.340  1.00 64.51  ? 1882 LEU A HD23   1 
ATOM   8493  N  N      . GLU A 1 521  ? -6.320  -61.405 10.960  1.00 112.74 ? 1883 GLU A N      1 
ATOM   8494  C  CA     . GLU A 1 521  ? -6.030  -62.774 10.546  1.00 115.27 ? 1883 GLU A CA     1 
ATOM   8495  C  C      . GLU A 1 521  ? -6.620  -63.739 11.614  1.00 114.73 ? 1883 GLU A C      1 
ATOM   8496  O  O      . GLU A 1 521  ? -5.993  -64.721 12.021  1.00 114.70 ? 1883 GLU A O      1 
ATOM   8497  C  CB     . GLU A 1 521  ? -4.513  -62.971 10.296  1.00 116.88 ? 1883 GLU A CB     1 
ATOM   8498  C  CG     . GLU A 1 521  ? -4.097  -62.222 9.035   1.00 118.06 ? 1883 GLU A CG     1 
ATOM   8499  C  CD     . GLU A 1 521  ? -2.630  -62.374 8.706   1.00 118.79 ? 1883 GLU A CD     1 
ATOM   8500  O  OE1    . GLU A 1 521  ? -1.904  -63.016 9.492   1.00 118.61 ? 1883 GLU A OE1    1 
ATOM   8501  O  OE2    . GLU A 1 521  ? -2.209  -61.853 7.655   1.00 119.48 1 1883 GLU A OE2    1 
ATOM   8502  H  H      . GLU A 1 521  ? -6.841  -60.963 10.438  1.00 135.29 ? 1883 GLU A H      1 
ATOM   8503  H  HA     . GLU A 1 521  ? -6.489  -62.947 9.709   1.00 138.32 ? 1883 GLU A HA     1 
ATOM   8504  H  HB2    . GLU A 1 521  ? -4.010  -62.616 11.046  1.00 140.26 ? 1883 GLU A HB2    1 
ATOM   8505  H  HB3    . GLU A 1 521  ? -4.323  -63.914 10.173  1.00 140.26 ? 1883 GLU A HB3    1 
ATOM   8506  H  HG2    . GLU A 1 521  ? -4.608  -62.564 8.284   1.00 141.67 ? 1883 GLU A HG2    1 
ATOM   8507  H  HG3    . GLU A 1 521  ? -4.280  -61.277 9.155   1.00 141.67 ? 1883 GLU A HG3    1 
ATOM   8508  N  N      . GLU A 1 522  ? -7.830  -63.393 12.073  1.00 80.66  ? 1884 GLU A N      1 
ATOM   8509  C  CA     . GLU A 1 522  ? -8.751  -64.277 12.814  1.00 75.19  ? 1884 GLU A CA     1 
ATOM   8510  C  C      . GLU A 1 522  ? -10.220 -64.031 12.417  1.00 73.60  ? 1884 GLU A C      1 
ATOM   8511  O  O      . GLU A 1 522  ? -10.686 -62.895 12.481  1.00 79.65  ? 1884 GLU A O      1 
ATOM   8512  C  CB     . GLU A 1 522  ? -8.605  -64.056 14.323  1.00 72.63  ? 1884 GLU A CB     1 
ATOM   8513  C  CG     . GLU A 1 522  ? -9.695  -64.724 15.160  1.00 73.65  ? 1884 GLU A CG     1 
ATOM   8514  C  CD     . GLU A 1 522  ? -9.173  -65.358 16.435  1.00 75.26  ? 1884 GLU A CD     1 
ATOM   8515  O  OE1    . GLU A 1 522  ? -8.177  -64.855 16.996  1.00 76.42  ? 1884 GLU A OE1    1 
ATOM   8516  O  OE2    . GLU A 1 522  ? -9.769  -66.363 16.879  1.00 78.39  1 1884 GLU A OE2    1 
ATOM   8517  H  H      . GLU A 1 522  ? -8.158  -62.606 11.961  1.00 96.79  ? 1884 GLU A H      1 
ATOM   8518  H  HA     . GLU A 1 522  ? -8.534  -65.202 12.619  1.00 90.23  ? 1884 GLU A HA     1 
ATOM   8519  H  HB2    . GLU A 1 522  ? -7.750  -64.415 14.609  1.00 87.15  ? 1884 GLU A HB2    1 
ATOM   8520  H  HB3    . GLU A 1 522  ? -8.636  -63.103 14.503  1.00 87.15  ? 1884 GLU A HB3    1 
ATOM   8521  H  HG2    . GLU A 1 522  ? -10.354 -64.057 15.407  1.00 88.38  ? 1884 GLU A HG2    1 
ATOM   8522  H  HG3    . GLU A 1 522  ? -10.113 -65.421 14.631  1.00 88.38  ? 1884 GLU A HG3    1 
ATOM   8523  N  N      . GLU A 1 523  ? -10.953 -65.070 12.012  1.00 63.13  ? 1885 GLU A N      1 
ATOM   8524  C  CA     . GLU A 1 523  ? -12.385 -64.906 11.700  1.00 63.01  ? 1885 GLU A CA     1 
ATOM   8525  C  C      . GLU A 1 523  ? -13.318 -65.223 12.874  1.00 60.98  ? 1885 GLU A C      1 
ATOM   8526  O  O      . GLU A 1 523  ? -13.200 -66.272 13.510  1.00 64.83  ? 1885 GLU A O      1 
ATOM   8527  C  CB     . GLU A 1 523  ? -12.775 -65.755 10.487  1.00 65.84  ? 1885 GLU A CB     1 
ATOM   8528  C  CG     . GLU A 1 523  ? -14.272 -65.627 10.143  1.00 72.22  ? 1885 GLU A CG     1 
ATOM   8529  C  CD     . GLU A 1 523  ? -14.573 -65.600 8.645   1.00 75.59  ? 1885 GLU A CD     1 
ATOM   8530  O  OE1    . GLU A 1 523  ? -13.621 -65.567 7.830   1.00 76.44  ? 1885 GLU A OE1    1 
ATOM   8531  O  OE2    . GLU A 1 523  ? -15.778 -65.572 8.293   1.00 76.21  1 1885 GLU A OE2    1 
ATOM   8532  H  H      . GLU A 1 523  ? -10.656 -65.871 11.909  1.00 75.76  ? 1885 GLU A H      1 
ATOM   8533  H  HA     . GLU A 1 523  ? -12.535 -63.978 11.459  1.00 75.62  ? 1885 GLU A HA     1 
ATOM   8534  H  HB2    . GLU A 1 523  ? -12.262 -65.464 9.717   1.00 79.01  ? 1885 GLU A HB2    1 
ATOM   8535  H  HB3    . GLU A 1 523  ? -12.589 -66.688 10.679  1.00 79.01  ? 1885 GLU A HB3    1 
ATOM   8536  H  HG2    . GLU A 1 523  ? -14.745 -66.382 10.525  1.00 86.66  ? 1885 GLU A HG2    1 
ATOM   8537  H  HG3    . GLU A 1 523  ? -14.609 -64.802 10.526  1.00 86.66  ? 1885 GLU A HG3    1 
ATOM   8538  N  N      . THR A 1 524  ? -14.234 -64.294 13.161  1.00 36.36  ? 1886 THR A N      1 
ATOM   8539  C  CA     . THR A 1 524  ? -15.208 -64.472 14.244  1.00 37.67  ? 1886 THR A CA     1 
ATOM   8540  C  C      . THR A 1 524  ? -16.614 -63.977 13.889  1.00 44.94  ? 1886 THR A C      1 
ATOM   8541  O  O      . THR A 1 524  ? -16.771 -63.090 13.048  1.00 49.35  ? 1886 THR A O      1 
ATOM   8542  C  CB     . THR A 1 524  ? -14.769 -63.747 15.527  1.00 35.44  ? 1886 THR A CB     1 
ATOM   8543  O  OG1    . THR A 1 524  ? -14.909 -62.333 15.367  1.00 35.09  ? 1886 THR A OG1    1 
ATOM   8544  C  CG2    . THR A 1 524  ? -13.332 -64.089 15.846  1.00 35.37  ? 1886 THR A CG2    1 
ATOM   8545  H  H      . THR A 1 524  ? -14.313 -63.548 12.740  1.00 43.63  ? 1886 THR A H      1 
ATOM   8546  H  HA     . THR A 1 524  ? -15.274 -65.418 14.448  1.00 45.20  ? 1886 THR A HA     1 
ATOM   8547  H  HB     . THR A 1 524  ? -15.322 -64.042 16.267  1.00 42.53  ? 1886 THR A HB     1 
ATOM   8548  H  HG1    . THR A 1 524  ? -14.668 -61.939 16.069  1.00 42.11  ? 1886 THR A HG1    1 
ATOM   8549  H  HG21   . THR A 1 524  ? -13.054 -63.633 16.655  1.00 42.45  ? 1886 THR A HG21   1 
ATOM   8550  H  HG22   . THR A 1 524  ? -13.240 -65.046 15.976  1.00 42.45  ? 1886 THR A HG22   1 
ATOM   8551  H  HG23   . THR A 1 524  ? -12.756 -63.815 15.115  1.00 42.45  ? 1886 THR A HG23   1 
ATOM   8552  N  N      . PRO A 1 525  ? -17.642 -64.548 14.543  1.00 24.98  ? 1887 PRO A N      1 
ATOM   8553  C  CA     . PRO A 1 525  ? -19.013 -64.046 14.450  1.00 25.01  ? 1887 PRO A CA     1 
ATOM   8554  C  C      . PRO A 1 525  ? -19.161 -62.768 15.259  1.00 24.39  ? 1887 PRO A C      1 
ATOM   8555  O  O      . PRO A 1 525  ? -18.280 -62.471 16.070  1.00 23.97  ? 1887 PRO A O      1 
ATOM   8556  C  CB     . PRO A 1 525  ? -19.836 -65.176 15.056  1.00 25.32  ? 1887 PRO A CB     1 
ATOM   8557  C  CG     . PRO A 1 525  ? -18.940 -65.723 16.077  1.00 25.10  ? 1887 PRO A CG     1 
ATOM   8558  C  CD     . PRO A 1 525  ? -17.566 -65.692 15.466  1.00 25.09  ? 1887 PRO A CD     1 
ATOM   8559  H  HA     . PRO A 1 525  ? -19.273 -63.896 13.528  1.00 30.01  ? 1887 PRO A HA     1 
ATOM   8560  H  HB2    . PRO A 1 525  ? -20.645 -64.821 15.455  1.00 30.38  ? 1887 PRO A HB2    1 
ATOM   8561  H  HB3    . PRO A 1 525  ? -20.040 -65.839 14.379  1.00 30.38  ? 1887 PRO A HB3    1 
ATOM   8562  H  HG2    . PRO A 1 525  ? -18.974 -65.168 16.872  1.00 30.12  ? 1887 PRO A HG2    1 
ATOM   8563  H  HG3    . PRO A 1 525  ? -19.201 -66.634 16.285  1.00 30.12  ? 1887 PRO A HG3    1 
ATOM   8564  H  HD2    . PRO A 1 525  ? -16.895 -65.534 16.148  1.00 30.11  ? 1887 PRO A HD2    1 
ATOM   8565  H  HD3    . PRO A 1 525  ? -17.393 -66.512 14.977  1.00 30.11  ? 1887 PRO A HD3    1 
ATOM   8566  N  N      . LEU A 1 526  ? -20.248 -62.034 15.043  1.00 24.40  ? 1888 LEU A N      1 
ATOM   8567  C  CA     . LEU A 1 526  ? -20.429 -60.735 15.678  1.00 23.92  ? 1888 LEU A CA     1 
ATOM   8568  C  C      . LEU A 1 526  ? -21.841 -60.533 16.206  1.00 23.94  ? 1888 LEU A C      1 
ATOM   8569  O  O      . LEU A 1 526  ? -22.806 -60.558 15.447  1.00 24.33  ? 1888 LEU A O      1 
ATOM   8570  C  CB     . LEU A 1 526  ? -20.088 -59.632 14.684  1.00 23.93  ? 1888 LEU A CB     1 
ATOM   8571  C  CG     . LEU A 1 526  ? -20.417 -58.208 15.114  1.00 23.59  ? 1888 LEU A CG     1 
ATOM   8572  C  CD1    . LEU A 1 526  ? -19.525 -57.828 16.278  1.00 23.07  ? 1888 LEU A CD1    1 
ATOM   8573  C  CD2    . LEU A 1 526  ? -20.244 -57.271 13.934  1.00 23.82  ? 1888 LEU A CD2    1 
ATOM   8574  H  H      . LEU A 1 526  ? -20.898 -62.268 14.531  1.00 29.28  ? 1888 LEU A H      1 
ATOM   8575  H  HA     . LEU A 1 526  ? -19.817 -60.662 16.427  1.00 28.70  ? 1888 LEU A HA     1 
ATOM   8576  H  HB2    . LEU A 1 526  ? -19.135 -59.667 14.507  1.00 28.72  ? 1888 LEU A HB2    1 
ATOM   8577  H  HB3    . LEU A 1 526  ? -20.574 -59.804 13.861  1.00 28.72  ? 1888 LEU A HB3    1 
ATOM   8578  H  HG     . LEU A 1 526  ? -21.340 -58.164 15.408  1.00 28.31  ? 1888 LEU A HG     1 
ATOM   8579  H  HD11   . LEU A 1 526  ? -19.734 -56.921 16.553  1.00 27.69  ? 1888 LEU A HD11   1 
ATOM   8580  H  HD12   . LEU A 1 526  ? -19.686 -58.441 17.012  1.00 27.69  ? 1888 LEU A HD12   1 
ATOM   8581  H  HD13   . LEU A 1 526  ? -18.598 -57.883 15.997  1.00 27.69  ? 1888 LEU A HD13   1 
ATOM   8582  H  HD21   . LEU A 1 526  ? -20.455 -56.367 14.216  1.00 28.58  ? 1888 LEU A HD21   1 
ATOM   8583  H  HD22   . LEU A 1 526  ? -19.325 -57.317 13.628  1.00 28.58  ? 1888 LEU A HD22   1 
ATOM   8584  H  HD23   . LEU A 1 526  ? -20.844 -57.545 13.223  1.00 28.58  ? 1888 LEU A HD23   1 
ATOM   8585  N  N      . SER A 1 527  ? -21.949 -60.314 17.513  1.00 31.32  ? 1889 SER A N      1 
ATOM   8586  C  CA     . SER A 1 527  ? -23.236 -60.019 18.129  1.00 31.35  ? 1889 SER A CA     1 
ATOM   8587  C  C      . SER A 1 527  ? -23.660 -58.594 17.793  1.00 31.22  ? 1889 SER A C      1 
ATOM   8588  O  O      . SER A 1 527  ? -22.870 -57.667 17.955  1.00 30.88  ? 1889 SER A O      1 
ATOM   8589  C  CB     . SER A 1 527  ? -23.179 -60.188 19.645  1.00 31.08  ? 1889 SER A CB     1 
ATOM   8590  O  OG     . SER A 1 527  ? -24.429 -59.867 20.225  1.00 31.17  ? 1889 SER A OG     1 
ATOM   8591  H  H      . SER A 1 527  ? -21.291 -60.330 18.066  1.00 37.59  ? 1889 SER A H      1 
ATOM   8592  H  HA     . SER A 1 527  ? -23.906 -60.627 17.780  1.00 37.62  ? 1889 SER A HA     1 
ATOM   8593  H  HB2    . SER A 1 527  ? -22.960 -61.110 19.853  1.00 37.30  ? 1889 SER A HB2    1 
ATOM   8594  H  HB3    . SER A 1 527  ? -22.500 -59.596 20.005  1.00 37.30  ? 1889 SER A HB3    1 
ATOM   8595  H  HG     . SER A 1 527  ? -24.392 -59.962 21.059  1.00 37.40  ? 1889 SER A HG     1 
ATOM   8596  N  N      . PRO A 1 528  ? -24.902 -58.408 17.325  1.00 23.80  ? 1890 PRO A N      1 
ATOM   8597  C  CA     . PRO A 1 528  ? -25.405 -57.057 17.055  1.00 23.76  ? 1890 PRO A CA     1 
ATOM   8598  C  C      . PRO A 1 528  ? -25.312 -56.142 18.270  1.00 23.35  ? 1890 PRO A C      1 
ATOM   8599  O  O      . PRO A 1 528  ? -25.316 -54.918 18.133  1.00 23.26  ? 1890 PRO A O      1 
ATOM   8600  C  CB     . PRO A 1 528  ? -26.868 -57.306 16.693  1.00 24.23  ? 1890 PRO A CB     1 
ATOM   8601  C  CG     . PRO A 1 528  ? -26.874 -58.670 16.111  1.00 24.61  ? 1890 PRO A CG     1 
ATOM   8602  C  CD     . PRO A 1 528  ? -25.881 -59.437 16.930  1.00 24.31  ? 1890 PRO A CD     1 
ATOM   8603  H  HA     . PRO A 1 528  ? -24.941 -56.659 16.302  1.00 28.52  ? 1890 PRO A HA     1 
ATOM   8604  H  HB2    . PRO A 1 528  ? -27.416 -57.270 17.492  1.00 29.07  ? 1890 PRO A HB2    1 
ATOM   8605  H  HB3    . PRO A 1 528  ? -27.162 -56.651 16.040  1.00 29.07  ? 1890 PRO A HB3    1 
ATOM   8606  H  HG2    . PRO A 1 528  ? -27.760 -59.058 16.191  1.00 29.53  ? 1890 PRO A HG2    1 
ATOM   8607  H  HG3    . PRO A 1 528  ? -26.597 -58.632 15.182  1.00 29.53  ? 1890 PRO A HG3    1 
ATOM   8608  H  HD2    . PRO A 1 528  ? -26.309 -59.815 17.714  1.00 29.18  ? 1890 PRO A HD2    1 
ATOM   8609  H  HD3    . PRO A 1 528  ? -25.454 -60.121 16.392  1.00 29.18  ? 1890 PRO A HD3    1 
ATOM   8610  N  N      . HIS A 1 529  ? -25.209 -56.752 19.446  1.00 28.93  ? 1891 HIS A N      1 
ATOM   8611  C  CA     . HIS A 1 529  ? -25.254 -56.034 20.709  1.00 28.64  ? 1891 HIS A CA     1 
ATOM   8612  C  C      . HIS A 1 529  ? -23.868 -55.630 21.212  1.00 28.24  ? 1891 HIS A C      1 
ATOM   8613  O  O      . HIS A 1 529  ? -23.738 -55.124 22.325  1.00 28.03  ? 1891 HIS A O      1 
ATOM   8614  C  CB     . HIS A 1 529  ? -25.966 -56.899 21.751  1.00 28.78  ? 1891 HIS A CB     1 
ATOM   8615  C  CG     . HIS A 1 529  ? -27.322 -57.370 21.316  1.00 29.23  ? 1891 HIS A CG     1 
ATOM   8616  N  ND1    . HIS A 1 529  ? -28.307 -56.509 20.879  1.00 29.42  ? 1891 HIS A ND1    1 
ATOM   8617  C  CD2    . HIS A 1 529  ? -27.858 -58.613 21.252  1.00 29.60  ? 1891 HIS A CD2    1 
ATOM   8618  C  CE1    . HIS A 1 529  ? -29.388 -57.201 20.563  1.00 29.86  ? 1891 HIS A CE1    1 
ATOM   8619  N  NE2    . HIS A 1 529  ? -29.143 -58.479 20.785  1.00 29.98  ? 1891 HIS A NE2    1 
ATOM   8620  H  H      . HIS A 1 529  ? -25.109 -57.601 19.538  1.00 34.71  ? 1891 HIS A H      1 
ATOM   8621  H  HA     . HIS A 1 529  ? -25.774 -55.223 20.589  1.00 34.37  ? 1891 HIS A HA     1 
ATOM   8622  H  HB2    . HIS A 1 529  ? -25.423 -57.682 21.931  1.00 34.53  ? 1891 HIS A HB2    1 
ATOM   8623  H  HB3    . HIS A 1 529  ? -26.078 -56.381 22.564  1.00 34.53  ? 1891 HIS A HB3    1 
ATOM   8624  H  HD2    . HIS A 1 529  ? -27.436 -59.408 21.485  1.00 35.52  ? 1891 HIS A HD2    1 
ATOM   8625  H  HE1    . HIS A 1 529  ? -30.187 -56.847 20.245  1.00 35.83  ? 1891 HIS A HE1    1 
ATOM   8626  H  HE2    . HIS A 1 529  ? -29.696 -59.124 20.652  1.00 35.98  ? 1891 HIS A HE2    1 
ATOM   8627  N  N      . THR A 1 530  ? -22.838 -55.860 20.400  1.00 24.68  ? 1892 THR A N      1 
ATOM   8628  C  CA     . THR A 1 530  ? -21.472 -55.460 20.749  1.00 24.35  ? 1892 THR A CA     1 
ATOM   8629  C  C      . THR A 1 530  ? -21.286 -53.957 20.613  1.00 24.24  ? 1892 THR A C      1 
ATOM   8630  O  O      . THR A 1 530  ? -21.895 -53.323 19.754  1.00 24.46  ? 1892 THR A O      1 
ATOM   8631  C  CB     . THR A 1 530  ? -20.430 -56.154 19.851  1.00 24.42  ? 1892 THR A CB     1 
ATOM   8632  O  OG1    . THR A 1 530  ? -20.712 -57.556 19.776  1.00 24.65  ? 1892 THR A OG1    1 
ATOM   8633  C  CG2    . THR A 1 530  ? -19.019 -55.947 20.387  1.00 24.12  ? 1892 THR A CG2    1 
ATOM   8634  H  H      . THR A 1 530  ? -22.902 -56.249 19.636  1.00 29.61  ? 1892 THR A H      1 
ATOM   8635  H  HA     . THR A 1 530  ? -21.293 -55.707 21.669  1.00 29.23  ? 1892 THR A HA     1 
ATOM   8636  H  HB     . THR A 1 530  ? -20.474 -55.773 18.960  1.00 29.30  ? 1892 THR A HB     1 
ATOM   8637  H  HG1    . THR A 1 530  ? -21.477 -57.678 19.453  1.00 29.58  ? 1892 THR A HG1    1 
ATOM   8638  H  HG21   . THR A 1 530  ? -18.377 -56.389 19.810  1.00 28.94  ? 1892 THR A HG21   1 
ATOM   8639  H  HG22   . THR A 1 530  ? -18.813 -54.999 20.419  1.00 28.94  ? 1892 THR A HG22   1 
ATOM   8640  H  HG23   . THR A 1 530  ? -18.947 -56.316 21.281  1.00 28.94  ? 1892 THR A HG23   1 
ATOM   8641  N  N      . ALA A 1 531  ? -20.426 -53.393 21.451  1.00 21.72  ? 1893 ALA A N      1 
ATOM   8642  C  CA     . ALA A 1 531  ? -20.086 -51.985 21.352  1.00 21.67  ? 1893 ALA A CA     1 
ATOM   8643  C  C      . ALA A 1 531  ? -18.711 -51.723 21.930  1.00 21.43  ? 1893 ALA A C      1 
ATOM   8644  O  O      . ALA A 1 531  ? -18.276 -52.400 22.859  1.00 21.27  ? 1893 ALA A O      1 
ATOM   8645  C  CB     . ALA A 1 531  ? -21.119 -51.145 22.051  1.00 21.74  ? 1893 ALA A CB     1 
ATOM   8646  H  H      . ALA A 1 531  ? -20.024 -53.808 22.089  1.00 26.06  ? 1893 ALA A H      1 
ATOM   8647  H  HA     . ALA A 1 531  ? -20.072 -51.728 20.417  1.00 26.00  ? 1893 ALA A HA     1 
ATOM   8648  H  HB1    . ALA A 1 531  ? -20.871 -50.210 21.972  1.00 26.08  ? 1893 ALA A HB1    1 
ATOM   8649  H  HB2    . ALA A 1 531  ? -21.982 -51.295 21.636  1.00 26.08  ? 1893 ALA A HB2    1 
ATOM   8650  H  HB3    . ALA A 1 531  ? -21.152 -51.400 22.987  1.00 26.08  ? 1893 ALA A HB3    1 
ATOM   8651  N  N      . VAL A 1 532  ? -18.038 -50.726 21.374  1.00 21.47  ? 1894 VAL A N      1 
ATOM   8652  C  CA     . VAL A 1 532  ? -16.698 -50.367 21.802  1.00 21.32  ? 1894 VAL A CA     1 
ATOM   8653  C  C      . VAL A 1 532  ? -16.608 -48.907 22.187  1.00 21.38  ? 1894 VAL A C      1 
ATOM   8654  O  O      . VAL A 1 532  ? -16.937 -48.028 21.393  1.00 21.62  ? 1894 VAL A O      1 
ATOM   8655  C  CB     . VAL A 1 532  ? -15.688 -50.659 20.700  1.00 21.40  ? 1894 VAL A CB     1 
ATOM   8656  C  CG1    . VAL A 1 532  ? -14.273 -50.389 21.186  1.00 21.27  ? 1894 VAL A CG1    1 
ATOM   8657  C  CG2    . VAL A 1 532  ? -15.839 -52.094 20.229  1.00 21.44  ? 1894 VAL A CG2    1 
ATOM   8658  H  H      . VAL A 1 532  ? -18.342 -50.235 20.737  1.00 25.77  ? 1894 VAL A H      1 
ATOM   8659  H  HA     . VAL A 1 532  ? -16.460 -50.899 22.578  1.00 25.58  ? 1894 VAL A HA     1 
ATOM   8660  H  HB     . VAL A 1 532  ? -15.864 -50.075 19.946  1.00 25.68  ? 1894 VAL A HB     1 
ATOM   8661  H  HG11   . VAL A 1 532  ? -13.651 -50.582 20.468  1.00 25.53  ? 1894 VAL A HG11   1 
ATOM   8662  H  HG12   . VAL A 1 532  ? -14.202 -49.457 21.445  1.00 25.53  ? 1894 VAL A HG12   1 
ATOM   8663  H  HG13   . VAL A 1 532  ? -14.087 -50.961 21.948  1.00 25.53  ? 1894 VAL A HG13   1 
ATOM   8664  H  HG21   . VAL A 1 532  ? -15.191 -52.266 19.528  1.00 25.73  ? 1894 VAL A HG21   1 
ATOM   8665  H  HG22   . VAL A 1 532  ? -15.683 -52.690 20.978  1.00 25.73  ? 1894 VAL A HG22   1 
ATOM   8666  H  HG23   . VAL A 1 532  ? -16.738 -52.221 19.887  1.00 25.73  ? 1894 VAL A HG23   1 
ATOM   8667  N  N      . PHE A 1 533  ? -16.137 -48.662 23.404  1.00 21.23  ? 1895 PHE A N      1 
ATOM   8668  C  CA     . PHE A 1 533  ? -15.977 -47.309 23.911  1.00 21.35  ? 1895 PHE A CA     1 
ATOM   8669  C  C      . PHE A 1 533  ? -14.514 -47.006 24.111  1.00 21.31  ? 1895 PHE A C      1 
ATOM   8670  O  O      . PHE A 1 533  ? -13.711 -47.910 24.313  1.00 21.14  ? 1895 PHE A O      1 
ATOM   8671  C  CB     . PHE A 1 533  ? -16.737 -47.117 25.219  1.00 21.35  ? 1895 PHE A CB     1 
ATOM   8672  C  CG     . PHE A 1 533  ? -18.204 -47.374 25.097  1.00 21.44  ? 1895 PHE A CG     1 
ATOM   8673  C  CD1    . PHE A 1 533  ? -19.014 -46.490 24.416  1.00 21.70  ? 1895 PHE A CD1    1 
ATOM   8674  C  CD2    . PHE A 1 533  ? -18.776 -48.490 25.673  1.00 21.34  ? 1895 PHE A CD2    1 
ATOM   8675  C  CE1    . PHE A 1 533  ? -20.366 -46.720 24.296  1.00 21.83  ? 1895 PHE A CE1    1 
ATOM   8676  C  CE2    . PHE A 1 533  ? -20.129 -48.727 25.559  1.00 21.48  ? 1895 PHE A CE2    1 
ATOM   8677  C  CZ     . PHE A 1 533  ? -20.926 -47.835 24.873  1.00 21.71  ? 1895 PHE A CZ     1 
ATOM   8678  H  H      . PHE A 1 533  ? -15.900 -49.273 23.962  1.00 25.48  ? 1895 PHE A H      1 
ATOM   8679  H  HA     . PHE A 1 533  ? -16.330 -46.682 23.261  1.00 25.62  ? 1895 PHE A HA     1 
ATOM   8680  H  HB2    . PHE A 1 533  ? -16.382 -47.730 25.881  1.00 25.61  ? 1895 PHE A HB2    1 
ATOM   8681  H  HB3    . PHE A 1 533  ? -16.619 -46.202 25.518  1.00 25.61  ? 1895 PHE A HB3    1 
ATOM   8682  H  HD1    . PHE A 1 533  ? -18.641 -45.734 24.023  1.00 26.04  ? 1895 PHE A HD1    1 
ATOM   8683  H  HD2    . PHE A 1 533  ? -18.241 -49.094 26.136  1.00 25.61  ? 1895 PHE A HD2    1 
ATOM   8684  H  HE1    . PHE A 1 533  ? -20.901 -46.117 23.833  1.00 26.19  ? 1895 PHE A HE1    1 
ATOM   8685  H  HE2    . PHE A 1 533  ? -20.504 -49.483 25.949  1.00 25.78  ? 1895 PHE A HE2    1 
ATOM   8686  H  HZ     . PHE A 1 533  ? -21.840 -47.992 24.794  1.00 26.06  ? 1895 PHE A HZ     1 
ATOM   8687  N  N      . ILE A 1 534  ? -14.175 -45.724 24.046  1.00 21.53  ? 1896 ILE A N      1 
ATOM   8688  C  CA     . ILE A 1 534  ? -12.795 -45.288 24.170  1.00 21.59  ? 1896 ILE A CA     1 
ATOM   8689  C  C      . ILE A 1 534  ? -12.692 -44.039 25.020  1.00 21.81  ? 1896 ILE A C      1 
ATOM   8690  O  O      . ILE A 1 534  ? -13.444 -43.091 24.831  1.00 22.07  ? 1896 ILE A O      1 
ATOM   8691  C  CB     . ILE A 1 534  ? -12.176 -44.995 22.800  1.00 21.80  ? 1896 ILE A CB     1 
ATOM   8692  C  CG1    . ILE A 1 534  ? -12.034 -46.291 21.999  1.00 21.64  ? 1896 ILE A CG1    1 
ATOM   8693  C  CG2    . ILE A 1 534  ? -10.835 -44.278 22.956  1.00 21.97  ? 1896 ILE A CG2    1 
ATOM   8694  C  CD1    . ILE A 1 534  ? -11.590 -46.080 20.567  1.00 21.93  ? 1896 ILE A CD1    1 
ATOM   8695  H  H      . ILE A 1 534  ? -14.735 -45.082 23.929  1.00 25.84  ? 1896 ILE A H      1 
ATOM   8696  H  HA     . ILE A 1 534  ? -12.275 -45.989 24.595  1.00 25.90  ? 1896 ILE A HA     1 
ATOM   8697  H  HB     . ILE A 1 534  ? -12.778 -44.407 22.318  1.00 26.15  ? 1896 ILE A HB     1 
ATOM   8698  H  HG12   . ILE A 1 534  ? -11.376 -46.856 22.433  1.00 25.97  ? 1896 ILE A HG12   1 
ATOM   8699  H  HG13   . ILE A 1 534  ? -12.893 -46.742 21.979  1.00 25.97  ? 1896 ILE A HG13   1 
ATOM   8700  H  HG21   . ILE A 1 534  ? -10.466 -44.105 22.076  1.00 26.36  ? 1896 ILE A HG21   1 
ATOM   8701  H  HG22   . ILE A 1 534  ? -10.977 -43.442 23.426  1.00 26.36  ? 1896 ILE A HG22   1 
ATOM   8702  H  HG23   . ILE A 1 534  ? -10.231 -44.845 23.462  1.00 26.36  ? 1896 ILE A HG23   1 
ATOM   8703  H  HD11   . ILE A 1 534  ? -11.523 -46.942 20.127  1.00 26.31  ? 1896 ILE A HD11   1 
ATOM   8704  H  HD12   . ILE A 1 534  ? -12.244 -45.526 20.113  1.00 26.31  ? 1896 ILE A HD12   1 
ATOM   8705  H  HD13   . ILE A 1 534  ? -10.726 -45.640 20.567  1.00 26.31  ? 1896 ILE A HD13   1 
ATOM   8706  N  N      . THR A 1 535  ? -11.763 -44.052 25.966  1.00 21.76  ? 1897 THR A N      1 
ATOM   8707  C  CA     . THR A 1 535  ? -11.418 -42.852 26.715  1.00 22.05  ? 1897 THR A CA     1 
ATOM   8708  C  C      . THR A 1 535  ? -9.999  -42.437 26.364  1.00 22.22  ? 1897 THR A C      1 
ATOM   8709  O  O      . THR A 1 535  ? -9.125  -43.287 26.206  1.00 22.02  ? 1897 THR A O      1 
ATOM   8710  C  CB     . THR A 1 535  ? -11.548 -43.063 28.206  1.00 21.99  ? 1897 THR A CB     1 
ATOM   8711  O  OG1    . THR A 1 535  ? -10.498 -43.933 28.642  1.00 21.80  ? 1897 THR A OG1    1 
ATOM   8712  C  CG2    . THR A 1 535  ? -12.909 -43.676 28.530  1.00 21.85  ? 1897 THR A CG2    1 
ATOM   8713  H  H      . THR A 1 535  ? -11.314 -44.749 26.195  1.00 26.11  ? 1897 THR A H      1 
ATOM   8714  H  HA     . THR A 1 535  ? -12.016 -42.133 26.458  1.00 26.46  ? 1897 THR A HA     1 
ATOM   8715  H  HB     . THR A 1 535  ? -11.476 -42.210 28.663  1.00 26.39  ? 1897 THR A HB     1 
ATOM   8716  H  HG1    . THR A 1 535  ? -10.556 -44.061 29.471  1.00 26.16  ? 1897 THR A HG1    1 
ATOM   8717  H  HG21   . THR A 1 535  ? -12.992 -43.811 29.487  1.00 26.21  ? 1897 THR A HG21   1 
ATOM   8718  H  HG22   . THR A 1 535  ? -13.618 -43.085 28.233  1.00 26.21  ? 1897 THR A HG22   1 
ATOM   8719  H  HG23   . THR A 1 535  ? -13.002 -44.531 28.082  1.00 26.21  ? 1897 THR A HG23   1 
ATOM   8720  N  N      . LEU A 1 536  ? -9.775  -41.133 26.259  1.00 24.68  ? 1898 LEU A N      1 
ATOM   8721  C  CA     . LEU A 1 536  ? -8.478  -40.594 25.854  1.00 24.95  ? 1898 LEU A CA     1 
ATOM   8722  C  C      . LEU A 1 536  ? -7.926  -39.524 26.796  1.00 25.35  ? 1898 LEU A C      1 
ATOM   8723  O  O      . LEU A 1 536  ? -8.511  -38.450 26.928  1.00 25.73  ? 1898 LEU A O      1 
ATOM   8724  C  CB     . LEU A 1 536  ? -8.603  -40.013 24.449  1.00 25.26  ? 1898 LEU A CB     1 
ATOM   8725  C  CG     . LEU A 1 536  ? -8.957  -41.016 23.359  1.00 25.00  ? 1898 LEU A CG     1 
ATOM   8726  C  CD1    . LEU A 1 536  ? -9.449  -40.290 22.133  1.00 25.40  ? 1898 LEU A CD1    1 
ATOM   8727  C  CD2    . LEU A 1 536  ? -7.736  -41.839 23.026  1.00 24.85  ? 1898 LEU A CD2    1 
ATOM   8728  H  H      . LEU A 1 536  ? -10.366 -40.529 26.418  1.00 29.61  ? 1898 LEU A H      1 
ATOM   8729  H  HA     . LEU A 1 536  ? -7.835  -41.320 25.820  1.00 29.95  ? 1898 LEU A HA     1 
ATOM   8730  H  HB2    . LEU A 1 536  ? -9.297  -39.335 24.457  1.00 30.31  ? 1898 LEU A HB2    1 
ATOM   8731  H  HB3    . LEU A 1 536  ? -7.756  -39.607 24.207  1.00 30.31  ? 1898 LEU A HB3    1 
ATOM   8732  H  HG     . LEU A 1 536  ? -9.658  -41.609 23.673  1.00 30.00  ? 1898 LEU A HG     1 
ATOM   8733  H  HD11   . LEU A 1 536  ? -9.671  -40.941 21.449  1.00 30.48  ? 1898 LEU A HD11   1 
ATOM   8734  H  HD12   . LEU A 1 536  ? -10.237 -39.775 22.366  1.00 30.48  ? 1898 LEU A HD12   1 
ATOM   8735  H  HD13   . LEU A 1 536  ? -8.749  -39.700 21.814  1.00 30.48  ? 1898 LEU A HD13   1 
ATOM   8736  H  HD21   . LEU A 1 536  ? -7.965  -42.476 22.332  1.00 29.82  ? 1898 LEU A HD21   1 
ATOM   8737  H  HD22   . LEU A 1 536  ? -7.033  -41.248 22.714  1.00 29.82  ? 1898 LEU A HD22   1 
ATOM   8738  H  HD23   . LEU A 1 536  ? -7.445  -42.308 23.824  1.00 29.82  ? 1898 LEU A HD23   1 
ATOM   8739  N  N      . ASN A 1 537  ? -6.805  -39.820 27.453  1.00 35.47  ? 1899 ASN A N      1 
ATOM   8740  C  CA     . ASN A 1 537  ? -6.128  -38.824 28.281  1.00 35.92  ? 1899 ASN A CA     1 
ATOM   8741  C  C      . ASN A 1 537  ? -5.101  -38.005 27.477  1.00 36.38  ? 1899 ASN A C      1 
ATOM   8742  O  O      . ASN A 1 537  ? -4.432  -38.544 26.594  1.00 37.35  ? 1899 ASN A O      1 
ATOM   8743  C  CB     . ASN A 1 537  ? -5.447  -39.505 29.468  1.00 35.75  ? 1899 ASN A CB     1 
ATOM   8744  C  CG     . ASN A 1 537  ? -6.438  -39.931 30.532  1.00 35.55  ? 1899 ASN A CG     1 
ATOM   8745  O  OD1    . ASN A 1 537  ? -7.630  -40.056 30.261  1.00 35.39  ? 1899 ASN A OD1    1 
ATOM   8746  N  ND2    . ASN A 1 537  ? -5.951  -40.165 31.745  1.00 35.63  ? 1899 ASN A ND2    1 
ATOM   8747  H  H      . ASN A 1 537  ? -6.418  -40.587 27.435  1.00 42.56  ? 1899 ASN A H      1 
ATOM   8748  H  HA     . ASN A 1 537  ? -6.790  -38.207 28.632  1.00 43.10  ? 1899 ASN A HA     1 
ATOM   8749  H  HB2    . ASN A 1 537  ? -4.981  -40.296 29.155  1.00 42.90  ? 1899 ASN A HB2    1 
ATOM   8750  H  HB3    . ASN A 1 537  ? -4.818  -38.886 29.871  1.00 42.90  ? 1899 ASN A HB3    1 
ATOM   8751  H  HD21   . ASN A 1 537  ? -6.478  -40.409 32.380  1.00 42.75  ? 1899 ASN A HD21   1 
ATOM   8752  H  HD22   . ASN A 1 537  ? -5.110  -40.073 31.896  1.00 42.75  ? 1899 ASN A HD22   1 
ATOM   8753  N  N      . PRO A 1 538  ? -4.974  -36.701 27.780  1.00 31.75  ? 1900 PRO A N      1 
ATOM   8754  C  CA     . PRO A 1 538  ? -4.096  -35.767 27.066  1.00 32.34  ? 1900 PRO A CA     1 
ATOM   8755  C  C      . PRO A 1 538  ? -2.616  -35.871 27.450  1.00 32.50  ? 1900 PRO A C      1 
ATOM   8756  O  O      . PRO A 1 538  ? -2.311  -36.244 28.583  1.00 33.40  ? 1900 PRO A O      1 
ATOM   8757  C  CB     . PRO A 1 538  ? -4.648  -34.404 27.481  1.00 32.95  ? 1900 PRO A CB     1 
ATOM   8758  C  CG     . PRO A 1 538  ? -5.090  -34.623 28.862  1.00 32.77  ? 1900 PRO A CG     1 
ATOM   8759  C  CD     . PRO A 1 538  ? -5.645  -36.030 28.906  1.00 31.99  ? 1900 PRO A CD     1 
ATOM   8760  H  HA     . PRO A 1 538  ? -4.191  -35.876 26.107  1.00 38.80  ? 1900 PRO A HA     1 
ATOM   8761  H  HB2    . PRO A 1 538  ? -3.946  -33.736 27.442  1.00 39.54  ? 1900 PRO A HB2    1 
ATOM   8762  H  HB3    . PRO A 1 538  ? -5.394  -34.161 26.911  1.00 39.54  ? 1900 PRO A HB3    1 
ATOM   8763  H  HG2    . PRO A 1 538  ? -4.332  -34.537 29.463  1.00 39.33  ? 1900 PRO A HG2    1 
ATOM   8764  H  HG3    . PRO A 1 538  ? -5.778  -33.978 29.088  1.00 39.33  ? 1900 PRO A HG3    1 
ATOM   8765  H  HD2    . PRO A 1 538  ? -5.411  -36.460 29.744  1.00 38.39  ? 1900 PRO A HD2    1 
ATOM   8766  H  HD3    . PRO A 1 538  ? -6.605  -36.018 28.769  1.00 38.39  ? 1900 PRO A HD3    1 
ATOM   8767  N  N      . GLY A 1 539  ? -1.722  -35.573 26.510  1.00 55.34  ? 1901 GLY A N      1 
ATOM   8768  C  CA     . GLY A 1 539  ? -0.306  -35.385 26.800  1.00 61.55  ? 1901 GLY A CA     1 
ATOM   8769  C  C      . GLY A 1 539  ? 0.015   -33.897 26.836  1.00 66.52  ? 1901 GLY A C      1 
ATOM   8770  O  O      . GLY A 1 539  ? -0.898  -33.072 26.768  1.00 75.78  ? 1901 GLY A O      1 
ATOM   8771  H  H      . GLY A 1 539  ? -1.918  -35.472 25.679  1.00 66.41  ? 1901 GLY A H      1 
ATOM   8772  H  HA2    . GLY A 1 539  ? -0.087  -35.778 27.659  1.00 73.86  ? 1901 GLY A HA2    1 
ATOM   8773  H  HA3    . GLY A 1 539  ? 0.233   -35.808 26.113  1.00 73.86  ? 1901 GLY A HA3    1 
ATOM   8774  N  N      . TYR A 1 540  ? 1.297   -33.542 26.943  1.00 109.59 ? 1902 TYR A N      1 
ATOM   8775  C  CA     . TYR A 1 540  ? 1.702   -32.132 27.034  1.00 106.96 ? 1902 TYR A CA     1 
ATOM   8776  C  C      . TYR A 1 540  ? 1.336   -31.395 25.744  1.00 105.12 ? 1902 TYR A C      1 
ATOM   8777  O  O      . TYR A 1 540  ? 1.168   -30.174 25.731  1.00 105.25 ? 1902 TYR A O      1 
ATOM   8778  C  CB     . TYR A 1 540  ? 3.208   -31.986 27.314  1.00 106.07 ? 1902 TYR A CB     1 
ATOM   8779  C  CG     . TYR A 1 540  ? 3.689   -32.589 28.620  1.00 106.90 ? 1902 TYR A CG     1 
ATOM   8780  C  CD1    . TYR A 1 540  ? 3.621   -31.851 29.797  1.00 107.64 ? 1902 TYR A CD1    1 
ATOM   8781  C  CD2    . TYR A 1 540  ? 4.220   -33.875 28.684  1.00 107.27 ? 1902 TYR A CD2    1 
ATOM   8782  C  CE1    . TYR A 1 540  ? 4.057   -32.371 31.000  1.00 108.30 ? 1902 TYR A CE1    1 
ATOM   8783  C  CE2    . TYR A 1 540  ? 4.662   -34.406 29.893  1.00 107.81 ? 1902 TYR A CE2    1 
ATOM   8784  C  CZ     . TYR A 1 540  ? 4.578   -33.646 31.045  1.00 108.30 ? 1902 TYR A CZ     1 
ATOM   8785  O  OH     . TYR A 1 540  ? 5.009   -34.155 32.251  1.00 108.74 ? 1902 TYR A OH     1 
ATOM   8786  H  H      . TYR A 1 540  ? 1.954   -34.097 26.966  1.00 131.51 ? 1902 TYR A H      1 
ATOM   8787  H  HA     . TYR A 1 540  ? 1.220   -31.713 27.764  1.00 128.35 ? 1902 TYR A HA     1 
ATOM   8788  H  HB2    . TYR A 1 540  ? 3.697   -32.419 26.597  1.00 127.28 ? 1902 TYR A HB2    1 
ATOM   8789  H  HB3    . TYR A 1 540  ? 3.427   -31.042 27.332  1.00 127.28 ? 1902 TYR A HB3    1 
ATOM   8790  H  HD1    . TYR A 1 540  ? 3.272   -30.990 29.774  1.00 129.17 ? 1902 TYR A HD1    1 
ATOM   8791  H  HD2    . TYR A 1 540  ? 4.278   -34.386 27.910  1.00 128.72 ? 1902 TYR A HD2    1 
ATOM   8792  H  HE1    . TYR A 1 540  ? 4.001   -31.862 31.776  1.00 129.97 ? 1902 TYR A HE1    1 
ATOM   8793  H  HE2    . TYR A 1 540  ? 5.013   -35.266 29.925  1.00 129.37 ? 1902 TYR A HE2    1 
ATOM   8794  H  HH     . TYR A 1 540  ? 5.303   -34.935 32.145  1.00 130.48 ? 1902 TYR A HH     1 
ATOM   8795  N  N      . ASN A 1 541  ? 1.219   -32.162 24.667  1.00 74.15  ? 1903 ASN A N      1 
ATOM   8796  C  CA     . ASN A 1 541  ? 0.912   -31.649 23.333  1.00 74.67  ? 1903 ASN A CA     1 
ATOM   8797  C  C      . ASN A 1 541  ? -0.544  -31.210 23.098  1.00 75.10  ? 1903 ASN A C      1 
ATOM   8798  O  O      . ASN A 1 541  ? -0.850  -30.612 22.062  1.00 74.27  ? 1903 ASN A O      1 
ATOM   8799  C  CB     . ASN A 1 541  ? 1.287   -32.718 22.301  1.00 74.52  ? 1903 ASN A CB     1 
ATOM   8800  C  CG     . ASN A 1 541  ? 0.648   -34.064 22.600  1.00 75.14  ? 1903 ASN A CG     1 
ATOM   8801  O  OD1    . ASN A 1 541  ? 0.536   -34.463 23.760  1.00 75.58  ? 1903 ASN A OD1    1 
ATOM   8802  N  ND2    . ASN A 1 541  ? 0.228   -34.772 21.559  1.00 75.19  ? 1903 ASN A ND2    1 
ATOM   8803  H  H      . ASN A 1 541  ? 1.316   -33.016 24.683  1.00 88.99  ? 1903 ASN A H      1 
ATOM   8804  H  HA     . ASN A 1 541  ? 1.476   -30.876 23.168  1.00 89.61  ? 1903 ASN A HA     1 
ATOM   8805  H  HB2    . ASN A 1 541  ? 0.988   -32.430 21.424  1.00 89.43  ? 1903 ASN A HB2    1 
ATOM   8806  H  HB3    . ASN A 1 541  ? 2.250   -32.835 22.302  1.00 89.43  ? 1903 ASN A HB3    1 
ATOM   8807  H  HD21   . ASN A 1 541  ? -0.139  -35.540 21.682  1.00 90.23  ? 1903 ASN A HD21   1 
ATOM   8808  H  HD22   . ASN A 1 541  ? 0.324   -34.464 20.762  1.00 90.23  ? 1903 ASN A HD22   1 
ATOM   8809  N  N      . GLY A 1 542  ? -1.431  -31.493 24.050  1.00 68.90  ? 1904 GLY A N      1 
ATOM   8810  C  CA     . GLY A 1 542  ? -2.851  -31.195 23.903  1.00 79.83  ? 1904 GLY A CA     1 
ATOM   8811  C  C      . GLY A 1 542  ? -3.715  -32.444 23.921  1.00 74.32  ? 1904 GLY A C      1 
ATOM   8812  O  O      . GLY A 1 542  ? -3.198  -33.559 23.969  1.00 86.42  ? 1904 GLY A O      1 
ATOM   8813  H  H      . GLY A 1 542  ? -1.231  -31.863 24.800  1.00 82.68  ? 1904 GLY A H      1 
ATOM   8814  H  HA2    . GLY A 1 542  ? -3.136  -30.615 24.627  1.00 95.80  ? 1904 GLY A HA2    1 
ATOM   8815  H  HA3    . GLY A 1 542  ? -2.998  -30.732 23.064  1.00 95.80  ? 1904 GLY A HA3    1 
ATOM   8816  N  N      . ARG A 1 543  ? -5.033  -32.255 23.881  1.00 111.18 ? 1905 ARG A N      1 
ATOM   8817  C  CA     . ARG A 1 543  ? -5.982  -33.356 24.064  1.00 110.80 ? 1905 ARG A CA     1 
ATOM   8818  C  C      . ARG A 1 543  ? -5.813  -34.429 22.991  1.00 107.93 ? 1905 ARG A C      1 
ATOM   8819  O  O      . ARG A 1 543  ? -5.845  -34.135 21.797  1.00 107.89 ? 1905 ARG A O      1 
ATOM   8820  C  CB     . ARG A 1 543  ? -7.426  -32.828 24.062  1.00 113.42 ? 1905 ARG A CB     1 
ATOM   8821  C  CG     . ARG A 1 543  ? -7.812  -32.060 25.333  1.00 117.54 ? 1905 ARG A CG     1 
ATOM   8822  C  CD     . ARG A 1 543  ? -9.161  -31.352 25.195  1.00 118.52 ? 1905 ARG A CD     1 
ATOM   8823  N  NE     . ARG A 1 543  ? -9.563  -30.647 26.417  1.00 120.52 ? 1905 ARG A NE     1 
ATOM   8824  C  CZ     . ARG A 1 543  ? -10.532 -31.031 27.248  1.00 121.39 ? 1905 ARG A CZ     1 
ATOM   8825  N  NH1    . ARG A 1 543  ? -11.221 -32.143 27.032  1.00 120.76 1 1905 ARG A NH1    1 
ATOM   8826  N  NH2    . ARG A 1 543  ? -10.810 -30.298 28.320  1.00 122.41 ? 1905 ARG A NH2    1 
ATOM   8827  H  H      . ARG A 1 543  ? -5.407  -31.492 23.750  1.00 133.41 ? 1905 ARG A H      1 
ATOM   8828  H  HA     . ARG A 1 543  ? -5.818  -33.769 24.926  1.00 132.96 ? 1905 ARG A HA     1 
ATOM   8829  H  HB2    . ARG A 1 543  ? -7.538  -32.228 23.308  1.00 136.10 ? 1905 ARG A HB2    1 
ATOM   8830  H  HB3    . ARG A 1 543  ? -8.033  -33.580 23.976  1.00 136.10 ? 1905 ARG A HB3    1 
ATOM   8831  H  HG2    . ARG A 1 543  ? -7.873  -32.682 26.075  1.00 141.05 ? 1905 ARG A HG2    1 
ATOM   8832  H  HG3    . ARG A 1 543  ? -7.137  -31.388 25.516  1.00 141.05 ? 1905 ARG A HG3    1 
ATOM   8833  H  HD2    . ARG A 1 543  ? -9.104  -30.700 24.478  1.00 142.22 ? 1905 ARG A HD2    1 
ATOM   8834  H  HD3    . ARG A 1 543  ? -9.844  -32.010 24.991  1.00 142.22 ? 1905 ARG A HD3    1 
ATOM   8835  H  HE     . ARG A 1 543  ? -9.137  -29.926 26.614  1.00 144.63 ? 1905 ARG A HE     1 
ATOM   8836  H  HH11   . ARG A 1 543  ? -11.053 -32.625 26.340  1.00 144.91 ? 1905 ARG A HH11   1 
ATOM   8837  H  HH12   . ARG A 1 543  ? -11.841 -32.378 27.580  1.00 144.91 ? 1905 ARG A HH12   1 
ATOM   8838  H  HH21   . ARG A 1 543  ? -10.367 -29.577 28.475  1.00 146.90 ? 1905 ARG A HH21   1 
ATOM   8839  H  HH22   . ARG A 1 543  ? -11.429 -30.547 28.862  1.00 146.90 ? 1905 ARG A HH22   1 
ATOM   8840  N  N      . SER A 1 544  ? -5.643  -35.675 23.433  1.00 69.09  ? 1906 SER A N      1 
ATOM   8841  C  CA     . SER A 1 544  ? -5.341  -36.790 22.535  1.00 63.62  ? 1906 SER A CA     1 
ATOM   8842  C  C      . SER A 1 544  ? -6.480  -37.044 21.556  1.00 53.65  ? 1906 SER A C      1 
ATOM   8843  O  O      . SER A 1 544  ? -7.628  -36.681 21.818  1.00 53.45  ? 1906 SER A O      1 
ATOM   8844  C  CB     . SER A 1 544  ? -5.061  -38.067 23.332  1.00 63.15  ? 1906 SER A CB     1 
ATOM   8845  O  OG     . SER A 1 544  ? -3.966  -37.896 24.215  1.00 64.43  ? 1906 SER A OG     1 
ATOM   8846  H  H      . SER A 1 544  ? -5.699  -35.903 24.261  1.00 82.90  ? 1906 SER A H      1 
ATOM   8847  H  HA     . SER A 1 544  ? -4.547  -36.575 22.022  1.00 76.35  ? 1906 SER A HA     1 
ATOM   8848  H  HB2    . SER A 1 544  ? -5.849  -38.293 23.850  1.00 75.78  ? 1906 SER A HB2    1 
ATOM   8849  H  HB3    . SER A 1 544  ? -4.855  -38.785 22.713  1.00 75.78  ? 1906 SER A HB3    1 
ATOM   8850  H  HG     . SER A 1 544  ? -3.828  -38.606 24.642  1.00 77.32  ? 1906 SER A HG     1 
ATOM   8851  N  N      . GLU A 1 545  ? -6.153  -37.675 20.432  1.00 48.61  ? 1907 GLU A N      1 
ATOM   8852  C  CA     . GLU A 1 545  ? -7.143  -37.980 19.406  1.00 52.43  ? 1907 GLU A CA     1 
ATOM   8853  C  C      . GLU A 1 545  ? -7.106  -39.425 18.955  1.00 48.11  ? 1907 GLU A C      1 
ATOM   8854  O  O      . GLU A 1 545  ? -6.114  -40.136 19.133  1.00 47.89  ? 1907 GLU A O      1 
ATOM   8855  C  CB     . GLU A 1 545  ? -6.951  -37.078 18.185  1.00 63.23  ? 1907 GLU A CB     1 
ATOM   8856  C  CG     . GLU A 1 545  ? -7.148  -35.595 18.451  1.00 74.13  ? 1907 GLU A CG     1 
ATOM   8857  C  CD     . GLU A 1 545  ? -7.133  -34.766 17.174  1.00 79.18  ? 1907 GLU A CD     1 
ATOM   8858  O  OE1    . GLU A 1 545  ? -7.564  -35.285 16.121  1.00 80.18  ? 1907 GLU A OE1    1 
ATOM   8859  O  OE2    . GLU A 1 545  ? -6.698  -33.594 17.223  1.00 80.08  1 1907 GLU A OE2    1 
ATOM   8860  H  H      . GLU A 1 545  ? -5.357  -37.940 20.239  1.00 58.34  ? 1907 GLU A H      1 
ATOM   8861  H  HA     . GLU A 1 545  ? -8.027  -37.805 19.766  1.00 62.91  ? 1907 GLU A HA     1 
ATOM   8862  H  HB2    . GLU A 1 545  ? -6.049  -37.198 17.850  1.00 75.88  ? 1907 GLU A HB2    1 
ATOM   8863  H  HB3    . GLU A 1 545  ? -7.589  -37.340 17.503  1.00 75.88  ? 1907 GLU A HB3    1 
ATOM   8864  H  HG2    . GLU A 1 545  ? -8.006  -35.463 18.885  1.00 88.96  ? 1907 GLU A HG2    1 
ATOM   8865  H  HG3    . GLU A 1 545  ? -6.433  -35.279 19.024  1.00 88.96  ? 1907 GLU A HG3    1 
ATOM   8866  N  N      . LEU A 1 546  ? -8.216  -39.840 18.358  1.00 24.43  ? 1908 LEU A N      1 
ATOM   8867  C  CA     . LEU A 1 546  ? -8.346  -41.170 17.803  1.00 24.08  ? 1908 LEU A CA     1 
ATOM   8868  C  C      . LEU A 1 546  ? -7.457  -41.320 16.581  1.00 24.47  ? 1908 LEU A C      1 
ATOM   8869  O  O      . LEU A 1 546  ? -7.302  -40.371 15.812  1.00 25.09  ? 1908 LEU A O      1 
ATOM   8870  C  CB     . LEU A 1 546  ? -9.798  -41.438 17.426  1.00 24.00  ? 1908 LEU A CB     1 
ATOM   8871  C  CG     . LEU A 1 546  ? -10.747 -41.470 18.616  1.00 23.61  ? 1908 LEU A CG     1 
ATOM   8872  C  CD1    . LEU A 1 546  ? -12.176 -41.455 18.129  1.00 23.70  ? 1908 LEU A CD1    1 
ATOM   8873  C  CD2    . LEU A 1 546  ? -10.483 -42.692 19.467  1.00 23.03  ? 1908 LEU A CD2    1 
ATOM   8874  H  H      . LEU A 1 546  ? -8.920  -39.355 18.263  1.00 29.32  ? 1908 LEU A H      1 
ATOM   8875  H  HA     . LEU A 1 546  ? -8.074  -41.825 18.465  1.00 28.90  ? 1908 LEU A HA     1 
ATOM   8876  H  HB2    . LEU A 1 546  ? -10.099 -40.739 16.826  1.00 28.80  ? 1908 LEU A HB2    1 
ATOM   8877  H  HB3    . LEU A 1 546  ? -9.851  -42.298 16.982  1.00 28.80  ? 1908 LEU A HB3    1 
ATOM   8878  H  HG     . LEU A 1 546  ? -10.604 -40.681 19.162  1.00 28.34  ? 1908 LEU A HG     1 
ATOM   8879  H  HD11   . LEU A 1 546  ? -12.770 -41.476 18.896  1.00 28.45  ? 1908 LEU A HD11   1 
ATOM   8880  H  HD12   . LEU A 1 546  ? -12.326 -40.646 17.616  1.00 28.45  ? 1908 LEU A HD12   1 
ATOM   8881  H  HD13   . LEU A 1 546  ? -12.327 -42.235 17.572  1.00 28.45  ? 1908 LEU A HD13   1 
ATOM   8882  H  HD21   . LEU A 1 546  ? -11.098 -42.692 20.217  1.00 27.64  ? 1908 LEU A HD21   1 
ATOM   8883  H  HD22   . LEU A 1 546  ? -10.618 -43.487 18.928  1.00 27.64  ? 1908 LEU A HD22   1 
ATOM   8884  H  HD23   . LEU A 1 546  ? -9.569  -42.660 19.788  1.00 27.64  ? 1908 LEU A HD23   1 
ATOM   8885  N  N      . PRO A 1 547  ? -6.866  -42.507 16.393  1.00 32.07  ? 1909 PRO A N      1 
ATOM   8886  C  CA     . PRO A 1 547  ? -6.152  -42.725 15.132  1.00 32.51  ? 1909 PRO A CA     1 
ATOM   8887  C  C      . PRO A 1 547  ? -7.092  -42.543 13.938  1.00 32.91  ? 1909 PRO A C      1 
ATOM   8888  O  O      . PRO A 1 547  ? -8.287  -42.789 14.077  1.00 32.67  ? 1909 PRO A O      1 
ATOM   8889  C  CB     . PRO A 1 547  ? -5.653  -44.166 15.259  1.00 33.84  ? 1909 PRO A CB     1 
ATOM   8890  C  CG     . PRO A 1 547  ? -5.557  -44.395 16.739  1.00 33.28  ? 1909 PRO A CG     1 
ATOM   8891  C  CD     . PRO A 1 547  ? -6.681  -43.622 17.337  1.00 31.46  ? 1909 PRO A CD     1 
ATOM   8892  H  HA     . PRO A 1 547  ? -5.398  -42.120 15.054  1.00 39.01  ? 1909 PRO A HA     1 
ATOM   8893  H  HB2    . PRO A 1 547  ? -6.293  -44.773 14.856  1.00 40.61  ? 1909 PRO A HB2    1 
ATOM   8894  H  HB3    . PRO A 1 547  ? -4.782  -44.251 14.839  1.00 40.61  ? 1909 PRO A HB3    1 
ATOM   8895  H  HG2    . PRO A 1 547  ? -5.654  -45.341 16.929  1.00 39.94  ? 1909 PRO A HG2    1 
ATOM   8896  H  HG3    . PRO A 1 547  ? -4.705  -44.066 17.065  1.00 39.94  ? 1909 PRO A HG3    1 
ATOM   8897  H  HD2    . PRO A 1 547  ? -7.482  -44.167 17.379  1.00 37.76  ? 1909 PRO A HD2    1 
ATOM   8898  H  HD3    . PRO A 1 547  ? -6.432  -43.286 18.212  1.00 37.76  ? 1909 PRO A HD3    1 
ATOM   8899  N  N      . GLU A 1 548  ? -6.550  -42.139 12.792  1.00 42.39  ? 1910 GLU A N      1 
ATOM   8900  C  CA     . GLU A 1 548  ? -7.352  -41.719 11.637  1.00 42.96  ? 1910 GLU A CA     1 
ATOM   8901  C  C      . GLU A 1 548  ? -8.410  -42.719 11.201  1.00 42.73  ? 1910 GLU A C      1 
ATOM   8902  O  O      . GLU A 1 548  ? -9.497  -42.334 10.765  1.00 42.97  ? 1910 GLU A O      1 
ATOM   8903  C  CB     . GLU A 1 548  ? -6.433  -41.462 10.441  1.00 43.72  ? 1910 GLU A CB     1 
ATOM   8904  C  CG     . GLU A 1 548  ? -5.536  -40.244 10.550  1.00 44.24  ? 1910 GLU A CG     1 
ATOM   8905  C  CD     . GLU A 1 548  ? -6.255  -38.949 10.228  1.00 45.55  ? 1910 GLU A CD     1 
ATOM   8906  O  OE1    . GLU A 1 548  ? -7.338  -38.999 9.601   1.00 45.02  ? 1910 GLU A OE1    1 
ATOM   8907  O  OE2    . GLU A 1 548  ? -5.726  -37.880 10.599  1.00 45.39  1 1910 GLU A OE2    1 
ATOM   8908  H  H      . GLU A 1 548  ? -5.702  -42.097 12.653  1.00 50.87  ? 1910 GLU A H      1 
ATOM   8909  H  HA     . GLU A 1 548  ? -7.801  -40.887 11.854  1.00 51.55  ? 1910 GLU A HA     1 
ATOM   8910  H  HB2    . GLU A 1 548  ? -5.859  -42.235 10.324  1.00 52.47  ? 1910 GLU A HB2    1 
ATOM   8911  H  HB3    . GLU A 1 548  ? -6.984  -41.346 9.651   1.00 52.47  ? 1910 GLU A HB3    1 
ATOM   8912  H  HG2    . GLU A 1 548  ? -5.199  -40.180 11.458  1.00 53.09  ? 1910 GLU A HG2    1 
ATOM   8913  H  HG3    . GLU A 1 548  ? -4.798  -40.339 9.928   1.00 53.09  ? 1910 GLU A HG3    1 
ATOM   8914  N  N      . ASN A 1 549  ? -8.081  -43.999 11.307  1.00 32.29  ? 1911 ASN A N      1 
ATOM   8915  C  CA     . ASN A 1 549  ? -8.988  -45.057 10.884  1.00 32.13  ? 1911 ASN A CA     1 
ATOM   8916  C  C      . ASN A 1 549  ? -10.273 -45.091 11.728  1.00 31.66  ? 1911 ASN A C      1 
ATOM   8917  O  O      . ASN A 1 549  ? -11.360 -45.315 11.188  1.00 31.80  ? 1911 ASN A O      1 
ATOM   8918  C  CB     . ASN A 1 549  ? -8.266  -46.402 10.892  1.00 31.87  ? 1911 ASN A CB     1 
ATOM   8919  C  CG     . ASN A 1 549  ? -7.558  -46.669 12.184  1.00 31.29  ? 1911 ASN A CG     1 
ATOM   8920  O  OD1    . ASN A 1 549  ? -8.156  -46.600 13.247  1.00 30.81  ? 1911 ASN A OD1    1 
ATOM   8921  N  ND2    . ASN A 1 549  ? -6.263  -46.961 12.109  1.00 31.39  ? 1911 ASN A ND2    1 
ATOM   8922  H  H      . ASN A 1 549  ? -7.333  -44.284 11.623  1.00 38.75  ? 1911 ASN A H      1 
ATOM   8923  H  HA     . ASN A 1 549  ? -9.253  -44.880 9.967   1.00 38.56  ? 1911 ASN A HA     1 
ATOM   8924  H  HB2    . ASN A 1 549  ? -8.914  -47.110 10.753  1.00 38.24  ? 1911 ASN A HB2    1 
ATOM   8925  H  HB3    . ASN A 1 549  ? -7.606  -46.412 10.181  1.00 38.24  ? 1911 ASN A HB3    1 
ATOM   8926  H  HD21   . ASN A 1 549  ? -5.816  -47.122 12.826  1.00 37.67  ? 1911 ASN A HD21   1 
ATOM   8927  H  HD22   . ASN A 1 549  ? -5.873  -46.990 11.343  1.00 37.67  ? 1911 ASN A HD22   1 
ATOM   8928  N  N      . LEU A 1 550  ? -10.150 -44.883 13.042  1.00 26.65  ? 1912 LEU A N      1 
ATOM   8929  C  CA     . LEU A 1 550  ? -11.317 -44.876 13.940  1.00 26.25  ? 1912 LEU A CA     1 
ATOM   8930  C  C      . LEU A 1 550  ? -12.038 -43.531 14.031  1.00 26.55  ? 1912 LEU A C      1 
ATOM   8931  O  O      . LEU A 1 550  ? -13.105 -43.448 14.635  1.00 26.33  ? 1912 LEU A O      1 
ATOM   8932  C  CB     . LEU A 1 550  ? -10.920 -45.278 15.358  1.00 25.65  ? 1912 LEU A CB     1 
ATOM   8933  C  CG     . LEU A 1 550  ? -10.323 -46.660 15.553  1.00 25.32  ? 1912 LEU A CG     1 
ATOM   8934  C  CD1    . LEU A 1 550  ? -9.728  -46.787 16.940  1.00 24.88  ? 1912 LEU A CD1    1 
ATOM   8935  C  CD2    . LEU A 1 550  ? -11.410 -47.681 15.331  1.00 25.18  ? 1912 LEU A CD2    1 
ATOM   8936  H  H      . LEU A 1 550  ? -9.402  -44.742 13.442  1.00 31.98  ? 1912 LEU A H      1 
ATOM   8937  H  HA     . LEU A 1 550  ? -11.957 -45.529 13.618  1.00 31.50  ? 1912 LEU A HA     1 
ATOM   8938  H  HB2    . LEU A 1 550  ? -10.264 -44.638 15.678  1.00 30.79  ? 1912 LEU A HB2    1 
ATOM   8939  H  HB3    . LEU A 1 550  ? -11.711 -45.229 15.916  1.00 30.79  ? 1912 LEU A HB3    1 
ATOM   8940  H  HG     . LEU A 1 550  ? -9.621  -46.808 14.900  1.00 30.38  ? 1912 LEU A HG     1 
ATOM   8941  H  HD11   . LEU A 1 550  ? -9.353  -47.676 17.042  1.00 29.86  ? 1912 LEU A HD11   1 
ATOM   8942  H  HD12   . LEU A 1 550  ? -9.032  -46.120 17.046  1.00 29.86  ? 1912 LEU A HD12   1 
ATOM   8943  H  HD13   . LEU A 1 550  ? -10.427 -46.644 17.597  1.00 29.86  ? 1912 LEU A HD13   1 
ATOM   8944  H  HD21   . LEU A 1 550  ? -11.038 -48.569 15.453  1.00 30.21  ? 1912 LEU A HD21   1 
ATOM   8945  H  HD22   . LEU A 1 550  ? -12.122 -47.528 15.971  1.00 30.21  ? 1912 LEU A HD22   1 
ATOM   8946  H  HD23   . LEU A 1 550  ? -11.751 -47.586 14.427  1.00 30.21  ? 1912 LEU A HD23   1 
ATOM   8947  N  N      . LYS A 1 551  ? -11.467 -42.482 13.452  1.00 34.67  ? 1913 LYS A N      1 
ATOM   8948  C  CA     . LYS A 1 551  ? -12.046 -41.152 13.590  1.00 35.04  ? 1913 LYS A CA     1 
ATOM   8949  C  C      . LYS A 1 551  ? -13.421 -41.134 12.944  1.00 35.28  ? 1913 LYS A C      1 
ATOM   8950  O  O      . LYS A 1 551  ? -14.313 -40.419 13.393  1.00 35.35  ? 1913 LYS A O      1 
ATOM   8951  C  CB     . LYS A 1 551  ? -11.148 -40.073 12.971  1.00 35.72  ? 1913 LYS A CB     1 
ATOM   8952  C  CG     . LYS A 1 551  ? -9.852  -39.799 13.744  1.00 35.58  ? 1913 LYS A CG     1 
ATOM   8953  C  CD     . LYS A 1 551  ? -9.020  -38.670 13.122  1.00 36.36  ? 1913 LYS A CD     1 
ATOM   8954  C  CE     . LYS A 1 551  ? -9.296  -37.311 13.761  1.00 36.69  ? 1913 LYS A CE     1 
ATOM   8955  N  NZ     . LYS A 1 551  ? -8.749  -37.188 15.145  1.00 36.26  1 1913 LYS A NZ     1 
ATOM   8956  H  H      . LYS A 1 551  ? -10.749 -42.512 12.979  1.00 41.60  ? 1913 LYS A H      1 
ATOM   8957  H  HA     . LYS A 1 551  ? -12.154 -40.950 14.532  1.00 42.04  ? 1913 LYS A HA     1 
ATOM   8958  H  HB2    . LYS A 1 551  ? -10.902 -40.350 12.075  1.00 42.86  ? 1913 LYS A HB2    1 
ATOM   8959  H  HB3    . LYS A 1 551  ? -11.646 -39.241 12.930  1.00 42.86  ? 1913 LYS A HB3    1 
ATOM   8960  H  HG2    . LYS A 1 551  ? -10.074 -39.542 14.653  1.00 42.70  ? 1913 LYS A HG2    1 
ATOM   8961  H  HG3    . LYS A 1 551  ? -9.311  -40.603 13.749  1.00 42.70  ? 1913 LYS A HG3    1 
ATOM   8962  H  HD2    . LYS A 1 551  ? -8.078  -38.871 13.238  1.00 43.64  ? 1913 LYS A HD2    1 
ATOM   8963  H  HD3    . LYS A 1 551  ? -9.231  -38.606 12.177  1.00 43.64  ? 1913 LYS A HD3    1 
ATOM   8964  H  HE2    . LYS A 1 551  ? -8.887  -36.619 13.217  1.00 44.03  ? 1913 LYS A HE2    1 
ATOM   8965  H  HE3    . LYS A 1 551  ? -10.255 -37.173 13.805  1.00 44.03  ? 1913 LYS A HE3    1 
ATOM   8966  H  HZ1    . LYS A 1 551  ? -7.866  -37.301 15.135  1.00 43.51  ? 1913 LYS A HZ1    1 
ATOM   8967  H  HZ2    . LYS A 1 551  ? -8.934  -36.383 15.475  1.00 43.51  ? 1913 LYS A HZ2    1 
ATOM   8968  H  HZ3    . LYS A 1 551  ? -9.114  -37.807 15.672  1.00 43.51  ? 1913 LYS A HZ3    1 
ATOM   8969  N  N      . LYS A 1 552  ? -13.590 -41.922 11.888  1.00 37.31  ? 1914 LYS A N      1 
ATOM   8970  C  CA     . LYS A 1 552  ? -14.850 -41.939 11.157  1.00 37.63  ? 1914 LYS A CA     1 
ATOM   8971  C  C      . LYS A 1 552  ? -15.892 -42.878 11.777  1.00 37.09  ? 1914 LYS A C      1 
ATOM   8972  O  O      . LYS A 1 552  ? -17.077 -42.745 11.489  1.00 37.30  ? 1914 LYS A O      1 
ATOM   8973  C  CB     . LYS A 1 552  ? -14.598 -42.336 9.703   1.00 38.20  ? 1914 LYS A CB     1 
ATOM   8974  C  CG     . LYS A 1 552  ? -13.787 -41.304 8.922   1.00 43.24  ? 1914 LYS A CG     1 
ATOM   8975  C  CD     . LYS A 1 552  ? -14.215 -41.190 7.467   1.00 51.71  ? 1914 LYS A CD     1 
ATOM   8976  C  CE     . LYS A 1 552  ? -15.032 -39.926 7.229   1.00 57.73  ? 1914 LYS A CE     1 
ATOM   8977  N  NZ     . LYS A 1 552  ? -16.263 -39.861 8.074   1.00 62.93  1 1914 LYS A NZ     1 
ATOM   8978  H  H      . LYS A 1 552  ? -12.992 -42.455 11.575  1.00 44.77  ? 1914 LYS A H      1 
ATOM   8979  H  HA     . LYS A 1 552  ? -15.222 -41.044 11.158  1.00 45.16  ? 1914 LYS A HA     1 
ATOM   8980  H  HB2    . LYS A 1 552  ? -14.108 -43.174 9.686   1.00 45.84  ? 1914 LYS A HB2    1 
ATOM   8981  H  HB3    . LYS A 1 552  ? -15.451 -42.445 9.255   1.00 45.84  ? 1914 LYS A HB3    1 
ATOM   8982  H  HG2    . LYS A 1 552  ? -13.901 -40.435 9.337   1.00 51.89  ? 1914 LYS A HG2    1 
ATOM   8983  H  HG3    . LYS A 1 552  ? -12.851 -41.560 8.940   1.00 51.89  ? 1914 LYS A HG3    1 
ATOM   8984  H  HD2    . LYS A 1 552  ? -13.427 -41.155 6.902   1.00 62.05  ? 1914 LYS A HD2    1 
ATOM   8985  H  HD3    . LYS A 1 552  ? -14.763 -41.956 7.232   1.00 62.05  ? 1914 LYS A HD3    1 
ATOM   8986  H  HE2    . LYS A 1 552  ? -14.484 -39.153 7.439   1.00 69.27  ? 1914 LYS A HE2    1 
ATOM   8987  H  HE3    . LYS A 1 552  ? -15.305 -39.896 6.299   1.00 69.27  ? 1914 LYS A HE3    1 
ATOM   8988  H  HZ1    . LYS A 1 552  ? -16.708 -39.109 7.904   1.00 75.52  ? 1914 LYS A HZ1    1 
ATOM   8989  H  HZ2    . LYS A 1 552  ? -16.790 -40.556 7.897   1.00 75.52  ? 1914 LYS A HZ2    1 
ATOM   8990  H  HZ3    . LYS A 1 552  ? -16.041 -39.878 8.936   1.00 75.52  ? 1914 LYS A HZ3    1 
ATOM   8991  N  N      . SER A 1 553  ? -15.457 -43.820 12.615  1.00 41.65  ? 1915 SER A N      1 
ATOM   8992  C  CA     . SER A 1 553  ? -16.361 -44.814 13.214  1.00 41.19  ? 1915 SER A CA     1 
ATOM   8993  C  C      . SER A 1 553  ? -16.846 -44.446 14.616  1.00 40.78  ? 1915 SER A C      1 
ATOM   8994  O  O      . SER A 1 553  ? -17.658 -45.170 15.193  1.00 40.46  ? 1915 SER A O      1 
ATOM   8995  C  CB     . SER A 1 553  ? -15.696 -46.190 13.272  1.00 40.84  ? 1915 SER A CB     1 
ATOM   8996  O  OG     . SER A 1 553  ? -15.154 -46.566 12.019  1.00 41.26  ? 1915 SER A OG     1 
ATOM   8997  H  H      . SER A 1 553  ? -14.636 -43.909 12.856  1.00 49.98  ? 1915 SER A H      1 
ATOM   8998  H  HA     . SER A 1 553  ? -17.144 -44.893 12.648  1.00 49.43  ? 1915 SER A HA     1 
ATOM   8999  H  HB2    . SER A 1 553  ? -14.981 -46.165 13.927  1.00 49.01  ? 1915 SER A HB2    1 
ATOM   9000  H  HB3    . SER A 1 553  ? -16.359 -46.847 13.535  1.00 49.01  ? 1915 SER A HB3    1 
ATOM   9001  H  HG     . SER A 1 553  ? -14.796 -47.324 12.076  1.00 49.51  ? 1915 SER A HG     1 
ATOM   9002  N  N      . PHE A 1 554  ? -16.340 -43.347 15.171  1.00 27.66  ? 1916 PHE A N      1 
ATOM   9003  C  CA     . PHE A 1 554  ? -16.674 -42.958 16.542  1.00 27.35  ? 1916 PHE A CA     1 
ATOM   9004  C  C      . PHE A 1 554  ? -17.319 -41.571 16.615  1.00 27.78  ? 1916 PHE A C      1 
ATOM   9005  O  O      . PHE A 1 554  ? -17.455 -40.879 15.603  1.00 28.34  ? 1916 PHE A O      1 
ATOM   9006  C  CB     . PHE A 1 554  ? -15.418 -42.998 17.419  1.00 27.03  ? 1916 PHE A CB     1 
ATOM   9007  C  CG     . PHE A 1 554  ? -15.109 -44.357 17.987  1.00 26.50  ? 1916 PHE A CG     1 
ATOM   9008  C  CD1    . PHE A 1 554  ? -14.710 -45.400 17.165  1.00 26.47  ? 1916 PHE A CD1    1 
ATOM   9009  C  CD2    . PHE A 1 554  ? -15.187 -44.583 19.353  1.00 26.12  ? 1916 PHE A CD2    1 
ATOM   9010  C  CE1    . PHE A 1 554  ? -14.419 -46.649 17.694  1.00 26.07  ? 1916 PHE A CE1    1 
ATOM   9011  C  CE2    . PHE A 1 554  ? -14.896 -45.829 19.885  1.00 25.73  ? 1916 PHE A CE2    1 
ATOM   9012  C  CZ     . PHE A 1 554  ? -14.509 -46.860 19.055  1.00 25.70  ? 1916 PHE A CZ     1 
ATOM   9013  H  H      . PHE A 1 554  ? -15.800 -42.808 14.774  1.00 33.20  ? 1916 PHE A H      1 
ATOM   9014  H  HA     . PHE A 1 554  ? -17.308 -43.598 16.902  1.00 32.82  ? 1916 PHE A HA     1 
ATOM   9015  H  HB2    . PHE A 1 554  ? -14.656 -42.720 16.886  1.00 32.43  ? 1916 PHE A HB2    1 
ATOM   9016  H  HB3    . PHE A 1 554  ? -15.537 -42.387 18.163  1.00 32.43  ? 1916 PHE A HB3    1 
ATOM   9017  H  HD1    . PHE A 1 554  ? -14.649 -45.263 16.247  1.00 31.77  ? 1916 PHE A HD1    1 
ATOM   9018  H  HD2    . PHE A 1 554  ? -15.448 -43.892 19.918  1.00 31.35  ? 1916 PHE A HD2    1 
ATOM   9019  H  HE1    . PHE A 1 554  ? -14.158 -47.343 17.132  1.00 31.29  ? 1916 PHE A HE1    1 
ATOM   9020  H  HE2    . PHE A 1 554  ? -14.958 -45.969 20.802  1.00 30.87  ? 1916 PHE A HE2    1 
ATOM   9021  H  HZ     . PHE A 1 554  ? -14.314 -47.697 19.412  1.00 30.84  ? 1916 PHE A HZ     1 
ATOM   9022  N  N      . ARG A 1 555  ? -17.726 -41.185 17.822  1.00 28.97  ? 1917 ARG A N      1 
ATOM   9023  C  CA     . ARG A 1 555  ? -18.235 -39.845 18.089  1.00 29.40  ? 1917 ARG A CA     1 
ATOM   9024  C  C      . ARG A 1 555  ? -17.509 -39.247 19.285  1.00 29.28  ? 1917 ARG A C      1 
ATOM   9025  O  O      . ARG A 1 555  ? -17.724 -39.681 20.414  1.00 28.89  ? 1917 ARG A O      1 
ATOM   9026  C  CB     . ARG A 1 555  ? -19.730 -39.911 18.364  1.00 29.43  ? 1917 ARG A CB     1 
ATOM   9027  C  CG     . ARG A 1 555  ? -20.560 -40.284 17.159  1.00 29.70  ? 1917 ARG A CG     1 
ATOM   9028  C  CD     . ARG A 1 555  ? -21.223 -39.053 16.580  1.00 30.40  ? 1917 ARG A CD     1 
ATOM   9029  N  NE     . ARG A 1 555  ? -20.228 -38.083 16.137  1.00 30.82  ? 1917 ARG A NE     1 
ATOM   9030  C  CZ     . ARG A 1 555  ? -20.502 -36.832 15.782  1.00 31.51  ? 1917 ARG A CZ     1 
ATOM   9031  N  NH1    . ARG A 1 555  ? -21.747 -36.373 15.822  1.00 31.84  1 1917 ARG A NH1    1 
ATOM   9032  N  NH2    . ARG A 1 555  ? -19.518 -36.034 15.398  1.00 34.54  ? 1917 ARG A NH2    1 
ATOM   9033  H  H      . ARG A 1 555  ? -17.716 -41.693 18.516  1.00 34.76  ? 1917 ARG A H      1 
ATOM   9034  H  HA     . ARG A 1 555  ? -18.085 -39.278 17.317  1.00 35.28  ? 1917 ARG A HA     1 
ATOM   9035  H  HB2    . ARG A 1 555  ? -19.892 -40.575 19.052  1.00 35.32  ? 1917 ARG A HB2    1 
ATOM   9036  H  HB3    . ARG A 1 555  ? -20.029 -39.041 18.671  1.00 35.32  ? 1917 ARG A HB3    1 
ATOM   9037  H  HG2    . ARG A 1 555  ? -19.988 -40.674 16.480  1.00 35.64  ? 1917 ARG A HG2    1 
ATOM   9038  H  HG3    . ARG A 1 555  ? -21.251 -40.911 17.423  1.00 35.64  ? 1917 ARG A HG3    1 
ATOM   9039  H  HD2    . ARG A 1 555  ? -21.763 -39.307 15.816  1.00 36.48  ? 1917 ARG A HD2    1 
ATOM   9040  H  HD3    . ARG A 1 555  ? -21.776 -38.635 17.259  1.00 36.48  ? 1917 ARG A HD3    1 
ATOM   9041  H  HE     . ARG A 1 555  ? -19.407 -38.338 16.104  1.00 36.99  ? 1917 ARG A HE     1 
ATOM   9042  H  HH11   . ARG A 1 555  ? -22.387 -36.889 16.072  1.00 38.21  ? 1917 ARG A HH11   1 
ATOM   9043  H  HH12   . ARG A 1 555  ? -21.913 -35.561 15.591  1.00 38.21  ? 1917 ARG A HH12   1 
ATOM   9044  H  HH21   . ARG A 1 555  ? -18.711 -36.328 15.373  1.00 41.44  ? 1917 ARG A HH21   1 
ATOM   9045  H  HH22   . ARG A 1 555  ? -19.688 -35.223 15.168  1.00 41.44  ? 1917 ARG A HH22   1 
ATOM   9046  N  N      . GLU A 1 556  ? -16.684 -38.229 19.051  1.00 51.28  ? 1918 GLU A N      1 
ATOM   9047  C  CA     . GLU A 1 556  ? -15.849 -37.691 20.124  1.00 51.23  ? 1918 GLU A CA     1 
ATOM   9048  C  C      . GLU A 1 556  ? -16.611 -36.672 20.965  1.00 51.55  ? 1918 GLU A C      1 
ATOM   9049  O  O      . GLU A 1 556  ? -17.391 -35.870 20.445  1.00 52.06  ? 1918 GLU A O      1 
ATOM   9050  C  CB     . GLU A 1 556  ? -14.564 -37.062 19.570  1.00 51.60  ? 1918 GLU A CB     1 
ATOM   9051  C  CG     . GLU A 1 556  ? -13.647 -38.046 18.846  1.00 51.34  ? 1918 GLU A CG     1 
ATOM   9052  C  CD     . GLU A 1 556  ? -12.341 -37.415 18.394  1.00 52.31  ? 1918 GLU A CD     1 
ATOM   9053  O  OE1    . GLU A 1 556  ? -12.185 -36.186 18.553  1.00 58.61  ? 1918 GLU A OE1    1 
ATOM   9054  O  OE2    . GLU A 1 556  ? -11.469 -38.151 17.881  1.00 51.59  1 1918 GLU A OE2    1 
ATOM   9055  H  H      . GLU A 1 556  ? -16.589 -37.837 18.292  1.00 61.53  ? 1918 GLU A H      1 
ATOM   9056  H  HA     . GLU A 1 556  ? -15.590 -38.420 20.710  1.00 61.48  ? 1918 GLU A HA     1 
ATOM   9057  H  HB2    . GLU A 1 556  ? -14.805 -36.365 18.940  1.00 61.92  ? 1918 GLU A HB2    1 
ATOM   9058  H  HB3    . GLU A 1 556  ? -14.062 -36.679 20.306  1.00 61.92  ? 1918 GLU A HB3    1 
ATOM   9059  H  HG2    . GLU A 1 556  ? -13.435 -38.778 19.445  1.00 61.61  ? 1918 GLU A HG2    1 
ATOM   9060  H  HG3    . GLU A 1 556  ? -14.105 -38.383 18.060  1.00 61.61  ? 1918 GLU A HG3    1 
ATOM   9061  N  N      . PHE A 1 557  ? -16.370 -36.721 22.273  1.00 24.75  ? 1919 PHE A N      1 
ATOM   9062  C  CA     . PHE A 1 557  ? -16.996 -35.805 23.216  1.00 25.08  ? 1919 PHE A CA     1 
ATOM   9063  C  C      . PHE A 1 557  ? -16.019 -35.493 24.352  1.00 25.06  ? 1919 PHE A C      1 
ATOM   9064  O  O      . PHE A 1 557  ? -15.140 -36.300 24.654  1.00 24.62  ? 1919 PHE A O      1 
ATOM   9065  C  CB     . PHE A 1 557  ? -18.294 -36.406 23.758  1.00 24.82  ? 1919 PHE A CB     1 
ATOM   9066  C  CG     . PHE A 1 557  ? -19.034 -35.505 24.696  1.00 25.21  ? 1919 PHE A CG     1 
ATOM   9067  C  CD1    . PHE A 1 557  ? -19.689 -34.395 24.210  1.00 25.86  ? 1919 PHE A CD1    1 
ATOM   9068  C  CD2    . PHE A 1 557  ? -19.090 -35.769 26.052  1.00 25.01  ? 1919 PHE A CD2    1 
ATOM   9069  C  CE1    . PHE A 1 557  ? -20.385 -33.549 25.053  1.00 26.30  ? 1919 PHE A CE1    1 
ATOM   9070  C  CE2    . PHE A 1 557  ? -19.783 -34.926 26.906  1.00 25.45  ? 1919 PHE A CE2    1 
ATOM   9071  C  CZ     . PHE A 1 557  ? -20.430 -33.815 26.403  1.00 26.09  ? 1919 PHE A CZ     1 
ATOM   9072  H  H      . PHE A 1 557  ? -15.838 -37.287 22.643  1.00 29.70  ? 1919 PHE A H      1 
ATOM   9073  H  HA     . PHE A 1 557  ? -17.211 -34.975 22.762  1.00 30.10  ? 1919 PHE A HA     1 
ATOM   9074  H  HB2    . PHE A 1 557  ? -18.882 -36.605 23.013  1.00 29.78  ? 1919 PHE A HB2    1 
ATOM   9075  H  HB3    . PHE A 1 557  ? -18.084 -37.223 24.237  1.00 29.78  ? 1919 PHE A HB3    1 
ATOM   9076  H  HD1    . PHE A 1 557  ? -19.660 -34.209 23.299  1.00 31.03  ? 1919 PHE A HD1    1 
ATOM   9077  H  HD2    . PHE A 1 557  ? -18.654 -36.515 26.394  1.00 30.01  ? 1919 PHE A HD2    1 
ATOM   9078  H  HE1    . PHE A 1 557  ? -20.819 -32.802 24.710  1.00 31.56  ? 1919 PHE A HE1    1 
ATOM   9079  H  HE2    . PHE A 1 557  ? -19.813 -35.110 27.817  1.00 30.54  ? 1919 PHE A HE2    1 
ATOM   9080  H  HZ     . PHE A 1 557  ? -20.897 -33.249 26.974  1.00 31.31  ? 1919 PHE A HZ     1 
ATOM   9081  N  N      . SER A 1 558  ? -16.168 -34.319 24.964  1.00 25.60  ? 1920 SER A N      1 
ATOM   9082  C  CA     . SER A 1 558  ? -15.238 -33.858 25.997  1.00 25.75  ? 1920 SER A CA     1 
ATOM   9083  C  C      . SER A 1 558  ? -15.784 -34.012 27.419  1.00 25.64  ? 1920 SER A C      1 
ATOM   9084  O  O      . SER A 1 558  ? -16.960 -33.746 27.671  1.00 25.83  ? 1920 SER A O      1 
ATOM   9085  C  CB     . SER A 1 558  ? -14.876 -32.390 25.758  1.00 26.57  ? 1920 SER A CB     1 
ATOM   9086  O  OG     . SER A 1 558  ? -15.992 -31.544 25.984  1.00 27.08  ? 1920 SER A OG     1 
ATOM   9087  H  H      . SER A 1 558  ? -16.805 -33.765 24.798  1.00 30.73  ? 1920 SER A H      1 
ATOM   9088  H  HA     . SER A 1 558  ? -14.421 -34.379 25.936  1.00 30.90  ? 1920 SER A HA     1 
ATOM   9089  H  HB2    . SER A 1 558  ? -14.162 -32.139 26.365  1.00 31.88  ? 1920 SER A HB2    1 
ATOM   9090  H  HB3    . SER A 1 558  ? -14.581 -32.285 24.840  1.00 31.88  ? 1920 SER A HB3    1 
ATOM   9091  H  HG     . SER A 1 558  ? -15.777 -30.743 25.848  1.00 32.49  ? 1920 SER A HG     1 
ATOM   9092  N  N      . MET A 1 559  ? -14.927 -34.445 28.343  1.00 50.77  ? 1921 MET A N      1 
ATOM   9093  C  CA     . MET A 1 559  ? -15.266 -34.453 29.763  1.00 50.83  ? 1921 MET A CA     1 
ATOM   9094  C  C      . MET A 1 559  ? -14.472 -33.328 30.403  1.00 51.44  ? 1921 MET A C      1 
ATOM   9095  O  O      . MET A 1 559  ? -13.242 -33.354 30.412  1.00 51.42  ? 1921 MET A O      1 
ATOM   9096  C  CB     . MET A 1 559  ? -14.944 -35.797 30.407  1.00 50.21  ? 1921 MET A CB     1 
ATOM   9097  C  CG     . MET A 1 559  ? -15.776 -36.946 29.856  1.00 49.68  ? 1921 MET A CG     1 
ATOM   9098  S  SD     . MET A 1 559  ? -17.564 -36.770 30.049  1.00 53.95  ? 1921 MET A SD     1 
ATOM   9099  C  CE     . MET A 1 559  ? -17.750 -37.191 31.787  1.00 49.88  ? 1921 MET A CE     1 
ATOM   9100  H  H      . MET A 1 559  ? -14.138 -34.741 28.171  1.00 60.93  ? 1921 MET A H      1 
ATOM   9101  H  HA     . MET A 1 559  ? -16.215 -34.281 29.870  1.00 60.99  ? 1921 MET A HA     1 
ATOM   9102  H  HB2    . MET A 1 559  ? -14.009 -36.004 30.249  1.00 60.25  ? 1921 MET A HB2    1 
ATOM   9103  H  HB3    . MET A 1 559  ? -15.113 -35.737 31.360  1.00 60.25  ? 1921 MET A HB3    1 
ATOM   9104  H  HG2    . MET A 1 559  ? -15.593 -37.032 28.908  1.00 59.61  ? 1921 MET A HG2    1 
ATOM   9105  H  HG3    . MET A 1 559  ? -15.513 -37.761 30.312  1.00 59.61  ? 1921 MET A HG3    1 
ATOM   9106  H  HE1    . MET A 1 559  ? -18.688 -37.134 32.027  1.00 59.85  ? 1921 MET A HE1    1 
ATOM   9107  H  HE2    . MET A 1 559  ? -17.426 -38.094 31.929  1.00 59.85  ? 1921 MET A HE2    1 
ATOM   9108  H  HE3    . MET A 1 559  ? -17.233 -36.566 32.319  1.00 59.85  ? 1921 MET A HE3    1 
ATOM   9109  N  N      . LYS A 1 560  ? -15.187 -32.346 30.940  1.00 58.92  ? 1922 LYS A N      1 
ATOM   9110  C  CA     . LYS A 1 560  ? -14.573 -31.083 31.352  1.00 64.36  ? 1922 LYS A CA     1 
ATOM   9111  C  C      . LYS A 1 560  ? -14.486 -30.800 32.849  1.00 62.02  ? 1922 LYS A C      1 
ATOM   9112  O  O      . LYS A 1 560  ? -13.410 -30.813 33.444  1.00 60.09  ? 1922 LYS A O      1 
ATOM   9113  C  CB     . LYS A 1 560  ? -15.330 -29.920 30.717  1.00 74.38  ? 1922 LYS A CB     1 
ATOM   9114  C  CG     . LYS A 1 560  ? -16.757 -30.220 30.226  1.00 78.55  ? 1922 LYS A CG     1 
ATOM   9115  C  CD     . LYS A 1 560  ? -17.543 -28.916 30.172  1.00 78.12  ? 1922 LYS A CD     1 
ATOM   9116  C  CE     . LYS A 1 560  ? -16.808 -27.809 29.414  1.00 75.12  ? 1922 LYS A CE     1 
ATOM   9117  N  NZ     . LYS A 1 560  ? -17.522 -26.517 29.526  1.00 72.36  1 1922 LYS A NZ     1 
ATOM   9118  H  H      . LYS A 1 560  ? -16.035 -32.384 31.078  1.00 70.70  ? 1922 LYS A H      1 
ATOM   9119  H  HA     . LYS A 1 560  ? -13.668 -31.061 31.005  1.00 77.23  ? 1922 LYS A HA     1 
ATOM   9120  H  HB2    . LYS A 1 560  ? -15.395 -29.206 31.370  1.00 89.26  ? 1922 LYS A HB2    1 
ATOM   9121  H  HB3    . LYS A 1 560  ? -14.822 -29.609 29.951  1.00 89.26  ? 1922 LYS A HB3    1 
ATOM   9122  H  HG2    . LYS A 1 560  ? -16.724 -30.602 29.335  1.00 94.26  ? 1922 LYS A HG2    1 
ATOM   9123  H  HG3    . LYS A 1 560  ? -17.197 -30.824 30.844  1.00 94.26  ? 1922 LYS A HG3    1 
ATOM   9124  H  HD2    . LYS A 1 560  ? -18.388 -29.075 29.723  1.00 93.75  ? 1922 LYS A HD2    1 
ATOM   9125  H  HD3    . LYS A 1 560  ? -17.702 -28.605 31.077  1.00 93.75  ? 1922 LYS A HD3    1 
ATOM   9126  H  HE2    . LYS A 1 560  ? -15.920 -27.699 29.788  1.00 90.14  ? 1922 LYS A HE2    1 
ATOM   9127  H  HE3    . LYS A 1 560  ? -16.751 -28.046 28.475  1.00 90.14  ? 1922 LYS A HE3    1 
ATOM   9128  H  HZ1    . LYS A 1 560  ? -18.341 -26.593 29.186  1.00 86.83  ? 1922 LYS A HZ1    1 
ATOM   9129  H  HZ2    . LYS A 1 560  ? -17.585 -26.278 30.381  1.00 86.83  ? 1922 LYS A HZ2    1 
ATOM   9130  H  HZ3    . LYS A 1 560  ? -17.081 -25.886 29.080  1.00 86.83  ? 1922 LYS A HZ3    1 
ATOM   9131  N  N      . SER A 1 561  ? -15.648 -30.536 33.433  1.00 66.67  ? 1923 SER A N      1 
ATOM   9132  C  CA     . SER A 1 561  ? -15.775 -29.950 34.761  1.00 68.30  ? 1923 SER A CA     1 
ATOM   9133  C  C      . SER A 1 561  ? -16.572 -30.910 35.641  1.00 69.09  ? 1923 SER A C      1 
ATOM   9134  O  O      . SER A 1 561  ? -17.805 -30.908 35.606  1.00 70.54  ? 1923 SER A O      1 
ATOM   9135  C  CB     . SER A 1 561  ? -16.453 -28.586 34.689  1.00 69.74  ? 1923 SER A CB     1 
ATOM   9136  O  OG     . SER A 1 561  ? -17.769 -28.693 34.178  1.00 70.37  ? 1923 SER A OG     1 
ATOM   9137  H  H      . SER A 1 561  ? -16.408 -30.695 33.063  1.00 80.00  ? 1923 SER A H      1 
ATOM   9138  H  HA     . SER A 1 561  ? -14.894 -29.835 35.150  1.00 81.96  ? 1923 SER A HA     1 
ATOM   9139  H  HB2    . SER A 1 561  ? -16.492 -28.207 35.581  1.00 83.69  ? 1923 SER A HB2    1 
ATOM   9140  H  HB3    . SER A 1 561  ? -15.936 -28.008 34.106  1.00 83.69  ? 1923 SER A HB3    1 
ATOM   9141  H  HG     . SER A 1 561  ? -18.230 -29.191 34.673  1.00 84.45  ? 1923 SER A HG     1 
ATOM   9142  N  N      . PRO A 1 562  ? -15.872 -31.733 36.439  1.00 45.60  ? 1924 PRO A N      1 
ATOM   9143  C  CA     . PRO A 1 562  ? -16.488 -32.843 37.176  1.00 44.96  ? 1924 PRO A CA     1 
ATOM   9144  C  C      . PRO A 1 562  ? -17.602 -32.469 38.156  1.00 50.78  ? 1924 PRO A C      1 
ATOM   9145  O  O      . PRO A 1 562  ? -18.252 -33.385 38.655  1.00 55.49  ? 1924 PRO A O      1 
ATOM   9146  C  CB     . PRO A 1 562  ? -15.305 -33.427 37.954  1.00 44.84  ? 1924 PRO A CB     1 
ATOM   9147  C  CG     . PRO A 1 562  ? -14.135 -33.135 37.120  1.00 44.85  ? 1924 PRO A CG     1 
ATOM   9148  C  CD     . PRO A 1 562  ? -14.400 -31.822 36.461  1.00 45.19  ? 1924 PRO A CD     1 
ATOM   9149  H  HA     . PRO A 1 562  ? -16.821 -33.511 36.557  1.00 53.96  ? 1924 PRO A HA     1 
ATOM   9150  H  HB2    . PRO A 1 562  ? -15.231 -32.989 38.816  1.00 53.81  ? 1924 PRO A HB2    1 
ATOM   9151  H  HB3    . PRO A 1 562  ? -15.422 -34.384 38.060  1.00 53.81  ? 1924 PRO A HB3    1 
ATOM   9152  H  HG2    . PRO A 1 562  ? -13.345 -33.081 37.680  1.00 53.82  ? 1924 PRO A HG2    1 
ATOM   9153  H  HG3    . PRO A 1 562  ? -14.031 -33.833 36.454  1.00 53.82  ? 1924 PRO A HG3    1 
ATOM   9154  H  HD2    . PRO A 1 562  ? -14.026 -31.098 36.989  1.00 54.23  ? 1924 PRO A HD2    1 
ATOM   9155  H  HD3    . PRO A 1 562  ? -14.048 -31.820 35.557  1.00 54.23  ? 1924 PRO A HD3    1 
ATOM   9156  N  N      . GLN A 1 563  ? -17.814 -31.187 38.440  1.00 39.07  ? 1925 GLN A N      1 
ATOM   9157  C  CA     . GLN A 1 563  ? -18.848 -30.772 39.391  1.00 39.70  ? 1925 GLN A CA     1 
ATOM   9158  C  C      . GLN A 1 563  ? -18.599 -31.358 40.761  1.00 39.82  ? 1925 GLN A C      1 
ATOM   9159  O  O      . GLN A 1 563  ? -19.510 -31.885 41.391  1.00 39.85  ? 1925 GLN A O      1 
ATOM   9160  C  CB     . GLN A 1 563  ? -20.248 -31.194 38.942  1.00 39.46  ? 1925 GLN A CB     1 
ATOM   9161  C  CG     . GLN A 1 563  ? -20.727 -30.632 37.625  1.00 39.45  ? 1925 GLN A CG     1 
ATOM   9162  C  CD     . GLN A 1 563  ? -22.242 -30.543 37.576  1.00 49.54  ? 1925 GLN A CD     1 
ATOM   9163  O  OE1    . GLN A 1 563  ? -22.916 -30.657 38.603  1.00 54.35  ? 1925 GLN A OE1    1 
ATOM   9164  N  NE2    . GLN A 1 563  ? -22.788 -30.330 36.385  1.00 56.31  ? 1925 GLN A NE2    1 
ATOM   9165  H  H      . GLN A 1 563  ? -17.372 -30.534 38.095  1.00 46.89  ? 1925 GLN A H      1 
ATOM   9166  H  HA     . GLN A 1 563  ? -18.836 -29.805 39.470  1.00 47.65  ? 1925 GLN A HA     1 
ATOM   9167  H  HB2    . GLN A 1 563  ? -20.263 -32.161 38.865  1.00 47.35  ? 1925 GLN A HB2    1 
ATOM   9168  H  HB3    . GLN A 1 563  ? -20.881 -30.916 39.621  1.00 47.35  ? 1925 GLN A HB3    1 
ATOM   9169  H  HG2    . GLN A 1 563  ? -20.366 -29.739 37.508  1.00 47.34  ? 1925 GLN A HG2    1 
ATOM   9170  H  HG3    . GLN A 1 563  ? -20.432 -31.211 36.905  1.00 47.34  ? 1925 GLN A HG3    1 
ATOM   9171  H  HE21   . GLN A 1 563  ? -22.286 -30.249 35.690  1.00 67.58  ? 1925 GLN A HE21   1 
ATOM   9172  H  HE22   . GLN A 1 563  ? -23.642 -30.272 36.307  1.00 67.58  ? 1925 GLN A HE22   1 
ATOM   9173  N  N      . SER A 1 564  ? -17.366 -31.237 41.223  1.00 32.73  ? 1926 SER A N      1 
ATOM   9174  C  CA     . SER A 1 564  ? -16.945 -31.817 42.487  1.00 32.87  ? 1926 SER A CA     1 
ATOM   9175  C  C      . SER A 1 564  ? -17.949 -31.509 43.596  1.00 33.60  ? 1926 SER A C      1 
ATOM   9176  O  O      . SER A 1 564  ? -18.218 -32.359 44.442  1.00 33.55  ? 1926 SER A O      1 
ATOM   9177  C  CB     . SER A 1 564  ? -15.540 -31.329 42.850  1.00 33.21  ? 1926 SER A CB     1 
ATOM   9178  O  OG     . SER A 1 564  ? -14.615 -31.685 41.825  1.00 32.55  ? 1926 SER A OG     1 
ATOM   9179  H  H      . SER A 1 564  ? -16.740 -30.813 40.813  1.00 39.27  ? 1926 SER A H      1 
ATOM   9180  H  HA     . SER A 1 564  ? -16.905 -32.781 42.387  1.00 39.44  ? 1926 SER A HA     1 
ATOM   9181  H  HB2    . SER A 1 564  ? -15.553 -30.364 42.945  1.00 39.86  ? 1926 SER A HB2    1 
ATOM   9182  H  HB3    . SER A 1 564  ? -15.265 -31.743 43.684  1.00 39.86  ? 1926 SER A HB3    1 
ATOM   9183  H  HG     . SER A 1 564  ? -13.846 -31.416 42.027  1.00 39.06  ? 1926 SER A HG     1 
ATOM   9184  N  N      . GLY A 1 565  ? -18.484 -30.293 43.597  1.00 38.31  ? 1927 GLY A N      1 
ATOM   9185  C  CA     . GLY A 1 565  ? -19.453 -29.882 44.603  1.00 39.12  ? 1927 GLY A CA     1 
ATOM   9186  C  C      . GLY A 1 565  ? -20.662 -30.791 44.780  1.00 38.82  ? 1927 GLY A C      1 
ATOM   9187  O  O      . GLY A 1 565  ? -20.905 -31.272 45.887  1.00 39.13  ? 1927 GLY A O      1 
ATOM   9188  H  H      . GLY A 1 565  ? -18.300 -29.682 43.021  1.00 45.97  ? 1927 GLY A H      1 
ATOM   9189  H  HA2    . GLY A 1 565  ? -19.004 -29.820 45.460  1.00 46.95  ? 1927 GLY A HA2    1 
ATOM   9190  H  HA3    . GLY A 1 565  ? -19.781 -28.998 44.375  1.00 46.95  ? 1927 GLY A HA3    1 
ATOM   9191  N  N      . THR A 1 566  ? -21.417 -31.041 43.713  1.00 31.39  ? 1928 THR A N      1 
ATOM   9192  C  CA     . THR A 1 566  ? -22.630 -31.850 43.827  1.00 31.18  ? 1928 THR A CA     1 
ATOM   9193  C  C      . THR A 1 566  ? -22.311 -33.296 44.218  1.00 30.56  ? 1928 THR A C      1 
ATOM   9194  O  O      . THR A 1 566  ? -23.084 -33.920 44.944  1.00 30.74  ? 1928 THR A O      1 
ATOM   9195  C  CB     . THR A 1 566  ? -23.452 -31.835 42.529  1.00 30.75  ? 1928 THR A CB     1 
ATOM   9196  O  OG1    . THR A 1 566  ? -22.622 -32.205 41.424  1.00 57.00  ? 1928 THR A OG1    1 
ATOM   9197  C  CG2    . THR A 1 566  ? -24.034 -30.450 42.289  1.00 31.53  ? 1928 THR A CG2    1 
ATOM   9198  H  H      . THR A 1 566  ? -21.252 -30.757 42.918  1.00 37.67  ? 1928 THR A H      1 
ATOM   9199  H  HA     . THR A 1 566  ? -23.185 -31.474 44.528  1.00 37.42  ? 1928 THR A HA     1 
ATOM   9200  H  HB     . THR A 1 566  ? -24.186 -32.465 42.606  1.00 36.90  ? 1928 THR A HB     1 
ATOM   9201  H  HG1    . THR A 1 566  ? -23.069 -32.197 40.713  1.00 68.40  ? 1928 THR A HG1    1 
ATOM   9202  H  HG21   . THR A 1 566  ? -24.552 -30.446 41.469  1.00 37.83  ? 1928 THR A HG21   1 
ATOM   9203  H  HG22   . THR A 1 566  ? -24.611 -30.201 43.027  1.00 37.83  ? 1928 THR A HG22   1 
ATOM   9204  H  HG23   . THR A 1 566  ? -23.319 -29.799 42.213  1.00 37.83  ? 1928 THR A HG23   1 
ATOM   9205  N  N      . ILE A 1 567  ? -21.195 -33.836 43.733  1.00 33.16  ? 1929 ILE A N      1 
ATOM   9206  C  CA     . ILE A 1 567  ? -20.760 -35.168 44.161  1.00 32.67  ? 1929 ILE A CA     1 
ATOM   9207  C  C      . ILE A 1 567  ? -20.596 -35.192 45.669  1.00 33.38  ? 1929 ILE A C      1 
ATOM   9208  O  O      . ILE A 1 567  ? -21.159 -36.044 46.353  1.00 33.46  ? 1929 ILE A O      1 
ATOM   9209  C  CB     . ILE A 1 567  ? -19.421 -35.598 43.510  1.00 32.00  ? 1929 ILE A CB     1 
ATOM   9210  C  CG1    . ILE A 1 567  ? -19.634 -36.017 42.058  1.00 31.21  ? 1929 ILE A CG1    1 
ATOM   9211  C  CG2    . ILE A 1 567  ? -18.799 -36.793 44.236  1.00 31.76  ? 1929 ILE A CG2    1 
ATOM   9212  C  CD1    . ILE A 1 567  ? -19.300 -34.953 41.080  1.00 31.26  ? 1929 ILE A CD1    1 
ATOM   9213  H  H      . ILE A 1 567  ? -20.675 -33.459 43.161  1.00 39.79  ? 1929 ILE A H      1 
ATOM   9214  H  HA     . ILE A 1 567  ? -21.438 -35.818 43.918  1.00 39.20  ? 1929 ILE A HA     1 
ATOM   9215  H  HB     . ILE A 1 567  ? -18.801 -34.853 43.537  1.00 38.40  ? 1929 ILE A HB     1 
ATOM   9216  H  HG12   . ILE A 1 567  ? -19.071 -36.784 41.867  1.00 37.45  ? 1929 ILE A HG12   1 
ATOM   9217  H  HG13   . ILE A 1 567  ? -20.566 -36.253 41.934  1.00 37.45  ? 1929 ILE A HG13   1 
ATOM   9218  H  HG21   . ILE A 1 567  ? -17.966 -37.029 43.799  1.00 38.11  ? 1929 ILE A HG21   1 
ATOM   9219  H  HG22   . ILE A 1 567  ? -18.631 -36.548 45.159  1.00 38.11  ? 1929 ILE A HG22   1 
ATOM   9220  H  HG23   . ILE A 1 567  ? -19.417 -37.540 44.199  1.00 38.11  ? 1929 ILE A HG23   1 
ATOM   9221  H  HD11   . ILE A 1 567  ? -19.459 -35.289 40.184  1.00 37.51  ? 1929 ILE A HD11   1 
ATOM   9222  H  HD12   . ILE A 1 567  ? -19.862 -34.181 41.249  1.00 37.51  ? 1929 ILE A HD12   1 
ATOM   9223  H  HD13   . ILE A 1 567  ? -18.366 -34.712 41.183  1.00 37.51  ? 1929 ILE A HD13   1 
ATOM   9224  N  N      . ALA A 1 568  ? -19.824 -34.242 46.179  1.00 30.73  ? 1930 ALA A N      1 
ATOM   9225  C  CA     . ALA A 1 568  ? -19.464 -34.219 47.586  1.00 31.46  ? 1930 ALA A CA     1 
ATOM   9226  C  C      . ALA A 1 568  ? -20.681 -34.060 48.475  1.00 32.22  ? 1930 ALA A C      1 
ATOM   9227  O  O      . ALA A 1 568  ? -20.791 -34.705 49.512  1.00 32.57  ? 1930 ALA A O      1 
ATOM   9228  C  CB     . ALA A 1 568  ? -18.475 -33.102 47.847  1.00 32.05  ? 1930 ALA A CB     1 
ATOM   9229  H  H      . ALA A 1 568  ? -19.492 -33.592 45.724  1.00 36.87  ? 1930 ALA A H      1 
ATOM   9230  H  HA     . ALA A 1 568  ? -19.034 -35.058 47.814  1.00 37.76  ? 1930 ALA A HA     1 
ATOM   9231  H  HB1    . ALA A 1 568  ? -18.244 -33.099 48.789  1.00 38.46  ? 1930 ALA A HB1    1 
ATOM   9232  H  HB2    . ALA A 1 568  ? -17.680 -33.252 47.312  1.00 38.46  ? 1930 ALA A HB2    1 
ATOM   9233  H  HB3    . ALA A 1 568  ? -18.883 -32.256 47.603  1.00 38.46  ? 1930 ALA A HB3    1 
ATOM   9234  N  N      . GLU A 1 569  ? -21.600 -33.209 48.049  1.00 38.99  ? 1931 GLU A N      1 
ATOM   9235  C  CA     . GLU A 1 569  ? -22.819 -32.957 48.796  1.00 39.76  ? 1931 GLU A CA     1 
ATOM   9236  C  C      . GLU A 1 569  ? -23.603 -34.249 49.027  1.00 39.42  ? 1931 GLU A C      1 
ATOM   9237  O  O      . GLU A 1 569  ? -24.030 -34.530 50.145  1.00 40.09  ? 1931 GLU A O      1 
ATOM   9238  C  CB     . GLU A 1 569  ? -23.679 -31.932 48.056  1.00 40.00  ? 1931 GLU A CB     1 
ATOM   9239  C  CG     . GLU A 1 569  ? -25.029 -31.653 48.691  1.00 40.79  ? 1931 GLU A CG     1 
ATOM   9240  C  CD     . GLU A 1 569  ? -25.819 -30.626 47.917  1.00 41.06  ? 1931 GLU A CD     1 
ATOM   9241  O  OE1    . GLU A 1 569  ? -25.235 -29.955 47.042  1.00 40.83  ? 1931 GLU A OE1    1 
ATOM   9242  O  OE2    . GLU A 1 569  ? -27.031 -30.496 48.178  1.00 41.56  1 1931 GLU A OE2    1 
ATOM   9243  H  H      . GLU A 1 569  ? -21.540 -32.759 47.319  1.00 46.79  ? 1931 GLU A H      1 
ATOM   9244  H  HA     . GLU A 1 569  ? -22.588 -32.586 49.662  1.00 47.71  ? 1931 GLU A HA     1 
ATOM   9245  H  HB2    . GLU A 1 569  ? -23.194 -31.093 48.017  1.00 48.00  ? 1931 GLU A HB2    1 
ATOM   9246  H  HB3    . GLU A 1 569  ? -23.840 -32.257 47.156  1.00 48.00  ? 1931 GLU A HB3    1 
ATOM   9247  H  HG2    . GLU A 1 569  ? -25.544 -32.475 48.716  1.00 48.95  ? 1931 GLU A HG2    1 
ATOM   9248  H  HG3    . GLU A 1 569  ? -24.894 -31.316 49.590  1.00 48.95  ? 1931 GLU A HG3    1 
ATOM   9249  N  N      . MET A 1 570  ? -23.793 -35.030 47.967  1.00 32.00  ? 1932 MET A N      1 
ATOM   9250  C  CA     . MET A 1 570  ? -24.650 -36.213 48.034  1.00 31.71  ? 1932 MET A CA     1 
ATOM   9251  C  C      . MET A 1 570  ? -23.998 -37.363 48.775  1.00 31.58  ? 1932 MET A C      1 
ATOM   9252  O  O      . MET A 1 570  ? -24.673 -38.160 49.420  1.00 31.84  ? 1932 MET A O      1 
ATOM   9253  C  CB     . MET A 1 570  ? -25.019 -36.684 46.631  1.00 30.79  ? 1932 MET A CB     1 
ATOM   9254  C  CG     . MET A 1 570  ? -25.771 -35.664 45.827  1.00 30.94  ? 1932 MET A CG     1 
ATOM   9255  S  SD     . MET A 1 570  ? -27.247 -35.148 46.702  1.00 31.98  ? 1932 MET A SD     1 
ATOM   9256  C  CE     . MET A 1 570  ? -28.057 -34.163 45.448  1.00 36.94  ? 1932 MET A CE     1 
ATOM   9257  H  H      . MET A 1 570  ? -23.437 -34.898 47.195  1.00 38.40  ? 1932 MET A H      1 
ATOM   9258  H  HA     . MET A 1 570  ? -25.471 -35.975 48.491  1.00 38.05  ? 1932 MET A HA     1 
ATOM   9259  H  HB2    . MET A 1 570  ? -24.205 -36.899 46.150  1.00 36.95  ? 1932 MET A HB2    1 
ATOM   9260  H  HB3    . MET A 1 570  ? -25.577 -37.474 46.704  1.00 36.95  ? 1932 MET A HB3    1 
ATOM   9261  H  HG2    . MET A 1 570  ? -25.210 -34.886 45.684  1.00 37.12  ? 1932 MET A HG2    1 
ATOM   9262  H  HG3    . MET A 1 570  ? -26.036 -36.052 44.978  1.00 37.12  ? 1932 MET A HG3    1 
ATOM   9263  H  HE1    . MET A 1 570  ? -28.889 -33.817 45.807  1.00 44.33  ? 1932 MET A HE1    1 
ATOM   9264  H  HE2    . MET A 1 570  ? -27.474 -33.429 45.198  1.00 44.33  ? 1932 MET A HE2    1 
ATOM   9265  H  HE3    . MET A 1 570  ? -28.236 -34.721 44.675  1.00 44.33  ? 1932 MET A HE3    1 
ATOM   9266  N  N      . ILE A 1 571  ? -22.683 -37.462 48.656  1.00 31.22  ? 1933 ILE A N      1 
ATOM   9267  C  CA     . ILE A 1 571  ? -21.935 -38.473 49.379  1.00 31.17  ? 1933 ILE A CA     1 
ATOM   9268  C  C      . ILE A 1 571  ? -21.947 -38.124 50.860  1.00 32.26  ? 1933 ILE A C      1 
ATOM   9269  O  O      . ILE A 1 571  ? -22.189 -38.981 51.707  1.00 32.60  ? 1933 ILE A O      1 
ATOM   9270  C  CB     . ILE A 1 571  ? -20.511 -38.589 48.836  1.00 30.56  ? 1933 ILE A CB     1 
ATOM   9271  C  CG1    . ILE A 1 571  ? -20.553 -39.285 47.475  1.00 29.52  ? 1933 ILE A CG1    1 
ATOM   9272  C  CG2    . ILE A 1 571  ? -19.609 -39.343 49.799  1.00 30.78  ? 1933 ILE A CG2    1 
ATOM   9273  C  CD1    . ILE A 1 571  ? -19.231 -39.312 46.748  1.00 28.92  ? 1933 ILE A CD1    1 
ATOM   9274  H  H      . ILE A 1 571  ? -22.199 -36.953 48.160  1.00 37.46  ? 1933 ILE A H      1 
ATOM   9275  H  HA     . ILE A 1 571  ? -22.372 -39.332 49.267  1.00 37.40  ? 1933 ILE A HA     1 
ATOM   9276  H  HB     . ILE A 1 571  ? -20.154 -37.695 48.715  1.00 36.67  ? 1933 ILE A HB     1 
ATOM   9277  H  HG12   . ILE A 1 571  ? -20.837 -40.203 47.604  1.00 35.43  ? 1933 ILE A HG12   1 
ATOM   9278  H  HG13   . ILE A 1 571  ? -21.191 -38.822 46.909  1.00 35.43  ? 1933 ILE A HG13   1 
ATOM   9279  H  HG21   . ILE A 1 571  ? -18.717 -39.395 49.420  1.00 36.94  ? 1933 ILE A HG21   1 
ATOM   9280  H  HG22   . ILE A 1 571  ? -19.582 -38.867 50.644  1.00 36.94  ? 1933 ILE A HG22   1 
ATOM   9281  H  HG23   . ILE A 1 571  ? -19.965 -40.235 49.932  1.00 36.94  ? 1933 ILE A HG23   1 
ATOM   9282  H  HD11   . ILE A 1 571  ? -19.347 -39.769 45.900  1.00 34.70  ? 1933 ILE A HD11   1 
ATOM   9283  H  HD12   . ILE A 1 571  ? -18.936 -38.401 46.596  1.00 34.70  ? 1933 ILE A HD12   1 
ATOM   9284  H  HD13   . ILE A 1 571  ? -18.582 -39.784 47.293  1.00 34.70  ? 1933 ILE A HD13   1 
ATOM   9285  N  N      . LEU A 1 572  ? -21.681 -36.861 51.169  1.00 37.49  ? 1934 LEU A N      1 
ATOM   9286  C  CA     . LEU A 1 572  ? -21.789 -36.379 52.538  1.00 38.66  ? 1934 LEU A CA     1 
ATOM   9287  C  C      . LEU A 1 572  ? -23.236 -36.577 53.002  1.00 39.18  ? 1934 LEU A C      1 
ATOM   9288  O  O      . LEU A 1 572  ? -23.494 -36.796 54.184  1.00 47.35  ? 1934 LEU A O      1 
ATOM   9289  C  CB     . LEU A 1 572  ? -21.357 -34.915 52.647  1.00 39.28  ? 1934 LEU A CB     1 
ATOM   9290  C  CG     . LEU A 1 572  ? -19.856 -34.639 52.458  1.00 39.04  ? 1934 LEU A CG     1 
ATOM   9291  C  CD1    . LEU A 1 572  ? -19.579 -33.141 52.398  1.00 39.67  ? 1934 LEU A CD1    1 
ATOM   9292  C  CD2    . LEU A 1 572  ? -19.015 -35.275 53.548  1.00 39.44  ? 1934 LEU A CD2    1 
ATOM   9293  H  H      . LEU A 1 572  ? -21.435 -36.263 50.602  1.00 44.99  ? 1934 LEU A H      1 
ATOM   9294  H  HA     . LEU A 1 572  ? -21.212 -36.908 53.110  1.00 46.39  ? 1934 LEU A HA     1 
ATOM   9295  H  HB2    . LEU A 1 572  ? -21.832 -34.405 51.972  1.00 47.13  ? 1934 LEU A HB2    1 
ATOM   9296  H  HB3    . LEU A 1 572  ? -21.602 -34.590 53.528  1.00 47.13  ? 1934 LEU A HB3    1 
ATOM   9297  H  HG     . LEU A 1 572  ? -19.576 -35.022 51.612  1.00 46.85  ? 1934 LEU A HG     1 
ATOM   9298  H  HD11   . LEU A 1 572  ? -18.626 -33.002 52.279  1.00 47.61  ? 1934 LEU A HD11   1 
ATOM   9299  H  HD12   . LEU A 1 572  ? -20.066 -32.760 51.651  1.00 47.61  ? 1934 LEU A HD12   1 
ATOM   9300  H  HD13   . LEU A 1 572  ? -19.872 -32.733 53.228  1.00 47.61  ? 1934 LEU A HD13   1 
ATOM   9301  H  HD21   . LEU A 1 572  ? -18.080 -35.072 53.384  1.00 47.33  ? 1934 LEU A HD21   1 
ATOM   9302  H  HD22   . LEU A 1 572  ? -19.286 -34.914 54.406  1.00 47.33  ? 1934 LEU A HD22   1 
ATOM   9303  H  HD23   . LEU A 1 572  ? -19.153 -36.235 53.534  1.00 47.33  ? 1934 LEU A HD23   1 
ATOM   9304  N  N      . GLN A 1 573  ? -24.175 -36.487 52.061  1.00 35.68  ? 1935 GLN A N      1 
ATOM   9305  C  CA     . GLN A 1 573  ? -25.600 -36.660 52.350  1.00 36.13  ? 1935 GLN A CA     1 
ATOM   9306  C  C      . GLN A 1 573  ? -25.987 -38.114 52.630  1.00 35.90  ? 1935 GLN A C      1 
ATOM   9307  O  O      . GLN A 1 573  ? -26.928 -38.360 53.376  1.00 36.61  ? 1935 GLN A O      1 
ATOM   9308  C  CB     . GLN A 1 573  ? -26.461 -36.129 51.197  1.00 35.74  ? 1935 GLN A CB     1 
ATOM   9309  C  CG     . GLN A 1 573  ? -27.971 -36.269 51.419  1.00 36.22  ? 1935 GLN A CG     1 
ATOM   9310  C  CD     . GLN A 1 573  ? -28.703 -34.952 51.405  1.00 36.94  ? 1935 GLN A CD     1 
ATOM   9311  O  OE1    . GLN A 1 573  ? -28.558 -34.148 50.482  1.00 36.63  ? 1935 GLN A OE1    1 
ATOM   9312  N  NE2    . GLN A 1 573  ? -29.501 -34.720 52.442  1.00 38.00  ? 1935 GLN A NE2    1 
ATOM   9313  H  H