data_4WCI
# 
_entry.id   4WCI 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4WCI         
WWPDB D_1000203544 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          3U23 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4WCI 
_pdbx_database_status.recvd_initial_deposition_date   2014-09-04 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Rouka, E.'                            1  
'Simister, P.C.'                       2  
'Janning, M.'                          3  
'Kirsch, K.H.'                         4  
'Krojer, T.'                           5  
'Knapp, S.'                            6  
'von Delft, F.'                        7  
'Arrowsmith, C.H.'                     8  
'Edwards, A.M.'                        9  
'Bountra, C.'                          10 
'Feller, S.M.'                         11 
'Structural Genomics Consortium (SGC)' 12 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            290 
_citation.language                  ? 
_citation.page_first                25275 
_citation.page_last                 25292 
_citation.title                     
;Differential Recognition Preferences of the Three Src Homology 3 (SH3) Domains from the Adaptor CD2-associated Protein (CD2AP) and Direct Association with Ras and Rab Interactor 3 (RIN3).
;
_citation.year                      2015 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.M115.637207 
_citation.pdbx_database_id_PubMed   26296892 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Rouka, E.'        1  
primary 'Simister, P.C.'   2  
primary 'Janning, M.'      3  
primary 'Kumbrink, J.'     4  
primary 'Konstantinou, T.' 5  
primary 'Muniz, J.R.'      6  
primary 'Joshi, D.'        7  
primary 
;O'Reilly, N.
;
8  
primary 'Volkmer, R.'      9  
primary 'Ritter, B.'       10 
primary 'Knapp, S.'        11 
primary 'von Delft, F.'    12 
primary 'Kirsch, K.H.'     13 
primary 'Feller, S.M.'     14 
# 
_cell.entry_id           4WCI 
_cell.length_a           95.526 
_cell.length_b           55.362 
_cell.length_c           64.557 
_cell.angle_alpha        90.00 
_cell.angle_beta         131.72 
_cell.angle_gamma        90.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4WCI 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'CD2-associated protein'   7593.522 3   ? ? 'UNP residues 1-60' ? 
2 polymer     syn 'Ras and Rab interactor 3' 1825.143 3   ? ? ?                   ? 
3 non-polymer syn 'SULFATE ION'              96.063   2   ? ? ?                   ? 
4 water       nat water                      18.015   279 ? ? ?                   ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Adapter protein CMS,Cas ligand with multiple SH3 domains' 
2 'Ras interaction/interference protein 3'                   
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no GPLGSMVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE 
GPLGSMVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE A,C,E ? 
2 'polypeptide(L)' no no AKKNLPTAPPRRRVSE                                                  AKKNLPTAPPRRRVSE B,D,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  LEU n 
1 4  GLY n 
1 5  SER n 
1 6  MET n 
1 7  VAL n 
1 8  ASP n 
1 9  TYR n 
1 10 ILE n 
1 11 VAL n 
1 12 GLU n 
1 13 TYR n 
1 14 ASP n 
1 15 TYR n 
1 16 ASP n 
1 17 ALA n 
1 18 VAL n 
1 19 HIS n 
1 20 ASP n 
1 21 ASP n 
1 22 GLU n 
1 23 LEU n 
1 24 THR n 
1 25 ILE n 
1 26 ARG n 
1 27 VAL n 
1 28 GLY n 
1 29 GLU n 
1 30 ILE n 
1 31 ILE n 
1 32 ARG n 
1 33 ASN n 
1 34 VAL n 
1 35 LYS n 
1 36 LYS n 
1 37 LEU n 
1 38 GLN n 
1 39 GLU n 
1 40 GLU n 
1 41 GLY n 
1 42 TRP n 
1 43 LEU n 
1 44 GLU n 
1 45 GLY n 
1 46 GLU n 
1 47 LEU n 
1 48 ASN n 
1 49 GLY n 
1 50 ARG n 
1 51 ARG n 
1 52 GLY n 
1 53 MET n 
1 54 PHE n 
1 55 PRO n 
1 56 ASP n 
1 57 ASN n 
1 58 PHE n 
1 59 VAL n 
1 60 LYS n 
1 61 GLU n 
1 62 ILE n 
1 63 LYS n 
1 64 ARG n 
1 65 GLU n 
2 1  ALA n 
2 2  LYS n 
2 3  LYS n 
2 4  ASN n 
2 5  LEU n 
2 6  PRO n 
2 7  THR n 
2 8  ALA n 
2 9  PRO n 
2 10 PRO n 
2 11 ARG n 
2 12 ARG n 
2 13 ARG n 
2 14 VAL n 
2 15 SER n 
2 16 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   65 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 CD2AP 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-6P-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_pdbx_entity_src_syn.entity_id              2 
_pdbx_entity_src_syn.pdbx_src_id            1 
_pdbx_entity_src_syn.pdbx_alt_source_flag   sample 
_pdbx_entity_src_syn.pdbx_beg_seq_num       1 
_pdbx_entity_src_syn.pdbx_end_seq_num       16 
_pdbx_entity_src_syn.organism_scientific    'Homo sapiens' 
_pdbx_entity_src_syn.organism_common_name   Human 
_pdbx_entity_src_syn.ncbi_taxonomy_id       9606 
_pdbx_entity_src_syn.details                ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CD2AP_HUMAN Q9Y5K6 ? 1 MVDYIVEYDYDAVHDDELTIRVGEIIRNVKKLQEEGWLEGELNGRRGMFPDNFVKEIKRE 1   
2 UNP RIN3_HUMAN  Q8TB24 ? 2 AKKNLPTAPPRRRVSE                                             378 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4WCI A 6 ? 65 ? Q9Y5K6 1   ? 60  ? 1   60  
2 2 4WCI B 1 ? 16 ? Q8TB24 378 ? 393 ? 378 393 
3 1 4WCI C 6 ? 65 ? Q9Y5K6 1   ? 60  ? 1   60  
4 2 4WCI D 1 ? 16 ? Q8TB24 378 ? 393 ? 378 393 
5 1 4WCI E 6 ? 65 ? Q9Y5K6 1   ? 60  ? 1   60  
6 2 4WCI F 1 ? 16 ? Q8TB24 378 ? 393 ? 378 393 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4WCI GLY A 1 ? UNP Q9Y5K6 ? ? 'expression tag' -4 1  
1 4WCI PRO A 2 ? UNP Q9Y5K6 ? ? 'expression tag' -3 2  
1 4WCI LEU A 3 ? UNP Q9Y5K6 ? ? 'expression tag' -2 3  
1 4WCI GLY A 4 ? UNP Q9Y5K6 ? ? 'expression tag' -1 4  
1 4WCI SER A 5 ? UNP Q9Y5K6 ? ? 'expression tag' 0  5  
3 4WCI GLY C 1 ? UNP Q9Y5K6 ? ? 'expression tag' -4 6  
3 4WCI PRO C 2 ? UNP Q9Y5K6 ? ? 'expression tag' -3 7  
3 4WCI LEU C 3 ? UNP Q9Y5K6 ? ? 'expression tag' -2 8  
3 4WCI GLY C 4 ? UNP Q9Y5K6 ? ? 'expression tag' -1 9  
3 4WCI SER C 5 ? UNP Q9Y5K6 ? ? 'expression tag' 0  10 
5 4WCI GLY E 1 ? UNP Q9Y5K6 ? ? 'expression tag' -4 11 
5 4WCI PRO E 2 ? UNP Q9Y5K6 ? ? 'expression tag' -3 12 
5 4WCI LEU E 3 ? UNP Q9Y5K6 ? ? 'expression tag' -2 13 
5 4WCI GLY E 4 ? UNP Q9Y5K6 ? ? 'expression tag' -1 14 
5 4WCI SER E 5 ? UNP Q9Y5K6 ? ? 'expression tag' 0  15 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4WCI 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.25 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         45.45 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M Ca(ac) pH 4.2, 0.2 M Li2SO4 and 25% PEG 10 000' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'PSI PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2011-12-20 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9173 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9173 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4WCI 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.65 
_reflns.d_resolution_low                 48.19 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       29731 
_reflns.number_obs                       29622 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             97.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.5 
_reflns.pdbx_Rmerge_I_obs                0.132 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.65 
_reflns_shell.d_res_low                   1.74 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.4 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        93.0 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.479 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             3.5 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4WCI 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.650 
_refine.ls_d_res_low                             48.186 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     29619 
_refine.ls_number_reflns_R_free                  1505 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    97.50 
_refine.ls_percent_reflns_R_free                 5.08 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1938 
_refine.ls_R_factor_R_free                       0.2188 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1924 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2J6F 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 22.80 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.20 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1737 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             279 
_refine_hist.number_atoms_total               2026 
_refine_hist.d_res_high                       1.650 
_refine_hist.d_res_low                        48.186 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.007  ? 1868 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.010  ? 2535 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 12.054 ? 749  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.044  ? 267  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005  ? 336  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 1.6500 1.7033  . . 139 2351 91.00 . . . 0.3212 . 0.2777 . . . . . . . . 
'X-RAY DIFFRACTION' 1.7033 1.7641  . . 145 2497 97.00 . . . 0.2955 . 0.2445 . . . . . . . . 
'X-RAY DIFFRACTION' 1.7641 1.8348  . . 135 2583 98.00 . . . 0.2679 . 0.2198 . . . . . . . . 
'X-RAY DIFFRACTION' 1.8348 1.9183  . . 133 2575 99.00 . . . 0.2196 . 0.1938 . . . . . . . . 
'X-RAY DIFFRACTION' 1.9183 2.0194  . . 114 2505 96.00 . . . 0.1973 . 0.1900 . . . . . . . . 
'X-RAY DIFFRACTION' 2.0194 2.1459  . . 137 2615 99.00 . . . 0.1944 . 0.1795 . . . . . . . . 
'X-RAY DIFFRACTION' 2.1459 2.3116  . . 155 2585 99.00 . . . 0.2362 . 0.1840 . . . . . . . . 
'X-RAY DIFFRACTION' 2.3116 2.5442  . . 143 2575 99.00 . . . 0.2211 . 0.1852 . . . . . . . . 
'X-RAY DIFFRACTION' 2.5442 2.9124  . . 118 2572 97.00 . . . 0.1974 . 0.1867 . . . . . . . . 
'X-RAY DIFFRACTION' 2.9124 3.6691  . . 135 2629 99.00 . . . 0.1757 . 0.1700 . . . . . . . . 
'X-RAY DIFFRACTION' 3.6691 48.2063 . . 151 2627 98.00 . . . 0.2258 . 0.1970 . . . . . . . . 
# 
_struct.entry_id                     4WCI 
_struct.title                        
'Crystal structure of the 1st SH3 domain from human CD2AP (CMS) in complex with a proline-rich peptide (aa 378-393) from human RIN3' 
_struct.pdbx_descriptor              'CD2-associated protein (CD2AP) SH3 domain 1, Ras and Rab interactor 3 (RIN3)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4WCI 
_struct_keywords.text            
;Endocytosis Adaptor protein Protein-peptide binary complex Kidney, signaling protein, Structural Genomics, Structural Genomics Consortium, SGC
;
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 4 ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 5 ? 
AA3 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA3 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 50 ? PRO A 55 ? ARG A 45 PRO A 50 
AA1 2 TRP A 42 ? LEU A 47 ? TRP A 37 LEU A 42 
AA1 3 ILE A 30 ? LYS A 35 ? ILE A 25 LYS A 30 
AA1 4 TYR A 9  ? VAL A 11 ? TYR A 4  VAL A 6  
AA1 5 VAL A 59 ? GLU A 61 ? VAL A 54 GLU A 56 
AA2 1 ARG C 50 ? PRO C 55 ? ARG C 45 PRO C 50 
AA2 2 TRP C 42 ? LEU C 47 ? TRP C 37 LEU C 42 
AA2 3 ILE C 30 ? LYS C 35 ? ILE C 25 LYS C 30 
AA2 4 TYR C 9  ? VAL C 11 ? TYR C 4  VAL C 6  
AA2 5 VAL C 59 ? GLU C 61 ? VAL C 54 GLU C 56 
AA3 1 ARG E 50 ? PRO E 55 ? ARG E 45 PRO E 50 
AA3 2 TRP E 42 ? LEU E 47 ? TRP E 37 LEU E 42 
AA3 3 ILE E 30 ? LYS E 35 ? ILE E 25 LYS E 30 
AA3 4 TYR E 9  ? VAL E 11 ? TYR E 4  VAL E 6  
AA3 5 VAL E 59 ? GLU E 61 ? VAL E 54 GLU E 56 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O ARG A 50 ? O ARG A 45 N LEU A 47 ? N LEU A 42 
AA1 2 3 O GLU A 46 ? O GLU A 41 N ARG A 32 ? N ARG A 27 
AA1 3 4 O ILE A 31 ? O ILE A 26 N TYR A 9  ? N TYR A 4  
AA1 4 5 N ILE A 10 ? N ILE A 5  O LYS A 60 ? O LYS A 55 
AA2 1 2 O ARG C 50 ? O ARG C 45 N LEU C 47 ? N LEU C 42 
AA2 2 3 O GLU C 46 ? O GLU C 41 N ARG C 32 ? N ARG C 27 
AA2 3 4 O ILE C 31 ? O ILE C 26 N TYR C 9  ? N TYR C 4  
AA2 4 5 N ILE C 10 ? N ILE C 5  O LYS C 60 ? O LYS C 55 
AA3 1 2 O ARG E 50 ? O ARG E 45 N LEU E 47 ? N LEU E 42 
AA3 2 3 O GLU E 46 ? O GLU E 41 N ARG E 32 ? N ARG E 27 
AA3 3 4 O ILE E 31 ? O ILE E 26 N TYR E 9  ? N TYR E 4  
AA3 4 5 N ILE E 10 ? N ILE E 5  O LYS E 60 ? O LYS E 55 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 101 ? 9 'binding site for residue SO4 A 101' 
AC2 Software C SO4 101 ? 3 'binding site for residue SO4 C 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 9 ARG A 32 ? ARG A 27  . ? 1_555 ? 
2  AC1 9 HOH I .  ? HOH A 232 . ? 1_555 ? 
3  AC1 9 HOH I .  ? HOH A 234 . ? 1_555 ? 
4  AC1 9 HOH I .  ? HOH A 237 . ? 1_555 ? 
5  AC1 9 ARG C 32 ? ARG C 27  . ? 1_555 ? 
6  AC1 9 HOH K .  ? HOH C 236 . ? 1_555 ? 
7  AC1 9 HOH K .  ? HOH C 248 . ? 1_555 ? 
8  AC1 9 ARG E 32 ? ARG E 27  . ? 1_555 ? 
9  AC1 9 HOH M .  ? HOH E 130 . ? 1_555 ? 
10 AC2 3 ARG A 32 ? ARG A 27  . ? 1_555 ? 
11 AC2 3 ARG C 32 ? ARG C 27  . ? 1_555 ? 
12 AC2 3 ARG E 32 ? ARG E 27  . ? 1_555 ? 
# 
_atom_sites.entry_id                    4WCI 
_atom_sites.fract_transf_matrix[1][1]   0.010468 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.009334 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018063 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020753 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 5  ? -15.981 -6.356  -23.331 0.68 40.82 ? 0   SER A N   1 
ATOM   2    C CA  . SER A 1 5  ? -14.760 -6.881  -22.738 0.89 37.66 ? 0   SER A CA  1 
ATOM   3    C C   . SER A 1 5  ? -14.281 -5.975  -21.611 1.00 33.74 ? 0   SER A C   1 
ATOM   4    O O   . SER A 1 5  ? -14.990 -5.058  -21.186 1.00 36.46 ? 0   SER A O   1 
ATOM   5    C CB  . SER A 1 5  ? -13.667 -7.040  -23.797 1.00 37.27 ? 0   SER A CB  1 
ATOM   6    O OG  . SER A 1 5  ? -12.437 -7.419  -23.202 0.46 35.87 ? 0   SER A OG  1 
ATOM   7    N N   . MET A 1 6  ? -13.065 -6.211  -21.138 1.00 27.93 ? 1   MET A N   1 
ATOM   8    C CA  A MET A 1 6  ? -12.564 -5.467  -19.991 0.55 25.20 ? 1   MET A CA  1 
ATOM   9    C CA  B MET A 1 6  ? -12.545 -5.486  -19.985 0.45 24.91 ? 1   MET A CA  1 
ATOM   10   C C   . MET A 1 6  ? -11.768 -4.230  -20.365 1.00 23.93 ? 1   MET A C   1 
ATOM   11   O O   . MET A 1 6  ? -11.046 -4.213  -21.357 1.00 26.70 ? 1   MET A O   1 
ATOM   12   C CB  A MET A 1 6  ? -11.702 -6.362  -19.120 0.55 23.81 ? 1   MET A CB  1 
ATOM   13   C CB  B MET A 1 6  ? -11.653 -6.402  -19.153 0.45 23.54 ? 1   MET A CB  1 
ATOM   14   C CG  A MET A 1 6  ? -12.508 -7.293  -18.262 0.55 23.21 ? 1   MET A CG  1 
ATOM   15   C CG  B MET A 1 6  ? -12.338 -7.684  -18.714 0.45 24.22 ? 1   MET A CG  1 
ATOM   16   S SD  A MET A 1 6  ? -11.472 -7.884  -16.944 0.55 21.19 ? 1   MET A SD  1 
ATOM   17   S SD  B MET A 1 6  ? -11.326 -8.592  -17.541 0.45 20.94 ? 1   MET A SD  1 
ATOM   18   C CE  A MET A 1 6  ? -12.333 -9.384  -16.496 0.55 17.75 ? 1   MET A CE  1 
ATOM   19   C CE  B MET A 1 6  ? -10.828 -7.244  -16.481 0.45 16.83 ? 1   MET A CE  1 
ATOM   20   N N   . VAL A 1 7  ? -11.912 -3.204  -19.540 1.00 13.85 ? 2   VAL A N   1 
ATOM   21   C CA  . VAL A 1 7  ? -11.226 -1.934  -19.718 1.00 13.35 ? 2   VAL A CA  1 
ATOM   22   C C   . VAL A 1 7  ? -10.203 -1.749  -18.612 1.00 15.54 ? 2   VAL A C   1 
ATOM   23   O O   . VAL A 1 7  ? -10.520 -1.972  -17.448 1.00 14.42 ? 2   VAL A O   1 
ATOM   24   C CB  . VAL A 1 7  ? -12.223 -0.759  -19.692 1.00 17.31 ? 2   VAL A CB  1 
ATOM   25   C CG1 . VAL A 1 7  ? -11.475 0.574   -19.718 1.00 19.26 ? 2   VAL A CG1 1 
ATOM   26   C CG2 . VAL A 1 7  ? -13.203 -0.867  -20.862 1.00 19.45 ? 2   VAL A CG2 1 
ATOM   27   N N   . ASP A 1 8  ? -8.980  -1.361  -18.979 1.00 12.17 ? 3   ASP A N   1 
ATOM   28   C CA  . ASP A 1 8  ? -7.919  -1.065  -18.014 1.00 11.28 ? 3   ASP A CA  1 
ATOM   29   C C   . ASP A 1 8  ? -7.474  0.373   -18.179 1.00 11.39 ? 3   ASP A C   1 
ATOM   30   O O   . ASP A 1 8  ? -7.621  0.945   -19.256 1.00 13.68 ? 3   ASP A O   1 
ATOM   31   C CB  . ASP A 1 8  ? -6.698  -1.974  -18.209 1.00 14.16 ? 3   ASP A CB  1 
ATOM   32   C CG  . ASP A 1 8  ? -7.021  -3.432  -18.021 1.00 17.98 ? 3   ASP A CG  1 
ATOM   33   O OD1 . ASP A 1 8  ? -7.989  -3.752  -17.302 1.00 19.64 ? 3   ASP A OD1 1 
ATOM   34   O OD2 . ASP A 1 8  ? -6.315  -4.261  -18.629 1.00 18.78 ? 3   ASP A OD2 1 
ATOM   35   N N   . TYR A 1 9  ? -6.917  0.940   -17.115 1.00 10.17 ? 4   TYR A N   1 
ATOM   36   C CA  . TYR A 1 9  ? -6.413  2.319   -17.117 1.00 10.00 ? 4   TYR A CA  1 
ATOM   37   C C   . TYR A 1 9  ? -4.989  2.359   -16.573 1.00 12.89 ? 4   TYR A C   1 
ATOM   38   O O   . TYR A 1 9  ? -4.633  1.577   -15.689 1.00 13.25 ? 4   TYR A O   1 
ATOM   39   C CB  . TYR A 1 9  ? -7.307  3.224   -16.254 1.00 11.48 ? 4   TYR A CB  1 
ATOM   40   C CG  . TYR A 1 9  ? -8.438  3.908   -16.981 1.00 11.18 ? 4   TYR A CG  1 
ATOM   41   C CD1 . TYR A 1 9  ? -8.419  5.279   -17.199 1.00 12.77 ? 4   TYR A CD1 1 
ATOM   42   C CD2 . TYR A 1 9  ? -9.520  3.190   -17.455 1.00 10.27 ? 4   TYR A CD2 1 
ATOM   43   C CE1 . TYR A 1 9  ? -9.458  5.917   -17.849 1.00 13.38 ? 4   TYR A CE1 1 
ATOM   44   C CE2 . TYR A 1 9  ? -10.558 3.816   -18.115 1.00 13.83 ? 4   TYR A CE2 1 
ATOM   45   C CZ  . TYR A 1 9  ? -10.522 5.180   -18.308 1.00 13.10 ? 4   TYR A CZ  1 
ATOM   46   O OH  . TYR A 1 9  ? -11.560 5.811   -18.968 1.00 13.17 ? 4   TYR A OH  1 
ATOM   47   N N   . ILE A 1 10 ? -4.181  3.283   -17.083 1.00 10.87 ? 5   ILE A N   1 
ATOM   48   C CA  . ILE A 1 10 ? -2.846  3.530   -16.534 1.00 11.86 ? 5   ILE A CA  1 
ATOM   49   C C   . ILE A 1 10 ? -2.892  4.725   -15.598 1.00 11.57 ? 5   ILE A C   1 
ATOM   50   O O   . ILE A 1 10 ? -3.506  5.741   -15.915 1.00 10.14 ? 5   ILE A O   1 
ATOM   51   C CB  . ILE A 1 10 ? -1.817  3.811   -17.640 1.00 15.45 ? 5   ILE A CB  1 
ATOM   52   C CG1 . ILE A 1 10 ? -1.810  2.698   -18.679 1.00 19.06 ? 5   ILE A CG1 1 
ATOM   53   C CG2 . ILE A 1 10 ? -0.413  4.027   -17.042 1.00 17.06 ? 5   ILE A CG2 1 
ATOM   54   C CD1 . ILE A 1 10 ? -0.974  3.045   -19.886 1.00 20.00 ? 5   ILE A CD1 1 
ATOM   55   N N   . VAL A 1 11 ? -2.256  4.610   -14.439 1.00 10.76 ? 6   VAL A N   1 
ATOM   56   C CA  . VAL A 1 11 ? -2.170  5.748   -13.529 1.00 10.32 ? 6   VAL A CA  1 
ATOM   57   C C   . VAL A 1 11 ? -1.076  6.722   -13.977 1.00 11.39 ? 6   VAL A C   1 
ATOM   58   O O   . VAL A 1 11 ? 0.090   6.343   -14.156 1.00 12.02 ? 6   VAL A O   1 
ATOM   59   C CB  . VAL A 1 11 ? -1.914  5.279   -12.077 1.00 9.65  ? 6   VAL A CB  1 
ATOM   60   C CG1 . VAL A 1 11 ? -1.853  6.475   -11.134 1.00 9.81  ? 6   VAL A CG1 1 
ATOM   61   C CG2 . VAL A 1 11 ? -2.993  4.307   -11.644 1.00 10.04 ? 6   VAL A CG2 1 
ATOM   62   N N   . GLU A 1 12 ? -1.457  7.981   -14.176 1.00 11.48 ? 7   GLU A N   1 
ATOM   63   C CA  . GLU A 1 12 ? -0.515  8.981   -14.669 1.00 11.23 ? 7   GLU A CA  1 
ATOM   64   C C   . GLU A 1 12 ? -0.107  9.971   -13.595 1.00 10.56 ? 7   GLU A C   1 
ATOM   65   O O   . GLU A 1 12 ? 0.926   10.637  -13.725 1.00 14.45 ? 7   GLU A O   1 
ATOM   66   C CB  . GLU A 1 12 ? -1.109  9.745   -15.860 1.00 11.19 ? 7   GLU A CB  1 
ATOM   67   C CG  . GLU A 1 12 ? -1.434  8.887   -17.069 1.00 13.15 ? 7   GLU A CG  1 
ATOM   68   C CD  . GLU A 1 12 ? -0.203  8.390   -17.812 1.00 15.60 ? 7   GLU A CD  1 
ATOM   69   O OE1 . GLU A 1 12 ? 0.912   8.917   -17.585 1.00 15.29 ? 7   GLU A OE1 1 
ATOM   70   O OE2 . GLU A 1 12 ? -0.359  7.446   -18.619 1.00 18.32 ? 7   GLU A OE2 1 
ATOM   71   N N   . TYR A 1 13 ? -0.917  10.062  -12.548 1.00 9.85  ? 8   TYR A N   1 
ATOM   72   C CA  . TYR A 1 13 ? -0.658  10.960  -11.430 1.00 9.94  ? 8   TYR A CA  1 
ATOM   73   C C   . TYR A 1 13 ? -1.001  10.291  -10.112 1.00 9.31  ? 8   TYR A C   1 
ATOM   74   O O   . TYR A 1 13 ? -2.028  9.605   -10.014 1.00 9.51  ? 8   TYR A O   1 
ATOM   75   C CB  . TYR A 1 13 ? -1.479  12.253  -11.573 1.00 10.15 ? 8   TYR A CB  1 
ATOM   76   C CG  . TYR A 1 13 ? -1.139  13.050  -12.804 1.00 14.33 ? 8   TYR A CG  1 
ATOM   77   C CD1 . TYR A 1 13 ? -1.876  12.904  -13.974 1.00 14.84 ? 8   TYR A CD1 1 
ATOM   78   C CD2 . TYR A 1 13 ? -0.071  13.939  -12.805 1.00 16.78 ? 8   TYR A CD2 1 
ATOM   79   C CE1 . TYR A 1 13 ? -1.559  13.624  -15.105 1.00 16.04 ? 8   TYR A CE1 1 
ATOM   80   C CE2 . TYR A 1 13 ? 0.254   14.660  -13.934 1.00 17.70 ? 8   TYR A CE2 1 
ATOM   81   C CZ  . TYR A 1 13 ? -0.494  14.497  -15.080 1.00 19.60 ? 8   TYR A CZ  1 
ATOM   82   O OH  . TYR A 1 13 ? -0.179  15.206  -16.209 1.00 22.85 ? 8   TYR A OH  1 
ATOM   83   N N   . ASP A 1 14 ? -0.182  10.537  -9.092  1.00 10.12 ? 9   ASP A N   1 
ATOM   84   C CA  . ASP A 1 14 ? -0.448  10.039  -7.742  1.00 10.14 ? 9   ASP A CA  1 
ATOM   85   C C   . ASP A 1 14 ? -1.726  10.634  -7.163  1.00 11.40 ? 9   ASP A C   1 
ATOM   86   O O   . ASP A 1 14 ? -2.033  11.815  -7.379  1.00 13.20 ? 9   ASP A O   1 
ATOM   87   C CB  . ASP A 1 14 ? 0.710   10.368  -6.794  1.00 11.24 ? 9   ASP A CB  1 
ATOM   88   C CG  . ASP A 1 14 ? 2.005   9.658   -7.153  1.00 16.58 ? 9   ASP A CG  1 
ATOM   89   O OD1 . ASP A 1 14 ? 1.982   8.601   -7.817  1.00 13.93 ? 9   ASP A OD1 1 
ATOM   90   O OD2 . ASP A 1 14 ? 3.059   10.170  -6.737  1.00 17.87 ? 9   ASP A OD2 1 
ATOM   91   N N   . TYR A 1 15 ? -2.456  9.814   -6.416  1.00 10.77 ? 10  TYR A N   1 
ATOM   92   C CA  . TYR A 1 15 ? -3.632  10.256  -5.686  1.00 10.15 ? 10  TYR A CA  1 
ATOM   93   C C   . TYR A 1 15 ? -3.748  9.457   -4.396  1.00 11.92 ? 10  TYR A C   1 
ATOM   94   O O   . TYR A 1 15 ? -3.701  8.221   -4.413  1.00 10.29 ? 10  TYR A O   1 
ATOM   95   C CB  . TYR A 1 15 ? -4.899  10.095  -6.514  1.00 11.28 ? 10  TYR A CB  1 
ATOM   96   C CG  . TYR A 1 15 ? -6.151  10.513  -5.766  1.00 9.88  ? 10  TYR A CG  1 
ATOM   97   C CD1 . TYR A 1 15 ? -6.481  11.857  -5.644  1.00 8.43  ? 10  TYR A CD1 1 
ATOM   98   C CD2 . TYR A 1 15 ? -6.995  9.571   -5.188  1.00 10.12 ? 10  TYR A CD2 1 
ATOM   99   C CE1 . TYR A 1 15 ? -7.628  12.259  -4.969  1.00 12.64 ? 10  TYR A CE1 1 
ATOM   100  C CE2 . TYR A 1 15 ? -8.151  9.964   -4.499  1.00 9.73  ? 10  TYR A CE2 1 
ATOM   101  C CZ  . TYR A 1 15 ? -8.451  11.318  -4.395  1.00 10.67 ? 10  TYR A CZ  1 
ATOM   102  O OH  . TYR A 1 15 ? -9.582  11.743  -3.725  1.00 13.92 ? 10  TYR A OH  1 
ATOM   103  N N   . ASP A 1 16 ? -3.890  10.171  -3.284  1.00 11.68 ? 11  ASP A N   1 
ATOM   104  C CA  . ASP A 1 16 ? -4.151  9.553   -1.987  1.00 10.93 ? 11  ASP A CA  1 
ATOM   105  C C   . ASP A 1 16 ? -5.645  9.565   -1.689  1.00 9.37  ? 11  ASP A C   1 
ATOM   106  O O   . ASP A 1 16 ? -6.275  10.624  -1.759  1.00 10.48 ? 11  ASP A O   1 
ATOM   107  C CB  . ASP A 1 16 ? -3.428  10.307  -0.871  1.00 12.81 ? 11  ASP A CB  1 
ATOM   108  C CG  . ASP A 1 16 ? -1.934  10.038  -0.836  1.00 14.53 ? 11  ASP A CG  1 
ATOM   109  O OD1 . ASP A 1 16 ? -1.279  10.583  0.079   1.00 14.23 ? 11  ASP A OD1 1 
ATOM   110  O OD2 . ASP A 1 16 ? -1.425  9.281   -1.694  1.00 14.20 ? 11  ASP A OD2 1 
ATOM   111  N N   . ALA A 1 17 ? -6.197  8.410   -1.319  1.00 9.51  ? 12  ALA A N   1 
ATOM   112  C CA  . ALA A 1 17 ? -7.618  8.312   -0.946  1.00 11.95 ? 12  ALA A CA  1 
ATOM   113  C C   . ALA A 1 17 ? -8.026  9.311   0.144   1.00 13.60 ? 12  ALA A C   1 
ATOM   114  O O   . ALA A 1 17 ? -7.345  9.450   1.168   1.00 15.68 ? 12  ALA A O   1 
ATOM   115  C CB  . ALA A 1 17 ? -7.945  6.887   -0.489  1.00 11.42 ? 12  ALA A CB  1 
ATOM   116  N N   . VAL A 1 18 ? -9.155  9.989   -0.082  1.00 12.86 ? 13  VAL A N   1 
ATOM   117  C CA  . VAL A 1 18 ? -9.713  10.951  0.869   1.00 13.90 ? 13  VAL A CA  1 
ATOM   118  C C   . VAL A 1 18 ? -10.974 10.376  1.535   1.00 13.17 ? 13  VAL A C   1 
ATOM   119  O O   . VAL A 1 18 ? -11.371 10.795  2.622   1.00 16.22 ? 13  VAL A O   1 
ATOM   120  C CB  . VAL A 1 18 ? -10.039 12.303  0.162   1.00 19.92 ? 13  VAL A CB  1 
ATOM   121  C CG1 . VAL A 1 18 ? -10.693 13.281  1.115   1.00 22.17 ? 13  VAL A CG1 1 
ATOM   122  C CG2 . VAL A 1 18 ? -8.772  12.891  -0.432  1.00 21.60 ? 13  VAL A CG2 1 
ATOM   123  N N   . HIS A 1 19 ? -11.586 9.404   0.869   1.00 13.04 ? 14  HIS A N   1 
ATOM   124  C CA  . HIS A 1 19 ? -12.723 8.659   1.410   1.00 12.21 ? 14  HIS A CA  1 
ATOM   125  C C   . HIS A 1 19 ? -12.426 7.172   1.304   1.00 10.61 ? 14  HIS A C   1 
ATOM   126  O O   . HIS A 1 19 ? -11.629 6.771   0.479   1.00 9.95  ? 14  HIS A O   1 
ATOM   127  C CB  . HIS A 1 19 ? -14.012 8.998   0.664   1.00 13.00 ? 14  HIS A CB  1 
ATOM   128  C CG  . HIS A 1 19 ? -14.345 10.454  0.685   1.00 15.84 ? 14  HIS A CG  1 
ATOM   129  N ND1 . HIS A 1 19 ? -14.100 11.291  -0.381  1.00 18.31 ? 14  HIS A ND1 1 
ATOM   130  C CD2 . HIS A 1 19 ? -14.858 11.232  1.663   1.00 18.78 ? 14  HIS A CD2 1 
ATOM   131  C CE1 . HIS A 1 19 ? -14.474 12.518  -0.070  1.00 18.35 ? 14  HIS A CE1 1 
ATOM   132  N NE2 . HIS A 1 19 ? -14.929 12.512  1.172   1.00 18.18 ? 14  HIS A NE2 1 
ATOM   133  N N   . ASP A 1 20 ? -13.083 6.358   2.120   1.00 12.46 ? 15  ASP A N   1 
ATOM   134  C CA  . ASP A 1 20 ? -12.683 4.958   2.259   1.00 11.33 ? 15  ASP A CA  1 
ATOM   135  C C   . ASP A 1 20 ? -12.993 4.109   1.027   1.00 11.21 ? 15  ASP A C   1 
ATOM   136  O O   . ASP A 1 20 ? -12.415 3.033   0.858   1.00 11.63 ? 15  ASP A O   1 
ATOM   137  C CB  . ASP A 1 20 ? -13.345 4.347   3.494   1.00 12.55 ? 15  ASP A CB  1 
ATOM   138  C CG  . ASP A 1 20 ? -12.714 4.821   4.787   1.00 15.89 ? 15  ASP A CG  1 
ATOM   139  O OD1 . ASP A 1 20 ? -13.076 4.279   5.840   1.00 17.42 ? 15  ASP A OD1 1 
ATOM   140  O OD2 . ASP A 1 20 ? -11.850 5.721   4.747   1.00 15.10 ? 15  ASP A OD2 1 
ATOM   141  N N   . ASP A 1 21 ? -13.867 4.594   0.148   1.00 11.51 ? 16  ASP A N   1 
ATOM   142  C CA  . ASP A 1 21 ? -14.168 3.844   -1.068  1.00 11.16 ? 16  ASP A CA  1 
ATOM   143  C C   . ASP A 1 21 ? -13.220 4.191   -2.217  1.00 11.01 ? 16  ASP A C   1 
ATOM   144  O O   . ASP A 1 21 ? -13.366 3.670   -3.321  1.00 12.80 ? 16  ASP A O   1 
ATOM   145  C CB  . ASP A 1 21 ? -15.637 4.063   -1.473  1.00 11.78 ? 16  ASP A CB  1 
ATOM   146  C CG  . ASP A 1 21 ? -15.933 5.494   -1.884  1.00 14.14 ? 16  ASP A CG  1 
ATOM   147  O OD1 . ASP A 1 21 ? -17.025 5.731   -2.458  1.00 15.28 ? 16  ASP A OD1 1 
ATOM   148  O OD2 . ASP A 1 21 ? -15.078 6.374   -1.653  1.00 12.99 ? 16  ASP A OD2 1 
ATOM   149  N N   . GLU A 1 22 ? -12.217 5.028   -1.944  1.00 9.04  ? 17  GLU A N   1 
ATOM   150  C CA  . GLU A 1 22 ? -11.289 5.453   -2.984  1.00 8.04  ? 17  GLU A CA  1 
ATOM   151  C C   . GLU A 1 22 ? -9.984  4.669   -2.971  1.00 10.14 ? 17  GLU A C   1 
ATOM   152  O O   . GLU A 1 22 ? -9.494  4.255   -1.918  1.00 11.53 ? 17  GLU A O   1 
ATOM   153  C CB  . GLU A 1 22 ? -10.970 6.945   -2.843  1.00 9.26  ? 17  GLU A CB  1 
ATOM   154  C CG  . GLU A 1 22 ? -12.195 7.837   -3.001  1.00 9.69  ? 17  GLU A CG  1 
ATOM   155  C CD  . GLU A 1 22 ? -11.901 9.288   -2.719  1.00 11.62 ? 17  GLU A CD  1 
ATOM   156  O OE1 . GLU A 1 22 ? -10.729 9.632   -2.486  1.00 11.36 ? 17  GLU A OE1 1 
ATOM   157  O OE2 . GLU A 1 22 ? -12.865 10.085  -2.739  1.00 12.53 ? 17  GLU A OE2 1 
ATOM   158  N N   . LEU A 1 23 ? -9.426  4.465   -4.159  1.00 8.83  ? 18  LEU A N   1 
ATOM   159  C CA  . LEU A 1 23 ? -8.094  3.894   -4.280  1.00 9.63  ? 18  LEU A CA  1 
ATOM   160  C C   . LEU A 1 23 ? -7.029  4.930   -3.958  1.00 8.02  ? 18  LEU A C   1 
ATOM   161  O O   . LEU A 1 23 ? -7.215  6.124   -4.203  1.00 8.83  ? 18  LEU A O   1 
ATOM   162  C CB  . LEU A 1 23 ? -7.850  3.375   -5.699  1.00 8.24  ? 18  LEU A CB  1 
ATOM   163  C CG  . LEU A 1 23 ? -8.721  2.245   -6.233  1.00 8.37  ? 18  LEU A CG  1 
ATOM   164  C CD1 . LEU A 1 23 ? -8.279  1.891   -7.667  1.00 9.77  ? 18  LEU A CD1 1 
ATOM   165  C CD2 . LEU A 1 23 ? -8.647  1.030   -5.315  1.00 8.94  ? 18  LEU A CD2 1 
ATOM   166  N N   . THR A 1 24 ? -5.907  4.453   -3.430  1.00 7.89  ? 19  THR A N   1 
ATOM   167  C CA  . THR A 1 24 ? -4.671  5.222   -3.408  1.00 9.65  ? 19  THR A CA  1 
ATOM   168  C C   . THR A 1 24 ? -3.853  4.690   -4.572  1.00 7.95  ? 19  THR A C   1 
ATOM   169  O O   . THR A 1 24 ? -3.630  3.478   -4.688  1.00 13.54 ? 19  THR A O   1 
ATOM   170  C CB  . THR A 1 24 ? -3.931  5.076   -2.082  1.00 9.59  ? 19  THR A CB  1 
ATOM   171  O OG1 . THR A 1 24 ? -4.719  5.672   -1.040  1.00 9.21  ? 19  THR A OG1 1 
ATOM   172  C CG2 . THR A 1 24 ? -2.534  5.746   -2.125  1.00 10.54 ? 19  THR A CG2 1 
ATOM   173  N N   . ILE A 1 25 ? -3.464  5.588   -5.468  1.00 9.21  ? 20  ILE A N   1 
ATOM   174  C CA  . ILE A 1 25 ? -2.870  5.175   -6.727  1.00 9.68  ? 20  ILE A CA  1 
ATOM   175  C C   . ILE A 1 25 ? -1.533  5.851   -6.940  1.00 8.27  ? 20  ILE A C   1 
ATOM   176  O O   . ILE A 1 25 ? -1.286  6.947   -6.442  1.00 8.51  ? 20  ILE A O   1 
ATOM   177  C CB  . ILE A 1 25 ? -3.795  5.486   -7.923  1.00 8.59  ? 20  ILE A CB  1 
ATOM   178  C CG1 . ILE A 1 25 ? -3.986  6.989   -8.111  1.00 10.38 ? 20  ILE A CG1 1 
ATOM   179  C CG2 . ILE A 1 25 ? -5.153  4.779   -7.729  1.00 10.43 ? 20  ILE A CG2 1 
ATOM   180  C CD1 . ILE A 1 25 ? -4.995  7.312   -9.204  1.00 12.32 ? 20  ILE A CD1 1 
ATOM   181  N N   . ARG A 1 26 ? -0.682  5.183   -7.701  1.00 9.55  ? 21  ARG A N   1 
ATOM   182  C CA  . ARG A 1 26 ? 0.683   5.632   -7.914  1.00 9.24  ? 21  ARG A CA  1 
ATOM   183  C C   . ARG A 1 26 ? 1.046   5.523   -9.389  1.00 9.44  ? 21  ARG A C   1 
ATOM   184  O O   . ARG A 1 26 ? 0.652   4.559   -10.041 1.00 11.26 ? 21  ARG A O   1 
ATOM   185  C CB  . ARG A 1 26 ? 1.657   4.804   -7.064  1.00 10.69 ? 21  ARG A CB  1 
ATOM   186  C CG  . ARG A 1 26 ? 1.479   4.984   -5.554  1.00 11.16 ? 21  ARG A CG  1 
ATOM   187  C CD  . ARG A 1 26 ? 1.877   6.388   -5.176  1.00 11.39 ? 21  ARG A CD  1 
ATOM   188  N NE  . ARG A 1 26 ? 1.821   6.654   -3.744  1.00 12.79 ? 21  ARG A NE  1 
ATOM   189  C CZ  . ARG A 1 26 ? 0.851   7.333   -3.144  1.00 13.26 ? 21  ARG A CZ  1 
ATOM   190  N NH1 . ARG A 1 26 ? 0.916   7.544   -1.840  1.00 12.45 ? 21  ARG A NH1 1 
ATOM   191  N NH2 . ARG A 1 26 ? -0.181  7.797   -3.845  1.00 12.00 ? 21  ARG A NH2 1 
ATOM   192  N N   . VAL A 1 27 ? 1.796   6.500   -9.906  1.00 9.97  ? 22  VAL A N   1 
ATOM   193  C CA  . VAL A 1 27 ? 2.132   6.532   -11.325 1.00 10.38 ? 22  VAL A CA  1 
ATOM   194  C C   . VAL A 1 27 ? 2.703   5.196   -11.771 1.00 11.39 ? 22  VAL A C   1 
ATOM   195  O O   . VAL A 1 27 ? 3.582   4.653   -11.116 1.00 13.96 ? 22  VAL A O   1 
ATOM   196  C CB  . VAL A 1 27 ? 3.156   7.644   -11.664 1.00 11.26 ? 22  VAL A CB  1 
ATOM   197  C CG1 . VAL A 1 27 ? 3.537   7.563   -13.143 1.00 12.94 ? 22  VAL A CG1 1 
ATOM   198  C CG2 . VAL A 1 27 ? 2.583   9.017   -11.318 1.00 12.24 ? 22  VAL A CG2 1 
ATOM   199  N N   . GLY A 1 28 ? 2.180   4.667   -12.872 1.00 10.72 ? 23  GLY A N   1 
ATOM   200  C CA  . GLY A 1 28 ? 2.663   3.402   -13.402 1.00 15.29 ? 23  GLY A CA  1 
ATOM   201  C C   . GLY A 1 28 ? 1.732   2.229   -13.171 1.00 13.76 ? 23  GLY A C   1 
ATOM   202  O O   . GLY A 1 28 ? 1.750   1.261   -13.933 1.00 13.64 ? 23  GLY A O   1 
ATOM   203  N N   . GLU A 1 29 ? 0.928   2.293   -12.116 1.00 10.86 ? 24  GLU A N   1 
ATOM   204  C CA  . GLU A 1 29 ? -0.005  1.201   -11.820 1.00 12.63 ? 24  GLU A CA  1 
ATOM   205  C C   . GLU A 1 29 ? -1.044  1.024   -12.925 1.00 10.65 ? 24  GLU A C   1 
ATOM   206  O O   . GLU A 1 29 ? -1.441  1.985   -13.582 1.00 12.02 ? 24  GLU A O   1 
ATOM   207  C CB  . GLU A 1 29 ? -0.716  1.447   -10.488 1.00 9.00  ? 24  GLU A CB  1 
ATOM   208  C CG  . GLU A 1 29 ? 0.177   1.229   -9.270  1.00 10.09 ? 24  GLU A CG  1 
ATOM   209  C CD  . GLU A 1 29 ? -0.505  1.612   -7.967  1.00 13.44 ? 24  GLU A CD  1 
ATOM   210  O OE1 . GLU A 1 29 ? -0.173  1.018   -6.924  1.00 19.14 ? 24  GLU A OE1 1 
ATOM   211  O OE2 . GLU A 1 29 ? -1.378  2.501   -7.977  1.00 18.36 ? 24  GLU A OE2 1 
ATOM   212  N N   . ILE A 1 30 ? -1.469  -0.220  -13.132 1.00 9.67  ? 25  ILE A N   1 
ATOM   213  C CA  . ILE A 1 30 ? -2.618  -0.503  -13.991 1.00 11.27 ? 25  ILE A CA  1 
ATOM   214  C C   . ILE A 1 30 ? -3.835  -0.817  -13.121 1.00 11.23 ? 25  ILE A C   1 
ATOM   215  O O   . ILE A 1 30 ? -3.767  -1.692  -12.265 1.00 12.03 ? 25  ILE A O   1 
ATOM   216  C CB  . ILE A 1 30 ? -2.351  -1.691  -14.933 1.00 12.22 ? 25  ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 30 ? -1.004  -1.532  -15.637 1.00 11.30 ? 25  ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 30 ? -3.471  -1.819  -15.960 1.00 13.52 ? 25  ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 30 ? -0.905  -0.249  -16.460 1.00 11.46 ? 25  ILE A CD1 1 
ATOM   220  N N   . ILE A 1 31 ? -4.930  -0.085  -13.326 1.00 8.70  ? 26  ILE A N   1 
ATOM   221  C CA  . ILE A 1 31 ? -6.199  -0.372  -12.668 1.00 9.14  ? 26  ILE A CA  1 
ATOM   222  C C   . ILE A 1 31 ? -7.019  -1.221  -13.619 1.00 10.75 ? 26  ILE A C   1 
ATOM   223  O O   . ILE A 1 31 ? -7.147  -0.874  -14.793 1.00 11.30 ? 26  ILE A O   1 
ATOM   224  C CB  . ILE A 1 31 ? -6.954  0.929   -12.310 1.00 9.52  ? 26  ILE A CB  1 
ATOM   225  C CG1 . ILE A 1 31 ? -6.087  1.813   -11.408 1.00 9.57  ? 26  ILE A CG1 1 
ATOM   226  C CG2 . ILE A 1 31 ? -8.297  0.610   -11.656 1.00 9.69  ? 26  ILE A CG2 1 
ATOM   227  C CD1 . ILE A 1 31 ? -6.682  3.200   -11.152 1.00 11.88 ? 26  ILE A CD1 1 
ATOM   228  N N   . ARG A 1 32 ? -7.567  -2.337  -13.139 1.00 9.34  ? 27  ARG A N   1 
ATOM   229  C CA  . ARG A 1 32 ? -8.202  -3.286  -14.051 1.00 12.06 ? 27  ARG A CA  1 
ATOM   230  C C   . ARG A 1 32 ? -9.712  -3.445  -13.860 1.00 9.97  ? 27  ARG A C   1 
ATOM   231  O O   . ARG A 1 32 ? -10.256 -3.091  -12.819 1.00 9.64  ? 27  ARG A O   1 
ATOM   232  C CB  . ARG A 1 32 ? -7.493  -4.646  -13.939 1.00 13.35 ? 27  ARG A CB  1 
ATOM   233  C CG  . ARG A 1 32 ? -5.970  -4.467  -14.079 1.00 15.69 ? 27  ARG A CG  1 
ATOM   234  C CD  . ARG A 1 32 ? -5.184  -5.744  -14.231 1.00 17.32 ? 27  ARG A CD  1 
ATOM   235  N NE  . ARG A 1 32 ? -3.762  -5.462  -14.435 1.00 12.61 ? 27  ARG A NE  1 
ATOM   236  C CZ  . ARG A 1 32 ? -3.161  -5.381  -15.617 1.00 13.19 ? 27  ARG A CZ  1 
ATOM   237  N NH1 . ARG A 1 32 ? -1.856  -5.116  -15.674 1.00 12.61 ? 27  ARG A NH1 1 
ATOM   238  N NH2 . ARG A 1 32 ? -3.839  -5.593  -16.740 1.00 15.02 ? 27  ARG A NH2 1 
ATOM   239  N N   . ASN A 1 33 ? -10.370 -3.967  -14.893 1.00 10.76 ? 28  ASN A N   1 
ATOM   240  C CA  . ASN A 1 33 ? -11.810 -4.212  -14.850 1.00 11.16 ? 28  ASN A CA  1 
ATOM   241  C C   . ASN A 1 33 ? -12.551 -2.938  -14.470 1.00 11.61 ? 28  ASN A C   1 
ATOM   242  O O   . ASN A 1 33 ? -13.394 -2.928  -13.572 1.00 11.55 ? 28  ASN A O   1 
ATOM   243  C CB  . ASN A 1 33 ? -12.137 -5.347  -13.868 1.00 13.23 ? 28  ASN A CB  1 
ATOM   244  C CG  . ASN A 1 33 ? -13.592 -5.801  -13.946 1.00 14.74 ? 28  ASN A CG  1 
ATOM   245  O OD1 . ASN A 1 33 ? -14.181 -6.191  -12.933 1.00 15.09 ? 28  ASN A OD1 1 
ATOM   246  N ND2 . ASN A 1 33 ? -14.177 -5.740  -15.135 1.00 14.58 ? 28  ASN A ND2 1 
ATOM   247  N N   . VAL A 1 34 ? -12.198 -1.855  -15.153 1.00 10.41 ? 29  VAL A N   1 
ATOM   248  C CA  . VAL A 1 34 ? -12.753 -0.540  -14.849 1.00 10.00 ? 29  VAL A CA  1 
ATOM   249  C C   . VAL A 1 34 ? -14.204 -0.392  -15.313 1.00 13.28 ? 29  VAL A C   1 
ATOM   250  O O   . VAL A 1 34 ? -14.596 -0.839  -16.400 1.00 13.57 ? 29  VAL A O   1 
ATOM   251  C CB  . VAL A 1 34 ? -11.891 0.556   -15.474 1.00 9.82  ? 29  VAL A CB  1 
ATOM   252  C CG1 . VAL A 1 34 ? -12.499 1.930   -15.233 1.00 9.63  ? 29  VAL A CG1 1 
ATOM   253  C CG2 . VAL A 1 34 ? -10.502 0.487   -14.880 1.00 9.21  ? 29  VAL A CG2 1 
ATOM   254  N N   . LYS A 1 35 ? -15.005 0.222   -14.452 1.00 10.47 ? 30  LYS A N   1 
ATOM   255  C CA  A LYS A 1 35 ? -16.406 0.461   -14.764 0.34 14.26 ? 30  LYS A CA  1 
ATOM   256  C CA  B LYS A 1 35 ? -16.420 0.451   -14.727 0.66 14.06 ? 30  LYS A CA  1 
ATOM   257  C C   . LYS A 1 35 ? -16.809 1.894   -14.450 1.00 14.30 ? 30  LYS A C   1 
ATOM   258  O O   . LYS A 1 35 ? -16.321 2.491   -13.512 1.00 11.96 ? 30  LYS A O   1 
ATOM   259  C CB  A LYS A 1 35 ? -17.300 -0.511  -13.992 0.34 14.23 ? 30  LYS A CB  1 
ATOM   260  C CB  B LYS A 1 35 ? -17.293 -0.463  -13.870 0.66 13.71 ? 30  LYS A CB  1 
ATOM   261  C CG  A LYS A 1 35 ? -16.998 -1.973  -14.262 0.34 15.04 ? 30  LYS A CG  1 
ATOM   262  C CG  B LYS A 1 35 ? -16.927 -1.929  -13.918 0.66 14.56 ? 30  LYS A CG  1 
ATOM   263  C CD  A LYS A 1 35 ? -17.831 -2.876  -13.373 0.34 16.68 ? 30  LYS A CD  1 
ATOM   264  C CD  B LYS A 1 35 ? -17.806 -2.697  -12.957 0.66 16.58 ? 30  LYS A CD  1 
ATOM   265  C CE  A LYS A 1 35 ? -17.493 -4.339  -13.611 0.34 17.78 ? 30  LYS A CE  1 
ATOM   266  C CE  B LYS A 1 35 ? -17.574 -4.195  -13.065 0.66 17.74 ? 30  LYS A CE  1 
ATOM   267  N NZ  A LYS A 1 35 ? -17.742 -4.739  -15.018 0.34 18.19 ? 30  LYS A NZ  1 
ATOM   268  N NZ  B LYS A 1 35 ? -18.491 -4.945  -12.168 0.66 17.14 ? 30  LYS A NZ  1 
ATOM   269  N N   . LYS A 1 36 ? -17.703 2.439   -15.260 1.00 14.99 ? 31  LYS A N   1 
ATOM   270  C CA  . LYS A 1 36 ? -18.314 3.714   -14.926 1.00 16.13 ? 31  LYS A CA  1 
ATOM   271  C C   . LYS A 1 36 ? -19.566 3.393   -14.109 1.00 15.66 ? 31  LYS A C   1 
ATOM   272  O O   . LYS A 1 36 ? -20.454 2.668   -14.571 1.00 19.12 ? 31  LYS A O   1 
ATOM   273  C CB  . LYS A 1 36 ? -18.650 4.518   -16.185 1.00 19.48 ? 31  LYS A CB  1 
ATOM   274  C CG  . LYS A 1 36 ? -19.550 5.737   -15.959 1.00 20.99 ? 31  LYS A CG  1 
ATOM   275  C CD  . LYS A 1 36 ? -18.905 6.733   -15.002 1.00 18.87 ? 31  LYS A CD  1 
ATOM   276  C CE  . LYS A 1 36 ? -19.625 8.085   -15.032 1.00 19.85 ? 31  LYS A CE  1 
ATOM   277  N NZ  . LYS A 1 36 ? -21.066 8.000   -14.634 1.00 19.18 ? 31  LYS A NZ  1 
ATOM   278  N N   . LEU A 1 37 ? -19.612 3.888   -12.876 1.00 13.86 ? 32  LEU A N   1 
ATOM   279  C CA  . LEU A 1 37 ? -20.778 3.695   -12.028 1.00 15.06 ? 32  LEU A CA  1 
ATOM   280  C C   . LEU A 1 37 ? -21.640 4.940   -12.159 1.00 17.91 ? 32  LEU A C   1 
ATOM   281  O O   . LEU A 1 37 ? -21.515 5.674   -13.129 1.00 20.74 ? 32  LEU A O   1 
ATOM   282  C CB  . LEU A 1 37 ? -20.377 3.441   -10.575 1.00 15.34 ? 32  LEU A CB  1 
ATOM   283  C CG  . LEU A 1 37 ? -19.431 2.246   -10.373 1.00 19.15 ? 32  LEU A CG  1 
ATOM   284  C CD1 . LEU A 1 37 ? -19.263 1.923   -8.891  1.00 20.99 ? 32  LEU A CD1 1 
ATOM   285  C CD2 . LEU A 1 37 ? -19.920 1.031   -11.133 1.00 20.03 ? 32  LEU A CD2 1 
ATOM   286  N N   . GLN A 1 38 ? -22.501 5.197   -11.187 1.00 20.58 ? 33  GLN A N   1 
ATOM   287  C CA  . GLN A 1 38 ? -23.412 6.334   -11.317 1.00 21.69 ? 33  GLN A CA  1 
ATOM   288  C C   . GLN A 1 38 ? -22.673 7.672   -11.204 1.00 19.54 ? 33  GLN A C   1 
ATOM   289  O O   . GLN A 1 38 ? -23.053 8.651   -11.835 1.00 20.74 ? 33  GLN A O   1 
ATOM   290  C CB  . GLN A 1 38 ? -24.530 6.250   -10.272 1.00 24.74 ? 33  GLN A CB  1 
ATOM   291  C CG  . GLN A 1 38 ? -25.421 5.014   -10.431 1.00 27.65 ? 33  GLN A CG  1 
ATOM   292  C CD  . GLN A 1 38 ? -26.700 5.087   -9.619  1.00 30.11 ? 33  GLN A CD  1 
ATOM   293  O OE1 . GLN A 1 38 ? -26.674 4.984   -8.394  1.00 30.55 ? 33  GLN A OE1 1 
ATOM   294  N NE2 . GLN A 1 38 ? -27.827 5.261   -10.299 1.00 32.78 ? 33  GLN A NE2 1 
ATOM   295  N N   . GLU A 1 39 ? -21.596 7.698   -10.429 1.00 17.53 ? 34  GLU A N   1 
ATOM   296  C CA  . GLU A 1 39 ? -20.901 8.941   -10.106 1.00 18.87 ? 34  GLU A CA  1 
ATOM   297  C C   . GLU A 1 39 ? -20.167 9.609   -11.276 1.00 19.85 ? 34  GLU A C   1 
ATOM   298  O O   . GLU A 1 39 ? -19.474 8.948   -12.043 1.00 24.24 ? 34  GLU A O   1 
ATOM   299  C CB  . GLU A 1 39 ? -19.914 8.669   -8.978  1.00 17.14 ? 34  GLU A CB  1 
ATOM   300  C CG  . GLU A 1 39 ? -19.422 9.895   -8.280  1.00 18.93 ? 34  GLU A CG  1 
ATOM   301  C CD  . GLU A 1 39 ? -19.030 9.603   -6.850  1.00 21.23 ? 34  GLU A CD  1 
ATOM   302  O OE1 . GLU A 1 39 ? -18.967 8.404   -6.479  1.00 23.58 ? 34  GLU A OE1 1 
ATOM   303  O OE2 . GLU A 1 39 ? -18.806 10.568  -6.096  1.00 19.90 ? 34  GLU A OE2 1 
ATOM   304  N N   . GLU A 1 40 ? -20.299 10.929  -11.374 1.00 16.69 ? 35  GLU A N   1 
ATOM   305  C CA  . GLU A 1 40 ? -19.696 11.717  -12.451 1.00 14.39 ? 35  GLU A CA  1 
ATOM   306  C C   . GLU A 1 40 ? -18.224 12.037  -12.181 1.00 15.38 ? 35  GLU A C   1 
ATOM   307  O O   . GLU A 1 40 ? -17.858 12.370  -11.055 1.00 15.93 ? 35  GLU A O   1 
ATOM   308  C CB  . GLU A 1 40 ? -20.484 13.026  -12.643 1.00 18.14 ? 35  GLU A CB  1 
ATOM   309  C CG  . GLU A 1 40 ? -20.005 13.893  -13.794 1.00 21.08 ? 35  GLU A CG  1 
ATOM   310  C CD  . GLU A 1 40 ? -20.925 15.073  -14.078 1.00 25.74 ? 35  GLU A CD  1 
ATOM   311  O OE1 . GLU A 1 40 ? -21.847 15.344  -13.270 1.00 26.77 ? 35  GLU A OE1 1 
ATOM   312  O OE2 . GLU A 1 40 ? -20.736 15.725  -15.130 1.00 27.89 ? 35  GLU A OE2 1 
ATOM   313  N N   . GLY A 1 41 ? -17.388 11.938  -13.211 1.00 13.85 ? 36  GLY A N   1 
ATOM   314  C CA  . GLY A 1 41 ? -15.979 12.302  -13.091 1.00 12.64 ? 36  GLY A CA  1 
ATOM   315  C C   . GLY A 1 41 ? -15.090 11.290  -12.389 1.00 13.24 ? 36  GLY A C   1 
ATOM   316  O O   . GLY A 1 41 ? -13.874 11.499  -12.248 1.00 12.66 ? 36  GLY A O   1 
ATOM   317  N N   . TRP A 1 42 ? -15.697 10.195  -11.934 1.00 11.29 ? 37  TRP A N   1 
ATOM   318  C CA  . TRP A 1 42 ? -14.977 9.138   -11.235 1.00 10.13 ? 37  TRP A CA  1 
ATOM   319  C C   . TRP A 1 42 ? -15.201 7.801   -11.932 1.00 11.03 ? 37  TRP A C   1 
ATOM   320  O O   . TRP A 1 42 ? -16.162 7.630   -12.686 1.00 13.52 ? 37  TRP A O   1 
ATOM   321  C CB  . TRP A 1 42 ? -15.419 9.080   -9.766  1.00 9.81  ? 37  TRP A CB  1 
ATOM   322  C CG  . TRP A 1 42 ? -14.894 10.251  -9.001  1.00 9.71  ? 37  TRP A CG  1 
ATOM   323  C CD1 . TRP A 1 42 ? -15.292 11.551  -9.117  1.00 12.64 ? 37  TRP A CD1 1 
ATOM   324  C CD2 . TRP A 1 42 ? -13.832 10.240  -8.043  1.00 10.41 ? 37  TRP A CD2 1 
ATOM   325  N NE1 . TRP A 1 42 ? -14.556 12.354  -8.277  1.00 10.46 ? 37  TRP A NE1 1 
ATOM   326  C CE2 . TRP A 1 42 ? -13.647 11.571  -7.607  1.00 10.13 ? 37  TRP A CE2 1 
ATOM   327  C CE3 . TRP A 1 42 ? -13.033 9.231   -7.490  1.00 9.81  ? 37  TRP A CE3 1 
ATOM   328  C CZ2 . TRP A 1 42 ? -12.688 11.921  -6.654  1.00 10.19 ? 37  TRP A CZ2 1 
ATOM   329  C CZ3 . TRP A 1 42 ? -12.076 9.581   -6.539  1.00 9.97  ? 37  TRP A CZ3 1 
ATOM   330  C CH2 . TRP A 1 42 ? -11.923 10.917  -6.127  1.00 9.60  ? 37  TRP A CH2 1 
ATOM   331  N N   . LEU A 1 43 ? -14.285 6.870   -11.709 1.00 9.43  ? 38  LEU A N   1 
ATOM   332  C CA  . LEU A 1 43 ? -14.433 5.505   -12.217 1.00 8.84  ? 38  LEU A CA  1 
ATOM   333  C C   . LEU A 1 43 ? -14.197 4.516   -11.092 1.00 9.72  ? 38  LEU A C   1 
ATOM   334  O O   . LEU A 1 43 ? -13.690 4.880   -10.033 1.00 9.23  ? 38  LEU A O   1 
ATOM   335  C CB  . LEU A 1 43 ? -13.449 5.250   -13.368 1.00 13.66 ? 38  LEU A CB  1 
ATOM   336  C CG  . LEU A 1 43 ? -13.720 6.029   -14.660 1.00 13.14 ? 38  LEU A CG  1 
ATOM   337  C CD1 . LEU A 1 43 ? -12.478 6.047   -15.515 1.00 14.53 ? 38  LEU A CD1 1 
ATOM   338  C CD2 . LEU A 1 43 ? -14.854 5.411   -15.426 1.00 14.88 ? 38  LEU A CD2 1 
ATOM   339  N N   . GLU A 1 44 ? -14.535 3.255   -11.333 1.00 10.95 ? 39  GLU A N   1 
ATOM   340  C CA  A GLU A 1 44 ? -14.331 2.207   -10.342 0.59 10.33 ? 39  GLU A CA  1 
ATOM   341  C CA  B GLU A 1 44 ? -14.338 2.194   -10.342 0.41 10.42 ? 39  GLU A CA  1 
ATOM   342  C C   . GLU A 1 44 ? -13.498 1.085   -10.941 1.00 10.05 ? 39  GLU A C   1 
ATOM   343  O O   . GLU A 1 44 ? -13.661 0.757   -12.104 1.00 11.41 ? 39  GLU A O   1 
ATOM   344  C CB  A GLU A 1 44 ? -15.673 1.673   -9.852  0.59 11.46 ? 39  GLU A CB  1 
ATOM   345  C CB  B GLU A 1 44 ? -15.672 1.615   -9.860  0.41 11.60 ? 39  GLU A CB  1 
ATOM   346  C CG  A GLU A 1 44 ? -15.577 0.966   -8.527  0.59 12.06 ? 39  GLU A CG  1 
ATOM   347  C CG  B GLU A 1 44 ? -15.500 0.594   -8.736  0.41 12.33 ? 39  GLU A CG  1 
ATOM   348  C CD  A GLU A 1 44 ? -15.743 -0.534  -8.632  0.59 13.59 ? 39  GLU A CD  1 
ATOM   349  C CD  B GLU A 1 44 ? -16.662 -0.381  -8.593  0.41 14.21 ? 39  GLU A CD  1 
ATOM   350  O OE1 A GLU A 1 44 ? -16.213 -1.030  -9.681  0.59 15.85 ? 39  GLU A OE1 1 
ATOM   351  O OE1 B GLU A 1 44 ? -17.160 -0.917  -9.609  0.41 15.61 ? 39  GLU A OE1 1 
ATOM   352  O OE2 A GLU A 1 44 ? -15.415 -1.221  -7.645  0.59 12.54 ? 39  GLU A OE2 1 
ATOM   353  O OE2 B GLU A 1 44 ? -17.082 -0.614  -7.445  0.41 13.24 ? 39  GLU A OE2 1 
ATOM   354  N N   . GLY A 1 45 ? -12.591 0.513   -10.154 1.00 9.51  ? 40  GLY A N   1 
ATOM   355  C CA  . GLY A 1 45 ? -11.753 -0.546  -10.697 1.00 10.48 ? 40  GLY A CA  1 
ATOM   356  C C   . GLY A 1 45 ? -10.982 -1.349  -9.676  1.00 9.87  ? 40  GLY A C   1 
ATOM   357  O O   . GLY A 1 45 ? -11.020 -1.041  -8.482  1.00 10.47 ? 40  GLY A O   1 
ATOM   358  N N   . GLU A 1 46 ? -10.287 -2.378  -10.161 1.00 9.62  ? 41  GLU A N   1 
ATOM   359  C CA  . GLU A 1 46 ? -9.544  -3.305  -9.321  1.00 9.35  ? 41  GLU A CA  1 
ATOM   360  C C   . GLU A 1 46 ? -8.071  -2.894  -9.271  1.00 10.77 ? 41  GLU A C   1 
ATOM   361  O O   . GLU A 1 46 ? -7.478  -2.577  -10.293 1.00 8.91  ? 41  GLU A O   1 
ATOM   362  C CB  . GLU A 1 46 ? -9.676  -4.743  -9.860  1.00 11.43 ? 41  GLU A CB  1 
ATOM   363  C CG  . GLU A 1 46 ? -9.091  -5.845  -8.947  1.00 11.84 ? 41  GLU A CG  1 
ATOM   364  C CD  . GLU A 1 46 ? -7.581  -5.965  -9.038  1.00 15.82 ? 41  GLU A CD  1 
ATOM   365  O OE1 . GLU A 1 46 ? -7.021  -5.726  -10.132 1.00 15.44 ? 41  GLU A OE1 1 
ATOM   366  O OE2 . GLU A 1 46 ? -6.951  -6.284  -8.005  1.00 17.16 ? 41  GLU A OE2 1 
ATOM   367  N N   . LEU A 1 47 ? -7.480  -2.914  -8.082  1.00 10.27 ? 42  LEU A N   1 
ATOM   368  C CA  . LEU A 1 47 ? -6.060  -2.595  -7.944  1.00 10.63 ? 42  LEU A CA  1 
ATOM   369  C C   . LEU A 1 47 ? -5.493  -3.323  -6.746  1.00 13.74 ? 42  LEU A C   1 
ATOM   370  O O   . LEU A 1 47 ? -5.979  -3.148  -5.632  1.00 12.07 ? 42  LEU A O   1 
ATOM   371  C CB  . LEU A 1 47 ? -5.844  -1.084  -7.788  1.00 8.91  ? 42  LEU A CB  1 
ATOM   372  C CG  . LEU A 1 47 ? -4.383  -0.642  -7.608  1.00 11.00 ? 42  LEU A CG  1 
ATOM   373  C CD1 . LEU A 1 47 ? -3.525  -1.083  -8.787  1.00 11.17 ? 42  LEU A CD1 1 
ATOM   374  C CD2 . LEU A 1 47 ? -4.350  0.851   -7.448  1.00 11.62 ? 42  LEU A CD2 1 
ATOM   375  N N   . ASN A 1 48 ? -4.484  -4.156  -7.000  1.00 16.85 ? 43  ASN A N   1 
ATOM   376  C CA  . ASN A 1 48 ? -3.774  -4.891  -5.960  1.00 20.14 ? 43  ASN A CA  1 
ATOM   377  C C   . ASN A 1 48 ? -4.717  -5.645  -5.017  1.00 18.57 ? 43  ASN A C   1 
ATOM   378  O O   . ASN A 1 48 ? -4.498  -5.704  -3.806  1.00 20.81 ? 43  ASN A O   1 
ATOM   379  C CB  . ASN A 1 48 ? -2.861  -3.931  -5.191  1.00 23.53 ? 43  ASN A CB  1 
ATOM   380  C CG  . ASN A 1 48 ? -1.789  -3.309  -6.085  1.00 26.99 ? 43  ASN A CG  1 
ATOM   381  O OD1 . ASN A 1 48 ? -1.309  -3.940  -7.028  1.00 31.09 ? 43  ASN A OD1 1 
ATOM   382  N ND2 . ASN A 1 48 ? -1.415  -2.071  -5.792  1.00 27.80 ? 43  ASN A ND2 1 
ATOM   383  N N   . GLY A 1 49 ? -5.777  -6.216  -5.588  1.00 14.98 ? 44  GLY A N   1 
ATOM   384  C CA  . GLY A 1 49 ? -6.626  -7.143  -4.860  1.00 17.45 ? 44  GLY A CA  1 
ATOM   385  C C   . GLY A 1 49 ? -7.917  -6.578  -4.288  1.00 17.43 ? 44  GLY A C   1 
ATOM   386  O O   . GLY A 1 49 ? -8.729  -7.315  -3.735  1.00 17.93 ? 44  GLY A O   1 
ATOM   387  N N   . ARG A 1 50 ? -8.096  -5.268  -4.404  1.00 16.09 ? 45  ARG A N   1 
ATOM   388  C CA  . ARG A 1 50 ? -9.299  -4.603  -3.902  1.00 15.69 ? 45  ARG A CA  1 
ATOM   389  C C   . ARG A 1 50 ? -9.955  -3.795  -5.015  1.00 14.83 ? 45  ARG A C   1 
ATOM   390  O O   . ARG A 1 50 ? -9.355  -3.585  -6.063  1.00 14.40 ? 45  ARG A O   1 
ATOM   391  C CB  . ARG A 1 50 ? -8.970  -3.673  -2.731  1.00 16.96 ? 45  ARG A CB  1 
ATOM   392  C CG  . ARG A 1 50 ? -8.083  -2.505  -3.106  1.00 17.62 ? 45  ARG A CG  1 
ATOM   393  C CD  . ARG A 1 50 ? -8.196  -1.347  -2.100  1.00 18.97 ? 45  ARG A CD  1 
ATOM   394  N NE  . ARG A 1 50 ? -9.514  -0.704  -2.138  1.00 18.31 ? 45  ARG A NE  1 
ATOM   395  C CZ  . ARG A 1 50 ? -9.798  0.443   -1.523  1.00 15.42 ? 45  ARG A CZ  1 
ATOM   396  N NH1 . ARG A 1 50 ? -8.866  1.056   -0.812  1.00 14.66 ? 45  ARG A NH1 1 
ATOM   397  N NH2 . ARG A 1 50 ? -11.017 0.971   -1.601  1.00 15.75 ? 45  ARG A NH2 1 
ATOM   398  N N   . ARG A 1 51 ? -11.180 -3.335  -4.787  1.00 14.04 ? 46  ARG A N   1 
ATOM   399  C CA  . ARG A 1 51 ? -11.822 -2.439  -5.741  1.00 13.00 ? 46  ARG A CA  1 
ATOM   400  C C   . ARG A 1 51 ? -12.051 -1.078  -5.097  1.00 13.25 ? 46  ARG A C   1 
ATOM   401  O O   . ARG A 1 51 ? -12.170 -0.969  -3.882  1.00 15.90 ? 46  ARG A O   1 
ATOM   402  C CB  . ARG A 1 51 ? -13.149 -3.010  -6.245  1.00 15.19 ? 46  ARG A CB  1 
ATOM   403  C CG  . ARG A 1 51 ? -13.029 -4.250  -7.117  1.00 16.05 ? 46  ARG A CG  1 
ATOM   404  C CD  . ARG A 1 51 ? -14.338 -4.541  -7.831  1.00 15.35 ? 46  ARG A CD  1 
ATOM   405  N NE  . ARG A 1 51 ? -14.624 -3.585  -8.900  1.00 16.34 ? 46  ARG A NE  1 
ATOM   406  C CZ  . ARG A 1 51 ? -14.243 -3.760  -10.161 1.00 17.53 ? 46  ARG A CZ  1 
ATOM   407  N NH1 . ARG A 1 51 ? -13.559 -4.847  -10.493 1.00 19.24 ? 46  ARG A NH1 1 
ATOM   408  N NH2 . ARG A 1 51 ? -14.543 -2.857  -11.081 1.00 17.64 ? 46  ARG A NH2 1 
ATOM   409  N N   . GLY A 1 52 ? -12.112 -0.038  -5.910  1.00 9.78  ? 47  GLY A N   1 
ATOM   410  C CA  . GLY A 1 52 ? -12.359 1.289   -5.373  1.00 8.30  ? 47  GLY A CA  1 
ATOM   411  C C   . GLY A 1 52 ? -12.508 2.352   -6.432  1.00 8.10  ? 47  GLY A C   1 
ATOM   412  O O   . GLY A 1 52 ? -12.298 2.100   -7.622  1.00 10.03 ? 47  GLY A O   1 
ATOM   413  N N   . MET A 1 53 ? -12.879 3.549   -5.989  1.00 7.69  ? 48  MET A N   1 
ATOM   414  C CA  . MET A 1 53 ? -13.094 4.690   -6.883  1.00 8.97  ? 48  MET A CA  1 
ATOM   415  C C   . MET A 1 53 ? -11.816 5.489   -7.143  1.00 8.49  ? 48  MET A C   1 
ATOM   416  O O   . MET A 1 53 ? -10.970 5.601   -6.262  1.00 11.20 ? 48  MET A O   1 
ATOM   417  C CB  . MET A 1 53 ? -14.147 5.621   -6.293  1.00 10.51 ? 48  MET A CB  1 
ATOM   418  C CG  . MET A 1 53 ? -15.425 4.910   -5.891  1.00 11.95 ? 48  MET A CG  1 
ATOM   419  S SD  . MET A 1 53 ? -16.271 4.192   -7.312  1.00 16.84 ? 48  MET A SD  1 
ATOM   420  C CE  . MET A 1 53 ? -16.605 5.661   -8.272  1.00 21.16 ? 48  MET A CE  1 
ATOM   421  N N   . PHE A 1 54 ? -11.688 6.049   -8.350  1.00 8.39  ? 49  PHE A N   1 
ATOM   422  C CA  . PHE A 1 54 ? -10.559 6.925   -8.668  1.00 7.97  ? 49  PHE A CA  1 
ATOM   423  C C   . PHE A 1 54 ? -10.966 8.022   -9.648  1.00 8.31  ? 49  PHE A C   1 
ATOM   424  O O   . PHE A 1 54 ? -11.878 7.836   -10.459 1.00 9.19  ? 49  PHE A O   1 
ATOM   425  C CB  . PHE A 1 54 ? -9.376  6.106   -9.215  1.00 9.63  ? 49  PHE A CB  1 
ATOM   426  C CG  . PHE A 1 54 ? -9.707  5.261   -10.424 1.00 8.38  ? 49  PHE A CG  1 
ATOM   427  C CD1 . PHE A 1 54 ? -9.390  5.700   -11.705 1.00 9.46  ? 49  PHE A CD1 1 
ATOM   428  C CD2 . PHE A 1 54 ? -10.317 4.013   -10.275 1.00 9.17  ? 49  PHE A CD2 1 
ATOM   429  C CE1 . PHE A 1 54 ? -9.673  4.911   -12.822 1.00 10.24 ? 49  PHE A CE1 1 
ATOM   430  C CE2 . PHE A 1 54 ? -10.618 3.235   -11.379 1.00 7.86  ? 49  PHE A CE2 1 
ATOM   431  C CZ  . PHE A 1 54 ? -10.289 3.675   -12.654 1.00 9.95  ? 49  PHE A CZ  1 
ATOM   432  N N   . PRO A 1 55 ? -10.322 9.194   -9.542  1.00 9.00  ? 50  PRO A N   1 
ATOM   433  C CA  . PRO A 1 55 ? -10.716 10.327  -10.393 1.00 8.18  ? 50  PRO A CA  1 
ATOM   434  C C   . PRO A 1 55 ? -10.280 10.112  -11.845 1.00 8.50  ? 50  PRO A C   1 
ATOM   435  O O   . PRO A 1 55 ? -9.151  9.663   -12.082 1.00 8.40  ? 50  PRO A O   1 
ATOM   436  C CB  . PRO A 1 55 ? -10.000 11.516  -9.739  1.00 10.92 ? 50  PRO A CB  1 
ATOM   437  C CG  . PRO A 1 55 ? -8.816  10.907  -9.035  1.00 10.98 ? 50  PRO A CG  1 
ATOM   438  C CD  . PRO A 1 55 ? -9.321  9.575   -8.523  1.00 10.27 ? 50  PRO A CD  1 
ATOM   439  N N   . ASP A 1 56 ? -11.141 10.413  -12.811 1.00 9.58  ? 51  ASP A N   1 
ATOM   440  C CA  . ASP A 1 56 ? -10.855 9.950   -14.166 1.00 11.02 ? 51  ASP A CA  1 
ATOM   441  C C   . ASP A 1 56 ? -9.849  10.846  -14.886 1.00 12.16 ? 51  ASP A C   1 
ATOM   442  O O   . ASP A 1 56 ? -9.427  10.522  -15.986 1.00 13.06 ? 51  ASP A O   1 
ATOM   443  C CB  . ASP A 1 56 ? -12.150 9.783   -15.004 1.00 17.01 ? 51  ASP A CB  1 
ATOM   444  C CG  . ASP A 1 56 ? -12.862 11.093  -15.336 1.00 19.55 ? 51  ASP A CG  1 
ATOM   445  O OD1 . ASP A 1 56 ? -12.240 12.175  -15.316 1.00 16.26 ? 51  ASP A OD1 1 
ATOM   446  O OD2 . ASP A 1 56 ? -14.067 11.013  -15.692 1.00 18.64 ? 51  ASP A OD2 1 
ATOM   447  N N   . ASN A 1 57 ? -9.428  11.943  -14.256 1.00 11.89 ? 52  ASN A N   1 
ATOM   448  C CA  . ASN A 1 57 ? -8.421  12.794  -14.883 1.00 11.20 ? 52  ASN A CA  1 
ATOM   449  C C   . ASN A 1 57 ? -7.005  12.548  -14.332 1.00 12.21 ? 52  ASN A C   1 
ATOM   450  O O   . ASN A 1 57 ? -6.081  13.291  -14.644 1.00 13.02 ? 52  ASN A O   1 
ATOM   451  C CB  . ASN A 1 57 ? -8.813  14.284  -14.774 1.00 13.06 ? 52  ASN A CB  1 
ATOM   452  C CG  . ASN A 1 57 ? -8.990  14.778  -13.328 1.00 13.39 ? 52  ASN A CG  1 
ATOM   453  O OD1 . ASN A 1 57 ? -9.156  13.995  -12.399 1.00 12.15 ? 52  ASN A OD1 1 
ATOM   454  N ND2 . ASN A 1 57 ? -9.000  16.105  -13.159 1.00 13.65 ? 52  ASN A ND2 1 
ATOM   455  N N   . PHE A 1 58 ? -6.836  11.475  -13.557 1.00 11.23 ? 53  PHE A N   1 
ATOM   456  C CA  . PHE A 1 58 ? -5.511  11.104  -13.047 1.00 10.24 ? 53  PHE A CA  1 
ATOM   457  C C   . PHE A 1 58 ? -4.963  9.903   -13.813 1.00 10.71 ? 53  PHE A C   1 
ATOM   458  O O   . PHE A 1 58 ? -3.868  9.426   -13.522 1.00 11.66 ? 53  PHE A O   1 
ATOM   459  C CB  . PHE A 1 58 ? -5.566  10.769  -11.546 1.00 9.58  ? 53  PHE A CB  1 
ATOM   460  C CG  . PHE A 1 58 ? -5.619  11.973  -10.641 1.00 9.95  ? 53  PHE A CG  1 
ATOM   461  C CD1 . PHE A 1 58 ? -6.625  12.921  -10.780 1.00 11.40 ? 53  PHE A CD1 1 
ATOM   462  C CD2 . PHE A 1 58 ? -4.702  12.118  -9.606  1.00 9.63  ? 53  PHE A CD2 1 
ATOM   463  C CE1 . PHE A 1 58 ? -6.683  14.024  -9.933  1.00 12.12 ? 53  PHE A CE1 1 
ATOM   464  C CE2 . PHE A 1 58 ? -4.752  13.210  -8.749  1.00 11.77 ? 53  PHE A CE2 1 
ATOM   465  C CZ  . PHE A 1 58 ? -5.746  14.172  -8.917  1.00 11.36 ? 53  PHE A CZ  1 
ATOM   466  N N   . VAL A 1 59 ? -5.730  9.432   -14.793 1.00 9.77  ? 54  VAL A N   1 
ATOM   467  C CA  . VAL A 1 59 ? -5.509  8.129   -15.409 1.00 9.37  ? 54  VAL A CA  1 
ATOM   468  C C   . VAL A 1 59 ? -5.758  8.217   -16.915 1.00 10.31 ? 54  VAL A C   1 
ATOM   469  O O   . VAL A 1 59 ? -6.476  9.105   -17.380 1.00 14.57 ? 54  VAL A O   1 
ATOM   470  C CB  . VAL A 1 59 ? -6.461  7.072   -14.811 1.00 10.60 ? 54  VAL A CB  1 
ATOM   471  C CG1 . VAL A 1 59 ? -6.089  6.750   -13.367 1.00 10.89 ? 54  VAL A CG1 1 
ATOM   472  C CG2 . VAL A 1 59 ? -7.898  7.583   -14.888 1.00 12.13 ? 54  VAL A CG2 1 
ATOM   473  N N   . LYS A 1 60 ? -5.164  7.298   -17.671 1.00 12.15 ? 55  LYS A N   1 
ATOM   474  C CA  . LYS A 1 60 ? -5.380  7.196   -19.103 1.00 13.30 ? 55  LYS A CA  1 
ATOM   475  C C   . LYS A 1 60 ? -5.917  5.822   -19.465 1.00 12.08 ? 55  LYS A C   1 
ATOM   476  O O   . LYS A 1 60 ? -5.374  4.799   -19.040 1.00 13.52 ? 55  LYS A O   1 
ATOM   477  C CB  . LYS A 1 60 ? -4.076  7.459   -19.860 1.00 15.73 ? 55  LYS A CB  1 
ATOM   478  C CG  . LYS A 1 60 ? -4.229  7.434   -21.374 1.00 21.25 ? 55  LYS A CG  1 
ATOM   479  C CD  . LYS A 1 60 ? -2.876  7.456   -22.071 1.00 27.14 ? 55  LYS A CD  1 
ATOM   480  C CE  . LYS A 1 60 ? -2.089  6.183   -21.789 1.00 30.26 ? 55  LYS A CE  1 
ATOM   481  N NZ  . LYS A 1 60 ? -0.935  6.009   -22.724 1.00 34.38 ? 55  LYS A NZ  1 
ATOM   482  N N   . GLU A 1 61 ? -6.979  5.792   -20.260 1.00 12.51 ? 56  GLU A N   1 
ATOM   483  C CA  . GLU A 1 61 ? -7.562  4.526   -20.698 1.00 15.30 ? 56  GLU A CA  1 
ATOM   484  C C   . GLU A 1 61 ? -6.646  3.794   -21.666 1.00 16.83 ? 56  GLU A C   1 
ATOM   485  O O   . GLU A 1 61 ? -6.175  4.374   -22.646 1.00 16.52 ? 56  GLU A O   1 
ATOM   486  C CB  . GLU A 1 61 ? -8.926  4.764   -21.360 1.00 16.84 ? 56  GLU A CB  1 
ATOM   487  C CG  . GLU A 1 61 ? -9.615  3.492   -21.827 1.00 18.21 ? 56  GLU A CG  1 
ATOM   488  C CD  . GLU A 1 61 ? -10.980 3.741   -22.452 1.00 21.08 ? 56  GLU A CD  1 
ATOM   489  O OE1 . GLU A 1 61 ? -11.386 4.915   -22.583 1.00 21.36 ? 56  GLU A OE1 1 
ATOM   490  O OE2 . GLU A 1 61 ? -11.650 2.750   -22.812 1.00 22.31 ? 56  GLU A OE2 1 
ATOM   491  N N   . ILE A 1 62 ? -6.398  2.514   -21.399 1.00 15.28 ? 57  ILE A N   1 
ATOM   492  C CA  . ILE A 1 62 ? -5.661  1.676   -22.340 1.00 19.98 ? 57  ILE A CA  1 
ATOM   493  C C   . ILE A 1 62 ? -6.581  1.255   -23.475 1.00 24.12 ? 57  ILE A C   1 
ATOM   494  O O   . ILE A 1 62 ? -7.539  0.523   -23.255 1.00 23.74 ? 57  ILE A O   1 
ATOM   495  C CB  . ILE A 1 62 ? -5.087  0.417   -21.661 1.00 20.94 ? 57  ILE A CB  1 
ATOM   496  C CG1 . ILE A 1 62 ? -4.097  0.802   -20.565 1.00 21.93 ? 57  ILE A CG1 1 
ATOM   497  C CG2 . ILE A 1 62 ? -4.430  -0.511  -22.688 1.00 21.37 ? 57  ILE A CG2 1 
ATOM   498  C CD1 . ILE A 1 62 ? -3.492  -0.414  -19.871 1.00 21.67 ? 57  ILE A CD1 1 
ATOM   499  N N   . LYS A 1 63 ? -6.295  1.720   -24.686 1.00 30.03 ? 58  LYS A N   1 
ATOM   500  C CA  . LYS A 1 63 ? -7.110  1.354   -25.840 1.00 36.03 ? 58  LYS A CA  1 
ATOM   501  C C   . LYS A 1 63 ? -6.332  0.450   -26.788 1.00 39.84 ? 58  LYS A C   1 
ATOM   502  O O   . LYS A 1 63 ? -6.073  -0.709  -26.472 1.00 41.38 ? 58  LYS A O   1 
ATOM   503  C CB  . LYS A 1 63 ? -7.599  2.605   -26.576 1.00 37.84 ? 58  LYS A CB  1 
ATOM   504  C CG  . LYS A 1 63 ? -8.492  3.500   -25.727 1.00 39.00 ? 58  LYS A CG  1 
ATOM   505  C CD  . LYS A 1 63 ? -8.817  4.801   -26.436 1.00 41.61 ? 58  LYS A CD  1 
ATOM   506  C CE  . LYS A 1 63 ? -9.450  5.813   -25.484 1.00 41.26 ? 58  LYS A CE  1 
ATOM   507  N NZ  . LYS A 1 63 ? -10.938 5.758   -25.490 1.00 42.34 ? 58  LYS A NZ  1 
ATOM   508  N N   . ASN B 2 4  ? 1.863   20.232  -15.114 1.00 38.04 ? 381 ASN B N   1 
ATOM   509  C CA  . ASN B 2 4  ? 0.436   20.446  -14.911 1.00 36.56 ? 381 ASN B CA  1 
ATOM   510  C C   . ASN B 2 4  ? -0.226  19.267  -14.203 1.00 32.27 ? 381 ASN B C   1 
ATOM   511  O O   . ASN B 2 4  ? -0.299  18.169  -14.750 1.00 34.76 ? 381 ASN B O   1 
ATOM   512  C CB  . ASN B 2 4  ? -0.255  20.706  -16.251 1.00 41.83 ? 381 ASN B CB  1 
ATOM   513  C CG  . ASN B 2 4  ? 0.220   21.983  -16.913 1.00 49.01 ? 381 ASN B CG  1 
ATOM   514  O OD1 . ASN B 2 4  ? -0.052  23.084  -16.433 1.00 51.11 ? 381 ASN B OD1 1 
ATOM   515  N ND2 . ASN B 2 4  ? 0.938   21.843  -18.022 1.00 53.20 ? 381 ASN B ND2 1 
ATOM   516  N N   . LEU B 2 5  ? -0.708  19.505  -12.987 1.00 24.90 ? 382 LEU B N   1 
ATOM   517  C CA  . LEU B 2 5  ? -1.318  18.452  -12.184 1.00 20.74 ? 382 LEU B CA  1 
ATOM   518  C C   . LEU B 2 5  ? -2.834  18.555  -12.213 1.00 17.89 ? 382 LEU B C   1 
ATOM   519  O O   . LEU B 2 5  ? -3.403  19.658  -12.183 1.00 18.06 ? 382 LEU B O   1 
ATOM   520  C CB  . LEU B 2 5  ? -0.828  18.517  -10.738 1.00 21.35 ? 382 LEU B CB  1 
ATOM   521  C CG  . LEU B 2 5  ? 0.681   18.380  -10.561 1.00 24.50 ? 382 LEU B CG  1 
ATOM   522  C CD1 . LEU B 2 5  ? 1.057   18.607  -9.108  1.00 26.45 ? 382 LEU B CD1 1 
ATOM   523  C CD2 . LEU B 2 5  ? 1.150   17.008  -11.045 1.00 25.18 ? 382 LEU B CD2 1 
ATOM   524  N N   . PRO B 2 6  ? -3.504  17.404  -12.253 1.00 16.41 ? 383 PRO B N   1 
ATOM   525  C CA  . PRO B 2 6  ? -4.965  17.408  -12.265 1.00 12.99 ? 383 PRO B CA  1 
ATOM   526  C C   . PRO B 2 6  ? -5.535  17.664  -10.882 1.00 13.01 ? 383 PRO B C   1 
ATOM   527  O O   . PRO B 2 6  ? -4.922  17.317  -9.870  1.00 13.52 ? 383 PRO B O   1 
ATOM   528  C CB  . PRO B 2 6  ? -5.312  15.995  -12.736 1.00 13.50 ? 383 PRO B CB  1 
ATOM   529  C CG  . PRO B 2 6  ? -4.166  15.168  -12.219 1.00 15.58 ? 383 PRO B CG  1 
ATOM   530  C CD  . PRO B 2 6  ? -2.947  16.041  -12.313 1.00 16.80 ? 383 PRO B CD  1 
ATOM   531  N N   . THR B 2 7  ? -6.705  18.283  -10.846 1.00 11.75 ? 384 THR B N   1 
ATOM   532  C CA  . THR B 2 7  ? -7.477  18.386  -9.616  1.00 11.09 ? 384 THR B CA  1 
ATOM   533  C C   . THR B 2 7  ? -8.629  17.380  -9.686  1.00 11.61 ? 384 THR B C   1 
ATOM   534  O O   . THR B 2 7  ? -9.338  17.322  -10.687 1.00 14.83 ? 384 THR B O   1 
ATOM   535  C CB  . THR B 2 7  ? -8.018  19.818  -9.414  1.00 13.48 ? 384 THR B CB  1 
ATOM   536  O OG1 . THR B 2 7  ? -6.927  20.713  -9.156  1.00 15.43 ? 384 THR B OG1 1 
ATOM   537  C CG2 . THR B 2 7  ? -9.007  19.878  -8.256  1.00 13.69 ? 384 THR B CG2 1 
ATOM   538  N N   . ALA B 2 8  ? -8.792  16.568  -8.649  1.00 9.21  ? 385 ALA B N   1 
ATOM   539  C CA  . ALA B 2 8  ? -9.833  15.550  -8.672  1.00 11.37 ? 385 ALA B CA  1 
ATOM   540  C C   . ALA B 2 8  ? -11.208 16.207  -8.666  1.00 10.88 ? 385 ALA B C   1 
ATOM   541  O O   . ALA B 2 8  ? -11.447 17.187  -7.949  1.00 12.80 ? 385 ALA B O   1 
ATOM   542  C CB  . ALA B 2 8  ? -9.675  14.598  -7.498  1.00 11.62 ? 385 ALA B CB  1 
ATOM   543  N N   . PRO B 2 9  ? -12.114 15.698  -9.503  1.00 10.22 ? 386 PRO B N   1 
ATOM   544  C CA  . PRO B 2 9  ? -13.461 16.279  -9.509  1.00 11.67 ? 386 PRO B CA  1 
ATOM   545  C C   . PRO B 2 9  ? -14.174 16.049  -8.176  1.00 12.54 ? 386 PRO B C   1 
ATOM   546  O O   . PRO B 2 9  ? -13.857 15.089  -7.477  1.00 14.67 ? 386 PRO B O   1 
ATOM   547  C CB  . PRO B 2 9  ? -14.166 15.529  -10.642 1.00 13.87 ? 386 PRO B CB  1 
ATOM   548  C CG  . PRO B 2 9  ? -13.096 14.885  -11.434 1.00 13.21 ? 386 PRO B CG  1 
ATOM   549  C CD  . PRO B 2 9  ? -11.971 14.612  -10.487 1.00 11.33 ? 386 PRO B CD  1 
ATOM   550  N N   . PRO B 2 10 ? -15.107 16.937  -7.802  1.00 16.16 ? 387 PRO B N   1 
ATOM   551  C CA  . PRO B 2 10 ? -15.840 16.692  -6.557  1.00 17.82 ? 387 PRO B CA  1 
ATOM   552  C C   . PRO B 2 10 ? -16.587 15.361  -6.579  1.00 17.64 ? 387 PRO B C   1 
ATOM   553  O O   . PRO B 2 10 ? -17.037 14.943  -7.648  1.00 16.75 ? 387 PRO B O   1 
ATOM   554  C CB  . PRO B 2 10 ? -16.829 17.862  -6.493  1.00 21.60 ? 387 PRO B CB  1 
ATOM   555  C CG  . PRO B 2 10 ? -16.171 18.956  -7.269  1.00 23.15 ? 387 PRO B CG  1 
ATOM   556  C CD  . PRO B 2 10 ? -15.379 18.272  -8.364  1.00 19.50 ? 387 PRO B CD  1 
ATOM   557  N N   . ARG B 2 11 ? -16.718 14.722  -5.418  1.00 18.54 ? 388 ARG B N   1 
ATOM   558  C CA  . ARG B 2 11 ? -17.573 13.544  -5.276  1.00 16.49 ? 388 ARG B CA  1 
ATOM   559  C C   . ARG B 2 11 ? -19.041 13.974  -5.252  1.00 17.96 ? 388 ARG B C   1 
ATOM   560  O O   . ARG B 2 11 ? -19.364 15.121  -4.917  1.00 19.84 ? 388 ARG B O   1 
ATOM   561  C CB  . ARG B 2 11 ? -17.263 12.769  -3.988  1.00 15.62 ? 388 ARG B CB  1 
ATOM   562  C CG  . ARG B 2 11 ? -15.849 12.229  -3.841  1.00 15.96 ? 388 ARG B CG  1 
ATOM   563  C CD  . ARG B 2 11 ? -15.536 11.178  -4.874  1.00 14.20 ? 388 ARG B CD  1 
ATOM   564  N NE  . ARG B 2 11 ? -16.485 10.064  -4.887  1.00 14.86 ? 388 ARG B NE  1 
ATOM   565  C CZ  . ARG B 2 11 ? -16.374 8.965   -4.139  1.00 16.82 ? 388 ARG B CZ  1 
ATOM   566  N NH1 . ARG B 2 11 ? -15.367 8.828   -3.289  1.00 15.51 ? 388 ARG B NH1 1 
ATOM   567  N NH2 . ARG B 2 11 ? -17.283 8.004   -4.233  1.00 13.28 ? 388 ARG B NH2 1 
ATOM   568  N N   . ARG B 2 12 ? -19.935 13.048  -5.571  1.00 17.28 ? 389 ARG B N   1 
ATOM   569  C CA  . ARG B 2 12 ? -21.365 13.349  -5.544  1.00 22.43 ? 389 ARG B CA  1 
ATOM   570  C C   . ARG B 2 12 ? -21.848 13.691  -4.136  1.00 29.61 ? 389 ARG B C   1 
ATOM   571  O O   . ARG B 2 12 ? -22.612 14.646  -3.952  1.00 31.20 ? 389 ARG B O   1 
ATOM   572  C CB  . ARG B 2 12 ? -22.168 12.175  -6.106  1.00 22.30 ? 389 ARG B CB  1 
ATOM   573  C CG  . ARG B 2 12 ? -23.624 12.503  -6.336  1.00 25.00 ? 389 ARG B CG  1 
ATOM   574  C CD  . ARG B 2 12 ? -24.243 11.559  -7.344  1.00 25.06 ? 389 ARG B CD  1 
ATOM   575  N NE  . ARG B 2 12 ? -25.278 12.247  -8.098  1.00 28.54 ? 389 ARG B NE  1 
ATOM   576  C CZ  . ARG B 2 12 ? -26.537 12.369  -7.698  1.00 29.95 ? 389 ARG B CZ  1 
ATOM   577  N NH1 . ARG B 2 12 ? -26.930 11.825  -6.551  1.00 33.25 ? 389 ARG B NH1 1 
ATOM   578  N NH2 . ARG B 2 12 ? -27.401 13.029  -8.451  1.00 28.13 ? 389 ARG B NH2 1 
ATOM   579  N N   . ARG B 2 13 ? -21.417 12.900  -3.155  1.00 32.49 ? 390 ARG B N   1 
ATOM   580  C CA  . ARG B 2 13 ? -21.603 13.221  -1.733  1.00 39.00 ? 390 ARG B CA  1 
ATOM   581  C C   . ARG B 2 13 ? -23.021 13.651  -1.361  1.00 45.13 ? 390 ARG B C   1 
ATOM   582  O O   . ARG B 2 13 ? -23.221 14.729  -0.795  1.00 49.27 ? 390 ARG B O   1 
ATOM   583  C CB  . ARG B 2 13 ? -20.619 14.319  -1.313  1.00 38.86 ? 390 ARG B CB  1 
ATOM   584  N N   . GLY C 1 1  ? 4.079   -17.536 -29.478 1.00 18.90 ? -4  GLY C N   1 
ATOM   585  C CA  . GLY C 1 1  ? 5.341   -16.889 -29.157 1.00 18.44 ? -4  GLY C CA  1 
ATOM   586  C C   . GLY C 1 1  ? 6.484   -17.865 -29.321 1.00 20.84 ? -4  GLY C C   1 
ATOM   587  O O   . GLY C 1 1  ? 6.258   -19.050 -29.590 1.00 19.52 ? -4  GLY C O   1 
ATOM   588  N N   . PRO C 1 2  ? 7.726   -17.377 -29.171 1.00 20.68 ? -3  PRO C N   1 
ATOM   589  C CA  . PRO C 1 2  ? 8.880   -18.275 -29.249 1.00 21.18 ? -3  PRO C CA  1 
ATOM   590  C C   . PRO C 1 2  ? 8.866   -19.313 -28.126 1.00 20.92 ? -3  PRO C C   1 
ATOM   591  O O   . PRO C 1 2  ? 8.145   -19.150 -27.138 1.00 15.62 ? -3  PRO C O   1 
ATOM   592  C CB  . PRO C 1 2  ? 10.081  -17.321 -29.129 1.00 22.23 ? -3  PRO C CB  1 
ATOM   593  C CG  . PRO C 1 2  ? 9.546   -16.099 -28.478 1.00 20.68 ? -3  PRO C CG  1 
ATOM   594  C CD  . PRO C 1 2  ? 8.116   -15.977 -28.930 1.00 20.57 ? -3  PRO C CD  1 
ATOM   595  N N   . LEU C 1 3  ? 9.640   -20.381 -28.294 1.00 21.59 ? -2  LEU C N   1 
ATOM   596  C CA  . LEU C 1 3  ? 9.680   -21.456 -27.308 1.00 22.85 ? -2  LEU C CA  1 
ATOM   597  C C   . LEU C 1 3  ? 9.994   -20.955 -25.909 1.00 24.16 ? -2  LEU C C   1 
ATOM   598  O O   . LEU C 1 3  ? 10.934  -20.179 -25.719 1.00 25.44 ? -2  LEU C O   1 
ATOM   599  C CB  . LEU C 1 3  ? 10.718  -22.507 -27.709 1.00 18.88 ? -2  LEU C CB  1 
ATOM   600  C CG  . LEU C 1 3  ? 10.389  -23.405 -28.900 1.00 21.98 ? -2  LEU C CG  1 
ATOM   601  C CD1 . LEU C 1 3  ? 11.595  -24.237 -29.254 1.00 23.84 ? -2  LEU C CD1 1 
ATOM   602  C CD2 . LEU C 1 3  ? 9.185   -24.285 -28.617 1.00 23.29 ? -2  LEU C CD2 1 
ATOM   603  N N   . GLY C 1 4  ? 9.203   -21.399 -24.937 1.00 23.41 ? -1  GLY C N   1 
ATOM   604  C CA  . GLY C 1 4  ? 9.455   -21.090 -23.539 1.00 24.70 ? -1  GLY C CA  1 
ATOM   605  C C   . GLY C 1 4  ? 8.950   -19.744 -23.053 1.00 25.60 ? -1  GLY C C   1 
ATOM   606  O O   . GLY C 1 4  ? 9.331   -19.285 -21.972 1.00 26.59 ? -1  GLY C O   1 
ATOM   607  N N   . SER C 1 5  ? 8.096   -19.100 -23.841 1.00 23.43 ? 0   SER C N   1 
ATOM   608  C CA  . SER C 1 5  ? 7.541   -17.814 -23.447 1.00 21.79 ? 0   SER C CA  1 
ATOM   609  C C   . SER C 1 5  ? 6.681   -17.968 -22.202 1.00 20.95 ? 0   SER C C   1 
ATOM   610  O O   . SER C 1 5  ? 6.054   -18.997 -21.997 1.00 19.82 ? 0   SER C O   1 
ATOM   611  C CB  . SER C 1 5  ? 6.704   -17.207 -24.574 1.00 23.43 ? 0   SER C CB  1 
ATOM   612  O OG  . SER C 1 5  ? 7.495   -16.960 -25.724 1.00 26.03 ? 0   SER C OG  1 
ATOM   613  N N   . MET C 1 6  ? 6.644   -16.933 -21.379 1.00 20.21 ? 1   MET C N   1 
ATOM   614  C CA  A MET C 1 6  ? 5.803   -16.963 -20.194 0.43 19.42 ? 1   MET C CA  1 
ATOM   615  C CA  B MET C 1 6  ? 5.807   -16.936 -20.191 0.57 19.39 ? 1   MET C CA  1 
ATOM   616  C C   . MET C 1 6  ? 4.328   -16.880 -20.550 1.00 17.36 ? 1   MET C C   1 
ATOM   617  O O   . MET C 1 6  ? 3.945   -16.281 -21.561 1.00 19.67 ? 1   MET C O   1 
ATOM   618  C CB  A MET C 1 6  ? 6.165   -15.829 -19.250 0.43 19.88 ? 1   MET C CB  1 
ATOM   619  C CB  B MET C 1 6  ? 6.170   -15.762 -19.293 0.57 19.90 ? 1   MET C CB  1 
ATOM   620  C CG  A MET C 1 6  ? 7.423   -16.090 -18.471 0.43 20.07 ? 1   MET C CG  1 
ATOM   621  C CG  B MET C 1 6  ? 7.620   -15.762 -18.862 0.57 20.83 ? 1   MET C CG  1 
ATOM   622  S SD  A MET C 1 6  ? 7.508   -14.975 -17.084 0.43 20.29 ? 1   MET C SD  1 
ATOM   623  S SD  B MET C 1 6  ? 7.919   -14.441 -17.692 0.57 24.01 ? 1   MET C SD  1 
ATOM   624  C CE  A MET C 1 6  ? 9.278   -14.909 -16.841 0.43 12.58 ? 1   MET C CE  1 
ATOM   625  C CE  B MET C 1 6  ? 6.434   -14.575 -16.712 0.57 14.39 ? 1   MET C CE  1 
ATOM   626  N N   . VAL C 1 7  ? 3.510   -17.488 -19.700 1.00 13.25 ? 2   VAL C N   1 
ATOM   627  C CA  . VAL C 1 7  ? 2.081   -17.563 -19.881 1.00 12.17 ? 2   VAL C CA  1 
ATOM   628  C C   . VAL C 1 7  ? 1.362   -16.790 -18.783 1.00 12.63 ? 2   VAL C C   1 
ATOM   629  O O   . VAL C 1 7  ? 1.661   -16.965 -17.601 1.00 13.69 ? 2   VAL C O   1 
ATOM   630  C CB  . VAL C 1 7  ? 1.605   -19.025 -19.871 1.00 14.53 ? 2   VAL C CB  1 
ATOM   631  C CG1 . VAL C 1 7  ? 0.099   -19.088 -20.034 1.00 16.26 ? 2   VAL C CG1 1 
ATOM   632  C CG2 . VAL C 1 7  ? 2.296   -19.814 -20.972 1.00 16.92 ? 2   VAL C CG2 1 
ATOM   633  N N   . ASP C 1 8  ? 0.439   -15.920 -19.180 1.00 11.92 ? 3   ASP C N   1 
ATOM   634  C CA  . ASP C 1 8  ? -0.373  -15.157 -18.225 1.00 11.71 ? 3   ASP C CA  1 
ATOM   635  C C   . ASP C 1 8  ? -1.861  -15.473 -18.374 1.00 10.74 ? 3   ASP C C   1 
ATOM   636  O O   . ASP C 1 8  ? -2.329  -15.806 -19.461 1.00 11.70 ? 3   ASP C O   1 
ATOM   637  C CB  . ASP C 1 8  ? -0.173  -13.650 -18.412 1.00 13.19 ? 3   ASP C CB  1 
ATOM   638  C CG  . ASP C 1 8  ? 1.263   -13.207 -18.205 1.00 18.13 ? 3   ASP C CG  1 
ATOM   639  O OD1 . ASP C 1 8  ? 2.016   -13.865 -17.455 1.00 19.27 ? 3   ASP C OD1 1 
ATOM   640  O OD2 . ASP C 1 8  ? 1.635   -12.177 -18.805 1.00 19.38 ? 3   ASP C OD2 1 
ATOM   641  N N   . TYR C 1 9  ? -2.602  -15.341 -17.279 1.00 10.54 ? 4   TYR C N   1 
ATOM   642  C CA  . TYR C 1 9  ? -4.046  -15.571 -17.282 1.00 9.13  ? 4   TYR C CA  1 
ATOM   643  C C   . TYR C 1 9  ? -4.794  -14.396 -16.665 1.00 10.90 ? 4   TYR C C   1 
ATOM   644  O O   . TYR C 1 9  ? -4.311  -13.782 -15.716 1.00 11.24 ? 4   TYR C O   1 
ATOM   645  C CB  . TYR C 1 9  ? -4.386  -16.835 -16.498 1.00 8.95  ? 4   TYR C CB  1 
ATOM   646  C CG  . TYR C 1 9  ? -4.197  -18.123 -17.256 1.00 10.06 ? 4   TYR C CG  1 
ATOM   647  C CD1 . TYR C 1 9  ? -5.293  -18.826 -17.737 1.00 13.22 ? 4   TYR C CD1 1 
ATOM   648  C CD2 . TYR C 1 9  ? -2.928  -18.639 -17.498 1.00 11.47 ? 4   TYR C CD2 1 
ATOM   649  C CE1 . TYR C 1 9  ? -5.137  -20.005 -18.420 1.00 13.40 ? 4   TYR C CE1 1 
ATOM   650  C CE2 . TYR C 1 9  ? -2.764  -19.827 -18.184 1.00 13.46 ? 4   TYR C CE2 1 
ATOM   651  C CZ  . TYR C 1 9  ? -3.874  -20.499 -18.643 1.00 14.54 ? 4   TYR C CZ  1 
ATOM   652  O OH  . TYR C 1 9  ? -3.738  -21.680 -19.331 1.00 18.21 ? 4   TYR C OH  1 
ATOM   653  N N   . ILE C 1 10 ? -5.974  -14.097 -17.191 1.00 9.82  ? 5   ILE C N   1 
ATOM   654  C CA  A ILE C 1 10 ? -6.789  -13.040 -16.603 0.42 11.28 ? 5   ILE C CA  1 
ATOM   655  C CA  B ILE C 1 10 ? -6.855  -13.047 -16.655 0.58 11.50 ? 5   ILE C CA  1 
ATOM   656  C C   . ILE C 1 10 ? -7.890  -13.655 -15.729 1.00 10.76 ? 5   ILE C C   1 
ATOM   657  O O   . ILE C 1 10 ? -8.541  -14.614 -16.103 1.00 12.56 ? 5   ILE C O   1 
ATOM   658  C CB  A ILE C 1 10 ? -7.377  -12.120 -17.700 0.42 12.99 ? 5   ILE C CB  1 
ATOM   659  C CB  B ILE C 1 10 ? -7.613  -12.301 -17.773 0.58 13.14 ? 5   ILE C CB  1 
ATOM   660  C CG1 A ILE C 1 10 ? -8.115  -10.925 -17.089 0.42 14.79 ? 5   ILE C CG1 1 
ATOM   661  C CG1 B ILE C 1 10 ? -6.647  -11.675 -18.773 0.58 13.88 ? 5   ILE C CG1 1 
ATOM   662  C CG2 A ILE C 1 10 ? -8.258  -12.904 -18.667 0.42 13.22 ? 5   ILE C CG2 1 
ATOM   663  C CG2 B ILE C 1 10 ? -8.580  -11.255 -17.183 0.58 13.50 ? 5   ILE C CG2 1 
ATOM   664  C CD1 A ILE C 1 10 ? -8.527  -9.901  -18.124 0.42 18.01 ? 5   ILE C CD1 1 
ATOM   665  C CD1 B ILE C 1 10 ? -7.325  -11.234 -20.056 0.58 17.03 ? 5   ILE C CD1 1 
ATOM   666  N N   . VAL C 1 11 ? -8.063  -13.104 -14.536 1.00 8.83  ? 6   VAL C N   1 
ATOM   667  C CA  . VAL C 1 11 ? -9.064  -13.628 -13.612 1.00 8.48  ? 6   VAL C CA  1 
ATOM   668  C C   . VAL C 1 11 ? -10.462 -13.158 -14.033 1.00 10.48 ? 6   VAL C C   1 
ATOM   669  O O   . VAL C 1 11 ? -10.708 -11.959 -14.176 1.00 11.23 ? 6   VAL C O   1 
ATOM   670  C CB  . VAL C 1 11 ? -8.756  -13.202 -12.160 1.00 7.98  ? 6   VAL C CB  1 
ATOM   671  C CG1 . VAL C 1 11 ? -9.880  -13.635 -11.222 1.00 9.04  ? 6   VAL C CG1 1 
ATOM   672  C CG2 . VAL C 1 11 ? -7.420  -13.788 -11.703 1.00 10.27 ? 6   VAL C CG2 1 
ATOM   673  N N   . GLU C 1 12 ? -11.381 -14.104 -14.232 1.00 11.17 ? 7   GLU C N   1 
ATOM   674  C CA  . GLU C 1 12 ? -12.733 -13.772 -14.680 1.00 12.50 ? 7   GLU C CA  1 
ATOM   675  C C   . GLU C 1 12 ? -13.795 -13.918 -13.581 1.00 11.10 ? 7   GLU C C   1 
ATOM   676  O O   . GLU C 1 12 ? -14.905 -13.375 -13.707 1.00 11.87 ? 7   GLU C O   1 
ATOM   677  C CB  . GLU C 1 12 ? -13.118 -14.641 -15.889 1.00 13.74 ? 7   GLU C CB  1 
ATOM   678  C CG  . GLU C 1 12 ? -12.221 -14.463 -17.117 1.00 15.09 ? 7   GLU C CG  1 
ATOM   679  C CD  . GLU C 1 12 ? -12.419 -13.125 -17.819 1.00 18.45 ? 7   GLU C CD  1 
ATOM   680  O OE1 . GLU C 1 12 ? -13.416 -12.428 -17.527 1.00 17.13 ? 7   GLU C OE1 1 
ATOM   681  O OE2 . GLU C 1 12 ? -11.566 -12.772 -18.666 1.00 20.86 ? 7   GLU C OE2 1 
ATOM   682  N N   . TYR C 1 13 ? -13.455 -14.645 -12.516 1.00 9.22  ? 8   TYR C N   1 
ATOM   683  C CA  . TYR C 1 13 ? -14.352 -14.849 -11.385 1.00 10.25 ? 8   TYR C CA  1 
ATOM   684  C C   . TYR C 1 13 ? -13.577 -14.820 -10.092 1.00 8.77  ? 8   TYR C C   1 
ATOM   685  O O   . TYR C 1 13 ? -12.459 -15.346 -10.032 1.00 9.91  ? 8   TYR C O   1 
ATOM   686  C CB  . TYR C 1 13 ? -15.092 -16.195 -11.484 1.00 7.82  ? 8   TYR C CB  1 
ATOM   687  C CG  . TYR C 1 13 ? -15.941 -16.302 -12.716 1.00 11.89 ? 8   TYR C CG  1 
ATOM   688  C CD1 . TYR C 1 13 ? -15.443 -16.890 -13.873 1.00 12.81 ? 8   TYR C CD1 1 
ATOM   689  C CD2 . TYR C 1 13 ? -17.244 -15.825 -12.726 1.00 14.58 ? 8   TYR C CD2 1 
ATOM   690  C CE1 . TYR C 1 13 ? -16.220 -16.979 -15.020 1.00 12.89 ? 8   TYR C CE1 1 
ATOM   691  C CE2 . TYR C 1 13 ? -18.026 -15.911 -13.872 1.00 16.09 ? 8   TYR C CE2 1 
ATOM   692  C CZ  . TYR C 1 13 ? -17.505 -16.489 -15.006 1.00 16.48 ? 8   TYR C CZ  1 
ATOM   693  O OH  . TYR C 1 13 ? -18.275 -16.578 -16.148 1.00 20.57 ? 8   TYR C OH  1 
ATOM   694  N N   . ASP C 1 14 ? -14.195 -14.252 -9.055  1.00 10.38 ? 9   ASP C N   1 
ATOM   695  C CA  . ASP C 1 14 ? -13.606 -14.230 -7.724  1.00 12.03 ? 9   ASP C CA  1 
ATOM   696  C C   . ASP C 1 14 ? -13.492 -15.639 -7.150  1.00 9.93  ? 9   ASP C C   1 
ATOM   697  O O   . ASP C 1 14 ? -14.349 -16.495 -7.392  1.00 10.83 ? 9   ASP C O   1 
ATOM   698  C CB  . ASP C 1 14 ? -14.426 -13.375 -6.758  1.00 12.69 ? 9   ASP C CB  1 
ATOM   699  C CG  . ASP C 1 14 ? -14.484 -11.896 -7.144  1.00 14.67 ? 9   ASP C CG  1 
ATOM   700  O OD1 . ASP C 1 14 ? -13.605 -11.368 -7.865  1.00 13.26 ? 9   ASP C OD1 1 
ATOM   701  O OD2 . ASP C 1 14 ? -15.437 -11.248 -6.676  1.00 15.78 ? 9   ASP C OD2 1 
ATOM   702  N N   . TYR C 1 15 ? -12.416 -15.870 -6.404  1.00 9.54  ? 10  TYR C N   1 
ATOM   703  C CA  . TYR C 1 15 ? -12.217 -17.118 -5.680  1.00 9.01  ? 10  TYR C CA  1 
ATOM   704  C C   . TYR C 1 15 ? -11.443 -16.828 -4.391  1.00 10.02 ? 10  TYR C C   1 
ATOM   705  O O   . TYR C 1 15 ? -10.403 -16.170 -4.414  1.00 11.15 ? 10  TYR C O   1 
ATOM   706  C CB  . TYR C 1 15 ? -11.473 -18.163 -6.531  1.00 9.80  ? 10  TYR C CB  1 
ATOM   707  C CG  . TYR C 1 15 ? -11.204 -19.468 -5.794  1.00 9.93  ? 10  TYR C CG  1 
ATOM   708  C CD1 . TYR C 1 15 ? -12.196 -20.448 -5.686  1.00 10.74 ? 10  TYR C CD1 1 
ATOM   709  C CD2 . TYR C 1 15 ? -9.969  -19.720 -5.200  1.00 9.58  ? 10  TYR C CD2 1 
ATOM   710  C CE1 . TYR C 1 15 ? -11.969 -21.637 -5.005  1.00 10.69 ? 10  TYR C CE1 1 
ATOM   711  C CE2 . TYR C 1 15 ? -9.726  -20.927 -4.515  1.00 9.67  ? 10  TYR C CE2 1 
ATOM   712  C CZ  . TYR C 1 15 ? -10.739 -21.878 -4.426  1.00 10.58 ? 10  TYR C CZ  1 
ATOM   713  O OH  . TYR C 1 15 ? -10.519 -23.052 -3.756  1.00 11.78 ? 10  TYR C OH  1 
ATOM   714  N N   . ASP C 1 16 ? -11.970 -17.318 -3.272  1.00 10.31 ? 11  ASP C N   1 
ATOM   715  C CA  . ASP C 1 16 ? -11.300 -17.231 -1.980  1.00 11.91 ? 11  ASP C CA  1 
ATOM   716  C C   . ASP C 1 16 ? -10.560 -18.524 -1.701  1.00 9.60  ? 11  ASP C C   1 
ATOM   717  O O   . ASP C 1 16 ? -11.154 -19.608 -1.775  1.00 10.51 ? 11  ASP C O   1 
ATOM   718  C CB  . ASP C 1 16 ? -12.289 -16.999 -0.843  1.00 12.93 ? 11  ASP C CB  1 
ATOM   719  C CG  . ASP C 1 16 ? -12.816 -15.580 -0.785  1.00 14.39 ? 11  ASP C CG  1 
ATOM   720  O OD1 . ASP C 1 16 ? -13.593 -15.321 0.153   1.00 14.80 ? 11  ASP C OD1 1 
ATOM   721  O OD2 . ASP C 1 16 ? -12.449 -14.737 -1.633  1.00 14.42 ? 11  ASP C OD2 1 
ATOM   722  N N   . ALA C 1 17 ? -9.284  -18.409 -1.346  1.00 10.96 ? 12  ALA C N   1 
ATOM   723  C CA  . ALA C 1 17 ? -8.479  -19.591 -1.023  1.00 11.29 ? 12  ALA C CA  1 
ATOM   724  C C   . ALA C 1 17 ? -9.142  -20.462 0.051   1.00 12.53 ? 12  ALA C C   1 
ATOM   725  O O   . ALA C 1 17 ? -9.582  -19.951 1.082   1.00 15.64 ? 12  ALA C O   1 
ATOM   726  C CB  . ALA C 1 17 ? -7.068  -19.164 -0.571  1.00 11.47 ? 12  ALA C CB  1 
ATOM   727  N N   . VAL C 1 18 ? -9.215  -21.775 -0.198  1.00 12.94 ? 13  VAL C N   1 
ATOM   728  C CA  . VAL C 1 18 ? -9.752  -22.746 0.766   1.00 13.05 ? 13  VAL C CA  1 
ATOM   729  C C   . VAL C 1 18 ? -8.611  -23.533 1.423   1.00 14.49 ? 13  VAL C C   1 
ATOM   730  O O   . VAL C 1 18 ? -8.747  -24.063 2.526   1.00 17.05 ? 13  VAL C O   1 
ATOM   731  C CB  . VAL C 1 18 ? -10.744 -23.740 0.080   1.00 17.86 ? 13  VAL C CB  1 
ATOM   732  C CG1 . VAL C 1 18 ? -11.252 -24.801 1.059   1.00 19.91 ? 13  VAL C CG1 1 
ATOM   733  C CG2 . VAL C 1 18 ? -11.912 -22.996 -0.557  1.00 18.74 ? 13  VAL C CG2 1 
ATOM   734  N N   . HIS C 1 19 ? -7.486  -23.618 0.724   1.00 12.93 ? 14  HIS C N   1 
ATOM   735  C CA  . HIS C 1 19 ? -6.287  -24.243 1.271   1.00 11.76 ? 14  HIS C CA  1 
ATOM   736  C C   . HIS C 1 19 ? -5.148  -23.249 1.156   1.00 11.41 ? 14  HIS C C   1 
ATOM   737  O O   . HIS C 1 19 ? -5.187  -22.372 0.312   1.00 12.16 ? 14  HIS C O   1 
ATOM   738  C CB  . HIS C 1 19 ? -5.954  -25.543 0.545   1.00 12.86 ? 14  HIS C CB  1 
ATOM   739  C CG  . HIS C 1 19 ? -7.070  -26.538 0.567   1.00 15.17 ? 14  HIS C CG  1 
ATOM   740  N ND1 . HIS C 1 19 ? -8.013  -26.627 -0.434  1.00 18.01 ? 14  HIS C ND1 1 
ATOM   741  C CD2 . HIS C 1 19 ? -7.408  -27.475 1.485   1.00 19.07 ? 14  HIS C CD2 1 
ATOM   742  C CE1 . HIS C 1 19 ? -8.882  -27.576 -0.135  1.00 17.01 ? 14  HIS C CE1 1 
ATOM   743  N NE2 . HIS C 1 19 ? -8.537  -28.106 1.024   1.00 17.97 ? 14  HIS C NE2 1 
ATOM   744  N N   . ASP C 1 20 ? -4.137  -23.397 2.000   1.00 12.24 ? 15  ASP C N   1 
ATOM   745  C CA  . ASP C 1 20 ? -3.104  -22.367 2.129   1.00 11.86 ? 15  ASP C CA  1 
ATOM   746  C C   . ASP C 1 20 ? -2.215  -22.215 0.897   1.00 12.65 ? 15  ASP C C   1 
ATOM   747  O O   . ASP C 1 20 ? -1.586  -21.163 0.715   1.00 12.46 ? 15  ASP C O   1 
ATOM   748  C CB  . ASP C 1 20 ? -2.232  -22.650 3.345   1.00 11.76 ? 15  ASP C CB  1 
ATOM   749  C CG  . ASP C 1 20 ? -2.965  -22.419 4.655   1.00 15.40 ? 15  ASP C CG  1 
ATOM   750  O OD1 . ASP C 1 20 ? -2.322  -22.584 5.703   1.00 19.64 ? 15  ASP C OD1 1 
ATOM   751  O OD2 . ASP C 1 20 ? -4.161  -22.059 4.639   1.00 18.61 ? 15  ASP C OD2 1 
ATOM   752  N N   . ASP C 1 21 ? -2.164  -23.241 0.046   1.00 11.23 ? 16  ASP C N   1 
ATOM   753  C CA  . ASP C 1 21 ? -1.365  -23.137 -1.172  1.00 10.14 ? 16  ASP C CA  1 
ATOM   754  C C   . ASP C 1 21 ? -2.113  -22.446 -2.311  1.00 10.52 ? 16  ASP C C   1 
ATOM   755  O O   . ASP C 1 21 ? -1.554  -22.277 -3.395  1.00 12.01 ? 16  ASP C O   1 
ATOM   756  C CB  . ASP C 1 21 ? -0.873  -24.530 -1.618  1.00 9.87  ? 16  ASP C CB  1 
ATOM   757  C CG  . ASP C 1 21 ? -1.991  -25.434 -2.111  1.00 15.58 ? 16  ASP C CG  1 
ATOM   758  O OD1 . ASP C 1 21 ? -1.674  -26.436 -2.795  1.00 18.12 ? 16  ASP C OD1 1 
ATOM   759  O OD2 . ASP C 1 21 ? -3.172  -25.142 -1.835  1.00 14.78 ? 16  ASP C OD2 1 
ATOM   760  N N   . GLU C 1 22 ? -3.351  -22.013 -2.057  1.00 9.76  ? 17  GLU C N   1 
ATOM   761  C CA  . GLU C 1 22 ? -4.175  -21.372 -3.081  1.00 8.36  ? 17  GLU C CA  1 
ATOM   762  C C   . GLU C 1 22 ? -4.141  -19.846 -3.044  1.00 10.69 ? 17  GLU C C   1 
ATOM   763  O O   . GLU C 1 22 ? -4.024  -19.224 -1.983  1.00 12.32 ? 17  GLU C O   1 
ATOM   764  C CB  . GLU C 1 22 ? -5.630  -21.836 -2.951  1.00 9.07  ? 17  GLU C CB  1 
ATOM   765  C CG  . GLU C 1 22 ? -5.807  -23.338 -3.135  1.00 9.88  ? 17  GLU C CG  1 
ATOM   766  C CD  . GLU C 1 22 ? -7.228  -23.802 -2.855  1.00 11.17 ? 17  GLU C CD  1 
ATOM   767  O OE1 . GLU C 1 22 ? -8.096  -22.953 -2.583  1.00 12.80 ? 17  GLU C OE1 1 
ATOM   768  O OE2 . GLU C 1 22 ? -7.480  -25.022 -2.910  1.00 12.31 ? 17  GLU C OE2 1 
ATOM   769  N N   . LEU C 1 23 ? -4.246  -19.251 -4.224  1.00 10.20 ? 18  LEU C N   1 
ATOM   770  C CA  . LEU C 1 23 ? -4.410  -17.808 -4.359  1.00 10.01 ? 18  LEU C CA  1 
ATOM   771  C C   . LEU C 1 23 ? -5.835  -17.403 -4.038  1.00 10.38 ? 18  LEU C C   1 
ATOM   772  O O   . LEU C 1 23 ? -6.768  -18.164 -4.304  1.00 9.82  ? 18  LEU C O   1 
ATOM   773  C CB  . LEU C 1 23 ? -4.081  -17.351 -5.783  1.00 8.82  ? 18  LEU C CB  1 
ATOM   774  C CG  . LEU C 1 23 ? -2.654  -17.580 -6.276  1.00 9.30  ? 18  LEU C CG  1 
ATOM   775  C CD1 . LEU C 1 23 ? -2.555  -17.142 -7.736  1.00 11.16 ? 18  LEU C CD1 1 
ATOM   776  C CD2 . LEU C 1 23 ? -1.643  -16.831 -5.401  1.00 10.59 ? 18  LEU C CD2 1 
ATOM   777  N N   . THR C 1 24 ? -5.990  -16.208 -3.472  1.00 9.31  ? 19  THR C N   1 
ATOM   778  C CA  . THR C 1 24 ? -7.276  -15.519 -3.462  1.00 9.98  ? 19  THR C CA  1 
ATOM   779  C C   . THR C 1 24 ? -7.254  -14.531 -4.609  1.00 10.84 ? 19  THR C C   1 
ATOM   780  O O   . THR C 1 24 ? -6.340  -13.712 -4.714  1.00 10.66 ? 19  THR C O   1 
ATOM   781  C CB  . THR C 1 24 ? -7.544  -14.801 -2.135  1.00 10.61 ? 19  THR C CB  1 
ATOM   782  O OG1 . THR C 1 24 ? -7.677  -15.779 -1.096  1.00 11.49 ? 19  THR C OG1 1 
ATOM   783  C CG2 . THR C 1 24 ? -8.827  -13.939 -2.209  1.00 12.55 ? 19  THR C CG2 1 
ATOM   784  N N   . ILE C 1 25 ? -8.231  -14.653 -5.505  1.00 11.13 ? 20  ILE C N   1 
ATOM   785  C CA  . ILE C 1 25 ? -8.190  -13.910 -6.751  1.00 9.82  ? 20  ILE C CA  1 
ATOM   786  C C   . ILE C 1 25 ? -9.459  -13.096 -6.955  1.00 10.06 ? 20  ILE C C   1 
ATOM   787  O O   . ILE C 1 25 ? -10.525 -13.417 -6.432  1.00 9.79  ? 20  ILE C O   1 
ATOM   788  C CB  . ILE C 1 25 ? -7.965  -14.848 -7.963  1.00 9.01  ? 20  ILE C CB  1 
ATOM   789  C CG1 . ILE C 1 25 ? -9.145  -15.807 -8.141  1.00 8.44  ? 20  ILE C CG1 1 
ATOM   790  C CG2 . ILE C 1 25 ? -6.666  -15.664 -7.757  1.00 9.74  ? 20  ILE C CG2 1 
ATOM   791  C CD1 . ILE C 1 25 ? -8.926  -16.869 -9.242  1.00 9.26  ? 20  ILE C CD1 1 
ATOM   792  N N   . ARG C 1 26 ? -9.311  -12.011 -7.701  1.00 11.64 ? 21  ARG C N   1 
ATOM   793  C CA  . ARG C 1 26 ? -10.382 -11.050 -7.913  1.00 10.04 ? 21  ARG C CA  1 
ATOM   794  C C   . ARG C 1 26 ? -10.456 -10.710 -9.389  1.00 8.76  ? 21  ARG C C   1 
ATOM   795  O O   . ARG C 1 26 ? -9.431  -10.558 -10.043 1.00 10.11 ? 21  ARG C O   1 
ATOM   796  C CB  . ARG C 1 26 ? -10.147 -9.776  -7.073  1.00 10.34 ? 21  ARG C CB  1 
ATOM   797  C CG  . ARG C 1 26 ? -10.195 -10.013 -5.561  1.00 12.01 ? 21  ARG C CG  1 
ATOM   798  C CD  . ARG C 1 26 ? -11.600 -10.426 -5.152  1.00 12.68 ? 21  ARG C CD  1 
ATOM   799  N NE  . ARG C 1 26 ? -11.786 -10.620 -3.716  1.00 12.93 ? 21  ARG C NE  1 
ATOM   800  C CZ  . ARG C 1 26 ? -11.894 -11.806 -3.125  1.00 13.29 ? 21  ARG C CZ  1 
ATOM   801  N NH1 . ARG C 1 26 ? -12.093 -11.875 -1.814  1.00 13.25 ? 21  ARG C NH1 1 
ATOM   802  N NH2 . ARG C 1 26 ? -11.795 -12.920 -3.841  1.00 11.79 ? 21  ARG C NH2 1 
ATOM   803  N N   . VAL C 1 27 ? -11.672 -10.591 -9.910  1.00 8.15  ? 22  VAL C N   1 
ATOM   804  C CA  . VAL C 1 27 ? -11.880 -10.291 -11.323 1.00 9.11  ? 22  VAL C CA  1 
ATOM   805  C C   . VAL C 1 27 ? -10.996 -9.138  -11.794 1.00 11.26 ? 22  VAL C C   1 
ATOM   806  O O   . VAL C 1 27 ? -10.958 -8.087  -11.157 1.00 11.79 ? 22  VAL C O   1 
ATOM   807  C CB  . VAL C 1 27 ? -13.353 -9.925  -11.587 1.00 12.29 ? 22  VAL C CB  1 
ATOM   808  C CG1 . VAL C 1 27 ? -13.564 -9.561  -13.054 1.00 12.57 ? 22  VAL C CG1 1 
ATOM   809  C CG2 . VAL C 1 27 ? -14.275 -11.059 -11.153 1.00 12.51 ? 22  VAL C CG2 1 
ATOM   810  N N   . GLY C 1 28 ? -10.294 -9.338  -12.905 1.00 9.85  ? 23  GLY C N   1 
ATOM   811  C CA  . GLY C 1 28 ? -9.436  -8.303  -13.455 1.00 11.35 ? 23  GLY C CA  1 
ATOM   812  C C   . GLY C 1 28 ? -7.958  -8.541  -13.240 1.00 11.93 ? 23  GLY C C   1 
ATOM   813  O O   . GLY C 1 28 ? -7.128  -8.116  -14.054 1.00 12.78 ? 23  GLY C O   1 
ATOM   814  N N   . GLU C 1 29 ? -7.622  -9.204  -12.141 1.00 11.42 ? 24  GLU C N   1 
ATOM   815  C CA  . GLU C 1 29 ? -6.227  -9.487  -11.837 1.00 11.30 ? 24  GLU C CA  1 
ATOM   816  C C   . GLU C 1 29 ? -5.573  -10.319 -12.922 1.00 10.58 ? 24  GLU C C   1 
ATOM   817  O O   . GLU C 1 29 ? -6.226  -11.120 -13.600 1.00 9.93  ? 24  GLU C O   1 
ATOM   818  C CB  . GLU C 1 29 ? -6.094  -10.210 -10.501 1.00 11.36 ? 24  GLU C CB  1 
ATOM   819  C CG  . GLU C 1 29 ? -6.373  -9.306  -9.300  1.00 13.36 ? 24  GLU C CG  1 
ATOM   820  C CD  . GLU C 1 29 ? -6.213  -10.049 -7.993  1.00 16.48 ? 24  GLU C CD  1 
ATOM   821  O OE1 . GLU C 1 29 ? -5.723  -9.451  -7.012  1.00 19.94 ? 24  GLU C OE1 1 
ATOM   822  O OE2 . GLU C 1 29 ? -6.548  -11.246 -7.958  1.00 19.90 ? 24  GLU C OE2 1 
ATOM   823  N N   . ILE C 1 30 ? -4.275  -10.101 -13.090 1.00 9.80  ? 25  ILE C N   1 
ATOM   824  C CA  . ILE C 1 30 ? -3.473  -10.909 -13.996 1.00 11.48 ? 25  ILE C CA  1 
ATOM   825  C C   . ILE C 1 30 ? -2.568  -11.821 -13.173 1.00 9.18  ? 25  ILE C C   1 
ATOM   826  O O   . ILE C 1 30 ? -1.803  -11.340 -12.336 1.00 10.05 ? 25  ILE C O   1 
ATOM   827  C CB  . ILE C 1 30 ? -2.589  -10.056 -14.934 1.00 13.20 ? 25  ILE C CB  1 
ATOM   828  C CG1 . ILE C 1 30 ? -3.401  -8.932  -15.588 1.00 13.07 ? 25  ILE C CG1 1 
ATOM   829  C CG2 . ILE C 1 30 ? -1.908  -10.959 -15.977 1.00 13.24 ? 25  ILE C CG2 1 
ATOM   830  C CD1 . ILE C 1 30 ? -4.572  -9.431  -16.434 1.00 13.17 ? 25  ILE C CD1 1 
ATOM   831  N N   . ILE C 1 31 ? -2.665  -13.125 -13.412 1.00 8.04  ? 26  ILE C N   1 
ATOM   832  C CA  . ILE C 1 31 ? -1.783  -14.113 -12.788 1.00 9.07  ? 26  ILE C CA  1 
ATOM   833  C C   . ILE C 1 31 ? -0.661  -14.424 -13.762 1.00 9.95  ? 26  ILE C C   1 
ATOM   834  O O   . ILE C 1 31 ? -0.921  -14.742 -14.925 1.00 10.44 ? 26  ILE C O   1 
ATOM   835  C CB  . ILE C 1 31 ? -2.540  -15.411 -12.420 1.00 11.28 ? 26  ILE C CB  1 
ATOM   836  C CG1 . ILE C 1 31 ? -3.786  -15.078 -11.581 1.00 12.33 ? 26  ILE C CG1 1 
ATOM   837  C CG2 . ILE C 1 31 ? -1.596  -16.411 -11.728 1.00 9.62  ? 26  ILE C CG2 1 
ATOM   838  C CD1 . ILE C 1 31 ? -4.692  -16.262 -11.324 1.00 12.42 ? 26  ILE C CD1 1 
ATOM   839  N N   . ARG C 1 32 ? 0.582   -14.305 -13.298 1.00 8.76  ? 27  ARG C N   1 
ATOM   840  C CA  . ARG C 1 32 ? 1.729   -14.358 -14.198 1.00 9.78  ? 27  ARG C CA  1 
ATOM   841  C C   . ARG C 1 32 ? 2.640   -15.567 -14.012 1.00 9.57  ? 27  ARG C C   1 
ATOM   842  O O   . ARG C 1 32 ? 2.602   -16.249 -12.988 1.00 10.11 ? 27  ARG C O   1 
ATOM   843  C CB  . ARG C 1 32 ? 2.531   -13.062 -14.057 1.00 11.85 ? 27  ARG C CB  1 
ATOM   844  C CG  . ARG C 1 32 ? 1.646   -11.844 -14.284 1.00 12.31 ? 27  ARG C CG  1 
ATOM   845  C CD  . ARG C 1 32 ? 2.397   -10.543 -14.276 1.00 14.44 ? 27  ARG C CD  1 
ATOM   846  N NE  . ARG C 1 32 ? 1.471   -9.437  -14.476 1.00 12.95 ? 27  ARG C NE  1 
ATOM   847  C CZ  . ARG C 1 32 ? 1.132   -8.949  -15.661 1.00 12.83 ? 27  ARG C CZ  1 
ATOM   848  N NH1 . ARG C 1 32 ? 0.273   -7.939  -15.734 1.00 13.18 ? 27  ARG C NH1 1 
ATOM   849  N NH2 . ARG C 1 32 ? 1.670   -9.448  -16.768 1.00 14.07 ? 27  ARG C NH2 1 
ATOM   850  N N   . ASN C 1 33 ? 3.440   -15.836 -15.037 1.00 10.15 ? 28  ASN C N   1 
ATOM   851  C CA  . ASN C 1 33 ? 4.371   -16.971 -15.022 1.00 10.32 ? 28  ASN C CA  1 
ATOM   852  C C   . ASN C 1 33 ? 3.658   -18.258 -14.639 1.00 9.29  ? 28  ASN C C   1 
ATOM   853  O O   . ASN C 1 33 ? 4.075   -18.971 -13.724 1.00 10.80 ? 28  ASN C O   1 
ATOM   854  C CB  . ASN C 1 33 ? 5.537   -16.691 -14.057 1.00 11.80 ? 28  ASN C CB  1 
ATOM   855  C CG  . ASN C 1 33 ? 6.676   -17.703 -14.189 1.00 14.60 ? 28  ASN C CG  1 
ATOM   856  O OD1 . ASN C 1 33 ? 7.313   -18.076 -13.199 1.00 15.71 ? 28  ASN C OD1 1 
ATOM   857  N ND2 . ASN C 1 33 ? 6.917   -18.166 -15.405 1.00 13.62 ? 28  ASN C ND2 1 
ATOM   858  N N   . VAL C 1 34 ? 2.562   -18.540 -15.335 1.00 9.27  ? 29  VAL C N   1 
ATOM   859  C CA  . VAL C 1 34 ? 1.702   -19.662 -14.989 1.00 10.39 ? 29  VAL C CA  1 
ATOM   860  C C   . VAL C 1 34 ? 2.262   -20.985 -15.482 1.00 11.78 ? 29  VAL C C   1 
ATOM   861  O O   . VAL C 1 34 ? 2.763   -21.103 -16.606 1.00 14.01 ? 29  VAL C O   1 
ATOM   862  C CB  . VAL C 1 34 ? 0.273   -19.455 -15.544 1.00 10.52 ? 29  VAL C CB  1 
ATOM   863  C CG1 . VAL C 1 34 ? -0.584  -20.695 -15.327 1.00 11.65 ? 29  VAL C CG1 1 
ATOM   864  C CG2 . VAL C 1 34 ? -0.374  -18.272 -14.875 1.00 9.23  ? 29  VAL C CG2 1 
ATOM   865  N N   . LYS C 1 35 ? 2.186   -21.983 -14.615 1.00 12.39 ? 30  LYS C N   1 
ATOM   866  C CA  . LYS C 1 35 ? 2.668   -23.315 -14.930 1.00 15.74 ? 30  LYS C CA  1 
ATOM   867  C C   . LYS C 1 35 ? 1.631   -24.353 -14.562 1.00 16.58 ? 30  LYS C C   1 
ATOM   868  O O   . LYS C 1 35 ? 0.904   -24.193 -13.593 1.00 13.92 ? 30  LYS C O   1 
ATOM   869  C CB  . LYS C 1 35 ? 3.965   -23.627 -14.181 1.00 19.46 ? 30  LYS C CB  1 
ATOM   870  C CG  . LYS C 1 35 ? 5.064   -22.585 -14.285 1.00 22.86 ? 30  LYS C CG  1 
ATOM   871  C CD  . LYS C 1 35 ? 6.163   -22.883 -13.276 1.00 28.52 ? 30  LYS C CD  1 
ATOM   872  C CE  . LYS C 1 35 ? 7.328   -21.906 -13.384 1.00 32.83 ? 30  LYS C CE  1 
ATOM   873  N NZ  . LYS C 1 35 ? 8.126   -22.106 -14.628 1.00 36.00 ? 30  LYS C NZ  1 
ATOM   874  N N   A LYS C 1 36 ? 1.567   -25.425 -15.343 0.53 18.27 ? 31  LYS C N   1 
ATOM   875  N N   B LYS C 1 36 ? 1.575   -25.424 -15.344 0.47 18.33 ? 31  LYS C N   1 
ATOM   876  C CA  A LYS C 1 36 ? 0.798   -26.600 -14.959 0.53 19.84 ? 31  LYS C CA  1 
ATOM   877  C CA  B LYS C 1 36 ? 0.813   -26.598 -14.960 0.47 19.87 ? 31  LYS C CA  1 
ATOM   878  C C   A LYS C 1 36 ? 1.688   -27.509 -14.124 0.53 21.06 ? 31  LYS C C   1 
ATOM   879  C C   B LYS C 1 36 ? 1.707   -27.489 -14.112 0.47 21.06 ? 31  LYS C C   1 
ATOM   880  O O   A LYS C 1 36 ? 2.766   -27.913 -14.565 0.53 22.89 ? 31  LYS C O   1 
ATOM   881  O O   B LYS C 1 36 ? 2.804   -27.861 -14.529 0.47 22.71 ? 31  LYS C O   1 
ATOM   882  C CB  A LYS C 1 36 ? 0.269   -27.341 -16.190 0.53 21.71 ? 31  LYS C CB  1 
ATOM   883  C CB  B LYS C 1 36 ? 0.305   -27.357 -16.186 0.47 21.68 ? 31  LYS C CB  1 
ATOM   884  C CG  A LYS C 1 36 ? -0.327  -28.723 -15.901 0.53 23.08 ? 31  LYS C CG  1 
ATOM   885  C CG  B LYS C 1 36 ? -0.583  -28.549 -15.843 0.47 22.93 ? 31  LYS C CG  1 
ATOM   886  C CD  A LYS C 1 36 ? -1.556  -28.650 -15.002 0.53 22.54 ? 31  LYS C CD  1 
ATOM   887  C CD  B LYS C 1 36 ? -1.836  -28.092 -15.109 0.47 22.30 ? 31  LYS C CD  1 
ATOM   888  C CE  A LYS C 1 36 ? -2.363  -29.944 -15.062 0.53 23.03 ? 31  LYS C CE  1 
ATOM   889  C CE  B LYS C 1 36 ? -3.087  -28.709 -15.701 0.47 23.64 ? 31  LYS C CE  1 
ATOM   890  N NZ  A LYS C 1 36 ? -1.571  -31.146 -14.652 0.53 22.45 ? 31  LYS C NZ  1 
ATOM   891  N NZ  B LYS C 1 36 ? -4.327  -28.048 -15.200 0.47 22.25 ? 31  LYS C NZ  1 
ATOM   892  N N   . LEU C 1 37 ? 1.251   -27.814 -12.911 1.00 21.22 ? 32  LEU C N   1 
ATOM   893  C CA  . LEU C 1 37 ? 1.992   -28.724 -12.065 1.00 21.79 ? 32  LEU C CA  1 
ATOM   894  C C   . LEU C 1 37 ? 1.331   -30.086 -12.193 1.00 23.55 ? 32  LEU C C   1 
ATOM   895  O O   . LEU C 1 37 ? 0.781   -30.407 -13.244 1.00 25.21 ? 32  LEU C O   1 
ATOM   896  C CB  . LEU C 1 37 ? 2.035   -28.232 -10.624 1.00 19.63 ? 32  LEU C CB  1 
ATOM   897  C CG  . LEU C 1 37 ? 2.671   -26.847 -10.461 1.00 21.35 ? 32  LEU C CG  1 
ATOM   898  C CD1 . LEU C 1 37 ? 2.905   -26.565 -8.992  1.00 22.04 ? 32  LEU C CD1 1 
ATOM   899  C CD2 . LEU C 1 37 ? 3.976   -26.738 -11.250 1.00 22.08 ? 32  LEU C CD2 1 
ATOM   900  N N   . GLN C 1 38 ? 1.377   -30.890 -11.144 1.00 26.10 ? 33  GLN C N   1 
ATOM   901  C CA  . GLN C 1 38 ? 0.909   -32.270 -11.274 1.00 26.41 ? 33  GLN C CA  1 
ATOM   902  C C   . GLN C 1 38 ? -0.613  -32.358 -11.195 1.00 24.03 ? 33  GLN C C   1 
ATOM   903  O O   . GLN C 1 38 ? -1.208  -33.350 -11.594 1.00 22.72 ? 33  GLN C O   1 
ATOM   904  C CB  . GLN C 1 38 ? 1.544   -33.154 -10.199 1.00 27.64 ? 33  GLN C CB  1 
ATOM   905  N N   . GLU C 1 39 ? -1.241  -31.299 -10.705 1.00 26.02 ? 34  GLU C N   1 
ATOM   906  C CA  . GLU C 1 39 ? -2.645  -31.360 -10.310 1.00 25.57 ? 34  GLU C CA  1 
ATOM   907  C C   . GLU C 1 39 ? -3.655  -31.052 -11.419 1.00 24.93 ? 34  GLU C C   1 
ATOM   908  O O   . GLU C 1 39 ? -3.587  -30.020 -12.083 1.00 28.46 ? 34  GLU C O   1 
ATOM   909  C CB  . GLU C 1 39 ? -2.875  -30.411 -9.138  1.00 24.33 ? 34  GLU C CB  1 
ATOM   910  C CG  . GLU C 1 39 ? -4.090  -30.738 -8.324  1.00 25.15 ? 34  GLU C CG  1 
ATOM   911  C CD  . GLU C 1 39 ? -4.008  -30.156 -6.935  1.00 24.59 ? 34  GLU C CD  1 
ATOM   912  O OE1 . GLU C 1 39 ? -3.048  -29.396 -6.661  1.00 25.87 ? 34  GLU C OE1 1 
ATOM   913  O OE2 . GLU C 1 39 ? -4.900  -30.455 -6.122  1.00 22.70 ? 34  GLU C OE2 1 
ATOM   914  N N   . GLU C 1 40 ? -4.615  -31.954 -11.583 1.00 21.27 ? 35  GLU C N   1 
ATOM   915  C CA  . GLU C 1 40 ? -5.672  -31.817 -12.576 1.00 18.35 ? 35  GLU C CA  1 
ATOM   916  C C   . GLU C 1 40 ? -6.652  -30.690 -12.212 1.00 17.54 ? 35  GLU C C   1 
ATOM   917  O O   . GLU C 1 40 ? -7.126  -30.619 -11.077 1.00 16.59 ? 35  GLU C O   1 
ATOM   918  C CB  . GLU C 1 40 ? -6.413  -33.158 -12.716 1.00 21.91 ? 35  GLU C CB  1 
ATOM   919  C CG  . GLU C 1 40 ? -7.435  -33.209 -13.821 1.00 23.79 ? 35  GLU C CG  1 
ATOM   920  C CD  . GLU C 1 40 ? -7.949  -34.623 -14.081 1.00 26.55 ? 35  GLU C CD  1 
ATOM   921  O OE1 . GLU C 1 40 ? -7.564  -35.562 -13.343 1.00 24.84 ? 35  GLU C OE1 1 
ATOM   922  O OE2 . GLU C 1 40 ? -8.737  -34.791 -15.033 1.00 29.38 ? 35  GLU C OE2 1 
ATOM   923  N N   . GLY C 1 41 ? -6.923  -29.798 -13.166 1.00 15.35 ? 36  GLY C N   1 
ATOM   924  C CA  . GLY C 1 41 ? -7.936  -28.761 -12.992 1.00 13.86 ? 36  GLY C CA  1 
ATOM   925  C C   . GLY C 1 41 ? -7.417  -27.486 -12.345 1.00 12.42 ? 36  GLY C C   1 
ATOM   926  O O   . GLY C 1 41 ? -8.130  -26.480 -12.230 1.00 13.86 ? 36  GLY C O   1 
ATOM   927  N N   . TRP C 1 42 ? -6.156  -27.531 -11.929 1.00 12.24 ? 37  TRP C N   1 
ATOM   928  C CA  . TRP C 1 42 ? -5.544  -26.433 -11.191 1.00 10.68 ? 37  TRP C CA  1 
ATOM   929  C C   . TRP C 1 42 ? -4.260  -25.982 -11.875 1.00 12.14 ? 37  TRP C C   1 
ATOM   930  O O   . TRP C 1 42 ? -3.552  -26.782 -12.484 1.00 15.85 ? 37  TRP C O   1 
ATOM   931  C CB  . TRP C 1 42 ? -5.288  -26.855 -9.739  1.00 11.40 ? 37  TRP C CB  1 
ATOM   932  C CG  . TRP C 1 42 ? -6.592  -26.964 -8.989  1.00 11.81 ? 37  TRP C CG  1 
ATOM   933  C CD1 . TRP C 1 42 ? -7.520  -27.956 -9.102  1.00 14.28 ? 37  TRP C CD1 1 
ATOM   934  C CD2 . TRP C 1 42 ? -7.139  -26.001 -8.082  1.00 11.16 ? 37  TRP C CD2 1 
ATOM   935  N NE1 . TRP C 1 42 ? -8.597  -27.687 -8.299  1.00 12.61 ? 37  TRP C NE1 1 
ATOM   936  C CE2 . TRP C 1 42 ? -8.392  -26.487 -7.670  1.00 12.45 ? 37  TRP C CE2 1 
ATOM   937  C CE3 . TRP C 1 42 ? -6.679  -24.781 -7.566  1.00 10.49 ? 37  TRP C CE3 1 
ATOM   938  C CZ2 . TRP C 1 42 ? -9.195  -25.799 -6.762  1.00 11.52 ? 37  TRP C CZ2 1 
ATOM   939  C CZ3 . TRP C 1 42 ? -7.481  -24.093 -6.665  1.00 9.37  ? 37  TRP C CZ3 1 
ATOM   940  C CH2 . TRP C 1 42 ? -8.726  -24.605 -6.272  1.00 9.59  ? 37  TRP C CH2 1 
ATOM   941  N N   . LEU C 1 43 ? -3.991  -24.684 -11.802 1.00 10.17 ? 38  LEU C N   1 
ATOM   942  C CA  . LEU C 1 43 ? -2.755  -24.116 -12.330 1.00 11.82 ? 38  LEU C CA  1 
ATOM   943  C C   . LEU C 1 43 ? -1.995  -23.440 -11.215 1.00 10.82 ? 38  LEU C C   1 
ATOM   944  O O   . LEU C 1 43 ? -2.536  -23.223 -10.136 1.00 11.17 ? 38  LEU C O   1 
ATOM   945  C CB  . LEU C 1 43 ? -3.055  -23.114 -13.444 1.00 13.15 ? 38  LEU C CB  1 
ATOM   946  C CG  . LEU C 1 43 ? -3.637  -23.752 -14.701 1.00 14.76 ? 38  LEU C CG  1 
ATOM   947  C CD1 . LEU C 1 43 ? -4.230  -22.698 -15.620 1.00 15.27 ? 38  LEU C CD1 1 
ATOM   948  C CD2 . LEU C 1 43 ? -2.568  -24.561 -15.410 1.00 18.44 ? 38  LEU C CD2 1 
ATOM   949  N N   . GLU C 1 44 ? -0.736  -23.108 -11.476 1.00 9.96  ? 39  GLU C N   1 
ATOM   950  C CA  A GLU C 1 44 ? 0.079   -22.401 -10.502 0.54 11.17 ? 39  GLU C CA  1 
ATOM   951  C CA  B GLU C 1 44 ? 0.090   -22.390 -10.500 0.46 11.19 ? 39  GLU C CA  1 
ATOM   952  C C   . GLU C 1 44 ? 0.631   -21.113 -11.112 1.00 11.25 ? 39  GLU C C   1 
ATOM   953  O O   . GLU C 1 44 ? 1.003   -21.087 -12.272 1.00 13.17 ? 39  GLU C O   1 
ATOM   954  C CB  A GLU C 1 44 ? 1.206   -23.310 -10.025 0.54 12.42 ? 39  GLU C CB  1 
ATOM   955  C CB  B GLU C 1 44 ? 1.258   -23.248 -10.009 0.46 12.76 ? 39  GLU C CB  1 
ATOM   956  C CG  A GLU C 1 44 ? 1.788   -22.922 -8.706  0.54 14.10 ? 39  GLU C CG  1 
ATOM   957  C CG  B GLU C 1 44 ? 2.073   -22.593 -8.893  0.46 14.38 ? 39  GLU C CG  1 
ATOM   958  C CD  A GLU C 1 44 ? 3.086   -22.195 -8.860  0.54 15.57 ? 39  GLU C CD  1 
ATOM   959  C CD  B GLU C 1 44 ? 3.497   -23.114 -8.809  0.46 15.73 ? 39  GLU C CD  1 
ATOM   960  O OE1 A GLU C 1 44 ? 3.689   -22.279 -9.951  0.54 16.02 ? 39  GLU C OE1 1 
ATOM   961  O OE1 B GLU C 1 44 ? 4.157   -23.240 -9.862  0.46 15.26 ? 39  GLU C OE1 1 
ATOM   962  O OE2 A GLU C 1 44 ? 3.505   -21.540 -7.892  0.54 18.90 ? 39  GLU C OE2 1 
ATOM   963  O OE2 B GLU C 1 44 ? 3.951   -23.418 -7.686  0.46 16.44 ? 39  GLU C OE2 1 
ATOM   964  N N   . GLY C 1 45 ? 0.688   -20.047 -10.329 1.00 10.25 ? 40  GLY C N   1 
ATOM   965  C CA  . GLY C 1 45 ? 1.136   -18.782 -10.891 1.00 8.82  ? 40  GLY C CA  1 
ATOM   966  C C   . GLY C 1 45 ? 1.451   -17.744 -9.852  1.00 8.69  ? 40  GLY C C   1 
ATOM   967  O O   . GLY C 1 45 ? 1.204   -17.948 -8.671  1.00 9.73  ? 40  GLY C O   1 
ATOM   968  N N   . GLU C 1 46 ? 1.993   -16.623 -10.322 1.00 9.11  ? 41  GLU C N   1 
ATOM   969  C CA  . GLU C 1 46 ? 2.450   -15.523 -9.482  1.00 9.88  ? 41  GLU C CA  1 
ATOM   970  C C   . GLU C 1 46 ? 1.381   -14.444 -9.411  1.00 8.07  ? 41  GLU C C   1 
ATOM   971  O O   . GLU C 1 46 ? 0.820   -14.058 -10.425 1.00 9.47  ? 41  GLU C O   1 
ATOM   972  C CB  . GLU C 1 46 ? 3.746   -14.934 -10.043 1.00 10.42 ? 41  GLU C CB  1 
ATOM   973  C CG  . GLU C 1 46 ? 4.449   -13.907 -9.135  1.00 11.02 ? 41  GLU C CG  1 
ATOM   974  C CD  . GLU C 1 46 ? 3.829   -12.522 -9.198  1.00 14.26 ? 41  GLU C CD  1 
ATOM   975  O OE1 . GLU C 1 46 ? 3.289   -12.141 -10.265 1.00 13.10 ? 41  GLU C OE1 1 
ATOM   976  O OE2 . GLU C 1 46 ? 3.853   -11.823 -8.162  1.00 14.87 ? 41  GLU C OE2 1 
ATOM   977  N N   . LEU C 1 47 ? 1.110   -13.951 -8.215  1.00 8.49  ? 42  LEU C N   1 
ATOM   978  C CA  . LEU C 1 47 ? 0.152   -12.857 -8.065  1.00 8.72  ? 42  LEU C CA  1 
ATOM   979  C C   . LEU C 1 47 ? 0.529   -11.999 -6.874  1.00 11.99 ? 42  LEU C C   1 
ATOM   980  O O   . LEU C 1 47 ? 0.598   -12.487 -5.743  1.00 12.73 ? 42  LEU C O   1 
ATOM   981  C CB  . LEU C 1 47 ? -1.270  -13.410 -7.906  1.00 10.01 ? 42  LEU C CB  1 
ATOM   982  C CG  . LEU C 1 47 ? -2.374  -12.373 -7.657  1.00 11.48 ? 42  LEU C CG  1 
ATOM   983  C CD1 . LEU C 1 47 ? -2.498  -11.410 -8.827  1.00 12.39 ? 42  LEU C CD1 1 
ATOM   984  C CD2 . LEU C 1 47 ? -3.676  -13.080 -7.393  1.00 12.03 ? 42  LEU C CD2 1 
ATOM   985  N N   . ASN C 1 48 ? 0.800   -10.725 -7.141  1.00 15.35 ? 43  ASN C N   1 
ATOM   986  C CA  . ASN C 1 48 ? 1.093   -9.755  -6.093  1.00 17.09 ? 43  ASN C CA  1 
ATOM   987  C C   . ASN C 1 48 ? 2.221   -10.185 -5.152  1.00 16.49 ? 43  ASN C C   1 
ATOM   988  O O   . ASN C 1 48 ? 2.180   -9.897  -3.956  1.00 19.72 ? 43  ASN C O   1 
ATOM   989  C CB  . ASN C 1 48 ? -0.181  -9.456  -5.295  1.00 20.14 ? 43  ASN C CB  1 
ATOM   990  C CG  . ASN C 1 48 ? -1.266  -8.797  -6.148  1.00 25.02 ? 43  ASN C CG  1 
ATOM   991  O OD1 . ASN C 1 48 ? -0.969  -8.027  -7.065  1.00 29.22 ? 43  ASN C OD1 1 
ATOM   992  N ND2 . ASN C 1 48 ? -2.526  -9.087  -5.836  1.00 24.61 ? 43  ASN C ND2 1 
ATOM   993  N N   . GLY C 1 49 ? 3.228   -10.871 -5.696  1.00 13.85 ? 44  GLY C N   1 
ATOM   994  C CA  . GLY C 1 49 ? 4.448   -11.142 -4.954  1.00 15.78 ? 44  GLY C CA  1 
ATOM   995  C C   . GLY C 1 49 ? 4.597   -12.561 -4.431  1.00 15.80 ? 44  GLY C C   1 
ATOM   996  O O   . GLY C 1 49 ? 5.668   -12.932 -3.937  1.00 17.24 ? 44  GLY C O   1 
ATOM   997  N N   . ARG C 1 50 ? 3.530   -13.350 -4.536  1.00 14.98 ? 45  ARG C N   1 
ATOM   998  C CA  . ARG C 1 50 ? 3.541   -14.738 -4.071  1.00 13.56 ? 45  ARG C CA  1 
ATOM   999  C C   . ARG C 1 50 ? 3.133   -15.671 -5.199  1.00 13.62 ? 45  ARG C C   1 
ATOM   1000 O O   . ARG C 1 50 ? 2.607   -15.239 -6.215  1.00 13.88 ? 45  ARG C O   1 
ATOM   1001 C CB  . ARG C 1 50 ? 2.585   -14.937 -2.886  1.00 14.91 ? 45  ARG C CB  1 
ATOM   1002 C CG  . ARG C 1 50 ? 1.128   -14.808 -3.283  1.00 17.01 ? 45  ARG C CG  1 
ATOM   1003 C CD  . ARG C 1 50 ? 0.182   -15.419 -2.252  1.00 18.06 ? 45  ARG C CD  1 
ATOM   1004 N NE  . ARG C 1 50 ? 0.256   -16.881 -2.228  1.00 18.34 ? 45  ARG C NE  1 
ATOM   1005 C CZ  . ARG C 1 50 ? -0.656  -17.650 -1.649  1.00 15.45 ? 45  ARG C CZ  1 
ATOM   1006 N NH1 . ARG C 1 50 ? -1.704  -17.086 -1.067  1.00 17.02 ? 45  ARG C NH1 1 
ATOM   1007 N NH2 . ARG C 1 50 ? -0.538  -18.975 -1.666  1.00 16.30 ? 45  ARG C NH2 1 
ATOM   1008 N N   . ARG C 1 51 ? 3.363   -16.962 -5.014  1.00 14.65 ? 46  ARG C N   1 
ATOM   1009 C CA  . ARG C 1 51 ? 2.894   -17.946 -5.980  1.00 13.32 ? 46  ARG C CA  1 
ATOM   1010 C C   . ARG C 1 51 ? 1.848   -18.826 -5.314  1.00 12.15 ? 46  ARG C C   1 
ATOM   1011 O O   . ARG C 1 51 ? 1.860   -19.018 -4.095  1.00 15.47 ? 46  ARG C O   1 
ATOM   1012 C CB  . ARG C 1 51 ? 4.043   -18.781 -6.527  1.00 16.53 ? 46  ARG C CB  1 
ATOM   1013 C CG  . ARG C 1 51 ? 5.027   -18.007 -7.379  1.00 17.01 ? 46  ARG C CG  1 
ATOM   1014 C CD  . ARG C 1 51 ? 5.999   -18.939 -8.077  1.00 15.62 ? 46  ARG C CD  1 
ATOM   1015 N NE  . ARG C 1 51 ? 5.350   -19.780 -9.084  1.00 14.46 ? 46  ARG C NE  1 
ATOM   1016 C CZ  . ARG C 1 51 ? 5.235   -19.445 -10.366 1.00 15.28 ? 46  ARG C CZ  1 
ATOM   1017 N NH1 . ARG C 1 51 ? 5.718   -18.288 -10.797 1.00 17.56 ? 46  ARG C NH1 1 
ATOM   1018 N NH2 . ARG C 1 51 ? 4.639   -20.258 -11.212 1.00 17.17 ? 46  ARG C NH2 1 
ATOM   1019 N N   . GLY C 1 52 ? 0.914   -19.323 -6.103  1.00 9.60  ? 47  GLY C N   1 
ATOM   1020 C CA  . GLY C 1 52 ? -0.111  -20.203 -5.567  1.00 8.71  ? 47  GLY C CA  1 
ATOM   1021 C C   . GLY C 1 52 ? -0.955  -20.880 -6.617  1.00 9.23  ? 47  GLY C C   1 
ATOM   1022 O O   . GLY C 1 52 ? -0.875  -20.560 -7.812  1.00 10.59 ? 47  GLY C O   1 
ATOM   1023 N N   . MET C 1 53 ? -1.777  -21.823 -6.160  1.00 9.06  ? 48  MET C N   1 
ATOM   1024 C CA  . MET C 1 53 ? -2.629  -22.611 -7.040  1.00 10.51 ? 48  MET C CA  1 
ATOM   1025 C C   . MET C 1 53 ? -3.939  -21.877 -7.285  1.00 8.77  ? 48  MET C C   1 
ATOM   1026 O O   . MET C 1 53 ? -4.425  -21.162 -6.418  1.00 9.97  ? 48  MET C O   1 
ATOM   1027 C CB  . MET C 1 53 ? -2.909  -23.991 -6.423  1.00 10.01 ? 48  MET C CB  1 
ATOM   1028 C CG  . MET C 1 53 ? -1.665  -24.729 -5.988  1.00 14.16 ? 48  MET C CG  1 
ATOM   1029 S SD  . MET C 1 53 ? -0.658  -25.080 -7.429  1.00 17.86 ? 48  MET C SD  1 
ATOM   1030 C CE  . MET C 1 53 ? -1.799  -26.027 -8.433  1.00 22.73 ? 48  MET C CE  1 
ATOM   1031 N N   . PHE C 1 54 ? -4.524  -22.062 -8.458  1.00 8.19  ? 49  PHE C N   1 
ATOM   1032 C CA  . PHE C 1 54 ? -5.832  -21.464 -8.730  1.00 8.70  ? 49  PHE C CA  1 
ATOM   1033 C C   . PHE C 1 54 ? -6.622  -22.355 -9.672  1.00 8.87  ? 49  PHE C C   1 
ATOM   1034 O O   . PHE C 1 54 ? -6.039  -23.135 -10.431 1.00 9.45  ? 49  PHE C O   1 
ATOM   1035 C CB  . PHE C 1 54 ? -5.685  -20.034 -9.286  1.00 7.50  ? 49  PHE C CB  1 
ATOM   1036 C CG  . PHE C 1 54 ? -4.894  -19.940 -10.563 1.00 9.58  ? 49  PHE C CG  1 
ATOM   1037 C CD1 . PHE C 1 54 ? -5.540  -19.901 -11.791 1.00 9.33  ? 49  PHE C CD1 1 
ATOM   1038 C CD2 . PHE C 1 54 ? -3.503  -19.865 -10.533 1.00 11.73 ? 49  PHE C CD2 1 
ATOM   1039 C CE1 . PHE C 1 54 ? -4.815  -19.797 -12.970 1.00 9.09  ? 49  PHE C CE1 1 
ATOM   1040 C CE2 . PHE C 1 54 ? -2.777  -19.776 -11.703 1.00 10.81 ? 49  PHE C CE2 1 
ATOM   1041 C CZ  . PHE C 1 54 ? -3.430  -19.734 -12.922 1.00 10.12 ? 49  PHE C CZ  1 
ATOM   1042 N N   . PRO C 1 55 ? -7.959  -22.287 -9.588  1.00 9.40  ? 50  PRO C N   1 
ATOM   1043 C CA  . PRO C 1 55 ? -8.757  -23.209 -10.406 1.00 10.33 ? 50  PRO C CA  1 
ATOM   1044 C C   . PRO C 1 55 ? -8.788  -22.725 -11.850 1.00 11.32 ? 50  PRO C C   1 
ATOM   1045 O O   . PRO C 1 55 ? -8.960  -21.514 -12.093 1.00 10.82 ? 50  PRO C O   1 
ATOM   1046 C CB  . PRO C 1 55 ? -10.143 -23.158 -9.748  1.00 9.65  ? 50  PRO C CB  1 
ATOM   1047 C CG  . PRO C 1 55 ? -10.203 -21.780 -9.114  1.00 8.89  ? 50  PRO C CG  1 
ATOM   1048 C CD  . PRO C 1 55 ? -8.789  -21.487 -8.659  1.00 9.74  ? 50  PRO C CD  1 
ATOM   1049 N N   . ASP C 1 56 ? -8.611  -23.645 -12.795 1.00 10.15 ? 51  ASP C N   1 
ATOM   1050 C CA  . ASP C 1 56 ? -8.341  -23.212 -14.151 1.00 13.00 ? 51  ASP C CA  1 
ATOM   1051 C C   . ASP C 1 56 ? -9.588  -22.744 -14.880 1.00 13.22 ? 51  ASP C C   1 
ATOM   1052 O O   . ASP C 1 56 ? -9.483  -22.192 -15.956 1.00 12.88 ? 51  ASP C O   1 
ATOM   1053 C CB  . ASP C 1 56 ? -7.623  -24.305 -14.971 1.00 15.89 ? 51  ASP C CB  1 
ATOM   1054 C CG  . ASP C 1 56 ? -8.471  -25.556 -15.234 1.00 18.41 ? 51  ASP C CG  1 
ATOM   1055 O OD1 . ASP C 1 56 ? -9.717  -25.559 -15.078 1.00 18.07 ? 51  ASP C OD1 1 
ATOM   1056 O OD2 . ASP C 1 56 ? -7.850  -26.563 -15.651 1.00 19.93 ? 51  ASP C OD2 1 
ATOM   1057 N N   . ASN C 1 57 ? -10.766 -22.942 -14.298 1.00 11.24 ? 52  ASN C N   1 
ATOM   1058 C CA  . ASN C 1 57 ? -11.985 -22.492 -14.955 1.00 11.14 ? 52  ASN C CA  1 
ATOM   1059 C C   . ASN C 1 57 ? -12.505 -21.145 -14.416 1.00 10.88 ? 52  ASN C C   1 
ATOM   1060 O O   . ASN C 1 57 ? -13.624 -20.736 -14.730 1.00 11.19 ? 52  ASN C O   1 
ATOM   1061 C CB  . ASN C 1 57 ? -13.066 -23.583 -14.875 1.00 12.80 ? 52  ASN C CB  1 
ATOM   1062 C CG  . ASN C 1 57 ? -13.444 -23.981 -13.446 1.00 11.00 ? 52  ASN C CG  1 
ATOM   1063 O OD1 . ASN C 1 57 ? -12.726 -23.722 -12.477 1.00 9.80  ? 52  ASN C OD1 1 
ATOM   1064 N ND2 . ASN C 1 57 ? -14.583 -24.640 -13.326 1.00 12.42 ? 52  ASN C ND2 1 
ATOM   1065 N N   . PHE C 1 58 ? -11.668 -20.461 -13.637 1.00 11.44 ? 53  PHE C N   1 
ATOM   1066 C CA  . PHE C 1 58 ? -11.992 -19.123 -13.115 1.00 9.18  ? 53  PHE C CA  1 
ATOM   1067 C C   . PHE C 1 58 ? -11.220 -18.047 -13.880 1.00 10.80 ? 53  PHE C C   1 
ATOM   1068 O O   . PHE C 1 58 ? -11.304 -16.849 -13.556 1.00 10.07 ? 53  PHE C O   1 
ATOM   1069 C CB  . PHE C 1 58 ? -11.658 -19.019 -11.612 1.00 8.22  ? 53  PHE C CB  1 
ATOM   1070 C CG  . PHE C 1 58 ? -12.690 -19.640 -10.691 1.00 7.81  ? 53  PHE C CG  1 
ATOM   1071 C CD1 . PHE C 1 58 ? -13.023 -20.981 -10.808 1.00 9.16  ? 53  PHE C CD1 1 
ATOM   1072 C CD2 . PHE C 1 58 ? -13.276 -18.892 -9.671  1.00 8.33  ? 53  PHE C CD2 1 
ATOM   1073 C CE1 . PHE C 1 58 ? -13.949 -21.572 -9.966  1.00 8.99  ? 53  PHE C CE1 1 
ATOM   1074 C CE2 . PHE C 1 58 ? -14.211 -19.475 -8.805  1.00 7.33  ? 53  PHE C CE2 1 
ATOM   1075 C CZ  . PHE C 1 58 ? -14.550 -20.816 -8.951  1.00 8.13  ? 53  PHE C CZ  1 
ATOM   1076 N N   . VAL C 1 59 ? -10.464 -18.477 -14.892 1.00 10.20 ? 54  VAL C N   1 
ATOM   1077 C CA  . VAL C 1 59 ? -9.514  -17.621 -15.580 1.00 10.50 ? 54  VAL C CA  1 
ATOM   1078 C C   . VAL C 1 59 ? -9.580  -17.820 -17.095 1.00 11.52 ? 54  VAL C C   1 
ATOM   1079 O O   . VAL C 1 59 ? -10.086 -18.841 -17.572 1.00 14.16 ? 54  VAL C O   1 
ATOM   1080 C CB  . VAL C 1 59 ? -8.069  -17.900 -15.132 1.00 11.39 ? 54  VAL C CB  1 
ATOM   1081 C CG1 . VAL C 1 59 ? -7.842  -17.496 -13.679 1.00 10.59 ? 54  VAL C CG1 1 
ATOM   1082 C CG2 . VAL C 1 59 ? -7.720  -19.383 -15.348 1.00 11.37 ? 54  VAL C CG2 1 
ATOM   1083 N N   . LYS C 1 60 ? -9.042  -16.849 -17.833 1.00 9.99  ? 55  LYS C N   1 
ATOM   1084 C CA  . LYS C 1 60 ? -8.918  -16.928 -19.287 1.00 14.44 ? 55  LYS C CA  1 
ATOM   1085 C C   . LYS C 1 60 ? -7.466  -16.716 -19.673 1.00 15.32 ? 55  LYS C C   1 
ATOM   1086 O O   . LYS C 1 60 ? -6.813  -15.823 -19.144 1.00 15.91 ? 55  LYS C O   1 
ATOM   1087 C CB  . LYS C 1 60 ? -9.798  -15.882 -19.978 1.00 17.62 ? 55  LYS C CB  1 
ATOM   1088 C CG  . LYS C 1 60 ? -9.691  -15.898 -21.496 1.00 23.30 ? 55  LYS C CG  1 
ATOM   1089 C CD  . LYS C 1 60 ? -10.502 -14.790 -22.146 1.00 29.17 ? 55  LYS C CD  1 
ATOM   1090 C CE  . LYS C 1 60 ? -9.838  -13.438 -21.970 1.00 33.33 ? 55  LYS C CE  1 
ATOM   1091 N NZ  . LYS C 1 60 ? -10.257 -12.475 -23.030 1.00 36.84 ? 55  LYS C NZ  1 
ATOM   1092 N N   . GLU C 1 61 ? -6.953  -17.525 -20.593 1.00 16.89 ? 56  GLU C N   1 
ATOM   1093 C CA  . GLU C 1 61 ? -5.555  -17.382 -20.987 1.00 18.16 ? 56  GLU C CA  1 
ATOM   1094 C C   . GLU C 1 61 ? -5.355  -16.150 -21.868 1.00 21.15 ? 56  GLU C C   1 
ATOM   1095 O O   . GLU C 1 61 ? -6.152  -15.875 -22.762 1.00 21.97 ? 56  GLU C O   1 
ATOM   1096 C CB  . GLU C 1 61 ? -5.067  -18.642 -21.710 1.00 20.26 ? 56  GLU C CB  1 
ATOM   1097 C CG  . GLU C 1 61 ? -3.579  -18.626 -22.030 1.00 21.72 ? 56  GLU C CG  1 
ATOM   1098 C CD  . GLU C 1 61 ? -3.103  -19.922 -22.650 1.00 26.69 ? 56  GLU C CD  1 
ATOM   1099 O OE1 . GLU C 1 61 ? -3.955  -20.750 -23.029 1.00 28.64 ? 56  GLU C OE1 1 
ATOM   1100 O OE2 . GLU C 1 61 ? -1.871  -20.117 -22.747 1.00 29.83 ? 56  GLU C OE2 1 
ATOM   1101 N N   . ILE C 1 62 ? -4.305  -15.388 -21.584 1.00 21.29 ? 57  ILE C N   1 
ATOM   1102 C CA  . ILE C 1 62 ? -3.906  -14.291 -22.455 1.00 24.08 ? 57  ILE C CA  1 
ATOM   1103 C C   . ILE C 1 62 ? -3.107  -14.865 -23.618 1.00 28.34 ? 57  ILE C C   1 
ATOM   1104 O O   . ILE C 1 62 ? -2.072  -15.496 -23.416 1.00 27.48 ? 57  ILE C O   1 
ATOM   1105 C CB  . ILE C 1 62 ? -3.068  -13.238 -21.705 1.00 22.69 ? 57  ILE C CB  1 
ATOM   1106 C CG1 . ILE C 1 62 ? -3.840  -12.730 -20.486 1.00 22.85 ? 57  ILE C CG1 1 
ATOM   1107 C CG2 . ILE C 1 62 ? -2.668  -12.095 -22.644 1.00 22.26 ? 57  ILE C CG2 1 
ATOM   1108 C CD1 . ILE C 1 62 ? -3.052  -11.784 -19.616 1.00 23.22 ? 57  ILE C CD1 1 
ATOM   1109 N N   . LYS C 1 63 ? -3.608  -14.669 -24.833 1.00 33.34 ? 58  LYS C N   1 
ATOM   1110 C CA  . LYS C 1 63 ? -2.946  -15.198 -26.020 1.00 37.36 ? 58  LYS C CA  1 
ATOM   1111 C C   . LYS C 1 63 ? -2.616  -14.077 -26.998 1.00 40.59 ? 58  LYS C C   1 
ATOM   1112 O O   . LYS C 1 63 ? -1.818  -13.190 -26.686 1.00 42.06 ? 58  LYS C O   1 
ATOM   1113 C CB  . LYS C 1 63 ? -3.821  -16.257 -26.699 1.00 38.77 ? 58  LYS C CB  1 
ATOM   1114 N N   . LYS D 2 3  ? -22.877 -14.050 -14.591 1.00 47.16 ? 380 LYS D N   1 
ATOM   1115 C CA  . LYS D 2 3  ? -24.071 -14.862 -14.788 1.00 49.00 ? 380 LYS D CA  1 
ATOM   1116 C C   . LYS D 2 3  ? -23.820 -16.288 -14.310 1.00 46.65 ? 380 LYS D C   1 
ATOM   1117 O O   . LYS D 2 3  ? -23.953 -16.585 -13.124 1.00 46.39 ? 380 LYS D O   1 
ATOM   1118 C CB  . LYS D 2 3  ? -24.493 -14.855 -16.258 1.00 51.99 ? 380 LYS D CB  1 
ATOM   1119 N N   . ASN D 2 4  ? -23.453 -17.168 -15.236 1.00 45.29 ? 381 ASN D N   1 
ATOM   1120 C CA  . ASN D 2 4  ? -23.079 -18.535 -14.887 1.00 42.02 ? 381 ASN D CA  1 
ATOM   1121 C C   . ASN D 2 4  ? -21.716 -18.588 -14.190 1.00 36.30 ? 381 ASN D C   1 
ATOM   1122 O O   . ASN D 2 4  ? -20.712 -18.146 -14.750 1.00 36.78 ? 381 ASN D O   1 
ATOM   1123 C CB  . ASN D 2 4  ? -23.060 -19.415 -16.137 1.00 44.59 ? 381 ASN D CB  1 
ATOM   1124 C CG  . ASN D 2 4  ? -24.447 -19.660 -16.700 1.00 49.86 ? 381 ASN D CG  1 
ATOM   1125 O OD1 . ASN D 2 4  ? -25.180 -20.525 -16.221 1.00 52.38 ? 381 ASN D OD1 1 
ATOM   1126 N ND2 . ASN D 2 4  ? -24.813 -18.900 -17.727 1.00 52.74 ? 381 ASN D ND2 1 
ATOM   1127 N N   . LEU D 2 5  ? -21.684 -19.134 -12.976 1.00 30.66 ? 382 LEU D N   1 
ATOM   1128 C CA  . LEU D 2 5  ? -20.452 -19.181 -12.189 1.00 25.01 ? 382 LEU D CA  1 
ATOM   1129 C C   . LEU D 2 5  ? -19.791 -20.547 -12.243 1.00 21.72 ? 382 LEU D C   1 
ATOM   1130 O O   . LEU D 2 5  ? -20.471 -21.581 -12.243 1.00 22.82 ? 382 LEU D O   1 
ATOM   1131 C CB  . LEU D 2 5  ? -20.726 -18.821 -10.729 1.00 25.16 ? 382 LEU D CB  1 
ATOM   1132 C CG  . LEU D 2 5  ? -21.376 -17.468 -10.449 1.00 28.01 ? 382 LEU D CG  1 
ATOM   1133 C CD1 . LEU D 2 5  ? -21.543 -17.281 -8.952  1.00 27.82 ? 382 LEU D CD1 1 
ATOM   1134 C CD2 . LEU D 2 5  ? -20.567 -16.322 -11.062 1.00 28.74 ? 382 LEU D CD2 1 
ATOM   1135 N N   . PRO D 2 6  ? -18.455 -20.557 -12.270 1.00 16.99 ? 383 PRO D N   1 
ATOM   1136 C CA  . PRO D 2 6  ? -17.723 -21.819 -12.248 1.00 15.05 ? 383 PRO D CA  1 
ATOM   1137 C C   . PRO D 2 6  ? -17.654 -22.442 -10.863 1.00 14.69 ? 383 PRO D C   1 
ATOM   1138 O O   . PRO D 2 6  ? -17.660 -21.762 -9.833  1.00 13.97 ? 383 PRO D O   1 
ATOM   1139 C CB  . PRO D 2 6  ? -16.321 -21.418 -12.722 1.00 13.22 ? 383 PRO D CB  1 
ATOM   1140 C CG  . PRO D 2 6  ? -16.171 -19.993 -12.252 1.00 13.12 ? 383 PRO D CG  1 
ATOM   1141 C CD  . PRO D 2 6  ? -17.557 -19.385 -12.338 1.00 14.90 ? 383 PRO D CD  1 
ATOM   1142 N N   . THR D 2 7  ? -17.568 -23.761 -10.855 1.00 12.77 ? 384 THR D N   1 
ATOM   1143 C CA  . THR D 2 7  ? -17.287 -24.488 -9.633  1.00 13.06 ? 384 THR D CA  1 
ATOM   1144 C C   . THR D 2 7  ? -15.845 -24.974 -9.692  1.00 13.00 ? 384 THR D C   1 
ATOM   1145 O O   . THR D 2 7  ? -15.459 -25.652 -10.646 1.00 14.85 ? 384 THR D O   1 
ATOM   1146 C CB  . THR D 2 7  ? -18.230 -25.691 -9.454  1.00 13.51 ? 384 THR D CB  1 
ATOM   1147 O OG1 . THR D 2 7  ? -19.569 -25.233 -9.234  1.00 15.82 ? 384 THR D OG1 1 
ATOM   1148 C CG2 . THR D 2 7  ? -17.807 -26.537 -8.268  1.00 15.77 ? 384 THR D CG2 1 
ATOM   1149 N N   . ALA D 2 8  ? -15.057 -24.640 -8.679  1.00 11.83 ? 385 ALA D N   1 
ATOM   1150 C CA  . ALA D 2 8  ? -13.655 -25.058 -8.657  1.00 11.28 ? 385 ALA D CA  1 
ATOM   1151 C C   . ALA D 2 8  ? -13.549 -26.583 -8.664  1.00 10.11 ? 385 ALA D C   1 
ATOM   1152 O O   . ALA D 2 8  ? -14.314 -27.280 -7.967  1.00 10.99 ? 385 ALA D O   1 
ATOM   1153 C CB  . ALA D 2 8  ? -12.955 -24.480 -7.454  1.00 11.53 ? 385 ALA D CB  1 
ATOM   1154 N N   . PRO D 2 9  ? -12.624 -27.119 -9.472  1.00 10.91 ? 386 PRO D N   1 
ATOM   1155 C CA  . PRO D 2 9  ? -12.483 -28.583 -9.494  1.00 10.92 ? 386 PRO D CA  1 
ATOM   1156 C C   . PRO D 2 9  ? -11.959 -29.108 -8.161  1.00 12.08 ? 386 PRO D C   1 
ATOM   1157 O O   . PRO D 2 9  ? -11.258 -28.377 -7.447  1.00 13.35 ? 386 PRO D O   1 
ATOM   1158 C CB  . PRO D 2 9  ? -11.462 -28.829 -10.618 1.00 14.69 ? 386 PRO D CB  1 
ATOM   1159 C CG  . PRO D 2 9  ? -11.426 -27.546 -11.415 1.00 14.50 ? 386 PRO D CG  1 
ATOM   1160 C CD  . PRO D 2 9  ? -11.709 -26.458 -10.418 1.00 12.83 ? 386 PRO D CD  1 
ATOM   1161 N N   . PRO D 2 10 ? -12.307 -30.362 -7.815  1.00 15.22 ? 387 PRO D N   1 
ATOM   1162 C CA  . PRO D 2 10 ? -11.751 -31.006 -6.621  1.00 16.60 ? 387 PRO D CA  1 
ATOM   1163 C C   . PRO D 2 10 ? -10.224 -30.956 -6.619  1.00 16.05 ? 387 PRO D C   1 
ATOM   1164 O O   . PRO D 2 10 ? -9.633  -31.106 -7.682  1.00 18.46 ? 387 PRO D O   1 
ATOM   1165 C CB  . PRO D 2 10 ? -12.235 -32.458 -6.741  1.00 19.70 ? 387 PRO D CB  1 
ATOM   1166 C CG  . PRO D 2 10 ? -13.479 -32.381 -7.571  1.00 21.91 ? 387 PRO D CG  1 
ATOM   1167 C CD  . PRO D 2 10 ? -13.279 -31.216 -8.518  1.00 18.61 ? 387 PRO D CD  1 
ATOM   1168 N N   . ARG D 2 11 ? -9.608  -30.741 -5.461  1.00 15.34 ? 388 ARG D N   1 
ATOM   1169 C CA  . ARG D 2 11 ? -8.156  -30.868 -5.327  1.00 16.21 ? 388 ARG D CA  1 
ATOM   1170 C C   . ARG D 2 11 ? -7.762  -32.352 -5.313  1.00 18.35 ? 388 ARG D C   1 
ATOM   1171 O O   . ARG D 2 11 ? -8.560  -33.206 -4.926  1.00 18.72 ? 388 ARG D O   1 
ATOM   1172 C CB  . ARG D 2 11 ? -7.664  -30.199 -4.041  1.00 16.19 ? 388 ARG D CB  1 
ATOM   1173 C CG  . ARG D 2 11 ? -7.921  -28.707 -3.929  1.00 15.70 ? 388 ARG D CG  1 
ATOM   1174 C CD  . ARG D 2 11 ? -7.130  -27.932 -4.956  1.00 16.90 ? 388 ARG D CD  1 
ATOM   1175 N NE  . ARG D 2 11 ? -5.702  -28.245 -4.969  1.00 17.30 ? 388 ARG D NE  1 
ATOM   1176 C CZ  . ARG D 2 11 ? -4.775  -27.601 -4.262  1.00 17.24 ? 388 ARG D CZ  1 
ATOM   1177 N NH1 . ARG D 2 11 ? -5.116  -26.593 -3.462  1.00 16.80 ? 388 ARG D NH1 1 
ATOM   1178 N NH2 . ARG D 2 11 ? -3.505  -27.957 -4.365  1.00 15.68 ? 388 ARG D NH2 1 
ATOM   1179 N N   . ARG D 2 12 ? -6.535  -32.663 -5.723  1.00 17.95 ? 389 ARG D N   1 
ATOM   1180 C CA  . ARG D 2 12 ? -6.086  -34.053 -5.691  1.00 24.80 ? 389 ARG D CA  1 
ATOM   1181 C C   . ARG D 2 12 ? -5.926  -34.547 -4.255  1.00 30.09 ? 389 ARG D C   1 
ATOM   1182 O O   . ARG D 2 12 ? -5.299  -33.888 -3.420  1.00 31.41 ? 389 ARG D O   1 
ATOM   1183 C CB  . ARG D 2 12 ? -4.767  -34.223 -6.452  1.00 27.40 ? 389 ARG D CB  1 
ATOM   1184 C CG  . ARG D 2 12 ? -4.301  -35.676 -6.542  1.00 32.18 ? 389 ARG D CG  1 
ATOM   1185 C CD  . ARG D 2 12 ? -2.982  -35.809 -7.293  1.00 37.59 ? 389 ARG D CD  1 
ATOM   1186 N NE  . ARG D 2 12 ? -1.880  -35.196 -6.561  1.00 42.43 ? 389 ARG D NE  1 
ATOM   1187 C CZ  . ARG D 2 12 ? -1.083  -35.848 -5.720  1.00 49.36 ? 389 ARG D CZ  1 
ATOM   1188 N NH1 . ARG D 2 12 ? -1.255  -37.148 -5.512  1.00 53.24 ? 389 ARG D NH1 1 
ATOM   1189 N NH2 . ARG D 2 12 ? -0.106  -35.203 -5.094  1.00 51.68 ? 389 ARG D NH2 1 
ATOM   1190 N N   . GLY E 1 1  ? 7.139   1.152   -29.781 1.00 26.58 ? -4  GLY E N   1 
ATOM   1191 C CA  . GLY E 1 1  ? 5.973   1.948   -29.432 1.00 25.94 ? -4  GLY E CA  1 
ATOM   1192 C C   . GLY E 1 1  ? 6.197   3.448   -29.541 1.00 27.22 ? -4  GLY E C   1 
ATOM   1193 O O   . GLY E 1 1  ? 7.280   3.898   -29.920 1.00 26.26 ? -4  GLY E O   1 
ATOM   1194 N N   . PRO E 1 2  ? 5.160   4.237   -29.214 1.00 27.00 ? -3  PRO E N   1 
ATOM   1195 C CA  . PRO E 1 2  ? 5.244   5.701   -29.253 1.00 27.54 ? -3  PRO E CA  1 
ATOM   1196 C C   . PRO E 1 2  ? 6.362   6.260   -28.379 1.00 26.19 ? -3  PRO E C   1 
ATOM   1197 O O   . PRO E 1 2  ? 6.726   5.662   -27.362 1.00 25.33 ? -3  PRO E O   1 
ATOM   1198 C CB  . PRO E 1 2  ? 3.873   6.144   -28.735 1.00 27.71 ? -3  PRO E CB  1 
ATOM   1199 C CG  . PRO E 1 2  ? 2.963   5.000   -29.065 1.00 28.02 ? -3  PRO E CG  1 
ATOM   1200 C CD  . PRO E 1 2  ? 3.806   3.769   -28.875 1.00 27.50 ? -3  PRO E CD  1 
ATOM   1201 N N   . LEU E 1 3  ? 6.915   7.389   -28.802 1.00 29.07 ? -2  LEU E N   1 
ATOM   1202 C CA  . LEU E 1 3  ? 7.899   8.115   -28.013 1.00 31.56 ? -2  LEU E CA  1 
ATOM   1203 C C   . LEU E 1 3  ? 7.290   8.573   -26.697 1.00 30.79 ? -2  LEU E C   1 
ATOM   1204 O O   . LEU E 1 3  ? 6.112   8.933   -26.646 1.00 29.32 ? -2  LEU E O   1 
ATOM   1205 C CB  . LEU E 1 3  ? 8.426   9.323   -28.789 1.00 35.79 ? -2  LEU E CB  1 
ATOM   1206 C CG  . LEU E 1 3  ? 9.945   9.490   -28.844 1.00 40.29 ? -2  LEU E CG  1 
ATOM   1207 C CD1 . LEU E 1 3  ? 10.562  8.412   -29.718 1.00 42.17 ? -2  LEU E CD1 1 
ATOM   1208 C CD2 . LEU E 1 3  ? 10.321  10.879  -29.342 1.00 42.55 ? -2  LEU E CD2 1 
ATOM   1209 N N   . GLY E 1 4  ? 8.092   8.556   -25.638 1.00 30.43 ? -1  GLY E N   1 
ATOM   1210 C CA  . GLY E 1 4  ? 7.666   9.080   -24.354 1.00 31.21 ? -1  GLY E CA  1 
ATOM   1211 C C   . GLY E 1 4  ? 6.715   8.158   -23.625 1.00 30.37 ? -1  GLY E C   1 
ATOM   1212 O O   . GLY E 1 4  ? 6.146   8.517   -22.593 1.00 31.38 ? -1  GLY E O   1 
ATOM   1213 N N   . SER E 1 5  ? 6.533   6.958   -24.157 1.00 28.44 ? 0   SER E N   1 
ATOM   1214 C CA  . SER E 1 5  ? 5.692   5.991   -23.479 1.00 26.68 ? 0   SER E CA  1 
ATOM   1215 C C   . SER E 1 5  ? 6.452   5.414   -22.296 1.00 23.02 ? 0   SER E C   1 
ATOM   1216 O O   . SER E 1 5  ? 7.683   5.425   -22.245 1.00 23.57 ? 0   SER E O   1 
ATOM   1217 C CB  . SER E 1 5  ? 5.226   4.885   -24.432 1.00 30.03 ? 0   SER E CB  1 
ATOM   1218 O OG  . SER E 1 5  ? 6.314   4.144   -24.948 1.00 33.60 ? 0   SER E OG  1 
ATOM   1219 N N   . MET E 1 6  ? 5.710   4.931   -21.322 1.00 21.02 ? 1   MET E N   1 
ATOM   1220 C CA  A MET E 1 6  ? 6.324   4.357   -20.138 0.54 19.27 ? 1   MET E CA  1 
ATOM   1221 C CA  B MET E 1 6  ? 6.323   4.371   -20.137 0.46 19.33 ? 1   MET E CA  1 
ATOM   1222 C C   . MET E 1 6  ? 7.043   3.068   -20.462 1.00 19.32 ? 1   MET E C   1 
ATOM   1223 O O   . MET E 1 6  ? 6.611   2.303   -21.325 1.00 20.73 ? 1   MET E O   1 
ATOM   1224 C CB  A MET E 1 6  ? 5.288   4.092   -19.068 0.54 18.64 ? 1   MET E CB  1 
ATOM   1225 C CB  B MET E 1 6  ? 5.271   4.156   -19.064 0.46 18.88 ? 1   MET E CB  1 
ATOM   1226 C CG  A MET E 1 6  ? 4.750   5.330   -18.433 0.54 19.64 ? 1   MET E CG  1 
ATOM   1227 C CG  B MET E 1 6  ? 4.450   5.399   -18.785 0.46 20.49 ? 1   MET E CG  1 
ATOM   1228 S SD  A MET E 1 6  ? 3.699   4.800   -17.105 0.54 19.64 ? 1   MET E SD  1 
ATOM   1229 S SD  B MET E 1 6  ? 3.162   5.030   -17.602 0.46 22.06 ? 1   MET E SD  1 
ATOM   1230 C CE  A MET E 1 6  ? 2.863   6.335   -16.725 0.54 14.18 ? 1   MET E CE  1 
ATOM   1231 C CE  B MET E 1 6  ? 4.098   3.996   -16.491 0.46 12.33 ? 1   MET E CE  1 
ATOM   1232 N N   . VAL E 1 7  ? 8.139   2.835   -19.759 1.00 13.23 ? 2   VAL E N   1 
ATOM   1233 C CA  . VAL E 1 7  ? 8.959   1.658   -19.981 1.00 13.13 ? 2   VAL E CA  1 
ATOM   1234 C C   . VAL E 1 7  ? 8.699   0.649   -18.881 1.00 13.92 ? 2   VAL E C   1 
ATOM   1235 O O   . VAL E 1 7  ? 8.741   0.985   -17.701 1.00 13.68 ? 2   VAL E O   1 
ATOM   1236 C CB  . VAL E 1 7  ? 10.454  2.033   -20.024 1.00 15.26 ? 2   VAL E CB  1 
ATOM   1237 C CG1 . VAL E 1 7  ? 11.300  0.803   -20.224 1.00 17.10 ? 2   VAL E CG1 1 
ATOM   1238 C CG2 . VAL E 1 7  ? 10.716  3.049   -21.134 1.00 16.63 ? 2   VAL E CG2 1 
ATOM   1239 N N   . ASP E 1 8  ? 8.401   -0.586  -19.274 1.00 11.47 ? 3   ASP E N   1 
ATOM   1240 C CA  . ASP E 1 8  ? 8.181   -1.667  -18.315 1.00 12.04 ? 3   ASP E CA  1 
ATOM   1241 C C   . ASP E 1 8  ? 9.233   -2.760  -18.473 1.00 11.85 ? 3   ASP E C   1 
ATOM   1242 O O   . ASP E 1 8  ? 9.774   -2.961  -19.563 1.00 13.35 ? 3   ASP E O   1 
ATOM   1243 C CB  . ASP E 1 8  ? 6.784   -2.276  -18.495 1.00 12.19 ? 3   ASP E CB  1 
ATOM   1244 C CG  . ASP E 1 8  ? 5.676   -1.258  -18.319 1.00 14.04 ? 3   ASP E CG  1 
ATOM   1245 O OD1 . ASP E 1 8  ? 5.902   -0.234  -17.644 1.00 13.60 ? 3   ASP E OD1 1 
ATOM   1246 O OD2 . ASP E 1 8  ? 4.572   -1.481  -18.863 1.00 15.23 ? 3   ASP E OD2 1 
ATOM   1247 N N   . TYR E 1 9  ? 9.511   -3.469  -17.384 1.00 10.13 ? 4   TYR E N   1 
ATOM   1248 C CA  . TYR E 1 9  ? 10.438  -4.599  -17.403 1.00 9.70  ? 4   TYR E CA  1 
ATOM   1249 C C   . TYR E 1 9  ? 9.775   -5.869  -16.858 1.00 11.50 ? 4   TYR E C   1 
ATOM   1250 O O   . TYR E 1 9  ? 8.910   -5.796  -15.987 1.00 12.81 ? 4   TYR E O   1 
ATOM   1251 C CB  . TYR E 1 9  ? 11.687  -4.269  -16.578 1.00 9.36  ? 4   TYR E CB  1 
ATOM   1252 C CG  . TYR E 1 9  ? 12.733  -3.485  -17.331 1.00 11.80 ? 4   TYR E CG  1 
ATOM   1253 C CD1 . TYR E 1 9  ? 13.953  -4.062  -17.650 1.00 13.01 ? 4   TYR E CD1 1 
ATOM   1254 C CD2 . TYR E 1 9  ? 12.504  -2.173  -17.724 1.00 12.27 ? 4   TYR E CD2 1 
ATOM   1255 C CE1 . TYR E 1 9  ? 14.916  -3.358  -18.336 1.00 13.55 ? 4   TYR E CE1 1 
ATOM   1256 C CE2 . TYR E 1 9  ? 13.470  -1.454  -18.421 1.00 14.12 ? 4   TYR E CE2 1 
ATOM   1257 C CZ  . TYR E 1 9  ? 14.676  -2.056  -18.713 1.00 14.83 ? 4   TYR E CZ  1 
ATOM   1258 O OH  . TYR E 1 9  ? 15.659  -1.374  -19.399 1.00 18.09 ? 4   TYR E OH  1 
ATOM   1259 N N   . ILE E 1 10 ? 10.175  -7.034  -17.360 1.00 10.34 ? 5   ILE E N   1 
ATOM   1260 C CA  A ILE E 1 10 ? 9.661   -8.274  -16.796 0.59 11.78 ? 5   ILE E CA  1 
ATOM   1261 C CA  B ILE E 1 10 ? 9.705   -8.324  -16.843 0.41 12.11 ? 5   ILE E CA  1 
ATOM   1262 C C   . ILE E 1 10 ? 10.733  -8.893  -15.886 1.00 12.97 ? 5   ILE E C   1 
ATOM   1263 O O   . ILE E 1 10 ? 11.919  -8.911  -16.210 1.00 13.13 ? 5   ILE E O   1 
ATOM   1264 C CB  A ILE E 1 10 ? 9.201   -9.247  -17.921 0.59 13.45 ? 5   ILE E CB  1 
ATOM   1265 C CB  B ILE E 1 10 ? 9.476   -9.357  -17.967 0.41 13.58 ? 5   ILE E CB  1 
ATOM   1266 C CG1 A ILE E 1 10 ? 8.489   -10.479 -17.347 0.59 14.69 ? 5   ILE E CG1 1 
ATOM   1267 C CG1 B ILE E 1 10 ? 8.340   -8.926  -18.883 0.41 14.36 ? 5   ILE E CG1 1 
ATOM   1268 C CG2 A ILE E 1 10 ? 10.359  -9.629  -18.841 0.59 14.38 ? 5   ILE E CG2 1 
ATOM   1269 C CG2 B ILE E 1 10 ? 9.206   -10.752 -17.389 0.41 13.16 ? 5   ILE E CG2 1 
ATOM   1270 C CD1 A ILE E 1 10 ? 7.641   -11.201 -18.387 0.59 18.59 ? 5   ILE E CD1 1 
ATOM   1271 C CD1 B ILE E 1 10 ? 8.168   -9.818  -20.091 0.41 16.76 ? 5   ILE E CD1 1 
ATOM   1272 N N   . VAL E 1 11 ? 10.310  -9.366  -14.715 1.00 9.01  ? 6   VAL E N   1 
ATOM   1273 C CA  . VAL E 1 11 ? 11.266  -9.973  -13.786 1.00 8.79  ? 6   VAL E CA  1 
ATOM   1274 C C   . VAL E 1 11 ? 11.568  -11.416 -14.233 1.00 11.15 ? 6   VAL E C   1 
ATOM   1275 O O   . VAL E 1 11 ? 10.665  -12.247 -14.380 1.00 11.30 ? 6   VAL E O   1 
ATOM   1276 C CB  . VAL E 1 11 ? 10.731  -9.944  -12.332 1.00 9.46  ? 6   VAL E CB  1 
ATOM   1277 C CG1 . VAL E 1 11 ? 11.706  -10.627 -11.372 1.00 8.70  ? 6   VAL E CG1 1 
ATOM   1278 C CG2 . VAL E 1 11 ? 10.485  -8.505  -11.889 1.00 9.94  ? 6   VAL E CG2 1 
ATOM   1279 N N   . GLU E 1 12 ? 12.844  -11.704 -14.474 1.00 11.84 ? 7   GLU E N   1 
ATOM   1280 C CA  . GLU E 1 12 ? 13.236  -13.036 -14.931 1.00 13.90 ? 7   GLU E CA  1 
ATOM   1281 C C   . GLU E 1 12 ? 13.852  -13.886 -13.826 1.00 12.43 ? 7   GLU E C   1 
ATOM   1282 O O   . GLU E 1 12 ? 13.929  -15.122 -13.953 1.00 12.36 ? 7   GLU E O   1 
ATOM   1283 C CB  . GLU E 1 12 ? 14.215  -12.927 -16.101 1.00 13.52 ? 7   GLU E CB  1 
ATOM   1284 C CG  . GLU E 1 12 ? 13.655  -12.216 -17.326 1.00 14.29 ? 7   GLU E CG  1 
ATOM   1285 C CD  . GLU E 1 12 ? 12.639  -13.044 -18.090 1.00 18.39 ? 7   GLU E CD  1 
ATOM   1286 O OE1 . GLU E 1 12 ? 12.437  -14.229 -17.744 1.00 19.42 ? 7   GLU E OE1 1 
ATOM   1287 O OE2 . GLU E 1 12 ? 12.038  -12.503 -19.042 1.00 19.81 ? 7   GLU E OE2 1 
ATOM   1288 N N   . TYR E 1 13 ? 14.288  -13.233 -12.752 1.00 9.84  ? 8   TYR E N   1 
ATOM   1289 C CA  . TYR E 1 13 ? 14.922  -13.918 -11.626 1.00 9.91  ? 8   TYR E CA  1 
ATOM   1290 C C   . TYR E 1 13 ? 14.514  -13.278 -10.311 1.00 9.57  ? 8   TYR E C   1 
ATOM   1291 O O   . TYR E 1 13 ? 14.419  -12.045 -10.221 1.00 10.27 ? 8   TYR E O   1 
ATOM   1292 C CB  . TYR E 1 13 ? 16.461  -13.889 -11.750 1.00 10.11 ? 8   TYR E CB  1 
ATOM   1293 C CG  . TYR E 1 13 ? 16.995  -14.533 -13.014 1.00 14.36 ? 8   TYR E CG  1 
ATOM   1294 C CD1 . TYR E 1 13 ? 17.237  -13.773 -14.149 1.00 13.39 ? 8   TYR E CD1 1 
ATOM   1295 C CD2 . TYR E 1 13 ? 17.278  -15.893 -13.064 1.00 15.35 ? 8   TYR E CD2 1 
ATOM   1296 C CE1 . TYR E 1 13 ? 17.721  -14.354 -15.319 1.00 15.03 ? 8   TYR E CE1 1 
ATOM   1297 C CE2 . TYR E 1 13 ? 17.771  -16.478 -14.226 1.00 16.89 ? 8   TYR E CE2 1 
ATOM   1298 C CZ  . TYR E 1 13 ? 17.985  -15.696 -15.347 1.00 17.63 ? 8   TYR E CZ  1 
ATOM   1299 O OH  . TYR E 1 13 ? 18.463  -16.252 -16.510 1.00 22.37 ? 8   TYR E OH  1 
ATOM   1300 N N   . ASP E 1 14 ? 14.341  -14.107 -9.279  1.00 10.67 ? 9   ASP E N   1 
ATOM   1301 C CA  . ASP E 1 14 ? 14.016  -13.611 -7.939  1.00 10.68 ? 9   ASP E CA  1 
ATOM   1302 C C   . ASP E 1 14 ? 15.163  -12.807 -7.338  1.00 11.88 ? 9   ASP E C   1 
ATOM   1303 O O   . ASP E 1 14 ? 16.347  -13.134 -7.532  1.00 13.01 ? 9   ASP E O   1 
ATOM   1304 C CB  . ASP E 1 14 ? 13.680  -14.760 -6.985  1.00 13.08 ? 9   ASP E CB  1 
ATOM   1305 C CG  . ASP E 1 14 ? 12.438  -15.543 -7.389  1.00 16.45 ? 9   ASP E CG  1 
ATOM   1306 O OD1 . ASP E 1 14 ? 11.543  -15.020 -8.090  1.00 14.34 ? 9   ASP E OD1 1 
ATOM   1307 O OD2 . ASP E 1 14 ? 12.361  -16.722 -6.981  1.00 19.73 ? 9   ASP E OD2 1 
ATOM   1308 N N   . TYR E 1 15 ? 14.810  -11.762 -6.596  1.00 10.48 ? 10  TYR E N   1 
ATOM   1309 C CA  . TYR E 1 15 ? 15.790  -10.974 -5.866  1.00 10.78 ? 10  TYR E CA  1 
ATOM   1310 C C   . TYR E 1 15 ? 15.145  -10.444 -4.588  1.00 10.83 ? 10  TYR E C   1 
ATOM   1311 O O   . TYR E 1 15 ? 14.058  -9.869  -4.609  1.00 11.43 ? 10  TYR E O   1 
ATOM   1312 C CB  . TYR E 1 15 ? 16.332  -9.824  -6.727  1.00 12.44 ? 10  TYR E CB  1 
ATOM   1313 C CG  . TYR E 1 15 ? 17.305  -8.932  -5.984  1.00 9.80  ? 10  TYR E CG  1 
ATOM   1314 C CD1 . TYR E 1 15 ? 18.636  -9.303  -5.823  1.00 10.21 ? 10  TYR E CD1 1 
ATOM   1315 C CD2 . TYR E 1 15 ? 16.887  -7.719  -5.433  1.00 10.65 ? 10  TYR E CD2 1 
ATOM   1316 C CE1 . TYR E 1 15 ? 19.525  -8.506  -5.142  1.00 12.82 ? 10  TYR E CE1 1 
ATOM   1317 C CE2 . TYR E 1 15 ? 17.780  -6.904  -4.737  1.00 11.37 ? 10  TYR E CE2 1 
ATOM   1318 C CZ  . TYR E 1 15 ? 19.104  -7.313  -4.602  1.00 13.45 ? 10  TYR E CZ  1 
ATOM   1319 O OH  . TYR E 1 15 ? 20.006  -6.539  -3.930  1.00 12.36 ? 10  TYR E OH  1 
ATOM   1320 N N   . ASP E 1 16 ? 15.828  -10.667 -3.471  1.00 10.92 ? 11  ASP E N   1 
ATOM   1321 C CA  . ASP E 1 16 ? 15.419  -10.131 -2.186  1.00 11.04 ? 11  ASP E CA  1 
ATOM   1322 C C   . ASP E 1 16 ? 16.175  -8.845  -1.877  1.00 9.62  ? 11  ASP E C   1 
ATOM   1323 O O   . ASP E 1 16 ? 17.406  -8.828  -1.928  1.00 11.58 ? 11  ASP E O   1 
ATOM   1324 C CB  . ASP E 1 16 ? 15.694  -11.143 -1.082  1.00 11.80 ? 11  ASP E CB  1 
ATOM   1325 C CG  . ASP E 1 16 ? 14.677  -12.267 -1.036  1.00 12.89 ? 11  ASP E CG  1 
ATOM   1326 O OD1 . ASP E 1 16 ? 14.769  -13.084 -0.099  1.00 13.73 ? 11  ASP E OD1 1 
ATOM   1327 O OD2 . ASP E 1 16 ? 13.774  -12.312 -1.892  1.00 11.98 ? 11  ASP E OD2 1 
ATOM   1328 N N   . ALA E 1 17 ? 15.445  -7.801  -1.506  1.00 10.42 ? 12  ALA E N   1 
ATOM   1329 C CA  . ALA E 1 17 ? 16.053  -6.504  -1.178  1.00 9.99  ? 12  ALA E CA  1 
ATOM   1330 C C   . ALA E 1 17 ? 17.145  -6.623  -0.111  1.00 12.20 ? 12  ALA E C   1 
ATOM   1331 O O   . ALA E 1 17 ? 16.945  -7.263  0.922   1.00 14.67 ? 12  ALA E O   1 
ATOM   1332 C CB  . ALA E 1 17 ? 14.979  -5.524  -0.718  1.00 10.59 ? 12  ALA E CB  1 
ATOM   1333 N N   . VAL E 1 18 ? 18.302  -6.009  -0.368  1.00 12.61 ? 13  VAL E N   1 
ATOM   1334 C CA  . VAL E 1 18 ? 19.421  -6.008  0.584   1.00 13.25 ? 13  VAL E CA  1 
ATOM   1335 C C   . VAL E 1 18 ? 19.525  -4.635  1.262   1.00 15.05 ? 13  VAL E C   1 
ATOM   1336 O O   . VAL E 1 18 ? 20.006  -4.507  2.395   1.00 17.32 ? 13  VAL E O   1 
ATOM   1337 C CB  . VAL E 1 18 ? 20.756  -6.363  -0.131  1.00 19.65 ? 13  VAL E CB  1 
ATOM   1338 C CG1 . VAL E 1 18 ? 21.926  -6.285  0.819   1.00 22.47 ? 13  VAL E CG1 1 
ATOM   1339 C CG2 . VAL E 1 18 ? 20.663  -7.755  -0.745  1.00 22.57 ? 13  VAL E CG2 1 
ATOM   1340 N N   . HIS E 1 19 ? 19.072  -3.612  0.550   1.00 12.78 ? 14  HIS E N   1 
ATOM   1341 C CA  . HIS E 1 19 ? 19.002  -2.253  1.088   1.00 13.61 ? 14  HIS E CA  1 
ATOM   1342 C C   . HIS E 1 19 ? 17.570  -1.758  1.001   1.00 10.77 ? 14  HIS E C   1 
ATOM   1343 O O   . HIS E 1 19 ? 16.780  -2.239  0.189   1.00 11.99 ? 14  HIS E O   1 
ATOM   1344 C CB  . HIS E 1 19 ? 19.954  -1.315  0.346   1.00 14.88 ? 14  HIS E CB  1 
ATOM   1345 C CG  . HIS E 1 19 ? 21.377  -1.764  0.388   1.00 18.46 ? 14  HIS E CG  1 
ATOM   1346 N ND1 . HIS E 1 19 ? 21.967  -2.480  -0.635  1.00 20.75 ? 14  HIS E ND1 1 
ATOM   1347 C CD2 . HIS E 1 19 ? 22.325  -1.632  1.344   1.00 19.97 ? 14  HIS E CD2 1 
ATOM   1348 C CE1 . HIS E 1 19 ? 23.213  -2.759  -0.312  1.00 20.86 ? 14  HIS E CE1 1 
ATOM   1349 N NE2 . HIS E 1 19 ? 23.458  -2.255  0.888   1.00 21.99 ? 14  HIS E NE2 1 
ATOM   1350 N N   . ASP E 1 20 ? 17.224  -0.799  1.841   1.00 11.55 ? 15  ASP E N   1 
ATOM   1351 C CA  . ASP E 1 20 ? 15.822  -0.433  1.988   1.00 12.05 ? 15  ASP E CA  1 
ATOM   1352 C C   . ASP E 1 20 ? 15.208  0.236   0.759   1.00 13.59 ? 15  ASP E C   1 
ATOM   1353 O O   . ASP E 1 20 ? 13.980  0.257   0.616   1.00 11.95 ? 15  ASP E O   1 
ATOM   1354 C CB  . ASP E 1 20 ? 15.661  0.465   3.200   1.00 13.24 ? 15  ASP E CB  1 
ATOM   1355 C CG  . ASP E 1 20 ? 15.763  -0.297  4.494   1.00 15.19 ? 15  ASP E CG  1 
ATOM   1356 O OD1 . ASP E 1 20 ? 15.504  0.317   5.534   1.00 18.18 ? 15  ASP E OD1 1 
ATOM   1357 O OD2 . ASP E 1 20 ? 16.067  -1.512  4.466   1.00 16.74 ? 15  ASP E OD2 1 
ATOM   1358 N N   . ASP E 1 21 ? 16.048  0.765   -0.126  1.00 11.02 ? 16  ASP E N   1 
ATOM   1359 C CA  . ASP E 1 21 ? 15.542  1.409   -1.329  1.00 12.34 ? 16  ASP E CA  1 
ATOM   1360 C C   . ASP E 1 21 ? 15.342  0.404   -2.462  1.00 9.75  ? 16  ASP E C   1 
ATOM   1361 O O   . ASP E 1 21 ? 14.957  0.781   -3.565  1.00 11.50 ? 16  ASP E O   1 
ATOM   1362 C CB  . ASP E 1 21 ? 16.477  2.550   -1.769  1.00 11.46 ? 16  ASP E CB  1 
ATOM   1363 C CG  . ASP E 1 21 ? 17.842  2.070   -2.226  1.00 16.25 ? 16  ASP E CG  1 
ATOM   1364 O OD1 . ASP E 1 21 ? 18.567  2.893   -2.830  1.00 17.21 ? 16  ASP E OD1 1 
ATOM   1365 O OD2 . ASP E 1 21 ? 18.191  0.895   -2.001  1.00 14.59 ? 16  ASP E OD2 1 
ATOM   1366 N N   . GLU E 1 22 ? 15.572  -0.876  -2.178  1.00 10.86 ? 17  GLU E N   1 
ATOM   1367 C CA  . GLU E 1 22 ? 15.490  -1.906  -3.212  1.00 8.61  ? 17  GLU E CA  1 
ATOM   1368 C C   . GLU E 1 22 ? 14.146  -2.641  -3.224  1.00 8.26  ? 17  GLU E C   1 
ATOM   1369 O O   . GLU E 1 22 ? 13.518  -2.854  -2.185  1.00 10.59 ? 17  GLU E O   1 
ATOM   1370 C CB  . GLU E 1 22 ? 16.625  -2.926  -3.039  1.00 11.73 ? 17  GLU E CB  1 
ATOM   1371 C CG  . GLU E 1 22 ? 18.004  -2.323  -3.237  1.00 11.88 ? 17  GLU E CG  1 
ATOM   1372 C CD  . GLU E 1 22 ? 19.122  -3.323  -3.026  1.00 11.33 ? 17  GLU E CD  1 
ATOM   1373 O OE1 . GLU E 1 22 ? 18.826  -4.515  -2.809  1.00 10.65 ? 17  GLU E OE1 1 
ATOM   1374 O OE2 . GLU E 1 22 ? 20.301  -2.906  -3.071  1.00 12.80 ? 17  GLU E OE2 1 
ATOM   1375 N N   . LEU E 1 23 ? 13.714  -3.027  -4.416  1.00 9.53  ? 18  LEU E N   1 
ATOM   1376 C CA  . LEU E 1 23 ? 12.529  -3.869  -4.556  1.00 9.80  ? 18  LEU E CA  1 
ATOM   1377 C C   . LEU E 1 23 ? 12.841  -5.333  -4.257  1.00 10.44 ? 18  LEU E C   1 
ATOM   1378 O O   . LEU E 1 23 ? 13.935  -5.808  -4.539  1.00 11.31 ? 18  LEU E O   1 
ATOM   1379 C CB  . LEU E 1 23 ? 11.962  -3.764  -5.972  1.00 8.55  ? 18  LEU E CB  1 
ATOM   1380 C CG  . LEU E 1 23 ? 11.444  -2.406  -6.449  1.00 10.22 ? 18  LEU E CG  1 
ATOM   1381 C CD1 . LEU E 1 23 ? 10.998  -2.498  -7.916  1.00 12.18 ? 18  LEU E CD1 1 
ATOM   1382 C CD2 . LEU E 1 23 ? 10.304  -1.934  -5.563  1.00 10.77 ? 18  LEU E CD2 1 
ATOM   1383 N N   . THR E 1 24 ? 11.876  -6.042  -3.679  1.00 7.84  ? 19  THR E N   1 
ATOM   1384 C CA  . THR E 1 24 ? 11.926  -7.506  -3.673  1.00 8.53  ? 19  THR E CA  1 
ATOM   1385 C C   . THR E 1 24 ? 11.073  -7.964  -4.833  1.00 10.91 ? 19  THR E C   1 
ATOM   1386 O O   . THR E 1 24 ? 9.902   -7.583  -4.936  1.00 12.44 ? 19  THR E O   1 
ATOM   1387 C CB  . THR E 1 24 ? 11.430  -8.089  -2.352  1.00 8.63  ? 19  THR E CB  1 
ATOM   1388 O OG1 . THR E 1 24 ? 12.336  -7.692  -1.315  1.00 10.66 ? 19  THR E OG1 1 
ATOM   1389 C CG2 . THR E 1 24 ? 11.335  -9.633  -2.405  1.00 11.83 ? 19  THR E CG2 1 
ATOM   1390 N N   . ILE E 1 25 ? 11.678  -8.745  -5.725  1.00 11.39 ? 20  ILE E N   1 
ATOM   1391 C CA  . ILE E 1 25 ? 11.043  -9.073  -6.989  1.00 9.72  ? 20  ILE E CA  1 
ATOM   1392 C C   . ILE E 1 25 ? 10.981  -10.583 -7.190  1.00 9.57  ? 20  ILE E C   1 
ATOM   1393 O O   . ILE E 1 25 ? 11.795  -11.326 -6.653  1.00 10.43 ? 20  ILE E O   1 
ATOM   1394 C CB  . ILE E 1 25 ? 11.770  -8.404  -8.166  1.00 8.87  ? 20  ILE E CB  1 
ATOM   1395 C CG1 . ILE E 1 25 ? 13.196  -8.950  -8.306  1.00 10.32 ? 20  ILE E CG1 1 
ATOM   1396 C CG2 . ILE E 1 25 ? 11.788  -6.861  -7.957  1.00 7.51  ? 20  ILE E CG2 1 
ATOM   1397 C CD1 . ILE E 1 25 ? 14.023  -8.203  -9.366  1.00 11.34 ? 20  ILE E CD1 1 
ATOM   1398 N N   . ARG E 1 26 ? 9.985   -11.013 -7.953  1.00 9.47  ? 21  ARG E N   1 
ATOM   1399 C CA  . ARG E 1 26 ? 9.699   -12.428 -8.155  1.00 9.26  ? 21  ARG E CA  1 
ATOM   1400 C C   . ARG E 1 26 ? 9.438   -12.655 -9.636  1.00 9.45  ? 21  ARG E C   1 
ATOM   1401 O O   . ARG E 1 26 ? 8.822   -11.820 -10.283 1.00 9.96  ? 21  ARG E O   1 
ATOM   1402 C CB  . ARG E 1 26 ? 8.489   -12.863 -7.311  1.00 9.98  ? 21  ARG E CB  1 
ATOM   1403 C CG  . ARG E 1 26 ? 8.699   -12.755 -5.787  1.00 10.11 ? 21  ARG E CG  1 
ATOM   1404 C CD  . ARG E 1 26 ? 9.750   -13.757 -5.339  1.00 12.26 ? 21  ARG E CD  1 
ATOM   1405 N NE  . ARG E 1 26 ? 9.984   -13.804 -3.896  1.00 12.02 ? 21  ARG E NE  1 
ATOM   1406 C CZ  . ARG E 1 26 ? 11.051  -13.302 -3.285  1.00 13.20 ? 21  ARG E CZ  1 
ATOM   1407 N NH1 . ARG E 1 26 ? 11.177  -13.424 -1.970  1.00 12.92 ? 21  ARG E NH1 1 
ATOM   1408 N NH2 . ARG E 1 26 ? 11.992  -12.681 -3.985  1.00 11.66 ? 21  ARG E NH2 1 
ATOM   1409 N N   . VAL E 1 27 ? 9.909   -13.785 -10.166 1.00 10.23 ? 22  VAL E N   1 
ATOM   1410 C CA  . VAL E 1 27 ? 9.756   -14.093 -11.586 1.00 10.82 ? 22  VAL E CA  1 
ATOM   1411 C C   . VAL E 1 27 ? 8.311   -13.894 -12.050 1.00 12.22 ? 22  VAL E C   1 
ATOM   1412 O O   . VAL E 1 27 ? 7.379   -14.347 -11.379 1.00 15.12 ? 22  VAL E O   1 
ATOM   1413 C CB  . VAL E 1 27 ? 10.183  -15.553 -11.887 1.00 11.43 ? 22  VAL E CB  1 
ATOM   1414 C CG1 . VAL E 1 27 ? 10.041  -15.849 -13.381 1.00 13.11 ? 22  VAL E CG1 1 
ATOM   1415 C CG2 . VAL E 1 27 ? 11.619  -15.822 -11.405 1.00 11.25 ? 22  VAL E CG2 1 
ATOM   1416 N N   . GLY E 1 28 ? 8.130   -13.219 -13.187 1.00 11.35 ? 23  GLY E N   1 
ATOM   1417 C CA  . GLY E 1 28 ? 6.793   -12.957 -13.707 1.00 12.60 ? 23  GLY E CA  1 
ATOM   1418 C C   . GLY E 1 28 ? 6.273   -11.547 -13.486 1.00 13.23 ? 23  GLY E C   1 
ATOM   1419 O O   . GLY E 1 28 ? 5.473   -11.041 -14.273 1.00 11.95 ? 23  GLY E O   1 
ATOM   1420 N N   . GLU E 1 29 ? 6.711   -10.906 -12.409 1.00 11.58 ? 24  GLU E N   1 
ATOM   1421 C CA  . GLU E 1 29 ? 6.218   -9.565  -12.095 1.00 12.26 ? 24  GLU E CA  1 
ATOM   1422 C C   . GLU E 1 29 ? 6.617   -8.560  -13.164 1.00 10.22 ? 24  GLU E C   1 
ATOM   1423 O O   . GLU E 1 29 ? 7.653   -8.722  -13.829 1.00 11.87 ? 24  GLU E O   1 
ATOM   1424 C CB  . GLU E 1 29 ? 6.734   -9.110  -10.731 1.00 11.55 ? 24  GLU E CB  1 
ATOM   1425 C CG  . GLU E 1 29 ? 6.064   -9.847  -9.590  1.00 13.67 ? 24  GLU E CG  1 
ATOM   1426 C CD  . GLU E 1 29 ? 6.505   -9.352  -8.236  1.00 16.75 ? 24  GLU E CD  1 
ATOM   1427 O OE1 . GLU E 1 29 ? 5.633   -9.078  -7.395  1.00 20.28 ? 24  GLU E OE1 1 
ATOM   1428 O OE2 . GLU E 1 29 ? 7.720   -9.230  -8.015  1.00 18.86 ? 24  GLU E OE2 1 
ATOM   1429 N N   . ILE E 1 30 ? 5.774   -7.543  -13.338 1.00 10.32 ? 25  ILE E N   1 
ATOM   1430 C CA  . ILE E 1 30 ? 6.074   -6.416  -14.212 1.00 11.54 ? 25  ILE E CA  1 
ATOM   1431 C C   . ILE E 1 30 ? 6.403   -5.206  -13.356 1.00 11.86 ? 25  ILE E C   1 
ATOM   1432 O O   . ILE E 1 30 ? 5.601   -4.800  -12.511 1.00 10.54 ? 25  ILE E O   1 
ATOM   1433 C CB  . ILE E 1 30 ? 4.892   -6.067  -15.136 1.00 13.39 ? 25  ILE E CB  1 
ATOM   1434 C CG1 . ILE E 1 30 ? 4.342   -7.337  -15.796 1.00 13.39 ? 25  ILE E CG1 1 
ATOM   1435 C CG2 . ILE E 1 30 ? 5.299   -5.005  -16.169 1.00 11.72 ? 25  ILE E CG2 1 
ATOM   1436 C CD1 . ILE E 1 30 ? 5.352   -8.054  -16.655 1.00 15.06 ? 25  ILE E CD1 1 
ATOM   1437 N N   . ILE E 1 31 ? 7.588   -4.652  -13.568 1.00 9.18  ? 26  ILE E N   1 
ATOM   1438 C CA  . ILE E 1 31 ? 7.983   -3.401  -12.932 1.00 8.86  ? 26  ILE E CA  1 
ATOM   1439 C C   . ILE E 1 31 ? 7.665   -2.295  -13.917 1.00 11.17 ? 26  ILE E C   1 
ATOM   1440 O O   . ILE E 1 31 ? 8.026   -2.389  -15.087 1.00 11.17 ? 26  ILE E O   1 
ATOM   1441 C CB  . ILE E 1 31 ? 9.478   -3.401  -12.566 1.00 9.77  ? 26  ILE E CB  1 
ATOM   1442 C CG1 . ILE E 1 31 ? 9.805   -4.640  -11.727 1.00 10.62 ? 26  ILE E CG1 1 
ATOM   1443 C CG2 . ILE E 1 31 ? 9.865   -2.110  -11.842 1.00 7.85  ? 26  ILE E CG2 1 
ATOM   1444 C CD1 . ILE E 1 31 ? 11.293  -4.859  -11.526 1.00 10.11 ? 26  ILE E CD1 1 
ATOM   1445 N N   . ARG E 1 32 ? 6.975   -1.258  -13.462 1.00 10.97 ? 27  ARG E N   1 
ATOM   1446 C CA  . ARG E 1 32 ? 6.472   -0.241  -14.386 1.00 11.19 ? 27  ARG E CA  1 
ATOM   1447 C C   . ARG E 1 32 ? 7.052   1.155   -14.177 1.00 12.19 ? 27  ARG E C   1 
ATOM   1448 O O   . ARG E 1 32 ? 7.622   1.449   -13.132 1.00 11.91 ? 27  ARG E O   1 
ATOM   1449 C CB  . ARG E 1 32 ? 4.949   -0.189  -14.289 1.00 14.85 ? 27  ARG E CB  1 
ATOM   1450 C CG  . ARG E 1 32 ? 4.336   -1.578  -14.403 1.00 16.63 ? 27  ARG E CG  1 
ATOM   1451 C CD  . ARG E 1 32 ? 2.840   -1.571  -14.529 1.00 18.38 ? 27  ARG E CD  1 
ATOM   1452 N NE  . ARG E 1 32 ? 2.322   -2.938  -14.633 1.00 15.33 ? 27  ARG E NE  1 
ATOM   1453 C CZ  . ARG E 1 32 ? 2.037   -3.548  -15.777 1.00 12.63 ? 27  ARG E CZ  1 
ATOM   1454 N NH1 . ARG E 1 32 ? 1.578   -4.795  -15.768 1.00 12.52 ? 27  ARG E NH1 1 
ATOM   1455 N NH2 . ARG E 1 32 ? 2.200   -2.911  -16.930 1.00 11.97 ? 27  ARG E NH2 1 
ATOM   1456 N N   . ASN E 1 33 ? 6.902   1.998   -15.194 1.00 11.78 ? 28  ASN E N   1 
ATOM   1457 C CA  . ASN E 1 33 ? 7.379   3.385   -15.137 1.00 11.90 ? 28  ASN E CA  1 
ATOM   1458 C C   . ASN E 1 33 ? 8.852   3.404   -14.788 1.00 13.06 ? 28  ASN E C   1 
ATOM   1459 O O   . ASN E 1 33 ? 9.284   4.117   -13.885 1.00 12.60 ? 28  ASN E O   1 
ATOM   1460 C CB  . ASN E 1 33 ? 6.563   4.192   -14.112 1.00 12.81 ? 28  ASN E CB  1 
ATOM   1461 C CG  . ASN E 1 33 ? 6.785   5.695   -14.216 1.00 15.09 ? 28  ASN E CG  1 
ATOM   1462 O OD1 . ASN E 1 33 ? 6.800   6.403   -13.199 1.00 15.95 ? 28  ASN E OD1 1 
ATOM   1463 N ND2 . ASN E 1 33 ? 6.969   6.186   -15.430 1.00 16.96 ? 28  ASN E ND2 1 
ATOM   1464 N N   . VAL E 1 34 ? 9.620   2.590   -15.504 1.00 12.89 ? 29  VAL E N   1 
ATOM   1465 C CA  . VAL E 1 34 ? 11.024  2.381   -15.164 1.00 12.03 ? 29  VAL E CA  1 
ATOM   1466 C C   . VAL E 1 34 ? 11.874  3.538   -15.656 1.00 13.64 ? 29  VAL E C   1 
ATOM   1467 O O   . VAL E 1 34 ? 11.687  4.054   -16.760 1.00 13.53 ? 29  VAL E O   1 
ATOM   1468 C CB  . VAL E 1 34 ? 11.537  1.042   -15.729 1.00 11.53 ? 29  VAL E CB  1 
ATOM   1469 C CG1 . VAL E 1 34 ? 13.048  0.899   -15.546 1.00 13.02 ? 29  VAL E CG1 1 
ATOM   1470 C CG2 . VAL E 1 34 ? 10.828  -0.112  -15.026 1.00 9.46  ? 29  VAL E CG2 1 
ATOM   1471 N N   . LYS E 1 35 ? 12.793  3.957   -14.794 1.00 13.98 ? 30  LYS E N   1 
ATOM   1472 C CA  A LYS E 1 35 ? 13.683  5.069   -15.079 0.50 17.66 ? 30  LYS E CA  1 
ATOM   1473 C CA  B LYS E 1 35 ? 13.684  5.067   -15.083 0.50 17.68 ? 30  LYS E CA  1 
ATOM   1474 C C   . LYS E 1 35 ? 15.127  4.682   -14.809 1.00 17.79 ? 30  LYS E C   1 
ATOM   1475 O O   . LYS E 1 35 ? 15.400  3.861   -13.938 1.00 15.25 ? 30  LYS E O   1 
ATOM   1476 C CB  A LYS E 1 35 ? 13.306  6.286   -14.232 0.50 19.11 ? 30  LYS E CB  1 
ATOM   1477 C CB  B LYS E 1 35 ? 13.312  6.290   -14.243 0.50 19.08 ? 30  LYS E CB  1 
ATOM   1478 C CG  A LYS E 1 35 ? 11.856  6.710   -14.355 0.50 20.54 ? 30  LYS E CG  1 
ATOM   1479 C CG  B LYS E 1 35 ? 11.857  6.703   -14.335 0.50 20.51 ? 30  LYS E CG  1 
ATOM   1480 C CD  A LYS E 1 35 ? 11.488  7.733   -13.299 0.50 22.37 ? 30  LYS E CD  1 
ATOM   1481 C CD  B LYS E 1 35 ? 11.594  7.944   -13.507 0.50 22.78 ? 30  LYS E CD  1 
ATOM   1482 C CE  A LYS E 1 35 ? 10.064  8.237   -13.499 0.50 22.87 ? 30  LYS E CE  1 
ATOM   1483 C CE  B LYS E 1 35 ? 10.120  8.324   -13.532 0.50 23.04 ? 30  LYS E CE  1 
ATOM   1484 N NZ  A LYS E 1 35 ? 9.880   8.920   -14.813 0.50 23.24 ? 30  LYS E NZ  1 
ATOM   1485 N NZ  B LYS E 1 35 ? 9.870   9.594   -12.794 0.50 24.31 ? 30  LYS E NZ  1 
ATOM   1486 N N   A LYS E 1 36 ? 16.047  5.271   -15.562 0.50 19.80 ? 31  LYS E N   1 
ATOM   1487 N N   B LYS E 1 36 ? 16.045  5.278   -15.558 0.50 19.84 ? 31  LYS E N   1 
ATOM   1488 C CA  A LYS E 1 36 ? 17.460  5.167   -15.232 0.50 21.43 ? 31  LYS E CA  1 
ATOM   1489 C CA  B LYS E 1 36 ? 17.456  5.167   -15.230 0.50 21.43 ? 31  LYS E CA  1 
ATOM   1490 C C   A LYS E 1 36 ? 17.839  6.389   -14.411 0.50 22.93 ? 31  LYS E C   1 
ATOM   1491 C C   B LYS E 1 36 ? 17.842  6.388   -14.411 0.50 22.96 ? 31  LYS E C   1 
ATOM   1492 O O   A LYS E 1 36 ? 17.763  7.520   -14.892 0.50 25.58 ? 31  LYS E O   1 
ATOM   1493 O O   B LYS E 1 36 ? 17.776  7.518   -14.896 0.50 25.51 ? 31  LYS E O   1 
ATOM   1494 C CB  A LYS E 1 36 ? 18.323  5.060   -16.493 0.50 23.15 ? 31  LYS E CB  1 
ATOM   1495 C CB  B LYS E 1 36 ? 18.317  5.058   -16.491 0.50 23.13 ? 31  LYS E CB  1 
ATOM   1496 C CG  A LYS E 1 36 ? 19.835  5.151   -16.248 0.50 24.17 ? 31  LYS E CG  1 
ATOM   1497 C CG  B LYS E 1 36 ? 19.792  4.772   -16.214 0.50 23.89 ? 31  LYS E CG  1 
ATOM   1498 C CD  A LYS E 1 36 ? 20.332  4.069   -15.294 0.50 23.19 ? 31  LYS E CD  1 
ATOM   1499 C CD  B LYS E 1 36 ? 19.957  3.461   -15.450 0.50 22.40 ? 31  LYS E CD  1 
ATOM   1500 C CE  A LYS E 1 36 ? 21.857  3.955   -15.320 0.50 23.30 ? 31  LYS E CE  1 
ATOM   1501 C CE  B LYS E 1 36 ? 21.232  2.732   -15.846 0.50 22.12 ? 31  LYS E CE  1 
ATOM   1502 N NZ  A LYS E 1 36 ? 22.558  5.222   -14.934 0.50 23.64 ? 31  LYS E NZ  1 
ATOM   1503 N NZ  B LYS E 1 36 ? 21.278  1.345   -15.292 0.50 21.05 ? 31  LYS E NZ  1 
ATOM   1504 N N   . LEU E 1 37 ? 18.213  6.163   -13.157 1.00 22.47 ? 32  LEU E N   1 
ATOM   1505 C CA  . LEU E 1 37 ? 18.642  7.252   -12.302 1.00 25.39 ? 32  LEU E CA  1 
ATOM   1506 C C   . LEU E 1 37 ? 20.159  7.333   -12.395 1.00 29.40 ? 32  LEU E C   1 
ATOM   1507 O O   . LEU E 1 37 ? 20.732  6.950   -13.410 1.00 32.33 ? 32  LEU E O   1 
ATOM   1508 C CB  . LEU E 1 37 ? 18.164  7.050   -10.870 1.00 24.71 ? 32  LEU E CB  1 
ATOM   1509 C CG  . LEU E 1 37 ? 16.637  7.013   -10.731 1.00 26.04 ? 32  LEU E CG  1 
ATOM   1510 C CD1 . LEU E 1 37 ? 16.243  6.950   -9.263  1.00 25.96 ? 32  LEU E CD1 1 
ATOM   1511 C CD2 . LEU E 1 37 ? 15.974  8.199   -11.421 1.00 27.33 ? 32  LEU E CD2 1 
ATOM   1512 N N   . GLN E 1 38 ? 20.815  7.822   -11.353 1.00 31.82 ? 33  GLN E N   1 
ATOM   1513 C CA  . GLN E 1 38 ? 22.252  8.074   -11.450 1.00 32.91 ? 33  GLN E CA  1 
ATOM   1514 C C   . GLN E 1 38 ? 23.086  6.794   -11.332 1.00 30.65 ? 33  GLN E C   1 
ATOM   1515 O O   . GLN E 1 38 ? 24.270  6.794   -11.659 1.00 32.14 ? 33  GLN E O   1 
ATOM   1516 C CB  . GLN E 1 38 ? 22.690  9.088   -10.385 1.00 35.95 ? 33  GLN E CB  1 
ATOM   1517 C CG  . GLN E 1 38 ? 22.042  10.470  -10.528 1.00 40.02 ? 33  GLN E CG  1 
ATOM   1518 C CD  . GLN E 1 38 ? 22.661  11.516  -9.612  1.00 43.32 ? 33  GLN E CD  1 
ATOM   1519 O OE1 . GLN E 1 38 ? 23.475  12.332  -10.041 1.00 46.88 ? 33  GLN E OE1 1 
ATOM   1520 N NE2 . GLN E 1 38 ? 22.272  11.494  -8.342  1.00 43.78 ? 33  GLN E NE2 1 
ATOM   1521 N N   . GLU E 1 39 ? 22.465  5.699   -10.905 1.00 28.15 ? 34  GLU E N   1 
ATOM   1522 C CA  . GLU E 1 39 ? 23.227  4.518   -10.493 1.00 27.33 ? 34  GLU E CA  1 
ATOM   1523 C C   . GLU E 1 39 ? 23.478  3.473   -11.586 1.00 27.05 ? 34  GLU E C   1 
ATOM   1524 O O   . GLU E 1 39 ? 22.564  3.029   -12.276 1.00 30.98 ? 34  GLU E O   1 
ATOM   1525 C CB  . GLU E 1 39 ? 22.529  3.849   -9.315  1.00 25.37 ? 34  GLU E CB  1 
ATOM   1526 C CG  . GLU E 1 39 ? 23.425  2.922   -8.524  1.00 26.19 ? 34  GLU E CG  1 
ATOM   1527 C CD  . GLU E 1 39 ? 22.964  2.788   -7.093  1.00 26.88 ? 34  GLU E CD  1 
ATOM   1528 O OE1 . GLU E 1 39 ? 21.871  3.316   -6.781  1.00 27.71 ? 34  GLU E OE1 1 
ATOM   1529 O OE2 . GLU E 1 39 ? 23.695  2.173   -6.285  1.00 23.87 ? 34  GLU E OE2 1 
ATOM   1530 N N   . GLU E 1 40 ? 24.735  3.059   -11.697 1.00 22.83 ? 35  GLU E N   1 
ATOM   1531 C CA  . GLU E 1 40 ? 25.189  2.112   -12.706 1.00 19.95 ? 35  GLU E CA  1 
ATOM   1532 C C   . GLU E 1 40 ? 24.742  0.684   -12.366 1.00 19.79 ? 35  GLU E C   1 
ATOM   1533 O O   . GLU E 1 40 ? 24.872  0.252   -11.221 1.00 19.10 ? 35  GLU E O   1 
ATOM   1534 C CB  . GLU E 1 40 ? 26.721  2.191   -12.822 1.00 25.32 ? 35  GLU E CB  1 
ATOM   1535 C CG  . GLU E 1 40 ? 27.321  1.450   -13.991 1.00 28.29 ? 35  GLU E CG  1 
ATOM   1536 C CD  . GLU E 1 40 ? 28.788  1.815   -14.224 1.00 31.66 ? 35  GLU E CD  1 
ATOM   1537 O OE1 . GLU E 1 40 ? 29.414  2.444   -13.337 1.00 29.52 ? 35  GLU E OE1 1 
ATOM   1538 O OE2 . GLU E 1 40 ? 29.314  1.474   -15.306 1.00 35.26 ? 35  GLU E OE2 1 
ATOM   1539 N N   . GLY E 1 41 ? 24.193  -0.030  -13.350 1.00 19.34 ? 36  GLY E N   1 
ATOM   1540 C CA  . GLY E 1 41 ? 23.783  -1.416  -13.158 1.00 16.10 ? 36  GLY E CA  1 
ATOM   1541 C C   . GLY E 1 41 ? 22.419  -1.623  -12.521 1.00 14.77 ? 36  GLY E C   1 
ATOM   1542 O O   . GLY E 1 41 ? 21.941  -2.765  -12.389 1.00 13.61 ? 36  GLY E O   1 
ATOM   1543 N N   . TRP E 1 42 ? 21.796  -0.517  -12.110 1.00 14.00 ? 37  TRP E N   1 
ATOM   1544 C CA  . TRP E 1 42 ? 20.539  -0.552  -11.377 1.00 12.73 ? 37  TRP E CA  1 
ATOM   1545 C C   . TRP E 1 42 ? 19.492  0.339   -12.036 1.00 13.25 ? 37  TRP E C   1 
ATOM   1546 O O   . TRP E 1 42 ? 19.822  1.358   -12.649 1.00 15.95 ? 37  TRP E O   1 
ATOM   1547 C CB  . TRP E 1 42 ? 20.767  -0.136  -9.919  1.00 11.91 ? 37  TRP E CB  1 
ATOM   1548 C CG  . TRP E 1 42 ? 21.494  -1.193  -9.141  1.00 11.00 ? 37  TRP E CG  1 
ATOM   1549 C CD1 . TRP E 1 42 ? 22.823  -1.499  -9.212  1.00 15.31 ? 37  TRP E CD1 1 
ATOM   1550 C CD2 . TRP E 1 42 ? 20.916  -2.130  -8.223  1.00 10.09 ? 37  TRP E CD2 1 
ATOM   1551 N NE1 . TRP E 1 42 ? 23.114  -2.556  -8.375  1.00 11.32 ? 37  TRP E NE1 1 
ATOM   1552 C CE2 . TRP E 1 42 ? 21.956  -2.961  -7.756  1.00 10.82 ? 37  TRP E CE2 1 
ATOM   1553 C CE3 . TRP E 1 42 ? 19.625  -2.328  -7.728  1.00 9.30  ? 37  TRP E CE3 1 
ATOM   1554 C CZ2 . TRP E 1 42 ? 21.745  -3.974  -6.823  1.00 11.69 ? 37  TRP E CZ2 1 
ATOM   1555 C CZ3 . TRP E 1 42 ? 19.416  -3.342  -6.795  1.00 8.90  ? 37  TRP E CZ3 1 
ATOM   1556 C CH2 . TRP E 1 42 ? 20.472  -4.154  -6.360  1.00 10.84 ? 37  TRP E CH2 1 
ATOM   1557 N N   . LEU E 1 43 ? 18.234  -0.071  -11.938 1.00 11.90 ? 38  LEU E N   1 
ATOM   1558 C CA  . LEU E 1 43 ? 17.128  0.721   -12.477 1.00 13.24 ? 38  LEU E CA  1 
ATOM   1559 C C   . LEU E 1 43 ? 16.172  1.052   -11.361 1.00 10.49 ? 38  LEU E C   1 
ATOM   1560 O O   . LEU E 1 43 ? 16.286  0.504   -10.266 1.00 10.77 ? 38  LEU E O   1 
ATOM   1561 C CB  . LEU E 1 43 ? 16.398  -0.043  -13.578 1.00 13.69 ? 38  LEU E CB  1 
ATOM   1562 C CG  . LEU E 1 43 ? 17.237  -0.228  -14.836 1.00 13.86 ? 38  LEU E CG  1 
ATOM   1563 C CD1 . LEU E 1 43 ? 16.662  -1.368  -15.661 1.00 15.21 ? 38  LEU E CD1 1 
ATOM   1564 C CD2 . LEU E 1 43 ? 17.282  1.062   -15.639 1.00 16.05 ? 38  LEU E CD2 1 
ATOM   1565 N N   . GLU E 1 44 ? 15.230  1.942   -11.639 1.00 10.24 ? 39  GLU E N   1 
ATOM   1566 C CA  A GLU E 1 44 ? 14.231  2.324   -10.652 0.72 9.93  ? 39  GLU E CA  1 
ATOM   1567 C CA  B GLU E 1 44 ? 14.221  2.327   -10.653 0.28 10.88 ? 39  GLU E CA  1 
ATOM   1568 C C   . GLU E 1 44 ? 12.836  2.189   -11.251 1.00 10.41 ? 39  GLU E C   1 
ATOM   1569 O O   . GLU E 1 44 ? 12.620  2.518   -12.401 1.00 12.91 ? 39  GLU E O   1 
ATOM   1570 C CB  A GLU E 1 44 ? 14.486  3.754   -10.172 0.72 11.37 ? 39  GLU E CB  1 
ATOM   1571 C CB  B GLU E 1 44 ? 14.425  3.763   -10.165 0.28 11.92 ? 39  GLU E CB  1 
ATOM   1572 C CG  A GLU E 1 44 ? 13.829  4.081   -8.858  0.72 11.94 ? 39  GLU E CG  1 
ATOM   1573 C CG  B GLU E 1 44 ? 13.511  4.128   -8.997  0.28 12.67 ? 39  GLU E CG  1 
ATOM   1574 C CD  A GLU E 1 44 ? 12.530  4.827   -9.022  0.72 14.08 ? 39  GLU E CD  1 
ATOM   1575 C CD  B GLU E 1 44 ? 13.098  5.591   -8.974  0.28 15.36 ? 39  GLU E CD  1 
ATOM   1576 O OE1 A GLU E 1 44 ? 12.208  5.237   -10.159 0.72 17.13 ? 39  GLU E OE1 1 
ATOM   1577 O OE1 B GLU E 1 44 ? 12.909  6.185   -10.058 0.28 16.13 ? 39  GLU E OE1 1 
ATOM   1578 O OE2 A GLU E 1 44 ? 11.827  5.010   -8.009  0.72 13.88 ? 39  GLU E OE2 1 
ATOM   1579 O OE2 B GLU E 1 44 ? 12.957  6.148   -7.864  0.28 15.79 ? 39  GLU E OE2 1 
ATOM   1580 N N   . GLY E 1 45 ? 11.886  1.711   -10.462 1.00 9.87  ? 40  GLY E N   1 
ATOM   1581 C CA  . GLY E 1 45 ? 10.563  1.465   -11.012 1.00 10.26 ? 40  GLY E CA  1 
ATOM   1582 C C   . GLY E 1 45 ? 9.511   1.203   -9.963  1.00 9.14  ? 40  GLY E C   1 
ATOM   1583 O O   . GLY E 1 45 ? 9.815   1.070   -8.788  1.00 10.23 ? 40  GLY E O   1 
ATOM   1584 N N   . GLU E 1 46 ? 8.261   1.135   -10.411 1.00 9.96  ? 41  GLU E N   1 
ATOM   1585 C CA  . GLU E 1 46 ? 7.113   0.941   -9.533  1.00 9.72  ? 41  GLU E CA  1 
ATOM   1586 C C   . GLU E 1 46 ? 6.728   -0.539  -9.508  1.00 8.47  ? 41  GLU E C   1 
ATOM   1587 O O   . GLU E 1 46 ? 6.716   -1.202  -10.534 1.00 11.17 ? 41  GLU E O   1 
ATOM   1588 C CB  . GLU E 1 46 ? 5.930   1.798   -10.009 1.00 12.61 ? 41  GLU E CB  1 
ATOM   1589 C CG  . GLU E 1 46 ? 4.718   1.808   -9.054  1.00 13.82 ? 41  GLU E CG  1 
ATOM   1590 C CD  . GLU E 1 46 ? 3.823   0.595   -9.229  1.00 15.59 ? 41  GLU E CD  1 
ATOM   1591 O OE1 . GLU E 1 46 ? 3.760   0.053   -10.354 1.00 14.27 ? 41  GLU E OE1 1 
ATOM   1592 O OE2 . GLU E 1 46 ? 3.207   0.168   -8.233  1.00 15.76 ? 41  GLU E OE2 1 
ATOM   1593 N N   . LEU E 1 47 ? 6.407   -1.045  -8.329  1.00 8.49  ? 42  LEU E N   1 
ATOM   1594 C CA  . LEU E 1 47 ? 5.920   -2.408  -8.204  1.00 8.41  ? 42  LEU E CA  1 
ATOM   1595 C C   . LEU E 1 47 ? 5.044   -2.525  -6.977  1.00 12.66 ? 42  LEU E C   1 
ATOM   1596 O O   . LEU E 1 47 ? 5.477   -2.189  -5.875  1.00 10.41 ? 42  LEU E O   1 
ATOM   1597 C CB  . LEU E 1 47 ? 7.092   -3.399  -8.112  1.00 9.78  ? 42  LEU E CB  1 
ATOM   1598 C CG  . LEU E 1 47 ? 6.737   -4.878  -7.921  1.00 11.55 ? 42  LEU E CG  1 
ATOM   1599 C CD1 . LEU E 1 47 ? 5.888   -5.373  -9.089  1.00 11.04 ? 42  LEU E CD1 1 
ATOM   1600 C CD2 . LEU E 1 47 ? 8.018   -5.680  -7.775  1.00 11.12 ? 42  LEU E CD2 1 
ATOM   1601 N N   . ASN E 1 48 ? 3.821   -3.009  -7.179  1.00 16.14 ? 43  ASN E N   1 
ATOM   1602 C CA  . ASN E 1 48 ? 2.878   -3.271  -6.092  1.00 18.43 ? 43  ASN E CA  1 
ATOM   1603 C C   . ASN E 1 48 ? 2.668   -2.055  -5.172  1.00 17.62 ? 43  ASN E C   1 
ATOM   1604 O O   . ASN E 1 48 ? 2.488   -2.201  -3.960  1.00 19.06 ? 43  ASN E O   1 
ATOM   1605 C CB  . ASN E 1 48 ? 3.347   -4.488  -5.283  1.00 20.97 ? 43  ASN E CB  1 
ATOM   1606 C CG  . ASN E 1 48 ? 3.467   -5.762  -6.135  1.00 22.46 ? 43  ASN E CG  1 
ATOM   1607 O OD1 . ASN E 1 48 ? 2.701   -5.978  -7.074  1.00 24.39 ? 43  ASN E OD1 1 
ATOM   1608 N ND2 . ASN E 1 48 ? 4.435   -6.599  -5.804  1.00 22.09 ? 43  ASN E ND2 1 
ATOM   1609 N N   . GLY E 1 49 ? 2.697   -0.858  -5.755  1.00 15.56 ? 44  GLY E N   1 
ATOM   1610 C CA  . GLY E 1 49 ? 2.329   0.354   -5.043  1.00 16.48 ? 44  GLY E CA  1 
ATOM   1611 C C   . GLY E 1 49 ? 3.468   1.186   -4.485  1.00 16.46 ? 44  GLY E C   1 
ATOM   1612 O O   . GLY E 1 49 ? 3.247   2.280   -3.964  1.00 16.02 ? 44  GLY E O   1 
ATOM   1613 N N   . ARG E 1 50 ? 4.688   0.668   -4.589  1.00 16.13 ? 45  ARG E N   1 
ATOM   1614 C CA  . ARG E 1 50 ? 5.866   1.380   -4.106  1.00 16.29 ? 45  ARG E CA  1 
ATOM   1615 C C   . ARG E 1 50 ? 6.870   1.515   -5.231  1.00 14.68 ? 45  ARG E C   1 
ATOM   1616 O O   . ARG E 1 50 ? 6.743   0.868   -6.264  1.00 13.41 ? 45  ARG E O   1 
ATOM   1617 C CB  . ARG E 1 50 ? 6.523   0.640   -2.947  1.00 18.56 ? 45  ARG E CB  1 
ATOM   1618 C CG  . ARG E 1 50 ? 7.097   -0.699  -3.385  1.00 18.84 ? 45  ARG E CG  1 
ATOM   1619 C CD  . ARG E 1 50 ? 8.135   -1.217  -2.416  1.00 18.65 ? 45  ARG E CD  1 
ATOM   1620 N NE  . ARG E 1 50 ? 9.344   -0.401  -2.425  1.00 18.04 ? 45  ARG E NE  1 
ATOM   1621 C CZ  . ARG E 1 50 ? 10.449  -0.725  -1.766  1.00 14.20 ? 45  ARG E CZ  1 
ATOM   1622 N NH1 . ARG E 1 50 ? 10.473  -1.839  -1.051  1.00 16.31 ? 45  ARG E NH1 1 
ATOM   1623 N NH2 . ARG E 1 50 ? 11.520  0.060   -1.813  1.00 13.40 ? 45  ARG E NH2 1 
ATOM   1624 N N   . ARG E 1 51 ? 7.876   2.354   -5.025  1.00 14.47 ? 46  ARG E N   1 
ATOM   1625 C CA  . ARG E 1 51 ? 8.966   2.454   -5.992  1.00 13.52 ? 46  ARG E CA  1 
ATOM   1626 C C   . ARG E 1 51 ? 10.249  1.965   -5.360  1.00 14.14 ? 46  ARG E C   1 
ATOM   1627 O O   . ARG E 1 51 ? 10.409  2.014   -4.139  1.00 16.17 ? 46  ARG E O   1 
ATOM   1628 C CB  . ARG E 1 51 ? 9.142   3.885   -6.486  1.00 15.54 ? 46  ARG E CB  1 
ATOM   1629 C CG  . ARG E 1 51 ? 7.932   4.467   -7.193  1.00 17.14 ? 46  ARG E CG  1 
ATOM   1630 C CD  . ARG E 1 51 ? 8.296   5.765   -7.879  1.00 16.64 ? 46  ARG E CD  1 
ATOM   1631 N NE  . ARG E 1 51 ? 9.218   5.563   -8.991  1.00 18.54 ? 46  ARG E NE  1 
ATOM   1632 C CZ  . ARG E 1 51 ? 8.826   5.337   -10.240 1.00 18.72 ? 46  ARG E CZ  1 
ATOM   1633 N NH1 . ARG E 1 51 ? 7.526   5.290   -10.525 1.00 17.73 ? 46  ARG E NH1 1 
ATOM   1634 N NH2 . ARG E 1 51 ? 9.727   5.169   -11.199 1.00 18.54 ? 46  ARG E NH2 1 
ATOM   1635 N N   . GLY E 1 52 ? 11.165  1.483   -6.187  1.00 12.27 ? 47  GLY E N   1 
ATOM   1636 C CA  . GLY E 1 52 ? 12.446  1.046   -5.672  1.00 10.29 ? 47  GLY E CA  1 
ATOM   1637 C C   . GLY E 1 52 ? 13.452  0.689   -6.744  1.00 11.04 ? 47  GLY E C   1 
ATOM   1638 O O   . GLY E 1 52 ? 13.150  0.684   -7.941  1.00 8.59  ? 47  GLY E O   1 
ATOM   1639 N N   . MET E 1 53 ? 14.665  0.402   -6.292  1.00 8.79  ? 48  MET E N   1 
ATOM   1640 C CA  A MET E 1 53 ? 15.763  0.038   -7.183  0.41 8.83  ? 48  MET E CA  1 
ATOM   1641 C CA  B MET E 1 53 ? 15.769  0.032   -7.174  0.59 8.82  ? 48  MET E CA  1 
ATOM   1642 C C   . MET E 1 53 ? 15.793  -1.468  -7.437  1.00 9.44  ? 48  MET E C   1 
ATOM   1643 O O   . MET E 1 53 ? 15.405  -2.258  -6.579  1.00 10.51 ? 48  MET E O   1 
ATOM   1644 C CB  A MET E 1 53 ? 17.100  0.490   -6.589  0.41 14.04 ? 48  MET E CB  1 
ATOM   1645 C CB  B MET E 1 53 ? 17.104  0.455   -6.560  0.59 9.45  ? 48  MET E CB  1 
ATOM   1646 C CG  A MET E 1 53 ? 17.131  1.951   -6.153  0.41 14.28 ? 48  MET E CG  1 
ATOM   1647 C CG  B MET E 1 53 ? 17.172  1.913   -6.148  0.59 14.11 ? 48  MET E CG  1 
ATOM   1648 S SD  A MET E 1 53 ? 16.954  3.097   -7.530  0.41 16.24 ? 48  MET E SD  1 
ATOM   1649 S SD  B MET E 1 53 ? 16.921  3.008   -7.546  0.59 16.08 ? 48  MET E SD  1 
ATOM   1650 C CE  A MET E 1 53 ? 18.342  2.609   -8.560  0.41 11.35 ? 48  MET E CE  1 
ATOM   1651 C CE  B MET E 1 53 ? 17.254  4.585   -6.784  0.59 12.25 ? 48  MET E CE  1 
ATOM   1652 N N   . PHE E 1 54 ? 16.243  -1.862  -8.623  1.00 8.26  ? 49  PHE E N   1 
ATOM   1653 C CA  . PHE E 1 54 ? 16.363  -3.282  -8.930  1.00 7.92  ? 49  PHE E CA  1 
ATOM   1654 C C   . PHE E 1 54 ? 17.512  -3.510  -9.906  1.00 8.39  ? 49  PHE E C   1 
ATOM   1655 O O   . PHE E 1 54 ? 17.851  -2.628  -10.698 1.00 9.97  ? 49  PHE E O   1 
ATOM   1656 C CB  . PHE E 1 54 ? 15.032  -3.848  -9.472  1.00 7.55  ? 49  PHE E CB  1 
ATOM   1657 C CG  . PHE E 1 54 ? 14.554  -3.208  -10.746 1.00 7.79  ? 49  PHE E CG  1 
ATOM   1658 C CD1 . PHE E 1 54 ? 14.795  -3.818  -11.974 1.00 8.03  ? 49  PHE E CD1 1 
ATOM   1659 C CD2 . PHE E 1 54 ? 13.822  -2.015  -10.711 1.00 9.45  ? 49  PHE E CD2 1 
ATOM   1660 C CE1 . PHE E 1 54 ? 14.339  -3.243  -13.155 1.00 9.49  ? 49  PHE E CE1 1 
ATOM   1661 C CE2 . PHE E 1 54 ? 13.371  -1.432  -11.876 1.00 10.96 ? 49  PHE E CE2 1 
ATOM   1662 C CZ  . PHE E 1 54 ? 13.622  -2.044  -13.103 1.00 10.96 ? 49  PHE E CZ  1 
ATOM   1663 N N   . PRO E 1 55 ? 18.170  -4.668  -9.791  1.00 8.38  ? 50  PRO E N   1 
ATOM   1664 C CA  . PRO E 1 55 ? 19.370  -4.918  -10.604 1.00 10.20 ? 50  PRO E CA  1 
ATOM   1665 C C   . PRO E 1 55 ? 19.009  -5.182  -12.063 1.00 10.31 ? 50  PRO E C   1 
ATOM   1666 O O   . PRO E 1 55 ? 18.084  -5.964  -12.326 1.00 10.88 ? 50  PRO E O   1 
ATOM   1667 C CB  . PRO E 1 55 ? 19.991  -6.153  -9.937  1.00 11.88 ? 50  PRO E CB  1 
ATOM   1668 C CG  . PRO E 1 55 ? 18.837  -6.848  -9.284  1.00 11.73 ? 50  PRO E CG  1 
ATOM   1669 C CD  . PRO E 1 55 ? 17.897  -5.756  -8.832  1.00 10.46 ? 50  PRO E CD  1 
ATOM   1670 N N   . ASP E 1 56 ? 19.723  -4.564  -12.997 1.00 10.95 ? 51  ASP E N   1 
ATOM   1671 C CA  . ASP E 1 56 ? 19.275  -4.597  -14.387 1.00 13.37 ? 51  ASP E CA  1 
ATOM   1672 C C   . ASP E 1 56 ? 19.543  -5.936  -15.077 1.00 13.75 ? 51  ASP E C   1 
ATOM   1673 O O   . ASP E 1 56 ? 19.070  -6.142  -16.185 1.00 15.55 ? 51  ASP E O   1 
ATOM   1674 C CB  . ASP E 1 56 ? 19.890  -3.443  -15.213 1.00 17.57 ? 51  ASP E CB  1 
ATOM   1675 C CG  . ASP E 1 56 ? 21.408  -3.519  -15.366 1.00 21.32 ? 51  ASP E CG  1 
ATOM   1676 O OD1 . ASP E 1 56 ? 22.022  -4.585  -15.155 1.00 21.40 ? 51  ASP E OD1 1 
ATOM   1677 O OD2 . ASP E 1 56 ? 21.990  -2.472  -15.741 1.00 23.05 ? 51  ASP E OD2 1 
ATOM   1678 N N   . ASN E 1 57 ? 20.275  -6.847  -14.432 1.00 13.29 ? 52  ASN E N   1 
ATOM   1679 C CA  . ASN E 1 57 ? 20.492  -8.164  -15.031 1.00 11.84 ? 52  ASN E CA  1 
ATOM   1680 C C   . ASN E 1 57 ? 19.541  -9.255  -14.479 1.00 10.68 ? 52  ASN E C   1 
ATOM   1681 O O   . ASN E 1 57 ? 19.697  -10.443 -14.790 1.00 12.03 ? 52  ASN E O   1 
ATOM   1682 C CB  . ASN E 1 57 ? 21.978  -8.583  -14.901 1.00 16.09 ? 52  ASN E CB  1 
ATOM   1683 C CG  . ASN E 1 57 ? 22.483  -8.639  -13.449 1.00 14.88 ? 52  ASN E CG  1 
ATOM   1684 O OD1 . ASN E 1 57 ? 21.857  -8.128  -12.528 1.00 10.83 ? 52  ASN E OD1 1 
ATOM   1685 N ND2 . ASN E 1 57 ? 23.659  -9.239  -13.265 1.00 14.34 ? 52  ASN E ND2 1 
ATOM   1686 N N   . PHE E 1 58 ? 18.522  -8.838  -13.722 1.00 9.78  ? 53  PHE E N   1 
ATOM   1687 C CA  . PHE E 1 58 ? 17.502  -9.765  -13.207 1.00 11.69 ? 53  PHE E CA  1 
ATOM   1688 C C   . PHE E 1 58 ? 16.193  -9.611  -13.975 1.00 12.48 ? 53  PHE E C   1 
ATOM   1689 O O   . PHE E 1 58 ? 15.203  -10.295 -13.673 1.00 11.75 ? 53  PHE E O   1 
ATOM   1690 C CB  . PHE E 1 58 ? 17.221  -9.525  -11.710 1.00 10.97 ? 53  PHE E CB  1 
ATOM   1691 C CG  . PHE E 1 58 ? 18.269  -10.092 -10.776 1.00 11.43 ? 53  PHE E CG  1 
ATOM   1692 C CD1 . PHE E 1 58 ? 19.593  -9.688  -10.871 1.00 10.63 ? 53  PHE E CD1 1 
ATOM   1693 C CD2 . PHE E 1 58 ? 17.919  -10.989 -9.772  1.00 10.33 ? 53  PHE E CD2 1 
ATOM   1694 C CE1 . PHE E 1 58 ? 20.566  -10.185 -10.009 1.00 10.76 ? 53  PHE E CE1 1 
ATOM   1695 C CE2 . PHE E 1 58 ? 18.885  -11.496 -8.886  1.00 9.49  ? 53  PHE E CE2 1 
ATOM   1696 C CZ  . PHE E 1 58 ? 20.210  -11.092 -9.002  1.00 12.21 ? 53  PHE E CZ  1 
ATOM   1697 N N   . VAL E 1 59 ? 16.203  -8.716  -14.965 1.00 10.45 ? 54  VAL E N   1 
ATOM   1698 C CA  . VAL E 1 59 ? 14.995  -8.271  -15.652 1.00 10.69 ? 54  VAL E CA  1 
ATOM   1699 C C   . VAL E 1 59 ? 15.202  -8.208  -17.165 1.00 12.27 ? 54  VAL E C   1 
ATOM   1700 O O   . VAL E 1 59 ? 16.337  -8.250  -17.654 1.00 11.19 ? 54  VAL E O   1 
ATOM   1701 C CB  . VAL E 1 59 ? 14.562  -6.871  -15.167 1.00 9.07  ? 54  VAL E CB  1 
ATOM   1702 C CG1 . VAL E 1 59 ? 14.063  -6.908  -13.717 1.00 9.88  ? 54  VAL E CG1 1 
ATOM   1703 C CG2 . VAL E 1 59 ? 15.724  -5.882  -15.292 1.00 9.43  ? 54  VAL E CG2 1 
ATOM   1704 N N   . LYS E 1 60 ? 14.102  -8.114  -17.903 1.00 11.70 ? 55  LYS E N   1 
ATOM   1705 C CA  . LYS E 1 60 ? 14.157  -7.924  -19.342 1.00 15.79 ? 55  LYS E CA  1 
ATOM   1706 C C   . LYS E 1 60 ? 13.246  -6.783  -19.728 1.00 15.14 ? 55  LYS E C   1 
ATOM   1707 O O   . LYS E 1 60 ? 12.092  -6.745  -19.307 1.00 14.29 ? 55  LYS E O   1 
ATOM   1708 C CB  . LYS E 1 60 ? 13.743  -9.201  -20.087 1.00 19.75 ? 55  LYS E CB  1 
ATOM   1709 C CG  . LYS E 1 60 ? 13.803  -9.062  -21.603 1.00 25.83 ? 55  LYS E CG  1 
ATOM   1710 C CD  . LYS E 1 60 ? 13.386  -10.334 -22.329 1.00 30.01 ? 55  LYS E CD  1 
ATOM   1711 C CE  . LYS E 1 60 ? 11.883  -10.516 -22.316 1.00 33.13 ? 55  LYS E CE  1 
ATOM   1712 N NZ  . LYS E 1 60 ? 11.426  -11.304 -23.495 1.00 36.72 ? 55  LYS E NZ  1 
ATOM   1713 N N   . GLU E 1 61 ? 13.750  -5.855  -20.536 1.00 15.48 ? 56  GLU E N   1 
ATOM   1714 C CA  . GLU E 1 61 ? 12.910  -4.758  -21.006 1.00 14.10 ? 56  GLU E CA  1 
ATOM   1715 C C   . GLU E 1 61 ? 11.815  -5.267  -21.933 1.00 14.32 ? 56  GLU E C   1 
ATOM   1716 O O   . GLU E 1 61 ? 12.076  -6.037  -22.854 1.00 16.30 ? 56  GLU E O   1 
ATOM   1717 C CB  . GLU E 1 61 ? 13.742  -3.694  -21.726 1.00 16.51 ? 56  GLU E CB  1 
ATOM   1718 C CG  . GLU E 1 61 ? 12.934  -2.482  -22.163 1.00 20.72 ? 56  GLU E CG  1 
ATOM   1719 C CD  . GLU E 1 61 ? 13.784  -1.432  -22.853 1.00 28.64 ? 56  GLU E CD  1 
ATOM   1720 O OE1 . GLU E 1 61 ? 14.970  -1.707  -23.123 1.00 32.21 ? 56  GLU E OE1 1 
ATOM   1721 O OE2 . GLU E 1 61 ? 13.263  -0.330  -23.125 1.00 31.98 ? 56  GLU E OE2 1 
ATOM   1722 N N   . ILE E 1 62 ? 10.587  -4.831  -21.672 1.00 13.29 ? 57  ILE E N   1 
ATOM   1723 C CA  . ILE E 1 62 ? 9.454   -5.101  -22.549 1.00 15.68 ? 57  ILE E CA  1 
ATOM   1724 C C   . ILE E 1 62 ? 9.476   -4.120  -23.705 1.00 18.11 ? 57  ILE E C   1 
ATOM   1725 O O   . ILE E 1 62 ? 9.380   -2.912  -23.496 1.00 19.00 ? 57  ILE E O   1 
ATOM   1726 C CB  . ILE E 1 62 ? 8.115   -4.976  -21.787 1.00 17.56 ? 57  ILE E CB  1 
ATOM   1727 C CG1 . ILE E 1 62 ? 8.087   -5.948  -20.616 1.00 17.69 ? 57  ILE E CG1 1 
ATOM   1728 C CG2 . ILE E 1 62 ? 6.912   -5.186  -22.715 1.00 18.36 ? 57  ILE E CG2 1 
ATOM   1729 C CD1 . ILE E 1 62 ? 6.887   -5.770  -19.743 1.00 17.76 ? 57  ILE E CD1 1 
ATOM   1730 N N   . LYS E 1 63 ? 9.615   -4.630  -24.922 1.00 22.05 ? 58  LYS E N   1 
ATOM   1731 C CA  . LYS E 1 63 ? 9.605   -3.762  -26.091 1.00 28.06 ? 58  LYS E CA  1 
ATOM   1732 C C   . LYS E 1 63 ? 8.393   -4.051  -26.962 1.00 30.80 ? 58  LYS E C   1 
ATOM   1733 O O   . LYS E 1 63 ? 7.445   -3.269  -26.974 1.00 31.91 ? 58  LYS E O   1 
ATOM   1734 C CB  . LYS E 1 63 ? 10.897  -3.915  -26.893 1.00 32.04 ? 58  LYS E CB  1 
ATOM   1735 C CG  . LYS E 1 63 ? 12.144  -3.530  -26.113 1.00 33.40 ? 58  LYS E CG  1 
ATOM   1736 C CD  . LYS E 1 63 ? 13.412  -3.770  -26.916 1.00 37.92 ? 58  LYS E CD  1 
ATOM   1737 C CE  . LYS E 1 63 ? 14.647  -3.634  -26.035 1.00 39.70 ? 58  LYS E CE  1 
ATOM   1738 N NZ  . LYS E 1 63 ? 15.906  -3.978  -26.760 1.00 42.29 ? 58  LYS E NZ  1 
ATOM   1739 N N   . LYS F 2 3  ? 18.534  -22.043 -14.585 1.00 43.19 ? 380 LYS F N   1 
ATOM   1740 C CA  . LYS F 2 3  ? 19.903  -22.529 -14.704 1.00 42.46 ? 380 LYS F CA  1 
ATOM   1741 C C   . LYS F 2 3  ? 20.902  -21.465 -14.261 1.00 38.21 ? 380 LYS F C   1 
ATOM   1742 O O   . LYS F 2 3  ? 21.155  -21.300 -13.070 1.00 38.36 ? 380 LYS F O   1 
ATOM   1743 C CB  . LYS F 2 3  ? 20.197  -22.960 -16.142 1.00 46.30 ? 380 LYS F CB  1 
ATOM   1744 N N   . ASN F 2 4  ? 21.464  -20.745 -15.227 1.00 34.32 ? 381 ASN F N   1 
ATOM   1745 C CA  . ASN F 2 4  ? 22.436  -19.697 -14.942 1.00 29.63 ? 381 ASN F CA  1 
ATOM   1746 C C   . ASN F 2 4  ? 21.800  -18.492 -14.261 1.00 25.73 ? 381 ASN F C   1 
ATOM   1747 O O   . ASN F 2 4  ? 20.893  -17.878 -14.812 1.00 28.86 ? 381 ASN F O   1 
ATOM   1748 C CB  . ASN F 2 4  ? 23.131  -19.261 -16.231 1.00 30.85 ? 381 ASN F CB  1 
ATOM   1749 C CG  . ASN F 2 4  ? 23.847  -20.405 -16.916 1.00 34.22 ? 381 ASN F CG  1 
ATOM   1750 O OD1 . ASN F 2 4  ? 24.862  -20.893 -16.426 1.00 33.91 ? 381 ASN F OD1 1 
ATOM   1751 N ND2 . ASN F 2 4  ? 23.322  -20.838 -18.057 1.00 37.43 ? 381 ASN F ND2 1 
ATOM   1752 N N   . LEU F 2 5  ? 22.280  -18.159 -13.065 1.00 19.56 ? 382 LEU F N   1 
ATOM   1753 C CA  . LEU F 2 5  ? 21.701  -17.078 -12.277 1.00 17.11 ? 382 LEU F CA  1 
ATOM   1754 C C   . LEU F 2 5  ? 22.586  -15.849 -12.301 1.00 15.79 ? 382 LEU F C   1 
ATOM   1755 O O   . LEU F 2 5  ? 23.820  -15.958 -12.273 1.00 15.34 ? 382 LEU F O   1 
ATOM   1756 C CB  . LEU F 2 5  ? 21.476  -17.507 -10.822 1.00 15.65 ? 382 LEU F CB  1 
ATOM   1757 C CG  . LEU F 2 5  ? 20.535  -18.690 -10.584 1.00 21.83 ? 382 LEU F CG  1 
ATOM   1758 C CD1 . LEU F 2 5  ? 20.440  -18.949 -9.090  1.00 17.76 ? 382 LEU F CD1 1 
ATOM   1759 C CD2 . LEU F 2 5  ? 19.157  -18.412 -11.179 1.00 23.18 ? 382 LEU F CD2 1 
ATOM   1760 N N   . PRO F 2 6  ? 21.958  -14.672 -12.326 1.00 13.10 ? 383 PRO F N   1 
ATOM   1761 C CA  . PRO F 2 6  ? 22.706  -13.421 -12.327 1.00 11.94 ? 383 PRO F CA  1 
ATOM   1762 C C   . PRO F 2 6  ? 23.173  -13.047 -10.931 1.00 12.78 ? 383 PRO F C   1 
ATOM   1763 O O   . PRO F 2 6  ? 22.547  -13.421 -9.933  1.00 12.69 ? 383 PRO F O   1 
ATOM   1764 C CB  . PRO F 2 6  ? 21.683  -12.411 -12.865 1.00 12.60 ? 383 PRO F CB  1 
ATOM   1765 C CG  . PRO F 2 6  ? 20.374  -12.943 -12.400 1.00 13.15 ? 383 PRO F CG  1 
ATOM   1766 C CD  . PRO F 2 6  ? 20.503  -14.446 -12.453 1.00 13.36 ? 383 PRO F CD  1 
ATOM   1767 N N   . THR F 2 7  ? 24.291  -12.337 -10.869 1.00 10.46 ? 384 THR F N   1 
ATOM   1768 C CA  . THR F 2 7  ? 24.743  -11.715 -9.638  1.00 9.73  ? 384 THR F CA  1 
ATOM   1769 C C   . THR F 2 7  ? 24.479  -10.211 -9.729  1.00 12.01 ? 384 THR F C   1 
ATOM   1770 O O   . THR F 2 7  ? 24.887  -9.561  -10.688 1.00 14.92 ? 384 THR F O   1 
ATOM   1771 C CB  . THR F 2 7  ? 26.234  -11.971 -9.388  1.00 12.54 ? 384 THR F CB  1 
ATOM   1772 O OG1 . THR F 2 7  ? 26.426  -13.365 -9.127  1.00 13.59 ? 384 THR F OG1 1 
ATOM   1773 C CG2 . THR F 2 7  ? 26.713  -11.152 -8.189  1.00 12.15 ? 384 THR F CG2 1 
ATOM   1774 N N   . ALA F 2 8  ? 23.771  -9.666  -8.750  1.00 11.25 ? 385 ALA F N   1 
ATOM   1775 C CA  . ALA F 2 8  ? 23.461  -8.241  -8.767  1.00 11.52 ? 385 ALA F CA  1 
ATOM   1776 C C   . ALA F 2 8  ? 24.722  -7.380  -8.775  1.00 11.38 ? 385 ALA F C   1 
ATOM   1777 O O   . ALA F 2 8  ? 25.675  -7.644  -8.034  1.00 11.93 ? 385 ALA F O   1 
ATOM   1778 C CB  . ALA F 2 8  ? 22.577  -7.886  -7.584  1.00 12.03 ? 385 ALA F CB  1 
ATOM   1779 N N   . PRO F 2 9  ? 24.743  -6.351  -9.629  1.00 12.32 ? 386 PRO F N   1 
ATOM   1780 C CA  . PRO F 2 9  ? 25.916  -5.470  -9.637  1.00 13.22 ? 386 PRO F CA  1 
ATOM   1781 C C   . PRO F 2 9  ? 26.065  -4.746  -8.298  1.00 12.23 ? 386 PRO F C   1 
ATOM   1782 O O   . PRO F 2 9  ? 25.066  -4.543  -7.606  1.00 12.07 ? 386 PRO F O   1 
ATOM   1783 C CB  . PRO F 2 9  ? 25.611  -4.477  -10.761 1.00 15.85 ? 386 PRO F CB  1 
ATOM   1784 C CG  . PRO F 2 9  ? 24.509  -5.096  -11.559 1.00 15.54 ? 386 PRO F CG  1 
ATOM   1785 C CD  . PRO F 2 9  ? 23.723  -5.925  -10.600 1.00 13.75 ? 386 PRO F CD  1 
ATOM   1786 N N   . PRO F 2 10 ? 27.299  -4.400  -7.914  1.00 14.11 ? 387 PRO F N   1 
ATOM   1787 C CA  . PRO F 2 10 ? 27.527  -3.591  -6.712  1.00 15.16 ? 387 PRO F CA  1 
ATOM   1788 C C   . PRO F 2 10 ? 26.727  -2.287  -6.731  1.00 14.68 ? 387 PRO F C   1 
ATOM   1789 O O   . PRO F 2 10 ? 26.561  -1.706  -7.807  1.00 14.61 ? 387 PRO F O   1 
ATOM   1790 C CB  . PRO F 2 10 ? 29.036  -3.311  -6.769  1.00 18.75 ? 387 PRO F CB  1 
ATOM   1791 C CG  . PRO F 2 10 ? 29.595  -4.481  -7.506  1.00 21.85 ? 387 PRO F CG  1 
ATOM   1792 C CD  . PRO F 2 10 ? 28.560  -4.859  -8.526  1.00 17.47 ? 387 PRO F CD  1 
ATOM   1793 N N   . ARG F 2 11 ? 26.222  -1.844  -5.579  1.00 15.15 ? 388 ARG F N   1 
ATOM   1794 C CA  . ARG F 2 11 ? 25.635  -0.501  -5.478  1.00 15.43 ? 388 ARG F CA  1 
ATOM   1795 C C   . ARG F 2 11 ? 26.729  0.567   -5.480  1.00 17.15 ? 388 ARG F C   1 
ATOM   1796 O O   . ARG F 2 11 ? 27.886  0.296   -5.152  1.00 17.54 ? 388 ARG F O   1 
ATOM   1797 C CB  . ARG F 2 11 ? 24.798  -0.335  -4.203  1.00 15.93 ? 388 ARG F CB  1 
ATOM   1798 C CG  . ARG F 2 11 ? 23.609  -1.274  -4.050  1.00 15.95 ? 388 ARG F CG  1 
ATOM   1799 C CD  . ARG F 2 11 ? 22.547  -1.050  -5.107  1.00 13.40 ? 388 ARG F CD  1 
ATOM   1800 N NE  . ARG F 2 11 ? 22.030  0.313   -5.138  1.00 14.60 ? 388 ARG F NE  1 
ATOM   1801 C CZ  . ARG F 2 11 ? 20.998  0.751   -4.414  1.00 14.31 ? 388 ARG F CZ  1 
ATOM   1802 N NH1 . ARG F 2 11 ? 20.365  -0.068  -3.579  1.00 14.21 ? 388 ARG F NH1 1 
ATOM   1803 N NH2 . ARG F 2 11 ? 20.593  2.008   -4.527  1.00 13.59 ? 388 ARG F NH2 1 
ATOM   1804 N N   . ARG F 2 12 ? 26.358  1.795   -5.818  1.00 17.89 ? 389 ARG F N   1 
ATOM   1805 C CA  . ARG F 2 12 ? 27.309  2.905   -5.756  1.00 22.15 ? 389 ARG F CA  1 
ATOM   1806 C C   . ARG F 2 12 ? 27.612  3.314   -4.309  1.00 27.39 ? 389 ARG F C   1 
ATOM   1807 O O   . ARG F 2 12 ? 26.700  3.495   -3.497  1.00 29.74 ? 389 ARG F O   1 
ATOM   1808 C CB  . ARG F 2 12 ? 26.776  4.110   -6.539  1.00 22.25 ? 389 ARG F CB  1 
ATOM   1809 C CG  . ARG F 2 12 ? 27.834  5.161   -6.841  1.00 27.75 ? 389 ARG F CG  1 
ATOM   1810 C CD  . ARG F 2 12 ? 27.232  6.382   -7.499  1.00 31.78 ? 389 ARG F CD  1 
ATOM   1811 N NE  . ARG F 2 12 ? 26.549  7.232   -6.531  1.00 37.32 ? 389 ARG F NE  1 
ATOM   1812 C CZ  . ARG F 2 12 ? 27.134  8.240   -5.894  1.00 42.96 ? 389 ARG F CZ  1 
ATOM   1813 N NH1 . ARG F 2 12 ? 28.408  8.522   -6.134  1.00 44.75 ? 389 ARG F NH1 1 
ATOM   1814 N NH2 . ARG F 2 12 ? 26.448  8.972   -5.025  1.00 46.04 ? 389 ARG F NH2 1 
ATOM   1815 N N   . ARG F 2 13 ? 28.895  3.471   -3.995  1.00 29.25 ? 390 ARG F N   1 
HETATM 1816 S S   . SO4 G 3 .  ? 0.063   -5.947  -12.565 1.00 15.69 ? 101 SO4 A S   1 
HETATM 1817 O O1  . SO4 G 3 .  ? 1.441   -5.999  -13.044 1.00 18.49 ? 101 SO4 A O1  1 
HETATM 1818 O O2  . SO4 G 3 .  ? -0.698  -7.072  -13.089 1.00 18.08 ? 101 SO4 A O2  1 
HETATM 1819 O O3  . SO4 G 3 .  ? 0.062   -6.010  -11.117 1.00 20.53 ? 101 SO4 A O3  1 
HETATM 1820 O O4  . SO4 G 3 .  ? -0.564  -4.709  -13.012 1.00 17.03 ? 101 SO4 A O4  1 
HETATM 1821 S S   . SO4 H 3 .  ? 0.013   -5.854  -19.341 0.78 40.18 ? 101 SO4 C S   1 
HETATM 1822 O O1  . SO4 H 3 .  ? 1.460   -5.899  -19.140 0.78 39.97 ? 101 SO4 C O1  1 
HETATM 1823 O O2  . SO4 H 3 .  ? -0.282  -6.081  -20.752 0.78 37.97 ? 101 SO4 C O2  1 
HETATM 1824 O O3  . SO4 H 3 .  ? -0.497  -4.543  -18.946 0.78 40.87 ? 101 SO4 C O3  1 
HETATM 1825 O O4  . SO4 H 3 .  ? -0.630  -6.887  -18.535 0.78 40.09 ? 101 SO4 C O4  1 
HETATM 1826 O O   . HOH I 4 .  ? -18.201 -3.110  -9.141  0.95 35.76 ? 201 HOH A O   1 
HETATM 1827 O O   . HOH I 4 .  ? -18.397 3.711   -3.177  1.00 30.66 ? 202 HOH A O   1 
HETATM 1828 O O   . HOH I 4 .  ? -6.650  6.534   -23.979 0.99 24.70 ? 203 HOH A O   1 
HETATM 1829 O O   . HOH I 4 .  ? -17.222 -3.054  -6.607  0.97 41.09 ? 204 HOH A O   1 
HETATM 1830 O O   . HOH I 4 .  ? -13.791 3.279   -24.191 1.00 37.19 ? 205 HOH A O   1 
HETATM 1831 O O   . HOH I 4 .  ? -5.128  8.600   2.301   0.83 17.93 ? 206 HOH A O   1 
HETATM 1832 O O   . HOH I 4 .  ? -5.675  3.792   0.536   1.00 19.89 ? 207 HOH A O   1 
HETATM 1833 O O   . HOH I 4 .  ? -9.465  3.414   0.606   0.87 16.19 ? 208 HOH A O   1 
HETATM 1834 O O   . HOH I 4 .  ? -22.692 17.459  -15.761 0.90 25.48 ? 209 HOH A O   1 
HETATM 1835 O O   . HOH I 4 .  ? -0.853  14.053  -8.334  1.00 17.34 ? 210 HOH A O   1 
HETATM 1836 O O   . HOH I 4 .  ? -11.309 -7.749  -2.862  0.97 24.52 ? 211 HOH A O   1 
HETATM 1837 O O   . HOH I 4 .  ? 3.564   7.260   -0.973  0.90 15.09 ? 212 HOH A O   1 
HETATM 1838 O O   . HOH I 4 .  ? -16.034 8.987   -15.483 1.00 18.85 ? 213 HOH A O   1 
HETATM 1839 O O   . HOH I 4 .  ? -8.298  8.244   -20.867 0.99 15.36 ? 214 HOH A O   1 
HETATM 1840 O O   . HOH I 4 .  ? -23.298 2.820   -14.685 1.00 41.53 ? 215 HOH A O   1 
HETATM 1841 O O   . HOH I 4 .  ? -14.688 7.696   4.145   1.00 20.98 ? 216 HOH A O   1 
HETATM 1842 O O   . HOH I 4 .  ? 1.877   6.607   -20.377 1.00 28.38 ? 217 HOH A O   1 
HETATM 1843 O O   . HOH I 4 .  ? -12.515 -4.172  -2.268  1.00 23.26 ? 218 HOH A O   1 
HETATM 1844 O O   . HOH I 4 .  ? -3.686  3.091   -25.146 1.00 31.90 ? 219 HOH A O   1 
HETATM 1845 O O   . HOH I 4 .  ? -5.830  0.900   -0.836  1.00 39.07 ? 220 HOH A O   1 
HETATM 1846 O O   . HOH I 4 .  ? -16.216 6.196   1.251   0.94 19.97 ? 221 HOH A O   1 
HETATM 1847 O O   . HOH I 4 .  ? 3.695   9.855   -3.535  0.99 33.15 ? 222 HOH A O   1 
HETATM 1848 O O   . HOH I 4 .  ? -1.953  13.930  1.095   1.00 43.53 ? 223 HOH A O   1 
HETATM 1849 O O   . HOH I 4 .  ? -8.633  -0.545  -29.068 1.00 49.02 ? 224 HOH A O   1 
HETATM 1850 O O   . HOH I 4 .  ? -22.470 12.494  -15.953 1.00 32.19 ? 225 HOH A O   1 
HETATM 1851 O O   . HOH I 4 .  ? -7.267  8.526   -22.870 1.00 43.58 ? 226 HOH A O   1 
HETATM 1852 O O   . HOH I 4 .  ? -7.934  6.385   3.483   1.00 38.51 ? 227 HOH A O   1 
HETATM 1853 O O   . HOH I 4 .  ? -0.919  13.046  -3.422  1.00 44.71 ? 228 HOH A O   1 
HETATM 1854 O O   . HOH I 4 .  ? -22.463 18.975  -17.350 1.00 43.42 ? 229 HOH A O   1 
HETATM 1855 O O   . HOH I 4 .  ? -4.648  -2.471  -0.451  1.00 38.46 ? 230 HOH A O   1 
HETATM 1856 O O   . HOH I 4 .  ? -0.886  2.586   -0.921  0.98 38.23 ? 231 HOH A O   1 
HETATM 1857 O O   . HOH I 4 .  ? 3.268   -7.673  -11.906 1.00 15.00 ? 232 HOH A O   1 
HETATM 1858 O O   . HOH I 4 .  ? -5.378  1.402   -3.199  1.00 17.02 ? 233 HOH A O   1 
HETATM 1859 O O   . HOH I 4 .  ? -0.149  -2.332  -11.732 1.00 14.21 ? 234 HOH A O   1 
HETATM 1860 O O   . HOH I 4 .  ? -14.017 -3.544  -17.398 0.95 13.90 ? 235 HOH A O   1 
HETATM 1861 O O   . HOH I 4 .  ? 5.030   5.263   -8.829  0.92 14.65 ? 236 HOH A O   1 
HETATM 1862 O O   . HOH I 4 .  ? -3.056  -4.212  -11.752 0.91 14.32 ? 237 HOH A O   1 
HETATM 1863 O O   . HOH I 4 .  ? 4.757   7.564   -7.831  0.98 18.16 ? 238 HOH A O   1 
HETATM 1864 O O   . HOH I 4 .  ? -5.594  13.335  -2.099  1.00 27.82 ? 239 HOH A O   1 
HETATM 1865 O O   . HOH I 4 .  ? -3.647  13.102  -3.504  0.95 23.52 ? 240 HOH A O   1 
HETATM 1866 O O   . HOH I 4 .  ? -1.338  2.018   -4.784  0.97 16.11 ? 241 HOH A O   1 
HETATM 1867 O O   . HOH I 4 .  ? -18.746 0.641   -17.395 0.92 19.74 ? 242 HOH A O   1 
HETATM 1868 O O   . HOH I 4 .  ? -16.248 -7.684  -9.290  1.00 36.36 ? 243 HOH A O   1 
HETATM 1869 O O   . HOH I 4 .  ? -16.481 -7.129  -12.109 0.90 21.44 ? 244 HOH A O   1 
HETATM 1870 O O   . HOH I 4 .  ? 1.899   12.460  -9.554  1.00 25.23 ? 245 HOH A O   1 
HETATM 1871 O O   . HOH I 4 .  ? -12.524 12.951  -2.999  0.99 20.98 ? 246 HOH A O   1 
HETATM 1872 O O   . HOH I 4 .  ? 2.561   1.374   -16.325 1.00 32.46 ? 247 HOH A O   1 
HETATM 1873 O O   . HOH I 4 .  ? 0.454   -2.298  -8.763  1.00 32.73 ? 248 HOH A O   1 
HETATM 1874 O O   . HOH I 4 .  ? -16.639 -0.670  -18.209 0.99 29.62 ? 249 HOH A O   1 
HETATM 1875 O O   . HOH I 4 .  ? -21.551 5.697   -8.032  1.00 33.73 ? 250 HOH A O   1 
HETATM 1876 O O   . HOH I 4 .  ? -18.445 6.171   -11.635 1.00 16.09 ? 251 HOH A O   1 
HETATM 1877 O O   . HOH I 4 .  ? -5.216  -1.083  -4.117  1.00 30.35 ? 252 HOH A O   1 
HETATM 1878 O O   . HOH I 4 .  ? -4.373  -5.566  -10.055 0.91 18.23 ? 253 HOH A O   1 
HETATM 1879 O O   . HOH I 4 .  ? -17.965 10.899  -15.783 0.95 17.32 ? 254 HOH A O   1 
HETATM 1880 O O   . HOH I 4 .  ? -7.590  -9.946  -2.904  1.00 30.20 ? 255 HOH A O   1 
HETATM 1881 O O   . HOH I 4 .  ? -20.001 10.360  -3.711  1.00 26.56 ? 256 HOH A O   1 
HETATM 1882 O O   . HOH I 4 .  ? -10.822 14.251  -3.628  1.00 34.24 ? 257 HOH A O   1 
HETATM 1883 O O   . HOH I 4 .  ? -8.143  -1.673  -21.792 0.99 28.27 ? 258 HOH A O   1 
HETATM 1884 O O   . HOH I 4 .  ? -16.843 -6.877  -15.668 0.83 26.90 ? 259 HOH A O   1 
HETATM 1885 O O   . HOH I 4 .  ? -6.382  -6.927  -18.596 0.87 27.05 ? 260 HOH A O   1 
HETATM 1886 O O   . HOH I 4 .  ? 2.719   10.512  -15.810 0.91 40.97 ? 261 HOH A O   1 
HETATM 1887 O O   . HOH I 4 .  ? -18.347 8.166   0.086   1.00 47.89 ? 262 HOH A O   1 
HETATM 1888 O O   . HOH I 4 .  ? -19.937 5.931   -6.300  1.00 34.82 ? 263 HOH A O   1 
HETATM 1889 O O   . HOH I 4 .  ? -21.364 -0.207  -14.413 1.00 44.65 ? 264 HOH A O   1 
HETATM 1890 O O   . HOH I 4 .  ? -20.302 -0.848  -16.325 1.00 43.07 ? 265 HOH A O   1 
HETATM 1891 O O   . HOH I 4 .  ? -21.073 13.682  -17.418 0.91 33.06 ? 266 HOH A O   1 
HETATM 1892 O O   . HOH I 4 .  ? -8.964  15.183  4.139   1.00 46.71 ? 267 HOH A O   1 
HETATM 1893 O O   . HOH I 4 .  ? -4.514  13.900  1.156   1.00 46.76 ? 268 HOH A O   1 
HETATM 1894 O O   . HOH I 4 .  ? -9.574  12.626  5.473   1.00 46.80 ? 269 HOH A O   1 
HETATM 1895 O O   . HOH I 4 .  ? -21.362 -4.638  -13.631 1.00 39.91 ? 270 HOH A O   1 
HETATM 1896 O O   . HOH I 4 .  ? -2.160  -0.846  -4.099  1.00 29.43 ? 271 HOH A O   1 
HETATM 1897 O O   . HOH I 4 .  ? -3.306  -3.795  -1.989  1.00 49.09 ? 272 HOH A O   1 
HETATM 1898 O O   . HOH I 4 .  ? -21.779 15.134  -19.322 1.00 41.58 ? 273 HOH A O   1 
HETATM 1899 O O   . HOH I 4 .  ? -6.460  -7.597  -20.838 1.00 50.03 ? 274 HOH A O   1 
HETATM 1900 O O   . HOH I 4 .  ? -22.694 -4.210  -17.219 0.98 42.29 ? 275 HOH A O   1 
HETATM 1901 O O   . HOH I 4 .  ? -20.771 -4.136  -15.877 1.00 45.36 ? 276 HOH A O   1 
HETATM 1902 O O   . HOH J 4 .  ? -4.447  20.984  -10.317 0.99 16.75 ? 401 HOH B O   1 
HETATM 1903 O O   . HOH J 4 .  ? -7.414  23.230  -8.997  0.91 25.42 ? 402 HOH B O   1 
HETATM 1904 O O   . HOH J 4 .  ? -29.970 12.427  -8.621  0.96 16.72 ? 403 HOH B O   1 
HETATM 1905 O O   . HOH J 4 .  ? 3.069   21.376  -12.988 1.00 48.31 ? 404 HOH B O   1 
HETATM 1906 O O   . HOH J 4 .  ? -12.624 19.614  -7.404  0.94 43.72 ? 405 HOH B O   1 
HETATM 1907 O O   . HOH J 4 .  ? -11.470 18.892  -11.831 0.89 26.23 ? 406 HOH B O   1 
HETATM 1908 O O   . HOH J 4 .  ? -7.129  16.932  -6.248  0.93 18.96 ? 407 HOH B O   1 
HETATM 1909 O O   . HOH J 4 .  ? -2.714  16.291  -8.198  0.99 20.57 ? 408 HOH B O   1 
HETATM 1910 O O   . HOH J 4 .  ? -20.371 17.877  -4.507  1.00 28.39 ? 409 HOH B O   1 
HETATM 1911 O O   . HOH J 4 .  ? -10.065 17.825  -5.368  1.00 33.40 ? 410 HOH B O   1 
HETATM 1912 O O   . HOH J 4 .  ? -26.445 15.214  -5.171  1.00 40.56 ? 411 HOH B O   1 
HETATM 1913 O O   . HOH J 4 .  ? -12.735 18.251  -4.455  1.00 65.31 ? 412 HOH B O   1 
HETATM 1914 O O   . HOH J 4 .  ? -12.558 20.545  -9.880  1.00 33.53 ? 413 HOH B O   1 
HETATM 1915 O O   . HOH J 4 .  ? -16.928 20.721  -10.157 0.88 38.43 ? 414 HOH B O   1 
HETATM 1916 O O   . HOH J 4 .  ? -15.604 16.059  -3.120  1.00 33.09 ? 415 HOH B O   1 
HETATM 1917 O O   . HOH J 4 .  ? -12.697 15.385  -5.045  0.97 34.04 ? 416 HOH B O   1 
HETATM 1918 O O   . HOH J 4 .  ? -26.838 12.805  0.209   0.94 46.23 ? 417 HOH B O   1 
HETATM 1919 O O   . HOH J 4 .  ? -25.184 13.580  1.507   1.00 43.57 ? 418 HOH B O   1 
HETATM 1920 O O   . HOH K 4 .  ? 6.494   -23.190 -9.759  1.00 41.27 ? 201 HOH C O   1 
HETATM 1921 O O   . HOH K 4 .  ? -0.641  -22.160 -22.674 1.00 36.28 ? 202 HOH C O   1 
HETATM 1922 O O   . HOH K 4 .  ? -9.880  -17.620 2.258   0.96 21.05 ? 203 HOH C O   1 
HETATM 1923 O O   . HOH K 4 .  ? 7.220   -14.882 -3.101  0.99 24.91 ? 204 HOH C O   1 
HETATM 1924 O O   . HOH K 4 .  ? 5.950   -20.205 -26.056 0.94 21.04 ? 205 HOH C O   1 
HETATM 1925 O O   . HOH K 4 .  ? 2.278   -15.599 -29.084 1.00 27.87 ? 206 HOH C O   1 
HETATM 1926 O O   . HOH K 4 .  ? -3.315  -18.880 0.573   1.00 16.14 ? 207 HOH C O   1 
HETATM 1927 O O   . HOH K 4 .  ? -11.984 -26.993 -15.426 1.00 27.17 ? 208 HOH C O   1 
HETATM 1928 O O   . HOH K 4 .  ? 0.972   -26.773 -3.258  1.00 28.53 ? 209 HOH C O   1 
HETATM 1929 O O   . HOH K 4 .  ? 6.070   -21.929 -6.863  0.98 39.19 ? 210 HOH C O   1 
HETATM 1930 O O   . HOH K 4 .  ? -5.314  -15.881 0.268   1.00 19.42 ? 211 HOH C O   1 
HETATM 1931 O O   . HOH K 4 .  ? -15.652 -21.631 -16.375 0.86 33.44 ? 212 HOH C O   1 
HETATM 1932 O O   . HOH K 4 .  ? -16.925 -16.746 -8.436  1.00 20.38 ? 213 HOH C O   1 
HETATM 1933 O O   . HOH K 4 .  ? -9.562  -15.670 1.010   0.98 16.76 ? 214 HOH C O   1 
HETATM 1934 O O   . HOH K 4 .  ? -8.852  -37.556 -15.641 1.00 32.32 ? 215 HOH C O   1 
HETATM 1935 O O   . HOH K 4 .  ? 11.651  -20.130 -30.311 0.98 19.23 ? 216 HOH C O   1 
HETATM 1936 O O   . HOH K 4 .  ? -8.037  -17.388 -24.300 1.00 32.29 ? 217 HOH C O   1 
HETATM 1937 O O   . HOH K 4 .  ? -3.237  -14.644 -0.950  1.00 33.86 ? 218 HOH C O   1 
HETATM 1938 O O   . HOH K 4 .  ? -6.773  -21.409 -23.013 1.00 42.50 ? 219 HOH C O   1 
HETATM 1939 O O   . HOH K 4 .  ? -2.946  -33.665 -14.216 1.00 37.69 ? 220 HOH C O   1 
HETATM 1940 O O   . HOH K 4 .  ? -6.560  -21.202 3.227   1.00 44.94 ? 221 HOH C O   1 
HETATM 1941 O O   . HOH K 4 .  ? -8.842  -28.882 -17.216 1.00 37.05 ? 222 HOH C O   1 
HETATM 1942 O O   . HOH K 4 .  ? 4.789   -17.605 -2.487  0.99 19.28 ? 223 HOH C O   1 
HETATM 1943 O O   . HOH K 4 .  ? -4.549  -25.633 3.923   0.98 19.04 ? 224 HOH C O   1 
HETATM 1944 O O   . HOH K 4 .  ? -1.042  -22.944 -19.764 1.00 42.20 ? 225 HOH C O   1 
HETATM 1945 O O   . HOH K 4 .  ? 3.671   -25.586 -17.561 0.89 34.42 ? 226 HOH C O   1 
HETATM 1946 O O   . HOH K 4 .  ? -2.325  -26.213 0.964   0.89 22.01 ? 227 HOH C O   1 
HETATM 1947 O O   . HOH K 4 .  ? -5.436  -25.968 -17.906 1.00 39.04 ? 228 HOH C O   1 
HETATM 1948 O O   . HOH K 4 .  ? 4.864   -13.153 -0.498  1.00 34.19 ? 229 HOH C O   1 
HETATM 1949 O O   . HOH K 4 .  ? -13.266 -7.273  -4.324  1.00 40.09 ? 230 HOH C O   1 
HETATM 1950 O O   . HOH K 4 .  ? 4.360   -13.789 -29.580 1.00 44.69 ? 231 HOH C O   1 
HETATM 1951 O O   . HOH K 4 .  ? 6.446   -18.958 -3.431  1.00 44.82 ? 232 HOH C O   1 
HETATM 1952 O O   . HOH K 4 .  ? -16.001 -16.397 -3.419  1.00 37.98 ? 233 HOH C O   1 
HETATM 1953 O O   . HOH K 4 .  ? -18.126 -20.700 -16.812 1.00 37.66 ? 234 HOH C O   1 
HETATM 1954 O O   . HOH K 4 .  ? -0.000  -11.954 0.000   0.50 37.69 ? 235 HOH C O   1 
HETATM 1955 O O   . HOH K 4 .  ? -3.146  -7.917  -11.716 0.98 13.25 ? 236 HOH C O   1 
HETATM 1956 O O   . HOH K 4 .  ? -6.276  -11.005 -4.857  1.00 16.28 ? 237 HOH C O   1 
HETATM 1957 O O   . HOH K 4 .  ? -3.732  -14.403 -3.263  1.00 17.93 ? 238 HOH C O   1 
HETATM 1958 O O   . HOH K 4 .  ? 4.764   -19.278 -17.576 0.92 13.48 ? 239 HOH C O   1 
HETATM 1959 O O   . HOH K 4 .  ? -16.926 -13.365 -9.408  1.00 20.86 ? 240 HOH C O   1 
HETATM 1960 O O   . HOH K 4 .  ? -12.180 -7.213  -8.634  0.88 16.64 ? 241 HOH C O   1 
HETATM 1961 O O   . HOH K 4 .  ? 0.082   -15.664 -21.966 1.00 26.21 ? 242 HOH C O   1 
HETATM 1962 O O   . HOH K 4 .  ? -13.841 -20.427 -1.858  0.89 20.84 ? 243 HOH C O   1 
HETATM 1963 O O   . HOH K 4 .  ? -1.640  -12.819 -4.029  0.94 19.36 ? 244 HOH C O   1 
HETATM 1964 O O   . HOH K 4 .  ? -12.081 -25.170 -3.832  1.00 33.66 ? 245 HOH C O   1 
HETATM 1965 O O   . HOH K 4 .  ? -7.728  -7.409  -16.398 1.00 28.56 ? 246 HOH C O   1 
HETATM 1966 O O   . HOH K 4 .  ? -13.992 -8.507  -7.796  0.96 21.23 ? 247 HOH C O   1 
HETATM 1967 O O   . HOH K 4 .  ? -0.053  -9.576  -11.888 0.98 18.62 ? 248 HOH C O   1 
HETATM 1968 O O   . HOH K 4 .  ? 7.375   -10.670 -2.909  0.88 26.48 ? 249 HOH C O   1 
HETATM 1969 O O   . HOH K 4 .  ? -1.339  -28.067 -11.679 1.00 20.46 ? 250 HOH C O   1 
HETATM 1970 O O   . HOH K 4 .  ? -14.445 -18.676 -3.330  1.00 30.84 ? 251 HOH C O   1 
HETATM 1971 O O   . HOH K 4 .  ? -10.089 -10.023 -22.037 1.00 49.33 ? 252 HOH C O   1 
HETATM 1972 O O   . HOH K 4 .  ? 0.417   -9.935  -20.637 1.00 48.56 ? 253 HOH C O   1 
HETATM 1973 O O   . HOH K 4 .  ? -10.637 -23.883 4.769   1.00 40.59 ? 254 HOH C O   1 
HETATM 1974 O O   . HOH K 4 .  ? 9.652   -19.344 -9.388  0.99 31.31 ? 255 HOH C O   1 
HETATM 1975 O O   . HOH K 4 .  ? -5.878  -30.039 -15.785 0.91 23.99 ? 256 HOH C O   1 
HETATM 1976 O O   . HOH K 4 .  ? -10.355 -26.127 -2.910  0.93 24.04 ? 257 HOH C O   1 
HETATM 1977 O O   . HOH K 4 .  ? -10.963 -31.760 -12.727 1.00 39.89 ? 258 HOH C O   1 
HETATM 1978 O O   . HOH K 4 .  ? -2.956  -7.514  -9.164  1.00 33.70 ? 259 HOH C O   1 
HETATM 1979 O O   . HOH K 4 .  ? -15.840 -12.044 -15.746 1.00 44.97 ? 260 HOH C O   1 
HETATM 1980 O O   . HOH K 4 .  ? 2.073   -23.073 -18.426 0.98 42.88 ? 261 HOH C O   1 
HETATM 1981 O O   . HOH K 4 .  ? 3.722   -11.083 -18.495 1.00 35.58 ? 262 HOH C O   1 
HETATM 1982 O O   . HOH K 4 .  ? 5.626   -8.743  -1.697  1.00 43.26 ? 263 HOH C O   1 
HETATM 1983 O O   . HOH K 4 .  ? -17.175 -10.154 -8.320  0.89 31.58 ? 264 HOH C O   1 
HETATM 1984 O O   . HOH K 4 .  ? -3.807  -10.306 -4.182  1.00 45.89 ? 265 HOH C O   1 
HETATM 1985 O O   . HOH K 4 .  ? 5.934   -25.655 -16.783 1.00 49.64 ? 266 HOH C O   1 
HETATM 1986 O O   . HOH K 4 .  ? 2.681   -10.239 -1.236  0.95 45.71 ? 267 HOH C O   1 
HETATM 1987 O O   . HOH K 4 .  ? 1.983   -10.089 -10.065 0.97 19.29 ? 268 HOH C O   1 
HETATM 1988 O O   . HOH K 4 .  ? 9.237   -19.679 -16.477 1.00 44.52 ? 269 HOH C O   1 
HETATM 1989 O O   . HOH K 4 .  ? 11.205  -19.107 -15.637 1.00 45.94 ? 270 HOH C O   1 
HETATM 1990 O O   . HOH K 4 .  ? 8.481   -24.486 -15.983 1.00 36.52 ? 271 HOH C O   1 
HETATM 1991 O O   . HOH K 4 .  ? -17.517 -12.854 -11.872 0.82 43.48 ? 272 HOH C O   1 
HETATM 1992 O O   . HOH K 4 .  ? 1.195   -10.808 -22.534 1.00 42.78 ? 273 HOH C O   1 
HETATM 1993 O O   . HOH K 4 .  ? -12.024 -10.607 -20.150 1.00 31.86 ? 274 HOH C O   1 
HETATM 1994 O O   . HOH K 4 .  ? -3.933  -25.537 -19.550 1.00 40.63 ? 275 HOH C O   1 
HETATM 1995 O O   . HOH K 4 .  ? 13.157  -19.012 -27.081 0.92 31.75 ? 276 HOH C O   1 
HETATM 1996 O O   . HOH K 4 .  ? 0.868   -30.192 -8.309  0.98 42.81 ? 277 HOH C O   1 
HETATM 1997 O O   . HOH K 4 .  ? -1.100  -11.280 -1.877  1.00 39.07 ? 278 HOH C O   1 
HETATM 1998 O O   . HOH L 4 .  ? -21.016 -23.249 -10.277 1.00 17.78 ? 401 HOH D O   1 
HETATM 1999 O O   . HOH L 4 .  ? -15.446 -26.583 -5.456  0.98 32.69 ? 402 HOH D O   1 
HETATM 2000 O O   . HOH L 4 .  ? -15.659 -29.263 -6.409  0.96 26.84 ? 403 HOH D O   1 
HETATM 2001 O O   . HOH L 4 .  ? -15.614 -28.458 -11.457 0.92 25.95 ? 404 HOH D O   1 
HETATM 2002 O O   . HOH L 4 .  ? -26.405 -17.869 -14.082 1.00 56.68 ? 405 HOH D O   1 
HETATM 2003 O O   . HOH L 4 .  ? -16.247 -23.339 -6.250  0.99 22.82 ? 406 HOH D O   1 
HETATM 2004 O O   . HOH L 4 .  ? -10.627 -35.440 -4.571  1.00 34.44 ? 407 HOH D O   1 
HETATM 2005 O O   . HOH L 4 .  ? -10.296 -32.627 -10.552 0.88 28.57 ? 408 HOH D O   1 
HETATM 2006 O O   . HOH L 4 .  ? -14.719 -28.880 -4.380  1.00 41.72 ? 409 HOH D O   1 
HETATM 2007 O O   . HOH L 4 .  ? -16.564 -29.854 -10.038 0.96 24.19 ? 410 HOH D O   1 
HETATM 2008 O O   . HOH L 4 .  ? -4.776  -39.712 -5.156  1.00 31.79 ? 411 HOH D O   1 
HETATM 2009 O O   . HOH L 4 .  ? -12.137 -27.572 -4.978  1.00 29.02 ? 412 HOH D O   1 
HETATM 2010 O O   . HOH L 4 .  ? -11.131 -30.423 -3.094  0.93 25.05 ? 413 HOH D O   1 
HETATM 2011 O O   . HOH L 4 .  ? -4.088  -31.474 -3.537  0.96 25.82 ? 414 HOH D O   1 
HETATM 2012 O O   . HOH L 4 .  ? -13.804 -31.473 -3.232  1.00 40.15 ? 415 HOH D O   1 
HETATM 2013 O O   . HOH L 4 .  ? -2.494  -38.818 0.088   1.00 44.44 ? 416 HOH D O   1 
HETATM 2014 O O   . HOH L 4 .  ? -4.317  -37.421 1.316   1.00 45.07 ? 417 HOH D O   1 
HETATM 2015 O O   . HOH M 4 .  ? 26.252  0.754   -9.190  0.89 15.69 ? 101 HOH E O   1 
HETATM 2016 O O   . HOH M 4 .  ? 11.537  8.270   -9.722  0.87 29.12 ? 102 HOH E O   1 
HETATM 2017 O O   . HOH M 4 .  ? 11.012  7.790   -7.234  1.00 32.86 ? 103 HOH E O   1 
HETATM 2018 O O   . HOH M 4 .  ? 4.047   4.593   -2.992  1.00 23.37 ? 104 HOH E O   1 
HETATM 2019 O O   . HOH M 4 .  ? 17.511  5.294   -3.353  1.00 31.13 ? 105 HOH E O   1 
HETATM 2020 O O   . HOH M 4 .  ? 15.076  -8.823  2.043   0.85 18.93 ? 106 HOH E O   1 
HETATM 2021 O O   . HOH M 4 .  ? 12.946  -2.467  0.426   1.00 18.20 ? 107 HOH E O   1 
HETATM 2022 O O   . HOH M 4 .  ? 31.682  2.581   -15.992 1.00 28.10 ? 108 HOH E O   1 
HETATM 2023 O O   . HOH M 4 .  ? 11.236  -5.751  0.212   1.00 17.37 ? 109 HOH E O   1 
HETATM 2024 O O   . HOH M 4 .  ? 3.581   8.531   -25.707 0.88 23.60 ? 110 HOH E O   1 
HETATM 2025 O O   . HOH M 4 .  ? 13.030  -9.462  0.659   0.97 15.20 ? 111 HOH E O   1 
HETATM 2026 O O   . HOH M 4 .  ? 6.598   -1.743  -29.141 1.00 29.75 ? 112 HOH E O   1 
HETATM 2027 O O   . HOH M 4 .  ? 19.418  -10.732 -2.244  1.00 24.44 ? 113 HOH E O   1 
HETATM 2028 O O   . HOH M 4 .  ? 25.311  5.457   -14.232 1.00 37.88 ? 114 HOH E O   1 
HETATM 2029 O O   . HOH M 4 .  ? 18.241  -12.323 -3.585  1.00 23.70 ? 115 HOH E O   1 
HETATM 2030 O O   . HOH M 4 .  ? 19.247  -0.177  3.901   1.00 21.41 ? 116 HOH E O   1 
HETATM 2031 O O   . HOH M 4 .  ? 7.758   3.978   -2.490  0.90 18.14 ? 117 HOH E O   1 
HETATM 2032 O O   . HOH M 4 .  ? 18.629  1.991   0.962   0.97 24.99 ? 118 HOH E O   1 
HETATM 2033 O O   . HOH M 4 .  ? 9.168   -4.794  -1.260  0.89 27.07 ? 119 HOH E O   1 
HETATM 2034 O O   . HOH M 4 .  ? 2.437   4.956   -21.444 1.00 32.94 ? 120 HOH E O   1 
HETATM 2035 O O   . HOH M 4 .  ? 12.395  -17.266 -3.545  1.00 46.33 ? 121 HOH E O   1 
HETATM 2036 O O   . HOH M 4 .  ? 1.178   3.552   -1.121  0.96 42.69 ? 122 HOH E O   1 
HETATM 2037 O O   . HOH M 4 .  ? 7.981   -16.991 -4.332  1.00 38.87 ? 123 HOH E O   1 
HETATM 2038 O O   . HOH M 4 .  ? 14.676  -5.339  3.295   1.00 32.00 ? 124 HOH E O   1 
HETATM 2039 O O   . HOH M 4 .  ? 4.927   -2.998  -29.883 0.99 50.15 ? 125 HOH E O   1 
HETATM 2040 O O   . HOH M 4 .  ? 16.742  -14.625 -3.389  1.00 49.65 ? 126 HOH E O   1 
HETATM 2041 O O   . HOH M 4 .  ? 7.533   -8.842  -5.221  1.00 14.85 ? 127 HOH E O   1 
HETATM 2042 O O   . HOH M 4 .  ? 9.161   -4.984  -3.427  1.00 15.82 ? 128 HOH E O   1 
HETATM 2043 O O   . HOH M 4 .  ? 9.264   -16.826 -8.043  1.00 17.83 ? 129 HOH E O   1 
HETATM 2044 O O   . HOH M 4 .  ? 3.149   -4.199  -12.038 0.94 14.64 ? 130 HOH E O   1 
HETATM 2045 O O   . HOH M 4 .  ? 8.204   -1.117  -22.154 1.00 21.56 ? 131 HOH E O   1 
HETATM 2046 O O   . HOH M 4 .  ? 14.209  -6.777  -24.347 1.00 35.52 ? 132 HOH E O   1 
HETATM 2047 O O   . HOH M 4 .  ? 16.546  -5.827  -21.381 0.84 23.60 ? 133 HOH E O   1 
HETATM 2048 O O   . HOH M 4 .  ? 19.688  3.935   -11.853 1.00 21.44 ? 134 HOH E O   1 
HETATM 2049 O O   . HOH M 4 .  ? 15.112  -16.815 -9.759  0.96 20.71 ? 135 HOH E O   1 
HETATM 2050 O O   . HOH M 4 .  ? 7.118   -16.172 -9.819  1.00 27.10 ? 136 HOH E O   1 
HETATM 2051 O O   . HOH M 4 .  ? 2.598   -0.130  -18.226 0.85 17.67 ? 137 HOH E O   1 
HETATM 2052 O O   . HOH M 4 .  ? 2.505   -2.269  -10.379 0.86 21.72 ? 138 HOH E O   1 
HETATM 2053 O O   . HOH M 4 .  ? 3.015   -7.758  -9.313  1.00 22.75 ? 139 HOH E O   1 
HETATM 2054 O O   . HOH M 4 .  ? 8.980   4.870   -17.743 0.97 19.66 ? 140 HOH E O   1 
HETATM 2055 O O   . HOH M 4 .  ? 18.170  -5.522  -18.687 1.00 35.04 ? 141 HOH E O   1 
HETATM 2056 O O   . HOH M 4 .  ? 22.639  -4.662  -2.993  0.99 28.90 ? 142 HOH E O   1 
HETATM 2057 O O   . HOH M 4 .  ? 23.891  3.419   -4.123  1.00 30.57 ? 143 HOH E O   1 
HETATM 2058 O O   . HOH M 4 .  ? 24.661  -5.719  -15.322 1.00 37.16 ? 144 HOH E O   1 
HETATM 2059 O O   . HOH M 4 .  ? 13.068  5.286   -18.859 0.80 32.17 ? 145 HOH E O   1 
HETATM 2060 O O   . HOH M 4 .  ? 15.028  7.097   -17.675 0.88 30.97 ? 146 HOH E O   1 
HETATM 2061 O O   . HOH M 4 .  ? 20.701  -6.195  4.581   0.92 33.97 ? 147 HOH E O   1 
HETATM 2062 O O   . HOH M 4 .  ? 5.504   -7.030  -3.874  1.00 39.42 ? 148 HOH E O   1 
HETATM 2063 O O   . HOH M 4 .  ? 19.037  -9.741  -18.300 1.00 38.73 ? 149 HOH E O   1 
HETATM 2064 O O   . HOH M 4 .  ? 23.560  1.641   -0.866  1.00 40.24 ? 150 HOH E O   1 
HETATM 2065 O O   . HOH M 4 .  ? 0.298   2.366   -2.942  0.94 29.19 ? 151 HOH E O   1 
HETATM 2066 O O   . HOH M 4 .  ? 4.737   -11.833 -16.589 1.00 35.89 ? 152 HOH E O   1 
HETATM 2067 O O   . HOH M 4 .  ? 9.746   6.958   -18.487 1.00 43.36 ? 153 HOH E O   1 
HETATM 2068 O O   . HOH M 4 .  ? 21.254  -8.630  -18.478 0.90 40.80 ? 154 HOH E O   1 
HETATM 2069 O O   . HOH M 4 .  ? 7.103   8.929   -12.540 0.90 25.82 ? 155 HOH E O   1 
HETATM 2070 O O   . HOH M 4 .  ? 2.198   -4.718  -9.097  0.89 34.20 ? 156 HOH E O   1 
HETATM 2071 O O   . HOH M 4 .  ? 6.884   -4.259  -3.965  0.98 32.95 ? 157 HOH E O   1 
HETATM 2072 O O   . HOH M 4 .  ? 22.955  -6.903  -3.693  1.00 43.41 ? 158 HOH E O   1 
HETATM 2073 O O   . HOH M 4 .  ? 23.967  1.099   -15.949 0.96 32.30 ? 159 HOH E O   1 
HETATM 2074 O O   . HOH M 4 .  ? 20.322  5.514   -6.849  1.00 46.93 ? 160 HOH E O   1 
HETATM 2075 O O   . HOH M 4 .  ? 26.132  -5.281  2.174   1.00 48.69 ? 161 HOH E O   1 
HETATM 2076 O O   . HOH M 4 .  ? 10.812  7.532   -25.850 1.00 48.48 ? 162 HOH E O   1 
HETATM 2077 O O   . HOH M 4 .  ? 6.524   8.947   -9.000  1.00 40.01 ? 163 HOH E O   1 
HETATM 2078 O O   . HOH M 4 .  ? 20.710  7.414   -7.980  1.00 42.18 ? 164 HOH E O   1 
HETATM 2079 O O   . HOH M 4 .  ? 19.675  -7.365  -19.479 1.00 48.15 ? 165 HOH E O   1 
HETATM 2080 O O   . HOH M 4 .  ? 24.898  -4.971  -2.546  0.94 36.48 ? 166 HOH E O   1 
HETATM 2081 O O   . HOH M 4 .  ? 0.374   -5.945  -7.206  1.00 46.26 ? 167 HOH E O   1 
HETATM 2082 O O   . HOH M 4 .  ? 13.632  2.197   -23.801 1.00 49.37 ? 168 HOH E O   1 
HETATM 2083 O O   . HOH M 4 .  ? 17.322  -12.099 -18.663 1.00 43.65 ? 169 HOH E O   1 
HETATM 2084 O O   . HOH M 4 .  ? 28.829  2.937   -19.347 1.00 41.13 ? 170 HOH E O   1 
HETATM 2085 O O   . HOH M 4 .  ? 12.964  -16.948 -15.969 1.00 38.40 ? 171 HOH E O   1 
HETATM 2086 O O   . HOH M 4 .  ? 9.702   -8.115  -24.985 1.00 45.76 ? 172 HOH E O   1 
HETATM 2087 O O   . HOH M 4 .  ? 9.916   6.211   -23.262 1.00 44.09 ? 173 HOH E O   1 
HETATM 2088 O O   . HOH N 4 .  ? 28.834  -14.333 -8.742  0.93 17.90 ? 401 HOH F O   1 
HETATM 2089 O O   . HOH N 4 .  ? 30.011  8.358   -8.275  0.96 18.77 ? 402 HOH F O   1 
HETATM 2090 O O   . HOH N 4 .  ? 25.332  -17.142 -14.146 1.00 16.46 ? 403 HOH F O   1 
HETATM 2091 O O   . HOH N 4 .  ? 25.289  -15.688 -9.958  1.00 17.88 ? 404 HOH F O   1 
HETATM 2092 O O   . HOH N 4 .  ? 30.643  -0.114  -4.626  1.00 30.89 ? 405 HOH F O   1 
HETATM 2093 O O   . HOH N 4 .  ? 27.221  -8.276  -11.883 1.00 34.60 ? 406 HOH F O   1 
HETATM 2094 O O   . HOH N 4 .  ? 23.107  -11.215 -6.304  1.00 17.22 ? 407 HOH F O   1 
HETATM 2095 O O   . HOH N 4 .  ? 31.499  6.688   -5.106  1.00 38.99 ? 408 HOH F O   1 
HETATM 2096 O O   . HOH N 4 .  ? 29.162  -8.363  -10.118 1.00 33.33 ? 409 HOH F O   1 
HETATM 2097 O O   . HOH N 4 .  ? 31.434  -4.447  -10.843 0.97 38.02 ? 410 HOH F O   1 
HETATM 2098 O O   . HOH N 4 .  ? 24.732  -5.519  -5.197  0.99 23.46 ? 411 HOH F O   1 
HETATM 2099 O O   . HOH N 4 .  ? 26.664  -3.511  -3.148  1.00 25.90 ? 412 HOH F O   1 
HETATM 2100 O O   . HOH N 4 .  ? 29.123  -4.874  -3.302  1.00 45.62 ? 413 HOH F O   1 
HETATM 2101 O O   . HOH N 4 .  ? 26.058  1.783   -0.089  1.00 43.70 ? 414 HOH F O   1 
HETATM 2102 O O   . HOH N 4 .  ? 23.978  6.926   -4.741  1.00 46.17 ? 415 HOH F O   1 
HETATM 2103 O O   . HOH N 4 .  ? 20.514  -20.316 -18.139 1.00 39.78 ? 416 HOH F O   1 
HETATM 2104 O O   . HOH N 4 .  ? 29.249  2.678   -1.061  1.00 46.62 ? 417 HOH F O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 5  ? 0.5470 0.5284 0.4757 -0.0303 -0.0681 -0.1246 0   SER A N   
2    C CA  . SER A 5  ? 0.5107 0.4779 0.4424 -0.0282 -0.0530 -0.1250 0   SER A CA  
3    C C   . SER A 5  ? 0.4586 0.4260 0.3975 -0.0228 -0.0482 -0.1117 0   SER A C   
4    O O   . SER A 5  ? 0.4878 0.4644 0.4330 -0.0212 -0.0550 -0.1011 0   SER A O   
5    C CB  . SER A 5  ? 0.5178 0.4775 0.4208 -0.0261 -0.0460 -0.1299 0   SER A CB  
6    O OG  . SER A 5  ? 0.5016 0.4505 0.4108 -0.0225 -0.0316 -0.1289 0   SER A OG  
7    N N   . MET A 6  ? 0.3885 0.3453 0.3274 -0.0196 -0.0349 -0.1077 1   MET A N   
8    C CA  A MET A 6  ? 0.3515 0.3072 0.2987 -0.0151 -0.0287 -0.0911 1   MET A CA  
9    C CA  B MET A 6  ? 0.3479 0.3034 0.2952 -0.0151 -0.0285 -0.0912 1   MET A CA  
10   C C   . MET A 6  ? 0.3415 0.3005 0.2673 -0.0102 -0.0267 -0.0812 1   MET A C   
11   O O   . MET A 6  ? 0.3839 0.3415 0.2889 -0.0092 -0.0231 -0.0863 1   MET A O   
12   C CB  A MET A 6  ? 0.3327 0.2765 0.2953 -0.0140 -0.0174 -0.0905 1   MET A CB  
13   C CB  B MET A 6  ? 0.3296 0.2730 0.2919 -0.0139 -0.0170 -0.0910 1   MET A CB  
14   C CG  A MET A 6  ? 0.3187 0.2572 0.3061 -0.0184 -0.0174 -0.0924 1   MET A CG  
15   C CG  B MET A 6  ? 0.3333 0.2693 0.3177 -0.0191 -0.0167 -0.0990 1   MET A CG  
16   S SD  A MET A 6  ? 0.2927 0.2180 0.2946 -0.0144 -0.0059 -0.0829 1   MET A SD  
17   S SD  B MET A 6  ? 0.2912 0.2115 0.2929 -0.0157 -0.0045 -0.0930 1   MET A SD  
18   C CE  A MET A 6  ? 0.2451 0.1585 0.2710 -0.0211 -0.0042 -0.0903 1   MET A CE  
19   C CE  B MET A 6  ? 0.2383 0.1653 0.2359 -0.0102 -0.0035 -0.0734 1   MET A CE  
20   N N   . VAL A 7  ? 0.2107 0.1734 0.1422 -0.0076 -0.0276 -0.0674 2   VAL A N   
21   C CA  . VAL A 7  ? 0.2090 0.1734 0.1250 -0.0037 -0.0252 -0.0565 2   VAL A CA  
22   C C   . VAL A 7  ? 0.2346 0.1944 0.1615 -0.0013 -0.0155 -0.0484 2   VAL A C   
23   O O   . VAL A 7  ? 0.2148 0.1733 0.1597 -0.0017 -0.0151 -0.0448 2   VAL A O   
24   C CB  . VAL A 7  ? 0.2571 0.2288 0.1717 -0.0022 -0.0351 -0.0476 2   VAL A CB  
25   C CG1 . VAL A 7  ? 0.2866 0.2567 0.1886 0.0014  -0.0310 -0.0353 2   VAL A CG1 
26   C CG2 . VAL A 7  ? 0.2859 0.2643 0.1886 -0.0037 -0.0475 -0.0548 2   VAL A CG2 
27   N N   . ASP A 8  ? 0.1961 0.1542 0.1120 0.0007  -0.0077 -0.0460 3   ASP A N   
28   C CA  . ASP A 8  ? 0.1817 0.1382 0.1085 0.0029  -0.0002 -0.0388 3   ASP A CA  
29   C C   . ASP A 8  ? 0.1859 0.1448 0.1021 0.0039  0.0014  -0.0291 3   ASP A C   
30   O O   . ASP A 8  ? 0.2209 0.1807 0.1181 0.0035  0.0001  -0.0283 3   ASP A O   
31   C CB  . ASP A 8  ? 0.2179 0.1711 0.1489 0.0043  0.0092  -0.0456 3   ASP A CB  
32   C CG  . ASP A 8  ? 0.2640 0.2115 0.2075 0.0037  0.0089  -0.0549 3   ASP A CG  
33   O OD1 . ASP A 8  ? 0.2823 0.2279 0.2362 0.0020  0.0032  -0.0533 3   ASP A OD1 
34   O OD2 . ASP A 8  ? 0.2754 0.2194 0.2187 0.0047  0.0155  -0.0643 3   ASP A OD2 
35   N N   . TYR A 9  ? 0.1664 0.1257 0.0944 0.0049  0.0042  -0.0218 4   TYR A N   
36   C CA  . TYR A 9  ? 0.1658 0.1258 0.0883 0.0049  0.0068  -0.0131 4   TYR A CA  
37   C C   . TYR A 9  ? 0.1981 0.1598 0.1317 0.0051  0.0147  -0.0121 4   TYR A C   
38   O O   . TYR A 9  ? 0.1976 0.1600 0.1460 0.0064  0.0149  -0.0145 4   TYR A O   
39   C CB  . TYR A 9  ? 0.1826 0.1424 0.1111 0.0052  0.0005  -0.0062 4   TYR A CB  
40   C CG  . TYR A 9  ? 0.1824 0.1422 0.1001 0.0059  -0.0067 -0.0030 4   TYR A CG  
41   C CD1 . TYR A 9  ? 0.2057 0.1627 0.1167 0.0068  -0.0067 0.0058  4   TYR A CD1 
42   C CD2 . TYR A 9  ? 0.1706 0.1331 0.0865 0.0059  -0.0140 -0.0086 4   TYR A CD2 
43   C CE1 . TYR A 9  ? 0.2164 0.1731 0.1188 0.0090  -0.0147 0.0102  4   TYR A CE1 
44   C CE2 . TYR A 9  ? 0.2175 0.1822 0.1257 0.0075  -0.0228 -0.0054 4   TYR A CE2 
45   C CZ  . TYR A 9  ? 0.2117 0.1734 0.1128 0.0097  -0.0234 0.0047  4   TYR A CZ  
46   O OH  . TYR A 9  ? 0.2141 0.1777 0.1087 0.0127  -0.0335 0.0092  4   TYR A OH  
47   N N   . ILE A 10 ? 0.1743 0.1369 0.1017 0.0037  0.0210  -0.0081 5   ILE A N   
48   C CA  . ILE A 10 ? 0.1806 0.1474 0.1226 0.0031  0.0277  -0.0070 5   ILE A CA  
49   C C   . ILE A 10 ? 0.1749 0.1411 0.1236 0.0015  0.0246  0.0000  5   ILE A C   
50   O O   . ILE A 10 ? 0.1618 0.1232 0.1004 0.0003  0.0229  0.0057  5   ILE A O   
51   C CB  . ILE A 10 ? 0.2277 0.1966 0.1626 0.0011  0.0390  -0.0079 5   ILE A CB  
52   C CG1 . ILE A 10 ? 0.2770 0.2456 0.2015 0.0025  0.0433  -0.0168 5   ILE A CG1 
53   C CG2 . ILE A 10 ? 0.2386 0.2149 0.1949 0.0001  0.0456  -0.0080 5   ILE A CG2 
54   C CD1 . ILE A 10 ? 0.2930 0.2626 0.2043 0.0001  0.0560  -0.0175 5   ILE A CD1 
55   N N   . VAL A 11 ? 0.1576 0.1280 0.1233 0.0018  0.0232  -0.0006 6   VAL A N   
56   C CA  . VAL A 11 ? 0.1501 0.1202 0.1220 -0.0005 0.0208  0.0036  6   VAL A CA  
57   C C   . VAL A 11 ? 0.1613 0.1336 0.1378 -0.0046 0.0286  0.0056  6   VAL A C   
58   O O   . VAL A 11 ? 0.1628 0.1429 0.1509 -0.0052 0.0344  0.0023  6   VAL A O   
59   C CB  . VAL A 11 ? 0.1359 0.1099 0.1208 0.0009  0.0151  0.0019  6   VAL A CB  
60   C CG1 . VAL A 11 ? 0.1368 0.1102 0.1257 -0.0021 0.0124  0.0038  6   VAL A CG1 
61   C CG2 . VAL A 11 ? 0.1436 0.1138 0.1240 0.0038  0.0097  0.0011  6   VAL A CG2 
62   N N   . GLU A 12 ? 0.1670 0.1324 0.1369 -0.0073 0.0295  0.0110  7   GLU A N   
63   C CA  . GLU A 12 ? 0.1627 0.1275 0.1366 -0.0123 0.0383  0.0142  7   GLU A CA  
64   C C   . GLU A 12 ? 0.1492 0.1140 0.1382 -0.0163 0.0364  0.0139  7   GLU A C   
65   O O   . GLU A 12 ? 0.1937 0.1612 0.1943 -0.0216 0.0434  0.0140  7   GLU A O   
66   C CB  . GLU A 12 ? 0.1724 0.1264 0.1264 -0.0130 0.0423  0.0219  7   GLU A CB  
67   C CG  . GLU A 12 ? 0.2034 0.1575 0.1386 -0.0103 0.0444  0.0213  7   GLU A CG  
68   C CD  . GLU A 12 ? 0.2316 0.1924 0.1689 -0.0127 0.0564  0.0175  7   GLU A CD  
69   O OE1 . GLU A 12 ? 0.2207 0.1860 0.1742 -0.0172 0.0644  0.0177  7   GLU A OE1 
70   O OE2 . GLU A 12 ? 0.2697 0.2322 0.1942 -0.0103 0.0583  0.0132  7   GLU A OE2 
71   N N   . TYR A 13 ? 0.1410 0.1031 0.1302 -0.0142 0.0276  0.0125  8   TYR A N   
72   C CA  . TYR A 13 ? 0.1386 0.0999 0.1391 -0.0178 0.0248  0.0099  8   TYR A CA  
73   C C   . TYR A 13 ? 0.1283 0.0944 0.1309 -0.0150 0.0158  0.0050  8   TYR A C   
74   O O   . TYR A 13 ? 0.1350 0.0985 0.1277 -0.0105 0.0121  0.0060  8   TYR A O   
75   C CB  . TYR A 13 ? 0.1480 0.0955 0.1423 -0.0190 0.0259  0.0146  8   TYR A CB  
76   C CG  . TYR A 13 ? 0.2050 0.1447 0.1950 -0.0221 0.0348  0.0219  8   TYR A CG  
77   C CD1 . TYR A 13 ? 0.2195 0.1529 0.1916 -0.0183 0.0362  0.0292  8   TYR A CD1 
78   C CD2 . TYR A 13 ? 0.2318 0.1706 0.2352 -0.0293 0.0419  0.0217  8   TYR A CD2 
79   C CE1 . TYR A 13 ? 0.2404 0.1653 0.2040 -0.0210 0.0446  0.0375  8   TYR A CE1 
80   C CE2 . TYR A 13 ? 0.2481 0.1781 0.2463 -0.0329 0.0519  0.0299  8   TYR A CE2 
81   C CZ  . TYR A 13 ? 0.2820 0.2044 0.2583 -0.0284 0.0534  0.0385  8   TYR A CZ  
82   O OH  . TYR A 13 ? 0.3297 0.2421 0.2963 -0.0318 0.0636  0.0483  8   TYR A OH  
83   N N   . ASP A 14 ? 0.1324 0.1051 0.1471 -0.0181 0.0124  0.0000  9   ASP A N   
84   C CA  . ASP A 14 ? 0.1321 0.1082 0.1448 -0.0160 0.0037  -0.0038 9   ASP A CA  
85   C C   . ASP A 14 ? 0.1553 0.1210 0.1568 -0.0153 0.0023  -0.0040 9   ASP A C   
86   O O   . ASP A 14 ? 0.1808 0.1378 0.1830 -0.0180 0.0060  -0.0039 9   ASP A O   
87   C CB  . ASP A 14 ? 0.1383 0.1240 0.1646 -0.0201 -0.0012 -0.0097 9   ASP A CB  
88   C CG  . ASP A 14 ? 0.1959 0.1954 0.2386 -0.0196 -0.0012 -0.0104 9   ASP A CG  
89   O OD1 . ASP A 14 ? 0.1621 0.1637 0.2033 -0.0147 0.0012  -0.0074 9   ASP A OD1 
90   O OD2 . ASP A 14 ? 0.2036 0.2124 0.2628 -0.0244 -0.0036 -0.0153 9   ASP A OD2 
91   N N   . TYR A 15 ? 0.1502 0.1162 0.1430 -0.0115 -0.0020 -0.0042 10  TYR A N   
92   C CA  . TYR A 15 ? 0.1476 0.1063 0.1319 -0.0108 -0.0022 -0.0058 10  TYR A CA  
93   C C   . TYR A 15 ? 0.1713 0.1336 0.1478 -0.0095 -0.0072 -0.0078 10  TYR A C   
94   O O   . TYR A 15 ? 0.1504 0.1162 0.1245 -0.0063 -0.0093 -0.0043 10  TYR A O   
95   C CB  . TYR A 15 ? 0.1654 0.1183 0.1450 -0.0071 0.0009  -0.0014 10  TYR A CB  
96   C CG  . TYR A 15 ? 0.1508 0.0984 0.1262 -0.0058 0.0019  -0.0037 10  TYR A CG  
97   C CD1 . TYR A 15 ? 0.1337 0.0738 0.1127 -0.0070 0.0047  -0.0063 10  TYR A CD1 
98   C CD2 . TYR A 15 ? 0.1551 0.1044 0.1250 -0.0035 0.0014  -0.0034 10  TYR A CD2 
99   C CE1 . TYR A 15 ? 0.1889 0.1246 0.1668 -0.0052 0.0071  -0.0095 10  TYR A CE1 
100  C CE2 . TYR A 15 ? 0.1518 0.0976 0.1200 -0.0027 0.0045  -0.0062 10  TYR A CE2 
101  C CZ  . TYR A 15 ? 0.1644 0.1041 0.1371 -0.0031 0.0073  -0.0098 10  TYR A CZ  
102  O OH  . TYR A 15 ? 0.2061 0.1428 0.1799 -0.0016 0.0117  -0.0138 10  TYR A OH  
103  N N   . ASP A 16 ? 0.1709 0.1309 0.1422 -0.0121 -0.0085 -0.0135 11  ASP A N   
104  C CA  . ASP A 16 ? 0.1653 0.1266 0.1235 -0.0112 -0.0121 -0.0148 11  ASP A CA  
105  C C   . ASP A 16 ? 0.1507 0.1049 0.1004 -0.0095 -0.0060 -0.0146 11  ASP A C   
106  O O   . ASP A 16 ? 0.1657 0.1141 0.1184 -0.0105 -0.0012 -0.0188 11  ASP A O   
107  C CB  . ASP A 16 ? 0.1896 0.1533 0.1438 -0.0155 -0.0171 -0.0228 11  ASP A CB  
108  C CG  . ASP A 16 ? 0.2046 0.1793 0.1684 -0.0169 -0.0254 -0.0233 11  ASP A CG  
109  O OD1 . ASP A 16 ? 0.2000 0.1789 0.1616 -0.0208 -0.0318 -0.0306 11  ASP A OD1 
110  O OD2 . ASP A 16 ? 0.1952 0.1751 0.1693 -0.0141 -0.0258 -0.0175 11  ASP A OD2 
111  N N   . ALA A 17 ? 0.1552 0.1097 0.0965 -0.0070 -0.0056 -0.0099 12  ALA A N   
112  C CA  . ALA A 17 ? 0.1894 0.1393 0.1254 -0.0062 0.0013  -0.0100 12  ALA A CA  
113  C C   . ALA A 17 ? 0.2144 0.1606 0.1416 -0.0086 0.0052  -0.0181 12  ALA A C   
114  O O   . ALA A 17 ? 0.2446 0.1919 0.1592 -0.0110 0.0013  -0.0219 12  ALA A O   
115  C CB  . ALA A 17 ? 0.1856 0.1354 0.1130 -0.0048 0.0017  -0.0037 12  ALA A CB  
116  N N   . VAL A 18 ? 0.2038 0.1464 0.1382 -0.0076 0.0126  -0.0212 13  VAL A N   
117  C CA  . VAL A 18 ? 0.2203 0.1584 0.1492 -0.0091 0.0189  -0.0303 13  VAL A CA  
118  C C   . VAL A 18 ? 0.2132 0.1513 0.1361 -0.0082 0.0278  -0.0299 13  VAL A C   
119  O O   . VAL A 18 ? 0.2565 0.1920 0.1679 -0.0100 0.0344  -0.0372 13  VAL A O   
120  C CB  . VAL A 18 ? 0.2928 0.2257 0.2384 -0.0078 0.0218  -0.0349 13  VAL A CB  
121  C CG1 . VAL A 18 ? 0.3240 0.2512 0.2669 -0.0085 0.0297  -0.0457 13  VAL A CG1 
122  C CG2 . VAL A 18 ? 0.3126 0.2444 0.2638 -0.0101 0.0152  -0.0349 13  VAL A CG2 
123  N N   . HIS A 19 ? 0.2076 0.1490 0.1388 -0.0062 0.0288  -0.0223 14  HIS A N   
124  C CA  . HIS A 19 ? 0.1975 0.1400 0.1264 -0.0066 0.0377  -0.0206 14  HIS A CA  
125  C C   . HIS A 19 ? 0.1789 0.1222 0.1019 -0.0073 0.0342  -0.0111 14  HIS A C   
126  O O   . HIS A 19 ? 0.1686 0.1132 0.0964 -0.0060 0.0258  -0.0067 14  HIS A O   
127  C CB  . HIS A 19 ? 0.1988 0.1446 0.1506 -0.0038 0.0433  -0.0221 14  HIS A CB  
128  C CG  . HIS A 19 ? 0.2325 0.1756 0.1937 -0.0016 0.0467  -0.0305 14  HIS A CG  
129  N ND1 . HIS A 19 ? 0.2598 0.2012 0.2349 0.0015  0.0407  -0.0299 14  HIS A ND1 
130  C CD2 . HIS A 19 ? 0.2718 0.2121 0.2297 -0.0021 0.0563  -0.0397 14  HIS A CD2 
131  C CE1 . HIS A 19 ? 0.2594 0.1961 0.2418 0.0033  0.0459  -0.0377 14  HIS A CE1 
132  N NE2 . HIS A 19 ? 0.2606 0.1970 0.2333 0.0012  0.0555  -0.0448 14  HIS A NE2 
133  N N   . ASP A 20 ? 0.2060 0.1478 0.1197 -0.0094 0.0420  -0.0079 15  ASP A N   
134  C CA  . ASP A 20 ? 0.1955 0.1345 0.1005 -0.0101 0.0390  0.0018  15  ASP A CA  
135  C C   . ASP A 20 ? 0.1867 0.1277 0.1116 -0.0090 0.0366  0.0062  15  ASP A C   
136  O O   . ASP A 20 ? 0.1941 0.1318 0.1160 -0.0086 0.0320  0.0131  15  ASP A O   
137  C CB  . ASP A 20 ? 0.2182 0.1526 0.1062 -0.0134 0.0497  0.0053  15  ASP A CB  
138  C CG  . ASP A 20 ? 0.2712 0.2021 0.1304 -0.0146 0.0490  0.0030  15  ASP A CG  
139  O OD1 . ASP A 20 ? 0.2990 0.2249 0.1379 -0.0172 0.0569  0.0074  15  ASP A OD1 
140  O OD2 . ASP A 20 ? 0.2614 0.1945 0.1178 -0.0135 0.0405  -0.0033 15  ASP A OD2 
141  N N   . ASP A 21 ? 0.1819 0.1282 0.1271 -0.0081 0.0386  0.0017  16  ASP A N   
142  C CA  . ASP A 21 ? 0.1709 0.1201 0.1330 -0.0074 0.0348  0.0039  16  ASP A CA  
143  C C   . ASP A 21 ? 0.1674 0.1181 0.1330 -0.0044 0.0245  0.0036  16  ASP A C   
144  O O   . ASP A 21 ? 0.1856 0.1386 0.1619 -0.0037 0.0206  0.0041  16  ASP A O   
145  C CB  . ASP A 21 ? 0.1695 0.1256 0.1524 -0.0079 0.0405  -0.0002 16  ASP A CB  
146  C CG  . ASP A 21 ? 0.1948 0.1553 0.1872 -0.0043 0.0389  -0.0060 16  ASP A CG  
147  O OD1 . ASP A 21 ? 0.1999 0.1677 0.2128 -0.0028 0.0400  -0.0088 16  ASP A OD1 
148  O OD2 . ASP A 21 ? 0.1851 0.1418 0.1666 -0.0027 0.0360  -0.0076 16  ASP A OD2 
149  N N   . GLU A 22 ? 0.1460 0.0953 0.1020 -0.0033 0.0207  0.0021  17  GLU A N   
150  C CA  . GLU A 22 ? 0.1316 0.0823 0.0914 -0.0013 0.0134  0.0019  17  GLU A CA  
151  C C   . GLU A 22 ? 0.1608 0.1105 0.1140 -0.0010 0.0079  0.0057  17  GLU A C   
152  O O   . GLU A 22 ? 0.1829 0.1304 0.1248 -0.0016 0.0073  0.0081  17  GLU A O   
153  C CB  . GLU A 22 ? 0.1476 0.0976 0.1067 -0.0010 0.0130  -0.0026 17  GLU A CB  
154  C CG  . GLU A 22 ? 0.1493 0.0998 0.1190 0.0004  0.0177  -0.0063 17  GLU A CG  
155  C CD  . GLU A 22 ? 0.1751 0.1217 0.1448 0.0007  0.0187  -0.0112 17  GLU A CD  
156  O OE1 . GLU A 22 ? 0.1750 0.1194 0.1372 -0.0013 0.0152  -0.0123 17  GLU A OE1 
157  O OE2 . GLU A 22 ? 0.1835 0.1293 0.1633 0.0028  0.0230  -0.0145 17  GLU A OE2 
158  N N   . LEU A 23 ? 0.1413 0.0928 0.1014 0.0005  0.0040  0.0062  18  LEU A N   
159  C CA  . LEU A 23 ? 0.1515 0.1039 0.1103 0.0017  -0.0005 0.0084  18  LEU A CA  
160  C C   . LEU A 23 ? 0.1309 0.0862 0.0877 0.0010  -0.0036 0.0061  18  LEU A C   
161  O O   . LEU A 23 ? 0.1405 0.0957 0.0994 -0.0003 -0.0022 0.0028  18  LEU A O   
162  C CB  . LEU A 23 ? 0.1309 0.0848 0.0976 0.0032  -0.0015 0.0080  18  LEU A CB  
163  C CG  . LEU A 23 ? 0.1319 0.0833 0.1029 0.0032  0.0001  0.0081  18  LEU A CG  
164  C CD1 . LEU A 23 ? 0.1477 0.1007 0.1228 0.0044  -0.0012 0.0055  18  LEU A CD1 
165  C CD2 . LEU A 23 ? 0.1415 0.0877 0.1105 0.0034  0.0010  0.0122  18  LEU A CD2 
166  N N   . THR A 24 ? 0.1289 0.0868 0.0839 0.0019  -0.0084 0.0078  19  THR A N   
167  C CA  . THR A 24 ? 0.1479 0.1115 0.1074 0.0009  -0.0125 0.0049  19  THR A CA  
168  C C   . THR A 24 ? 0.1211 0.0887 0.0924 0.0029  -0.0126 0.0059  19  THR A C   
169  O O   . THR A 24 ? 0.1910 0.1583 0.1650 0.0062  -0.0138 0.0090  19  THR A O   
170  C CB  . THR A 24 ? 0.1486 0.1151 0.1005 0.0009  -0.0191 0.0053  19  THR A CB  
171  O OG1 . THR A 24 ? 0.1499 0.1121 0.0878 -0.0016 -0.0171 0.0028  19  THR A OG1 
172  C CG2 . THR A 24 ? 0.1543 0.1298 0.1165 -0.0006 -0.0248 0.0013  19  THR A CG2 
173  N N   . ILE A 25 ? 0.1339 0.1039 0.1120 0.0009  -0.0101 0.0033  20  ILE A N   
174  C CA  . ILE A 25 ? 0.1362 0.1091 0.1226 0.0021  -0.0072 0.0035  20  ILE A CA  
175  C C   . ILE A 25 ? 0.1120 0.0925 0.1096 -0.0002 -0.0070 0.0012  20  ILE A C   
176  O O   . ILE A 25 ? 0.1143 0.0957 0.1134 -0.0040 -0.0081 -0.0011 20  ILE A O   
177  C CB  . ILE A 25 ? 0.1255 0.0934 0.1074 0.0017  -0.0023 0.0040  20  ILE A CB  
178  C CG1 . ILE A 25 ? 0.1496 0.1145 0.1303 -0.0014 -0.0002 0.0037  20  ILE A CG1 
179  C CG2 . ILE A 25 ? 0.1526 0.1155 0.1283 0.0033  -0.0028 0.0051  20  ILE A CG2 
180  C CD1 . ILE A 25 ? 0.1777 0.1375 0.1528 -0.0005 0.0022  0.0060  20  ILE A CD1 
181  N N   . ARG A 26 ? 0.1231 0.1092 0.1306 0.0018  -0.0046 0.0008  21  ARG A N   
182  C CA  . ARG A 26 ? 0.1106 0.1067 0.1338 -0.0004 -0.0033 -0.0017 21  ARG A CA  
183  C C   . ARG A 26 ? 0.1114 0.1086 0.1385 -0.0007 0.0062  -0.0023 21  ARG A C   
184  O O   . ARG A 26 ? 0.1374 0.1312 0.1594 0.0029  0.0088  -0.0022 21  ARG A O   
185  C CB  . ARG A 26 ? 0.1215 0.1273 0.1574 0.0033  -0.0108 -0.0023 21  ARG A CB  
186  C CG  . ARG A 26 ? 0.1298 0.1357 0.1584 0.0031  -0.0208 -0.0016 21  ARG A CG  
187  C CD  . ARG A 26 ? 0.1302 0.1399 0.1626 -0.0035 -0.0221 -0.0062 21  ARG A CD  
188  N NE  . ARG A 26 ? 0.1505 0.1613 0.1743 -0.0046 -0.0317 -0.0080 21  ARG A NE  
189  C CZ  . ARG A 26 ? 0.1652 0.1665 0.1723 -0.0074 -0.0311 -0.0095 21  ARG A CZ  
190  N NH1 . ARG A 26 ? 0.1575 0.1606 0.1549 -0.0086 -0.0393 -0.0123 21  ARG A NH1 
191  N NH2 . ARG A 26 ? 0.1549 0.1458 0.1551 -0.0086 -0.0225 -0.0085 21  ARG A NH2 
192  N N   . VAL A 27 ? 0.1141 0.1152 0.1494 -0.0057 0.0121  -0.0034 22  VAL A N   
193  C CA  . VAL A 27 ? 0.1195 0.1206 0.1543 -0.0069 0.0231  -0.0032 22  VAL A CA  
194  C C   . VAL A 27 ? 0.1274 0.1350 0.1705 -0.0018 0.0259  -0.0064 22  VAL A C   
195  O O   . VAL A 27 ? 0.1502 0.1681 0.2120 0.0009  0.0218  -0.0088 22  VAL A O   
196  C CB  . VAL A 27 ? 0.1245 0.1309 0.1725 -0.0136 0.0305  -0.0037 22  VAL A CB  
197  C CG1 . VAL A 27 ? 0.1469 0.1532 0.1914 -0.0149 0.0438  -0.0029 22  VAL A CG1 
198  C CG2 . VAL A 27 ? 0.1425 0.1393 0.1833 -0.0187 0.0290  -0.0010 22  VAL A CG2 
199  N N   . GLY A 28 ? 0.1255 0.1269 0.1551 -0.0001 0.0320  -0.0068 23  GLY A N   
200  C CA  . GLY A 28 ? 0.1796 0.1850 0.2164 0.0047  0.0363  -0.0117 23  GLY A CA  
201  C C   . GLY A 28 ? 0.1656 0.1632 0.1941 0.0097  0.0303  -0.0126 23  GLY A C   
202  O O   . GLY A 28 ? 0.1652 0.1607 0.1925 0.0127  0.0353  -0.0176 23  GLY A O   
203  N N   . GLU A 29 ? 0.1322 0.1248 0.1557 0.0101  0.0207  -0.0087 24  GLU A N   
204  C CA  . GLU A 29 ? 0.1594 0.1439 0.1767 0.0136  0.0160  -0.0087 24  GLU A CA  
205  C C   . GLU A 29 ? 0.1424 0.1193 0.1430 0.0121  0.0193  -0.0113 24  GLU A C   
206  O O   . GLU A 29 ? 0.1642 0.1400 0.1526 0.0086  0.0215  -0.0098 24  GLU A O   
207  C CB  . GLU A 29 ? 0.1160 0.0969 0.1290 0.0131  0.0073  -0.0037 24  GLU A CB  
208  C CG  . GLU A 29 ? 0.1234 0.1105 0.1492 0.0159  0.0010  -0.0013 24  GLU A CG  
209  C CD  . GLU A 29 ? 0.1703 0.1537 0.1865 0.0145  -0.0063 0.0031  24  GLU A CD  
210  O OE1 . GLU A 29 ? 0.2412 0.2253 0.2606 0.0178  -0.0128 0.0064  24  GLU A OE1 
211  O OE2 . GLU A 29 ? 0.2377 0.2171 0.2426 0.0105  -0.0053 0.0034  24  GLU A OE2 
212  N N   . ILE A 30 ? 0.1317 0.1032 0.1325 0.0148  0.0190  -0.0153 25  ILE A N   
213  C CA  . ILE A 30 ? 0.1590 0.1240 0.1453 0.0130  0.0190  -0.0189 25  ILE A CA  
214  C C   . ILE A 30 ? 0.1608 0.1200 0.1460 0.0124  0.0120  -0.0158 25  ILE A C   
215  O O   . ILE A 30 ? 0.1689 0.1245 0.1637 0.0147  0.0100  -0.0144 25  ILE A O   
216  C CB  . ILE A 30 ? 0.1715 0.1337 0.1592 0.0150  0.0245  -0.0280 25  ILE A CB  
217  C CG1 . ILE A 30 ? 0.1557 0.1248 0.1488 0.0162  0.0339  -0.0317 25  ILE A CG1 
218  C CG2 . ILE A 30 ? 0.1952 0.1529 0.1656 0.0120  0.0232  -0.0333 25  ILE A CG2 
219  C CD1 . ILE A 30 ? 0.1616 0.1345 0.1394 0.0120  0.0383  -0.0291 25  ILE A CD1 
220  N N   . ILE A 31 ? 0.1325 0.0910 0.1070 0.0094  0.0087  -0.0140 26  ILE A N   
221  C CA  . ILE A 31 ? 0.1391 0.0938 0.1145 0.0082  0.0040  -0.0125 26  ILE A CA  
222  C C   . ILE A 31 ? 0.1614 0.1133 0.1337 0.0068  0.0031  -0.0198 26  ILE A C   
223  O O   . ILE A 31 ? 0.1713 0.1255 0.1327 0.0059  0.0030  -0.0235 26  ILE A O   
224  C CB  . ILE A 31 ? 0.1448 0.1018 0.1151 0.0065  0.0009  -0.0075 26  ILE A CB  
225  C CG1 . ILE A 31 ? 0.1438 0.1031 0.1168 0.0069  0.0017  -0.0026 26  ILE A CG1 
226  C CG2 . ILE A 31 ? 0.1463 0.1014 0.1205 0.0051  -0.0021 -0.0070 26  ILE A CG2 
227  C CD1 . ILE A 31 ? 0.1743 0.1340 0.1432 0.0055  0.0002  0.0009  26  ILE A CD1 
228  N N   . ARG A 32 ? 0.1425 0.0888 0.1234 0.0061  0.0025  -0.0219 27  ARG A N   
229  C CA  . ARG A 32 ? 0.1780 0.1212 0.1590 0.0039  0.0018  -0.0313 27  ARG A CA  
230  C C   . ARG A 32 ? 0.1499 0.0935 0.1355 -0.0001 -0.0028 -0.0325 27  ARG A C   
231  O O   . ARG A 32 ? 0.1436 0.0879 0.1347 -0.0009 -0.0034 -0.0258 27  ARG A O   
232  C CB  . ARG A 32 ? 0.1938 0.1286 0.1850 0.0060  0.0064  -0.0357 27  ARG A CB  
233  C CG  . ARG A 32 ? 0.2223 0.1597 0.2143 0.0106  0.0112  -0.0348 27  ARG A CG  
234  C CD  . ARG A 32 ? 0.2414 0.1716 0.2451 0.0142  0.0161  -0.0407 27  ARG A CD  
235  N NE  . ARG A 32 ? 0.1784 0.1146 0.1861 0.0187  0.0211  -0.0406 27  ARG A NE  
236  C CZ  . ARG A 32 ? 0.1864 0.1264 0.1883 0.0190  0.0274  -0.0491 27  ARG A CZ  
237  N NH1 . ARG A 32 ? 0.1740 0.1210 0.1842 0.0227  0.0331  -0.0484 27  ARG A NH1 
238  N NH2 . ARG A 32 ? 0.2149 0.1527 0.2032 0.0154  0.0284  -0.0587 27  ARG A NH2 
239  N N   . ASN A 33 ? 0.1604 0.1046 0.1440 -0.0030 -0.0059 -0.0422 28  ASN A N   
240  C CA  . ASN A 33 ? 0.1614 0.1086 0.1539 -0.0075 -0.0110 -0.0456 28  ASN A CA  
241  C C   . ASN A 33 ? 0.1644 0.1204 0.1562 -0.0069 -0.0153 -0.0381 28  ASN A C   
242  O O   . ASN A 33 ? 0.1591 0.1165 0.1634 -0.0090 -0.0148 -0.0348 28  ASN A O   
243  C CB  . ASN A 33 ? 0.1850 0.1232 0.1944 -0.0104 -0.0067 -0.0450 28  ASN A CB  
244  C CG  . ASN A 33 ? 0.1985 0.1400 0.2215 -0.0166 -0.0103 -0.0509 28  ASN A CG  
245  O OD1 . ASN A 33 ? 0.1996 0.1375 0.2362 -0.0197 -0.0063 -0.0464 28  ASN A OD1 
246  N ND2 . ASN A 33 ? 0.1952 0.1443 0.2145 -0.0189 -0.0178 -0.0609 28  ASN A ND2 
247  N N   . VAL A 34 ? 0.1524 0.1133 0.1298 -0.0040 -0.0181 -0.0353 29  VAL A N   
248  C CA  . VAL A 34 ? 0.1454 0.1124 0.1224 -0.0021 -0.0216 -0.0278 29  VAL A CA  
249  C C   . VAL A 34 ? 0.1814 0.1572 0.1659 -0.0036 -0.0304 -0.0314 29  VAL A C   
250  O O   . VAL A 34 ? 0.1856 0.1649 0.1652 -0.0052 -0.0371 -0.0391 29  VAL A O   
251  C CB  . VAL A 34 ? 0.1486 0.1157 0.1088 0.0012  -0.0212 -0.0227 29  VAL A CB  
252  C CG1 . VAL A 34 ? 0.1446 0.1154 0.1057 0.0036  -0.0249 -0.0152 29  VAL A CG1 
253  C CG2 . VAL A 34 ? 0.1432 0.1048 0.1021 0.0024  -0.0131 -0.0196 29  VAL A CG2 
254  N N   . LYS A 35 ? 0.1400 0.1202 0.1376 -0.0031 -0.0305 -0.0266 30  LYS A N   
255  C CA  A LYS A 35 ? 0.1800 0.1711 0.1907 -0.0036 -0.0388 -0.0294 30  LYS A CA  
256  C CA  B LYS A 35 ? 0.1772 0.1683 0.1885 -0.0037 -0.0386 -0.0294 30  LYS A CA  
257  C C   . LYS A 35 ? 0.1780 0.1735 0.1917 0.0013  -0.0407 -0.0216 30  LYS A C   
258  O O   . LYS A 35 ? 0.1504 0.1407 0.1633 0.0029  -0.0332 -0.0157 30  LYS A O   
259  C CB  A LYS A 35 ? 0.1713 0.1648 0.2047 -0.0090 -0.0353 -0.0343 30  LYS A CB  
260  C CB  B LYS A 35 ? 0.1646 0.1578 0.1985 -0.0089 -0.0345 -0.0336 30  LYS A CB  
261  C CG  A LYS A 35 ? 0.1835 0.1702 0.2177 -0.0142 -0.0330 -0.0423 30  LYS A CG  
262  C CG  B LYS A 35 ? 0.1775 0.1627 0.2130 -0.0140 -0.0305 -0.0402 30  LYS A CG  
263  C CD  A LYS A 35 ? 0.1968 0.1830 0.2539 -0.0203 -0.0272 -0.0448 30  LYS A CD  
264  C CD  B LYS A 35 ? 0.1954 0.1809 0.2535 -0.0197 -0.0245 -0.0417 30  LYS A CD  
265  C CE  A LYS A 35 ? 0.2134 0.1894 0.2728 -0.0253 -0.0241 -0.0523 30  LYS A CE  
266  C CE  B LYS A 35 ? 0.2120 0.1874 0.2747 -0.0251 -0.0208 -0.0484 30  LYS A CE  
267  N NZ  A LYS A 35 ? 0.2181 0.1991 0.2740 -0.0273 -0.0342 -0.0644 30  LYS A NZ  
268  N NZ  B LYS A 35 ? 0.1972 0.1716 0.2826 -0.0318 -0.0138 -0.0488 30  LYS A NZ  
269  N N   . LYS A 36 ? 0.1824 0.1874 0.1998 0.0040  -0.0515 -0.0220 31  LYS A N   
270  C CA  . LYS A 36 ? 0.1922 0.2016 0.2192 0.0094  -0.0536 -0.0155 31  LYS A CA  
271  C C   . LYS A 36 ? 0.1729 0.1926 0.2294 0.0072  -0.0519 -0.0199 31  LYS A C   
272  O O   . LYS A 36 ? 0.2085 0.2387 0.2793 0.0041  -0.0589 -0.0271 31  LYS A O   
273  C CB  . LYS A 36 ? 0.2363 0.2504 0.2535 0.0149  -0.0668 -0.0117 31  LYS A CB  
274  C CG  . LYS A 36 ? 0.2481 0.2680 0.2816 0.0217  -0.0715 -0.0057 31  LYS A CG  
275  C CD  . LYS A 36 ? 0.2253 0.2343 0.2573 0.0243  -0.0603 0.0012  31  LYS A CD  
276  C CE  . LYS A 36 ? 0.2329 0.2439 0.2772 0.0325  -0.0652 0.0079  31  LYS A CE  
277  N NZ  . LYS A 36 ? 0.2086 0.2349 0.2852 0.0344  -0.0689 0.0029  31  LYS A NZ  
278  N N   . LEU A 37 ? 0.1481 0.1648 0.2137 0.0079  -0.0416 -0.0166 32  LEU A N   
279  C CA  . LEU A 37 ? 0.1508 0.1772 0.2441 0.0058  -0.0368 -0.0204 32  LEU A CA  
280  C C   . LEU A 37 ? 0.1787 0.2141 0.2876 0.0131  -0.0422 -0.0178 32  LEU A C   
281  O O   . LEU A 37 ? 0.2177 0.2531 0.3171 0.0190  -0.0530 -0.0135 32  LEU A O   
282  C CB  . LEU A 37 ? 0.1578 0.1755 0.2496 0.0022  -0.0213 -0.0189 32  LEU A CB  
283  C CG  . LEU A 37 ? 0.2147 0.2215 0.2915 -0.0034 -0.0164 -0.0194 32  LEU A CG  
284  C CD1 . LEU A 37 ? 0.2404 0.2402 0.3168 -0.0068 -0.0027 -0.0169 32  LEU A CD1 
285  C CD2 . LEU A 37 ? 0.2210 0.2327 0.3073 -0.0085 -0.0219 -0.0264 32  LEU A CD2 
286  N N   . GLN A 38 ? 0.2023 0.2445 0.3350 0.0133  -0.0341 -0.0198 33  GLN A N   
287  C CA  . GLN A 38 ? 0.2063 0.2582 0.3597 0.0213  -0.0392 -0.0184 33  GLN A CA  
288  C C   . GLN A 38 ? 0.1886 0.2275 0.3261 0.0283  -0.0374 -0.0111 33  GLN A C   
289  O O   . GLN A 38 ? 0.2009 0.2423 0.3450 0.0364  -0.0466 -0.0067 33  GLN A O   
290  C CB  . GLN A 38 ? 0.2304 0.2937 0.4158 0.0194  -0.0283 -0.0240 33  GLN A CB  
291  C CG  . GLN A 38 ? 0.2548 0.3327 0.4629 0.0119  -0.0300 -0.0315 33  GLN A CG  
292  C CD  . GLN A 38 ? 0.2682 0.3614 0.5143 0.0109  -0.0204 -0.0370 33  GLN A CD  
293  O OE1 . GLN A 38 ? 0.2754 0.3632 0.5220 0.0070  -0.0025 -0.0377 33  GLN A OE1 
294  N NE2 . GLN A 38 ? 0.2846 0.3981 0.5626 0.0145  -0.0323 -0.0410 33  GLN A NE2 
295  N N   . GLU A 39 ? 0.1748 0.1993 0.2919 0.0250  -0.0265 -0.0094 34  GLU A N   
296  C CA  . GLU A 39 ? 0.1998 0.2117 0.3054 0.0296  -0.0225 -0.0046 34  GLU A CA  
297  C C   . GLU A 39 ? 0.2211 0.2248 0.3082 0.0340  -0.0326 0.0031  34  GLU A C   
298  O O   . GLU A 39 ? 0.2838 0.2850 0.3521 0.0308  -0.0376 0.0047  34  GLU A O   
299  C CB  . GLU A 39 ? 0.1872 0.1881 0.2760 0.0239  -0.0100 -0.0060 34  GLU A CB  
300  C CG  . GLU A 39 ? 0.2151 0.2054 0.2987 0.0269  -0.0033 -0.0050 34  GLU A CG  
301  C CD  . GLU A 39 ? 0.2486 0.2340 0.3241 0.0215  0.0095  -0.0094 34  GLU A CD  
302  O OE1 . GLU A 39 ? 0.2790 0.2672 0.3497 0.0158  0.0127  -0.0107 34  GLU A OE1 
303  O OE2 . GLU A 39 ? 0.2348 0.2130 0.3083 0.0231  0.0160  -0.0116 34  GLU A OE2 
304  N N   . GLU A 40 ? 0.1813 0.1792 0.2735 0.0412  -0.0340 0.0080  35  GLU A N   
305  C CA  . GLU A 40 ? 0.1611 0.1492 0.2365 0.0456  -0.0421 0.0174  35  GLU A CA  
306  C C   . GLU A 40 ? 0.1865 0.1588 0.2391 0.0413  -0.0340 0.0201  35  GLU A C   
307  O O   . GLU A 40 ? 0.1947 0.1609 0.2498 0.0389  -0.0235 0.0160  35  GLU A O   
308  C CB  . GLU A 40 ? 0.2030 0.1895 0.2965 0.0557  -0.0467 0.0226  35  GLU A CB  
309  C CG  . GLU A 40 ? 0.2498 0.2246 0.3264 0.0610  -0.0553 0.0349  35  GLU A CG  
310  C CD  . GLU A 40 ? 0.3025 0.2760 0.3994 0.0724  -0.0622 0.0416  35  GLU A CD  
311  O OE1 . GLU A 40 ? 0.3035 0.2846 0.4291 0.0761  -0.0578 0.0351  35  GLU A OE1 
312  O OE2 . GLU A 40 ? 0.3377 0.3033 0.4187 0.0767  -0.0696 0.0527  35  GLU A OE2 
313  N N   . GLY A 41 ? 0.1764 0.1429 0.2069 0.0401  -0.0388 0.0262  36  GLY A N   
314  C CA  . GLY A 41 ? 0.1714 0.1247 0.1841 0.0360  -0.0315 0.0290  36  GLY A CA  
315  C C   . GLY A 41 ? 0.1811 0.1359 0.1859 0.0284  -0.0242 0.0224  36  GLY A C   
316  O O   . GLY A 41 ? 0.1803 0.1272 0.1736 0.0247  -0.0187 0.0236  36  GLY A O   
317  N N   . TRP A 42 ? 0.1503 0.1153 0.1633 0.0261  -0.0242 0.0158  37  TRP A N   
318  C CA  . TRP A 42 ? 0.1376 0.1031 0.1444 0.0200  -0.0182 0.0109  37  TRP A CA  
319  C C   . TRP A 42 ? 0.1474 0.1201 0.1515 0.0176  -0.0231 0.0079  37  TRP A C   
320  O O   . TRP A 42 ? 0.1743 0.1545 0.1851 0.0198  -0.0309 0.0073  37  TRP A O   
321  C CB  . TRP A 42 ? 0.1292 0.0962 0.1472 0.0184  -0.0106 0.0058  37  TRP A CB  
322  C CG  . TRP A 42 ? 0.1314 0.0897 0.1479 0.0190  -0.0049 0.0060  37  TRP A CG  
323  C CD1 . TRP A 42 ? 0.1674 0.1207 0.1920 0.0237  -0.0051 0.0080  37  TRP A CD1 
324  C CD2 . TRP A 42 ? 0.1453 0.0982 0.1520 0.0147  0.0009  0.0036  37  TRP A CD2 
325  N NE1 . TRP A 42 ? 0.1441 0.0884 0.1649 0.0217  0.0012  0.0056  37  TRP A NE1 
326  C CE2 . TRP A 42 ? 0.1435 0.0885 0.1528 0.0160  0.0043  0.0026  37  TRP A CE2 
327  C CE3 . TRP A 42 ? 0.1406 0.0944 0.1376 0.0103  0.0028  0.0021  37  TRP A CE3 
328  C CZ2 . TRP A 42 ? 0.1485 0.0882 0.1503 0.0121  0.0087  -0.0012 37  TRP A CZ2 
329  C CZ3 . TRP A 42 ? 0.1467 0.0960 0.1362 0.0075  0.0063  -0.0001 37  TRP A CZ3 
330  C CH2 . TRP A 42 ? 0.1433 0.0863 0.1350 0.0079  0.0089  -0.0025 37  TRP A CH2 
331  N N   . LEU A 43 ? 0.1310 0.1013 0.1260 0.0133  -0.0191 0.0057  38  LEU A N   
332  C CA  . LEU A 43 ? 0.1224 0.0970 0.1165 0.0105  -0.0218 0.0012  38  LEU A CA  
333  C C   . LEU A 43 ? 0.1327 0.1056 0.1311 0.0067  -0.0151 -0.0018 38  LEU A C   
334  O O   . LEU A 43 ? 0.1284 0.0971 0.1251 0.0063  -0.0093 0.0001  38  LEU A O   
335  C CB  . LEU A 43 ? 0.1902 0.1616 0.1672 0.0102  -0.0239 0.0018  38  LEU A CB  
336  C CG  . LEU A 43 ? 0.1867 0.1588 0.1539 0.0136  -0.0312 0.0059  38  LEU A CG  
337  C CD1 . LEU A 43 ? 0.2126 0.1792 0.1604 0.0127  -0.0282 0.0079  38  LEU A CD1 
338  C CD2 . LEU A 43 ? 0.2043 0.1851 0.1759 0.0139  -0.0407 0.0013  38  LEU A CD2 
339  N N   . GLU A 44 ? 0.1461 0.1212 0.1488 0.0037  -0.0161 -0.0062 39  GLU A N   
340  C CA  A GLU A 44 ? 0.1385 0.1095 0.1446 0.0003  -0.0098 -0.0071 39  GLU A CA  
341  C CA  B GLU A 44 ? 0.1396 0.1106 0.1458 0.0003  -0.0098 -0.0072 39  GLU A CA  
342  C C   . GLU A 44 ? 0.1386 0.1049 0.1382 -0.0010 -0.0102 -0.0098 39  GLU A C   
343  O O   . GLU A 44 ? 0.1557 0.1246 0.1533 -0.0013 -0.0153 -0.0144 39  GLU A O   
344  C CB  A GLU A 44 ? 0.1454 0.1214 0.1685 -0.0028 -0.0078 -0.0101 39  GLU A CB  
345  C CB  B GLU A 44 ? 0.1472 0.1231 0.1704 -0.0030 -0.0078 -0.0102 39  GLU A CB  
346  C CG  A GLU A 44 ? 0.1546 0.1246 0.1789 -0.0060 0.0010  -0.0077 39  GLU A CG  
347  C CG  B GLU A 44 ? 0.1583 0.1273 0.1827 -0.0067 0.0003  -0.0086 39  GLU A CG  
348  C CD  A GLU A 44 ? 0.1732 0.1391 0.2040 -0.0104 0.0027  -0.0103 39  GLU A CD  
349  C CD  B GLU A 44 ? 0.1753 0.1473 0.2172 -0.0119 0.0030  -0.0124 39  GLU A CD  
350  O OE1 A GLU A 44 ? 0.1980 0.1681 0.2363 -0.0121 -0.0029 -0.0165 39  GLU A OE1 
351  O OE1 B GLU A 44 ? 0.1886 0.1653 0.2393 -0.0138 -0.0030 -0.0185 39  GLU A OE1 
352  O OE2 A GLU A 44 ? 0.1638 0.1213 0.1914 -0.0123 0.0094  -0.0062 39  GLU A OE2 
353  O OE2 B GLU A 44 ? 0.1623 0.1319 0.2087 -0.0147 0.0117  -0.0095 39  GLU A OE2 
354  N N   . GLY A 45 ? 0.1352 0.0948 0.1314 -0.0013 -0.0053 -0.0073 40  GLY A N   
355  C CA  . GLY A 45 ? 0.1500 0.1047 0.1433 -0.0013 -0.0050 -0.0102 40  GLY A CA  
356  C C   . GLY A 45 ? 0.1447 0.0918 0.1388 -0.0009 -0.0006 -0.0063 40  GLY A C   
357  O O   . GLY A 45 ? 0.1531 0.0988 0.1459 -0.0009 0.0018  -0.0008 40  GLY A O   
358  N N   . GLU A 46 ? 0.1427 0.0846 0.1382 0.0000  0.0001  -0.0094 41  GLU A N   
359  C CA  . GLU A 46 ? 0.1410 0.0746 0.1395 0.0018  0.0029  -0.0050 41  GLU A CA  
360  C C   . GLU A 46 ? 0.1597 0.0956 0.1540 0.0064  0.0021  -0.0026 41  GLU A C   
361  O O   . GLU A 46 ? 0.1353 0.0756 0.1276 0.0077  0.0020  -0.0073 41  GLU A O   
362  C CB  . GLU A 46 ? 0.1673 0.0925 0.1745 0.0007  0.0047  -0.0106 41  GLU A CB  
363  C CG  . GLU A 46 ? 0.1747 0.0880 0.1873 0.0031  0.0076  -0.0044 41  GLU A CG  
364  C CD  . GLU A 46 ? 0.2250 0.1382 0.2379 0.0096  0.0068  -0.0031 41  GLU A CD  
365  O OE1 . GLU A 46 ? 0.2185 0.1373 0.2309 0.0110  0.0068  -0.0106 41  GLU A OE1 
366  O OE2 . GLU A 46 ? 0.2434 0.1516 0.2570 0.0133  0.0060  0.0057  41  GLU A OE2 
367  N N   . LEU A 47 ? 0.1544 0.0881 0.1475 0.0086  0.0017  0.0047  42  LEU A N   
368  C CA  . LEU A 47 ? 0.1574 0.0955 0.1512 0.0127  -0.0004 0.0065  42  LEU A CA  
369  C C   . LEU A 47 ? 0.1980 0.1306 0.1934 0.0162  -0.0025 0.0141  42  LEU A C   
370  O O   . LEU A 47 ? 0.1806 0.1104 0.1678 0.0147  -0.0034 0.0202  42  LEU A O   
371  C CB  . LEU A 47 ? 0.1348 0.0815 0.1221 0.0114  -0.0021 0.0070  42  LEU A CB  
372  C CG  . LEU A 47 ? 0.1577 0.1111 0.1490 0.0141  -0.0043 0.0079  42  LEU A CG  
373  C CD1 . LEU A 47 ? 0.1560 0.1124 0.1560 0.0165  -0.0013 0.0028  42  LEU A CD1 
374  C CD2 . LEU A 47 ? 0.1654 0.1247 0.1515 0.0112  -0.0051 0.0075  42  LEU A CD2 
375  N N   . ASN A 48 ? 0.2347 0.1654 0.2401 0.0212  -0.0032 0.0139  43  ASN A N   
376  C CA  . ASN A 48 ? 0.2769 0.2027 0.2856 0.0265  -0.0072 0.0223  43  ASN A CA  
377  C C   . ASN A 48 ? 0.2638 0.1763 0.2654 0.0247  -0.0058 0.0304  43  ASN A C   
378  O O   . ASN A 48 ? 0.2961 0.2057 0.2890 0.0267  -0.0098 0.0400  43  ASN A O   
379  C CB  . ASN A 48 ? 0.3173 0.2542 0.3224 0.0282  -0.0137 0.0257  43  ASN A CB  
380  C CG  . ASN A 48 ? 0.3532 0.3027 0.3697 0.0296  -0.0135 0.0187  43  ASN A CG  
381  O OD1 . ASN A 48 ? 0.4010 0.3505 0.4299 0.0325  -0.0096 0.0136  43  ASN A OD1 
382  N ND2 . ASN A 48 ? 0.3613 0.3211 0.3739 0.0269  -0.0165 0.0177  43  ASN A ND2 
383  N N   . GLY A 49 ? 0.2199 0.1246 0.2245 0.0204  -0.0001 0.0262  44  GLY A N   
384  C CA  . GLY A 49 ? 0.2565 0.1470 0.2594 0.0179  0.0036  0.0333  44  GLY A CA  
385  C C   . GLY A 49 ? 0.2593 0.1507 0.2521 0.0109  0.0076  0.0350  44  GLY A C   
386  O O   . GLY A 49 ? 0.2695 0.1498 0.2621 0.0073  0.0129  0.0403  44  GLY A O   
387  N N   . ARG A 50 ? 0.2403 0.1446 0.2265 0.0089  0.0060  0.0306  45  ARG A N   
388  C CA  . ARG A 50 ? 0.2364 0.1435 0.2161 0.0033  0.0104  0.0306  45  ARG A CA  
389  C C   . ARG A 50 ? 0.2199 0.1373 0.2062 0.0005  0.0103  0.0205  45  ARG A C   
390  O O   . ARG A 50 ? 0.2116 0.1339 0.2018 0.0028  0.0068  0.0147  45  ARG A O   
391  C CB  . ARG A 50 ? 0.2566 0.1678 0.2202 0.0042  0.0084  0.0358  45  ARG A CB  
392  C CG  . ARG A 50 ? 0.2616 0.1842 0.2236 0.0067  0.0024  0.0308  45  ARG A CG  
393  C CD  . ARG A 50 ? 0.2818 0.2091 0.2299 0.0051  0.0021  0.0314  45  ARG A CD  
394  N NE  . ARG A 50 ? 0.2725 0.2020 0.2213 0.0007  0.0086  0.0271  45  ARG A NE  
395  C CZ  . ARG A 50 ? 0.2372 0.1708 0.1778 -0.0009 0.0102  0.0243  45  ARG A CZ  
396  N NH1 . ARG A 50 ? 0.2307 0.1665 0.1599 0.0005  0.0053  0.0248  45  ARG A NH1 
397  N NH2 . ARG A 50 ? 0.2389 0.1750 0.1844 -0.0038 0.0166  0.0202  45  ARG A NH2 
398  N N   . ARG A 51 ? 0.2084 0.1293 0.1958 -0.0040 0.0144  0.0189  46  ARG A N   
399  C CA  . ARG A 51 ? 0.1898 0.1211 0.1831 -0.0053 0.0124  0.0111  46  ARG A CA  
400  C C   . ARG A 51 ? 0.1932 0.1310 0.1794 -0.0050 0.0132  0.0119  46  ARG A C   
401  O O   . ARG A 51 ? 0.2306 0.1652 0.2084 -0.0060 0.0174  0.0165  46  ARG A O   
402  C CB  . ARG A 51 ? 0.2124 0.1449 0.2199 -0.0102 0.0151  0.0061  46  ARG A CB  
403  C CG  . ARG A 51 ? 0.2223 0.1487 0.2386 -0.0114 0.0139  0.0016  46  ARG A CG  
404  C CD  . ARG A 51 ? 0.2065 0.1384 0.2381 -0.0168 0.0136  -0.0063 46  ARG A CD  
405  N NE  . ARG A 51 ? 0.2150 0.1593 0.2465 -0.0152 0.0065  -0.0128 46  ARG A NE  
406  C CZ  . ARG A 51 ? 0.2304 0.1763 0.2592 -0.0140 0.0007  -0.0198 46  ARG A CZ  
407  N NH1 . ARG A 51 ? 0.2553 0.1916 0.2840 -0.0140 0.0020  -0.0227 46  ARG A NH1 
408  N NH2 . ARG A 51 ? 0.2296 0.1856 0.2549 -0.0124 -0.0060 -0.0235 46  ARG A NH2 
409  N N   . GLY A 52 ? 0.1460 0.0914 0.1341 -0.0036 0.0095  0.0073  47  GLY A N   
410  C CA  . GLY A 52 ? 0.1272 0.0769 0.1113 -0.0031 0.0107  0.0070  47  GLY A CA  
411  C C   . GLY A 52 ? 0.1213 0.0770 0.1094 -0.0011 0.0065  0.0034  47  GLY A C   
412  O O   . GLY A 52 ? 0.1446 0.1018 0.1347 -0.0002 0.0022  0.0014  47  GLY A O   
413  N N   . MET A 53 ? 0.1154 0.0733 0.1035 -0.0003 0.0082  0.0026  48  MET A N   
414  C CA  . MET A 53 ? 0.1292 0.0904 0.1213 0.0023  0.0045  0.0011  48  MET A CA  
415  C C   . MET A 53 ? 0.1271 0.0852 0.1103 0.0036  0.0022  0.0026  48  MET A C   
416  O O   . MET A 53 ? 0.1645 0.1200 0.1409 0.0025  0.0038  0.0030  48  MET A O   
417  C CB  . MET A 53 ? 0.1451 0.1088 0.1454 0.0033  0.0084  -0.0009 48  MET A CB  
418  C CG  . MET A 53 ? 0.1577 0.1261 0.1702 0.0012  0.0129  -0.0028 48  MET A CG  
419  S SD  . MET A 53 ? 0.2122 0.1885 0.2392 0.0012  0.0057  -0.0048 48  MET A SD  
420  C CE  . MET A 53 ? 0.2638 0.2441 0.2960 0.0071  -0.0015 -0.0043 48  MET A CE  
421  N N   . PHE A 54 ? 0.1255 0.0843 0.1089 0.0054  -0.0016 0.0035  49  PHE A N   
422  C CA  . PHE A 54 ? 0.1232 0.0788 0.1006 0.0056  -0.0019 0.0053  49  PHE A CA  
423  C C   . PHE A 54 ? 0.1278 0.0817 0.1062 0.0081  -0.0041 0.0080  49  PHE A C   
424  O O   . PHE A 54 ? 0.1370 0.0940 0.1180 0.0102  -0.0081 0.0087  49  PHE A O   
425  C CB  . PHE A 54 ? 0.1458 0.1021 0.1181 0.0047  -0.0024 0.0057  49  PHE A CB  
426  C CG  . PHE A 54 ? 0.1298 0.0881 0.1006 0.0054  -0.0048 0.0047  49  PHE A CG  
427  C CD1 . PHE A 54 ? 0.1458 0.1037 0.1098 0.0062  -0.0059 0.0062  49  PHE A CD1 
428  C CD2 . PHE A 54 ? 0.1380 0.0975 0.1128 0.0047  -0.0054 0.0020  49  PHE A CD2 
429  C CE1 . PHE A 54 ? 0.1568 0.1166 0.1158 0.0065  -0.0085 0.0037  49  PHE A CE1 
430  C CE2 . PHE A 54 ? 0.1213 0.0823 0.0949 0.0046  -0.0080 -0.0011 49  PHE A CE2 
431  C CZ  . PHE A 54 ? 0.1506 0.1123 0.1151 0.0056  -0.0100 -0.0009 49  PHE A CZ  
432  N N   . PRO A 55 ? 0.1388 0.0873 0.1159 0.0077  -0.0021 0.0097  50  PRO A N   
433  C CA  . PRO A 55 ? 0.1296 0.0733 0.1077 0.0106  -0.0037 0.0143  50  PRO A CA  
434  C C   . PRO A 55 ? 0.1372 0.0807 0.1050 0.0110  -0.0061 0.0190  50  PRO A C   
435  O O   . PRO A 55 ? 0.1378 0.0820 0.0995 0.0079  -0.0032 0.0185  50  PRO A O   
436  C CB  . PRO A 55 ? 0.1661 0.1023 0.1464 0.0086  0.0006  0.0137  50  PRO A CB  
437  C CG  . PRO A 55 ? 0.1668 0.1063 0.1440 0.0041  0.0026  0.0099  50  PRO A CG  
438  C CD  . PRO A 55 ? 0.1558 0.1021 0.1322 0.0046  0.0011  0.0072  50  PRO A CD  
439  N N   . ASP A 56 ? 0.1517 0.0949 0.1173 0.0149  -0.0113 0.0234  51  ASP A N   
440  C CA  . ASP A 56 ? 0.1744 0.1187 0.1256 0.0149  -0.0141 0.0263  51  ASP A CA  
441  C C   . ASP A 56 ? 0.1954 0.1310 0.1356 0.0135  -0.0095 0.0334  51  ASP A C   
442  O O   . ASP A 56 ? 0.2118 0.1474 0.1369 0.0128  -0.0091 0.0358  51  ASP A O   
443  C CB  . ASP A 56 ? 0.2490 0.1981 0.1991 0.0193  -0.0237 0.0279  51  ASP A CB  
444  C CG  . ASP A 56 ? 0.2820 0.2255 0.2353 0.0248  -0.0281 0.0360  51  ASP A CG  
445  O OD1 . ASP A 56 ? 0.2448 0.1776 0.1954 0.0248  -0.0233 0.0423  51  ASP A OD1 
446  O OD2 . ASP A 56 ? 0.2660 0.2162 0.2259 0.0293  -0.0372 0.0363  51  ASP A OD2 
447  N N   . ASN A 57 ? 0.1922 0.1200 0.1396 0.0124  -0.0048 0.0358  52  ASN A N   
448  C CA  . ASN A 57 ? 0.1889 0.1078 0.1288 0.0095  0.0014  0.0425  52  ASN A CA  
449  C C   . ASN A 57 ? 0.1992 0.1209 0.1440 0.0032  0.0091  0.0373  52  ASN A C   
450  O O   . ASN A 57 ? 0.2116 0.1272 0.1558 -0.0007 0.0158  0.0413  52  ASN A O   
451  C CB  . ASN A 57 ? 0.2147 0.1208 0.1607 0.0119  0.0019  0.0494  52  ASN A CB  
452  C CG  . ASN A 57 ? 0.2135 0.1181 0.1773 0.0112  0.0037  0.0422  52  ASN A CG  
453  O OD1 . ASN A 57 ? 0.1927 0.1064 0.1624 0.0103  0.0026  0.0335  52  ASN A OD1 
454  N ND2 . ASN A 57 ? 0.2188 0.1102 0.1898 0.0116  0.0067  0.0461  52  ASN A ND2 
455  N N   . PHE A 58 ? 0.1816 0.1129 0.1321 0.0023  0.0079  0.0291  53  PHE A N   
456  C CA  . PHE A 58 ? 0.1652 0.1017 0.1222 -0.0023 0.0127  0.0244  53  PHE A CA  
457  C C   . PHE A 58 ? 0.1709 0.1145 0.1215 -0.0023 0.0145  0.0223  53  PHE A C   
458  O O   . PHE A 58 ? 0.1784 0.1282 0.1364 -0.0047 0.0182  0.0183  53  PHE A O   
459  C CB  . PHE A 58 ? 0.1518 0.0929 0.1191 -0.0027 0.0098  0.0176  53  PHE A CB  
460  C CG  . PHE A 58 ? 0.1561 0.0910 0.1310 -0.0046 0.0106  0.0162  53  PHE A CG  
461  C CD1 . PHE A 58 ? 0.1774 0.1034 0.1524 -0.0018 0.0099  0.0195  53  PHE A CD1 
462  C CD2 . PHE A 58 ? 0.1483 0.0867 0.1311 -0.0087 0.0111  0.0104  53  PHE A CD2 
463  C CE1 . PHE A 58 ? 0.1862 0.1049 0.1693 -0.0034 0.0117  0.0165  53  PHE A CE1 
464  C CE2 . PHE A 58 ? 0.1754 0.1077 0.1642 -0.0112 0.0117  0.0067  53  PHE A CE2 
465  C CZ  . PHE A 58 ? 0.1738 0.0952 0.1628 -0.0086 0.0129  0.0093  53  PHE A CZ  
466  N N   . VAL A 59 ? 0.1634 0.1065 0.1013 0.0007  0.0116  0.0241  54  VAL A N   
467  C CA  . VAL A 59 ? 0.1584 0.1075 0.0903 0.0012  0.0122  0.0191  54  VAL A CA  
468  C C   . VAL A 59 ? 0.1779 0.1238 0.0899 0.0020  0.0129  0.0229  54  VAL A C   
469  O O   . VAL A 59 ? 0.2368 0.1767 0.1402 0.0038  0.0092  0.0301  54  VAL A O   
470  C CB  . VAL A 59 ? 0.1710 0.1239 0.1079 0.0037  0.0054  0.0137  54  VAL A CB  
471  C CG1 . VAL A 59 ? 0.1689 0.1246 0.1202 0.0029  0.0054  0.0105  54  VAL A CG1 
472  C CG2 . VAL A 59 ? 0.1918 0.1424 0.1267 0.0063  -0.0017 0.0168  54  VAL A CG2 
473  N N   . LYS A 60 ? 0.2026 0.1522 0.1069 0.0012  0.0175  0.0179  55  LYS A N   
474  C CA  . LYS A 60 ? 0.2256 0.1729 0.1067 0.0016  0.0182  0.0193  55  LYS A CA  
475  C C   . LYS A 60 ? 0.2102 0.1622 0.0867 0.0030  0.0134  0.0095  55  LYS A C   
476  O O   . LYS A 60 ? 0.2231 0.1791 0.1114 0.0026  0.0169  0.0013  55  LYS A O   
477  C CB  . LYS A 60 ? 0.2595 0.2058 0.1325 -0.0019 0.0314  0.0210  55  LYS A CB  
478  C CG  . LYS A 60 ? 0.3405 0.2832 0.1836 -0.0020 0.0339  0.0232  55  LYS A CG  
479  C CD  . LYS A 60 ? 0.4171 0.3604 0.2538 -0.0060 0.0502  0.0226  55  LYS A CD  
480  C CE  . LYS A 60 ? 0.4482 0.4007 0.3007 -0.0060 0.0562  0.0093  55  LYS A CE  
481  N NZ  . LYS A 60 ? 0.5026 0.4573 0.3463 -0.0090 0.0728  0.0061  55  LYS A NZ  
482  N N   . GLU A 61 ? 0.2211 0.1723 0.0818 0.0047  0.0047  0.0101  56  GLU A N   
483  C CA  . GLU A 61 ? 0.2566 0.2119 0.1129 0.0049  -0.0007 -0.0007 56  GLU A CA  
484  C C   . GLU A 61 ? 0.2810 0.2362 0.1223 0.0031  0.0086  -0.0084 56  GLU A C   
485  O O   . GLU A 61 ? 0.2855 0.2376 0.1048 0.0021  0.0145  -0.0037 56  GLU A O   
486  C CB  . GLU A 61 ? 0.2797 0.2364 0.1237 0.0070  -0.0142 0.0013  56  GLU A CB  
487  C CG  . GLU A 61 ? 0.2964 0.2580 0.1377 0.0060  -0.0212 -0.0115 56  GLU A CG  
488  C CD  . GLU A 61 ? 0.3341 0.3001 0.1667 0.0079  -0.0367 -0.0103 56  GLU A CD  
489  O OE1 . GLU A 61 ? 0.3399 0.3044 0.1674 0.0113  -0.0421 0.0018  56  GLU A OE1 
490  O OE2 . GLU A 61 ? 0.3477 0.3190 0.1809 0.0062  -0.0440 -0.0217 56  GLU A OE2 
491  N N   . ILE A 62 ? 0.2567 0.2143 0.1097 0.0026  0.0112  -0.0201 57  ILE A N   
492  C CA  . ILE A 62 ? 0.3205 0.2778 0.1610 0.0015  0.0201  -0.0304 57  ILE A CA  
493  C C   . ILE A 62 ? 0.3810 0.3381 0.1975 0.0007  0.0120  -0.0374 57  ILE A C   
494  O O   . ILE A 62 ? 0.3728 0.3315 0.1976 0.0005  0.0019  -0.0446 57  ILE A O   
495  C CB  . ILE A 62 ? 0.3246 0.2827 0.1884 0.0023  0.0253  -0.0406 57  ILE A CB  
496  C CG1 . ILE A 62 ? 0.3288 0.2890 0.2153 0.0034  0.0316  -0.0340 57  ILE A CG1 
497  C CG2 . ILE A 62 ? 0.3341 0.2913 0.1867 0.0018  0.0350  -0.0536 57  ILE A CG2 
498  C CD1 . ILE A 62 ? 0.3177 0.2784 0.2273 0.0057  0.0352  -0.0418 57  ILE A CD1 
499  N N   . LYS A 63 ? 0.4666 0.4218 0.2527 -0.0003 0.0162  -0.0355 58  LYS A N   
500  C CA  . LYS A 63 ? 0.5512 0.5074 0.3105 -0.0011 0.0072  -0.0426 58  LYS A CA  
501  C C   . LYS A 63 ? 0.6010 0.5606 0.3523 -0.0022 0.0181  -0.0557 58  LYS A C   
502  O O   . LYS A 63 ? 0.6160 0.5740 0.3823 -0.0024 0.0223  -0.0694 58  LYS A O   
503  C CB  . LYS A 63 ? 0.5793 0.5382 0.3201 0.0001  0.0001  -0.0278 58  LYS A CB  
504  C CG  . LYS A 63 ? 0.5912 0.5476 0.3430 0.0030  -0.0120 -0.0156 58  LYS A CG  
505  C CD  . LYS A 63 ? 0.6287 0.5859 0.3663 0.0047  -0.0167 0.0004  58  LYS A CD  
506  C CE  . LYS A 63 ? 0.6203 0.5733 0.3740 0.0085  -0.0246 0.0130  58  LYS A CE  
507  N NZ  . LYS A 63 ? 0.6291 0.5895 0.3900 0.0116  -0.0433 0.0121  58  LYS A NZ  
508  N N   . ASN B 4  ? 0.4265 0.4331 0.5856 -0.1040 0.1277  0.0467  381 ASN B N   
509  C CA  . ASN B 4  ? 0.4340 0.4090 0.5460 -0.0910 0.1060  0.0542  381 ASN B CA  
510  C C   . ASN B 4  ? 0.3814 0.3576 0.4871 -0.0705 0.0919  0.0291  381 ASN B C   
511  O O   . ASN B 4  ? 0.4084 0.4085 0.5037 -0.0656 0.1043  0.0137  381 ASN B O   
512  C CB  . ASN B 4  ? 0.5186 0.4969 0.5738 -0.0990 0.1172  0.0763  381 ASN B CB  
513  C CG  . ASN B 4  ? 0.6118 0.5823 0.6679 -0.1218 0.1257  0.1115  381 ASN B CG  
514  O OD1 . ASN B 4  ? 0.6464 0.5816 0.7141 -0.1209 0.1028  0.1268  381 ASN B OD1 
515  N ND2 . ASN B 4  ? 0.6574 0.6662 0.6977 -0.1388 0.1493  0.1173  381 ASN B ND2 
516  N N   . LEU B 5  ? 0.2941 0.2452 0.4069 -0.0608 0.0671  0.0242  382 LEU B N   
517  C CA  . LEU B 5  ? 0.2428 0.1952 0.3502 -0.0457 0.0527  0.0061  382 LEU B CA  
518  C C   . LEU B 5  ? 0.2266 0.1613 0.2917 -0.0346 0.0427  0.0099  382 LEU B C   
519  O O   . LEU B 5  ? 0.2400 0.1511 0.2950 -0.0350 0.0358  0.0223  382 LEU B O   
520  C CB  . LEU B 5  ? 0.2429 0.1873 0.3810 -0.0462 0.0327  -0.0030 382 LEU B CB  
521  C CG  . LEU B 5  ? 0.2580 0.2222 0.4507 -0.0564 0.0356  -0.0064 382 LEU B CG  
522  C CD1 . LEU B 5  ? 0.2821 0.2397 0.4830 -0.0560 0.0083  -0.0115 382 LEU B CD1 
523  C CD2 . LEU B 5  ? 0.2479 0.2425 0.4664 -0.0506 0.0473  -0.0177 382 LEU B CD2 
524  N N   . PRO B 6  ? 0.2093 0.1550 0.2592 -0.0245 0.0406  -0.0014 383 PRO B N   
525  C CA  . PRO B 6  ? 0.1802 0.1147 0.1986 -0.0145 0.0309  0.0010  383 PRO B CA  
526  C C   . PRO B 6  ? 0.1839 0.1028 0.2077 -0.0085 0.0154  -0.0060 383 PRO B C   
527  O O   . PRO B 6  ? 0.1836 0.1054 0.2249 -0.0116 0.0086  -0.0150 383 PRO B O   
528  C CB  . PRO B 6  ? 0.1832 0.1372 0.1926 -0.0091 0.0347  -0.0115 383 PRO B CB  
529  C CG  . PRO B 6  ? 0.1922 0.1594 0.2404 -0.0112 0.0373  -0.0243 383 PRO B CG  
530  C CD  . PRO B 6  ? 0.1994 0.1683 0.2707 -0.0220 0.0464  -0.0175 383 PRO B CD  
531  N N   . THR B 7  ? 0.1771 0.0823 0.1871 -0.0012 0.0096  -0.0021 384 THR B N   
532  C CA  . THR B 7  ? 0.1709 0.0689 0.1818 0.0046  0.0011  -0.0149 384 THR B CA  
533  C C   . THR B 7  ? 0.1774 0.0893 0.1743 0.0129  -0.0008 -0.0185 384 THR B C   
534  O O   . THR B 7  ? 0.2202 0.1354 0.2078 0.0181  -0.0008 -0.0099 384 THR B O   
535  C CB  . THR B 7  ? 0.2052 0.0797 0.2273 0.0082  -0.0018 -0.0143 384 THR B CB  
536  O OG1 . THR B 7  ? 0.2287 0.0882 0.2694 -0.0020 -0.0020 -0.0139 384 THR B OG1 
537  C CG2 . THR B 7  ? 0.2079 0.0820 0.2303 0.0148  -0.0039 -0.0342 384 THR B CG2 
538  N N   . ALA B 8  ? 0.1445 0.0657 0.1396 0.0115  -0.0046 -0.0286 385 ALA B N   
539  C CA  . ALA B 8  ? 0.1696 0.1045 0.1580 0.0163  -0.0063 -0.0302 385 ALA B CA  
540  C C   . ALA B 8  ? 0.1638 0.0969 0.1529 0.0251  -0.0053 -0.0326 385 ALA B C   
541  O O   . ALA B 8  ? 0.1889 0.1126 0.1847 0.0266  -0.0028 -0.0412 385 ALA B O   
542  C CB  . ALA B 8  ? 0.1697 0.1142 0.1575 0.0089  -0.0118 -0.0336 385 ALA B CB  
543  N N   . PRO B 9  ? 0.1524 0.0953 0.1408 0.0311  -0.0081 -0.0276 386 PRO B N   
544  C CA  . PRO B 9  ? 0.1653 0.1106 0.1675 0.0406  -0.0099 -0.0289 386 PRO B CA  
545  C C   . PRO B 9  ? 0.1697 0.1273 0.1793 0.0394  -0.0028 -0.0435 386 PRO B C   
546  O O   . PRO B 9  ? 0.1976 0.1648 0.1949 0.0297  -0.0013 -0.0454 386 PRO B O   
547  C CB  . PRO B 9  ? 0.1902 0.1483 0.1887 0.0434  -0.0183 -0.0208 386 PRO B CB  
548  C CG  . PRO B 9  ? 0.1885 0.1464 0.1671 0.0358  -0.0175 -0.0176 386 PRO B CG  
549  C CD  . PRO B 9  ? 0.1654 0.1188 0.1461 0.0292  -0.0107 -0.0242 386 PRO B CD  
550  N N   . PRO B 10 ? 0.2077 0.1661 0.2403 0.0479  0.0023  -0.0535 387 PRO B N   
551  C CA  . PRO B 10 ? 0.2209 0.1987 0.2575 0.0438  0.0152  -0.0710 387 PRO B CA  
552  C C   . PRO B 10 ? 0.2108 0.2130 0.2466 0.0390  0.0143  -0.0642 387 PRO B C   
553  O O   . PRO B 10 ? 0.1946 0.2001 0.2417 0.0450  0.0033  -0.0530 387 PRO B O   
554  C CB  . PRO B 10 ? 0.2577 0.2355 0.3276 0.0537  0.0204  -0.0780 387 PRO B CB  
555  C CG  . PRO B 10 ? 0.2843 0.2346 0.3609 0.0590  0.0108  -0.0671 387 PRO B CG  
556  C CD  . PRO B 10 ? 0.2471 0.1890 0.3048 0.0581  -0.0017 -0.0492 387 PRO B CD  
557  N N   . ARG B 11 ? 0.2213 0.2405 0.2426 0.0256  0.0244  -0.0700 388 ARG B N   
558  C CA  . ARG B 11 ? 0.1847 0.2280 0.2137 0.0183  0.0256  -0.0626 388 ARG B CA  
559  C C   . ARG B 11 ? 0.1829 0.2490 0.2504 0.0271  0.0372  -0.0746 388 ARG B C   
560  O O   . ARG B 11 ? 0.2007 0.2670 0.2863 0.0361  0.0491  -0.0933 388 ARG B O   
561  C CB  . ARG B 11 ? 0.1791 0.2348 0.1794 -0.0030 0.0318  -0.0582 388 ARG B CB  
562  C CG  . ARG B 11 ? 0.1981 0.2356 0.1726 -0.0127 0.0168  -0.0439 388 ARG B CG  
563  C CD  . ARG B 11 ? 0.1734 0.2016 0.1645 -0.0090 0.0007  -0.0290 388 ARG B CD  
564  N NE  . ARG B 11 ? 0.1702 0.2148 0.1796 -0.0157 -0.0007 -0.0199 388 ARG B NE  
565  C CZ  . ARG B 11 ? 0.1938 0.2443 0.2008 -0.0332 -0.0066 -0.0025 388 ARG B CZ  
566  N NH1 . ARG B 11 ? 0.1873 0.2305 0.1715 -0.0454 -0.0139 0.0088  388 ARG B NH1 
567  N NH2 . ARG B 11 ? 0.1367 0.2003 0.1678 -0.0400 -0.0081 0.0063  388 ARG B NH2 
568  N N   . ARG B 12 ? 0.1604 0.2468 0.2493 0.0244  0.0336  -0.0662 389 ARG B N   
569  C CA  . ARG B 12 ? 0.2002 0.3148 0.3372 0.0319  0.0437  -0.0767 389 ARG B CA  
570  C C   . ARG B 12 ? 0.2819 0.4227 0.4204 0.0224  0.0741  -0.0969 389 ARG B C   
571  O O   . ARG B 12 ? 0.2927 0.4348 0.4578 0.0318  0.0819  -0.1093 389 ARG B O   
572  C CB  . ARG B 12 ? 0.1845 0.3176 0.3453 0.0265  0.0325  -0.0635 389 ARG B CB  
573  C CG  . ARG B 12 ? 0.1880 0.3513 0.4106 0.0364  0.0363  -0.0717 389 ARG B CG  
574  C CD  . ARG B 12 ? 0.1777 0.3497 0.4246 0.0347  0.0132  -0.0583 389 ARG B CD  
575  N NE  . ARG B 12 ? 0.2102 0.3838 0.4906 0.0479  0.0009  -0.0562 389 ARG B NE  
576  C CZ  . ARG B 12 ? 0.2059 0.4047 0.5273 0.0478  0.0118  -0.0612 389 ARG B CZ  
577  N NH1 . ARG B 12 ? 0.2361 0.4621 0.5652 0.0339  0.0377  -0.0678 389 ARG B NH1 
578  N NH2 . ARG B 12 ? 0.1719 0.3708 0.5262 0.0598  -0.0033 -0.0578 389 ARG B NH2 
579  N N   . ARG B 13 ? 0.3297 0.4790 0.4259 -0.0005 0.0829  -0.0898 390 ARG B N   
580  C CA  . ARG B 13 ? 0.4143 0.5822 0.4853 -0.0160 0.1081  -0.1050 390 ARG B CA  
581  C C   . ARG B 13 ? 0.4711 0.6622 0.5815 -0.0114 0.1254  -0.1189 390 ARG B C   
582  O O   . ARG B 13 ? 0.5241 0.7105 0.6374 -0.0060 0.1363  -0.1401 390 ARG B O   
583  C CB  . ARG B 13 ? 0.4330 0.5713 0.4723 -0.0125 0.1053  -0.1184 390 ARG B CB  
584  N N   . GLY C 1  ? 0.2350 0.3370 0.1461 -0.0314 0.0510  -0.0497 -4  GLY C N   
585  C CA  . GLY C 1  ? 0.2251 0.3312 0.1444 -0.0242 0.0535  -0.0433 -4  GLY C CA  
586  C C   . GLY C 1  ? 0.2579 0.3546 0.1792 -0.0188 0.0629  -0.0537 -4  GLY C C   
587  O O   . GLY C 1  ? 0.2469 0.3312 0.1637 -0.0201 0.0676  -0.0657 -4  GLY C O   
588  N N   . PRO C 2  ? 0.2509 0.3542 0.1806 -0.0125 0.0660  -0.0480 -3  PRO C N   
589  C CA  . PRO C 2  ? 0.2584 0.3535 0.1929 -0.0058 0.0756  -0.0558 -3  PRO C CA  
590  C C   . PRO C 2  ? 0.2613 0.3312 0.2023 0.0010  0.0797  -0.0630 -3  PRO C C   
591  O O   . PRO C 2  ? 0.1970 0.2556 0.1407 0.0015  0.0732  -0.0593 -3  PRO C O   
592  C CB  . PRO C 2  ? 0.2634 0.3729 0.2083 -0.0008 0.0753  -0.0439 -3  PRO C CB  
593  C CG  . PRO C 2  ? 0.2420 0.3518 0.1920 -0.0021 0.0631  -0.0293 -3  PRO C CG  
594  C CD  . PRO C 2  ? 0.2428 0.3571 0.1816 -0.0107 0.0585  -0.0311 -3  PRO C CD  
595  N N   . LEU C 3  ? 0.2717 0.3315 0.2170 0.0067  0.0884  -0.0704 -2  LEU C N   
596  C CA  . LEU C 3  ? 0.2924 0.3292 0.2466 0.0135  0.0917  -0.0748 -2  LEU C CA  
597  C C   . LEU C 3  ? 0.3064 0.3379 0.2737 0.0199  0.0889  -0.0655 -2  LEU C C   
598  O O   . LEU C 3  ? 0.3162 0.3584 0.2920 0.0240  0.0862  -0.0542 -2  LEU C O   
599  C CB  . LEU C 3  ? 0.2416 0.2732 0.2025 0.0202  0.1016  -0.0805 -2  LEU C CB  
600  C CG  . LEU C 3  ? 0.2853 0.3148 0.2353 0.0144  0.1065  -0.0929 -2  LEU C CG  
601  C CD1 . LEU C 3  ? 0.3069 0.3338 0.2653 0.0222  0.1170  -0.0971 -2  LEU C CD1 
602  C CD2 . LEU C 3  ? 0.3089 0.3214 0.2545 0.0091  0.1038  -0.1004 -2  LEU C CD2 
603  N N   . GLY C 4  ? 0.3020 0.3163 0.2714 0.0204  0.0849  -0.0660 -1  GLY C N   
604  C CA  . GLY C 4  ? 0.3166 0.3236 0.2985 0.0262  0.0780  -0.0541 -1  GLY C CA  
605  C C   . GLY C 4  ? 0.3265 0.3403 0.3059 0.0224  0.0655  -0.0431 -1  GLY C C   
606  O O   . GLY C 4  ? 0.3367 0.3483 0.3254 0.0259  0.0599  -0.0333 -1  GLY C O   
607  N N   . SER C 5  ? 0.2998 0.3229 0.2676 0.0147  0.0614  -0.0443 0   SER C N   
608  C CA  . SER C 5  ? 0.2775 0.3058 0.2448 0.0115  0.0510  -0.0339 0   SER C CA  
609  C C   . SER C 5  ? 0.2711 0.2842 0.2406 0.0122  0.0456  -0.0327 0   SER C C   
610  O O   . SER C 5  ? 0.2617 0.2632 0.2281 0.0118  0.0483  -0.0406 0   SER C O   
611  C CB  . SER C 5  ? 0.2970 0.3396 0.2535 0.0034  0.0485  -0.0340 0   SER C CB  
612  O OG  . SER C 5  ? 0.3250 0.3849 0.2792 0.0020  0.0530  -0.0338 0   SER C OG  
613  N N   . MET C 6  ? 0.2600 0.2732 0.2346 0.0125  0.0382  -0.0231 1   MET C N   
614  C CA  A MET C 6  ? 0.2536 0.2547 0.2294 0.0126  0.0332  -0.0219 1   MET C CA  
615  C CA  B MET C 6  ? 0.2532 0.2545 0.2291 0.0125  0.0331  -0.0218 1   MET C CA  
616  C C   . MET C 6  ? 0.2307 0.2312 0.1978 0.0072  0.0303  -0.0247 1   MET C C   
617  O O   . MET C 6  ? 0.2577 0.2702 0.2196 0.0028  0.0294  -0.0230 1   MET C O   
618  C CB  A MET C 6  ? 0.2569 0.2587 0.2396 0.0132  0.0273  -0.0127 1   MET C CB  
619  C CB  B MET C 6  ? 0.2570 0.2594 0.2396 0.0131  0.0272  -0.0125 1   MET C CB  
620  C CG  A MET C 6  ? 0.2565 0.2577 0.2483 0.0176  0.0286  -0.0093 1   MET C CG  
621  C CG  B MET C 6  ? 0.2646 0.2705 0.2562 0.0169  0.0288  -0.0080 1   MET C CG  
622  S SD  A MET C 6  ? 0.2583 0.2575 0.2552 0.0156  0.0213  -0.0018 1   MET C SD  
623  S SD  B MET C 6  ? 0.3029 0.3090 0.3003 0.0147  0.0217  0.0006  1   MET C SD  
624  C CE  A MET C 6  ? 0.1540 0.1631 0.1608 0.0182  0.0228  0.0048  1   MET C CE  
625  C CE  B MET C 6  ? 0.1869 0.1801 0.1799 0.0130  0.0180  -0.0029 1   MET C CE  
626  N N   . VAL C 7  ? 0.1827 0.1714 0.1492 0.0074  0.0287  -0.0276 2   VAL C N   
627  C CA  . VAL C 7  ? 0.1717 0.1596 0.1310 0.0026  0.0260  -0.0298 2   VAL C CA  
628  C C   . VAL C 7  ? 0.1778 0.1611 0.1408 0.0031  0.0200  -0.0234 2   VAL C C   
629  O O   . VAL C 7  ? 0.1924 0.1670 0.1607 0.0065  0.0189  -0.0223 2   VAL C O   
630  C CB  . VAL C 7  ? 0.2065 0.1841 0.1616 0.0014  0.0301  -0.0395 2   VAL C CB  
631  C CG1 . VAL C 7  ? 0.2305 0.2092 0.1783 -0.0047 0.0266  -0.0409 2   VAL C CG1 
632  C CG2 . VAL C 7  ? 0.2370 0.2174 0.1884 0.0005  0.0380  -0.0480 2   VAL C CG2 
633  N N   . ASP C 8  ? 0.1671 0.1577 0.1280 -0.0003 0.0166  -0.0187 3   ASP C N   
634  C CA  . ASP C 8  ? 0.1646 0.1508 0.1295 0.0004  0.0124  -0.0135 3   ASP C CA  
635  C C   . ASP C 8  ? 0.1534 0.1410 0.1136 -0.0032 0.0106  -0.0142 3   ASP C C   
636  O O   . ASP C 8  ? 0.1645 0.1616 0.1184 -0.0077 0.0113  -0.0158 3   ASP C O   
637  C CB  . ASP C 8  ? 0.1790 0.1718 0.1502 0.0006  0.0105  -0.0049 3   ASP C CB  
638  C CG  . ASP C 8  ? 0.2399 0.2325 0.2163 0.0029  0.0115  -0.0032 3   ASP C CG  
639  O OD1 . ASP C 8  ? 0.2564 0.2422 0.2337 0.0053  0.0125  -0.0069 3   ASP C OD1 
640  O OD2 . ASP C 8  ? 0.2518 0.2523 0.2324 0.0020  0.0110  0.0032  3   ASP C OD2 
641  N N   . TYR C 9  ? 0.1524 0.1326 0.1153 -0.0017 0.0084  -0.0128 4   TYR C N   
642  C CA  . TYR C 9  ? 0.1349 0.1172 0.0949 -0.0047 0.0065  -0.0119 4   TYR C CA  
643  C C   . TYR C 9  ? 0.1548 0.1378 0.1217 -0.0027 0.0046  -0.0045 4   TYR C C   
644  O O   . TYR C 9  ? 0.1598 0.1353 0.1320 0.0007  0.0049  -0.0038 4   TYR C O   
645  C CB  . TYR C 9  ? 0.1371 0.1091 0.0939 -0.0049 0.0068  -0.0183 4   TYR C CB  
646  C CG  . TYR C 9  ? 0.1538 0.1245 0.1040 -0.0084 0.0097  -0.0262 4   TYR C CG  
647  C CD1 . TYR C 9  ? 0.1949 0.1686 0.1386 -0.0143 0.0091  -0.0293 4   TYR C CD1 
648  C CD2 . TYR C 9  ? 0.1728 0.1393 0.1237 -0.0061 0.0136  -0.0309 4   TYR C CD2 
649  C CE1 . TYR C 9  ? 0.2004 0.1709 0.1377 -0.0187 0.0128  -0.0384 4   TYR C CE1 
650  C CE2 . TYR C 9  ? 0.2009 0.1640 0.1467 -0.0090 0.0181  -0.0395 4   TYR C CE2 
651  C CZ  . TYR C 9  ? 0.2165 0.1809 0.1551 -0.0157 0.0178  -0.0441 4   TYR C CZ  
652  O OH  . TYR C 9  ? 0.2664 0.2258 0.1995 -0.0198 0.0232  -0.0545 4   TYR C OH  
653  N N   . ILE C 10 ? 0.1376 0.1303 0.1050 -0.0051 0.0032  0.0010  5   ILE C N   
654  C CA  A ILE C 10 ? 0.1533 0.1460 0.1294 -0.0023 0.0029  0.0082  5   ILE C CA  
655  C CA  B ILE C 10 ? 0.1558 0.1493 0.1318 -0.0025 0.0028  0.0086  5   ILE C CA  
656  C C   . ILE C 10 ? 0.1487 0.1371 0.1231 -0.0024 0.0019  0.0062  5   ILE C C   
657  O O   . ILE C 10 ? 0.1721 0.1650 0.1400 -0.0066 0.0005  0.0041  5   ILE C O   
658  C CB  A ILE C 10 ? 0.1676 0.1762 0.1497 -0.0037 0.0024  0.0193  5   ILE C CB  
659  C CB  B ILE C 10 ? 0.1695 0.1797 0.1502 -0.0046 0.0020  0.0192  5   ILE C CB  
660  C CG1 A ILE C 10 ? 0.1869 0.1935 0.1817 0.0008  0.0039  0.0275  5   ILE C CG1 
661  C CG1 B ILE C 10 ? 0.1753 0.1937 0.1583 -0.0053 0.0026  0.0232  5   ILE C CG1 
662  C CG2 A ILE C 10 ? 0.1681 0.1914 0.1429 -0.0100 0.0002  0.0205  5   ILE C CG2 
663  C CG2 B ILE C 10 ? 0.1701 0.1802 0.1628 -0.0006 0.0031  0.0278  5   ILE C CG2 
664  C CD1 A ILE C 10 ? 0.2191 0.2412 0.2240 0.0006  0.0041  0.0410  5   ILE C CD1 
665  C CD1 B ILE C 10 ? 0.2073 0.2470 0.1929 -0.0092 0.0012  0.0342  5   ILE C CD1 
666  N N   . VAL C 11 ? 0.1252 0.1051 0.1051 0.0014  0.0031  0.0063  6   VAL C N   
667  C CA  . VAL C 11 ? 0.1222 0.0991 0.1009 0.0016  0.0026  0.0049  6   VAL C CA  
668  C C   . VAL C 11 ? 0.1420 0.1301 0.1261 0.0014  0.0024  0.0135  6   VAL C C   
669  O O   . VAL C 11 ? 0.1471 0.1384 0.1412 0.0046  0.0047  0.0207  6   VAL C O   
670  C CB  . VAL C 11 ? 0.1185 0.0846 0.1001 0.0049  0.0045  0.0012  6   VAL C CB  
671  C CG1 . VAL C 11 ? 0.1322 0.0981 0.1132 0.0051  0.0043  0.0009  6   VAL C CG1 
672  C CG2 . VAL C 11 ? 0.1515 0.1104 0.1285 0.0044  0.0039  -0.0052 6   VAL C CG2 
673  N N   . GLU C 12 ? 0.1504 0.1449 0.1293 -0.0026 0.0000  0.0137  7   GLU C N   
674  C CA  . GLU C 12 ? 0.1607 0.1694 0.1448 -0.0038 -0.0008 0.0233  7   GLU C CA  
675  C C   . GLU C 12 ? 0.1425 0.1495 0.1298 -0.0016 -0.0002 0.0244  7   GLU C C   
676  O O   . GLU C 12 ? 0.1458 0.1639 0.1413 -0.0002 0.0005  0.0339  7   GLU C O   
677  C CB  . GLU C 12 ? 0.1747 0.1969 0.1506 -0.0119 -0.0043 0.0241  7   GLU C CB  
678  C CG  . GLU C 12 ? 0.1907 0.2194 0.1632 -0.0149 -0.0045 0.0239  7   GLU C CG  
679  C CD  . GLU C 12 ? 0.2250 0.2674 0.2086 -0.0125 -0.0038 0.0370  7   GLU C CD  
680  O OE1 . GLU C 12 ? 0.2025 0.2514 0.1970 -0.0091 -0.0030 0.0470  7   GLU C OE1 
681  O OE2 . GLU C 12 ? 0.2542 0.3013 0.2371 -0.0136 -0.0035 0.0380  7   GLU C OE2 
682  N N   . TYR C 13 ? 0.1245 0.1195 0.1063 -0.0013 -0.0002 0.0159  8   TYR C N   
683  C CA  . TYR C 13 ? 0.1373 0.1312 0.1210 0.0002  0.0005  0.0163  8   TYR C CA  
684  C C   . TYR C 13 ? 0.1233 0.1044 0.1055 0.0031  0.0024  0.0089  8   TYR C C   
685  O O   . TYR C 13 ? 0.1421 0.1156 0.1189 0.0018  0.0013  0.0029  8   TYR C O   
686  C CB  . TYR C 13 ? 0.1073 0.1060 0.0841 -0.0059 -0.0034 0.0155  8   TYR C CB  
687  C CG  . TYR C 13 ? 0.1536 0.1680 0.1302 -0.0111 -0.0059 0.0224  8   TYR C CG  
688  C CD1 . TYR C 13 ? 0.1668 0.1841 0.1357 -0.0174 -0.0081 0.0191  8   TYR C CD1 
689  C CD2 . TYR C 13 ? 0.1805 0.2087 0.1648 -0.0102 -0.0058 0.0326  8   TYR C CD2 
690  C CE1 . TYR C 13 ? 0.1625 0.1974 0.1297 -0.0240 -0.0107 0.0253  8   TYR C CE1 
691  C CE2 . TYR C 13 ? 0.1935 0.2400 0.1778 -0.0161 -0.0087 0.0407  8   TYR C CE2 
692  C CZ  . TYR C 13 ? 0.2003 0.2506 0.1754 -0.0237 -0.0115 0.0367  8   TYR C CZ  
693  O OH  . TYR C 13 ? 0.2456 0.3169 0.2193 -0.0314 -0.0147 0.0445  8   TYR C OH  
694  N N   . ASP C 14 ? 0.1422 0.1227 0.1294 0.0066  0.0057  0.0097  9   ASP C N   
695  C CA  . ASP C 14 ? 0.1668 0.1389 0.1515 0.0076  0.0075  0.0028  9   ASP C CA  
696  C C   . ASP C 14 ? 0.1429 0.1142 0.1202 0.0038  0.0035  -0.0002 9   ASP C C   
697  O O   . ASP C 14 ? 0.1529 0.1299 0.1287 0.0011  0.0009  0.0030  9   ASP C O   
698  C CB  . ASP C 14 ? 0.1727 0.1459 0.1635 0.0113  0.0128  0.0033  9   ASP C CB  
699  C CG  . ASP C 14 ? 0.1951 0.1660 0.1964 0.0160  0.0185  0.0060  9   ASP C CG  
700  O OD1 . ASP C 14 ? 0.1781 0.1446 0.1811 0.0162  0.0185  0.0061  9   ASP C OD1 
701  O OD2 . ASP C 14 ? 0.2057 0.1791 0.2148 0.0197  0.0238  0.0086  9   ASP C OD2 
702  N N   . TYR C 15 ? 0.1412 0.1063 0.1150 0.0032  0.0032  -0.0054 10  TYR C N   
703  C CA  . TYR C 15 ? 0.1358 0.1007 0.1056 0.0004  0.0002  -0.0064 10  TYR C CA  
704  C C   . TYR C 15 ? 0.1494 0.1133 0.1178 0.0002  0.0014  -0.0099 10  TYR C C   
705  O O   . TYR C 15 ? 0.1650 0.1252 0.1334 0.0007  0.0027  -0.0130 10  TYR C O   
706  C CB  . TYR C 15 ? 0.1481 0.1086 0.1156 -0.0018 -0.0025 -0.0072 10  TYR C CB  
707  C CG  . TYR C 15 ? 0.1507 0.1094 0.1173 -0.0039 -0.0047 -0.0068 10  TYR C CG  
708  C CD1 . TYR C 15 ? 0.1602 0.1212 0.1268 -0.0068 -0.0066 -0.0041 10  TYR C CD1 
709  C CD2 . TYR C 15 ? 0.1468 0.1028 0.1143 -0.0033 -0.0049 -0.0077 10  TYR C CD2 
710  C CE1 . TYR C 15 ? 0.1597 0.1187 0.1279 -0.0086 -0.0082 -0.0022 10  TYR C CE1 
711  C CE2 . TYR C 15 ? 0.1473 0.1032 0.1171 -0.0048 -0.0066 -0.0048 10  TYR C CE2 
712  C CZ  . TYR C 15 ? 0.1583 0.1150 0.1289 -0.0072 -0.0080 -0.0021 10  TYR C CZ  
713  O OH  . TYR C 15 ? 0.1722 0.1283 0.1472 -0.0086 -0.0094 0.0021  10  TYR C OH  
714  N N   . ASP C 16 ? 0.1517 0.1211 0.1189 -0.0014 0.0009  -0.0090 11  ASP C N   
715  C CA  . ASP C 16 ? 0.1716 0.1445 0.1363 -0.0034 0.0012  -0.0114 11  ASP C CA  
716  C C   . ASP C 16 ? 0.1419 0.1162 0.1067 -0.0057 -0.0030 -0.0077 11  ASP C C   
717  O O   . ASP C 16 ? 0.1525 0.1279 0.1188 -0.0066 -0.0053 -0.0034 11  ASP C O   
718  C CB  . ASP C 16 ? 0.1823 0.1633 0.1458 -0.0044 0.0036  -0.0118 11  ASP C CB  
719  C CG  . ASP C 16 ? 0.2009 0.1800 0.1660 -0.0018 0.0099  -0.0165 11  ASP C CG  
720  O OD1 . ASP C 16 ? 0.2041 0.1898 0.1684 -0.0022 0.0133  -0.0181 11  ASP C OD1 
721  O OD2 . ASP C 16 ? 0.2027 0.1742 0.1708 0.0007  0.0121  -0.0183 11  ASP C OD2 
722  N N   . ALA C 17 ? 0.1591 0.1339 0.1234 -0.0069 -0.0036 -0.0087 12  ALA C N   
723  C CA  . ALA C 17 ? 0.1614 0.1388 0.1288 -0.0081 -0.0068 -0.0033 12  ALA C CA  
724  C C   . ALA C 17 ? 0.1737 0.1605 0.1421 -0.0107 -0.0088 0.0023  12  ALA C C   
725  O O   . ALA C 17 ? 0.2110 0.2075 0.1756 -0.0133 -0.0080 0.0010  12  ALA C O   
726  C CB  . ALA C 17 ? 0.1623 0.1438 0.1296 -0.0098 -0.0072 -0.0038 12  ALA C CB  
727  N N   . VAL C 18 ? 0.1779 0.1620 0.1519 -0.0104 -0.0109 0.0083  13  VAL C N   
728  C CA  . VAL C 18 ? 0.1752 0.1681 0.1525 -0.0130 -0.0132 0.0158  13  VAL C CA  
729  C C   . VAL C 18 ? 0.1889 0.1882 0.1733 -0.0138 -0.0152 0.0240  13  VAL C C   
730  O O   . VAL C 18 ? 0.2160 0.2284 0.2034 -0.0167 -0.0174 0.0318  13  VAL C O   
731  C CB  . VAL C 18 ? 0.2376 0.2227 0.2182 -0.0129 -0.0138 0.0180  13  VAL C CB  
732  C CG1 . VAL C 18 ? 0.2589 0.2526 0.2448 -0.0158 -0.0163 0.0272  13  VAL C CG1 
733  C CG2 . VAL C 18 ? 0.2514 0.2343 0.2264 -0.0125 -0.0124 0.0126  13  VAL C CG2 
734  N N   . HIS C 19 ? 0.1703 0.1622 0.1587 -0.0111 -0.0143 0.0235  14  HIS C N   
735  C CA  . HIS C 19 ? 0.1501 0.1495 0.1474 -0.0109 -0.0156 0.0324  14  HIS C CA  
736  C C   . HIS C 19 ? 0.1457 0.1481 0.1396 -0.0109 -0.0151 0.0285  14  HIS C C   
737  O O   . HIS C 19 ? 0.1604 0.1536 0.1481 -0.0094 -0.0131 0.0194  14  HIS C O   
738  C CB  . HIS C 19 ? 0.1640 0.1515 0.1730 -0.0072 -0.0141 0.0374  14  HIS C CB  
739  C CG  . HIS C 19 ? 0.1938 0.1761 0.2066 -0.0083 -0.0144 0.0405  14  HIS C CG  
740  N ND1 . HIS C 19 ? 0.2358 0.2047 0.2437 -0.0084 -0.0129 0.0326  14  HIS C ND1 
741  C CD2 . HIS C 19 ? 0.2377 0.2282 0.2588 -0.0103 -0.0164 0.0513  14  HIS C CD2 
742  C CE1 . HIS C 19 ? 0.2219 0.1900 0.2346 -0.0108 -0.0139 0.0377  14  HIS C CE1 
743  N NE2 . HIS C 19 ? 0.2271 0.2074 0.2482 -0.0116 -0.0158 0.0492  14  HIS C NE2 
744  N N   . ASP C 20 ? 0.1498 0.1667 0.1486 -0.0130 -0.0170 0.0367  15  ASP C N   
745  C CA  . ASP C 20 ? 0.1441 0.1679 0.1385 -0.0153 -0.0173 0.0334  15  ASP C CA  
746  C C   . ASP C 20 ? 0.1571 0.1685 0.1550 -0.0104 -0.0149 0.0302  15  ASP C C   
747  O O   . ASP C 20 ? 0.1561 0.1687 0.1486 -0.0121 -0.0146 0.0247  15  ASP C O   
748  C CB  . ASP C 20 ? 0.1337 0.1799 0.1330 -0.0201 -0.0206 0.0447  15  ASP C CB  
749  C CG  . ASP C 20 ? 0.1768 0.2399 0.1685 -0.0273 -0.0228 0.0454  15  ASP C CG  
750  O OD1 . ASP C 20 ? 0.2224 0.3075 0.2164 -0.0329 -0.0259 0.0547  15  ASP C OD1 
751  O OD2 . ASP C 20 ? 0.2223 0.2787 0.2060 -0.0276 -0.0211 0.0372  15  ASP C OD2 
752  N N   . ASP C 21 ? 0.1402 0.1396 0.1471 -0.0048 -0.0128 0.0331  16  ASP C N   
753  C CA  . ASP C 21 ? 0.1290 0.1176 0.1387 -0.0002 -0.0097 0.0293  16  ASP C CA  
754  C C   . ASP C 21 ? 0.1415 0.1162 0.1418 0.0007  -0.0076 0.0175  16  ASP C C   
755  O O   . ASP C 21 ? 0.1628 0.1297 0.1637 0.0038  -0.0051 0.0136  16  ASP C O   
756  C CB  . ASP C 21 ? 0.1231 0.1049 0.1472 0.0051  -0.0067 0.0364  16  ASP C CB  
757  C CG  . ASP C 21 ? 0.1997 0.1674 0.2248 0.0062  -0.0047 0.0333  16  ASP C CG  
758  O OD1 . ASP C 21 ? 0.2324 0.1889 0.2673 0.0103  -0.0004 0.0344  16  ASP C OD1 
759  O OD2 . ASP C 21 ? 0.1925 0.1603 0.2089 0.0027  -0.0069 0.0294  16  ASP C OD2 
760  N N   . GLU C 22 ? 0.1349 0.1087 0.1271 -0.0019 -0.0086 0.0128  17  GLU C N   
761  C CA  . GLU C 22 ? 0.1228 0.0867 0.1080 -0.0011 -0.0069 0.0043  17  GLU C CA  
762  C C   . GLU C 22 ? 0.1539 0.1201 0.1322 -0.0028 -0.0066 -0.0014 17  GLU C C   
763  O O   . GLU C 22 ? 0.1725 0.1475 0.1479 -0.0063 -0.0076 -0.0014 17  GLU C O   
764  C CB  . GLU C 22 ? 0.1333 0.0950 0.1162 -0.0024 -0.0075 0.0039  17  GLU C CB  
765  C CG  . GLU C 22 ? 0.1431 0.0991 0.1331 -0.0016 -0.0072 0.0083  17  GLU C CG  
766  C CD  . GLU C 22 ? 0.1601 0.1161 0.1481 -0.0041 -0.0085 0.0090  17  GLU C CD  
767  O OE1 . GLU C 22 ? 0.1813 0.1423 0.1627 -0.0057 -0.0093 0.0063  17  GLU C OE1 
768  O OE2 . GLU C 22 ? 0.1742 0.1251 0.1684 -0.0046 -0.0082 0.0126  17  GLU C OE2 
769  N N   . LEU C 23 ? 0.1510 0.1095 0.1270 -0.0009 -0.0047 -0.0062 18  LEU C N   
770  C CA  . LEU C 23 ? 0.1502 0.1082 0.1220 -0.0018 -0.0034 -0.0110 18  LEU C CA  
771  C C   . LEU C 23 ? 0.1559 0.1139 0.1246 -0.0024 -0.0026 -0.0130 18  LEU C C   
772  O O   . LEU C 23 ? 0.1493 0.1059 0.1181 -0.0018 -0.0032 -0.0114 18  LEU C O   
773  C CB  . LEU C 23 ? 0.1369 0.0890 0.1092 0.0006  -0.0018 -0.0131 18  LEU C CB  
774  C CG  . LEU C 23 ? 0.1417 0.0942 0.1175 0.0019  -0.0015 -0.0115 18  LEU C CG  
775  C CD1 . LEU C 23 ? 0.1667 0.1153 0.1420 0.0037  0.0003  -0.0136 18  LEU C CD1 
776  C CD2 . LEU C 23 ? 0.1556 0.1146 0.1321 -0.0008 -0.0024 -0.0106 18  LEU C CD2 
777  N N   . THR C 24 ? 0.1426 0.1020 0.1091 -0.0040 -0.0006 -0.0168 19  THR C N   
778  C CA  . THR C 24 ? 0.1519 0.1097 0.1177 -0.0029 0.0021  -0.0190 19  THR C CA  
779  C C   . THR C 24 ? 0.1638 0.1156 0.1325 -0.0004 0.0045  -0.0199 19  THR C C   
780  O O   . THR C 24 ? 0.1620 0.1113 0.1317 -0.0012 0.0058  -0.0222 19  THR C O   
781  C CB  . THR C 24 ? 0.1593 0.1215 0.1223 -0.0060 0.0047  -0.0232 19  THR C CB  
782  O OG1 . THR C 24 ? 0.1683 0.1394 0.1289 -0.0088 0.0020  -0.0204 19  THR C OG1 
783  C CG2 . THR C 24 ? 0.1841 0.1435 0.1491 -0.0035 0.0094  -0.0255 19  THR C CG2 
784  N N   . ILE C 25 ? 0.1670 0.1182 0.1377 0.0020  0.0048  -0.0171 20  ILE C N   
785  C CA  . ILE C 25 ? 0.1500 0.0989 0.1243 0.0041  0.0062  -0.0153 20  ILE C CA  
786  C C   . ILE C 25 ? 0.1508 0.1012 0.1302 0.0065  0.0094  -0.0127 20  ILE C C   
787  O O   . ILE C 25 ? 0.1463 0.1003 0.1255 0.0068  0.0098  -0.0115 20  ILE C O   
788  C CB  . ILE C 25 ? 0.1398 0.0900 0.1126 0.0039  0.0034  -0.0130 20  ILE C CB  
789  C CG1 . ILE C 25 ? 0.1321 0.0857 0.1029 0.0028  0.0017  -0.0108 20  ILE C CG1 
790  C CG2 . ILE C 25 ? 0.1504 0.0986 0.1210 0.0028  0.0016  -0.0148 20  ILE C CG2 
791  C CD1 . ILE C 25 ? 0.1435 0.0970 0.1113 0.0008  -0.0002 -0.0110 20  ILE C CD1 
792  N N   . ARG C 26 ? 0.1695 0.1180 0.1548 0.0085  0.0120  -0.0105 21  ARG C N   
793  C CA  . ARG C 26 ? 0.1459 0.0958 0.1399 0.0119  0.0163  -0.0061 21  ARG C CA  
794  C C   . ARG C 26 ? 0.1261 0.0811 0.1255 0.0131  0.0153  0.0016  21  ARG C C   
795  O O   . ARG C 26 ? 0.1440 0.0976 0.1426 0.0119  0.0140  0.0015  21  ARG C O   
796  C CB  . ARG C 26 ? 0.1507 0.0923 0.1499 0.0130  0.0225  -0.0110 21  ARG C CB  
797  C CG  . ARG C 26 ? 0.1745 0.1144 0.1674 0.0105  0.0241  -0.0190 21  ARG C CG  
798  C CD  . ARG C 26 ? 0.1806 0.1266 0.1746 0.0126  0.0253  -0.0163 21  ARG C CD  
799  N NE  . ARG C 26 ? 0.1853 0.1324 0.1736 0.0102  0.0273  -0.0231 21  ARG C NE  
800  C CZ  . ARG C 26 ? 0.1901 0.1441 0.1709 0.0073  0.0226  -0.0229 21  ARG C CZ  
801  N NH1 . ARG C 26 ? 0.1899 0.1475 0.1661 0.0047  0.0247  -0.0281 21  ARG C NH1 
802  N NH2 . ARG C 26 ? 0.1708 0.1282 0.1490 0.0066  0.0162  -0.0177 21  ARG C NH2 
803  N N   . VAL C 27 ? 0.1136 0.0770 0.1191 0.0149  0.0160  0.0094  22  VAL C N   
804  C CA  . VAL C 27 ? 0.1207 0.0937 0.1316 0.0150  0.0146  0.0187  22  VAL C CA  
805  C C   . VAL C 27 ? 0.1470 0.1155 0.1655 0.0167  0.0174  0.0209  22  VAL C C   
806  O O   . VAL C 27 ? 0.1538 0.1134 0.1809 0.0199  0.0230  0.0197  22  VAL C O   
807  C CB  . VAL C 27 ? 0.1541 0.1380 0.1748 0.0177  0.0165  0.0290  22  VAL C CB  
808  C CG1 . VAL C 27 ? 0.1508 0.1487 0.1780 0.0168  0.0147  0.0408  22  VAL C CG1 
809  C CG2 . VAL C 27 ? 0.1573 0.1469 0.1709 0.0152  0.0135  0.0277  22  VAL C CG2 
810  N N   . GLY C 28 ? 0.1280 0.1025 0.1436 0.0141  0.0141  0.0236  23  GLY C N   
811  C CA  . GLY C 28 ? 0.1453 0.1177 0.1684 0.0151  0.0160  0.0272  23  GLY C CA  
812  C C   . GLY C 28 ? 0.1579 0.1223 0.1733 0.0127  0.0146  0.0188  23  GLY C C   
813  O O   . GLY C 28 ? 0.1668 0.1342 0.1846 0.0118  0.0140  0.0223  23  GLY C O   
814  N N   . GLU C 29 ? 0.1568 0.1131 0.1640 0.0116  0.0139  0.0093  24  GLU C N   
815  C CA  . GLU C 29 ? 0.1590 0.1101 0.1601 0.0093  0.0125  0.0029  24  GLU C CA  
816  C C   . GLU C 29 ? 0.1494 0.1079 0.1446 0.0075  0.0091  0.0039  24  GLU C C   
817  O O   . GLU C 29 ? 0.1401 0.1061 0.1312 0.0065  0.0072  0.0057  24  GLU C O   
818  C CB  . GLU C 29 ? 0.1641 0.1096 0.1580 0.0080  0.0117  -0.0051 24  GLU C CB  
819  C CG  . GLU C 29 ? 0.1907 0.1286 0.1883 0.0082  0.0160  -0.0092 24  GLU C CG  
820  C CD  . GLU C 29 ? 0.2332 0.1698 0.2229 0.0057  0.0147  -0.0160 24  GLU C CD  
821  O OE1 . GLU C 29 ? 0.2790 0.2109 0.2679 0.0030  0.0170  -0.0218 24  GLU C OE1 
822  O OE2 . GLU C 29 ? 0.2769 0.2179 0.2612 0.0056  0.0114  -0.0154 24  GLU C OE2 
823  N N   . ILE C 30 ? 0.1401 0.0971 0.1351 0.0066  0.0089  0.0025  25  ILE C N   
824  C CA  . ILE C 30 ? 0.1611 0.1243 0.1508 0.0053  0.0071  0.0019  25  ILE C CA  
825  C C   . ILE C 30 ? 0.1355 0.0936 0.1199 0.0049  0.0062  -0.0045 25  ILE C C   
826  O O   . ILE C 30 ? 0.1473 0.1009 0.1337 0.0044  0.0065  -0.0062 25  ILE C O   
827  C CB  . ILE C 30 ? 0.1795 0.1479 0.1741 0.0049  0.0077  0.0070  25  ILE C CB  
828  C CG1 . ILE C 30 ? 0.1731 0.1467 0.1769 0.0056  0.0090  0.0160  25  ILE C CG1 
829  C CG2 . ILE C 30 ? 0.1793 0.1560 0.1676 0.0036  0.0069  0.0058  25  ILE C CG2 
830  C CD1 . ILE C 30 ? 0.1712 0.1562 0.1728 0.0049  0.0077  0.0206  25  ILE C CD1 
831  N N   . ILE C 31 ? 0.1225 0.0819 0.1011 0.0047  0.0054  -0.0075 26  ILE C N   
832  C CA  . ILE C 31 ? 0.1374 0.0934 0.1139 0.0052  0.0053  -0.0113 26  ILE C CA  
833  C C   . ILE C 31 ? 0.1470 0.1073 0.1235 0.0057  0.0067  -0.0114 26  ILE C C   
834  O O   . ILE C 31 ? 0.1528 0.1178 0.1261 0.0048  0.0078  -0.0119 26  ILE C O   
835  C CB  . ILE C 31 ? 0.1676 0.1205 0.1404 0.0050  0.0048  -0.0143 26  ILE C CB  
836  C CG1 . ILE C 31 ? 0.1816 0.1327 0.1542 0.0044  0.0036  -0.0135 26  ILE C CG1 
837  C CG2 . ILE C 31 ? 0.1471 0.0970 0.1212 0.0062  0.0051  -0.0158 26  ILE C CG2 
838  C CD1 . ILE C 31 ? 0.1844 0.1339 0.1538 0.0034  0.0027  -0.0152 26  ILE C CD1 
839  N N   . ARG C 32 ? 0.1309 0.0913 0.1107 0.0065  0.0069  -0.0107 27  ARG C N   
840  C CA  . ARG C 32 ? 0.1414 0.1075 0.1228 0.0075  0.0087  -0.0096 27  ARG C CA  
841  C C   . ARG C 32 ? 0.1384 0.1039 0.1215 0.0100  0.0108  -0.0112 27  ARG C C   
842  O O   . ARG C 32 ? 0.1460 0.1074 0.1307 0.0109  0.0101  -0.0115 27  ARG C O   
843  C CB  . ARG C 32 ? 0.1650 0.1342 0.1511 0.0062  0.0077  -0.0055 27  ARG C CB  
844  C CG  . ARG C 32 ? 0.1706 0.1389 0.1583 0.0045  0.0070  -0.0029 27  ARG C CG  
845  C CD  . ARG C 32 ? 0.1951 0.1647 0.1887 0.0026  0.0069  0.0010  27  ARG C CD  
846  N NE  . ARG C 32 ? 0.1757 0.1427 0.1737 0.0020  0.0075  0.0043  27  ARG C NE  
847  C CZ  . ARG C 32 ? 0.1708 0.1448 0.1719 0.0023  0.0081  0.0102  27  ARG C CZ  
848  N NH1 . ARG C 32 ? 0.1737 0.1455 0.1817 0.0025  0.0092  0.0149  27  ARG C NH1 
849  N NH2 . ARG C 32 ? 0.1839 0.1683 0.1823 0.0023  0.0082  0.0120  27  ARG C NH2 
850  N N   . ASN C 33 ? 0.1437 0.1143 0.1275 0.0114  0.0140  -0.0117 28  ASN C N   
851  C CA  . ASN C 33 ? 0.1447 0.1148 0.1326 0.0151  0.0179  -0.0128 28  ASN C CA  
852  C C   . ASN C 33 ? 0.1350 0.0961 0.1220 0.0161  0.0196  -0.0170 28  ASN C C   
853  O O   . ASN C 33 ? 0.1529 0.1111 0.1462 0.0188  0.0200  -0.0145 28  ASN C O   
854  C CB  . ASN C 33 ? 0.1594 0.1337 0.1551 0.0164  0.0164  -0.0068 28  ASN C CB  
855  C CG  . ASN C 33 ? 0.1915 0.1685 0.1949 0.0212  0.0212  -0.0051 28  ASN C CG  
856  O OD1 . ASN C 33 ? 0.2022 0.1816 0.2131 0.0230  0.0203  0.0003  28  ASN C OD1 
857  N ND2 . ASN C 33 ? 0.1791 0.1570 0.1813 0.0233  0.0268  -0.0093 28  ASN C ND2 
858  N N   . VAL C 34 ? 0.1382 0.0963 0.1179 0.0134  0.0202  -0.0223 29  VAL C N   
859  C CA  . VAL C 34 ? 0.1558 0.1050 0.1340 0.0129  0.0212  -0.0264 29  VAL C CA  
860  C C   . VAL C 34 ? 0.1743 0.1177 0.1557 0.0154  0.0281  -0.0316 29  VAL C C   
861  O O   . VAL C 34 ? 0.2021 0.1488 0.1812 0.0153  0.0330  -0.0361 29  VAL C O   
862  C CB  . VAL C 34 ? 0.1602 0.1100 0.1296 0.0078  0.0190  -0.0295 29  VAL C CB  
863  C CG1 . VAL C 34 ? 0.1781 0.1191 0.1456 0.0060  0.0203  -0.0343 29  VAL C CG1 
864  C CG2 . VAL C 34 ? 0.1427 0.0958 0.1120 0.0067  0.0136  -0.0241 29  VAL C CG2 
865  N N   . LYS C 35 ? 0.1827 0.1176 0.1705 0.0176  0.0293  -0.0307 30  LYS C N   
866  C CA  . LYS C 35 ? 0.2259 0.1522 0.2200 0.0208  0.0371  -0.0350 30  LYS C CA  
867  C C   . LYS C 35 ? 0.2404 0.1554 0.2343 0.0184  0.0376  -0.0386 30  LYS C C   
868  O O   . LYS C 35 ? 0.2068 0.1218 0.2005 0.0168  0.0318  -0.0337 30  LYS C O   
869  C CB  . LYS C 35 ? 0.2675 0.1958 0.2761 0.0276  0.0394  -0.0269 30  LYS C CB  
870  C CG  . LYS C 35 ? 0.3056 0.2466 0.3163 0.0294  0.0377  -0.0212 30  LYS C CG  
871  C CD  . LYS C 35 ? 0.3708 0.3167 0.3961 0.0347  0.0379  -0.0107 30  LYS C CD  
872  C CE  . LYS C 35 ? 0.4200 0.3795 0.4479 0.0357  0.0363  -0.0047 30  LYS C CE  
873  N NZ  . LYS C 35 ? 0.4589 0.4203 0.4886 0.0390  0.0440  -0.0089 30  LYS C NZ  
874  N N   A LYS C 36 ? 0.2635 0.1733 0.2574 0.0169  0.0426  -0.0454 31  LYS C N   
875  N N   B LYS C 36 ? 0.2643 0.1741 0.2582 0.0169  0.0426  -0.0454 31  LYS C N   
876  C CA  A LYS C 36 ? 0.2853 0.1866 0.2821 0.0147  0.0424  -0.0464 31  LYS C CA  
877  C CA  B LYS C 36 ? 0.2856 0.1870 0.2825 0.0148  0.0424  -0.0463 31  LYS C CA  
878  C C   A LYS C 36 ? 0.2969 0.1935 0.3099 0.0212  0.0459  -0.0394 31  LYS C C   
879  C C   B LYS C 36 ? 0.2967 0.1936 0.3098 0.0213  0.0458  -0.0392 31  LYS C C   
880  O O   A LYS C 36 ? 0.3175 0.2143 0.3379 0.0255  0.0520  -0.0397 31  LYS C O   
881  O O   B LYS C 36 ? 0.3151 0.2122 0.3357 0.0258  0.0519  -0.0392 31  LYS C O   
882  C CB  A LYS C 36 ? 0.3124 0.2109 0.3016 0.0089  0.0460  -0.0567 31  LYS C CB  
883  C CB  B LYS C 36 ? 0.3120 0.2103 0.3015 0.0091  0.0462  -0.0566 31  LYS C CB  
884  C CG  A LYS C 36 ? 0.3316 0.2195 0.3257 0.0069  0.0478  -0.0584 31  LYS C CG  
885  C CG  B LYS C 36 ? 0.3302 0.2191 0.3221 0.0058  0.0462  -0.0582 31  LYS C CG  
886  C CD  A LYS C 36 ? 0.3260 0.2125 0.3178 0.0034  0.0412  -0.0545 31  LYS C CD  
887  C CD  B LYS C 36 ? 0.3234 0.2139 0.3100 0.0018  0.0387  -0.0547 31  LYS C CD  
888  C CE  A LYS C 36 ? 0.3349 0.2120 0.3280 -0.0011 0.0431  -0.0585 31  LYS C CE  
889  C CE  B LYS C 36 ? 0.3440 0.2320 0.3225 -0.0066 0.0381  -0.0615 31  LYS C CE  
890  N NZ  A LYS C 36 ? 0.3259 0.1934 0.3336 0.0041  0.0492  -0.0559 31  LYS C NZ  
891  N NZ  B LYS C 36 ? 0.3269 0.2196 0.2987 -0.0110 0.0310  -0.0583 31  LYS C NZ  
892  N N   . LEU C 37 ? 0.2976 0.1917 0.3169 0.0218  0.0422  -0.0320 32  LEU C N   
893  C CA  . LEU C 37 ? 0.3000 0.1921 0.3359 0.0273  0.0451  -0.0232 32  LEU C CA  
894  C C   . LEU C 37 ? 0.3248 0.2064 0.3636 0.0246  0.0481  -0.0270 32  LEU C C   
895  O O   . LEU C 37 ? 0.3506 0.2271 0.3801 0.0198  0.0505  -0.0377 32  LEU C O   
896  C CB  . LEU C 37 ? 0.2682 0.1667 0.3108 0.0295  0.0395  -0.0110 32  LEU C CB  
897  C CG  . LEU C 37 ? 0.2877 0.1959 0.3277 0.0315  0.0368  -0.0074 32  LEU C CG  
898  C CD1 . LEU C 37 ? 0.2902 0.2101 0.3372 0.0321  0.0304  0.0059  32  LEU C CD1 
899  C CD2 . LEU C 37 ? 0.2939 0.2062 0.3388 0.0361  0.0423  -0.0081 32  LEU C CD2 
900  N N   . GLN C 38 ? 0.3534 0.2329 0.4054 0.0271  0.0482  -0.0178 33  GLN C N   
901  C CA  . GLN C 38 ? 0.3592 0.2276 0.4167 0.0253  0.0525  -0.0208 33  GLN C CA  
902  C C   . GLN C 38 ? 0.3342 0.1979 0.3810 0.0179  0.0475  -0.0253 33  GLN C C   
903  O O   . GLN C 38 ? 0.3208 0.1749 0.3676 0.0141  0.0506  -0.0311 33  GLN C O   
904  C CB  . GLN C 38 ? 0.3677 0.2370 0.4454 0.0307  0.0549  -0.0077 33  GLN C CB  
905  N N   . GLU C 39 ? 0.3599 0.2305 0.3980 0.0155  0.0402  -0.0228 34  GLU C N   
906  C CA  . GLU C 39 ? 0.3573 0.2255 0.3887 0.0094  0.0350  -0.0234 34  GLU C CA  
907  C C   . GLU C 39 ? 0.3549 0.2220 0.3702 0.0019  0.0337  -0.0350 34  GLU C C   
908  O O   . GLU C 39 ? 0.4006 0.2746 0.4060 0.0009  0.0322  -0.0394 34  GLU C O   
909  C CB  . GLU C 39 ? 0.3388 0.2154 0.3702 0.0103  0.0286  -0.0142 34  GLU C CB  
910  C CG  . GLU C 39 ? 0.3498 0.2246 0.3811 0.0058  0.0244  -0.0101 34  GLU C CG  
911  C CD  . GLU C 39 ? 0.3375 0.2216 0.3751 0.0081  0.0198  0.0023  34  GLU C CD  
912  O OE1 . GLU C 39 ? 0.3499 0.2439 0.3890 0.0122  0.0186  0.0066  34  GLU C OE1 
913  O OE2 . GLU C 39 ? 0.3122 0.1990 0.3511 0.0048  0.0158  0.0080  34  GLU C OE2 
914  N N   . GLU C 40 ? 0.3115 0.1714 0.3254 -0.0038 0.0340  -0.0388 35  GLU C N   
915  C CA  . GLU C 40 ? 0.2786 0.1396 0.2789 -0.0122 0.0326  -0.0483 35  GLU C CA  
916  C C   . GLU C 40 ? 0.2684 0.1385 0.2594 -0.0159 0.0254  -0.0457 35  GLU C C   
917  O O   . GLU C 40 ? 0.2550 0.1250 0.2502 -0.0155 0.0217  -0.0380 35  GLU C O   
918  C CB  . GLU C 40 ? 0.3262 0.1769 0.3292 -0.0177 0.0349  -0.0521 35  GLU C CB  
919  C CG  . GLU C 40 ? 0.3537 0.2065 0.3435 -0.0275 0.0343  -0.0621 35  GLU C CG  
920  C CD  . GLU C 40 ? 0.3916 0.2327 0.3846 -0.0330 0.0382  -0.0673 35  GLU C CD  
921  O OE1 . GLU C 40 ? 0.3689 0.1995 0.3754 -0.0288 0.0412  -0.0624 35  GLU C OE1 
922  O OE2 . GLU C 40 ? 0.4302 0.2734 0.4128 -0.0420 0.0384  -0.0759 35  GLU C OE2 
923  N N   . GLY C 41 ? 0.2419 0.1205 0.2208 -0.0195 0.0241  -0.0513 36  GLY C N   
924  C CA  . GLY C 41 ? 0.2231 0.1106 0.1928 -0.0238 0.0184  -0.0491 36  GLY C CA  
925  C C   . GLY C 41 ? 0.2031 0.0961 0.1725 -0.0182 0.0159  -0.0432 36  GLY C C   
926  O O   . GLY C 41 ? 0.2203 0.1233 0.1831 -0.0199 0.0111  -0.0400 36  GLY C O   
927  N N   . TRP C 42 ? 0.1988 0.0891 0.1772 -0.0107 0.0186  -0.0400 37  TRP C N   
928  C CA  . TRP C 42 ? 0.1761 0.0735 0.1562 -0.0053 0.0158  -0.0332 37  TRP C CA  
929  C C   . TRP C 42 ? 0.1939 0.0925 0.1749 -0.0011 0.0196  -0.0357 37  TRP C C   
930  O O   . TRP C 42 ? 0.2407 0.1352 0.2265 0.0006  0.0245  -0.0393 37  TRP C O   
931  C CB  . TRP C 42 ? 0.1816 0.0787 0.1727 -0.0015 0.0141  -0.0238 37  TRP C CB  
932  C CG  . TRP C 42 ? 0.1865 0.0870 0.1753 -0.0056 0.0092  -0.0200 37  TRP C CG  
933  C CD1 . TRP C 42 ? 0.2200 0.1135 0.2091 -0.0107 0.0098  -0.0221 37  TRP C CD1 
934  C CD2 . TRP C 42 ? 0.1754 0.0876 0.1609 -0.0054 0.0038  -0.0144 37  TRP C CD2 
935  N NE1 . TRP C 42 ? 0.1969 0.0984 0.1836 -0.0133 0.0045  -0.0167 37  TRP C NE1 
936  C CE2 . TRP C 42 ? 0.1920 0.1049 0.1763 -0.0098 0.0012  -0.0124 37  TRP C CE2 
937  C CE3 . TRP C 42 ? 0.1644 0.0861 0.1481 -0.0025 0.0015  -0.0114 37  TRP C CE3 
938  C CZ2 . TRP C 42 ? 0.1774 0.1011 0.1592 -0.0105 -0.0030 -0.0074 37  TRP C CZ2 
939  C CZ3 . TRP C 42 ? 0.1482 0.0788 0.1289 -0.0037 -0.0023 -0.0078 37  TRP C CZ3 
940  C CH2 . TRP C 42 ? 0.1509 0.0828 0.1307 -0.0072 -0.0042 -0.0058 37  TRP C CH2 
941  N N   . LEU C 43 ? 0.1666 0.0758 0.1441 0.0007  0.0161  -0.0324 38  LEU C N   
942  C CA  . LEU C 43 ? 0.1859 0.0985 0.1648 0.0046  0.0187  -0.0329 38  LEU C CA  
943  C C   . LEU C 43 ? 0.1690 0.0880 0.1543 0.0088  0.0156  -0.0246 38  LEU C C   
944  O O   . LEU C 43 ? 0.1721 0.0942 0.1581 0.0080  0.0113  -0.0197 38  LEU C O   
945  C CB  . LEU C 43 ? 0.2034 0.1239 0.1725 0.0014  0.0176  -0.0364 38  LEU C CB  
946  C CG  . LEU C 43 ? 0.2270 0.1453 0.1885 -0.0045 0.0209  -0.0452 38  LEU C CG  
947  C CD1 . LEU C 43 ? 0.2323 0.1630 0.1848 -0.0088 0.0180  -0.0451 38  LEU C CD1 
948  C CD2 . LEU C 43 ? 0.2740 0.1874 0.2393 -0.0023 0.0278  -0.0507 38  LEU C CD2 
949  N N   . GLU C 44 ? 0.1556 0.0779 0.1450 0.0125  0.0179  -0.0232 39  GLU C N   
950  C CA  A GLU C 44 ? 0.1666 0.0969 0.1609 0.0148  0.0148  -0.0157 39  GLU C CA  
951  C CA  B GLU C 44 ? 0.1668 0.0972 0.1612 0.0148  0.0148  -0.0156 39  GLU C CA  
952  C C   . GLU C 44 ? 0.1667 0.1040 0.1568 0.0145  0.0139  -0.0164 39  GLU C C   
953  O O   . GLU C 44 ? 0.1917 0.1289 0.1798 0.0150  0.0174  -0.0205 39  GLU C O   
954  C CB  A GLU C 44 ? 0.1783 0.1083 0.1854 0.0195  0.0181  -0.0100 39  GLU C CB  
955  C CB  B GLU C 44 ? 0.1823 0.1129 0.1894 0.0196  0.0180  -0.0098 39  GLU C CB  
956  C CG  A GLU C 44 ? 0.1943 0.1346 0.2070 0.0199  0.0139  -0.0006 39  GLU C CG  
957  C CG  B GLU C 44 ? 0.1974 0.1397 0.2094 0.0200  0.0139  -0.0010 39  GLU C CG  
958  C CD  A GLU C 44 ? 0.2087 0.1580 0.2247 0.0216  0.0141  0.0027  39  GLU C CD  
959  C CD  B GLU C 44 ? 0.2087 0.1557 0.2335 0.0250  0.0175  0.0059  39  GLU C CD  
960  O OE1 A GLU C 44 ? 0.2149 0.1617 0.2320 0.0243  0.0188  -0.0008 39  GLU C OE1 
961  O OE1 B GLU C 44 ? 0.2029 0.1472 0.2297 0.0282  0.0227  0.0023  39  GLU C OE1 
962  O OE2 A GLU C 44 ? 0.2471 0.2069 0.2640 0.0193  0.0098  0.0086  39  GLU C OE2 
963  O OE2 B GLU C 44 ? 0.2119 0.1672 0.2455 0.0256  0.0152  0.0156  39  GLU C OE2 
964  N N   . GLY C 45 ? 0.1522 0.0959 0.1413 0.0130  0.0096  -0.0127 40  GLY C N   
965  C CA  . GLY C 45 ? 0.1334 0.0822 0.1196 0.0121  0.0089  -0.0130 40  GLY C CA  
966  C C   . GLY C 45 ? 0.1297 0.0838 0.1166 0.0100  0.0055  -0.0095 40  GLY C C   
967  O O   . GLY C 45 ? 0.1422 0.0977 0.1300 0.0086  0.0033  -0.0074 40  GLY C O   
968  N N   . GLU C 46 ? 0.1340 0.0916 0.1204 0.0089  0.0053  -0.0092 41  GLU C N   
969  C CA  . GLU C 46 ? 0.1422 0.1040 0.1293 0.0056  0.0029  -0.0075 41  GLU C CA  
970  C C   . GLU C 46 ? 0.1220 0.0795 0.1051 0.0032  0.0024  -0.0105 41  GLU C C   
971  O O   . GLU C 46 ? 0.1408 0.0962 0.1228 0.0042  0.0037  -0.0112 41  GLU C O   
972  C CB  . GLU C 46 ? 0.1458 0.1134 0.1366 0.0055  0.0036  -0.0048 41  GLU C CB  
973  C CG  . GLU C 46 ? 0.1514 0.1240 0.1432 0.0004  0.0012  -0.0031 41  GLU C CG  
974  C CD  . GLU C 46 ? 0.1951 0.1623 0.1843 -0.0030 0.0013  -0.0065 41  GLU C CD  
975  O OE1 . GLU C 46 ? 0.1818 0.1452 0.1709 -0.0009 0.0029  -0.0069 41  GLU C OE1 
976  O OE2 . GLU C 46 ? 0.2033 0.1706 0.1910 -0.0082 0.0002  -0.0085 41  GLU C OE2 
977  N N   . LEU C 47 ? 0.1277 0.0853 0.1094 -0.0002 0.0011  -0.0117 42  LEU C N   
978  C CA  . LEU C 47 ? 0.1329 0.0855 0.1129 -0.0018 0.0023  -0.0149 42  LEU C CA  
979  C C   . LEU C 47 ? 0.1743 0.1279 0.1533 -0.0072 0.0022  -0.0176 42  LEU C C   
980  O O   . LEU C 47 ? 0.1830 0.1414 0.1594 -0.0100 0.0006  -0.0182 42  LEU C O   
981  C CB  . LEU C 47 ? 0.1511 0.1007 0.1286 -0.0001 0.0025  -0.0161 42  LEU C CB  
982  C CG  . LEU C 47 ? 0.1711 0.1164 0.1488 -0.0006 0.0048  -0.0184 42  LEU C CG  
983  C CD1 . LEU C 47 ? 0.1818 0.1249 0.1640 0.0011  0.0067  -0.0160 42  LEU C CD1 
984  C CD2 . LEU C 47 ? 0.1788 0.1239 0.1543 0.0009  0.0045  -0.0184 42  LEU C CD2 
985  N N   . ASN C 48 ? 0.2173 0.1672 0.1987 -0.0094 0.0040  -0.0191 43  ASN C N   
986  C CA  . ASN C 48 ? 0.2402 0.1889 0.2202 -0.0160 0.0052  -0.0241 43  ASN C CA  
987  C C   . ASN C 48 ? 0.2300 0.1893 0.2072 -0.0216 0.0019  -0.0232 43  ASN C C   
988  O O   . ASN C 48 ? 0.2715 0.2338 0.2441 -0.0280 0.0020  -0.0279 43  ASN C O   
989  C CB  . ASN C 48 ? 0.2815 0.2247 0.2588 -0.0165 0.0081  -0.0296 43  ASN C CB  
990  C CG  . ASN C 48 ? 0.3446 0.2790 0.3272 -0.0114 0.0119  -0.0288 43  ASN C CG  
991  O OD1 . ASN C 48 ? 0.3969 0.3278 0.3856 -0.0102 0.0134  -0.0260 43  ASN C OD1 
992  N ND2 . ASN C 48 ? 0.3402 0.2731 0.3218 -0.0087 0.0135  -0.0299 43  ASN C ND2 
993  N N   . GLY C 49 ? 0.1931 0.1598 0.1734 -0.0194 -0.0006 -0.0169 44  GLY C N   
994  C CA  . GLY C 49 ? 0.2132 0.1925 0.1938 -0.0246 -0.0037 -0.0134 44  GLY C CA  
995  C C   . GLY C 49 ? 0.2098 0.1989 0.1917 -0.0221 -0.0061 -0.0075 44  GLY C C   
996  O O   . GLY C 49 ? 0.2225 0.2249 0.2075 -0.0250 -0.0087 -0.0014 44  GLY C O   
997  N N   . ARG C 50 ? 0.2016 0.1850 0.1825 -0.0169 -0.0052 -0.0081 45  ARG C N   
998  C CA  . ARG C 50 ? 0.1803 0.1705 0.1643 -0.0141 -0.0069 -0.0020 45  ARG C CA  
999  C C   . ARG C 50 ? 0.1827 0.1644 0.1703 -0.0060 -0.0047 -0.0007 45  ARG C C   
1000 O O   . ARG C 50 ? 0.1897 0.1623 0.1753 -0.0035 -0.0026 -0.0049 45  ARG C O   
1001 C CB  . ARG C 50 ? 0.1982 0.1910 0.1772 -0.0176 -0.0079 -0.0041 45  ARG C CB  
1002 C CG  . ARG C 50 ? 0.2302 0.2106 0.2054 -0.0143 -0.0055 -0.0100 45  ARG C CG  
1003 C CD  . ARG C 50 ? 0.2433 0.2276 0.2155 -0.0158 -0.0065 -0.0097 45  ARG C CD  
1004 N NE  . ARG C 50 ? 0.2436 0.2316 0.2216 -0.0120 -0.0081 -0.0019 45  ARG C NE  
1005 C CZ  . ARG C 50 ? 0.2066 0.1961 0.1842 -0.0117 -0.0088 0.0001  45  ARG C CZ  
1006 N NH1 . ARG C 50 ? 0.2289 0.2179 0.2000 -0.0145 -0.0080 -0.0054 45  ARG C NH1 
1007 N NH2 . ARG C 50 ? 0.2144 0.2056 0.1993 -0.0083 -0.0097 0.0076  45  ARG C NH2 
1008 N N   . ARG C 51 ? 0.1926 0.1781 0.1860 -0.0026 -0.0049 0.0053  46  ARG C N   
1009 C CA  . ARG C 51 ? 0.1780 0.1541 0.1742 0.0036  -0.0020 0.0046  46  ARG C CA  
1010 C C   . ARG C 51 ? 0.1641 0.1378 0.1598 0.0038  -0.0028 0.0053  46  ARG C C   
1011 O O   . ARG C 51 ? 0.2028 0.1856 0.1995 0.0006  -0.0054 0.0098  46  ARG C O   
1012 C CB  . ARG C 51 ? 0.2145 0.1935 0.2202 0.0085  0.0005  0.0101  46  ARG C CB  
1013 C CG  . ARG C 51 ? 0.2193 0.2010 0.2259 0.0089  0.0018  0.0096  46  ARG C CG  
1014 C CD  . ARG C 51 ? 0.1979 0.1811 0.2143 0.0150  0.0060  0.0139  46  ARG C CD  
1015 N NE  . ARG C 51 ? 0.1876 0.1588 0.2031 0.0194  0.0106  0.0083  46  ARG C NE  
1016 C CZ  . ARG C 51 ? 0.2011 0.1677 0.2117 0.0202  0.0135  0.0020  46  ARG C CZ  
1017 N NH1 . ARG C 51 ? 0.2291 0.2012 0.2367 0.0180  0.0121  0.0019  46  ARG C NH1 
1018 N NH2 . ARG C 51 ? 0.2288 0.1862 0.2374 0.0223  0.0177  -0.0038 46  ARG C NH2 
1019 N N   . GLY C 52 ? 0.1359 0.0993 0.1295 0.0064  -0.0008 0.0012  47  GLY C N   
1020 C CA  . GLY C 52 ? 0.1256 0.0861 0.1192 0.0062  -0.0014 0.0021  47  GLY C CA  
1021 C C   . GLY C 52 ? 0.1364 0.0860 0.1284 0.0082  0.0011  -0.0024 47  GLY C C   
1022 O O   . GLY C 52 ? 0.1561 0.1012 0.1452 0.0093  0.0033  -0.0071 47  GLY C O   
1023 N N   . MET C 53 ? 0.1346 0.0814 0.1283 0.0077  0.0006  -0.0007 48  MET C N   
1024 C CA  . MET C 53 ? 0.1568 0.0937 0.1489 0.0077  0.0028  -0.0052 48  MET C CA  
1025 C C   . MET C 53 ? 0.1378 0.0748 0.1208 0.0046  0.0009  -0.0094 48  MET C C   
1026 O O   . MET C 53 ? 0.1518 0.0948 0.1321 0.0030  -0.0016 -0.0079 48  MET C O   
1027 C CB  . MET C 53 ? 0.1491 0.0825 0.1488 0.0080  0.0034  -0.0005 48  MET C CB  
1028 C CG  . MET C 53 ? 0.1968 0.1323 0.2091 0.0118  0.0054  0.0070  48  MET C CG  
1029 S SD  . MET C 53 ? 0.2454 0.1718 0.2616 0.0161  0.0122  0.0016  48  MET C SD  
1030 C CE  . MET C 53 ? 0.3135 0.2247 0.3255 0.0134  0.0159  -0.0078 48  MET C CE  
1031 N N   . PHE C 54 ? 0.1336 0.0654 0.1123 0.0034  0.0026  -0.0145 49  PHE C N   
1032 C CA  . PHE C 54 ? 0.1413 0.0757 0.1136 0.0006  0.0008  -0.0162 49  PHE C CA  
1033 C C   . PHE C 54 ? 0.1460 0.0758 0.1153 -0.0028 0.0019  -0.0200 49  PHE C C   
1034 O O   . PHE C 54 ? 0.1551 0.0787 0.1253 -0.0029 0.0053  -0.0239 49  PHE C O   
1035 C CB  . PHE C 54 ? 0.1256 0.0646 0.0948 0.0012  0.0007  -0.0171 49  PHE C CB  
1036 C CG  . PHE C 54 ? 0.1525 0.0907 0.1208 0.0019  0.0031  -0.0199 49  PHE C CG  
1037 C CD1 . PHE C 54 ? 0.1502 0.0906 0.1136 -0.0010 0.0037  -0.0225 49  PHE C CD1 
1038 C CD2 . PHE C 54 ? 0.1786 0.1164 0.1507 0.0046  0.0047  -0.0194 49  PHE C CD2 
1039 C CE1 . PHE C 54 ? 0.1472 0.0892 0.1088 -0.0011 0.0062  -0.0252 49  PHE C CE1 
1040 C CE2 . PHE C 54 ? 0.1669 0.1054 0.1382 0.0053  0.0074  -0.0219 49  PHE C CE2 
1041 C CZ  . PHE C 54 ? 0.1595 0.1000 0.1251 0.0023  0.0082  -0.0252 49  PHE C CZ  
1042 N N   . PRO C 55 ? 0.1527 0.0859 0.1184 -0.0061 -0.0003 -0.0190 50  PRO C N   
1043 C CA  . PRO C 55 ? 0.1667 0.0969 0.1289 -0.0113 0.0002  -0.0226 50  PRO C CA  
1044 C C   . PRO C 55 ? 0.1798 0.1143 0.1359 -0.0140 0.0013  -0.0266 50  PRO C C   
1045 O O   . PRO C 55 ? 0.1711 0.1142 0.1260 -0.0127 0.0000  -0.0235 50  PRO C O   
1046 C CB  . PRO C 55 ? 0.1564 0.0924 0.1178 -0.0139 -0.0031 -0.0184 50  PRO C CB  
1047 C CG  . PRO C 55 ? 0.1439 0.0875 0.1062 -0.0100 -0.0043 -0.0144 50  PRO C CG  
1048 C CD  . PRO C 55 ? 0.1547 0.0949 0.1203 -0.0057 -0.0029 -0.0148 50  PRO C CD  
1049 N N   . ASP C 56 ? 0.1679 0.0970 0.1207 -0.0181 0.0043  -0.0333 51  ASP C N   
1050 C CA  . ASP C 56 ? 0.2040 0.1391 0.1508 -0.0208 0.0060  -0.0374 51  ASP C CA  
1051 C C   . ASP C 56 ? 0.2046 0.1527 0.1450 -0.0272 0.0028  -0.0353 51  ASP C C   
1052 O O   . ASP C 56 ? 0.1986 0.1563 0.1344 -0.0298 0.0032  -0.0360 51  ASP C O   
1053 C CB  . ASP C 56 ? 0.2444 0.1702 0.1892 -0.0233 0.0118  -0.0469 51  ASP C CB  
1054 C CG  . ASP C 56 ? 0.2794 0.1990 0.2210 -0.0311 0.0131  -0.0529 51  ASP C CG  
1055 O OD1 . ASP C 56 ? 0.2745 0.1996 0.2125 -0.0367 0.0089  -0.0502 51  ASP C OD1 
1056 O OD2 . ASP C 56 ? 0.2994 0.2124 0.2454 -0.0302 0.0177  -0.0579 51  ASP C OD2 
1057 N N   . ASN C 57 ? 0.1785 0.1293 0.1194 -0.0299 -0.0004 -0.0314 52  ASN C N   
1058 C CA  . ASN C 57 ? 0.1735 0.1394 0.1102 -0.0359 -0.0036 -0.0272 52  ASN C CA  
1059 C C   . ASN C 57 ? 0.1650 0.1410 0.1075 -0.0303 -0.0061 -0.0170 52  ASN C C   
1060 O O   . ASN C 57 ? 0.1644 0.1539 0.1069 -0.0337 -0.0086 -0.0107 52  ASN C O   
1061 C CB  . ASN C 57 ? 0.1960 0.1611 0.1294 -0.0440 -0.0052 -0.0292 52  ASN C CB  
1062 C CG  . ASN C 57 ? 0.1734 0.1311 0.1134 -0.0403 -0.0065 -0.0253 52  ASN C CG  
1063 O OD1 . ASN C 57 ? 0.1585 0.1093 0.1044 -0.0325 -0.0056 -0.0233 52  ASN C OD1 
1064 N ND2 . ASN C 57 ? 0.1908 0.1520 0.1293 -0.0471 -0.0090 -0.0238 52  ASN C ND2 
1065 N N   . PHE C 58 ? 0.1723 0.1421 0.1204 -0.0223 -0.0048 -0.0156 53  PHE C N   
1066 C CA  . PHE C 58 ? 0.1396 0.1154 0.0939 -0.0169 -0.0053 -0.0081 53  PHE C CA  
1067 C C   . PHE C 58 ? 0.1581 0.1380 0.1144 -0.0142 -0.0039 -0.0063 53  PHE C C   
1068 O O   . PHE C 58 ? 0.1457 0.1283 0.1086 -0.0095 -0.0030 -0.0007 53  PHE C O   
1069 C CB  . PHE C 58 ? 0.1288 0.0959 0.0875 -0.0115 -0.0046 -0.0084 53  PHE C CB  
1070 C CG  . PHE C 58 ? 0.1232 0.0910 0.0825 -0.0130 -0.0062 -0.0064 53  PHE C CG  
1071 C CD1 . PHE C 58 ? 0.1424 0.1070 0.0984 -0.0184 -0.0075 -0.0091 53  PHE C CD1 
1072 C CD2 . PHE C 58 ? 0.1272 0.0984 0.0911 -0.0092 -0.0056 -0.0023 53  PHE C CD2 
1073 C CE1 . PHE C 58 ? 0.1394 0.1055 0.0967 -0.0202 -0.0092 -0.0063 53  PHE C CE1 
1074 C CE2 . PHE C 58 ? 0.1134 0.0872 0.0779 -0.0107 -0.0069 0.0000  53  PHE C CE2 
1075 C CZ  . PHE C 58 ? 0.1253 0.0971 0.0867 -0.0162 -0.0092 -0.0013 53  PHE C CZ  
1076 N N   . VAL C 59 ? 0.1522 0.1322 0.1032 -0.0173 -0.0029 -0.0111 54  VAL C N   
1077 C CA  . VAL C 59 ? 0.1543 0.1376 0.1070 -0.0150 -0.0014 -0.0098 54  VAL C CA  
1078 C C   . VAL C 59 ? 0.1653 0.1608 0.1116 -0.0216 -0.0014 -0.0106 54  VAL C C   
1079 O O   . VAL C 59 ? 0.2006 0.1980 0.1396 -0.0285 -0.0018 -0.0157 54  VAL C O   
1080 C CB  . VAL C 59 ? 0.1693 0.1406 0.1227 -0.0110 0.0010  -0.0155 54  VAL C CB  
1081 C CG1 . VAL C 59 ? 0.1600 0.1232 0.1191 -0.0058 0.0008  -0.0140 54  VAL C CG1 
1082 C CG2 . VAL C 59 ? 0.1734 0.1370 0.1215 -0.0142 0.0028  -0.0239 54  VAL C CG2 
1083 N N   . LYS C 60 ? 0.1421 0.1462 0.0911 -0.0202 -0.0009 -0.0059 55  LYS C N   
1084 C CA  . LYS C 60 ? 0.1958 0.2143 0.1385 -0.0267 -0.0007 -0.0062 55  LYS C CA  
1085 C C   . LYS C 60 ? 0.2082 0.2233 0.1508 -0.0238 0.0023  -0.0098 55  LYS C C   
1086 O O   . LYS C 60 ? 0.2146 0.2248 0.1652 -0.0174 0.0027  -0.0055 55  LYS C O   
1087 C CB  . LYS C 60 ? 0.2277 0.2664 0.1754 -0.0287 -0.0033 0.0068  55  LYS C CB  
1088 C CG  . LYS C 60 ? 0.2954 0.3538 0.2363 -0.0366 -0.0036 0.0082  55  LYS C CG  
1089 C CD  . LYS C 60 ? 0.3594 0.4405 0.3084 -0.0380 -0.0064 0.0244  55  LYS C CD  
1090 C CE  . LYS C 60 ? 0.4084 0.4875 0.3706 -0.0297 -0.0051 0.0337  55  LYS C CE  
1091 N NZ  . LYS C 60 ? 0.4419 0.5463 0.4116 -0.0325 -0.0068 0.0495  55  LYS C NZ  
1092 N N   . GLU C 61 ? 0.2301 0.2480 0.1638 -0.0290 0.0049  -0.0181 56  GLU C N   
1093 C CA  . GLU C 61 ? 0.2467 0.2627 0.1807 -0.0260 0.0083  -0.0214 56  GLU C CA  
1094 C C   . GLU C 61 ? 0.2775 0.3113 0.2150 -0.0265 0.0070  -0.0114 56  GLU C C   
1095 O O   . GLU C 61 ? 0.2828 0.3349 0.2172 -0.0329 0.0048  -0.0056 56  GLU C O   
1096 C CB  . GLU C 61 ? 0.2774 0.2906 0.2018 -0.0309 0.0132  -0.0343 56  GLU C CB  
1097 C CG  . GLU C 61 ? 0.2963 0.3069 0.2222 -0.0267 0.0179  -0.0381 56  GLU C CG  
1098 C CD  . GLU C 61 ? 0.3638 0.3687 0.2818 -0.0305 0.0246  -0.0519 56  GLU C CD  
1099 O OE1 . GLU C 61 ? 0.3911 0.3962 0.3008 -0.0383 0.0254  -0.0592 56  GLU C OE1 
1100 O OE2 . GLU C 61 ? 0.4041 0.4041 0.3251 -0.0257 0.0297  -0.0558 56  GLU C OE2 
1101 N N   . ILE C 62 ? 0.2781 0.3078 0.2229 -0.0204 0.0080  -0.0079 57  ILE C N   
1102 C CA  . ILE C 62 ? 0.3068 0.3522 0.2559 -0.0209 0.0074  0.0015  57  ILE C CA  
1103 C C   . ILE C 62 ? 0.3604 0.4158 0.3005 -0.0255 0.0108  -0.0051 57  ILE C C   
1104 O O   . ILE C 62 ? 0.3537 0.3985 0.2920 -0.0225 0.0148  -0.0138 57  ILE C O   
1105 C CB  . ILE C 62 ? 0.2883 0.3250 0.2488 -0.0138 0.0073  0.0073  57  ILE C CB  
1106 C CG1 . ILE C 62 ? 0.2916 0.3169 0.2597 -0.0098 0.0054  0.0111  57  ILE C CG1 
1107 C CG2 . ILE C 62 ? 0.2755 0.3283 0.2420 -0.0148 0.0068  0.0182  57  ILE C CG2 
1108 C CD1 . ILE C 62 ? 0.2966 0.3113 0.2742 -0.0045 0.0060  0.0138  57  ILE C CD1 
1109 N N   . LYS C 63 ? 0.4181 0.4957 0.3531 -0.0330 0.0097  -0.0006 58  LYS C N   
1110 C CA  . LYS C 63 ? 0.4681 0.5584 0.3929 -0.0388 0.0136  -0.0078 58  LYS C CA  
1111 C C   . LYS C 63 ? 0.4999 0.6135 0.4289 -0.0408 0.0120  0.0050  58  LYS C C   
1112 O O   . LYS C 63 ? 0.5161 0.6262 0.4558 -0.0344 0.0117  0.0124  58  LYS C O   
1113 C CB  . LYS C 63 ? 0.4880 0.5862 0.3987 -0.0492 0.0144  -0.0171 58  LYS C CB  
1114 N N   . LYS D 3  ? 0.5351 0.4999 0.7567 0.0985  -0.1238 0.1001  380 LYS D N   
1115 C CA  . LYS D 3  ? 0.5256 0.5429 0.7932 0.0972  -0.1428 0.0994  380 LYS D CA  
1116 C C   . LYS D 3  ? 0.4841 0.5265 0.7620 0.0745  -0.1378 0.0868  380 LYS D C   
1117 O O   . LYS D 3  ? 0.4609 0.5265 0.7753 0.0729  -0.1120 0.0760  380 LYS D O   
1118 C CB  . LYS D 3  ? 0.5738 0.5873 0.8142 0.0975  -0.1796 0.1142  380 LYS D CB  
1119 N N   . ASN D 4  ? 0.4831 0.5165 0.7211 0.0576  -0.1614 0.0877  381 ASN D N   
1120 C CA  . ASN D 4  ? 0.4385 0.4831 0.6749 0.0361  -0.1591 0.0750  381 ASN D CA  
1121 C C   . ASN D 4  ? 0.3865 0.4039 0.5889 0.0306  -0.1292 0.0670  381 ASN D C   
1122 O O   . ASN D 4  ? 0.4255 0.4039 0.5679 0.0305  -0.1243 0.0707  381 ASN D O   
1123 C CB  . ASN D 4  ? 0.4918 0.5226 0.6800 0.0221  -0.1917 0.0729  381 ASN D CB  
1124 C CG  . ASN D 4  ? 0.5371 0.5975 0.7598 0.0201  -0.2183 0.0758  381 ASN D CG  
1125 O OD1 . ASN D 4  ? 0.5435 0.6349 0.8118 0.0068  -0.2183 0.0695  381 ASN D OD1 
1126 N ND2 . ASN D 4  ? 0.5845 0.6347 0.7845 0.0325  -0.2407 0.0879  381 ASN D ND2 
1127 N N   . LEU D 5  ? 0.2978 0.3363 0.5308 0.0228  -0.1033 0.0554  382 LEU D N   
1128 C CA  . LEU D 5  ? 0.2457 0.2611 0.4434 0.0157  -0.0722 0.0452  382 LEU D CA  
1129 C C   . LEU D 5  ? 0.2154 0.2260 0.3838 -0.0032 -0.0718 0.0357  382 LEU D C   
1130 O O   . LEU D 5  ? 0.2141 0.2451 0.4079 -0.0140 -0.0849 0.0330  382 LEU D O   
1131 C CB  . LEU D 5  ? 0.2291 0.2621 0.4647 0.0223  -0.0431 0.0387  382 LEU D CB  
1132 C CG  . LEU D 5  ? 0.2554 0.2874 0.5215 0.0466  -0.0370 0.0428  382 LEU D CG  
1133 C CD1 . LEU D 5  ? 0.2417 0.2863 0.5289 0.0534  -0.0038 0.0309  382 LEU D CD1 
1134 C CD2 . LEU D 5  ? 0.2960 0.2778 0.5180 0.0534  -0.0415 0.0486  382 LEU D CD2 
1135 N N   . PRO D 6  ? 0.1805 0.1642 0.3009 -0.0073 -0.0570 0.0314  383 PRO D N   
1136 C CA  . PRO D 6  ? 0.1668 0.1434 0.2616 -0.0190 -0.0535 0.0220  383 PRO D CA  
1137 C C   . PRO D 6  ? 0.1486 0.1403 0.2692 -0.0265 -0.0349 0.0163  383 PRO D C   
1138 O O   . PRO D 6  ? 0.1307 0.1312 0.2689 -0.0227 -0.0166 0.0167  383 PRO D O   
1139 C CB  . PRO D 6  ? 0.1676 0.1205 0.2141 -0.0168 -0.0409 0.0234  383 PRO D CB  
1140 C CG  . PRO D 6  ? 0.1637 0.1125 0.2224 -0.0114 -0.0290 0.0312  383 PRO D CG  
1141 C CD  . PRO D 6  ? 0.1711 0.1303 0.2649 -0.0014 -0.0439 0.0370  383 PRO D CD  
1142 N N   . THR D 7  ? 0.1274 0.1153 0.2426 -0.0367 -0.0405 0.0109  384 THR D N   
1143 C CA  . THR D 7  ? 0.1253 0.1191 0.2518 -0.0443 -0.0241 0.0095  384 THR D CA  
1144 C C   . THR D 7  ? 0.1450 0.1168 0.2321 -0.0424 -0.0164 0.0043  384 THR D C   
1145 O O   . THR D 7  ? 0.1845 0.1360 0.2437 -0.0405 -0.0271 -0.0017 384 THR D O   
1146 C CB  . THR D 7  ? 0.1233 0.1252 0.2648 -0.0528 -0.0324 0.0104  384 THR D CB  
1147 O OG1 . THR D 7  ? 0.1280 0.1602 0.3128 -0.0525 -0.0343 0.0176  384 THR D OG1 
1148 C CG2 . THR D 7  ? 0.1571 0.1565 0.2856 -0.0561 -0.0156 0.0116  384 THR D CG2 
1149 N N   . ALA D 8  ? 0.1301 0.1072 0.2121 -0.0404 0.0012  0.0055  385 ALA D N   
1150 C CA  . ALA D 8  ? 0.1337 0.1004 0.1946 -0.0382 0.0075  0.0037  385 ALA D CA  
1151 C C   . ALA D 8  ? 0.1257 0.0773 0.1810 -0.0396 0.0010  0.0010  385 ALA D C   
1152 O O   . ALA D 8  ? 0.1330 0.0882 0.1965 -0.0455 -0.0013 0.0043  385 ALA D O   
1153 C CB  . ALA D 8  ? 0.1342 0.1130 0.1909 -0.0369 0.0175  0.0059  385 ALA D CB  
1154 N N   . PRO D 9  ? 0.1493 0.0853 0.1800 -0.0297 0.0003  -0.0049 386 PRO D N   
1155 C CA  . PRO D 9  ? 0.1609 0.0710 0.1831 -0.0272 -0.0067 -0.0099 386 PRO D CA  
1156 C C   . PRO D 9  ? 0.1696 0.0842 0.2053 -0.0285 0.0000  -0.0006 386 PRO D C   
1157 O O   . PRO D 9  ? 0.1758 0.1137 0.2178 -0.0270 0.0098  0.0056  386 PRO D O   
1158 C CB  . PRO D 9  ? 0.2239 0.1199 0.2142 -0.0093 -0.0020 -0.0197 386 PRO D CB  
1159 C CG  . PRO D 9  ? 0.2199 0.1323 0.1989 -0.0081 0.0035  -0.0174 386 PRO D CG  
1160 C CD  . PRO D 9  ? 0.1798 0.1186 0.1891 -0.0194 0.0081  -0.0063 386 PRO D CD  
1161 N N   . PRO D 10 ? 0.2174 0.1059 0.2550 -0.0330 -0.0086 0.0015  387 PRO D N   
1162 C CA  . PRO D 10 ? 0.2344 0.1196 0.2767 -0.0319 -0.0051 0.0140  387 PRO D CA  
1163 C C   . PRO D 10 ? 0.2262 0.1210 0.2626 -0.0120 0.0010  0.0134  387 PRO D C   
1164 O O   . PRO D 10 ? 0.2632 0.1498 0.2886 0.0037  0.0033  0.0019  387 PRO D O   
1165 C CB  . PRO D 10 ? 0.2880 0.1396 0.3210 -0.0343 -0.0145 0.0128  387 PRO D CB  
1166 C CG  . PRO D 10 ? 0.3140 0.1688 0.3495 -0.0455 -0.0214 0.0039  387 PRO D CG  
1167 C CD  . PRO D 10 ? 0.2700 0.1369 0.3004 -0.0395 -0.0217 -0.0059 387 PRO D CD  
1168 N N   . ARG D 11 ? 0.2083 0.1228 0.2517 -0.0123 0.0034  0.0260  388 ARG D N   
1169 C CA  . ARG D 11 ? 0.2118 0.1417 0.2624 0.0055  0.0041  0.0295  388 ARG D CA  
1170 C C   . ARG D 11 ? 0.2512 0.1465 0.2993 0.0222  -0.0032 0.0332  388 ARG D C   
1171 O O   . ARG D 11 ? 0.2707 0.1303 0.3102 0.0131  -0.0109 0.0393  388 ARG D O   
1172 C CB  . ARG D 11 ? 0.2002 0.1590 0.2560 -0.0023 0.0009  0.0416  388 ARG D CB  
1173 C CG  . ARG D 11 ? 0.1859 0.1690 0.2416 -0.0168 0.0065  0.0361  388 ARG D CG  
1174 C CD  . ARG D 11 ? 0.1887 0.1941 0.2591 -0.0110 0.0131  0.0294  388 ARG D CD  
1175 N NE  . ARG D 11 ? 0.1781 0.2083 0.2709 0.0028  0.0112  0.0358  388 ARG D NE  
1176 C CZ  . ARG D 11 ? 0.1602 0.2226 0.2721 -0.0036 0.0032  0.0431  388 ARG D CZ  
1177 N NH1 . ARG D 11 ? 0.1582 0.2217 0.2583 -0.0233 -0.0037 0.0413  388 ARG D NH1 
1178 N NH2 . ARG D 11 ? 0.1191 0.2129 0.2638 0.0104  0.0010  0.0510  388 ARG D NH2 
1179 N N   . ARG D 12 ? 0.2390 0.1445 0.2985 0.0471  0.0001  0.0310  389 ARG D N   
1180 C CA  . ARG D 12 ? 0.3384 0.2066 0.3973 0.0694  -0.0067 0.0337  389 ARG D CA  
1181 C C   . ARG D 12 ? 0.4054 0.2690 0.4691 0.0654  -0.0211 0.0575  389 ARG D C   
1182 O O   . ARG D 12 ? 0.4036 0.3095 0.4803 0.0621  -0.0253 0.0698  389 ARG D O   
1183 C CB  . ARG D 12 ? 0.3587 0.2473 0.4351 0.1028  0.0046  0.0263  389 ARG D CB  
1184 C CG  . ARG D 12 ? 0.4349 0.2781 0.5097 0.1330  -0.0010 0.0248  389 ARG D CG  
1185 C CD  . ARG D 12 ? 0.4843 0.3626 0.5812 0.1634  0.0127  0.0144  389 ARG D CD  
1186 N NE  . ARG D 12 ? 0.5085 0.4542 0.6494 0.1687  0.0122  0.0334  389 ARG D NE  
1187 C CZ  . ARG D 12 ? 0.5858 0.5403 0.7492 0.1829  -0.0037 0.0471  389 ARG D CZ  
1188 N NH1 . ARG D 12 ? 0.6601 0.5565 0.8060 0.1958  -0.0181 0.0453  389 ARG D NH1 
1189 N NH2 . ARG D 12 ? 0.5799 0.5996 0.7840 0.1818  -0.0088 0.0626  389 ARG D NH2 
1190 N N   . GLY E 1  ? 0.3994 0.4123 0.1981 0.0946  -0.0146 0.0768  -4  GLY E N   
1191 C CA  . GLY E 1  ? 0.3945 0.3911 0.1998 0.0938  -0.0240 0.0795  -4  GLY E CA  
1192 C C   . GLY E 1  ? 0.4144 0.4000 0.2198 0.0862  -0.0194 0.0993  -4  GLY E C   
1193 O O   . GLY E 1  ? 0.4020 0.3931 0.2027 0.0801  -0.0087 0.1120  -4  GLY E O   
1194 N N   . PRO E 2  ? 0.4145 0.3843 0.2271 0.0867  -0.0286 0.1013  -3  PRO E N   
1195 C CA  . PRO E 2  ? 0.4259 0.3802 0.2402 0.0799  -0.0278 0.1186  -3  PRO E CA  
1196 C C   . PRO E 2  ? 0.4066 0.3547 0.2339 0.0652  -0.0174 0.1288  -3  PRO E C   
1197 O O   . PRO E 2  ? 0.3901 0.3417 0.2305 0.0605  -0.0130 0.1211  -3  PRO E O   
1198 C CB  . PRO E 2  ? 0.4290 0.3694 0.2545 0.0849  -0.0405 0.1125  -3  PRO E CB  
1199 C CG  . PRO E 2  ? 0.4300 0.3821 0.2524 0.0963  -0.0493 0.0944  -3  PRO E CG  
1200 C CD  . PRO E 2  ? 0.4193 0.3857 0.2398 0.0945  -0.0418 0.0861  -3  PRO E CD  
1201 N N   . LEU E 3  ? 0.4476 0.3858 0.2709 0.0578  -0.0142 0.1455  -2  LEU E N   
1202 C CA  . LEU E 3  ? 0.4779 0.4061 0.3153 0.0432  -0.0069 0.1545  -2  LEU E CA  
1203 C C   . LEU E 3  ? 0.4682 0.3771 0.3246 0.0402  -0.0140 0.1485  -2  LEU E C   
1204 O O   . LEU E 3  ? 0.4530 0.3504 0.3107 0.0480  -0.0255 0.1450  -2  LEU E O   
1205 C CB  . LEU E 3  ? 0.5384 0.4550 0.3666 0.0370  -0.0047 0.1730  -2  LEU E CB  
1206 C CG  . LEU E 3  ? 0.5903 0.5172 0.4235 0.0253  0.0094  0.1829  -2  LEU E CG  
1207 C CD1 . LEU E 3  ? 0.6078 0.5655 0.4291 0.0314  0.0186  0.1803  -2  LEU E CD1 
1208 C CD2 . LEU E 3  ? 0.6263 0.5351 0.4553 0.0179  0.0102  0.2016  -2  LEU E CD2 
1209 N N   . GLY E 4  ? 0.4586 0.3662 0.3315 0.0300  -0.0074 0.1465  -1  GLY E N   
1210 C CA  . GLY E 4  ? 0.4687 0.3576 0.3595 0.0273  -0.0131 0.1405  -1  GLY E CA  
1211 C C   . GLY E 4  ? 0.4532 0.3490 0.3517 0.0362  -0.0174 0.1256  -1  GLY E C   
1212 O O   . GLY E 4  ? 0.4654 0.3484 0.3783 0.0374  -0.0226 0.1188  -1  GLY E O   
1213 N N   . SER E 5  ? 0.4258 0.3411 0.3136 0.0437  -0.0151 0.1188  0   SER E N   
1214 C CA  . SER E 5  ? 0.3984 0.3206 0.2948 0.0493  -0.0192 0.1003  0   SER E CA  
1215 C C   . SER E 5  ? 0.3447 0.2729 0.2572 0.0392  -0.0118 0.0920  0   SER E C   
1216 O O   . SER E 5  ? 0.3500 0.2828 0.2627 0.0310  -0.0030 0.0998  0   SER E O   
1217 C CB  . SER E 5  ? 0.4405 0.3785 0.3220 0.0596  -0.0226 0.0925  0   SER E CB  
1218 O OG  . SER E 5  ? 0.4845 0.4375 0.3545 0.0581  -0.0138 0.0956  0   SER E OG  
1219 N N   . MET E 6  ? 0.3140 0.2437 0.2408 0.0399  -0.0153 0.0768  1   MET E N   
1220 C CA  A MET E 6  ? 0.2857 0.2206 0.2260 0.0318  -0.0092 0.0688  1   MET E CA  
1221 C CA  B MET E 6  ? 0.2865 0.2212 0.2268 0.0318  -0.0093 0.0689  1   MET E CA  
1222 C C   . MET E 6  ? 0.2830 0.2341 0.2171 0.0308  -0.0036 0.0650  1   MET E C   
1223 O O   . MET E 6  ? 0.3014 0.2609 0.2251 0.0381  -0.0071 0.0610  1   MET E O   
1224 C CB  A MET E 6  ? 0.2726 0.2081 0.2277 0.0339  -0.0134 0.0553  1   MET E CB  
1225 C CB  B MET E 6  ? 0.2757 0.2105 0.2310 0.0340  -0.0136 0.0555  1   MET E CB  
1226 C CG  A MET E 6  ? 0.2874 0.2081 0.2508 0.0358  -0.0182 0.0557  1   MET E CG  
1227 C CG  B MET E 6  ? 0.2991 0.2195 0.2598 0.0386  -0.0205 0.0566  1   MET E CG  
1228 S SD  A MET E 6  ? 0.2785 0.2088 0.2588 0.0387  -0.0193 0.0399  1   MET E SD  
1229 S SD  B MET E 6  ? 0.3104 0.2394 0.2883 0.0433  -0.0236 0.0410  1   MET E SD  
1230 C CE  A MET E 6  ? 0.2129 0.1272 0.1987 0.0467  -0.0275 0.0391  1   MET E CE  
1231 C CE  B MET E 6  ? 0.1817 0.1205 0.1661 0.0338  -0.0141 0.0354  1   MET E CE  
1232 N N   . VAL E 7  ? 0.2023 0.1571 0.1432 0.0227  0.0037  0.0651  2   VAL E N   
1233 C CA  . VAL E 7  ? 0.1978 0.1673 0.1338 0.0226  0.0089  0.0612  2   VAL E CA  
1234 C C   . VAL E 7  ? 0.2030 0.1752 0.1505 0.0207  0.0079  0.0478  2   VAL E C   
1235 O O   . VAL E 7  ? 0.1977 0.1644 0.1576 0.0154  0.0090  0.0453  2   VAL E O   
1236 C CB  . VAL E 7  ? 0.2228 0.1979 0.1592 0.0154  0.0178  0.0716  2   VAL E CB  
1237 C CG1 . VAL E 7  ? 0.2419 0.2339 0.1737 0.0175  0.0228  0.0659  2   VAL E CG1 
1238 C CG2 . VAL E 7  ? 0.2443 0.2176 0.1699 0.0158  0.0199  0.0885  2   VAL E CG2 
1239 N N   . ASP E 8  ? 0.1710 0.1510 0.1140 0.0258  0.0048  0.0393  3   ASP E N   
1240 C CA  . ASP E 8  ? 0.1741 0.1559 0.1277 0.0234  0.0035  0.0288  3   ASP E CA  
1241 C C   . ASP E 8  ? 0.1708 0.1604 0.1191 0.0242  0.0064  0.0250  3   ASP E C   
1242 O O   . ASP E 8  ? 0.1920 0.1888 0.1266 0.0301  0.0072  0.0268  3   ASP E O   
1243 C CB  . ASP E 8  ? 0.1744 0.1561 0.1327 0.0275  -0.0052 0.0212  3   ASP E CB  
1244 C CG  . ASP E 8  ? 0.1972 0.1741 0.1624 0.0286  -0.0086 0.0234  3   ASP E CG  
1245 O OD1 . ASP E 8  ? 0.1922 0.1631 0.1616 0.0253  -0.0046 0.0283  3   ASP E OD1 
1246 O OD2 . ASP E 8  ? 0.2108 0.1899 0.1780 0.0336  -0.0166 0.0194  3   ASP E OD2 
1247 N N   . TYR E 9  ? 0.1461 0.1351 0.1039 0.0199  0.0077  0.0197  4   TYR E N   
1248 C CA  . TYR E 9  ? 0.1399 0.1344 0.0942 0.0219  0.0086  0.0145  4   TYR E CA  
1249 C C   . TYR E 9  ? 0.1620 0.1516 0.1235 0.0217  0.0020  0.0058  4   TYR E C   
1250 O O   . TYR E 9  ? 0.1763 0.1614 0.1492 0.0168  0.0008  0.0058  4   TYR E O   
1251 C CB  . TYR E 9  ? 0.1328 0.1308 0.0919 0.0165  0.0161  0.0181  4   TYR E CB  
1252 C CG  . TYR E 9  ? 0.1627 0.1700 0.1158 0.0166  0.0226  0.0265  4   TYR E CG  
1253 C CD1 . TYR E 9  ? 0.1748 0.1952 0.1242 0.0197  0.0267  0.0255  4   TYR E CD1 
1254 C CD2 . TYR E 9  ? 0.1699 0.1739 0.1223 0.0137  0.0245  0.0364  4   TYR E CD2 
1255 C CE1 . TYR E 9  ? 0.1783 0.2118 0.1248 0.0189  0.0342  0.0352  4   TYR E CE1 
1256 C CE2 . TYR E 9  ? 0.1915 0.2047 0.1404 0.0120  0.0310  0.0472  4   TYR E CE2 
1257 C CZ  . TYR E 9  ? 0.1957 0.2254 0.1424 0.0141  0.0366  0.0470  4   TYR E CZ  
1258 O OH  . TYR E 9  ? 0.2327 0.2764 0.1784 0.0117  0.0446  0.0594  4   TYR E OH  
1259 N N   . ILE E 10 ? 0.1489 0.1397 0.1043 0.0273  -0.0026 -0.0013 5   ILE E N   
1260 C CA  A ILE E 10 ? 0.1668 0.1498 0.1309 0.0256  -0.0099 -0.0080 5   ILE E CA  
1261 C CA  B ILE E 10 ? 0.1711 0.1542 0.1346 0.0261  -0.0101 -0.0084 5   ILE E CA  
1262 C C   . ILE E 10 ? 0.1816 0.1636 0.1476 0.0239  -0.0064 -0.0089 5   ILE E C   
1263 O O   . ILE E 10 ? 0.1840 0.1731 0.1418 0.0286  -0.0026 -0.0098 5   ILE E O   
1264 C CB  A ILE E 10 ? 0.1911 0.1711 0.1490 0.0337  -0.0216 -0.0174 5   ILE E CB  
1265 C CB  B ILE E 10 ? 0.1931 0.1739 0.1489 0.0350  -0.0211 -0.0181 5   ILE E CB  
1266 C CG1 A ILE E 10 ? 0.2059 0.1750 0.1774 0.0295  -0.0312 -0.0227 5   ILE E CG1 
1267 C CG1 B ILE E 10 ? 0.2035 0.1849 0.1574 0.0380  -0.0275 -0.0191 5   ILE E CG1 
1268 C CG2 A ILE E 10 ? 0.2061 0.1929 0.1474 0.0445  -0.0213 -0.0225 5   ILE E CG2 
1269 C CG2 B ILE E 10 ? 0.1883 0.1578 0.1540 0.0326  -0.0301 -0.0246 5   ILE E CG2 
1270 C CD1 A ILE E 10 ? 0.2569 0.2212 0.2280 0.0351  -0.0457 -0.0321 5   ILE E CD1 
1271 C CD1 B ILE E 10 ? 0.2379 0.2176 0.1813 0.0488  -0.0398 -0.0302 5   ILE E CD1 
1272 N N   . VAL E 11 ? 0.1300 0.1051 0.1070 0.0174  -0.0073 -0.0077 6   VAL E N   
1273 C CA  . VAL E 11 ? 0.1279 0.1006 0.1055 0.0165  -0.0052 -0.0080 6   VAL E CA  
1274 C C   . VAL E 11 ? 0.1614 0.1265 0.1357 0.0226  -0.0147 -0.0160 6   VAL E C   
1275 O O   . VAL E 11 ? 0.1646 0.1197 0.1449 0.0213  -0.0239 -0.0190 6   VAL E O   
1276 C CB  . VAL E 11 ? 0.1344 0.1031 0.1219 0.0086  -0.0022 -0.0024 6   VAL E CB  
1277 C CG1 . VAL E 11 ? 0.1265 0.0917 0.1123 0.0089  -0.0015 -0.0023 6   VAL E CG1 
1278 C CG2 . VAL E 11 ? 0.1377 0.1128 0.1272 0.0052  0.0054  0.0028  6   VAL E CG2 
1279 N N   . GLU E 12 ? 0.1713 0.1413 0.1373 0.0298  -0.0135 -0.0201 7   GLU E N   
1280 C CA  . GLU E 12 ? 0.2015 0.1638 0.1628 0.0386  -0.0235 -0.0298 7   GLU E CA  
1281 C C   . GLU E 12 ? 0.1847 0.1379 0.1498 0.0377  -0.0258 -0.0296 7   GLU E C   
1282 O O   . GLU E 12 ? 0.1884 0.1284 0.1526 0.0432  -0.0367 -0.0365 7   GLU E O   
1283 C CB  . GLU E 12 ? 0.1963 0.1729 0.1444 0.0508  -0.0217 -0.0362 7   GLU E CB  
1284 C CG  . GLU E 12 ? 0.2060 0.1909 0.1462 0.0542  -0.0208 -0.0361 7   GLU E CG  
1285 C CD  . GLU E 12 ? 0.2627 0.2354 0.2008 0.0591  -0.0348 -0.0452 7   GLU E CD  
1286 O OE1 . GLU E 12 ? 0.2791 0.2360 0.2228 0.0597  -0.0459 -0.0519 7   GLU E OE1 
1287 O OE2 . GLU E 12 ? 0.2812 0.2592 0.2125 0.0622  -0.0359 -0.0454 7   GLU E OE2 
1288 N N   . TYR E 13 ? 0.1489 0.1076 0.1173 0.0317  -0.0170 -0.0221 8   TYR E N   
1289 C CA  . TYR E 13 ? 0.1516 0.1031 0.1216 0.0317  -0.0187 -0.0208 8   TYR E CA  
1290 C C   . TYR E 13 ? 0.1456 0.0971 0.1209 0.0221  -0.0119 -0.0112 8   TYR E C   
1291 O O   . TYR E 13 ? 0.1505 0.1127 0.1271 0.0182  -0.0039 -0.0076 8   TYR E O   
1292 C CB  . TYR E 13 ? 0.1517 0.1158 0.1164 0.0405  -0.0161 -0.0258 8   TYR E CB  
1293 C CG  . TYR E 13 ? 0.2065 0.1750 0.1639 0.0532  -0.0216 -0.0364 8   TYR E CG  
1294 C CD1 . TYR E 13 ? 0.1901 0.1765 0.1423 0.0574  -0.0156 -0.0380 8   TYR E CD1 
1295 C CD2 . TYR E 13 ? 0.2247 0.1795 0.1790 0.0623  -0.0332 -0.0447 8   TYR E CD2 
1296 C CE1 . TYR E 13 ? 0.2115 0.2052 0.1542 0.0713  -0.0199 -0.0481 8   TYR E CE1 
1297 C CE2 . TYR E 13 ? 0.2454 0.2050 0.1912 0.0767  -0.0391 -0.0568 8   TYR E CE2 
1298 C CZ  . TYR E 13 ? 0.2499 0.2307 0.1892 0.0816  -0.0318 -0.0586 8   TYR E CZ  
1299 O OH  . TYR E 13 ? 0.3107 0.2999 0.2393 0.0975  -0.0367 -0.0703 8   TYR E OH  
1300 N N   . ASP E 14 ? 0.1630 0.1022 0.1402 0.0195  -0.0156 -0.0069 9   ASP E N   
1301 C CA  . ASP E 14 ? 0.1620 0.1029 0.1410 0.0130  -0.0091 0.0020  9   ASP E CA  
1302 C C   . ASP E 14 ? 0.1749 0.1270 0.1493 0.0160  -0.0036 0.0006  9   ASP E C   
1303 O O   . ASP E 14 ? 0.1893 0.1445 0.1605 0.0229  -0.0064 -0.0050 9   ASP E O   
1304 C CB  . ASP E 14 ? 0.1970 0.1232 0.1769 0.0104  -0.0140 0.0089  9   ASP E CB  
1305 C CG  . ASP E 14 ? 0.2402 0.1551 0.2297 0.0043  -0.0201 0.0124  9   ASP E CG  
1306 O OD1 . ASP E 14 ? 0.2092 0.1302 0.2055 0.0006  -0.0186 0.0114  9   ASP E OD1 
1307 O OD2 . ASP E 14 ? 0.2863 0.1853 0.2779 0.0030  -0.0276 0.0167  9   ASP E OD2 
1308 N N   . TYR E 15 ? 0.1547 0.1136 0.1300 0.0115  0.0032  0.0049  10  TYR E N   
1309 C CA  . TYR E 15 ? 0.1566 0.1239 0.1293 0.0134  0.0063  0.0031  10  TYR E CA  
1310 C C   . TYR E 15 ? 0.1579 0.1255 0.1282 0.0107  0.0102  0.0082  10  TYR E C   
1311 O O   . TYR E 15 ? 0.1638 0.1332 0.1371 0.0068  0.0142  0.0113  10  TYR E O   
1312 C CB  . TYR E 15 ? 0.1722 0.1512 0.1492 0.0129  0.0097  -0.0008 10  TYR E CB  
1313 C CG  . TYR E 15 ? 0.1355 0.1226 0.1141 0.0130  0.0111  -0.0028 10  TYR E CG  
1314 C CD1 . TYR E 15 ? 0.1382 0.1319 0.1179 0.0175  0.0081  -0.0069 10  TYR E CD1 
1315 C CD2 . TYR E 15 ? 0.1453 0.1336 0.1258 0.0092  0.0139  -0.0018 10  TYR E CD2 
1316 C CE1 . TYR E 15 ? 0.1671 0.1688 0.1512 0.0170  0.0075  -0.0095 10  TYR E CE1 
1317 C CE2 . TYR E 15 ? 0.1516 0.1454 0.1351 0.0093  0.0125  -0.0052 10  TYR E CE2 
1318 C CZ  . TYR E 15 ? 0.1748 0.1755 0.1609 0.0125  0.0092  -0.0088 10  TYR E CZ  
1319 O OH  . TYR E 15 ? 0.1569 0.1639 0.1487 0.0119  0.0061  -0.0128 10  TYR E OH  
1320 N N   . ASP E 16 ? 0.1614 0.1285 0.1251 0.0143  0.0087  0.0086  11  ASP E N   
1321 C CA  . ASP E 16 ? 0.1641 0.1338 0.1217 0.0148  0.0121  0.0118  11  ASP E CA  
1322 C C   . ASP E 16 ? 0.1431 0.1209 0.1013 0.0167  0.0120  0.0044  11  ASP E C   
1323 O O   . ASP E 16 ? 0.1664 0.1474 0.1262 0.0194  0.0078  -0.0009 11  ASP E O   
1324 C CB  . ASP E 16 ? 0.1790 0.1427 0.1265 0.0188  0.0093  0.0170  11  ASP E CB  
1325 C CG  . ASP E 16 ? 0.1956 0.1503 0.1437 0.0148  0.0099  0.0277  11  ASP E CG  
1326 O OD1 . ASP E 16 ? 0.2112 0.1597 0.1506 0.0171  0.0082  0.0352  11  ASP E OD1 
1327 O OD2 . ASP E 16 ? 0.1812 0.1350 0.1389 0.0091  0.0114  0.0293  11  ASP E OD2 
1328 N N   . ALA E 17 ? 0.1522 0.1333 0.1102 0.0158  0.0155  0.0038  12  ALA E N   
1329 C CA  . ALA E 17 ? 0.1449 0.1300 0.1048 0.0172  0.0133  -0.0038 12  ALA E CA  
1330 C C   . ALA E 17 ? 0.1745 0.1613 0.1277 0.0229  0.0076  -0.0085 12  ALA E C   
1331 O O   . ALA E 17 ? 0.2103 0.1959 0.1510 0.0281  0.0076  -0.0053 12  ALA E O   
1332 C CB  . ALA E 17 ? 0.1528 0.1390 0.1106 0.0184  0.0164  -0.0047 12  ALA E CB  
1333 N N   . VAL E 18 ? 0.1753 0.1661 0.1376 0.0218  0.0026  -0.0152 13  VAL E N   
1334 C CA  . VAL E 18 ? 0.1834 0.1775 0.1426 0.0271  -0.0048 -0.0216 13  VAL E CA  
1335 C C   . VAL E 18 ? 0.2055 0.1998 0.1665 0.0283  -0.0098 -0.0300 13  VAL E C   
1336 O O   . VAL E 18 ? 0.2366 0.2319 0.1894 0.0352  -0.0165 -0.0364 13  VAL E O   
1337 C CB  . VAL E 18 ? 0.2576 0.2594 0.2295 0.0254  -0.0084 -0.0239 13  VAL E CB  
1338 C CG1 . VAL E 18 ? 0.2914 0.2987 0.2635 0.0307  -0.0173 -0.0314 13  VAL E CG1 
1339 C CG2 . VAL E 18 ? 0.2968 0.2960 0.2649 0.0270  -0.0057 -0.0182 13  VAL E CG2 
1340 N N   . HIS E 19 ? 0.1741 0.1661 0.1453 0.0223  -0.0078 -0.0305 14  HIS E N   
1341 C CA  . HIS E 19 ? 0.1852 0.1730 0.1590 0.0235  -0.0139 -0.0389 14  HIS E CA  
1342 C C   . HIS E 19 ? 0.1529 0.1353 0.1208 0.0250  -0.0084 -0.0368 14  HIS E C   
1343 O O   . HIS E 19 ? 0.1681 0.1508 0.1367 0.0215  -0.0005 -0.0285 14  HIS E O   
1344 C CB  . HIS E 19 ? 0.1939 0.1824 0.1889 0.0146  -0.0192 -0.0415 14  HIS E CB  
1345 C CG  . HIS E 19 ? 0.2326 0.2313 0.2374 0.0131  -0.0242 -0.0437 14  HIS E CG  
1346 N ND1 . HIS E 19 ? 0.2552 0.2637 0.2694 0.0084  -0.0190 -0.0371 14  HIS E ND1 
1347 C CD2 . HIS E 19 ? 0.2499 0.2522 0.2566 0.0172  -0.0345 -0.0526 14  HIS E CD2 
1348 C CE1 . HIS E 19 ? 0.2503 0.2694 0.2730 0.0096  -0.0252 -0.0415 14  HIS E CE1 
1349 N NE2 . HIS E 19 ? 0.2671 0.2823 0.2861 0.0143  -0.0351 -0.0508 14  HIS E NE2 
1350 N N   . ASP E 20 ? 0.1662 0.1443 0.1285 0.0314  -0.0136 -0.0455 15  ASP E N   
1351 C CA  . ASP E 20 ? 0.1755 0.1522 0.1300 0.0365  -0.0082 -0.0448 15  ASP E CA  
1352 C C   . ASP E 20 ? 0.1926 0.1636 0.1601 0.0293  -0.0055 -0.0407 15  ASP E C   
1353 O O   . ASP E 20 ? 0.1726 0.1454 0.1363 0.0323  0.0006  -0.0375 15  ASP E O   
1354 C CB  . ASP E 20 ? 0.1949 0.1691 0.1390 0.0481  -0.0157 -0.0574 15  ASP E CB  
1355 C CG  . ASP E 20 ? 0.2235 0.2060 0.1475 0.0587  -0.0151 -0.0590 15  ASP E CG  
1356 O OD1 . ASP E 20 ? 0.2655 0.2488 0.1765 0.0709  -0.0200 -0.0694 15  ASP E OD1 
1357 O OD2 . ASP E 20 ? 0.2427 0.2306 0.1628 0.0560  -0.0101 -0.0498 15  ASP E OD2 
1358 N N   . ASP E 21 ? 0.1566 0.1224 0.1396 0.0201  -0.0098 -0.0398 16  ASP E N   
1359 C CA  . ASP E 21 ? 0.1720 0.1318 0.1652 0.0137  -0.0076 -0.0342 16  ASP E CA  
1360 C C   . ASP E 21 ? 0.1363 0.1029 0.1312 0.0080  0.0012  -0.0232 16  ASP E C   
1361 O O   . ASP E 21 ? 0.1575 0.1208 0.1586 0.0033  0.0035  -0.0175 16  ASP E O   
1362 C CB  . ASP E 21 ? 0.1583 0.1094 0.1677 0.0059  -0.0162 -0.0360 16  ASP E CB  
1363 C CG  . ASP E 21 ? 0.2123 0.1722 0.2329 -0.0025 -0.0161 -0.0318 16  ASP E CG  
1364 O OD1 . ASP E 21 ? 0.2200 0.1768 0.2572 -0.0115 -0.0204 -0.0289 16  ASP E OD1 
1365 O OD2 . ASP E 21 ? 0.1899 0.1605 0.2040 0.0000  -0.0121 -0.0306 16  ASP E OD2 
1366 N N   . GLU E 22 ? 0.1501 0.1246 0.1381 0.0096  0.0051  -0.0207 17  GLU E N   
1367 C CA  . GLU E 22 ? 0.1196 0.0986 0.1090 0.0056  0.0109  -0.0128 17  GLU E CA  
1368 C C   . GLU E 22 ? 0.1170 0.0972 0.0996 0.0082  0.0165  -0.0083 17  GLU E C   
1369 O O   . GLU E 22 ? 0.1484 0.1308 0.1230 0.0136  0.0180  -0.0094 17  GLU E O   
1370 C CB  . GLU E 22 ? 0.1573 0.1424 0.1459 0.0057  0.0098  -0.0128 17  GLU E CB  
1371 C CG  . GLU E 22 ? 0.1540 0.1431 0.1543 0.0016  0.0050  -0.0158 17  GLU E CG  
1372 C CD  . GLU E 22 ? 0.1441 0.1416 0.1446 0.0037  0.0034  -0.0171 17  GLU E CD  
1373 O OE1 . GLU E 22 ? 0.1391 0.1360 0.1294 0.0082  0.0054  -0.0151 17  GLU E OE1 
1374 O OE2 . GLU E 22 ? 0.1564 0.1611 0.1688 0.0006  -0.0007 -0.0199 17  GLU E OE2 
1375 N N   . LEU E 23 ? 0.1316 0.1122 0.1182 0.0045  0.0193  -0.0030 18  LEU E N   
1376 C CA  . LEU E 23 ? 0.1351 0.1176 0.1196 0.0052  0.0230  0.0014  18  LEU E CA  
1377 C C   . LEU E 23 ? 0.1443 0.1277 0.1246 0.0053  0.0233  0.0043  18  LEU E C   
1378 O O   . LEU E 23 ? 0.1555 0.1385 0.1356 0.0049  0.0208  0.0030  18  LEU E O   
1379 C CB  . LEU E 23 ? 0.1178 0.0992 0.1078 0.0022  0.0234  0.0044  18  LEU E CB  
1380 C CG  . LEU E 23 ? 0.1388 0.1169 0.1326 0.0024  0.0224  0.0037  18  LEU E CG  
1381 C CD1 . LEU E 23 ? 0.1630 0.1407 0.1591 0.0006  0.0222  0.0076  18  LEU E CD1 
1382 C CD2 . LEU E 23 ? 0.1453 0.1253 0.1386 0.0072  0.0236  0.0015  18  LEU E CD2 
1383 N N   . THR E 24 ? 0.1114 0.0967 0.0897 0.0059  0.0261  0.0089  19  THR E N   
1384 C CA  . THR E 24 ? 0.1217 0.1038 0.0987 0.0043  0.0251  0.0139  19  THR E CA  
1385 C C   . THR E 24 ? 0.1495 0.1300 0.1349 0.0003  0.0241  0.0163  19  THR E C   
1386 O O   . THR E 24 ? 0.1654 0.1506 0.1567 -0.0011 0.0267  0.0184  19  THR E O   
1387 C CB  . THR E 24 ? 0.1240 0.1089 0.0951 0.0059  0.0283  0.0200  19  THR E CB  
1388 O OG1 . THR E 24 ? 0.1527 0.1387 0.1135 0.0115  0.0273  0.0160  19  THR E OG1 
1389 C CG2 . THR E 24 ? 0.1664 0.1443 0.1386 0.0027  0.0261  0.0275  19  THR E CG2 
1390 N N   . ILE E 25 ? 0.1574 0.1322 0.1432 -0.0001 0.0195  0.0145  20  ILE E N   
1391 C CA  . ILE E 25 ? 0.1351 0.1077 0.1267 -0.0019 0.0164  0.0138  20  ILE E CA  
1392 C C   . ILE E 25 ? 0.1355 0.0992 0.1288 -0.0028 0.0104  0.0152  20  ILE E C   
1393 O O   . ILE E 25 ? 0.1500 0.1082 0.1383 -0.0006 0.0081  0.0155  20  ILE E O   
1394 C CB  . ILE E 25 ? 0.1242 0.0991 0.1137 0.0005  0.0154  0.0088  20  ILE E CB  
1395 C CG1 . ILE E 25 ? 0.1444 0.1190 0.1289 0.0042  0.0132  0.0052  20  ILE E CG1 
1396 C CG2 . ILE E 25 ? 0.1053 0.0850 0.0952 0.0001  0.0196  0.0087  20  ILE E CG2 
1397 C CD1 . ILE E 25 ? 0.1552 0.1373 0.1384 0.0061  0.0148  0.0026  20  ILE E CD1 
1398 N N   . ARG E 26 ? 0.1323 0.0937 0.1337 -0.0057 0.0064  0.0157  21  ARG E N   
1399 C CA  . ARG E 26 ? 0.1318 0.0819 0.1382 -0.0078 -0.0017 0.0168  21  ARG E CA  
1400 C C   . ARG E 26 ? 0.1345 0.0814 0.1431 -0.0053 -0.0096 0.0093  21  ARG E C   
1401 O O   . ARG E 26 ? 0.1376 0.0923 0.1487 -0.0053 -0.0078 0.0077  21  ARG E O   
1402 C CB  . ARG E 26 ? 0.1365 0.0879 0.1547 -0.0157 0.0003  0.0270  21  ARG E CB  
1403 C CG  . ARG E 26 ? 0.1385 0.0944 0.1512 -0.0164 0.0082  0.0354  21  ARG E CG  
1404 C CD  . ARG E 26 ? 0.1731 0.1156 0.1772 -0.0137 0.0033  0.0363  21  ARG E CD  
1405 N NE  . ARG E 26 ? 0.1718 0.1170 0.1680 -0.0132 0.0092  0.0448  21  ARG E NE  
1406 C CZ  . ARG E 26 ? 0.1902 0.1381 0.1733 -0.0065 0.0115  0.0410  21  ARG E CZ  
1407 N NH1 . ARG E 26 ? 0.1888 0.1389 0.1631 -0.0048 0.0156  0.0486  21  ARG E NH1 
1408 N NH2 . ARG E 26 ? 0.1713 0.1210 0.1506 -0.0013 0.0096  0.0300  21  ARG E NH2 
1409 N N   . VAL E 27 ? 0.1491 0.0841 0.1555 -0.0017 -0.0192 0.0039  22  VAL E N   
1410 C CA  . VAL E 27 ? 0.1581 0.0898 0.1632 0.0035  -0.0283 -0.0055 22  VAL E CA  
1411 C C   . VAL E 27 ? 0.1708 0.1053 0.1883 -0.0021 -0.0316 -0.0042 22  VAL E C   
1412 O O   . VAL E 27 ? 0.2034 0.1353 0.2357 -0.0109 -0.0329 0.0031  22  VAL E O   
1413 C CB  . VAL E 27 ? 0.1719 0.0865 0.1758 0.0081  -0.0412 -0.0120 22  VAL E CB  
1414 C CG1 . VAL E 27 ? 0.1955 0.1076 0.1951 0.0162  -0.0518 -0.0242 22  VAL E CG1 
1415 C CG2 . VAL E 27 ? 0.1738 0.0869 0.1666 0.0151  -0.0390 -0.0140 22  VAL E CG2 
1416 N N   . GLY E 28 ? 0.1592 0.1006 0.1714 0.0032  -0.0329 -0.0102 23  GLY E N   
1417 C CA  . GLY E 28 ? 0.1698 0.1154 0.1934 -0.0003 -0.0373 -0.0102 23  GLY E CA  
1418 C C   . GLY E 28 ? 0.1727 0.1321 0.1979 -0.0021 -0.0272 -0.0046 23  GLY E C   
1419 O O   . GLY E 28 ? 0.1538 0.1185 0.1819 -0.0003 -0.0307 -0.0070 23  GLY E O   
1420 N N   . GLU E 29 ? 0.1509 0.1152 0.1738 -0.0045 -0.0161 0.0018  24  GLU E N   
1421 C CA  . GLU E 29 ? 0.1554 0.1303 0.1800 -0.0051 -0.0080 0.0058  24  GLU E CA  
1422 C C   . GLU E 29 ? 0.1329 0.1100 0.1456 0.0014  -0.0076 0.0025  24  GLU E C   
1423 O O   . GLU E 29 ? 0.1587 0.1331 0.1592 0.0063  -0.0087 -0.0010 24  GLU E O   
1424 C CB  . GLU E 29 ? 0.1464 0.1243 0.1684 -0.0071 0.0017  0.0111  24  GLU E CB  
1425 C CG  . GLU E 29 ? 0.1686 0.1486 0.2019 -0.0134 0.0037  0.0177  24  GLU E CG  
1426 C CD  . GLU E 29 ? 0.2081 0.1926 0.2357 -0.0129 0.0129  0.0220  24  GLU E CD  
1427 O OE1 . GLU E 29 ? 0.2468 0.2418 0.2819 -0.0150 0.0185  0.0273  24  GLU E OE1 
1428 O OE2 . GLU E 29 ? 0.2404 0.2199 0.2563 -0.0097 0.0141  0.0196  24  GLU E OE2 
1429 N N   . ILE E 30 ? 0.1308 0.1139 0.1476 0.0021  -0.0061 0.0043  25  ILE E N   
1430 C CA  . ILE E 30 ? 0.1495 0.1334 0.1555 0.0074  -0.0050 0.0044  25  ILE E CA  
1431 C C   . ILE E 30 ? 0.1535 0.1385 0.1586 0.0062  0.0031  0.0087  25  ILE E C   
1432 O O   . ILE E 30 ? 0.1323 0.1213 0.1467 0.0047  0.0055  0.0100  25  ILE E O   
1433 C CB  . ILE E 30 ? 0.1706 0.1576 0.1805 0.0107  -0.0118 0.0028  25  ILE E CB  
1434 C CG1 . ILE E 30 ? 0.1693 0.1548 0.1847 0.0111  -0.0224 -0.0032 25  ILE E CG1 
1435 C CG2 . ILE E 30 ? 0.1549 0.1405 0.1501 0.0169  -0.0113 0.0049  25  ILE E CG2 
1436 C CD1 . ILE E 30 ? 0.1973 0.1772 0.1976 0.0164  -0.0266 -0.0084 25  ILE E CD1 
1437 N N   . ILE E 31 ? 0.1238 0.1063 0.1188 0.0072  0.0068  0.0104  26  ILE E N   
1438 C CA  . ILE E 31 ? 0.1204 0.1011 0.1152 0.0061  0.0116  0.0136  26  ILE E CA  
1439 C C   . ILE E 31 ? 0.1519 0.1298 0.1426 0.0091  0.0096  0.0171  26  ILE E C   
1440 O O   . ILE E 31 ? 0.1546 0.1333 0.1364 0.0116  0.0081  0.0191  26  ILE E O   
1441 C CB  . ILE E 31 ? 0.1335 0.1138 0.1239 0.0038  0.0156  0.0145  26  ILE E CB  
1442 C CG1 . ILE E 31 ? 0.1433 0.1248 0.1354 0.0024  0.0160  0.0113  26  ILE E CG1 
1443 C CG2 . ILE E 31 ? 0.1097 0.0861 0.1025 0.0019  0.0181  0.0164  26  ILE E CG2 
1444 C CD1 . ILE E 31 ? 0.1375 0.1208 0.1258 0.0020  0.0184  0.0108  26  ILE E CD1 
1445 N N   . ARG E 32 ? 0.1488 0.1236 0.1445 0.0103  0.0092  0.0178  27  ARG E N   
1446 C CA  . ARG E 32 ? 0.1544 0.1244 0.1466 0.0142  0.0054  0.0215  27  ARG E CA  
1447 C C   . ARG E 32 ? 0.1709 0.1306 0.1618 0.0131  0.0063  0.0263  27  ARG E C   
1448 O O   . ARG E 32 ? 0.1669 0.1238 0.1619 0.0101  0.0087  0.0243  27  ARG E O   
1449 C CB  . ARG E 32 ? 0.1965 0.1706 0.1972 0.0186  0.0010  0.0179  27  ARG E CB  
1450 C CG  . ARG E 32 ? 0.2138 0.1974 0.2207 0.0175  -0.0012 0.0138  27  ARG E CG  
1451 C CD  . ARG E 32 ? 0.2295 0.2208 0.2480 0.0210  -0.0063 0.0110  27  ARG E CD  
1452 N NE  . ARG E 32 ? 0.1852 0.1842 0.2130 0.0177  -0.0098 0.0078  27  ARG E NE  
1453 C CZ  . ARG E 32 ? 0.1518 0.1507 0.1773 0.0199  -0.0181 0.0051  27  ARG E CZ  
1454 N NH1 . ARG E 32 ? 0.1453 0.1486 0.1819 0.0159  -0.0230 0.0015  27  ARG E NH1 
1455 N NH2 . ARG E 32 ? 0.1498 0.1435 0.1614 0.0263  -0.0223 0.0061  27  ARG E NH2 
1456 N N   . ASN E 33 ? 0.1698 0.1228 0.1548 0.0157  0.0031  0.0328  28  ASN E N   
1457 C CA  . ASN E 33 ? 0.1758 0.1154 0.1610 0.0137  0.0018  0.0392  28  ASN E CA  
1458 C C   . ASN E 33 ? 0.1899 0.1297 0.1767 0.0057  0.0068  0.0427  28  ASN E C   
1459 O O   . ASN E 33 ? 0.1844 0.1159 0.1784 0.0024  0.0056  0.0410  28  ASN E O   
1460 C CB  . ASN E 33 ? 0.1871 0.1189 0.1807 0.0178  -0.0024 0.0327  28  ASN E CB  
1461 C CG  . ASN E 33 ? 0.2220 0.1350 0.2163 0.0178  -0.0076 0.0384  28  ASN E CG  
1462 O OD1 . ASN E 33 ? 0.2339 0.1378 0.2346 0.0190  -0.0108 0.0325  28  ASN E OD1 
1463 N ND2 . ASN E 33 ? 0.2504 0.1566 0.2373 0.0171  -0.0094 0.0498  28  ASN E ND2 
1464 N N   . VAL E 34 ? 0.1863 0.1369 0.1668 0.0037  0.0115  0.0462  29  VAL E N   
1465 C CA  . VAL E 34 ? 0.1722 0.1286 0.1562 -0.0030 0.0166  0.0482  29  VAL E CA  
1466 C C   . VAL E 34 ? 0.1936 0.1445 0.1802 -0.0092 0.0178  0.0606  29  VAL E C   
1467 O O   . VAL E 34 ? 0.1956 0.1440 0.1746 -0.0078 0.0176  0.0709  29  VAL E O   
1468 C CB  . VAL E 34 ? 0.1631 0.1348 0.1401 -0.0009 0.0208  0.0460  29  VAL E CB  
1469 C CG1 . VAL E 34 ? 0.1774 0.1586 0.1588 -0.0064 0.0263  0.0490  29  VAL E CG1 
1470 C CG2 . VAL E 34 ? 0.1356 0.1097 0.1142 0.0025  0.0187  0.0349  29  VAL E CG2 
1471 N N   . LYS E 35 ? 0.1949 0.1434 0.1930 -0.0163 0.0180  0.0600  30  LYS E N   
1472 C CA  A LYS E 35 ? 0.2406 0.1832 0.2470 -0.0251 0.0180  0.0721  30  LYS E CA  
1473 C CA  B LYS E 35 ? 0.2409 0.1836 0.2473 -0.0251 0.0180  0.0721  30  LYS E CA  
1474 C C   . LYS E 35 ? 0.2340 0.1918 0.2500 -0.0324 0.0233  0.0735  30  LYS E C   
1475 O O   . LYS E 35 ? 0.1987 0.1636 0.2171 -0.0307 0.0237  0.0623  30  LYS E O   
1476 C CB  A LYS E 35 ? 0.2633 0.1837 0.2791 -0.0269 0.0089  0.0691  30  LYS E CB  
1477 C CB  B LYS E 35 ? 0.2628 0.1833 0.2787 -0.0270 0.0090  0.0693  30  LYS E CB  
1478 C CG  A LYS E 35 ? 0.2883 0.1952 0.2969 -0.0179 0.0029  0.0657  30  LYS E CG  
1479 C CG  B LYS E 35 ? 0.2879 0.1948 0.2966 -0.0179 0.0029  0.0655  30  LYS E CG  
1480 C CD  A LYS E 35 ? 0.3152 0.2024 0.3324 -0.0163 -0.0066 0.0578  30  LYS E CD  
1481 C CD  B LYS E 35 ? 0.3210 0.2057 0.3387 -0.0178 -0.0070 0.0612  30  LYS E CD  
1482 C CE  A LYS E 35 ? 0.3274 0.2030 0.3386 -0.0059 -0.0128 0.0548  30  LYS E CE  
1483 C CE  B LYS E 35 ? 0.3298 0.2041 0.3414 -0.0065 -0.0131 0.0557  30  LYS E CE  
1484 N NZ  A LYS E 35 ? 0.3371 0.2033 0.3427 -0.0066 -0.0147 0.0701  30  LYS E NZ  
1485 N NZ  B LYS E 35 ? 0.3510 0.2022 0.3703 -0.0040 -0.0242 0.0505  30  LYS E NZ  
1486 N N   A LYS E 36 ? 0.2554 0.2194 0.2775 -0.0404 0.0274  0.0883  31  LYS E N   
1487 N N   B LYS E 36 ? 0.2559 0.2197 0.2781 -0.0404 0.0274  0.0883  31  LYS E N   
1488 C CA  A LYS E 36 ? 0.2664 0.2455 0.3026 -0.0483 0.0309  0.0890  31  LYS E CA  
1489 C CA  B LYS E 36 ? 0.2664 0.2454 0.3025 -0.0482 0.0308  0.0889  31  LYS E CA  
1490 C C   A LYS E 36 ? 0.2853 0.2476 0.3382 -0.0569 0.0223  0.0879  31  LYS E C   
1491 C C   B LYS E 36 ? 0.2856 0.2479 0.3386 -0.0569 0.0223  0.0879  31  LYS E C   
1492 O O   A LYS E 36 ? 0.3226 0.2723 0.3770 -0.0607 0.0190  0.0955  31  LYS E O   
1493 O O   B LYS E 36 ? 0.3216 0.2716 0.3761 -0.0607 0.0190  0.0956  31  LYS E O   
1494 C CB  A LYS E 36 ? 0.2827 0.2824 0.3145 -0.0493 0.0394  0.0989  31  LYS E CB  
1495 C CB  B LYS E 36 ? 0.2824 0.2821 0.3142 -0.0493 0.0394  0.0988  31  LYS E CB  
1496 C CG  A LYS E 36 ? 0.2840 0.3007 0.3335 -0.0577 0.0427  0.1007  31  LYS E CG  
1497 C CG  B LYS E 36 ? 0.2800 0.3006 0.3270 -0.0553 0.0438  0.0984  31  LYS E CG  
1498 C CD  A LYS E 36 ? 0.2650 0.2948 0.3214 -0.0557 0.0435  0.0897  31  LYS E CD  
1499 C CD  B LYS E 36 ? 0.2570 0.2898 0.3041 -0.0499 0.0454  0.0870  31  LYS E CD  
1500 C CE  A LYS E 36 ? 0.2534 0.3066 0.3253 -0.0612 0.0480  0.0918  31  LYS E CE  
1501 C CE  B LYS E 36 ? 0.2424 0.3041 0.2941 -0.0488 0.0529  0.0871  31  LYS E CE  
1502 N NZ  A LYS E 36 ? 0.2535 0.2989 0.3459 -0.0736 0.0426  0.0969  31  LYS E NZ  
1503 N NZ  B LYS E 36 ? 0.2264 0.2996 0.2739 -0.0405 0.0542  0.0759  31  LYS E NZ  
1504 N N   . LEU E 37 ? 0.2761 0.2368 0.3410 -0.0592 0.0177  0.0777  32  LEU E N   
1505 C CA  . LEU E 37 ? 0.3129 0.2584 0.3933 -0.0658 0.0075  0.0735  32  LEU E CA  
1506 C C   . LEU E 37 ? 0.3521 0.3163 0.4488 -0.0752 0.0105  0.0782  32  LEU E C   
1507 O O   . LEU E 37 ? 0.3832 0.3679 0.4773 -0.0764 0.0205  0.0878  32  LEU E O   
1508 C CB  . LEU E 37 ? 0.3083 0.2416 0.3890 -0.0600 -0.0010 0.0565  32  LEU E CB  
1509 C CG  . LEU E 37 ? 0.3355 0.2548 0.3990 -0.0482 -0.0033 0.0491  32  LEU E CG  
1510 C CD1 . LEU E 37 ? 0.3380 0.2493 0.3991 -0.0405 -0.0108 0.0313  32  LEU E CD1 
1511 C CD2 . LEU E 37 ? 0.3586 0.2573 0.4223 -0.0496 -0.0084 0.0587  32  LEU E CD2 
1512 N N   . GLN E 38 ? 0.3791 0.3375 0.4925 -0.0806 0.0014  0.0705  33  GLN E N   
1513 C CA  . GLN E 38 ? 0.3809 0.3563 0.5130 -0.0903 0.0028  0.0755  33  GLN E CA  
1514 C C   . GLN E 38 ? 0.3411 0.3457 0.4776 -0.0890 0.0104  0.0725  33  GLN E C   
1515 O O   . GLN E 38 ? 0.3485 0.3740 0.4988 -0.0952 0.0148  0.0780  33  GLN E O   
1516 C CB  . GLN E 38 ? 0.4192 0.3783 0.5684 -0.0959 -0.0115 0.0674  33  GLN E CB  
1517 C CG  . GLN E 38 ? 0.4805 0.4119 0.6283 -0.0971 -0.0201 0.0705  33  GLN E CG  
1518 C CD  . GLN E 38 ? 0.5207 0.4385 0.6869 -0.1028 -0.0345 0.0634  33  GLN E CD  
1519 O OE1 . GLN E 38 ? 0.5598 0.4793 0.7419 -0.1132 -0.0358 0.0735  33  GLN E OE1 
1520 N NE2 . GLN E 38 ? 0.5319 0.4363 0.6954 -0.0952 -0.0458 0.0456  33  GLN E NE2 
1521 N N   . GLU E 39 ? 0.3123 0.3194 0.4377 -0.0804 0.0123  0.0643  34  GLU E N   
1522 C CA  . GLU E 39 ? 0.2933 0.3238 0.4213 -0.0762 0.0159  0.0567  34  GLU E CA  
1523 C C   . GLU E 39 ? 0.2846 0.3407 0.4024 -0.0706 0.0293  0.0633  34  GLU E C   
1524 O O   . GLU E 39 ? 0.3427 0.3944 0.4398 -0.0627 0.0344  0.0650  34  GLU E O   
1525 C CB  . GLU E 39 ? 0.2782 0.2959 0.3900 -0.0645 0.0096  0.0389  34  GLU E CB  
1526 C CG  . GLU E 39 ? 0.2816 0.3159 0.3974 -0.0603 0.0080  0.0286  34  GLU E CG  
1527 C CD  . GLU E 39 ? 0.2988 0.3172 0.4052 -0.0528 -0.0019 0.0131  34  GLU E CD  
1528 O OE1 . GLU E 39 ? 0.3200 0.3172 0.4157 -0.0495 -0.0057 0.0099  34  GLU E OE1 
1529 O OE2 . GLU E 39 ? 0.2565 0.2849 0.3657 -0.0490 -0.0057 0.0043  34  GLU E OE2 
1530 N N   . GLU E 40 ? 0.2168 0.3007 0.3498 -0.0734 0.0337  0.0652  35  GLU E N   
1531 C CA  . GLU E 40 ? 0.1747 0.2849 0.2983 -0.0657 0.0451  0.0685  35  GLU E CA  
1532 C C   . GLU E 40 ? 0.1789 0.2900 0.2832 -0.0511 0.0451  0.0551  35  GLU E C   
1533 O O   . GLU E 40 ? 0.1718 0.2764 0.2774 -0.0476 0.0374  0.0424  35  GLU E O   
1534 C CB  . GLU E 40 ? 0.2275 0.3635 0.3713 -0.0706 0.0479  0.0705  35  GLU E CB  
1535 C CG  . GLU E 40 ? 0.2591 0.4214 0.3944 -0.0623 0.0592  0.0741  35  GLU E CG  
1536 C CD  . GLU E 40 ? 0.2863 0.4728 0.4440 -0.0692 0.0627  0.0791  35  GLU E CD  
1537 O OE1 . GLU E 40 ? 0.2517 0.4372 0.4329 -0.0795 0.0553  0.0770  35  GLU E OE1 
1538 O OE2 . GLU E 40 ? 0.3268 0.5341 0.4789 -0.0638 0.0723  0.0846  35  GLU E OE2 
1539 N N   . GLY E 41 ? 0.1781 0.2939 0.2626 -0.0416 0.0520  0.0569  36  GLY E N   
1540 C CA  . GLY E 41 ? 0.1440 0.2575 0.2102 -0.0278 0.0504  0.0440  36  GLY E CA  
1541 C C   . GLY E 41 ? 0.1421 0.2264 0.1927 -0.0239 0.0435  0.0362  36  GLY E C   
1542 O O   . GLY E 41 ? 0.1336 0.2131 0.1702 -0.0141 0.0415  0.0274  36  GLY E O   
1543 N N   . TRP E 42 ? 0.1373 0.2027 0.1920 -0.0316 0.0393  0.0395  37  TRP E N   
1544 C CA  . TRP E 42 ? 0.1328 0.1746 0.1763 -0.0282 0.0334  0.0324  37  TRP E CA  
1545 C C   . TRP E 42 ? 0.1460 0.1736 0.1839 -0.0306 0.0336  0.0399  37  TRP E C   
1546 O O   . TRP E 42 ? 0.1768 0.2057 0.2234 -0.0381 0.0355  0.0508  37  TRP E O   
1547 C CB  . TRP E 42 ? 0.1227 0.1547 0.1750 -0.0311 0.0255  0.0246  37  TRP E CB  
1548 C CG  . TRP E 42 ? 0.1080 0.1497 0.1602 -0.0256 0.0235  0.0157  37  TRP E CG  
1549 C CD1 . TRP E 42 ? 0.1517 0.2138 0.2161 -0.0265 0.0247  0.0156  37  TRP E CD1 
1550 C CD2 . TRP E 42 ? 0.1040 0.1364 0.1431 -0.0176 0.0200  0.0070  37  TRP E CD2 
1551 N NE1 . TRP E 42 ? 0.1025 0.1663 0.1612 -0.0186 0.0209  0.0061  37  TRP E NE1 
1552 C CE2 . TRP E 42 ? 0.1079 0.1527 0.1504 -0.0136 0.0182  0.0017  37  TRP E CE2 
1553 C CE3 . TRP E 42 ? 0.1036 0.1200 0.1297 -0.0136 0.0185  0.0041  37  TRP E CE3 
1554 C CZ2 . TRP E 42 ? 0.1248 0.1632 0.1563 -0.0059 0.0144  -0.0052 37  TRP E CZ2 
1555 C CZ3 . TRP E 42 ? 0.1029 0.1158 0.1196 -0.0071 0.0160  -0.0018 37  TRP E CZ3 
1556 C CH2 . TRP E 42 ? 0.1238 0.1460 0.1422 -0.0034 0.0137  -0.0058 37  TRP E CH2 
1557 N N   . LEU E 43 ? 0.1376 0.1525 0.1621 -0.0242 0.0315  0.0349  38  LEU E N   
1558 C CA  . LEU E 43 ? 0.1609 0.1622 0.1800 -0.0244 0.0303  0.0401  38  LEU E CA  
1559 C C   . LEU E 43 ? 0.1319 0.1166 0.1502 -0.0225 0.0242  0.0323  38  LEU E C   
1560 O O   . LEU E 43 ? 0.1353 0.1201 0.1539 -0.0202 0.0220  0.0237  38  LEU E O   
1561 C CB  . LEU E 43 ? 0.1701 0.1755 0.1747 -0.0173 0.0332  0.0414  38  LEU E CB  
1562 C CG  . LEU E 43 ? 0.1673 0.1906 0.1688 -0.0166 0.0398  0.0496  38  LEU E CG  
1563 C CD1 . LEU E 43 ? 0.1880 0.2162 0.1738 -0.0063 0.0401  0.0448  38  LEU E CD1 
1564 C CD2 . LEU E 43 ? 0.1950 0.2158 0.1991 -0.0226 0.0420  0.0639  38  LEU E CD2 
1565 N N   . GLU E 44 ? 0.1337 0.1053 0.1502 -0.0222 0.0214  0.0355  39  GLU E N   
1566 C CA  A GLU E 44 ? 0.1344 0.0932 0.1499 -0.0181 0.0161  0.0276  39  GLU E CA  
1567 C CA  B GLU E 44 ? 0.1463 0.1051 0.1619 -0.0181 0.0161  0.0276  39  GLU E CA  
1568 C C   . GLU E 44 ? 0.1443 0.0996 0.1516 -0.0122 0.0161  0.0283  39  GLU E C   
1569 O O   . GLU E 44 ? 0.1775 0.1318 0.1814 -0.0124 0.0169  0.0362  39  GLU E O   
1570 C CB  A GLU E 44 ? 0.1541 0.0987 0.1794 -0.0223 0.0096  0.0280  39  GLU E CB  
1571 C CB  B GLU E 44 ? 0.1613 0.1055 0.1862 -0.0220 0.0095  0.0279  39  GLU E CB  
1572 C CG  A GLU E 44 ? 0.1647 0.0999 0.1890 -0.0163 0.0037  0.0164  39  GLU E CG  
1573 C CG  B GLU E 44 ? 0.1750 0.1087 0.1976 -0.0150 0.0038  0.0169  39  GLU E CG  
1574 C CD  A GLU E 44 ? 0.1970 0.1201 0.2178 -0.0102 0.0001  0.0155  39  GLU E CD  
1575 C CD  B GLU E 44 ? 0.2138 0.1285 0.2413 -0.0145 -0.0043 0.0172  39  GLU E CD  
1576 O OE1 A GLU E 44 ? 0.2374 0.1561 0.2573 -0.0117 0.0005  0.0247  39  GLU E OE1 
1577 O OE1 B GLU E 44 ? 0.2255 0.1335 0.2539 -0.0174 -0.0046 0.0274  39  GLU E OE1 
1578 O OE2 A GLU E 44 ? 0.1965 0.1160 0.2148 -0.0026 -0.0033 0.0056  39  GLU E OE2 
1579 O OE2 B GLU E 44 ? 0.2216 0.1274 0.2510 -0.0101 -0.0111 0.0068  39  GLU E OE2 
1580 N N   . GLY E 45 ? 0.1384 0.0936 0.1431 -0.0066 0.0152  0.0206  40  GLY E N   
1581 C CA  . GLY E 45 ? 0.1445 0.1003 0.1452 -0.0016 0.0148  0.0208  40  GLY E CA  
1582 C C   . GLY E 45 ? 0.1291 0.0869 0.1312 0.0036  0.0144  0.0136  40  GLY E C   
1583 O O   . GLY E 45 ? 0.1422 0.1015 0.1449 0.0042  0.0151  0.0085  40  GLY E O   
1584 N N   . GLU E 46 ? 0.1386 0.0986 0.1412 0.0078  0.0132  0.0137  41  GLU E N   
1585 C CA  . GLU E 46 ? 0.1319 0.0987 0.1385 0.0128  0.0140  0.0086  41  GLU E CA  
1586 C C   . GLU E 46 ? 0.1117 0.0899 0.1201 0.0107  0.0170  0.0092  41  GLU E C   
1587 O O   . GLU E 46 ? 0.1459 0.1252 0.1533 0.0087  0.0156  0.0117  41  GLU E O   
1588 C CB  . GLU E 46 ? 0.1681 0.1328 0.1781 0.0189  0.0099  0.0081  41  GLU E CB  
1589 C CG  . GLU E 46 ? 0.1777 0.1535 0.1941 0.0256  0.0114  0.0026  41  GLU E CG  
1590 C CD  . GLU E 46 ? 0.1925 0.1839 0.2159 0.0239  0.0142  0.0044  41  GLU E CD  
1591 O OE1 . GLU E 46 ? 0.1760 0.1666 0.1996 0.0206  0.0114  0.0077  41  GLU E OE1 
1592 O OE2 . GLU E 46 ? 0.1882 0.1933 0.2173 0.0257  0.0188  0.0027  41  GLU E OE2 
1593 N N   . LEU E 47 ? 0.1086 0.0946 0.1194 0.0116  0.0206  0.0071  42  LEU E N   
1594 C CA  . LEU E 47 ? 0.1030 0.0982 0.1184 0.0085  0.0229  0.0095  42  LEU E CA  
1595 C C   . LEU E 47 ? 0.1510 0.1585 0.1714 0.0113  0.0276  0.0094  42  LEU E C   
1596 O O   . LEU E 47 ? 0.1245 0.1326 0.1387 0.0145  0.0305  0.0072  42  LEU E O   
1597 C CB  . LEU E 47 ? 0.1236 0.1148 0.1332 0.0041  0.0235  0.0108  42  LEU E CB  
1598 C CG  . LEU E 47 ? 0.1432 0.1386 0.1572 0.0003  0.0239  0.0139  42  LEU E CG  
1599 C CD1 . LEU E 47 ? 0.1338 0.1303 0.1553 -0.0012 0.0189  0.0143  42  LEU E CD1 
1600 C CD2 . LEU E 47 ? 0.1423 0.1314 0.1490 -0.0015 0.0232  0.0138  42  LEU E CD2 
1601 N N   . ASN E 48 ? 0.1875 0.2065 0.2194 0.0105  0.0282  0.0120  43  ASN E N   
1602 C CA  . ASN E 48 ? 0.2081 0.2446 0.2477 0.0122  0.0345  0.0146  43  ASN E CA  
1603 C C   . ASN E 48 ? 0.1977 0.2397 0.2323 0.0223  0.0376  0.0090  43  ASN E C   
1604 O O   . ASN E 48 ? 0.2128 0.2669 0.2446 0.0259  0.0442  0.0101  43  ASN E O   
1605 C CB  . ASN E 48 ? 0.2405 0.2788 0.2775 0.0065  0.0388  0.0207  43  ASN E CB  
1606 C CG  . ASN E 48 ? 0.2596 0.2908 0.3029 -0.0022 0.0339  0.0248  43  ASN E CG  
1607 O OD1 . ASN E 48 ? 0.2794 0.3130 0.3343 -0.0047 0.0291  0.0247  43  ASN E OD1 
1608 N ND2 . ASN E 48 ? 0.2607 0.2827 0.2960 -0.0056 0.0336  0.0272  43  ASN E ND2 
1609 N N   . GLY E 49 ? 0.1757 0.2078 0.2079 0.0278  0.0321  0.0031  44  GLY E N   
1610 C CA  . GLY E 49 ? 0.1874 0.2221 0.2166 0.0391  0.0320  -0.0041 44  GLY E CA  
1611 C C   . GLY E 49 ? 0.1969 0.2154 0.2131 0.0427  0.0285  -0.0104 44  GLY E C   
1612 O O   . GLY E 49 ? 0.1932 0.2091 0.2064 0.0529  0.0255  -0.0185 44  GLY E O   
1613 N N   . ARG E 50 ? 0.1984 0.2063 0.2083 0.0348  0.0278  -0.0077 45  ARG E N   
1614 C CA  . ARG E 50 ? 0.2081 0.2018 0.2093 0.0362  0.0233  -0.0133 45  ARG E CA  
1615 C C   . ARG E 50 ? 0.1924 0.1708 0.1945 0.0276  0.0187  -0.0097 45  ARG E C   
1616 O O   . ARG E 50 ? 0.1746 0.1545 0.1802 0.0218  0.0197  -0.0034 45  ARG E O   
1617 C CB  . ARG E 50 ? 0.2375 0.2372 0.2304 0.0362  0.0273  -0.0137 45  ARG E CB  
1618 C CG  . ARG E 50 ? 0.2405 0.2410 0.2341 0.0263  0.0301  -0.0055 45  ARG E CG  
1619 C CD  . ARG E 50 ? 0.2416 0.2413 0.2256 0.0263  0.0306  -0.0065 45  ARG E CD  
1620 N NE  . ARG E 50 ? 0.2389 0.2259 0.2205 0.0259  0.0238  -0.0128 45  ARG E NE  
1621 C CZ  . ARG E 50 ? 0.1931 0.1781 0.1685 0.0255  0.0217  -0.0149 45  ARG E CZ  
1622 N NH1 . ARG E 50 ? 0.2195 0.2124 0.1880 0.0264  0.0260  -0.0108 45  ARG E NH1 
1623 N NH2 . ARG E 50 ? 0.1854 0.1607 0.1630 0.0239  0.0146  -0.0205 45  ARG E NH2 
1624 N N   . ARG E 51 ? 0.1950 0.1602 0.1945 0.0271  0.0132  -0.0136 46  ARG E N   
1625 C CA  . ARG E 51 ? 0.1855 0.1408 0.1874 0.0181  0.0105  -0.0084 46  ARG E CA  
1626 C C   . ARG E 51 ? 0.1939 0.1502 0.1933 0.0141  0.0108  -0.0098 46  ARG E C   
1627 O O   . ARG E 51 ? 0.2205 0.1788 0.2152 0.0192  0.0097  -0.0166 46  ARG E O   
1628 C CB  . ARG E 51 ? 0.2153 0.1541 0.2211 0.0181  0.0030  -0.0088 46  ARG E CB  
1629 C CG  . ARG E 51 ? 0.2360 0.1716 0.2438 0.0233  0.0010  -0.0072 46  ARG E CG  
1630 C CD  . ARG E 51 ? 0.2350 0.1511 0.2461 0.0211  -0.0069 -0.0039 46  ARG E CD  
1631 N NE  . ARG E 51 ? 0.2595 0.1735 0.2716 0.0107  -0.0049 0.0072  46  ARG E NE  
1632 C CZ  . ARG E 51 ? 0.2617 0.1781 0.2713 0.0095  -0.0028 0.0157  46  ARG E CZ  
1633 N NH1 . ARG E 51 ? 0.2486 0.1685 0.2567 0.0170  -0.0037 0.0140  46  ARG E NH1 
1634 N NH2 . ARG E 51 ? 0.2595 0.1769 0.2681 0.0017  -0.0001 0.0256  46  ARG E NH2 
1635 N N   . GLY E 52 ? 0.1692 0.1260 0.1709 0.0065  0.0120  -0.0039 47  GLY E N   
1636 C CA  . GLY E 52 ? 0.1433 0.1028 0.1447 0.0032  0.0115  -0.0055 47  GLY E CA  
1637 C C   . GLY E 52 ? 0.1504 0.1130 0.1561 -0.0040 0.0132  0.0010  47  GLY E C   
1638 O O   . GLY E 52 ? 0.1191 0.0821 0.1253 -0.0061 0.0153  0.0073  47  GLY E O   
1639 N N   . MET E 53 ? 0.1196 0.0866 0.1279 -0.0065 0.0119  -0.0010 48  MET E N   
1640 C CA  A MET E 53 ? 0.1156 0.0905 0.1292 -0.0119 0.0142  0.0042  48  MET E CA  
1641 C CA  B MET E 53 ? 0.1155 0.0906 0.1292 -0.0119 0.0142  0.0042  48  MET E CA  
1642 C C   . MET E 53 ? 0.1227 0.1064 0.1295 -0.0089 0.0183  0.0048  48  MET E C   
1643 O O   . MET E 53 ? 0.1385 0.1219 0.1389 -0.0046 0.0181  0.0012  48  MET E O   
1644 C CB  A MET E 53 ? 0.1775 0.1552 0.2010 -0.0158 0.0098  0.0012  48  MET E CB  
1645 C CB  B MET E 53 ? 0.1194 0.0972 0.1426 -0.0156 0.0098  0.0010  48  MET E CB  
1646 C CG  A MET E 53 ? 0.1818 0.1472 0.2136 -0.0187 0.0025  -0.0015 48  MET E CG  
1647 C CG  B MET E 53 ? 0.1795 0.1454 0.2113 -0.0188 0.0026  -0.0015 48  MET E CG  
1648 S SD  A MET E 53 ? 0.2064 0.1641 0.2467 -0.0263 0.0031  0.0099  48  MET E SD  
1649 S SD  B MET E 53 ? 0.2043 0.1628 0.2438 -0.0259 0.0036  0.0099  48  MET E SD  
1650 C CE  A MET E 53 ? 0.1347 0.1117 0.1847 -0.0342 0.0096  0.0198  48  MET E CE  
1651 C CE  B MET E 53 ? 0.1573 0.0984 0.2097 -0.0298 -0.0084 0.0050  48  MET E CE  
1652 N N   . PHE E 54 ? 0.1049 0.0962 0.1126 -0.0104 0.0214  0.0096  49  PHE E N   
1653 C CA  . PHE E 54 ? 0.1006 0.0980 0.1022 -0.0063 0.0230  0.0082  49  PHE E CA  
1654 C C   . PHE E 54 ? 0.1011 0.1117 0.1058 -0.0066 0.0257  0.0108  49  PHE E C   
1655 O O   . PHE E 54 ? 0.1178 0.1333 0.1277 -0.0108 0.0284  0.0169  49  PHE E O   
1656 C CB  . PHE E 54 ? 0.1000 0.0922 0.0947 -0.0034 0.0233  0.0091  49  PHE E CB  
1657 C CG  . PHE E 54 ? 0.1033 0.0954 0.0971 -0.0042 0.0246  0.0140  49  PHE E CG  
1658 C CD1 . PHE E 54 ? 0.1058 0.1048 0.0944 -0.0011 0.0257  0.0153  49  PHE E CD1 
1659 C CD2 . PHE E 54 ? 0.1261 0.1108 0.1224 -0.0062 0.0237  0.0166  49  PHE E CD2 
1660 C CE1 . PHE E 54 ? 0.1254 0.1250 0.1101 -0.0004 0.0266  0.0204  49  PHE E CE1 
1661 C CE2 . PHE E 54 ? 0.1463 0.1297 0.1403 -0.0061 0.0240  0.0221  49  PHE E CE2 
1662 C CZ  . PHE E 54 ? 0.1460 0.1372 0.1334 -0.0033 0.0257  0.0246  49  PHE E CZ  
1663 N N   . PRO E 55 ? 0.0995 0.1169 0.1018 -0.0018 0.0251  0.0066  50  PRO E N   
1664 C CA  . PRO E 55 ? 0.1156 0.1501 0.1217 0.0000  0.0281  0.0076  50  PRO E CA  
1665 C C   . PRO E 55 ? 0.1179 0.1576 0.1162 0.0039  0.0314  0.0106  50  PRO E C   
1666 O O   . PRO E 55 ? 0.1314 0.1617 0.1202 0.0087  0.0284  0.0072  50  PRO E O   
1667 C CB  . PRO E 55 ? 0.1369 0.1737 0.1409 0.0065  0.0244  0.0005  50  PRO E CB  
1668 C CG  . PRO E 55 ? 0.1438 0.1632 0.1388 0.0085  0.0205  -0.0018 50  PRO E CG  
1669 C CD  . PRO E 55 ? 0.1303 0.1405 0.1268 0.0025  0.0214  0.0016  50  PRO E CD  
1670 N N   . ASP E 56 ? 0.1195 0.1747 0.1219 0.0021  0.0370  0.0171  51  ASP E N   
1671 C CA  . ASP E 56 ? 0.1521 0.2120 0.1439 0.0066  0.0402  0.0212  51  ASP E CA  
1672 C C   . ASP E 56 ? 0.1575 0.2264 0.1387 0.0187  0.0392  0.0135  51  ASP E C   
1673 O O   . ASP E 56 ? 0.1834 0.2546 0.1527 0.0250  0.0396  0.0138  51  ASP E O   
1674 C CB  . ASP E 56 ? 0.1985 0.2727 0.1963 0.0007  0.0476  0.0336  51  ASP E CB  
1675 C CG  . ASP E 56 ? 0.2337 0.3338 0.2426 0.0004  0.0534  0.0362  51  ASP E CG  
1676 O OD1 . ASP E 56 ? 0.2318 0.3417 0.2397 0.0085  0.0521  0.0271  51  ASP E OD1 
1677 O OD2 . ASP E 56 ? 0.2481 0.3595 0.2681 -0.0081 0.0591  0.0483  51  ASP E OD2 
1678 N N   . ASN E 57 ? 0.1493 0.2221 0.1337 0.0233  0.0363  0.0057  52  ASN E N   
1679 C CA  . ASN E 57 ? 0.1327 0.2102 0.1069 0.0365  0.0329  -0.0035 52  ASN E CA  
1680 C C   . ASN E 57 ? 0.1281 0.1817 0.0959 0.0398  0.0229  -0.0117 52  ASN E C   
1681 O O   . ASN E 57 ? 0.1482 0.1996 0.1091 0.0504  0.0168  -0.0207 52  ASN E O   
1682 C CB  . ASN E 57 ? 0.1770 0.2761 0.1584 0.0423  0.0354  -0.0072 52  ASN E CB  
1683 C CG  . ASN E 57 ? 0.1596 0.2530 0.1527 0.0373  0.0316  -0.0094 52  ASN E CG  
1684 O OD1 . ASN E 57 ? 0.1128 0.1896 0.1092 0.0284  0.0292  -0.0066 52  ASN E OD1 
1685 N ND2 . ASN E 57 ? 0.1454 0.2550 0.1442 0.0446  0.0310  -0.0150 52  ASN E ND2 
1686 N N   . PHE E 58 ? 0.1215 0.1579 0.0923 0.0310  0.0208  -0.0081 53  PHE E N   
1687 C CA  . PHE E 58 ? 0.1533 0.1696 0.1212 0.0315  0.0128  -0.0123 53  PHE E CA  
1688 C C   . PHE E 58 ? 0.1674 0.1757 0.1309 0.0305  0.0104  -0.0113 53  PHE E C   
1689 O O   . PHE E 58 ? 0.1628 0.1565 0.1273 0.0291  0.0039  -0.0134 53  PHE E O   
1690 C CB  . PHE E 58 ? 0.1454 0.1516 0.1199 0.0237  0.0126  -0.0090 53  PHE E CB  
1691 C CG  . PHE E 58 ? 0.1497 0.1579 0.1265 0.0266  0.0107  -0.0120 53  PHE E CG  
1692 C CD1 . PHE E 58 ? 0.1322 0.1579 0.1139 0.0286  0.0143  -0.0129 53  PHE E CD1 
1693 C CD2 . PHE E 58 ? 0.1413 0.1349 0.1164 0.0269  0.0051  -0.0128 53  PHE E CD2 
1694 C CE1 . PHE E 58 ? 0.1317 0.1607 0.1166 0.0321  0.0113  -0.0165 53  PHE E CE1 
1695 C CE2 . PHE E 58 ? 0.1302 0.1247 0.1056 0.0307  0.0023  -0.0151 53  PHE E CE2 
1696 C CZ  . PHE E 58 ? 0.1572 0.1693 0.1374 0.0339  0.0048  -0.0179 53  PHE E CZ  
1697 N N   . VAL E 59 ? 0.1395 0.1582 0.0992 0.0309  0.0154  -0.0070 54  VAL E N   
1698 C CA  . VAL E 59 ? 0.1458 0.1586 0.1018 0.0297  0.0135  -0.0046 54  VAL E CA  
1699 C C   . VAL E 59 ? 0.1662 0.1905 0.1097 0.0385  0.0144  -0.0053 54  VAL E C   
1700 O O   . VAL E 59 ? 0.1485 0.1890 0.0877 0.0441  0.0196  -0.0052 54  VAL E O   
1701 C CB  . VAL E 59 ? 0.1237 0.1343 0.0865 0.0203  0.0186  0.0043  54  VAL E CB  
1702 C CG1 . VAL E 59 ? 0.1345 0.1344 0.1064 0.0139  0.0171  0.0040  54  VAL E CG1 
1703 C CG2 . VAL E 59 ? 0.1230 0.1466 0.0887 0.0173  0.0265  0.0113  54  VAL E CG2 
1704 N N   . LYS E 60 ? 0.1629 0.1811 0.1005 0.0407  0.0095  -0.0060 55  LYS E N   
1705 C CA  . LYS E 60 ? 0.2162 0.2450 0.1389 0.0500  0.0100  -0.0057 55  LYS E CA  
1706 C C   . LYS E 60 ? 0.2096 0.2348 0.1309 0.0456  0.0112  0.0030  55  LYS E C   
1707 O O   . LYS E 60 ? 0.2007 0.2130 0.1293 0.0412  0.0052  0.0015  55  LYS E O   
1708 C CB  . LYS E 60 ? 0.2712 0.2952 0.1839 0.0618  -0.0015 -0.0191 55  LYS E CB  
1709 C CG  . LYS E 60 ? 0.3506 0.3870 0.2438 0.0745  -0.0018 -0.0205 55  LYS E CG  
1710 C CD  . LYS E 60 ? 0.4091 0.4389 0.2920 0.0878  -0.0160 -0.0367 55  LYS E CD  
1711 C CE  . LYS E 60 ? 0.4524 0.4645 0.3418 0.0836  -0.0284 -0.0408 55  LYS E CE  
1712 N NZ  . LYS E 60 ? 0.5035 0.5135 0.3781 0.0984  -0.0424 -0.0546 55  LYS E NZ  
1713 N N   . GLU E 61 ? 0.2126 0.2501 0.1256 0.0472  0.0188  0.0130  56  GLU E N   
1714 C CA  . GLU E 61 ? 0.1980 0.2301 0.1075 0.0447  0.0186  0.0221  56  GLU E CA  
1715 C C   . GLU E 61 ? 0.2064 0.2338 0.1039 0.0544  0.0082  0.0145  56  GLU E C   
1716 O O   . GLU E 61 ? 0.2336 0.2693 0.1163 0.0663  0.0048  0.0072  56  GLU E O   
1717 C CB  . GLU E 61 ? 0.2264 0.2719 0.1290 0.0437  0.0289  0.0370  56  GLU E CB  
1718 C CG  . GLU E 61 ? 0.2839 0.3206 0.1830 0.0410  0.0279  0.0481  56  GLU E CG  
1719 C CD  . GLU E 61 ? 0.3821 0.4304 0.2758 0.0383  0.0380  0.0659  56  GLU E CD  
1720 O OE1 . GLU E 61 ? 0.4207 0.4860 0.3170 0.0383  0.0448  0.0665  56  GLU E OE1 
1721 O OE2 . GLU E 61 ? 0.4280 0.4663 0.3206 0.0347  0.0371  0.0771  56  GLU E OE2 
1722 N N   . ILE E 62 ? 0.1951 0.2102 0.0997 0.0504  0.0021  0.0150  57  ILE E N   
1723 C CA  . ILE E 62 ? 0.2294 0.2408 0.1256 0.0586  -0.0089 0.0089  57  ILE E CA  
1724 C C   . ILE E 62 ? 0.2641 0.2816 0.1425 0.0649  -0.0060 0.0194  57  ILE E C   
1725 O O   . ILE E 62 ? 0.2754 0.2888 0.1579 0.0585  -0.0010 0.0318  57  ILE E O   
1726 C CB  . ILE E 62 ? 0.2512 0.2510 0.1649 0.0520  -0.0159 0.0061  57  ILE E CB  
1727 C CG1 . ILE E 62 ? 0.2490 0.2437 0.1795 0.0451  -0.0175 -0.0013 57  ILE E CG1 
1728 C CG2 . ILE E 62 ? 0.2638 0.2617 0.1721 0.0601  -0.0285 -0.0002 57  ILE E CG2 
1729 C CD1 . ILE E 62 ? 0.2457 0.2343 0.1948 0.0378  -0.0209 -0.0015 57  ILE E CD1 
1730 N N   . LYS E 63 ? 0.3178 0.3444 0.1756 0.0783  -0.0099 0.0147  58  LYS E N   
1731 C CA  . LYS E 63 ? 0.3985 0.4320 0.2357 0.0860  -0.0073 0.0260  58  LYS E CA  
1732 C C   . LYS E 63 ? 0.4377 0.4662 0.2664 0.0961  -0.0216 0.0167  58  LYS E C   
1733 O O   . LYS E 63 ? 0.4541 0.4740 0.2843 0.0949  -0.0268 0.0222  58  LYS E O   
1734 C CB  . LYS E 63 ? 0.4452 0.4965 0.2755 0.0900  0.0030  0.0291  58  LYS E CB  
1735 C CG  . LYS E 63 ? 0.4558 0.5148 0.2984 0.0791  0.0164  0.0389  58  LYS E CG  
1736 C CD  . LYS E 63 ? 0.5073 0.5869 0.3466 0.0838  0.0249  0.0408  58  LYS E CD  
1737 C CE  . LYS E 63 ? 0.5217 0.6098 0.3771 0.0735  0.0352  0.0463  58  LYS E CE  
1738 N NZ  . LYS E 63 ? 0.5473 0.6580 0.4015 0.0794  0.0422  0.0469  58  LYS E NZ  
1739 N N   . LYS F 3  ? 0.5931 0.3991 0.6487 -0.0556 -0.0633 -0.1318 380 LYS F N   
1740 C CA  . LYS F 3  ? 0.6011 0.3809 0.6313 -0.0366 -0.0504 -0.1378 380 LYS F CA  
1741 C C   . LYS F 3  ? 0.5448 0.3427 0.5642 -0.0191 -0.0418 -0.1250 380 LYS F C   
1742 O O   . LYS F 3  ? 0.5415 0.3376 0.5785 -0.0144 -0.0334 -0.1012 380 LYS F O   
1743 C CB  . LYS F 3  ? 0.6657 0.4348 0.6588 -0.0326 -0.0557 -0.1673 380 LYS F CB  
1744 N N   . ASN F 4  ? 0.5016 0.3163 0.4863 -0.0092 -0.0422 -0.1385 381 ASN F N   
1745 C CA  . ASN F 4  ? 0.4364 0.2788 0.4107 0.0048  -0.0282 -0.1210 381 ASN F CA  
1746 C C   . ASN F 4  ? 0.3735 0.2476 0.3567 -0.0026 -0.0328 -0.0954 381 ASN F C   
1747 O O   . ASN F 4  ? 0.4113 0.3013 0.3839 -0.0119 -0.0456 -0.0970 381 ASN F O   
1748 C CB  . ASN F 4  ? 0.4636 0.3131 0.3956 0.0142  -0.0195 -0.1384 381 ASN F CB  
1749 C CG  . ASN F 4  ? 0.5201 0.3392 0.4410 0.0244  -0.0089 -0.1649 381 ASN F CG  
1750 O OD1 . ASN F 4  ? 0.5099 0.3232 0.4551 0.0383  0.0060  -0.1616 381 ASN F OD1 
1751 N ND2 . ASN F 4  ? 0.5779 0.3818 0.4625 0.0166  -0.0158 -0.1837 381 ASN F ND2 
1752 N N   . LEU F 5  ? 0.2870 0.1682 0.2881 0.0037  -0.0245 -0.0734 382 LEU F N   
1753 C CA  . LEU F 5  ? 0.2458 0.1505 0.2539 -0.0017 -0.0262 -0.0515 382 LEU F CA  
1754 C C   . LEU F 5  ? 0.2246 0.1540 0.2212 0.0076  -0.0193 -0.0435 382 LEU F C   
1755 O O   . LEU F 5  ? 0.2177 0.1476 0.2175 0.0195  -0.0107 -0.0472 382 LEU F O   
1756 C CB  . LEU F 5  ? 0.2265 0.1152 0.2530 -0.0025 -0.0221 -0.0327 382 LEU F CB  
1757 C CG  . LEU F 5  ? 0.3081 0.1678 0.3537 -0.0156 -0.0224 -0.0346 382 LEU F CG  
1758 C CD1 . LEU F 5  ? 0.2625 0.1012 0.3111 -0.0138 -0.0118 -0.0100 382 LEU F CD1 
1759 C CD2 . LEU F 5  ? 0.3128 0.1918 0.3761 -0.0338 -0.0313 -0.0424 382 LEU F CD2 
1760 N N   . PRO F 6  ? 0.1855 0.1358 0.1765 0.0021  -0.0228 -0.0332 383 PRO F N   
1761 C CA  . PRO F 6  ? 0.1672 0.1358 0.1506 0.0076  -0.0154 -0.0248 383 PRO F CA  
1762 C C   . PRO F 6  ? 0.1708 0.1433 0.1714 0.0123  -0.0134 -0.0115 383 PRO F C   
1763 O O   . PRO F 6  ? 0.1708 0.1331 0.1782 0.0104  -0.0168 -0.0028 383 PRO F O   
1764 C CB  . PRO F 6  ? 0.1761 0.1564 0.1461 0.0015  -0.0232 -0.0187 383 PRO F CB  
1765 C CG  . PRO F 6  ? 0.1767 0.1557 0.1674 -0.0067 -0.0340 -0.0176 383 PRO F CG  
1766 C CD  . PRO F 6  ? 0.1839 0.1417 0.1819 -0.0092 -0.0344 -0.0308 383 PRO F CD  
1767 N N   . THR F 7  ? 0.1352 0.1204 0.1417 0.0181  -0.0072 -0.0110 384 THR F N   
1768 C CA  . THR F 7  ? 0.1201 0.1110 0.1386 0.0222  -0.0113 -0.0021 384 THR F CA  
1769 C C   . THR F 7  ? 0.1464 0.1497 0.1603 0.0162  -0.0085 0.0049  384 THR F C   
1770 O O   . THR F 7  ? 0.1813 0.1928 0.1928 0.0130  0.0009  0.0027  384 THR F O   
1771 C CB  . THR F 7  ? 0.1448 0.1438 0.1879 0.0325  -0.0115 -0.0097 384 THR F CB  
1772 O OG1 . THR F 7  ? 0.1628 0.1437 0.2100 0.0420  -0.0167 -0.0136 384 THR F OG1 
1773 C CG2 . THR F 7  ? 0.1340 0.1405 0.1873 0.0360  -0.0225 -0.0045 384 THR F CG2 
1774 N N   . ALA F 8  ? 0.1394 0.1391 0.1488 0.0153  -0.0136 0.0137  385 ALA F N   
1775 C CA  . ALA F 8  ? 0.1417 0.1473 0.1487 0.0117  -0.0113 0.0192  385 ALA F CA  
1776 C C   . ALA F 8  ? 0.1321 0.1459 0.1544 0.0110  -0.0081 0.0151  385 ALA F C   
1777 O O   . ALA F 8  ? 0.1323 0.1500 0.1708 0.0155  -0.0150 0.0087  385 ALA F O   
1778 C CB  . ALA F 8  ? 0.1529 0.1509 0.1534 0.0135  -0.0138 0.0257  385 ALA F CB  
1779 N N   . PRO F 9  ? 0.1443 0.1596 0.1642 0.0052  0.0013  0.0193  386 PRO F N   
1780 C CA  . PRO F 9  ? 0.1455 0.1673 0.1893 0.0001  0.0087  0.0157  386 PRO F CA  
1781 C C   . PRO F 9  ? 0.1300 0.1488 0.1860 0.0007  -0.0037 0.0118  386 PRO F C   
1782 O O   . PRO F 9  ? 0.1386 0.1457 0.1744 0.0048  -0.0103 0.0160  386 PRO F O   
1783 C CB  . PRO F 9  ? 0.1878 0.1996 0.2148 -0.0060 0.0230  0.0266  386 PRO F CB  
1784 C CG  . PRO F 9  ? 0.1972 0.2026 0.1905 -0.0015 0.0191  0.0319  386 PRO F CG  
1785 C CD  . PRO F 9  ? 0.1722 0.1808 0.1693 0.0035  0.0040  0.0281  386 PRO F CD  
1786 N N   . PRO F 10 ? 0.1385 0.1686 0.2291 -0.0028 -0.0071 0.0013  387 PRO F N   
1787 C CA  . PRO F 10 ? 0.1510 0.1751 0.2499 -0.0032 -0.0228 -0.0072 387 PRO F CA  
1788 C C   . PRO F 10 ? 0.1569 0.1605 0.2403 -0.0083 -0.0159 -0.0008 387 PRO F C   
1789 O O   . PRO F 10 ? 0.1576 0.1559 0.2416 -0.0153 0.0016  0.0098  387 PRO F O   
1790 C CB  . PRO F 10 ? 0.1708 0.2164 0.3253 -0.0107 -0.0247 -0.0207 387 PRO F CB  
1791 C CG  . PRO F 10 ? 0.1980 0.2631 0.3693 -0.0060 -0.0158 -0.0213 387 PRO F CG  
1792 C CD  . PRO F 10 ? 0.1612 0.2126 0.2899 -0.0053 0.0020  -0.0068 387 PRO F CD  
1793 N N   . ARG F 11 ? 0.1745 0.1623 0.2387 -0.0027 -0.0282 -0.0064 388 ARG F N   
1794 C CA  . ARG F 11 ? 0.1874 0.1535 0.2455 -0.0057 -0.0223 -0.0051 388 ARG F CA  
1795 C C   . ARG F 11 ? 0.1976 0.1602 0.2937 -0.0192 -0.0236 -0.0166 388 ARG F C   
1796 O O   . ARG F 11 ? 0.1858 0.1663 0.3145 -0.0242 -0.0357 -0.0307 388 ARG F O   
1797 C CB  . ARG F 11 ? 0.2109 0.1586 0.2357 0.0055  -0.0305 -0.0116 388 ARG F CB  
1798 C CG  . ARG F 11 ? 0.2202 0.1696 0.2160 0.0160  -0.0241 -0.0006 388 ARG F CG  
1799 C CD  . ARG F 11 ? 0.1852 0.1376 0.1862 0.0164  -0.0103 0.0146  388 ARG F CD  
1800 N NE  . ARG F 11 ? 0.2052 0.1393 0.2101 0.0185  -0.0045 0.0152  388 ARG F NE  
1801 C CZ  . ARG F 11 ? 0.2091 0.1315 0.2031 0.0291  0.0012  0.0126  388 ARG F CZ  
1802 N NH1 . ARG F 11 ? 0.2122 0.1394 0.1884 0.0361  0.0055  0.0108  388 ARG F NH1 
1803 N NH2 . ARG F 11 ? 0.2037 0.1068 0.2059 0.0332  0.0061  0.0126  388 ARG F NH2 
1804 N N   . ARG F 12 ? 0.2143 0.1531 0.3123 -0.0247 -0.0123 -0.0112 389 ARG F N   
1805 C CA  . ARG F 12 ? 0.2586 0.1867 0.3965 -0.0406 -0.0113 -0.0226 389 ARG F CA  
1806 C C   . ARG F 12 ? 0.3277 0.2458 0.4670 -0.0389 -0.0365 -0.0495 389 ARG F C   
1807 O O   . ARG F 12 ? 0.3783 0.2753 0.4764 -0.0256 -0.0429 -0.0540 389 ARG F O   
1808 C CB  . ARG F 12 ? 0.2723 0.1670 0.4063 -0.0456 0.0086  -0.0064 389 ARG F CB  
1809 C CG  . ARG F 12 ? 0.3314 0.2163 0.5069 -0.0653 0.0189  -0.0110 389 ARG F CG  
1810 C CD  . ARG F 12 ? 0.4018 0.2495 0.5561 -0.0645 0.0347  0.0069  389 ARG F CD  
1811 N NE  . ARG F 12 ? 0.4865 0.3039 0.6278 -0.0563 0.0225  -0.0056 389 ARG F NE  
1812 C CZ  . ARG F 12 ? 0.5567 0.3581 0.7176 -0.0662 0.0164  -0.0234 389 ARG F CZ  
1813 N NH1 . ARG F 12 ? 0.5608 0.3771 0.7624 -0.0850 0.0208  -0.0292 389 ARG F NH1 
1814 N NH2 . ARG F 12 ? 0.6124 0.3833 0.7535 -0.0563 0.0073  -0.0363 389 ARG F NH2 
1815 N N   . ARG F 13 ? 0.3300 0.2634 0.5177 -0.0518 -0.0507 -0.0690 390 ARG F N   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  -4  ?   ?   ?   A . n 
A 1 2  PRO 2  -3  ?   ?   ?   A . n 
A 1 3  LEU 3  -2  ?   ?   ?   A . n 
A 1 4  GLY 4  -1  ?   ?   ?   A . n 
A 1 5  SER 5  0   0   SER SER A . n 
A 1 6  MET 6  1   1   MET MET A . n 
A 1 7  VAL 7  2   2   VAL VAL A . n 
A 1 8  ASP 8  3   3   ASP ASP A . n 
A 1 9  TYR 9  4   4   TYR TYR A . n 
A 1 10 ILE 10 5   5   ILE ILE A . n 
A 1 11 VAL 11 6   6   VAL VAL A . n 
A 1 12 GLU 12 7   7   GLU GLU A . n 
A 1 13 TYR 13 8   8   TYR TYR A . n 
A 1 14 ASP 14 9   9   ASP ASP A . n 
A 1 15 TYR 15 10  10  TYR TYR A . n 
A 1 16 ASP 16 11  11  ASP ASP A . n 
A 1 17 ALA 17 12  12  ALA ALA A . n 
A 1 18 VAL 18 13  13  VAL VAL A . n 
A 1 19 HIS 19 14  14  HIS HIS A . n 
A 1 20 ASP 20 15  15  ASP ASP A . n 
A 1 21 ASP 21 16  16  ASP ASP A . n 
A 1 22 GLU 22 17  17  GLU GLU A . n 
A 1 23 LEU 23 18  18  LEU LEU A . n 
A 1 24 THR 24 19  19  THR THR A . n 
A 1 25 ILE 25 20  20  ILE ILE A . n 
A 1 26 ARG 26 21  21  ARG ARG A . n 
A 1 27 VAL 27 22  22  VAL VAL A . n 
A 1 28 GLY 28 23  23  GLY GLY A . n 
A 1 29 GLU 29 24  24  GLU GLU A . n 
A 1 30 ILE 30 25  25  ILE ILE A . n 
A 1 31 ILE 31 26  26  ILE ILE A . n 
A 1 32 ARG 32 27  27  ARG ARG A . n 
A 1 33 ASN 33 28  28  ASN ASN A . n 
A 1 34 VAL 34 29  29  VAL VAL A . n 
A 1 35 LYS 35 30  30  LYS LYS A . n 
A 1 36 LYS 36 31  31  LYS LYS A . n 
A 1 37 LEU 37 32  32  LEU LEU A . n 
A 1 38 GLN 38 33  33  GLN GLN A . n 
A 1 39 GLU 39 34  34  GLU GLU A . n 
A 1 40 GLU 40 35  35  GLU GLU A . n 
A 1 41 GLY 41 36  36  GLY GLY A . n 
A 1 42 TRP 42 37  37  TRP TRP A . n 
A 1 43 LEU 43 38  38  LEU LEU A . n 
A 1 44 GLU 44 39  39  GLU GLU A . n 
A 1 45 GLY 45 40  40  GLY GLY A . n 
A 1 46 GLU 46 41  41  GLU GLU A . n 
A 1 47 LEU 47 42  42  LEU LEU A . n 
A 1 48 ASN 48 43  43  ASN ASN A . n 
A 1 49 GLY 49 44  44  GLY GLY A . n 
A 1 50 ARG 50 45  45  ARG ARG A . n 
A 1 51 ARG 51 46  46  ARG ARG A . n 
A 1 52 GLY 52 47  47  GLY GLY A . n 
A 1 53 MET 53 48  48  MET MET A . n 
A 1 54 PHE 54 49  49  PHE PHE A . n 
A 1 55 PRO 55 50  50  PRO PRO A . n 
A 1 56 ASP 56 51  51  ASP ASP A . n 
A 1 57 ASN 57 52  52  ASN ASN A . n 
A 1 58 PHE 58 53  53  PHE PHE A . n 
A 1 59 VAL 59 54  54  VAL VAL A . n 
A 1 60 LYS 60 55  55  LYS LYS A . n 
A 1 61 GLU 61 56  56  GLU GLU A . n 
A 1 62 ILE 62 57  57  ILE ILE A . n 
A 1 63 LYS 63 58  58  LYS LYS A . n 
A 1 64 ARG 64 59  ?   ?   ?   A . n 
A 1 65 GLU 65 60  ?   ?   ?   A . n 
B 2 1  ALA 1  378 ?   ?   ?   B . n 
B 2 2  LYS 2  379 ?   ?   ?   B . n 
B 2 3  LYS 3  380 ?   ?   ?   B . n 
B 2 4  ASN 4  381 380 ASN ASN B . n 
B 2 5  LEU 5  382 381 LEU LEU B . n 
B 2 6  PRO 6  383 382 PRO PRO B . n 
B 2 7  THR 7  384 383 THR THR B . n 
B 2 8  ALA 8  385 384 ALA ALA B . n 
B 2 9  PRO 9  386 385 PRO PRO B . n 
B 2 10 PRO 10 387 386 PRO PRO B . n 
B 2 11 ARG 11 388 387 ARG ARG B . n 
B 2 12 ARG 12 389 388 ARG ARG B . n 
B 2 13 ARG 13 390 389 ARG ARG B . n 
B 2 14 VAL 14 391 ?   ?   ?   B . n 
B 2 15 SER 15 392 ?   ?   ?   B . n 
B 2 16 GLU 16 393 ?   ?   ?   B . n 
C 1 1  GLY 1  -4  -4  GLY GLY C . n 
C 1 2  PRO 2  -3  -3  PRO PRO C . n 
C 1 3  LEU 3  -2  -2  LEU LEU C . n 
C 1 4  GLY 4  -1  -1  GLY GLY C . n 
C 1 5  SER 5  0   0   SER SER C . n 
C 1 6  MET 6  1   1   MET MET C . n 
C 1 7  VAL 7  2   2   VAL VAL C . n 
C 1 8  ASP 8  3   3   ASP ASP C . n 
C 1 9  TYR 9  4   4   TYR TYR C . n 
C 1 10 ILE 10 5   5   ILE ILE C . n 
C 1 11 VAL 11 6   6   VAL VAL C . n 
C 1 12 GLU 12 7   7   GLU GLU C . n 
C 1 13 TYR 13 8   8   TYR TYR C . n 
C 1 14 ASP 14 9   9   ASP ASP C . n 
C 1 15 TYR 15 10  10  TYR TYR C . n 
C 1 16 ASP 16 11  11  ASP ASP C . n 
C 1 17 ALA 17 12  12  ALA ALA C . n 
C 1 18 VAL 18 13  13  VAL VAL C . n 
C 1 19 HIS 19 14  14  HIS HIS C . n 
C 1 20 ASP 20 15  15  ASP ASP C . n 
C 1 21 ASP 21 16  16  ASP ASP C . n 
C 1 22 GLU 22 17  17  GLU GLU C . n 
C 1 23 LEU 23 18  18  LEU LEU C . n 
C 1 24 THR 24 19  19  THR THR C . n 
C 1 25 ILE 25 20  20  ILE ILE C . n 
C 1 26 ARG 26 21  21  ARG ARG C . n 
C 1 27 VAL 27 22  22  VAL VAL C . n 
C 1 28 GLY 28 23  23  GLY GLY C . n 
C 1 29 GLU 29 24  24  GLU GLU C . n 
C 1 30 ILE 30 25  25  ILE ILE C . n 
C 1 31 ILE 31 26  26  ILE ILE C . n 
C 1 32 ARG 32 27  27  ARG ARG C . n 
C 1 33 ASN 33 28  28  ASN ASN C . n 
C 1 34 VAL 34 29  29  VAL VAL C . n 
C 1 35 LYS 35 30  30  LYS LYS C . n 
C 1 36 LYS 36 31  31  LYS LYS C . n 
C 1 37 LEU 37 32  32  LEU LEU C . n 
C 1 38 GLN 38 33  33  GLN GLN C . n 
C 1 39 GLU 39 34  34  GLU GLU C . n 
C 1 40 GLU 40 35  35  GLU GLU C . n 
C 1 41 GLY 41 36  36  GLY GLY C . n 
C 1 42 TRP 42 37  37  TRP TRP C . n 
C 1 43 LEU 43 38  38  LEU LEU C . n 
C 1 44 GLU 44 39  39  GLU GLU C . n 
C 1 45 GLY 45 40  40  GLY GLY C . n 
C 1 46 GLU 46 41  41  GLU GLU C . n 
C 1 47 LEU 47 42  42  LEU LEU C . n 
C 1 48 ASN 48 43  43  ASN ASN C . n 
C 1 49 GLY 49 44  44  GLY GLY C . n 
C 1 50 ARG 50 45  45  ARG ARG C . n 
C 1 51 ARG 51 46  46  ARG ARG C . n 
C 1 52 GLY 52 47  47  GLY GLY C . n 
C 1 53 MET 53 48  48  MET MET C . n 
C 1 54 PHE 54 49  49  PHE PHE C . n 
C 1 55 PRO 55 50  50  PRO PRO C . n 
C 1 56 ASP 56 51  51  ASP ASP C . n 
C 1 57 ASN 57 52  52  ASN ASN C . n 
C 1 58 PHE 58 53  53  PHE PHE C . n 
C 1 59 VAL 59 54  54  VAL VAL C . n 
C 1 60 LYS 60 55  55  LYS LYS C . n 
C 1 61 GLU 61 56  56  GLU GLU C . n 
C 1 62 ILE 62 57  57  ILE ILE C . n 
C 1 63 LYS 63 58  58  LYS LYS C . n 
C 1 64 ARG 64 59  ?   ?   ?   C . n 
C 1 65 GLU 65 60  ?   ?   ?   C . n 
D 2 1  ALA 1  378 ?   ?   ?   D . n 
D 2 2  LYS 2  379 ?   ?   ?   D . n 
D 2 3  LYS 3  380 379 LYS LYS D . n 
D 2 4  ASN 4  381 380 ASN ASN D . n 
D 2 5  LEU 5  382 381 LEU LEU D . n 
D 2 6  PRO 6  383 382 PRO PRO D . n 
D 2 7  THR 7  384 383 THR THR D . n 
D 2 8  ALA 8  385 384 ALA ALA D . n 
D 2 9  PRO 9  386 385 PRO PRO D . n 
D 2 10 PRO 10 387 386 PRO PRO D . n 
D 2 11 ARG 11 388 387 ARG ARG D . n 
D 2 12 ARG 12 389 388 ARG ARG D . n 
D 2 13 ARG 13 390 ?   ?   ?   D . n 
D 2 14 VAL 14 391 ?   ?   ?   D . n 
D 2 15 SER 15 392 ?   ?   ?   D . n 
D 2 16 GLU 16 393 ?   ?   ?   D . n 
E 1 1  GLY 1  -4  -4  GLY GLY E . n 
E 1 2  PRO 2  -3  -3  PRO PRO E . n 
E 1 3  LEU 3  -2  -2  LEU LEU E . n 
E 1 4  GLY 4  -1  -1  GLY GLY E . n 
E 1 5  SER 5  0   0   SER SER E . n 
E 1 6  MET 6  1   1   MET MET E . n 
E 1 7  VAL 7  2   2   VAL VAL E . n 
E 1 8  ASP 8  3   3   ASP ASP E . n 
E 1 9  TYR 9  4   4   TYR TYR E . n 
E 1 10 ILE 10 5   5   ILE ILE E . n 
E 1 11 VAL 11 6   6   VAL VAL E . n 
E 1 12 GLU 12 7   7   GLU GLU E . n 
E 1 13 TYR 13 8   8   TYR TYR E . n 
E 1 14 ASP 14 9   9   ASP ASP E . n 
E 1 15 TYR 15 10  10  TYR TYR E . n 
E 1 16 ASP 16 11  11  ASP ASP E . n 
E 1 17 ALA 17 12  12  ALA ALA E . n 
E 1 18 VAL 18 13  13  VAL VAL E . n 
E 1 19 HIS 19 14  14  HIS HIS E . n 
E 1 20 ASP 20 15  15  ASP ASP E . n 
E 1 21 ASP 21 16  16  ASP ASP E . n 
E 1 22 GLU 22 17  17  GLU GLU E . n 
E 1 23 LEU 23 18  18  LEU LEU E . n 
E 1 24 THR 24 19  19  THR THR E . n 
E 1 25 ILE 25 20  20  ILE ILE E . n 
E 1 26 ARG 26 21  21  ARG ARG E . n 
E 1 27 VAL 27 22  22  VAL VAL E . n 
E 1 28 GLY 28 23  23  GLY GLY E . n 
E 1 29 GLU 29 24  24  GLU GLU E . n 
E 1 30 ILE 30 25  25  ILE ILE E . n 
E 1 31 ILE 31 26  26  ILE ILE E . n 
E 1 32 ARG 32 27  27  ARG ARG E . n 
E 1 33 ASN 33 28  28  ASN ASN E . n 
E 1 34 VAL 34 29  29  VAL VAL E . n 
E 1 35 LYS 35 30  30  LYS LYS E . n 
E 1 36 LYS 36 31  31  LYS LYS E . n 
E 1 37 LEU 37 32  32  LEU LEU E . n 
E 1 38 GLN 38 33  33  GLN GLN E . n 
E 1 39 GLU 39 34  34  GLU GLU E . n 
E 1 40 GLU 40 35  35  GLU GLU E . n 
E 1 41 GLY 41 36  36  GLY GLY E . n 
E 1 42 TRP 42 37  37  TRP TRP E . n 
E 1 43 LEU 43 38  38  LEU LEU E . n 
E 1 44 GLU 44 39  39  GLU GLU E . n 
E 1 45 GLY 45 40  40  GLY GLY E . n 
E 1 46 GLU 46 41  41  GLU GLU E . n 
E 1 47 LEU 47 42  42  LEU LEU E . n 
E 1 48 ASN 48 43  43  ASN ASN E . n 
E 1 49 GLY 49 44  44  GLY GLY E . n 
E 1 50 ARG 50 45  45  ARG ARG E . n 
E 1 51 ARG 51 46  46  ARG ARG E . n 
E 1 52 GLY 52 47  47  GLY GLY E . n 
E 1 53 MET 53 48  48  MET MET E . n 
E 1 54 PHE 54 49  49  PHE PHE E . n 
E 1 55 PRO 55 50  50  PRO PRO E . n 
E 1 56 ASP 56 51  51  ASP ASP E . n 
E 1 57 ASN 57 52  52  ASN ASN E . n 
E 1 58 PHE 58 53  53  PHE PHE E . n 
E 1 59 VAL 59 54  54  VAL VAL E . n 
E 1 60 LYS 60 55  55  LYS LYS E . n 
E 1 61 GLU 61 56  56  GLU GLU E . n 
E 1 62 ILE 62 57  57  ILE ILE E . n 
E 1 63 LYS 63 58  58  LYS LYS E . n 
E 1 64 ARG 64 59  ?   ?   ?   E . n 
E 1 65 GLU 65 60  ?   ?   ?   E . n 
F 2 1  ALA 1  378 ?   ?   ?   F . n 
F 2 2  LYS 2  379 ?   ?   ?   F . n 
F 2 3  LYS 3  380 379 LYS LYS F . n 
F 2 4  ASN 4  381 380 ASN ASN F . n 
F 2 5  LEU 5  382 381 LEU LEU F . n 
F 2 6  PRO 6  383 382 PRO PRO F . n 
F 2 7  THR 7  384 383 THR THR F . n 
F 2 8  ALA 8  385 384 ALA ALA F . n 
F 2 9  PRO 9  386 385 PRO PRO F . n 
F 2 10 PRO 10 387 386 PRO PRO F . n 
F 2 11 ARG 11 388 387 ARG ARG F . n 
F 2 12 ARG 12 389 388 ARG ARG F . n 
F 2 13 ARG 13 390 389 ARG ARG F . n 
F 2 14 VAL 14 391 ?   ?   ?   F . n 
F 2 15 SER 15 392 ?   ?   ?   F . n 
F 2 16 GLU 16 393 ?   ?   ?   F . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 3 SO4 1  101 1   SO4 SO4 A . 
H 3 SO4 1  101 2   SO4 SO4 C . 
I 4 HOH 1  201 217 HOH HOH A . 
I 4 HOH 2  202 29  HOH HOH A . 
I 4 HOH 3  203 19  HOH HOH A . 
I 4 HOH 4  204 200 HOH HOH A . 
I 4 HOH 5  205 130 HOH HOH A . 
I 4 HOH 6  206 77  HOH HOH A . 
I 4 HOH 7  207 78  HOH HOH A . 
I 4 HOH 8  208 55  HOH HOH A . 
I 4 HOH 9  209 69  HOH HOH A . 
I 4 HOH 10 210 7   HOH HOH A . 
I 4 HOH 11 211 97  HOH HOH A . 
I 4 HOH 12 212 76  HOH HOH A . 
I 4 HOH 13 213 2   HOH HOH A . 
I 4 HOH 14 214 46  HOH HOH A . 
I 4 HOH 15 215 270 HOH HOH A . 
I 4 HOH 16 216 17  HOH HOH A . 
I 4 HOH 17 217 227 HOH HOH A . 
I 4 HOH 18 218 176 HOH HOH A . 
I 4 HOH 19 219 129 HOH HOH A . 
I 4 HOH 20 220 154 HOH HOH A . 
I 4 HOH 21 221 80  HOH HOH A . 
I 4 HOH 22 222 232 HOH HOH A . 
I 4 HOH 23 223 185 HOH HOH A . 
I 4 HOH 24 224 236 HOH HOH A . 
I 4 HOH 25 225 68  HOH HOH A . 
I 4 HOH 26 226 199 HOH HOH A . 
I 4 HOH 27 227 231 HOH HOH A . 
I 4 HOH 28 228 149 HOH HOH A . 
I 4 HOH 29 229 245 HOH HOH A . 
I 4 HOH 30 230 215 HOH HOH A . 
I 4 HOH 31 231 187 HOH HOH A . 
I 4 HOH 32 232 12  HOH HOH A . 
I 4 HOH 33 233 15  HOH HOH A . 
I 4 HOH 34 234 18  HOH HOH A . 
I 4 HOH 35 235 20  HOH HOH A . 
I 4 HOH 36 236 24  HOH HOH A . 
I 4 HOH 37 237 25  HOH HOH A . 
I 4 HOH 38 238 30  HOH HOH A . 
I 4 HOH 39 239 32  HOH HOH A . 
I 4 HOH 40 240 36  HOH HOH A . 
I 4 HOH 41 241 41  HOH HOH A . 
I 4 HOH 42 242 47  HOH HOH A . 
I 4 HOH 43 243 72  HOH HOH A . 
I 4 HOH 44 244 73  HOH HOH A . 
I 4 HOH 45 245 75  HOH HOH A . 
I 4 HOH 46 246 79  HOH HOH A . 
I 4 HOH 47 247 82  HOH HOH A . 
I 4 HOH 48 248 84  HOH HOH A . 
I 4 HOH 49 249 86  HOH HOH A . 
I 4 HOH 50 250 87  HOH HOH A . 
I 4 HOH 51 251 88  HOH HOH A . 
I 4 HOH 52 252 95  HOH HOH A . 
I 4 HOH 53 253 96  HOH HOH A . 
I 4 HOH 54 254 98  HOH HOH A . 
I 4 HOH 55 255 102 HOH HOH A . 
I 4 HOH 56 256 109 HOH HOH A . 
I 4 HOH 57 257 116 HOH HOH A . 
I 4 HOH 58 258 125 HOH HOH A . 
I 4 HOH 59 259 127 HOH HOH A . 
I 4 HOH 60 260 156 HOH HOH A . 
I 4 HOH 61 261 164 HOH HOH A . 
I 4 HOH 62 262 166 HOH HOH A . 
I 4 HOH 63 263 179 HOH HOH A . 
I 4 HOH 64 264 186 HOH HOH A . 
I 4 HOH 65 265 192 HOH HOH A . 
I 4 HOH 66 266 194 HOH HOH A . 
I 4 HOH 67 267 196 HOH HOH A . 
I 4 HOH 68 268 198 HOH HOH A . 
I 4 HOH 69 269 205 HOH HOH A . 
I 4 HOH 70 270 206 HOH HOH A . 
I 4 HOH 71 271 211 HOH HOH A . 
I 4 HOH 72 272 219 HOH HOH A . 
I 4 HOH 73 273 223 HOH HOH A . 
I 4 HOH 74 274 224 HOH HOH A . 
I 4 HOH 75 275 259 HOH HOH A . 
I 4 HOH 76 276 265 HOH HOH A . 
J 4 HOH 1  401 57  HOH HOH B . 
J 4 HOH 2  402 60  HOH HOH B . 
J 4 HOH 3  403 14  HOH HOH B . 
J 4 HOH 4  404 264 HOH HOH B . 
J 4 HOH 5  405 244 HOH HOH B . 
J 4 HOH 6  406 99  HOH HOH B . 
J 4 HOH 7  407 210 HOH HOH B . 
J 4 HOH 8  408 182 HOH HOH B . 
J 4 HOH 9  409 275 HOH HOH B . 
J 4 HOH 10 410 93  HOH HOH B . 
J 4 HOH 11 411 230 HOH HOH B . 
J 4 HOH 12 412 274 HOH HOH B . 
J 4 HOH 13 413 58  HOH HOH B . 
J 4 HOH 14 414 241 HOH HOH B . 
J 4 HOH 15 415 117 HOH HOH B . 
J 4 HOH 16 416 118 HOH HOH B . 
J 4 HOH 17 417 269 HOH HOH B . 
J 4 HOH 18 418 271 HOH HOH B . 
K 4 HOH 1  201 266 HOH HOH C . 
K 4 HOH 2  202 167 HOH HOH C . 
K 4 HOH 3  203 40  HOH HOH C . 
K 4 HOH 4  204 92  HOH HOH C . 
K 4 HOH 5  205 45  HOH HOH C . 
K 4 HOH 6  206 255 HOH HOH C . 
K 4 HOH 7  207 21  HOH HOH C . 
K 4 HOH 8  208 48  HOH HOH C . 
K 4 HOH 9  209 136 HOH HOH C . 
K 4 HOH 10 210 133 HOH HOH C . 
K 4 HOH 11 211 33  HOH HOH C . 
K 4 HOH 12 212 170 HOH HOH C . 
K 4 HOH 13 213 13  HOH HOH C . 
K 4 HOH 14 214 52  HOH HOH C . 
K 4 HOH 15 215 100 HOH HOH C . 
K 4 HOH 16 216 128 HOH HOH C . 
K 4 HOH 17 217 74  HOH HOH C . 
K 4 HOH 18 218 138 HOH HOH C . 
K 4 HOH 19 219 262 HOH HOH C . 
K 4 HOH 20 220 158 HOH HOH C . 
K 4 HOH 21 221 247 HOH HOH C . 
K 4 HOH 22 222 226 HOH HOH C . 
K 4 HOH 23 223 137 HOH HOH C . 
K 4 HOH 24 224 28  HOH HOH C . 
K 4 HOH 25 225 131 HOH HOH C . 
K 4 HOH 26 226 140 HOH HOH C . 
K 4 HOH 27 227 135 HOH HOH C . 
K 4 HOH 28 228 256 HOH HOH C . 
K 4 HOH 29 229 235 HOH HOH C . 
K 4 HOH 30 230 168 HOH HOH C . 
K 4 HOH 31 231 260 HOH HOH C . 
K 4 HOH 32 232 234 HOH HOH C . 
K 4 HOH 33 233 113 HOH HOH C . 
K 4 HOH 34 234 171 HOH HOH C . 
K 4 HOH 35 235 278 HOH HOH C . 
K 4 HOH 36 236 4   HOH HOH C . 
K 4 HOH 37 237 6   HOH HOH C . 
K 4 HOH 38 238 16  HOH HOH C . 
K 4 HOH 39 239 23  HOH HOH C . 
K 4 HOH 40 240 31  HOH HOH C . 
K 4 HOH 41 241 38  HOH HOH C . 
K 4 HOH 42 242 43  HOH HOH C . 
K 4 HOH 43 243 44  HOH HOH C . 
K 4 HOH 44 244 50  HOH HOH C . 
K 4 HOH 45 245 63  HOH HOH C . 
K 4 HOH 46 246 70  HOH HOH C . 
K 4 HOH 47 247 71  HOH HOH C . 
K 4 HOH 48 248 89  HOH HOH C . 
K 4 HOH 49 249 91  HOH HOH C . 
K 4 HOH 50 250 103 HOH HOH C . 
K 4 HOH 51 251 112 HOH HOH C . 
K 4 HOH 52 252 124 HOH HOH C . 
K 4 HOH 53 253 126 HOH HOH C . 
K 4 HOH 54 254 132 HOH HOH C . 
K 4 HOH 55 255 134 HOH HOH C . 
K 4 HOH 56 256 139 HOH HOH C . 
K 4 HOH 57 257 152 HOH HOH C . 
K 4 HOH 58 258 159 HOH HOH C . 
K 4 HOH 59 259 169 HOH HOH C . 
K 4 HOH 60 260 178 HOH HOH C . 
K 4 HOH 61 261 180 HOH HOH C . 
K 4 HOH 62 262 188 HOH HOH C . 
K 4 HOH 63 263 190 HOH HOH C . 
K 4 HOH 64 264 197 HOH HOH C . 
K 4 HOH 65 265 201 HOH HOH C . 
K 4 HOH 66 266 218 HOH HOH C . 
K 4 HOH 67 267 221 HOH HOH C . 
K 4 HOH 68 268 225 HOH HOH C . 
K 4 HOH 69 269 240 HOH HOH C . 
K 4 HOH 70 270 242 HOH HOH C . 
K 4 HOH 71 271 243 HOH HOH C . 
K 4 HOH 72 272 250 HOH HOH C . 
K 4 HOH 73 273 252 HOH HOH C . 
K 4 HOH 74 274 258 HOH HOH C . 
K 4 HOH 75 275 263 HOH HOH C . 
K 4 HOH 76 276 272 HOH HOH C . 
K 4 HOH 77 277 273 HOH HOH C . 
K 4 HOH 78 278 279 HOH HOH C . 
L 4 HOH 1  401 10  HOH HOH D . 
L 4 HOH 2  402 151 HOH HOH D . 
L 4 HOH 3  403 120 HOH HOH D . 
L 4 HOH 4  404 66  HOH HOH D . 
L 4 HOH 5  405 248 HOH HOH D . 
L 4 HOH 6  406 53  HOH HOH D . 
L 4 HOH 7  407 94  HOH HOH D . 
L 4 HOH 8  408 59  HOH HOH D . 
L 4 HOH 9  409 193 HOH HOH D . 
L 4 HOH 10 410 184 HOH HOH D . 
L 4 HOH 11 411 229 HOH HOH D . 
L 4 HOH 12 412 62  HOH HOH D . 
L 4 HOH 13 413 64  HOH HOH D . 
L 4 HOH 14 414 65  HOH HOH D . 
L 4 HOH 15 415 222 HOH HOH D . 
L 4 HOH 16 416 237 HOH HOH D . 
L 4 HOH 17 417 251 HOH HOH D . 
M 4 HOH 1  101 39  HOH HOH E . 
M 4 HOH 2  102 146 HOH HOH E . 
M 4 HOH 3  103 183 HOH HOH E . 
M 4 HOH 4  104 81  HOH HOH E . 
M 4 HOH 5  105 145 HOH HOH E . 
M 4 HOH 6  106 119 HOH HOH E . 
M 4 HOH 7  107 9   HOH HOH E . 
M 4 HOH 8  108 257 HOH HOH E . 
M 4 HOH 9  109 253 HOH HOH E . 
M 4 HOH 10 110 141 HOH HOH E . 
M 4 HOH 11 111 22  HOH HOH E . 
M 4 HOH 12 112 108 HOH HOH E . 
M 4 HOH 13 113 1   HOH HOH E . 
M 4 HOH 14 114 54  HOH HOH E . 
M 4 HOH 15 115 163 HOH HOH E . 
M 4 HOH 16 116 51  HOH HOH E . 
M 4 HOH 17 117 42  HOH HOH E . 
M 4 HOH 18 118 107 HOH HOH E . 
M 4 HOH 19 119 160 HOH HOH E . 
M 4 HOH 20 120 228 HOH HOH E . 
M 4 HOH 21 121 267 HOH HOH E . 
M 4 HOH 22 122 208 HOH HOH E . 
M 4 HOH 23 123 213 HOH HOH E . 
M 4 HOH 24 124 254 HOH HOH E . 
M 4 HOH 25 125 249 HOH HOH E . 
M 4 HOH 26 126 268 HOH HOH E . 
M 4 HOH 27 127 3   HOH HOH E . 
M 4 HOH 28 128 5   HOH HOH E . 
M 4 HOH 29 129 8   HOH HOH E . 
M 4 HOH 30 130 11  HOH HOH E . 
M 4 HOH 31 131 27  HOH HOH E . 
M 4 HOH 32 132 34  HOH HOH E . 
M 4 HOH 33 133 35  HOH HOH E . 
M 4 HOH 34 134 37  HOH HOH E . 
M 4 HOH 35 135 49  HOH HOH E . 
M 4 HOH 36 136 56  HOH HOH E . 
M 4 HOH 37 137 83  HOH HOH E . 
M 4 HOH 38 138 85  HOH HOH E . 
M 4 HOH 39 139 90  HOH HOH E . 
M 4 HOH 40 140 104 HOH HOH E . 
M 4 HOH 41 141 105 HOH HOH E . 
M 4 HOH 42 142 106 HOH HOH E . 
M 4 HOH 43 143 111 HOH HOH E . 
M 4 HOH 44 144 122 HOH HOH E . 
M 4 HOH 45 145 142 HOH HOH E . 
M 4 HOH 46 146 143 HOH HOH E . 
M 4 HOH 47 147 144 HOH HOH E . 
M 4 HOH 48 148 147 HOH HOH E . 
M 4 HOH 49 149 148 HOH HOH E . 
M 4 HOH 50 150 153 HOH HOH E . 
M 4 HOH 51 151 155 HOH HOH E . 
M 4 HOH 52 152 157 HOH HOH E . 
M 4 HOH 53 153 161 HOH HOH E . 
M 4 HOH 54 154 162 HOH HOH E . 
M 4 HOH 55 155 165 HOH HOH E . 
M 4 HOH 56 156 172 HOH HOH E . 
M 4 HOH 57 157 173 HOH HOH E . 
M 4 HOH 58 158 174 HOH HOH E . 
M 4 HOH 59 159 177 HOH HOH E . 
M 4 HOH 60 160 181 HOH HOH E . 
M 4 HOH 61 161 189 HOH HOH E . 
M 4 HOH 62 162 195 HOH HOH E . 
M 4 HOH 63 163 202 HOH HOH E . 
M 4 HOH 64 164 203 HOH HOH E . 
M 4 HOH 65 165 207 HOH HOH E . 
M 4 HOH 66 166 212 HOH HOH E . 
M 4 HOH 67 167 214 HOH HOH E . 
M 4 HOH 68 168 216 HOH HOH E . 
M 4 HOH 69 169 220 HOH HOH E . 
M 4 HOH 70 170 239 HOH HOH E . 
M 4 HOH 71 171 261 HOH HOH E . 
M 4 HOH 72 172 276 HOH HOH E . 
M 4 HOH 73 173 277 HOH HOH E . 
N 4 HOH 1  401 101 HOH HOH F . 
N 4 HOH 2  402 150 HOH HOH F . 
N 4 HOH 3  403 67  HOH HOH F . 
N 4 HOH 4  404 26  HOH HOH F . 
N 4 HOH 5  405 115 HOH HOH F . 
N 4 HOH 6  406 121 HOH HOH F . 
N 4 HOH 7  407 110 HOH HOH F . 
N 4 HOH 8  408 233 HOH HOH F . 
N 4 HOH 9  409 123 HOH HOH F . 
N 4 HOH 10 410 238 HOH HOH F . 
N 4 HOH 11 411 61  HOH HOH F . 
N 4 HOH 12 412 114 HOH HOH F . 
N 4 HOH 13 413 175 HOH HOH F . 
N 4 HOH 14 414 191 HOH HOH F . 
N 4 HOH 15 415 204 HOH HOH F . 
N 4 HOH 16 416 209 HOH HOH F . 
N 4 HOH 17 417 246 HOH HOH F . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric 2 
2 author_and_software_defined_assembly PISA dimeric 2 
3 author_and_software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,G,I,J 
2 1 C,D,H,K,L 
3 1 E,F,M,N   
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 960  ? 
1 MORE         -8   ? 
1 'SSA (A^2)'  4780 ? 
2 'ABSA (A^2)' 1000 ? 
2 MORE         -9   ? 
2 'SSA (A^2)'  4990 ? 
3 'ABSA (A^2)' 880  ? 
3 MORE         -3   ? 
3 'SSA (A^2)'  5110 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    C 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     235 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   K 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-08-19 
2 'Structure model' 1 1 2016-02-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Database references' 
# 
loop_
_pdbx_refine_tls.id 
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[1][1]_esd 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][2]_esd 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[1][3]_esd 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[2][2]_esd 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.T[2][3]_esd 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[3][3]_esd 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[1][1]_esd 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][2]_esd 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[1][3]_esd 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[2][2]_esd 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.L[2][3]_esd 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[3][3]_esd 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][1]_esd 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][2]_esd 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[1][3]_esd 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][1]_esd 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][2]_esd 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][3]_esd 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][1]_esd 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][2]_esd 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[3][3]_esd 
1 'X-RAY DIFFRACTION' ? refined -9.2841  4.0042   -10.9796 0.1150 ? 0.0050  ? -0.0048 ? 0.0740 ? 0.0021  ? 0.0841 ? 2.2893 ? 
0.0943  ? -0.3303 ? 2.4978 ? 0.3635  ? 1.3748 ? 0.0065  ? 0.1300  ? -0.0449 ? -0.1093 ? -0.0185 ? 0.0698  ? -0.0032 ? -0.0220 ? 
0.0064  ? 
2 'X-RAY DIFFRACTION' ? refined -11.9408 15.9392  -8.6300  0.1372 ? 0.0284  ? -0.0057 ? 0.0774 ? -0.0341 ? 0.1274 ? 8.0716 ? 
2.4098  ? 1.0838  ? 5.9502 ? 0.2923  ? 2.4067 ? 0.0943  ? -0.0441 ? 0.4604  ? -0.0018 ? -0.1026 ? 0.1266  ? -0.3165 ? -0.1725 ? 
0.0095  ? 
3 'X-RAY DIFFRACTION' ? refined -3.5861  -18.8426 -11.7900 0.1151 ? 0.0036  ? 0.0053  ? 0.0576 ? -0.0207 ? 0.0833 ? 2.2033 ? 
0.6683  ? -0.5567 ? 0.5804 ? -0.6883 ? 1.1299 ? -0.0372 ? 0.1099  ? -0.1077 ? -0.0693 ? 0.0158  ? -0.0742 ? 0.1069  ? -0.0128 ? 
0.0136  ? 
4 'X-RAY DIFFRACTION' ? refined -14.0624 -25.7125 -9.3881  0.1159 ? -0.0382 ? -0.0035 ? 0.0719 ? 0.0005  ? 0.1713 ? 5.1459 ? 
-0.4832 ? 0.9875  ? 6.9862 ? -1.3759 ? 5.8219 ? 0.1674  ? 0.1543  ? -0.1941 ? -0.4296 ? -0.0568 ? 0.4448  ? 0.2846  ? -0.1095 ? 
-0.1145 ? 
5 'X-RAY DIFFRACTION' ? refined 13.0624  -2.4457  -11.9963 0.1091 ? -0.0029 ? 0.0236  ? 0.0952 ? 0.0189  ? 0.0991 ? 2.4839 ? 
-0.9979 ? 1.0769  ? 1.7153 ? -0.0083 ? 2.0087 ? 0.0282  ? 0.1817  ? 0.1696  ? -0.1035 ? -0.0402 ? -0.0301 ? -0.0916 ? 0.1317  ? 
0.0189  ? 
6 'X-RAY DIFFRACTION' ? refined 24.2386  -8.1031  -9.4071  0.0949 ? 0.0108  ? -0.0064 ? 0.1063 ? 0.0151  ? 0.1075 ? 4.5903 ? 
-1.0701 ? -0.3710 ? 8.2124 ? 1.1016  ? 3.8979 ? -0.0075 ? 0.2130  ? -0.0581 ? -0.1433 ? 0.1483  ? -0.3457 ? 0.0714  ? 0.1489  ? 
-0.1437 ? 
# 
loop_
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? 
;(chain 'A' and resid 0 through 58)
;
2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? 
;(chain 'B' and resid 380 through 389)
;
3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? 
;(chain 'C' and resid -4 through 58)
;
4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? 
;(chain 'D' and resid 379 through 388)
;
5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? 
;(chain 'E' and resid -4 through 58)
;
6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? 
;(chain 'F' and resid 379 through 389)
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 1 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .                           2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? SCALA  ? ? ? .                           3 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .                           4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   O 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   HOH 
_pdbx_validate_close_contact.auth_seq_id_1    217 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   E 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    120 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.04 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LEU A 32 ? ? -96.41  -158.37 
2 1 LEU C 32 ? ? -98.64  -149.30 
3 1 LEU C 32 ? ? -100.14 -149.30 
4 1 LEU E 32 ? ? -94.25  -152.42 
5 1 LEU E 32 ? ? -94.10  -152.42 
# 
loop_
_pdbx_distant_solvent_atoms.id 
_pdbx_distant_solvent_atoms.PDB_model_num 
_pdbx_distant_solvent_atoms.auth_atom_id 
_pdbx_distant_solvent_atoms.label_alt_id 
_pdbx_distant_solvent_atoms.auth_asym_id 
_pdbx_distant_solvent_atoms.auth_comp_id 
_pdbx_distant_solvent_atoms.auth_seq_id 
_pdbx_distant_solvent_atoms.PDB_ins_code 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance 
1 1 O ? D HOH 416 ? 5.97 . 
2 1 O ? D HOH 417 ? 5.99 . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 B ARG 390 ? CG  ? B ARG 13 CG  
2  1 Y 1 B ARG 390 ? CD  ? B ARG 13 CD  
3  1 Y 1 B ARG 390 ? NE  ? B ARG 13 NE  
4  1 Y 1 B ARG 390 ? CZ  ? B ARG 13 CZ  
5  1 Y 1 B ARG 390 ? NH1 ? B ARG 13 NH1 
6  1 Y 1 B ARG 390 ? NH2 ? B ARG 13 NH2 
7  1 Y 1 C GLN 33  ? CG  ? C GLN 38 CG  
8  1 Y 1 C GLN 33  ? CD  ? C GLN 38 CD  
9  1 Y 1 C GLN 33  ? OE1 ? C GLN 38 OE1 
10 1 Y 1 C GLN 33  ? NE2 ? C GLN 38 NE2 
11 1 Y 1 C LYS 58  ? CG  ? C LYS 63 CG  
12 1 Y 1 C LYS 58  ? CD  ? C LYS 63 CD  
13 1 Y 1 C LYS 58  ? CE  ? C LYS 63 CE  
14 1 Y 1 C LYS 58  ? NZ  ? C LYS 63 NZ  
15 1 Y 1 D LYS 380 ? CG  ? D LYS 3  CG  
16 1 Y 1 D LYS 380 ? CD  ? D LYS 3  CD  
17 1 Y 1 D LYS 380 ? CE  ? D LYS 3  CE  
18 1 Y 1 D LYS 380 ? NZ  ? D LYS 3  NZ  
19 1 Y 1 F LYS 380 ? CG  ? F LYS 3  CG  
20 1 Y 1 F LYS 380 ? CD  ? F LYS 3  CD  
21 1 Y 1 F LYS 380 ? CE  ? F LYS 3  CE  
22 1 Y 1 F LYS 380 ? NZ  ? F LYS 3  NZ  
23 1 Y 1 F ARG 390 ? CA  ? F ARG 13 CA  
24 1 Y 1 F ARG 390 ? C   ? F ARG 13 C   
25 1 Y 1 F ARG 390 ? O   ? F ARG 13 O   
26 1 Y 1 F ARG 390 ? CB  ? F ARG 13 CB  
27 1 Y 1 F ARG 390 ? CG  ? F ARG 13 CG  
28 1 Y 1 F ARG 390 ? CD  ? F ARG 13 CD  
29 1 Y 1 F ARG 390 ? NE  ? F ARG 13 NE  
30 1 Y 1 F ARG 390 ? CZ  ? F ARG 13 CZ  
31 1 Y 1 F ARG 390 ? NH1 ? F ARG 13 NH1 
32 1 Y 1 F ARG 390 ? NH2 ? F ARG 13 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -4  ? A GLY 1  
2  1 Y 1 A PRO -3  ? A PRO 2  
3  1 Y 1 A LEU -2  ? A LEU 3  
4  1 Y 1 A GLY -1  ? A GLY 4  
5  1 Y 1 A ARG 59  ? A ARG 64 
6  1 Y 1 A GLU 60  ? A GLU 65 
7  1 Y 1 B ALA 378 ? B ALA 1  
8  1 Y 1 B LYS 379 ? B LYS 2  
9  1 Y 1 B LYS 380 ? B LYS 3  
10 1 Y 1 B VAL 391 ? B VAL 14 
11 1 Y 1 B SER 392 ? B SER 15 
12 1 Y 1 B GLU 393 ? B GLU 16 
13 1 Y 1 C ARG 59  ? C ARG 64 
14 1 Y 1 C GLU 60  ? C GLU 65 
15 1 Y 1 D ALA 378 ? D ALA 1  
16 1 Y 1 D LYS 379 ? D LYS 2  
17 1 Y 1 D ARG 390 ? D ARG 13 
18 1 Y 1 D VAL 391 ? D VAL 14 
19 1 Y 1 D SER 392 ? D SER 15 
20 1 Y 1 D GLU 393 ? D GLU 16 
21 1 Y 1 E ARG 59  ? E ARG 64 
22 1 Y 1 E GLU 60  ? E GLU 65 
23 1 Y 1 F ALA 378 ? F ALA 1  
24 1 Y 1 F LYS 379 ? F LYS 2  
25 1 Y 1 F VAL 391 ? F VAL 14 
26 1 Y 1 F SER 392 ? F SER 15 
27 1 Y 1 F GLU 393 ? F GLU 16 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'SULFATE ION' SO4 
4 water         HOH 
#