data_4WEB
# 
_entry.id   4WEB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   4WEB         
WWPDB D_1000203586 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             2014-12-17 
_pdbx_database_PDB_obs_spr.pdb_id           4WEB 
_pdbx_database_PDB_obs_spr.replace_pdb_id   4NX3 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4WEB 
_pdbx_database_status.recvd_initial_deposition_date   2014-09-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Khan, A.G.'        1  
'Whidby, J.'        2  
'Miller, M.T.'      3  
'Scarborough, H.'   4  
'Zatorski, A.V.'    5  
'Cygan, A.'         6  
'Price, A.A.'       7  
'Yost, S.A.'        8  
'Bohannon, C.D.'    9  
'Jacob, J.'         10 
'Grakoui, A.'       11 
'Marcotrigiano, J.' 12 
# 
_citation.id                        primary 
_citation.title                     'Structure of the core ectodomain of the hepatitis C virus envelope glycoprotein 2.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            509 
_citation.page_first                381 
_citation.page_last                 384 
_citation.year                      2014 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   24553139 
_citation.pdbx_database_id_DOI      10.1038/nature13117 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Khan, A.G.'        1  ? 
primary 'Whidby, J.'        2  ? 
primary 'Miller, M.T.'      3  ? 
primary 'Scarborough, H.'   4  ? 
primary 'Zatorski, A.V.'    5  ? 
primary 'Cygan, A.'         6  ? 
primary 'Price, A.A.'       7  ? 
primary 'Yost, S.A.'        8  ? 
primary 'Bohannon, C.D.'    9  ? 
primary 'Jacob, J.'         10 ? 
primary 'Grakoui, A.'       11 ? 
primary 'Marcotrigiano, J.' 12 ? 
# 
_cell.entry_id           4WEB 
_cell.length_a           85.960 
_cell.length_b           194.570 
_cell.length_c           37.920 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         4WEB 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'hepatitis C virus envelope glycoprotein 2' 24270.604 1   ? ? 'UNP RESIDUES 456-655' ? 
2 polymer     man 'Mouse Fab Heavy Chain'                     51340.848 1   ? ? ?                      ? 
3 polymer     man 'Mouse Fab Light Chain'                     26553.533 1   ? ? ?                      ? 
4 non-polymer syn 2-acetamido-2-deoxy-beta-D-glucopyranose    221.208   2   ? ? ?                      ? 
5 non-polymer syn FORMAMIDE                                   45.041    6   ? ? ?                      ? 
6 water       nat water                                       18.015    136 ? ? ?                      ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;TPVGLAMSACRSIEAFRVGWGALQYEDNVTNPEDMRPYCWHYPPRQCGVVSAKTVCGPVYCFTPSPVVVGTTDRLGAPTY
TWGENETDVFLLNSTRPPLGSWFGCTWMNSSGYTKTCGAPPCRTRADFNASTDLLCPTDCFRKHPDTTYLKCGSGPWLTP
RCLIDYPYRLWHYPCTVNYTIFKIRMYVGGVEHRLTAACNFTRGDRGSASGLEVLFQ
;
;TPVGLAMSACRSIEAFRVGWGALQYEDNVTNPEDMRPYCWHYPPRQCGVVSAKTVCGPVYCFTPSPVVVGTTDRLGAPTY
TWGENETDVFLLNSTRPPLGSWFGCTWMNSSGYTKTCGAPPCRTRADFNASTDLLCPTDCFRKHPDTTYLKCGSGPWLTP
RCLIDYPYRLWHYPCTVNYTIFKIRMYVGGVEHRLTAACNFTRGDRGSASGLEVLFQ
;
E ? 
2 'polypeptide(L)' no no 
;MKCSWVIFFLMAVVTGVISEVQLQQSGAELVKPGASVKLSCTASGFNIKDTYIHWVNQRPEQGLEWIGRIDPANGHTQYD
PKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCATSDYSYALDSWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSV
TLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
IKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTL
RVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVE
WTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
;
;MKCSWVIFFLMAVVTGVISEVQLQQSGAELVKPGASVKLSCTASGFNIKDTYIHWVNQRPEQGLEWIGRIDPANGHTQYD
PKFQGKATITADTSSNTAYLQLSSLTSEDTAVYYCATSDYSYALDSWGQGTSVTVSSAKTTAPSVYPLAPVCGDTTGSSV
TLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVTSSTWPSQSITCNVAHPASSTKVDKKIEPRGPT
IKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTL
RVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVE
WTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK
;
H ? 
3 'polypeptide(L)' no no 
;MESQTQVLMFLLLWVSGACADIVMTQSPSSLAMSVGQKVTMSCKSSQSLLNSNNQKNYLAWYQQKPGQSPKLLVYFASTR
ESGVPDRFIGSGSGTDFTLTISSVQAEDLADYFCQQHYSTPYTFGGGTKLEIRRADAAPTVSIFPPSSEQLTSGGASVVC
FLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
;MESQTQVLMFLLLWVSGACADIVMTQSPSSLAMSVGQKVTMSCKSSQSLLNSNNQKNYLAWYQQKPGQSPKLLVYFASTR
ESGVPDRFIGSGSGTDFTLTISSVQAEDLADYFCQQHYSTPYTFGGGTKLEIRRADAAPTVSIFPPSSEQLTSGGASVVC
FLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC
;
L ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   THR n 
1 2   PRO n 
1 3   VAL n 
1 4   GLY n 
1 5   LEU n 
1 6   ALA n 
1 7   MET n 
1 8   SER n 
1 9   ALA n 
1 10  CYS n 
1 11  ARG n 
1 12  SER n 
1 13  ILE n 
1 14  GLU n 
1 15  ALA n 
1 16  PHE n 
1 17  ARG n 
1 18  VAL n 
1 19  GLY n 
1 20  TRP n 
1 21  GLY n 
1 22  ALA n 
1 23  LEU n 
1 24  GLN n 
1 25  TYR n 
1 26  GLU n 
1 27  ASP n 
1 28  ASN n 
1 29  VAL n 
1 30  THR n 
1 31  ASN n 
1 32  PRO n 
1 33  GLU n 
1 34  ASP n 
1 35  MET n 
1 36  ARG n 
1 37  PRO n 
1 38  TYR n 
1 39  CYS n 
1 40  TRP n 
1 41  HIS n 
1 42  TYR n 
1 43  PRO n 
1 44  PRO n 
1 45  ARG n 
1 46  GLN n 
1 47  CYS n 
1 48  GLY n 
1 49  VAL n 
1 50  VAL n 
1 51  SER n 
1 52  ALA n 
1 53  LYS n 
1 54  THR n 
1 55  VAL n 
1 56  CYS n 
1 57  GLY n 
1 58  PRO n 
1 59  VAL n 
1 60  TYR n 
1 61  CYS n 
1 62  PHE n 
1 63  THR n 
1 64  PRO n 
1 65  SER n 
1 66  PRO n 
1 67  VAL n 
1 68  VAL n 
1 69  VAL n 
1 70  GLY n 
1 71  THR n 
1 72  THR n 
1 73  ASP n 
1 74  ARG n 
1 75  LEU n 
1 76  GLY n 
1 77  ALA n 
1 78  PRO n 
1 79  THR n 
1 80  TYR n 
1 81  THR n 
1 82  TRP n 
1 83  GLY n 
1 84  GLU n 
1 85  ASN n 
1 86  GLU n 
1 87  THR n 
1 88  ASP n 
1 89  VAL n 
1 90  PHE n 
1 91  LEU n 
1 92  LEU n 
1 93  ASN n 
1 94  SER n 
1 95  THR n 
1 96  ARG n 
1 97  PRO n 
1 98  PRO n 
1 99  LEU n 
1 100 GLY n 
1 101 SER n 
1 102 TRP n 
1 103 PHE n 
1 104 GLY n 
1 105 CYS n 
1 106 THR n 
1 107 TRP n 
1 108 MET n 
1 109 ASN n 
1 110 SER n 
1 111 SER n 
1 112 GLY n 
1 113 TYR n 
1 114 THR n 
1 115 LYS n 
1 116 THR n 
1 117 CYS n 
1 118 GLY n 
1 119 ALA n 
1 120 PRO n 
1 121 PRO n 
1 122 CYS n 
1 123 ARG n 
1 124 THR n 
1 125 ARG n 
1 126 ALA n 
1 127 ASP n 
1 128 PHE n 
1 129 ASN n 
1 130 ALA n 
1 131 SER n 
1 132 THR n 
1 133 ASP n 
1 134 LEU n 
1 135 LEU n 
1 136 CYS n 
1 137 PRO n 
1 138 THR n 
1 139 ASP n 
1 140 CYS n 
1 141 PHE n 
1 142 ARG n 
1 143 LYS n 
1 144 HIS n 
1 145 PRO n 
1 146 ASP n 
1 147 THR n 
1 148 THR n 
1 149 TYR n 
1 150 LEU n 
1 151 LYS n 
1 152 CYS n 
1 153 GLY n 
1 154 SER n 
1 155 GLY n 
1 156 PRO n 
1 157 TRP n 
1 158 LEU n 
1 159 THR n 
1 160 PRO n 
1 161 ARG n 
1 162 CYS n 
1 163 LEU n 
1 164 ILE n 
1 165 ASP n 
1 166 TYR n 
1 167 PRO n 
1 168 TYR n 
1 169 ARG n 
1 170 LEU n 
1 171 TRP n 
1 172 HIS n 
1 173 TYR n 
1 174 PRO n 
1 175 CYS n 
1 176 THR n 
1 177 VAL n 
1 178 ASN n 
1 179 TYR n 
1 180 THR n 
1 181 ILE n 
1 182 PHE n 
1 183 LYS n 
1 184 ILE n 
1 185 ARG n 
1 186 MET n 
1 187 TYR n 
1 188 VAL n 
1 189 GLY n 
1 190 GLY n 
1 191 VAL n 
1 192 GLU n 
1 193 HIS n 
1 194 ARG n 
1 195 LEU n 
1 196 THR n 
1 197 ALA n 
1 198 ALA n 
1 199 CYS n 
1 200 ASN n 
1 201 PHE n 
1 202 THR n 
1 203 ARG n 
1 204 GLY n 
1 205 ASP n 
1 206 ARG n 
1 207 GLY n 
1 208 SER n 
1 209 ALA n 
1 210 SER n 
1 211 GLY n 
1 212 LEU n 
1 213 GLU n 
1 214 VAL n 
1 215 LEU n 
1 216 PHE n 
1 217 GLN n 
2 1   MET n 
2 2   LYS n 
2 3   CYS n 
2 4   SER n 
2 5   TRP n 
2 6   VAL n 
2 7   ILE n 
2 8   PHE n 
2 9   PHE n 
2 10  LEU n 
2 11  MET n 
2 12  ALA n 
2 13  VAL n 
2 14  VAL n 
2 15  THR n 
2 16  GLY n 
2 17  VAL n 
2 18  ILE n 
2 19  SER n 
2 20  GLU n 
2 21  VAL n 
2 22  GLN n 
2 23  LEU n 
2 24  GLN n 
2 25  GLN n 
2 26  SER n 
2 27  GLY n 
2 28  ALA n 
2 29  GLU n 
2 30  LEU n 
2 31  VAL n 
2 32  LYS n 
2 33  PRO n 
2 34  GLY n 
2 35  ALA n 
2 36  SER n 
2 37  VAL n 
2 38  LYS n 
2 39  LEU n 
2 40  SER n 
2 41  CYS n 
2 42  THR n 
2 43  ALA n 
2 44  SER n 
2 45  GLY n 
2 46  PHE n 
2 47  ASN n 
2 48  ILE n 
2 49  LYS n 
2 50  ASP n 
2 51  THR n 
2 52  TYR n 
2 53  ILE n 
2 54  HIS n 
2 55  TRP n 
2 56  VAL n 
2 57  ASN n 
2 58  GLN n 
2 59  ARG n 
2 60  PRO n 
2 61  GLU n 
2 62  GLN n 
2 63  GLY n 
2 64  LEU n 
2 65  GLU n 
2 66  TRP n 
2 67  ILE n 
2 68  GLY n 
2 69  ARG n 
2 70  ILE n 
2 71  ASP n 
2 72  PRO n 
2 73  ALA n 
2 74  ASN n 
2 75  GLY n 
2 76  HIS n 
2 77  THR n 
2 78  GLN n 
2 79  TYR n 
2 80  ASP n 
2 81  PRO n 
2 82  LYS n 
2 83  PHE n 
2 84  GLN n 
2 85  GLY n 
2 86  LYS n 
2 87  ALA n 
2 88  THR n 
2 89  ILE n 
2 90  THR n 
2 91  ALA n 
2 92  ASP n 
2 93  THR n 
2 94  SER n 
2 95  SER n 
2 96  ASN n 
2 97  THR n 
2 98  ALA n 
2 99  TYR n 
2 100 LEU n 
2 101 GLN n 
2 102 LEU n 
2 103 SER n 
2 104 SER n 
2 105 LEU n 
2 106 THR n 
2 107 SER n 
2 108 GLU n 
2 109 ASP n 
2 110 THR n 
2 111 ALA n 
2 112 VAL n 
2 113 TYR n 
2 114 TYR n 
2 115 CYS n 
2 116 ALA n 
2 117 THR n 
2 118 SER n 
2 119 ASP n 
2 120 TYR n 
2 121 SER n 
2 122 TYR n 
2 123 ALA n 
2 124 LEU n 
2 125 ASP n 
2 126 SER n 
2 127 TRP n 
2 128 GLY n 
2 129 GLN n 
2 130 GLY n 
2 131 THR n 
2 132 SER n 
2 133 VAL n 
2 134 THR n 
2 135 VAL n 
2 136 SER n 
2 137 SER n 
2 138 ALA n 
2 139 LYS n 
2 140 THR n 
2 141 THR n 
2 142 ALA n 
2 143 PRO n 
2 144 SER n 
2 145 VAL n 
2 146 TYR n 
2 147 PRO n 
2 148 LEU n 
2 149 ALA n 
2 150 PRO n 
2 151 VAL n 
2 152 CYS n 
2 153 GLY n 
2 154 ASP n 
2 155 THR n 
2 156 THR n 
2 157 GLY n 
2 158 SER n 
2 159 SER n 
2 160 VAL n 
2 161 THR n 
2 162 LEU n 
2 163 GLY n 
2 164 CYS n 
2 165 LEU n 
2 166 VAL n 
2 167 LYS n 
2 168 GLY n 
2 169 TYR n 
2 170 PHE n 
2 171 PRO n 
2 172 GLU n 
2 173 PRO n 
2 174 VAL n 
2 175 THR n 
2 176 LEU n 
2 177 THR n 
2 178 TRP n 
2 179 ASN n 
2 180 SER n 
2 181 GLY n 
2 182 SER n 
2 183 LEU n 
2 184 SER n 
2 185 SER n 
2 186 GLY n 
2 187 VAL n 
2 188 HIS n 
2 189 THR n 
2 190 PHE n 
2 191 PRO n 
2 192 ALA n 
2 193 VAL n 
2 194 LEU n 
2 195 GLN n 
2 196 SER n 
2 197 ASP n 
2 198 LEU n 
2 199 TYR n 
2 200 THR n 
2 201 LEU n 
2 202 SER n 
2 203 SER n 
2 204 SER n 
2 205 VAL n 
2 206 THR n 
2 207 VAL n 
2 208 THR n 
2 209 SER n 
2 210 SER n 
2 211 THR n 
2 212 TRP n 
2 213 PRO n 
2 214 SER n 
2 215 GLN n 
2 216 SER n 
2 217 ILE n 
2 218 THR n 
2 219 CYS n 
2 220 ASN n 
2 221 VAL n 
2 222 ALA n 
2 223 HIS n 
2 224 PRO n 
2 225 ALA n 
2 226 SER n 
2 227 SER n 
2 228 THR n 
2 229 LYS n 
2 230 VAL n 
2 231 ASP n 
2 232 LYS n 
2 233 LYS n 
2 234 ILE n 
2 235 GLU n 
2 236 PRO n 
2 237 ARG n 
2 238 GLY n 
2 239 PRO n 
2 240 THR n 
2 241 ILE n 
2 242 LYS n 
2 243 PRO n 
2 244 CYS n 
2 245 PRO n 
2 246 PRO n 
2 247 CYS n 
2 248 LYS n 
2 249 CYS n 
2 250 PRO n 
2 251 ALA n 
2 252 PRO n 
2 253 ASN n 
2 254 LEU n 
2 255 LEU n 
2 256 GLY n 
2 257 GLY n 
2 258 PRO n 
2 259 SER n 
2 260 VAL n 
2 261 PHE n 
2 262 ILE n 
2 263 PHE n 
2 264 PRO n 
2 265 PRO n 
2 266 LYS n 
2 267 ILE n 
2 268 LYS n 
2 269 ASP n 
2 270 VAL n 
2 271 LEU n 
2 272 MET n 
2 273 ILE n 
2 274 SER n 
2 275 LEU n 
2 276 SER n 
2 277 PRO n 
2 278 ILE n 
2 279 VAL n 
2 280 THR n 
2 281 CYS n 
2 282 VAL n 
2 283 VAL n 
2 284 VAL n 
2 285 ASP n 
2 286 VAL n 
2 287 SER n 
2 288 GLU n 
2 289 ASP n 
2 290 ASP n 
2 291 PRO n 
2 292 ASP n 
2 293 VAL n 
2 294 GLN n 
2 295 ILE n 
2 296 SER n 
2 297 TRP n 
2 298 PHE n 
2 299 VAL n 
2 300 ASN n 
2 301 ASN n 
2 302 VAL n 
2 303 GLU n 
2 304 VAL n 
2 305 HIS n 
2 306 THR n 
2 307 ALA n 
2 308 GLN n 
2 309 THR n 
2 310 GLN n 
2 311 THR n 
2 312 HIS n 
2 313 ARG n 
2 314 GLU n 
2 315 ASP n 
2 316 TYR n 
2 317 ASN n 
2 318 SER n 
2 319 THR n 
2 320 LEU n 
2 321 ARG n 
2 322 VAL n 
2 323 VAL n 
2 324 SER n 
2 325 ALA n 
2 326 LEU n 
2 327 PRO n 
2 328 ILE n 
2 329 GLN n 
2 330 HIS n 
2 331 GLN n 
2 332 ASP n 
2 333 TRP n 
2 334 MET n 
2 335 SER n 
2 336 GLY n 
2 337 LYS n 
2 338 GLU n 
2 339 PHE n 
2 340 LYS n 
2 341 CYS n 
2 342 LYS n 
2 343 VAL n 
2 344 ASN n 
2 345 ASN n 
2 346 LYS n 
2 347 ASP n 
2 348 LEU n 
2 349 PRO n 
2 350 ALA n 
2 351 PRO n 
2 352 ILE n 
2 353 GLU n 
2 354 ARG n 
2 355 THR n 
2 356 ILE n 
2 357 SER n 
2 358 LYS n 
2 359 PRO n 
2 360 LYS n 
2 361 GLY n 
2 362 SER n 
2 363 VAL n 
2 364 ARG n 
2 365 ALA n 
2 366 PRO n 
2 367 GLN n 
2 368 VAL n 
2 369 TYR n 
2 370 VAL n 
2 371 LEU n 
2 372 PRO n 
2 373 PRO n 
2 374 PRO n 
2 375 GLU n 
2 376 GLU n 
2 377 GLU n 
2 378 MET n 
2 379 THR n 
2 380 LYS n 
2 381 LYS n 
2 382 GLN n 
2 383 VAL n 
2 384 THR n 
2 385 LEU n 
2 386 THR n 
2 387 CYS n 
2 388 MET n 
2 389 VAL n 
2 390 THR n 
2 391 ASP n 
2 392 PHE n 
2 393 MET n 
2 394 PRO n 
2 395 GLU n 
2 396 ASP n 
2 397 ILE n 
2 398 TYR n 
2 399 VAL n 
2 400 GLU n 
2 401 TRP n 
2 402 THR n 
2 403 ASN n 
2 404 ASN n 
2 405 GLY n 
2 406 LYS n 
2 407 THR n 
2 408 GLU n 
2 409 LEU n 
2 410 ASN n 
2 411 TYR n 
2 412 LYS n 
2 413 ASN n 
2 414 THR n 
2 415 GLU n 
2 416 PRO n 
2 417 VAL n 
2 418 LEU n 
2 419 ASP n 
2 420 SER n 
2 421 ASP n 
2 422 GLY n 
2 423 SER n 
2 424 TYR n 
2 425 PHE n 
2 426 MET n 
2 427 TYR n 
2 428 SER n 
2 429 LYS n 
2 430 LEU n 
2 431 ARG n 
2 432 VAL n 
2 433 GLU n 
2 434 LYS n 
2 435 LYS n 
2 436 ASN n 
2 437 TRP n 
2 438 VAL n 
2 439 GLU n 
2 440 ARG n 
2 441 ASN n 
2 442 SER n 
2 443 TYR n 
2 444 SER n 
2 445 CYS n 
2 446 SER n 
2 447 VAL n 
2 448 VAL n 
2 449 HIS n 
2 450 GLU n 
2 451 GLY n 
2 452 LEU n 
2 453 HIS n 
2 454 ASN n 
2 455 HIS n 
2 456 HIS n 
2 457 THR n 
2 458 THR n 
2 459 LYS n 
2 460 SER n 
2 461 PHE n 
2 462 SER n 
2 463 ARG n 
2 464 THR n 
2 465 PRO n 
2 466 GLY n 
2 467 LYS n 
3 1   MET n 
3 2   GLU n 
3 3   SER n 
3 4   GLN n 
3 5   THR n 
3 6   GLN n 
3 7   VAL n 
3 8   LEU n 
3 9   MET n 
3 10  PHE n 
3 11  LEU n 
3 12  LEU n 
3 13  LEU n 
3 14  TRP n 
3 15  VAL n 
3 16  SER n 
3 17  GLY n 
3 18  ALA n 
3 19  CYS n 
3 20  ALA n 
3 21  ASP n 
3 22  ILE n 
3 23  VAL n 
3 24  MET n 
3 25  THR n 
3 26  GLN n 
3 27  SER n 
3 28  PRO n 
3 29  SER n 
3 30  SER n 
3 31  LEU n 
3 32  ALA n 
3 33  MET n 
3 34  SER n 
3 35  VAL n 
3 36  GLY n 
3 37  GLN n 
3 38  LYS n 
3 39  VAL n 
3 40  THR n 
3 41  MET n 
3 42  SER n 
3 43  CYS n 
3 44  LYS n 
3 45  SER n 
3 46  SER n 
3 47  GLN n 
3 48  SER n 
3 49  LEU n 
3 50  LEU n 
3 51  ASN n 
3 52  SER n 
3 53  ASN n 
3 54  ASN n 
3 55  GLN n 
3 56  LYS n 
3 57  ASN n 
3 58  TYR n 
3 59  LEU n 
3 60  ALA n 
3 61  TRP n 
3 62  TYR n 
3 63  GLN n 
3 64  GLN n 
3 65  LYS n 
3 66  PRO n 
3 67  GLY n 
3 68  GLN n 
3 69  SER n 
3 70  PRO n 
3 71  LYS n 
3 72  LEU n 
3 73  LEU n 
3 74  VAL n 
3 75  TYR n 
3 76  PHE n 
3 77  ALA n 
3 78  SER n 
3 79  THR n 
3 80  ARG n 
3 81  GLU n 
3 82  SER n 
3 83  GLY n 
3 84  VAL n 
3 85  PRO n 
3 86  ASP n 
3 87  ARG n 
3 88  PHE n 
3 89  ILE n 
3 90  GLY n 
3 91  SER n 
3 92  GLY n 
3 93  SER n 
3 94  GLY n 
3 95  THR n 
3 96  ASP n 
3 97  PHE n 
3 98  THR n 
3 99  LEU n 
3 100 THR n 
3 101 ILE n 
3 102 SER n 
3 103 SER n 
3 104 VAL n 
3 105 GLN n 
3 106 ALA n 
3 107 GLU n 
3 108 ASP n 
3 109 LEU n 
3 110 ALA n 
3 111 ASP n 
3 112 TYR n 
3 113 PHE n 
3 114 CYS n 
3 115 GLN n 
3 116 GLN n 
3 117 HIS n 
3 118 TYR n 
3 119 SER n 
3 120 THR n 
3 121 PRO n 
3 122 TYR n 
3 123 THR n 
3 124 PHE n 
3 125 GLY n 
3 126 GLY n 
3 127 GLY n 
3 128 THR n 
3 129 LYS n 
3 130 LEU n 
3 131 GLU n 
3 132 ILE n 
3 133 ARG n 
3 134 ARG n 
3 135 ALA n 
3 136 ASP n 
3 137 ALA n 
3 138 ALA n 
3 139 PRO n 
3 140 THR n 
3 141 VAL n 
3 142 SER n 
3 143 ILE n 
3 144 PHE n 
3 145 PRO n 
3 146 PRO n 
3 147 SER n 
3 148 SER n 
3 149 GLU n 
3 150 GLN n 
3 151 LEU n 
3 152 THR n 
3 153 SER n 
3 154 GLY n 
3 155 GLY n 
3 156 ALA n 
3 157 SER n 
3 158 VAL n 
3 159 VAL n 
3 160 CYS n 
3 161 PHE n 
3 162 LEU n 
3 163 ASN n 
3 164 ASN n 
3 165 PHE n 
3 166 TYR n 
3 167 PRO n 
3 168 LYS n 
3 169 ASP n 
3 170 ILE n 
3 171 ASN n 
3 172 VAL n 
3 173 LYS n 
3 174 TRP n 
3 175 LYS n 
3 176 ILE n 
3 177 ASP n 
3 178 GLY n 
3 179 SER n 
3 180 GLU n 
3 181 ARG n 
3 182 GLN n 
3 183 ASN n 
3 184 GLY n 
3 185 VAL n 
3 186 LEU n 
3 187 ASN n 
3 188 SER n 
3 189 TRP n 
3 190 THR n 
3 191 ASP n 
3 192 GLN n 
3 193 ASP n 
3 194 SER n 
3 195 LYS n 
3 196 ASP n 
3 197 SER n 
3 198 THR n 
3 199 TYR n 
3 200 SER n 
3 201 MET n 
3 202 SER n 
3 203 SER n 
3 204 THR n 
3 205 LEU n 
3 206 THR n 
3 207 LEU n 
3 208 THR n 
3 209 LYS n 
3 210 ASP n 
3 211 GLU n 
3 212 TYR n 
3 213 GLU n 
3 214 ARG n 
3 215 HIS n 
3 216 ASN n 
3 217 SER n 
3 218 TYR n 
3 219 THR n 
3 220 CYS n 
3 221 GLU n 
3 222 ALA n 
3 223 THR n 
3 224 HIS n 
3 225 LYS n 
3 226 THR n 
3 227 SER n 
3 228 THR n 
3 229 SER n 
3 230 PRO n 
3 231 ILE n 
3 232 VAL n 
3 233 LYS n 
3 234 SER n 
3 235 PHE n 
3 236 ASN n 
3 237 ARG n 
3 238 ASN n 
3 239 GLU n 
3 240 CYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 217 ? ? ? ? ? ? ? ? ? 'Hepatitis C virus subtype 2a' 31649 ? ? ? ? ? ? ? ? Lentivirus 11646 ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 467 ? ? ? ? ? ? ? ? ? 'Mus musculus'                 10090 ? ? ? ? ? ? ? ? Lentivirus 11646 ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 240 ? ? ? ? ? ? ? ? ? 'Mus musculus'                 10090 ? ? ? ? ? ? ? ? Lentivirus 11646 ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP Q9QF35_9HEPC Q9QF35 ? 1 
;MSACRSIEAFRVGWGALQYEDNVTNPEDMRPYCWHYPPRQCGVVSAKTVCGPVYCFTPSPVVVGTTDRLGAPTYTWGENE
TDVFLLNSTRPPLGSWFGCTWMNSSGYTKTCGAPPCRTRADFNASTDLLCPTDCFRKHPDTTYLKCGSGPWLTPRCLIDY
PYRLWHYPCTVNYTIFKIRMYVGGVEHRLTAACNFTRGDR
;
456 
2 PDB 4WEB         4WEB   ? 2 ? 1   
3 PDB 4WEB         4WEB   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4WEB E 7 ? 206 ? Q9QF35 456 ? 655 ? 456 655 
2 2 4WEB H 1 ? 467 ? 4WEB   -18 ? 448 ? -18 448 
3 3 4WEB L 1 ? 240 ? 4WEB   -19 ? 220 ? -19 220 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4WEB THR E 1   ? UNP Q9QF35 ? ? 'expression tag' 450 1  
1 4WEB PRO E 2   ? UNP Q9QF35 ? ? 'expression tag' 451 2  
1 4WEB VAL E 3   ? UNP Q9QF35 ? ? 'expression tag' 452 3  
1 4WEB GLY E 4   ? UNP Q9QF35 ? ? 'expression tag' 453 4  
1 4WEB LEU E 5   ? UNP Q9QF35 ? ? 'expression tag' 454 5  
1 4WEB ALA E 6   ? UNP Q9QF35 ? ? 'expression tag' 455 6  
1 4WEB GLY E 207 ? UNP Q9QF35 ? ? 'expression tag' 656 7  
1 4WEB SER E 208 ? UNP Q9QF35 ? ? 'expression tag' 657 8  
1 4WEB ALA E 209 ? UNP Q9QF35 ? ? 'expression tag' 658 9  
1 4WEB SER E 210 ? UNP Q9QF35 ? ? 'expression tag' 659 10 
1 4WEB GLY E 211 ? UNP Q9QF35 ? ? 'expression tag' 660 11 
1 4WEB LEU E 212 ? UNP Q9QF35 ? ? 'expression tag' 661 12 
1 4WEB GLU E 213 ? UNP Q9QF35 ? ? 'expression tag' 662 13 
1 4WEB VAL E 214 ? UNP Q9QF35 ? ? 'expression tag' 663 14 
1 4WEB LEU E 215 ? UNP Q9QF35 ? ? 'expression tag' 664 15 
1 4WEB PHE E 216 ? UNP Q9QF35 ? ? 'expression tag' 665 16 
1 4WEB GLN E 217 ? UNP Q9QF35 ? ? 'expression tag' 666 17 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'            y ALANINE                                  ? 'C3 H7 N O2'     89.093  
ARF 'L-peptide NH3 amino terminus' . FORMAMIDE                                ? 'C H3 N O'       45.041  
ARG 'L-peptide linking'            y ARGININE                                 ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking'            y ASPARAGINE                               ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking'            y 'ASPARTIC ACID'                          ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking'            y CYSTEINE                                 ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking'            y GLUTAMINE                                ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking'            y 'GLUTAMIC ACID'                          ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'              y GLYCINE                                  ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking'            y HISTIDINE                                ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer                    . WATER                                    ? 'H2 O'           18.015  
ILE 'L-peptide linking'            y ISOLEUCINE                               ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking'            y LEUCINE                                  ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking'            y LYSINE                                   ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking'            y METHIONINE                               ? 'C5 H11 N O2 S'  149.211 
NAG 'D-saccharide, beta linking'   . 2-acetamido-2-deoxy-beta-D-glucopyranose ? 'C8 H15 N O6'    221.208 
PHE 'L-peptide linking'            y PHENYLALANINE                            ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking'            y PROLINE                                  ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking'            y SERINE                                   ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking'            y THREONINE                                ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking'            y TRYPTOPHAN                               ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking'            y TYROSINE                                 ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking'            y VALINE                                   ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4WEB 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            ? 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         ? 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'22% (w/v) PEG 3350, 0.5 M MgCl2, 0.1 M HEPES, 15% dioxane, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-10-13 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal monochromator' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.979 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X25 
_diffrn_source.pdbx_synchrotron_site       NSLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         4WEB 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.40 
_reflns.d_resolution_low                 24.69 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       25892 
_reflns.number_obs                       24344 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.7 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.6 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4WEB 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.400 
_refine.ls_d_res_low                             24.69 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     24344 
_refine.ls_number_reflns_R_free                  1999 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    94.23 
_refine.ls_percent_reflns_R_free                 8.21 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2038 
_refine.ls_R_factor_R_free                       0.2587 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1988 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.42 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 26.63 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.35 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4155 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         46 
_refine_hist.number_atoms_solvent             136 
_refine_hist.number_atoms_total               4337 
_refine_hist.d_res_high                       2.400 
_refine_hist.d_res_low                        24.69 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.009  ? 4309 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.358  ? 5876 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.593 ? 1477 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.046  ? 683  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.007  ? 745  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
'X-RAY DIFFRACTION' 2.4000 2.4600  . . 121 1359 83.00  . . . 0.3289 . 0.2335 . . . . . . . . 
'X-RAY DIFFRACTION' 2.4600 2.5265  . . 130 1447 86.00  . . . 0.2872 . 0.2348 . . . . . . . . 
'X-RAY DIFFRACTION' 2.5265 2.6008  . . 132 1465 89.00  . . . 0.3035 . 0.2252 . . . . . . . . 
'X-RAY DIFFRACTION' 2.6008 2.6847  . . 136 1523 91.00  . . . 0.3111 . 0.2243 . . . . . . . . 
'X-RAY DIFFRACTION' 2.6847 2.7806  . . 133 1493 91.00  . . . 0.3014 . 0.2326 . . . . . . . . 
'X-RAY DIFFRACTION' 2.7806 2.8918  . . 141 1565 93.00  . . . 0.3237 . 0.2216 . . . . . . . . 
'X-RAY DIFFRACTION' 2.8918 3.0233  . . 142 1596 96.00  . . . 0.3049 . 0.2241 . . . . . . . . 
'X-RAY DIFFRACTION' 3.0233 3.1826  . . 147 1639 97.00  . . . 0.3056 . 0.2156 . . . . . . . . 
'X-RAY DIFFRACTION' 3.1826 3.3817  . . 146 1627 97.00  . . . 0.2827 . 0.2263 . . . . . . . . 
'X-RAY DIFFRACTION' 3.3817 3.6424  . . 148 1657 98.00  . . . 0.2771 . 0.1927 . . . . . . . . 
'X-RAY DIFFRACTION' 3.6424 4.0082  . . 149 1678 99.00  . . . 0.2509 . 0.1933 . . . . . . . . 
'X-RAY DIFFRACTION' 4.0082 4.5864  . . 154 1712 99.00  . . . 0.2549 . 0.1690 . . . . . . . . 
'X-RAY DIFFRACTION' 4.5864 5.7715  . . 154 1740 100.00 . . . 0.1902 . 0.1763 . . . . . . . . 
'X-RAY DIFFRACTION' 5.7715 29.9086 . . 166 1844 100.00 . . . 0.2267 . 0.1957 . . . . . . . . 
# 
_struct.entry_id                     4WEB 
_struct.pdbx_CASP_flag               ? 
_struct.pdbx_descriptor              'hepatitis C virus envelope glycoprotein 2, Mouse Fab Heavy Chain, Mouse Fab Light Chain' 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_details           ? 
_struct.pdbx_model_type_details      ? 
_struct.title                        'Structure of the core ectodomain of the hepatitis C virus envelope glycoprotein 2' 
# 
_struct_keywords.entry_id        4WEB 
_struct_keywords.text            
'Hepatitis C virus, E2, IgG-like fold, scavenger receptor class B type I (SR-BI), CD81, IMMUNE SYSTEM-VIRAL PROTEIN complex' 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM/VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 148 ? CYS A 152 ? THR E 597 CYS E 601 1 ? 5 
HELX_P HELX_P2  AA2 TYR A 168 ? TYR A 173 ? TYR E 617 TYR E 622 1 ? 6 
HELX_P HELX_P3  AA3 PRO A 174 ? VAL A 177 ? PRO E 623 VAL E 626 5 ? 4 
HELX_P HELX_P4  AA4 ASN B 47  ? THR B 51  ? ASN H 28  THR H 32  5 ? 5 
HELX_P HELX_P5  AA5 PRO B 81  ? GLN B 84  ? PRO H 62  GLN H 65  5 ? 4 
HELX_P HELX_P6  AA6 THR B 93  ? SER B 95  ? THR H 74  SER H 76  5 ? 3 
HELX_P HELX_P7  AA7 THR B 106 ? THR B 110 ? THR H 87  THR H 91  5 ? 5 
HELX_P HELX_P8  AA8 PRO B 224 ? SER B 227 ? PRO H 205 SER H 208 5 ? 4 
HELX_P HELX_P9  AA9 GLN C 105 ? LEU C 109 ? GLN L 85  LEU L 89  5 ? 5 
HELX_P HELX_P10 AB1 SER C 147 ? SER C 153 ? SER L 127 SER L 133 1 ? 7 
HELX_P HELX_P11 AB2 LYS C 209 ? HIS C 215 ? LYS L 189 HIS L 195 1 ? 7 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?   ? A CYS 39  SG  ? ? ? 1_555 A CYS 175 SG ? ? E CYS 488 E CYS 624 1_555 ? ? ? ? ? ? ? 2.063 ? ?               
disulf2 disulf ?   ? A CYS 47  SG  ? ? ? 1_555 A CYS 117 SG ? ? E CYS 496 E CYS 566 1_555 ? ? ? ? ? ? ? 2.077 ? ?               
disulf3 disulf ?   ? A CYS 61  SG  ? ? ? 1_555 A CYS 105 SG ? ? E CYS 510 E CYS 554 1_555 ? ? ? ? ? ? ? 2.043 ? ?               
disulf4 disulf ?   ? A CYS 122 SG  ? ? ? 1_555 A CYS 152 SG ? ? E CYS 571 E CYS 601 1_555 ? ? ? ? ? ? ? 2.026 ? ?               
disulf5 disulf ?   ? A CYS 162 SG  ? ? ? 1_555 A CYS 199 SG ? ? E CYS 611 E CYS 648 1_555 ? ? ? ? ? ? ? 1.999 ? ?               
disulf6 disulf ?   ? B CYS 41  SG  ? ? ? 1_555 B CYS 115 SG ? ? H CYS 22  H CYS 96  1_555 ? ? ? ? ? ? ? 2.057 ? ?               
disulf7 disulf ?   ? B CYS 164 SG  ? ? ? 1_555 B CYS 219 SG ? ? H CYS 145 H CYS 200 1_555 ? ? ? ? ? ? ? 2.022 ? ?               
disulf8 disulf ?   ? C CYS 43  SG  ? ? ? 1_555 C CYS 114 SG ? ? L CYS 23  L CYS 94  1_555 ? ? ? ? ? ? ? 2.086 ? ?               
disulf9 disulf ?   ? C CYS 160 SG  ? ? ? 1_555 C CYS 220 SG ? ? L CYS 140 L CYS 200 1_555 ? ? ? ? ? ? ? 2.048 ? ?               
covale1 covale one ? A ASN 109 ND2 ? ? ? 1_555 D NAG .   C1 ? ? E ASN 558 E NAG 701 1_555 ? ? ? ? ? ? ? 1.507 ? N-Glycosylation 
covale2 covale one ? A ASN 200 ND2 ? ? ? 1_555 E NAG .   C1 ? ? E ASN 649 E NAG 702 1_555 ? ? ? ? ? ? ? 1.553 ? N-Glycosylation 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  CYS 39  A . ? CYS 488 E TRP 40  A ? TRP 489 E 1 -2.43  
2  THR 63  A . ? THR 512 E PRO 64  A ? PRO 513 E 1 9.03   
3  PHE 170 B . ? PHE 151 H PRO 171 B ? PRO 152 H 1 -1.35  
4  GLU 172 B . ? GLU 153 H PRO 173 B ? PRO 154 H 1 11.23  
5  VAL 193 B . ? VAL 174 H LEU 194 B ? LEU 175 H 1 0.25   
6  LEU 194 B . ? LEU 175 H GLN 195 B ? GLN 176 H 1 -0.43  
7  SER 196 B . ? SER 177 H ASP 197 B ? ASP 178 H 1 -11.16 
8  TRP 212 B . ? TRP 193 H PRO 213 B ? PRO 194 H 1 -0.38  
9  SER 27  C . ? SER 7   L PRO 28  C ? PRO 8   L 1 -3.00  
10 THR 120 C . ? THR 100 L PRO 121 C ? PRO 101 L 1 -5.49  
11 TYR 166 C . ? TYR 146 L PRO 167 C ? PRO 147 L 1 0.13   
12 ASN 216 C . ? ASN 196 L SER 217 C ? SER 197 L 1 10.99  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 6 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 3 ? 
AA8 ? 4 ? 
AA9 ? 6 ? 
AB1 ? 4 ? 
AB2 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? parallel      
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA4 5 6 ? anti-parallel 
AA5 1 2 ? parallel      
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? parallel      
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AA9 4 5 ? anti-parallel 
AA9 5 6 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB1 3 4 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PRO A 66  ? VAL A 69  ? PRO E 515 VAL E 518 
AA1 2 VAL A 59  ? PHE A 62  ? VAL E 508 PHE E 511 
AA1 3 GLY A 104 ? MET A 108 ? GLY E 553 MET E 557 
AA1 4 THR A 114 ? GLY A 118 ? THR E 563 GLY E 567 
AA2 1 LEU A 163 ? ILE A 164 ? LEU E 612 ILE E 613 
AA2 2 VAL A 191 ? ALA A 198 ? VAL E 640 ALA E 647 
AA2 3 ILE A 181 ? VAL A 188 ? ILE E 630 VAL E 637 
AA3 1 GLN B 22  ? GLN B 25  ? GLN H 3   GLN H 6   
AA3 2 VAL B 37  ? SER B 44  ? VAL H 18  SER H 25  
AA3 3 THR B 97  ? LEU B 102 ? THR H 78  LEU H 83  
AA3 4 ALA B 87  ? ASP B 92  ? ALA H 68  ASP H 73  
AA4 1 GLU B 29  ? VAL B 31  ? GLU H 10  VAL H 12  
AA4 2 THR B 131 ? VAL B 135 ? THR H 112 VAL H 116 
AA4 3 ALA B 111 ? SER B 118 ? ALA H 92  SER H 99  
AA4 4 TYR B 52  ? GLN B 58  ? TYR H 33  GLN H 39  
AA4 5 GLU B 65  ? ILE B 70  ? GLU H 46  ILE H 51  
AA4 6 THR B 77  ? TYR B 79  ? THR H 58  TYR H 60  
AA5 1 GLU B 29  ? VAL B 31  ? GLU H 10  VAL H 12  
AA5 2 THR B 131 ? VAL B 135 ? THR H 112 VAL H 116 
AA5 3 ALA B 111 ? SER B 118 ? ALA H 92  SER H 99  
AA5 4 SER B 126 ? TRP B 127 ? SER H 107 TRP H 108 
AA6 1 SER B 144 ? LEU B 148 ? SER H 125 LEU H 129 
AA6 2 VAL B 160 ? TYR B 169 ? VAL H 141 TYR H 150 
AA6 3 TYR B 199 ? VAL B 207 ? TYR H 180 VAL H 188 
AA6 4 VAL B 187 ? VAL B 193 ? VAL H 168 VAL H 174 
AA7 1 THR B 175 ? TRP B 178 ? THR H 156 TRP H 159 
AA7 2 THR B 218 ? HIS B 223 ? THR H 199 HIS H 204 
AA7 3 THR B 228 ? LYS B 233 ? THR H 209 LYS H 214 
AA8 1 MET C 24  ? SER C 27  ? MET L 4   SER L 7   
AA8 2 VAL C 39  ? SER C 45  ? VAL L 19  SER L 25  
AA8 3 ASP C 96  ? ILE C 101 ? ASP L 76  ILE L 81  
AA8 4 PHE C 88  ? SER C 93  ? PHE L 68  SER L 73  
AA9 1 SER C 30  ? MET C 33  ? SER L 10  MET L 13  
AA9 2 THR C 128 ? ILE C 132 ? THR L 108 ILE L 112 
AA9 3 ALA C 110 ? GLN C 116 ? ALA L 90  GLN L 96  
AA9 4 LEU C 59  ? GLN C 64  ? LEU L 39  GLN L 44  
AA9 5 LYS C 71  ? TYR C 75  ? LYS L 51  TYR L 55  
AA9 6 THR C 79  ? ARG C 80  ? THR L 59  ARG L 60  
AB1 1 THR C 140 ? PHE C 144 ? THR L 120 PHE L 124 
AB1 2 GLY C 155 ? PHE C 165 ? GLY L 135 PHE L 145 
AB1 3 TYR C 199 ? THR C 208 ? TYR L 179 THR L 188 
AB1 4 VAL C 185 ? TRP C 189 ? VAL L 165 TRP L 169 
AB2 1 SER C 179 ? ARG C 181 ? SER L 159 ARG L 161 
AB2 2 ASN C 171 ? ILE C 176 ? ASN L 151 ILE L 156 
AB2 3 TYR C 218 ? THR C 223 ? TYR L 198 THR L 203 
AB2 4 ILE C 231 ? PHE C 235 ? ILE L 211 PHE L 215 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O VAL A 67  ? O VAL E 516 N CYS A 61  ? N CYS E 510 
AA1 2 3 N TYR A 60  ? N TYR E 509 O THR A 106 ? O THR E 555 
AA1 3 4 N CYS A 105 ? N CYS E 554 O CYS A 117 ? O CYS E 566 
AA2 1 2 N LEU A 163 ? N LEU E 612 O ALA A 198 ? O ALA E 647 
AA2 2 3 O ALA A 197 ? O ALA E 646 N PHE A 182 ? N PHE E 631 
AA3 1 2 N GLN B 24  ? N GLN H 5   O THR B 42  ? O THR H 23  
AA3 2 3 N LEU B 39  ? N LEU H 20  O LEU B 100 ? O LEU H 81  
AA3 3 4 O TYR B 99  ? O TYR H 80  N THR B 90  ? N THR H 71  
AA4 1 2 N GLU B 29  ? N GLU H 10  O THR B 134 ? O THR H 115 
AA4 2 3 O VAL B 133 ? O VAL H 114 N ALA B 111 ? N ALA H 92  
AA4 3 4 O ALA B 116 ? O ALA H 97  N HIS B 54  ? N HIS H 35  
AA4 4 5 N TRP B 55  ? N TRP H 36  O ILE B 67  ? O ILE H 48  
AA4 5 6 N ARG B 69  ? N ARG H 50  O GLN B 78  ? O GLN H 59  
AA5 1 2 N GLU B 29  ? N GLU H 10  O THR B 134 ? O THR H 115 
AA5 2 3 O VAL B 133 ? O VAL H 114 N ALA B 111 ? N ALA H 92  
AA5 3 4 N THR B 117 ? N THR H 98  O SER B 126 ? O SER H 107 
AA6 1 2 N LEU B 148 ? N LEU H 129 O GLY B 163 ? O GLY H 144 
AA6 2 3 N TYR B 169 ? N TYR H 150 O TYR B 199 ? O TYR H 180 
AA6 3 4 O THR B 200 ? O THR H 181 N VAL B 193 ? N VAL H 174 
AA7 1 2 N THR B 177 ? N THR H 158 O ASN B 220 ? O ASN H 201 
AA7 2 3 N VAL B 221 ? N VAL H 202 O VAL B 230 ? O VAL H 211 
AA8 1 2 N SER C 27  ? N SER L 7   O SER C 42  ? O SER L 22  
AA8 2 3 N VAL C 39  ? N VAL L 19  O ILE C 101 ? O ILE L 81  
AA8 3 4 O THR C 100 ? O THR L 80  N ILE C 89  ? N ILE L 69  
AA9 1 2 N LEU C 31  ? N LEU L 11  O GLU C 131 ? O GLU L 111 
AA9 2 3 O LEU C 130 ? O LEU L 110 N ALA C 110 ? N ALA L 90  
AA9 3 4 O PHE C 113 ? O PHE L 93  N TYR C 62  ? N TYR L 42  
AA9 4 5 N TRP C 61  ? N TRP L 41  O LEU C 73  ? O LEU L 53  
AA9 5 6 N TYR C 75  ? N TYR L 55  O THR C 79  ? O THR L 59  
AB1 1 2 N PHE C 144 ? N PHE L 124 O VAL C 159 ? O VAL L 139 
AB1 2 3 N VAL C 158 ? N VAL L 138 O LEU C 205 ? O LEU L 185 
AB1 3 4 O THR C 204 ? O THR L 184 N LEU C 186 ? N LEU L 166 
AB2 1 2 O ARG C 181 ? O ARG L 161 N TRP C 174 ? N TRP L 154 
AB2 2 3 N LYS C 173 ? N LYS L 153 O GLU C 221 ? O GLU L 201 
AB2 3 4 N ALA C 222 ? N ALA L 202 O ILE C 231 ? O ILE L 211 
# 
_atom_sites.entry_id                    4WEB 
_atom_sites.fract_transf_matrix[1][1]   0.011633 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005140 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.026371 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . CYS A 1 39  ? 102.339 -1.954 17.746  1.00 109.32 ? 488 CYS E N   1 
ATOM   2    C CA  . CYS A 1 39  ? 102.592 -0.583 18.229  1.00 112.71 ? 488 CYS E CA  1 
ATOM   3    C C   . CYS A 1 39  ? 103.186 -0.427 19.657  1.00 111.92 ? 488 CYS E C   1 
ATOM   4    O O   . CYS A 1 39  ? 104.028 0.479  19.860  1.00 97.02  ? 488 CYS E O   1 
ATOM   5    C CB  . CYS A 1 39  ? 101.301 0.253  18.134  1.00 109.31 ? 488 CYS E CB  1 
ATOM   6    S SG  . CYS A 1 39  ? 101.268 1.422  16.740  1.00 103.41 ? 488 CYS E SG  1 
ATOM   7    N N   . TRP A 1 40  ? 102.777 -1.247 20.648  1.00 117.24 ? 489 TRP E N   1 
ATOM   8    C CA  . TRP A 1 40  ? 101.745 -2.311 20.578  1.00 112.76 ? 489 TRP E CA  1 
ATOM   9    C C   . TRP A 1 40  ? 100.345 -1.812 20.953  1.00 113.23 ? 489 TRP E C   1 
ATOM   10   O O   . TRP A 1 40  ? 99.460  -2.630 21.236  1.00 111.51 ? 489 TRP E O   1 
ATOM   11   C CB  . TRP A 1 40  ? 102.123 -3.490 21.491  1.00 106.86 ? 489 TRP E CB  1 
ATOM   12   N N   . HIS A 1 41  ? 100.179 -0.479 20.918  1.00 115.53 ? 490 HIS E N   1 
ATOM   13   C CA  . HIS A 1 41  ? 99.035  0.298  21.440  1.00 111.43 ? 490 HIS E CA  1 
ATOM   14   C C   . HIS A 1 41  ? 99.063  0.349  22.980  1.00 114.50 ? 490 HIS E C   1 
ATOM   15   O O   . HIS A 1 41  ? 99.684  1.245  23.562  1.00 111.57 ? 490 HIS E O   1 
ATOM   16   C CB  . HIS A 1 41  ? 97.701  -0.255 20.936  1.00 105.21 ? 490 HIS E CB  1 
ATOM   17   N N   . TYR A 1 42  ? 98.400  -0.615 23.622  1.00 114.81 ? 491 TYR E N   1 
ATOM   18   C CA  . TYR A 1 42  ? 98.414  -0.809 25.089  1.00 113.91 ? 491 TYR E CA  1 
ATOM   19   C C   . TYR A 1 42  ? 97.955  0.414  25.898  1.00 114.23 ? 491 TYR E C   1 
ATOM   20   O O   . TYR A 1 42  ? 98.692  1.413  25.986  1.00 108.99 ? 491 TYR E O   1 
ATOM   21   C CB  . TYR A 1 42  ? 99.818  -1.230 25.563  1.00 107.72 ? 491 TYR E CB  1 
ATOM   22   N N   . PRO A 1 43  ? 96.747  0.341  26.518  1.00 111.98 ? 492 PRO E N   1 
ATOM   23   C CA  . PRO A 1 43  ? 96.381  1.495  27.349  1.00 108.04 ? 492 PRO E CA  1 
ATOM   24   C C   . PRO A 1 43  ? 96.975  1.311  28.731  1.00 107.29 ? 492 PRO E C   1 
ATOM   25   O O   . PRO A 1 43  ? 97.087  0.183  29.185  1.00 105.77 ? 492 PRO E O   1 
ATOM   26   C CB  . PRO A 1 43  ? 94.865  1.418  27.397  1.00 107.69 ? 492 PRO E CB  1 
ATOM   27   C CG  . PRO A 1 43  ? 94.565  -0.025 27.469  1.00 105.64 ? 492 PRO E CG  1 
ATOM   28   C CD  . PRO A 1 43  ? 95.704  -0.757 26.820  1.00 108.26 ? 492 PRO E CD  1 
ATOM   29   N N   . PRO A 1 44  ? 97.391  2.389  29.379  1.00 104.34 ? 493 PRO E N   1 
ATOM   30   C CA  . PRO A 1 44  ? 98.289  2.240  30.520  1.00 100.13 ? 493 PRO E CA  1 
ATOM   31   C C   . PRO A 1 44  ? 97.728  2.789  31.802  1.00 95.51  ? 493 PRO E C   1 
ATOM   32   O O   . PRO A 1 44  ? 96.675  3.390  31.792  1.00 93.97  ? 493 PRO E O   1 
ATOM   33   C CB  . PRO A 1 44  ? 99.476  3.099  30.112  1.00 95.12  ? 493 PRO E CB  1 
ATOM   34   C CG  . PRO A 1 44  ? 98.900  4.180  29.246  1.00 91.58  ? 493 PRO E CG  1 
ATOM   35   C CD  . PRO A 1 44  ? 97.448  3.887  29.048  1.00 95.06  ? 493 PRO E CD  1 
ATOM   36   N N   . ARG A 1 45  ? 98.445  2.583  32.897  1.00 91.91  ? 494 ARG E N   1 
ATOM   37   C CA  . ARG A 1 45  ? 97.915  2.896  34.223  1.00 88.53  ? 494 ARG E CA  1 
ATOM   38   C C   . ARG A 1 45  ? 98.367  4.273  34.690  1.00 81.91  ? 494 ARG E C   1 
ATOM   39   O O   . ARG A 1 45  ? 99.144  4.936  34.004  1.00 81.43  ? 494 ARG E O   1 
ATOM   40   C CB  . ARG A 1 45  ? 98.348  1.836  35.238  1.00 85.66  ? 494 ARG E CB  1 
ATOM   41   N N   . GLN A 1 46  ? 97.878  4.692  35.857  1.00 80.56  ? 495 GLN E N   1 
ATOM   42   C CA  . GLN A 1 46  ? 98.278  5.960  36.463  1.00 81.41  ? 495 GLN E CA  1 
ATOM   43   C C   . GLN A 1 46  ? 99.796  6.078  36.453  1.00 84.12  ? 495 GLN E C   1 
ATOM   44   O O   . GLN A 1 46  ? 100.505 5.074  36.521  1.00 83.58  ? 495 GLN E O   1 
ATOM   45   C CB  . GLN A 1 46  ? 97.738  6.086  37.889  1.00 81.33  ? 495 GLN E CB  1 
ATOM   46   N N   . CYS A 1 47  ? 100.293 7.304  36.355  1.00 79.03  ? 496 CYS E N   1 
ATOM   47   C CA  . CYS A 1 47  ? 101.688 7.512  36.000  1.00 79.54  ? 496 CYS E CA  1 
ATOM   48   C C   . CYS A 1 47  ? 102.694 7.025  37.047  1.00 86.73  ? 496 CYS E C   1 
ATOM   49   O O   . CYS A 1 47  ? 103.594 6.240  36.726  1.00 88.51  ? 496 CYS E O   1 
ATOM   50   C CB  . CYS A 1 47  ? 101.916 8.987  35.686  1.00 75.86  ? 496 CYS E CB  1 
ATOM   51   S SG  . CYS A 1 47  ? 101.589 9.360  33.945  1.00 69.83  ? 496 CYS E SG  1 
ATOM   52   N N   . GLY A 1 48  ? 102.552 7.482  38.286  1.00 82.85  ? 497 GLY E N   1 
ATOM   53   C CA  . GLY A 1 48  ? 103.454 7.066  39.350  1.00 86.63  ? 497 GLY E CA  1 
ATOM   54   C C   . GLY A 1 48  ? 104.899 7.482  39.140  1.00 83.73  ? 497 GLY E C   1 
ATOM   55   O O   . GLY A 1 48  ? 105.212 8.188  38.184  1.00 83.64  ? 497 GLY E O   1 
ATOM   56   N N   . VAL A 1 49  ? 105.783 7.032  40.026  1.00 84.84  ? 498 VAL E N   1 
ATOM   57   C CA  . VAL A 1 49  ? 107.197 7.415  39.980  1.00 87.33  ? 498 VAL E CA  1 
ATOM   58   C C   . VAL A 1 49  ? 108.091 6.356  39.301  1.00 87.06  ? 498 VAL E C   1 
ATOM   59   O O   . VAL A 1 49  ? 108.064 5.185  39.672  1.00 89.75  ? 498 VAL E O   1 
ATOM   60   C CB  . VAL A 1 49  ? 107.712 7.687  41.398  1.00 82.71  ? 498 VAL E CB  1 
ATOM   61   C CG1 . VAL A 1 49  ? 107.131 6.669  42.380  1.00 87.12  ? 498 VAL E CG1 1 
ATOM   62   C CG2 . VAL A 1 49  ? 109.225 7.689  41.417  1.00 84.76  ? 498 VAL E CG2 1 
ATOM   63   N N   . VAL A 1 50  ? 108.866 6.769  38.302  1.00 84.41  ? 499 VAL E N   1 
ATOM   64   C CA  . VAL A 1 50  ? 109.715 5.853  37.545  1.00 83.63  ? 499 VAL E CA  1 
ATOM   65   C C   . VAL A 1 50  ? 111.172 6.082  37.955  1.00 91.79  ? 499 VAL E C   1 
ATOM   66   O O   . VAL A 1 50  ? 111.586 7.223  38.090  1.00 90.91  ? 499 VAL E O   1 
ATOM   67   C CB  . VAL A 1 50  ? 109.535 6.062  36.017  1.00 82.40  ? 499 VAL E CB  1 
ATOM   68   C CG1 . VAL A 1 50  ? 109.557 7.540  35.688  1.00 91.41  ? 499 VAL E CG1 1 
ATOM   69   C CG2 . VAL A 1 50  ? 110.591 5.311  35.217  1.00 84.64  ? 499 VAL E CG2 1 
ATOM   70   N N   . SER A 1 51  ? 111.945 5.013  38.171  1.00 95.62  ? 500 SER E N   1 
ATOM   71   C CA  . SER A 1 51  ? 113.270 5.124  38.821  1.00 98.33  ? 500 SER E CA  1 
ATOM   72   C C   . SER A 1 51  ? 114.303 5.977  38.074  1.00 93.65  ? 500 SER E C   1 
ATOM   73   O O   . SER A 1 51  ? 114.444 5.908  36.854  1.00 90.84  ? 500 SER E O   1 
ATOM   74   C CB  . SER A 1 51  ? 113.877 3.732  39.065  1.00 99.84  ? 500 SER E CB  1 
ATOM   75   O OG  . SER A 1 51  ? 114.723 3.342  37.996  1.00 101.67 ? 500 SER E OG  1 
ATOM   76   N N   . ALA A 1 52  ? 115.040 6.774  38.840  1.00 94.81  ? 501 ALA E N   1 
ATOM   77   C CA  . ALA A 1 52  ? 116.096 7.618  38.293  1.00 95.44  ? 501 ALA E CA  1 
ATOM   78   C C   . ALA A 1 52  ? 117.294 6.785  37.867  1.00 100.69 ? 501 ALA E C   1 
ATOM   79   O O   . ALA A 1 52  ? 118.414 7.069  38.294  1.00 106.96 ? 501 ALA E O   1 
ATOM   80   C CB  . ALA A 1 52  ? 116.528 8.660  39.304  1.00 89.11  ? 501 ALA E CB  1 
ATOM   81   N N   . LYS A 1 53  ? 117.039 5.784  37.018  1.00 96.76  ? 502 LYS E N   1 
ATOM   82   C CA  . LYS A 1 53  ? 118.030 4.829  36.526  1.00 93.04  ? 502 LYS E CA  1 
ATOM   83   C C   . LYS A 1 53  ? 117.324 3.647  35.865  1.00 96.63  ? 502 LYS E C   1 
ATOM   84   O O   . LYS A 1 53  ? 117.587 2.500  36.215  1.00 98.38  ? 502 LYS E O   1 
ATOM   85   C CB  . LYS A 1 53  ? 118.930 4.317  37.652  1.00 91.98  ? 502 LYS E CB  1 
ATOM   86   N N   . THR A 1 54  ? 116.414 3.922  34.933  1.00 94.63  ? 503 THR E N   1 
ATOM   87   C CA  . THR A 1 54  ? 115.758 2.867  34.152  1.00 90.70  ? 503 THR E CA  1 
ATOM   88   C C   . THR A 1 54  ? 115.425 3.327  32.748  1.00 90.45  ? 503 THR E C   1 
ATOM   89   O O   . THR A 1 54  ? 115.189 2.518  31.852  1.00 90.70  ? 503 THR E O   1 
ATOM   90   C CB  . THR A 1 54  ? 114.447 2.382  34.787  1.00 91.76  ? 503 THR E CB  1 
ATOM   91   O OG1 . THR A 1 54  ? 113.905 3.407  35.625  1.00 97.36  ? 503 THR E OG1 1 
ATOM   92   C CG2 . THR A 1 54  ? 114.679 1.130  35.594  1.00 92.73  ? 503 THR E CG2 1 
ATOM   93   N N   . VAL A 1 55  ? 115.411 4.638  32.564  1.00 88.81  ? 504 VAL E N   1 
ATOM   94   C CA  . VAL A 1 55  ? 114.996 5.228  31.306  1.00 88.02  ? 504 VAL E CA  1 
ATOM   95   C C   . VAL A 1 55  ? 116.219 5.437  30.432  1.00 86.15  ? 504 VAL E C   1 
ATOM   96   O O   . VAL A 1 55  ? 117.280 5.808  30.937  1.00 84.73  ? 504 VAL E O   1 
ATOM   97   C CB  . VAL A 1 55  ? 114.264 6.573  31.533  1.00 87.42  ? 504 VAL E CB  1 
ATOM   98   C CG1 . VAL A 1 55  ? 113.812 7.184  30.206  1.00 84.22  ? 504 VAL E CG1 1 
ATOM   99   C CG2 . VAL A 1 55  ? 113.084 6.385  32.493  1.00 85.61  ? 504 VAL E CG2 1 
ATOM   100  N N   . CYS A 1 56  ? 116.089 5.153  29.140  1.00 82.66  ? 505 CYS E N   1 
ATOM   101  C CA  . CYS A 1 56  ? 117.105 5.555  28.187  1.00 83.25  ? 505 CYS E CA  1 
ATOM   102  C C   . CYS A 1 56  ? 116.501 6.625  27.300  1.00 79.09  ? 505 CYS E C   1 
ATOM   103  O O   . CYS A 1 56  ? 115.544 6.367  26.570  1.00 78.88  ? 505 CYS E O   1 
ATOM   104  C CB  . CYS A 1 56  ? 117.604 4.374  27.356  1.00 84.62  ? 505 CYS E CB  1 
ATOM   105  S SG  . CYS A 1 56  ? 119.256 4.625  26.643  1.00 96.57  ? 505 CYS E SG  1 
ATOM   106  N N   . GLY A 1 57  ? 117.057 7.830  27.386  1.00 77.15  ? 506 GLY E N   1 
ATOM   107  C CA  . GLY A 1 57  ? 116.550 8.970  26.643  1.00 74.21  ? 506 GLY E CA  1 
ATOM   108  C C   . GLY A 1 57  ? 115.698 9.889  27.500  1.00 74.62  ? 506 GLY E C   1 
ATOM   109  O O   . GLY A 1 57  ? 115.737 9.829  28.729  1.00 78.86  ? 506 GLY E O   1 
ATOM   110  N N   . PRO A 1 58  ? 114.918 10.761 26.852  1.00 76.56  ? 507 PRO E N   1 
ATOM   111  C CA  . PRO A 1 58  ? 114.062 11.705 27.572  1.00 72.28  ? 507 PRO E CA  1 
ATOM   112  C C   . PRO A 1 58  ? 112.666 11.158 27.833  1.00 68.20  ? 507 PRO E C   1 
ATOM   113  O O   . PRO A 1 58  ? 112.194 10.279 27.120  1.00 71.77  ? 507 PRO E O   1 
ATOM   114  C CB  . PRO A 1 58  ? 113.999 12.886 26.619  1.00 62.94  ? 507 PRO E CB  1 
ATOM   115  C CG  . PRO A 1 58  ? 114.018 12.236 25.282  1.00 66.65  ? 507 PRO E CG  1 
ATOM   116  C CD  . PRO A 1 58  ? 114.923 11.034 25.405  1.00 71.38  ? 507 PRO E CD  1 
ATOM   117  N N   . VAL A 1 59  ? 112.012 11.681 28.858  1.00 63.90  ? 508 VAL E N   1 
ATOM   118  C CA  . VAL A 1 59  ? 110.617 11.362 29.093  1.00 64.58  ? 508 VAL E CA  1 
ATOM   119  C C   . VAL A 1 59  ? 109.734 12.504 28.626  1.00 69.15  ? 508 VAL E C   1 
ATOM   120  O O   . VAL A 1 59  ? 109.804 13.625 29.147  1.00 64.80  ? 508 VAL E O   1 
ATOM   121  C CB  . VAL A 1 59  ? 110.335 11.087 30.564  1.00 71.06  ? 508 VAL E CB  1 
ATOM   122  C CG1 . VAL A 1 59  ? 108.851 10.836 30.774  1.00 69.32  ? 508 VAL E CG1 1 
ATOM   123  C CG2 . VAL A 1 59  ? 111.157 9.903  31.034  1.00 78.11  ? 508 VAL E CG2 1 
ATOM   124  N N   . TYR A 1 60  ? 108.910 12.219 27.628  1.00 66.62  ? 509 TYR E N   1 
ATOM   125  C CA  . TYR A 1 60  ? 107.983 13.210 27.121  1.00 60.18  ? 509 TYR E CA  1 
ATOM   126  C C   . TYR A 1 60  ? 106.621 13.075 27.799  1.00 59.11  ? 509 TYR E C   1 
ATOM   127  O O   . TYR A 1 60  ? 106.149 11.970 28.061  1.00 60.03  ? 509 TYR E O   1 
ATOM   128  C CB  . TYR A 1 60  ? 107.857 13.084 25.605  1.00 57.04  ? 509 TYR E CB  1 
ATOM   129  C CG  . TYR A 1 60  ? 108.869 13.917 24.845  1.00 62.48  ? 509 TYR E CG  1 
ATOM   130  C CD1 . TYR A 1 60  ? 108.538 15.180 24.369  1.00 61.02  ? 509 TYR E CD1 1 
ATOM   131  C CD2 . TYR A 1 60  ? 110.151 13.450 24.608  1.00 65.96  ? 509 TYR E CD2 1 
ATOM   132  C CE1 . TYR A 1 60  ? 109.444 15.949 23.675  1.00 58.23  ? 509 TYR E CE1 1 
ATOM   133  C CE2 . TYR A 1 60  ? 111.075 14.221 23.912  1.00 66.10  ? 509 TYR E CE2 1 
ATOM   134  C CZ  . TYR A 1 60  ? 110.714 15.467 23.446  1.00 65.72  ? 509 TYR E CZ  1 
ATOM   135  O OH  . TYR A 1 60  ? 111.625 16.244 22.760  1.00 63.76  ? 509 TYR E OH  1 
ATOM   136  N N   . CYS A 1 61  ? 106.019 14.219 28.111  1.00 58.03  ? 510 CYS E N   1 
ATOM   137  C CA  . CYS A 1 61  ? 104.658 14.287 28.631  1.00 56.19  ? 510 CYS E CA  1 
ATOM   138  C C   . CYS A 1 61  ? 103.836 15.210 27.734  1.00 49.55  ? 510 CYS E C   1 
ATOM   139  O O   . CYS A 1 61  ? 104.382 16.088 27.073  1.00 53.12  ? 510 CYS E O   1 
ATOM   140  C CB  . CYS A 1 61  ? 104.649 14.770 30.087  1.00 57.15  ? 510 CYS E CB  1 
ATOM   141  S SG  . CYS A 1 61  ? 105.369 13.588 31.289  1.00 64.24  ? 510 CYS E SG  1 
ATOM   142  N N   . PHE A 1 62  ? 102.530 15.001 27.691  1.00 46.82  ? 511 PHE E N   1 
ATOM   143  C CA  . PHE A 1 62  ? 101.702 15.665 26.699  1.00 46.82  ? 511 PHE E CA  1 
ATOM   144  C C   . PHE A 1 62  ? 100.632 16.496 27.364  1.00 49.85  ? 511 PHE E C   1 
ATOM   145  O O   . PHE A 1 62  ? 99.725  15.955 27.996  1.00 47.25  ? 511 PHE E O   1 
ATOM   146  C CB  . PHE A 1 62  ? 101.098 14.627 25.769  1.00 49.76  ? 511 PHE E CB  1 
ATOM   147  C CG  . PHE A 1 62  ? 102.120 13.724 25.188  1.00 52.01  ? 511 PHE E CG  1 
ATOM   148  C CD1 . PHE A 1 62  ? 102.787 14.077 24.026  1.00 52.33  ? 511 PHE E CD1 1 
ATOM   149  C CD2 . PHE A 1 62  ? 102.482 12.556 25.840  1.00 54.27  ? 511 PHE E CD2 1 
ATOM   150  C CE1 . PHE A 1 62  ? 103.772 13.256 23.500  1.00 56.81  ? 511 PHE E CE1 1 
ATOM   151  C CE2 . PHE A 1 62  ? 103.463 11.731 25.323  1.00 55.74  ? 511 PHE E CE2 1 
ATOM   152  C CZ  . PHE A 1 62  ? 104.108 12.076 24.152  1.00 57.48  ? 511 PHE E CZ  1 
ATOM   153  N N   . THR A 1 63  ? 100.750 17.816 27.223  1.00 44.18  ? 512 THR E N   1 
ATOM   154  C CA  . THR A 1 63  ? 99.905  18.726 27.985  1.00 45.76  ? 512 THR E CA  1 
ATOM   155  C C   . THR A 1 63  ? 98.660  19.332 27.333  1.00 45.30  ? 512 THR E C   1 
ATOM   156  O O   . THR A 1 63  ? 97.973  20.098 28.005  1.00 43.63  ? 512 THR E O   1 
ATOM   157  C CB  . THR A 1 63  ? 100.723 19.930 28.494  1.00 44.77  ? 512 THR E CB  1 
ATOM   158  O OG1 . THR A 1 63  ? 100.977 20.832 27.408  1.00 47.54  ? 512 THR E OG1 1 
ATOM   159  C CG2 . THR A 1 63  ? 102.031 19.467 29.108  1.00 45.50  ? 512 THR E CG2 1 
ATOM   160  N N   . PRO A 1 64  ? 98.322  18.989 26.068  1.00 43.71  ? 513 PRO E N   1 
ATOM   161  C CA  . PRO A 1 64  ? 98.748  18.006 25.071  1.00 44.49  ? 513 PRO E CA  1 
ATOM   162  C C   . PRO A 1 64  ? 100.065 18.368 24.426  1.00 46.09  ? 513 PRO E C   1 
ATOM   163  O O   . PRO A 1 64  ? 100.637 17.555 23.692  1.00 43.43  ? 513 PRO E O   1 
ATOM   164  C CB  . PRO A 1 64  ? 97.629  18.051 24.040  1.00 45.50  ? 513 PRO E CB  1 
ATOM   165  C CG  . PRO A 1 64  ? 97.178  19.431 24.076  1.00 42.27  ? 513 PRO E CG  1 
ATOM   166  C CD  . PRO A 1 64  ? 97.244  19.832 25.523  1.00 44.03  ? 513 PRO E CD  1 
ATOM   167  N N   . SER A 1 65  ? 100.535 19.579 24.694  1.00 45.93  ? 514 SER E N   1 
ATOM   168  C CA  . SER A 1 65  ? 101.796 20.018 24.124  1.00 45.47  ? 514 SER E CA  1 
ATOM   169  C C   . SER A 1 65  ? 102.925 19.166 24.678  1.00 45.92  ? 514 SER E C   1 
ATOM   170  O O   . SER A 1 65  ? 102.944 18.873 25.874  1.00 49.49  ? 514 SER E O   1 
ATOM   171  C CB  . SER A 1 65  ? 102.026 21.501 24.399  1.00 46.94  ? 514 SER E CB  1 
ATOM   172  O OG  . SER A 1 65  ? 101.304 22.290 23.464  1.00 44.99  ? 514 SER E OG  1 
ATOM   173  N N   . PRO A 1 66  ? 103.823 18.710 23.788  1.00 41.05  ? 515 PRO E N   1 
ATOM   174  C CA  . PRO A 1 66  ? 105.007 17.892 24.093  1.00 49.05  ? 515 PRO E CA  1 
ATOM   175  C C   . PRO A 1 66  ? 106.055 18.633 24.916  1.00 48.59  ? 515 PRO E C   1 
ATOM   176  O O   . PRO A 1 66  ? 106.633 19.581 24.419  1.00 49.97  ? 515 PRO E O   1 
ATOM   177  C CB  . PRO A 1 66  ? 105.575 17.563 22.709  1.00 43.56  ? 515 PRO E CB  1 
ATOM   178  C CG  . PRO A 1 66  ? 104.461 17.760 21.773  1.00 44.81  ? 515 PRO E CG  1 
ATOM   179  C CD  . PRO A 1 66  ? 103.612 18.841 22.338  1.00 40.61  ? 515 PRO E CD  1 
ATOM   180  N N   . VAL A 1 67  ? 106.290 18.203 26.148  1.00 53.44  ? 516 VAL E N   1 
ATOM   181  C CA  . VAL A 1 67  ? 107.329 18.793 26.984  1.00 54.20  ? 516 VAL E CA  1 
ATOM   182  C C   . VAL A 1 67  ? 108.269 17.684 27.434  1.00 58.69  ? 516 VAL E C   1 
ATOM   183  O O   . VAL A 1 67  ? 107.995 16.511 27.180  1.00 59.22  ? 516 VAL E O   1 
ATOM   184  C CB  . VAL A 1 67  ? 106.743 19.511 28.206  1.00 50.63  ? 516 VAL E CB  1 
ATOM   185  C CG1 . VAL A 1 67  ? 105.733 20.556 27.763  1.00 55.44  ? 516 VAL E CG1 1 
ATOM   186  C CG2 . VAL A 1 67  ? 106.086 18.521 29.131  1.00 48.01  ? 516 VAL E CG2 1 
ATOM   187  N N   . VAL A 1 68  ? 109.370 18.044 28.093  1.00 58.48  ? 517 VAL E N   1 
ATOM   188  C CA  . VAL A 1 68  ? 110.331 17.047 28.565  1.00 57.29  ? 517 VAL E CA  1 
ATOM   189  C C   . VAL A 1 68  ? 110.590 17.199 30.060  1.00 59.24  ? 517 VAL E C   1 
ATOM   190  O O   . VAL A 1 68  ? 111.106 18.218 30.510  1.00 57.54  ? 517 VAL E O   1 
ATOM   191  C CB  . VAL A 1 68  ? 111.664 17.136 27.813  1.00 59.62  ? 517 VAL E CB  1 
ATOM   192  C CG1 . VAL A 1 68  ? 112.585 16.011 28.257  1.00 63.17  ? 517 VAL E CG1 1 
ATOM   193  C CG2 . VAL A 1 68  ? 111.433 17.064 26.318  1.00 58.73  ? 517 VAL E CG2 1 
ATOM   194  N N   . VAL A 1 69  ? 110.226 16.172 30.821  1.00 62.01  ? 518 VAL E N   1 
ATOM   195  C CA  . VAL A 1 69  ? 110.267 16.228 32.281  1.00 67.45  ? 518 VAL E CA  1 
ATOM   196  C C   . VAL A 1 69  ? 111.610 15.688 32.788  1.00 72.23  ? 518 VAL E C   1 
ATOM   197  O O   . VAL A 1 69  ? 112.292 14.958 32.071  1.00 73.29  ? 518 VAL E O   1 
ATOM   198  C CB  . VAL A 1 69  ? 109.061 15.444 32.884  1.00 67.40  ? 518 VAL E CB  1 
ATOM   199  C CG1 . VAL A 1 69  ? 109.050 14.019 32.386  1.00 74.80  ? 518 VAL E CG1 1 
ATOM   200  C CG2 . VAL A 1 69  ? 109.037 15.496 34.410  1.00 69.44  ? 518 VAL E CG2 1 
ATOM   201  N N   . GLY A 1 70  ? 112.004 16.075 34.000  1.00 75.56  ? 519 GLY E N   1 
ATOM   202  C CA  . GLY A 1 70  ? 113.287 15.675 34.550  1.00 83.84  ? 519 GLY E CA  1 
ATOM   203  C C   . GLY A 1 70  ? 113.283 15.066 35.946  1.00 91.91  ? 519 GLY E C   1 
ATOM   204  O O   . GLY A 1 70  ? 112.252 14.599 36.439  1.00 89.09  ? 519 GLY E O   1 
ATOM   205  N N   . THR A 1 71  ? 114.458 15.091 36.577  1.00 95.70  ? 520 THR E N   1 
ATOM   206  C CA  . THR A 1 71  ? 114.723 14.427 37.856  1.00 95.76  ? 520 THR E CA  1 
ATOM   207  C C   . THR A 1 71  ? 114.496 15.329 39.070  1.00 99.66  ? 520 THR E C   1 
ATOM   208  O O   . THR A 1 71  ? 114.946 16.477 39.091  1.00 99.53  ? 520 THR E O   1 
ATOM   209  C CB  . THR A 1 71  ? 116.184 13.903 37.896  1.00 97.69  ? 520 THR E CB  1 
ATOM   210  O OG1 . THR A 1 71  ? 116.355 12.874 36.914  1.00 94.77  ? 520 THR E OG1 1 
ATOM   211  C CG2 . THR A 1 71  ? 116.547 13.352 39.272  1.00 98.71  ? 520 THR E CG2 1 
ATOM   212  N N   . THR A 1 72  ? 113.796 14.795 40.072  1.00 98.90  ? 521 THR E N   1 
ATOM   213  C CA  . THR A 1 72  ? 113.565 15.448 41.372  1.00 100.44 ? 521 THR E CA  1 
ATOM   214  C C   . THR A 1 72  ? 112.895 16.821 41.244  1.00 100.03 ? 521 THR E C   1 
ATOM   215  O O   . THR A 1 72  ? 111.684 16.907 41.025  1.00 98.07  ? 521 THR E O   1 
ATOM   216  C CB  . THR A 1 72  ? 114.888 15.595 42.192  1.00 100.59 ? 521 THR E CB  1 
ATOM   217  O OG1 . THR A 1 72  ? 115.651 14.381 42.121  1.00 99.42  ? 521 THR E OG1 1 
ATOM   218  C CG2 . THR A 1 72  ? 114.588 15.905 43.662  1.00 93.14  ? 521 THR E CG2 1 
ATOM   219  N N   . ASP A 1 73  ? 113.677 17.890 41.388  1.00 96.17  ? 522 ASP E N   1 
ATOM   220  C CA  . ASP A 1 73  ? 113.128 19.244 41.400  1.00 88.41  ? 522 ASP E CA  1 
ATOM   221  C C   . ASP A 1 73  ? 113.859 20.160 40.420  1.00 87.98  ? 522 ASP E C   1 
ATOM   222  O O   . ASP A 1 73  ? 113.281 21.112 39.888  1.00 85.07  ? 522 ASP E O   1 
ATOM   223  C CB  . ASP A 1 73  ? 113.194 19.829 42.814  1.00 81.80  ? 522 ASP E CB  1 
ATOM   224  C CG  . ASP A 1 73  ? 112.510 18.945 43.848  1.00 84.81  ? 522 ASP E CG  1 
ATOM   225  O OD1 . ASP A 1 73  ? 111.570 18.212 43.475  1.00 84.10  ? 522 ASP E OD1 1 
ATOM   226  O OD2 . ASP A 1 73  ? 112.907 18.990 45.034  1.00 83.12  ? 522 ASP E OD2 1 
ATOM   227  N N   . VAL A 1 89  ? 114.788 10.986 35.808  1.00 101.18 ? 538 VAL E N   1 
ATOM   228  C CA  . VAL A 1 89  ? 113.506 11.612 35.499  1.00 97.19  ? 538 VAL E CA  1 
ATOM   229  C C   . VAL A 1 89  ? 112.332 10.796 36.040  1.00 94.62  ? 538 VAL E C   1 
ATOM   230  O O   . VAL A 1 89  ? 112.113 9.659  35.627  1.00 90.57  ? 538 VAL E O   1 
ATOM   231  C CB  . VAL A 1 89  ? 113.338 11.818 33.977  1.00 88.03  ? 538 VAL E CB  1 
ATOM   232  C CG1 . VAL A 1 89  ? 113.804 10.584 33.207  1.00 85.13  ? 538 VAL E CG1 1 
ATOM   233  C CG2 . VAL A 1 89  ? 111.903 12.169 33.656  1.00 83.27  ? 538 VAL E CG2 1 
ATOM   234  N N   . PHE A 1 90  ? 111.583 11.370 36.978  1.00 94.74  ? 539 PHE E N   1 
ATOM   235  C CA  . PHE A 1 90  ? 110.450 10.649 37.554  1.00 89.11  ? 539 PHE E CA  1 
ATOM   236  C C   . PHE A 1 90  ? 109.220 11.483 37.882  1.00 91.41  ? 539 PHE E C   1 
ATOM   237  O O   . PHE A 1 90  ? 108.913 12.468 37.209  1.00 94.90  ? 539 PHE E O   1 
ATOM   238  C CB  . PHE A 1 90  ? 110.875 9.914  38.827  1.00 92.50  ? 539 PHE E CB  1 
ATOM   239  C CG  . PHE A 1 90  ? 111.959 10.598 39.613  1.00 96.03  ? 539 PHE E CG  1 
ATOM   240  C CD1 . PHE A 1 90  ? 111.650 11.601 40.508  1.00 103.20 ? 539 PHE E CD1 1 
ATOM   241  C CD2 . PHE A 1 90  ? 113.282 10.204 39.494  1.00 96.20  ? 539 PHE E CD2 1 
ATOM   242  C CE1 . PHE A 1 90  ? 112.638 12.210 41.251  1.00 105.75 ? 539 PHE E CE1 1 
ATOM   243  C CE2 . PHE A 1 90  ? 114.275 10.822 40.239  1.00 99.66  ? 539 PHE E CE2 1 
ATOM   244  C CZ  . PHE A 1 90  ? 113.954 11.822 41.112  1.00 101.63 ? 539 PHE E CZ  1 
ATOM   245  N N   . LEU A 1 91  ? 108.565 11.066 38.963  1.00 85.45  ? 540 LEU E N   1 
ATOM   246  C CA  . LEU A 1 91  ? 107.177 11.391 39.310  1.00 86.72  ? 540 LEU E CA  1 
ATOM   247  C C   . LEU A 1 91  ? 106.367 12.134 38.263  1.00 80.85  ? 540 LEU E C   1 
ATOM   248  O O   . LEU A 1 91  ? 106.404 13.359 38.161  1.00 76.28  ? 540 LEU E O   1 
ATOM   249  C CB  . LEU A 1 91  ? 107.112 12.184 40.610  1.00 87.30  ? 540 LEU E CB  1 
ATOM   250  C CG  . LEU A 1 91  ? 105.695 11.982 41.165  1.00 88.81  ? 540 LEU E CG  1 
ATOM   251  C CD1 . LEU A 1 91  ? 105.352 10.493 41.136  1.00 85.89  ? 540 LEU E CD1 1 
ATOM   252  C CD2 . LEU A 1 91  ? 105.537 12.539 42.572  1.00 93.83  ? 540 LEU E CD2 1 
ATOM   253  N N   . LEU A 1 92  ? 105.603 11.361 37.511  1.00 79.72  ? 541 LEU E N   1 
ATOM   254  C CA  . LEU A 1 92  ? 104.789 11.899 36.451  1.00 74.99  ? 541 LEU E CA  1 
ATOM   255  C C   . LEU A 1 92  ? 103.345 12.016 36.918  1.00 69.46  ? 541 LEU E C   1 
ATOM   256  O O   . LEU A 1 92  ? 102.448 12.169 36.103  1.00 66.67  ? 541 LEU E O   1 
ATOM   257  C CB  . LEU A 1 92  ? 104.896 11.010 35.212  1.00 72.94  ? 541 LEU E CB  1 
ATOM   258  C CG  . LEU A 1 92  ? 106.238 10.291 35.029  1.00 75.20  ? 541 LEU E CG  1 
ATOM   259  C CD1 . LEU A 1 92  ? 106.106 9.209  33.980  1.00 78.82  ? 541 LEU E CD1 1 
ATOM   260  C CD2 . LEU A 1 92  ? 107.361 11.245 34.653  1.00 75.72  ? 541 LEU E CD2 1 
ATOM   261  N N   . ASN A 1 93  ? 103.127 11.934 38.229  1.00 70.68  ? 542 ASN E N   1 
ATOM   262  C CA  . ASN A 1 93  ? 101.789 12.113 38.791  1.00 73.61  ? 542 ASN E CA  1 
ATOM   263  C C   . ASN A 1 93  ? 101.123 13.379 38.292  1.00 69.23  ? 542 ASN E C   1 
ATOM   264  O O   . ASN A 1 93  ? 101.711 14.459 38.362  1.00 67.30  ? 542 ASN E O   1 
ATOM   265  C CB  . ASN A 1 93  ? 101.829 12.159 40.320  1.00 76.27  ? 542 ASN E CB  1 
ATOM   266  C CG  . ASN A 1 93  ? 102.135 10.817 40.935  1.00 85.43  ? 542 ASN E CG  1 
ATOM   267  O OD1 . ASN A 1 93  ? 102.189 9.808  40.236  1.00 86.99  ? 542 ASN E OD1 1 
ATOM   268  N ND2 . ASN A 1 93  ? 102.340 10.794 42.253  1.00 83.03  ? 542 ASN E ND2 1 
ATOM   269  N N   . SER A 1 94  ? 99.897  13.239 37.796  1.00 66.22  ? 543 SER E N   1 
ATOM   270  C CA  . SER A 1 94  ? 99.121  14.381 37.329  1.00 66.67  ? 543 SER E CA  1 
ATOM   271  C C   . SER A 1 94  ? 97.714  13.977 36.921  1.00 63.39  ? 543 SER E C   1 
ATOM   272  O O   . SER A 1 94  ? 97.505  12.893 36.378  1.00 61.56  ? 543 SER E O   1 
ATOM   273  C CB  . SER A 1 94  ? 99.815  15.067 36.144  1.00 60.65  ? 543 SER E CB  1 
ATOM   274  O OG  . SER A 1 94  ? 98.936  15.983 35.513  1.00 61.18  ? 543 SER E OG  1 
ATOM   275  N N   . THR A 1 95  ? 96.751  14.857 37.180  1.00 60.13  ? 544 THR E N   1 
ATOM   276  C CA  . THR A 1 95  ? 95.415  14.676 36.635  1.00 62.21  ? 544 THR E CA  1 
ATOM   277  C C   . THR A 1 95  ? 95.372  15.410 35.310  1.00 62.27  ? 544 THR E C   1 
ATOM   278  O O   . THR A 1 95  ? 96.349  16.065 34.935  1.00 65.37  ? 544 THR E O   1 
ATOM   279  C CB  . THR A 1 95  ? 94.309  15.202 37.573  1.00 65.82  ? 544 THR E CB  1 
ATOM   280  O OG1 . THR A 1 95  ? 94.747  15.106 38.931  1.00 65.61  ? 544 THR E OG1 1 
ATOM   281  C CG2 . THR A 1 95  ? 93.000  14.397 37.393  1.00 61.72  ? 544 THR E CG2 1 
ATOM   282  N N   . ARG A 1 96  ? 94.249  15.288 34.608  1.00 58.98  ? 545 ARG E N   1 
ATOM   283  C CA  . ARG A 1 96  ? 94.057  15.914 33.309  1.00 58.96  ? 545 ARG E CA  1 
ATOM   284  C C   . ARG A 1 96  ? 94.389  17.401 33.381  1.00 60.81  ? 545 ARG E C   1 
ATOM   285  O O   . ARG A 1 96  ? 93.931  18.089 34.286  1.00 58.77  ? 545 ARG E O   1 
ATOM   286  C CB  . ARG A 1 96  ? 92.622  15.699 32.825  1.00 57.09  ? 545 ARG E CB  1 
ATOM   287  N N   . PRO A 1 97  ? 95.216  17.888 32.435  1.00 62.63  ? 546 PRO E N   1 
ATOM   288  C CA  . PRO A 1 97  ? 95.826  19.220 32.324  1.00 59.19  ? 546 PRO E CA  1 
ATOM   289  C C   . PRO A 1 97  ? 94.983  20.500 32.320  1.00 66.45  ? 546 PRO E C   1 
ATOM   290  O O   . PRO A 1 97  ? 95.609  21.565 32.263  1.00 72.72  ? 546 PRO E O   1 
ATOM   291  C CB  . PRO A 1 97  ? 96.553  19.122 30.995  1.00 53.43  ? 546 PRO E CB  1 
ATOM   292  C CG  . PRO A 1 97  ? 97.050  17.796 31.023  1.00 54.86  ? 546 PRO E CG  1 
ATOM   293  C CD  . PRO A 1 97  ? 95.908  16.957 31.536  1.00 58.98  ? 546 PRO E CD  1 
ATOM   294  N N   . PRO A 1 98  ? 93.638  20.434 32.354  1.00 60.03  ? 547 PRO E N   1 
ATOM   295  C CA  . PRO A 1 98  ? 93.095  21.737 32.768  1.00 56.48  ? 547 PRO E CA  1 
ATOM   296  C C   . PRO A 1 98  ? 93.533  22.027 34.201  1.00 56.95  ? 547 PRO E C   1 
ATOM   297  O O   . PRO A 1 98  ? 93.744  23.170 34.597  1.00 58.73  ? 547 PRO E O   1 
ATOM   298  C CB  . PRO A 1 98  ? 91.579  21.541 32.669  1.00 57.45  ? 547 PRO E CB  1 
ATOM   299  C CG  . PRO A 1 98  ? 91.413  20.462 31.621  1.00 57.96  ? 547 PRO E CG  1 
ATOM   300  C CD  . PRO A 1 98  ? 92.615  19.552 31.759  1.00 49.73  ? 547 PRO E CD  1 
ATOM   301  N N   . LEU A 1 99  ? 93.712  20.938 34.944  1.00 61.09  ? 548 LEU E N   1 
ATOM   302  C CA  . LEU A 1 99  ? 93.965  20.921 36.373  1.00 59.10  ? 548 LEU E CA  1 
ATOM   303  C C   . LEU A 1 99  ? 94.980  19.817 36.651  1.00 61.48  ? 548 LEU E C   1 
ATOM   304  O O   . LEU A 1 99  ? 94.610  18.673 36.909  1.00 67.27  ? 548 LEU E O   1 
ATOM   305  C CB  . LEU A 1 99  ? 92.648  20.667 37.111  1.00 56.99  ? 548 LEU E CB  1 
ATOM   306  C CG  . LEU A 1 99  ? 92.459  20.742 38.621  1.00 47.93  ? 548 LEU E CG  1 
ATOM   307  C CD1 . LEU A 1 99  ? 90.982  20.817 38.876  1.00 50.31  ? 548 LEU E CD1 1 
ATOM   308  C CD2 . LEU A 1 99  ? 93.054  19.566 39.379  1.00 56.06  ? 548 LEU E CD2 1 
ATOM   309  N N   . GLY A 1 100 ? 96.262  20.138 36.588  1.00 60.97  ? 549 GLY E N   1 
ATOM   310  C CA  . GLY A 1 100 ? 97.266  19.093 36.566  1.00 59.40  ? 549 GLY E CA  1 
ATOM   311  C C   . GLY A 1 100 ? 98.092  19.266 35.316  1.00 57.54  ? 549 GLY E C   1 
ATOM   312  O O   . GLY A 1 100 ? 97.721  20.042 34.443  1.00 55.79  ? 549 GLY E O   1 
ATOM   313  N N   . SER A 1 101 ? 99.198  18.537 35.218  1.00 56.43  ? 550 SER E N   1 
ATOM   314  C CA  . SER A 1 101 ? 100.267 18.909 34.303  1.00 47.28  ? 550 SER E CA  1 
ATOM   315  C C   . SER A 1 101 ? 100.212 18.291 32.905  1.00 52.61  ? 550 SER E C   1 
ATOM   316  O O   . SER A 1 101 ? 100.357 18.999 31.907  1.00 51.54  ? 550 SER E O   1 
ATOM   317  C CB  . SER A 1 101 ? 101.601 18.576 34.955  1.00 56.37  ? 550 SER E CB  1 
ATOM   318  O OG  . SER A 1 101 ? 101.736 19.238 36.197  1.00 63.15  ? 550 SER E OG  1 
ATOM   319  N N   . TRP A 1 102 ? 100.018 16.981 32.831  1.00 52.33  ? 551 TRP E N   1 
ATOM   320  C CA  . TRP A 1 102 ? 100.033 16.271 31.555  1.00 51.09  ? 551 TRP E CA  1 
ATOM   321  C C   . TRP A 1 102 ? 98.991  15.155 31.553  1.00 52.86  ? 551 TRP E C   1 
ATOM   322  O O   . TRP A 1 102 ? 98.646  14.640 32.604  1.00 49.05  ? 551 TRP E O   1 
ATOM   323  C CB  . TRP A 1 102 ? 101.420 15.705 31.281  1.00 51.79  ? 551 TRP E CB  1 
ATOM   324  C CG  . TRP A 1 102 ? 102.092 15.295 32.528  1.00 53.58  ? 551 TRP E CG  1 
ATOM   325  C CD1 . TRP A 1 102 ? 101.827 14.188 33.272  1.00 56.72  ? 551 TRP E CD1 1 
ATOM   326  C CD2 . TRP A 1 102 ? 103.121 16.006 33.214  1.00 56.68  ? 551 TRP E CD2 1 
ATOM   327  N NE1 . TRP A 1 102 ? 102.638 14.158 34.378  1.00 58.53  ? 551 TRP E NE1 1 
ATOM   328  C CE2 . TRP A 1 102 ? 103.446 15.262 34.364  1.00 57.82  ? 551 TRP E CE2 1 
ATOM   329  C CE3 . TRP A 1 102 ? 103.809 17.199 32.962  1.00 56.36  ? 551 TRP E CE3 1 
ATOM   330  C CZ2 . TRP A 1 102 ? 104.424 15.672 35.267  1.00 63.63  ? 551 TRP E CZ2 1 
ATOM   331  C CZ3 . TRP A 1 102 ? 104.776 17.607 33.859  1.00 61.35  ? 551 TRP E CZ3 1 
ATOM   332  C CH2 . TRP A 1 102 ? 105.077 16.844 34.998  1.00 66.27  ? 551 TRP E CH2 1 
ATOM   333  N N   . PHE A 1 103 ? 98.480  14.811 30.370  1.00 56.08  ? 552 PHE E N   1 
ATOM   334  C CA  . PHE A 1 103 ? 97.506  13.734 30.213  1.00 52.92  ? 552 PHE E CA  1 
ATOM   335  C C   . PHE A 1 103 ? 98.154  12.372 30.389  1.00 58.65  ? 552 PHE E C   1 
ATOM   336  O O   . PHE A 1 103 ? 97.536  11.433 30.892  1.00 60.22  ? 552 PHE E O   1 
ATOM   337  C CB  . PHE A 1 103 ? 96.842  13.796 28.843  1.00 50.45  ? 552 PHE E CB  1 
ATOM   338  C CG  . PHE A 1 103 ? 96.010  15.014 28.633  1.00 56.95  ? 552 PHE E CG  1 
ATOM   339  C CD1 . PHE A 1 103 ? 94.659  15.004 28.945  1.00 57.79  ? 552 PHE E CD1 1 
ATOM   340  C CD2 . PHE A 1 103 ? 96.570  16.175 28.125  1.00 52.11  ? 552 PHE E CD2 1 
ATOM   341  C CE1 . PHE A 1 103 ? 93.881  16.132 28.756  1.00 56.73  ? 552 PHE E CE1 1 
ATOM   342  C CE2 . PHE A 1 103 ? 95.792  17.311 27.934  1.00 52.59  ? 552 PHE E CE2 1 
ATOM   343  C CZ  . PHE A 1 103 ? 94.448  17.286 28.250  1.00 53.22  ? 552 PHE E CZ  1 
ATOM   344  N N   . GLY A 1 104 ? 99.403  12.268 29.961  1.00 57.98  ? 553 GLY E N   1 
ATOM   345  C CA  . GLY A 1 104 ? 100.138 11.028 30.078  1.00 59.37  ? 553 GLY E CA  1 
ATOM   346  C C   . GLY A 1 104 ? 101.567 11.251 29.659  1.00 58.22  ? 553 GLY E C   1 
ATOM   347  O O   . GLY A 1 104 ? 101.954 12.370 29.332  1.00 56.13  ? 553 GLY E O   1 
ATOM   348  N N   . CYS A 1 105 ? 102.362 10.190 29.673  1.00 67.61  ? 554 CYS E N   1 
ATOM   349  C CA  . CYS A 1 105 ? 103.747 10.293 29.244  1.00 63.03  ? 554 CYS E CA  1 
ATOM   350  C C   . CYS A 1 105 ? 104.178 9.082  28.432  1.00 62.96  ? 554 CYS E C   1 
ATOM   351  O O   . CYS A 1 105 ? 103.412 8.144  28.232  1.00 59.35  ? 554 CYS E O   1 
ATOM   352  C CB  . CYS A 1 105 ? 104.668 10.473 30.450  1.00 61.27  ? 554 CYS E CB  1 
ATOM   353  S SG  . CYS A 1 105 ? 104.259 11.886 31.501  1.00 60.33  ? 554 CYS E SG  1 
ATOM   354  N N   . THR A 1 106 ? 105.416 9.129  27.955  1.00 68.92  ? 555 THR E N   1 
ATOM   355  C CA  . THR A 1 106 ? 106.008 8.046  27.185  1.00 66.74  ? 555 THR E CA  1 
ATOM   356  C C   . THR A 1 106 ? 107.525 8.114  27.336  1.00 71.78  ? 555 THR E C   1 
ATOM   357  O O   . THR A 1 106 ? 108.106 9.194  27.276  1.00 72.42  ? 555 THR E O   1 
ATOM   358  C CB  . THR A 1 106 ? 105.620 8.131  25.695  1.00 65.82  ? 555 THR E CB  1 
ATOM   359  O OG1 . THR A 1 106 ? 104.192 8.169  25.576  1.00 70.57  ? 555 THR E OG1 1 
ATOM   360  C CG2 . THR A 1 106 ? 106.158 6.939  24.927  1.00 63.27  ? 555 THR E CG2 1 
ATOM   361  N N   . TRP A 1 107 ? 108.173 6.976  27.556  1.00 71.92  ? 556 TRP E N   1 
ATOM   362  C CA  . TRP A 1 107 ? 109.626 6.979  27.603  1.00 72.20  ? 556 TRP E CA  1 
ATOM   363  C C   . TRP A 1 107 ? 110.200 5.688  27.062  1.00 76.12  ? 556 TRP E C   1 
ATOM   364  O O   . TRP A 1 107 ? 109.585 5.040  26.223  1.00 78.50  ? 556 TRP E O   1 
ATOM   365  C CB  . TRP A 1 107 ? 110.121 7.237  29.021  1.00 74.74  ? 556 TRP E CB  1 
ATOM   366  C CG  . TRP A 1 107 ? 109.590 6.324  30.082  1.00 76.97  ? 556 TRP E CG  1 
ATOM   367  C CD1 . TRP A 1 107 ? 110.269 5.323  30.708  1.00 77.92  ? 556 TRP E CD1 1 
ATOM   368  C CD2 . TRP A 1 107 ? 108.284 6.354  30.676  1.00 78.21  ? 556 TRP E CD2 1 
ATOM   369  N NE1 . TRP A 1 107 ? 109.468 4.719  31.644  1.00 76.95  ? 556 TRP E NE1 1 
ATOM   370  C CE2 . TRP A 1 107 ? 108.244 5.333  31.645  1.00 75.98  ? 556 TRP E CE2 1 
ATOM   371  C CE3 . TRP A 1 107 ? 107.145 7.146  30.483  1.00 76.26  ? 556 TRP E CE3 1 
ATOM   372  C CZ2 . TRP A 1 107 ? 107.110 5.073  32.409  1.00 75.99  ? 556 TRP E CZ2 1 
ATOM   373  C CZ3 . TRP A 1 107 ? 106.017 6.887  31.246  1.00 74.93  ? 556 TRP E CZ3 1 
ATOM   374  C CH2 . TRP A 1 107 ? 106.009 5.859  32.196  1.00 77.57  ? 556 TRP E CH2 1 
ATOM   375  N N   . MET A 1 108 ? 111.390 5.323  27.514  1.00 78.00  ? 557 MET E N   1 
ATOM   376  C CA  . MET A 1 108 ? 112.008 4.092  27.037  1.00 83.72  ? 557 MET E CA  1 
ATOM   377  C C   . MET A 1 108 ? 112.912 3.461  28.077  1.00 86.14  ? 557 MET E C   1 
ATOM   378  O O   . MET A 1 108 ? 113.938 4.042  28.443  1.00 87.40  ? 557 MET E O   1 
ATOM   379  C CB  . MET A 1 108 ? 112.808 4.352  25.764  1.00 84.93  ? 557 MET E CB  1 
ATOM   380  C CG  . MET A 1 108 ? 113.635 3.160  25.330  1.00 86.40  ? 557 MET E CG  1 
ATOM   381  S SD  . MET A 1 108 ? 113.475 2.822  23.570  1.00 90.35  ? 557 MET E SD  1 
ATOM   382  C CE  . MET A 1 108 ? 111.714 2.546  23.429  1.00 83.40  ? 557 MET E CE  1 
ATOM   383  N N   . ASN A 1 109 ? 112.549 2.265  28.539  1.00 85.73  ? 558 ASN E N   1 
ATOM   384  C CA  . ASN A 1 109 ? 113.371 1.592  29.539  1.00 92.32  ? 558 ASN E CA  1 
ATOM   385  C C   . ASN A 1 109 ? 114.679 1.070  28.941  1.00 90.27  ? 558 ASN E C   1 
ATOM   386  O O   . ASN A 1 109 ? 114.989 1.319  27.771  1.00 85.53  ? 558 ASN E O   1 
ATOM   387  C CB  . ASN A 1 109 ? 112.594 0.457  30.234  1.00 88.16  ? 558 ASN E CB  1 
ATOM   388  C CG  . ASN A 1 109 ? 112.094 -0.615 29.276  1.00 91.36  ? 558 ASN E CG  1 
ATOM   389  O OD1 . ASN A 1 109 ? 112.528 -0.711 28.129  1.00 91.33  ? 558 ASN E OD1 1 
ATOM   390  N ND2 . ASN A 1 109 ? 111.174 -1.440 29.761  1.00 91.70  ? 558 ASN E ND2 1 
ATOM   391  N N   . SER A 1 110 ? 115.453 0.367  29.760  1.00 92.30  ? 559 SER E N   1 
ATOM   392  C CA  . SER A 1 110 ? 116.737 -0.162 29.329  1.00 89.15  ? 559 SER E CA  1 
ATOM   393  C C   . SER A 1 110 ? 116.546 -1.173 28.203  1.00 89.82  ? 559 SER E C   1 
ATOM   394  O O   . SER A 1 110 ? 117.214 -1.105 27.170  1.00 87.26  ? 559 SER E O   1 
ATOM   395  C CB  . SER A 1 110 ? 117.466 -0.804 30.506  1.00 89.76  ? 559 SER E CB  1 
ATOM   396  O OG  . SER A 1 110 ? 117.200 -0.107 31.715  1.00 88.10  ? 559 SER E OG  1 
ATOM   397  N N   . SER A 1 111 ? 115.594 -2.082 28.401  1.00 91.46  ? 560 SER E N   1 
ATOM   398  C CA  . SER A 1 111 ? 115.320 -3.177 27.468  1.00 89.78  ? 560 SER E CA  1 
ATOM   399  C C   . SER A 1 111 ? 114.893 -2.733 26.070  1.00 89.45  ? 560 SER E C   1 
ATOM   400  O O   . SER A 1 111 ? 114.703 -3.566 25.181  1.00 85.94  ? 560 SER E O   1 
ATOM   401  C CB  . SER A 1 111 ? 114.245 -4.087 28.056  1.00 88.43  ? 560 SER E CB  1 
ATOM   402  O OG  . SER A 1 111 ? 114.560 -4.412 29.397  1.00 91.00  ? 560 SER E OG  1 
ATOM   403  N N   . GLY A 1 112 ? 114.742 -1.426 25.878  1.00 91.42  ? 561 GLY E N   1 
ATOM   404  C CA  . GLY A 1 112 ? 114.368 -0.884 24.586  1.00 86.71  ? 561 GLY E CA  1 
ATOM   405  C C   . GLY A 1 112 ? 112.880 -0.998 24.347  1.00 84.52  ? 561 GLY E C   1 
ATOM   406  O O   . GLY A 1 112 ? 112.427 -1.066 23.205  1.00 85.14  ? 561 GLY E O   1 
ATOM   407  N N   . TYR A 1 113 ? 112.117 -1.020 25.434  1.00 85.76  ? 562 TYR E N   1 
ATOM   408  C CA  . TYR A 1 113 ? 110.663 -1.072 25.345  1.00 86.95  ? 562 TYR E CA  1 
ATOM   409  C C   . TYR A 1 113 ? 110.022 0.297  25.636  1.00 85.15  ? 562 TYR E C   1 
ATOM   410  O O   . TYR A 1 113 ? 110.340 0.956  26.633  1.00 81.25  ? 562 TYR E O   1 
ATOM   411  C CB  . TYR A 1 113 ? 110.117 -2.134 26.301  1.00 86.15  ? 562 TYR E CB  1 
ATOM   412  N N   . THR A 1 114 ? 109.122 0.717  24.750  1.00 84.89  ? 563 THR E N   1 
ATOM   413  C CA  . THR A 1 114 ? 108.426 1.998  24.880  1.00 79.12  ? 563 THR E CA  1 
ATOM   414  C C   . THR A 1 114 ? 107.406 1.990  26.022  1.00 79.07  ? 563 THR E C   1 
ATOM   415  O O   . THR A 1 114 ? 106.301 1.460  25.879  1.00 79.09  ? 563 THR E O   1 
ATOM   416  C CB  . THR A 1 114 ? 107.703 2.373  23.567  1.00 75.86  ? 563 THR E CB  1 
ATOM   417  O OG1 . THR A 1 114 ? 108.667 2.602  22.534  1.00 72.32  ? 563 THR E OG1 1 
ATOM   418  C CG2 . THR A 1 114 ? 106.862 3.629  23.749  1.00 78.69  ? 563 THR E CG2 1 
ATOM   419  N N   . LYS A 1 115 ? 107.778 2.587  27.151  1.00 72.23  ? 564 LYS E N   1 
ATOM   420  C CA  . LYS A 1 115 ? 106.903 2.626  28.319  1.00 76.99  ? 564 LYS E CA  1 
ATOM   421  C C   . LYS A 1 115 ? 105.969 3.847  28.319  1.00 79.15  ? 564 LYS E C   1 
ATOM   422  O O   . LYS A 1 115 ? 106.409 4.978  28.096  1.00 74.56  ? 564 LYS E O   1 
ATOM   423  C CB  . LYS A 1 115 ? 107.744 2.609  29.598  1.00 75.35  ? 564 LYS E CB  1 
ATOM   424  N N   . THR A 1 116 ? 104.679 3.616  28.562  1.00 76.03  ? 565 THR E N   1 
ATOM   425  C CA  . THR A 1 116 ? 103.721 4.718  28.666  1.00 76.12  ? 565 THR E CA  1 
ATOM   426  C C   . THR A 1 116 ? 103.035 4.758  30.026  1.00 73.05  ? 565 THR E C   1 
ATOM   427  O O   . THR A 1 116 ? 103.052 3.788  30.775  1.00 74.50  ? 565 THR E O   1 
ATOM   428  C CB  . THR A 1 116 ? 102.621 4.655  27.569  1.00 79.61  ? 565 THR E CB  1 
ATOM   429  O OG1 . THR A 1 116 ? 101.794 3.499  27.758  1.00 78.45  ? 565 THR E OG1 1 
ATOM   430  C CG2 . THR A 1 116 ? 103.244 4.623  26.185  1.00 77.63  ? 565 THR E CG2 1 
ATOM   431  N N   . CYS A 1 117 ? 102.436 5.898  30.335  1.00 71.26  ? 566 CYS E N   1 
ATOM   432  C CA  . CYS A 1 117 ? 101.646 6.038  31.539  1.00 69.89  ? 566 CYS E CA  1 
ATOM   433  C C   . CYS A 1 117 ? 100.630 7.136  31.306  1.00 69.98  ? 566 CYS E C   1 
ATOM   434  O O   . CYS A 1 117 ? 100.921 8.137  30.660  1.00 70.36  ? 566 CYS E O   1 
ATOM   435  C CB  . CYS A 1 117 ? 102.528 6.351  32.744  1.00 71.89  ? 566 CYS E CB  1 
ATOM   436  S SG  . CYS A 1 117 ? 102.916 8.103  32.959  1.00 76.29  ? 566 CYS E SG  1 
ATOM   437  N N   . GLY A 1 118 ? 99.421  6.934  31.802  1.00 75.78  ? 567 GLY E N   1 
ATOM   438  C CA  . GLY A 1 118 ? 98.382  7.927  31.648  1.00 74.75  ? 567 GLY E CA  1 
ATOM   439  C C   . GLY A 1 118 ? 97.780  8.257  32.992  1.00 78.29  ? 567 GLY E C   1 
ATOM   440  O O   . GLY A 1 118 ? 98.385  8.009  34.033  1.00 80.09  ? 567 GLY E O   1 
ATOM   441  N N   . ALA A 1 119 ? 96.591  8.839  32.966  1.00 82.76  ? 568 ALA E N   1 
ATOM   442  C CA  . ALA A 1 119 ? 95.793  9.014  34.167  1.00 87.18  ? 568 ALA E CA  1 
ATOM   443  C C   . ALA A 1 119 ? 94.623  8.033  34.056  1.00 89.31  ? 568 ALA E C   1 
ATOM   444  O O   . ALA A 1 119 ? 94.358  7.532  32.957  1.00 85.56  ? 568 ALA E O   1 
ATOM   445  C CB  . ALA A 1 119 ? 95.321  10.469 34.301  1.00 84.93  ? 568 ALA E CB  1 
ATOM   446  N N   . PRO A 1 120 ? 93.942  7.727  35.183  1.00 91.03  ? 569 PRO E N   1 
ATOM   447  C CA  . PRO A 1 120 ? 92.807  6.789  35.176  1.00 88.25  ? 569 PRO E CA  1 
ATOM   448  C C   . PRO A 1 120 ? 91.781  7.052  34.067  1.00 87.90  ? 569 PRO E C   1 
ATOM   449  O O   . PRO A 1 120 ? 91.122  8.094  34.080  1.00 89.30  ? 569 PRO E O   1 
ATOM   450  C CB  . PRO A 1 120 ? 92.176  7.006  36.553  1.00 88.68  ? 569 PRO E CB  1 
ATOM   451  C CG  . PRO A 1 120 ? 93.317  7.393  37.420  1.00 87.89  ? 569 PRO E CG  1 
ATOM   452  C CD  . PRO A 1 120 ? 94.261  8.185  36.551  1.00 90.74  ? 569 PRO E CD  1 
ATOM   453  N N   . PRO A 1 121 ? 91.650  6.110  33.116  1.00 90.15  ? 570 PRO E N   1 
ATOM   454  C CA  . PRO A 1 121 ? 90.759  6.216  31.948  1.00 94.46  ? 570 PRO E CA  1 
ATOM   455  C C   . PRO A 1 121 ? 89.270  6.095  32.300  1.00 93.20  ? 570 PRO E C   1 
ATOM   456  O O   . PRO A 1 121 ? 88.901  5.236  33.098  1.00 93.49  ? 570 PRO E O   1 
ATOM   457  C CB  . PRO A 1 121 ? 91.199  5.039  31.061  1.00 89.55  ? 570 PRO E CB  1 
ATOM   458  C CG  . PRO A 1 121 ? 92.532  4.595  31.614  1.00 87.18  ? 570 PRO E CG  1 
ATOM   459  C CD  . PRO A 1 121 ? 92.452  4.877  33.075  1.00 88.00  ? 570 PRO E CD  1 
ATOM   460  N N   . CYS A 1 122 ? 88.426  6.933  31.706  1.00 90.53  ? 571 CYS E N   1 
ATOM   461  C CA  . CYS A 1 122 ? 87.002  6.923  32.038  1.00 95.47  ? 571 CYS E CA  1 
ATOM   462  C C   . CYS A 1 122 ? 86.240  5.845  31.262  1.00 92.66  ? 571 CYS E C   1 
ATOM   463  O O   . CYS A 1 122 ? 85.186  5.374  31.700  1.00 88.21  ? 571 CYS E O   1 
ATOM   464  C CB  . CYS A 1 122 ? 86.381  8.304  31.781  1.00 100.75 ? 571 CYS E CB  1 
ATOM   465  S SG  . CYS A 1 122 ? 86.551  8.945  30.086  1.00 100.13 ? 571 CYS E SG  1 
ATOM   466  N N   . THR A 1 147 ? 85.826  17.824 22.480  1.00 95.93  ? 596 THR E N   1 
ATOM   467  C CA  . THR A 1 147 ? 86.832  16.777 22.339  1.00 88.18  ? 596 THR E CA  1 
ATOM   468  C C   . THR A 1 147 ? 86.723  15.767 23.476  1.00 85.42  ? 596 THR E C   1 
ATOM   469  O O   . THR A 1 147 ? 86.534  16.137 24.634  1.00 82.24  ? 596 THR E O   1 
ATOM   470  C CB  . THR A 1 147 ? 88.270  17.358 22.313  1.00 90.74  ? 596 THR E CB  1 
ATOM   471  O OG1 . THR A 1 147 ? 88.361  18.393 21.323  1.00 94.34  ? 596 THR E OG1 1 
ATOM   472  C CG2 . THR A 1 147 ? 89.286  16.266 21.991  1.00 83.95  ? 596 THR E CG2 1 
ATOM   473  N N   . THR A 1 148 ? 86.844  14.488 23.141  1.00 87.25  ? 597 THR E N   1 
ATOM   474  C CA  . THR A 1 148 ? 86.787  13.439 24.146  1.00 83.43  ? 597 THR E CA  1 
ATOM   475  C C   . THR A 1 148 ? 88.159  13.228 24.775  1.00 80.14  ? 597 THR E C   1 
ATOM   476  O O   . THR A 1 148 ? 88.268  12.658 25.859  1.00 79.49  ? 597 THR E O   1 
ATOM   477  C CB  . THR A 1 148 ? 86.275  12.113 23.551  1.00 87.87  ? 597 THR E CB  1 
ATOM   478  O OG1 . THR A 1 148 ? 86.017  11.180 24.608  1.00 90.48  ? 597 THR E OG1 1 
ATOM   479  C CG2 . THR A 1 148 ? 87.291  11.523 22.576  1.00 84.51  ? 597 THR E CG2 1 
ATOM   480  N N   . TYR A 1 149 ? 89.202  13.699 24.091  1.00 81.19  ? 598 TYR E N   1 
ATOM   481  C CA  . TYR A 1 149 ? 90.567  13.621 24.615  1.00 78.76  ? 598 TYR E CA  1 
ATOM   482  C C   . TYR A 1 149 ? 90.721  14.476 25.853  1.00 74.28  ? 598 TYR E C   1 
ATOM   483  O O   . TYR A 1 149 ? 91.466  14.126 26.768  1.00 69.00  ? 598 TYR E O   1 
ATOM   484  C CB  . TYR A 1 149 ? 91.592  14.069 23.573  1.00 69.44  ? 598 TYR E CB  1 
ATOM   485  C CG  . TYR A 1 149 ? 93.026  14.116 24.088  1.00 72.63  ? 598 TYR E CG  1 
ATOM   486  C CD1 . TYR A 1 149 ? 93.818  12.968 24.104  1.00 66.81  ? 598 TYR E CD1 1 
ATOM   487  C CD2 . TYR A 1 149 ? 93.594  15.309 24.545  1.00 65.07  ? 598 TYR E CD2 1 
ATOM   488  C CE1 . TYR A 1 149 ? 95.130  13.004 24.559  1.00 60.06  ? 598 TYR E CE1 1 
ATOM   489  C CE2 . TYR A 1 149 ? 94.911  15.357 25.004  1.00 60.53  ? 598 TYR E CE2 1 
ATOM   490  C CZ  . TYR A 1 149 ? 95.677  14.198 25.008  1.00 65.73  ? 598 TYR E CZ  1 
ATOM   491  O OH  . TYR A 1 149 ? 96.990  14.224 25.457  1.00 58.78  ? 598 TYR E OH  1 
ATOM   492  N N   . LEU A 1 150 ? 90.025  15.609 25.859  1.00 72.64  ? 599 LEU E N   1 
ATOM   493  C CA  . LEU A 1 150 ? 90.068  16.530 26.985  1.00 73.01  ? 599 LEU E CA  1 
ATOM   494  C C   . LEU A 1 150 ? 89.544  15.864 28.252  1.00 75.14  ? 599 LEU E C   1 
ATOM   495  O O   . LEU A 1 150 ? 90.143  15.982 29.325  1.00 69.44  ? 599 LEU E O   1 
ATOM   496  C CB  . LEU A 1 150 ? 89.251  17.787 26.682  1.00 74.89  ? 599 LEU E CB  1 
ATOM   497  C CG  . LEU A 1 150 ? 89.883  19.086 27.171  1.00 66.06  ? 599 LEU E CG  1 
ATOM   498  C CD1 . LEU A 1 150 ? 90.920  19.524 26.154  1.00 60.19  ? 599 LEU E CD1 1 
ATOM   499  C CD2 . LEU A 1 150 ? 88.836  20.173 27.424  1.00 65.89  ? 599 LEU E CD2 1 
ATOM   500  N N   . LYS A 1 151 ? 88.417  15.169 28.114  1.00 79.77  ? 600 LYS E N   1 
ATOM   501  C CA  . LYS A 1 151 ? 87.820  14.444 29.225  1.00 79.74  ? 600 LYS E CA  1 
ATOM   502  C C   . LYS A 1 151 ? 88.792  13.389 29.743  1.00 79.52  ? 600 LYS E C   1 
ATOM   503  O O   . LYS A 1 151 ? 89.235  13.448 30.891  1.00 82.56  ? 600 LYS E O   1 
ATOM   504  C CB  . LYS A 1 151 ? 86.500  13.800 28.795  1.00 77.51  ? 600 LYS E CB  1 
ATOM   505  N N   . CYS A 1 152 ? 89.139  12.439 28.881  1.00 77.99  ? 601 CYS E N   1 
ATOM   506  C CA  . CYS A 1 152 ? 90.017  11.343 29.264  1.00 78.57  ? 601 CYS E CA  1 
ATOM   507  C C   . CYS A 1 152 ? 90.964  10.956 28.140  1.00 80.74  ? 601 CYS E C   1 
ATOM   508  O O   . CYS A 1 152 ? 90.588  10.212 27.239  1.00 80.91  ? 601 CYS E O   1 
ATOM   509  C CB  . CYS A 1 152 ? 89.190  10.130 29.683  1.00 85.34  ? 601 CYS E CB  1 
ATOM   510  S SG  . CYS A 1 152 ? 87.681  9.878  28.687  1.00 102.54 ? 601 CYS E SG  1 
ATOM   511  N N   . GLY A 1 153 ? 92.187  11.477 28.194  1.00 78.98  ? 602 GLY E N   1 
ATOM   512  C CA  . GLY A 1 153 ? 93.254  11.072 27.291  1.00 66.03  ? 602 GLY E CA  1 
ATOM   513  C C   . GLY A 1 153 ? 94.411  10.607 28.149  1.00 61.97  ? 602 GLY E C   1 
ATOM   514  O O   . GLY A 1 153 ? 94.589  11.124 29.249  1.00 63.45  ? 602 GLY E O   1 
ATOM   515  N N   . SER A 1 154 ? 95.185  9.632  27.680  1.00 59.71  ? 603 SER E N   1 
ATOM   516  C CA  . SER A 1 154 ? 96.241  9.051  28.518  1.00 65.96  ? 603 SER E CA  1 
ATOM   517  C C   . SER A 1 154 ? 97.649  9.253  27.962  1.00 63.86  ? 603 SER E C   1 
ATOM   518  O O   . SER A 1 154 ? 98.538  8.423  28.168  1.00 67.03  ? 603 SER E O   1 
ATOM   519  C CB  . SER A 1 154 ? 95.991  7.556  28.727  1.00 67.51  ? 603 SER E CB  1 
ATOM   520  O OG  . SER A 1 154 ? 94.975  7.341  29.689  1.00 74.16  ? 603 SER E OG  1 
ATOM   521  N N   . GLY A 1 155 ? 97.853  10.364 27.270  1.00 62.13  ? 604 GLY E N   1 
ATOM   522  C CA  . GLY A 1 155 ? 99.151  10.650 26.699  1.00 60.33  ? 604 GLY E CA  1 
ATOM   523  C C   . GLY A 1 155 ? 99.053  11.036 25.241  1.00 58.44  ? 604 GLY E C   1 
ATOM   524  O O   . GLY A 1 155 ? 98.116  11.726 24.842  1.00 54.93  ? 604 GLY E O   1 
ATOM   525  N N   . PRO A 1 156 ? 100.009 10.557 24.432  1.00 58.69  ? 605 PRO E N   1 
ATOM   526  C CA  . PRO A 1 156 ? 100.229 10.969 23.040  1.00 50.10  ? 605 PRO E CA  1 
ATOM   527  C C   . PRO A 1 156 ? 99.071  10.699 22.079  1.00 55.47  ? 605 PRO E C   1 
ATOM   528  O O   . PRO A 1 156 ? 98.933  11.442 21.107  1.00 55.25  ? 605 PRO E O   1 
ATOM   529  C CB  . PRO A 1 156 ? 101.454 10.152 22.632  1.00 54.29  ? 605 PRO E CB  1 
ATOM   530  C CG  . PRO A 1 156 ? 101.430 8.968  23.529  1.00 61.16  ? 605 PRO E CG  1 
ATOM   531  C CD  . PRO A 1 156 ? 100.924 9.476  24.838  1.00 58.25  ? 605 PRO E CD  1 
ATOM   532  N N   . TRP A 1 157 ? 98.262  9.671  22.327  1.00 57.27  ? 606 TRP E N   1 
ATOM   533  C CA  . TRP A 1 157 ? 97.203  9.299  21.388  1.00 56.85  ? 606 TRP E CA  1 
ATOM   534  C C   . TRP A 1 157 ? 95.956  10.155 21.520  1.00 60.27  ? 606 TRP E C   1 
ATOM   535  O O   . TRP A 1 157 ? 95.305  10.152 22.560  1.00 67.29  ? 606 TRP E O   1 
ATOM   536  C CB  . TRP A 1 157 ? 96.841  7.825  21.564  1.00 60.07  ? 606 TRP E CB  1 
ATOM   537  C CG  . TRP A 1 157 ? 97.915  6.964  21.041  1.00 57.30  ? 606 TRP E CG  1 
ATOM   538  C CD1 . TRP A 1 157 ? 98.971  6.451  21.740  1.00 56.35  ? 606 TRP E CD1 1 
ATOM   539  C CD2 . TRP A 1 157 ? 98.091  6.556  19.680  1.00 57.51  ? 606 TRP E CD2 1 
ATOM   540  N NE1 . TRP A 1 157 ? 99.786  5.729  20.898  1.00 59.70  ? 606 TRP E NE1 1 
ATOM   541  C CE2 . TRP A 1 157 ? 99.269  5.779  19.628  1.00 59.50  ? 606 TRP E CE2 1 
ATOM   542  C CE3 . TRP A 1 157 ? 97.366  6.769  18.500  1.00 56.78  ? 606 TRP E CE3 1 
ATOM   543  C CZ2 . TRP A 1 157 ? 99.737  5.211  18.441  1.00 57.34  ? 606 TRP E CZ2 1 
ATOM   544  C CZ3 . TRP A 1 157 ? 97.829  6.202  17.322  1.00 59.94  ? 606 TRP E CZ3 1 
ATOM   545  C CH2 . TRP A 1 157 ? 99.004  5.432  17.303  1.00 62.87  ? 606 TRP E CH2 1 
ATOM   546  N N   . LEU A 1 158 ? 95.624  10.876 20.453  1.00 56.41  ? 607 LEU E N   1 
ATOM   547  C CA  . LEU A 1 158 ? 94.445  11.736 20.423  1.00 61.59  ? 607 LEU E CA  1 
ATOM   548  C C   . LEU A 1 158 ? 93.208  10.927 20.066  1.00 68.64  ? 607 LEU E C   1 
ATOM   549  O O   . LEU A 1 158 ? 92.149  11.069 20.678  1.00 70.58  ? 607 LEU E O   1 
ATOM   550  C CB  . LEU A 1 158 ? 94.632  12.869 19.413  1.00 64.00  ? 607 LEU E CB  1 
ATOM   551  C CG  . LEU A 1 158 ? 95.881  13.740 19.547  1.00 53.73  ? 607 LEU E CG  1 
ATOM   552  C CD1 . LEU A 1 158 ? 96.057  14.603 18.326  1.00 44.31  ? 607 LEU E CD1 1 
ATOM   553  C CD2 . LEU A 1 158 ? 95.763  14.593 20.785  1.00 59.94  ? 607 LEU E CD2 1 
ATOM   554  N N   . THR A 1 159 ? 93.360  10.091 19.043  1.00 72.55  ? 608 THR E N   1 
ATOM   555  C CA  . THR A 1 159 ? 92.334  9.148  18.622  1.00 64.13  ? 608 THR E CA  1 
ATOM   556  C C   . THR A 1 159 ? 93.011  7.792  18.499  1.00 67.20  ? 608 THR E C   1 
ATOM   557  O O   . THR A 1 159 ? 94.228  7.685  18.698  1.00 67.37  ? 608 THR E O   1 
ATOM   558  C CB  . THR A 1 159 ? 91.695  9.551  17.276  1.00 63.64  ? 608 THR E CB  1 
ATOM   559  O OG1 . THR A 1 159 ? 92.644  9.369  16.219  1.00 62.48  ? 608 THR E OG1 1 
ATOM   560  C CG2 . THR A 1 159 ? 91.230  10.997 17.310  1.00 58.82  ? 608 THR E CG2 1 
ATOM   561  N N   . PRO A 1 160 ? 92.239  6.740  18.192  1.00 72.01  ? 609 PRO E N   1 
ATOM   562  C CA  . PRO A 1 160 ? 92.941  5.482  17.920  1.00 70.46  ? 609 PRO E CA  1 
ATOM   563  C C   . PRO A 1 160 ? 93.842  5.578  16.692  1.00 69.64  ? 609 PRO E C   1 
ATOM   564  O O   . PRO A 1 160 ? 94.832  4.853  16.612  1.00 68.57  ? 609 PRO E O   1 
ATOM   565  C CB  . PRO A 1 160 ? 91.802  4.491  17.688  1.00 69.54  ? 609 PRO E CB  1 
ATOM   566  C CG  . PRO A 1 160 ? 90.680  5.038  18.481  1.00 73.83  ? 609 PRO E CG  1 
ATOM   567  C CD  . PRO A 1 160 ? 90.794  6.530  18.391  1.00 71.32  ? 609 PRO E CD  1 
ATOM   568  N N   . ARG A 1 161 ? 93.508  6.476  15.769  1.00 67.31  ? 610 ARG E N   1 
ATOM   569  C CA  . ARG A 1 161 ? 94.256  6.616  14.525  1.00 67.24  ? 610 ARG E CA  1 
ATOM   570  C C   . ARG A 1 161 ? 95.333  7.725  14.541  1.00 69.35  ? 610 ARG E C   1 
ATOM   571  O O   . ARG A 1 161 ? 96.130  7.824  13.605  1.00 69.36  ? 610 ARG E O   1 
ATOM   572  C CB  . ARG A 1 161 ? 93.278  6.867  13.376  1.00 64.58  ? 610 ARG E CB  1 
ATOM   573  N N   . CYS A 1 162 ? 95.362  8.557  15.584  1.00 66.05  ? 611 CYS E N   1 
ATOM   574  C CA  . CYS A 1 162 ? 96.269  9.715  15.598  1.00 62.55  ? 611 CYS E CA  1 
ATOM   575  C C   . CYS A 1 162 ? 96.975  9.945  16.925  1.00 56.97  ? 611 CYS E C   1 
ATOM   576  O O   . CYS A 1 162 ? 96.374  9.842  17.993  1.00 60.48  ? 611 CYS E O   1 
ATOM   577  C CB  . CYS A 1 162 ? 95.511  10.985 15.232  1.00 56.90  ? 611 CYS E CB  1 
ATOM   578  S SG  . CYS A 1 162 ? 94.223  10.720 14.021  1.00 68.98  ? 611 CYS E SG  1 
ATOM   579  N N   . LEU A 1 163 ? 98.257  10.269 16.852  1.00 50.05  ? 612 LEU E N   1 
ATOM   580  C CA  . LEU A 1 163 ? 99.002  10.619 18.049  1.00 55.28  ? 612 LEU E CA  1 
ATOM   581  C C   . LEU A 1 163 ? 99.746  11.939 17.848  1.00 54.09  ? 612 LEU E C   1 
ATOM   582  O O   . LEU A 1 163 ? 100.022 12.349 16.721  1.00 55.72  ? 612 LEU E O   1 
ATOM   583  C CB  . LEU A 1 163 ? 99.986  9.511  18.432  1.00 56.31  ? 612 LEU E CB  1 
ATOM   584  C CG  . LEU A 1 163 ? 101.302 9.452  17.656  1.00 57.21  ? 612 LEU E CG  1 
ATOM   585  C CD1 . LEU A 1 163 ? 102.362 8.704  18.452  1.00 58.67  ? 612 LEU E CD1 1 
ATOM   586  C CD2 . LEU A 1 163 ? 101.097 8.822  16.285  1.00 56.70  ? 612 LEU E CD2 1 
ATOM   587  N N   . ILE A 1 164 ? 100.056 12.601 18.955  1.00 50.91  ? 613 ILE E N   1 
ATOM   588  C CA  . ILE A 1 164 ? 100.753 13.878 18.935  1.00 49.72  ? 613 ILE E CA  1 
ATOM   589  C C   . ILE A 1 164 ? 102.184 13.707 18.457  1.00 54.02  ? 613 ILE E C   1 
ATOM   590  O O   . ILE A 1 164 ? 102.933 12.910 19.018  1.00 57.28  ? 613 ILE E O   1 
ATOM   591  C CB  . ILE A 1 164 ? 100.758 14.515 20.338  1.00 51.35  ? 613 ILE E CB  1 
ATOM   592  C CG1 . ILE A 1 164 ? 99.323  14.793 20.784  1.00 43.31  ? 613 ILE E CG1 1 
ATOM   593  C CG2 . ILE A 1 164 ? 101.639 15.775 20.367  1.00 46.09  ? 613 ILE E CG2 1 
ATOM   594  C CD1 . ILE A 1 164 ? 99.138  14.774 22.265  1.00 51.04  ? 613 ILE E CD1 1 
ATOM   595  N N   . ASP A 1 165 ? 102.579 14.444 17.426  1.00 51.31  ? 614 ASP E N   1 
ATOM   596  C CA  . ASP A 1 165 ? 103.944 14.307 16.932  1.00 56.19  ? 614 ASP E CA  1 
ATOM   597  C C   . ASP A 1 165 ? 104.964 14.971 17.880  1.00 55.81  ? 614 ASP E C   1 
ATOM   598  O O   . ASP A 1 165 ? 104.650 15.924 18.587  1.00 49.82  ? 614 ASP E O   1 
ATOM   599  C CB  . ASP A 1 165 ? 104.056 14.878 15.520  1.00 52.68  ? 614 ASP E CB  1 
ATOM   600  C CG  . ASP A 1 165 ? 105.372 14.523 14.851  1.00 59.27  ? 614 ASP E CG  1 
ATOM   601  O OD1 . ASP A 1 165 ? 106.168 13.763 15.452  1.00 60.72  ? 614 ASP E OD1 1 
ATOM   602  O OD2 . ASP A 1 165 ? 105.608 14.998 13.721  1.00 54.42  ? 614 ASP E OD2 1 
ATOM   603  N N   . TYR A 1 166 ? 106.179 14.440 17.910  1.00 55.16  ? 615 TYR E N   1 
ATOM   604  C CA  . TYR A 1 166 ? 107.243 15.014 18.731  1.00 56.74  ? 615 TYR E CA  1 
ATOM   605  C C   . TYR A 1 166 ? 108.579 14.400 18.315  1.00 63.19  ? 615 TYR E C   1 
ATOM   606  O O   . TYR A 1 166 ? 108.590 13.468 17.506  1.00 65.02  ? 615 TYR E O   1 
ATOM   607  C CB  . TYR A 1 166 ? 106.957 14.803 20.224  1.00 60.12  ? 615 TYR E CB  1 
ATOM   608  C CG  . TYR A 1 166 ? 106.900 13.374 20.693  1.00 58.40  ? 615 TYR E CG  1 
ATOM   609  C CD1 . TYR A 1 166 ? 105.837 12.556 20.351  1.00 58.98  ? 615 TYR E CD1 1 
ATOM   610  C CD2 . TYR A 1 166 ? 107.884 12.862 21.524  1.00 59.84  ? 615 TYR E CD2 1 
ATOM   611  C CE1 . TYR A 1 166 ? 105.772 11.252 20.799  1.00 65.89  ? 615 TYR E CE1 1 
ATOM   612  C CE2 . TYR A 1 166 ? 107.829 11.564 21.981  1.00 62.57  ? 615 TYR E CE2 1 
ATOM   613  C CZ  . TYR A 1 166 ? 106.772 10.760 21.613  1.00 64.44  ? 615 TYR E CZ  1 
ATOM   614  O OH  . TYR A 1 166 ? 106.712 9.464  22.065  1.00 66.24  ? 615 TYR E OH  1 
ATOM   615  N N   . PRO A 1 167 ? 109.708 14.939 18.826  1.00 65.59  ? 616 PRO E N   1 
ATOM   616  C CA  . PRO A 1 167 ? 111.004 14.428 18.357  1.00 68.91  ? 616 PRO E CA  1 
ATOM   617  C C   . PRO A 1 167 ? 111.129 12.905 18.406  1.00 66.88  ? 616 PRO E C   1 
ATOM   618  O O   . PRO A 1 167 ? 111.354 12.264 17.378  1.00 65.64  ? 616 PRO E O   1 
ATOM   619  C CB  . PRO A 1 167 ? 111.994 15.083 19.322  1.00 65.87  ? 616 PRO E CB  1 
ATOM   620  C CG  . PRO A 1 167 ? 111.358 16.382 19.657  1.00 65.18  ? 616 PRO E CG  1 
ATOM   621  C CD  . PRO A 1 167 ? 109.881 16.115 19.707  1.00 61.03  ? 616 PRO E CD  1 
ATOM   622  N N   . TYR A 1 168 ? 110.945 12.337 19.589  1.00 68.53  ? 617 TYR E N   1 
ATOM   623  C CA  . TYR A 1 168 ? 111.140 10.910 19.785  1.00 71.48  ? 617 TYR E CA  1 
ATOM   624  C C   . TYR A 1 168 ? 109.893 10.092 19.471  1.00 66.39  ? 617 TYR E C   1 
ATOM   625  O O   . TYR A 1 168 ? 109.719 9.009  20.022  1.00 68.90  ? 617 TYR E O   1 
ATOM   626  C CB  . TYR A 1 168 ? 111.588 10.635 21.225  1.00 75.26  ? 617 TYR E CB  1 
ATOM   627  C CG  . TYR A 1 168 ? 112.965 11.176 21.562  1.00 78.44  ? 617 TYR E CG  1 
ATOM   628  C CD1 . TYR A 1 168 ? 113.183 12.542 21.701  1.00 73.02  ? 617 TYR E CD1 1 
ATOM   629  C CD2 . TYR A 1 168 ? 114.046 10.317 21.749  1.00 79.21  ? 617 TYR E CD2 1 
ATOM   630  C CE1 . TYR A 1 168 ? 114.433 13.038 22.010  1.00 74.92  ? 617 TYR E CE1 1 
ATOM   631  C CE2 . TYR A 1 168 ? 115.301 10.806 22.058  1.00 74.44  ? 617 TYR E CE2 1 
ATOM   632  C CZ  . TYR A 1 168 ? 115.488 12.167 22.190  1.00 75.92  ? 617 TYR E CZ  1 
ATOM   633  O OH  . TYR A 1 168 ? 116.734 12.664 22.499  1.00 84.04  ? 617 TYR E OH  1 
ATOM   634  N N   . ARG A 1 169 ? 109.031 10.603 18.594  1.00 66.22  ? 618 ARG E N   1 
ATOM   635  C CA  . ARG A 1 169 ? 107.822 9.874  18.213  1.00 69.19  ? 618 ARG E CA  1 
ATOM   636  C C   . ARG A 1 169 ? 108.156 8.603  17.449  1.00 67.81  ? 618 ARG E C   1 
ATOM   637  O O   . ARG A 1 169 ? 107.600 7.541  17.714  1.00 69.15  ? 618 ARG E O   1 
ATOM   638  C CB  . ARG A 1 169 ? 106.889 10.735 17.356  1.00 62.99  ? 618 ARG E CB  1 
ATOM   639  C CG  . ARG A 1 169 ? 105.802 9.910  16.656  1.00 61.71  ? 618 ARG E CG  1 
ATOM   640  C CD  . ARG A 1 169 ? 104.890 10.756 15.793  1.00 58.92  ? 618 ARG E CD  1 
ATOM   641  N NE  . ARG A 1 169 ? 104.571 10.117 14.519  1.00 61.73  ? 618 ARG E NE  1 
ATOM   642  C CZ  . ARG A 1 169 ? 105.090 10.489 13.354  1.00 61.39  ? 618 ARG E CZ  1 
ATOM   643  N NH1 . ARG A 1 169 ? 105.943 11.499 13.310  1.00 51.86  ? 618 ARG E NH1 1 
ATOM   644  N NH2 . ARG A 1 169 ? 104.752 9.863  12.236  1.00 65.72  ? 618 ARG E NH2 1 
ATOM   645  N N   . LEU A 1 170 ? 109.066 8.729  16.493  1.00 70.85  ? 619 LEU E N   1 
ATOM   646  C CA  . LEU A 1 170 ? 109.433 7.615  15.625  1.00 76.33  ? 619 LEU E CA  1 
ATOM   647  C C   . LEU A 1 170 ? 110.291 6.567  16.351  1.00 73.78  ? 619 LEU E C   1 
ATOM   648  O O   . LEU A 1 170 ? 110.257 5.389  16.002  1.00 73.33  ? 619 LEU E O   1 
ATOM   649  C CB  . LEU A 1 170 ? 110.146 8.142  14.374  1.00 71.80  ? 619 LEU E CB  1 
ATOM   650  C CG  . LEU A 1 170 ? 109.224 8.898  13.407  1.00 70.46  ? 619 LEU E CG  1 
ATOM   651  C CD1 . LEU A 1 170 ? 110.010 9.549  12.283  1.00 70.48  ? 619 LEU E CD1 1 
ATOM   652  C CD2 . LEU A 1 170 ? 108.139 7.972  12.848  1.00 71.50  ? 619 LEU E CD2 1 
ATOM   653  N N   . TRP A 1 171 ? 111.050 6.980  17.359  1.00 69.23  ? 620 TRP E N   1 
ATOM   654  C CA  . TRP A 1 171 ? 111.638 5.996  18.246  1.00 67.16  ? 620 TRP E CA  1 
ATOM   655  C C   . TRP A 1 171 ? 110.501 5.331  19.025  1.00 72.97  ? 620 TRP E C   1 
ATOM   656  O O   . TRP A 1 171 ? 110.220 4.151  18.836  1.00 78.24  ? 620 TRP E O   1 
ATOM   657  C CB  . TRP A 1 171 ? 112.662 6.628  19.187  1.00 64.63  ? 620 TRP E CB  1 
ATOM   658  N N   . HIS A 1 172 ? 109.821 6.104  19.867  1.00 70.38  ? 621 HIS E N   1 
ATOM   659  C CA  . HIS A 1 172 ? 108.782 5.573  20.750  1.00 70.85  ? 621 HIS E CA  1 
ATOM   660  C C   . HIS A 1 172 ? 107.623 4.885  20.023  1.00 72.81  ? 621 HIS E C   1 
ATOM   661  O O   . HIS A 1 172 ? 106.964 4.015  20.590  1.00 75.06  ? 621 HIS E O   1 
ATOM   662  C CB  . HIS A 1 172 ? 108.217 6.694  21.627  1.00 72.59  ? 621 HIS E CB  1 
ATOM   663  C CG  . HIS A 1 172 ? 109.183 7.226  22.641  1.00 70.15  ? 621 HIS E CG  1 
ATOM   664  N ND1 . HIS A 1 172 ? 108.865 8.252  23.503  1.00 69.59  ? 621 HIS E ND1 1 
ATOM   665  C CD2 . HIS A 1 172 ? 110.456 6.869  22.936  1.00 76.71  ? 621 HIS E CD2 1 
ATOM   666  C CE1 . HIS A 1 172 ? 109.897 8.504  24.287  1.00 70.13  ? 621 HIS E CE1 1 
ATOM   667  N NE2 . HIS A 1 172 ? 110.876 7.679  23.965  1.00 74.10  ? 621 HIS E NE2 1 
ATOM   668  N N   . TYR A 1 173 ? 107.360 5.284  18.783  1.00 73.35  ? 622 TYR E N   1 
ATOM   669  C CA  . TYR A 1 173 ? 106.242 4.726  18.021  1.00 72.33  ? 622 TYR E CA  1 
ATOM   670  C C   . TYR A 1 173 ? 106.624 4.521  16.558  1.00 75.04  ? 622 TYR E C   1 
ATOM   671  O O   . TYR A 1 173 ? 106.258 5.320  15.694  1.00 76.77  ? 622 TYR E O   1 
ATOM   672  C CB  . TYR A 1 173 ? 105.015 5.637  18.126  1.00 71.35  ? 622 TYR E CB  1 
ATOM   673  C CG  . TYR A 1 173 ? 104.474 5.775  19.538  1.00 76.94  ? 622 TYR E CG  1 
ATOM   674  C CD1 . TYR A 1 173 ? 103.541 4.869  20.035  1.00 74.76  ? 622 TYR E CD1 1 
ATOM   675  C CD2 . TYR A 1 173 ? 104.894 6.808  20.374  1.00 70.23  ? 622 TYR E CD2 1 
ATOM   676  C CE1 . TYR A 1 173 ? 103.044 4.983  21.319  1.00 67.00  ? 622 TYR E CE1 1 
ATOM   677  C CE2 . TYR A 1 173 ? 104.400 6.927  21.665  1.00 69.87  ? 622 TYR E CE2 1 
ATOM   678  C CZ  . TYR A 1 173 ? 103.476 6.008  22.128  1.00 67.92  ? 622 TYR E CZ  1 
ATOM   679  O OH  . TYR A 1 173 ? 102.974 6.109  23.404  1.00 72.61  ? 622 TYR E OH  1 
ATOM   680  N N   . PRO A 1 174 ? 107.363 3.440  16.275  1.00 77.42  ? 623 PRO E N   1 
ATOM   681  C CA  . PRO A 1 174 ? 107.910 3.206  14.935  1.00 74.20  ? 623 PRO E CA  1 
ATOM   682  C C   . PRO A 1 174 ? 106.850 2.759  13.941  1.00 74.57  ? 623 PRO E C   1 
ATOM   683  O O   . PRO A 1 174 ? 106.945 3.085  12.763  1.00 79.89  ? 623 PRO E O   1 
ATOM   684  C CB  . PRO A 1 174 ? 108.942 2.098  15.165  1.00 71.38  ? 623 PRO E CB  1 
ATOM   685  C CG  . PRO A 1 174 ? 109.128 2.028  16.668  1.00 72.14  ? 623 PRO E CG  1 
ATOM   686  C CD  . PRO A 1 174 ? 107.812 2.416  17.229  1.00 76.33  ? 623 PRO E CD  1 
ATOM   687  N N   . CYS A 1 175 ? 105.840 2.040  14.414  1.00 67.75  ? 624 CYS E N   1 
ATOM   688  C CA  . CYS A 1 175 ? 104.774 1.563  13.542  1.00 73.66  ? 624 CYS E CA  1 
ATOM   689  C C   . CYS A 1 175 ? 104.046 2.689  12.803  1.00 77.47  ? 624 CYS E C   1 
ATOM   690  O O   . CYS A 1 175 ? 103.276 2.437  11.877  1.00 78.08  ? 624 CYS E O   1 
ATOM   691  C CB  . CYS A 1 175 ? 103.770 0.749  14.355  1.00 82.86  ? 624 CYS E CB  1 
ATOM   692  S SG  . CYS A 1 175 ? 103.085 1.623  15.783  1.00 98.52  ? 624 CYS E SG  1 
ATOM   693  N N   . THR A 1 176 ? 104.310 3.928  13.205  1.00 77.84  ? 625 THR E N   1 
ATOM   694  C CA  . THR A 1 176 ? 103.545 5.078  12.735  1.00 77.99  ? 625 THR E CA  1 
ATOM   695  C C   . THR A 1 176 ? 104.269 5.922  11.698  1.00 75.54  ? 625 THR E C   1 
ATOM   696  O O   . THR A 1 176 ? 103.818 7.008  11.359  1.00 74.52  ? 625 THR E O   1 
ATOM   697  C CB  . THR A 1 176 ? 103.174 5.989  13.907  1.00 76.15  ? 625 THR E CB  1 
ATOM   698  O OG1 . THR A 1 176 ? 104.364 6.587  14.434  1.00 69.19  ? 625 THR E OG1 1 
ATOM   699  C CG2 . THR A 1 176 ? 102.482 5.185  15.003  1.00 73.80  ? 625 THR E CG2 1 
ATOM   700  N N   . VAL A 1 177 ? 105.392 5.426  11.196  1.00 79.85  ? 626 VAL E N   1 
ATOM   701  C CA  . VAL A 1 177 ? 106.182 6.168  10.220  1.00 79.07  ? 626 VAL E CA  1 
ATOM   702  C C   . VAL A 1 177 ? 105.433 6.383  8.903   1.00 78.35  ? 626 VAL E C   1 
ATOM   703  O O   . VAL A 1 177 ? 105.831 7.207  8.087   1.00 78.77  ? 626 VAL E O   1 
ATOM   704  C CB  . VAL A 1 177 ? 107.507 5.453  9.924   1.00 83.54  ? 626 VAL E CB  1 
ATOM   705  C CG1 . VAL A 1 177 ? 107.296 4.347  8.897   1.00 82.09  ? 626 VAL E CG1 1 
ATOM   706  C CG2 . VAL A 1 177 ? 108.537 6.445  9.428   1.00 85.95  ? 626 VAL E CG2 1 
ATOM   707  N N   . ASN A 1 178 ? 104.351 5.641  8.695   1.00 77.41  ? 627 ASN E N   1 
ATOM   708  C CA  . ASN A 1 178 ? 103.553 5.792  7.486   1.00 81.25  ? 627 ASN E CA  1 
ATOM   709  C C   . ASN A 1 178 ? 102.484 6.869  7.663   1.00 78.77  ? 627 ASN E C   1 
ATOM   710  O O   . ASN A 1 178 ? 101.771 7.222  6.722   1.00 79.23  ? 627 ASN E O   1 
ATOM   711  C CB  . ASN A 1 178 ? 102.909 4.454  7.098   1.00 82.70  ? 627 ASN E CB  1 
ATOM   712  C CG  . ASN A 1 178 ? 103.936 3.411  6.662   1.00 94.02  ? 627 ASN E CG  1 
ATOM   713  O OD1 . ASN A 1 178 ? 105.050 3.751  6.259   1.00 84.57  ? 627 ASN E OD1 1 
ATOM   714  N ND2 . ASN A 1 178 ? 103.558 2.136  6.735   1.00 94.37  ? 627 ASN E ND2 1 
ATOM   715  N N   . TYR A 1 179 ? 102.391 7.398  8.878   1.00 74.80  ? 628 TYR E N   1 
ATOM   716  C CA  . TYR A 1 179 ? 101.330 8.339  9.233   1.00 72.93  ? 628 TYR E CA  1 
ATOM   717  C C   . TYR A 1 179 ? 101.524 9.707  8.603   1.00 69.07  ? 628 TYR E C   1 
ATOM   718  O O   . TYR A 1 179 ? 102.621 10.266 8.639   1.00 75.32  ? 628 TYR E O   1 
ATOM   719  C CB  . TYR A 1 179 ? 101.242 8.492  10.752  1.00 68.41  ? 628 TYR E CB  1 
ATOM   720  C CG  . TYR A 1 179 ? 100.580 7.323  11.442  1.00 75.85  ? 628 TYR E CG  1 
ATOM   721  C CD1 . TYR A 1 179 ? 100.296 6.151  10.745  1.00 78.37  ? 628 TYR E CD1 1 
ATOM   722  C CD2 . TYR A 1 179 ? 100.190 7.406  12.775  1.00 72.61  ? 628 TYR E CD2 1 
ATOM   723  C CE1 . TYR A 1 179 ? 99.669  5.087  11.360  1.00 81.84  ? 628 TYR E CE1 1 
ATOM   724  C CE2 . TYR A 1 179 ? 99.557  6.345  13.400  1.00 77.22  ? 628 TYR E CE2 1 
ATOM   725  C CZ  . TYR A 1 179 ? 99.299  5.186  12.686  1.00 82.37  ? 628 TYR E CZ  1 
ATOM   726  O OH  . TYR A 1 179 ? 98.673  4.122  13.293  1.00 80.84  ? 628 TYR E OH  1 
ATOM   727  N N   . THR A 1 180 ? 100.458 10.257 8.040   1.00 60.31  ? 629 THR E N   1 
ATOM   728  C CA  . THR A 1 180 ? 100.524 11.619 7.534   1.00 65.74  ? 629 THR E CA  1 
ATOM   729  C C   . THR A 1 180 ? 100.481 12.638 8.668   1.00 62.75  ? 629 THR E C   1 
ATOM   730  O O   . THR A 1 180 ? 99.651  12.533 9.568   1.00 62.68  ? 629 THR E O   1 
ATOM   731  C CB  . THR A 1 180 ? 99.385  11.913 6.579   1.00 68.33  ? 629 THR E CB  1 
ATOM   732  O OG1 . THR A 1 180 ? 99.281  10.846 5.632   1.00 76.09  ? 629 THR E OG1 1 
ATOM   733  C CG2 . THR A 1 180 ? 99.643  13.231 5.851   1.00 70.71  ? 629 THR E CG2 1 
ATOM   734  N N   . ILE A 1 181 ? 101.372 13.624 8.625   1.00 62.84  ? 630 ILE E N   1 
ATOM   735  C CA  . ILE A 1 181 ? 101.388 14.663 9.652   1.00 60.55  ? 630 ILE E CA  1 
ATOM   736  C C   . ILE A 1 181 ? 100.532 15.872 9.283   1.00 55.52  ? 630 ILE E C   1 
ATOM   737  O O   . ILE A 1 181 ? 100.560 16.349 8.151   1.00 51.28  ? 630 ILE E O   1 
ATOM   738  C CB  . ILE A 1 181 ? 102.818 15.148 9.963   1.00 56.16  ? 630 ILE E CB  1 
ATOM   739  C CG1 . ILE A 1 181 ? 103.621 15.341 8.683   1.00 62.02  ? 630 ILE E CG1 1 
ATOM   740  C CG2 . ILE A 1 181 ? 103.533 14.156 10.850  1.00 57.52  ? 630 ILE E CG2 1 
ATOM   741  C CD1 . ILE A 1 181 ? 105.076 15.677 8.948   1.00 61.33  ? 630 ILE E CD1 1 
ATOM   742  N N   . PHE A 1 182 ? 99.771  16.341 10.273  1.00 53.85  ? 631 PHE E N   1 
ATOM   743  C CA  . PHE A 1 182 ? 98.903  17.513 10.172  1.00 49.41  ? 631 PHE E CA  1 
ATOM   744  C C   . PHE A 1 182 ? 99.155  18.504 11.309  1.00 45.95  ? 631 PHE E C   1 
ATOM   745  O O   . PHE A 1 182 ? 99.373  18.094 12.451  1.00 46.73  ? 631 PHE E O   1 
ATOM   746  C CB  . PHE A 1 182 ? 97.430  17.103 10.223  1.00 51.04  ? 631 PHE E CB  1 
ATOM   747  C CG  . PHE A 1 182 ? 96.934  16.460 8.977   1.00 58.56  ? 631 PHE E CG  1 
ATOM   748  C CD1 . PHE A 1 182 ? 96.501  17.234 7.907   1.00 64.56  ? 631 PHE E CD1 1 
ATOM   749  C CD2 . PHE A 1 182 ? 96.873  15.077 8.874   1.00 66.00  ? 631 PHE E CD2 1 
ATOM   750  C CE1 . PHE A 1 182 ? 96.025  16.643 6.739   1.00 68.26  ? 631 PHE E CE1 1 
ATOM   751  C CE2 . PHE A 1 182 ? 96.402  14.475 7.716   1.00 70.19  ? 631 PHE E CE2 1 
ATOM   752  C CZ  . PHE A 1 182 ? 95.975  15.261 6.644   1.00 75.80  ? 631 PHE E CZ  1 
ATOM   753  N N   . LYS A 1 183 ? 99.084  19.799 11.015  1.00 39.71  ? 632 LYS E N   1 
ATOM   754  C CA  . LYS A 1 183 ? 99.100  20.807 12.071  1.00 37.75  ? 632 LYS E CA  1 
ATOM   755  C C   . LYS A 1 183 ? 97.691  21.055 12.612  1.00 34.31  ? 632 LYS E C   1 
ATOM   756  O O   . LYS A 1 183 ? 96.761  21.284 11.852  1.00 35.49  ? 632 LYS E O   1 
ATOM   757  C CB  . LYS A 1 183 ? 99.687  22.115 11.560  1.00 34.47  ? 632 LYS E CB  1 
ATOM   758  C CG  . LYS A 1 183 ? 101.039 21.980 10.912  1.00 39.02  ? 632 LYS E CG  1 
ATOM   759  C CD  . LYS A 1 183 ? 101.616 23.354 10.594  1.00 36.41  ? 632 LYS E CD  1 
ATOM   760  C CE  . LYS A 1 183 ? 102.857 23.244 9.768   1.00 33.72  ? 632 LYS E CE  1 
ATOM   761  N NZ  . LYS A 1 183 ? 103.877 22.473 10.497  1.00 39.39  ? 632 LYS E NZ  1 
ATOM   762  N N   . ILE A 1 184 ? 97.532  21.032 13.925  1.00 33.44  ? 633 ILE E N   1 
ATOM   763  C CA  . ILE A 1 184 ? 96.207  21.199 14.502  1.00 35.41  ? 633 ILE E CA  1 
ATOM   764  C C   . ILE A 1 184 ? 96.198  22.194 15.659  1.00 36.18  ? 633 ILE E C   1 
ATOM   765  O O   . ILE A 1 184 ? 97.259  22.633 16.118  1.00 36.09  ? 633 ILE E O   1 
ATOM   766  C CB  . ILE A 1 184 ? 95.635  19.847 15.000  1.00 34.84  ? 633 ILE E CB  1 
ATOM   767  C CG1 . ILE A 1 184 ? 96.590  19.190 15.995  1.00 36.83  ? 633 ILE E CG1 1 
ATOM   768  C CG2 . ILE A 1 184 ? 95.433  18.918 13.848  1.00 35.73  ? 633 ILE E CG2 1 
ATOM   769  C CD1 . ILE A 1 184 ? 95.924  18.204 16.907  1.00 31.83  ? 633 ILE E CD1 1 
ATOM   770  N N   . ARG A 1 185 ? 94.991  22.552 16.105  1.00 34.30  ? 634 ARG E N   1 
ATOM   771  C CA  . ARG A 1 185 ? 94.798  23.441 17.251  1.00 35.38  ? 634 ARG E CA  1 
ATOM   772  C C   . ARG A 1 185 ? 93.965  22.743 18.294  1.00 36.72  ? 634 ARG E C   1 
ATOM   773  O O   . ARG A 1 185 ? 93.073  21.976 17.952  1.00 33.20  ? 634 ARG E O   1 
ATOM   774  C CB  . ARG A 1 185 ? 94.084  24.734 16.861  1.00 33.80  ? 634 ARG E CB  1 
ATOM   775  C CG  . ARG A 1 185 ? 94.489  25.325 15.544  1.00 35.95  ? 634 ARG E CG  1 
ATOM   776  C CD  . ARG A 1 185 ? 93.420  26.284 15.065  1.00 35.09  ? 634 ARG E CD  1 
ATOM   777  N NE  . ARG A 1 185 ? 93.281  27.432 15.953  1.00 31.47  ? 634 ARG E NE  1 
ATOM   778  C CZ  . ARG A 1 185 ? 92.277  28.307 15.894  1.00 37.75  ? 634 ARG E CZ  1 
ATOM   779  N NH1 . ARG A 1 185 ? 91.316  28.165 14.980  1.00 35.00  ? 634 ARG E NH1 1 
ATOM   780  N NH2 . ARG A 1 185 ? 92.241  29.336 16.743  1.00 38.81  ? 634 ARG E NH2 1 
ATOM   781  N N   . MET A 1 186 ? 94.223  23.041 19.563  1.00 33.42  ? 635 MET E N   1 
ATOM   782  C CA  . MET A 1 186 ? 93.466  22.419 20.633  1.00 39.46  ? 635 MET E CA  1 
ATOM   783  C C   . MET A 1 186 ? 93.322  23.312 21.873  1.00 41.54  ? 635 MET E C   1 
ATOM   784  O O   . MET A 1 186 ? 94.290  23.928 22.324  1.00 38.63  ? 635 MET E O   1 
ATOM   785  C CB  . MET A 1 186 ? 94.123  21.101 21.012  1.00 41.87  ? 635 MET E CB  1 
ATOM   786  C CG  . MET A 1 186 ? 93.242  20.222 21.830  1.00 48.48  ? 635 MET E CG  1 
ATOM   787  S SD  . MET A 1 186 ? 93.935  18.567 21.940  1.00 70.79  ? 635 MET E SD  1 
ATOM   788  C CE  . MET A 1 186 ? 92.480  17.713 22.534  1.00 71.87  ? 635 MET E CE  1 
ATOM   789  N N   . TYR A 1 187 ? 92.109  23.375 22.419  1.00 37.50  ? 636 TYR E N   1 
ATOM   790  C CA  . TYR A 1 187 ? 91.872  24.134 23.635  1.00 41.00  ? 636 TYR E CA  1 
ATOM   791  C C   . TYR A 1 187 ? 91.798  23.287 24.884  1.00 40.03  ? 636 TYR E C   1 
ATOM   792  O O   . TYR A 1 187 ? 91.021  22.347 24.955  1.00 44.71  ? 636 TYR E O   1 
ATOM   793  C CB  . TYR A 1 187 ? 90.592  24.929 23.508  1.00 39.99  ? 636 TYR E CB  1 
ATOM   794  C CG  . TYR A 1 187 ? 90.735  26.035 22.531  1.00 42.45  ? 636 TYR E CG  1 
ATOM   795  C CD1 . TYR A 1 187 ? 90.380  25.853 21.201  1.00 45.55  ? 636 TYR E CD1 1 
ATOM   796  C CD2 . TYR A 1 187 ? 91.261  27.263 22.924  1.00 40.34  ? 636 TYR E CD2 1 
ATOM   797  C CE1 . TYR A 1 187 ? 90.531  26.872 20.281  1.00 48.37  ? 636 TYR E CE1 1 
ATOM   798  C CE2 . TYR A 1 187 ? 91.416  28.279 22.019  1.00 40.05  ? 636 TYR E CE2 1 
ATOM   799  C CZ  . TYR A 1 187 ? 91.048  28.082 20.697  1.00 45.63  ? 636 TYR E CZ  1 
ATOM   800  O OH  . TYR A 1 187 ? 91.189  29.105 19.783  1.00 56.93  ? 636 TYR E OH  1 
ATOM   801  N N   . VAL A 1 188 ? 92.601  23.641 25.877  1.00 40.75  ? 637 VAL E N   1 
ATOM   802  C CA  . VAL A 1 188 ? 92.553  22.963 27.166  1.00 43.56  ? 637 VAL E CA  1 
ATOM   803  C C   . VAL A 1 188 ? 92.348  23.983 28.268  1.00 42.06  ? 637 VAL E C   1 
ATOM   804  O O   . VAL A 1 188 ? 93.194  24.840 28.477  1.00 40.04  ? 637 VAL E O   1 
ATOM   805  C CB  . VAL A 1 188 ? 93.829  22.178 27.436  1.00 41.56  ? 637 VAL E CB  1 
ATOM   806  C CG1 . VAL A 1 188 ? 93.708  21.406 28.751  1.00 42.53  ? 637 VAL E CG1 1 
ATOM   807  C CG2 . VAL A 1 188 ? 94.102  21.246 26.281  1.00 44.93  ? 637 VAL E CG2 1 
ATOM   808  N N   . GLY A 1 189 ? 91.218  23.902 28.957  1.00 39.16  ? 638 GLY E N   1 
ATOM   809  C CA  . GLY A 1 189 ? 90.887  24.878 29.974  1.00 38.30  ? 638 GLY E CA  1 
ATOM   810  C C   . GLY A 1 189 ? 90.947  26.293 29.430  1.00 40.25  ? 638 GLY E C   1 
ATOM   811  O O   . GLY A 1 189 ? 91.376  27.216 30.116  1.00 41.81  ? 638 GLY E O   1 
ATOM   812  N N   . GLY A 1 190 ? 90.543  26.454 28.175  1.00 41.83  ? 639 GLY E N   1 
ATOM   813  C CA  . GLY A 1 190 ? 90.507  27.754 27.538  1.00 39.55  ? 639 GLY E CA  1 
ATOM   814  C C   . GLY A 1 190 ? 91.838  28.300 27.048  1.00 41.96  ? 639 GLY E C   1 
ATOM   815  O O   . GLY A 1 190 ? 91.898  29.448 26.585  1.00 39.79  ? 639 GLY E O   1 
ATOM   816  N N   . VAL A 1 191 ? 92.913  27.523 27.146  1.00 35.88  ? 640 VAL E N   1 
ATOM   817  C CA  . VAL A 1 191 ? 94.154  28.003 26.556  1.00 37.65  ? 640 VAL E CA  1 
ATOM   818  C C   . VAL A 1 191 ? 94.448  27.178 25.311  1.00 38.80  ? 640 VAL E C   1 
ATOM   819  O O   . VAL A 1 191 ? 94.281  25.955 25.304  1.00 40.27  ? 640 VAL E O   1 
ATOM   820  C CB  . VAL A 1 191 ? 95.370  27.986 27.555  1.00 42.92  ? 640 VAL E CB  1 
ATOM   821  C CG1 . VAL A 1 191 ? 95.587  26.633 28.176  1.00 44.13  ? 640 VAL E CG1 1 
ATOM   822  C CG2 . VAL A 1 191 ? 96.665  28.452 26.857  1.00 37.42  ? 640 VAL E CG2 1 
ATOM   823  N N   . GLU A 1 192 ? 94.854  27.871 24.250  1.00 36.65  ? 641 GLU E N   1 
ATOM   824  C CA  . GLU A 1 192 ? 95.116  27.256 22.964  1.00 36.25  ? 641 GLU E CA  1 
ATOM   825  C C   . GLU A 1 192 ? 96.500  26.589 22.851  1.00 34.43  ? 641 GLU E C   1 
ATOM   826  O O   . GLU A 1 192 ? 97.515  27.184 23.173  1.00 33.42  ? 641 GLU E O   1 
ATOM   827  C CB  . GLU A 1 192 ? 94.968  28.290 21.862  1.00 34.75  ? 641 GLU E CB  1 
ATOM   828  C CG  . GLU A 1 192 ? 95.166  27.705 20.472  1.00 36.34  ? 641 GLU E CG  1 
ATOM   829  C CD  . GLU A 1 192 ? 94.826  28.691 19.405  1.00 37.48  ? 641 GLU E CD  1 
ATOM   830  O OE1 . GLU A 1 192 ? 94.461  29.829 19.765  1.00 43.33  ? 641 GLU E OE1 1 
ATOM   831  O OE2 . GLU A 1 192 ? 94.920  28.338 18.217  1.00 37.32  ? 641 GLU E OE2 1 
ATOM   832  N N   . HIS A 1 193 ? 96.505  25.338 22.406  1.00 32.52  ? 642 HIS E N   1 
ATOM   833  C CA  . HIS A 1 193 ? 97.728  24.609 22.114  1.00 31.98  ? 642 HIS E CA  1 
ATOM   834  C C   . HIS A 1 193 ? 97.812  24.368 20.624  1.00 34.29  ? 642 HIS E C   1 
ATOM   835  O O   . HIS A 1 193 ? 96.804  24.077 19.966  1.00 33.64  ? 642 HIS E O   1 
ATOM   836  C CB  . HIS A 1 193 ? 97.781  23.267 22.840  1.00 34.34  ? 642 HIS E CB  1 
ATOM   837  C CG  . HIS A 1 193 ? 97.855  23.373 24.328  1.00 35.13  ? 642 HIS E CG  1 
ATOM   838  N ND1 . HIS A 1 193 ? 98.923  22.892 25.053  1.00 38.44  ? 642 HIS E ND1 1 
ATOM   839  C CD2 . HIS A 1 193 ? 96.976  23.863 25.235  1.00 39.54  ? 642 HIS E CD2 1 
ATOM   840  C CE1 . HIS A 1 193 ? 98.715  23.103 26.340  1.00 35.72  ? 642 HIS E CE1 1 
ATOM   841  N NE2 . HIS A 1 193 ? 97.535  23.682 26.478  1.00 39.67  ? 642 HIS E NE2 1 
ATOM   842  N N   . ARG A 1 194 ? 99.023  24.502 20.097  1.00 35.22  ? 643 ARG E N   1 
ATOM   843  C CA  . ARG A 1 194 ? 99.321  24.241 18.699  1.00 32.82  ? 643 ARG E CA  1 
ATOM   844  C C   . ARG A 1 194 ? 100.160 22.994 18.640  1.00 37.84  ? 643 ARG E C   1 
ATOM   845  O O   . ARG A 1 194 ? 101.237 22.960 19.217  1.00 40.49  ? 643 ARG E O   1 
ATOM   846  C CB  . ARG A 1 194 ? 100.080 25.416 18.063  1.00 31.57  ? 643 ARG E CB  1 
ATOM   847  C CG  . ARG A 1 194 ? 99.263  26.659 17.968  1.00 32.92  ? 643 ARG E CG  1 
ATOM   848  C CD  . ARG A 1 194 ? 97.991  26.360 17.200  1.00 32.79  ? 643 ARG E CD  1 
ATOM   849  N NE  . ARG A 1 194 ? 97.256  27.573 16.979  1.00 38.14  ? 643 ARG E NE  1 
ATOM   850  C CZ  . ARG A 1 194 ? 96.958  28.094 15.799  1.00 34.08  ? 643 ARG E CZ  1 
ATOM   851  N NH1 . ARG A 1 194 ? 97.294  27.501 14.662  1.00 25.47  ? 643 ARG E NH1 1 
ATOM   852  N NH2 . ARG A 1 194 ? 96.289  29.226 15.789  1.00 31.04  ? 643 ARG E NH2 1 
ATOM   853  N N   . LEU A 1 195 ? 99.673  21.977 17.941  1.00 41.50  ? 644 LEU E N   1 
ATOM   854  C CA  . LEU A 1 195 ? 100.346 20.690 17.875  1.00 35.58  ? 644 LEU E CA  1 
ATOM   855  C C   . LEU A 1 195 ? 100.443 20.178 16.457  1.00 37.88  ? 644 LEU E C   1 
ATOM   856  O O   . LEU A 1 195 ? 99.677  20.554 15.576  1.00 35.33  ? 644 LEU E O   1 
ATOM   857  C CB  . LEU A 1 195 ? 99.607  19.642 18.704  1.00 41.23  ? 644 LEU E CB  1 
ATOM   858  C CG  . LEU A 1 195 ? 99.006  19.981 20.067  1.00 42.65  ? 644 LEU E CG  1 
ATOM   859  C CD1 . LEU A 1 195 ? 98.069  18.854 20.495  1.00 44.94  ? 644 LEU E CD1 1 
ATOM   860  C CD2 . LEU A 1 195 ? 100.103 20.150 21.076  1.00 40.10  ? 644 LEU E CD2 1 
ATOM   861  N N   . THR A 1 196 ? 101.385 19.281 16.244  1.00 43.81  ? 645 THR E N   1 
ATOM   862  C CA  . THR A 1 196 ? 101.396 18.545 15.005  1.00 43.84  ? 645 THR E CA  1 
ATOM   863  C C   . THR A 1 196 ? 100.936 17.129 15.324  1.00 43.72  ? 645 THR E C   1 
ATOM   864  O O   . THR A 1 196 ? 101.332 16.559 16.333  1.00 45.43  ? 645 THR E O   1 
ATOM   865  C CB  . THR A 1 196 ? 102.776 18.576 14.359  1.00 42.23  ? 645 THR E CB  1 
ATOM   866  O OG1 . THR A 1 196 ? 103.143 19.945 14.143  1.00 39.46  ? 645 THR E OG1 1 
ATOM   867  C CG2 . THR A 1 196 ? 102.749 17.854 13.037  1.00 41.75  ? 645 THR E CG2 1 
ATOM   868  N N   . ALA A 1 197 ? 100.057 16.588 14.488  1.00 46.98  ? 646 ALA E N   1 
ATOM   869  C CA  . ALA A 1 197 ? 99.545  15.229 14.674  1.00 52.64  ? 646 ALA E CA  1 
ATOM   870  C C   . ALA A 1 197 ? 99.831  14.346 13.468  1.00 51.28  ? 646 ALA E C   1 
ATOM   871  O O   . ALA A 1 197 ? 99.675  14.771 12.326  1.00 50.88  ? 646 ALA E O   1 
ATOM   872  C CB  . ALA A 1 197 ? 98.049  15.252 14.946  1.00 43.84  ? 646 ALA E CB  1 
ATOM   873  N N   . ALA A 1 198 ? 100.241 13.115 13.737  1.00 50.52  ? 647 ALA E N   1 
ATOM   874  C CA  . ALA A 1 198 ? 100.393 12.107 12.696  1.00 57.21  ? 647 ALA E CA  1 
ATOM   875  C C   . ALA A 1 198 ? 99.214  11.140 12.746  1.00 58.05  ? 647 ALA E C   1 
ATOM   876  O O   . ALA A 1 198 ? 98.945  10.529 13.783  1.00 56.02  ? 647 ALA E O   1 
ATOM   877  C CB  . ALA A 1 198 ? 101.699 11.376 12.863  1.00 62.05  ? 647 ALA E CB  1 
ATOM   878  N N   . CYS A 1 199 ? 98.504  11.018 11.629  1.00 65.10  ? 648 CYS E N   1 
ATOM   879  C CA  . CYS A 1 199 ? 97.256  10.253 11.595  1.00 70.66  ? 648 CYS E CA  1 
ATOM   880  C C   . CYS A 1 199 ? 97.279  9.031  10.683  1.00 72.23  ? 648 CYS E C   1 
ATOM   881  O O   . CYS A 1 199 ? 98.086  8.143  10.863  1.00 69.78  ? 648 CYS E O   1 
ATOM   882  C CB  . CYS A 1 199 ? 96.096  11.159 11.189  1.00 70.31  ? 648 CYS E CB  1 
ATOM   883  S SG  . CYS A 1 199 ? 95.182  11.770 12.616  1.00 73.22  ? 648 CYS E SG  1 
ATOM   884  N N   . ASN A 1 200 ? 96.364  8.971  9.724   1.00 77.77  ? 649 ASN E N   1 
ATOM   885  C CA  . ASN A 1 200 ? 96.236  7.773  8.905   1.00 73.31  ? 649 ASN E CA  1 
ATOM   886  C C   . ASN A 1 200 ? 95.331  7.982  7.700   1.00 74.70  ? 649 ASN E C   1 
ATOM   887  O O   . ASN A 1 200 ? 94.375  7.238  7.500   1.00 81.43  ? 649 ASN E O   1 
ATOM   888  C CB  . ASN A 1 200 ? 95.708  6.612  9.748   1.00 74.64  ? 649 ASN E CB  1 
ATOM   889  C CG  . ASN A 1 200 ? 96.201  5.270  9.252   1.00 88.74  ? 649 ASN E CG  1 
ATOM   890  O OD1 . ASN A 1 200 ? 97.038  5.209  8.353   1.00 91.12  ? 649 ASN E OD1 1 
ATOM   891  N ND2 . ASN A 1 200 ? 95.694  4.185  9.837   1.00 90.03  ? 649 ASN E ND2 1 
ATOM   892  N N   . GLU B 2 20  ? 98.633  31.594 25.369  1.00 52.54  ? 1   GLU H N   1 
ATOM   893  C CA  . GLU B 2 20  ? 97.949  32.422 24.381  1.00 51.04  ? 1   GLU H CA  1 
ATOM   894  C C   . GLU B 2 20  ? 98.788  32.622 23.124  1.00 51.32  ? 1   GLU H C   1 
ATOM   895  O O   . GLU B 2 20  ? 99.982  32.929 23.207  1.00 50.24  ? 1   GLU H O   1 
ATOM   896  C CB  . GLU B 2 20  ? 97.581  33.781 24.968  1.00 50.77  ? 1   GLU H CB  1 
ATOM   897  C CG  . GLU B 2 20  ? 96.970  34.735 23.936  1.00 56.78  ? 1   GLU H CG  1 
ATOM   898  C CD  . GLU B 2 20  ? 96.283  35.931 24.568  1.00 64.23  ? 1   GLU H CD  1 
ATOM   899  O OE1 . GLU B 2 20  ? 96.969  36.751 25.220  1.00 67.97  ? 1   GLU H OE1 1 
ATOM   900  O OE2 . GLU B 2 20  ? 95.049  36.047 24.417  1.00 69.66  ? 1   GLU H OE2 1 
ATOM   901  N N   . VAL B 2 21  ? 98.145  32.445 21.969  1.00 46.11  ? 2   VAL H N   1 
ATOM   902  C CA  . VAL B 2 21  ? 98.790  32.596 20.670  1.00 42.08  ? 2   VAL H CA  1 
ATOM   903  C C   . VAL B 2 21  ? 98.882  34.077 20.297  1.00 40.02  ? 2   VAL H C   1 
ATOM   904  O O   . VAL B 2 21  ? 97.872  34.742 20.122  1.00 40.68  ? 2   VAL H O   1 
ATOM   905  C CB  . VAL B 2 21  ? 98.026  31.840 19.548  1.00 36.90  ? 2   VAL H CB  1 
ATOM   906  C CG1 . VAL B 2 21  ? 98.634  32.156 18.208  1.00 31.75  ? 2   VAL H CG1 1 
ATOM   907  C CG2 . VAL B 2 21  ? 98.013  30.334 19.793  1.00 34.41  ? 2   VAL H CG2 1 
ATOM   908  N N   . GLN B 2 22  ? 100.102 34.564 20.143  1.00 36.03  ? 3   GLN H N   1 
ATOM   909  C CA  . GLN B 2 22  ? 100.362 35.972 19.955  1.00 34.28  ? 3   GLN H CA  1 
ATOM   910  C C   . GLN B 2 22  ? 101.404 36.201 18.857  1.00 33.80  ? 3   GLN H C   1 
ATOM   911  O O   . GLN B 2 22  ? 102.387 35.471 18.737  1.00 29.70  ? 3   GLN H O   1 
ATOM   912  C CB  . GLN B 2 22  ? 100.818 36.575 21.282  1.00 39.25  ? 3   GLN H CB  1 
ATOM   913  C CG  . GLN B 2 22  ? 101.496 37.917 21.172  1.00 51.08  ? 3   GLN H CG  1 
ATOM   914  C CD  . GLN B 2 22  ? 102.014 38.429 22.518  1.00 62.84  ? 3   GLN H CD  1 
ATOM   915  O OE1 . GLN B 2 22  ? 101.280 38.455 23.507  1.00 70.03  ? 3   GLN H OE1 1 
ATOM   916  N NE2 . GLN B 2 22  ? 103.285 38.840 22.555  1.00 59.09  ? 3   GLN H NE2 1 
ATOM   917  N N   . LEU B 2 23  ? 101.183 37.223 18.046  1.00 34.58  ? 4   LEU H N   1 
ATOM   918  C CA  . LEU B 2 23  ? 102.113 37.549 16.984  1.00 27.58  ? 4   LEU H CA  1 
ATOM   919  C C   . LEU B 2 23  ? 102.533 38.993 17.098  1.00 31.01  ? 4   LEU H C   1 
ATOM   920  O O   . LEU B 2 23  ? 101.727 39.895 16.934  1.00 37.04  ? 4   LEU H O   1 
ATOM   921  C CB  . LEU B 2 23  ? 101.503 37.296 15.613  1.00 24.49  ? 4   LEU H CB  1 
ATOM   922  C CG  . LEU B 2 23  ? 101.204 35.817 15.335  1.00 33.13  ? 4   LEU H CG  1 
ATOM   923  C CD1 . LEU B 2 23  ? 100.399 35.644 14.040  1.00 31.18  ? 4   LEU H CD1 1 
ATOM   924  C CD2 . LEU B 2 23  ? 102.503 35.006 15.292  1.00 28.16  ? 4   LEU H CD2 1 
ATOM   925  N N   . GLN B 2 24  ? 103.813 39.203 17.351  1.00 31.75  ? 5   GLN H N   1 
ATOM   926  C CA  . GLN B 2 24  ? 104.368 40.535 17.489  1.00 37.05  ? 5   GLN H CA  1 
ATOM   927  C C   . GLN B 2 24  ? 105.166 40.905 16.232  1.00 33.83  ? 5   GLN H C   1 
ATOM   928  O O   . GLN B 2 24  ? 106.161 40.250 15.885  1.00 29.22  ? 5   GLN H O   1 
ATOM   929  C CB  . GLN B 2 24  ? 105.247 40.590 18.749  1.00 38.13  ? 5   GLN H CB  1 
ATOM   930  C CG  . GLN B 2 24  ? 105.873 41.922 19.053  1.00 40.74  ? 5   GLN H CG  1 
ATOM   931  C CD  . GLN B 2 24  ? 104.904 42.858 19.726  1.00 52.20  ? 5   GLN H CD  1 
ATOM   932  O OE1 . GLN B 2 24  ? 104.577 43.920 19.195  1.00 52.30  ? 5   GLN H OE1 1 
ATOM   933  N NE2 . GLN B 2 24  ? 104.433 42.469 20.909  1.00 66.23  ? 5   GLN H NE2 1 
ATOM   934  N N   . GLN B 2 25  ? 104.730 41.954 15.548  1.00 30.43  ? 6   GLN H N   1 
ATOM   935  C CA  . GLN B 2 25  ? 105.398 42.351 14.316  1.00 29.18  ? 6   GLN H CA  1 
ATOM   936  C C   . GLN B 2 25  ? 106.349 43.512 14.564  1.00 31.64  ? 6   GLN H C   1 
ATOM   937  O O   . GLN B 2 25  ? 106.200 44.268 15.539  1.00 29.72  ? 6   GLN H O   1 
ATOM   938  C CB  . GLN B 2 25  ? 104.384 42.713 13.228  1.00 25.92  ? 6   GLN H CB  1 
ATOM   939  C CG  . GLN B 2 25  ? 103.698 41.509 12.605  1.00 26.15  ? 6   GLN H CG  1 
ATOM   940  C CD  . GLN B 2 25  ? 102.725 41.894 11.510  1.00 25.84  ? 6   GLN H CD  1 
ATOM   941  O OE1 . GLN B 2 25  ? 101.506 41.769 11.670  1.00 29.07  ? 6   GLN H OE1 1 
ATOM   942  N NE2 . GLN B 2 25  ? 103.252 42.355 10.393  1.00 26.48  ? 6   GLN H NE2 1 
ATOM   943  N N   . SER B 2 26  ? 107.336 43.626 13.680  1.00 27.80  ? 7   SER H N   1 
ATOM   944  C CA  . SER B 2 26  ? 108.336 44.681 13.754  1.00 24.80  ? 7   SER H CA  1 
ATOM   945  C C   . SER B 2 26  ? 107.730 46.032 13.404  1.00 29.61  ? 7   SER H C   1 
ATOM   946  O O   . SER B 2 26  ? 106.583 46.114 12.969  1.00 32.24  ? 7   SER H O   1 
ATOM   947  C CB  . SER B 2 26  ? 109.499 44.366 12.822  1.00 24.24  ? 7   SER H CB  1 
ATOM   948  O OG  . SER B 2 26  ? 109.034 43.931 11.556  1.00 24.09  ? 7   SER H OG  1 
ATOM   949  N N   . GLY B 2 27  ? 108.522 47.086 13.549  1.00 25.52  ? 8   GLY H N   1 
ATOM   950  C CA  . GLY B 2 27  ? 108.006 48.429 13.449  1.00 21.14  ? 8   GLY H CA  1 
ATOM   951  C C   . GLY B 2 27  ? 107.920 48.951 12.040  1.00 29.61  ? 8   GLY H C   1 
ATOM   952  O O   . GLY B 2 27  ? 108.500 48.377 11.104  1.00 29.75  ? 8   GLY H O   1 
ATOM   953  N N   . ALA B 2 28  ? 107.220 50.074 11.917  1.00 26.18  ? 9   ALA H N   1 
ATOM   954  C CA  . ALA B 2 28  ? 106.979 50.774 10.658  1.00 31.80  ? 9   ALA H CA  1 
ATOM   955  C C   . ALA B 2 28  ? 108.230 50.990 9.827   1.00 35.10  ? 9   ALA H C   1 
ATOM   956  O O   . ALA B 2 28  ? 109.319 51.178 10.366  1.00 37.07  ? 9   ALA H O   1 
ATOM   957  C CB  . ALA B 2 28  ? 106.315 52.122 10.934  1.00 32.52  ? 9   ALA H CB  1 
ATOM   958  N N   . GLU B 2 29  ? 108.054 50.997 8.508   1.00 34.20  ? 10  GLU H N   1 
ATOM   959  C CA  . GLU B 2 29  ? 109.177 51.119 7.590   1.00 32.97  ? 10  GLU H CA  1 
ATOM   960  C C   . GLU B 2 29  ? 108.938 52.178 6.528   1.00 35.48  ? 10  GLU H C   1 
ATOM   961  O O   . GLU B 2 29  ? 107.873 52.216 5.904   1.00 35.65  ? 10  GLU H O   1 
ATOM   962  C CB  . GLU B 2 29  ? 109.463 49.780 6.898   1.00 34.42  ? 10  GLU H CB  1 
ATOM   963  C CG  . GLU B 2 29  ? 109.836 48.617 7.817   1.00 36.09  ? 10  GLU H CG  1 
ATOM   964  C CD  . GLU B 2 29  ? 111.298 48.621 8.237   1.00 40.94  ? 10  GLU H CD  1 
ATOM   965  O OE1 . GLU B 2 29  ? 112.096 49.368 7.641   1.00 39.99  ? 10  GLU H OE1 1 
ATOM   966  O OE2 . GLU B 2 29  ? 111.650 47.878 9.178   1.00 47.29  ? 10  GLU H OE2 1 
ATOM   967  N N   . LEU B 2 30  ? 109.942 53.035 6.342   1.00 35.13  ? 11  LEU H N   1 
ATOM   968  C CA  . LEU B 2 30  ? 110.085 53.846 5.140   1.00 34.71  ? 11  LEU H CA  1 
ATOM   969  C C   . LEU B 2 30  ? 111.141 53.173 4.269   1.00 35.18  ? 11  LEU H C   1 
ATOM   970  O O   . LEU B 2 30  ? 112.138 52.678 4.777   1.00 35.60  ? 11  LEU H O   1 
ATOM   971  C CB  . LEU B 2 30  ? 110.484 55.280 5.475   1.00 30.93  ? 11  LEU H CB  1 
ATOM   972  C CG  . LEU B 2 30  ? 110.772 56.206 4.291   1.00 35.66  ? 11  LEU H CG  1 
ATOM   973  C CD1 . LEU B 2 30  ? 109.589 56.242 3.307   1.00 39.20  ? 11  LEU H CD1 1 
ATOM   974  C CD2 . LEU B 2 30  ? 111.071 57.604 4.797   1.00 32.89  ? 11  LEU H CD2 1 
ATOM   975  N N   . VAL B 2 31  ? 110.909 53.128 2.965   1.00 32.40  ? 12  VAL H N   1 
ATOM   976  C CA  . VAL B 2 31  ? 111.811 52.437 2.056   1.00 33.75  ? 12  VAL H CA  1 
ATOM   977  C C   . VAL B 2 31  ? 111.725 53.091 0.697   1.00 38.15  ? 12  VAL H C   1 
ATOM   978  O O   . VAL B 2 31  ? 110.620 53.364 0.211   1.00 36.43  ? 12  VAL H O   1 
ATOM   979  C CB  . VAL B 2 31  ? 111.470 50.923 1.943   1.00 37.88  ? 12  VAL H CB  1 
ATOM   980  C CG1 . VAL B 2 31  ? 109.984 50.703 1.884   1.00 36.33  ? 12  VAL H CG1 1 
ATOM   981  C CG2 . VAL B 2 31  ? 112.132 50.294 0.743   1.00 37.37  ? 12  VAL H CG2 1 
ATOM   982  N N   . LYS B 2 32  ? 112.883 53.346 0.083   1.00 38.71  ? 13  LYS H N   1 
ATOM   983  C CA  . LYS B 2 32  ? 112.926 54.020 -1.212  1.00 32.25  ? 13  LYS H CA  1 
ATOM   984  C C   . LYS B 2 32  ? 112.543 53.069 -2.325  1.00 28.79  ? 13  LYS H C   1 
ATOM   985  O O   . LYS B 2 32  ? 112.694 51.872 -2.196  1.00 27.66  ? 13  LYS H O   1 
ATOM   986  C CB  . LYS B 2 32  ? 114.310 54.623 -1.448  1.00 34.28  ? 13  LYS H CB  1 
ATOM   987  C CG  . LYS B 2 32  ? 114.578 55.715 -0.436  1.00 33.83  ? 13  LYS H CG  1 
ATOM   988  C CD  . LYS B 2 32  ? 115.880 56.438 -0.659  1.00 38.06  ? 13  LYS H CD  1 
ATOM   989  C CE  . LYS B 2 32  ? 116.254 57.208 0.615   1.00 40.64  ? 13  LYS H CE  1 
ATOM   990  N NZ  . LYS B 2 32  ? 115.391 58.408 0.876   1.00 35.30  ? 13  LYS H NZ  1 
ATOM   991  N N   . PRO B 2 33  ? 111.999 53.609 -3.412  1.00 33.47  ? 14  PRO H N   1 
ATOM   992  C CA  . PRO B 2 33  ? 111.616 52.738 -4.526  1.00 33.60  ? 14  PRO H CA  1 
ATOM   993  C C   . PRO B 2 33  ? 112.818 51.987 -5.053  1.00 34.02  ? 14  PRO H C   1 
ATOM   994  O O   . PRO B 2 33  ? 113.903 52.542 -5.120  1.00 37.27  ? 14  PRO H O   1 
ATOM   995  C CB  . PRO B 2 33  ? 111.052 53.708 -5.577  1.00 37.01  ? 14  PRO H CB  1 
ATOM   996  C CG  . PRO B 2 33  ? 111.359 55.105 -5.051  1.00 30.58  ? 14  PRO H CG  1 
ATOM   997  C CD  . PRO B 2 33  ? 111.561 55.004 -3.591  1.00 28.93  ? 14  PRO H CD  1 
ATOM   998  N N   . GLY B 2 34  ? 112.619 50.726 -5.404  1.00 36.63  ? 15  GLY H N   1 
ATOM   999  C CA  . GLY B 2 34  ? 113.706 49.912 -5.883  1.00 35.02  ? 15  GLY H CA  1 
ATOM   1000 C C   . GLY B 2 34  ? 114.352 49.195 -4.731  1.00 35.26  ? 15  GLY H C   1 
ATOM   1001 O O   . GLY B 2 34  ? 114.958 48.134 -4.903  1.00 33.92  ? 15  GLY H O   1 
ATOM   1002 N N   . ALA B 2 35  ? 114.222 49.764 -3.539  1.00 31.01  ? 16  ALA H N   1 
ATOM   1003 C CA  . ALA B 2 35  ? 114.881 49.150 -2.407  1.00 32.69  ? 16  ALA H CA  1 
ATOM   1004 C C   . ALA B 2 35  ? 114.106 47.937 -1.901  1.00 33.60  ? 16  ALA H C   1 
ATOM   1005 O O   . ALA B 2 35  ? 113.033 47.579 -2.409  1.00 34.26  ? 16  ALA H O   1 
ATOM   1006 C CB  . ALA B 2 35  ? 115.092 50.163 -1.282  1.00 30.28  ? 16  ALA H CB  1 
ATOM   1007 N N   . SER B 2 36  ? 114.679 47.309 -0.887  1.00 30.95  ? 17  SER H N   1 
ATOM   1008 C CA  . SER B 2 36  ? 114.144 46.097 -0.332  1.00 31.50  ? 17  SER H CA  1 
ATOM   1009 C C   . SER B 2 36  ? 114.050 46.243 1.193   1.00 36.17  ? 17  SER H C   1 
ATOM   1010 O O   . SER B 2 36  ? 114.792 47.026 1.809   1.00 33.46  ? 17  SER H O   1 
ATOM   1011 C CB  . SER B 2 36  ? 115.017 44.901 -0.744  1.00 33.61  ? 17  SER H CB  1 
ATOM   1012 O OG  . SER B 2 36  ? 115.817 44.470 0.335   1.00 38.78  ? 17  SER H OG  1 
ATOM   1013 N N   . VAL B 2 37  ? 113.117 45.522 1.804   1.00 32.00  ? 18  VAL H N   1 
ATOM   1014 C CA  . VAL B 2 37  ? 112.903 45.658 3.238   1.00 31.25  ? 18  VAL H CA  1 
ATOM   1015 C C   . VAL B 2 37  ? 112.591 44.286 3.831   1.00 32.84  ? 18  VAL H C   1 
ATOM   1016 O O   . VAL B 2 37  ? 112.054 43.402 3.150   1.00 33.60  ? 18  VAL H O   1 
ATOM   1017 C CB  . VAL B 2 37  ? 111.762 46.678 3.543   1.00 33.72  ? 18  VAL H CB  1 
ATOM   1018 C CG1 . VAL B 2 37  ? 110.396 46.082 3.238   1.00 31.77  ? 18  VAL H CG1 1 
ATOM   1019 C CG2 . VAL B 2 37  ? 111.819 47.162 4.995   1.00 36.21  ? 18  VAL H CG2 1 
ATOM   1020 N N   . LYS B 2 38  ? 112.937 44.092 5.094   1.00 31.99  ? 19  LYS H N   1 
ATOM   1021 C CA  . LYS B 2 38  ? 112.674 42.807 5.717   1.00 31.97  ? 19  LYS H CA  1 
ATOM   1022 C C   . LYS B 2 38  ? 111.865 42.951 6.989   1.00 28.81  ? 19  LYS H C   1 
ATOM   1023 O O   . LYS B 2 38  ? 112.296 43.572 7.949   1.00 32.89  ? 19  LYS H O   1 
ATOM   1024 C CB  . LYS B 2 38  ? 113.979 42.067 6.011   1.00 34.01  ? 19  LYS H CB  1 
ATOM   1025 C CG  . LYS B 2 38  ? 113.799 40.548 6.053   1.00 33.81  ? 19  LYS H CG  1 
ATOM   1026 C CD  . LYS B 2 38  ? 115.079 39.865 6.442   1.00 35.57  ? 19  LYS H CD  1 
ATOM   1027 C CE  . LYS B 2 38  ? 115.061 38.409 6.014   1.00 42.73  ? 19  LYS H CE  1 
ATOM   1028 N NZ  . LYS B 2 38  ? 116.260 37.697 6.523   1.00 46.47  ? 19  LYS H NZ  1 
ATOM   1029 N N   . LEU B 2 39  ? 110.681 42.365 6.992   1.00 29.12  ? 20  LEU H N   1 
ATOM   1030 C CA  . LEU B 2 39  ? 109.810 42.460 8.148   1.00 27.80  ? 20  LEU H CA  1 
ATOM   1031 C C   . LEU B 2 39  ? 109.871 41.180 8.969   1.00 28.98  ? 20  LEU H C   1 
ATOM   1032 O O   . LEU B 2 39  ? 110.106 40.104 8.431   1.00 30.64  ? 20  LEU H O   1 
ATOM   1033 C CB  . LEU B 2 39  ? 108.381 42.727 7.709   1.00 25.52  ? 20  LEU H CB  1 
ATOM   1034 C CG  . LEU B 2 39  ? 108.226 43.607 6.480   1.00 29.98  ? 20  LEU H CG  1 
ATOM   1035 C CD1 . LEU B 2 39  ? 106.717 43.688 6.075   1.00 29.24  ? 20  LEU H CD1 1 
ATOM   1036 C CD2 . LEU B 2 39  ? 108.810 44.985 6.761   1.00 27.03  ? 20  LEU H CD2 1 
ATOM   1037 N N   . SER B 2 40  ? 109.631 41.298 10.266  1.00 25.31  ? 21  SER H N   1 
ATOM   1038 C CA  . SER B 2 40  ? 109.695 40.158 11.152  1.00 24.77  ? 21  SER H CA  1 
ATOM   1039 C C   . SER B 2 40  ? 108.382 39.973 11.887  1.00 32.66  ? 21  SER H C   1 
ATOM   1040 O O   . SER B 2 40  ? 107.669 40.945 12.175  1.00 32.66  ? 21  SER H O   1 
ATOM   1041 C CB  . SER B 2 40  ? 110.809 40.337 12.162  1.00 26.39  ? 21  SER H CB  1 
ATOM   1042 O OG  . SER B 2 40  ? 110.476 41.415 13.000  1.00 28.72  ? 21  SER H OG  1 
ATOM   1043 N N   . CYS B 2 41  ? 108.084 38.720 12.206  1.00 29.73  ? 22  CYS H N   1 
ATOM   1044 C CA  . CYS B 2 41  ? 106.871 38.362 12.927  1.00 29.00  ? 22  CYS H CA  1 
ATOM   1045 C C   . CYS B 2 41  ? 107.235 37.373 14.015  1.00 29.16  ? 22  CYS H C   1 
ATOM   1046 O O   . CYS B 2 41  ? 107.604 36.232 13.721  1.00 31.28  ? 22  CYS H O   1 
ATOM   1047 C CB  . CYS B 2 41  ? 105.843 37.744 11.987  1.00 31.92  ? 22  CYS H CB  1 
ATOM   1048 S SG  . CYS B 2 41  ? 104.420 37.054 12.835  1.00 37.00  ? 22  CYS H SG  1 
ATOM   1049 N N   . THR B 2 42  ? 107.150 37.797 15.264  1.00 28.15  ? 23  THR H N   1 
ATOM   1050 C CA  . THR B 2 42  ? 107.618 36.953 16.350  1.00 29.74  ? 23  THR H CA  1 
ATOM   1051 C C   . THR B 2 42  ? 106.463 36.407 17.147  1.00 27.79  ? 23  THR H C   1 
ATOM   1052 O O   . THR B 2 42  ? 105.649 37.148 17.679  1.00 29.07  ? 23  THR H O   1 
ATOM   1053 C CB  . THR B 2 42  ? 108.577 37.713 17.278  1.00 31.61  ? 23  THR H CB  1 
ATOM   1054 O OG1 . THR B 2 42  ? 109.720 38.117 16.520  1.00 34.39  ? 23  THR H OG1 1 
ATOM   1055 C CG2 . THR B 2 42  ? 109.029 36.837 18.435  1.00 27.47  ? 23  THR H CG2 1 
ATOM   1056 N N   . ALA B 2 43  ? 106.416 35.086 17.221  1.00 29.32  ? 24  ALA H N   1 
ATOM   1057 C CA  . ALA B 2 43  ? 105.328 34.385 17.883  1.00 30.58  ? 24  ALA H CA  1 
ATOM   1058 C C   . ALA B 2 43  ? 105.668 34.073 19.328  1.00 29.54  ? 24  ALA H C   1 
ATOM   1059 O O   . ALA B 2 43  ? 106.834 33.876 19.662  1.00 35.90  ? 24  ALA H O   1 
ATOM   1060 C CB  . ALA B 2 43  ? 105.011 33.118 17.137  1.00 25.56  ? 24  ALA H CB  1 
ATOM   1061 N N   . SER B 2 44  ? 104.658 34.019 20.191  1.00 33.68  ? 25  SER H N   1 
ATOM   1062 C CA  . SER B 2 44  ? 104.880 33.569 21.564  1.00 36.51  ? 25  SER H CA  1 
ATOM   1063 C C   . SER B 2 44  ? 103.701 32.753 22.107  1.00 39.35  ? 25  SER H C   1 
ATOM   1064 O O   . SER B 2 44  ? 102.566 32.935 21.686  1.00 36.02  ? 25  SER H O   1 
ATOM   1065 C CB  . SER B 2 44  ? 105.147 34.758 22.478  1.00 34.91  ? 25  SER H CB  1 
ATOM   1066 O OG  . SER B 2 44  ? 103.962 35.505 22.684  1.00 42.54  ? 25  SER H OG  1 
ATOM   1067 N N   . GLY B 2 45  ? 103.985 31.861 23.051  1.00 37.82  ? 26  GLY H N   1 
ATOM   1068 C CA  . GLY B 2 45  ? 102.947 31.064 23.668  1.00 35.40  ? 26  GLY H CA  1 
ATOM   1069 C C   . GLY B 2 45  ? 102.649 29.835 22.834  1.00 34.53  ? 26  GLY H C   1 
ATOM   1070 O O   . GLY B 2 45  ? 101.662 29.161 23.056  1.00 36.40  ? 26  GLY H O   1 
ATOM   1071 N N   . PHE B 2 46  ? 103.505 29.567 21.856  1.00 31.96  ? 27  PHE H N   1 
ATOM   1072 C CA  . PHE B 2 46  ? 103.407 28.365 21.035  1.00 33.73  ? 27  PHE H CA  1 
ATOM   1073 C C   . PHE B 2 46  ? 104.663 28.324 20.174  1.00 38.23  ? 27  PHE H C   1 
ATOM   1074 O O   . PHE B 2 46  ? 105.397 29.315 20.107  1.00 32.54  ? 27  PHE H O   1 
ATOM   1075 C CB  . PHE B 2 46  ? 102.149 28.355 20.154  1.00 29.46  ? 27  PHE H CB  1 
ATOM   1076 C CG  . PHE B 2 46  ? 102.242 29.254 18.962  1.00 30.51  ? 27  PHE H CG  1 
ATOM   1077 C CD1 . PHE B 2 46  ? 102.056 30.630 19.094  1.00 36.18  ? 27  PHE H CD1 1 
ATOM   1078 C CD2 . PHE B 2 46  ? 102.521 28.741 17.707  1.00 32.96  ? 27  PHE H CD2 1 
ATOM   1079 C CE1 . PHE B 2 46  ? 102.155 31.481 17.996  1.00 31.12  ? 27  PHE H CE1 1 
ATOM   1080 C CE2 . PHE B 2 46  ? 102.620 29.588 16.593  1.00 33.22  ? 27  PHE H CE2 1 
ATOM   1081 C CZ  . PHE B 2 46  ? 102.427 30.959 16.742  1.00 29.33  ? 27  PHE H CZ  1 
ATOM   1082 N N   . ASN B 2 47  ? 104.899 27.185 19.521  1.00 37.86  ? 28  ASN H N   1 
ATOM   1083 C CA  . ASN B 2 47  ? 106.043 27.017 18.631  1.00 33.86  ? 28  ASN H CA  1 
ATOM   1084 C C   . ASN B 2 47  ? 105.645 27.071 17.151  1.00 35.49  ? 28  ASN H C   1 
ATOM   1085 O O   . ASN B 2 47  ? 104.738 26.348 16.729  1.00 35.29  ? 28  ASN H O   1 
ATOM   1086 C CB  . ASN B 2 47  ? 106.735 25.697 18.932  1.00 35.15  ? 28  ASN H CB  1 
ATOM   1087 C CG  . ASN B 2 47  ? 108.089 25.622 18.303  1.00 51.30  ? 28  ASN H CG  1 
ATOM   1088 O OD1 . ASN B 2 47  ? 108.221 25.266 17.127  1.00 50.83  ? 28  ASN H OD1 1 
ATOM   1089 N ND2 . ASN B 2 47  ? 109.117 26.004 19.065  1.00 56.12  ? 28  ASN H ND2 1 
ATOM   1090 N N   . ILE B 2 48  ? 106.318 27.900 16.354  1.00 34.07  ? 29  ILE H N   1 
ATOM   1091 C CA  . ILE B 2 48  ? 105.819 28.183 14.999  1.00 36.16  ? 29  ILE H CA  1 
ATOM   1092 C C   . ILE B 2 48  ? 105.929 26.991 14.076  1.00 31.53  ? 29  ILE H C   1 
ATOM   1093 O O   . ILE B 2 48  ? 105.411 26.996 12.969  1.00 32.57  ? 29  ILE H O   1 
ATOM   1094 C CB  . ILE B 2 48  ? 106.550 29.384 14.330  1.00 34.20  ? 29  ILE H CB  1 
ATOM   1095 C CG1 . ILE B 2 48  ? 108.024 29.086 14.099  1.00 33.71  ? 29  ILE H CG1 1 
ATOM   1096 C CG2 . ILE B 2 48  ? 106.364 30.651 15.143  1.00 33.61  ? 29  ILE H CG2 1 
ATOM   1097 C CD1 . ILE B 2 48  ? 108.756 30.183 13.296  1.00 34.92  ? 29  ILE H CD1 1 
ATOM   1098 N N   . LYS B 2 49  ? 106.609 25.966 14.547  1.00 32.01  ? 30  LYS H N   1 
ATOM   1099 C CA  . LYS B 2 49  ? 106.762 24.746 13.781  1.00 38.78  ? 30  LYS H CA  1 
ATOM   1100 C C   . LYS B 2 49  ? 105.403 24.125 13.584  1.00 36.80  ? 30  LYS H C   1 
ATOM   1101 O O   . LYS B 2 49  ? 105.100 23.602 12.518  1.00 38.05  ? 30  LYS H O   1 
ATOM   1102 C CB  . LYS B 2 49  ? 107.701 23.772 14.491  1.00 36.62  ? 30  LYS H CB  1 
ATOM   1103 C CG  . LYS B 2 49  ? 108.959 23.505 13.716  1.00 47.26  ? 30  LYS H CG  1 
ATOM   1104 C CD  . LYS B 2 49  ? 110.228 23.751 14.548  1.00 56.78  ? 30  LYS H CD  1 
ATOM   1105 C CE  . LYS B 2 49  ? 110.355 22.804 15.734  1.00 59.16  ? 30  LYS H CE  1 
ATOM   1106 N NZ  . LYS B 2 49  ? 111.719 22.874 16.339  1.00 62.36  ? 30  LYS H NZ  1 
ATOM   1107 N N   . ASP B 2 50  ? 104.584 24.224 14.626  1.00 37.16  ? 31  ASP H N   1 
ATOM   1108 C CA  . ASP B 2 50  ? 103.243 23.657 14.644  1.00 35.06  ? 31  ASP H CA  1 
ATOM   1109 C C   . ASP B 2 50  ? 102.184 24.496 13.918  1.00 35.79  ? 31  ASP H C   1 
ATOM   1110 O O   . ASP B 2 50  ? 100.994 24.160 13.954  1.00 33.99  ? 31  ASP H O   1 
ATOM   1111 C CB  . ASP B 2 50  ? 102.832 23.433 16.089  1.00 32.53  ? 31  ASP H CB  1 
ATOM   1112 C CG  . ASP B 2 50  ? 103.716 22.432 16.772  1.00 35.69  ? 31  ASP H CG  1 
ATOM   1113 O OD1 . ASP B 2 50  ? 103.816 21.303 16.250  1.00 35.99  ? 31  ASP H OD1 1 
ATOM   1114 O OD2 . ASP B 2 50  ? 104.337 22.780 17.796  1.00 36.14  ? 31  ASP H OD2 1 
ATOM   1115 N N   . THR B 2 51  ? 102.611 25.568 13.252  1.00 31.57  ? 32  THR H N   1 
ATOM   1116 C CA  . THR B 2 51  ? 101.693 26.368 12.444  1.00 34.26  ? 32  THR H CA  1 
ATOM   1117 C C   . THR B 2 51  ? 102.208 26.642 11.032  1.00 33.78  ? 32  THR H C   1 
ATOM   1118 O O   . THR B 2 51  ? 103.381 26.439 10.744  1.00 35.58  ? 32  THR H O   1 
ATOM   1119 C CB  . THR B 2 51  ? 101.410 27.725 13.097  1.00 32.10  ? 32  THR H CB  1 
ATOM   1120 O OG1 . THR B 2 51  ? 102.632 28.480 13.167  1.00 29.89  ? 32  THR H OG1 1 
ATOM   1121 C CG2 . THR B 2 51  ? 100.804 27.541 14.488  1.00 25.45  ? 32  THR H CG2 1 
ATOM   1122 N N   . TYR B 2 52  ? 101.320 27.091 10.153  1.00 30.57  ? 33  TYR H N   1 
ATOM   1123 C CA  . TYR B 2 52  ? 101.744 27.784 8.949   1.00 33.13  ? 33  TYR H CA  1 
ATOM   1124 C C   . TYR B 2 52  ? 101.742 29.269 9.251   1.00 33.21  ? 33  TYR H C   1 
ATOM   1125 O O   . TYR B 2 52  ? 100.763 29.767 9.771   1.00 32.51  ? 33  TYR H O   1 
ATOM   1126 C CB  . TYR B 2 52  ? 100.818 27.507 7.776   1.00 31.06  ? 33  TYR H CB  1 
ATOM   1127 C CG  . TYR B 2 52  ? 100.767 26.073 7.341   1.00 30.55  ? 33  TYR H CG  1 
ATOM   1128 C CD1 . TYR B 2 52  ? 101.758 25.542 6.534   1.00 31.80  ? 33  TYR H CD1 1 
ATOM   1129 C CD2 . TYR B 2 52  ? 99.706  25.257 7.714   1.00 32.49  ? 33  TYR H CD2 1 
ATOM   1130 C CE1 . TYR B 2 52  ? 101.713 24.230 6.124   1.00 36.48  ? 33  TYR H CE1 1 
ATOM   1131 C CE2 . TYR B 2 52  ? 99.643  23.938 7.315   1.00 36.99  ? 33  TYR H CE2 1 
ATOM   1132 C CZ  . TYR B 2 52  ? 100.656 23.426 6.516   1.00 42.58  ? 33  TYR H CZ  1 
ATOM   1133 O OH  . TYR B 2 52  ? 100.601 22.118 6.101   1.00 41.23  ? 33  TYR H OH  1 
ATOM   1134 N N   . ILE B 2 53  ? 102.823 29.982 8.958   1.00 31.61  ? 34  ILE H N   1 
ATOM   1135 C CA  . ILE B 2 53  ? 102.761 31.438 9.066   1.00 29.53  ? 34  ILE H CA  1 
ATOM   1136 C C   . ILE B 2 53  ? 102.457 32.066 7.708   1.00 29.20  ? 34  ILE H C   1 
ATOM   1137 O O   . ILE B 2 53  ? 103.177 31.826 6.741   1.00 33.64  ? 34  ILE H O   1 
ATOM   1138 C CB  . ILE B 2 53  ? 104.064 32.032 9.609   1.00 28.00  ? 34  ILE H CB  1 
ATOM   1139 C CG1 . ILE B 2 53  ? 104.345 31.493 11.013  1.00 27.50  ? 34  ILE H CG1 1 
ATOM   1140 C CG2 . ILE B 2 53  ? 103.979 33.544 9.605   1.00 23.08  ? 34  ILE H CG2 1 
ATOM   1141 C CD1 . ILE B 2 53  ? 103.278 31.876 12.046  1.00 28.17  ? 34  ILE H CD1 1 
ATOM   1142 N N   . HIS B 2 54  ? 101.396 32.870 7.627   1.00 30.31  ? 35  HIS H N   1 
ATOM   1143 C CA  . HIS B 2 54  ? 101.054 33.533 6.371   1.00 25.14  ? 35  HIS H CA  1 
ATOM   1144 C C   . HIS B 2 54  ? 101.374 35.017 6.401   1.00 26.04  ? 35  HIS H C   1 
ATOM   1145 O O   . HIS B 2 54  ? 101.434 35.626 7.456   1.00 24.76  ? 35  HIS H O   1 
ATOM   1146 C CB  . HIS B 2 54  ? 99.580  33.361 6.056   1.00 25.56  ? 35  HIS H CB  1 
ATOM   1147 C CG  . HIS B 2 54  ? 99.101  31.949 6.144   1.00 26.57  ? 35  HIS H CG  1 
ATOM   1148 N ND1 . HIS B 2 54  ? 98.563  31.277 5.065   1.00 22.37  ? 35  HIS H ND1 1 
ATOM   1149 C CD2 . HIS B 2 54  ? 99.048  31.092 7.189   1.00 23.81  ? 35  HIS H CD2 1 
ATOM   1150 C CE1 . HIS B 2 54  ? 98.212  30.064 5.444   1.00 26.06  ? 35  HIS H CE1 1 
ATOM   1151 N NE2 . HIS B 2 54  ? 98.500  29.925 6.725   1.00 23.48  ? 35  HIS H NE2 1 
ATOM   1152 N N   . TRP B 2 55  ? 101.553 35.608 5.228   1.00 26.15  ? 36  TRP H N   1 
ATOM   1153 C CA  . TRP B 2 55  ? 101.585 37.057 5.138   1.00 25.18  ? 36  TRP H CA  1 
ATOM   1154 C C   . TRP B 2 55  ? 100.474 37.531 4.207   1.00 23.42  ? 36  TRP H C   1 
ATOM   1155 O O   . TRP B 2 55  ? 100.197 36.895 3.196   1.00 29.30  ? 36  TRP H O   1 
ATOM   1156 C CB  . TRP B 2 55  ? 102.956 37.548 4.664   1.00 21.90  ? 36  TRP H CB  1 
ATOM   1157 C CG  . TRP B 2 55  ? 104.048 37.315 5.662   1.00 28.35  ? 36  TRP H CG  1 
ATOM   1158 C CD1 . TRP B 2 55  ? 104.770 36.163 5.832   1.00 29.78  ? 36  TRP H CD1 1 
ATOM   1159 C CD2 . TRP B 2 55  ? 104.558 38.247 6.628   1.00 27.22  ? 36  TRP H CD2 1 
ATOM   1160 N NE1 . TRP B 2 55  ? 105.697 36.328 6.829   1.00 27.00  ? 36  TRP H NE1 1 
ATOM   1161 C CE2 . TRP B 2 55  ? 105.600 37.595 7.328   1.00 21.96  ? 36  TRP H CE2 1 
ATOM   1162 C CE3 . TRP B 2 55  ? 104.262 39.580 6.942   1.00 26.10  ? 36  TRP H CE3 1 
ATOM   1163 C CZ2 . TRP B 2 55  ? 106.319 38.208 8.342   1.00 25.08  ? 36  TRP H CZ2 1 
ATOM   1164 C CZ3 . TRP B 2 55  ? 104.983 40.192 7.947   1.00 26.31  ? 36  TRP H CZ3 1 
ATOM   1165 C CH2 . TRP B 2 55  ? 105.999 39.511 8.636   1.00 28.42  ? 36  TRP H CH2 1 
ATOM   1166 N N   . VAL B 2 56  ? 99.844  38.643 4.578   1.00 23.99  ? 37  VAL H N   1 
ATOM   1167 C CA  . VAL B 2 56  ? 98.729  39.265 3.847   1.00 26.11  ? 37  VAL H CA  1 
ATOM   1168 C C   . VAL B 2 56  ? 99.000  40.774 3.777   1.00 26.46  ? 37  VAL H C   1 
ATOM   1169 O O   . VAL B 2 56  ? 99.576  41.337 4.711   1.00 32.32  ? 37  VAL H O   1 
ATOM   1170 C CB  . VAL B 2 56  ? 97.370  38.971 4.555   1.00 28.00  ? 37  VAL H CB  1 
ATOM   1171 C CG1 . VAL B 2 56  ? 96.195  39.708 3.906   1.00 25.17  ? 37  VAL H CG1 1 
ATOM   1172 C CG2 . VAL B 2 56  ? 97.103  37.482 4.566   1.00 28.82  ? 37  VAL H CG2 1 
ATOM   1173 N N   . ASN B 2 57  ? 98.652  41.448 2.686   1.00 28.79  ? 38  ASN H N   1 
ATOM   1174 C CA  . ASN B 2 57  ? 98.813  42.905 2.684   1.00 27.02  ? 38  ASN H CA  1 
ATOM   1175 C C   . ASN B 2 57  ? 97.496  43.609 2.532   1.00 28.20  ? 38  ASN H C   1 
ATOM   1176 O O   . ASN B 2 57  ? 96.523  43.052 2.049   1.00 26.98  ? 38  ASN H O   1 
ATOM   1177 C CB  . ASN B 2 57  ? 99.765  43.387 1.573   1.00 28.29  ? 38  ASN H CB  1 
ATOM   1178 C CG  . ASN B 2 57  ? 99.174  43.204 0.190   1.00 36.53  ? 38  ASN H CG  1 
ATOM   1179 O OD1 . ASN B 2 57  ? 98.372  44.176 -0.271  1.00 42.23  ? 38  ASN H OD1 1 
ATOM   1180 N ND2 . ASN B 2 57  ? 99.397  42.176 -0.442  1.00 42.12  ? 38  ASN H ND2 1 
ATOM   1181 N N   . GLN B 2 58  ? 97.498  44.874 2.917   1.00 32.95  ? 39  GLN H N   1 
ATOM   1182 C CA  . GLN B 2 58  ? 96.316  45.696 2.830   1.00 29.44  ? 39  GLN H CA  1 
ATOM   1183 C C   . GLN B 2 58  ? 96.741  47.089 2.462   1.00 30.17  ? 39  GLN H C   1 
ATOM   1184 O O   . GLN B 2 58  ? 97.292  47.809 3.306   1.00 31.10  ? 39  GLN H O   1 
ATOM   1185 C CB  . GLN B 2 58  ? 95.556  45.701 4.157   1.00 29.79  ? 39  GLN H CB  1 
ATOM   1186 C CG  . GLN B 2 58  ? 94.288  46.556 4.162   1.00 29.67  ? 39  GLN H CG  1 
ATOM   1187 C CD  . GLN B 2 58  ? 93.452  46.336 5.417   1.00 34.46  ? 39  GLN H CD  1 
ATOM   1188 O OE1 . GLN B 2 58  ? 93.992  46.253 6.526   1.00 34.58  ? 39  GLN H OE1 1 
ATOM   1189 N NE2 . GLN B 2 58  ? 92.128  46.222 5.247   1.00 30.80  ? 39  GLN H NE2 1 
ATOM   1190 N N   . ARG B 2 59  ? 96.492  47.462 1.206   1.00 27.18  ? 40  ARG H N   1 
ATOM   1191 C CA  . ARG B 2 59  ? 96.811  48.796 0.703   1.00 32.66  ? 40  ARG H CA  1 
ATOM   1192 C C   . ARG B 2 59  ? 95.836  49.825 1.296   1.00 34.92  ? 40  ARG H C   1 
ATOM   1193 O O   . ARG B 2 59  ? 94.718  49.458 1.657   1.00 35.92  ? 40  ARG H O   1 
ATOM   1194 C CB  . ARG B 2 59  ? 96.754  48.817 -0.824  1.00 35.30  ? 40  ARG H CB  1 
ATOM   1195 C CG  . ARG B 2 59  ? 97.752  47.926 -1.530  1.00 39.26  ? 40  ARG H CG  1 
ATOM   1196 C CD  . ARG B 2 59  ? 98.012  48.516 -2.885  1.00 39.84  ? 40  ARG H CD  1 
ATOM   1197 N NE  . ARG B 2 59  ? 98.388  47.547 -3.898  1.00 51.03  ? 40  ARG H NE  1 
ATOM   1198 C CZ  . ARG B 2 59  ? 98.316  47.800 -5.203  1.00 59.84  ? 40  ARG H CZ  1 
ATOM   1199 N NH1 . ARG B 2 59  ? 97.860  48.980 -5.621  1.00 48.85  ? 40  ARG H NH1 1 
ATOM   1200 N NH2 . ARG B 2 59  ? 98.681  46.879 -6.090  1.00 58.47  ? 40  ARG H NH2 1 
ATOM   1201 N N   . PRO B 2 60  ? 96.247  51.109 1.395   1.00 35.24  ? 41  PRO H N   1 
ATOM   1202 C CA  . PRO B 2 60  ? 95.426  52.096 2.119   1.00 35.04  ? 41  PRO H CA  1 
ATOM   1203 C C   . PRO B 2 60  ? 93.977  52.135 1.627   1.00 39.45  ? 41  PRO H C   1 
ATOM   1204 O O   . PRO B 2 60  ? 93.769  52.120 0.418   1.00 34.10  ? 41  PRO H O   1 
ATOM   1205 C CB  . PRO B 2 60  ? 96.134  53.419 1.831   1.00 32.99  ? 41  PRO H CB  1 
ATOM   1206 C CG  . PRO B 2 60  ? 97.562  53.030 1.563   1.00 33.95  ? 41  PRO H CG  1 
ATOM   1207 C CD  . PRO B 2 60  ? 97.455  51.729 0.817   1.00 34.38  ? 41  PRO H CD  1 
ATOM   1208 N N   . GLU B 2 61  ? 93.017  52.122 2.558   1.00 42.07  ? 42  GLU H N   1 
ATOM   1209 C CA  . GLU B 2 61  ? 91.585  52.102 2.239   1.00 39.02  ? 42  GLU H CA  1 
ATOM   1210 C C   . GLU B 2 61  ? 91.173  50.961 1.323   1.00 39.81  ? 42  GLU H C   1 
ATOM   1211 O O   . GLU B 2 61  ? 90.209  51.068 0.588   1.00 39.10  ? 42  GLU H O   1 
ATOM   1212 C CB  . GLU B 2 61  ? 91.173  53.432 1.611   1.00 37.52  ? 42  GLU H CB  1 
ATOM   1213 C CG  . GLU B 2 61  ? 91.213  54.532 2.618   1.00 41.38  ? 42  GLU H CG  1 
ATOM   1214 C CD  . GLU B 2 61  ? 90.696  54.049 3.972   1.00 57.81  ? 42  GLU H CD  1 
ATOM   1215 O OE1 . GLU B 2 61  ? 89.464  53.829 4.116   1.00 58.90  ? 42  GLU H OE1 1 
ATOM   1216 O OE2 . GLU B 2 61  ? 91.532  53.865 4.887   1.00 66.27  ? 42  GLU H OE2 1 
ATOM   1217 N N   . GLN B 2 62  ? 91.901  49.859 1.350   1.00 39.87  ? 43  GLN H N   1 
ATOM   1218 C CA  . GLN B 2 62  ? 91.594  48.804 0.414   1.00 36.08  ? 43  GLN H CA  1 
ATOM   1219 C C   . GLN B 2 62  ? 91.379  47.508 1.156   1.00 32.57  ? 43  GLN H C   1 
ATOM   1220 O O   . GLN B 2 62  ? 91.276  47.508 2.386   1.00 31.73  ? 43  GLN H O   1 
ATOM   1221 C CB  . GLN B 2 62  ? 92.705  48.684 -0.629  1.00 39.15  ? 43  GLN H CB  1 
ATOM   1222 C CG  . GLN B 2 62  ? 92.755  49.863 -1.603  1.00 40.11  ? 43  GLN H CG  1 
ATOM   1223 C CD  . GLN B 2 62  ? 93.716  49.613 -2.768  1.00 50.14  ? 43  GLN H CD  1 
ATOM   1224 O OE1 . GLN B 2 62  ? 93.682  48.547 -3.400  1.00 54.32  ? 43  GLN H OE1 1 
ATOM   1225 N NE2 . GLN B 2 62  ? 94.583  50.595 -3.053  1.00 48.80  ? 43  GLN H NE2 1 
ATOM   1226 N N   . GLY B 2 63  ? 91.295  46.412 0.408   1.00 27.78  ? 44  GLY H N   1 
ATOM   1227 C CA  . GLY B 2 63  ? 90.976  45.116 0.982   1.00 29.44  ? 44  GLY H CA  1 
ATOM   1228 C C   . GLY B 2 63  ? 92.218  44.323 1.347   1.00 34.55  ? 44  GLY H C   1 
ATOM   1229 O O   . GLY B 2 63  ? 93.320  44.868 1.385   1.00 29.80  ? 44  GLY H O   1 
ATOM   1230 N N   . LEU B 2 64  ? 92.013  43.031 1.604   1.00 35.45  ? 45  LEU H N   1 
ATOM   1231 C CA  . LEU B 2 64  ? 93.058  42.101 2.020   1.00 29.00  ? 45  LEU H CA  1 
ATOM   1232 C C   . LEU B 2 64  ? 93.529  41.254 0.864   1.00 34.13  ? 45  LEU H C   1 
ATOM   1233 O O   . LEU B 2 64  ? 92.745  40.901 -0.025  1.00 32.54  ? 45  LEU H O   1 
ATOM   1234 C CB  . LEU B 2 64  ? 92.545  41.188 3.139   1.00 28.87  ? 45  LEU H CB  1 
ATOM   1235 C CG  . LEU B 2 64  ? 92.146  41.913 4.423   1.00 30.71  ? 45  LEU H CG  1 
ATOM   1236 C CD1 . LEU B 2 64  ? 91.395  40.978 5.328   1.00 26.66  ? 45  LEU H CD1 1 
ATOM   1237 C CD2 . LEU B 2 64  ? 93.410  42.440 5.124   1.00 28.45  ? 45  LEU H CD2 1 
ATOM   1238 N N   . GLU B 2 65  ? 94.810  40.897 0.880   1.00 35.97  ? 46  GLU H N   1 
ATOM   1239 C CA  . GLU B 2 65  ? 95.359  40.114 -0.209  1.00 29.17  ? 46  GLU H CA  1 
ATOM   1240 C C   . GLU B 2 65  ? 96.429  39.166 0.288   1.00 30.53  ? 46  GLU H C   1 
ATOM   1241 O O   . GLU B 2 65  ? 97.394  39.585 0.921   1.00 39.09  ? 46  GLU H O   1 
ATOM   1242 C CB  . GLU B 2 65  ? 95.898  41.061 -1.264  1.00 36.53  ? 46  GLU H CB  1 
ATOM   1243 C CG  . GLU B 2 65  ? 96.437  40.400 -2.495  1.00 41.55  ? 46  GLU H CG  1 
ATOM   1244 C CD  . GLU B 2 65  ? 96.930  41.427 -3.489  1.00 49.62  ? 46  GLU H CD  1 
ATOM   1245 O OE1 . GLU B 2 65  ? 97.730  42.295 -3.083  1.00 59.79  ? 46  GLU H OE1 1 
ATOM   1246 O OE2 . GLU B 2 65  ? 96.508  41.388 -4.663  1.00 54.01  ? 46  GLU H OE2 1 
ATOM   1247 N N   . TRP B 2 66  ? 96.263  37.878 0.027   1.00 32.18  ? 47  TRP H N   1 
ATOM   1248 C CA  . TRP B 2 66  ? 97.254  36.895 0.445   1.00 27.44  ? 47  TRP H CA  1 
ATOM   1249 C C   . TRP B 2 66  ? 98.567  37.053 -0.329  1.00 27.67  ? 47  TRP H C   1 
ATOM   1250 O O   . TRP B 2 66  ? 98.562  37.215 -1.551  1.00 32.06  ? 47  TRP H O   1 
ATOM   1251 C CB  . TRP B 2 66  ? 96.685  35.502 0.251   1.00 25.84  ? 47  TRP H CB  1 
ATOM   1252 C CG  . TRP B 2 66  ? 97.383  34.392 0.961   1.00 29.14  ? 47  TRP H CG  1 
ATOM   1253 C CD1 . TRP B 2 66  ? 97.361  34.133 2.298   1.00 27.95  ? 47  TRP H CD1 1 
ATOM   1254 C CD2 . TRP B 2 66  ? 98.167  33.340 0.361   1.00 35.72  ? 47  TRP H CD2 1 
ATOM   1255 N NE1 . TRP B 2 66  ? 98.095  32.994 2.577   1.00 34.29  ? 47  TRP H NE1 1 
ATOM   1256 C CE2 . TRP B 2 66  ? 98.603  32.493 1.405   1.00 32.45  ? 47  TRP H CE2 1 
ATOM   1257 C CE3 . TRP B 2 66  ? 98.553  33.043 -0.953  1.00 35.29  ? 47  TRP H CE3 1 
ATOM   1258 C CZ2 . TRP B 2 66  ? 99.395  31.370 1.176   1.00 33.77  ? 47  TRP H CZ2 1 
ATOM   1259 C CZ3 . TRP B 2 66  ? 99.342  31.911 -1.177  1.00 36.54  ? 47  TRP H CZ3 1 
ATOM   1260 C CH2 . TRP B 2 66  ? 99.754  31.097 -0.120  1.00 33.20  ? 47  TRP H CH2 1 
ATOM   1261 N N   . ILE B 2 67  ? 99.695  37.007 0.373   1.00 28.99  ? 48  ILE H N   1 
ATOM   1262 C CA  . ILE B 2 67  ? 101.018 36.995 -0.303  1.00 35.56  ? 48  ILE H CA  1 
ATOM   1263 C C   . ILE B 2 67  ? 101.605 35.572 -0.459  1.00 31.83  ? 48  ILE H C   1 
ATOM   1264 O O   . ILE B 2 67  ? 101.995 35.156 -1.551  1.00 33.57  ? 48  ILE H O   1 
ATOM   1265 C CB  . ILE B 2 67  ? 102.030 37.912 0.448   1.00 34.05  ? 48  ILE H CB  1 
ATOM   1266 C CG1 . ILE B 2 67  ? 101.612 39.374 0.270   1.00 30.28  ? 48  ILE H CG1 1 
ATOM   1267 C CG2 . ILE B 2 67  ? 103.473 37.702 -0.066  1.00 26.81  ? 48  ILE H CG2 1 
ATOM   1268 C CD1 . ILE B 2 67  ? 102.143 40.330 1.328   1.00 31.94  ? 48  ILE H CD1 1 
ATOM   1269 N N   . GLY B 2 68  ? 101.634 34.822 0.637   1.00 33.00  ? 49  GLY H N   1 
ATOM   1270 C CA  . GLY B 2 68  ? 102.114 33.452 0.624   1.00 30.19  ? 49  GLY H CA  1 
ATOM   1271 C C   . GLY B 2 68  ? 102.166 32.931 2.049   1.00 30.46  ? 49  GLY H C   1 
ATOM   1272 O O   . GLY B 2 68  ? 101.652 33.568 2.966   1.00 29.42  ? 49  GLY H O   1 
ATOM   1273 N N   . ARG B 2 69  ? 102.776 31.770 2.244   1.00 29.73  ? 50  ARG H N   1 
ATOM   1274 C CA  . ARG B 2 69  ? 102.952 31.232 3.589   1.00 33.78  ? 50  ARG H CA  1 
ATOM   1275 C C   . ARG B 2 69  ? 104.204 30.380 3.651   1.00 32.80  ? 50  ARG H C   1 
ATOM   1276 O O   . ARG B 2 69  ? 104.783 30.056 2.624   1.00 36.98  ? 50  ARG H O   1 
ATOM   1277 C CB  . ARG B 2 69  ? 101.724 30.408 4.036   1.00 31.11  ? 50  ARG H CB  1 
ATOM   1278 C CG  . ARG B 2 69  ? 101.378 29.206 3.151   1.00 34.91  ? 50  ARG H CG  1 
ATOM   1279 C CD  . ARG B 2 69  ? 102.250 27.979 3.422   1.00 34.39  ? 50  ARG H CD  1 
ATOM   1280 N NE  . ARG B 2 69  ? 101.708 26.763 2.825   1.00 43.45  ? 50  ARG H NE  1 
ATOM   1281 C CZ  . ARG B 2 69  ? 102.391 25.629 2.664   1.00 47.35  ? 50  ARG H CZ  1 
ATOM   1282 N NH1 . ARG B 2 69  ? 103.671 25.547 3.032   1.00 42.35  ? 50  ARG H NH1 1 
ATOM   1283 N NH2 . ARG B 2 69  ? 101.795 24.572 2.122   1.00 41.59  ? 50  ARG H NH2 1 
ATOM   1284 N N   . ILE B 2 70  ? 104.589 29.993 4.860   1.00 30.76  ? 51  ILE H N   1 
ATOM   1285 C CA  . ILE B 2 70  ? 105.703 29.084 5.063   1.00 31.50  ? 51  ILE H CA  1 
ATOM   1286 C C   . ILE B 2 70  ? 105.315 28.022 6.091   1.00 32.80  ? 51  ILE H C   1 
ATOM   1287 O O   . ILE B 2 70  ? 104.492 28.274 6.969   1.00 34.13  ? 51  ILE H O   1 
ATOM   1288 C CB  . ILE B 2 70  ? 106.981 29.834 5.534   1.00 32.06  ? 51  ILE H CB  1 
ATOM   1289 C CG1 . ILE B 2 70  ? 108.196 28.886 5.591   1.00 32.06  ? 51  ILE H CG1 1 
ATOM   1290 C CG2 . ILE B 2 70  ? 106.752 30.492 6.894   1.00 28.23  ? 51  ILE H CG2 1 
ATOM   1291 C CD1 . ILE B 2 70  ? 109.553 29.605 5.613   1.00 30.72  ? 51  ILE H CD1 1 
ATOM   1292 N N   . ASP B 2 71  ? 105.891 26.833 5.943   1.00 35.60  ? 52  ASP H N   1 
ATOM   1293 C CA  . ASP B 2 71  ? 105.855 25.787 6.951   1.00 34.96  ? 52  ASP H CA  1 
ATOM   1294 C C   . ASP B 2 71  ? 107.204 25.811 7.662   1.00 34.59  ? 52  ASP H C   1 
ATOM   1295 O O   . ASP B 2 71  ? 108.204 25.390 7.093   1.00 36.74  ? 52  ASP H O   1 
ATOM   1296 C CB  . ASP B 2 71  ? 105.586 24.424 6.294   1.00 35.44  ? 52  ASP H CB  1 
ATOM   1297 C CG  . ASP B 2 71  ? 105.406 23.294 7.292   1.00 36.84  ? 52  ASP H CG  1 
ATOM   1298 O OD1 . ASP B 2 71  ? 105.884 23.381 8.445   1.00 37.58  ? 52  ASP H OD1 1 
ATOM   1299 O OD2 . ASP B 2 71  ? 104.781 22.284 6.906   1.00 43.62  ? 52  ASP H OD2 1 
ATOM   1300 N N   . PRO B 2 72  ? 107.252 26.341 8.894   1.00 37.87  ? 53  PRO H N   1 
ATOM   1301 C CA  . PRO B 2 72  ? 108.546 26.493 9.577   1.00 36.58  ? 53  PRO H CA  1 
ATOM   1302 C C   . PRO B 2 72  ? 109.168 25.165 9.944   1.00 38.48  ? 53  PRO H C   1 
ATOM   1303 O O   . PRO B 2 72  ? 110.355 25.144 10.237  1.00 38.76  ? 53  PRO H O   1 
ATOM   1304 C CB  . PRO B 2 72  ? 108.199 27.285 10.841  1.00 32.24  ? 53  PRO H CB  1 
ATOM   1305 C CG  . PRO B 2 72  ? 106.913 27.977 10.489  1.00 35.32  ? 53  PRO H CG  1 
ATOM   1306 C CD  . PRO B 2 72  ? 106.171 27.017 9.622   1.00 32.00  ? 53  PRO H CD  1 
ATOM   1307 N N   . ALA B 2 73  ? 108.377 24.096 9.975   1.00 37.86  ? 54  ALA H N   1 
ATOM   1308 C CA  . ALA B 2 73  ? 108.924 22.751 10.157  1.00 48.17  ? 54  ALA H CA  1 
ATOM   1309 C C   . ALA B 2 73  ? 109.669 22.314 8.888   1.00 45.36  ? 54  ALA H C   1 
ATOM   1310 O O   . ALA B 2 73  ? 110.659 21.597 8.948   1.00 45.60  ? 54  ALA H O   1 
ATOM   1311 C CB  . ALA B 2 73  ? 107.810 21.747 10.507  1.00 35.41  ? 54  ALA H CB  1 
ATOM   1312 N N   . ASN B 2 74  ? 109.168 22.776 7.750   1.00 44.11  ? 55  ASN H N   1 
ATOM   1313 C CA  . ASN B 2 74  ? 109.655 22.416 6.424   1.00 46.61  ? 55  ASN H CA  1 
ATOM   1314 C C   . ASN B 2 74  ? 110.704 23.340 5.845   1.00 47.61  ? 55  ASN H C   1 
ATOM   1315 O O   . ASN B 2 74  ? 111.675 22.895 5.233   1.00 45.19  ? 55  ASN H O   1 
ATOM   1316 C CB  . ASN B 2 74  ? 108.485 22.409 5.445   1.00 42.66  ? 55  ASN H CB  1 
ATOM   1317 C CG  . ASN B 2 74  ? 107.975 21.044 5.189   1.00 46.53  ? 55  ASN H CG  1 
ATOM   1318 O OD1 . ASN B 2 74  ? 108.622 20.067 5.539   1.00 61.91  ? 55  ASN H OD1 1 
ATOM   1319 N ND2 . ASN B 2 74  ? 106.811 20.950 4.569   1.00 52.44  ? 55  ASN H ND2 1 
ATOM   1320 N N   . GLY B 2 75  ? 110.446 24.638 6.000   1.00 43.51  ? 56  GLY H N   1 
ATOM   1321 C CA  . GLY B 2 75  ? 111.056 25.663 5.174   1.00 37.11  ? 56  GLY H CA  1 
ATOM   1322 C C   . GLY B 2 75  ? 110.218 25.883 3.918   1.00 41.47  ? 56  GLY H C   1 
ATOM   1323 O O   . GLY B 2 75  ? 110.403 26.878 3.214   1.00 41.84  ? 56  GLY H O   1 
ATOM   1324 N N   . HIS B 2 76  ? 109.289 24.962 3.642   1.00 38.64  ? 57  HIS H N   1 
ATOM   1325 C CA  . HIS B 2 76  ? 108.530 24.997 2.402   1.00 39.50  ? 57  HIS H CA  1 
ATOM   1326 C C   . HIS B 2 76  ? 107.580 26.167 2.359   1.00 37.98  ? 57  HIS H C   1 
ATOM   1327 O O   . HIS B 2 76  ? 106.893 26.466 3.334   1.00 35.31  ? 57  HIS H O   1 
ATOM   1328 C CB  . HIS B 2 76  ? 107.754 23.705 2.193   1.00 41.42  ? 57  HIS H CB  1 
ATOM   1329 C CG  . HIS B 2 76  ? 108.634 22.522 1.953   1.00 57.77  ? 57  HIS H CG  1 
ATOM   1330 N ND1 . HIS B 2 76  ? 108.146 21.239 1.830   1.00 56.08  ? 57  HIS H ND1 1 
ATOM   1331 C CD2 . HIS B 2 76  ? 109.980 22.428 1.819   1.00 57.54  ? 57  HIS H CD2 1 
ATOM   1332 C CE1 . HIS B 2 76  ? 109.152 20.407 1.629   1.00 63.32  ? 57  HIS H CE1 1 
ATOM   1333 N NE2 . HIS B 2 76  ? 110.276 21.103 1.618   1.00 61.40  ? 57  HIS H NE2 1 
ATOM   1334 N N   . THR B 2 77  ? 107.549 26.820 1.206   1.00 29.92  ? 58  THR H N   1 
ATOM   1335 C CA  . THR B 2 77  ? 106.761 28.018 1.036   1.00 38.13  ? 58  THR H CA  1 
ATOM   1336 C C   . THR B 2 77  ? 105.849 27.934 -0.188  1.00 38.14  ? 58  THR H C   1 
ATOM   1337 O O   . THR B 2 77  ? 106.107 27.190 -1.127  1.00 38.16  ? 58  THR H O   1 
ATOM   1338 C CB  . THR B 2 77  ? 107.667 29.239 0.897   1.00 38.90  ? 58  THR H CB  1 
ATOM   1339 O OG1 . THR B 2 77  ? 108.510 29.044 -0.241  1.00 40.37  ? 58  THR H OG1 1 
ATOM   1340 C CG2 . THR B 2 77  ? 108.544 29.394 2.130   1.00 32.84  ? 58  THR H CG2 1 
ATOM   1341 N N   . GLN B 2 78  ? 104.781 28.716 -0.170  1.00 39.13  ? 59  GLN H N   1 
ATOM   1342 C CA  . GLN B 2 78  ? 103.881 28.791 -1.295  1.00 37.90  ? 59  GLN H CA  1 
ATOM   1343 C C   . GLN B 2 78  ? 103.560 30.254 -1.486  1.00 40.04  ? 59  GLN H C   1 
ATOM   1344 O O   . GLN B 2 78  ? 103.479 30.997 -0.515  1.00 38.78  ? 59  GLN H O   1 
ATOM   1345 C CB  . GLN B 2 78  ? 102.631 27.958 -1.046  1.00 40.00  ? 59  GLN H CB  1 
ATOM   1346 C CG  . GLN B 2 78  ? 101.808 27.721 -2.293  1.00 50.46  ? 59  GLN H CG  1 
ATOM   1347 C CD  . GLN B 2 78  ? 101.062 26.402 -2.251  1.00 61.46  ? 59  GLN H CD  1 
ATOM   1348 O OE1 . GLN B 2 78  ? 100.381 26.087 -1.271  1.00 58.90  ? 59  GLN H OE1 1 
ATOM   1349 N NE2 . GLN B 2 78  ? 101.201 25.611 -3.314  1.00 66.31  ? 59  GLN H NE2 1 
ATOM   1350 N N   . TYR B 2 79  ? 103.408 30.684 -2.729  1.00 38.01  ? 60  TYR H N   1 
ATOM   1351 C CA  . TYR B 2 79  ? 103.200 32.095 -2.992  1.00 37.31  ? 60  TYR H CA  1 
ATOM   1352 C C   . TYR B 2 79  ? 102.051 32.304 -3.952  1.00 42.73  ? 60  TYR H C   1 
ATOM   1353 O O   . TYR B 2 79  ? 101.669 31.392 -4.677  1.00 42.83  ? 60  TYR H O   1 
ATOM   1354 C CB  . TYR B 2 79  ? 104.468 32.737 -3.572  1.00 41.28  ? 60  TYR H CB  1 
ATOM   1355 C CG  . TYR B 2 79  ? 105.657 32.751 -2.643  1.00 37.58  ? 60  TYR H CG  1 
ATOM   1356 C CD1 . TYR B 2 79  ? 105.879 33.833 -1.789  1.00 35.05  ? 60  TYR H CD1 1 
ATOM   1357 C CD2 . TYR B 2 79  ? 106.560 31.682 -2.607  1.00 36.93  ? 60  TYR H CD2 1 
ATOM   1358 C CE1 . TYR B 2 79  ? 106.972 33.859 -0.927  1.00 32.93  ? 60  TYR H CE1 1 
ATOM   1359 C CE2 . TYR B 2 79  ? 107.656 31.695 -1.741  1.00 34.20  ? 60  TYR H CE2 1 
ATOM   1360 C CZ  . TYR B 2 79  ? 107.860 32.794 -0.905  1.00 34.08  ? 60  TYR H CZ  1 
ATOM   1361 O OH  . TYR B 2 79  ? 108.942 32.837 -0.035  1.00 34.69  ? 60  TYR H OH  1 
ATOM   1362 N N   . ASP B 2 80  ? 101.496 33.511 -3.937  1.00 43.41  ? 61  ASP H N   1 
ATOM   1363 C CA  . ASP B 2 80  ? 100.692 33.968 -5.054  1.00 42.82  ? 61  ASP H CA  1 
ATOM   1364 C C   . ASP B 2 80  ? 101.661 34.360 -6.149  1.00 49.56  ? 61  ASP H C   1 
ATOM   1365 O O   . ASP B 2 80  ? 102.456 35.283 -5.968  1.00 50.61  ? 61  ASP H O   1 
ATOM   1366 C CB  . ASP B 2 80  ? 99.796  35.148 -4.681  1.00 40.65  ? 61  ASP H CB  1 
ATOM   1367 C CG  . ASP B 2 80  ? 98.877  35.578 -5.836  1.00 50.61  ? 61  ASP H CG  1 
ATOM   1368 O OD1 . ASP B 2 80  ? 99.308  35.532 -7.016  1.00 52.50  ? 61  ASP H OD1 1 
ATOM   1369 O OD2 . ASP B 2 80  ? 97.713  35.960 -5.564  1.00 45.89  ? 61  ASP H OD2 1 
ATOM   1370 N N   . PRO B 2 81  ? 101.579 33.674 -7.297  1.00 54.36  ? 62  PRO H N   1 
ATOM   1371 C CA  . PRO B 2 81  ? 102.512 33.843 -8.416  1.00 53.09  ? 62  PRO H CA  1 
ATOM   1372 C C   . PRO B 2 81  ? 102.815 35.308 -8.696  1.00 55.78  ? 62  PRO H C   1 
ATOM   1373 O O   . PRO B 2 81  ? 103.946 35.635 -9.025  1.00 60.72  ? 62  PRO H O   1 
ATOM   1374 C CB  . PRO B 2 81  ? 101.767 33.210 -9.591  1.00 56.00  ? 62  PRO H CB  1 
ATOM   1375 C CG  . PRO B 2 81  ? 100.894 32.191 -8.958  1.00 63.14  ? 62  PRO H CG  1 
ATOM   1376 C CD  . PRO B 2 81  ? 100.470 32.765 -7.636  1.00 52.09  ? 62  PRO H CD  1 
ATOM   1377 N N   . LYS B 2 82  ? 101.822 36.177 -8.537  1.00 53.19  ? 63  LYS H N   1 
ATOM   1378 C CA  . LYS B 2 82  ? 102.019 37.597 -8.781  1.00 50.93  ? 63  LYS H CA  1 
ATOM   1379 C C   . LYS B 2 82  ? 103.070 38.215 -7.853  1.00 52.75  ? 63  LYS H C   1 
ATOM   1380 O O   . LYS B 2 82  ? 103.657 39.247 -8.171  1.00 51.64  ? 63  LYS H O   1 
ATOM   1381 C CB  . LYS B 2 82  ? 100.697 38.345 -8.632  1.00 47.88  ? 63  LYS H CB  1 
ATOM   1382 C CG  . LYS B 2 82  ? 100.191 38.418 -7.218  1.00 50.82  ? 63  LYS H CG  1 
ATOM   1383 C CD  . LYS B 2 82  ? 99.002  39.346 -7.099  1.00 50.39  ? 63  LYS H CD  1 
ATOM   1384 C CE  . LYS B 2 82  ? 99.440  40.796 -7.102  1.00 54.54  ? 63  LYS H CE  1 
ATOM   1385 N NZ  . LYS B 2 82  ? 98.303  41.725 -6.833  1.00 60.01  ? 63  LYS H NZ  1 
ATOM   1386 N N   . PHE B 2 83  ? 103.306 37.598 -6.703  1.00 51.51  ? 64  PHE H N   1 
ATOM   1387 C CA  . PHE B 2 83  ? 104.303 38.138 -5.788  1.00 52.12  ? 64  PHE H CA  1 
ATOM   1388 C C   . PHE B 2 83  ? 105.645 37.439 -5.944  1.00 57.22  ? 64  PHE H C   1 
ATOM   1389 O O   . PHE B 2 83  ? 106.656 37.880 -5.380  1.00 59.54  ? 64  PHE H O   1 
ATOM   1390 C CB  . PHE B 2 83  ? 103.824 38.037 -4.337  1.00 47.23  ? 64  PHE H CB  1 
ATOM   1391 C CG  . PHE B 2 83  ? 102.724 38.987 -4.000  1.00 45.86  ? 64  PHE H CG  1 
ATOM   1392 C CD1 . PHE B 2 83  ? 102.985 40.332 -3.854  1.00 44.94  ? 64  PHE H CD1 1 
ATOM   1393 C CD2 . PHE B 2 83  ? 101.421 38.533 -3.830  1.00 45.11  ? 64  PHE H CD2 1 
ATOM   1394 C CE1 . PHE B 2 83  ? 101.959 41.214 -3.543  1.00 53.05  ? 64  PHE H CE1 1 
ATOM   1395 C CE2 . PHE B 2 83  ? 100.390 39.401 -3.517  1.00 42.36  ? 64  PHE H CE2 1 
ATOM   1396 C CZ  . PHE B 2 83  ? 100.654 40.741 -3.378  1.00 51.85  ? 64  PHE H CZ  1 
ATOM   1397 N N   . GLN B 2 84  ? 105.652 36.345 -6.701  1.00 62.07  ? 65  GLN H N   1 
ATOM   1398 C CA  . GLN B 2 84  ? 106.885 35.610 -6.971  1.00 66.73  ? 65  GLN H CA  1 
ATOM   1399 C C   . GLN B 2 84  ? 107.910 36.553 -7.595  1.00 57.29  ? 65  GLN H C   1 
ATOM   1400 O O   . GLN B 2 84  ? 107.619 37.234 -8.574  1.00 58.67  ? 65  GLN H O   1 
ATOM   1401 C CB  . GLN B 2 84  ? 106.609 34.413 -7.888  1.00 69.19  ? 65  GLN H CB  1 
ATOM   1402 C CG  . GLN B 2 84  ? 107.504 33.209 -7.650  1.00 71.31  ? 65  GLN H CG  1 
ATOM   1403 C CD  . GLN B 2 84  ? 106.729 31.902 -7.706  1.00 79.92  ? 65  GLN H CD  1 
ATOM   1404 O OE1 . GLN B 2 84  ? 105.530 31.892 -7.996  1.00 76.23  ? 65  GLN H OE1 1 
ATOM   1405 N NE2 . GLN B 2 84  ? 107.407 30.793 -7.417  1.00 86.06  ? 65  GLN H NE2 1 
ATOM   1406 N N   . GLY B 2 85  ? 109.091 36.623 -6.996  1.00 54.55  ? 66  GLY H N   1 
ATOM   1407 C CA  . GLY B 2 85  ? 110.118 37.528 -7.465  1.00 53.82  ? 66  GLY H CA  1 
ATOM   1408 C C   . GLY B 2 85  ? 110.248 38.780 -6.615  1.00 55.74  ? 66  GLY H C   1 
ATOM   1409 O O   . GLY B 2 85  ? 111.280 39.458 -6.660  1.00 55.64  ? 66  GLY H O   1 
ATOM   1410 N N   . LYS B 2 86  ? 109.214 39.101 -5.840  1.00 49.74  ? 67  LYS H N   1 
ATOM   1411 C CA  . LYS B 2 86  ? 109.248 40.314 -5.028  1.00 44.80  ? 67  LYS H CA  1 
ATOM   1412 C C   . LYS B 2 86  ? 109.102 40.028 -3.534  1.00 39.63  ? 67  LYS H C   1 
ATOM   1413 O O   . LYS B 2 86  ? 109.480 40.851 -2.701  1.00 35.44  ? 67  LYS H O   1 
ATOM   1414 C CB  . LYS B 2 86  ? 108.158 41.294 -5.482  1.00 51.47  ? 67  LYS H CB  1 
ATOM   1415 C CG  . LYS B 2 86  ? 108.695 42.519 -6.248  1.00 49.36  ? 67  LYS H CG  1 
ATOM   1416 C CD  . LYS B 2 86  ? 107.561 43.419 -6.759  1.00 46.89  ? 67  LYS H CD  1 
ATOM   1417 C CE  . LYS B 2 86  ? 106.918 44.229 -5.643  1.00 41.97  ? 67  LYS H CE  1 
ATOM   1418 N NZ  . LYS B 2 86  ? 107.574 45.567 -5.451  1.00 41.02  ? 67  LYS H NZ  1 
ATOM   1419 N N   . ALA B 2 87  ? 108.545 38.869 -3.201  1.00 38.69  ? 68  ALA H N   1 
ATOM   1420 C CA  . ALA B 2 87  ? 108.404 38.472 -1.813  1.00 32.62  ? 68  ALA H CA  1 
ATOM   1421 C C   . ALA B 2 87  ? 109.098 37.150 -1.562  1.00 33.90  ? 68  ALA H C   1 
ATOM   1422 O O   . ALA B 2 87  ? 109.100 36.265 -2.413  1.00 35.39  ? 68  ALA H O   1 
ATOM   1423 C CB  . ALA B 2 87  ? 106.928 38.382 -1.418  1.00 30.39  ? 68  ALA H CB  1 
ATOM   1424 N N   . THR B 2 88  ? 109.671 37.040 -0.369  1.00 31.54  ? 69  THR H N   1 
ATOM   1425 C CA  . THR B 2 88  ? 110.382 35.865 0.076   1.00 29.74  ? 69  THR H CA  1 
ATOM   1426 C C   . THR B 2 88  ? 110.123 35.622 1.543   1.00 30.23  ? 69  THR H C   1 
ATOM   1427 O O   . THR B 2 88  ? 110.493 36.427 2.391   1.00 31.20  ? 69  THR H O   1 
ATOM   1428 C CB  . THR B 2 88  ? 111.914 36.003 -0.124  1.00 34.44  ? 69  THR H CB  1 
ATOM   1429 O OG1 . THR B 2 88  ? 112.192 36.368 -1.477  1.00 42.42  ? 69  THR H OG1 1 
ATOM   1430 C CG2 . THR B 2 88  ? 112.609 34.689 0.199   1.00 26.88  ? 69  THR H CG2 1 
ATOM   1431 N N   . ILE B 2 89  ? 109.528 34.486 1.865   1.00 31.33  ? 70  ILE H N   1 
ATOM   1432 C CA  . ILE B 2 89  ? 109.216 34.239 3.253   1.00 28.91  ? 70  ILE H CA  1 
ATOM   1433 C C   . ILE B 2 89  ? 110.198 33.253 3.836   1.00 33.30  ? 70  ILE H C   1 
ATOM   1434 O O   . ILE B 2 89  ? 110.559 32.255 3.212   1.00 32.82  ? 70  ILE H O   1 
ATOM   1435 C CB  . ILE B 2 89  ? 107.773 33.728 3.419   1.00 28.59  ? 70  ILE H CB  1 
ATOM   1436 C CG1 . ILE B 2 89  ? 106.789 34.798 2.959   1.00 29.89  ? 70  ILE H CG1 1 
ATOM   1437 C CG2 . ILE B 2 89  ? 107.504 33.393 4.851   1.00 30.43  ? 70  ILE H CG2 1 
ATOM   1438 C CD1 . ILE B 2 89  ? 105.358 34.292 2.757   1.00 28.68  ? 70  ILE H CD1 1 
ATOM   1439 N N   . THR B 2 90  ? 110.658 33.545 5.040   1.00 34.55  ? 71  THR H N   1 
ATOM   1440 C CA  . THR B 2 90  ? 111.558 32.633 5.718   1.00 32.73  ? 71  THR H CA  1 
ATOM   1441 C C   . THR B 2 90  ? 111.156 32.579 7.173   1.00 31.58  ? 71  THR H C   1 
ATOM   1442 O O   . THR B 2 90  ? 110.230 33.266 7.599   1.00 31.53  ? 71  THR H O   1 
ATOM   1443 C CB  . THR B 2 90  ? 113.030 33.066 5.593   1.00 34.56  ? 71  THR H CB  1 
ATOM   1444 O OG1 . THR B 2 90  ? 113.156 34.413 6.060   1.00 31.46  ? 71  THR H OG1 1 
ATOM   1445 C CG2 . THR B 2 90  ? 113.509 32.970 4.127   1.00 30.87  ? 71  THR H CG2 1 
ATOM   1446 N N   . ALA B 2 91  ? 111.871 31.775 7.935   1.00 26.49  ? 72  ALA H N   1 
ATOM   1447 C CA  . ALA B 2 91  ? 111.491 31.492 9.299   1.00 33.34  ? 72  ALA H CA  1 
ATOM   1448 C C   . ALA B 2 91  ? 112.715 30.976 10.050  1.00 34.13  ? 72  ALA H C   1 
ATOM   1449 O O   . ALA B 2 91  ? 113.487 30.205 9.514   1.00 30.57  ? 72  ALA H O   1 
ATOM   1450 C CB  . ALA B 2 91  ? 110.339 30.449 9.338   1.00 30.26  ? 72  ALA H CB  1 
ATOM   1451 N N   . ASP B 2 92  ? 112.875 31.408 11.290  1.00 36.19  ? 73  ASP H N   1 
ATOM   1452 C CA  . ASP B 2 92  ? 113.943 30.918 12.134  1.00 33.60  ? 73  ASP H CA  1 
ATOM   1453 C C   . ASP B 2 92  ? 113.321 30.302 13.384  1.00 33.12  ? 73  ASP H C   1 
ATOM   1454 O O   . ASP B 2 92  ? 112.842 31.003 14.277  1.00 35.44  ? 73  ASP H O   1 
ATOM   1455 C CB  . ASP B 2 92  ? 114.911 32.042 12.489  1.00 32.99  ? 73  ASP H CB  1 
ATOM   1456 C CG  . ASP B 2 92  ? 115.990 31.597 13.470  1.00 42.03  ? 73  ASP H CG  1 
ATOM   1457 O OD1 . ASP B 2 92  ? 116.176 30.372 13.661  1.00 42.62  ? 73  ASP H OD1 1 
ATOM   1458 O OD2 . ASP B 2 92  ? 116.666 32.479 14.040  1.00 46.58  ? 73  ASP H OD2 1 
ATOM   1459 N N   . THR B 2 93  ? 113.329 28.981 13.444  1.00 33.10  ? 74  THR H N   1 
ATOM   1460 C CA  . THR B 2 93  ? 112.618 28.301 14.505  1.00 33.43  ? 74  THR H CA  1 
ATOM   1461 C C   . THR B 2 93  ? 113.290 28.501 15.857  1.00 32.32  ? 74  THR H C   1 
ATOM   1462 O O   . THR B 2 93  ? 112.622 28.407 16.883  1.00 38.11  ? 74  THR H O   1 
ATOM   1463 C CB  . THR B 2 93  ? 112.453 26.793 14.197  1.00 36.29  ? 74  THR H CB  1 
ATOM   1464 O OG1 . THR B 2 93  ? 113.733 26.160 14.117  1.00 35.53  ? 74  THR H OG1 1 
ATOM   1465 C CG2 . THR B 2 93  ? 111.745 26.625 12.867  1.00 33.70  ? 74  THR H CG2 1 
ATOM   1466 N N   . SER B 2 94  ? 114.581 28.826 15.888  1.00 35.16  ? 75  SER H N   1 
ATOM   1467 C CA  . SER B 2 94  ? 115.233 28.992 17.190  1.00 30.85  ? 75  SER H CA  1 
ATOM   1468 C C   . SER B 2 94  ? 114.791 30.305 17.860  1.00 32.95  ? 75  SER H C   1 
ATOM   1469 O O   . SER B 2 94  ? 114.860 30.447 19.081  1.00 34.74  ? 75  SER H O   1 
ATOM   1470 C CB  . SER B 2 94  ? 116.770 28.900 17.065  1.00 37.87  ? 75  SER H CB  1 
ATOM   1471 O OG  . SER B 2 94  ? 117.290 29.681 16.006  1.00 45.45  ? 75  SER H OG  1 
ATOM   1472 N N   . SER B 2 95  ? 114.296 31.255 17.081  1.00 31.55  ? 76  SER H N   1 
ATOM   1473 C CA  . SER B 2 95  ? 113.788 32.481 17.685  1.00 33.62  ? 76  SER H CA  1 
ATOM   1474 C C   . SER B 2 95  ? 112.266 32.651 17.453  1.00 37.78  ? 76  SER H C   1 
ATOM   1475 O O   . SER B 2 95  ? 111.698 33.726 17.699  1.00 33.18  ? 76  SER H O   1 
ATOM   1476 C CB  . SER B 2 95  ? 114.570 33.706 17.171  1.00 32.10  ? 76  SER H CB  1 
ATOM   1477 O OG  . SER B 2 95  ? 114.379 33.922 15.794  1.00 36.44  ? 76  SER H OG  1 
ATOM   1478 N N   . ASN B 2 96  ? 111.615 31.577 17.004  1.00 34.27  ? 77  ASN H N   1 
ATOM   1479 C CA  . ASN B 2 96  ? 110.156 31.559 16.884  1.00 32.28  ? 77  ASN H CA  1 
ATOM   1480 C C   . ASN B 2 96  ? 109.647 32.707 16.021  1.00 30.56  ? 77  ASN H C   1 
ATOM   1481 O O   . ASN B 2 96  ? 108.591 33.260 16.293  1.00 31.09  ? 77  ASN H O   1 
ATOM   1482 C CB  . ASN B 2 96  ? 109.514 31.635 18.272  1.00 31.63  ? 77  ASN H CB  1 
ATOM   1483 C CG  . ASN B 2 96  ? 108.450 30.581 18.491  1.00 34.63  ? 77  ASN H CG  1 
ATOM   1484 O OD1 . ASN B 2 96  ? 108.543 29.466 17.982  1.00 35.43  ? 77  ASN H OD1 1 
ATOM   1485 N ND2 . ASN B 2 96  ? 107.423 30.933 19.261  1.00 37.36  ? 77  ASN H ND2 1 
ATOM   1486 N N   . THR B 2 97  ? 110.427 33.067 15.004  1.00 30.15  ? 78  THR H N   1 
ATOM   1487 C CA  . THR B 2 97  ? 110.178 34.238 14.182  1.00 26.15  ? 78  THR H CA  1 
ATOM   1488 C C   . THR B 2 97  ? 110.108 33.889 12.703  1.00 30.96  ? 78  THR H C   1 
ATOM   1489 O O   . THR B 2 97  ? 110.883 33.058 12.205  1.00 33.68  ? 78  THR H O   1 
ATOM   1490 C CB  . THR B 2 97  ? 111.276 35.299 14.412  1.00 29.05  ? 78  THR H CB  1 
ATOM   1491 O OG1 . THR B 2 97  ? 111.296 35.642 15.805  1.00 34.75  ? 78  THR H OG1 1 
ATOM   1492 C CG2 . THR B 2 97  ? 111.024 36.572 13.574  1.00 26.54  ? 78  THR H CG2 1 
ATOM   1493 N N   . ALA B 2 98  ? 109.168 34.502 11.999  1.00 26.56  ? 79  ALA H N   1 
ATOM   1494 C CA  . ALA B 2 98  ? 109.092 34.335 10.554  1.00 27.86  ? 79  ALA H CA  1 
ATOM   1495 C C   . ALA B 2 98  ? 109.406 35.662 9.928   1.00 25.70  ? 79  ALA H C   1 
ATOM   1496 O O   . ALA B 2 98  ? 109.299 36.679 10.592  1.00 31.70  ? 79  ALA H O   1 
ATOM   1497 C CB  . ALA B 2 98  ? 107.716 33.835 10.122  1.00 31.50  ? 79  ALA H CB  1 
ATOM   1498 N N   . TYR B 2 99  ? 109.811 35.670 8.665   1.00 28.61  ? 80  TYR H N   1 
ATOM   1499 C CA  . TYR B 2 99  ? 110.181 36.925 8.016   1.00 26.24  ? 80  TYR H CA  1 
ATOM   1500 C C   . TYR B 2 99  ? 109.589 37.047 6.642   1.00 28.27  ? 80  TYR H C   1 
ATOM   1501 O O   . TYR B 2 99  ? 109.434 36.061 5.919   1.00 27.65  ? 80  TYR H O   1 
ATOM   1502 C CB  . TYR B 2 99  ? 111.693 37.078 7.872   1.00 30.44  ? 80  TYR H CB  1 
ATOM   1503 C CG  . TYR B 2 99  ? 112.469 36.987 9.144   1.00 30.59  ? 80  TYR H CG  1 
ATOM   1504 C CD1 . TYR B 2 99  ? 112.792 38.134 9.859   1.00 28.89  ? 80  TYR H CD1 1 
ATOM   1505 C CD2 . TYR B 2 99  ? 112.898 35.757 9.626   1.00 26.40  ? 80  TYR H CD2 1 
ATOM   1506 C CE1 . TYR B 2 99  ? 113.515 38.064 11.029  1.00 30.35  ? 80  TYR H CE1 1 
ATOM   1507 C CE2 . TYR B 2 99  ? 113.615 35.671 10.811  1.00 28.05  ? 80  TYR H CE2 1 
ATOM   1508 C CZ  . TYR B 2 99  ? 113.921 36.825 11.505  1.00 31.59  ? 80  TYR H CZ  1 
ATOM   1509 O OH  . TYR B 2 99  ? 114.631 36.758 12.679  1.00 40.60  ? 80  TYR H OH  1 
ATOM   1510 N N   . LEU B 2 100 ? 109.316 38.290 6.272   1.00 28.47  ? 81  LEU H N   1 
ATOM   1511 C CA  . LEU B 2 100 ? 108.887 38.599 4.933   1.00 28.90  ? 81  LEU H CA  1 
ATOM   1512 C C   . LEU B 2 100 ? 109.870 39.579 4.329   1.00 30.13  ? 81  LEU H C   1 
ATOM   1513 O O   . LEU B 2 100 ? 109.987 40.711 4.774   1.00 31.80  ? 81  LEU H O   1 
ATOM   1514 C CB  . LEU B 2 100 ? 107.475 39.175 4.937   1.00 28.34  ? 81  LEU H CB  1 
ATOM   1515 C CG  . LEU B 2 100 ? 107.013 39.712 3.588   1.00 33.78  ? 81  LEU H CG  1 
ATOM   1516 C CD1 . LEU B 2 100 ? 106.959 38.585 2.548   1.00 25.65  ? 81  LEU H CD1 1 
ATOM   1517 C CD2 . LEU B 2 100 ? 105.667 40.467 3.705   1.00 25.95  ? 81  LEU H CD2 1 
ATOM   1518 N N   . GLN B 2 101 ? 110.610 39.137 3.328   1.00 32.89  ? 82  GLN H N   1 
ATOM   1519 C CA  . GLN B 2 101 ? 111.460 40.075 2.635   1.00 34.41  ? 82  GLN H CA  1 
ATOM   1520 C C   . GLN B 2 101 ? 110.803 40.515 1.355   1.00 33.88  ? 82  GLN H C   1 
ATOM   1521 O O   . GLN B 2 101 ? 110.356 39.683 0.562   1.00 34.94  ? 82  GLN H O   1 
ATOM   1522 C CB  . GLN B 2 101 ? 112.825 39.486 2.333   1.00 35.73  ? 82  GLN H CB  1 
ATOM   1523 C CG  . GLN B 2 101 ? 113.622 40.443 1.468   1.00 40.28  ? 82  GLN H CG  1 
ATOM   1524 C CD  . GLN B 2 101 ? 115.089 40.147 1.472   1.00 42.05  ? 82  GLN H CD  1 
ATOM   1525 O OE1 . GLN B 2 101 ? 115.672 39.848 2.516   1.00 48.26  ? 82  GLN H OE1 1 
ATOM   1526 N NE2 . GLN B 2 101 ? 115.708 40.233 0.298   1.00 50.25  ? 82  GLN H NE2 1 
ATOM   1527 N N   . LEU B 2 102 ? 110.741 41.826 1.163   1.00 31.08  ? 83  LEU H N   1 
ATOM   1528 C CA  . LEU B 2 102 ? 110.212 42.405 -0.068  1.00 32.68  ? 83  LEU H CA  1 
ATOM   1529 C C   . LEU B 2 102 ? 111.325 43.149 -0.788  1.00 36.90  ? 83  LEU H C   1 
ATOM   1530 O O   . LEU B 2 102 ? 112.178 43.754 -0.137  1.00 35.23  ? 83  LEU H O   1 
ATOM   1531 C CB  . LEU B 2 102 ? 109.046 43.354 0.222   1.00 35.08  ? 83  LEU H CB  1 
ATOM   1532 C CG  . LEU B 2 102 ? 107.981 42.757 1.130   1.00 35.81  ? 83  LEU H CG  1 
ATOM   1533 C CD1 . LEU B 2 102 ? 106.849 43.740 1.380   1.00 29.68  ? 83  LEU H CD1 1 
ATOM   1534 C CD2 . LEU B 2 102 ? 107.478 41.459 0.509   1.00 36.02  ? 83  LEU H CD2 1 
ATOM   1535 N N   . SER B 2 103 ? 111.315 43.093 -2.119  1.00 35.86  ? 84  SER H N   1 
ATOM   1536 C CA  . SER B 2 103 ? 112.380 43.663 -2.934  1.00 34.23  ? 84  SER H CA  1 
ATOM   1537 C C   . SER B 2 103 ? 111.823 44.401 -4.134  1.00 34.82  ? 84  SER H C   1 
ATOM   1538 O O   . SER B 2 103 ? 110.718 44.115 -4.571  1.00 34.75  ? 84  SER H O   1 
ATOM   1539 C CB  . SER B 2 103 ? 113.314 42.567 -3.413  1.00 38.02  ? 84  SER H CB  1 
ATOM   1540 O OG  . SER B 2 103 ? 112.656 41.820 -4.411  1.00 46.04  ? 84  SER H OG  1 
ATOM   1541 N N   . SER B 2 104 ? 112.615 45.332 -4.667  1.00 36.86  ? 85  SER H N   1 
ATOM   1542 C CA  . SER B 2 104 ? 112.232 46.200 -5.789  1.00 35.57  ? 85  SER H CA  1 
ATOM   1543 C C   . SER B 2 104 ? 110.900 46.851 -5.539  1.00 35.93  ? 85  SER H C   1 
ATOM   1544 O O   . SER B 2 104 ? 110.017 46.810 -6.387  1.00 34.76  ? 85  SER H O   1 
ATOM   1545 C CB  . SER B 2 104 ? 112.163 45.434 -7.109  1.00 30.29  ? 85  SER H CB  1 
ATOM   1546 O OG  . SER B 2 104 ? 113.348 44.715 -7.342  1.00 42.29  ? 85  SER H OG  1 
ATOM   1547 N N   . LEU B 2 105 ? 110.757 47.455 -4.371  1.00 37.18  ? 86  LEU H N   1 
ATOM   1548 C CA  . LEU B 2 105 ? 109.475 48.023 -3.979  1.00 32.65  ? 86  LEU H CA  1 
ATOM   1549 C C   . LEU B 2 105 ? 109.132 49.237 -4.819  1.00 37.95  ? 86  LEU H C   1 
ATOM   1550 O O   . LEU B 2 105 ? 110.023 49.948 -5.307  1.00 41.63  ? 86  LEU H O   1 
ATOM   1551 C CB  . LEU B 2 105 ? 109.489 48.387 -2.498  1.00 32.72  ? 86  LEU H CB  1 
ATOM   1552 C CG  . LEU B 2 105 ? 109.581 47.145 -1.621  1.00 32.70  ? 86  LEU H CG  1 
ATOM   1553 C CD1 . LEU B 2 105 ? 109.950 47.515 -0.228  1.00 38.31  ? 86  LEU H CD1 1 
ATOM   1554 C CD2 . LEU B 2 105 ? 108.252 46.379 -1.649  1.00 35.98  ? 86  LEU H CD2 1 
ATOM   1555 N N   . THR B 2 106 ? 107.836 49.445 -5.012  1.00 36.46  ? 87  THR H N   1 
ATOM   1556 C CA  . THR B 2 106 ? 107.331 50.656 -5.631  1.00 36.66  ? 87  THR H CA  1 
ATOM   1557 C C   . THR B 2 106 ? 106.251 51.281 -4.757  1.00 36.00  ? 87  THR H C   1 
ATOM   1558 O O   . THR B 2 106 ? 105.881 50.725 -3.721  1.00 33.89  ? 87  THR H O   1 
ATOM   1559 C CB  . THR B 2 106 ? 106.765 50.376 -7.012  1.00 41.39  ? 87  THR H CB  1 
ATOM   1560 O OG1 . THR B 2 106 ? 105.664 49.467 -6.880  1.00 48.39  ? 87  THR H OG1 1 
ATOM   1561 C CG2 . THR B 2 106 ? 107.842 49.755 -7.900  1.00 37.61  ? 87  THR H CG2 1 
ATOM   1562 N N   . SER B 2 107 ? 105.766 52.447 -5.168  1.00 36.34  ? 88  SER H N   1 
ATOM   1563 C CA  . SER B 2 107 ? 104.722 53.147 -4.424  1.00 39.47  ? 88  SER H CA  1 
ATOM   1564 C C   . SER B 2 107 ? 103.458 52.288 -4.279  1.00 39.00  ? 88  SER H C   1 
ATOM   1565 O O   . SER B 2 107 ? 102.751 52.362 -3.281  1.00 38.03  ? 88  SER H O   1 
ATOM   1566 C CB  . SER B 2 107 ? 104.388 54.460 -5.109  1.00 36.43  ? 88  SER H CB  1 
ATOM   1567 O OG  . SER B 2 107 ? 103.766 54.199 -6.354  1.00 49.10  ? 88  SER H OG  1 
ATOM   1568 N N   . GLU B 2 108 ? 103.204 51.445 -5.270  1.00 41.48  ? 89  GLU H N   1 
ATOM   1569 C CA  . GLU B 2 108 ? 102.055 50.558 -5.245  1.00 41.08  ? 89  GLU H CA  1 
ATOM   1570 C C   . GLU B 2 108 ? 102.101 49.506 -4.124  1.00 42.64  ? 89  GLU H C   1 
ATOM   1571 O O   . GLU B 2 108 ? 101.077 48.879 -3.821  1.00 42.53  ? 89  GLU H O   1 
ATOM   1572 C CB  . GLU B 2 108 ? 101.929 49.847 -6.586  1.00 43.74  ? 89  GLU H CB  1 
ATOM   1573 C CG  . GLU B 2 108 ? 101.782 50.763 -7.772  1.00 50.15  ? 89  GLU H CG  1 
ATOM   1574 C CD  . GLU B 2 108 ? 101.502 49.980 -9.056  1.00 71.16  ? 89  GLU H CD  1 
ATOM   1575 O OE1 . GLU B 2 108 ? 101.244 48.755 -8.964  1.00 69.90  ? 89  GLU H OE1 1 
ATOM   1576 O OE2 . GLU B 2 108 ? 101.536 50.585 -10.153 1.00 75.14  ? 89  GLU H OE2 1 
ATOM   1577 N N   . ASP B 2 109 ? 103.278 49.292 -3.537  1.00 35.13  ? 90  ASP H N   1 
ATOM   1578 C CA  . ASP B 2 109 ? 103.435 48.315 -2.450  1.00 32.81  ? 90  ASP H CA  1 
ATOM   1579 C C   . ASP B 2 109 ? 103.236 48.962 -1.091  1.00 30.13  ? 90  ASP H C   1 
ATOM   1580 O O   . ASP B 2 109 ? 103.346 48.304 -0.063  1.00 28.38  ? 90  ASP H O   1 
ATOM   1581 C CB  . ASP B 2 109 ? 104.819 47.653 -2.458  1.00 33.62  ? 90  ASP H CB  1 
ATOM   1582 C CG  . ASP B 2 109 ? 105.207 47.066 -3.800  1.00 36.14  ? 90  ASP H CG  1 
ATOM   1583 O OD1 . ASP B 2 109 ? 104.486 46.195 -4.335  1.00 35.98  ? 90  ASP H OD1 1 
ATOM   1584 O OD2 . ASP B 2 109 ? 106.278 47.468 -4.306  1.00 40.64  ? 90  ASP H OD2 1 
ATOM   1585 N N   . THR B 2 110 ? 102.988 50.264 -1.082  1.00 31.80  ? 91  THR H N   1 
ATOM   1586 C CA  . THR B 2 110 ? 102.726 50.951 0.163   1.00 30.93  ? 91  THR H CA  1 
ATOM   1587 C C   . THR B 2 110 ? 101.477 50.327 0.756   1.00 31.69  ? 91  THR H C   1 
ATOM   1588 O O   . THR B 2 110 ? 100.438 50.250 0.097   1.00 31.02  ? 91  THR H O   1 
ATOM   1589 C CB  . THR B 2 110 ? 102.546 52.452 -0.044  1.00 32.11  ? 91  THR H CB  1 
ATOM   1590 O OG1 . THR B 2 110 ? 103.798 53.025 -0.450  1.00 36.65  ? 91  THR H OG1 1 
ATOM   1591 C CG2 . THR B 2 110 ? 102.094 53.101 1.235   1.00 33.15  ? 91  THR H CG2 1 
ATOM   1592 N N   . ALA B 2 111 ? 101.589 49.851 1.986   1.00 28.19  ? 92  ALA H N   1 
ATOM   1593 C CA  . ALA B 2 111 ? 100.572 48.967 2.535   1.00 30.03  ? 92  ALA H CA  1 
ATOM   1594 C C   . ALA B 2 111 ? 100.848 48.590 3.973   1.00 30.85  ? 92  ALA H C   1 
ATOM   1595 O O   . ALA B 2 111 ? 101.918 48.872 4.519   1.00 29.54  ? 92  ALA H O   1 
ATOM   1596 C CB  . ALA B 2 111 ? 100.461 47.711 1.698   1.00 28.37  ? 92  ALA H CB  1 
ATOM   1597 N N   . VAL B 2 112 ? 99.862  47.957 4.590   1.00 27.84  ? 93  VAL H N   1 
ATOM   1598 C CA  . VAL B 2 112 ? 100.070 47.372 5.891   1.00 25.96  ? 93  VAL H CA  1 
ATOM   1599 C C   . VAL B 2 112 ? 100.261 45.877 5.667   1.00 26.46  ? 93  VAL H C   1 
ATOM   1600 O O   . VAL B 2 112 ? 99.506  45.234 4.939   1.00 25.84  ? 93  VAL H O   1 
ATOM   1601 C CB  . VAL B 2 112 ? 98.911  47.674 6.847   1.00 31.16  ? 93  VAL H CB  1 
ATOM   1602 C CG1 . VAL B 2 112 ? 99.040  46.847 8.130   1.00 29.35  ? 93  VAL H CG1 1 
ATOM   1603 C CG2 . VAL B 2 112 ? 98.879  49.165 7.168   1.00 26.63  ? 93  VAL H CG2 1 
ATOM   1604 N N   . TYR B 2 113 ? 101.335 45.342 6.224   1.00 26.07  ? 94  TYR H N   1 
ATOM   1605 C CA  . TYR B 2 113 ? 101.648 43.935 6.022   1.00 29.19  ? 94  TYR H CA  1 
ATOM   1606 C C   . TYR B 2 113 ? 101.356 43.191 7.317   1.00 27.05  ? 94  TYR H C   1 
ATOM   1607 O O   . TYR B 2 113 ? 101.829 43.582 8.390   1.00 31.01  ? 94  TYR H O   1 
ATOM   1608 C CB  . TYR B 2 113 ? 103.112 43.761 5.556   1.00 23.29  ? 94  TYR H CB  1 
ATOM   1609 C CG  . TYR B 2 113 ? 103.317 44.276 4.138   1.00 25.00  ? 94  TYR H CG  1 
ATOM   1610 C CD1 . TYR B 2 113 ? 103.415 45.643 3.882   1.00 26.05  ? 94  TYR H CD1 1 
ATOM   1611 C CD2 . TYR B 2 113 ? 103.380 43.404 3.053   1.00 23.25  ? 94  TYR H CD2 1 
ATOM   1612 C CE1 . TYR B 2 113 ? 103.566 46.136 2.591   1.00 20.72  ? 94  TYR H CE1 1 
ATOM   1613 C CE2 . TYR B 2 113 ? 103.550 43.888 1.748   1.00 24.31  ? 94  TYR H CE2 1 
ATOM   1614 C CZ  . TYR B 2 113 ? 103.637 45.258 1.535   1.00 23.37  ? 94  TYR H CZ  1 
ATOM   1615 O OH  . TYR B 2 113 ? 103.775 45.755 0.268   1.00 25.67  ? 94  TYR H OH  1 
ATOM   1616 N N   . TYR B 2 114 ? 100.535 42.155 7.213   1.00 22.31  ? 95  TYR H N   1 
ATOM   1617 C CA  . TYR B 2 114 ? 100.180 41.321 8.362   1.00 21.85  ? 95  TYR H CA  1 
ATOM   1618 C C   . TYR B 2 114 ? 100.785 39.922 8.251   1.00 24.40  ? 95  TYR H C   1 
ATOM   1619 O O   . TYR B 2 114 ? 100.903 39.371 7.155   1.00 21.84  ? 95  TYR H O   1 
ATOM   1620 C CB  . TYR B 2 114 ? 98.667  41.169 8.498   1.00 20.05  ? 95  TYR H CB  1 
ATOM   1621 C CG  . TYR B 2 114 ? 97.884  42.428 8.795   1.00 24.62  ? 95  TYR H CG  1 
ATOM   1622 C CD1 . TYR B 2 114 ? 97.812  42.936 10.086  1.00 20.80  ? 95  TYR H CD1 1 
ATOM   1623 C CD2 . TYR B 2 114 ? 97.171  43.086 7.794   1.00 26.43  ? 95  TYR H CD2 1 
ATOM   1624 C CE1 . TYR B 2 114 ? 97.097  44.078 10.369  1.00 24.59  ? 95  TYR H CE1 1 
ATOM   1625 C CE2 . TYR B 2 114 ? 96.413  44.232 8.084   1.00 27.62  ? 95  TYR H CE2 1 
ATOM   1626 C CZ  . TYR B 2 114 ? 96.383  44.721 9.379   1.00 28.23  ? 95  TYR H CZ  1 
ATOM   1627 O OH  . TYR B 2 114 ? 95.652  45.854 9.698   1.00 27.62  ? 95  TYR H OH  1 
ATOM   1628 N N   . CYS B 2 115 ? 101.138 39.348 9.397   1.00 24.02  ? 96  CYS H N   1 
ATOM   1629 C CA  . CYS B 2 115 ? 101.383 37.910 9.476   1.00 23.72  ? 96  CYS H CA  1 
ATOM   1630 C C   . CYS B 2 115 ? 100.274 37.216 10.283  1.00 26.82  ? 96  CYS H C   1 
ATOM   1631 O O   . CYS B 2 115 ? 99.681  37.804 11.187  1.00 25.72  ? 96  CYS H O   1 
ATOM   1632 C CB  . CYS B 2 115 ? 102.759 37.611 10.087  1.00 28.59  ? 96  CYS H CB  1 
ATOM   1633 S SG  . CYS B 2 115 ? 102.867 37.959 11.835  1.00 38.71  ? 96  CYS H SG  1 
ATOM   1634 N N   . ALA B 2 116 ? 99.993  35.962 9.939   1.00 30.72  ? 97  ALA H N   1 
ATOM   1635 C CA  . ALA B 2 116 ? 98.919  35.211 10.585  1.00 27.82  ? 97  ALA H CA  1 
ATOM   1636 C C   . ALA B 2 116 ? 99.228  33.735 10.643  1.00 27.59  ? 97  ALA H C   1 
ATOM   1637 O O   . ALA B 2 116 ? 99.921  33.191 9.779   1.00 30.30  ? 97  ALA H O   1 
ATOM   1638 C CB  . ALA B 2 116 ? 97.568  35.441 9.868   1.00 26.42  ? 97  ALA H CB  1 
ATOM   1639 N N   . THR B 2 117 ? 98.715  33.103 11.687  1.00 26.88  ? 98  THR H N   1 
ATOM   1640 C CA  . THR B 2 117 ? 98.798  31.663 11.856  1.00 28.84  ? 98  THR H CA  1 
ATOM   1641 C C   . THR B 2 117 ? 97.603  30.978 11.226  1.00 30.23  ? 98  THR H C   1 
ATOM   1642 O O   . THR B 2 117 ? 96.484  31.513 11.243  1.00 26.78  ? 98  THR H O   1 
ATOM   1643 C CB  . THR B 2 117 ? 98.833  31.265 13.345  1.00 31.03  ? 98  THR H CB  1 
ATOM   1644 O OG1 . THR B 2 117 ? 97.758  31.929 14.029  1.00 33.12  ? 98  THR H OG1 1 
ATOM   1645 C CG2 . THR B 2 117 ? 100.146 31.675 13.984  1.00 30.14  ? 98  THR H CG2 1 
ATOM   1646 N N   . SER B 2 118 ? 97.848  29.792 10.670  1.00 30.75  ? 99  SER H N   1 
ATOM   1647 C CA  . SER B 2 118 ? 96.775  28.853 10.370  1.00 30.63  ? 99  SER H CA  1 
ATOM   1648 C C   . SER B 2 118 ? 97.207  27.492 10.842  1.00 31.77  ? 99  SER H C   1 
ATOM   1649 O O   . SER B 2 118 ? 98.399  27.263 11.055  1.00 29.03  ? 99  SER H O   1 
ATOM   1650 C CB  . SER B 2 118 ? 96.465  28.796 8.881   1.00 31.81  ? 99  SER H CB  1 
ATOM   1651 O OG  . SER B 2 118 ? 97.350  27.900 8.225   1.00 31.77  ? 99  SER H OG  1 
ATOM   1652 N N   . ASP B 2 119 ? 96.237  26.593 11.001  1.00 31.74  ? 100 ASP H N   1 
ATOM   1653 C CA  . ASP B 2 119 ? 96.532  25.173 11.155  1.00 32.35  ? 100 ASP H CA  1 
ATOM   1654 C C   . ASP B 2 119 ? 96.391  24.532 9.765   1.00 32.43  ? 100 ASP H C   1 
ATOM   1655 O O   . ASP B 2 119 ? 96.451  25.239 8.750   1.00 33.91  ? 100 ASP H O   1 
ATOM   1656 C CB  . ASP B 2 119 ? 95.620  24.518 12.211  1.00 28.54  ? 100 ASP H CB  1 
ATOM   1657 C CG  . ASP B 2 119 ? 94.150  24.442 11.782  1.00 33.50  ? 100 ASP H CG  1 
ATOM   1658 O OD1 . ASP B 2 119 ? 93.746  25.015 10.741  1.00 32.85  ? 100 ASP H OD1 1 
ATOM   1659 O OD2 . ASP B 2 119 ? 93.372  23.804 12.517  1.00 33.67  ? 100 ASP H OD2 1 
ATOM   1660 N N   . TYR B 2 120 ? 96.195  23.219 9.712   1.00 31.65  ? 101 TYR H N   1 
ATOM   1661 C CA  . TYR B 2 120 ? 96.011  22.505 8.434   1.00 35.15  ? 101 TYR H CA  1 
ATOM   1662 C C   . TYR B 2 120 ? 94.970  23.111 7.514   1.00 33.87  ? 101 TYR H C   1 
ATOM   1663 O O   . TYR B 2 120 ? 94.982  22.840 6.317   1.00 34.45  ? 101 TYR H O   1 
ATOM   1664 C CB  . TYR B 2 120 ? 95.610  21.051 8.675   1.00 32.80  ? 101 TYR H CB  1 
ATOM   1665 C CG  . TYR B 2 120 ? 94.156  20.890 9.031   1.00 29.48  ? 101 TYR H CG  1 
ATOM   1666 C CD1 . TYR B 2 120 ? 93.727  21.082 10.335  1.00 31.70  ? 101 TYR H CD1 1 
ATOM   1667 C CD2 . TYR B 2 120 ? 93.207  20.525 8.068   1.00 32.46  ? 101 TYR H CD2 1 
ATOM   1668 C CE1 . TYR B 2 120 ? 92.407  20.926 10.679  1.00 32.87  ? 101 TYR H CE1 1 
ATOM   1669 C CE2 . TYR B 2 120 ? 91.866  20.371 8.400   1.00 26.76  ? 101 TYR H CE2 1 
ATOM   1670 C CZ  . TYR B 2 120 ? 91.480  20.568 9.714   1.00 31.66  ? 101 TYR H CZ  1 
ATOM   1671 O OH  . TYR B 2 120 ? 90.170  20.437 10.079  1.00 37.23  ? 101 TYR H OH  1 
ATOM   1672 N N   . SER B 2 121 ? 94.061  23.907 8.079   1.00 34.42  ? 102 SER H N   1 
ATOM   1673 C CA  . SER B 2 121 ? 92.909  24.401 7.340   1.00 34.45  ? 102 SER H CA  1 
ATOM   1674 C C   . SER B 2 121 ? 93.222  25.605 6.456   1.00 32.36  ? 102 SER H C   1 
ATOM   1675 O O   . SER B 2 121 ? 92.457  25.902 5.518   1.00 34.09  ? 102 SER H O   1 
ATOM   1676 C CB  . SER B 2 121 ? 91.781  24.777 8.314   1.00 33.97  ? 102 SER H CB  1 
ATOM   1677 O OG  . SER B 2 121 ? 92.082  25.979 9.027   1.00 32.71  ? 102 SER H OG  1 
ATOM   1678 N N   . TYR B 2 122 ? 94.292  26.325 6.808   1.00 29.29  ? 103 TYR H N   1 
ATOM   1679 C CA  . TYR B 2 122 ? 94.703  27.569 6.134   1.00 30.02  ? 103 TYR H CA  1 
ATOM   1680 C C   . TYR B 2 122 ? 93.797  28.773 6.435   1.00 32.25  ? 103 TYR H C   1 
ATOM   1681 O O   . TYR B 2 122 ? 94.015  29.881 5.923   1.00 31.17  ? 103 TYR H O   1 
ATOM   1682 C CB  . TYR B 2 122 ? 94.805  27.361 4.615   1.00 30.32  ? 103 TYR H CB  1 
ATOM   1683 C CG  . TYR B 2 122 ? 95.888  26.371 4.243   1.00 36.36  ? 103 TYR H CG  1 
ATOM   1684 C CD1 . TYR B 2 122 ? 97.215  26.627 4.573   1.00 31.73  ? 103 TYR H CD1 1 
ATOM   1685 C CD2 . TYR B 2 122 ? 95.586  25.177 3.593   1.00 33.40  ? 103 TYR H CD2 1 
ATOM   1686 C CE1 . TYR B 2 122 ? 98.213  25.744 4.252   1.00 36.52  ? 103 TYR H CE1 1 
ATOM   1687 C CE2 . TYR B 2 122 ? 96.581  24.280 3.268   1.00 39.68  ? 103 TYR H CE2 1 
ATOM   1688 C CZ  . TYR B 2 122 ? 97.900  24.577 3.603   1.00 40.26  ? 103 TYR H CZ  1 
ATOM   1689 O OH  . TYR B 2 122 ? 98.915  23.714 3.293   1.00 43.49  ? 103 TYR H OH  1 
ATOM   1690 N N   . ALA B 2 123 ? 92.783  28.576 7.264   1.00 31.67  ? 104 ALA H N   1 
ATOM   1691 C CA  . ALA B 2 123 ? 92.038  29.733 7.730   1.00 30.75  ? 104 ALA H CA  1 
ATOM   1692 C C   . ALA B 2 123 ? 92.935  30.515 8.695   1.00 25.33  ? 104 ALA H C   1 
ATOM   1693 O O   . ALA B 2 123 ? 93.667  29.945 9.502   1.00 23.24  ? 104 ALA H O   1 
ATOM   1694 C CB  . ALA B 2 123 ? 90.725  29.320 8.383   1.00 22.18  ? 104 ALA H CB  1 
ATOM   1695 N N   . LEU B 2 124 ? 92.878  31.837 8.603   1.00 30.45  ? 105 LEU H N   1 
ATOM   1696 C CA  . LEU B 2 124 ? 93.818  32.678 9.343   1.00 26.42  ? 105 LEU H CA  1 
ATOM   1697 C C   . LEU B 2 124 ? 93.283  33.013 10.740  1.00 26.83  ? 105 LEU H C   1 
ATOM   1698 O O   . LEU B 2 124 ? 92.490  33.929 10.934  1.00 28.98  ? 105 LEU H O   1 
ATOM   1699 C CB  . LEU B 2 124 ? 94.130  33.925 8.528   1.00 24.24  ? 105 LEU H CB  1 
ATOM   1700 C CG  . LEU B 2 124 ? 94.718  33.591 7.143   1.00 22.30  ? 105 LEU H CG  1 
ATOM   1701 C CD1 . LEU B 2 124 ? 95.196  34.837 6.420   1.00 23.68  ? 105 LEU H CD1 1 
ATOM   1702 C CD2 . LEU B 2 124 ? 95.855  32.562 7.243   1.00 20.90  ? 105 LEU H CD2 1 
ATOM   1703 N N   . ASP B 2 125 ? 93.737  32.246 11.719  1.00 25.97  ? 106 ASP H N   1 
ATOM   1704 C CA  . ASP B 2 125 ? 93.091  32.224 13.014  1.00 29.55  ? 106 ASP H CA  1 
ATOM   1705 C C   . ASP B 2 125 ? 93.646  33.235 14.042  1.00 29.95  ? 106 ASP H C   1 
ATOM   1706 O O   . ASP B 2 125 ? 92.946  33.598 14.997  1.00 29.40  ? 106 ASP H O   1 
ATOM   1707 C CB  . ASP B 2 125 ? 93.154  30.795 13.558  1.00 28.73  ? 106 ASP H CB  1 
ATOM   1708 C CG  . ASP B 2 125 ? 94.572  30.324 13.792  1.00 33.70  ? 106 ASP H CG  1 
ATOM   1709 O OD1 . ASP B 2 125 ? 95.301  31.041 14.514  1.00 33.43  ? 106 ASP H OD1 1 
ATOM   1710 O OD2 . ASP B 2 125 ? 94.971  29.251 13.254  1.00 31.68  ? 106 ASP H OD2 1 
ATOM   1711 N N   . SER B 2 126 ? 94.889  33.670 13.858  1.00 26.29  ? 107 SER H N   1 
ATOM   1712 C CA  . SER B 2 126 ? 95.466  34.735 14.690  1.00 26.42  ? 107 SER H CA  1 
ATOM   1713 C C   . SER B 2 126 ? 96.323  35.681 13.847  1.00 26.31  ? 107 SER H C   1 
ATOM   1714 O O   . SER B 2 126 ? 97.000  35.242 12.937  1.00 26.66  ? 107 SER H O   1 
ATOM   1715 C CB  . SER B 2 126 ? 96.293  34.146 15.834  1.00 27.80  ? 107 SER H CB  1 
ATOM   1716 O OG  . SER B 2 126 ? 95.552  33.131 16.508  1.00 31.21  ? 107 SER H OG  1 
ATOM   1717 N N   . TRP B 2 127 ? 96.285  36.973 14.165  1.00 22.83  ? 108 TRP H N   1 
ATOM   1718 C CA  . TRP B 2 127 ? 96.942  38.011 13.370  1.00 24.14  ? 108 TRP H CA  1 
ATOM   1719 C C   . TRP B 2 127 ? 97.835  38.944 14.190  1.00 29.87  ? 108 TRP H C   1 
ATOM   1720 O O   . TRP B 2 127 ? 97.389  39.468 15.216  1.00 31.24  ? 108 TRP H O   1 
ATOM   1721 C CB  . TRP B 2 127 ? 95.901  38.890 12.681  1.00 24.88  ? 108 TRP H CB  1 
ATOM   1722 C CG  . TRP B 2 127 ? 95.027  38.194 11.713  1.00 25.37  ? 108 TRP H CG  1 
ATOM   1723 C CD1 . TRP B 2 127 ? 94.138  37.187 11.973  1.00 21.86  ? 108 TRP H CD1 1 
ATOM   1724 C CD2 . TRP B 2 127 ? 94.934  38.467 10.314  1.00 25.49  ? 108 TRP H CD2 1 
ATOM   1725 N NE1 . TRP B 2 127 ? 93.512  36.804 10.815  1.00 23.58  ? 108 TRP H NE1 1 
ATOM   1726 C CE2 . TRP B 2 127 ? 93.968  37.581 9.781   1.00 24.42  ? 108 TRP H CE2 1 
ATOM   1727 C CE3 . TRP B 2 127 ? 95.573  39.375 9.455   1.00 23.08  ? 108 TRP H CE3 1 
ATOM   1728 C CZ2 . TRP B 2 127 ? 93.625  37.572 8.429   1.00 23.88  ? 108 TRP H CZ2 1 
ATOM   1729 C CZ3 . TRP B 2 127 ? 95.232  39.371 8.102   1.00 26.81  ? 108 TRP H CZ3 1 
ATOM   1730 C CH2 . TRP B 2 127 ? 94.260  38.472 7.604   1.00 25.33  ? 108 TRP H CH2 1 
ATOM   1731 N N   . GLY B 2 128 ? 99.065  39.191 13.732  1.00 23.39  ? 109 GLY H N   1 
ATOM   1732 C CA  . GLY B 2 128 ? 99.847  40.286 14.276  1.00 26.31  ? 109 GLY H CA  1 
ATOM   1733 C C   . GLY B 2 128 ? 99.176  41.659 14.141  1.00 24.76  ? 109 GLY H C   1 
ATOM   1734 O O   . GLY B 2 128 ? 98.151  41.808 13.484  1.00 23.70  ? 109 GLY H O   1 
ATOM   1735 N N   . GLN B 2 129 ? 99.775  42.666 14.758  1.00 23.08  ? 110 GLN H N   1 
ATOM   1736 C CA  . GLN B 2 129 ? 99.222  44.009 14.764  1.00 22.28  ? 110 GLN H CA  1 
ATOM   1737 C C   . GLN B 2 129 ? 99.417  44.656 13.416  1.00 21.59  ? 110 GLN H C   1 
ATOM   1738 O O   . GLN B 2 129 ? 98.853  45.699 13.152  1.00 28.84  ? 110 GLN H O   1 
ATOM   1739 C CB  . GLN B 2 129 ? 99.854  44.871 15.873  1.00 21.83  ? 110 GLN H CB  1 
ATOM   1740 C CG  . GLN B 2 129 ? 101.226 45.520 15.516  1.00 26.05  ? 110 GLN H CG  1 
ATOM   1741 C CD  . GLN B 2 129 ? 102.449 44.621 15.846  1.00 34.04  ? 110 GLN H CD  1 
ATOM   1742 O OE1 . GLN B 2 129 ? 102.342 43.391 15.901  1.00 26.47  ? 110 GLN H OE1 1 
ATOM   1743 N NE2 . GLN B 2 129 ? 103.614 45.257 16.079  1.00 30.68  ? 110 GLN H NE2 1 
ATOM   1744 N N   . GLY B 2 130 ? 100.203 44.033 12.548  1.00 22.76  ? 111 GLY H N   1 
ATOM   1745 C CA  . GLY B 2 130 ? 100.528 44.645 11.268  1.00 23.43  ? 111 GLY H CA  1 
ATOM   1746 C C   . GLY B 2 130 ? 101.765 45.546 11.275  1.00 27.88  ? 111 GLY H C   1 
ATOM   1747 O O   . GLY B 2 130 ? 102.150 46.116 12.303  1.00 24.75  ? 111 GLY H O   1 
ATOM   1748 N N   . THR B 2 131 ? 102.394 45.666 10.110  1.00 27.48  ? 112 THR H N   1 
ATOM   1749 C CA  . THR B 2 131 ? 103.543 46.542 9.933   1.00 27.06  ? 112 THR H CA  1 
ATOM   1750 C C   . THR B 2 131 ? 103.287 47.499 8.798   1.00 27.27  ? 112 THR H C   1 
ATOM   1751 O O   . THR B 2 131 ? 103.094 47.081 7.666   1.00 30.73  ? 112 THR H O   1 
ATOM   1752 C CB  . THR B 2 131 ? 104.841 45.760 9.616   1.00 28.22  ? 112 THR H CB  1 
ATOM   1753 O OG1 . THR B 2 131 ? 105.173 44.884 10.706  1.00 29.97  ? 112 THR H OG1 1 
ATOM   1754 C CG2 . THR B 2 131 ? 106.003 46.732 9.393   1.00 26.94  ? 112 THR H CG2 1 
ATOM   1755 N N   . SER B 2 132 ? 103.314 48.790 9.075   1.00 28.91  ? 113 SER H N   1 
ATOM   1756 C CA  . SER B 2 132 ? 103.044 49.740 8.020   1.00 28.22  ? 113 SER H CA  1 
ATOM   1757 C C   . SER B 2 132 ? 104.289 50.086 7.229   1.00 33.07  ? 113 SER H C   1 
ATOM   1758 O O   . SER B 2 132 ? 105.257 50.602 7.782   1.00 35.92  ? 113 SER H O   1 
ATOM   1759 C CB  . SER B 2 132 ? 102.442 51.008 8.577   1.00 30.26  ? 113 SER H CB  1 
ATOM   1760 O OG  . SER B 2 132 ? 102.264 51.904 7.503   1.00 43.66  ? 113 SER H OG  1 
ATOM   1761 N N   . VAL B 2 133 ? 104.233 49.819 5.925   1.00 33.65  ? 114 VAL H N   1 
ATOM   1762 C CA  . VAL B 2 133 ? 105.352 50.001 5.013   1.00 28.80  ? 114 VAL H CA  1 
ATOM   1763 C C   . VAL B 2 133 ? 105.076 51.075 3.974   1.00 36.07  ? 114 VAL H C   1 
ATOM   1764 O O   . VAL B 2 133 ? 104.196 50.910 3.115   1.00 33.68  ? 114 VAL H O   1 
ATOM   1765 C CB  . VAL B 2 133 ? 105.687 48.687 4.254   1.00 29.80  ? 114 VAL H CB  1 
ATOM   1766 C CG1 . VAL B 2 133 ? 106.674 48.964 3.119   1.00 24.07  ? 114 VAL H CG1 1 
ATOM   1767 C CG2 . VAL B 2 133 ? 106.197 47.597 5.218   1.00 25.23  ? 114 VAL H CG2 1 
ATOM   1768 N N   . THR B 2 134 ? 105.833 52.170 4.034   1.00 37.82  ? 115 THR H N   1 
ATOM   1769 C CA  . THR B 2 134 ? 105.662 53.241 3.060   1.00 34.18  ? 115 THR H CA  1 
ATOM   1770 C C   . THR B 2 134 ? 106.793 53.229 2.059   1.00 31.43  ? 115 THR H C   1 
ATOM   1771 O O   . THR B 2 134 ? 107.955 53.257 2.440   1.00 34.91  ? 115 THR H O   1 
ATOM   1772 C CB  . THR B 2 134 ? 105.599 54.629 3.724   1.00 32.93  ? 115 THR H CB  1 
ATOM   1773 O OG1 . THR B 2 134 ? 104.477 54.690 4.602   1.00 34.34  ? 115 THR H OG1 1 
ATOM   1774 C CG2 . THR B 2 134 ? 105.458 55.712 2.666   1.00 29.89  ? 115 THR H CG2 1 
ATOM   1775 N N   . VAL B 2 135 ? 106.457 53.176 0.776   1.00 29.66  ? 116 VAL H N   1 
ATOM   1776 C CA  . VAL B 2 135 ? 107.480 53.252 -0.250  1.00 30.58  ? 116 VAL H CA  1 
ATOM   1777 C C   . VAL B 2 135 ? 107.503 54.646 -0.869  1.00 35.56  ? 116 VAL H C   1 
ATOM   1778 O O   . VAL B 2 135 ? 106.553 55.053 -1.546  1.00 38.25  ? 116 VAL H O   1 
ATOM   1779 C CB  . VAL B 2 135 ? 107.267 52.192 -1.341  1.00 31.32  ? 116 VAL H CB  1 
ATOM   1780 C CG1 . VAL B 2 135 ? 108.447 52.166 -2.286  1.00 31.63  ? 116 VAL H CG1 1 
ATOM   1781 C CG2 . VAL B 2 135 ? 107.101 50.818 -0.705  1.00 29.55  ? 116 VAL H CG2 1 
ATOM   1782 N N   . SER B 2 136 ? 108.589 55.378 -0.648  1.00 33.75  ? 117 SER H N   1 
ATOM   1783 C CA  . SER B 2 136 ? 108.644 56.765 -1.104  1.00 38.24  ? 117 SER H CA  1 
ATOM   1784 C C   . SER B 2 136 ? 110.053 57.332 -1.212  1.00 38.19  ? 117 SER H C   1 
ATOM   1785 O O   . SER B 2 136 ? 110.936 56.979 -0.428  1.00 37.77  ? 117 SER H O   1 
ATOM   1786 C CB  . SER B 2 136 ? 107.828 57.650 -0.158  1.00 31.38  ? 117 SER H CB  1 
ATOM   1787 O OG  . SER B 2 136 ? 107.686 58.941 -0.687  1.00 36.36  ? 117 SER H OG  1 
ATOM   1788 N N   . SER B 2 137 ? 110.247 58.235 -2.171  1.00 41.31  ? 118 SER H N   1 
ATOM   1789 C CA  . SER B 2 137 ? 111.516 58.963 -2.313  1.00 40.16  ? 118 SER H CA  1 
ATOM   1790 C C   . SER B 2 137 ? 111.625 60.141 -1.348  1.00 46.91  ? 118 SER H C   1 
ATOM   1791 O O   . SER B 2 137 ? 112.701 60.723 -1.211  1.00 44.61  ? 118 SER H O   1 
ATOM   1792 C CB  . SER B 2 137 ? 111.693 59.491 -3.735  1.00 36.78  ? 118 SER H CB  1 
ATOM   1793 O OG  . SER B 2 137 ? 111.820 58.431 -4.655  1.00 45.92  ? 118 SER H OG  1 
ATOM   1794 N N   . ALA B 2 138 ? 110.522 60.500 -0.692  1.00 40.60  ? 119 ALA H N   1 
ATOM   1795 C CA  . ALA B 2 138 ? 110.509 61.694 0.142   1.00 41.21  ? 119 ALA H CA  1 
ATOM   1796 C C   . ALA B 2 138 ? 111.377 61.482 1.371   1.00 43.59  ? 119 ALA H C   1 
ATOM   1797 O O   . ALA B 2 138 ? 111.558 60.348 1.810   1.00 45.78  ? 119 ALA H O   1 
ATOM   1798 C CB  . ALA B 2 138 ? 109.089 62.055 0.532   1.00 44.46  ? 119 ALA H CB  1 
ATOM   1799 N N   . LYS B 2 139 ? 111.931 62.561 1.921   1.00 42.75  ? 120 LYS H N   1 
ATOM   1800 C CA  . LYS B 2 139 ? 112.819 62.434 3.078   1.00 42.19  ? 120 LYS H CA  1 
ATOM   1801 C C   . LYS B 2 139 ? 112.000 62.424 4.346   1.00 43.38  ? 120 LYS H C   1 
ATOM   1802 O O   . LYS B 2 139 ? 110.938 63.043 4.406   1.00 44.84  ? 120 LYS H O   1 
ATOM   1803 C CB  . LYS B 2 139 ? 113.855 63.572 3.134   1.00 46.88  ? 120 LYS H CB  1 
ATOM   1804 C CG  . LYS B 2 139 ? 113.276 64.947 3.488   1.00 52.27  ? 120 LYS H CG  1 
ATOM   1805 C CD  . LYS B 2 139 ? 114.276 66.071 3.231   1.00 53.70  ? 120 LYS H CD  1 
ATOM   1806 C CE  . LYS B 2 139 ? 113.644 67.462 3.411   1.00 63.09  ? 120 LYS H CE  1 
ATOM   1807 N NZ  . LYS B 2 139 ? 112.503 67.745 2.479   1.00 68.49  ? 120 LYS H NZ  1 
ATOM   1808 N N   . THR B 2 140 ? 112.497 61.714 5.352   1.00 39.77  ? 121 THR H N   1 
ATOM   1809 C CA  . THR B 2 140 ? 111.880 61.709 6.667   1.00 41.58  ? 121 THR H CA  1 
ATOM   1810 C C   . THR B 2 140 ? 111.869 63.132 7.212   1.00 41.33  ? 121 THR H C   1 
ATOM   1811 O O   . THR B 2 140 ? 112.788 63.907 6.956   1.00 44.30  ? 121 THR H O   1 
ATOM   1812 C CB  . THR B 2 140 ? 112.626 60.756 7.623   1.00 39.50  ? 121 THR H CB  1 
ATOM   1813 O OG1 . THR B 2 140 ? 112.550 59.432 7.100   1.00 43.19  ? 121 THR H OG1 1 
ATOM   1814 C CG2 . THR B 2 140 ? 112.022 60.756 9.035   1.00 42.27  ? 121 THR H CG2 1 
ATOM   1815 N N   . THR B 2 141 ? 110.802 63.482 7.920   1.00 44.43  ? 122 THR H N   1 
ATOM   1816 C CA  . THR B 2 141 ? 110.652 64.809 8.525   1.00 46.58  ? 122 THR H CA  1 
ATOM   1817 C C   . THR B 2 141 ? 110.007 64.665 9.888   1.00 43.79  ? 122 THR H C   1 
ATOM   1818 O O   . THR B 2 141 ? 108.995 63.979 10.028  1.00 46.51  ? 122 THR H O   1 
ATOM   1819 C CB  . THR B 2 141 ? 109.774 65.768 7.679   1.00 43.93  ? 122 THR H CB  1 
ATOM   1820 O OG1 . THR B 2 141 ? 110.224 65.802 6.320   1.00 44.35  ? 122 THR H OG1 1 
ATOM   1821 C CG2 . THR B 2 141 ? 109.805 67.177 8.264   1.00 47.23  ? 122 THR H CG2 1 
ATOM   1822 N N   . ALA B 2 142 ? 110.585 65.309 10.892  1.00 39.43  ? 123 ALA H N   1 
ATOM   1823 C CA  . ALA B 2 142 ? 109.986 65.308 12.212  1.00 43.13  ? 123 ALA H CA  1 
ATOM   1824 C C   . ALA B 2 142 ? 108.852 66.347 12.262  1.00 44.70  ? 123 ALA H C   1 
ATOM   1825 O O   . ALA B 2 142 ? 108.867 67.331 11.533  1.00 42.20  ? 123 ALA H O   1 
ATOM   1826 C CB  . ALA B 2 142 ? 111.040 65.582 13.274  1.00 38.45  ? 123 ALA H CB  1 
ATOM   1827 N N   . PRO B 2 143 ? 107.838 66.110 13.094  1.00 48.91  ? 124 PRO H N   1 
ATOM   1828 C CA  . PRO B 2 143 ? 106.759 67.102 13.069  1.00 50.15  ? 124 PRO H CA  1 
ATOM   1829 C C   . PRO B 2 143 ? 106.941 68.170 14.126  1.00 47.95  ? 124 PRO H C   1 
ATOM   1830 O O   . PRO B 2 143 ? 107.593 67.920 15.136  1.00 51.24  ? 124 PRO H O   1 
ATOM   1831 C CB  . PRO B 2 143 ? 105.515 66.271 13.370  1.00 45.82  ? 124 PRO H CB  1 
ATOM   1832 C CG  . PRO B 2 143 ? 106.040 65.156 14.268  1.00 47.77  ? 124 PRO H CG  1 
ATOM   1833 C CD  . PRO B 2 143 ? 107.478 64.897 13.855  1.00 45.87  ? 124 PRO H CD  1 
ATOM   1834 N N   . SER B 2 144 ? 106.367 69.340 13.890  1.00 47.57  ? 125 SER H N   1 
ATOM   1835 C CA  . SER B 2 144 ? 106.200 70.316 14.948  1.00 48.88  ? 125 SER H CA  1 
ATOM   1836 C C   . SER B 2 144 ? 104.922 69.939 15.683  1.00 51.23  ? 125 SER H C   1 
ATOM   1837 O O   . SER B 2 144 ? 103.967 69.466 15.063  1.00 46.35  ? 125 SER H O   1 
ATOM   1838 C CB  . SER B 2 144 ? 106.127 71.723 14.378  1.00 47.25  ? 125 SER H CB  1 
ATOM   1839 O OG  . SER B 2 144 ? 107.033 71.859 13.296  1.00 49.29  ? 125 SER H OG  1 
ATOM   1840 N N   . VAL B 2 145 ? 104.906 70.110 17.000  1.00 51.12  ? 126 VAL H N   1 
ATOM   1841 C CA  . VAL B 2 145 ? 103.761 69.687 17.800  1.00 50.28  ? 126 VAL H CA  1 
ATOM   1842 C C   . VAL B 2 145 ? 103.197 70.857 18.581  1.00 51.89  ? 126 VAL H C   1 
ATOM   1843 O O   . VAL B 2 145 ? 103.866 71.407 19.451  1.00 60.93  ? 126 VAL H O   1 
ATOM   1844 C CB  . VAL B 2 145 ? 104.143 68.548 18.765  1.00 50.74  ? 126 VAL H CB  1 
ATOM   1845 C CG1 . VAL B 2 145 ? 103.019 68.273 19.727  1.00 46.87  ? 126 VAL H CG1 1 
ATOM   1846 C CG2 . VAL B 2 145 ? 104.486 67.300 17.983  1.00 44.91  ? 126 VAL H CG2 1 
ATOM   1847 N N   . TYR B 2 146 ? 101.964 71.237 18.275  1.00 45.08  ? 127 TYR H N   1 
ATOM   1848 C CA  . TYR B 2 146 ? 101.432 72.503 18.774  1.00 48.74  ? 127 TYR H CA  1 
ATOM   1849 C C   . TYR B 2 146 ? 100.277 72.356 19.749  1.00 49.12  ? 127 TYR H C   1 
ATOM   1850 O O   . TYR B 2 146 ? 99.230  71.832 19.389  1.00 48.15  ? 127 TYR H O   1 
ATOM   1851 C CB  . TYR B 2 146 ? 100.980 73.358 17.602  1.00 45.86  ? 127 TYR H CB  1 
ATOM   1852 C CG  . TYR B 2 146 ? 102.096 73.723 16.669  1.00 50.20  ? 127 TYR H CG  1 
ATOM   1853 C CD1 . TYR B 2 146 ? 103.292 74.236 17.156  1.00 52.23  ? 127 TYR H CD1 1 
ATOM   1854 C CD2 . TYR B 2 146 ? 101.958 73.552 15.300  1.00 47.49  ? 127 TYR H CD2 1 
ATOM   1855 C CE1 . TYR B 2 146 ? 104.321 74.572 16.299  1.00 53.66  ? 127 TYR H CE1 1 
ATOM   1856 C CE2 . TYR B 2 146 ? 102.975 73.881 14.440  1.00 51.62  ? 127 TYR H CE2 1 
ATOM   1857 C CZ  . TYR B 2 146 ? 104.159 74.393 14.940  1.00 52.56  ? 127 TYR H CZ  1 
ATOM   1858 O OH  . TYR B 2 146 ? 105.176 74.724 14.069  1.00 55.07  ? 127 TYR H OH  1 
ATOM   1859 N N   . PRO B 2 147 ? 100.453 72.845 20.986  1.00 53.16  ? 128 PRO H N   1 
ATOM   1860 C CA  . PRO B 2 147 ? 99.349  72.757 21.950  1.00 50.53  ? 128 PRO H CA  1 
ATOM   1861 C C   . PRO B 2 147 ? 98.192  73.659 21.532  1.00 47.35  ? 128 PRO H C   1 
ATOM   1862 O O   . PRO B 2 147 ? 98.408  74.825 21.211  1.00 48.37  ? 128 PRO H O   1 
ATOM   1863 C CB  . PRO B 2 147 ? 99.981  73.234 23.263  1.00 51.65  ? 128 PRO H CB  1 
ATOM   1864 C CG  . PRO B 2 147 ? 101.069 74.170 22.824  1.00 58.64  ? 128 PRO H CG  1 
ATOM   1865 C CD  . PRO B 2 147 ? 101.605 73.599 21.519  1.00 55.33  ? 128 PRO H CD  1 
ATOM   1866 N N   . LEU B 2 148 ? 96.980  73.116 21.503  1.00 48.32  ? 129 LEU H N   1 
ATOM   1867 C CA  . LEU B 2 148 ? 95.820  73.910 21.121  1.00 48.89  ? 129 LEU H CA  1 
ATOM   1868 C C   . LEU B 2 148 ? 94.949  74.222 22.329  1.00 48.85  ? 129 LEU H C   1 
ATOM   1869 O O   . LEU B 2 148 ? 94.227  73.359 22.838  1.00 46.33  ? 129 LEU H O   1 
ATOM   1870 C CB  . LEU B 2 148 ? 95.006  73.193 20.055  1.00 48.57  ? 129 LEU H CB  1 
ATOM   1871 C CG  . LEU B 2 148 ? 95.368  73.433 18.586  1.00 44.61  ? 129 LEU H CG  1 
ATOM   1872 C CD1 . LEU B 2 148 ? 96.849  73.619 18.375  1.00 44.99  ? 129 LEU H CD1 1 
ATOM   1873 C CD2 . LEU B 2 148 ? 94.847  72.279 17.756  1.00 43.46  ? 129 LEU H CD2 1 
ATOM   1874 N N   . ALA B 2 149 ? 95.041  75.469 22.784  1.00 47.83  ? 130 ALA H N   1 
ATOM   1875 C CA  . ALA B 2 149 ? 94.290  75.935 23.942  1.00 53.37  ? 130 ALA H CA  1 
ATOM   1876 C C   . ALA B 2 149 ? 93.079  76.709 23.473  1.00 51.71  ? 130 ALA H C   1 
ATOM   1877 O O   . ALA B 2 149 ? 93.114  77.317 22.399  1.00 55.01  ? 130 ALA H O   1 
ATOM   1878 C CB  . ALA B 2 149 ? 95.173  76.808 24.849  1.00 57.22  ? 130 ALA H CB  1 
ATOM   1879 N N   . PRO B 2 150 ? 91.998  76.686 24.265  1.00 49.85  ? 131 PRO H N   1 
ATOM   1880 C CA  . PRO B 2 150 ? 90.793  77.458 23.931  1.00 49.72  ? 131 PRO H CA  1 
ATOM   1881 C C   . PRO B 2 150 ? 91.038  78.968 23.936  1.00 58.39  ? 131 PRO H C   1 
ATOM   1882 O O   . PRO B 2 150 ? 92.050  79.444 24.466  1.00 60.52  ? 131 PRO H O   1 
ATOM   1883 C CB  . PRO B 2 150 ? 89.803  77.062 25.025  1.00 46.36  ? 131 PRO H CB  1 
ATOM   1884 C CG  . PRO B 2 150 ? 90.611  76.474 26.113  1.00 49.29  ? 131 PRO H CG  1 
ATOM   1885 C CD  . PRO B 2 150 ? 91.835  75.894 25.495  1.00 49.47  ? 131 PRO H CD  1 
ATOM   1886 N N   . VAL B 2 151 ? 90.115  79.710 23.334  1.00 59.62  ? 132 VAL H N   1 
ATOM   1887 C CA  . VAL B 2 151 ? 90.215  81.164 23.231  1.00 58.94  ? 132 VAL H CA  1 
ATOM   1888 C C   . VAL B 2 151 ? 90.045  81.851 24.594  1.00 66.74  ? 132 VAL H C   1 
ATOM   1889 O O   . VAL B 2 151 ? 89.626  81.213 25.563  1.00 67.15  ? 132 VAL H O   1 
ATOM   1890 C CB  . VAL B 2 151 ? 89.159  81.700 22.262  1.00 62.13  ? 132 VAL H CB  1 
ATOM   1891 C CG1 . VAL B 2 151 ? 89.058  80.787 21.048  1.00 54.95  ? 132 VAL H CG1 1 
ATOM   1892 C CG2 . VAL B 2 151 ? 87.811  81.785 22.955  1.00 63.35  ? 132 VAL H CG2 1 
ATOM   1893 N N   . CYS B 2 152 ? 90.366  83.145 24.667  1.00 70.62  ? 133 CYS H N   1 
ATOM   1894 C CA  . CYS B 2 152 ? 90.201  83.916 25.907  1.00 70.10  ? 133 CYS H CA  1 
ATOM   1895 C C   . CYS B 2 152 ? 88.756  84.359 26.126  1.00 66.09  ? 133 CYS H C   1 
ATOM   1896 O O   . CYS B 2 152 ? 87.878  83.548 26.437  1.00 65.74  ? 133 CYS H O   1 
ATOM   1897 C CB  . CYS B 2 152 ? 91.116  85.142 25.905  1.00 71.24  ? 133 CYS H CB  1 
ATOM   1898 S SG  . CYS B 2 152 ? 92.877  84.751 25.790  1.00 80.43  ? 133 CYS H SG  1 
ATOM   1899 N N   . THR B 2 155 ? 83.818  81.679 28.972  1.00 99.93  ? 136 THR H N   1 
ATOM   1900 C CA  . THR B 2 155 ? 84.590  80.830 29.877  1.00 102.87 ? 136 THR H CA  1 
ATOM   1901 C C   . THR B 2 155 ? 83.688  79.766 30.512  1.00 101.92 ? 136 THR H C   1 
ATOM   1902 O O   . THR B 2 155 ? 82.850  80.054 31.370  1.00 98.30  ? 136 THR H O   1 
ATOM   1903 C CB  . THR B 2 155 ? 85.307  81.674 30.971  1.00 106.14 ? 136 THR H CB  1 
ATOM   1904 O OG1 . THR B 2 155 ? 86.271  82.539 30.351  1.00 107.76 ? 136 THR H OG1 1 
ATOM   1905 C CG2 . THR B 2 155 ? 86.027  80.782 31.972  1.00 98.86  ? 136 THR H CG2 1 
ATOM   1906 N N   . THR B 2 156 ? 83.862  78.539 30.026  1.00 105.51 ? 137 THR H N   1 
ATOM   1907 C CA  . THR B 2 156 ? 83.245  77.314 30.556  1.00 101.64 ? 137 THR H CA  1 
ATOM   1908 C C   . THR B 2 156 ? 81.717  77.222 30.461  1.00 99.77  ? 137 THR H C   1 
ATOM   1909 O O   . THR B 2 156 ? 80.982  78.007 31.062  1.00 99.93  ? 137 THR H O   1 
ATOM   1910 C CB  . THR B 2 156 ? 83.644  77.090 32.031  1.00 103.31 ? 137 THR H CB  1 
ATOM   1911 O OG1 . THR B 2 156 ? 85.058  76.852 32.115  1.00 96.79  ? 137 THR H OG1 1 
ATOM   1912 C CG2 . THR B 2 156 ? 82.901  75.893 32.612  1.00 94.77  ? 137 THR H CG2 1 
ATOM   1913 N N   . GLY B 2 157 ? 81.260  76.234 29.697  1.00 95.98  ? 138 GLY H N   1 
ATOM   1914 C CA  . GLY B 2 157 ? 79.879  75.799 29.730  1.00 91.52  ? 138 GLY H CA  1 
ATOM   1915 C C   . GLY B 2 157 ? 79.827  74.399 30.322  1.00 93.11  ? 138 GLY H C   1 
ATOM   1916 O O   . GLY B 2 157 ? 79.199  73.503 29.752  1.00 94.32  ? 138 GLY H O   1 
ATOM   1917 N N   . SER B 2 158 ? 80.493  74.220 31.465  1.00 86.26  ? 139 SER H N   1 
ATOM   1918 C CA  . SER B 2 158 ? 80.609  72.924 32.149  1.00 87.14  ? 139 SER H CA  1 
ATOM   1919 C C   . SER B 2 158 ? 81.213  71.840 31.256  1.00 84.86  ? 139 SER H C   1 
ATOM   1920 O O   . SER B 2 158 ? 80.949  70.654 31.440  1.00 83.84  ? 139 SER H O   1 
ATOM   1921 C CB  . SER B 2 158 ? 79.248  72.459 32.675  1.00 88.25  ? 139 SER H CB  1 
ATOM   1922 O OG  . SER B 2 158 ? 78.755  73.331 33.677  1.00 91.31  ? 139 SER H OG  1 
ATOM   1923 N N   . SER B 2 159 ? 82.026  72.264 30.294  1.00 84.40  ? 140 SER H N   1 
ATOM   1924 C CA  . SER B 2 159 ? 82.696  71.358 29.366  1.00 76.66  ? 140 SER H CA  1 
ATOM   1925 C C   . SER B 2 159 ? 83.789  72.109 28.613  1.00 72.52  ? 140 SER H C   1 
ATOM   1926 O O   . SER B 2 159 ? 83.590  73.246 28.176  1.00 71.36  ? 140 SER H O   1 
ATOM   1927 C CB  . SER B 2 159 ? 81.698  70.747 28.379  1.00 80.09  ? 140 SER H CB  1 
ATOM   1928 O OG  . SER B 2 159 ? 82.366  70.081 27.319  1.00 74.39  ? 140 SER H OG  1 
ATOM   1929 N N   . VAL B 2 160 ? 84.950  71.486 28.469  1.00 66.51  ? 141 VAL H N   1 
ATOM   1930 C CA  . VAL B 2 160 ? 86.036  72.141 27.758  1.00 61.45  ? 141 VAL H CA  1 
ATOM   1931 C C   . VAL B 2 160 ? 86.864  71.147 26.932  1.00 57.14  ? 141 VAL H C   1 
ATOM   1932 O O   . VAL B 2 160 ? 87.134  70.011 27.345  1.00 53.50  ? 141 VAL H O   1 
ATOM   1933 C CB  . VAL B 2 160 ? 86.951  72.925 28.731  1.00 50.68  ? 141 VAL H CB  1 
ATOM   1934 C CG1 . VAL B 2 160 ? 87.721  71.988 29.640  1.00 57.46  ? 141 VAL H CG1 1 
ATOM   1935 C CG2 . VAL B 2 160 ? 87.907  73.821 27.954  1.00 57.54  ? 141 VAL H CG2 1 
ATOM   1936 N N   . THR B 2 161 ? 87.258  71.597 25.749  1.00 55.01  ? 142 THR H N   1 
ATOM   1937 C CA  . THR B 2 161 ? 87.984  70.766 24.812  1.00 48.01  ? 142 THR H CA  1 
ATOM   1938 C C   . THR B 2 161 ? 89.370  71.352 24.527  1.00 48.31  ? 142 THR H C   1 
ATOM   1939 O O   . THR B 2 161 ? 89.505  72.540 24.238  1.00 50.00  ? 142 THR H O   1 
ATOM   1940 C CB  . THR B 2 161 ? 87.177  70.606 23.516  1.00 44.09  ? 142 THR H CB  1 
ATOM   1941 O OG1 . THR B 2 161 ? 85.934  69.982 23.831  1.00 48.23  ? 142 THR H OG1 1 
ATOM   1942 C CG2 . THR B 2 161 ? 87.918  69.750 22.501  1.00 45.45  ? 142 THR H CG2 1 
ATOM   1943 N N   . LEU B 2 162 ? 90.398  70.515 24.662  1.00 47.29  ? 143 LEU H N   1 
ATOM   1944 C CA  . LEU B 2 162 ? 91.760  70.875 24.276  1.00 49.48  ? 143 LEU H CA  1 
ATOM   1945 C C   . LEU B 2 162 ? 92.142  70.168 22.981  1.00 45.95  ? 143 LEU H C   1 
ATOM   1946 O O   . LEU B 2 162 ? 91.534  69.162 22.604  1.00 43.38  ? 143 LEU H O   1 
ATOM   1947 C CB  . LEU B 2 162 ? 92.766  70.509 25.372  1.00 48.10  ? 143 LEU H CB  1 
ATOM   1948 C CG  . LEU B 2 162 ? 92.568  71.099 26.763  1.00 53.06  ? 143 LEU H CG  1 
ATOM   1949 C CD1 . LEU B 2 162 ? 93.749  70.745 27.628  1.00 51.70  ? 143 LEU H CD1 1 
ATOM   1950 C CD2 . LEU B 2 162 ? 92.371  72.609 26.703  1.00 53.29  ? 143 LEU H CD2 1 
ATOM   1951 N N   . GLY B 2 163 ? 93.169  70.686 22.320  1.00 45.78  ? 144 GLY H N   1 
ATOM   1952 C CA  . GLY B 2 163 ? 93.618  70.128 21.062  1.00 43.50  ? 144 GLY H CA  1 
ATOM   1953 C C   . GLY B 2 163 ? 95.123  70.006 20.947  1.00 44.31  ? 144 GLY H C   1 
ATOM   1954 O O   . GLY B 2 163 ? 95.883  70.660 21.663  1.00 44.33  ? 144 GLY H O   1 
ATOM   1955 N N   . CYS B 2 164 ? 95.549  69.155 20.025  1.00 45.11  ? 145 CYS H N   1 
ATOM   1956 C CA  . CYS B 2 164 ? 96.955  68.939 19.748  1.00 43.07  ? 145 CYS H CA  1 
ATOM   1957 C C   . CYS B 2 164 ? 97.109  68.845 18.248  1.00 41.07  ? 145 CYS H C   1 
ATOM   1958 O O   . CYS B 2 164 ? 96.431  68.053 17.587  1.00 41.92  ? 145 CYS H O   1 
ATOM   1959 C CB  . CYS B 2 164 ? 97.466  67.667 20.437  1.00 45.23  ? 145 CYS H CB  1 
ATOM   1960 S SG  . CYS B 2 164 ? 99.269  67.438 20.424  1.00 47.89  ? 145 CYS H SG  1 
ATOM   1961 N N   . LEU B 2 165 ? 97.993  69.663 17.707  1.00 39.62  ? 146 LEU H N   1 
ATOM   1962 C CA  . LEU B 2 165 ? 98.186  69.712 16.276  1.00 39.35  ? 146 LEU H CA  1 
ATOM   1963 C C   . LEU B 2 165 ? 99.583  69.197 15.881  1.00 44.75  ? 146 LEU H C   1 
ATOM   1964 O O   . LEU B 2 165 ? 100.601 69.841 16.134  1.00 45.85  ? 146 LEU H O   1 
ATOM   1965 C CB  . LEU B 2 165 ? 97.961  71.144 15.793  1.00 36.24  ? 146 LEU H CB  1 
ATOM   1966 C CG  . LEU B 2 165 ? 98.215  71.401 14.313  1.00 43.10  ? 146 LEU H CG  1 
ATOM   1967 C CD1 . LEU B 2 165 ? 97.337  70.509 13.472  1.00 35.10  ? 146 LEU H CD1 1 
ATOM   1968 C CD2 . LEU B 2 165 ? 97.955  72.861 13.999  1.00 45.39  ? 146 LEU H CD2 1 
ATOM   1969 N N   . VAL B 2 166 ? 99.630  68.032 15.250  1.00 43.04  ? 147 VAL H N   1 
ATOM   1970 C CA  . VAL B 2 166 ? 100.908 67.448 14.853  1.00 37.81  ? 147 VAL H CA  1 
ATOM   1971 C C   . VAL B 2 166 ? 101.168 67.719 13.380  1.00 40.98  ? 147 VAL H C   1 
ATOM   1972 O O   . VAL B 2 166 ? 100.540 67.112 12.513  1.00 44.86  ? 147 VAL H O   1 
ATOM   1973 C CB  . VAL B 2 166 ? 100.923 65.950 15.120  1.00 36.70  ? 147 VAL H CB  1 
ATOM   1974 C CG1 . VAL B 2 166 ? 102.278 65.366 14.787  1.00 39.18  ? 147 VAL H CG1 1 
ATOM   1975 C CG2 . VAL B 2 166 ? 100.564 65.689 16.582  1.00 34.05  ? 147 VAL H CG2 1 
ATOM   1976 N N   . LYS B 2 167 ? 102.095 68.630 13.096  1.00 39.88  ? 148 LYS H N   1 
ATOM   1977 C CA  . LYS B 2 167 ? 102.172 69.226 11.763  1.00 44.35  ? 148 LYS H CA  1 
ATOM   1978 C C   . LYS B 2 167 ? 103.486 69.037 10.982  1.00 42.46  ? 148 LYS H C   1 
ATOM   1979 O O   . LYS B 2 167 ? 104.590 69.142 11.524  1.00 41.63  ? 148 LYS H O   1 
ATOM   1980 C CB  . LYS B 2 167 ? 101.865 70.725 11.868  1.00 41.80  ? 148 LYS H CB  1 
ATOM   1981 C CG  . LYS B 2 167 ? 101.609 71.370 10.529  1.00 42.30  ? 148 LYS H CG  1 
ATOM   1982 C CD  . LYS B 2 167 ? 100.896 72.697 10.653  1.00 40.76  ? 148 LYS H CD  1 
ATOM   1983 C CE  . LYS B 2 167 ? 100.543 73.195 9.272   1.00 44.20  ? 148 LYS H CE  1 
ATOM   1984 N NZ  . LYS B 2 167 ? 101.749 73.113 8.388   1.00 48.61  ? 148 LYS H NZ  1 
ATOM   1985 N N   . GLY B 2 168 ? 103.324 68.759 9.691   1.00 39.10  ? 149 GLY H N   1 
ATOM   1986 C CA  . GLY B 2 168 ? 104.427 68.686 8.754   1.00 46.51  ? 149 GLY H CA  1 
ATOM   1987 C C   . GLY B 2 168 ? 105.440 67.585 8.987   1.00 48.17  ? 149 GLY H C   1 
ATOM   1988 O O   . GLY B 2 168 ? 106.621 67.869 9.156   1.00 52.03  ? 149 GLY H O   1 
ATOM   1989 N N   . TYR B 2 169 ? 104.984 66.334 8.983   1.00 46.71  ? 150 TYR H N   1 
ATOM   1990 C CA  . TYR B 2 169 ? 105.882 65.195 9.139   1.00 44.62  ? 150 TYR H CA  1 
ATOM   1991 C C   . TYR B 2 169 ? 105.759 64.184 8.020   1.00 48.71  ? 150 TYR H C   1 
ATOM   1992 O O   . TYR B 2 169 ? 104.820 64.221 7.213   1.00 51.69  ? 150 TYR H O   1 
ATOM   1993 C CB  . TYR B 2 169 ? 105.630 64.479 10.459  1.00 42.64  ? 150 TYR H CB  1 
ATOM   1994 C CG  . TYR B 2 169 ? 104.278 63.808 10.542  1.00 46.24  ? 150 TYR H CG  1 
ATOM   1995 C CD1 . TYR B 2 169 ? 104.129 62.451 10.258  1.00 47.81  ? 150 TYR H CD1 1 
ATOM   1996 C CD2 . TYR B 2 169 ? 103.140 64.527 10.909  1.00 43.26  ? 150 TYR H CD2 1 
ATOM   1997 C CE1 . TYR B 2 169 ? 102.886 61.829 10.336  1.00 42.02  ? 150 TYR H CE1 1 
ATOM   1998 C CE2 . TYR B 2 169 ? 101.904 63.913 11.000  1.00 40.00  ? 150 TYR H CE2 1 
ATOM   1999 C CZ  . TYR B 2 169 ? 101.783 62.569 10.717  1.00 43.35  ? 150 TYR H CZ  1 
ATOM   2000 O OH  . TYR B 2 169 ? 100.553 61.963 10.802  1.00 42.74  ? 150 TYR H OH  1 
ATOM   2001 N N   . PHE B 2 170 ? 106.704 63.252 8.013   1.00 42.44  ? 151 PHE H N   1 
ATOM   2002 C CA  . PHE B 2 170 ? 106.729 62.184 7.043   1.00 38.14  ? 151 PHE H CA  1 
ATOM   2003 C C   . PHE B 2 170 ? 107.725 61.114 7.484   1.00 40.62  ? 151 PHE H C   1 
ATOM   2004 O O   . PHE B 2 170 ? 108.793 61.432 7.984   1.00 45.38  ? 151 PHE H O   1 
ATOM   2005 C CB  . PHE B 2 170 ? 107.096 62.725 5.673   1.00 38.68  ? 151 PHE H CB  1 
ATOM   2006 C CG  . PHE B 2 170 ? 106.922 61.736 4.589   1.00 45.53  ? 151 PHE H CG  1 
ATOM   2007 C CD1 . PHE B 2 170 ? 105.661 61.458 4.095   1.00 44.82  ? 151 PHE H CD1 1 
ATOM   2008 C CD2 . PHE B 2 170 ? 108.005 61.055 4.076   1.00 39.68  ? 151 PHE H CD2 1 
ATOM   2009 C CE1 . PHE B 2 170 ? 105.485 60.526 3.096   1.00 45.90  ? 151 PHE H CE1 1 
ATOM   2010 C CE2 . PHE B 2 170 ? 107.833 60.125 3.072   1.00 41.60  ? 151 PHE H CE2 1 
ATOM   2011 C CZ  . PHE B 2 170 ? 106.570 59.863 2.578   1.00 42.05  ? 151 PHE H CZ  1 
ATOM   2012 N N   . PRO B 2 171 ? 107.370 59.834 7.332   1.00 40.72  ? 152 PRO H N   1 
ATOM   2013 C CA  . PRO B 2 171 ? 106.106 59.315 6.808   1.00 42.49  ? 152 PRO H CA  1 
ATOM   2014 C C   . PRO B 2 171 ? 105.085 59.020 7.917   1.00 41.24  ? 152 PRO H C   1 
ATOM   2015 O O   . PRO B 2 171 ? 105.320 59.318 9.084   1.00 39.13  ? 152 PRO H O   1 
ATOM   2016 C CB  . PRO B 2 171 ? 106.550 58.016 6.142   1.00 39.00  ? 152 PRO H CB  1 
ATOM   2017 C CG  . PRO B 2 171 ? 107.559 57.498 7.117   1.00 33.61  ? 152 PRO H CG  1 
ATOM   2018 C CD  . PRO B 2 171 ? 108.286 58.729 7.662   1.00 36.74  ? 152 PRO H CD  1 
ATOM   2019 N N   . GLU B 2 172 ? 103.965 58.420 7.543   1.00 42.75  ? 153 GLU H N   1 
ATOM   2020 C CA  . GLU B 2 172 ? 103.085 57.791 8.514   1.00 43.72  ? 153 GLU H CA  1 
ATOM   2021 C C   . GLU B 2 172 ? 103.860 56.614 9.119   1.00 41.53  ? 153 GLU H C   1 
ATOM   2022 O O   . GLU B 2 172 ? 104.547 55.907 8.398   1.00 43.96  ? 153 GLU H O   1 
ATOM   2023 C CB  . GLU B 2 172 ? 101.797 57.331 7.832   1.00 37.32  ? 153 GLU H CB  1 
ATOM   2024 C CG  . GLU B 2 172 ? 100.627 57.106 8.740   1.00 56.59  ? 153 GLU H CG  1 
ATOM   2025 C CD  . GLU B 2 172 ? 99.872  58.381 9.033   1.00 51.91  ? 153 GLU H CD  1 
ATOM   2026 O OE1 . GLU B 2 172 ? 100.128 58.996 10.099  1.00 45.81  ? 153 GLU H OE1 1 
ATOM   2027 O OE2 . GLU B 2 172 ? 99.027  58.751 8.188   1.00 52.56  ? 153 GLU H OE2 1 
ATOM   2028 N N   . PRO B 2 173 ? 103.711 56.347 10.420  1.00 42.21  ? 154 PRO H N   1 
ATOM   2029 C CA  . PRO B 2 173 ? 102.733 56.876 11.370  1.00 41.45  ? 154 PRO H CA  1 
ATOM   2030 C C   . PRO B 2 173 ? 103.292 57.685 12.537  1.00 42.84  ? 154 PRO H C   1 
ATOM   2031 O O   . PRO B 2 173 ? 104.496 57.666 12.818  1.00 43.01  ? 154 PRO H O   1 
ATOM   2032 C CB  . PRO B 2 173 ? 102.093 55.596 11.897  1.00 43.52  ? 154 PRO H CB  1 
ATOM   2033 C CG  . PRO B 2 173 ? 103.261 54.535 11.806  1.00 45.72  ? 154 PRO H CG  1 
ATOM   2034 C CD  . PRO B 2 173 ? 104.363 55.147 10.968  1.00 41.11  ? 154 PRO H CD  1 
ATOM   2035 N N   . VAL B 2 174 ? 102.395 58.396 13.213  1.00 42.89  ? 155 VAL H N   1 
ATOM   2036 C CA  . VAL B 2 174 ? 102.686 58.957 14.527  1.00 41.97  ? 155 VAL H CA  1 
ATOM   2037 C C   . VAL B 2 174 ? 101.751 58.308 15.539  1.00 40.75  ? 155 VAL H C   1 
ATOM   2038 O O   . VAL B 2 174 ? 100.707 57.785 15.175  1.00 36.90  ? 155 VAL H O   1 
ATOM   2039 C CB  . VAL B 2 174 ? 102.501 60.495 14.579  1.00 42.65  ? 155 VAL H CB  1 
ATOM   2040 C CG1 . VAL B 2 174 ? 103.454 61.203 13.628  1.00 38.36  ? 155 VAL H CG1 1 
ATOM   2041 C CG2 . VAL B 2 174 ? 101.072 60.861 14.261  1.00 41.51  ? 155 VAL H CG2 1 
ATOM   2042 N N   . THR B 2 175 ? 102.120 58.340 16.811  1.00 43.27  ? 156 THR H N   1 
ATOM   2043 C CA  . THR B 2 175 ? 101.216 57.894 17.858  1.00 39.83  ? 156 THR H CA  1 
ATOM   2044 C C   . THR B 2 175 ? 100.995 59.027 18.828  1.00 43.08  ? 156 THR H C   1 
ATOM   2045 O O   . THR B 2 175 ? 101.936 59.700 19.225  1.00 42.58  ? 156 THR H O   1 
ATOM   2046 C CB  . THR B 2 175 ? 101.757 56.678 18.628  1.00 46.33  ? 156 THR H CB  1 
ATOM   2047 O OG1 . THR B 2 175 ? 103.031 57.014 19.195  1.00 50.44  ? 156 THR H OG1 1 
ATOM   2048 C CG2 . THR B 2 175 ? 101.876 55.448 17.700  1.00 38.65  ? 156 THR H CG2 1 
ATOM   2049 N N   . LEU B 2 176 ? 99.743  59.241 19.201  1.00 45.69  ? 157 LEU H N   1 
ATOM   2050 C CA  . LEU B 2 176 ? 99.389  60.353 20.070  1.00 44.84  ? 157 LEU H CA  1 
ATOM   2051 C C   . LEU B 2 176 ? 98.634  59.819 21.261  1.00 46.42  ? 157 LEU H C   1 
ATOM   2052 O O   . LEU B 2 176 ? 97.772  58.958 21.129  1.00 49.14  ? 157 LEU H O   1 
ATOM   2053 C CB  . LEU B 2 176 ? 98.546  61.398 19.326  1.00 40.13  ? 157 LEU H CB  1 
ATOM   2054 C CG  . LEU B 2 176 ? 98.236  62.716 20.041  1.00 44.59  ? 157 LEU H CG  1 
ATOM   2055 C CD1 . LEU B 2 176 ? 98.058  63.844 19.024  1.00 40.10  ? 157 LEU H CD1 1 
ATOM   2056 C CD2 . LEU B 2 176 ? 97.019  62.603 20.931  1.00 36.84  ? 157 LEU H CD2 1 
ATOM   2057 N N   . THR B 2 177 ? 98.961  60.339 22.431  1.00 49.72  ? 158 THR H N   1 
ATOM   2058 C CA  . THR B 2 177 ? 98.236  59.985 23.634  1.00 50.67  ? 158 THR H CA  1 
ATOM   2059 C C   . THR B 2 177 ? 98.062  61.254 24.432  1.00 48.63  ? 158 THR H C   1 
ATOM   2060 O O   . THR B 2 177 ? 98.763  62.238 24.198  1.00 48.58  ? 158 THR H O   1 
ATOM   2061 C CB  . THR B 2 177 ? 98.978  58.918 24.476  1.00 54.57  ? 158 THR H CB  1 
ATOM   2062 O OG1 . THR B 2 177 ? 100.343 59.309 24.637  1.00 57.08  ? 158 THR H OG1 1 
ATOM   2063 C CG2 . THR B 2 177 ? 98.931  57.558 23.799  1.00 46.90  ? 158 THR H CG2 1 
ATOM   2064 N N   . TRP B 2 178 ? 97.123  61.237 25.365  1.00 47.94  ? 159 TRP H N   1 
ATOM   2065 C CA  . TRP B 2 178 ? 96.933  62.378 26.244  1.00 53.66  ? 159 TRP H CA  1 
ATOM   2066 C C   . TRP B 2 178 ? 97.272  61.962 27.668  1.00 59.50  ? 159 TRP H C   1 
ATOM   2067 O O   . TRP B 2 178 ? 96.666  61.030 28.213  1.00 56.92  ? 159 TRP H O   1 
ATOM   2068 C CB  . TRP B 2 178 ? 95.508  62.914 26.168  1.00 47.61  ? 159 TRP H CB  1 
ATOM   2069 C CG  . TRP B 2 178 ? 95.149  63.544 24.874  1.00 43.76  ? 159 TRP H CG  1 
ATOM   2070 C CD1 . TRP B 2 178 ? 94.539  62.941 23.819  1.00 40.56  ? 159 TRP H CD1 1 
ATOM   2071 C CD2 . TRP B 2 178 ? 95.335  64.917 24.503  1.00 45.72  ? 159 TRP H CD2 1 
ATOM   2072 N NE1 . TRP B 2 178 ? 94.340  63.847 22.808  1.00 43.49  ? 159 TRP H NE1 1 
ATOM   2073 C CE2 . TRP B 2 178 ? 94.818  65.070 23.203  1.00 43.05  ? 159 TRP H CE2 1 
ATOM   2074 C CE3 . TRP B 2 178 ? 95.898  66.030 25.140  1.00 47.11  ? 159 TRP H CE3 1 
ATOM   2075 C CZ2 . TRP B 2 178 ? 94.855  66.288 22.523  1.00 44.14  ? 159 TRP H CZ2 1 
ATOM   2076 C CZ3 . TRP B 2 178 ? 95.936  67.236 24.468  1.00 42.60  ? 159 TRP H CZ3 1 
ATOM   2077 C CH2 . TRP B 2 178 ? 95.418  67.358 23.174  1.00 49.37  ? 159 TRP H CH2 1 
ATOM   2078 N N   . ASN B 2 179 ? 98.238  62.671 28.254  1.00 62.43  ? 160 ASN H N   1 
ATOM   2079 C CA  . ASN B 2 179 ? 98.827  62.313 29.541  1.00 61.18  ? 160 ASN H CA  1 
ATOM   2080 C C   . ASN B 2 179 ? 99.117  60.816 29.609  1.00 59.55  ? 160 ASN H C   1 
ATOM   2081 O O   . ASN B 2 179 ? 98.619  60.114 30.482  1.00 60.12  ? 160 ASN H O   1 
ATOM   2082 C CB  . ASN B 2 179 ? 97.918  62.755 30.689  1.00 59.22  ? 160 ASN H CB  1 
ATOM   2083 C CG  . ASN B 2 179 ? 97.996  64.254 30.951  1.00 59.54  ? 160 ASN H CG  1 
ATOM   2084 O OD1 . ASN B 2 179 ? 96.992  64.895 31.224  1.00 62.18  ? 160 ASN H OD1 1 
ATOM   2085 N ND2 . ASN B 2 179 ? 99.200  64.813 30.869  1.00 65.06  ? 160 ASN H ND2 1 
ATOM   2086 N N   . SER B 2 180 ? 99.891  60.345 28.634  1.00 57.50  ? 161 SER H N   1 
ATOM   2087 C CA  . SER B 2 180 ? 100.403 58.981 28.597  1.00 60.91  ? 161 SER H CA  1 
ATOM   2088 C C   . SER B 2 180 ? 99.315  57.893 28.672  1.00 66.75  ? 161 SER H C   1 
ATOM   2089 O O   . SER B 2 180 ? 99.513  56.849 29.299  1.00 73.61  ? 161 SER H O   1 
ATOM   2090 C CB  . SER B 2 180 ? 101.424 58.795 29.724  1.00 64.21  ? 161 SER H CB  1 
ATOM   2091 O OG  . SER B 2 180 ? 102.296 57.707 29.459  1.00 75.64  ? 161 SER H OG  1 
ATOM   2092 N N   . GLY B 2 181 ? 98.178  58.129 28.021  1.00 60.37  ? 162 GLY H N   1 
ATOM   2093 C CA  . GLY B 2 181 ? 97.166  57.097 27.860  1.00 61.94  ? 162 GLY H CA  1 
ATOM   2094 C C   . GLY B 2 181 ? 96.143  57.064 28.979  1.00 71.27  ? 162 GLY H C   1 
ATOM   2095 O O   . GLY B 2 181 ? 95.034  56.533 28.816  1.00 67.83  ? 162 GLY H O   1 
ATOM   2096 N N   . SER B 2 182 ? 96.525  57.638 30.116  1.00 68.38  ? 163 SER H N   1 
ATOM   2097 C CA  . SER B 2 182 ? 95.651  57.736 31.280  1.00 68.85  ? 163 SER H CA  1 
ATOM   2098 C C   . SER B 2 182 ? 94.318  58.395 30.935  1.00 66.64  ? 163 SER H C   1 
ATOM   2099 O O   . SER B 2 182 ? 93.258  58.001 31.430  1.00 69.84  ? 163 SER H O   1 
ATOM   2100 C CB  . SER B 2 182 ? 96.350  58.525 32.379  1.00 64.34  ? 163 SER H CB  1 
ATOM   2101 O OG  . SER B 2 182 ? 96.759  59.783 31.880  1.00 66.88  ? 163 SER H OG  1 
ATOM   2102 N N   . LEU B 2 183 ? 94.388  59.406 30.082  1.00 64.09  ? 164 LEU H N   1 
ATOM   2103 C CA  . LEU B 2 183 ? 93.207  60.115 29.619  1.00 65.06  ? 164 LEU H CA  1 
ATOM   2104 C C   . LEU B 2 183 ? 92.812  59.557 28.264  1.00 63.67  ? 164 LEU H C   1 
ATOM   2105 O O   . LEU B 2 183 ? 93.610  59.616 27.327  1.00 62.37  ? 164 LEU H O   1 
ATOM   2106 C CB  . LEU B 2 183 ? 93.498  61.601 29.527  1.00 56.05  ? 164 LEU H CB  1 
ATOM   2107 C CG  . LEU B 2 183 ? 92.297  62.468 29.236  1.00 60.38  ? 164 LEU H CG  1 
ATOM   2108 C CD1 . LEU B 2 183 ? 91.235  62.150 30.257  1.00 65.58  ? 164 LEU H CD1 1 
ATOM   2109 C CD2 . LEU B 2 183 ? 92.727  63.933 29.320  1.00 64.47  ? 164 LEU H CD2 1 
ATOM   2110 N N   . SER B 2 184 ? 91.604  59.009 28.147  1.00 60.05  ? 165 SER H N   1 
ATOM   2111 C CA  . SER B 2 184 ? 91.269  58.238 26.949  1.00 58.97  ? 165 SER H CA  1 
ATOM   2112 C C   . SER B 2 184 ? 89.839  58.447 26.474  1.00 56.03  ? 165 SER H C   1 
ATOM   2113 O O   . SER B 2 184 ? 89.594  58.608 25.277  1.00 52.82  ? 165 SER H O   1 
ATOM   2114 C CB  . SER B 2 184 ? 91.511  56.738 27.192  1.00 60.73  ? 165 SER H CB  1 
ATOM   2115 O OG  . SER B 2 184 ? 90.506  56.172 28.019  1.00 66.20  ? 165 SER H OG  1 
ATOM   2116 N N   . SER B 2 185 ? 88.883  58.406 27.391  1.00 56.49  ? 166 SER H N   1 
ATOM   2117 C CA  . SER B 2 185 ? 87.531  58.746 26.990  1.00 54.65  ? 166 SER H CA  1 
ATOM   2118 C C   . SER B 2 185 ? 87.532  60.240 26.751  1.00 48.84  ? 166 SER H C   1 
ATOM   2119 O O   . SER B 2 185 ? 88.307  60.978 27.366  1.00 53.65  ? 166 SER H O   1 
ATOM   2120 C CB  . SER B 2 185 ? 86.497  58.332 28.037  1.00 57.78  ? 166 SER H CB  1 
ATOM   2121 O OG  . SER B 2 185 ? 87.066  58.309 29.330  1.00 69.01  ? 166 SER H OG  1 
ATOM   2122 N N   . GLY B 2 186 ? 86.698  60.688 25.830  1.00 46.94  ? 167 GLY H N   1 
ATOM   2123 C CA  . GLY B 2 186 ? 86.649  62.100 25.519  1.00 46.73  ? 167 GLY H CA  1 
ATOM   2124 C C   . GLY B 2 186 ? 87.684  62.452 24.471  1.00 45.82  ? 167 GLY H C   1 
ATOM   2125 O O   . GLY B 2 186 ? 87.732  63.588 23.996  1.00 43.39  ? 167 GLY H O   1 
ATOM   2126 N N   . VAL B 2 187 ? 88.500  61.467 24.097  1.00 41.57  ? 168 VAL H N   1 
ATOM   2127 C CA  . VAL B 2 187 ? 89.521  61.675 23.085  1.00 41.59  ? 168 VAL H CA  1 
ATOM   2128 C C   . VAL B 2 187 ? 89.060  61.337 21.661  1.00 41.05  ? 168 VAL H C   1 
ATOM   2129 O O   . VAL B 2 187 ? 88.519  60.266 21.406  1.00 42.80  ? 168 VAL H O   1 
ATOM   2130 C CB  . VAL B 2 187 ? 90.774  60.851 23.398  1.00 43.18  ? 168 VAL H CB  1 
ATOM   2131 C CG1 . VAL B 2 187 ? 91.639  60.730 22.167  1.00 31.34  ? 168 VAL H CG1 1 
ATOM   2132 C CG2 . VAL B 2 187 ? 91.537  61.478 24.553  1.00 41.17  ? 168 VAL H CG2 1 
ATOM   2133 N N   . HIS B 2 188 ? 89.275  62.277 20.744  1.00 39.44  ? 169 HIS H N   1 
ATOM   2134 C CA  . HIS B 2 188 ? 89.116  62.032 19.315  1.00 36.76  ? 169 HIS H CA  1 
ATOM   2135 C C   . HIS B 2 188 ? 90.419  62.347 18.612  1.00 33.84  ? 169 HIS H C   1 
ATOM   2136 O O   . HIS B 2 188 ? 90.897  63.480 18.649  1.00 35.29  ? 169 HIS H O   1 
ATOM   2137 C CB  . HIS B 2 188 ? 87.995  62.882 18.720  1.00 36.09  ? 169 HIS H CB  1 
ATOM   2138 C CG  . HIS B 2 188 ? 86.639  62.554 19.254  1.00 38.15  ? 169 HIS H CG  1 
ATOM   2139 N ND1 . HIS B 2 188 ? 85.980  61.386 18.939  1.00 39.87  ? 169 HIS H ND1 1 
ATOM   2140 C CD2 . HIS B 2 188 ? 85.815  63.244 20.074  1.00 38.55  ? 169 HIS H CD2 1 
ATOM   2141 C CE1 . HIS B 2 188 ? 84.808  61.369 19.544  1.00 43.30  ? 169 HIS H CE1 1 
ATOM   2142 N NE2 . HIS B 2 188 ? 84.686  62.482 20.246  1.00 44.02  ? 169 HIS H NE2 1 
ATOM   2143 N N   . THR B 2 189 ? 91.012  61.346 17.986  1.00 35.19  ? 170 THR H N   1 
ATOM   2144 C CA  . THR B 2 189 ? 92.236  61.570 17.224  1.00 35.79  ? 170 THR H CA  1 
ATOM   2145 C C   . THR B 2 189 ? 91.949  61.358 15.742  1.00 36.00  ? 170 THR H C   1 
ATOM   2146 O O   . THR B 2 189 ? 91.372  60.350 15.342  1.00 38.57  ? 170 THR H O   1 
ATOM   2147 C CB  . THR B 2 189 ? 93.373  60.661 17.698  1.00 32.08  ? 170 THR H CB  1 
ATOM   2148 O OG1 . THR B 2 189 ? 93.785  61.070 19.012  1.00 36.61  ? 170 THR H OG1 1 
ATOM   2149 C CG2 . THR B 2 189 ? 94.559  60.768 16.760  1.00 33.83  ? 170 THR H CG2 1 
ATOM   2150 N N   . PHE B 2 190 ? 92.336  62.318 14.922  1.00 30.19  ? 171 PHE H N   1 
ATOM   2151 C CA  . PHE B 2 190 ? 91.877  62.312 13.549  1.00 33.22  ? 171 PHE H CA  1 
ATOM   2152 C C   . PHE B 2 190 ? 92.940  61.783 12.576  1.00 34.06  ? 171 PHE H C   1 
ATOM   2153 O O   . PHE B 2 190 ? 94.131  62.023 12.748  1.00 38.12  ? 171 PHE H O   1 
ATOM   2154 C CB  . PHE B 2 190 ? 91.413  63.723 13.174  1.00 30.92  ? 171 PHE H CB  1 
ATOM   2155 C CG  . PHE B 2 190 ? 90.413  64.301 14.147  1.00 33.09  ? 171 PHE H CG  1 
ATOM   2156 C CD1 . PHE B 2 190 ? 90.838  64.925 15.315  1.00 33.50  ? 171 PHE H CD1 1 
ATOM   2157 C CD2 . PHE B 2 190 ? 89.045  64.206 13.904  1.00 34.42  ? 171 PHE H CD2 1 
ATOM   2158 C CE1 . PHE B 2 190 ? 89.933  65.440 16.217  1.00 34.35  ? 171 PHE H CE1 1 
ATOM   2159 C CE2 . PHE B 2 190 ? 88.131  64.724 14.804  1.00 33.81  ? 171 PHE H CE2 1 
ATOM   2160 C CZ  . PHE B 2 190 ? 88.575  65.345 15.959  1.00 33.54  ? 171 PHE H CZ  1 
ATOM   2161 N N   . PRO B 2 191 ? 92.502  61.021 11.568  1.00 33.86  ? 172 PRO H N   1 
ATOM   2162 C CA  . PRO B 2 191 ? 93.388  60.493 10.535  1.00 32.40  ? 172 PRO H CA  1 
ATOM   2163 C C   . PRO B 2 191 ? 94.194  61.604 9.906   1.00 35.11  ? 172 PRO H C   1 
ATOM   2164 O O   . PRO B 2 191 ? 93.683  62.718 9.752   1.00 37.16  ? 172 PRO H O   1 
ATOM   2165 C CB  . PRO B 2 191 ? 92.421  59.885 9.518   1.00 33.38  ? 172 PRO H CB  1 
ATOM   2166 C CG  . PRO B 2 191 ? 91.206  59.562 10.318  1.00 39.44  ? 172 PRO H CG  1 
ATOM   2167 C CD  . PRO B 2 191 ? 91.100  60.635 11.343  1.00 32.64  ? 172 PRO H CD  1 
ATOM   2168 N N   . ALA B 2 192 ? 95.434  61.309 9.543   1.00 30.40  ? 173 ALA H N   1 
ATOM   2169 C CA  . ALA B 2 192 ? 96.314  62.335 9.021   1.00 42.01  ? 173 ALA H CA  1 
ATOM   2170 C C   . ALA B 2 192 ? 95.964  62.714 7.582   1.00 42.25  ? 173 ALA H C   1 
ATOM   2171 O O   . ALA B 2 192 ? 95.451  61.910 6.821   1.00 45.04  ? 173 ALA H O   1 
ATOM   2172 C CB  . ALA B 2 192 ? 97.772  61.880 9.118   1.00 41.37  ? 173 ALA H CB  1 
ATOM   2173 N N   . VAL B 2 193 ? 96.223  63.970 7.249   1.00 43.28  ? 174 VAL H N   1 
ATOM   2174 C CA  . VAL B 2 193 ? 96.209  64.487 5.884   1.00 49.99  ? 174 VAL H CA  1 
ATOM   2175 C C   . VAL B 2 193 ? 97.676  64.948 5.704   1.00 51.96  ? 174 VAL H C   1 
ATOM   2176 O O   . VAL B 2 193 ? 98.421  64.772 6.650   1.00 54.89  ? 174 VAL H O   1 
ATOM   2177 C CB  . VAL B 2 193 ? 95.159  65.592 5.755   1.00 54.09  ? 174 VAL H CB  1 
ATOM   2178 C CG1 . VAL B 2 193 ? 93.814  65.057 6.219   1.00 47.68  ? 174 VAL H CG1 1 
ATOM   2179 C CG2 . VAL B 2 193 ? 95.550  66.784 6.607   1.00 53.57  ? 174 VAL H CG2 1 
ATOM   2180 N N   . LEU B 2 194 ? 98.163  65.503 4.591   1.00 64.43  ? 175 LEU H N   1 
ATOM   2181 C CA  . LEU B 2 194 ? 97.493  65.807 3.339   1.00 68.73  ? 175 LEU H CA  1 
ATOM   2182 C C   . LEU B 2 194 ? 98.503  65.291 2.278   1.00 65.59  ? 175 LEU H C   1 
ATOM   2183 O O   . LEU B 2 194 ? 98.551  64.074 2.169   1.00 58.32  ? 175 LEU H O   1 
ATOM   2184 C CB  . LEU B 2 194 ? 97.108  67.293 3.288   1.00 70.13  ? 175 LEU H CB  1 
ATOM   2185 C CG  . LEU B 2 194 ? 96.413  67.973 2.114   1.00 74.37  ? 175 LEU H CG  1 
ATOM   2186 C CD1 . LEU B 2 194 ? 94.917  67.703 2.133   1.00 77.09  ? 175 LEU H CD1 1 
ATOM   2187 C CD2 . LEU B 2 194 ? 96.749  69.459 2.180   1.00 76.44  ? 175 LEU H CD2 1 
ATOM   2188 N N   . GLN B 2 195 ? 99.360  66.041 1.547   1.00 77.24  ? 176 GLN H N   1 
ATOM   2189 C CA  . GLN B 2 195 ? 99.631  67.496 1.478   1.00 78.67  ? 176 GLN H CA  1 
ATOM   2190 C C   . GLN B 2 195 ? 100.501 67.809 0.264   1.00 79.18  ? 176 GLN H C   1 
ATOM   2191 O O   . GLN B 2 195 ? 99.999  67.969 -0.851  1.00 80.07  ? 176 GLN H O   1 
ATOM   2192 C CB  . GLN B 2 195 ? 100.312 68.011 2.751   1.00 79.91  ? 176 GLN H CB  1 
ATOM   2193 C CG  . GLN B 2 195 ? 100.456 69.539 2.874   1.00 77.01  ? 176 GLN H CG  1 
ATOM   2194 C CD  . GLN B 2 195 ? 101.843 70.050 2.469   1.00 82.26  ? 176 GLN H CD  1 
ATOM   2195 O OE1 . GLN B 2 195 ? 102.867 69.423 2.762   1.00 78.11  ? 176 GLN H OE1 1 
ATOM   2196 N NE2 . GLN B 2 195 ? 101.874 71.187 1.776   1.00 83.98  ? 176 GLN H NE2 1 
ATOM   2197 N N   . SER B 2 196 ? 101.807 67.879 0.517   1.00 78.11  ? 177 SER H N   1 
ATOM   2198 C CA  . SER B 2 196 ? 102.850 68.157 -0.466  1.00 76.69  ? 177 SER H CA  1 
ATOM   2199 C C   . SER B 2 196 ? 104.195 68.308 0.229   1.00 80.42  ? 177 SER H C   1 
ATOM   2200 O O   . SER B 2 196 ? 104.693 69.425 0.339   1.00 87.97  ? 177 SER H O   1 
ATOM   2201 C CB  . SER B 2 196 ? 102.563 69.439 -1.254  1.00 81.34  ? 177 SER H CB  1 
ATOM   2202 O OG  . SER B 2 196 ? 101.559 69.247 -2.228  1.00 81.06  ? 177 SER H OG  1 
ATOM   2203 N N   . ASP B 2 197 ? 104.772 67.227 0.746   1.00 78.02  ? 178 ASP H N   1 
ATOM   2204 C CA  . ASP B 2 197 ? 104.114 65.943 0.904   1.00 69.73  ? 178 ASP H CA  1 
ATOM   2205 C C   . ASP B 2 197 ? 104.029 65.650 2.392   1.00 71.59  ? 178 ASP H C   1 
ATOM   2206 O O   . ASP B 2 197 ? 104.139 64.509 2.819   1.00 76.31  ? 178 ASP H O   1 
ATOM   2207 C CB  . ASP B 2 197 ? 104.871 64.830 0.168   1.00 75.84  ? 178 ASP H CB  1 
ATOM   2208 C CG  . ASP B 2 197 ? 106.319 64.683 0.635   1.00 70.26  ? 178 ASP H CG  1 
ATOM   2209 O OD1 . ASP B 2 197 ? 106.575 64.490 1.845   1.00 63.83  ? 178 ASP H OD1 1 
ATOM   2210 O OD2 . ASP B 2 197 ? 107.215 64.768 -0.228  1.00 75.11  ? 178 ASP H OD2 1 
ATOM   2211 N N   . LEU B 2 198 ? 103.844 66.684 3.196   1.00 70.61  ? 179 LEU H N   1 
ATOM   2212 C CA  . LEU B 2 198 ? 103.932 66.493 4.633   1.00 60.25  ? 179 LEU H CA  1 
ATOM   2213 C C   . LEU B 2 198 ? 102.586 66.175 5.278   1.00 58.45  ? 179 LEU H C   1 
ATOM   2214 O O   . LEU B 2 198 ? 101.576 66.785 4.982   1.00 61.53  ? 179 LEU H O   1 
ATOM   2215 C CB  . LEU B 2 198 ? 104.556 67.726 5.278   1.00 54.79  ? 179 LEU H CB  1 
ATOM   2216 C CG  . LEU B 2 198 ? 106.057 67.819 5.012   1.00 59.10  ? 179 LEU H CG  1 
ATOM   2217 C CD1 . LEU B 2 198 ? 106.657 69.041 5.690   1.00 56.85  ? 179 LEU H CD1 1 
ATOM   2218 C CD2 . LEU B 2 198 ? 106.750 66.541 5.469   1.00 49.98  ? 179 LEU H CD2 1 
ATOM   2219 N N   . TYR B 2 199 ? 102.587 65.209 6.183   1.00 55.31  ? 180 TYR H N   1 
ATOM   2220 C CA  . TYR B 2 199 ? 101.378 64.862 6.909   1.00 46.99  ? 180 TYR H CA  1 
ATOM   2221 C C   . TYR B 2 199 ? 101.040 65.849 8.018   1.00 43.85  ? 180 TYR H C   1 
ATOM   2222 O O   . TYR B 2 199 ? 101.926 66.398 8.669   1.00 43.15  ? 180 TYR H O   1 
ATOM   2223 C CB  . TYR B 2 199 ? 101.503 63.472 7.516   1.00 46.40  ? 180 TYR H CB  1 
ATOM   2224 C CG  . TYR B 2 199 ? 101.355 62.336 6.538   1.00 45.05  ? 180 TYR H CG  1 
ATOM   2225 C CD1 . TYR B 2 199 ? 100.107 61.882 6.166   1.00 47.91  ? 180 TYR H CD1 1 
ATOM   2226 C CD2 . TYR B 2 199 ? 102.466 61.695 6.015   1.00 44.73  ? 180 TYR H CD2 1 
ATOM   2227 C CE1 . TYR B 2 199 ? 99.964  60.829 5.288   1.00 53.05  ? 180 TYR H CE1 1 
ATOM   2228 C CE2 . TYR B 2 199 ? 102.337 60.644 5.140   1.00 46.82  ? 180 TYR H CE2 1 
ATOM   2229 C CZ  . TYR B 2 199 ? 101.079 60.214 4.778   1.00 54.33  ? 180 TYR H CZ  1 
ATOM   2230 O OH  . TYR B 2 199 ? 100.928 59.170 3.901   1.00 48.04  ? 180 TYR H OH  1 
ATOM   2231 N N   . THR B 2 200 ? 99.750  66.071 8.230   1.00 40.21  ? 181 THR H N   1 
ATOM   2232 C CA  . THR B 2 200 ? 99.283  66.779 9.421   1.00 38.51  ? 181 THR H CA  1 
ATOM   2233 C C   . THR B 2 200 ? 98.198  65.967 10.149  1.00 40.35  ? 181 THR H C   1 
ATOM   2234 O O   . THR B 2 200 ? 97.256  65.465 9.541   1.00 41.78  ? 181 THR H O   1 
ATOM   2235 C CB  . THR B 2 200 ? 98.725  68.170 9.086   1.00 34.98  ? 181 THR H CB  1 
ATOM   2236 O OG1 . THR B 2 200 ? 99.686  68.917 8.339   1.00 42.30  ? 181 THR H OG1 1 
ATOM   2237 C CG2 . THR B 2 200 ? 98.411  68.922 10.357  1.00 39.13  ? 181 THR H CG2 1 
ATOM   2238 N N   . LEU B 2 201 ? 98.336  65.841 11.457  1.00 40.71  ? 182 LEU H N   1 
ATOM   2239 C CA  . LEU B 2 201 ? 97.359  65.126 12.262  1.00 37.16  ? 182 LEU H CA  1 
ATOM   2240 C C   . LEU B 2 201 ? 96.885  66.015 13.416  1.00 37.23  ? 182 LEU H C   1 
ATOM   2241 O O   . LEU B 2 201 ? 97.626  66.910 13.858  1.00 38.85  ? 182 LEU H O   1 
ATOM   2242 C CB  . LEU B 2 201 ? 97.976  63.824 12.782  1.00 36.02  ? 182 LEU H CB  1 
ATOM   2243 C CG  . LEU B 2 201 ? 97.229  62.971 13.808  1.00 40.42  ? 182 LEU H CG  1 
ATOM   2244 C CD1 . LEU B 2 201 ? 97.583  61.524 13.606  1.00 37.46  ? 182 LEU H CD1 1 
ATOM   2245 C CD2 . LEU B 2 201 ? 97.566  63.397 15.243  1.00 39.89  ? 182 LEU H CD2 1 
ATOM   2246 N N   . SER B 2 202 ? 95.663  65.776 13.899  1.00 30.27  ? 183 SER H N   1 
ATOM   2247 C CA  . SER B 2 202 ? 95.178  66.470 15.093  1.00 34.63  ? 183 SER H CA  1 
ATOM   2248 C C   . SER B 2 202 ? 94.448  65.543 16.045  1.00 32.29  ? 183 SER H C   1 
ATOM   2249 O O   . SER B 2 202 ? 93.990  64.477 15.671  1.00 31.35  ? 183 SER H O   1 
ATOM   2250 C CB  . SER B 2 202 ? 94.262  67.654 14.736  1.00 35.10  ? 183 SER H CB  1 
ATOM   2251 O OG  . SER B 2 202 ? 93.331  67.338 13.727  1.00 34.14  ? 183 SER H OG  1 
ATOM   2252 N N   . SER B 2 203 ? 94.368  65.964 17.297  1.00 34.15  ? 184 SER H N   1 
ATOM   2253 C CA  . SER B 2 203 ? 93.625  65.232 18.294  1.00 34.36  ? 184 SER H CA  1 
ATOM   2254 C C   . SER B 2 203 ? 92.944  66.189 19.266  1.00 35.11  ? 184 SER H C   1 
ATOM   2255 O O   . SER B 2 203 ? 93.526  67.186 19.689  1.00 34.75  ? 184 SER H O   1 
ATOM   2256 C CB  . SER B 2 203 ? 94.537  64.274 19.047  1.00 36.35  ? 184 SER H CB  1 
ATOM   2257 O OG  . SER B 2 203 ? 93.797  63.473 19.956  1.00 37.57  ? 184 SER H OG  1 
ATOM   2258 N N   . SER B 2 204 ? 91.704  65.869 19.614  1.00 36.67  ? 185 SER H N   1 
ATOM   2259 C CA  . SER B 2 204 ? 90.952  66.664 20.570  1.00 36.93  ? 185 SER H CA  1 
ATOM   2260 C C   . SER B 2 204 ? 90.702  65.840 21.801  1.00 37.24  ? 185 SER H C   1 
ATOM   2261 O O   . SER B 2 204 ? 90.524  64.626 21.722  1.00 40.65  ? 185 SER H O   1 
ATOM   2262 C CB  . SER B 2 204 ? 89.626  67.148 19.981  1.00 37.92  ? 185 SER H CB  1 
ATOM   2263 O OG  . SER B 2 204 ? 88.679  66.101 19.920  1.00 39.47  ? 185 SER H OG  1 
ATOM   2264 N N   . VAL B 2 205 ? 90.722  66.490 22.951  1.00 41.40  ? 186 VAL H N   1 
ATOM   2265 C CA  . VAL B 2 205 ? 90.332  65.820 24.172  1.00 43.57  ? 186 VAL H CA  1 
ATOM   2266 C C   . VAL B 2 205 ? 89.317  66.695 24.872  1.00 47.16  ? 186 VAL H C   1 
ATOM   2267 O O   . VAL B 2 205 ? 89.484  67.913 24.962  1.00 45.15  ? 186 VAL H O   1 
ATOM   2268 C CB  . VAL B 2 205 ? 91.529  65.523 25.093  1.00 40.42  ? 186 VAL H CB  1 
ATOM   2269 C CG1 . VAL B 2 205 ? 92.295  66.781 25.422  1.00 43.49  ? 186 VAL H CG1 1 
ATOM   2270 C CG2 . VAL B 2 205 ? 91.046  64.831 26.349  1.00 45.00  ? 186 VAL H CG2 1 
ATOM   2271 N N   . THR B 2 206 ? 88.235  66.083 25.328  1.00 46.86  ? 187 THR H N   1 
ATOM   2272 C CA  . THR B 2 206 ? 87.211  66.845 26.025  1.00 49.89  ? 187 THR H CA  1 
ATOM   2273 C C   . THR B 2 206 ? 87.105  66.375 27.469  1.00 55.72  ? 187 THR H C   1 
ATOM   2274 O O   . THR B 2 206 ? 87.036  65.172 27.745  1.00 55.71  ? 187 THR H O   1 
ATOM   2275 C CB  . THR B 2 206 ? 85.858  66.734 25.323  1.00 48.69  ? 187 THR H CB  1 
ATOM   2276 O OG1 . THR B 2 206 ? 85.944  67.360 24.034  1.00 49.22  ? 187 THR H OG1 1 
ATOM   2277 C CG2 . THR B 2 206 ? 84.781  67.434 26.138  1.00 52.09  ? 187 THR H CG2 1 
ATOM   2278 N N   . VAL B 2 207 ? 87.131  67.330 28.391  1.00 54.26  ? 188 VAL H N   1 
ATOM   2279 C CA  . VAL B 2 207 ? 87.094  67.007 29.808  1.00 60.88  ? 188 VAL H CA  1 
ATOM   2280 C C   . VAL B 2 207 ? 86.156  67.970 30.547  1.00 61.29  ? 188 VAL H C   1 
ATOM   2281 O O   . VAL B 2 207 ? 85.690  68.962 29.981  1.00 59.67  ? 188 VAL H O   1 
ATOM   2282 C CB  . VAL B 2 207 ? 88.510  67.031 30.416  1.00 57.93  ? 188 VAL H CB  1 
ATOM   2283 C CG1 . VAL B 2 207 ? 88.873  68.432 30.887  1.00 59.74  ? 188 VAL H CG1 1 
ATOM   2284 C CG2 . VAL B 2 207 ? 88.624  66.015 31.547  1.00 66.80  ? 188 VAL H CG2 1 
ATOM   2285 N N   . THR B 2 208 ? 85.890  67.676 31.814  1.00 66.98  ? 189 THR H N   1 
ATOM   2286 C CA  . THR B 2 208 ? 84.728  68.228 32.514  1.00 79.23  ? 189 THR H CA  1 
ATOM   2287 C C   . THR B 2 208 ? 84.796  69.699 32.963  1.00 80.49  ? 189 THR H C   1 
ATOM   2288 O O   . THR B 2 208 ? 84.129  70.066 33.931  1.00 85.07  ? 189 THR H O   1 
ATOM   2289 C CB  . THR B 2 208 ? 84.430  67.381 33.763  1.00 77.50  ? 189 THR H CB  1 
ATOM   2290 O OG1 . THR B 2 208 ? 85.376  67.700 34.792  1.00 83.81  ? 189 THR H OG1 1 
ATOM   2291 C CG2 . THR B 2 208 ? 84.535  65.897 33.429  1.00 74.68  ? 189 THR H CG2 1 
ATOM   2292 N N   . SER B 2 209 ? 85.592  70.525 32.276  1.00 77.87  ? 190 SER H N   1 
ATOM   2293 C CA  . SER B 2 209 ? 85.753  71.970 32.573  1.00 81.16  ? 190 SER H CA  1 
ATOM   2294 C C   . SER B 2 209 ? 86.411  72.219 33.928  1.00 83.82  ? 190 SER H C   1 
ATOM   2295 O O   . SER B 2 209 ? 87.024  73.263 34.161  1.00 79.23  ? 190 SER H O   1 
ATOM   2296 C CB  . SER B 2 209 ? 84.409  72.710 32.509  1.00 81.27  ? 190 SER H CB  1 
ATOM   2297 O OG  . SER B 2 209 ? 83.702  72.621 33.735  1.00 84.82  ? 190 SER H OG  1 
ATOM   2298 N N   . SER B 2 210 ? 86.246  71.253 34.821  1.00 85.51  ? 191 SER H N   1 
ATOM   2299 C CA  . SER B 2 210 ? 86.996  71.179 36.052  1.00 82.51  ? 191 SER H CA  1 
ATOM   2300 C C   . SER B 2 210 ? 88.130  70.190 35.811  1.00 83.48  ? 191 SER H C   1 
ATOM   2301 O O   . SER B 2 210 ? 88.105  69.427 34.837  1.00 77.30  ? 191 SER H O   1 
ATOM   2302 C CB  . SER B 2 210 ? 86.096  70.749 37.208  1.00 85.68  ? 191 SER H CB  1 
ATOM   2303 O OG  . SER B 2 210 ? 84.880  71.481 37.183  1.00 81.69  ? 191 SER H OG  1 
ATOM   2304 N N   . THR B 2 211 ? 89.121  70.227 36.693  1.00 83.71  ? 192 THR H N   1 
ATOM   2305 C CA  . THR B 2 211 ? 90.417  69.578 36.493  1.00 82.22  ? 192 THR H CA  1 
ATOM   2306 C C   . THR B 2 211 ? 91.177  70.227 35.319  1.00 78.56  ? 192 THR H C   1 
ATOM   2307 O O   . THR B 2 211 ? 92.359  69.964 35.144  1.00 79.44  ? 192 THR H O   1 
ATOM   2308 C CB  . THR B 2 211 ? 90.285  68.024 36.304  1.00 81.98  ? 192 THR H CB  1 
ATOM   2309 O OG1 . THR B 2 211 ? 91.213  67.352 37.167  1.00 74.44  ? 192 THR H OG1 1 
ATOM   2310 C CG2 . THR B 2 211 ? 90.517  67.585 34.852  1.00 79.56  ? 192 THR H CG2 1 
ATOM   2311 N N   . TRP B 2 212 ? 90.535  71.102 34.540  1.00 76.75  ? 193 TRP H N   1 
ATOM   2312 C CA  . TRP B 2 212 ? 91.307  71.988 33.657  1.00 76.01  ? 193 TRP H CA  1 
ATOM   2313 C C   . TRP B 2 212 ? 90.812  73.435 33.679  1.00 74.35  ? 193 TRP H C   1 
ATOM   2314 O O   . TRP B 2 212 ? 89.637  73.708 33.426  1.00 75.15  ? 193 TRP H O   1 
ATOM   2315 C CB  . TRP B 2 212 ? 91.344  71.491 32.204  1.00 72.79  ? 193 TRP H CB  1 
ATOM   2316 C CG  . TRP B 2 212 ? 92.561  72.049 31.469  1.00 66.41  ? 193 TRP H CG  1 
ATOM   2317 C CD1 . TRP B 2 212 ? 93.821  71.510 31.438  1.00 64.93  ? 193 TRP H CD1 1 
ATOM   2318 C CD2 . TRP B 2 212 ? 92.634  73.269 30.713  1.00 59.15  ? 193 TRP H CD2 1 
ATOM   2319 N NE1 . TRP B 2 212 ? 94.663  72.309 30.698  1.00 59.38  ? 193 TRP H NE1 1 
ATOM   2320 C CE2 . TRP B 2 212 ? 93.959  73.393 30.242  1.00 60.87  ? 193 TRP H CE2 1 
ATOM   2321 C CE3 . TRP B 2 212 ? 91.707  74.262 30.383  1.00 57.98  ? 193 TRP H CE3 1 
ATOM   2322 C CZ2 . TRP B 2 212 ? 94.374  74.471 29.457  1.00 58.75  ? 193 TRP H CZ2 1 
ATOM   2323 C CZ3 . TRP B 2 212 ? 92.123  75.332 29.606  1.00 58.78  ? 193 TRP H CZ3 1 
ATOM   2324 C CH2 . TRP B 2 212 ? 93.442  75.428 29.152  1.00 53.80  ? 193 TRP H CH2 1 
ATOM   2325 N N   . PRO B 2 213 ? 91.733  74.371 33.967  1.00 73.13  ? 194 PRO H N   1 
ATOM   2326 C CA  . PRO B 2 213 ? 93.139  74.045 34.256  1.00 71.10  ? 194 PRO H CA  1 
ATOM   2327 C C   . PRO B 2 213 ? 93.363  73.511 35.678  1.00 76.84  ? 194 PRO H C   1 
ATOM   2328 O O   . PRO B 2 213 ? 92.400  73.057 36.308  1.00 80.30  ? 194 PRO H O   1 
ATOM   2329 C CB  . PRO B 2 213 ? 93.862  75.389 34.060  1.00 67.72  ? 194 PRO H CB  1 
ATOM   2330 C CG  . PRO B 2 213 ? 92.871  76.283 33.370  1.00 65.71  ? 194 PRO H CG  1 
ATOM   2331 C CD  . PRO B 2 213 ? 91.531  75.821 33.836  1.00 69.07  ? 194 PRO H CD  1 
ATOM   2332 N N   . SER B 2 214 ? 94.618  73.566 36.135  1.00 74.62  ? 195 SER H N   1 
ATOM   2333 C CA  . SER B 2 214 ? 95.105  73.136 37.461  1.00 70.90  ? 195 SER H CA  1 
ATOM   2334 C C   . SER B 2 214 ? 95.585  71.686 37.416  1.00 75.29  ? 195 SER H C   1 
ATOM   2335 O O   . SER B 2 214 ? 96.743  71.421 37.733  1.00 75.24  ? 195 SER H O   1 
ATOM   2336 C CB  . SER B 2 214 ? 94.067  73.337 38.581  1.00 75.25  ? 195 SER H CB  1 
ATOM   2337 O OG  . SER B 2 214 ? 92.860  72.628 38.350  1.00 79.88  ? 195 SER H OG  1 
ATOM   2338 N N   . GLN B 2 215 ? 94.727  70.749 37.024  1.00 75.89  ? 196 GLN H N   1 
ATOM   2339 C CA  . GLN B 2 215 ? 95.236  69.435 36.636  1.00 76.27  ? 196 GLN H CA  1 
ATOM   2340 C C   . GLN B 2 215 ? 95.689  69.539 35.182  1.00 69.67  ? 196 GLN H C   1 
ATOM   2341 O O   . GLN B 2 215 ? 94.891  69.819 34.296  1.00 70.69  ? 196 GLN H O   1 
ATOM   2342 C CB  . GLN B 2 215 ? 94.190  68.333 36.811  1.00 74.11  ? 196 GLN H CB  1 
ATOM   2343 N N   . SER B 2 216 ? 96.975  69.335 34.941  1.00 66.62  ? 197 SER H N   1 
ATOM   2344 C CA  . SER B 2 216 ? 97.543  69.609 33.628  1.00 68.03  ? 197 SER H CA  1 
ATOM   2345 C C   . SER B 2 216 ? 97.359  68.480 32.613  1.00 65.00  ? 197 SER H C   1 
ATOM   2346 O O   . SER B 2 216 ? 97.485  67.301 32.935  1.00 68.21  ? 197 SER H O   1 
ATOM   2347 C CB  . SER B 2 216 ? 99.027  69.923 33.766  1.00 72.92  ? 197 SER H CB  1 
ATOM   2348 O OG  . SER B 2 216 ? 99.735  68.787 34.220  1.00 78.41  ? 197 SER H OG  1 
ATOM   2349 N N   . ILE B 2 217 ? 97.076  68.862 31.375  1.00 63.26  ? 198 ILE H N   1 
ATOM   2350 C CA  . ILE B 2 217 ? 96.908  67.904 30.295  1.00 60.42  ? 198 ILE H CA  1 
ATOM   2351 C C   . ILE B 2 217 ? 98.036  68.069 29.285  1.00 58.07  ? 198 ILE H C   1 
ATOM   2352 O O   . ILE B 2 217 ? 98.364  69.176 28.872  1.00 59.08  ? 198 ILE H O   1 
ATOM   2353 C CB  . ILE B 2 217 ? 95.536  68.072 29.603  1.00 64.54  ? 198 ILE H CB  1 
ATOM   2354 C CG1 . ILE B 2 217 ? 94.402  67.862 30.614  1.00 62.47  ? 198 ILE H CG1 1 
ATOM   2355 C CG2 . ILE B 2 217 ? 95.401  67.114 28.439  1.00 56.65  ? 198 ILE H CG2 1 
ATOM   2356 C CD1 . ILE B 2 217 ? 93.026  68.150 30.070  1.00 57.27  ? 198 ILE H CD1 1 
ATOM   2357 N N   . THR B 2 218 ? 98.646  66.956 28.912  1.00 58.48  ? 199 THR H N   1 
ATOM   2358 C CA  . THR B 2 218 ? 99.761  66.963 27.979  1.00 54.38  ? 199 THR H CA  1 
ATOM   2359 C C   . THR B 2 218 ? 99.474  65.959 26.876  1.00 58.52  ? 199 THR H C   1 
ATOM   2360 O O   . THR B 2 218 ? 99.026  64.848 27.161  1.00 58.91  ? 199 THR H O   1 
ATOM   2361 C CB  . THR B 2 218 ? 101.077 66.582 28.678  1.00 57.92  ? 199 THR H CB  1 
ATOM   2362 O OG1 . THR B 2 218 ? 101.373 67.530 29.711  1.00 63.68  ? 199 THR H OG1 1 
ATOM   2363 C CG2 . THR B 2 218 ? 102.218 66.522 27.684  1.00 59.62  ? 199 THR H CG2 1 
ATOM   2364 N N   . CYS B 2 219 ? 99.707  66.306 25.618  1.00 56.18  ? 200 CYS H N   1 
ATOM   2365 C CA  . CYS B 2 219 ? 99.590  65.251 24.631  1.00 51.04  ? 200 CYS H CA  1 
ATOM   2366 C C   . CYS B 2 219 ? 100.981 64.754 24.321  1.00 48.84  ? 200 CYS H C   1 
ATOM   2367 O O   . CYS B 2 219 ? 101.937 65.517 24.323  1.00 45.10  ? 200 CYS H O   1 
ATOM   2368 C CB  . CYS B 2 219 ? 98.845  65.700 23.374  1.00 43.65  ? 200 CYS H CB  1 
ATOM   2369 S SG  . CYS B 2 219 ? 99.711  66.777 22.283  1.00 53.93  ? 200 CYS H SG  1 
ATOM   2370 N N   . ASN B 2 220 ? 101.070 63.448 24.101  1.00 50.07  ? 201 ASN H N   1 
ATOM   2371 C CA  . ASN B 2 220 ? 102.330 62.771 23.880  1.00 48.59  ? 201 ASN H CA  1 
ATOM   2372 C C   . ASN B 2 220 ? 102.396 62.244 22.455  1.00 51.88  ? 201 ASN H C   1 
ATOM   2373 O O   . ASN B 2 220 ? 101.571 61.429 22.055  1.00 52.96  ? 201 ASN H O   1 
ATOM   2374 C CB  . ASN B 2 220 ? 102.490 61.628 24.880  1.00 54.41  ? 201 ASN H CB  1 
ATOM   2375 C CG  . ASN B 2 220 ? 101.774 61.902 26.204  1.00 58.01  ? 201 ASN H CG  1 
ATOM   2376 O OD1 . ASN B 2 220 ? 100.720 61.327 26.482  1.00 56.42  ? 201 ASN H OD1 1 
ATOM   2377 N ND2 . ASN B 2 220 ? 102.350 62.780 27.025  1.00 56.87  ? 201 ASN H ND2 1 
ATOM   2378 N N   . VAL B 2 221 ? 103.373 62.715 21.691  1.00 47.35  ? 202 VAL H N   1 
ATOM   2379 C CA  . VAL B 2 221 ? 103.474 62.352 20.288  1.00 46.72  ? 202 VAL H CA  1 
ATOM   2380 C C   . VAL B 2 221 ? 104.808 61.692 19.964  1.00 50.55  ? 202 VAL H C   1 
ATOM   2381 O O   . VAL B 2 221 ? 105.870 62.244 20.240  1.00 53.40  ? 202 VAL H O   1 
ATOM   2382 C CB  . VAL B 2 221 ? 103.300 63.577 19.368  1.00 45.44  ? 202 VAL H CB  1 
ATOM   2383 C CG1 . VAL B 2 221 ? 103.199 63.134 17.923  1.00 42.19  ? 202 VAL H CG1 1 
ATOM   2384 C CG2 . VAL B 2 221 ? 102.076 64.377 19.769  1.00 46.72  ? 202 VAL H CG2 1 
ATOM   2385 N N   . ALA B 2 222 ? 104.742 60.505 19.372  1.00 52.98  ? 203 ALA H N   1 
ATOM   2386 C CA  . ALA B 2 222 ? 105.928 59.798 18.903  1.00 51.09  ? 203 ALA H CA  1 
ATOM   2387 C C   . ALA B 2 222 ? 105.911 59.723 17.387  1.00 50.49  ? 203 ALA H C   1 
ATOM   2388 O O   . ALA B 2 222 ? 104.969 59.179 16.807  1.00 52.36  ? 203 ALA H O   1 
ATOM   2389 C CB  . ALA B 2 222 ? 105.992 58.397 19.500  1.00 49.79  ? 203 ALA H CB  1 
ATOM   2390 N N   . HIS B 2 223 ? 106.924 60.295 16.742  1.00 48.07  ? 204 HIS H N   1 
ATOM   2391 C CA  . HIS B 2 223 ? 107.184 60.003 15.334  1.00 47.18  ? 204 HIS H CA  1 
ATOM   2392 C C   . HIS B 2 223 ? 108.379 59.080 15.323  1.00 46.91  ? 204 HIS H C   1 
ATOM   2393 O O   . HIS B 2 223 ? 109.504 59.532 15.496  1.00 50.95  ? 204 HIS H O   1 
ATOM   2394 C CB  . HIS B 2 223 ? 107.460 61.267 14.518  1.00 43.21  ? 204 HIS H CB  1 
ATOM   2395 C CG  . HIS B 2 223 ? 107.438 61.054 13.036  1.00 39.38  ? 204 HIS H CG  1 
ATOM   2396 N ND1 . HIS B 2 223 ? 108.436 61.511 12.204  1.00 43.75  ? 204 HIS H ND1 1 
ATOM   2397 C CD2 . HIS B 2 223 ? 106.534 60.443 12.234  1.00 43.06  ? 204 HIS H CD2 1 
ATOM   2398 C CE1 . HIS B 2 223 ? 108.150 61.193 10.953  1.00 42.51  ? 204 HIS H CE1 1 
ATOM   2399 N NE2 . HIS B 2 223 ? 107.000 60.546 10.943  1.00 45.03  ? 204 HIS H NE2 1 
ATOM   2400 N N   . PRO B 2 224 ? 108.140 57.776 15.157  1.00 48.99  ? 205 PRO H N   1 
ATOM   2401 C CA  . PRO B 2 224 ? 109.236 56.813 15.308  1.00 49.25  ? 205 PRO H CA  1 
ATOM   2402 C C   . PRO B 2 224 ? 110.322 57.018 14.243  1.00 49.27  ? 205 PRO H C   1 
ATOM   2403 O O   . PRO B 2 224 ? 111.506 57.091 14.595  1.00 47.41  ? 205 PRO H O   1 
ATOM   2404 C CB  . PRO B 2 224 ? 108.536 55.456 15.160  1.00 46.81  ? 205 PRO H CB  1 
ATOM   2405 C CG  . PRO B 2 224 ? 107.288 55.760 14.357  1.00 54.41  ? 205 PRO H CG  1 
ATOM   2406 C CD  . PRO B 2 224 ? 106.867 57.135 14.778  1.00 50.40  ? 205 PRO H CD  1 
ATOM   2407 N N   . ALA B 2 225 ? 109.907 57.140 12.981  1.00 44.95  ? 206 ALA H N   1 
ATOM   2408 C CA  . ALA B 2 225 ? 110.796 57.426 11.853  1.00 43.16  ? 206 ALA H CA  1 
ATOM   2409 C C   . ALA B 2 225 ? 111.896 58.475 12.128  1.00 46.38  ? 206 ALA H C   1 
ATOM   2410 O O   . ALA B 2 225 ? 113.028 58.324 11.675  1.00 45.49  ? 206 ALA H O   1 
ATOM   2411 C CB  . ALA B 2 225 ? 109.964 57.870 10.661  1.00 38.71  ? 206 ALA H CB  1 
ATOM   2412 N N   . SER B 2 226 ? 111.555 59.543 12.842  1.00 47.31  ? 207 SER H N   1 
ATOM   2413 C CA  . SER B 2 226 ? 112.514 60.605 13.152  1.00 44.40  ? 207 SER H CA  1 
ATOM   2414 C C   . SER B 2 226 ? 112.924 60.550 14.612  1.00 49.04  ? 207 SER H C   1 
ATOM   2415 O O   . SER B 2 226 ? 113.495 61.512 15.133  1.00 48.61  ? 207 SER H O   1 
ATOM   2416 C CB  . SER B 2 226 ? 111.925 61.988 12.836  1.00 47.02  ? 207 SER H CB  1 
ATOM   2417 O OG  . SER B 2 226 ? 110.855 62.302 13.719  1.00 43.53  ? 207 SER H OG  1 
ATOM   2418 N N   . SER B 2 227 ? 112.610 59.428 15.266  1.00 47.25  ? 208 SER H N   1 
ATOM   2419 C CA  . SER B 2 227 ? 112.984 59.184 16.655  1.00 43.16  ? 208 SER H CA  1 
ATOM   2420 C C   . SER B 2 227 ? 112.484 60.292 17.553  1.00 46.68  ? 208 SER H C   1 
ATOM   2421 O O   . SER B 2 227 ? 113.124 60.633 18.543  1.00 49.59  ? 208 SER H O   1 
ATOM   2422 C CB  . SER B 2 227 ? 114.504 59.050 16.795  1.00 48.08  ? 208 SER H CB  1 
ATOM   2423 O OG  . SER B 2 227 ? 114.999 58.059 15.917  1.00 54.93  ? 208 SER H OG  1 
ATOM   2424 N N   . THR B 2 228 ? 111.330 60.845 17.203  1.00 46.93  ? 209 THR H N   1 
ATOM   2425 C CA  . THR B 2 228 ? 110.795 62.011 17.880  1.00 41.86  ? 209 THR H CA  1 
ATOM   2426 C C   . THR B 2 228 ? 109.817 61.622 18.974  1.00 45.51  ? 209 THR H C   1 
ATOM   2427 O O   . THR B 2 228 ? 108.918 60.819 18.759  1.00 54.60  ? 209 THR H O   1 
ATOM   2428 C CB  . THR B 2 228 ? 110.109 62.951 16.869  1.00 46.80  ? 209 THR H CB  1 
ATOM   2429 O OG1 . THR B 2 228 ? 111.048 63.294 15.840  1.00 48.44  ? 209 THR H OG1 1 
ATOM   2430 C CG2 . THR B 2 228 ? 109.606 64.221 17.544  1.00 42.22  ? 209 THR H CG2 1 
ATOM   2431 N N   . LYS B 2 229 ? 110.013 62.178 20.158  1.00 44.42  ? 210 LYS H N   1 
ATOM   2432 C CA  . LYS B 2 229 ? 109.111 61.940 21.270  1.00 49.09  ? 210 LYS H CA  1 
ATOM   2433 C C   . LYS B 2 229 ? 108.871 63.271 21.971  1.00 53.25  ? 210 LYS H C   1 
ATOM   2434 O O   . LYS B 2 229 ? 109.748 63.795 22.663  1.00 48.54  ? 210 LYS H O   1 
ATOM   2435 C CB  . LYS B 2 229 ? 109.678 60.899 22.247  1.00 48.57  ? 210 LYS H CB  1 
ATOM   2436 C CG  . LYS B 2 229 ? 109.710 59.463 21.734  1.00 46.20  ? 210 LYS H CG  1 
ATOM   2437 C CD  . LYS B 2 229 ? 109.313 58.498 22.845  1.00 45.93  ? 210 LYS H CD  1 
ATOM   2438 C CE  . LYS B 2 229 ? 109.321 57.050 22.379  1.00 46.38  ? 210 LYS H CE  1 
ATOM   2439 N NZ  . LYS B 2 229 ? 110.506 56.737 21.522  1.00 44.80  ? 210 LYS H NZ  1 
ATOM   2440 N N   . VAL B 2 230 ? 107.681 63.824 21.778  1.00 50.49  ? 211 VAL H N   1 
ATOM   2441 C CA  . VAL B 2 230 ? 107.368 65.127 22.327  1.00 47.14  ? 211 VAL H CA  1 
ATOM   2442 C C   . VAL B 2 230 ? 106.173 65.082 23.259  1.00 52.10  ? 211 VAL H C   1 
ATOM   2443 O O   . VAL B 2 230 ? 105.122 64.533 22.911  1.00 52.12  ? 211 VAL H O   1 
ATOM   2444 C CB  . VAL B 2 230 ? 107.085 66.134 21.215  1.00 48.03  ? 211 VAL H CB  1 
ATOM   2445 C CG1 . VAL B 2 230 ? 106.628 67.462 21.805  1.00 47.60  ? 211 VAL H CG1 1 
ATOM   2446 C CG2 . VAL B 2 230 ? 108.315 66.305 20.340  1.00 51.52  ? 211 VAL H CG2 1 
ATOM   2447 N N   . ASP B 2 231 ? 106.353 65.650 24.448  1.00 47.93  ? 212 ASP H N   1 
ATOM   2448 C CA  . ASP B 2 231 ? 105.256 65.906 25.372  1.00 51.36  ? 212 ASP H CA  1 
ATOM   2449 C C   . ASP B 2 231 ? 104.968 67.410 25.379  1.00 58.08  ? 212 ASP H C   1 
ATOM   2450 O O   . ASP B 2 231 ? 105.833 68.203 25.744  1.00 57.32  ? 212 ASP H O   1 
ATOM   2451 C CB  . ASP B 2 231 ? 105.598 65.407 26.785  1.00 48.33  ? 212 ASP H CB  1 
ATOM   2452 C CG  . ASP B 2 231 ? 105.381 63.895 26.958  1.00 60.70  ? 212 ASP H CG  1 
ATOM   2453 O OD1 . ASP B 2 231 ? 105.259 63.163 25.947  1.00 58.92  ? 212 ASP H OD1 1 
ATOM   2454 O OD2 . ASP B 2 231 ? 105.341 63.429 28.119  1.00 67.90  ? 212 ASP H OD2 1 
ATOM   2455 N N   . LYS B 2 232 ? 103.773 67.816 24.954  1.00 55.00  ? 213 LYS H N   1 
ATOM   2456 C CA  . LYS B 2 232 ? 103.417 69.235 25.013  1.00 56.36  ? 213 LYS H CA  1 
ATOM   2457 C C   . LYS B 2 232 ? 102.301 69.455 26.020  1.00 60.10  ? 213 LYS H C   1 
ATOM   2458 O O   . LYS B 2 232 ? 101.180 69.000 25.806  1.00 62.20  ? 213 LYS H O   1 
ATOM   2459 C CB  . LYS B 2 232 ? 102.994 69.759 23.640  1.00 54.60  ? 213 LYS H CB  1 
ATOM   2460 C CG  . LYS B 2 232 ? 103.833 70.920 23.120  1.00 56.01  ? 213 LYS H CG  1 
ATOM   2461 C CD  . LYS B 2 232 ? 105.319 70.573 23.112  1.00 59.24  ? 213 LYS H CD  1 
ATOM   2462 C CE  . LYS B 2 232 ? 106.111 71.460 22.159  1.00 52.56  ? 213 LYS H CE  1 
ATOM   2463 N NZ  . LYS B 2 232 ? 105.742 72.897 22.310  1.00 63.76  ? 213 LYS H NZ  1 
ATOM   2464 N N   . LYS B 2 233 ? 102.614 70.119 27.130  1.00 58.21  ? 214 LYS H N   1 
ATOM   2465 C CA  . LYS B 2 233 ? 101.594 70.524 28.099  1.00 61.04  ? 214 LYS H CA  1 
ATOM   2466 C C   . LYS B 2 233 ? 100.662 71.573 27.477  1.00 60.03  ? 214 LYS H C   1 
ATOM   2467 O O   . LYS B 2 233 ? 101.093 72.393 26.665  1.00 62.20  ? 214 LYS H O   1 
ATOM   2468 C CB  . LYS B 2 233 ? 102.264 71.069 29.366  1.00 65.16  ? 214 LYS H CB  1 
ATOM   2469 C CG  . LYS B 2 233 ? 101.339 71.527 30.501  1.00 67.60  ? 214 LYS H CG  1 
ATOM   2470 C CD  . LYS B 2 233 ? 102.181 71.738 31.766  1.00 70.01  ? 214 LYS H CD  1 
ATOM   2471 C CE  . LYS B 2 233 ? 101.397 72.284 32.946  1.00 73.87  ? 214 LYS H CE  1 
ATOM   2472 N NZ  . LYS B 2 233 ? 102.237 72.347 34.178  1.00 73.55  ? 214 LYS H NZ  1 
ATOM   2473 N N   . ILE B 2 234 ? 99.385  71.538 27.837  1.00 57.73  ? 215 ILE H N   1 
ATOM   2474 C CA  . ILE B 2 234 ? 98.437  72.525 27.326  1.00 57.72  ? 215 ILE H CA  1 
ATOM   2475 C C   . ILE B 2 234 ? 98.212  73.608 28.375  1.00 60.26  ? 215 ILE H C   1 
ATOM   2476 O O   . ILE B 2 234 ? 97.844  73.297 29.504  1.00 62.08  ? 215 ILE H O   1 
ATOM   2477 C CB  . ILE B 2 234 ? 97.077  71.892 26.958  1.00 53.61  ? 215 ILE H CB  1 
ATOM   2478 C CG1 . ILE B 2 234 ? 97.256  70.511 26.304  1.00 56.43  ? 215 ILE H CG1 1 
ATOM   2479 C CG2 . ILE B 2 234 ? 96.273  72.835 26.077  1.00 46.30  ? 215 ILE H CG2 1 
ATOM   2480 C CD1 . ILE B 2 234 ? 98.013  70.521 24.991  1.00 52.13  ? 215 ILE H CD1 1 
ATOM   2481 N N   . GLU B 2 235 ? 98.412  74.871 28.000  1.00 54.01  ? 216 GLU H N   1 
ATOM   2482 C CA  . GLU B 2 235 ? 98.397  75.973 28.962  1.00 58.63  ? 216 GLU H CA  1 
ATOM   2483 C C   . GLU B 2 235 ? 97.496  77.135 28.521  1.00 59.43  ? 216 GLU H C   1 
ATOM   2484 O O   . GLU B 2 235 ? 97.438  77.462 27.337  1.00 63.94  ? 216 GLU H O   1 
ATOM   2485 C CB  . GLU B 2 235 ? 99.830  76.468 29.181  1.00 60.88  ? 216 GLU H CB  1 
ATOM   2486 C CG  . GLU B 2 235 ? 100.111 77.001 30.578  1.00 66.43  ? 216 GLU H CG  1 
ATOM   2487 C CD  . GLU B 2 235 ? 100.072 75.920 31.650  1.00 73.86  ? 216 GLU H CD  1 
ATOM   2488 O OE1 . GLU B 2 235 ? 100.838 74.939 31.524  1.00 78.12  ? 216 GLU H OE1 1 
ATOM   2489 O OE2 . GLU B 2 235 ? 99.284  76.053 32.618  1.00 68.12  ? 216 GLU H OE2 1 
ATOM   2490 N N   . PRO B 2 236 ? 96.781  77.763 29.472  1.00 61.08  ? 217 PRO H N   1 
ATOM   2491 C CA  . PRO B 2 236 ? 95.903  78.897 29.138  1.00 58.69  ? 217 PRO H CA  1 
ATOM   2492 C C   . PRO B 2 236 ? 96.680  80.065 28.560  1.00 63.51  ? 217 PRO H C   1 
ATOM   2493 O O   . PRO B 2 236 ? 97.778  80.364 29.033  1.00 64.50  ? 217 PRO H O   1 
ATOM   2494 C CB  . PRO B 2 236 ? 95.280  79.281 30.483  1.00 58.54  ? 217 PRO H CB  1 
ATOM   2495 C CG  . PRO B 2 236 ? 95.401  78.064 31.327  1.00 58.21  ? 217 PRO H CG  1 
ATOM   2496 C CD  . PRO B 2 236 ? 96.673  77.383 30.890  1.00 60.87  ? 217 PRO H CD  1 
ATOM   2497 N N   . ARG B 2 237 ? 96.106  80.715 27.556  1.00 59.62  ? 218 ARG H N   1 
ATOM   2498 C CA  . ARG B 2 237 ? 96.799  81.748 26.801  1.00 60.40  ? 218 ARG H CA  1 
ATOM   2499 C C   . ARG B 2 237 ? 97.037  83.017 27.615  1.00 66.39  ? 218 ARG H C   1 
ATOM   2500 O O   . ARG B 2 237 ? 96.129  83.826 27.804  1.00 64.44  ? 218 ARG H O   1 
ATOM   2501 C CB  . ARG B 2 237 ? 96.004  82.064 25.532  1.00 64.64  ? 218 ARG H CB  1 
ATOM   2502 C CG  . ARG B 2 237 ? 95.732  80.821 24.695  1.00 65.65  ? 218 ARG H CG  1 
ATOM   2503 C CD  . ARG B 2 237 ? 94.857  81.085 23.481  1.00 64.88  ? 218 ARG H CD  1 
ATOM   2504 N NE  . ARG B 2 237 ? 94.840  79.917 22.600  1.00 62.91  ? 218 ARG H NE  1 
ATOM   2505 C CZ  . ARG B 2 237 ? 95.355  79.889 21.373  1.00 59.52  ? 218 ARG H CZ  1 
ATOM   2506 N NH1 . ARG B 2 237 ? 95.909  80.977 20.847  1.00 56.36  ? 218 ARG H NH1 1 
ATOM   2507 N NH2 . ARG B 2 237 ? 95.292  78.774 20.655  1.00 58.93  ? 218 ARG H NH2 1 
ATOM   2508 N N   . ASP C 3 21  ? 92.449  31.721 -10.509 1.00 41.29  ? 1   ASP L N   1 
ATOM   2509 C CA  . ASP C 3 21  ? 92.156  31.940 -9.096  1.00 39.11  ? 1   ASP L CA  1 
ATOM   2510 C C   . ASP C 3 21  ? 90.662  31.937 -8.891  1.00 35.02  ? 1   ASP L C   1 
ATOM   2511 O O   . ASP C 3 21  ? 89.908  32.325 -9.771  1.00 38.41  ? 1   ASP L O   1 
ATOM   2512 C CB  . ASP C 3 21  ? 92.735  33.269 -8.599  1.00 44.36  ? 1   ASP L CB  1 
ATOM   2513 C CG  . ASP C 3 21  ? 94.224  33.407 -8.879  1.00 49.60  ? 1   ASP L CG  1 
ATOM   2514 O OD1 . ASP C 3 21  ? 94.869  32.397 -9.246  1.00 47.17  ? 1   ASP L OD1 1 
ATOM   2515 O OD2 . ASP C 3 21  ? 94.748  34.536 -8.728  1.00 58.67  ? 1   ASP L OD2 1 
ATOM   2516 N N   . ILE C 3 22  ? 90.221  31.487 -7.732  1.00 40.46  ? 2   ILE L N   1 
ATOM   2517 C CA  . ILE C 3 22  ? 88.813  31.608 -7.388  1.00 36.73  ? 2   ILE L CA  1 
ATOM   2518 C C   . ILE C 3 22  ? 88.494  33.069 -7.085  1.00 35.49  ? 2   ILE L C   1 
ATOM   2519 O O   . ILE C 3 22  ? 89.187  33.719 -6.314  1.00 39.60  ? 2   ILE L O   1 
ATOM   2520 C CB  . ILE C 3 22  ? 88.461  30.714 -6.201  1.00 36.84  ? 2   ILE L CB  1 
ATOM   2521 C CG1 . ILE C 3 22  ? 88.967  29.300 -6.477  1.00 33.97  ? 2   ILE L CG1 1 
ATOM   2522 C CG2 . ILE C 3 22  ? 86.959  30.683 -5.977  1.00 39.03  ? 2   ILE L CG2 1 
ATOM   2523 C CD1 . ILE C 3 22  ? 88.767  28.376 -5.330  1.00 39.75  ? 2   ILE L CD1 1 
ATOM   2524 N N   . VAL C 3 23  ? 87.482  33.601 -7.752  1.00 36.69  ? 3   VAL L N   1 
ATOM   2525 C CA  . VAL C 3 23  ? 86.992  34.936 -7.454  1.00 33.33  ? 3   VAL L CA  1 
ATOM   2526 C C   . VAL C 3 23  ? 85.938  34.915 -6.338  1.00 34.97  ? 3   VAL L C   1 
ATOM   2527 O O   . VAL C 3 23  ? 84.967  34.141 -6.382  1.00 37.65  ? 3   VAL L O   1 
ATOM   2528 C CB  . VAL C 3 23  ? 86.388  35.609 -8.700  1.00 38.58  ? 3   VAL L CB  1 
ATOM   2529 C CG1 . VAL C 3 23  ? 85.783  36.956 -8.325  1.00 38.12  ? 3   VAL L CG1 1 
ATOM   2530 C CG2 . VAL C 3 23  ? 87.450  35.778 -9.786  1.00 31.93  ? 3   VAL L CG2 1 
ATOM   2531 N N   . MET C 3 24  ? 86.158  35.760 -5.332  1.00 38.01  ? 4   MET L N   1 
ATOM   2532 C CA  . MET C 3 24  ? 85.213  35.985 -4.247  1.00 33.60  ? 4   MET L CA  1 
ATOM   2533 C C   . MET C 3 24  ? 84.524  37.332 -4.441  1.00 34.43  ? 4   MET L C   1 
ATOM   2534 O O   . MET C 3 24  ? 85.161  38.348 -4.723  1.00 32.17  ? 4   MET L O   1 
ATOM   2535 C CB  . MET C 3 24  ? 85.912  35.944 -2.894  1.00 32.41  ? 4   MET L CB  1 
ATOM   2536 C CG  . MET C 3 24  ? 86.684  34.676 -2.657  1.00 30.36  ? 4   MET L CG  1 
ATOM   2537 S SD  . MET C 3 24  ? 85.727  33.157 -2.903  1.00 38.07  ? 4   MET L SD  1 
ATOM   2538 C CE  . MET C 3 24  ? 84.568  33.254 -1.560  1.00 37.02  ? 4   MET L CE  1 
ATOM   2539 N N   . THR C 3 25  ? 83.210  37.328 -4.298  1.00 34.32  ? 5   THR L N   1 
ATOM   2540 C CA  . THR C 3 25  ? 82.436  38.543 -4.452  1.00 36.31  ? 5   THR L CA  1 
ATOM   2541 C C   . THR C 3 25  ? 81.534  38.736 -3.243  1.00 34.57  ? 5   THR L C   1 
ATOM   2542 O O   . THR C 3 25  ? 80.786  37.833 -2.855  1.00 35.96  ? 5   THR L O   1 
ATOM   2543 C CB  . THR C 3 25  ? 81.610  38.507 -5.748  1.00 38.51  ? 5   THR L CB  1 
ATOM   2544 O OG1 . THR C 3 25  ? 82.504  38.613 -6.867  1.00 37.48  ? 5   THR L OG1 1 
ATOM   2545 C CG2 . THR C 3 25  ? 80.620  39.661 -5.789  1.00 38.09  ? 5   THR L CG2 1 
ATOM   2546 N N   . GLN C 3 26  ? 81.620  39.903 -2.622  1.00 34.56  ? 6   GLN L N   1 
ATOM   2547 C CA  . GLN C 3 26  ? 80.783  40.149 -1.449  1.00 35.88  ? 6   GLN L CA  1 
ATOM   2548 C C   . GLN C 3 26  ? 79.661  41.118 -1.732  1.00 34.29  ? 6   GLN L C   1 
ATOM   2549 O O   . GLN C 3 26  ? 79.800  42.020 -2.558  1.00 30.98  ? 6   GLN L O   1 
ATOM   2550 C CB  . GLN C 3 26  ? 81.614  40.675 -0.288  1.00 25.91  ? 6   GLN L CB  1 
ATOM   2551 C CG  . GLN C 3 26  ? 82.167  39.594 0.565   1.00 32.27  ? 6   GLN L CG  1 
ATOM   2552 C CD  . GLN C 3 26  ? 83.061  40.128 1.665   1.00 33.40  ? 6   GLN L CD  1 
ATOM   2553 O OE1 . GLN C 3 26  ? 84.289  40.236 1.490   1.00 30.63  ? 6   GLN L OE1 1 
ATOM   2554 N NE2 . GLN C 3 26  ? 82.456  40.451 2.815   1.00 28.43  ? 6   GLN L NE2 1 
ATOM   2555 N N   . SER C 3 27  ? 78.561  40.924 -1.016  1.00 34.45  ? 7   SER L N   1 
ATOM   2556 C CA  . SER C 3 27  ? 77.418  41.819 -1.087  1.00 36.83  ? 7   SER L CA  1 
ATOM   2557 C C   . SER C 3 27  ? 76.763  42.002 0.272   1.00 38.84  ? 7   SER L C   1 
ATOM   2558 O O   . SER C 3 27  ? 76.601  41.023 1.029   1.00 35.88  ? 7   SER L O   1 
ATOM   2559 C CB  . SER C 3 27  ? 76.398  41.288 -2.085  1.00 37.76  ? 7   SER L CB  1 
ATOM   2560 O OG  . SER C 3 27  ? 76.825  41.607 -3.389  1.00 46.72  ? 7   SER L OG  1 
ATOM   2561 N N   . PRO C 3 28  ? 76.386  43.252 0.587   1.00 36.49  ? 8   PRO L N   1 
ATOM   2562 C CA  . PRO C 3 28  ? 76.606  44.451 -0.232  1.00 36.49  ? 8   PRO L CA  1 
ATOM   2563 C C   . PRO C 3 28  ? 77.893  45.168 0.143   1.00 35.67  ? 8   PRO L C   1 
ATOM   2564 O O   . PRO C 3 28  ? 78.533  44.787 1.124   1.00 37.18  ? 8   PRO L O   1 
ATOM   2565 C CB  . PRO C 3 28  ? 75.409  45.321 0.126   1.00 30.21  ? 8   PRO L CB  1 
ATOM   2566 C CG  . PRO C 3 28  ? 75.230  45.037 1.565   1.00 32.29  ? 8   PRO L CG  1 
ATOM   2567 C CD  . PRO C 3 28  ? 75.623  43.588 1.801   1.00 36.48  ? 8   PRO L CD  1 
ATOM   2568 N N   . SER C 3 29  ? 78.245  46.221 -0.584  1.00 30.93  ? 9   SER L N   1 
ATOM   2569 C CA  . SER C 3 29  ? 79.478  46.948 -0.305  1.00 34.51  ? 9   SER L CA  1 
ATOM   2570 C C   . SER C 3 29  ? 79.443  47.657 1.049   1.00 34.84  ? 9   SER L C   1 
ATOM   2571 O O   . SER C 3 29  ? 80.469  47.776 1.726   1.00 33.10  ? 9   SER L O   1 
ATOM   2572 C CB  . SER C 3 29  ? 79.751  47.967 -1.401  1.00 33.80  ? 9   SER L CB  1 
ATOM   2573 O OG  . SER C 3 29  ? 78.691  48.897 -1.427  1.00 51.23  ? 9   SER L OG  1 
ATOM   2574 N N   . SER C 3 30  ? 78.271  48.160 1.421   1.00 33.80  ? 10  SER L N   1 
ATOM   2575 C CA  . SER C 3 30  ? 78.076  48.667 2.769   1.00 35.33  ? 10  SER L CA  1 
ATOM   2576 C C   . SER C 3 30  ? 76.678  48.417 3.343   1.00 36.43  ? 10  SER L C   1 
ATOM   2577 O O   . SER C 3 30  ? 75.698  48.191 2.618   1.00 31.49  ? 10  SER L O   1 
ATOM   2578 C CB  . SER C 3 30  ? 78.375  50.160 2.823   1.00 35.15  ? 10  SER L CB  1 
ATOM   2579 O OG  . SER C 3 30  ? 77.455  50.861 2.032   1.00 37.61  ? 10  SER L OG  1 
ATOM   2580 N N   . LEU C 3 31  ? 76.625  48.505 4.669   1.00 33.98  ? 11  LEU L N   1 
ATOM   2581 C CA  . LEU C 3 31  ? 75.469  48.182 5.475   1.00 37.23  ? 11  LEU L CA  1 
ATOM   2582 C C   . LEU C 3 31  ? 75.292  49.191 6.588   1.00 37.34  ? 11  LEU L C   1 
ATOM   2583 O O   . LEU C 3 31  ? 76.268  49.598 7.207   1.00 41.21  ? 11  LEU L O   1 
ATOM   2584 C CB  . LEU C 3 31  ? 75.637  46.790 6.095   1.00 42.16  ? 11  LEU L CB  1 
ATOM   2585 C CG  . LEU C 3 31  ? 75.194  45.602 5.271   1.00 37.02  ? 11  LEU L CG  1 
ATOM   2586 C CD1 . LEU C 3 31  ? 75.102  44.360 6.129   1.00 38.82  ? 11  LEU L CD1 1 
ATOM   2587 C CD2 . LEU C 3 31  ? 73.853  45.960 4.721   1.00 36.19  ? 11  LEU L CD2 1 
ATOM   2588 N N   . ALA C 3 32  ? 74.057  49.571 6.881   1.00 37.35  ? 12  ALA L N   1 
ATOM   2589 C CA  . ALA C 3 32  ? 73.799  50.383 8.067   1.00 37.64  ? 12  ALA L CA  1 
ATOM   2590 C C   . ALA C 3 32  ? 72.543  49.884 8.792   1.00 37.63  ? 12  ALA L C   1 
ATOM   2591 O O   . ALA C 3 32  ? 71.467  49.839 8.220   1.00 39.77  ? 12  ALA L O   1 
ATOM   2592 C CB  . ALA C 3 32  ? 73.674  51.866 7.693   1.00 29.61  ? 12  ALA L CB  1 
ATOM   2593 N N   . MET C 3 33  ? 72.705  49.482 10.045  1.00 32.94  ? 13  MET L N   1 
ATOM   2594 C CA  . MET C 3 33  ? 71.611  49.012 10.860  1.00 31.20  ? 13  MET L CA  1 
ATOM   2595 C C   . MET C 3 33  ? 71.724  49.566 12.266  1.00 37.15  ? 13  MET L C   1 
ATOM   2596 O O   . MET C 3 33  ? 72.821  49.870 12.744  1.00 33.76  ? 13  MET L O   1 
ATOM   2597 C CB  . MET C 3 33  ? 71.592  47.490 10.918  1.00 41.74  ? 13  MET L CB  1 
ATOM   2598 C CG  . MET C 3 33  ? 71.333  46.810 9.590   1.00 46.09  ? 13  MET L CG  1 
ATOM   2599 S SD  . MET C 3 33  ? 69.586  46.396 9.436   1.00 66.87  ? 13  MET L SD  1 
ATOM   2600 C CE  . MET C 3 33  ? 68.883  47.957 8.880   1.00 37.81  ? 13  MET L CE  1 
ATOM   2601 N N   . SER C 3 34  ? 70.591  49.685 12.944  1.00 36.73  ? 14  SER L N   1 
ATOM   2602 C CA  . SER C 3 34  ? 70.604  50.153 14.324  1.00 38.83  ? 14  SER L CA  1 
ATOM   2603 C C   . SER C 3 34  ? 70.796  48.985 15.279  1.00 36.97  ? 14  SER L C   1 
ATOM   2604 O O   . SER C 3 34  ? 70.541  47.834 14.925  1.00 40.24  ? 14  SER L O   1 
ATOM   2605 C CB  . SER C 3 34  ? 69.321  50.921 14.650  1.00 37.46  ? 14  SER L CB  1 
ATOM   2606 O OG  . SER C 3 34  ? 68.185  50.332 14.051  1.00 36.00  ? 14  SER L OG  1 
ATOM   2607 N N   . VAL C 3 35  ? 71.264  49.287 16.482  1.00 32.12  ? 15  VAL L N   1 
ATOM   2608 C CA  . VAL C 3 35  ? 71.559  48.259 17.474  1.00 36.83  ? 15  VAL L CA  1 
ATOM   2609 C C   . VAL C 3 35  ? 70.331  47.431 17.818  1.00 39.93  ? 15  VAL L C   1 
ATOM   2610 O O   . VAL C 3 35  ? 69.260  47.978 18.093  1.00 37.80  ? 15  VAL L O   1 
ATOM   2611 C CB  . VAL C 3 35  ? 72.151  48.886 18.763  1.00 38.25  ? 15  VAL L CB  1 
ATOM   2612 C CG1 . VAL C 3 35  ? 71.999  47.959 19.957  1.00 32.54  ? 15  VAL L CG1 1 
ATOM   2613 C CG2 . VAL C 3 35  ? 73.606  49.234 18.551  1.00 34.46  ? 15  VAL L CG2 1 
ATOM   2614 N N   . GLY C 3 36  ? 70.501  46.109 17.775  1.00 46.58  ? 16  GLY L N   1 
ATOM   2615 C CA  . GLY C 3 36  ? 69.438  45.158 18.049  1.00 37.82  ? 16  GLY L CA  1 
ATOM   2616 C C   . GLY C 3 36  ? 68.900  44.494 16.800  1.00 42.09  ? 16  GLY L C   1 
ATOM   2617 O O   . GLY C 3 36  ? 68.386  43.383 16.850  1.00 43.87  ? 16  GLY L O   1 
ATOM   2618 N N   . GLN C 3 37  ? 68.998  45.186 15.670  1.00 44.25  ? 17  GLN L N   1 
ATOM   2619 C CA  . GLN C 3 37  ? 68.536  44.633 14.403  1.00 38.09  ? 17  GLN L CA  1 
ATOM   2620 C C   . GLN C 3 37  ? 69.445  43.525 13.882  1.00 43.84  ? 17  GLN L C   1 
ATOM   2621 O O   . GLN C 3 37  ? 70.615  43.421 14.264  1.00 44.99  ? 17  GLN L O   1 
ATOM   2622 C CB  . GLN C 3 37  ? 68.423  45.725 13.351  1.00 39.98  ? 17  GLN L CB  1 
ATOM   2623 C CG  . GLN C 3 37  ? 67.458  46.842 13.694  1.00 43.58  ? 17  GLN L CG  1 
ATOM   2624 C CD  . GLN C 3 37  ? 67.123  47.696 12.473  1.00 58.57  ? 17  GLN L CD  1 
ATOM   2625 O OE1 . GLN C 3 37  ? 68.021  48.232 11.805  1.00 52.96  ? 17  GLN L OE1 1 
ATOM   2626 N NE2 . GLN C 3 37  ? 65.826  47.808 12.160  1.00 54.05  ? 17  GLN L NE2 1 
ATOM   2627 N N   . LYS C 3 38  ? 68.880  42.700 13.006  1.00 45.80  ? 18  LYS L N   1 
ATOM   2628 C CA  . LYS C 3 38  ? 69.585  41.583 12.383  1.00 48.69  ? 18  LYS L CA  1 
ATOM   2629 C C   . LYS C 3 38  ? 70.375  42.076 11.182  1.00 45.55  ? 18  LYS L C   1 
ATOM   2630 O O   . LYS C 3 38  ? 69.878  42.873 10.376  1.00 43.30  ? 18  LYS L O   1 
ATOM   2631 C CB  . LYS C 3 38  ? 68.597  40.487 11.960  1.00 49.38  ? 18  LYS L CB  1 
ATOM   2632 C CG  . LYS C 3 38  ? 69.225  39.215 11.381  1.00 47.29  ? 18  LYS L CG  1 
ATOM   2633 C CD  . LYS C 3 38  ? 68.153  38.300 10.772  1.00 49.79  ? 18  LYS L CD  1 
ATOM   2634 C CE  . LYS C 3 38  ? 68.769  37.112 10.026  1.00 63.38  ? 18  LYS L CE  1 
ATOM   2635 N NZ  . LYS C 3 38  ? 67.766  36.238 9.341   1.00 56.48  ? 18  LYS L NZ  1 
ATOM   2636 N N   . VAL C 3 39  ? 71.609  41.599 11.070  1.00 39.06  ? 19  VAL L N   1 
ATOM   2637 C CA  . VAL C 3 39  ? 72.467  41.993 9.959   1.00 43.79  ? 19  VAL L CA  1 
ATOM   2638 C C   . VAL C 3 39  ? 72.739  40.814 9.024   1.00 38.51  ? 19  VAL L C   1 
ATOM   2639 O O   . VAL C 3 39  ? 72.983  39.688 9.464   1.00 37.28  ? 19  VAL L O   1 
ATOM   2640 C CB  . VAL C 3 39  ? 73.796  42.588 10.480  1.00 45.68  ? 19  VAL L CB  1 
ATOM   2641 C CG1 . VAL C 3 39  ? 74.797  42.814 9.340   1.00 39.03  ? 19  VAL L CG1 1 
ATOM   2642 C CG2 . VAL C 3 39  ? 73.513  43.895 11.215  1.00 40.97  ? 19  VAL L CG2 1 
ATOM   2643 N N   . THR C 3 40  ? 72.683  41.080 7.729   1.00 37.15  ? 20  THR L N   1 
ATOM   2644 C CA  . THR C 3 40  ? 72.955  40.050 6.756   1.00 35.25  ? 20  THR L CA  1 
ATOM   2645 C C   . THR C 3 40  ? 73.885  40.525 5.649   1.00 41.41  ? 20  THR L C   1 
ATOM   2646 O O   . THR C 3 40  ? 73.694  41.608 5.066   1.00 39.71  ? 20  THR L O   1 
ATOM   2647 C CB  . THR C 3 40  ? 71.649  39.527 6.144   1.00 43.34  ? 20  THR L CB  1 
ATOM   2648 O OG1 . THR C 3 40  ? 71.202  38.408 6.918   1.00 45.49  ? 20  THR L OG1 1 
ATOM   2649 C CG2 . THR C 3 40  ? 71.866  39.090 4.695   1.00 46.13  ? 20  THR L CG2 1 
ATOM   2650 N N   . MET C 3 41  ? 74.899  39.704 5.371   1.00 36.50  ? 21  MET L N   1 
ATOM   2651 C CA  . MET C 3 41  ? 75.780  39.954 4.247   1.00 34.54  ? 21  MET L CA  1 
ATOM   2652 C C   . MET C 3 41  ? 76.211  38.646 3.555   1.00 34.86  ? 21  MET L C   1 
ATOM   2653 O O   . MET C 3 41  ? 76.271  37.561 4.173   1.00 31.37  ? 21  MET L O   1 
ATOM   2654 C CB  . MET C 3 41  ? 76.990  40.762 4.708   1.00 33.82  ? 21  MET L CB  1 
ATOM   2655 C CG  . MET C 3 41  ? 78.010  40.004 5.560   1.00 32.16  ? 21  MET L CG  1 
ATOM   2656 S SD  . MET C 3 41  ? 79.203  41.146 6.310   1.00 41.07  ? 21  MET L SD  1 
ATOM   2657 C CE  . MET C 3 41  ? 78.295  41.842 7.688   1.00 21.02  ? 21  MET L CE  1 
ATOM   2658 N N   . SER C 3 42  ? 76.517  38.745 2.269   1.00 28.44  ? 22  SER L N   1 
ATOM   2659 C CA  . SER C 3 42  ? 76.709  37.529 1.500   1.00 34.58  ? 22  SER L CA  1 
ATOM   2660 C C   . SER C 3 42  ? 78.023  37.494 0.746   1.00 37.29  ? 22  SER L C   1 
ATOM   2661 O O   . SER C 3 42  ? 78.701  38.513 0.556   1.00 32.33  ? 22  SER L O   1 
ATOM   2662 C CB  . SER C 3 42  ? 75.555  37.337 0.511   1.00 32.07  ? 22  SER L CB  1 
ATOM   2663 O OG  . SER C 3 42  ? 75.708  38.221 -0.580  1.00 39.43  ? 22  SER L OG  1 
ATOM   2664 N N   . CYS C 3 43  ? 78.331  36.292 0.277   1.00 38.01  ? 23  CYS L N   1 
ATOM   2665 C CA  . CYS C 3 43  ? 79.605  35.990 -0.330  1.00 36.65  ? 23  CYS L CA  1 
ATOM   2666 C C   . CYS C 3 43  ? 79.434  34.936 -1.401  1.00 36.29  ? 23  CYS L C   1 
ATOM   2667 O O   . CYS C 3 43  ? 79.006  33.813 -1.108  1.00 34.14  ? 23  CYS L O   1 
ATOM   2668 C CB  . CYS C 3 43  ? 80.585  35.486 0.726   1.00 39.40  ? 23  CYS L CB  1 
ATOM   2669 S SG  . CYS C 3 43  ? 82.258  35.171 0.107   1.00 48.48  ? 23  CYS L SG  1 
ATOM   2670 N N   . LYS C 3 44  ? 79.789  35.288 -2.630  1.00 30.75  ? 24  LYS L N   1 
ATOM   2671 C CA  . LYS C 3 44  ? 79.730  34.335 -3.722  1.00 37.42  ? 24  LYS L CA  1 
ATOM   2672 C C   . LYS C 3 44  ? 81.144  34.013 -4.244  1.00 37.53  ? 24  LYS L C   1 
ATOM   2673 O O   . LYS C 3 44  ? 81.937  34.909 -4.569  1.00 37.01  ? 24  LYS L O   1 
ATOM   2674 C CB  . LYS C 3 44  ? 78.825  34.863 -4.846  1.00 35.02  ? 24  LYS L CB  1 
ATOM   2675 N N   . SER C 3 45  ? 81.448  32.721 -4.291  1.00 34.44  ? 25  SER L N   1 
ATOM   2676 C CA  . SER C 3 45  ? 82.680  32.209 -4.891  1.00 39.76  ? 25  SER L CA  1 
ATOM   2677 C C   . SER C 3 45  ? 82.465  31.764 -6.335  1.00 41.68  ? 25  SER L C   1 
ATOM   2678 O O   . SER C 3 45  ? 81.428  31.191 -6.666  1.00 41.09  ? 25  SER L O   1 
ATOM   2679 C CB  . SER C 3 45  ? 83.213  31.029 -4.092  1.00 34.46  ? 25  SER L CB  1 
ATOM   2680 O OG  . SER C 3 45  ? 82.272  29.987 -4.103  1.00 36.42  ? 25  SER L OG  1 
ATOM   2681 N N   . SER C 3 46  ? 83.461  31.999 -7.182  1.00 39.52  ? 26  SER L N   1 
ATOM   2682 C CA  . SER C 3 46  ? 83.378  31.608 -8.586  1.00 38.53  ? 26  SER L CA  1 
ATOM   2683 C C   . SER C 3 46  ? 83.198  30.107 -8.807  1.00 43.41  ? 26  SER L C   1 
ATOM   2684 O O   . SER C 3 46  ? 82.876  29.688 -9.909  1.00 51.76  ? 26  SER L O   1 
ATOM   2685 C CB  . SER C 3 46  ? 84.625  32.073 -9.337  1.00 37.11  ? 26  SER L CB  1 
ATOM   2686 O OG  . SER C 3 46  ? 85.786  31.463 -8.808  1.00 40.96  ? 26  SER L OG  1 
ATOM   2687 N N   . GLN C 3 47  ? 83.409  29.298 -7.773  1.00 40.81  ? 27  GLN L N   1 
ATOM   2688 C CA  . GLN C 3 47  ? 83.244  27.856 -7.895  1.00 39.88  ? 27  GLN L CA  1 
ATOM   2689 C C   . GLN C 3 47  ? 83.119  27.243 -6.505  1.00 43.52  ? 27  GLN L C   1 
ATOM   2690 O O   . GLN C 3 47  ? 83.328  27.938 -5.519  1.00 44.12  ? 27  GLN L O   1 
ATOM   2691 C CB  . GLN C 3 47  ? 84.412  27.239 -8.647  1.00 39.22  ? 27  GLN L CB  1 
ATOM   2692 C CG  . GLN C 3 47  ? 85.668  27.106 -7.812  1.00 44.96  ? 27  GLN L CG  1 
ATOM   2693 C CD  . GLN C 3 47  ? 86.755  26.327 -8.540  1.00 49.92  ? 27  GLN L CD  1 
ATOM   2694 O OE1 . GLN C 3 47  ? 87.139  25.221 -8.130  1.00 45.13  ? 27  GLN L OE1 1 
ATOM   2695 N NE2 . GLN C 3 47  ? 87.243  26.894 -9.642  1.00 46.66  ? 27  GLN L NE2 1 
ATOM   2696 N N   . SER C 3 48  ? 82.790  25.953 -6.426  1.00 40.75  ? 28  SER L N   1 
ATOM   2697 C CA  . SER C 3 48  ? 82.506  25.309 -5.144  1.00 41.05  ? 28  SER L CA  1 
ATOM   2698 C C   . SER C 3 48  ? 83.695  25.285 -4.180  1.00 42.24  ? 28  SER L C   1 
ATOM   2699 O O   . SER C 3 48  ? 84.840  25.091 -4.586  1.00 42.87  ? 28  SER L O   1 
ATOM   2700 C CB  . SER C 3 48  ? 82.020  23.886 -5.375  1.00 40.43  ? 28  SER L CB  1 
ATOM   2701 O OG  . SER C 3 48  ? 81.682  23.277 -4.140  1.00 47.58  ? 28  SER L OG  1 
ATOM   2702 N N   . LEU C 3 49  ? 83.417  25.487 -2.897  1.00 42.97  ? 29  LEU L N   1 
ATOM   2703 C CA  . LEU C 3 49  ? 84.473  25.504 -1.887  1.00 39.84  ? 29  LEU L CA  1 
ATOM   2704 C C   . LEU C 3 49  ? 84.371  24.221 -1.076  1.00 41.96  ? 29  LEU L C   1 
ATOM   2705 O O   . LEU C 3 49  ? 85.003  24.064 -0.034  1.00 39.16  ? 29  LEU L O   1 
ATOM   2706 C CB  . LEU C 3 49  ? 84.363  26.757 -1.000  1.00 31.53  ? 29  LEU L CB  1 
ATOM   2707 C CG  . LEU C 3 49  ? 84.549  28.078 -1.777  1.00 38.28  ? 29  LEU L CG  1 
ATOM   2708 C CD1 . LEU C 3 49  ? 84.470  29.334 -0.906  1.00 33.39  ? 29  LEU L CD1 1 
ATOM   2709 C CD2 . LEU C 3 49  ? 85.868  28.071 -2.539  1.00 32.64  ? 29  LEU L CD2 1 
ATOM   2710 N N   . LEU C 3 50  ? 83.568  23.296 -1.594  1.00 50.82  ? 30  LEU L N   1 
ATOM   2711 C CA  . LEU C 3 50  ? 83.238  22.041 -0.915  1.00 48.93  ? 30  LEU L CA  1 
ATOM   2712 C C   . LEU C 3 50  ? 84.312  20.978 -1.086  1.00 45.87  ? 30  LEU L C   1 
ATOM   2713 O O   . LEU C 3 50  ? 84.521  20.447 -2.170  1.00 56.09  ? 30  LEU L O   1 
ATOM   2714 C CB  . LEU C 3 50  ? 81.893  21.512 -1.431  1.00 49.02  ? 30  LEU L CB  1 
ATOM   2715 C CG  . LEU C 3 50  ? 81.119  20.376 -0.733  1.00 57.76  ? 30  LEU L CG  1 
ATOM   2716 C CD1 . LEU C 3 50  ? 81.696  18.977 -1.019  1.00 58.77  ? 30  LEU L CD1 1 
ATOM   2717 C CD2 . LEU C 3 50  ? 80.994  20.617 0.772   1.00 51.45  ? 30  LEU L CD2 1 
ATOM   2718 N N   . ASN C 3 51  ? 84.991  20.677 0.004   1.00 47.41  ? 31  ASN L N   1 
ATOM   2719 C CA  . ASN C 3 51  ? 85.877  19.530 0.074   1.00 56.81  ? 31  ASN L CA  1 
ATOM   2720 C C   . ASN C 3 51  ? 85.072  18.228 0.133   1.00 62.25  ? 31  ASN L C   1 
ATOM   2721 O O   . ASN C 3 51  ? 84.432  17.931 1.141   1.00 60.65  ? 31  ASN L O   1 
ATOM   2722 C CB  . ASN C 3 51  ? 86.781  19.657 1.297   1.00 56.96  ? 31  ASN L CB  1 
ATOM   2723 C CG  . ASN C 3 51  ? 87.832  18.574 1.372   1.00 59.32  ? 31  ASN L CG  1 
ATOM   2724 O OD1 . ASN C 3 51  ? 87.751  17.548 0.694   1.00 63.02  ? 31  ASN L OD1 1 
ATOM   2725 N ND2 . ASN C 3 51  ? 88.834  18.800 2.213   1.00 53.89  ? 31  ASN L ND2 1 
ATOM   2726 N N   . SER C 3 52  ? 85.117  17.459 -0.951  1.00 67.72  ? 32  SER L N   1 
ATOM   2727 C CA  . SER C 3 52  ? 84.377  16.204 -1.046  1.00 65.33  ? 32  SER L CA  1 
ATOM   2728 C C   . SER C 3 52  ? 84.751  15.212 0.049   1.00 62.67  ? 32  SER L C   1 
ATOM   2729 O O   . SER C 3 52  ? 83.880  14.656 0.697   1.00 67.93  ? 32  SER L O   1 
ATOM   2730 C CB  . SER C 3 52  ? 84.595  15.570 -2.417  1.00 69.40  ? 32  SER L CB  1 
ATOM   2731 O OG  . SER C 3 52  ? 84.038  16.378 -3.440  1.00 76.22  ? 32  SER L OG  1 
ATOM   2732 N N   . ASN C 3 53  ? 86.040  15.006 0.279   1.00 61.12  ? 33  ASN L N   1 
ATOM   2733 C CA  . ASN C 3 53  ? 86.471  14.018 1.266   1.00 67.21  ? 33  ASN L CA  1 
ATOM   2734 C C   . ASN C 3 53  ? 86.107  14.433 2.690   1.00 69.71  ? 33  ASN L C   1 
ATOM   2735 O O   . ASN C 3 53  ? 86.209  13.642 3.633   1.00 69.03  ? 33  ASN L O   1 
ATOM   2736 C CB  . ASN C 3 53  ? 87.985  13.778 1.159   1.00 71.18  ? 33  ASN L CB  1 
ATOM   2737 C CG  . ASN C 3 53  ? 88.407  13.280 -0.225  1.00 78.17  ? 33  ASN L CG  1 
ATOM   2738 O OD1 . ASN C 3 53  ? 87.729  13.546 -1.221  1.00 83.24  ? 33  ASN L OD1 1 
ATOM   2739 N ND2 . ASN C 3 53  ? 89.525  12.552 -0.290  1.00 67.87  ? 33  ASN L ND2 1 
ATOM   2740 N N   . ASN C 3 54  ? 85.654  15.676 2.820   1.00 65.96  ? 34  ASN L N   1 
ATOM   2741 C CA  . ASN C 3 54  ? 85.501  16.344 4.104   1.00 63.24  ? 34  ASN L CA  1 
ATOM   2742 C C   . ASN C 3 54  ? 84.059  16.701 4.387   1.00 58.94  ? 34  ASN L C   1 
ATOM   2743 O O   . ASN C 3 54  ? 83.624  16.766 5.537   1.00 57.12  ? 34  ASN L O   1 
ATOM   2744 C CB  . ASN C 3 54  ? 86.342  17.623 4.121   1.00 58.28  ? 34  ASN L CB  1 
ATOM   2745 C CG  . ASN C 3 54  ? 86.690  18.071 5.511   1.00 60.30  ? 34  ASN L CG  1 
ATOM   2746 O OD1 . ASN C 3 54  ? 85.812  18.363 6.317   1.00 71.39  ? 34  ASN L OD1 1 
ATOM   2747 N ND2 . ASN C 3 54  ? 87.980  18.122 5.809   1.00 58.10  ? 34  ASN L ND2 1 
ATOM   2748 N N   . GLN C 3 55  ? 83.339  16.973 3.309   1.00 57.96  ? 35  GLN L N   1 
ATOM   2749 C CA  . GLN C 3 55  ? 82.001  17.530 3.378   1.00 59.83  ? 35  GLN L CA  1 
ATOM   2750 C C   . GLN C 3 55  ? 82.005  18.874 4.110   1.00 57.44  ? 35  GLN L C   1 
ATOM   2751 O O   . GLN C 3 55  ? 80.987  19.306 4.644   1.00 55.67  ? 35  GLN L O   1 
ATOM   2752 C CB  . GLN C 3 55  ? 81.048  16.532 4.041   1.00 64.26  ? 35  GLN L CB  1 
ATOM   2753 C CG  . GLN C 3 55  ? 79.669  16.452 3.393   1.00 71.56  ? 35  GLN L CG  1 
ATOM   2754 C CD  . GLN C 3 55  ? 79.675  15.911 1.960   1.00 75.62  ? 35  GLN L CD  1 
ATOM   2755 O OE1 . GLN C 3 55  ? 80.727  15.657 1.359   1.00 67.40  ? 35  GLN L OE1 1 
ATOM   2756 N NE2 . GLN C 3 55  ? 78.478  15.735 1.408   1.00 84.17  ? 35  GLN L NE2 1 
ATOM   2757 N N   . LYS C 3 56  ? 83.159  19.535 4.123   1.00 54.01  ? 36  LYS L N   1 
ATOM   2758 C CA  . LYS C 3 56  ? 83.258  20.886 4.662   1.00 50.28  ? 36  LYS L CA  1 
ATOM   2759 C C   . LYS C 3 56  ? 83.446  21.900 3.544   1.00 44.58  ? 36  LYS L C   1 
ATOM   2760 O O   . LYS C 3 56  ? 84.066  21.613 2.523   1.00 45.56  ? 36  LYS L O   1 
ATOM   2761 C CB  . LYS C 3 56  ? 84.403  20.991 5.671   1.00 46.78  ? 36  LYS L CB  1 
ATOM   2762 C CG  . LYS C 3 56  ? 83.936  21.343 7.078   1.00 52.17  ? 36  LYS L CG  1 
ATOM   2763 C CD  . LYS C 3 56  ? 84.552  20.436 8.147   1.00 58.75  ? 36  LYS L CD  1 
ATOM   2764 C CE  . LYS C 3 56  ? 83.785  20.538 9.471   1.00 63.41  ? 36  LYS L CE  1 
ATOM   2765 N NZ  . LYS C 3 56  ? 82.312  20.321 9.285   1.00 63.68  ? 36  LYS L NZ  1 
ATOM   2766 N N   . ASN C 3 57  ? 82.880  23.083 3.727   1.00 43.99  ? 37  ASN L N   1 
ATOM   2767 C CA  . ASN C 3 57  ? 83.124  24.187 2.808   1.00 40.58  ? 37  ASN L CA  1 
ATOM   2768 C C   . ASN C 3 57  ? 84.207  25.093 3.371   1.00 36.64  ? 37  ASN L C   1 
ATOM   2769 O O   . ASN C 3 57  ? 84.095  25.572 4.487   1.00 36.48  ? 37  ASN L O   1 
ATOM   2770 C CB  . ASN C 3 57  ? 81.849  24.976 2.557   1.00 39.36  ? 37  ASN L CB  1 
ATOM   2771 C CG  . ASN C 3 57  ? 80.833  24.201 1.734   1.00 43.59  ? 37  ASN L CG  1 
ATOM   2772 O OD1 . ASN C 3 57  ? 79.794  23.713 2.389   1.00 39.39  ? 37  ASN L OD1 1 
ATOM   2773 N ND2 . ASN C 3 57  ? 80.981  24.057 0.522   1.00 44.61  ? 37  ASN L ND2 1 
ATOM   2774 N N   . TYR C 3 58  ? 85.257  25.330 2.601   1.00 41.06  ? 38  TYR L N   1 
ATOM   2775 C CA  . TYR C 3 58  ? 86.403  26.081 3.115   1.00 35.52  ? 38  TYR L CA  1 
ATOM   2776 C C   . TYR C 3 58  ? 86.215  27.562 2.876   1.00 33.36  ? 38  TYR L C   1 
ATOM   2777 O O   . TYR C 3 58  ? 86.922  28.172 2.063   1.00 31.62  ? 38  TYR L O   1 
ATOM   2778 C CB  . TYR C 3 58  ? 87.704  25.587 2.480   1.00 38.55  ? 38  TYR L CB  1 
ATOM   2779 C CG  . TYR C 3 58  ? 88.140  24.236 3.010   1.00 36.52  ? 38  TYR L CG  1 
ATOM   2780 C CD1 . TYR C 3 58  ? 89.471  23.983 3.310   1.00 31.98  ? 38  TYR L CD1 1 
ATOM   2781 C CD2 . TYR C 3 58  ? 87.207  23.216 3.231   1.00 36.78  ? 38  TYR L CD2 1 
ATOM   2782 C CE1 . TYR C 3 58  ? 89.866  22.741 3.798   1.00 37.37  ? 38  TYR L CE1 1 
ATOM   2783 C CE2 . TYR C 3 58  ? 87.590  21.980 3.723   1.00 38.39  ? 38  TYR L CE2 1 
ATOM   2784 C CZ  . TYR C 3 58  ? 88.919  21.748 4.000   1.00 39.31  ? 38  TYR L CZ  1 
ATOM   2785 O OH  . TYR C 3 58  ? 89.309  20.532 4.477   1.00 43.21  ? 38  TYR L OH  1 
ATOM   2786 N N   . LEU C 3 59  ? 85.241  28.127 3.588   1.00 32.68  ? 39  LEU L N   1 
ATOM   2787 C CA  . LEU C 3 59  ? 85.007  29.567 3.555   1.00 33.89  ? 39  LEU L CA  1 
ATOM   2788 C C   . LEU C 3 59  ? 85.155  30.177 4.960   1.00 34.95  ? 39  LEU L C   1 
ATOM   2789 O O   . LEU C 3 59  ? 84.682  29.615 5.966   1.00 28.66  ? 39  LEU L O   1 
ATOM   2790 C CB  . LEU C 3 59  ? 83.625  29.888 2.971   1.00 32.13  ? 39  LEU L CB  1 
ATOM   2791 C CG  . LEU C 3 59  ? 83.464  31.403 2.962   1.00 35.32  ? 39  LEU L CG  1 
ATOM   2792 C CD1 . LEU C 3 59  ? 83.483  31.960 1.562   1.00 38.54  ? 39  LEU L CD1 1 
ATOM   2793 C CD2 . LEU C 3 59  ? 82.240  31.872 3.749   1.00 34.01  ? 39  LEU L CD2 1 
ATOM   2794 N N   . ALA C 3 60  ? 85.835  31.318 5.026   1.00 29.11  ? 40  ALA L N   1 
ATOM   2795 C CA  . ALA C 3 60  ? 86.093  31.944 6.306   1.00 27.89  ? 40  ALA L CA  1 
ATOM   2796 C C   . ALA C 3 60  ? 85.543  33.356 6.329   1.00 27.84  ? 40  ALA L C   1 
ATOM   2797 O O   . ALA C 3 60  ? 85.486  34.023 5.302   1.00 29.37  ? 40  ALA L O   1 
ATOM   2798 C CB  . ALA C 3 60  ? 87.599  31.946 6.604   1.00 26.86  ? 40  ALA L CB  1 
ATOM   2799 N N   . TRP C 3 61  ? 85.144  33.821 7.498   1.00 22.89  ? 41  TRP L N   1 
ATOM   2800 C CA  . TRP C 3 61  ? 84.761  35.222 7.628   1.00 28.47  ? 41  TRP L CA  1 
ATOM   2801 C C   . TRP C 3 61  ? 85.643  35.967 8.608   1.00 24.11  ? 41  TRP L C   1 
ATOM   2802 O O   . TRP C 3 61  ? 85.917  35.470 9.702   1.00 25.10  ? 41  TRP L O   1 
ATOM   2803 C CB  . TRP C 3 61  ? 83.311  35.357 8.087   1.00 29.96  ? 41  TRP L CB  1 
ATOM   2804 C CG  . TRP C 3 61  ? 82.295  34.982 7.085   1.00 26.53  ? 41  TRP L CG  1 
ATOM   2805 C CD1 . TRP C 3 61  ? 81.626  33.783 6.998   1.00 28.20  ? 41  TRP L CD1 1 
ATOM   2806 C CD2 . TRP C 3 61  ? 81.781  35.805 6.039   1.00 27.47  ? 41  TRP L CD2 1 
ATOM   2807 N NE1 . TRP C 3 61  ? 80.732  33.819 5.959   1.00 30.44  ? 41  TRP L NE1 1 
ATOM   2808 C CE2 . TRP C 3 61  ? 80.800  35.045 5.351   1.00 26.90  ? 41  TRP L CE2 1 
ATOM   2809 C CE3 . TRP C 3 61  ? 82.044  37.112 5.615   1.00 29.77  ? 41  TRP L CE3 1 
ATOM   2810 C CZ2 . TRP C 3 61  ? 80.097  35.543 4.257   1.00 26.00  ? 41  TRP L CZ2 1 
ATOM   2811 C CZ3 . TRP C 3 61  ? 81.343  37.613 4.524   1.00 28.47  ? 41  TRP L CZ3 1 
ATOM   2812 C CH2 . TRP C 3 61  ? 80.378  36.828 3.861   1.00 32.34  ? 41  TRP L CH2 1 
ATOM   2813 N N   . TYR C 3 62  ? 86.060  37.170 8.233   1.00 20.47  ? 42  TYR L N   1 
ATOM   2814 C CA  . TYR C 3 62  ? 86.894  37.981 9.128   1.00 23.44  ? 42  TYR L CA  1 
ATOM   2815 C C   . TYR C 3 62  ? 86.321  39.360 9.436   1.00 29.44  ? 42  TYR L C   1 
ATOM   2816 O O   . TYR C 3 62  ? 85.643  39.990 8.600   1.00 27.92  ? 42  TYR L O   1 
ATOM   2817 C CB  . TYR C 3 62  ? 88.285  38.166 8.551   1.00 19.96  ? 42  TYR L CB  1 
ATOM   2818 C CG  . TYR C 3 62  ? 89.026  36.894 8.225   1.00 21.90  ? 42  TYR L CG  1 
ATOM   2819 C CD1 . TYR C 3 62  ? 89.956  36.357 9.104   1.00 25.72  ? 42  TYR L CD1 1 
ATOM   2820 C CD2 . TYR C 3 62  ? 88.835  36.251 7.004   1.00 25.18  ? 42  TYR L CD2 1 
ATOM   2821 C CE1 . TYR C 3 62  ? 90.682  35.179 8.773   1.00 23.95  ? 42  TYR L CE1 1 
ATOM   2822 C CE2 . TYR C 3 62  ? 89.535  35.080 6.679   1.00 24.19  ? 42  TYR L CE2 1 
ATOM   2823 C CZ  . TYR C 3 62  ? 90.465  34.562 7.556   1.00 19.37  ? 42  TYR L CZ  1 
ATOM   2824 O OH  . TYR C 3 62  ? 91.128  33.409 7.221   1.00 24.67  ? 42  TYR L OH  1 
ATOM   2825 N N   . GLN C 3 63  ? 86.617  39.837 10.639  1.00 30.05  ? 43  GLN L N   1 
ATOM   2826 C CA  . GLN C 3 63  ? 86.134  41.134 11.081  1.00 25.77  ? 43  GLN L CA  1 
ATOM   2827 C C   . GLN C 3 63  ? 87.313  42.063 11.297  1.00 26.04  ? 43  GLN L C   1 
ATOM   2828 O O   . GLN C 3 63  ? 88.291  41.680 11.940  1.00 26.55  ? 43  GLN L O   1 
ATOM   2829 C CB  . GLN C 3 63  ? 85.326  40.989 12.369  1.00 26.71  ? 43  GLN L CB  1 
ATOM   2830 C CG  . GLN C 3 63  ? 84.803  42.285 12.947  1.00 24.16  ? 43  GLN L CG  1 
ATOM   2831 C CD  . GLN C 3 63  ? 84.348  42.135 14.398  1.00 28.67  ? 43  GLN L CD  1 
ATOM   2832 O OE1 . GLN C 3 63  ? 85.068  41.579 15.228  1.00 33.22  ? 43  GLN L OE1 1 
ATOM   2833 N NE2 . GLN C 3 63  ? 83.152  42.636 14.709  1.00 26.34  ? 43  GLN L NE2 1 
ATOM   2834 N N   . GLN C 3 64  ? 87.237  43.276 10.756  1.00 23.98  ? 44  GLN L N   1 
ATOM   2835 C CA  . GLN C 3 64  ? 88.309  44.234 10.980  1.00 22.72  ? 44  GLN L CA  1 
ATOM   2836 C C   . GLN C 3 64  ? 87.757  45.575 11.420  1.00 25.15  ? 44  GLN L C   1 
ATOM   2837 O O   . GLN C 3 64  ? 87.240  46.366 10.623  1.00 24.67  ? 44  GLN L O   1 
ATOM   2838 C CB  . GLN C 3 64  ? 89.183  44.393 9.741   1.00 24.99  ? 44  GLN L CB  1 
ATOM   2839 C CG  . GLN C 3 64  ? 90.327  45.368 9.900   1.00 26.20  ? 44  GLN L CG  1 
ATOM   2840 C CD  . GLN C 3 64  ? 91.185  45.465 8.654   1.00 27.79  ? 44  GLN L CD  1 
ATOM   2841 O OE1 . GLN C 3 64  ? 90.676  45.452 7.537   1.00 23.64  ? 44  GLN L OE1 1 
ATOM   2842 N NE2 . GLN C 3 64  ? 92.498  45.562 8.843   1.00 27.96  ? 44  GLN L NE2 1 
ATOM   2843 N N   . LYS C 3 65  ? 87.887  45.797 12.722  1.00 25.16  ? 45  LYS L N   1 
ATOM   2844 C CA  . LYS C 3 65  ? 87.524  47.035 13.372  1.00 26.52  ? 45  LYS L CA  1 
ATOM   2845 C C   . LYS C 3 65  ? 88.526  48.085 12.967  1.00 25.93  ? 45  LYS L C   1 
ATOM   2846 O O   . LYS C 3 65  ? 89.686  47.766 12.692  1.00 29.20  ? 45  LYS L O   1 
ATOM   2847 C CB  . LYS C 3 65  ? 87.466  46.852 14.897  1.00 25.85  ? 45  LYS L CB  1 
ATOM   2848 C CG  . LYS C 3 65  ? 86.272  45.997 15.310  1.00 25.14  ? 45  LYS L CG  1 
ATOM   2849 C CD  . LYS C 3 65  ? 86.120  45.831 16.806  1.00 26.05  ? 45  LYS L CD  1 
ATOM   2850 C CE  . LYS C 3 65  ? 85.054  44.774 17.098  1.00 31.01  ? 45  LYS L CE  1 
ATOM   2851 N NZ  . LYS C 3 65  ? 84.769  44.608 18.543  1.00 41.68  ? 45  LYS L NZ  1 
ATOM   2852 N N   . PRO C 3 66  ? 88.063  49.331 12.854  1.00 27.30  ? 46  PRO L N   1 
ATOM   2853 C CA  . PRO C 3 66  ? 88.904  50.420 12.347  1.00 30.88  ? 46  PRO L CA  1 
ATOM   2854 C C   . PRO C 3 66  ? 90.216  50.513 13.126  1.00 31.52  ? 46  PRO L C   1 
ATOM   2855 O O   . PRO C 3 66  ? 90.217  50.431 14.357  1.00 33.37  ? 46  PRO L O   1 
ATOM   2856 C CB  . PRO C 3 66  ? 88.036  51.665 12.549  1.00 25.60  ? 46  PRO L CB  1 
ATOM   2857 C CG  . PRO C 3 66  ? 86.842  51.213 13.341  1.00 30.09  ? 46  PRO L CG  1 
ATOM   2858 C CD  . PRO C 3 66  ? 86.684  49.768 13.129  1.00 28.10  ? 46  PRO L CD  1 
ATOM   2859 N N   . GLY C 3 67  ? 91.324  50.625 12.408  1.00 32.88  ? 47  GLY L N   1 
ATOM   2860 C CA  . GLY C 3 67  ? 92.626  50.739 13.042  1.00 26.80  ? 47  GLY L CA  1 
ATOM   2861 C C   . GLY C 3 67  ? 93.127  49.460 13.683  1.00 32.27  ? 47  GLY L C   1 
ATOM   2862 O O   . GLY C 3 67  ? 94.174  49.461 14.316  1.00 37.46  ? 47  GLY L O   1 
ATOM   2863 N N   . GLN C 3 68  ? 92.376  48.370 13.548  1.00 33.36  ? 48  GLN L N   1 
ATOM   2864 C CA  . GLN C 3 68  ? 92.788  47.101 14.130  1.00 28.01  ? 48  GLN L CA  1 
ATOM   2865 C C   . GLN C 3 68  ? 93.095  46.111 13.023  1.00 27.20  ? 48  GLN L C   1 
ATOM   2866 O O   . GLN C 3 68  ? 92.794  46.351 11.868  1.00 27.58  ? 48  GLN L O   1 
ATOM   2867 C CB  . GLN C 3 68  ? 91.709  46.545 15.053  1.00 24.36  ? 48  GLN L CB  1 
ATOM   2868 C CG  . GLN C 3 68  ? 91.443  47.419 16.231  1.00 28.31  ? 48  GLN L CG  1 
ATOM   2869 C CD  . GLN C 3 68  ? 90.513  46.791 17.259  1.00 27.19  ? 48  GLN L CD  1 
ATOM   2870 O OE1 . GLN C 3 68  ? 90.551  45.595 17.491  1.00 35.46  ? 48  GLN L OE1 1 
ATOM   2871 N NE2 . GLN C 3 68  ? 89.674  47.613 17.885  1.00 32.78  ? 48  GLN L NE2 1 
ATOM   2872 N N   . SER C 3 69  ? 93.686  44.986 13.384  1.00 28.78  ? 49  SER L N   1 
ATOM   2873 C CA  . SER C 3 69  ? 94.004  43.965 12.403  1.00 27.01  ? 49  SER L CA  1 
ATOM   2874 C C   . SER C 3 69  ? 92.802  43.030 12.233  1.00 29.52  ? 49  SER L C   1 
ATOM   2875 O O   . SER C 3 69  ? 91.974  42.935 13.127  1.00 31.84  ? 49  SER L O   1 
ATOM   2876 C CB  . SER C 3 69  ? 95.263  43.207 12.835  1.00 27.80  ? 49  SER L CB  1 
ATOM   2877 O OG  . SER C 3 69  ? 95.042  42.435 13.986  1.00 37.27  ? 49  SER L OG  1 
ATOM   2878 N N   . PRO C 3 70  ? 92.695  42.344 11.085  1.00 26.94  ? 50  PRO L N   1 
ATOM   2879 C CA  . PRO C 3 70  ? 91.560  41.434 10.916  1.00 26.52  ? 50  PRO L CA  1 
ATOM   2880 C C   . PRO C 3 70  ? 91.550  40.366 12.000  1.00 28.23  ? 50  PRO L C   1 
ATOM   2881 O O   . PRO C 3 70  ? 92.603  40.037 12.526  1.00 26.74  ? 50  PRO L O   1 
ATOM   2882 C CB  . PRO C 3 70  ? 91.793  40.811 9.534   1.00 22.89  ? 50  PRO L CB  1 
ATOM   2883 C CG  . PRO C 3 70  ? 92.741  41.720 8.847   1.00 25.38  ? 50  PRO L CG  1 
ATOM   2884 C CD  . PRO C 3 70  ? 93.617  42.283 9.940   1.00 27.88  ? 50  PRO L CD  1 
ATOM   2885 N N   . LYS C 3 71  ? 90.360  39.873 12.335  1.00 27.09  ? 51  LYS L N   1 
ATOM   2886 C CA  . LYS C 3 71  ? 90.181  38.807 13.308  1.00 24.60  ? 51  LYS L CA  1 
ATOM   2887 C C   . LYS C 3 71  ? 89.180  37.750 12.775  1.00 30.05  ? 51  LYS L C   1 
ATOM   2888 O O   . LYS C 3 71  ? 88.145  38.085 12.187  1.00 34.03  ? 51  LYS L O   1 
ATOM   2889 C CB  . LYS C 3 71  ? 89.714  39.395 14.638  1.00 33.00  ? 51  LYS L CB  1 
ATOM   2890 C CG  . LYS C 3 71  ? 88.581  38.633 15.347  1.00 40.58  ? 51  LYS L CG  1 
ATOM   2891 C CD  . LYS C 3 71  ? 88.222  39.306 16.682  1.00 41.38  ? 51  LYS L CD  1 
ATOM   2892 C CE  . LYS C 3 71  ? 87.249  38.489 17.501  1.00 49.78  ? 51  LYS L CE  1 
ATOM   2893 N NZ  . LYS C 3 71  ? 86.665  39.305 18.615  1.00 61.05  ? 51  LYS L NZ  1 
ATOM   2894 N N   . LEU C 3 72  ? 89.502  36.482 12.974  1.00 23.56  ? 52  LEU L N   1 
ATOM   2895 C CA  . LEU C 3 72  ? 88.707  35.379 12.455  1.00 26.61  ? 52  LEU L CA  1 
ATOM   2896 C C   . LEU C 3 72  ? 87.389  35.161 13.201  1.00 29.00  ? 52  LEU L C   1 
ATOM   2897 O O   . LEU C 3 72  ? 87.372  34.970 14.407  1.00 27.08  ? 52  LEU L O   1 
ATOM   2898 C CB  . LEU C 3 72  ? 89.528  34.092 12.508  1.00 25.09  ? 52  LEU L CB  1 
ATOM   2899 C CG  . LEU C 3 72  ? 88.806  32.834 12.029  1.00 34.24  ? 52  LEU L CG  1 
ATOM   2900 C CD1 . LEU C 3 72  ? 88.468  32.939 10.542  1.00 30.07  ? 52  LEU L CD1 1 
ATOM   2901 C CD2 . LEU C 3 72  ? 89.644  31.561 12.313  1.00 31.08  ? 52  LEU L CD2 1 
ATOM   2902 N N   . LEU C 3 73  ? 86.281  35.174 12.474  1.00 29.34  ? 53  LEU L N   1 
ATOM   2903 C CA  . LEU C 3 73  ? 84.976  34.952 13.093  1.00 32.00  ? 53  LEU L CA  1 
ATOM   2904 C C   . LEU C 3 73  ? 84.520  33.513 12.917  1.00 34.77  ? 53  LEU L C   1 
ATOM   2905 O O   . LEU C 3 73  ? 84.252  32.794 13.890  1.00 34.20  ? 53  LEU L O   1 
ATOM   2906 C CB  . LEU C 3 73  ? 83.935  35.894 12.496  1.00 28.27  ? 53  LEU L CB  1 
ATOM   2907 C CG  . LEU C 3 73  ? 84.167  37.376 12.764  1.00 28.67  ? 53  LEU L CG  1 
ATOM   2908 C CD1 . LEU C 3 73  ? 83.191  38.201 11.950  1.00 27.57  ? 53  LEU L CD1 1 
ATOM   2909 C CD2 . LEU C 3 73  ? 84.056  37.694 14.254  1.00 28.35  ? 53  LEU L CD2 1 
ATOM   2910 N N   . VAL C 3 74  ? 84.457  33.115 11.650  1.00 34.16  ? 54  VAL L N   1 
ATOM   2911 C CA  . VAL C 3 74  ? 83.941  31.830 11.236  1.00 32.68  ? 54  VAL L CA  1 
ATOM   2912 C C   . VAL C 3 74  ? 84.918  31.196 10.259  1.00 33.51  ? 54  VAL L C   1 
ATOM   2913 O O   . VAL C 3 74  ? 85.515  31.898 9.434   1.00 33.03  ? 54  VAL L O   1 
ATOM   2914 C CB  . VAL C 3 74  ? 82.570  31.973 10.553  1.00 31.90  ? 54  VAL L CB  1 
ATOM   2915 C CG1 . VAL C 3 74  ? 82.001  30.602 10.179  1.00 34.72  ? 54  VAL L CG1 1 
ATOM   2916 C CG2 . VAL C 3 74  ? 81.613  32.756 11.434  1.00 29.42  ? 54  VAL L CG2 1 
ATOM   2917 N N   . TYR C 3 75  ? 85.065  29.877 10.360  1.00 32.24  ? 55  TYR L N   1 
ATOM   2918 C CA  . TYR C 3 75  ? 85.773  29.076 9.368   1.00 32.60  ? 55  TYR L CA  1 
ATOM   2919 C C   . TYR C 3 75  ? 84.950  27.817 9.013   1.00 38.22  ? 55  TYR L C   1 
ATOM   2920 O O   . TYR C 3 75  ? 84.030  27.448 9.751   1.00 38.00  ? 55  TYR L O   1 
ATOM   2921 C CB  . TYR C 3 75  ? 87.149  28.705 9.899   1.00 30.95  ? 55  TYR L CB  1 
ATOM   2922 C CG  . TYR C 3 75  ? 87.128  27.886 11.173  1.00 38.74  ? 55  TYR L CG  1 
ATOM   2923 C CD1 . TYR C 3 75  ? 86.942  26.505 11.129  1.00 41.58  ? 55  TYR L CD1 1 
ATOM   2924 C CD2 . TYR C 3 75  ? 87.304  28.483 12.423  1.00 36.73  ? 55  TYR L CD2 1 
ATOM   2925 C CE1 . TYR C 3 75  ? 86.925  25.735 12.293  1.00 44.35  ? 55  TYR L CE1 1 
ATOM   2926 C CE2 . TYR C 3 75  ? 87.292  27.716 13.594  1.00 39.45  ? 55  TYR L CE2 1 
ATOM   2927 C CZ  . TYR C 3 75  ? 87.103  26.344 13.516  1.00 42.09  ? 55  TYR L CZ  1 
ATOM   2928 O OH  . TYR C 3 75  ? 87.084  25.568 14.651  1.00 49.09  ? 55  TYR L OH  1 
ATOM   2929 N N   . PHE C 3 76  ? 85.274  27.167 7.896   1.00 33.49  ? 56  PHE L N   1 
ATOM   2930 C CA  . PHE C 3 76  ? 84.510  26.006 7.421   1.00 39.05  ? 56  PHE L CA  1 
ATOM   2931 C C   . PHE C 3 76  ? 83.037  26.372 7.222   1.00 37.92  ? 56  PHE L C   1 
ATOM   2932 O O   . PHE C 3 76  ? 82.145  25.550 7.450   1.00 38.93  ? 56  PHE L O   1 
ATOM   2933 C CB  . PHE C 3 76  ? 84.636  24.805 8.381   1.00 43.05  ? 56  PHE L CB  1 
ATOM   2934 C CG  . PHE C 3 76  ? 85.963  24.079 8.294   1.00 40.97  ? 56  PHE L CG  1 
ATOM   2935 C CD1 . PHE C 3 76  ? 86.637  23.964 7.080   1.00 40.28  ? 56  PHE L CD1 1 
ATOM   2936 C CD2 . PHE C 3 76  ? 86.535  23.511 9.428   1.00 40.63  ? 56  PHE L CD2 1 
ATOM   2937 C CE1 . PHE C 3 76  ? 87.851  23.295 6.994   1.00 35.27  ? 56  PHE L CE1 1 
ATOM   2938 C CE2 . PHE C 3 76  ? 87.749  22.849 9.355   1.00 33.73  ? 56  PHE L CE2 1 
ATOM   2939 C CZ  . PHE C 3 76  ? 88.411  22.746 8.136   1.00 36.66  ? 56  PHE L CZ  1 
ATOM   2940 N N   . ALA C 3 77  ? 82.828  27.627 6.811   1.00 34.19  ? 57  ALA L N   1 
ATOM   2941 C CA  . ALA C 3 77  ? 81.536  28.240 6.493   1.00 33.34  ? 57  ALA L CA  1 
ATOM   2942 C C   . ALA C 3 77  ? 80.609  28.476 7.692   1.00 33.12  ? 57  ALA L C   1 
ATOM   2943 O O   . ALA C 3 77  ? 79.831  29.426 7.687   1.00 28.34  ? 57  ALA L O   1 
ATOM   2944 C CB  . ALA C 3 77  ? 80.809  27.424 5.434   1.00 34.96  ? 57  ALA L CB  1 
ATOM   2945 N N   . SER C 3 78  ? 80.711  27.653 8.722   1.00 31.69  ? 58  SER L N   1 
ATOM   2946 C CA  . SER C 3 78  ? 79.737  27.697 9.796   1.00 33.31  ? 58  SER L CA  1 
ATOM   2947 C C   . SER C 3 78  ? 80.344  27.464 11.175  1.00 37.26  ? 58  SER L C   1 
ATOM   2948 O O   . SER C 3 78  ? 79.698  27.704 12.187  1.00 38.57  ? 58  SER L O   1 
ATOM   2949 C CB  . SER C 3 78  ? 78.649  26.646 9.553   1.00 40.08  ? 58  SER L CB  1 
ATOM   2950 O OG  . SER C 3 78  ? 79.172  25.329 9.760   1.00 35.46  ? 58  SER L OG  1 
ATOM   2951 N N   . THR C 3 79  ? 81.564  26.955 11.243  1.00 35.96  ? 59  THR L N   1 
ATOM   2952 C CA  . THR C 3 79  ? 82.125  26.740 12.564  1.00 38.51  ? 59  THR L CA  1 
ATOM   2953 C C   . THR C 3 79  ? 82.631  28.072 13.096  1.00 41.93  ? 59  THR L C   1 
ATOM   2954 O O   . THR C 3 79  ? 83.439  28.756 12.455  1.00 41.11  ? 59  THR L O   1 
ATOM   2955 C CB  . THR C 3 79  ? 83.245  25.708 12.560  1.00 38.33  ? 59  THR L CB  1 
ATOM   2956 O OG1 . THR C 3 79  ? 82.747  24.471 12.040  1.00 45.35  ? 59  THR L OG1 1 
ATOM   2957 C CG2 . THR C 3 79  ? 83.751  25.495 13.974  1.00 39.46  ? 59  THR L CG2 1 
ATOM   2958 N N   . ARG C 3 80  ? 82.127  28.445 14.259  1.00 40.78  ? 60  ARG L N   1 
ATOM   2959 C CA  . ARG C 3 80  ? 82.419  29.741 14.831  1.00 36.54  ? 60  ARG L CA  1 
ATOM   2960 C C   . ARG C 3 80  ? 83.711  29.646 15.604  1.00 40.49  ? 60  ARG L C   1 
ATOM   2961 O O   . ARG C 3 80  ? 83.917  28.671 16.329  1.00 45.53  ? 60  ARG L O   1 
ATOM   2962 C CB  . ARG C 3 80  ? 81.263  30.183 15.719  1.00 38.12  ? 60  ARG L CB  1 
ATOM   2963 C CG  . ARG C 3 80  ? 81.615  31.194 16.784  1.00 45.16  ? 60  ARG L CG  1 
ATOM   2964 C CD  . ARG C 3 80  ? 80.424  31.443 17.742  1.00 48.35  ? 60  ARG L CD  1 
ATOM   2965 N NE  . ARG C 3 80  ? 79.141  31.608 17.052  1.00 49.58  ? 60  ARG L NE  1 
ATOM   2966 C CZ  . ARG C 3 80  ? 78.157  30.709 17.087  1.00 55.01  ? 60  ARG L CZ  1 
ATOM   2967 N NH1 . ARG C 3 80  ? 78.307  29.584 17.778  1.00 60.06  ? 60  ARG L NH1 1 
ATOM   2968 N NH2 . ARG C 3 80  ? 77.022  30.929 16.439  1.00 49.63  ? 60  ARG L NH2 1 
ATOM   2969 N N   . GLU C 3 81  ? 84.592  30.630 15.435  1.00 36.41  ? 61  GLU L N   1 
ATOM   2970 C CA  . GLU C 3 81  ? 85.869  30.638 16.152  1.00 36.27  ? 61  GLU L CA  1 
ATOM   2971 C C   . GLU C 3 81  ? 85.667  30.774 17.656  1.00 39.24  ? 61  GLU L C   1 
ATOM   2972 O O   . GLU C 3 81  ? 84.772  31.490 18.130  1.00 38.10  ? 61  GLU L O   1 
ATOM   2973 C CB  . GLU C 3 81  ? 86.776  31.772 15.644  1.00 34.48  ? 61  GLU L CB  1 
ATOM   2974 C CG  . GLU C 3 81  ? 88.022  32.060 16.503  1.00 34.46  ? 61  GLU L CG  1 
ATOM   2975 C CD  . GLU C 3 81  ? 89.191  31.064 16.272  1.00 44.11  ? 61  GLU L CD  1 
ATOM   2976 O OE1 . GLU C 3 81  ? 88.955  29.949 15.744  1.00 47.41  ? 61  GLU L OE1 1 
ATOM   2977 O OE2 . GLU C 3 81  ? 90.352  31.389 16.630  1.00 44.13  ? 61  GLU L OE2 1 
ATOM   2978 N N   . SER C 3 82  ? 86.501  30.065 18.405  1.00 44.14  ? 62  SER L N   1 
ATOM   2979 C CA  . SER C 3 82  ? 86.541  30.195 19.855  1.00 45.39  ? 62  SER L CA  1 
ATOM   2980 C C   . SER C 3 82  ? 86.669  31.652 20.313  1.00 44.89  ? 62  SER L C   1 
ATOM   2981 O O   . SER C 3 82  ? 87.575  32.370 19.880  1.00 50.41  ? 62  SER L O   1 
ATOM   2982 C CB  . SER C 3 82  ? 87.704  29.377 20.410  1.00 46.13  ? 62  SER L CB  1 
ATOM   2983 O OG  . SER C 3 82  ? 88.003  29.763 21.740  1.00 57.57  ? 62  SER L OG  1 
ATOM   2984 N N   . GLY C 3 83  ? 85.758  32.076 21.187  1.00 48.40  ? 63  GLY L N   1 
ATOM   2985 C CA  . GLY C 3 83  ? 85.823  33.394 21.807  1.00 49.35  ? 63  GLY L CA  1 
ATOM   2986 C C   . GLY C 3 83  ? 85.015  34.447 21.068  1.00 48.26  ? 63  GLY L C   1 
ATOM   2987 O O   . GLY C 3 83  ? 85.075  35.637 21.378  1.00 52.93  ? 63  GLY L O   1 
ATOM   2988 N N   . VAL C 3 84  ? 84.272  33.992 20.070  1.00 44.63  ? 64  VAL L N   1 
ATOM   2989 C CA  . VAL C 3 84  ? 83.453  34.856 19.238  1.00 42.75  ? 64  VAL L CA  1 
ATOM   2990 C C   . VAL C 3 84  ? 81.995  34.718 19.668  1.00 47.39  ? 64  VAL L C   1 
ATOM   2991 O O   . VAL C 3 84  ? 81.491  33.599 19.759  1.00 48.18  ? 64  VAL L O   1 
ATOM   2992 C CB  . VAL C 3 84  ? 83.592  34.492 17.728  1.00 40.10  ? 64  VAL L CB  1 
ATOM   2993 C CG1 . VAL C 3 84  ? 82.628  35.306 16.882  1.00 39.84  ? 64  VAL L CG1 1 
ATOM   2994 C CG2 . VAL C 3 84  ? 85.040  34.670 17.233  1.00 36.19  ? 64  VAL L CG2 1 
ATOM   2995 N N   . PRO C 3 85  ? 81.319  35.853 19.939  1.00 47.07  ? 65  PRO L N   1 
ATOM   2996 C CA  . PRO C 3 85  ? 79.903  35.907 20.324  1.00 43.13  ? 65  PRO L CA  1 
ATOM   2997 C C   . PRO C 3 85  ? 79.015  35.034 19.464  1.00 48.09  ? 65  PRO L C   1 
ATOM   2998 O O   . PRO C 3 85  ? 79.280  34.839 18.273  1.00 47.35  ? 65  PRO L O   1 
ATOM   2999 C CB  . PRO C 3 85  ? 79.546  37.375 20.130  1.00 42.41  ? 65  PRO L CB  1 
ATOM   3000 C CG  . PRO C 3 85  ? 80.821  38.084 20.428  1.00 43.34  ? 65  PRO L CG  1 
ATOM   3001 C CD  . PRO C 3 85  ? 81.928  37.194 19.929  1.00 44.90  ? 65  PRO L CD  1 
ATOM   3002 N N   . ASP C 3 86  ? 77.958  34.522 20.084  1.00 47.84  ? 66  ASP L N   1 
ATOM   3003 C CA  . ASP C 3 86  ? 77.030  33.618 19.432  1.00 47.21  ? 66  ASP L CA  1 
ATOM   3004 C C   . ASP C 3 86  ? 76.144  34.321 18.439  1.00 42.35  ? 66  ASP L C   1 
ATOM   3005 O O   . ASP C 3 86  ? 75.455  33.675 17.642  1.00 42.50  ? 66  ASP L O   1 
ATOM   3006 C CB  . ASP C 3 86  ? 76.190  32.912 20.484  1.00 50.90  ? 66  ASP L CB  1 
ATOM   3007 C CG  . ASP C 3 86  ? 77.039  32.062 21.400  1.00 57.81  ? 66  ASP L CG  1 
ATOM   3008 O OD1 . ASP C 3 86  ? 77.953  31.390 20.881  1.00 59.53  ? 66  ASP L OD1 1 
ATOM   3009 O OD2 . ASP C 3 86  ? 76.823  32.087 22.631  1.00 71.86  ? 66  ASP L OD2 1 
ATOM   3010 N N   . ARG C 3 87  ? 76.163  35.651 18.474  1.00 44.77  ? 67  ARG L N   1 
ATOM   3011 C CA  . ARG C 3 87  ? 75.314  36.433 17.572  1.00 40.18  ? 67  ARG L CA  1 
ATOM   3012 C C   . ARG C 3 87  ? 75.867  36.379 16.157  1.00 42.18  ? 67  ARG L C   1 
ATOM   3013 O O   . ARG C 3 87  ? 75.182  36.743 15.198  1.00 42.59  ? 67  ARG L O   1 
ATOM   3014 C CB  . ARG C 3 87  ? 75.185  37.886 18.044  1.00 39.02  ? 67  ARG L CB  1 
ATOM   3015 C CG  . ARG C 3 87  ? 76.488  38.699 18.141  1.00 39.21  ? 67  ARG L CG  1 
ATOM   3016 C CD  . ARG C 3 87  ? 76.170  40.104 18.672  1.00 41.10  ? 67  ARG L CD  1 
ATOM   3017 N NE  . ARG C 3 87  ? 77.334  40.977 18.761  1.00 34.93  ? 67  ARG L NE  1 
ATOM   3018 C CZ  . ARG C 3 87  ? 78.201  40.973 19.774  1.00 44.96  ? 67  ARG L CZ  1 
ATOM   3019 N NH1 . ARG C 3 87  ? 78.036  40.141 20.806  1.00 40.98  ? 67  ARG L NH1 1 
ATOM   3020 N NH2 . ARG C 3 87  ? 79.247  41.797 19.757  1.00 39.91  ? 67  ARG L NH2 1 
ATOM   3021 N N   . PHE C 3 88  ? 77.112  35.920 16.035  1.00 43.51  ? 68  PHE L N   1 
ATOM   3022 C CA  . PHE C 3 88  ? 77.755  35.820 14.735  1.00 42.85  ? 68  PHE L CA  1 
ATOM   3023 C C   . PHE C 3 88  ? 77.522  34.456 14.164  1.00 41.65  ? 68  PHE L C   1 
ATOM   3024 O O   . PHE C 3 88  ? 77.877  33.447 14.780  1.00 42.65  ? 68  PHE L O   1 
ATOM   3025 C CB  . PHE C 3 88  ? 79.250  36.100 14.839  1.00 45.23  ? 68  PHE L CB  1 
ATOM   3026 C CG  . PHE C 3 88  ? 79.563  37.534 15.084  1.00 42.63  ? 68  PHE L CG  1 
ATOM   3027 C CD1 . PHE C 3 88  ? 79.531  38.446 14.041  1.00 36.98  ? 68  PHE L CD1 1 
ATOM   3028 C CD2 . PHE C 3 88  ? 79.865  37.977 16.352  1.00 40.71  ? 68  PHE L CD2 1 
ATOM   3029 C CE1 . PHE C 3 88  ? 79.808  39.774 14.262  1.00 32.87  ? 68  PHE L CE1 1 
ATOM   3030 C CE2 . PHE C 3 88  ? 80.139  39.315 16.574  1.00 41.01  ? 68  PHE L CE2 1 
ATOM   3031 C CZ  . PHE C 3 88  ? 80.108  40.210 15.524  1.00 32.94  ? 68  PHE L CZ  1 
ATOM   3032 N N   . ILE C 3 89  ? 76.929  34.418 12.980  1.00 36.91  ? 69  ILE L N   1 
ATOM   3033 C CA  . ILE C 3 89  ? 76.479  33.146 12.438  1.00 39.48  ? 69  ILE L CA  1 
ATOM   3034 C C   . ILE C 3 89  ? 76.724  33.046 10.935  1.00 35.44  ? 69  ILE L C   1 
ATOM   3035 O O   . ILE C 3 89  ? 76.177  33.816 10.145  1.00 35.12  ? 69  ILE L O   1 
ATOM   3036 C CB  . ILE C 3 89  ? 74.987  32.936 12.767  1.00 40.52  ? 69  ILE L CB  1 
ATOM   3037 C CG1 . ILE C 3 89  ? 74.851  32.517 14.232  1.00 45.20  ? 69  ILE L CG1 1 
ATOM   3038 C CG2 . ILE C 3 89  ? 74.381  31.875 11.888  1.00 45.20  ? 69  ILE L CG2 1 
ATOM   3039 C CD1 . ILE C 3 89  ? 73.646  33.085 14.903  1.00 51.63  ? 69  ILE L CD1 1 
ATOM   3040 N N   . GLY C 3 90  ? 77.573  32.103 10.549  1.00 32.25  ? 70  GLY L N   1 
ATOM   3041 C CA  . GLY C 3 90  ? 77.896  31.923 9.147   1.00 33.16  ? 70  GLY L CA  1 
ATOM   3042 C C   . GLY C 3 90  ? 77.165  30.724 8.575   1.00 38.99  ? 70  GLY L C   1 
ATOM   3043 O O   . GLY C 3 90  ? 77.021  29.688 9.233   1.00 39.12  ? 70  GLY L O   1 
ATOM   3044 N N   . SER C 3 91  ? 76.708  30.841 7.341   1.00 34.84  ? 71  SER L N   1 
ATOM   3045 C CA  . SER C 3 91  ? 75.959  29.739 6.768   1.00 38.50  ? 71  SER L CA  1 
ATOM   3046 C C   . SER C 3 91  ? 76.079  29.664 5.253   1.00 40.39  ? 71  SER L C   1 
ATOM   3047 O O   . SER C 3 91  ? 76.703  30.514 4.604   1.00 35.72  ? 71  SER L O   1 
ATOM   3048 C CB  . SER C 3 91  ? 74.493  29.864 7.153   1.00 40.10  ? 71  SER L CB  1 
ATOM   3049 O OG  . SER C 3 91  ? 73.960  31.031 6.550   1.00 39.62  ? 71  SER L OG  1 
ATOM   3050 N N   . GLY C 3 92  ? 75.450  28.636 4.696   1.00 42.11  ? 72  GLY L N   1 
ATOM   3051 C CA  . GLY C 3 92  ? 75.433  28.447 3.262   1.00 41.12  ? 72  GLY L CA  1 
ATOM   3052 C C   . GLY C 3 92  ? 76.387  27.349 2.880   1.00 39.31  ? 72  GLY L C   1 
ATOM   3053 O O   . GLY C 3 92  ? 77.026  26.728 3.746   1.00 40.19  ? 72  GLY L O   1 
ATOM   3054 N N   . SER C 3 93  ? 76.490  27.104 1.582   1.00 36.58  ? 73  SER L N   1 
ATOM   3055 C CA  . SER C 3 93  ? 77.337  26.024 1.101   1.00 46.73  ? 73  SER L CA  1 
ATOM   3056 C C   . SER C 3 93  ? 77.434  26.119 -0.405  1.00 41.43  ? 73  SER L C   1 
ATOM   3057 O O   . SER C 3 93  ? 76.820  26.987 -1.016  1.00 43.52  ? 73  SER L O   1 
ATOM   3058 C CB  . SER C 3 93  ? 76.796  24.648 1.529   1.00 45.30  ? 73  SER L CB  1 
ATOM   3059 O OG  . SER C 3 93  ? 75.811  24.205 0.622   1.00 48.86  ? 73  SER L OG  1 
ATOM   3060 N N   . GLY C 3 94  ? 78.240  25.247 -0.996  1.00 42.39  ? 74  GLY L N   1 
ATOM   3061 C CA  . GLY C 3 94  ? 78.465  25.308 -2.426  1.00 44.56  ? 74  GLY L CA  1 
ATOM   3062 C C   . GLY C 3 94  ? 79.207  26.563 -2.850  1.00 47.96  ? 74  GLY L C   1 
ATOM   3063 O O   . GLY C 3 94  ? 80.438  26.630 -2.724  1.00 52.03  ? 74  GLY L O   1 
ATOM   3064 N N   . THR C 3 95  ? 78.471  27.553 -3.358  1.00 39.93  ? 75  THR L N   1 
ATOM   3065 C CA  . THR C 3 95  ? 79.085  28.779 -3.866  1.00 41.04  ? 75  THR L CA  1 
ATOM   3066 C C   . THR C 3 95  ? 78.429  30.011 -3.276  1.00 43.48  ? 75  THR L C   1 
ATOM   3067 O O   . THR C 3 95  ? 78.787  31.148 -3.625  1.00 39.72  ? 75  THR L O   1 
ATOM   3068 C CB  . THR C 3 95  ? 78.990  28.880 -5.386  1.00 42.96  ? 75  THR L CB  1 
ATOM   3069 O OG1 . THR C 3 95  ? 77.606  28.905 -5.779  1.00 45.74  ? 75  THR L OG1 1 
ATOM   3070 C CG2 . THR C 3 95  ? 79.706  27.704 -6.038  1.00 41.29  ? 75  THR L CG2 1 
ATOM   3071 N N   . ASP C 3 96  ? 77.452  29.776 -2.401  1.00 42.16  ? 76  ASP L N   1 
ATOM   3072 C CA  . ASP C 3 96  ? 76.710  30.865 -1.794  1.00 39.38  ? 76  ASP L CA  1 
ATOM   3073 C C   . ASP C 3 96  ? 76.824  30.806 -0.291  1.00 37.27  ? 76  ASP L C   1 
ATOM   3074 O O   . ASP C 3 96  ? 76.548  29.778 0.334   1.00 36.86  ? 76  ASP L O   1 
ATOM   3075 C CB  . ASP C 3 96  ? 75.251  30.825 -2.226  1.00 39.34  ? 76  ASP L CB  1 
ATOM   3076 C CG  . ASP C 3 96  ? 75.085  31.089 -3.701  1.00 44.65  ? 76  ASP L CG  1 
ATOM   3077 O OD1 . ASP C 3 96  ? 75.869  31.872 -4.267  1.00 45.13  ? 76  ASP L OD1 1 
ATOM   3078 O OD2 . ASP C 3 96  ? 74.179  30.496 -4.308  1.00 63.51  ? 76  ASP L OD2 1 
ATOM   3079 N N   . PHE C 3 97  ? 77.263  31.920 0.281   1.00 34.12  ? 77  PHE L N   1 
ATOM   3080 C CA  . PHE C 3 97  ? 77.525  31.982 1.706   1.00 31.54  ? 77  PHE L CA  1 
ATOM   3081 C C   . PHE C 3 97  ? 76.997  33.267 2.310   1.00 30.25  ? 77  PHE L C   1 
ATOM   3082 O O   . PHE C 3 97  ? 76.900  34.309 1.661   1.00 31.10  ? 77  PHE L O   1 
ATOM   3083 C CB  . PHE C 3 97  ? 79.026  31.826 1.953   1.00 33.90  ? 77  PHE L CB  1 
ATOM   3084 C CG  . PHE C 3 97  ? 79.567  30.527 1.445   1.00 30.88  ? 77  PHE L CG  1 
ATOM   3085 C CD1 . PHE C 3 97  ? 80.062  30.421 0.152   1.00 37.57  ? 77  PHE L CD1 1 
ATOM   3086 C CD2 . PHE C 3 97  ? 79.525  29.392 2.233   1.00 32.97  ? 77  PHE L CD2 1 
ATOM   3087 C CE1 . PHE C 3 97  ? 80.537  29.196 -0.332  1.00 39.29  ? 77  PHE L CE1 1 
ATOM   3088 C CE2 . PHE C 3 97  ? 80.008  28.169 1.754   1.00 38.03  ? 77  PHE L CE2 1 
ATOM   3089 C CZ  . PHE C 3 97  ? 80.510  28.077 0.472   1.00 33.70  ? 77  PHE L CZ  1 
ATOM   3090 N N   . THR C 3 98  ? 76.618  33.194 3.566   1.00 31.87  ? 78  THR L N   1 
ATOM   3091 C CA  . THR C 3 98  ? 76.157  34.395 4.226   1.00 36.22  ? 78  THR L CA  1 
ATOM   3092 C C   . THR C 3 98  ? 76.736  34.449 5.603   1.00 29.96  ? 78  THR L C   1 
ATOM   3093 O O   . THR C 3 98  ? 76.900  33.426 6.263   1.00 30.96  ? 78  THR L O   1 
ATOM   3094 C CB  . THR C 3 98  ? 74.606  34.467 4.351   1.00 32.77  ? 78  THR L CB  1 
ATOM   3095 O OG1 . THR C 3 98  ? 74.152  33.324 5.061   1.00 37.42  ? 78  THR L OG1 1 
ATOM   3096 C CG2 . THR C 3 98  ? 73.944  34.512 2.997   1.00 33.29  ? 78  THR L CG2 1 
ATOM   3097 N N   . LEU C 3 99  ? 77.029  35.659 6.040   1.00 30.49  ? 79  LEU L N   1 
ATOM   3098 C CA  . LEU C 3 99  ? 77.305  35.883 7.442   1.00 32.82  ? 79  LEU L CA  1 
ATOM   3099 C C   . LEU C 3 99  ? 76.165  36.713 8.044   1.00 33.43  ? 79  LEU L C   1 
ATOM   3100 O O   . LEU C 3 99  ? 75.747  37.748 7.486   1.00 32.54  ? 79  LEU L O   1 
ATOM   3101 C CB  . LEU C 3 99  ? 78.653  36.578 7.632   1.00 26.12  ? 79  LEU L CB  1 
ATOM   3102 C CG  . LEU C 3 99  ? 78.890  37.006 9.071   1.00 25.47  ? 79  LEU L CG  1 
ATOM   3103 C CD1 . LEU C 3 99  ? 78.961  35.787 9.947   1.00 26.73  ? 79  LEU L CD1 1 
ATOM   3104 C CD2 . LEU C 3 99  ? 80.160  37.857 9.176   1.00 26.93  ? 79  LEU L CD2 1 
ATOM   3105 N N   . THR C 3 100 ? 75.653  36.264 9.180   1.00 31.38  ? 80  THR L N   1 
ATOM   3106 C CA  . THR C 3 100 ? 74.617  37.034 9.837   1.00 37.27  ? 80  THR L CA  1 
ATOM   3107 C C   . THR C 3 100 ? 74.981  37.349 11.289  1.00 37.74  ? 80  THR L C   1 
ATOM   3108 O O   . THR C 3 100 ? 75.557  36.520 12.007  1.00 36.15  ? 80  THR L O   1 
ATOM   3109 C CB  . THR C 3 100 ? 73.220  36.326 9.759   1.00 36.33  ? 80  THR L CB  1 
ATOM   3110 O OG1 . THR C 3 100 ? 72.469  36.624 10.941  1.00 47.29  ? 80  THR L OG1 1 
ATOM   3111 C CG2 . THR C 3 100 ? 73.351  34.833 9.630   1.00 33.99  ? 80  THR L CG2 1 
ATOM   3112 N N   . ILE C 3 101 ? 74.686  38.597 11.666  1.00 36.35  ? 81  ILE L N   1 
ATOM   3113 C CA  . ILE C 3 101 ? 74.719  39.055 13.053  1.00 40.26  ? 81  ILE L CA  1 
ATOM   3114 C C   . ILE C 3 101 ? 73.279  39.170 13.530  1.00 41.51  ? 81  ILE L C   1 
ATOM   3115 O O   . ILE C 3 101 ? 72.512  39.993 13.025  1.00 38.40  ? 81  ILE L O   1 
ATOM   3116 C CB  . ILE C 3 101 ? 75.424  40.424 13.216  1.00 42.82  ? 81  ILE L CB  1 
ATOM   3117 C CG1 . ILE C 3 101 ? 76.784  40.423 12.521  1.00 34.35  ? 81  ILE L CG1 1 
ATOM   3118 C CG2 . ILE C 3 101 ? 75.580  40.775 14.696  1.00 42.36  ? 81  ILE L CG2 1 
ATOM   3119 C CD1 . ILE C 3 101 ? 77.465  41.768 12.555  1.00 36.70  ? 81  ILE L CD1 1 
ATOM   3120 N N   . SER C 3 102 ? 72.907  38.324 14.484  1.00 48.13  ? 82  SER L N   1 
ATOM   3121 C CA  . SER C 3 102 ? 71.497  38.151 14.823  1.00 44.52  ? 82  SER L CA  1 
ATOM   3122 C C   . SER C 3 102 ? 70.910  39.437 15.413  1.00 47.23  ? 82  SER L C   1 
ATOM   3123 O O   . SER C 3 102 ? 69.864  39.905 14.948  1.00 48.77  ? 82  SER L O   1 
ATOM   3124 C CB  . SER C 3 102 ? 71.316  36.973 15.775  1.00 40.72  ? 82  SER L CB  1 
ATOM   3125 O OG  . SER C 3 102 ? 72.222  37.030 16.853  1.00 41.73  ? 82  SER L OG  1 
ATOM   3126 N N   . SER C 3 103 ? 71.578  40.023 16.408  1.00 39.47  ? 83  SER L N   1 
ATOM   3127 C CA  . SER C 3 103 ? 71.215  41.379 16.845  1.00 47.19  ? 83  SER L CA  1 
ATOM   3128 C C   . SER C 3 103 ? 72.474  42.225 17.037  1.00 45.56  ? 83  SER L C   1 
ATOM   3129 O O   . SER C 3 103 ? 73.312  41.925 17.891  1.00 43.07  ? 83  SER L O   1 
ATOM   3130 C CB  . SER C 3 103 ? 70.351  41.361 18.122  1.00 42.33  ? 83  SER L CB  1 
ATOM   3131 O OG  . SER C 3 103 ? 70.966  40.716 19.212  1.00 39.98  ? 83  SER L OG  1 
ATOM   3132 N N   . VAL C 3 104 ? 72.596  43.279 16.230  1.00 41.25  ? 84  VAL L N   1 
ATOM   3133 C CA  . VAL C 3 104 ? 73.858  43.997 16.107  1.00 41.13  ? 84  VAL L CA  1 
ATOM   3134 C C   . VAL C 3 104 ? 74.119  44.924 17.294  1.00 41.22  ? 84  VAL L C   1 
ATOM   3135 O O   . VAL C 3 104 ? 73.195  45.464 17.914  1.00 39.77  ? 84  VAL L O   1 
ATOM   3136 C CB  . VAL C 3 104 ? 73.926  44.808 14.774  1.00 43.43  ? 84  VAL L CB  1 
ATOM   3137 C CG1 . VAL C 3 104 ? 73.105  46.066 14.850  1.00 41.29  ? 84  VAL L CG1 1 
ATOM   3138 C CG2 . VAL C 3 104 ? 75.372  45.147 14.414  1.00 44.25  ? 84  VAL L CG2 1 
ATOM   3139 N N   . GLN C 3 105 ? 75.403  45.048 17.622  1.00 42.02  ? 85  GLN L N   1 
ATOM   3140 C CA  . GLN C 3 105 ? 75.874  45.864 18.728  1.00 35.81  ? 85  GLN L CA  1 
ATOM   3141 C C   . GLN C 3 105 ? 76.710  47.015 18.211  1.00 34.33  ? 85  GLN L C   1 
ATOM   3142 O O   . GLN C 3 105 ? 77.232  46.983 17.095  1.00 34.10  ? 85  GLN L O   1 
ATOM   3143 C CB  . GLN C 3 105 ? 76.694  45.031 19.714  1.00 36.59  ? 85  GLN L CB  1 
ATOM   3144 C CG  . GLN C 3 105 ? 75.973  43.802 20.246  1.00 40.60  ? 85  GLN L CG  1 
ATOM   3145 C CD  . GLN C 3 105 ? 74.686  44.154 20.998  1.00 41.97  ? 85  GLN L CD  1 
ATOM   3146 O OE1 . GLN C 3 105 ? 73.575  43.838 20.549  1.00 43.30  ? 85  GLN L OE1 1 
ATOM   3147 N NE2 . GLN C 3 105 ? 74.835  44.798 22.147  1.00 35.77  ? 85  GLN L NE2 1 
ATOM   3148 N N   . ALA C 3 106 ? 76.835  48.031 19.045  1.00 33.72  ? 86  ALA L N   1 
ATOM   3149 C CA  . ALA C 3 106 ? 77.535  49.241 18.681  1.00 34.16  ? 86  ALA L CA  1 
ATOM   3150 C C   . ALA C 3 106 ? 78.986  48.941 18.343  1.00 31.81  ? 86  ALA L C   1 
ATOM   3151 O O   . ALA C 3 106 ? 79.584  49.620 17.520  1.00 31.94  ? 86  ALA L O   1 
ATOM   3152 C CB  . ALA C 3 106 ? 77.449  50.263 19.818  1.00 32.66  ? 86  ALA L CB  1 
ATOM   3153 N N   . GLU C 3 107 ? 79.539  47.917 18.982  1.00 31.80  ? 87  GLU L N   1 
ATOM   3154 C CA  . GLU C 3 107 ? 80.960  47.601 18.851  1.00 38.14  ? 87  GLU L CA  1 
ATOM   3155 C C   . GLU C 3 107 ? 81.247  46.764 17.606  1.00 34.28  ? 87  GLU L C   1 
ATOM   3156 O O   . GLU C 3 107 ? 82.396  46.455 17.313  1.00 37.23  ? 87  GLU L O   1 
ATOM   3157 C CB  . GLU C 3 107 ? 81.447  46.848 20.096  1.00 36.41  ? 87  GLU L CB  1 
ATOM   3158 C CG  . GLU C 3 107 ? 80.782  45.495 20.205  1.00 43.78  ? 87  GLU L CG  1 
ATOM   3159 C CD  . GLU C 3 107 ? 81.278  44.655 21.369  1.00 56.01  ? 87  GLU L CD  1 
ATOM   3160 O OE1 . GLU C 3 107 ? 80.679  44.766 22.472  1.00 60.14  ? 87  GLU L OE1 1 
ATOM   3161 O OE2 . GLU C 3 107 ? 82.245  43.869 21.168  1.00 53.40  ? 87  GLU L OE2 1 
ATOM   3162 N N   . ASP C 3 108 ? 80.195  46.376 16.891  1.00 36.00  ? 88  ASP L N   1 
ATOM   3163 C CA  . ASP C 3 108 ? 80.324  45.465 15.754  1.00 32.00  ? 88  ASP L CA  1 
ATOM   3164 C C   . ASP C 3 108 ? 80.678  46.231 14.473  1.00 31.53  ? 88  ASP L C   1 
ATOM   3165 O O   . ASP C 3 108 ? 80.929  45.620 13.422  1.00 30.89  ? 88  ASP L O   1 
ATOM   3166 C CB  . ASP C 3 108 ? 79.026  44.652 15.546  1.00 34.89  ? 88  ASP L CB  1 
ATOM   3167 C CG  . ASP C 3 108 ? 78.765  43.613 16.664  1.00 36.41  ? 88  ASP L CG  1 
ATOM   3168 O OD1 . ASP C 3 108 ? 79.726  43.171 17.318  1.00 33.42  ? 88  ASP L OD1 1 
ATOM   3169 O OD2 . ASP C 3 108 ? 77.589  43.221 16.872  1.00 38.24  ? 88  ASP L OD2 1 
ATOM   3170 N N   . LEU C 3 109 ? 80.704  47.558 14.539  1.00 23.35  ? 89  LEU L N   1 
ATOM   3171 C CA  . LEU C 3 109 ? 81.115  48.311 13.356  1.00 27.97  ? 89  LEU L CA  1 
ATOM   3172 C C   . LEU C 3 109 ? 82.542  47.935 12.926  1.00 27.40  ? 89  LEU L C   1 
ATOM   3173 O O   . LEU C 3 109 ? 83.458  47.848 13.755  1.00 21.37  ? 89  LEU L O   1 
ATOM   3174 C CB  . LEU C 3 109 ? 80.995  49.815 13.601  1.00 28.37  ? 89  LEU L CB  1 
ATOM   3175 C CG  . LEU C 3 109 ? 82.079  50.644 14.281  1.00 35.57  ? 89  LEU L CG  1 
ATOM   3176 C CD1 . LEU C 3 109 ? 83.085  51.121 13.274  1.00 25.68  ? 89  LEU L CD1 1 
ATOM   3177 C CD2 . LEU C 3 109 ? 81.414  51.841 14.979  1.00 38.50  ? 89  LEU L CD2 1 
ATOM   3178 N N   . ALA C 3 110 ? 82.701  47.709 11.623  1.00 26.22  ? 90  ALA L N   1 
ATOM   3179 C CA  . ALA C 3 110 ? 83.884  47.039 11.064  1.00 24.64  ? 90  ALA L CA  1 
ATOM   3180 C C   . ALA C 3 110 ? 83.789  46.899 9.560   1.00 25.15  ? 90  ALA L C   1 
ATOM   3181 O O   . ALA C 3 110 ? 82.736  47.134 8.977   1.00 27.79  ? 90  ALA L O   1 
ATOM   3182 C CB  . ALA C 3 110 ? 84.060  45.631 11.693  1.00 22.36  ? 90  ALA L CB  1 
ATOM   3183 N N   . ASP C 3 111 ? 84.873  46.461 8.932   1.00 26.32  ? 91  ASP L N   1 
ATOM   3184 C CA  . ASP C 3 111 ? 84.777  45.875 7.598   1.00 25.29  ? 91  ASP L CA  1 
ATOM   3185 C C   . ASP C 3 111 ? 84.772  44.370 7.770   1.00 27.43  ? 91  ASP L C   1 
ATOM   3186 O O   . ASP C 3 111 ? 85.532  43.854 8.586   1.00 30.94  ? 91  ASP L O   1 
ATOM   3187 C CB  . ASP C 3 111 ? 85.931  46.312 6.698   1.00 26.67  ? 91  ASP L CB  1 
ATOM   3188 C CG  . ASP C 3 111 ? 86.018  47.820 6.547   1.00 34.84  ? 91  ASP L CG  1 
ATOM   3189 O OD1 . ASP C 3 111 ? 84.956  48.501 6.542   1.00 36.72  ? 91  ASP L OD1 1 
ATOM   3190 O OD2 . ASP C 3 111 ? 87.157  48.329 6.451   1.00 40.10  ? 91  ASP L OD2 1 
ATOM   3191 N N   . TYR C 3 112 ? 83.928  43.671 7.011   1.00 25.42  ? 92  TYR L N   1 
ATOM   3192 C CA  . TYR C 3 112 ? 83.860  42.215 7.067   1.00 24.28  ? 92  TYR L CA  1 
ATOM   3193 C C   . TYR C 3 112 ? 84.323  41.617 5.747   1.00 27.90  ? 92  TYR L C   1 
ATOM   3194 O O   . TYR C 3 112 ? 83.957  42.078 4.671   1.00 29.83  ? 92  TYR L O   1 
ATOM   3195 C CB  . TYR C 3 112 ? 82.438  41.734 7.409   1.00 20.82  ? 92  TYR L CB  1 
ATOM   3196 C CG  . TYR C 3 112 ? 82.032  42.065 8.821   1.00 26.51  ? 92  TYR L CG  1 
ATOM   3197 C CD1 . TYR C 3 112 ? 81.578  43.347 9.163   1.00 25.20  ? 92  TYR L CD1 1 
ATOM   3198 C CD2 . TYR C 3 112 ? 82.149  41.120 9.830   1.00 24.55  ? 92  TYR L CD2 1 
ATOM   3199 C CE1 . TYR C 3 112 ? 81.249  43.650 10.472  1.00 23.40  ? 92  TYR L CE1 1 
ATOM   3200 C CE2 . TYR C 3 112 ? 81.812  41.412 11.132  1.00 22.19  ? 92  TYR L CE2 1 
ATOM   3201 C CZ  . TYR C 3 112 ? 81.361  42.678 11.445  1.00 22.34  ? 92  TYR L CZ  1 
ATOM   3202 O OH  . TYR C 3 112 ? 81.035  42.955 12.743  1.00 25.69  ? 92  TYR L OH  1 
ATOM   3203 N N   . PHE C 3 113 ? 85.148  40.592 5.838   1.00 22.87  ? 93  PHE L N   1 
ATOM   3204 C CA  . PHE C 3 113 ? 85.738  40.000 4.660   1.00 24.76  ? 93  PHE L CA  1 
ATOM   3205 C C   . PHE C 3 113 ? 85.426  38.531 4.649   1.00 26.54  ? 93  PHE L C   1 
ATOM   3206 O O   . PHE C 3 113 ? 85.560  37.855 5.686   1.00 25.87  ? 93  PHE L O   1 
ATOM   3207 C CB  . PHE C 3 113 ? 87.267  40.212 4.631   1.00 22.93  ? 93  PHE L CB  1 
ATOM   3208 C CG  . PHE C 3 113 ? 87.673  41.651 4.504   1.00 26.35  ? 93  PHE L CG  1 
ATOM   3209 C CD1 . PHE C 3 113 ? 87.712  42.264 3.259   1.00 25.29  ? 93  PHE L CD1 1 
ATOM   3210 C CD2 . PHE C 3 113 ? 87.990  42.406 5.625   1.00 24.01  ? 93  PHE L CD2 1 
ATOM   3211 C CE1 . PHE C 3 113 ? 88.077  43.587 3.139   1.00 22.57  ? 93  PHE L CE1 1 
ATOM   3212 C CE2 . PHE C 3 113 ? 88.354  43.738 5.501   1.00 24.47  ? 93  PHE L CE2 1 
ATOM   3213 C CZ  . PHE C 3 113 ? 88.395  44.324 4.270   1.00 18.36  ? 93  PHE L CZ  1 
ATOM   3214 N N   . CYS C 3 114 ? 85.007  38.017 3.502   1.00 25.37  ? 94  CYS L N   1 
ATOM   3215 C CA  . CYS C 3 114 ? 85.101  36.561 3.340   1.00 31.46  ? 94  CYS L CA  1 
ATOM   3216 C C   . CYS C 3 114 ? 86.412  36.210 2.622   1.00 29.13  ? 94  CYS L C   1 
ATOM   3217 O O   . CYS C 3 114 ? 87.017  37.033 1.905   1.00 28.17  ? 94  CYS L O   1 
ATOM   3218 C CB  . CYS C 3 114 ? 83.891  35.964 2.588   1.00 25.64  ? 94  CYS L CB  1 
ATOM   3219 S SG  . CYS C 3 114 ? 83.777  36.387 0.859   1.00 41.83  ? 94  CYS L SG  1 
ATOM   3220 N N   . GLN C 3 115 ? 86.840  34.981 2.859   1.00 24.51  ? 95  GLN L N   1 
ATOM   3221 C CA  . GLN C 3 115 ? 87.995  34.398 2.236   1.00 25.00  ? 95  GLN L CA  1 
ATOM   3222 C C   . GLN C 3 115 ? 87.717  32.927 1.928   1.00 27.82  ? 95  GLN L C   1 
ATOM   3223 O O   . GLN C 3 115 ? 87.294  32.179 2.797   1.00 30.43  ? 95  GLN L O   1 
ATOM   3224 C CB  . GLN C 3 115 ? 89.221  34.524 3.159   1.00 23.25  ? 95  GLN L CB  1 
ATOM   3225 C CG  . GLN C 3 115 ? 90.493  34.052 2.518   1.00 26.62  ? 95  GLN L CG  1 
ATOM   3226 C CD  . GLN C 3 115 ? 91.546  33.531 3.500   1.00 28.71  ? 95  GLN L CD  1 
ATOM   3227 O OE1 . GLN C 3 115 ? 91.246  33.076 4.612   1.00 28.20  ? 95  GLN L OE1 1 
ATOM   3228 N NE2 . GLN C 3 115 ? 92.788  33.581 3.072   1.00 28.46  ? 95  GLN L NE2 1 
ATOM   3229 N N   . GLN C 3 116 ? 87.968  32.488 0.706   1.00 29.18  ? 96  GLN L N   1 
ATOM   3230 C CA  . GLN C 3 116 ? 88.080  31.050 0.521   1.00 29.12  ? 96  GLN L CA  1 
ATOM   3231 C C   . GLN C 3 116 ? 89.465  30.599 1.021   1.00 30.77  ? 96  GLN L C   1 
ATOM   3232 O O   . GLN C 3 116 ? 90.496  31.103 0.589   1.00 26.44  ? 96  GLN L O   1 
ATOM   3233 C CB  . GLN C 3 116 ? 87.855  30.645 -0.947  1.00 28.15  ? 96  GLN L CB  1 
ATOM   3234 C CG  . GLN C 3 116 ? 88.833  31.219 -1.967  1.00 33.03  ? 96  GLN L CG  1 
ATOM   3235 C CD  . GLN C 3 116 ? 90.017  30.296 -2.236  1.00 32.71  ? 96  GLN L CD  1 
ATOM   3236 O OE1 . GLN C 3 116 ? 90.092  29.176 -1.721  1.00 33.31  ? 96  GLN L OE1 1 
ATOM   3237 N NE2 . GLN C 3 116 ? 90.948  30.769 -3.047  1.00 39.09  ? 96  GLN L NE2 1 
ATOM   3238 N N   . HIS C 3 117 ? 89.477  29.660 1.956   1.00 32.09  ? 97  HIS L N   1 
ATOM   3239 C CA  . HIS C 3 117 ? 90.719  29.061 2.368   1.00 30.14  ? 97  HIS L CA  1 
ATOM   3240 C C   . HIS C 3 117 ? 90.791  27.629 1.829   1.00 32.66  ? 97  HIS L C   1 
ATOM   3241 O O   . HIS C 3 117 ? 91.183  26.693 2.527   1.00 29.82  ? 97  HIS L O   1 
ATOM   3242 C CB  . HIS C 3 117 ? 90.872  29.120 3.896   1.00 31.55  ? 97  HIS L CB  1 
ATOM   3243 C CG  . HIS C 3 117 ? 89.794  28.417 4.669   1.00 32.01  ? 97  HIS L CG  1 
ATOM   3244 N ND1 . HIS C 3 117 ? 90.009  27.217 5.317   1.00 35.24  ? 97  HIS L ND1 1 
ATOM   3245 C CD2 . HIS C 3 117 ? 88.525  28.784 4.973   1.00 32.93  ? 97  HIS L CD2 1 
ATOM   3246 C CE1 . HIS C 3 117 ? 88.908  26.861 5.959   1.00 30.94  ? 97  HIS L CE1 1 
ATOM   3247 N NE2 . HIS C 3 117 ? 87.993  27.795 5.767   1.00 32.37  ? 97  HIS L NE2 1 
ATOM   3248 N N   . TYR C 3 118 ? 90.433  27.494 0.554   1.00 34.62  ? 98  TYR L N   1 
ATOM   3249 C CA  . TYR C 3 118 ? 90.328  26.187 -0.103  1.00 40.60  ? 98  TYR L CA  1 
ATOM   3250 C C   . TYR C 3 118 ? 91.556  25.839 -0.936  1.00 37.40  ? 98  TYR L C   1 
ATOM   3251 O O   . TYR C 3 118 ? 92.126  24.761 -0.793  1.00 36.71  ? 98  TYR L O   1 
ATOM   3252 C CB  . TYR C 3 118 ? 89.082  26.165 -0.987  1.00 39.78  ? 98  TYR L CB  1 
ATOM   3253 C CG  . TYR C 3 118 ? 88.757  24.842 -1.636  1.00 39.11  ? 98  TYR L CG  1 
ATOM   3254 C CD1 . TYR C 3 118 ? 88.776  24.707 -3.015  1.00 42.19  ? 98  TYR L CD1 1 
ATOM   3255 C CD2 . TYR C 3 118 ? 88.402  23.741 -0.876  1.00 46.42  ? 98  TYR L CD2 1 
ATOM   3256 C CE1 . TYR C 3 118 ? 88.461  23.506 -3.625  1.00 43.21  ? 98  TYR L CE1 1 
ATOM   3257 C CE2 . TYR C 3 118 ? 88.084  22.524 -1.474  1.00 49.41  ? 98  TYR L CE2 1 
ATOM   3258 C CZ  . TYR C 3 118 ? 88.117  22.418 -2.847  1.00 50.11  ? 98  TYR L CZ  1 
ATOM   3259 O OH  . TYR C 3 118 ? 87.804  21.230 -3.448  1.00 48.83  ? 98  TYR L OH  1 
ATOM   3260 N N   . SER C 3 119 ? 91.960  26.768 -1.797  1.00 36.16  ? 99  SER L N   1 
ATOM   3261 C CA  . SER C 3 119 ? 93.084  26.542 -2.681  1.00 37.81  ? 99  SER L CA  1 
ATOM   3262 C C   . SER C 3 119 ? 93.917  27.814 -2.867  1.00 40.62  ? 99  SER L C   1 
ATOM   3263 O O   . SER C 3 119 ? 93.399  28.934 -2.745  1.00 36.89  ? 99  SER L O   1 
ATOM   3264 C CB  . SER C 3 119 ? 92.590  26.016 -4.029  1.00 40.96  ? 99  SER L CB  1 
ATOM   3265 O OG  . SER C 3 119 ? 92.473  27.055 -4.986  1.00 42.91  ? 99  SER L OG  1 
ATOM   3266 N N   . THR C 3 120 ? 95.208  27.644 -3.154  1.00 37.83  ? 100 THR L N   1 
ATOM   3267 C CA  . THR C 3 120 ? 96.085  28.790 -3.336  1.00 35.58  ? 100 THR L CA  1 
ATOM   3268 C C   . THR C 3 120 ? 95.751  29.412 -4.655  1.00 38.35  ? 100 THR L C   1 
ATOM   3269 O O   . THR C 3 120 ? 95.410  28.697 -5.591  1.00 42.54  ? 100 THR L O   1 
ATOM   3270 C CB  . THR C 3 120 ? 97.596  28.425 -3.290  1.00 41.41  ? 100 THR L CB  1 
ATOM   3271 O OG1 . THR C 3 120 ? 97.886  27.403 -4.247  1.00 57.06  ? 100 THR L OG1 1 
ATOM   3272 C CG2 . THR C 3 120 ? 97.975  27.916 -1.930  1.00 43.09  ? 100 THR L CG2 1 
ATOM   3273 N N   . PRO C 3 121 ? 95.792  30.752 -4.724  1.00 37.24  ? 101 PRO L N   1 
ATOM   3274 C CA  . PRO C 3 121 ? 96.024  31.664 -3.595  1.00 36.07  ? 101 PRO L CA  1 
ATOM   3275 C C   . PRO C 3 121 ? 94.739  31.897 -2.800  1.00 40.31  ? 101 PRO L C   1 
ATOM   3276 O O   . PRO C 3 121 ? 93.675  32.052 -3.405  1.00 49.42  ? 101 PRO L O   1 
ATOM   3277 C CB  . PRO C 3 121 ? 96.495  32.946 -4.274  1.00 36.61  ? 101 PRO L CB  1 
ATOM   3278 C CG  . PRO C 3 121 ? 95.809  32.923 -5.608  1.00 44.53  ? 101 PRO L CG  1 
ATOM   3279 C CD  . PRO C 3 121 ? 95.572  31.477 -5.986  1.00 39.17  ? 101 PRO L CD  1 
ATOM   3280 N N   . TYR C 3 122 ? 94.805  31.906 -1.475  1.00 34.90  ? 102 TYR L N   1 
ATOM   3281 C CA  . TYR C 3 122 ? 93.563  31.981 -0.704  1.00 34.33  ? 102 TYR L CA  1 
ATOM   3282 C C   . TYR C 3 122 ? 92.946  33.370 -0.807  1.00 36.48  ? 102 TYR L C   1 
ATOM   3283 O O   . TYR C 3 122 ? 93.320  34.289 -0.089  1.00 42.33  ? 102 TYR L O   1 
ATOM   3284 C CB  . TYR C 3 122 ? 93.820  31.593 0.736   1.00 27.98  ? 102 TYR L CB  1 
ATOM   3285 C CG  . TYR C 3 122 ? 94.528  30.274 0.803   1.00 31.42  ? 102 TYR L CG  1 
ATOM   3286 C CD1 . TYR C 3 122 ? 93.826  29.076 0.683   1.00 32.38  ? 102 TYR L CD1 1 
ATOM   3287 C CD2 . TYR C 3 122 ? 95.919  30.217 0.934   1.00 39.69  ? 102 TYR L CD2 1 
ATOM   3288 C CE1 . TYR C 3 122 ? 94.486  27.837 0.721   1.00 37.77  ? 102 TYR L CE1 1 
ATOM   3289 C CE2 . TYR C 3 122 ? 96.595  28.991 0.987   1.00 42.55  ? 102 TYR L CE2 1 
ATOM   3290 C CZ  . TYR C 3 122 ? 95.876  27.808 0.874   1.00 44.26  ? 102 TYR L CZ  1 
ATOM   3291 O OH  . TYR C 3 122 ? 96.548  26.613 0.916   1.00 47.39  ? 102 TYR L OH  1 
ATOM   3292 N N   . THR C 3 123 ? 92.004  33.521 -1.720  1.00 30.88  ? 103 THR L N   1 
ATOM   3293 C CA  . THR C 3 123 ? 91.503  34.838 -2.061  1.00 33.79  ? 103 THR L CA  1 
ATOM   3294 C C   . THR C 3 123 ? 90.376  35.369 -1.151  1.00 31.06  ? 103 THR L C   1 
ATOM   3295 O O   . THR C 3 123 ? 89.541  34.619 -0.628  1.00 28.87  ? 103 THR L O   1 
ATOM   3296 C CB  . THR C 3 123 ? 91.043  34.822 -3.508  1.00 34.12  ? 103 THR L CB  1 
ATOM   3297 O OG1 . THR C 3 123 ? 90.523  33.522 -3.793  1.00 37.73  ? 103 THR L OG1 1 
ATOM   3298 C CG2 . THR C 3 123 ? 92.229  35.045 -4.422  1.00 39.86  ? 103 THR L CG2 1 
ATOM   3299 N N   . PHE C 3 124 ? 90.390  36.682 -0.964  1.00 34.55  ? 104 PHE L N   1 
ATOM   3300 C CA  . PHE C 3 124 ? 89.425  37.391 -0.130  1.00 28.76  ? 104 PHE L CA  1 
ATOM   3301 C C   . PHE C 3 124 ? 88.387  38.102 -0.958  1.00 29.20  ? 104 PHE L C   1 
ATOM   3302 O O   . PHE C 3 124 ? 88.683  38.577 -2.056  1.00 31.96  ? 104 PHE L O   1 
ATOM   3303 C CB  . PHE C 3 124 ? 90.115  38.457 0.731   1.00 26.15  ? 104 PHE L CB  1 
ATOM   3304 C CG  . PHE C 3 124 ? 91.020  37.914 1.797   1.00 29.15  ? 104 PHE L CG  1 
ATOM   3305 C CD1 . PHE C 3 124 ? 90.535  37.670 3.077   1.00 24.87  ? 104 PHE L CD1 1 
ATOM   3306 C CD2 . PHE C 3 124 ? 92.379  37.706 1.538   1.00 32.23  ? 104 PHE L CD2 1 
ATOM   3307 C CE1 . PHE C 3 124 ? 91.377  37.190 4.080   1.00 26.75  ? 104 PHE L CE1 1 
ATOM   3308 C CE2 . PHE C 3 124 ? 93.230  37.235 2.543   1.00 33.05  ? 104 PHE L CE2 1 
ATOM   3309 C CZ  . PHE C 3 124 ? 92.722  36.968 3.811   1.00 24.74  ? 104 PHE L CZ  1 
ATOM   3310 N N   . GLY C 3 125 ? 87.190  38.254 -0.399  1.00 29.69  ? 105 GLY L N   1 
ATOM   3311 C CA  . GLY C 3 125 ? 86.205  39.140 -0.990  1.00 27.99  ? 105 GLY L CA  1 
ATOM   3312 C C   . GLY C 3 125 ? 86.615  40.589 -0.784  1.00 28.16  ? 105 GLY L C   1 
ATOM   3313 O O   . GLY C 3 125 ? 87.509  40.888 0.011   1.00 28.89  ? 105 GLY L O   1 
ATOM   3314 N N   . GLY C 3 126 ? 85.945  41.493 -1.486  1.00 30.01  ? 106 GLY L N   1 
ATOM   3315 C CA  . GLY C 3 126 ? 86.248  42.907 -1.403  1.00 22.04  ? 106 GLY L CA  1 
ATOM   3316 C C   . GLY C 3 126 ? 85.779  43.582 -0.128  1.00 25.47  ? 106 GLY L C   1 
ATOM   3317 O O   . GLY C 3 126 ? 86.096  44.737 0.124   1.00 28.25  ? 106 GLY L O   1 
ATOM   3318 N N   . GLY C 3 127 ? 85.007  42.876 0.684   1.00 27.92  ? 107 GLY L N   1 
ATOM   3319 C CA  . GLY C 3 127 ? 84.591  43.438 1.956   1.00 25.50  ? 107 GLY L CA  1 
ATOM   3320 C C   . GLY C 3 127 ? 83.242  44.145 1.987   1.00 30.40  ? 107 GLY L C   1 
ATOM   3321 O O   . GLY C 3 127 ? 82.834  44.804 1.036   1.00 29.28  ? 107 GLY L O   1 
ATOM   3322 N N   . THR C 3 128 ? 82.557  43.996 3.116   1.00 31.82  ? 108 THR L N   1 
ATOM   3323 C CA  . THR C 3 128 ? 81.350  44.739 3.413   1.00 28.85  ? 108 THR L CA  1 
ATOM   3324 C C   . THR C 3 128 ? 81.605  45.712 4.566   1.00 29.03  ? 108 THR L C   1 
ATOM   3325 O O   . THR C 3 128 ? 82.010  45.306 5.653   1.00 28.68  ? 108 THR L O   1 
ATOM   3326 C CB  . THR C 3 128 ? 80.201  43.800 3.801   1.00 33.72  ? 108 THR L CB  1 
ATOM   3327 O OG1 . THR C 3 128 ? 79.929  42.880 2.729   1.00 32.70  ? 108 THR L OG1 1 
ATOM   3328 C CG2 . THR C 3 128 ? 78.944  44.614 4.182   1.00 27.93  ? 108 THR L CG2 1 
ATOM   3329 N N   . LYS C 3 129 ? 81.358  46.993 4.351   1.00 27.37  ? 109 LYS L N   1 
ATOM   3330 C CA  . LYS C 3 129 ? 81.507  47.930 5.454   1.00 34.94  ? 109 LYS L CA  1 
ATOM   3331 C C   . LYS C 3 129 ? 80.191  48.025 6.246   1.00 34.90  ? 109 LYS L C   1 
ATOM   3332 O O   . LYS C 3 129 ? 79.172  48.441 5.704   1.00 34.80  ? 109 LYS L O   1 
ATOM   3333 C CB  . LYS C 3 129 ? 81.939  49.300 4.937   1.00 26.11  ? 109 LYS L CB  1 
ATOM   3334 C CG  . LYS C 3 129 ? 81.988  50.366 6.010   1.00 35.66  ? 109 LYS L CG  1 
ATOM   3335 C CD  . LYS C 3 129 ? 82.196  51.755 5.383   1.00 44.23  ? 109 LYS L CD  1 
ATOM   3336 C CE  . LYS C 3 129 ? 82.552  52.829 6.418   1.00 50.11  ? 109 LYS L CE  1 
ATOM   3337 N NZ  . LYS C 3 129 ? 83.917  52.640 7.018   1.00 58.17  ? 109 LYS L NZ  1 
ATOM   3338 N N   . LEU C 3 130 ? 80.222  47.614 7.512   1.00 30.83  ? 110 LEU L N   1 
ATOM   3339 C CA  . LEU C 3 130 ? 79.072  47.708 8.423   1.00 30.42  ? 110 LEU L CA  1 
ATOM   3340 C C   . LEU C 3 130 ? 79.132  48.960 9.286   1.00 29.40  ? 110 LEU L C   1 
ATOM   3341 O O   . LEU C 3 130 ? 80.088  49.157 10.032  1.00 31.19  ? 110 LEU L O   1 
ATOM   3342 C CB  . LEU C 3 130 ? 78.989  46.473 9.339   1.00 29.00  ? 110 LEU L CB  1 
ATOM   3343 C CG  . LEU C 3 130 ? 78.010  46.599 10.518  1.00 34.22  ? 110 LEU L CG  1 
ATOM   3344 C CD1 . LEU C 3 130 ? 76.571  46.638 10.006  1.00 40.72  ? 110 LEU L CD1 1 
ATOM   3345 C CD2 . LEU C 3 130 ? 78.168  45.475 11.554  1.00 28.69  ? 110 LEU L CD2 1 
ATOM   3346 N N   . GLU C 3 131 ? 78.113  49.807 9.182   1.00 35.79  ? 111 GLU L N   1 
ATOM   3347 C CA  . GLU C 3 131 ? 77.982  50.976 10.054  1.00 34.07  ? 111 GLU L CA  1 
ATOM   3348 C C   . GLU C 3 131 ? 76.728  50.902 10.923  1.00 34.44  ? 111 GLU L C   1 
ATOM   3349 O O   . GLU C 3 131 ? 75.782  50.156 10.634  1.00 38.79  ? 111 GLU L O   1 
ATOM   3350 C CB  . GLU C 3 131 ? 77.994  52.263 9.225   1.00 38.90  ? 111 GLU L CB  1 
ATOM   3351 C CG  . GLU C 3 131 ? 79.341  52.420 8.474   1.00 46.38  ? 111 GLU L CG  1 
ATOM   3352 C CD  . GLU C 3 131 ? 79.647  53.841 7.996   1.00 51.25  ? 111 GLU L CD  1 
ATOM   3353 O OE1 . GLU C 3 131 ? 78.999  54.303 7.031   1.00 58.16  ? 111 GLU L OE1 1 
ATOM   3354 O OE2 . GLU C 3 131 ? 80.557  54.482 8.576   1.00 50.06  ? 111 GLU L OE2 1 
ATOM   3355 N N   . ILE C 3 132 ? 76.726  51.658 12.008  1.00 35.72  ? 112 ILE L N   1 
ATOM   3356 C CA  . ILE C 3 132 ? 75.601  51.629 12.927  1.00 31.51  ? 112 ILE L CA  1 
ATOM   3357 C C   . ILE C 3 132 ? 74.687  52.809 12.673  1.00 32.72  ? 112 ILE L C   1 
ATOM   3358 O O   . ILE C 3 132 ? 75.139  53.955 12.678  1.00 32.23  ? 112 ILE L O   1 
ATOM   3359 C CB  . ILE C 3 132 ? 76.077  51.645 14.389  1.00 29.72  ? 112 ILE L CB  1 
ATOM   3360 C CG1 . ILE C 3 132 ? 77.113  50.545 14.617  1.00 32.77  ? 112 ILE L CG1 1 
ATOM   3361 C CG2 . ILE C 3 132 ? 74.902  51.435 15.323  1.00 31.43  ? 112 ILE L CG2 1 
ATOM   3362 C CD1 . ILE C 3 132 ? 76.540  49.135 14.499  1.00 31.86  ? 112 ILE L CD1 1 
ATOM   3363 N N   . ARG C 3 133 ? 73.409  52.542 12.416  1.00 34.05  ? 113 ARG L N   1 
ATOM   3364 C CA  . ARG C 3 133 ? 72.442  53.644 12.294  1.00 38.11  ? 113 ARG L CA  1 
ATOM   3365 C C   . ARG C 3 133 ? 72.023  54.059 13.701  1.00 37.43  ? 113 ARG L C   1 
ATOM   3366 O O   . ARG C 3 133 ? 71.722  53.211 14.539  1.00 35.18  ? 113 ARG L O   1 
ATOM   3367 C CB  . ARG C 3 133 ? 71.220  53.255 11.454  1.00 35.35  ? 113 ARG L CB  1 
ATOM   3368 N N   . ARG C 3 134 ? 72.068  55.358 13.978  1.00 33.04  ? 114 ARG L N   1 
ATOM   3369 C CA  . ARG C 3 134 ? 71.601  55.856 15.263  1.00 31.66  ? 114 ARG L CA  1 
ATOM   3370 C C   . ARG C 3 134 ? 70.775  57.120 15.041  1.00 34.38  ? 114 ARG L C   1 
ATOM   3371 O O   . ARG C 3 134 ? 70.525  57.520 13.894  1.00 29.20  ? 114 ARG L O   1 
ATOM   3372 C CB  . ARG C 3 134 ? 72.762  56.145 16.209  1.00 29.95  ? 114 ARG L CB  1 
ATOM   3373 C CG  . ARG C 3 134 ? 73.727  57.222 15.691  1.00 33.72  ? 114 ARG L CG  1 
ATOM   3374 C CD  . ARG C 3 134 ? 74.376  57.980 16.830  1.00 31.81  ? 114 ARG L CD  1 
ATOM   3375 N NE  . ARG C 3 134 ? 73.424  58.902 17.451  1.00 35.51  ? 114 ARG L NE  1 
ATOM   3376 C CZ  . ARG C 3 134 ? 73.478  59.315 18.714  1.00 37.05  ? 114 ARG L CZ  1 
ATOM   3377 N NH1 . ARG C 3 134 ? 74.440  58.887 19.530  1.00 33.71  ? 114 ARG L NH1 1 
ATOM   3378 N NH2 . ARG C 3 134 ? 72.554  60.156 19.169  1.00 35.33  ? 114 ARG L NH2 1 
ATOM   3379 N N   . ALA C 3 135 ? 70.371  57.730 16.154  1.00 33.71  ? 115 ALA L N   1 
ATOM   3380 C CA  . ALA C 3 135 ? 69.653  58.994 16.164  1.00 34.67  ? 115 ALA L CA  1 
ATOM   3381 C C   . ALA C 3 135 ? 70.561  60.130 15.752  1.00 38.21  ? 115 ALA L C   1 
ATOM   3382 O O   . ALA C 3 135 ? 71.775  60.095 16.011  1.00 36.24  ? 115 ALA L O   1 
ATOM   3383 C CB  . ALA C 3 135 ? 69.094  59.265 17.536  1.00 37.26  ? 115 ALA L CB  1 
ATOM   3384 N N   . ASP C 3 136 ? 69.964  61.133 15.118  1.00 34.72  ? 116 ASP L N   1 
ATOM   3385 C CA  . ASP C 3 136 ? 70.662  62.340 14.739  1.00 33.47  ? 116 ASP L CA  1 
ATOM   3386 C C   . ASP C 3 136 ? 71.277  63.034 15.949  1.00 34.32  ? 116 ASP L C   1 
ATOM   3387 O O   . ASP C 3 136 ? 70.675  63.084 17.019  1.00 37.15  ? 116 ASP L O   1 
ATOM   3388 C CB  . ASP C 3 136 ? 69.710  63.289 14.031  1.00 38.84  ? 116 ASP L CB  1 
ATOM   3389 C CG  . ASP C 3 136 ? 69.610  63.017 12.555  1.00 43.02  ? 116 ASP L CG  1 
ATOM   3390 O OD1 . ASP C 3 136 ? 70.129  61.979 12.108  1.00 39.77  ? 116 ASP L OD1 1 
ATOM   3391 O OD2 . ASP C 3 136 ? 68.997  63.843 11.843  1.00 50.59  ? 116 ASP L OD2 1 
ATOM   3392 N N   . ALA C 3 137 ? 72.494  63.538 15.775  1.00 34.89  ? 117 ALA L N   1 
ATOM   3393 C CA  . ALA C 3 137 ? 73.170  64.322 16.805  1.00 36.75  ? 117 ALA L CA  1 
ATOM   3394 C C   . ALA C 3 137 ? 73.928  65.474 16.150  1.00 38.14  ? 117 ALA L C   1 
ATOM   3395 O O   . ALA C 3 137 ? 74.601  65.282 15.149  1.00 38.51  ? 117 ALA L O   1 
ATOM   3396 C CB  . ALA C 3 137 ? 74.124  63.438 17.643  1.00 33.48  ? 117 ALA L CB  1 
ATOM   3397 N N   . ALA C 3 138 ? 73.764  66.671 16.700  1.00 37.41  ? 118 ALA L N   1 
ATOM   3398 C CA  . ALA C 3 138 ? 74.480  67.853 16.252  1.00 35.76  ? 118 ALA L CA  1 
ATOM   3399 C C   . ALA C 3 138 ? 75.876  67.856 16.838  1.00 39.15  ? 118 ALA L C   1 
ATOM   3400 O O   . ALA C 3 138 ? 76.089  67.367 17.948  1.00 37.84  ? 118 ALA L O   1 
ATOM   3401 C CB  . ALA C 3 138 ? 73.735  69.125 16.663  1.00 34.84  ? 118 ALA L CB  1 
ATOM   3402 N N   . PRO C 3 139 ? 76.834  68.437 16.110  1.00 39.37  ? 119 PRO L N   1 
ATOM   3403 C CA  . PRO C 3 139 ? 78.205  68.400 16.623  1.00 36.52  ? 119 PRO L CA  1 
ATOM   3404 C C   . PRO C 3 139 ? 78.394  69.383 17.757  1.00 37.92  ? 119 PRO L C   1 
ATOM   3405 O O   . PRO C 3 139 ? 77.740  70.416 17.794  1.00 44.41  ? 119 PRO L O   1 
ATOM   3406 C CB  . PRO C 3 139 ? 79.040  68.807 15.411  1.00 33.37  ? 119 PRO L CB  1 
ATOM   3407 C CG  . PRO C 3 139 ? 78.098  69.673 14.602  1.00 37.37  ? 119 PRO L CG  1 
ATOM   3408 C CD  . PRO C 3 139 ? 76.732  69.122 14.807  1.00 35.79  ? 119 PRO L CD  1 
ATOM   3409 N N   . THR C 3 140 ? 79.250  69.025 18.694  1.00 33.88  ? 120 THR L N   1 
ATOM   3410 C CA  . THR C 3 140 ? 79.863  69.973 19.587  1.00 35.40  ? 120 THR L CA  1 
ATOM   3411 C C   . THR C 3 140 ? 81.048  70.636 18.868  1.00 44.90  ? 120 THR L C   1 
ATOM   3412 O O   . THR C 3 140 ? 81.961  69.937 18.384  1.00 43.76  ? 120 THR L O   1 
ATOM   3413 C CB  . THR C 3 140 ? 80.357  69.290 20.845  1.00 35.00  ? 120 THR L CB  1 
ATOM   3414 O OG1 . THR C 3 140 ? 79.241  68.777 21.577  1.00 38.36  ? 120 THR L OG1 1 
ATOM   3415 C CG2 . THR C 3 140 ? 81.122  70.279 21.705  1.00 46.43  ? 120 THR L CG2 1 
ATOM   3416 N N   . VAL C 3 141 ? 81.047  71.966 18.795  1.00 39.04  ? 121 VAL L N   1 
ATOM   3417 C CA  . VAL C 3 141 ? 82.086  72.663 18.048  1.00 40.98  ? 121 VAL L CA  1 
ATOM   3418 C C   . VAL C 3 141 ? 83.039  73.476 18.931  1.00 43.98  ? 121 VAL L C   1 
ATOM   3419 O O   . VAL C 3 141 ? 82.633  74.091 19.910  1.00 46.03  ? 121 VAL L O   1 
ATOM   3420 C CB  . VAL C 3 141 ? 81.479  73.588 16.978  1.00 43.85  ? 121 VAL L CB  1 
ATOM   3421 C CG1 . VAL C 3 141 ? 82.581  74.227 16.139  1.00 43.99  ? 121 VAL L CG1 1 
ATOM   3422 C CG2 . VAL C 3 141 ? 80.543  72.804 16.077  1.00 41.02  ? 121 VAL L CG2 1 
ATOM   3423 N N   . SER C 3 142 ? 84.321  73.444 18.581  1.00 40.55  ? 122 SER L N   1 
ATOM   3424 C CA  . SER C 3 142 ? 85.335  74.188 19.297  1.00 43.84  ? 122 SER L CA  1 
ATOM   3425 C C   . SER C 3 142 ? 86.320  74.784 18.301  1.00 47.63  ? 122 SER L C   1 
ATOM   3426 O O   . SER C 3 142 ? 86.850  74.076 17.443  1.00 47.48  ? 122 SER L O   1 
ATOM   3427 C CB  . SER C 3 142 ? 86.070  73.290 20.286  1.00 44.11  ? 122 SER L CB  1 
ATOM   3428 O OG  . SER C 3 142 ? 85.181  72.383 20.896  1.00 49.62  ? 122 SER L OG  1 
ATOM   3429 N N   . ILE C 3 143 ? 86.566  76.081 18.413  1.00 43.52  ? 123 ILE L N   1 
ATOM   3430 C CA  . ILE C 3 143 ? 87.516  76.730 17.530  1.00 48.31  ? 123 ILE L CA  1 
ATOM   3431 C C   . ILE C 3 143 ? 88.799  77.057 18.305  1.00 48.08  ? 123 ILE L C   1 
ATOM   3432 O O   . ILE C 3 143 ? 88.747  77.481 19.453  1.00 46.52  ? 123 ILE L O   1 
ATOM   3433 C CB  . ILE C 3 143 ? 86.897  77.986 16.880  1.00 47.38  ? 123 ILE L CB  1 
ATOM   3434 C CG1 . ILE C 3 143 ? 87.706  78.437 15.676  1.00 45.85  ? 123 ILE L CG1 1 
ATOM   3435 C CG2 . ILE C 3 143 ? 86.701  79.109 17.888  1.00 54.04  ? 123 ILE L CG2 1 
ATOM   3436 C CD1 . ILE C 3 143 ? 87.004  79.518 14.894  1.00 51.15  ? 123 ILE L CD1 1 
ATOM   3437 N N   . PHE C 3 144 ? 89.947  76.788 17.689  1.00 44.44  ? 124 PHE L N   1 
ATOM   3438 C CA  . PHE C 3 144 ? 91.238  77.062 18.306  1.00 46.72  ? 124 PHE L CA  1 
ATOM   3439 C C   . PHE C 3 144 ? 92.104  77.932 17.406  1.00 52.07  ? 124 PHE L C   1 
ATOM   3440 O O   . PHE C 3 144 ? 92.338  77.599 16.236  1.00 52.05  ? 124 PHE L O   1 
ATOM   3441 C CB  . PHE C 3 144 ? 91.988  75.767 18.628  1.00 45.37  ? 124 PHE L CB  1 
ATOM   3442 C CG  . PHE C 3 144 ? 91.272  74.877 19.593  1.00 47.11  ? 124 PHE L CG  1 
ATOM   3443 C CD1 . PHE C 3 144 ? 90.280  74.010 19.151  1.00 42.84  ? 124 PHE L CD1 1 
ATOM   3444 C CD2 . PHE C 3 144 ? 91.587  74.896 20.938  1.00 42.99  ? 124 PHE L CD2 1 
ATOM   3445 C CE1 . PHE C 3 144 ? 89.616  73.187 20.038  1.00 40.23  ? 124 PHE L CE1 1 
ATOM   3446 C CE2 . PHE C 3 144 ? 90.934  74.064 21.825  1.00 42.90  ? 124 PHE L CE2 1 
ATOM   3447 C CZ  . PHE C 3 144 ? 89.942  73.210 21.368  1.00 40.91  ? 124 PHE L CZ  1 
ATOM   3448 N N   . PRO C 3 145 ? 92.578  79.061 17.949  1.00 55.72  ? 125 PRO L N   1 
ATOM   3449 C CA  . PRO C 3 145 ? 93.524  79.914 17.212  1.00 57.47  ? 125 PRO L CA  1 
ATOM   3450 C C   . PRO C 3 145 ? 94.941  79.310 17.188  1.00 53.75  ? 125 PRO L C   1 
ATOM   3451 O O   . PRO C 3 145 ? 95.228  78.373 17.938  1.00 51.49  ? 125 PRO L O   1 
ATOM   3452 C CB  . PRO C 3 145 ? 93.478  81.247 17.987  1.00 55.26  ? 125 PRO L CB  1 
ATOM   3453 C CG  . PRO C 3 145 ? 92.950  80.906 19.343  1.00 53.70  ? 125 PRO L CG  1 
ATOM   3454 C CD  . PRO C 3 145 ? 92.106  79.673 19.207  1.00 52.64  ? 125 PRO L CD  1 
ATOM   3455 N N   . PRO C 3 146 ? 95.822  79.826 16.317  1.00 54.09  ? 126 PRO L N   1 
ATOM   3456 C CA  . PRO C 3 146 ? 97.197  79.314 16.322  1.00 51.53  ? 126 PRO L CA  1 
ATOM   3457 C C   . PRO C 3 146 ? 97.901  79.499 17.666  1.00 55.01  ? 126 PRO L C   1 
ATOM   3458 O O   . PRO C 3 146 ? 97.707  80.515 18.347  1.00 51.90  ? 126 PRO L O   1 
ATOM   3459 C CB  . PRO C 3 146 ? 97.886  80.134 15.226  1.00 49.94  ? 126 PRO L CB  1 
ATOM   3460 C CG  . PRO C 3 146 ? 96.985  81.296 14.975  1.00 55.22  ? 126 PRO L CG  1 
ATOM   3461 C CD  . PRO C 3 146 ? 95.606  80.800 15.235  1.00 52.68  ? 126 PRO L CD  1 
ATOM   3462 N N   . SER C 3 147 ? 98.699  78.503 18.042  1.00 50.05  ? 127 SER L N   1 
ATOM   3463 C CA  . SER C 3 147 ? 99.479  78.565 19.259  1.00 50.01  ? 127 SER L CA  1 
ATOM   3464 C C   . SER C 3 147 ? 100.614 79.570 19.093  1.00 57.03  ? 127 SER L C   1 
ATOM   3465 O O   . SER C 3 147 ? 100.919 80.005 17.980  1.00 55.65  ? 127 SER L O   1 
ATOM   3466 C CB  . SER C 3 147 ? 100.032 77.176 19.628  1.00 57.74  ? 127 SER L CB  1 
ATOM   3467 O OG  . SER C 3 147 ? 101.009 76.705 18.702  1.00 54.94  ? 127 SER L OG  1 
ATOM   3468 N N   . SER C 3 148 ? 101.236 79.943 20.202  1.00 56.38  ? 128 SER L N   1 
ATOM   3469 C CA  . SER C 3 148 ? 102.371 80.843 20.138  1.00 59.31  ? 128 SER L CA  1 
ATOM   3470 C C   . SER C 3 148 ? 103.542 80.147 19.447  1.00 62.11  ? 128 SER L C   1 
ATOM   3471 O O   . SER C 3 148 ? 104.108 80.689 18.498  1.00 65.72  ? 128 SER L O   1 
ATOM   3472 C CB  . SER C 3 148 ? 102.759 81.332 21.537  1.00 58.47  ? 128 SER L CB  1 
ATOM   3473 O OG  . SER C 3 148 ? 102.813 80.258 22.455  1.00 61.69  ? 128 SER L OG  1 
ATOM   3474 N N   . GLU C 3 149 ? 103.880 78.941 19.907  1.00 64.04  ? 129 GLU L N   1 
ATOM   3475 C CA  . GLU C 3 149 ? 104.957 78.134 19.318  1.00 58.93  ? 129 GLU L CA  1 
ATOM   3476 C C   . GLU C 3 149 ? 104.912 78.090 17.787  1.00 60.74  ? 129 GLU L C   1 
ATOM   3477 O O   . GLU C 3 149 ? 105.949 78.155 17.135  1.00 63.27  ? 129 GLU L O   1 
ATOM   3478 C CB  . GLU C 3 149 ? 104.915 76.700 19.862  1.00 62.68  ? 129 GLU L CB  1 
ATOM   3479 C CG  . GLU C 3 149 ? 105.152 76.557 21.366  1.00 65.90  ? 129 GLU L CG  1 
ATOM   3480 C CD  . GLU C 3 149 ? 103.871 76.641 22.199  1.00 69.23  ? 129 GLU L CD  1 
ATOM   3481 O OE1 . GLU C 3 149 ? 103.003 77.497 21.911  1.00 61.47  ? 129 GLU L OE1 1 
ATOM   3482 O OE2 . GLU C 3 149 ? 103.735 75.842 23.153  1.00 70.13  ? 129 GLU L OE2 1 
ATOM   3483 N N   . GLN C 3 150 ? 103.715 77.982 17.214  1.00 62.89  ? 130 GLN L N   1 
ATOM   3484 C CA  . GLN C 3 150 ? 103.585 77.911 15.757  1.00 62.02  ? 130 GLN L CA  1 
ATOM   3485 C C   . GLN C 3 150 ? 103.822 79.273 15.107  1.00 62.82  ? 130 GLN L C   1 
ATOM   3486 O O   . GLN C 3 150 ? 104.360 79.363 13.991  1.00 59.41  ? 130 GLN L O   1 
ATOM   3487 C CB  . GLN C 3 150 ? 102.205 77.379 15.350  1.00 53.80  ? 130 GLN L CB  1 
ATOM   3488 C CG  . GLN C 3 150 ? 102.032 77.249 13.843  1.00 51.96  ? 130 GLN L CG  1 
ATOM   3489 C CD  . GLN C 3 150 ? 100.607 76.938 13.431  1.00 54.86  ? 130 GLN L CD  1 
ATOM   3490 O OE1 . GLN C 3 150 ? 99.674  77.084 14.219  1.00 55.34  ? 130 GLN L OE1 1 
ATOM   3491 N NE2 . GLN C 3 150 ? 100.433 76.505 12.186  1.00 52.43  ? 130 GLN L NE2 1 
ATOM   3492 N N   . LEU C 3 151 ? 103.406 80.325 15.810  1.00 60.59  ? 131 LEU L N   1 
ATOM   3493 C CA  . LEU C 3 151 ? 103.541 81.688 15.304  1.00 63.44  ? 131 LEU L CA  1 
ATOM   3494 C C   . LEU C 3 151 ? 104.997 82.142 15.339  1.00 62.02  ? 131 LEU L C   1 
ATOM   3495 O O   . LEU C 3 151 ? 105.384 83.051 14.610  1.00 67.01  ? 131 LEU L O   1 
ATOM   3496 C CB  . LEU C 3 151 ? 102.646 82.653 16.097  1.00 56.49  ? 131 LEU L CB  1 
ATOM   3497 C CG  . LEU C 3 151 ? 101.153 82.530 15.740  1.00 55.23  ? 131 LEU L CG  1 
ATOM   3498 C CD1 . LEU C 3 151 ? 100.235 83.055 16.840  1.00 50.24  ? 131 LEU L CD1 1 
ATOM   3499 C CD2 . LEU C 3 151 ? 100.836 83.220 14.413  1.00 51.12  ? 131 LEU L CD2 1 
ATOM   3500 N N   . THR C 3 152 ? 105.804 81.504 16.180  1.00 65.35  ? 132 THR L N   1 
ATOM   3501 C CA  . THR C 3 152 ? 107.230 81.795 16.191  1.00 67.10  ? 132 THR L CA  1 
ATOM   3502 C C   . THR C 3 152 ? 107.865 81.125 14.981  1.00 70.68  ? 132 THR L C   1 
ATOM   3503 O O   . THR C 3 152 ? 108.658 81.742 14.270  1.00 72.23  ? 132 THR L O   1 
ATOM   3504 C CB  . THR C 3 152 ? 107.943 81.323 17.489  1.00 67.01  ? 132 THR L CB  1 
ATOM   3505 O OG1 . THR C 3 152 ? 108.182 79.909 17.435  1.00 76.16  ? 132 THR L OG1 1 
ATOM   3506 C CG2 . THR C 3 152 ? 107.123 81.672 18.725  1.00 64.75  ? 132 THR L CG2 1 
ATOM   3507 N N   . SER C 3 153 ? 107.497 79.873 14.719  1.00 65.58  ? 133 SER L N   1 
ATOM   3508 C CA  . SER C 3 153 ? 108.069 79.171 13.577  1.00 65.04  ? 133 SER L CA  1 
ATOM   3509 C C   . SER C 3 153 ? 107.489 79.716 12.270  1.00 65.26  ? 133 SER L C   1 
ATOM   3510 O O   . SER C 3 153 ? 107.793 79.211 11.190  1.00 67.66  ? 133 SER L O   1 
ATOM   3511 C CB  . SER C 3 153 ? 107.849 77.658 13.688  1.00 67.36  ? 133 SER L CB  1 
ATOM   3512 O OG  . SER C 3 153 ? 106.495 77.303 13.470  1.00 68.20  ? 133 SER L OG  1 
ATOM   3513 N N   . GLY C 3 154 ? 106.655 80.749 12.373  1.00 63.82  ? 134 GLY L N   1 
ATOM   3514 C CA  . GLY C 3 154 ? 106.261 81.530 11.215  1.00 57.26  ? 134 GLY L CA  1 
ATOM   3515 C C   . GLY C 3 154 ? 104.971 81.153 10.514  1.00 67.22  ? 134 GLY L C   1 
ATOM   3516 O O   . GLY C 3 154 ? 104.692 81.642 9.414   1.00 64.65  ? 134 GLY L O   1 
ATOM   3517 N N   . GLY C 3 155 ? 104.171 80.293 11.134  1.00 68.48  ? 135 GLY L N   1 
ATOM   3518 C CA  . GLY C 3 155 ? 102.948 79.844 10.491  1.00 65.47  ? 135 GLY L CA  1 
ATOM   3519 C C   . GLY C 3 155 ? 101.706 80.085 11.316  1.00 58.36  ? 135 GLY L C   1 
ATOM   3520 O O   . GLY C 3 155 ? 101.799 80.462 12.489  1.00 57.34  ? 135 GLY L O   1 
ATOM   3521 N N   . ALA C 3 156 ? 100.540 79.859 10.712  1.00 51.37  ? 136 ALA L N   1 
ATOM   3522 C CA  . ALA C 3 156 ? 99.292  80.029 11.441  1.00 54.43  ? 136 ALA L CA  1 
ATOM   3523 C C   . ALA C 3 156 ? 98.186  79.062 11.007  1.00 53.30  ? 136 ALA L C   1 
ATOM   3524 O O   . ALA C 3 156 ? 97.683  79.133 9.881   1.00 53.35  ? 136 ALA L O   1 
ATOM   3525 C CB  . ALA C 3 156 ? 98.816  81.456 11.303  1.00 58.96  ? 136 ALA L CB  1 
ATOM   3526 N N   . SER C 3 157 ? 97.797  78.172 11.914  1.00 50.51  ? 137 SER L N   1 
ATOM   3527 C CA  . SER C 3 157 ? 96.679  77.266 11.656  1.00 48.84  ? 137 SER L CA  1 
ATOM   3528 C C   . SER C 3 157 ? 95.529  77.560 12.605  1.00 49.35  ? 137 SER L C   1 
ATOM   3529 O O   . SER C 3 157 ? 95.714  77.616 13.825  1.00 52.24  ? 137 SER L O   1 
ATOM   3530 C CB  . SER C 3 157 ? 97.108  75.803 11.800  1.00 46.41  ? 137 SER L CB  1 
ATOM   3531 O OG  . SER C 3 157 ? 98.220  75.493 10.974  1.00 48.97  ? 137 SER L OG  1 
ATOM   3532 N N   . VAL C 3 158 ? 94.343  77.761 12.050  1.00 44.33  ? 138 VAL L N   1 
ATOM   3533 C CA  . VAL C 3 158 ? 93.146  77.817 12.872  1.00 47.76  ? 138 VAL L CA  1 
ATOM   3534 C C   . VAL C 3 158 ? 92.464  76.448 12.842  1.00 45.34  ? 138 VAL L C   1 
ATOM   3535 O O   . VAL C 3 158 ? 92.156  75.939 11.766  1.00 42.95  ? 138 VAL L O   1 
ATOM   3536 C CB  . VAL C 3 158 ? 92.175  78.898 12.385  1.00 49.96  ? 138 VAL L CB  1 
ATOM   3537 C CG1 . VAL C 3 158 ? 91.310  79.365 13.532  1.00 50.46  ? 138 VAL L CG1 1 
ATOM   3538 C CG2 . VAL C 3 158 ? 92.942  80.067 11.798  1.00 51.94  ? 138 VAL L CG2 1 
ATOM   3539 N N   . VAL C 3 159 ? 92.232  75.854 14.011  1.00 41.48  ? 139 VAL L N   1 
ATOM   3540 C CA  . VAL C 3 159 ? 91.661  74.503 14.074  1.00 43.00  ? 139 VAL L CA  1 
ATOM   3541 C C   . VAL C 3 159 ? 90.240  74.463 14.650  1.00 47.31  ? 139 VAL L C   1 
ATOM   3542 O O   . VAL C 3 159 ? 89.955  75.073 15.682  1.00 48.68  ? 139 VAL L O   1 
ATOM   3543 C CB  . VAL C 3 159 ? 92.550  73.566 14.912  1.00 44.79  ? 139 VAL L CB  1 
ATOM   3544 C CG1 . VAL C 3 159 ? 91.841  72.240 15.188  1.00 35.21  ? 139 VAL L CG1 1 
ATOM   3545 C CG2 . VAL C 3 159 ? 93.896  73.357 14.229  1.00 43.09  ? 139 VAL L CG2 1 
ATOM   3546 N N   . CYS C 3 160 ? 89.353  73.730 13.986  1.00 45.10  ? 140 CYS L N   1 
ATOM   3547 C CA  . CYS C 3 160 ? 87.968  73.637 14.422  1.00 42.92  ? 140 CYS L CA  1 
ATOM   3548 C C   . CYS C 3 160 ? 87.556  72.180 14.604  1.00 41.75  ? 140 CYS L C   1 
ATOM   3549 O O   . CYS C 3 160 ? 87.631  71.385 13.673  1.00 42.84  ? 140 CYS L O   1 
ATOM   3550 C CB  . CYS C 3 160 ? 87.062  74.338 13.407  1.00 48.79  ? 140 CYS L CB  1 
ATOM   3551 S SG  . CYS C 3 160 ? 85.359  74.679 13.933  1.00 63.44  ? 140 CYS L SG  1 
ATOM   3552 N N   . PHE C 3 161 ? 87.143  71.812 15.808  1.00 43.51  ? 141 PHE L N   1 
ATOM   3553 C CA  . PHE C 3 161 ? 86.714  70.440 16.044  1.00 38.66  ? 141 PHE L CA  1 
ATOM   3554 C C   . PHE C 3 161 ? 85.192  70.331 16.027  1.00 41.28  ? 141 PHE L C   1 
ATOM   3555 O O   . PHE C 3 161 ? 84.496  71.145 16.638  1.00 40.48  ? 141 PHE L O   1 
ATOM   3556 C CB  . PHE C 3 161 ? 87.259  69.923 17.369  1.00 37.67  ? 141 PHE L CB  1 
ATOM   3557 C CG  . PHE C 3 161 ? 88.742  69.726 17.379  1.00 39.82  ? 141 PHE L CG  1 
ATOM   3558 C CD1 . PHE C 3 161 ? 89.342  68.815 16.526  1.00 40.30  ? 141 PHE L CD1 1 
ATOM   3559 C CD2 . PHE C 3 161 ? 89.541  70.431 18.261  1.00 38.80  ? 141 PHE L CD2 1 
ATOM   3560 C CE1 . PHE C 3 161 ? 90.706  68.638 16.536  1.00 33.80  ? 141 PHE L CE1 1 
ATOM   3561 C CE2 . PHE C 3 161 ? 90.905  70.240 18.284  1.00 37.35  ? 141 PHE L CE2 1 
ATOM   3562 C CZ  . PHE C 3 161 ? 91.486  69.349 17.422  1.00 33.88  ? 141 PHE L CZ  1 
ATOM   3563 N N   . LEU C 3 162 ? 84.686  69.329 15.312  1.00 38.12  ? 142 LEU L N   1 
ATOM   3564 C CA  . LEU C 3 162 ? 83.249  69.079 15.232  1.00 38.11  ? 142 LEU L CA  1 
ATOM   3565 C C   . LEU C 3 162 ? 83.027  67.674 15.703  1.00 34.79  ? 142 LEU L C   1 
ATOM   3566 O O   . LEU C 3 162 ? 83.155  66.722 14.927  1.00 35.92  ? 142 LEU L O   1 
ATOM   3567 C CB  . LEU C 3 162 ? 82.692  69.236 13.811  1.00 34.25  ? 142 LEU L CB  1 
ATOM   3568 C CG  . LEU C 3 162 ? 82.707  70.580 13.097  1.00 36.84  ? 142 LEU L CG  1 
ATOM   3569 C CD1 . LEU C 3 162 ? 84.096  70.911 12.652  1.00 40.87  ? 142 LEU L CD1 1 
ATOM   3570 C CD2 . LEU C 3 162 ? 81.827  70.493 11.894  1.00 40.45  ? 142 LEU L CD2 1 
ATOM   3571 N N   . ASN C 3 163 ? 82.688  67.545 16.975  1.00 33.98  ? 143 ASN L N   1 
ATOM   3572 C CA  . ASN C 3 163 ? 82.668  66.242 17.604  1.00 34.62  ? 143 ASN L CA  1 
ATOM   3573 C C   . ASN C 3 163 ? 81.277  65.686 17.871  1.00 35.91  ? 143 ASN L C   1 
ATOM   3574 O O   . ASN C 3 163 ? 80.334  66.416 18.202  1.00 38.82  ? 143 ASN L O   1 
ATOM   3575 C CB  . ASN C 3 163 ? 83.479  66.297 18.903  1.00 36.22  ? 143 ASN L CB  1 
ATOM   3576 C CG  . ASN C 3 163 ? 84.966  66.557 18.638  1.00 40.95  ? 143 ASN L CG  1 
ATOM   3577 O OD1 . ASN C 3 163 ? 85.466  66.207 17.572  1.00 36.41  ? 143 ASN L OD1 1 
ATOM   3578 N ND2 . ASN C 3 163 ? 85.667  67.169 19.597  1.00 39.28  ? 143 ASN L ND2 1 
ATOM   3579 N N   . ASN C 3 164 ? 81.168  64.380 17.672  1.00 35.06  ? 144 ASN L N   1 
ATOM   3580 C CA  . ASN C 3 164 ? 80.043  63.584 18.144  1.00 33.26  ? 144 ASN L CA  1 
ATOM   3581 C C   . ASN C 3 164 ? 78.733  63.988 17.517  1.00 33.52  ? 144 ASN L C   1 
ATOM   3582 O O   . ASN C 3 164 ? 77.755  64.301 18.189  1.00 35.14  ? 144 ASN L O   1 
ATOM   3583 C CB  . ASN C 3 164 ? 79.983  63.653 19.654  1.00 31.43  ? 144 ASN L CB  1 
ATOM   3584 C CG  . ASN C 3 164 ? 81.176  62.967 20.285  1.00 35.28  ? 144 ASN L CG  1 
ATOM   3585 O OD1 . ASN C 3 164 ? 82.177  63.601 20.614  1.00 37.17  ? 144 ASN L OD1 1 
ATOM   3586 N ND2 . ASN C 3 164 ? 81.089  61.656 20.421  1.00 36.12  ? 144 ASN L ND2 1 
ATOM   3587 N N   . PHE C 3 165 ? 78.752  63.969 16.195  1.00 32.80  ? 145 PHE L N   1 
ATOM   3588 C CA  . PHE C 3 165 ? 77.596  64.258 15.402  1.00 33.67  ? 145 PHE L CA  1 
ATOM   3589 C C   . PHE C 3 165 ? 77.213  63.021 14.585  1.00 34.84  ? 145 PHE L C   1 
ATOM   3590 O O   . PHE C 3 165 ? 77.995  62.068 14.442  1.00 29.01  ? 145 PHE L O   1 
ATOM   3591 C CB  . PHE C 3 165 ? 77.851  65.464 14.491  1.00 33.91  ? 145 PHE L CB  1 
ATOM   3592 C CG  . PHE C 3 165 ? 78.921  65.239 13.459  1.00 33.66  ? 145 PHE L CG  1 
ATOM   3593 C CD1 . PHE C 3 165 ? 80.236  65.614 13.712  1.00 31.88  ? 145 PHE L CD1 1 
ATOM   3594 C CD2 . PHE C 3 165 ? 78.609  64.679 12.223  1.00 38.11  ? 145 PHE L CD2 1 
ATOM   3595 C CE1 . PHE C 3 165 ? 81.228  65.428 12.758  1.00 34.59  ? 145 PHE L CE1 1 
ATOM   3596 C CE2 . PHE C 3 165 ? 79.590  64.478 11.266  1.00 38.72  ? 145 PHE L CE2 1 
ATOM   3597 C CZ  . PHE C 3 165 ? 80.914  64.859 11.537  1.00 37.28  ? 145 PHE L CZ  1 
ATOM   3598 N N   . TYR C 3 166 ? 75.988  63.061 14.075  1.00 36.95  ? 146 TYR L N   1 
ATOM   3599 C CA  . TYR C 3 166 ? 75.417  62.023 13.241  1.00 33.66  ? 146 TYR L CA  1 
ATOM   3600 C C   . TYR C 3 166 ? 74.299  62.669 12.435  1.00 36.60  ? 146 TYR L C   1 
ATOM   3601 O O   . TYR C 3 166 ? 73.527  63.456 12.993  1.00 35.43  ? 146 TYR L O   1 
ATOM   3602 C CB  . TYR C 3 166 ? 74.874  60.857 14.076  1.00 30.47  ? 146 TYR L CB  1 
ATOM   3603 C CG  . TYR C 3 166 ? 74.492  59.695 13.199  1.00 33.59  ? 146 TYR L CG  1 
ATOM   3604 C CD1 . TYR C 3 166 ? 73.227  59.615 12.619  1.00 32.59  ? 146 TYR L CD1 1 
ATOM   3605 C CD2 . TYR C 3 166 ? 75.421  58.718 12.884  1.00 32.88  ? 146 TYR L CD2 1 
ATOM   3606 C CE1 . TYR C 3 166 ? 72.903  58.577 11.772  1.00 33.95  ? 146 TYR L CE1 1 
ATOM   3607 C CE2 . TYR C 3 166 ? 75.100  57.679 12.058  1.00 36.11  ? 146 TYR L CE2 1 
ATOM   3608 C CZ  . TYR C 3 166 ? 73.844  57.604 11.506  1.00 31.15  ? 146 TYR L CZ  1 
ATOM   3609 O OH  . TYR C 3 166 ? 73.546  56.552 10.678  1.00 36.78  ? 146 TYR L OH  1 
ATOM   3610 N N   . PRO C 3 167 ? 74.202  62.350 11.129  1.00 38.69  ? 147 PRO L N   1 
ATOM   3611 C CA  . PRO C 3 167 ? 75.048  61.433 10.339  1.00 33.60  ? 147 PRO L CA  1 
ATOM   3612 C C   . PRO C 3 167 ? 76.377  62.014 9.813   1.00 39.97  ? 147 PRO L C   1 
ATOM   3613 O O   . PRO C 3 167 ? 76.638  63.212 9.942   1.00 39.14  ? 147 PRO L O   1 
ATOM   3614 C CB  . PRO C 3 167 ? 74.148  61.085 9.155   1.00 32.53  ? 147 PRO L CB  1 
ATOM   3615 C CG  . PRO C 3 167 ? 73.377  62.344 8.930   1.00 37.06  ? 147 PRO L CG  1 
ATOM   3616 C CD  . PRO C 3 167 ? 73.068  62.853 10.329  1.00 37.69  ? 147 PRO L CD  1 
ATOM   3617 N N   . LYS C 3 168 ? 77.173  61.133 9.200   1.00 38.52  ? 148 LYS L N   1 
ATOM   3618 C CA  . LYS C 3 168 ? 78.510  61.411 8.709   1.00 35.26  ? 148 LYS L CA  1 
ATOM   3619 C C   . LYS C 3 168 ? 78.626  62.731 7.930   1.00 40.05  ? 148 LYS L C   1 
ATOM   3620 O O   . LYS C 3 168 ? 79.577  63.495 8.104   1.00 41.64  ? 148 LYS L O   1 
ATOM   3621 C CB  . LYS C 3 168 ? 78.963  60.243 7.835   1.00 32.65  ? 148 LYS L CB  1 
ATOM   3622 N N   . ASP C 3 169 ? 77.638  63.009 7.096   1.00 37.72  ? 149 ASP L N   1 
ATOM   3623 C CA  . ASP C 3 169 ? 77.708  64.131 6.164   1.00 47.54  ? 149 ASP L CA  1 
ATOM   3624 C C   . ASP C 3 169 ? 77.535  65.474 6.852   1.00 48.49  ? 149 ASP L C   1 
ATOM   3625 O O   . ASP C 3 169 ? 76.463  65.796 7.340   1.00 52.97  ? 149 ASP L O   1 
ATOM   3626 C CB  . ASP C 3 169 ? 76.653  63.955 5.078   1.00 47.21  ? 149 ASP L CB  1 
ATOM   3627 C CG  . ASP C 3 169 ? 76.474  62.493 4.696   1.00 65.07  ? 149 ASP L CG  1 
ATOM   3628 O OD1 . ASP C 3 169 ? 77.294  61.989 3.889   1.00 70.69  ? 149 ASP L OD1 1 
ATOM   3629 O OD2 . ASP C 3 169 ? 75.545  61.837 5.235   1.00 59.81  ? 149 ASP L OD2 1 
ATOM   3630 N N   . ILE C 3 170 ? 78.607  66.249 6.898   1.00 49.55  ? 150 ILE L N   1 
ATOM   3631 C CA  . ILE C 3 170 ? 78.569  67.561 7.519   1.00 51.17  ? 150 ILE L CA  1 
ATOM   3632 C C   . ILE C 3 170 ? 79.395  68.510 6.671   1.00 55.89  ? 150 ILE L C   1 
ATOM   3633 O O   . ILE C 3 170 ? 80.228  68.080 5.865   1.00 54.10  ? 150 ILE L O   1 
ATOM   3634 C CB  . ILE C 3 170 ? 79.100  67.531 8.984   1.00 50.49  ? 150 ILE L CB  1 
ATOM   3635 C CG1 . ILE C 3 170 ? 78.708  68.806 9.743   1.00 48.66  ? 150 ILE L CG1 1 
ATOM   3636 C CG2 . ILE C 3 170 ? 80.604  67.320 9.013   1.00 42.09  ? 150 ILE L CG2 1 
ATOM   3637 C CD1 . ILE C 3 170 ? 78.826  68.684 11.236  1.00 41.75  ? 150 ILE L CD1 1 
ATOM   3638 N N   . ASN C 3 171 ? 79.148  69.801 6.839   1.00 57.02  ? 151 ASN L N   1 
ATOM   3639 C CA  . ASN C 3 171 ? 79.819  70.801 6.047   1.00 55.47  ? 151 ASN L CA  1 
ATOM   3640 C C   . ASN C 3 171 ? 80.358  71.896 6.938   1.00 55.00  ? 151 ASN L C   1 
ATOM   3641 O O   . ASN C 3 171 ? 79.731  72.277 7.933   1.00 54.35  ? 151 ASN L O   1 
ATOM   3642 C CB  . ASN C 3 171 ? 78.863  71.367 5.001   1.00 59.15  ? 151 ASN L CB  1 
ATOM   3643 C CG  . ASN C 3 171 ? 78.150  70.276 4.227   1.00 64.08  ? 151 ASN L CG  1 
ATOM   3644 O OD1 . ASN C 3 171 ? 76.936  70.079 4.369   1.00 67.27  ? 151 ASN L OD1 1 
ATOM   3645 N ND2 . ASN C 3 171 ? 78.906  69.541 3.416   1.00 67.18  ? 151 ASN L ND2 1 
ATOM   3646 N N   . VAL C 3 172 ? 81.537  72.384 6.577   1.00 56.52  ? 152 VAL L N   1 
ATOM   3647 C CA  . VAL C 3 172 ? 82.198  73.433 7.331   1.00 58.06  ? 152 VAL L CA  1 
ATOM   3648 C C   . VAL C 3 172 ? 82.485  74.614 6.436   1.00 57.78  ? 152 VAL L C   1 
ATOM   3649 O O   . VAL C 3 172 ? 83.194  74.487 5.436   1.00 55.44  ? 152 VAL L O   1 
ATOM   3650 C CB  . VAL C 3 172 ? 83.517  72.946 7.963   1.00 52.87  ? 152 VAL L CB  1 
ATOM   3651 C CG1 . VAL C 3 172 ? 83.227  72.142 9.181   1.00 52.92  ? 152 VAL L CG1 1 
ATOM   3652 C CG2 . VAL C 3 172 ? 84.318  72.124 6.973   1.00 55.48  ? 152 VAL L CG2 1 
ATOM   3653 N N   . LYS C 3 173 ? 81.911  75.760 6.784   1.00 59.45  ? 153 LYS L N   1 
ATOM   3654 C CA  . LYS C 3 173 ? 82.273  77.001 6.122   1.00 60.50  ? 153 LYS L CA  1 
ATOM   3655 C C   . LYS C 3 173 ? 83.207  77.779 7.036   1.00 57.87  ? 153 LYS L C   1 
ATOM   3656 O O   . LYS C 3 173 ? 82.829  78.178 8.135   1.00 58.55  ? 153 LYS L O   1 
ATOM   3657 C CB  . LYS C 3 173 ? 81.036  77.830 5.766   1.00 60.05  ? 153 LYS L CB  1 
ATOM   3658 N N   . TRP C 3 174 ? 84.441  77.956 6.589   1.00 55.86  ? 154 TRP L N   1 
ATOM   3659 C CA  . TRP C 3 174 ? 85.369  78.838 7.277   1.00 61.68  ? 154 TRP L CA  1 
ATOM   3660 C C   . TRP C 3 174 ? 85.173  80.274 6.801   1.00 71.91  ? 154 TRP L C   1 
ATOM   3661 O O   . TRP C 3 174 ? 85.502  80.608 5.656   1.00 75.42  ? 154 TRP L O   1 
ATOM   3662 C CB  . TRP C 3 174 ? 86.815  78.420 7.035   1.00 62.84  ? 154 TRP L CB  1 
ATOM   3663 C CG  . TRP C 3 174 ? 87.337  77.341 7.929   1.00 58.95  ? 154 TRP L CG  1 
ATOM   3664 C CD1 . TRP C 3 174 ? 87.440  76.020 7.630   1.00 53.84  ? 154 TRP L CD1 1 
ATOM   3665 C CD2 . TRP C 3 174 ? 87.869  77.496 9.255   1.00 57.45  ? 154 TRP L CD2 1 
ATOM   3666 N NE1 . TRP C 3 174 ? 87.994  75.337 8.684   1.00 55.10  ? 154 TRP L NE1 1 
ATOM   3667 C CE2 . TRP C 3 174 ? 88.264  76.220 9.696   1.00 56.35  ? 154 TRP L CE2 1 
ATOM   3668 C CE3 . TRP C 3 174 ? 88.043  78.585 10.110  1.00 52.76  ? 154 TRP L CE3 1 
ATOM   3669 C CZ2 . TRP C 3 174 ? 88.822  76.005 10.959  1.00 52.31  ? 154 TRP L CZ2 1 
ATOM   3670 C CZ3 . TRP C 3 174 ? 88.593  78.368 11.357  1.00 50.66  ? 154 TRP L CZ3 1 
ATOM   3671 C CH2 . TRP C 3 174 ? 88.977  77.093 11.771  1.00 49.52  ? 154 TRP L CH2 1 
ATOM   3672 N N   . LYS C 3 175 ? 84.640  81.121 7.676   1.00 67.31  ? 155 LYS L N   1 
ATOM   3673 C CA  . LYS C 3 175 ? 84.451  82.521 7.339   1.00 66.74  ? 155 LYS L CA  1 
ATOM   3674 C C   . LYS C 3 175 ? 85.532  83.377 7.982   1.00 70.51  ? 155 LYS L C   1 
ATOM   3675 O O   . LYS C 3 175 ? 85.703  83.376 9.203   1.00 65.41  ? 155 LYS L O   1 
ATOM   3676 C CB  . LYS C 3 175 ? 83.063  82.996 7.771   1.00 68.69  ? 155 LYS L CB  1 
ATOM   3677 N N   . ILE C 3 176 ? 86.287  84.074 7.137   1.00 77.36  ? 156 ILE L N   1 
ATOM   3678 C CA  . ILE C 3 176 ? 87.185  85.142 7.571   1.00 76.06  ? 156 ILE L CA  1 
ATOM   3679 C C   . ILE C 3 176 ? 86.573  86.471 7.152   1.00 85.31  ? 156 ILE L C   1 
ATOM   3680 O O   . ILE C 3 176 ? 86.579  86.805 5.964   1.00 85.73  ? 156 ILE L O   1 
ATOM   3681 C CB  . ILE C 3 176 ? 88.590  85.022 6.954   1.00 76.21  ? 156 ILE L CB  1 
ATOM   3682 C CG1 . ILE C 3 176 ? 89.287  83.745 7.419   1.00 72.07  ? 156 ILE L CG1 1 
ATOM   3683 C CG2 . ILE C 3 176 ? 89.434  86.240 7.306   1.00 77.06  ? 156 ILE L CG2 1 
ATOM   3684 C CD1 . ILE C 3 176 ? 90.615  83.500 6.736   1.00 62.66  ? 156 ILE L CD1 1 
ATOM   3685 N N   . ASP C 3 177 ? 86.031  87.210 8.119   1.00 84.51  ? 157 ASP L N   1 
ATOM   3686 C CA  . ASP C 3 177 ? 85.342  88.471 7.845   1.00 82.99  ? 157 ASP L CA  1 
ATOM   3687 C C   . ASP C 3 177 ? 84.170  88.282 6.898   1.00 84.65  ? 157 ASP L C   1 
ATOM   3688 O O   . ASP C 3 177 ? 84.101  88.927 5.852   1.00 92.38  ? 157 ASP L O   1 
ATOM   3689 C CB  . ASP C 3 177 ? 86.311  89.496 7.262   1.00 82.66  ? 157 ASP L CB  1 
ATOM   3690 C CG  . ASP C 3 177 ? 87.517  89.677 8.122   1.00 85.24  ? 157 ASP L CG  1 
ATOM   3691 O OD1 . ASP C 3 177 ? 87.369  89.387 9.322   1.00 87.50  ? 157 ASP L OD1 1 
ATOM   3692 O OD2 . ASP C 3 177 ? 88.590  90.083 7.617   1.00 85.01  ? 157 ASP L OD2 1 
ATOM   3693 N N   . GLY C 3 178 ? 83.260  87.382 7.251   1.00 81.40  ? 158 GLY L N   1 
ATOM   3694 C CA  . GLY C 3 178 ? 82.071  87.143 6.453   1.00 82.46  ? 158 GLY L CA  1 
ATOM   3695 C C   . GLY C 3 178 ? 82.328  86.549 5.078   1.00 85.69  ? 158 GLY L C   1 
ATOM   3696 O O   . GLY C 3 178 ? 81.399  86.056 4.435   1.00 83.07  ? 158 GLY L O   1 
ATOM   3697 N N   . SER C 3 179 ? 83.582  86.597 4.626   1.00 85.62  ? 159 SER L N   1 
ATOM   3698 C CA  . SER C 3 179 ? 83.970  86.069 3.319   1.00 83.44  ? 159 SER L CA  1 
ATOM   3699 C C   . SER C 3 179 ? 84.502  84.640 3.427   1.00 84.61  ? 159 SER L C   1 
ATOM   3700 O O   . SER C 3 179 ? 85.494  84.392 4.116   1.00 83.37  ? 159 SER L O   1 
ATOM   3701 C CB  . SER C 3 179 ? 85.021  86.969 2.675   1.00 82.85  ? 159 SER L CB  1 
ATOM   3702 O OG  . SER C 3 179 ? 86.161  87.069 3.507   1.00 85.20  ? 159 SER L OG  1 
ATOM   3703 N N   . GLU C 3 180 ? 83.832  83.709 2.748   1.00 83.55  ? 160 GLU L N   1 
ATOM   3704 C CA  . GLU C 3 180 ? 84.189  82.298 2.803   1.00 78.56  ? 160 GLU L CA  1 
ATOM   3705 C C   . GLU C 3 180 ? 85.630  82.086 2.366   1.00 81.90  ? 160 GLU L C   1 
ATOM   3706 O O   . GLU C 3 180 ? 86.074  82.625 1.352   1.00 82.96  ? 160 GLU L O   1 
ATOM   3707 C CB  . GLU C 3 180 ? 83.246  81.466 1.931   1.00 75.42  ? 160 GLU L CB  1 
ATOM   3708 N N   . ARG C 3 181 ? 86.369  81.326 3.161   1.00 79.30  ? 161 ARG L N   1 
ATOM   3709 C CA  . ARG C 3 181 ? 87.685  80.873 2.754   1.00 78.16  ? 161 ARG L CA  1 
ATOM   3710 C C   . ARG C 3 181 ? 87.580  79.386 2.471   1.00 80.36  ? 161 ARG L C   1 
ATOM   3711 O O   . ARG C 3 181 ? 87.068  78.624 3.294   1.00 79.13  ? 161 ARG L O   1 
ATOM   3712 C CB  . ARG C 3 181 ? 88.737  81.160 3.829   1.00 78.60  ? 161 ARG L CB  1 
ATOM   3713 C CG  . ARG C 3 181 ? 90.161  80.719 3.460   1.00 79.32  ? 161 ARG L CG  1 
ATOM   3714 C CD  . ARG C 3 181 ? 90.771  81.557 2.338   1.00 76.76  ? 161 ARG L CD  1 
ATOM   3715 N NE  . ARG C 3 181 ? 90.716  82.987 2.634   1.00 91.27  ? 161 ARG L NE  1 
ATOM   3716 C CZ  . ARG C 3 181 ? 91.017  83.950 1.765   1.00 96.41  ? 161 ARG L CZ  1 
ATOM   3717 N NH1 . ARG C 3 181 ? 91.406  83.637 0.535   1.00 101.46 ? 161 ARG L NH1 1 
ATOM   3718 N NH2 . ARG C 3 181 ? 90.928  85.226 2.126   1.00 89.90  ? 161 ARG L NH2 1 
ATOM   3719 N N   . GLN C 3 182 ? 88.036  78.974 1.295   1.00 78.26  ? 162 GLN L N   1 
ATOM   3720 C CA  . GLN C 3 182 ? 87.928  77.580 0.911   1.00 75.00  ? 162 GLN L CA  1 
ATOM   3721 C C   . GLN C 3 182 ? 89.277  76.985 0.532   1.00 75.93  ? 162 GLN L C   1 
ATOM   3722 O O   . GLN C 3 182 ? 89.360  75.805 0.190   1.00 78.95  ? 162 GLN L O   1 
ATOM   3723 C CB  . GLN C 3 182 ? 86.930  77.428 -0.235  1.00 72.71  ? 162 GLN L CB  1 
ATOM   3724 C CG  . GLN C 3 182 ? 85.517  77.811 0.167   1.00 77.63  ? 162 GLN L CG  1 
ATOM   3725 C CD  . GLN C 3 182 ? 84.492  77.531 -0.909  1.00 77.14  ? 162 GLN L CD  1 
ATOM   3726 O OE1 . GLN C 3 182 ? 84.768  76.834 -1.887  1.00 83.28  ? 162 GLN L OE1 1 
ATOM   3727 N NE2 . GLN C 3 182 ? 83.298  78.076 -0.734  1.00 68.84  ? 162 GLN L NE2 1 
ATOM   3728 N N   . ASN C 3 183 ? 90.337  77.787 0.605   1.00 74.38  ? 163 ASN L N   1 
ATOM   3729 C CA  . ASN C 3 183 ? 91.682  77.259 0.369   1.00 75.78  ? 163 ASN L CA  1 
ATOM   3730 C C   . ASN C 3 183 ? 92.605  77.397 1.587   1.00 72.49  ? 163 ASN L C   1 
ATOM   3731 O O   . ASN C 3 183 ? 92.619  78.416 2.285   1.00 64.72  ? 163 ASN L O   1 
ATOM   3732 C CB  . ASN C 3 183 ? 92.318  77.922 -0.859  1.00 78.56  ? 163 ASN L CB  1 
ATOM   3733 C CG  . ASN C 3 183 ? 92.393  79.431 -0.745  1.00 82.03  ? 163 ASN L CG  1 
ATOM   3734 O OD1 . ASN C 3 183 ? 91.439  80.083 -0.312  1.00 84.91  ? 163 ASN L OD1 1 
ATOM   3735 N ND2 . ASN C 3 183 ? 93.533  79.998 -1.140  1.00 78.92  ? 163 ASN L ND2 1 
ATOM   3736 N N   . GLY C 3 184 ? 93.376  76.347 1.833   1.00 71.05  ? 164 GLY L N   1 
ATOM   3737 C CA  . GLY C 3 184 ? 94.150  76.245 3.053   1.00 69.89  ? 164 GLY L CA  1 
ATOM   3738 C C   . GLY C 3 184 ? 93.422  75.410 4.096   1.00 62.26  ? 164 GLY L C   1 
ATOM   3739 O O   . GLY C 3 184 ? 94.014  75.006 5.098   1.00 63.62  ? 164 GLY L O   1 
ATOM   3740 N N   . VAL C 3 185 ? 92.140  75.144 3.863   1.00 54.00  ? 165 VAL L N   1 
ATOM   3741 C CA  . VAL C 3 185 ? 91.344  74.401 4.830   1.00 57.29  ? 165 VAL L CA  1 
ATOM   3742 C C   . VAL C 3 185 ? 91.358  72.916 4.513   1.00 59.34  ? 165 VAL L C   1 
ATOM   3743 O O   . VAL C 3 185 ? 91.008  72.518 3.406   1.00 58.50  ? 165 VAL L O   1 
ATOM   3744 C CB  . VAL C 3 185 ? 89.888  74.905 4.877   1.00 57.28  ? 165 VAL L CB  1 
ATOM   3745 C CG1 . VAL C 3 185 ? 89.415  75.291 3.496   1.00 71.44  ? 165 VAL L CG1 1 
ATOM   3746 C CG2 . VAL C 3 185 ? 88.970  73.851 5.481   1.00 56.96  ? 165 VAL L CG2 1 
ATOM   3747 N N   . LEU C 3 186 ? 91.783  72.110 5.491   1.00 59.49  ? 166 LEU L N   1 
ATOM   3748 C CA  . LEU C 3 186 ? 91.832  70.646 5.359   1.00 52.68  ? 166 LEU L CA  1 
ATOM   3749 C C   . LEU C 3 186 ? 90.851  69.981 6.302   1.00 50.32  ? 166 LEU L C   1 
ATOM   3750 O O   . LEU C 3 186 ? 90.608  70.471 7.406   1.00 52.12  ? 166 LEU L O   1 
ATOM   3751 C CB  . LEU C 3 186 ? 93.237  70.104 5.632   1.00 51.57  ? 166 LEU L CB  1 
ATOM   3752 C CG  . LEU C 3 186 ? 94.285  70.543 4.618   1.00 59.81  ? 166 LEU L CG  1 
ATOM   3753 C CD1 . LEU C 3 186 ? 93.635  70.670 3.255   1.00 66.48  ? 166 LEU L CD1 1 
ATOM   3754 C CD2 . LEU C 3 186 ? 94.919  71.855 5.035   1.00 66.51  ? 166 LEU L CD2 1 
ATOM   3755 N N   . ASN C 3 187 ? 90.304  68.851 5.876   1.00 44.38  ? 167 ASN L N   1 
ATOM   3756 C CA  . ASN C 3 187 ? 89.307  68.158 6.673   1.00 42.85  ? 167 ASN L CA  1 
ATOM   3757 C C   . ASN C 3 187 ? 89.610  66.680 6.832   1.00 42.97  ? 167 ASN L C   1 
ATOM   3758 O O   . ASN C 3 187 ? 90.172  66.046 5.932   1.00 43.42  ? 167 ASN L O   1 
ATOM   3759 C CB  . ASN C 3 187 ? 87.931  68.337 6.053   1.00 41.53  ? 167 ASN L CB  1 
ATOM   3760 C CG  . ASN C 3 187 ? 87.509  69.776 6.010   1.00 43.47  ? 167 ASN L CG  1 
ATOM   3761 O OD1 . ASN C 3 187 ? 87.546  70.467 7.019   1.00 48.27  ? 167 ASN L OD1 1 
ATOM   3762 N ND2 . ASN C 3 187 ? 87.131  70.250 4.836   1.00 47.35  ? 167 ASN L ND2 1 
ATOM   3763 N N   . SER C 3 188 ? 89.214  66.134 7.978   1.00 40.40  ? 168 SER L N   1 
ATOM   3764 C CA  . SER C 3 188 ? 89.505  64.746 8.321   1.00 37.86  ? 168 SER L CA  1 
ATOM   3765 C C   . SER C 3 188 ? 88.429  64.166 9.249   1.00 35.79  ? 168 SER L C   1 
ATOM   3766 O O   . SER C 3 188 ? 88.183  64.715 10.319  1.00 35.71  ? 168 SER L O   1 
ATOM   3767 C CB  . SER C 3 188 ? 90.889  64.663 8.976   1.00 31.44  ? 168 SER L CB  1 
ATOM   3768 O OG  . SER C 3 188 ? 91.166  63.364 9.458   1.00 35.72  ? 168 SER L OG  1 
ATOM   3769 N N   . TRP C 3 189 ? 87.797  63.065 8.839   1.00 34.70  ? 169 TRP L N   1 
ATOM   3770 C CA  . TRP C 3 189 ? 86.782  62.384 9.661   1.00 34.82  ? 169 TRP L CA  1 
ATOM   3771 C C   . TRP C 3 189 ? 87.315  61.166 10.383  1.00 31.66  ? 169 TRP L C   1 
ATOM   3772 O O   . TRP C 3 189 ? 87.995  60.345 9.788   1.00 32.44  ? 169 TRP L O   1 
ATOM   3773 C CB  . TRP C 3 189 ? 85.605  61.892 8.813   1.00 42.22  ? 169 TRP L CB  1 
ATOM   3774 C CG  . TRP C 3 189 ? 84.621  62.917 8.358   1.00 46.12  ? 169 TRP L CG  1 
ATOM   3775 C CD1 . TRP C 3 189 ? 83.307  63.033 8.748   1.00 42.17  ? 169 TRP L CD1 1 
ATOM   3776 C CD2 . TRP C 3 189 ? 84.847  63.941 7.394   1.00 43.53  ? 169 TRP L CD2 1 
ATOM   3777 N NE1 . TRP C 3 189 ? 82.713  64.079 8.088   1.00 49.80  ? 169 TRP L NE1 1 
ATOM   3778 C CE2 . TRP C 3 189 ? 83.634  64.655 7.251   1.00 48.89  ? 169 TRP L CE2 1 
ATOM   3779 C CE3 . TRP C 3 189 ? 85.956  64.328 6.637   1.00 42.63  ? 169 TRP L CE3 1 
ATOM   3780 C CZ2 . TRP C 3 189 ? 83.505  65.738 6.390   1.00 46.83  ? 169 TRP L CZ2 1 
ATOM   3781 C CZ3 . TRP C 3 189 ? 85.828  65.404 5.778   1.00 42.60  ? 169 TRP L CZ3 1 
ATOM   3782 C CH2 . TRP C 3 189 ? 84.612  66.095 5.661   1.00 53.35  ? 169 TRP L CH2 1 
ATOM   3783 N N   . THR C 3 190 ? 86.957  61.013 11.647  1.00 32.20  ? 170 THR L N   1 
ATOM   3784 C CA  . THR C 3 190 ? 87.141  59.735 12.311  1.00 35.72  ? 170 THR L CA  1 
ATOM   3785 C C   . THR C 3 190 ? 86.275  58.647 11.658  1.00 35.29  ? 170 THR L C   1 
ATOM   3786 O O   . THR C 3 190 ? 85.333  58.932 10.902  1.00 30.45  ? 170 THR L O   1 
ATOM   3787 C CB  . THR C 3 190 ? 86.772  59.801 13.805  1.00 33.56  ? 170 THR L CB  1 
ATOM   3788 O OG1 . THR C 3 190 ? 85.347  59.877 13.933  1.00 34.44  ? 170 THR L OG1 1 
ATOM   3789 C CG2 . THR C 3 190 ? 87.428  61.007 14.478  1.00 33.98  ? 170 THR L CG2 1 
ATOM   3790 N N   . ASP C 3 191 ? 86.615  57.397 11.945  1.00 35.07  ? 171 ASP L N   1 
ATOM   3791 C CA  . ASP C 3 191 ? 85.655  56.316 11.813  1.00 34.07  ? 171 ASP L CA  1 
ATOM   3792 C C   . ASP C 3 191 ? 84.539  56.495 12.839  1.00 33.22  ? 171 ASP L C   1 
ATOM   3793 O O   . ASP C 3 191 ? 84.628  57.322 13.742  1.00 34.66  ? 171 ASP L O   1 
ATOM   3794 C CB  . ASP C 3 191 ? 86.326  54.960 11.998  1.00 33.73  ? 171 ASP L CB  1 
ATOM   3795 C CG  . ASP C 3 191 ? 87.015  54.480 10.746  1.00 34.84  ? 171 ASP L CG  1 
ATOM   3796 O OD1 . ASP C 3 191 ? 86.386  54.458 9.671   1.00 46.38  ? 171 ASP L OD1 1 
ATOM   3797 O OD2 . ASP C 3 191 ? 88.196  54.129 10.829  1.00 42.09  ? 171 ASP L OD2 1 
ATOM   3798 N N   . GLN C 3 192 ? 83.479  55.718 12.686  1.00 37.79  ? 172 GLN L N   1 
ATOM   3799 C CA  . GLN C 3 192 ? 82.374  55.739 13.627  1.00 30.18  ? 172 GLN L CA  1 
ATOM   3800 C C   . GLN C 3 192 ? 82.788  55.228 15.005  1.00 29.44  ? 172 GLN L C   1 
ATOM   3801 O O   . GLN C 3 192 ? 83.497  54.238 15.128  1.00 33.89  ? 172 GLN L O   1 
ATOM   3802 C CB  . GLN C 3 192 ? 81.214  54.921 13.075  1.00 27.87  ? 172 GLN L CB  1 
ATOM   3803 C CG  . GLN C 3 192 ? 79.901  55.213 13.766  1.00 32.31  ? 172 GLN L CG  1 
ATOM   3804 C CD  . GLN C 3 192 ? 78.724  54.444 13.159  1.00 35.34  ? 172 GLN L CD  1 
ATOM   3805 O OE1 . GLN C 3 192 ? 78.907  53.489 12.397  1.00 31.23  ? 172 GLN L OE1 1 
ATOM   3806 N NE2 . GLN C 3 192 ? 77.511  54.868 13.492  1.00 33.10  ? 172 GLN L NE2 1 
ATOM   3807 N N   . ASP C 3 193 ? 82.332  55.920 16.038  1.00 31.99  ? 173 ASP L N   1 
ATOM   3808 C CA  . ASP C 3 193 ? 82.568  55.543 17.419  1.00 25.51  ? 173 ASP L CA  1 
ATOM   3809 C C   . ASP C 3 193 ? 81.949  54.202 17.779  1.00 31.96  ? 173 ASP L C   1 
ATOM   3810 O O   . ASP C 3 193 ? 80.771  53.957 17.515  1.00 31.95  ? 173 ASP L O   1 
ATOM   3811 C CB  . ASP C 3 193 ? 82.008  56.607 18.335  1.00 26.10  ? 173 ASP L CB  1 
ATOM   3812 C CG  . ASP C 3 193 ? 82.582  56.537 19.717  1.00 31.23  ? 173 ASP L CG  1 
ATOM   3813 O OD1 . ASP C 3 193 ? 83.650  57.145 19.921  1.00 40.05  ? 173 ASP L OD1 1 
ATOM   3814 O OD2 . ASP C 3 193 ? 81.981  55.894 20.607  1.00 33.03  ? 173 ASP L OD2 1 
ATOM   3815 N N   . SER C 3 194 ? 82.733  53.336 18.412  1.00 38.35  ? 174 SER L N   1 
ATOM   3816 C CA  . SER C 3 194 ? 82.254  52.001 18.757  1.00 32.51  ? 174 SER L CA  1 
ATOM   3817 C C   . SER C 3 194 ? 81.320  51.995 19.964  1.00 32.81  ? 174 SER L C   1 
ATOM   3818 O O   . SER C 3 194 ? 80.754  50.963 20.286  1.00 35.94  ? 174 SER L O   1 
ATOM   3819 C CB  . SER C 3 194 ? 83.422  51.059 19.027  1.00 32.00  ? 174 SER L CB  1 
ATOM   3820 O OG  . SER C 3 194 ? 84.011  51.315 20.285  1.00 34.59  ? 174 SER L OG  1 
ATOM   3821 N N   . LYS C 3 195 ? 81.140  53.137 20.623  1.00 36.64  ? 175 LYS L N   1 
ATOM   3822 C CA  . LYS C 3 195 ? 80.238  53.182 21.776  1.00 38.36  ? 175 LYS L CA  1 
ATOM   3823 C C   . LYS C 3 195 ? 79.003  54.058 21.578  1.00 34.58  ? 175 LYS L C   1 
ATOM   3824 O O   . LYS C 3 195 ? 77.885  53.596 21.796  1.00 37.15  ? 175 LYS L O   1 
ATOM   3825 C CB  . LYS C 3 195 ? 81.003  53.619 23.022  1.00 42.79  ? 175 LYS L CB  1 
ATOM   3826 C CG  . LYS C 3 195 ? 81.920  52.515 23.522  1.00 46.30  ? 175 LYS L CG  1 
ATOM   3827 C CD  . LYS C 3 195 ? 82.774  52.941 24.693  1.00 55.46  ? 175 LYS L CD  1 
ATOM   3828 C CE  . LYS C 3 195 ? 83.735  51.816 25.083  1.00 73.62  ? 175 LYS L CE  1 
ATOM   3829 N NZ  . LYS C 3 195 ? 84.695  52.218 26.152  1.00 84.09  ? 175 LYS L NZ  1 
ATOM   3830 N N   . ASP C 3 196 ? 79.168  55.307 21.164  1.00 36.64  ? 176 ASP L N   1 
ATOM   3831 C CA  . ASP C 3 196 ? 77.988  56.143 21.010  1.00 27.53  ? 176 ASP L CA  1 
ATOM   3832 C C   . ASP C 3 196 ? 77.567  56.236 19.539  1.00 33.41  ? 176 ASP L C   1 
ATOM   3833 O O   . ASP C 3 196 ? 76.556  56.861 19.213  1.00 32.05  ? 176 ASP L O   1 
ATOM   3834 C CB  . ASP C 3 196 ? 78.224  57.520 21.641  1.00 27.47  ? 176 ASP L CB  1 
ATOM   3835 C CG  . ASP C 3 196 ? 79.061  58.467 20.779  1.00 38.99  ? 176 ASP L CG  1 
ATOM   3836 O OD1 . ASP C 3 196 ? 79.668  58.064 19.763  1.00 36.82  ? 176 ASP L OD1 1 
ATOM   3837 O OD2 . ASP C 3 196 ? 79.111  59.664 21.145  1.00 42.35  ? 176 ASP L OD2 1 
ATOM   3838 N N   . SER C 3 197 ? 78.347  55.599 18.662  1.00 32.55  ? 177 SER L N   1 
ATOM   3839 C CA  . SER C 3 197 ? 78.023  55.503 17.229  1.00 35.31  ? 177 SER L CA  1 
ATOM   3840 C C   . SER C 3 197 ? 78.063  56.829 16.453  1.00 33.43  ? 177 SER L C   1 
ATOM   3841 O O   . SER C 3 197 ? 77.452  56.925 15.387  1.00 31.81  ? 177 SER L O   1 
ATOM   3842 C CB  . SER C 3 197 ? 76.631  54.867 17.027  1.00 34.52  ? 177 SER L CB  1 
ATOM   3843 O OG  . SER C 3 197 ? 76.517  53.627 17.700  1.00 34.89  ? 177 SER L OG  1 
ATOM   3844 N N   . THR C 3 198 ? 78.764  57.844 16.963  1.00 35.89  ? 178 THR L N   1 
ATOM   3845 C CA  . THR C 3 198 ? 78.837  59.129 16.247  1.00 33.26  ? 178 THR L CA  1 
ATOM   3846 C C   . THR C 3 198 ? 80.063  59.188 15.362  1.00 33.27  ? 178 THR L C   1 
ATOM   3847 O O   . THR C 3 198 ? 80.844  58.244 15.309  1.00 35.05  ? 178 THR L O   1 
ATOM   3848 C CB  . THR C 3 198 ? 78.867  60.358 17.205  1.00 32.77  ? 178 THR L CB  1 
ATOM   3849 O OG1 . THR C 3 198 ? 79.836  60.166 18.235  1.00 27.16  ? 178 THR L OG1 1 
ATOM   3850 C CG2 . THR C 3 198 ? 77.522  60.564 17.855  1.00 33.13  ? 178 THR L CG2 1 
ATOM   3851 N N   . TYR C 3 199 ? 80.212  60.300 14.652  1.00 33.81  ? 179 TYR L N   1 
ATOM   3852 C CA  . TYR C 3 199 ? 81.446  60.622 13.943  1.00 30.73  ? 179 TYR L CA  1 
ATOM   3853 C C   . TYR C 3 199 ? 82.003  61.893 14.527  1.00 32.41  ? 179 TYR L C   1 
ATOM   3854 O O   . TYR C 3 199 ? 81.270  62.687 15.098  1.00 35.28  ? 179 TYR L O   1 
ATOM   3855 C CB  . TYR C 3 199 ? 81.207  60.796 12.439  1.00 34.43  ? 179 TYR L CB  1 
ATOM   3856 C CG  . TYR C 3 199 ? 80.645  59.570 11.766  1.00 35.87  ? 179 TYR L CG  1 
ATOM   3857 C CD1 . TYR C 3 199 ? 79.272  59.356 11.728  1.00 31.46  ? 179 TYR L CD1 1 
ATOM   3858 C CD2 . TYR C 3 199 ? 81.485  58.608 11.189  1.00 34.68  ? 179 TYR L CD2 1 
ATOM   3859 C CE1 . TYR C 3 199 ? 78.740  58.228 11.144  1.00 33.97  ? 179 TYR L CE1 1 
ATOM   3860 C CE2 . TYR C 3 199 ? 80.952  57.469 10.575  1.00 32.71  ? 179 TYR L CE2 1 
ATOM   3861 C CZ  . TYR C 3 199 ? 79.576  57.287 10.563  1.00 37.40  ? 179 TYR L CZ  1 
ATOM   3862 O OH  . TYR C 3 199 ? 79.006  56.170 9.974   1.00 39.61  ? 179 TYR L OH  1 
ATOM   3863 N N   . SER C 3 200 ? 83.305  62.095 14.404  1.00 38.84  ? 180 SER L N   1 
ATOM   3864 C CA  . SER C 3 200 ? 83.868  63.408 14.705  1.00 39.77  ? 180 SER L CA  1 
ATOM   3865 C C   . SER C 3 200 ? 84.662  63.914 13.515  1.00 38.96  ? 180 SER L C   1 
ATOM   3866 O O   . SER C 3 200 ? 84.947  63.172 12.577  1.00 35.79  ? 180 SER L O   1 
ATOM   3867 C CB  . SER C 3 200 ? 84.735  63.367 15.955  1.00 34.80  ? 180 SER L CB  1 
ATOM   3868 O OG  . SER C 3 200 ? 83.929  63.282 17.112  1.00 39.37  ? 180 SER L OG  1 
ATOM   3869 N N   . MET C 3 201 ? 85.021  65.184 13.542  1.00 38.78  ? 181 MET L N   1 
ATOM   3870 C CA  . MET C 3 201 ? 85.653  65.736 12.371  1.00 38.41  ? 181 MET L CA  1 
ATOM   3871 C C   . MET C 3 201 ? 86.518  66.948 12.727  1.00 40.19  ? 181 MET L C   1 
ATOM   3872 O O   . MET C 3 201 ? 86.160  67.757 13.593  1.00 36.97  ? 181 MET L O   1 
ATOM   3873 C CB  . MET C 3 201 ? 84.572  66.088 11.346  1.00 40.17  ? 181 MET L CB  1 
ATOM   3874 C CG  . MET C 3 201 ? 85.066  66.544 10.010  1.00 45.05  ? 181 MET L CG  1 
ATOM   3875 S SD  . MET C 3 201 ? 85.160  68.328 10.002  1.00 62.50  ? 181 MET L SD  1 
ATOM   3876 C CE  . MET C 3 201 ? 85.152  68.618 8.249   1.00 50.88  ? 181 MET L CE  1 
ATOM   3877 N N   . SER C 3 202 ? 87.657  67.039 12.044  1.00 34.80  ? 182 SER L N   1 
ATOM   3878 C CA  . SER C 3 202 ? 88.655  68.066 12.266  1.00 36.77  ? 182 SER L CA  1 
ATOM   3879 C C   . SER C 3 202 ? 88.828  68.929 11.025  1.00 40.04  ? 182 SER L C   1 
ATOM   3880 O O   . SER C 3 202 ? 89.037  68.416 9.925   1.00 39.09  ? 182 SER L O   1 
ATOM   3881 C CB  . SER C 3 202 ? 89.987  67.435 12.638  1.00 29.69  ? 182 SER L CB  1 
ATOM   3882 O OG  . SER C 3 202 ? 90.860  68.415 13.137  1.00 39.53  ? 182 SER L OG  1 
ATOM   3883 N N   . SER C 3 203 ? 88.746  70.237 11.217  1.00 36.23  ? 183 SER L N   1 
ATOM   3884 C CA  . SER C 3 203 ? 88.885  71.194 10.131  1.00 44.82  ? 183 SER L CA  1 
ATOM   3885 C C   . SER C 3 203 ? 89.994  72.204 10.443  1.00 47.53  ? 183 SER L C   1 
ATOM   3886 O O   . SER C 3 203 ? 89.952  72.904 11.465  1.00 43.21  ? 183 SER L O   1 
ATOM   3887 C CB  . SER C 3 203 ? 87.558  71.918 9.885   1.00 45.95  ? 183 SER L CB  1 
ATOM   3888 O OG  . SER C 3 203 ? 87.585  72.633 8.663   1.00 48.38  ? 183 SER L OG  1 
ATOM   3889 N N   . THR C 3 204 ? 90.988  72.281 9.568   1.00 47.97  ? 184 THR L N   1 
ATOM   3890 C CA  . THR C 3 204 ? 92.149  73.096 9.867   1.00 46.47  ? 184 THR L CA  1 
ATOM   3891 C C   . THR C 3 204 ? 92.528  74.033 8.736   1.00 51.59  ? 184 THR L C   1 
ATOM   3892 O O   . THR C 3 204 ? 93.185  73.637 7.767   1.00 52.95  ? 184 THR L O   1 
ATOM   3893 C CB  . THR C 3 204 ? 93.357  72.234 10.216  1.00 45.14  ? 184 THR L CB  1 
ATOM   3894 O OG1 . THR C 3 204 ? 93.048  71.453 11.375  1.00 45.96  ? 184 THR L OG1 1 
ATOM   3895 C CG2 . THR C 3 204 ? 94.569  73.112 10.524  1.00 46.07  ? 184 THR L CG2 1 
ATOM   3896 N N   . LEU C 3 205 ? 92.099  75.283 8.901   1.00 49.64  ? 185 LEU L N   1 
ATOM   3897 C CA  . LEU C 3 205 ? 92.516  76.419 8.092   1.00 50.01  ? 185 LEU L CA  1 
ATOM   3898 C C   . LEU C 3 205 ? 93.958  76.827 8.379   1.00 49.19  ? 185 LEU L C   1 
ATOM   3899 O O   . LEU C 3 205 ? 94.276  77.307 9.464   1.00 47.06  ? 185 LEU L O   1 
ATOM   3900 C CB  . LEU C 3 205 ? 91.603  77.610 8.361   1.00 51.12  ? 185 LEU L CB  1 
ATOM   3901 C CG  . LEU C 3 205 ? 92.063  78.892 7.678   1.00 53.73  ? 185 LEU L CG  1 
ATOM   3902 C CD1 . LEU C 3 205 ? 91.804  78.790 6.193   1.00 58.94  ? 185 LEU L CD1 1 
ATOM   3903 C CD2 . LEU C 3 205 ? 91.362  80.100 8.274   1.00 57.87  ? 185 LEU L CD2 1 
ATOM   3904 N N   . THR C 3 206 ? 94.838  76.639 7.413   1.00 46.71  ? 186 THR L N   1 
ATOM   3905 C CA  . THR C 3 206 ? 96.212  77.049 7.630   1.00 55.27  ? 186 THR L CA  1 
ATOM   3906 C C   . THR C 3 206 ? 96.583  78.136 6.643   1.00 57.46  ? 186 THR L C   1 
ATOM   3907 O O   . THR C 3 206 ? 96.467  77.953 5.433   1.00 52.62  ? 186 THR L O   1 
ATOM   3908 C CB  . THR C 3 206 ? 97.189  75.874 7.520   1.00 50.37  ? 186 THR L CB  1 
ATOM   3909 O OG1 . THR C 3 206 ? 97.049  75.062 8.683   1.00 52.40  ? 186 THR L OG1 1 
ATOM   3910 C CG2 . THR C 3 206 ? 98.608  76.371 7.479   1.00 49.08  ? 186 THR L CG2 1 
ATOM   3911 N N   . LEU C 3 207 ? 97.005  79.274 7.191   1.00 57.62  ? 187 LEU L N   1 
ATOM   3912 C CA  . LEU C 3 207 ? 97.367  80.451 6.412   1.00 61.44  ? 187 LEU L CA  1 
ATOM   3913 C C   . LEU C 3 207 ? 98.806  80.838 6.673   1.00 64.79  ? 187 LEU L C   1 
ATOM   3914 O O   . LEU C 3 207 ? 99.529  80.153 7.400   1.00 61.73  ? 187 LEU L O   1 
ATOM   3915 C CB  . LEU C 3 207 ? 96.466  81.634 6.758   1.00 63.95  ? 187 LEU L CB  1 
ATOM   3916 C CG  . LEU C 3 207 ? 94.974  81.425 6.553   1.00 64.74  ? 187 LEU L CG  1 
ATOM   3917 C CD1 . LEU C 3 207 ? 94.250  82.709 6.850   1.00 66.75  ? 187 LEU L CD1 1 
ATOM   3918 C CD2 . LEU C 3 207 ? 94.702  80.960 5.130   1.00 71.71  ? 187 LEU L CD2 1 
ATOM   3919 N N   . THR C 3 208 ? 99.213  81.957 6.093   1.00 67.36  ? 188 THR L N   1 
ATOM   3920 C CA  . THR C 3 208 ? 100.521 82.509 6.389   1.00 67.09  ? 188 THR L CA  1 
ATOM   3921 C C   . THR C 3 208 ? 100.439 83.275 7.708   1.00 67.12  ? 188 THR L C   1 
ATOM   3922 O O   . THR C 3 208 ? 99.363  83.758 8.074   1.00 66.27  ? 188 THR L O   1 
ATOM   3923 C CB  . THR C 3 208 ? 101.000 83.428 5.267   1.00 70.10  ? 188 THR L CB  1 
ATOM   3924 O OG1 . THR C 3 208 ? 100.734 84.792 5.620   1.00 74.52  ? 188 THR L OG1 1 
ATOM   3925 C CG2 . THR C 3 208 ? 100.282 83.081 3.961   1.00 64.89  ? 188 THR L CG2 1 
ATOM   3926 N N   . LYS C 3 209 ? 101.561 83.379 8.421   1.00 65.46  ? 189 LYS L N   1 
ATOM   3927 C CA  . LYS C 3 209 ? 101.591 84.103 9.692   1.00 66.19  ? 189 LYS L CA  1 
ATOM   3928 C C   . LYS C 3 209 ? 101.082 85.528 9.529   1.00 71.05  ? 189 LYS L C   1 
ATOM   3929 O O   . LYS C 3 209 ? 100.324 86.014 10.366  1.00 69.59  ? 189 LYS L O   1 
ATOM   3930 C CB  . LYS C 3 209 ? 102.997 84.127 10.290  1.00 59.44  ? 189 LYS L CB  1 
ATOM   3931 N N   . ASP C 3 210 ? 101.465 86.200 8.450   1.00 66.85  ? 190 ASP L N   1 
ATOM   3932 C CA  . ASP C 3 210 ? 100.986 87.560 8.291   1.00 75.09  ? 190 ASP L CA  1 
ATOM   3933 C C   . ASP C 3 210 ? 99.692  87.656 7.495   1.00 72.72  ? 190 ASP L C   1 
ATOM   3934 O O   . ASP C 3 210 ? 99.031  88.689 7.532   1.00 78.14  ? 190 ASP L O   1 
ATOM   3935 C CB  . ASP C 3 210 ? 102.044 88.461 7.658   1.00 84.85  ? 190 ASP L CB  1 
ATOM   3936 C CG  . ASP C 3 210 ? 101.949 89.898 8.174   1.00 91.75  ? 190 ASP L CG  1 
ATOM   3937 O OD1 . ASP C 3 210 ? 101.081 90.661 7.686   1.00 91.75  ? 190 ASP L OD1 1 
ATOM   3938 O OD2 . ASP C 3 210 ? 102.728 90.263 9.087   1.00 95.11  ? 190 ASP L OD2 1 
ATOM   3939 N N   . GLU C 3 211 ? 99.307  86.604 6.784   1.00 75.87  ? 191 GLU L N   1 
ATOM   3940 C CA  . GLU C 3 211 ? 97.942  86.584 6.271   1.00 75.53  ? 191 GLU L CA  1 
ATOM   3941 C C   . GLU C 3 211 ? 97.017  86.492 7.475   1.00 74.56  ? 191 GLU L C   1 
ATOM   3942 O O   . GLU C 3 211 ? 95.947  87.103 7.503   1.00 79.63  ? 191 GLU L O   1 
ATOM   3943 C CB  . GLU C 3 211 ? 97.696  85.428 5.312   1.00 72.82  ? 191 GLU L CB  1 
ATOM   3944 C CG  . GLU C 3 211 ? 96.363  85.531 4.591   1.00 75.64  ? 191 GLU L CG  1 
ATOM   3945 C CD  . GLU C 3 211 ? 96.137  84.389 3.618   1.00 84.78  ? 191 GLU L CD  1 
ATOM   3946 O OE1 . GLU C 3 211 ? 96.725  83.297 3.820   1.00 80.98  ? 191 GLU L OE1 1 
ATOM   3947 O OE2 . GLU C 3 211 ? 95.374  84.590 2.648   1.00 88.50  ? 191 GLU L OE2 1 
ATOM   3948 N N   . TYR C 3 212 ? 97.454  85.736 8.479   1.00 68.13  ? 192 TYR L N   1 
ATOM   3949 C CA  . TYR C 3 212 ? 96.720  85.629 9.731   1.00 70.69  ? 192 TYR L CA  1 
ATOM   3950 C C   . TYR C 3 212 ? 96.741  86.937 10.501  1.00 71.68  ? 192 TYR L C   1 
ATOM   3951 O O   . TYR C 3 212 ? 95.803  87.257 11.231  1.00 72.34  ? 192 TYR L O   1 
ATOM   3952 C CB  . TYR C 3 212 ? 97.290  84.516 10.611  1.00 64.53  ? 192 TYR L CB  1 
ATOM   3953 C CG  . TYR C 3 212 ? 96.658  84.463 11.984  1.00 60.74  ? 192 TYR L CG  1 
ATOM   3954 C CD1 . TYR C 3 212 ? 95.319  84.135 12.140  1.00 61.57  ? 192 TYR L CD1 1 
ATOM   3955 C CD2 . TYR C 3 212 ? 97.395  84.746 13.121  1.00 58.90  ? 192 TYR L CD2 1 
ATOM   3956 C CE1 . TYR C 3 212 ? 94.735  84.087 13.388  1.00 58.93  ? 192 TYR L CE1 1 
ATOM   3957 C CE2 . TYR C 3 212 ? 96.817  84.703 14.375  1.00 59.59  ? 192 TYR L CE2 1 
ATOM   3958 C CZ  . TYR C 3 212 ? 95.484  84.373 14.501  1.00 57.82  ? 192 TYR L CZ  1 
ATOM   3959 O OH  . TYR C 3 212 ? 94.896  84.327 15.746  1.00 54.74  ? 192 TYR L OH  1 
ATOM   3960 N N   . GLU C 3 213 ? 97.824  87.687 10.347  1.00 75.06  ? 193 GLU L N   1 
ATOM   3961 C CA  . GLU C 3 213 ? 97.980  88.933 11.078  1.00 75.10  ? 193 GLU L CA  1 
ATOM   3962 C C   . GLU C 3 213 ? 97.354  90.111 10.343  1.00 79.61  ? 193 GLU L C   1 
ATOM   3963 O O   . GLU C 3 213 ? 96.924  91.079 10.970  1.00 80.67  ? 193 GLU L O   1 
ATOM   3964 C CB  . GLU C 3 213 ? 99.452  89.192 11.352  1.00 75.83  ? 193 GLU L CB  1 
ATOM   3965 C CG  . GLU C 3 213 ? 99.979  88.319 12.456  1.00 73.67  ? 193 GLU L CG  1 
ATOM   3966 C CD  . GLU C 3 213 ? 101.439 88.548 12.725  1.00 78.92  ? 193 GLU L CD  1 
ATOM   3967 O OE1 . GLU C 3 213 ? 102.097 89.225 11.903  1.00 84.31  ? 193 GLU L OE1 1 
ATOM   3968 O OE2 . GLU C 3 213 ? 101.926 88.053 13.762  1.00 75.18  ? 193 GLU L OE2 1 
ATOM   3969 N N   . ARG C 3 214 ? 97.284  90.016 9.019   1.00 80.37  ? 194 ARG L N   1 
ATOM   3970 C CA  . ARG C 3 214 ? 96.621  91.036 8.215   1.00 81.93  ? 194 ARG L CA  1 
ATOM   3971 C C   . ARG C 3 214 ? 95.133  91.099 8.545   1.00 80.36  ? 194 ARG L C   1 
ATOM   3972 O O   . ARG C 3 214 ? 94.547  92.181 8.598   1.00 86.26  ? 194 ARG L O   1 
ATOM   3973 C CB  . ARG C 3 214 ? 96.817  90.771 6.718   1.00 79.90  ? 194 ARG L CB  1 
ATOM   3974 N N   . HIS C 3 215 ? 94.521  89.946 8.783   1.00 77.96  ? 195 HIS L N   1 
ATOM   3975 C CA  . HIS C 3 215 ? 93.082  89.921 8.996   1.00 76.47  ? 195 HIS L CA  1 
ATOM   3976 C C   . HIS C 3 215 ? 92.651  89.718 10.436  1.00 76.24  ? 195 HIS L C   1 
ATOM   3977 O O   . HIS C 3 215 ? 93.469  89.592 11.354  1.00 72.96  ? 195 HIS L O   1 
ATOM   3978 C CB  . HIS C 3 215 ? 92.437  88.831 8.146   1.00 75.72  ? 195 HIS L CB  1 
ATOM   3979 C CG  . HIS C 3 215 ? 92.653  89.003 6.680   1.00 82.32  ? 195 HIS L CG  1 
ATOM   3980 N ND1 . HIS C 3 215 ? 93.852  88.707 6.065   1.00 81.87  ? 195 HIS L ND1 1 
ATOM   3981 C CD2 . HIS C 3 215 ? 91.824  89.439 5.703   1.00 80.70  ? 195 HIS L CD2 1 
ATOM   3982 C CE1 . HIS C 3 215 ? 93.752  88.954 4.772   1.00 85.15  ? 195 HIS L CE1 1 
ATOM   3983 N NE2 . HIS C 3 215 ? 92.532  89.400 4.526   1.00 90.71  ? 195 HIS L NE2 1 
ATOM   3984 N N   . ASN C 3 216 ? 91.328  89.691 10.569  1.00 76.70  ? 196 ASN L N   1 
ATOM   3985 C CA  . ASN C 3 216 ? 90.573  89.453 11.787  1.00 78.47  ? 196 ASN L CA  1 
ATOM   3986 C C   . ASN C 3 216 ? 89.161  89.854 11.418  1.00 83.05  ? 196 ASN L C   1 
ATOM   3987 O O   . ASN C 3 216 ? 88.992  90.915 10.815  1.00 86.65  ? 196 ASN L O   1 
ATOM   3988 C CB  . ASN C 3 216 ? 91.086  90.271 12.966  1.00 75.01  ? 196 ASN L CB  1 
ATOM   3989 C CG  . ASN C 3 216 ? 91.018  89.503 14.264  1.00 79.04  ? 196 ASN L CG  1 
ATOM   3990 O OD1 . ASN C 3 216 ? 89.941  89.328 14.845  1.00 77.73  ? 196 ASN L OD1 1 
ATOM   3991 N ND2 . ASN C 3 216 ? 92.171  89.013 14.719  1.00 77.70  ? 196 ASN L ND2 1 
ATOM   3992 N N   . SER C 3 217 ? 88.140  89.054 11.740  1.00 79.73  ? 197 SER L N   1 
ATOM   3993 C CA  . SER C 3 217 ? 88.215  87.900 12.630  1.00 71.01  ? 197 SER L CA  1 
ATOM   3994 C C   . SER C 3 217 ? 88.118  86.538 11.929  1.00 69.89  ? 197 SER L C   1 
ATOM   3995 O O   . SER C 3 217 ? 88.199  86.442 10.702  1.00 70.83  ? 197 SER L O   1 
ATOM   3996 C CB  . SER C 3 217 ? 87.095  88.008 13.654  1.00 70.85  ? 197 SER L CB  1 
ATOM   3997 O OG  . SER C 3 217 ? 85.850  88.229 13.003  1.00 65.21  ? 197 SER L OG  1 
ATOM   3998 N N   . TYR C 3 218 ? 87.919  85.488 12.723  1.00 63.13  ? 198 TYR L N   1 
ATOM   3999 C CA  . TYR C 3 218 ? 87.920  84.123 12.200  1.00 66.64  ? 198 TYR L CA  1 
ATOM   4000 C C   . TYR C 3 218 ? 86.761  83.276 12.712  1.00 62.41  ? 198 TYR L C   1 
ATOM   4001 O O   . TYR C 3 218 ? 86.552  83.152 13.923  1.00 60.10  ? 198 TYR L O   1 
ATOM   4002 C CB  . TYR C 3 218 ? 89.244  83.434 12.537  1.00 63.04  ? 198 TYR L CB  1 
ATOM   4003 C CG  . TYR C 3 218 ? 90.428  84.081 11.866  1.00 59.53  ? 198 TYR L CG  1 
ATOM   4004 C CD1 . TYR C 3 218 ? 90.869  83.650 10.624  1.00 57.07  ? 198 TYR L CD1 1 
ATOM   4005 C CD2 . TYR C 3 218 ? 91.090  85.139 12.470  1.00 63.31  ? 198 TYR L CD2 1 
ATOM   4006 C CE1 . TYR C 3 218 ? 91.946  84.250 10.007  1.00 65.83  ? 198 TYR L CE1 1 
ATOM   4007 C CE2 . TYR C 3 218 ? 92.168  85.752 11.863  1.00 65.90  ? 198 TYR L CE2 1 
ATOM   4008 C CZ  . TYR C 3 218 ? 92.594  85.305 10.632  1.00 68.46  ? 198 TYR L CZ  1 
ATOM   4009 O OH  . TYR C 3 218 ? 93.672  85.918 10.034  1.00 65.78  ? 198 TYR L OH  1 
ATOM   4010 N N   . THR C 3 219 ? 86.028  82.682 11.770  1.00 62.39  ? 199 THR L N   1 
ATOM   4011 C CA  . THR C 3 219 ? 84.848  81.878 12.075  1.00 59.55  ? 199 THR L CA  1 
ATOM   4012 C C   . THR C 3 219 ? 84.778  80.593 11.257  1.00 61.03  ? 199 THR L C   1 
ATOM   4013 O O   . THR C 3 219 ? 85.114  80.571 10.071  1.00 55.33  ? 199 THR L O   1 
ATOM   4014 C CB  . THR C 3 219 ? 83.550  82.661 11.815  1.00 59.69  ? 199 THR L CB  1 
ATOM   4015 O OG1 . THR C 3 219 ? 83.663  83.965 12.391  1.00 68.10  ? 199 THR L OG1 1 
ATOM   4016 C CG2 . THR C 3 219 ? 82.347  81.943 12.429  1.00 58.79  ? 199 THR L CG2 1 
ATOM   4017 N N   . CYS C 3 220 ? 84.332  79.524 11.903  1.00 61.76  ? 200 CYS L N   1 
ATOM   4018 C CA  . CYS C 3 220 ? 83.964  78.317 11.189  1.00 59.86  ? 200 CYS L CA  1 
ATOM   4019 C C   . CYS C 3 220 ? 82.498  78.026 11.480  1.00 55.53  ? 200 CYS L C   1 
ATOM   4020 O O   . CYS C 3 220 ? 82.041  78.139 12.621  1.00 51.99  ? 200 CYS L O   1 
ATOM   4021 C CB  . CYS C 3 220 ? 84.865  77.139 11.584  1.00 54.58  ? 200 CYS L CB  1 
ATOM   4022 S SG  . CYS C 3 220 ? 84.576  76.432 13.221  1.00 60.40  ? 200 CYS L SG  1 
ATOM   4023 N N   . GLU C 3 221 ? 81.761  77.688 10.427  1.00 61.79  ? 201 GLU L N   1 
ATOM   4024 C CA  . GLU C 3 221 ? 80.331  77.404 10.530  1.00 62.87  ? 201 GLU L CA  1 
ATOM   4025 C C   . GLU C 3 221 ? 80.067  75.946 10.231  1.00 57.58  ? 201 GLU L C   1 
ATOM   4026 O O   . GLU C 3 221 ? 80.437  75.452 9.162   1.00 58.92  ? 201 GLU L O   1 
ATOM   4027 C CB  . GLU C 3 221 ? 79.519  78.270 9.565   1.00 62.83  ? 201 GLU L CB  1 
ATOM   4028 C CG  . GLU C 3 221 ? 79.677  79.769 9.741   1.00 68.47  ? 201 GLU L CG  1 
ATOM   4029 C CD  . GLU C 3 221 ? 78.917  80.542 8.681   1.00 74.16  ? 201 GLU L CD  1 
ATOM   4030 O OE1 . GLU C 3 221 ? 78.437  79.891 7.724   1.00 72.16  ? 201 GLU L OE1 1 
ATOM   4031 O OE2 . GLU C 3 221 ? 78.800  81.785 8.806   1.00 74.03  ? 201 GLU L OE2 1 
ATOM   4032 N N   . ALA C 3 222 ? 79.427  75.265 11.174  1.00 56.15  ? 202 ALA L N   1 
ATOM   4033 C CA  . ALA C 3 222 ? 79.086  73.859 11.009  1.00 56.90  ? 202 ALA L CA  1 
ATOM   4034 C C   . ALA C 3 222 ? 77.623  73.720 10.626  1.00 64.28  ? 202 ALA L C   1 
ATOM   4035 O O   . ALA C 3 222 ? 76.730  73.849 11.466  1.00 63.91  ? 202 ALA L O   1 
ATOM   4036 C CB  . ALA C 3 222 ? 79.376  73.080 12.283  1.00 52.46  ? 202 ALA L CB  1 
ATOM   4037 N N   . THR C 3 223 ? 77.375  73.470 9.350   1.00 61.25  ? 203 THR L N   1 
ATOM   4038 C CA  . THR C 3 223 ? 76.014  73.275 8.896   1.00 58.67  ? 203 THR L CA  1 
ATOM   4039 C C   . THR C 3 223 ? 75.728  71.790 8.791   1.00 58.63  ? 203 THR L C   1 
ATOM   4040 O O   . THR C 3 223 ? 76.416  71.050 8.087   1.00 58.04  ? 203 THR L O   1 
ATOM   4041 C CB  . THR C 3 223 ? 75.763  73.964 7.552   1.00 62.42  ? 203 THR L CB  1 
ATOM   4042 O OG1 . THR C 3 223 ? 76.882  73.733 6.689   1.00 61.49  ? 203 THR L OG1 1 
ATOM   4043 C CG2 . THR C 3 223 ? 75.597  75.466 7.759   1.00 66.60  ? 203 THR L CG2 1 
ATOM   4044 N N   . HIS C 3 224 ? 74.709  71.364 9.516   1.00 62.02  ? 204 HIS L N   1 
ATOM   4045 C CA  . HIS C 3 224 ? 74.333  69.966 9.580   1.00 60.90  ? 204 HIS L CA  1 
ATOM   4046 C C   . HIS C 3 224 ? 72.869  69.872 9.193   1.00 63.34  ? 204 HIS L C   1 
ATOM   4047 O O   . HIS C 3 224 ? 72.146  70.872 9.262   1.00 66.28  ? 204 HIS L O   1 
ATOM   4048 C CB  . HIS C 3 224 ? 74.579  69.419 10.991  1.00 63.46  ? 204 HIS L CB  1 
ATOM   4049 C CG  . HIS C 3 224 ? 74.814  67.940 11.053  1.00 62.62  ? 204 HIS L CG  1 
ATOM   4050 N ND1 . HIS C 3 224 ? 73.818  67.042 11.361  1.00 59.32  ? 204 HIS L ND1 1 
ATOM   4051 C CD2 . HIS C 3 224 ? 75.937  67.206 10.876  1.00 59.48  ? 204 HIS L CD2 1 
ATOM   4052 C CE1 . HIS C 3 224 ? 74.314  65.818 11.359  1.00 53.41  ? 204 HIS L CE1 1 
ATOM   4053 N NE2 . HIS C 3 224 ? 75.598  65.889 11.068  1.00 52.27  ? 204 HIS L NE2 1 
ATOM   4054 N N   . LYS C 3 225 ? 72.430  68.689 8.781   1.00 59.93  ? 205 LYS L N   1 
ATOM   4055 C CA  . LYS C 3 225 ? 71.009  68.469 8.517   1.00 68.43  ? 205 LYS L CA  1 
ATOM   4056 C C   . LYS C 3 225 ? 70.194  68.710 9.799   1.00 67.93  ? 205 LYS L C   1 
ATOM   4057 O O   . LYS C 3 225 ? 69.034  69.124 9.739   1.00 68.17  ? 205 LYS L O   1 
ATOM   4058 C CB  . LYS C 3 225 ? 70.774  67.052 7.966   1.00 63.13  ? 205 LYS L CB  1 
ATOM   4059 C CG  . LYS C 3 225 ? 69.967  66.115 8.869   1.00 61.74  ? 205 LYS L CG  1 
ATOM   4060 C CD  . LYS C 3 225 ? 70.229  64.648 8.523   1.00 57.81  ? 205 LYS L CD  1 
ATOM   4061 C CE  . LYS C 3 225 ? 69.007  63.760 8.799   1.00 58.52  ? 205 LYS L CE  1 
ATOM   4062 N NZ  . LYS C 3 225 ? 69.386  62.333 9.078   1.00 53.89  ? 205 LYS L NZ  1 
ATOM   4063 N N   . THR C 3 226 ? 70.836  68.490 10.951  1.00 66.52  ? 206 THR L N   1 
ATOM   4064 C CA  . THR C 3 226 ? 70.196  68.562 12.268  1.00 61.89  ? 206 THR L CA  1 
ATOM   4065 C C   . THR C 3 226 ? 69.719  69.960 12.637  1.00 65.22  ? 206 THR L C   1 
ATOM   4066 O O   . THR C 3 226 ? 69.122  70.161 13.696  1.00 70.65  ? 206 THR L O   1 
ATOM   4067 C CB  . THR C 3 226 ? 71.149  68.066 13.392  1.00 59.92  ? 206 THR L CB  1 
ATOM   4068 O OG1 . THR C 3 226 ? 72.448  68.658 13.232  1.00 54.53  ? 206 THR L OG1 1 
ATOM   4069 C CG2 . THR C 3 226 ? 71.279  66.548 13.359  1.00 56.51  ? 206 THR L CG2 1 
ATOM   4070 N N   . SER C 3 227 ? 69.990  70.933 11.777  1.00 66.93  ? 207 SER L N   1 
ATOM   4071 C CA  . SER C 3 227 ? 69.473  72.269 12.003  1.00 65.92  ? 207 SER L CA  1 
ATOM   4072 C C   . SER C 3 227 ? 69.342  73.074 10.727  1.00 70.94  ? 207 SER L C   1 
ATOM   4073 O O   . SER C 3 227 ? 69.987  72.806 9.715   1.00 74.69  ? 207 SER L O   1 
ATOM   4074 C CB  . SER C 3 227 ? 70.358  73.028 12.993  1.00 72.04  ? 207 SER L CB  1 
ATOM   4075 O OG  . SER C 3 227 ? 69.866  74.338 13.226  1.00 69.68  ? 207 SER L OG  1 
ATOM   4076 N N   . THR C 3 228 ? 68.464  74.059 10.802  1.00 73.21  ? 208 THR L N   1 
ATOM   4077 C CA  . THR C 3 228 ? 68.364  75.117 9.820   1.00 71.27  ? 208 THR L CA  1 
ATOM   4078 C C   . THR C 3 228 ? 69.477  76.110 10.111  1.00 74.49  ? 208 THR L C   1 
ATOM   4079 O O   . THR C 3 228 ? 69.982  76.815 9.224   1.00 67.04  ? 208 THR L O   1 
ATOM   4080 C CB  . THR C 3 228 ? 67.021  75.809 9.930   1.00 67.93  ? 208 THR L CB  1 
ATOM   4081 O OG1 . THR C 3 228 ? 67.006  76.586 11.135  1.00 68.12  ? 208 THR L OG1 1 
ATOM   4082 C CG2 . THR C 3 228 ? 65.911  74.766 10.014  1.00 67.22  ? 208 THR L CG2 1 
ATOM   4083 N N   . SER C 3 229 ? 69.839  76.141 11.390  1.00 72.15  ? 209 SER L N   1 
ATOM   4084 C CA  . SER C 3 229 ? 70.779  77.100 11.941  1.00 70.30  ? 209 SER L CA  1 
ATOM   4085 C C   . SER C 3 229 ? 72.171  76.513 12.106  1.00 72.15  ? 209 SER L C   1 
ATOM   4086 O O   . SER C 3 229 ? 72.337  75.440 12.691  1.00 69.31  ? 209 SER L O   1 
ATOM   4087 C CB  . SER C 3 229 ? 70.266  77.594 13.291  1.00 75.34  ? 209 SER L CB  1 
ATOM   4088 O OG  . SER C 3 229 ? 69.734  76.512 14.039  1.00 75.75  ? 209 SER L OG  1 
ATOM   4089 N N   . PRO C 3 230 ? 73.182  77.223 11.594  1.00 76.30  ? 210 PRO L N   1 
ATOM   4090 C CA  . PRO C 3 230 ? 74.586  76.823 11.723  1.00 68.21  ? 210 PRO L CA  1 
ATOM   4091 C C   . PRO C 3 230 ? 75.078  76.911 13.159  1.00 70.14  ? 210 PRO L C   1 
ATOM   4092 O O   . PRO C 3 230 ? 74.797  77.907 13.829  1.00 70.58  ? 210 PRO L O   1 
ATOM   4093 C CB  . PRO C 3 230 ? 75.325  77.837 10.843  1.00 66.07  ? 210 PRO L CB  1 
ATOM   4094 C CG  . PRO C 3 230 ? 74.285  78.382 9.922   1.00 75.05  ? 210 PRO L CG  1 
ATOM   4095 C CD  . PRO C 3 230 ? 73.026  78.403 10.729  1.00 76.12  ? 210 PRO L CD  1 
ATOM   4096 N N   . ILE C 3 231 ? 75.770  75.882 13.643  1.00 67.38  ? 211 ILE L N   1 
ATOM   4097 C CA  . ILE C 3 231 ? 76.533  76.052 14.869  1.00 63.93  ? 211 ILE L CA  1 
ATOM   4098 C C   . ILE C 3 231 ? 77.772  76.824 14.478  1.00 62.19  ? 211 ILE L C   1 
ATOM   4099 O O   . ILE C 3 231 ? 78.436  76.493 13.494  1.00 61.00  ? 211 ILE L O   1 
ATOM   4100 C CB  . ILE C 3 231 ? 76.915  74.735 15.544  1.00 58.82  ? 211 ILE L CB  1 
ATOM   4101 C CG1 . ILE C 3 231 ? 75.656  73.936 15.881  1.00 55.47  ? 211 ILE L CG1 1 
ATOM   4102 C CG2 . ILE C 3 231 ? 77.733  75.014 16.802  1.00 48.90  ? 211 ILE L CG2 1 
ATOM   4103 C CD1 . ILE C 3 231 ? 75.889  72.769 16.817  1.00 46.28  ? 211 ILE L CD1 1 
ATOM   4104 N N   . VAL C 3 232 ? 78.059  77.877 15.231  1.00 61.82  ? 212 VAL L N   1 
ATOM   4105 C CA  . VAL C 3 232 ? 79.082  78.819 14.830  1.00 62.39  ? 212 VAL L CA  1 
ATOM   4106 C C   . VAL C 3 232 ? 80.007  79.130 15.980  1.00 62.61  ? 212 VAL L C   1 
ATOM   4107 O O   . VAL C 3 232 ? 79.566  79.432 17.091  1.00 63.89  ? 212 VAL L O   1 
ATOM   4108 C CB  . VAL C 3 232 ? 78.465  80.111 14.313  1.00 64.28  ? 212 VAL L CB  1 
ATOM   4109 C CG1 . VAL C 3 232 ? 78.064  79.945 12.867  1.00 65.27  ? 212 VAL L CG1 1 
ATOM   4110 C CG2 . VAL C 3 232 ? 77.257  80.480 15.167  1.00 70.01  ? 212 VAL L CG2 1 
ATOM   4111 N N   . LYS C 3 233 ? 81.298  79.021 15.712  1.00 59.36  ? 213 LYS L N   1 
ATOM   4112 C CA  . LYS C 3 233 ? 82.292  79.381 16.699  1.00 59.43  ? 213 LYS L CA  1 
ATOM   4113 C C   . LYS C 3 233 ? 83.256  80.358 16.055  1.00 61.37  ? 213 LYS L C   1 
ATOM   4114 O O   . LYS C 3 233 ? 83.647  80.193 14.888  1.00 56.57  ? 213 LYS L O   1 
ATOM   4115 C CB  . LYS C 3 233 ? 83.024  78.147 17.227  1.00 58.42  ? 213 LYS L CB  1 
ATOM   4116 C CG  . LYS C 3 233 ? 82.140  77.184 18.006  1.00 55.96  ? 213 LYS L CG  1 
ATOM   4117 C CD  . LYS C 3 233 ? 81.532  77.838 19.220  1.00 52.57  ? 213 LYS L CD  1 
ATOM   4118 C CE  . LYS C 3 233 ? 80.977  76.794 20.167  1.00 54.55  ? 213 LYS L CE  1 
ATOM   4119 N NZ  . LYS C 3 233 ? 80.604  77.408 21.463  1.00 56.31  ? 213 LYS L NZ  1 
ATOM   4120 N N   . SER C 3 234 ? 83.621  81.388 16.810  1.00 56.21  ? 214 SER L N   1 
ATOM   4121 C CA  . SER C 3 234 ? 84.462  82.435 16.266  1.00 59.99  ? 214 SER L CA  1 
ATOM   4122 C C   . SER C 3 234 ? 85.371  83.058 17.319  1.00 56.23  ? 214 SER L C   1 
ATOM   4123 O O   . SER C 3 234 ? 85.279  82.741 18.505  1.00 52.64  ? 214 SER L O   1 
ATOM   4124 C CB  . SER C 3 234 ? 83.586  83.503 15.617  1.00 60.78  ? 214 SER L CB  1 
ATOM   4125 O OG  . SER C 3 234 ? 84.238  84.057 14.495  1.00 65.16  ? 214 SER L OG  1 
ATOM   4126 N N   . PHE C 3 235 ? 86.266  83.931 16.876  1.00 57.65  ? 215 PHE L N   1 
ATOM   4127 C CA  . PHE C 3 235 ? 87.104  84.678 17.807  1.00 62.56  ? 215 PHE L CA  1 
ATOM   4128 C C   . PHE C 3 235 ? 87.723  85.907 17.151  1.00 64.17  ? 215 PHE L C   1 
ATOM   4129 O O   . PHE C 3 235 ? 87.646  86.074 15.933  1.00 64.25  ? 215 PHE L O   1 
ATOM   4130 C CB  . PHE C 3 235 ? 88.208  83.784 18.383  1.00 65.73  ? 215 PHE L CB  1 
ATOM   4131 C CG  . PHE C 3 235 ? 89.255  83.364 17.379  1.00 66.03  ? 215 PHE L CG  1 
ATOM   4132 C CD1 . PHE C 3 235 ? 89.076  82.232 16.599  1.00 63.99  ? 215 PHE L CD1 1 
ATOM   4133 C CD2 . PHE C 3 235 ? 90.430  84.087 17.234  1.00 62.56  ? 215 PHE L CD2 1 
ATOM   4134 C CE1 . PHE C 3 235 ? 90.046  81.836 15.684  1.00 61.67  ? 215 PHE L CE1 1 
ATOM   4135 C CE2 . PHE C 3 235 ? 91.399  83.696 16.320  1.00 63.11  ? 215 PHE L CE2 1 
ATOM   4136 C CZ  . PHE C 3 235 ? 91.206  82.570 15.546  1.00 59.60  ? 215 PHE L CZ  1 
ATOM   4137 N N   . ASN C 3 236 ? 88.333  86.759 17.974  1.00 66.78  ? 216 ASN L N   1 
ATOM   4138 C CA  . ASN C 3 236 ? 89.053  87.937 17.500  1.00 67.42  ? 216 ASN L CA  1 
ATOM   4139 C C   . ASN C 3 236 ? 90.437  88.020 18.136  1.00 71.26  ? 216 ASN L C   1 
ATOM   4140 O O   . ASN C 3 236 ? 90.747  87.239 19.040  1.00 63.63  ? 216 ASN L O   1 
ATOM   4141 C CB  . ASN C 3 236 ? 88.267  89.217 17.799  1.00 75.43  ? 216 ASN L CB  1 
ATOM   4142 C CG  . ASN C 3 236 ? 86.816  89.124 17.370  1.00 77.12  ? 216 ASN L CG  1 
ATOM   4143 O OD1 . ASN C 3 236 ? 86.465  89.471 16.245  1.00 77.69  ? 216 ASN L OD1 1 
ATOM   4144 N ND2 . ASN C 3 236 ? 85.961  88.653 18.272  1.00 74.11  ? 216 ASN L ND2 1 
ATOM   4145 N N   . ARG C 3 237 ? 91.232  88.994 17.677  1.00 77.52  ? 217 ARG L N   1 
ATOM   4146 C CA  . ARG C 3 237 ? 92.656  89.154 18.008  1.00 67.79  ? 217 ARG L CA  1 
ATOM   4147 C C   . ARG C 3 237 ? 93.479  87.982 17.479  1.00 68.61  ? 217 ARG L C   1 
ATOM   4148 O O   . ARG C 3 237 ? 93.619  87.803 16.264  1.00 65.78  ? 217 ARG L O   1 
ATOM   4149 C CB  . ARG C 3 237 ? 92.872  89.302 19.514  1.00 65.66  ? 217 ARG L CB  1 
ATOM   4150 C CG  . ARG C 3 237 ? 92.100  90.425 20.156  1.00 66.66  ? 217 ARG L CG  1 
ATOM   4151 C CD  . ARG C 3 237 ? 92.198  90.313 21.662  1.00 63.32  ? 217 ARG L CD  1 
ATOM   4152 N NE  . ARG C 3 237 ? 91.181  89.424 22.215  1.00 65.51  ? 217 ARG L NE  1 
ATOM   4153 C CZ  . ARG C 3 237 ? 91.302  88.794 23.380  1.00 64.36  ? 217 ARG L CZ  1 
ATOM   4154 N NH1 . ARG C 3 237 ? 92.404  88.939 24.097  1.00 57.92  ? 217 ARG L NH1 1 
ATOM   4155 N NH2 . ARG C 3 237 ? 90.328  88.010 23.821  1.00 66.09  ? 217 ARG L NH2 1 
HETATM 4156 C C1  . NAG D 4 .   ? 111.353 -2.930 29.628  1.00 95.12  ? 701 NAG E C1  1 
HETATM 4157 C C2  . NAG D 4 .   ? 111.642 -3.529 31.011  1.00 95.23  ? 701 NAG E C2  1 
HETATM 4158 C C3  . NAG D 4 .   ? 111.147 -4.975 31.089  1.00 93.46  ? 701 NAG E C3  1 
HETATM 4159 C C4  . NAG D 4 .   ? 109.703 -5.094 30.617  1.00 96.16  ? 701 NAG E C4  1 
HETATM 4160 C C5  . NAG D 4 .   ? 109.554 -4.454 29.244  1.00 94.05  ? 701 NAG E C5  1 
HETATM 4161 C C6  . NAG D 4 .   ? 108.130 -4.463 28.737  1.00 97.00  ? 701 NAG E C6  1 
HETATM 4162 C C7  . NAG D 4 .   ? 113.641 -2.521 32.047  1.00 94.43  ? 701 NAG E C7  1 
HETATM 4163 C C8  . NAG D 4 .   ? 115.121 -2.652 32.249  1.00 91.50  ? 701 NAG E C8  1 
HETATM 4164 N N2  . NAG D 4 .   ? 113.069 -3.474 31.306  1.00 95.96  ? 701 NAG E N2  1 
HETATM 4165 O O3  . NAG D 4 .   ? 111.272 -5.464 32.420  1.00 92.60  ? 701 NAG E O3  1 
HETATM 4166 O O4  . NAG D 4 .   ? 109.337 -6.467 30.534  1.00 101.59 ? 701 NAG E O4  1 
HETATM 4167 O O5  . NAG D 4 .   ? 109.966 -3.084 29.320  1.00 94.96  ? 701 NAG E O5  1 
HETATM 4168 O O6  . NAG D 4 .   ? 107.419 -3.302 29.146  1.00 102.89 ? 701 NAG E O6  1 
HETATM 4169 O O7  . NAG D 4 .   ? 112.998 -1.595 32.534  1.00 93.74  ? 701 NAG E O7  1 
HETATM 4170 C C1  . NAG E 4 .   ? 96.445  2.829  9.749   1.00 92.10  ? 702 NAG E C1  1 
HETATM 4171 C C2  . NAG E 4 .   ? 96.974  1.593  10.492  1.00 93.04  ? 702 NAG E C2  1 
HETATM 4172 C C3  . NAG E 4 .   ? 96.147  0.355  10.125  1.00 98.54  ? 702 NAG E C3  1 
HETATM 4173 C C4  . NAG E 4 .   ? 95.882  0.299  8.624   1.00 99.82  ? 702 NAG E C4  1 
HETATM 4174 C C5  . NAG E 4 .   ? 95.188  1.577  8.145   1.00 97.71  ? 702 NAG E C5  1 
HETATM 4175 C C6  . NAG E 4 .   ? 93.759  1.364  7.690   1.00 88.72  ? 702 NAG E C6  1 
HETATM 4176 C C7  . NAG E 4 .   ? 99.304  1.261  11.182  1.00 87.23  ? 702 NAG E C7  1 
HETATM 4177 C C8  . NAG E 4 .   ? 100.708 1.010  10.725  1.00 85.03  ? 702 NAG E C8  1 
HETATM 4178 N N2  . NAG E 4 .   ? 98.380  1.363  10.219  1.00 89.08  ? 702 NAG E N2  1 
HETATM 4179 O O3  . NAG E 4 .   ? 94.925  0.347  10.854  1.00 103.40 ? 702 NAG E O3  1 
HETATM 4180 O O4  . NAG E 4 .   ? 97.110  0.118  7.926   1.00 93.85  ? 702 NAG E O4  1 
HETATM 4181 O O5  . NAG E 4 .   ? 95.154  2.551  9.201   1.00 95.77  ? 702 NAG E O5  1 
HETATM 4182 O O6  . NAG E 4 .   ? 92.952  0.760  8.691   1.00 83.26  ? 702 NAG E O6  1 
HETATM 4183 O O7  . NAG E 4 .   ? 99.017  1.374  12.370  1.00 86.45  ? 702 NAG E O7  1 
HETATM 4184 N N   . ARF F 5 .   ? 94.002  31.741 18.042  1.00 40.73  ? 703 ARF E N   1 
HETATM 4185 C C   . ARF F 5 .   ? 93.865  32.740 19.035  1.00 47.98  ? 703 ARF E C   1 
HETATM 4186 O O   . ARF F 5 .   ? 93.369  33.828 18.782  1.00 50.35  ? 703 ARF E O   1 
HETATM 4187 N N   . ARF G 5 .   ? 87.095  58.964 17.749  1.00 32.73  ? 501 ARF H N   1 
HETATM 4188 C C   . ARF G 5 .   ? 85.971  58.101 17.611  1.00 37.34  ? 501 ARF H C   1 
HETATM 4189 O O   . ARF G 5 .   ? 84.851  58.535 17.382  1.00 35.98  ? 501 ARF H O   1 
HETATM 4190 N N   . ARF H 5 .   ? 101.257 54.371 5.395   1.00 44.58  ? 502 ARF H N   1 
HETATM 4191 C C   . ARF H 5 .   ? 101.334 53.034 4.927   1.00 36.64  ? 502 ARF H C   1 
HETATM 4192 O O   . ARF H 5 .   ? 100.363 52.314 5.017   1.00 36.85  ? 502 ARF H O   1 
HETATM 4193 N N   . ARF I 5 .   ? 90.543  24.143 12.230  1.00 32.55  ? 503 ARF H N   1 
HETATM 4194 C C   . ARF I 5 .   ? 90.348  25.522 11.911  1.00 41.73  ? 503 ARF H C   1 
HETATM 4195 O O   . ARF I 5 .   ? 90.923  26.437 12.497  1.00 36.10  ? 503 ARF H O   1 
HETATM 4196 N N   . ARF J 5 .   ? 89.018  52.121 7.078   1.00 52.09  ? 301 ARF L N   1 
HETATM 4197 C C   . ARF J 5 .   ? 87.734  51.669 6.689   1.00 54.52  ? 301 ARF L C   1 
HETATM 4198 O O   . ARF J 5 .   ? 86.783  51.744 7.455   1.00 53.99  ? 301 ARF L O   1 
HETATM 4199 N N   . ARF K 5 .   ? 84.025  40.910 18.009  1.00 36.00  ? 302 ARF L N   1 
HETATM 4200 C C   . ARF K 5 .   ? 82.717  41.454 18.233  1.00 42.33  ? 302 ARF L C   1 
HETATM 4201 O O   . ARF K 5 .   ? 82.314  42.512 17.721  1.00 33.54  ? 302 ARF L O   1 
HETATM 4202 O O   . HOH L 6 .   ? 91.315  33.958 19.625  1.00 47.88  ? 801 HOH E O   1 
HETATM 4203 O O   . HOH L 6 .   ? 95.539  9.089  24.886  1.00 56.93  ? 802 HOH E O   1 
HETATM 4204 O O   . HOH L 6 .   ? 98.215  22.124 29.719  1.00 47.56  ? 803 HOH E O   1 
HETATM 4205 O O   . HOH L 6 .   ? 82.625  5.117  30.907  1.00 70.77  ? 804 HOH E O   1 
HETATM 4206 O O   . HOH L 6 .   ? 92.951  21.706 14.496  1.00 31.61  ? 805 HOH E O   1 
HETATM 4207 O O   . HOH L 6 .   ? 98.251  24.743 14.686  1.00 31.78  ? 806 HOH E O   1 
HETATM 4208 O O   . HOH L 6 .   ? 95.137  31.814 21.566  1.00 40.61  ? 807 HOH E O   1 
HETATM 4209 O O   . HOH L 6 .   ? 89.014  22.199 29.815  1.00 46.47  ? 808 HOH E O   1 
HETATM 4210 O O   . HOH L 6 .   ? 101.141 24.911 22.090  1.00 33.06  ? 809 HOH E O   1 
HETATM 4211 O O   . HOH L 6 .   ? 89.730  21.837 21.563  1.00 40.23  ? 810 HOH E O   1 
HETATM 4212 O O   . HOH L 6 .   ? 108.889 -0.767 22.116  1.00 63.26  ? 811 HOH E O   1 
HETATM 4213 O O   . HOH L 6 .   ? 120.165 8.421  27.409  1.00 53.64  ? 812 HOH E O   1 
HETATM 4214 O O   . HOH M 6 .   ? 117.704 28.763 13.757  1.00 43.90  ? 601 HOH H O   1 
HETATM 4215 O O   . HOH M 6 .   ? 115.654 46.142 -4.055  1.00 38.39  ? 602 HOH H O   1 
HETATM 4216 O O   . HOH M 6 .   ? 92.252  41.194 -2.276  1.00 40.96  ? 603 HOH H O   1 
HETATM 4217 O O   . HOH M 6 .   ? 113.885 42.399 -6.999  1.00 40.83  ? 604 HOH H O   1 
HETATM 4218 O O   . HOH M 6 .   ? 109.447 45.888 10.140  1.00 31.14  ? 605 HOH H O   1 
HETATM 4219 O O   . HOH M 6 .   ? 97.525  71.477 31.132  1.00 56.47  ? 606 HOH H O   1 
HETATM 4220 O O   . HOH M 6 .   ? 87.549  65.494 22.443  1.00 43.66  ? 607 HOH H O   1 
HETATM 4221 O O   . HOH M 6 .   ? 93.690  83.356 27.930  1.00 65.83  ? 608 HOH H O   1 
HETATM 4222 O O   . HOH M 6 .   ? 103.646 49.679 11.375  1.00 28.11  ? 609 HOH H O   1 
HETATM 4223 O O   . HOH M 6 .   ? 104.546 21.864 4.056   1.00 44.68  ? 610 HOH H O   1 
HETATM 4224 O O   . HOH M 6 .   ? 109.494 64.878 3.523   1.00 43.78  ? 611 HOH H O   1 
HETATM 4225 O O   . HOH M 6 .   ? 99.650  26.544 1.110   1.00 43.16  ? 612 HOH H O   1 
HETATM 4226 O O   . HOH M 6 .   ? 113.326 45.690 8.895   1.00 41.32  ? 613 HOH H O   1 
HETATM 4227 O O   . HOH M 6 .   ? 104.851 53.518 6.880   1.00 36.81  ? 614 HOH H O   1 
HETATM 4228 O O   . HOH M 6 .   ? 90.216  41.733 0.254   1.00 30.01  ? 615 HOH H O   1 
HETATM 4229 O O   . HOH M 6 .   ? 107.706 70.152 9.811   1.00 56.53  ? 616 HOH H O   1 
HETATM 4230 O O   . HOH M 6 .   ? 115.734 35.237 7.266   1.00 31.51  ? 617 HOH H O   1 
HETATM 4231 O O   . HOH M 6 .   ? 105.299 59.871 -1.252  1.00 42.21  ? 618 HOH H O   1 
HETATM 4232 O O   . HOH M 6 .   ? 103.362 24.522 19.500  1.00 37.56  ? 619 HOH H O   1 
HETATM 4233 O O   . HOH M 6 .   ? 99.701  51.146 -2.275  1.00 40.03  ? 620 HOH H O   1 
HETATM 4234 O O   . HOH M 6 .   ? 93.814  27.881 11.305  1.00 30.33  ? 621 HOH H O   1 
HETATM 4235 O O   . HOH M 6 .   ? 96.935  46.600 14.744  1.00 33.59  ? 622 HOH H O   1 
HETATM 4236 O O   . HOH M 6 .   ? 99.334  58.057 12.458  1.00 47.97  ? 623 HOH H O   1 
HETATM 4237 O O   . HOH M 6 .   ? 102.032 44.692 19.477  1.00 45.95  ? 624 HOH H O   1 
HETATM 4238 O O   . HOH M 6 .   ? 103.331 57.303 5.190   1.00 40.39  ? 625 HOH H O   1 
HETATM 4239 O O   . HOH M 6 .   ? 102.531 71.000 6.928   1.00 42.35  ? 626 HOH H O   1 
HETATM 4240 O O   . HOH M 6 .   ? 106.289 42.410 10.355  1.00 31.62  ? 627 HOH H O   1 
HETATM 4241 O O   . HOH M 6 .   ? 112.225 38.913 -2.423  1.00 41.49  ? 628 HOH H O   1 
HETATM 4242 O O   . HOH M 6 .   ? 95.485  48.390 7.306   1.00 34.98  ? 629 HOH H O   1 
HETATM 4243 O O   . HOH M 6 .   ? 110.827 30.903 -0.442  1.00 37.66  ? 630 HOH H O   1 
HETATM 4244 O O   . HOH M 6 .   ? 112.119 30.508 1.785   1.00 33.96  ? 631 HOH H O   1 
HETATM 4245 O O   . HOH M 6 .   ? 96.218  47.419 11.881  1.00 27.17  ? 632 HOH H O   1 
HETATM 4246 O O   . HOH M 6 .   ? 116.269 43.679 2.932   1.00 40.24  ? 633 HOH H O   1 
HETATM 4247 O O   . HOH M 6 .   ? 91.744  36.050 14.654  1.00 24.39  ? 634 HOH H O   1 
HETATM 4248 O O   . HOH M 6 .   ? 109.360 40.695 15.451  1.00 30.69  ? 635 HOH H O   1 
HETATM 4249 O O   . HOH M 6 .   ? 83.913  71.378 25.388  1.00 44.91  ? 636 HOH H O   1 
HETATM 4250 O O   . HOH M 6 .   ? 96.535  41.700 16.664  1.00 37.42  ? 637 HOH H O   1 
HETATM 4251 O O   . HOH M 6 .   ? 95.354  58.648 25.360  1.00 48.95  ? 638 HOH H O   1 
HETATM 4252 O O   . HOH M 6 .   ? 99.044  20.629 7.932   1.00 26.54  ? 639 HOH H O   1 
HETATM 4253 O O   . HOH M 6 .   ? 101.657 34.516 24.841  1.00 53.44  ? 640 HOH H O   1 
HETATM 4254 O O   . HOH M 6 .   ? 91.275  49.378 4.517   1.00 40.04  ? 641 HOH H O   1 
HETATM 4255 O O   . HOH M 6 .   ? 104.988 37.301 20.453  1.00 38.98  ? 642 HOH H O   1 
HETATM 4256 O O   . HOH M 6 .   ? 112.677 36.591 4.243   1.00 31.48  ? 643 HOH H O   1 
HETATM 4257 O O   . HOH M 6 .   ? 104.251 47.761 13.355  1.00 27.57  ? 644 HOH H O   1 
HETATM 4258 O O   . HOH M 6 .   ? 108.339 59.056 -4.204  1.00 42.77  ? 645 HOH H O   1 
HETATM 4259 O O   . HOH M 6 .   ? 103.620 48.163 15.730  1.00 34.23  ? 646 HOH H O   1 
HETATM 4260 O O   . HOH M 6 .   ? 115.225 52.280 1.478   1.00 31.52  ? 647 HOH H O   1 
HETATM 4261 O O   . HOH M 6 .   ? 95.254  45.495 -0.728  1.00 31.68  ? 648 HOH H O   1 
HETATM 4262 O O   . HOH M 6 .   ? 114.860 45.806 6.502   1.00 36.69  ? 649 HOH H O   1 
HETATM 4263 O O   . HOH M 6 .   ? 93.141  50.710 5.143   1.00 34.27  ? 650 HOH H O   1 
HETATM 4264 O O   . HOH M 6 .   ? 104.591 29.091 -4.914  1.00 44.77  ? 651 HOH H O   1 
HETATM 4265 O O   . HOH M 6 .   ? 113.110 66.918 10.300  1.00 38.17  ? 652 HOH H O   1 
HETATM 4266 O O   . HOH M 6 .   ? 107.619 70.073 18.462  1.00 49.04  ? 653 HOH H O   1 
HETATM 4267 O O   . HOH M 6 .   ? 107.701 54.054 -7.002  1.00 37.11  ? 654 HOH H O   1 
HETATM 4268 O O   . HOH M 6 .   ? 115.062 36.852 3.154   1.00 38.75  ? 655 HOH H O   1 
HETATM 4269 O O   . HOH M 6 .   ? 113.254 29.511 6.085   1.00 31.80  ? 656 HOH H O   1 
HETATM 4270 O O   . HOH M 6 .   ? 101.940 21.303 3.036   1.00 46.21  ? 657 HOH H O   1 
HETATM 4271 O O   . HOH M 6 .   ? 103.221 58.449 22.741  1.00 57.13  ? 658 HOH H O   1 
HETATM 4272 O O   . HOH M 6 .   ? 106.014 60.259 23.460  1.00 50.85  ? 659 HOH H O   1 
HETATM 4273 O O   . HOH M 6 .   ? 90.261  20.387 13.873  1.00 41.37  ? 660 HOH H O   1 
HETATM 4274 O O   . HOH M 6 .   ? 114.905 31.468 0.868   1.00 46.66  ? 661 HOH H O   1 
HETATM 4275 O O   . HOH N 6 .   ? 94.873  36.411 -9.779  1.00 56.51  ? 401 HOH L O   1 
HETATM 4276 O O   . HOH N 6 .   ? 103.180 81.857 7.764   1.00 62.37  ? 402 HOH L O   1 
HETATM 4277 O O   . HOH N 6 .   ? 101.490 78.120 23.519  1.00 66.43  ? 403 HOH L O   1 
HETATM 4278 O O   . HOH N 6 .   ? 79.203  40.509 22.758  1.00 47.46  ? 404 HOH L O   1 
HETATM 4279 O O   . HOH N 6 .   ? 94.873  87.919 14.323  1.00 63.27  ? 405 HOH L O   1 
HETATM 4280 O O   . HOH N 6 .   ? 84.198  70.289 20.512  1.00 39.99  ? 406 HOH L O   1 
HETATM 4281 O O   . HOH N 6 .   ? 73.921  66.894 8.438   1.00 53.25  ? 407 HOH L O   1 
HETATM 4282 O O   . HOH N 6 .   ? 79.589  31.098 5.906   1.00 26.35  ? 408 HOH L O   1 
HETATM 4283 O O   . HOH N 6 .   ? 84.960  50.833 8.827   1.00 43.36  ? 409 HOH L O   1 
HETATM 4284 O O   . HOH N 6 .   ? 72.936  76.315 14.936  1.00 63.87  ? 410 HOH L O   1 
HETATM 4285 O O   . HOH N 6 .   ? 71.703  52.409 16.889  1.00 43.66  ? 411 HOH L O   1 
HETATM 4286 O O   . HOH N 6 .   ? 76.694  56.010 9.021   1.00 39.03  ? 412 HOH L O   1 
HETATM 4287 O O   . HOH N 6 .   ? 83.836  48.326 16.193  1.00 30.80  ? 413 HOH L O   1 
HETATM 4288 O O   . HOH N 6 .   ? 81.406  41.703 22.191  1.00 45.58  ? 414 HOH L O   1 
HETATM 4289 O O   . HOH N 6 .   ? 82.653  35.489 -6.954  1.00 41.73  ? 415 HOH L O   1 
HETATM 4290 O O   . HOH N 6 .   ? 88.539  28.061 17.425  1.00 45.02  ? 416 HOH L O   1 
HETATM 4291 O O   . HOH N 6 .   ? 95.166  24.642 -0.055  1.00 37.23  ? 417 HOH L O   1 
HETATM 4292 O O   . HOH N 6 .   ? 64.889  50.162 11.497  1.00 53.08  ? 418 HOH L O   1 
HETATM 4293 O O   . HOH N 6 .   ? 78.910  52.184 17.004  1.00 33.48  ? 419 HOH L O   1 
HETATM 4294 O O   . HOH N 6 .   ? 88.330  80.884 -0.488  1.00 71.08  ? 420 HOH L O   1 
HETATM 4295 O O   . HOH N 6 .   ? 73.888  26.741 5.643   1.00 45.00  ? 421 HOH L O   1 
HETATM 4296 O O   . HOH N 6 .   ? 96.087  84.625 18.088  1.00 51.16  ? 422 HOH L O   1 
HETATM 4297 O O   . HOH N 6 .   ? 80.065  49.605 22.450  1.00 40.08  ? 423 HOH L O   1 
HETATM 4298 O O   . HOH N 6 .   ? 86.873  29.443 -10.333 1.00 37.16  ? 424 HOH L O   1 
HETATM 4299 O O   . HOH N 6 .   ? 68.035  62.923 17.419  1.00 38.72  ? 425 HOH L O   1 
HETATM 4300 O O   . HOH N 6 .   ? 68.105  66.082 13.045  1.00 50.05  ? 426 HOH L O   1 
HETATM 4301 O O   . HOH N 6 .   ? 74.904  49.492 0.396   1.00 36.11  ? 427 HOH L O   1 
HETATM 4302 O O   . HOH N 6 .   ? 85.543  52.986 16.394  1.00 32.21  ? 428 HOH L O   1 
HETATM 4303 O O   . HOH N 6 .   ? 92.217  38.083 -2.414  1.00 36.92  ? 429 HOH L O   1 
HETATM 4304 O O   . HOH N 6 .   ? 84.665  42.623 21.435  1.00 46.80  ? 430 HOH L O   1 
HETATM 4305 O O   . HOH N 6 .   ? 89.230  43.914 14.201  1.00 20.94  ? 431 HOH L O   1 
HETATM 4306 O O   . HOH N 6 .   ? 83.312  47.503 1.200   1.00 37.75  ? 432 HOH L O   1 
HETATM 4307 O O   . HOH N 6 .   ? 69.082  59.441 11.881  1.00 45.34  ? 433 HOH L O   1 
HETATM 4308 O O   . HOH N 6 .   ? 79.524  40.040 2.699   1.00 35.21  ? 434 HOH L O   1 
HETATM 4309 O O   . HOH N 6 .   ? 76.988  61.120 22.197  1.00 41.48  ? 435 HOH L O   1 
HETATM 4310 O O   . HOH N 6 .   ? 91.431  49.988 9.702   1.00 39.97  ? 436 HOH L O   1 
HETATM 4311 O O   . HOH N 6 .   ? 88.940  61.839 6.600   1.00 35.69  ? 437 HOH L O   1 
HETATM 4312 O O   . HOH N 6 .   ? 78.000  52.067 5.628   1.00 48.14  ? 438 HOH L O   1 
HETATM 4313 O O   . HOH N 6 .   ? 74.244  53.205 19.332  1.00 42.09  ? 439 HOH L O   1 
HETATM 4314 O O   . HOH N 6 .   ? 88.076  57.990 8.206   1.00 39.31  ? 440 HOH L O   1 
HETATM 4315 O O   . HOH N 6 .   ? 82.770  60.691 17.198  1.00 36.13  ? 441 HOH L O   1 
HETATM 4316 O O   . HOH N 6 .   ? 78.909  73.255 20.166  1.00 35.81  ? 442 HOH L O   1 
HETATM 4317 O O   . HOH N 6 .   ? 87.504  49.014 9.534   1.00 38.23  ? 443 HOH L O   1 
HETATM 4318 O O   . HOH N 6 .   ? 75.855  47.813 21.755  1.00 38.04  ? 444 HOH L O   1 
HETATM 4319 O O   . HOH N 6 .   ? 82.174  46.031 24.690  1.00 59.06  ? 445 HOH L O   1 
HETATM 4320 O O   . HOH N 6 .   ? 76.346  58.412 8.380   1.00 32.79  ? 446 HOH L O   1 
HETATM 4321 O O   . HOH N 6 .   ? 83.772  41.720 -3.613  1.00 30.13  ? 447 HOH L O   1 
HETATM 4322 O O   . HOH N 6 .   ? 83.482  53.952 10.231  1.00 42.89  ? 448 HOH L O   1 
HETATM 4323 O O   . HOH N 6 .   ? 74.674  60.918 21.765  1.00 37.79  ? 449 HOH L O   1 
HETATM 4324 O O   . HOH N 6 .   ? 78.670  47.160 21.809  1.00 40.92  ? 450 HOH L O   1 
HETATM 4325 O O   . HOH N 6 .   ? 85.316  47.376 19.732  1.00 40.10  ? 451 HOH L O   1 
HETATM 4326 O O   . HOH N 6 .   ? 88.185  10.254 -1.891  1.00 66.87  ? 452 HOH L O   1 
HETATM 4327 O O   . HOH N 6 .   ? 96.254  89.769 13.713  1.00 72.31  ? 453 HOH L O   1 
HETATM 4328 O O   . HOH N 6 .   ? 87.352  42.829 18.866  1.00 37.07  ? 454 HOH L O   1 
HETATM 4329 O O   . HOH N 6 .   ? 95.162  44.930 16.210  1.00 35.05  ? 455 HOH L O   1 
HETATM 4330 O O   . HOH N 6 .   ? 85.905  53.811 18.902  1.00 40.26  ? 456 HOH L O   1 
HETATM 4331 O O   . HOH N 6 .   ? 82.532  26.659 18.487  1.00 46.63  ? 457 HOH L O   1 
HETATM 4332 O O   . HOH N 6 .   ? 81.280  26.515 16.765  1.00 49.66  ? 458 HOH L O   1 
HETATM 4333 O O   . HOH N 6 .   ? 73.372  71.785 12.720  1.00 56.39  ? 459 HOH L O   1 
HETATM 4334 O O   . HOH N 6 .   ? 91.001  67.799 2.731   1.00 52.75  ? 460 HOH L O   1 
HETATM 4335 O O   . HOH N 6 .   ? 103.442 75.821 10.725  1.00 43.11  ? 461 HOH L O   1 
HETATM 4336 O O   . HOH N 6 .   ? 73.450  25.739 2.582   1.00 42.75  ? 462 HOH L O   1 
HETATM 4337 O O   . HOH N 6 .   ? 75.561  63.149 20.961  1.00 36.21  ? 463 HOH L O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   THR 1   450 ?   ?   ?   E . n 
A 1 2   PRO 2   451 ?   ?   ?   E . n 
A 1 3   VAL 3   452 ?   ?   ?   E . n 
A 1 4   GLY 4   453 ?   ?   ?   E . n 
A 1 5   LEU 5   454 ?   ?   ?   E . n 
A 1 6   ALA 6   455 ?   ?   ?   E . n 
A 1 7   MET 7   456 ?   ?   ?   E . n 
A 1 8   SER 8   457 ?   ?   ?   E . n 
A 1 9   ALA 9   458 ?   ?   ?   E . n 
A 1 10  CYS 10  459 ?   ?   ?   E . n 
A 1 11  ARG 11  460 ?   ?   ?   E . n 
A 1 12  SER 12  461 ?   ?   ?   E . n 
A 1 13  ILE 13  462 ?   ?   ?   E . n 
A 1 14  GLU 14  463 ?   ?   ?   E . n 
A 1 15  ALA 15  464 ?   ?   ?   E . n 
A 1 16  PHE 16  465 ?   ?   ?   E . n 
A 1 17  ARG 17  466 ?   ?   ?   E . n 
A 1 18  VAL 18  467 ?   ?   ?   E . n 
A 1 19  GLY 19  468 ?   ?   ?   E . n 
A 1 20  TRP 20  469 ?   ?   ?   E . n 
A 1 21  GLY 21  470 ?   ?   ?   E . n 
A 1 22  ALA 22  471 ?   ?   ?   E . n 
A 1 23  LEU 23  472 ?   ?   ?   E . n 
A 1 24  GLN 24  473 ?   ?   ?   E . n 
A 1 25  TYR 25  474 ?   ?   ?   E . n 
A 1 26  GLU 26  475 ?   ?   ?   E . n 
A 1 27  ASP 27  476 ?   ?   ?   E . n 
A 1 28  ASN 28  477 ?   ?   ?   E . n 
A 1 29  VAL 29  478 ?   ?   ?   E . n 
A 1 30  THR 30  479 ?   ?   ?   E . n 
A 1 31  ASN 31  480 ?   ?   ?   E . n 
A 1 32  PRO 32  481 ?   ?   ?   E . n 
A 1 33  GLU 33  482 ?   ?   ?   E . n 
A 1 34  ASP 34  483 ?   ?   ?   E . n 
A 1 35  MET 35  484 ?   ?   ?   E . n 
A 1 36  ARG 36  485 ?   ?   ?   E . n 
A 1 37  PRO 37  486 ?   ?   ?   E . n 
A 1 38  TYR 38  487 ?   ?   ?   E . n 
A 1 39  CYS 39  488 488 CYS CYS E . n 
A 1 40  TRP 40  489 489 TRP TRP E . n 
A 1 41  HIS 41  490 490 HIS HIS E . n 
A 1 42  TYR 42  491 491 TYR TYR E . n 
A 1 43  PRO 43  492 492 PRO PRO E . n 
A 1 44  PRO 44  493 493 PRO PRO E . n 
A 1 45  ARG 45  494 494 ARG ARG E . n 
A 1 46  GLN 46  495 495 GLN GLN E . n 
A 1 47  CYS 47  496 496 CYS CYS E . n 
A 1 48  GLY 48  497 497 GLY GLY E . n 
A 1 49  VAL 49  498 498 VAL VAL E . n 
A 1 50  VAL 50  499 499 VAL VAL E . n 
A 1 51  SER 51  500 500 SER SER E . n 
A 1 52  ALA 52  501 501 ALA ALA E . n 
A 1 53  LYS 53  502 502 LYS LYS E . n 
A 1 54  THR 54  503 503 THR THR E . n 
A 1 55  VAL 55  504 504 VAL VAL E . n 
A 1 56  CYS 56  505 505 CYS CYS E . n 
A 1 57  GLY 57  506 506 GLY GLY E . n 
A 1 58  PRO 58  507 507 PRO PRO E . n 
A 1 59  VAL 59  508 508 VAL VAL E . n 
A 1 60  TYR 60  509 509 TYR TYR E . n 
A 1 61  CYS 61  510 510 CYS CYS E . n 
A 1 62  PHE 62  511 511 PHE PHE E . n 
A 1 63  THR 63  512 512 THR THR E . n 
A 1 64  PRO 64  513 513 PRO PRO E . n 
A 1 65  SER 65  514 514 SER SER E . n 
A 1 66  PRO 66  515 515 PRO PRO E . n 
A 1 67  VAL 67  516 516 VAL VAL E . n 
A 1 68  VAL 68  517 517 VAL VAL E . n 
A 1 69  VAL 69  518 518 VAL VAL E . n 
A 1 70  GLY 70  519 519 GLY GLY E . n 
A 1 71  THR 71  520 520 THR THR E . n 
A 1 72  THR 72  521 521 THR THR E . n 
A 1 73  ASP 73  522 522 ASP ASP E . n 
A 1 74  ARG 74  523 ?   ?   ?   E . n 
A 1 75  LEU 75  524 ?   ?   ?   E . n 
A 1 76  GLY 76  525 ?   ?   ?   E . n 
A 1 77  ALA 77  526 ?   ?   ?   E . n 
A 1 78  PRO 78  527 ?   ?   ?   E . n 
A 1 79  THR 79  528 ?   ?   ?   E . n 
A 1 80  TYR 80  529 ?   ?   ?   E . n 
A 1 81  THR 81  530 ?   ?   ?   E . n 
A 1 82  TRP 82  531 ?   ?   ?   E . n 
A 1 83  GLY 83  532 ?   ?   ?   E . n 
A 1 84  GLU 84  533 ?   ?   ?   E . n 
A 1 85  ASN 85  534 ?   ?   ?   E . n 
A 1 86  GLU 86  535 ?   ?   ?   E . n 
A 1 87  THR 87  536 ?   ?   ?   E . n 
A 1 88  ASP 88  537 ?   ?   ?   E . n 
A 1 89  VAL 89  538 538 VAL VAL E . n 
A 1 90  PHE 90  539 539 PHE PHE E . n 
A 1 91  LEU 91  540 540 LEU LEU E . n 
A 1 92  LEU 92  541 541 LEU LEU E . n 
A 1 93  ASN 93  542 542 ASN ASN E . n 
A 1 94  SER 94  543 543 SER SER E . n 
A 1 95  THR 95  544 544 THR THR E . n 
A 1 96  ARG 96  545 545 ARG ARG E . n 
A 1 97  PRO 97  546 546 PRO PRO E . n 
A 1 98  PRO 98  547 547 PRO PRO E . n 
A 1 99  LEU 99  548 548 LEU LEU E . n 
A 1 100 GLY 100 549 549 GLY GLY E . n 
A 1 101 SER 101 550 550 SER SER E . n 
A 1 102 TRP 102 551 551 TRP TRP E . n 
A 1 103 PHE 103 552 552 PHE PHE E . n 
A 1 104 GLY 104 553 553 GLY GLY E . n 
A 1 105 CYS 105 554 554 CYS CYS E . n 
A 1 106 THR 106 555 555 THR THR E . n 
A 1 107 TRP 107 556 556 TRP TRP E . n 
A 1 108 MET 108 557 557 MET MET E . n 
A 1 109 ASN 109 558 558 ASN ASN E . n 
A 1 110 SER 110 559 559 SER SER E . n 
A 1 111 SER 111 560 560 SER SER E . n 
A 1 112 GLY 112 561 561 GLY GLY E . n 
A 1 113 TYR 113 562 562 TYR TYR E . n 
A 1 114 THR 114 563 563 THR THR E . n 
A 1 115 LYS 115 564 564 LYS LYS E . n 
A 1 116 THR 116 565 565 THR THR E . n 
A 1 117 CYS 117 566 566 CYS CYS E . n 
A 1 118 GLY 118 567 567 GLY GLY E . n 
A 1 119 ALA 119 568 568 ALA ALA E . n 
A 1 120 PRO 120 569 569 PRO PRO E . n 
A 1 121 PRO 121 570 570 PRO PRO E . n 
A 1 122 CYS 122 571 571 CYS CYS E . n 
A 1 123 ARG 123 572 ?   ?   ?   E . n 
A 1 124 THR 124 573 ?   ?   ?   E . n 
A 1 125 ARG 125 574 ?   ?   ?   E . n 
A 1 126 ALA 126 575 ?   ?   ?   E . n 
A 1 127 ASP 127 576 ?   ?   ?   E . n 
A 1 128 PHE 128 577 ?   ?   ?   E . n 
A 1 129 ASN 129 578 ?   ?   ?   E . n 
A 1 130 ALA 130 579 ?   ?   ?   E . n 
A 1 131 SER 131 580 ?   ?   ?   E . n 
A 1 132 THR 132 581 ?   ?   ?   E . n 
A 1 133 ASP 133 582 ?   ?   ?   E . n 
A 1 134 LEU 134 583 ?   ?   ?   E . n 
A 1 135 LEU 135 584 ?   ?   ?   E . n 
A 1 136 CYS 136 585 ?   ?   ?   E . n 
A 1 137 PRO 137 586 ?   ?   ?   E . n 
A 1 138 THR 138 587 ?   ?   ?   E . n 
A 1 139 ASP 139 588 ?   ?   ?   E . n 
A 1 140 CYS 140 589 ?   ?   ?   E . n 
A 1 141 PHE 141 590 ?   ?   ?   E . n 
A 1 142 ARG 142 591 ?   ?   ?   E . n 
A 1 143 LYS 143 592 ?   ?   ?   E . n 
A 1 144 HIS 144 593 ?   ?   ?   E . n 
A 1 145 PRO 145 594 ?   ?   ?   E . n 
A 1 146 ASP 146 595 ?   ?   ?   E . n 
A 1 147 THR 147 596 596 THR THR E . n 
A 1 148 THR 148 597 597 THR THR E . n 
A 1 149 TYR 149 598 598 TYR TYR E . n 
A 1 150 LEU 150 599 599 LEU LEU E . n 
A 1 151 LYS 151 600 600 LYS LYS E . n 
A 1 152 CYS 152 601 601 CYS CYS E . n 
A 1 153 GLY 153 602 602 GLY GLY E . n 
A 1 154 SER 154 603 603 SER SER E . n 
A 1 155 GLY 155 604 604 GLY GLY E . n 
A 1 156 PRO 156 605 605 PRO PRO E . n 
A 1 157 TRP 157 606 606 TRP TRP E . n 
A 1 158 LEU 158 607 607 LEU LEU E . n 
A 1 159 THR 159 608 608 THR THR E . n 
A 1 160 PRO 160 609 609 PRO PRO E . n 
A 1 161 ARG 161 610 610 ARG ARG E . n 
A 1 162 CYS 162 611 611 CYS CYS E . n 
A 1 163 LEU 163 612 612 LEU LEU E . n 
A 1 164 ILE 164 613 613 ILE ILE E . n 
A 1 165 ASP 165 614 614 ASP ASP E . n 
A 1 166 TYR 166 615 615 TYR TYR E . n 
A 1 167 PRO 167 616 616 PRO PRO E . n 
A 1 168 TYR 168 617 617 TYR TYR E . n 
A 1 169 ARG 169 618 618 ARG ARG E . n 
A 1 170 LEU 170 619 619 LEU LEU E . n 
A 1 171 TRP 171 620 620 TRP TRP E . n 
A 1 172 HIS 172 621 621 HIS HIS E . n 
A 1 173 TYR 173 622 622 TYR TYR E . n 
A 1 174 PRO 174 623 623 PRO PRO E . n 
A 1 175 CYS 175 624 624 CYS CYS E . n 
A 1 176 THR 176 625 625 THR THR E . n 
A 1 177 VAL 177 626 626 VAL VAL E . n 
A 1 178 ASN 178 627 627 ASN ASN E . n 
A 1 179 TYR 179 628 628 TYR TYR E . n 
A 1 180 THR 180 629 629 THR THR E . n 
A 1 181 ILE 181 630 630 ILE ILE E . n 
A 1 182 PHE 182 631 631 PHE PHE E . n 
A 1 183 LYS 183 632 632 LYS LYS E . n 
A 1 184 ILE 184 633 633 ILE ILE E . n 
A 1 185 ARG 185 634 634 ARG ARG E . n 
A 1 186 MET 186 635 635 MET MET E . n 
A 1 187 TYR 187 636 636 TYR TYR E . n 
A 1 188 VAL 188 637 637 VAL VAL E . n 
A 1 189 GLY 189 638 638 GLY GLY E . n 
A 1 190 GLY 190 639 639 GLY GLY E . n 
A 1 191 VAL 191 640 640 VAL VAL E . n 
A 1 192 GLU 192 641 641 GLU GLU E . n 
A 1 193 HIS 193 642 642 HIS HIS E . n 
A 1 194 ARG 194 643 643 ARG ARG E . n 
A 1 195 LEU 195 644 644 LEU LEU E . n 
A 1 196 THR 196 645 645 THR THR E . n 
A 1 197 ALA 197 646 646 ALA ALA E . n 
A 1 198 ALA 198 647 647 ALA ALA E . n 
A 1 199 CYS 199 648 648 CYS CYS E . n 
A 1 200 ASN 200 649 649 ASN ASN E . n 
A 1 201 PHE 201 650 ?   ?   ?   E . n 
A 1 202 THR 202 651 ?   ?   ?   E . n 
A 1 203 ARG 203 652 ?   ?   ?   E . n 
A 1 204 GLY 204 653 ?   ?   ?   E . n 
A 1 205 ASP 205 654 ?   ?   ?   E . n 
A 1 206 ARG 206 655 ?   ?   ?   E . n 
A 1 207 GLY 207 656 ?   ?   ?   E . n 
A 1 208 SER 208 657 ?   ?   ?   E . n 
A 1 209 ALA 209 658 ?   ?   ?   E . n 
A 1 210 SER 210 659 ?   ?   ?   E . n 
A 1 211 GLY 211 660 ?   ?   ?   E . n 
A 1 212 LEU 212 661 ?   ?   ?   E . n 
A 1 213 GLU 213 662 ?   ?   ?   E . n 
A 1 214 VAL 214 663 ?   ?   ?   E . n 
A 1 215 LEU 215 664 ?   ?   ?   E . n 
A 1 216 PHE 216 665 ?   ?   ?   E . n 
A 1 217 GLN 217 666 ?   ?   ?   E . n 
B 2 1   MET 1   -18 ?   ?   ?   H . n 
B 2 2   LYS 2   -17 ?   ?   ?   H . n 
B 2 3   CYS 3   -16 ?   ?   ?   H . n 
B 2 4   SER 4   -15 ?   ?   ?   H . n 
B 2 5   TRP 5   -14 ?   ?   ?   H . n 
B 2 6   VAL 6   -13 ?   ?   ?   H . n 
B 2 7   ILE 7   -12 ?   ?   ?   H . n 
B 2 8   PHE 8   -11 ?   ?   ?   H . n 
B 2 9   PHE 9   -10 ?   ?   ?   H . n 
B 2 10  LEU 10  -9  ?   ?   ?   H . n 
B 2 11  MET 11  -8  ?   ?   ?   H . n 
B 2 12  ALA 12  -7  ?   ?   ?   H . n 
B 2 13  VAL 13  -6  ?   ?   ?   H . n 
B 2 14  VAL 14  -5  ?   ?   ?   H . n 
B 2 15  THR 15  -4  ?   ?   ?   H . n 
B 2 16  GLY 16  -3  ?   ?   ?   H . n 
B 2 17  VAL 17  -2  ?   ?   ?   H . n 
B 2 18  ILE 18  -1  ?   ?   ?   H . n 
B 2 19  SER 19  0   ?   ?   ?   H . n 
B 2 20  GLU 20  1   1   GLU GLU H . n 
B 2 21  VAL 21  2   2   VAL VAL H . n 
B 2 22  GLN 22  3   3   GLN GLN H . n 
B 2 23  LEU 23  4   4   LEU LEU H . n 
B 2 24  GLN 24  5   5   GLN GLN H . n 
B 2 25  GLN 25  6   6   GLN GLN H . n 
B 2 26  SER 26  7   7   SER SER H . n 
B 2 27  GLY 27  8   8   GLY GLY H . n 
B 2 28  ALA 28  9   9   ALA ALA H . n 
B 2 29  GLU 29  10  10  GLU GLU H . n 
B 2 30  LEU 30  11  11  LEU LEU H . n 
B 2 31  VAL 31  12  12  VAL VAL H . n 
B 2 32  LYS 32  13  13  LYS LYS H . n 
B 2 33  PRO 33  14  14  PRO PRO H . n 
B 2 34  GLY 34  15  15  GLY GLY H . n 
B 2 35  ALA 35  16  16  ALA ALA H . n 
B 2 36  SER 36  17  17  SER SER H . n 
B 2 37  VAL 37  18  18  VAL VAL H . n 
B 2 38  LYS 38  19  19  LYS LYS H . n 
B 2 39  LEU 39  20  20  LEU LEU H . n 
B 2 40  SER 40  21  21  SER SER H . n 
B 2 41  CYS 41  22  22  CYS CYS H . n 
B 2 42  THR 42  23  23  THR THR H . n 
B 2 43  ALA 43  24  24  ALA ALA H . n 
B 2 44  SER 44  25  25  SER SER H . n 
B 2 45  GLY 45  26  26  GLY GLY H . n 
B 2 46  PHE 46  27  27  PHE PHE H . n 
B 2 47  ASN 47  28  28  ASN ASN H . n 
B 2 48  ILE 48  29  29  ILE ILE H . n 
B 2 49  LYS 49  30  30  LYS LYS H . n 
B 2 50  ASP 50  31  31  ASP ASP H . n 
B 2 51  THR 51  32  32  THR THR H . n 
B 2 52  TYR 52  33  33  TYR TYR H . n 
B 2 53  ILE 53  34  34  ILE ILE H . n 
B 2 54  HIS 54  35  35  HIS HIS H . n 
B 2 55  TRP 55  36  36  TRP TRP H . n 
B 2 56  VAL 56  37  37  VAL VAL H . n 
B 2 57  ASN 57  38  38  ASN ASN H . n 
B 2 58  GLN 58  39  39  GLN GLN H . n 
B 2 59  ARG 59  40  40  ARG ARG H . n 
B 2 60  PRO 60  41  41  PRO PRO H . n 
B 2 61  GLU 61  42  42  GLU GLU H . n 
B 2 62  GLN 62  43  43  GLN GLN H . n 
B 2 63  GLY 63  44  44  GLY GLY H . n 
B 2 64  LEU 64  45  45  LEU LEU H . n 
B 2 65  GLU 65  46  46  GLU GLU H . n 
B 2 66  TRP 66  47  47  TRP TRP H . n 
B 2 67  ILE 67  48  48  ILE ILE H . n 
B 2 68  GLY 68  49  49  GLY GLY H . n 
B 2 69  ARG 69  50  50  ARG ARG H . n 
B 2 70  ILE 70  51  51  ILE ILE H . n 
B 2 71  ASP 71  52  52  ASP ASP H . n 
B 2 72  PRO 72  53  53  PRO PRO H . n 
B 2 73  ALA 73  54  54  ALA ALA H . n 
B 2 74  ASN 74  55  55  ASN ASN H . n 
B 2 75  GLY 75  56  56  GLY GLY H . n 
B 2 76  HIS 76  57  57  HIS HIS H . n 
B 2 77  THR 77  58  58  THR THR H . n 
B 2 78  GLN 78  59  59  GLN GLN H . n 
B 2 79  TYR 79  60  60  TYR TYR H . n 
B 2 80  ASP 80  61  61  ASP ASP H . n 
B 2 81  PRO 81  62  62  PRO PRO H . n 
B 2 82  LYS 82  63  63  LYS LYS H . n 
B 2 83  PHE 83  64  64  PHE PHE H . n 
B 2 84  GLN 84  65  65  GLN GLN H . n 
B 2 85  GLY 85  66  66  GLY GLY H . n 
B 2 86  LYS 86  67  67  LYS LYS H . n 
B 2 87  ALA 87  68  68  ALA ALA H . n 
B 2 88  THR 88  69  69  THR THR H . n 
B 2 89  ILE 89  70  70  ILE ILE H . n 
B 2 90  THR 90  71  71  THR THR H . n 
B 2 91  ALA 91  72  72  ALA ALA H . n 
B 2 92  ASP 92  73  73  ASP ASP H . n 
B 2 93  THR 93  74  74  THR THR H . n 
B 2 94  SER 94  75  75  SER SER H . n 
B 2 95  SER 95  76  76  SER SER H . n 
B 2 96  ASN 96  77  77  ASN ASN H . n 
B 2 97  THR 97  78  78  THR THR H . n 
B 2 98  ALA 98  79  79  ALA ALA H . n 
B 2 99  TYR 99  80  80  TYR TYR H . n 
B 2 100 LEU 100 81  81  LEU LEU H . n 
B 2 101 GLN 101 82  82  GLN GLN H . n 
B 2 102 LEU 102 83  83  LEU LEU H . n 
B 2 103 SER 103 84  84  SER SER H . n 
B 2 104 SER 104 85  85  SER SER H . n 
B 2 105 LEU 105 86  86  LEU LEU H . n 
B 2 106 THR 106 87  87  THR THR H . n 
B 2 107 SER 107 88  88  SER SER H . n 
B 2 108 GLU 108 89  89  GLU GLU H . n 
B 2 109 ASP 109 90  90  ASP ASP H . n 
B 2 110 THR 110 91  91  THR THR H . n 
B 2 111 ALA 111 92  92  ALA ALA H . n 
B 2 112 VAL 112 93  93  VAL VAL H . n 
B 2 113 TYR 113 94  94  TYR TYR H . n 
B 2 114 TYR 114 95  95  TYR TYR H . n 
B 2 115 CYS 115 96  96  CYS CYS H . n 
B 2 116 ALA 116 97  97  ALA ALA H . n 
B 2 117 THR 117 98  98  THR THR H . n 
B 2 118 SER 118 99  99  SER SER H . n 
B 2 119 ASP 119 100 100 ASP ASP H . n 
B 2 120 TYR 120 101 101 TYR TYR H . n 
B 2 121 SER 121 102 102 SER SER H . n 
B 2 122 TYR 122 103 103 TYR TYR H . n 
B 2 123 ALA 123 104 104 ALA ALA H . n 
B 2 124 LEU 124 105 105 LEU LEU H . n 
B 2 125 ASP 125 106 106 ASP ASP H . n 
B 2 126 SER 126 107 107 SER SER H . n 
B 2 127 TRP 127 108 108 TRP TRP H . n 
B 2 128 GLY 128 109 109 GLY GLY H . n 
B 2 129 GLN 129 110 110 GLN GLN H . n 
B 2 130 GLY 130 111 111 GLY GLY H . n 
B 2 131 THR 131 112 112 THR THR H . n 
B 2 132 SER 132 113 113 SER SER H . n 
B 2 133 VAL 133 114 114 VAL VAL H . n 
B 2 134 THR 134 115 115 THR THR H . n 
B 2 135 VAL 135 116 116 VAL VAL H . n 
B 2 136 SER 136 117 117 SER SER H . n 
B 2 137 SER 137 118 118 SER SER H . n 
B 2 138 ALA 138 119 119 ALA ALA H . n 
B 2 139 LYS 139 120 120 LYS LYS H . n 
B 2 140 THR 140 121 121 THR THR H . n 
B 2 141 THR 141 122 122 THR THR H . n 
B 2 142 ALA 142 123 123 ALA ALA H . n 
B 2 143 PRO 143 124 124 PRO PRO H . n 
B 2 144 SER 144 125 125 SER SER H . n 
B 2 145 VAL 145 126 126 VAL VAL H . n 
B 2 146 TYR 146 127 127 TYR TYR H . n 
B 2 147 PRO 147 128 128 PRO PRO H . n 
B 2 148 LEU 148 129 129 LEU LEU H . n 
B 2 149 ALA 149 130 130 ALA ALA H . n 
B 2 150 PRO 150 131 131 PRO PRO H . n 
B 2 151 VAL 151 132 132 VAL VAL H . n 
B 2 152 CYS 152 133 133 CYS CYS H . n 
B 2 153 GLY 153 134 ?   ?   ?   H . n 
B 2 154 ASP 154 135 ?   ?   ?   H . n 
B 2 155 THR 155 136 136 THR THR H . n 
B 2 156 THR 156 137 137 THR THR H . n 
B 2 157 GLY 157 138 138 GLY GLY H . n 
B 2 158 SER 158 139 139 SER SER H . n 
B 2 159 SER 159 140 140 SER SER H . n 
B 2 160 VAL 160 141 141 VAL VAL H . n 
B 2 161 THR 161 142 142 THR THR H . n 
B 2 162 LEU 162 143 143 LEU LEU H . n 
B 2 163 GLY 163 144 144 GLY GLY H . n 
B 2 164 CYS 164 145 145 CYS CYS H . n 
B 2 165 LEU 165 146 146 LEU LEU H . n 
B 2 166 VAL 166 147 147 VAL VAL H . n 
B 2 167 LYS 167 148 148 LYS LYS H . n 
B 2 168 GLY 168 149 149 GLY GLY H . n 
B 2 169 TYR 169 150 150 TYR TYR H . n 
B 2 170 PHE 170 151 151 PHE PHE H . n 
B 2 171 PRO 171 152 152 PRO PRO H . n 
B 2 172 GLU 172 153 153 GLU GLU H . n 
B 2 173 PRO 173 154 154 PRO PRO H . n 
B 2 174 VAL 174 155 155 VAL VAL H . n 
B 2 175 THR 175 156 156 THR THR H . n 
B 2 176 LEU 176 157 157 LEU LEU H . n 
B 2 177 THR 177 158 158 THR THR H . n 
B 2 178 TRP 178 159 159 TRP TRP H . n 
B 2 179 ASN 179 160 160 ASN ASN H . n 
B 2 180 SER 180 161 161 SER SER H . n 
B 2 181 GLY 181 162 162 GLY GLY H . n 
B 2 182 SER 182 163 163 SER SER H . n 
B 2 183 LEU 183 164 164 LEU LEU H . n 
B 2 184 SER 184 165 165 SER SER H . n 
B 2 185 SER 185 166 166 SER SER H . n 
B 2 186 GLY 186 167 167 GLY GLY H . n 
B 2 187 VAL 187 168 168 VAL VAL H . n 
B 2 188 HIS 188 169 169 HIS HIS H . n 
B 2 189 THR 189 170 170 THR THR H . n 
B 2 190 PHE 190 171 171 PHE PHE H . n 
B 2 191 PRO 191 172 172 PRO PRO H . n 
B 2 192 ALA 192 173 173 ALA ALA H . n 
B 2 193 VAL 193 174 174 VAL VAL H . n 
B 2 194 LEU 194 175 175 LEU LEU H . n 
B 2 195 GLN 195 176 176 GLN GLN H . n 
B 2 196 SER 196 177 177 SER SER H . n 
B 2 197 ASP 197 178 178 ASP ASP H . n 
B 2 198 LEU 198 179 179 LEU LEU H . n 
B 2 199 TYR 199 180 180 TYR TYR H . n 
B 2 200 THR 200 181 181 THR THR H . n 
B 2 201 LEU 201 182 182 LEU LEU H . n 
B 2 202 SER 202 183 183 SER SER H . n 
B 2 203 SER 203 184 184 SER SER H . n 
B 2 204 SER 204 185 185 SER SER H . n 
B 2 205 VAL 205 186 186 VAL VAL H . n 
B 2 206 THR 206 187 187 THR THR H . n 
B 2 207 VAL 207 188 188 VAL VAL H . n 
B 2 208 THR 208 189 189 THR THR H . n 
B 2 209 SER 209 190 190 SER SER H . n 
B 2 210 SER 210 191 191 SER SER H . n 
B 2 211 THR 211 192 192 THR THR H . n 
B 2 212 TRP 212 193 193 TRP TRP H . n 
B 2 213 PRO 213 194 194 PRO PRO H . n 
B 2 214 SER 214 195 195 SER SER H . n 
B 2 215 GLN 215 196 196 GLN GLN H . n 
B 2 216 SER 216 197 197 SER SER H . n 
B 2 217 ILE 217 198 198 ILE ILE H . n 
B 2 218 THR 218 199 199 THR THR H . n 
B 2 219 CYS 219 200 200 CYS CYS H . n 
B 2 220 ASN 220 201 201 ASN ASN H . n 
B 2 221 VAL 221 202 202 VAL VAL H . n 
B 2 222 ALA 222 203 203 ALA ALA H . n 
B 2 223 HIS 223 204 204 HIS HIS H . n 
B 2 224 PRO 224 205 205 PRO PRO H . n 
B 2 225 ALA 225 206 206 ALA ALA H . n 
B 2 226 SER 226 207 207 SER SER H . n 
B 2 227 SER 227 208 208 SER SER H . n 
B 2 228 THR 228 209 209 THR THR H . n 
B 2 229 LYS 229 210 210 LYS LYS H . n 
B 2 230 VAL 230 211 211 VAL VAL H . n 
B 2 231 ASP 231 212 212 ASP ASP H . n 
B 2 232 LYS 232 213 213 LYS LYS H . n 
B 2 233 LYS 233 214 214 LYS LYS H . n 
B 2 234 ILE 234 215 215 ILE ILE H . n 
B 2 235 GLU 235 216 216 GLU GLU H . n 
B 2 236 PRO 236 217 217 PRO PRO H . n 
B 2 237 ARG 237 218 218 ARG ARG H . n 
B 2 238 GLY 238 219 ?   ?   ?   H . n 
B 2 239 PRO 239 220 ?   ?   ?   H . n 
B 2 240 THR 240 221 ?   ?   ?   H . n 
B 2 241 ILE 241 222 ?   ?   ?   H . n 
B 2 242 LYS 242 223 ?   ?   ?   H . n 
B 2 243 PRO 243 224 ?   ?   ?   H . n 
B 2 244 CYS 244 225 ?   ?   ?   H . n 
B 2 245 PRO 245 226 ?   ?   ?   H . n 
B 2 246 PRO 246 227 ?   ?   ?   H . n 
B 2 247 CYS 247 228 ?   ?   ?   H . n 
B 2 248 LYS 248 229 ?   ?   ?   H . n 
B 2 249 CYS 249 230 ?   ?   ?   H . n 
B 2 250 PRO 250 231 ?   ?   ?   H . n 
B 2 251 ALA 251 232 ?   ?   ?   H . n 
B 2 252 PRO 252 233 ?   ?   ?   H . n 
B 2 253 ASN 253 234 ?   ?   ?   H . n 
B 2 254 LEU 254 235 ?   ?   ?   H . n 
B 2 255 LEU 255 236 ?   ?   ?   H . n 
B 2 256 GLY 256 237 ?   ?   ?   H . n 
B 2 257 GLY 257 238 ?   ?   ?   H . n 
B 2 258 PRO 258 239 ?   ?   ?   H . n 
B 2 259 SER 259 240 ?   ?   ?   H . n 
B 2 260 VAL 260 241 ?   ?   ?   H . n 
B 2 261 PHE 261 242 ?   ?   ?   H . n 
B 2 262 ILE 262 243 ?   ?   ?   H . n 
B 2 263 PHE 263 244 ?   ?   ?   H . n 
B 2 264 PRO 264 245 ?   ?   ?   H . n 
B 2 265 PRO 265 246 ?   ?   ?   H . n 
B 2 266 LYS 266 247 ?   ?   ?   H . n 
B 2 267 ILE 267 248 ?   ?   ?   H . n 
B 2 268 LYS 268 249 ?   ?   ?   H . n 
B 2 269 ASP 269 250 ?   ?   ?   H . n 
B 2 270 VAL 270 251 ?   ?   ?   H . n 
B 2 271 LEU 271 252 ?   ?   ?   H . n 
B 2 272 MET 272 253 ?   ?   ?   H . n 
B 2 273 ILE 273 254 ?   ?   ?   H . n 
B 2 274 SER 274 255 ?   ?   ?   H . n 
B 2 275 LEU 275 256 ?   ?   ?   H . n 
B 2 276 SER 276 257 ?   ?   ?   H . n 
B 2 277 PRO 277 258 ?   ?   ?   H . n 
B 2 278 ILE 278 259 ?   ?   ?   H . n 
B 2 279 VAL 279 260 ?   ?   ?   H . n 
B 2 280 THR 280 261 ?   ?   ?   H . n 
B 2 281 CYS 281 262 ?   ?   ?   H . n 
B 2 282 VAL 282 263 ?   ?   ?   H . n 
B 2 283 VAL 283 264 ?   ?   ?   H . n 
B 2 284 VAL 284 265 ?   ?   ?   H . n 
B 2 285 ASP 285 266 ?   ?   ?   H . n 
B 2 286 VAL 286 267 ?   ?   ?   H . n 
B 2 287 SER 287 268 ?   ?   ?   H . n 
B 2 288 GLU 288 269 ?   ?   ?   H . n 
B 2 289 ASP 289 270 ?   ?   ?   H . n 
B 2 290 ASP 290 271 ?   ?   ?   H . n 
B 2 291 PRO 291 272 ?   ?   ?   H . n 
B 2 292 ASP 292 273 ?   ?   ?   H . n 
B 2 293 VAL 293 274 ?   ?   ?   H . n 
B 2 294 GLN 294 275 ?   ?   ?   H . n 
B 2 295 ILE 295 276 ?   ?   ?   H . n 
B 2 296 SER 296 277 ?   ?   ?   H . n 
B 2 297 TRP 297 278 ?   ?   ?   H . n 
B 2 298 PHE 298 279 ?   ?   ?   H . n 
B 2 299 VAL 299 280 ?   ?   ?   H . n 
B 2 300 ASN 300 281 ?   ?   ?   H . n 
B 2 301 ASN 301 282 ?   ?   ?   H . n 
B 2 302 VAL 302 283 ?   ?   ?   H . n 
B 2 303 GLU 303 284 ?   ?   ?   H . n 
B 2 304 VAL 304 285 ?   ?   ?   H . n 
B 2 305 HIS 305 286 ?   ?   ?   H . n 
B 2 306 THR 306 287 ?   ?   ?   H . n 
B 2 307 ALA 307 288 ?   ?   ?   H . n 
B 2 308 GLN 308 289 ?   ?   ?   H . n 
B 2 309 THR 309 290 ?   ?   ?   H . n 
B 2 310 GLN 310 291 ?   ?   ?   H . n 
B 2 311 THR 311 292 ?   ?   ?   H . n 
B 2 312 HIS 312 293 ?   ?   ?   H . n 
B 2 313 ARG 313 294 ?   ?   ?   H . n 
B 2 314 GLU 314 295 ?   ?   ?   H . n 
B 2 315 ASP 315 296 ?   ?   ?   H . n 
B 2 316 TYR 316 297 ?   ?   ?   H . n 
B 2 317 ASN 317 298 ?   ?   ?   H . n 
B 2 318 SER 318 299 ?   ?   ?   H . n 
B 2 319 THR 319 300 ?   ?   ?   H . n 
B 2 320 LEU 320 301 ?   ?   ?   H . n 
B 2 321 ARG 321 302 ?   ?   ?   H . n 
B 2 322 VAL 322 303 ?   ?   ?   H . n 
B 2 323 VAL 323 304 ?   ?   ?   H . n 
B 2 324 SER 324 305 ?   ?   ?   H . n 
B 2 325 ALA 325 306 ?   ?   ?   H . n 
B 2 326 LEU 326 307 ?   ?   ?   H . n 
B 2 327 PRO 327 308 ?   ?   ?   H . n 
B 2 328 ILE 328 309 ?   ?   ?   H . n 
B 2 329 GLN 329 310 ?   ?   ?   H . n 
B 2 330 HIS 330 311 ?   ?   ?   H . n 
B 2 331 GLN 331 312 ?   ?   ?   H . n 
B 2 332 ASP 332 313 ?   ?   ?   H . n 
B 2 333 TRP 333 314 ?   ?   ?   H . n 
B 2 334 MET 334 315 ?   ?   ?   H . n 
B 2 335 SER 335 316 ?   ?   ?   H . n 
B 2 336 GLY 336 317 ?   ?   ?   H . n 
B 2 337 LYS 337 318 ?   ?   ?   H . n 
B 2 338 GLU 338 319 ?   ?   ?   H . n 
B 2 339 PHE 339 320 ?   ?   ?   H . n 
B 2 340 LYS 340 321 ?   ?   ?   H . n 
B 2 341 CYS 341 322 ?   ?   ?   H . n 
B 2 342 LYS 342 323 ?   ?   ?   H . n 
B 2 343 VAL 343 324 ?   ?   ?   H . n 
B 2 344 ASN 344 325 ?   ?   ?   H . n 
B 2 345 ASN 345 326 ?   ?   ?   H . n 
B 2 346 LYS 346 327 ?   ?   ?   H . n 
B 2 347 ASP 347 328 ?   ?   ?   H . n 
B 2 348 LEU 348 329 ?   ?   ?   H . n 
B 2 349 PRO 349 330 ?   ?   ?   H . n 
B 2 350 ALA 350 331 ?   ?   ?   H . n 
B 2 351 PRO 351 332 ?   ?   ?   H . n 
B 2 352 ILE 352 333 ?   ?   ?   H . n 
B 2 353 GLU 353 334 ?   ?   ?   H . n 
B 2 354 ARG 354 335 ?   ?   ?   H . n 
B 2 355 THR 355 336 ?   ?   ?   H . n 
B 2 356 ILE 356 337 ?   ?   ?   H . n 
B 2 357 SER 357 338 ?   ?   ?   H . n 
B 2 358 LYS 358 339 ?   ?   ?   H . n 
B 2 359 PRO 359 340 ?   ?   ?   H . n 
B 2 360 LYS 360 341 ?   ?   ?   H . n 
B 2 361 GLY 361 342 ?   ?   ?   H . n 
B 2 362 SER 362 343 ?   ?   ?   H . n 
B 2 363 VAL 363 344 ?   ?   ?   H . n 
B 2 364 ARG 364 345 ?   ?   ?   H . n 
B 2 365 ALA 365 346 ?   ?   ?   H . n 
B 2 366 PRO 366 347 ?   ?   ?   H . n 
B 2 367 GLN 367 348 ?   ?   ?   H . n 
B 2 368 VAL 368 349 ?   ?   ?   H . n 
B 2 369 TYR 369 350 ?   ?   ?   H . n 
B 2 370 VAL 370 351 ?   ?   ?   H . n 
B 2 371 LEU 371 352 ?   ?   ?   H . n 
B 2 372 PRO 372 353 ?   ?   ?   H . n 
B 2 373 PRO 373 354 ?   ?   ?   H . n 
B 2 374 PRO 374 355 ?   ?   ?   H . n 
B 2 375 GLU 375 356 ?   ?   ?   H . n 
B 2 376 GLU 376 357 ?   ?   ?   H . n 
B 2 377 GLU 377 358 ?   ?   ?   H . n 
B 2 378 MET 378 359 ?   ?   ?   H . n 
B 2 379 THR 379 360 ?   ?   ?   H . n 
B 2 380 LYS 380 361 ?   ?   ?   H . n 
B 2 381 LYS 381 362 ?   ?   ?   H . n 
B 2 382 GLN 382 363 ?   ?   ?   H . n 
B 2 383 VAL 383 364 ?   ?   ?   H . n 
B 2 384 THR 384 365 ?   ?   ?   H . n 
B 2 385 LEU 385 366 ?   ?   ?   H . n 
B 2 386 THR 386 367 ?   ?   ?   H . n 
B 2 387 CYS 387 368 ?   ?   ?   H . n 
B 2 388 MET 388 369 ?   ?   ?   H . n 
B 2 389 VAL 389 370 ?   ?   ?   H . n 
B 2 390 THR 390 371 ?   ?   ?   H . n 
B 2 391 ASP 391 372 ?   ?   ?   H . n 
B 2 392 PHE 392 373 ?   ?   ?   H . n 
B 2 393 MET 393 374 ?   ?   ?   H . n 
B 2 394 PRO 394 375 ?   ?   ?   H . n 
B 2 395 GLU 395 376 ?   ?   ?   H . n 
B 2 396 ASP 396 377 ?   ?   ?   H . n 
B 2 397 ILE 397 378 ?   ?   ?   H . n 
B 2 398 TYR 398 379 ?   ?   ?   H . n 
B 2 399 VAL 399 380 ?   ?   ?   H . n 
B 2 400 GLU 400 381 ?   ?   ?   H . n 
B 2 401 TRP 401 382 ?   ?   ?   H . n 
B 2 402 THR 402 383 ?   ?   ?   H . n 
B 2 403 ASN 403 384 ?   ?   ?   H . n 
B 2 404 ASN 404 385 ?   ?   ?   H . n 
B 2 405 GLY 405 386 ?   ?   ?   H . n 
B 2 406 LYS 406 387 ?   ?   ?   H . n 
B 2 407 THR 407 388 ?   ?   ?   H . n 
B 2 408 GLU 408 389 ?   ?   ?   H . n 
B 2 409 LEU 409 390 ?   ?   ?   H . n 
B 2 410 ASN 410 391 ?   ?   ?   H . n 
B 2 411 TYR 411 392 ?   ?   ?   H . n 
B 2 412 LYS 412 393 ?   ?   ?   H . n 
B 2 413 ASN 413 394 ?   ?   ?   H . n 
B 2 414 THR 414 395 ?   ?   ?   H . n 
B 2 415 GLU 415 396 ?   ?   ?   H . n 
B 2 416 PRO 416 397 ?   ?   ?   H . n 
B 2 417 VAL 417 398 ?   ?   ?   H . n 
B 2 418 LEU 418 399 ?   ?   ?   H . n 
B 2 419 ASP 419 400 ?   ?   ?   H . n 
B 2 420 SER 420 401 ?   ?   ?   H . n 
B 2 421 ASP 421 402 ?   ?   ?   H . n 
B 2 422 GLY 422 403 ?   ?   ?   H . n 
B 2 423 SER 423 404 ?   ?   ?   H . n 
B 2 424 TYR 424 405 ?   ?   ?   H . n 
B 2 425 PHE 425 406 ?   ?   ?   H . n 
B 2 426 MET 426 407 ?   ?   ?   H . n 
B 2 427 TYR 427 408 ?   ?   ?   H . n 
B 2 428 SER 428 409 ?   ?   ?   H . n 
B 2 429 LYS 429 410 ?   ?   ?   H . n 
B 2 430 LEU 430 411 ?   ?   ?   H . n 
B 2 431 ARG 431 412 ?   ?   ?   H . n 
B 2 432 VAL 432 413 ?   ?   ?   H . n 
B 2 433 GLU 433 414 ?   ?   ?   H . n 
B 2 434 LYS 434 415 ?   ?   ?   H . n 
B 2 435 LYS 435 416 ?   ?   ?   H . n 
B 2 436 ASN 436 417 ?   ?   ?   H . n 
B 2 437 TRP 437 418 ?   ?   ?   H . n 
B 2 438 VAL 438 419 ?   ?   ?   H . n 
B 2 439 GLU 439 420 ?   ?   ?   H . n 
B 2 440 ARG 440 421 ?   ?   ?   H . n 
B 2 441 ASN 441 422 ?   ?   ?   H . n 
B 2 442 SER 442 423 ?   ?   ?   H . n 
B 2 443 TYR 443 424 ?   ?   ?   H . n 
B 2 444 SER 444 425 ?   ?   ?   H . n 
B 2 445 CYS 445 426 ?   ?   ?   H . n 
B 2 446 SER 446 427 ?   ?   ?   H . n 
B 2 447 VAL 447 428 ?   ?   ?   H . n 
B 2 448 VAL 448 429 ?   ?   ?   H . n 
B 2 449 HIS 449 430 ?   ?   ?   H . n 
B 2 450 GLU 450 431 ?   ?   ?   H . n 
B 2 451 GLY 451 432 ?   ?   ?   H . n 
B 2 452 LEU 452 433 ?   ?   ?   H . n 
B 2 453 HIS 453 434 ?   ?   ?   H . n 
B 2 454 ASN 454 435 ?   ?   ?   H . n 
B 2 455 HIS 455 436 ?   ?   ?   H . n 
B 2 456 HIS 456 437 ?   ?   ?   H . n 
B 2 457 THR 457 438 ?   ?   ?   H . n 
B 2 458 THR 458 439 ?   ?   ?   H . n 
B 2 459 LYS 459 440 ?   ?   ?   H . n 
B 2 460 SER 460 441 ?   ?   ?   H . n 
B 2 461 PHE 461 442 ?   ?   ?   H . n 
B 2 462 SER 462 443 ?   ?   ?   H . n 
B 2 463 ARG 463 444 ?   ?   ?   H . n 
B 2 464 THR 464 445 ?   ?   ?   H . n 
B 2 465 PRO 465 446 ?   ?   ?   H . n 
B 2 466 GLY 466 447 ?   ?   ?   H . n 
B 2 467 LYS 467 448 ?   ?   ?   H . n 
C 3 1   MET 1   -19 ?   ?   ?   L . n 
C 3 2   GLU 2   -18 ?   ?   ?   L . n 
C 3 3   SER 3   -17 ?   ?   ?   L . n 
C 3 4   GLN 4   -16 ?   ?   ?   L . n 
C 3 5   THR 5   -15 ?   ?   ?   L . n 
C 3 6   GLN 6   -14 ?   ?   ?   L . n 
C 3 7   VAL 7   -13 ?   ?   ?   L . n 
C 3 8   LEU 8   -12 ?   ?   ?   L . n 
C 3 9   MET 9   -11 ?   ?   ?   L . n 
C 3 10  PHE 10  -10 ?   ?   ?   L . n 
C 3 11  LEU 11  -9  ?   ?   ?   L . n 
C 3 12  LEU 12  -8  ?   ?   ?   L . n 
C 3 13  LEU 13  -7  ?   ?   ?   L . n 
C 3 14  TRP 14  -6  ?   ?   ?   L . n 
C 3 15  VAL 15  -5  ?   ?   ?   L . n 
C 3 16  SER 16  -4  ?   ?   ?   L . n 
C 3 17  GLY 17  -3  ?   ?   ?   L . n 
C 3 18  ALA 18  -2  ?   ?   ?   L . n 
C 3 19  CYS 19  -1  ?   ?   ?   L . n 
C 3 20  ALA 20  0   ?   ?   ?   L . n 
C 3 21  ASP 21  1   1   ASP ASP L . n 
C 3 22  ILE 22  2   2   ILE ILE L . n 
C 3 23  VAL 23  3   3   VAL VAL L . n 
C 3 24  MET 24  4   4   MET MET L . n 
C 3 25  THR 25  5   5   THR THR L . n 
C 3 26  GLN 26  6   6   GLN GLN L . n 
C 3 27  SER 27  7   7   SER SER L . n 
C 3 28  PRO 28  8   8   PRO PRO L . n 
C 3 29  SER 29  9   9   SER SER L . n 
C 3 30  SER 30  10  10  SER SER L . n 
C 3 31  LEU 31  11  11  LEU LEU L . n 
C 3 32  ALA 32  12  12  ALA ALA L . n 
C 3 33  MET 33  13  13  MET MET L . n 
C 3 34  SER 34  14  14  SER SER L . n 
C 3 35  VAL 35  15  15  VAL VAL L . n 
C 3 36  GLY 36  16  16  GLY GLY L . n 
C 3 37  GLN 37  17  17  GLN GLN L . n 
C 3 38  LYS 38  18  18  LYS LYS L . n 
C 3 39  VAL 39  19  19  VAL VAL L . n 
C 3 40  THR 40  20  20  THR THR L . n 
C 3 41  MET 41  21  21  MET MET L . n 
C 3 42  SER 42  22  22  SER SER L . n 
C 3 43  CYS 43  23  23  CYS CYS L . n 
C 3 44  LYS 44  24  24  LYS LYS L . n 
C 3 45  SER 45  25  25  SER SER L . n 
C 3 46  SER 46  26  26  SER SER L . n 
C 3 47  GLN 47  27  27  GLN GLN L . n 
C 3 48  SER 48  28  28  SER SER L . n 
C 3 49  LEU 49  29  29  LEU LEU L . n 
C 3 50  LEU 50  30  30  LEU LEU L . n 
C 3 51  ASN 51  31  31  ASN ASN L . n 
C 3 52  SER 52  32  32  SER SER L . n 
C 3 53  ASN 53  33  33  ASN ASN L . n 
C 3 54  ASN 54  34  34  ASN ASN L . n 
C 3 55  GLN 55  35  35  GLN GLN L . n 
C 3 56  LYS 56  36  36  LYS LYS L . n 
C 3 57  ASN 57  37  37  ASN ASN L . n 
C 3 58  TYR 58  38  38  TYR TYR L . n 
C 3 59  LEU 59  39  39  LEU LEU L . n 
C 3 60  ALA 60  40  40  ALA ALA L . n 
C 3 61  TRP 61  41  41  TRP TRP L . n 
C 3 62  TYR 62  42  42  TYR TYR L . n 
C 3 63  GLN 63  43  43  GLN GLN L . n 
C 3 64  GLN 64  44  44  GLN GLN L . n 
C 3 65  LYS 65  45  45  LYS LYS L . n 
C 3 66  PRO 66  46  46  PRO PRO L . n 
C 3 67  GLY 67  47  47  GLY GLY L . n 
C 3 68  GLN 68  48  48  GLN GLN L . n 
C 3 69  SER 69  49  49  SER SER L . n 
C 3 70  PRO 70  50  50  PRO PRO L . n 
C 3 71  LYS 71  51  51  LYS LYS L . n 
C 3 72  LEU 72  52  52  LEU LEU L . n 
C 3 73  LEU 73  53  53  LEU LEU L . n 
C 3 74  VAL 74  54  54  VAL VAL L . n 
C 3 75  TYR 75  55  55  TYR TYR L . n 
C 3 76  PHE 76  56  56  PHE PHE L . n 
C 3 77  ALA 77  57  57  ALA ALA L . n 
C 3 78  SER 78  58  58  SER SER L . n 
C 3 79  THR 79  59  59  THR THR L . n 
C 3 80  ARG 80  60  60  ARG ARG L . n 
C 3 81  GLU 81  61  61  GLU GLU L . n 
C 3 82  SER 82  62  62  SER SER L . n 
C 3 83  GLY 83  63  63  GLY GLY L . n 
C 3 84  VAL 84  64  64  VAL VAL L . n 
C 3 85  PRO 85  65  65  PRO PRO L . n 
C 3 86  ASP 86  66  66  ASP ASP L . n 
C 3 87  ARG 87  67  67  ARG ARG L . n 
C 3 88  PHE 88  68  68  PHE PHE L . n 
C 3 89  ILE 89  69  69  ILE ILE L . n 
C 3 90  GLY 90  70  70  GLY GLY L . n 
C 3 91  SER 91  71  71  SER SER L . n 
C 3 92  GLY 92  72  72  GLY GLY L . n 
C 3 93  SER 93  73  73  SER SER L . n 
C 3 94  GLY 94  74  74  GLY GLY L . n 
C 3 95  THR 95  75  75  THR THR L . n 
C 3 96  ASP 96  76  76  ASP ASP L . n 
C 3 97  PHE 97  77  77  PHE PHE L . n 
C 3 98  THR 98  78  78  THR THR L . n 
C 3 99  LEU 99  79  79  LEU LEU L . n 
C 3 100 THR 100 80  80  THR THR L . n 
C 3 101 ILE 101 81  81  ILE ILE L . n 
C 3 102 SER 102 82  82  SER SER L . n 
C 3 103 SER 103 83  83  SER SER L . n 
C 3 104 VAL 104 84  84  VAL VAL L . n 
C 3 105 GLN 105 85  85  GLN GLN L . n 
C 3 106 ALA 106 86  86  ALA ALA L . n 
C 3 107 GLU 107 87  87  GLU GLU L . n 
C 3 108 ASP 108 88  88  ASP ASP L . n 
C 3 109 LEU 109 89  89  LEU LEU L . n 
C 3 110 ALA 110 90  90  ALA ALA L . n 
C 3 111 ASP 111 91  91  ASP ASP L . n 
C 3 112 TYR 112 92  92  TYR TYR L . n 
C 3 113 PHE 113 93  93  PHE PHE L . n 
C 3 114 CYS 114 94  94  CYS CYS L . n 
C 3 115 GLN 115 95  95  GLN GLN L . n 
C 3 116 GLN 116 96  96  GLN GLN L . n 
C 3 117 HIS 117 97  97  HIS HIS L . n 
C 3 118 TYR 118 98  98  TYR TYR L . n 
C 3 119 SER 119 99  99  SER SER L . n 
C 3 120 THR 120 100 100 THR THR L . n 
C 3 121 PRO 121 101 101 PRO PRO L . n 
C 3 122 TYR 122 102 102 TYR TYR L . n 
C 3 123 THR 123 103 103 THR THR L . n 
C 3 124 PHE 124 104 104 PHE PHE L . n 
C 3 125 GLY 125 105 105 GLY GLY L . n 
C 3 126 GLY 126 106 106 GLY GLY L . n 
C 3 127 GLY 127 107 107 GLY GLY L . n 
C 3 128 THR 128 108 108 THR THR L . n 
C 3 129 LYS 129 109 109 LYS LYS L . n 
C 3 130 LEU 130 110 110 LEU LEU L . n 
C 3 131 GLU 131 111 111 GLU GLU L . n 
C 3 132 ILE 132 112 112 ILE ILE L . n 
C 3 133 ARG 133 113 113 ARG ARG L . n 
C 3 134 ARG 134 114 114 ARG ARG L . n 
C 3 135 ALA 135 115 115 ALA ALA L . n 
C 3 136 ASP 136 116 116 ASP ASP L . n 
C 3 137 ALA 137 117 117 ALA ALA L . n 
C 3 138 ALA 138 118 118 ALA ALA L . n 
C 3 139 PRO 139 119 119 PRO PRO L . n 
C 3 140 THR 140 120 120 THR THR L . n 
C 3 141 VAL 141 121 121 VAL VAL L . n 
C 3 142 SER 142 122 122 SER SER L . n 
C 3 143 ILE 143 123 123 ILE ILE L . n 
C 3 144 PHE 144 124 124 PHE PHE L . n 
C 3 145 PRO 145 125 125 PRO PRO L . n 
C 3 146 PRO 146 126 126 PRO PRO L . n 
C 3 147 SER 147 127 127 SER SER L . n 
C 3 148 SER 148 128 128 SER SER L . n 
C 3 149 GLU 149 129 129 GLU GLU L . n 
C 3 150 GLN 150 130 130 GLN GLN L . n 
C 3 151 LEU 151 131 131 LEU LEU L . n 
C 3 152 THR 152 132 132 THR THR L . n 
C 3 153 SER 153 133 133 SER SER L . n 
C 3 154 GLY 154 134 134 GLY GLY L . n 
C 3 155 GLY 155 135 135 GLY GLY L . n 
C 3 156 ALA 156 136 136 ALA ALA L . n 
C 3 157 SER 157 137 137 SER SER L . n 
C 3 158 VAL 158 138 138 VAL VAL L . n 
C 3 159 VAL 159 139 139 VAL VAL L . n 
C 3 160 CYS 160 140 140 CYS CYS L . n 
C 3 161 PHE 161 141 141 PHE PHE L . n 
C 3 162 LEU 162 142 142 LEU LEU L . n 
C 3 163 ASN 163 143 143 ASN ASN L . n 
C 3 164 ASN 164 144 144 ASN ASN L . n 
C 3 165 PHE 165 145 145 PHE PHE L . n 
C 3 166 TYR 166 146 146 TYR TYR L . n 
C 3 167 PRO 167 147 147 PRO PRO L . n 
C 3 168 LYS 168 148 148 LYS LYS L . n 
C 3 169 ASP 169 149 149 ASP ASP L . n 
C 3 170 ILE 170 150 150 ILE ILE L . n 
C 3 171 ASN 171 151 151 ASN ASN L . n 
C 3 172 VAL 172 152 152 VAL VAL L . n 
C 3 173 LYS 173 153 153 LYS LYS L . n 
C 3 174 TRP 174 154 154 TRP TRP L . n 
C 3 175 LYS 175 155 155 LYS LYS L . n 
C 3 176 ILE 176 156 156 ILE ILE L . n 
C 3 177 ASP 177 157 157 ASP ASP L . n 
C 3 178 GLY 178 158 158 GLY GLY L . n 
C 3 179 SER 179 159 159 SER SER L . n 
C 3 180 GLU 180 160 160 GLU GLU L . n 
C 3 181 ARG 181 161 161 ARG ARG L . n 
C 3 182 GLN 182 162 162 GLN GLN L . n 
C 3 183 ASN 183 163 163 ASN ASN L . n 
C 3 184 GLY 184 164 164 GLY GLY L . n 
C 3 185 VAL 185 165 165 VAL VAL L . n 
C 3 186 LEU 186 166 166 LEU LEU L . n 
C 3 187 ASN 187 167 167 ASN ASN L . n 
C 3 188 SER 188 168 168 SER SER L . n 
C 3 189 TRP 189 169 169 TRP TRP L . n 
C 3 190 THR 190 170 170 THR THR L . n 
C 3 191 ASP 191 171 171 ASP ASP L . n 
C 3 192 GLN 192 172 172 GLN GLN L . n 
C 3 193 ASP 193 173 173 ASP ASP L . n 
C 3 194 SER 194 174 174 SER SER L . n 
C 3 195 LYS 195 175 175 LYS LYS L . n 
C 3 196 ASP 196 176 176 ASP ASP L . n 
C 3 197 SER 197 177 177 SER SER L . n 
C 3 198 THR 198 178 178 THR THR L . n 
C 3 199 TYR 199 179 179 TYR TYR L . n 
C 3 200 SER 200 180 180 SER SER L . n 
C 3 201 MET 201 181 181 MET MET L . n 
C 3 202 SER 202 182 182 SER SER L . n 
C 3 203 SER 203 183 183 SER SER L . n 
C 3 204 THR 204 184 184 THR THR L . n 
C 3 205 LEU 205 185 185 LEU LEU L . n 
C 3 206 THR 206 186 186 THR THR L . n 
C 3 207 LEU 207 187 187 LEU LEU L . n 
C 3 208 THR 208 188 188 THR THR L . n 
C 3 209 LYS 209 189 189 LYS LYS L . n 
C 3 210 ASP 210 190 190 ASP ASP L . n 
C 3 211 GLU 211 191 191 GLU GLU L . n 
C 3 212 TYR 212 192 192 TYR TYR L . n 
C 3 213 GLU 213 193 193 GLU GLU L . n 
C 3 214 ARG 214 194 194 ARG ARG L . n 
C 3 215 HIS 215 195 195 HIS HIS L . n 
C 3 216 ASN 216 196 196 ASN ASN L . n 
C 3 217 SER 217 197 197 SER SER L . n 
C 3 218 TYR 218 198 198 TYR TYR L . n 
C 3 219 THR 219 199 199 THR THR L . n 
C 3 220 CYS 220 200 200 CYS CYS L . n 
C 3 221 GLU 221 201 201 GLU GLU L . n 
C 3 222 ALA 222 202 202 ALA ALA L . n 
C 3 223 THR 223 203 203 THR THR L . n 
C 3 224 HIS 224 204 204 HIS HIS L . n 
C 3 225 LYS 225 205 205 LYS LYS L . n 
C 3 226 THR 226 206 206 THR THR L . n 
C 3 227 SER 227 207 207 SER SER L . n 
C 3 228 THR 228 208 208 THR THR L . n 
C 3 229 SER 229 209 209 SER SER L . n 
C 3 230 PRO 230 210 210 PRO PRO L . n 
C 3 231 ILE 231 211 211 ILE ILE L . n 
C 3 232 VAL 232 212 212 VAL VAL L . n 
C 3 233 LYS 233 213 213 LYS LYS L . n 
C 3 234 SER 234 214 214 SER SER L . n 
C 3 235 PHE 235 215 215 PHE PHE L . n 
C 3 236 ASN 236 216 216 ASN ASN L . n 
C 3 237 ARG 237 217 217 ARG ARG L . n 
C 3 238 ASN 238 218 ?   ?   ?   L . n 
C 3 239 GLU 239 219 ?   ?   ?   L . n 
C 3 240 CYS 240 220 ?   ?   ?   L . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 NAG 1  701 701 NAG NAG E . 
E 4 NAG 1  702 702 NAG NAG E . 
F 5 ARF 1  703 703 ARF ARF E . 
G 5 ARF 1  501 501 ARF ARF H . 
H 5 ARF 1  502 502 ARF ARF H . 
I 5 ARF 1  503 503 ARF ARF H . 
J 5 ARF 1  301 301 ARF ARF L . 
K 5 ARF 1  302 302 ARF ARF L . 
L 6 HOH 1  801 814 HOH HOH E . 
L 6 HOH 2  802 808 HOH HOH E . 
L 6 HOH 3  803 806 HOH HOH E . 
L 6 HOH 4  804 807 HOH HOH E . 
L 6 HOH 5  805 801 HOH HOH E . 
L 6 HOH 6  806 813 HOH HOH E . 
L 6 HOH 7  807 804 HOH HOH E . 
L 6 HOH 8  808 811 HOH HOH E . 
L 6 HOH 9  809 802 HOH HOH E . 
L 6 HOH 10 810 803 HOH HOH E . 
L 6 HOH 11 811 809 HOH HOH E . 
L 6 HOH 12 812 812 HOH HOH E . 
M 6 HOH 1  601 652 HOH HOH H . 
M 6 HOH 2  602 645 HOH HOH H . 
M 6 HOH 3  603 658 HOH HOH H . 
M 6 HOH 4  604 636 HOH HOH H . 
M 6 HOH 5  605 622 HOH HOH H . 
M 6 HOH 6  606 638 HOH HOH H . 
M 6 HOH 7  607 640 HOH HOH H . 
M 6 HOH 8  608 654 HOH HOH H . 
M 6 HOH 9  609 623 HOH HOH H . 
M 6 HOH 10 610 637 HOH HOH H . 
M 6 HOH 11 611 629 HOH HOH H . 
M 6 HOH 12 612 639 HOH HOH H . 
M 6 HOH 13 613 642 HOH HOH H . 
M 6 HOH 14 614 625 HOH HOH H . 
M 6 HOH 15 615 603 HOH HOH H . 
M 6 HOH 16 616 651 HOH HOH H . 
M 6 HOH 17 617 604 HOH HOH H . 
M 6 HOH 18 618 616 HOH HOH H . 
M 6 HOH 19 619 606 HOH HOH H . 
M 6 HOH 20 620 621 HOH HOH H . 
M 6 HOH 21 621 631 HOH HOH H . 
M 6 HOH 22 622 611 HOH HOH H . 
M 6 HOH 23 623 634 HOH HOH H . 
M 6 HOH 24 624 632 HOH HOH H . 
M 6 HOH 25 625 624 HOH HOH H . 
M 6 HOH 26 626 610 HOH HOH H . 
M 6 HOH 27 627 608 HOH HOH H . 
M 6 HOH 28 628 628 HOH HOH H . 
M 6 HOH 29 629 627 HOH HOH H . 
M 6 HOH 30 630 660 HOH HOH H . 
M 6 HOH 31 631 615 HOH HOH H . 
M 6 HOH 32 632 602 HOH HOH H . 
M 6 HOH 33 633 620 HOH HOH H . 
M 6 HOH 34 634 601 HOH HOH H . 
M 6 HOH 35 635 626 HOH HOH H . 
M 6 HOH 36 636 618 HOH HOH H . 
M 6 HOH 37 637 643 HOH HOH H . 
M 6 HOH 38 638 648 HOH HOH H . 
M 6 HOH 39 639 617 HOH HOH H . 
M 6 HOH 40 640 630 HOH HOH H . 
M 6 HOH 41 641 613 HOH HOH H . 
M 6 HOH 42 642 633 HOH HOH H . 
M 6 HOH 43 643 612 HOH HOH H . 
M 6 HOH 44 644 619 HOH HOH H . 
M 6 HOH 45 645 614 HOH HOH H . 
M 6 HOH 46 646 657 HOH HOH H . 
M 6 HOH 47 647 607 HOH HOH H . 
M 6 HOH 48 648 644 HOH HOH H . 
M 6 HOH 49 649 635 HOH HOH H . 
M 6 HOH 50 650 605 HOH HOH H . 
M 6 HOH 51 651 649 HOH HOH H . 
M 6 HOH 52 652 609 HOH HOH H . 
M 6 HOH 53 653 659 HOH HOH H . 
M 6 HOH 54 654 656 HOH HOH H . 
M 6 HOH 55 655 641 HOH HOH H . 
M 6 HOH 56 656 650 HOH HOH H . 
M 6 HOH 57 657 646 HOH HOH H . 
M 6 HOH 58 658 655 HOH HOH H . 
M 6 HOH 59 659 653 HOH HOH H . 
M 6 HOH 60 660 805 HOH HOH H . 
M 6 HOH 61 661 647 HOH HOH H . 
N 6 HOH 1  401 455 HOH HOH L . 
N 6 HOH 2  402 437 HOH HOH L . 
N 6 HOH 3  403 450 HOH HOH L . 
N 6 HOH 4  404 421 HOH HOH L . 
N 6 HOH 5  405 438 HOH HOH L . 
N 6 HOH 6  406 441 HOH HOH L . 
N 6 HOH 7  407 440 HOH HOH L . 
N 6 HOH 8  408 413 HOH HOH L . 
N 6 HOH 9  409 432 HOH HOH L . 
N 6 HOH 10 410 443 HOH HOH L . 
N 6 HOH 11 411 414 HOH HOH L . 
N 6 HOH 12 412 423 HOH HOH L . 
N 6 HOH 13 413 402 HOH HOH L . 
N 6 HOH 14 414 446 HOH HOH L . 
N 6 HOH 15 415 409 HOH HOH L . 
N 6 HOH 16 416 411 HOH HOH L . 
N 6 HOH 17 417 424 HOH HOH L . 
N 6 HOH 18 418 454 HOH HOH L . 
N 6 HOH 19 419 415 HOH HOH L . 
N 6 HOH 20 420 418 HOH HOH L . 
N 6 HOH 21 421 452 HOH HOH L . 
N 6 HOH 22 422 445 HOH HOH L . 
N 6 HOH 23 423 419 HOH HOH L . 
N 6 HOH 24 424 428 HOH HOH L . 
N 6 HOH 25 425 417 HOH HOH L . 
N 6 HOH 26 426 453 HOH HOH L . 
N 6 HOH 27 427 426 HOH HOH L . 
N 6 HOH 28 428 410 HOH HOH L . 
N 6 HOH 29 429 403 HOH HOH L . 
N 6 HOH 30 430 462 HOH HOH L . 
N 6 HOH 31 431 401 HOH HOH L . 
N 6 HOH 32 432 412 HOH HOH L . 
N 6 HOH 33 433 425 HOH HOH L . 
N 6 HOH 34 434 434 HOH HOH L . 
N 6 HOH 35 435 463 HOH HOH L . 
N 6 HOH 36 436 430 HOH HOH L . 
N 6 HOH 37 437 431 HOH HOH L . 
N 6 HOH 38 438 416 HOH HOH L . 
N 6 HOH 39 439 449 HOH HOH L . 
N 6 HOH 40 440 422 HOH HOH L . 
N 6 HOH 41 441 435 HOH HOH L . 
N 6 HOH 42 442 405 HOH HOH L . 
N 6 HOH 43 443 427 HOH HOH L . 
N 6 HOH 44 444 429 HOH HOH L . 
N 6 HOH 45 445 456 HOH HOH L . 
N 6 HOH 46 446 407 HOH HOH L . 
N 6 HOH 47 447 404 HOH HOH L . 
N 6 HOH 48 448 408 HOH HOH L . 
N 6 HOH 49 449 461 HOH HOH L . 
N 6 HOH 50 450 420 HOH HOH L . 
N 6 HOH 51 451 433 HOH HOH L . 
N 6 HOH 52 452 448 HOH HOH L . 
N 6 HOH 53 453 442 HOH HOH L . 
N 6 HOH 54 454 458 HOH HOH L . 
N 6 HOH 55 455 457 HOH HOH L . 
N 6 HOH 56 456 406 HOH HOH L . 
N 6 HOH 57 457 439 HOH HOH L . 
N 6 HOH 58 458 436 HOH HOH L . 
N 6 HOH 59 459 447 HOH HOH L . 
N 6 HOH 60 460 451 HOH HOH L . 
N 6 HOH 61 461 460 HOH HOH L . 
N 6 HOH 62 462 444 HOH HOH L . 
N 6 HOH 63 463 459 HOH HOH L . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6390  ? 
1 MORE         -13   ? 
1 'SSA (A^2)'  24440 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2014-12-17 
2 'Structure model' 1 1 2017-08-23 
3 'Structure model' 2 0 2017-10-25 
4 'Structure model' 2 1 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 4 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1  2 'Structure model' 'Data collection'        
2  2 'Structure model' 'Derived calculations'   
3  2 'Structure model' Other                    
4  2 'Structure model' 'Refinement description' 
5  2 'Structure model' 'Source and taxonomy'    
6  2 'Structure model' 'Structure summary'      
7  3 'Structure model' Advisory                 
8  3 'Structure model' 'Atomic model'           
9  3 'Structure model' 'Derived calculations'   
10 3 'Structure model' 'Refinement description' 
11 4 'Structure model' 'Data collection'        
12 4 'Structure model' 'Derived calculations'   
13 4 'Structure model' 'Structure summary'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' diffrn_detector             
2  2 'Structure model' entity                      
3  2 'Structure model' entity_src_gen              
4  2 'Structure model' pdbx_database_status        
5  2 'Structure model' pdbx_struct_oper_list       
6  2 'Structure model' software                    
7  3 'Structure model' atom_site                   
8  3 'Structure model' pdbx_struct_assembly        
9  3 'Structure model' pdbx_struct_assembly_gen    
10 3 'Structure model' pdbx_struct_assembly_prop   
11 3 'Structure model' pdbx_validate_close_contact 
12 3 'Structure model' refine_hist                 
13 3 'Structure model' struct_site_gen             
14 4 'Structure model' chem_comp                   
15 4 'Structure model' entity                      
16 4 'Structure model' pdbx_chem_comp_identifier   
17 4 'Structure model' pdbx_entity_nonpoly         
18 4 'Structure model' struct_conn                 
19 4 'Structure model' struct_site                 
20 4 'Structure model' struct_site_gen             
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_diffrn_detector.detector'                   
2  2 'Structure model' '_entity.pdbx_description'                    
3  2 'Structure model' '_entity_src_gen.pdbx_alt_source_flag'        
4  2 'Structure model' '_pdbx_database_status.pdb_format_compatible' 
5  2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation'   
6  2 'Structure model' '_software.version'                           
7  3 'Structure model' '_atom_site.B_iso_or_equiv'                   
8  3 'Structure model' '_atom_site.Cartn_x'                          
9  3 'Structure model' '_atom_site.Cartn_y'                          
10 3 'Structure model' '_atom_site.Cartn_z'                          
11 3 'Structure model' '_pdbx_struct_assembly_prop.biol_id'          
12 3 'Structure model' '_pdbx_struct_assembly_prop.value'            
13 3 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_1'  
14 3 'Structure model' '_pdbx_validate_close_contact.auth_seq_id_2'  
15 3 'Structure model' '_struct_site_gen.auth_seq_id'                
16 4 'Structure model' '_chem_comp.name'                             
17 4 'Structure model' '_chem_comp.type'                             
18 4 'Structure model' '_entity.pdbx_description'                    
19 4 'Structure model' '_pdbx_entity_nonpoly.name'                   
20 4 'Structure model' '_struct_conn.pdbx_role'                      
# 
_software.citation_id            ? 
_software.classification         refinement 
_software.compiler_name          ? 
_software.compiler_version       ? 
_software.contact_author         ? 
_software.contact_author_email   ? 
_software.date                   ? 
_software.description            ? 
_software.dependencies           ? 
_software.hardware               ? 
_software.language               ? 
_software.location               ? 
_software.mods                   ? 
_software.name                   PHENIX 
_software.os                     ? 
_software.os_version             ? 
_software.type                   ? 
_software.version                1.9_1690 
_software.pdbx_ordinal           1 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 ND2 E ASN 649 ? ? O5 E NAG 702 ? ? 1.83 
2 1 ND2 E ASN 558 ? ? O5 E NAG 701 ? ? 2.09 
3 1 O   L HOH 457 ? ? O  L HOH 458 ? ? 2.13 
4 1 OD2 L ASP 1   ? ? O  L HOH 401 ? ? 2.15 
5 1 OG1 L THR 199 ? ? OG L SER 214 ? ? 2.18 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 C E ARG 545 ? ? N E PRO 546 ? ? CA E PRO 546 ? ? 129.45 119.30 10.15 1.50 Y 
2 1 C E PRO 546 ? ? N E PRO 547 ? ? CA E PRO 547 ? ? 109.41 119.30 -9.89 1.50 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 HIS E 490 ? ? 73.40   -91.04  
2  1 TYR E 491 ? ? 56.99   108.71  
3  1 LYS E 502 ? ? 166.15  51.72   
4  1 THR E 503 ? ? -147.59 -18.28  
5  1 THR E 521 ? ? 56.83   -102.79 
6  1 PHE E 539 ? ? -143.25 -145.73 
7  1 LEU E 540 ? ? 7.64    96.79   
8  1 SER E 543 ? ? -175.12 144.43  
9  1 PRO E 546 ? ? -55.62  -3.25   
10 1 TRP E 556 ? ? -146.69 -153.56 
11 1 CYS E 648 ? ? -116.78 -122.70 
12 1 GLN H 43  ? ? -126.02 -169.86 
13 1 ASP H 100 ? ? -96.18  -159.25 
14 1 THR H 137 ? ? 64.68   116.95  
15 1 SER H 165 ? ? -141.82 -45.92  
16 1 LEU H 175 ? ? -134.66 -101.69 
17 1 GLN H 176 ? ? -168.14 -95.29  
18 1 SER H 177 ? ? 173.69  70.77   
19 1 THR H 189 ? ? -75.40  26.35   
20 1 SER H 190 ? ? 65.66   -26.03  
21 1 THR H 192 ? ? 65.34   -9.65   
22 1 PRO H 194 ? ? -78.04  -161.15 
23 1 SER H 195 ? ? 92.47   -57.68  
24 1 ALA L 57  ? ? 69.25   -29.33  
25 1 SER L 58  ? ? -142.65 -15.25  
26 1 ALA L 90  ? ? 179.20  171.82  
27 1 HIS L 97  ? ? -107.75 45.40   
28 1 ASN L 196 ? ? 167.26  133.39  
29 1 SER L 197 ? ? -107.77 -167.26 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 E TRP 489 ? CG  ? A TRP 40  CG  
2   1 Y 1 E TRP 489 ? CD1 ? A TRP 40  CD1 
3   1 Y 1 E TRP 489 ? CD2 ? A TRP 40  CD2 
4   1 Y 1 E TRP 489 ? NE1 ? A TRP 40  NE1 
5   1 Y 1 E TRP 489 ? CE2 ? A TRP 40  CE2 
6   1 Y 1 E TRP 489 ? CE3 ? A TRP 40  CE3 
7   1 Y 1 E TRP 489 ? CZ2 ? A TRP 40  CZ2 
8   1 Y 1 E TRP 489 ? CZ3 ? A TRP 40  CZ3 
9   1 Y 1 E TRP 489 ? CH2 ? A TRP 40  CH2 
10  1 Y 1 E HIS 490 ? CG  ? A HIS 41  CG  
11  1 Y 1 E HIS 490 ? ND1 ? A HIS 41  ND1 
12  1 Y 1 E HIS 490 ? CD2 ? A HIS 41  CD2 
13  1 Y 1 E HIS 490 ? CE1 ? A HIS 41  CE1 
14  1 Y 1 E HIS 490 ? NE2 ? A HIS 41  NE2 
15  1 Y 1 E TYR 491 ? CG  ? A TYR 42  CG  
16  1 Y 1 E TYR 491 ? CD1 ? A TYR 42  CD1 
17  1 Y 1 E TYR 491 ? CD2 ? A TYR 42  CD2 
18  1 Y 1 E TYR 491 ? CE1 ? A TYR 42  CE1 
19  1 Y 1 E TYR 491 ? CE2 ? A TYR 42  CE2 
20  1 Y 1 E TYR 491 ? CZ  ? A TYR 42  CZ  
21  1 Y 1 E TYR 491 ? OH  ? A TYR 42  OH  
22  1 Y 1 E ARG 494 ? CG  ? A ARG 45  CG  
23  1 Y 1 E ARG 494 ? CD  ? A ARG 45  CD  
24  1 Y 1 E ARG 494 ? NE  ? A ARG 45  NE  
25  1 Y 1 E ARG 494 ? CZ  ? A ARG 45  CZ  
26  1 Y 1 E ARG 494 ? NH1 ? A ARG 45  NH1 
27  1 Y 1 E ARG 494 ? NH2 ? A ARG 45  NH2 
28  1 Y 1 E GLN 495 ? CG  ? A GLN 46  CG  
29  1 Y 1 E GLN 495 ? CD  ? A GLN 46  CD  
30  1 Y 1 E GLN 495 ? OE1 ? A GLN 46  OE1 
31  1 Y 1 E GLN 495 ? NE2 ? A GLN 46  NE2 
32  1 Y 1 E LYS 502 ? CG  ? A LYS 53  CG  
33  1 Y 1 E LYS 502 ? CD  ? A LYS 53  CD  
34  1 Y 1 E LYS 502 ? CE  ? A LYS 53  CE  
35  1 Y 1 E LYS 502 ? NZ  ? A LYS 53  NZ  
36  1 Y 1 E ARG 545 ? CG  ? A ARG 96  CG  
37  1 Y 1 E ARG 545 ? CD  ? A ARG 96  CD  
38  1 Y 1 E ARG 545 ? NE  ? A ARG 96  NE  
39  1 Y 1 E ARG 545 ? CZ  ? A ARG 96  CZ  
40  1 Y 1 E ARG 545 ? NH1 ? A ARG 96  NH1 
41  1 Y 1 E ARG 545 ? NH2 ? A ARG 96  NH2 
42  1 Y 1 E TYR 562 ? CG  ? A TYR 113 CG  
43  1 Y 1 E TYR 562 ? CD1 ? A TYR 113 CD1 
44  1 Y 1 E TYR 562 ? CD2 ? A TYR 113 CD2 
45  1 Y 1 E TYR 562 ? CE1 ? A TYR 113 CE1 
46  1 Y 1 E TYR 562 ? CE2 ? A TYR 113 CE2 
47  1 Y 1 E TYR 562 ? CZ  ? A TYR 113 CZ  
48  1 Y 1 E TYR 562 ? OH  ? A TYR 113 OH  
49  1 Y 1 E LYS 564 ? CG  ? A LYS 115 CG  
50  1 Y 1 E LYS 564 ? CD  ? A LYS 115 CD  
51  1 Y 1 E LYS 564 ? CE  ? A LYS 115 CE  
52  1 Y 1 E LYS 564 ? NZ  ? A LYS 115 NZ  
53  1 Y 1 E LYS 600 ? CG  ? A LYS 151 CG  
54  1 Y 1 E LYS 600 ? CD  ? A LYS 151 CD  
55  1 Y 1 E LYS 600 ? CE  ? A LYS 151 CE  
56  1 Y 1 E LYS 600 ? NZ  ? A LYS 151 NZ  
57  1 Y 1 E ARG 610 ? CG  ? A ARG 161 CG  
58  1 Y 1 E ARG 610 ? CD  ? A ARG 161 CD  
59  1 Y 1 E ARG 610 ? NE  ? A ARG 161 NE  
60  1 Y 1 E ARG 610 ? CZ  ? A ARG 161 CZ  
61  1 Y 1 E ARG 610 ? NH1 ? A ARG 161 NH1 
62  1 Y 1 E ARG 610 ? NH2 ? A ARG 161 NH2 
63  1 Y 1 E TRP 620 ? CG  ? A TRP 171 CG  
64  1 Y 1 E TRP 620 ? CD1 ? A TRP 171 CD1 
65  1 Y 1 E TRP 620 ? CD2 ? A TRP 171 CD2 
66  1 Y 1 E TRP 620 ? NE1 ? A TRP 171 NE1 
67  1 Y 1 E TRP 620 ? CE2 ? A TRP 171 CE2 
68  1 Y 1 E TRP 620 ? CE3 ? A TRP 171 CE3 
69  1 Y 1 E TRP 620 ? CZ2 ? A TRP 171 CZ2 
70  1 Y 1 E TRP 620 ? CZ3 ? A TRP 171 CZ3 
71  1 Y 1 E TRP 620 ? CH2 ? A TRP 171 CH2 
72  1 Y 1 H GLN 196 ? CG  ? B GLN 215 CG  
73  1 Y 1 H GLN 196 ? CD  ? B GLN 215 CD  
74  1 Y 1 H GLN 196 ? OE1 ? B GLN 215 OE1 
75  1 Y 1 H GLN 196 ? NE2 ? B GLN 215 NE2 
76  1 Y 1 L LYS 24  ? CG  ? C LYS 44  CG  
77  1 Y 1 L LYS 24  ? CD  ? C LYS 44  CD  
78  1 Y 1 L LYS 24  ? CE  ? C LYS 44  CE  
79  1 Y 1 L LYS 24  ? NZ  ? C LYS 44  NZ  
80  1 Y 1 L ARG 113 ? CG  ? C ARG 133 CG  
81  1 Y 1 L ARG 113 ? CD  ? C ARG 133 CD  
82  1 Y 1 L ARG 113 ? NE  ? C ARG 133 NE  
83  1 Y 1 L ARG 113 ? CZ  ? C ARG 133 CZ  
84  1 Y 1 L ARG 113 ? NH1 ? C ARG 133 NH1 
85  1 Y 1 L ARG 113 ? NH2 ? C ARG 133 NH2 
86  1 Y 1 L LYS 148 ? CG  ? C LYS 168 CG  
87  1 Y 1 L LYS 148 ? CD  ? C LYS 168 CD  
88  1 Y 1 L LYS 148 ? CE  ? C LYS 168 CE  
89  1 Y 1 L LYS 148 ? NZ  ? C LYS 168 NZ  
90  1 Y 1 L LYS 153 ? CG  ? C LYS 173 CG  
91  1 Y 1 L LYS 153 ? CD  ? C LYS 173 CD  
92  1 Y 1 L LYS 153 ? CE  ? C LYS 173 CE  
93  1 Y 1 L LYS 153 ? NZ  ? C LYS 173 NZ  
94  1 Y 1 L LYS 155 ? CG  ? C LYS 175 CG  
95  1 Y 1 L LYS 155 ? CD  ? C LYS 175 CD  
96  1 Y 1 L LYS 155 ? CE  ? C LYS 175 CE  
97  1 Y 1 L LYS 155 ? NZ  ? C LYS 175 NZ  
98  1 Y 1 L GLU 160 ? CG  ? C GLU 180 CG  
99  1 Y 1 L GLU 160 ? CD  ? C GLU 180 CD  
100 1 Y 1 L GLU 160 ? OE1 ? C GLU 180 OE1 
101 1 Y 1 L GLU 160 ? OE2 ? C GLU 180 OE2 
102 1 Y 1 L LYS 189 ? CG  ? C LYS 209 CG  
103 1 Y 1 L LYS 189 ? CD  ? C LYS 209 CD  
104 1 Y 1 L LYS 189 ? CE  ? C LYS 209 CE  
105 1 Y 1 L LYS 189 ? NZ  ? C LYS 209 NZ  
106 1 Y 1 L ARG 194 ? CG  ? C ARG 214 CG  
107 1 Y 1 L ARG 194 ? CD  ? C ARG 214 CD  
108 1 Y 1 L ARG 194 ? NE  ? C ARG 214 NE  
109 1 Y 1 L ARG 194 ? CZ  ? C ARG 214 CZ  
110 1 Y 1 L ARG 194 ? NH1 ? C ARG 214 NH1 
111 1 Y 1 L ARG 194 ? NH2 ? C ARG 214 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 E THR 450 ? A THR 1   
2   1 Y 1 E PRO 451 ? A PRO 2   
3   1 Y 1 E VAL 452 ? A VAL 3   
4   1 Y 1 E GLY 453 ? A GLY 4   
5   1 Y 1 E LEU 454 ? A LEU 5   
6   1 Y 1 E ALA 455 ? A ALA 6   
7   1 Y 1 E MET 456 ? A MET 7   
8   1 Y 1 E SER 457 ? A SER 8   
9   1 Y 1 E ALA 458 ? A ALA 9   
10  1 Y 1 E CYS 459 ? A CYS 10  
11  1 Y 1 E ARG 460 ? A ARG 11  
12  1 Y 1 E SER 461 ? A SER 12  
13  1 Y 1 E ILE 462 ? A ILE 13  
14  1 Y 1 E GLU 463 ? A GLU 14  
15  1 Y 1 E ALA 464 ? A ALA 15  
16  1 Y 1 E PHE 465 ? A PHE 16  
17  1 Y 1 E ARG 466 ? A ARG 17  
18  1 Y 1 E VAL 467 ? A VAL 18  
19  1 Y 1 E GLY 468 ? A GLY 19  
20  1 Y 1 E TRP 469 ? A TRP 20  
21  1 Y 1 E GLY 470 ? A GLY 21  
22  1 Y 1 E ALA 471 ? A ALA 22  
23  1 Y 1 E LEU 472 ? A LEU 23  
24  1 Y 1 E GLN 473 ? A GLN 24  
25  1 Y 1 E TYR 474 ? A TYR 25  
26  1 Y 1 E GLU 475 ? A GLU 26  
27  1 Y 1 E ASP 476 ? A ASP 27  
28  1 Y 1 E ASN 477 ? A ASN 28  
29  1 Y 1 E VAL 478 ? A VAL 29  
30  1 Y 1 E THR 479 ? A THR 30  
31  1 Y 1 E ASN 480 ? A ASN 31  
32  1 Y 1 E PRO 481 ? A PRO 32  
33  1 Y 1 E GLU 482 ? A GLU 33  
34  1 Y 1 E ASP 483 ? A ASP 34  
35  1 Y 1 E MET 484 ? A MET 35  
36  1 Y 1 E ARG 485 ? A ARG 36  
37  1 Y 1 E PRO 486 ? A PRO 37  
38  1 Y 1 E TYR 487 ? A TYR 38  
39  1 Y 1 E ARG 523 ? A ARG 74  
40  1 Y 1 E LEU 524 ? A LEU 75  
41  1 Y 1 E GLY 525 ? A GLY 76  
42  1 Y 1 E ALA 526 ? A ALA 77  
43  1 Y 1 E PRO 527 ? A PRO 78  
44  1 Y 1 E THR 528 ? A THR 79  
45  1 Y 1 E TYR 529 ? A TYR 80  
46  1 Y 1 E THR 530 ? A THR 81  
47  1 Y 1 E TRP 531 ? A TRP 82  
48  1 Y 1 E GLY 532 ? A GLY 83  
49  1 Y 1 E GLU 533 ? A GLU 84  
50  1 Y 1 E ASN 534 ? A ASN 85  
51  1 Y 1 E GLU 535 ? A GLU 86  
52  1 Y 1 E THR 536 ? A THR 87  
53  1 Y 1 E ASP 537 ? A ASP 88  
54  1 Y 1 E ARG 572 ? A ARG 123 
55  1 Y 1 E THR 573 ? A THR 124 
56  1 Y 1 E ARG 574 ? A ARG 125 
57  1 Y 1 E ALA 575 ? A ALA 126 
58  1 Y 1 E ASP 576 ? A ASP 127 
59  1 Y 1 E PHE 577 ? A PHE 128 
60  1 Y 1 E ASN 578 ? A ASN 129 
61  1 Y 1 E ALA 579 ? A ALA 130 
62  1 Y 1 E SER 580 ? A SER 131 
63  1 Y 1 E THR 581 ? A THR 132 
64  1 Y 1 E ASP 582 ? A ASP 133 
65  1 Y 1 E LEU 583 ? A LEU 134 
66  1 Y 1 E LEU 584 ? A LEU 135 
67  1 Y 1 E CYS 585 ? A CYS 136 
68  1 Y 1 E PRO 586 ? A PRO 137 
69  1 Y 1 E THR 587 ? A THR 138 
70  1 Y 1 E ASP 588 ? A ASP 139 
71  1 Y 1 E CYS 589 ? A CYS 140 
72  1 Y 1 E PHE 590 ? A PHE 141 
73  1 Y 1 E ARG 591 ? A ARG 142 
74  1 Y 1 E LYS 592 ? A LYS 143 
75  1 Y 1 E HIS 593 ? A HIS 144 
76  1 Y 1 E PRO 594 ? A PRO 145 
77  1 Y 1 E ASP 595 ? A ASP 146 
78  1 Y 1 E PHE 650 ? A PHE 201 
79  1 Y 1 E THR 651 ? A THR 202 
80  1 Y 1 E ARG 652 ? A ARG 203 
81  1 Y 1 E GLY 653 ? A GLY 204 
82  1 Y 1 E ASP 654 ? A ASP 205 
83  1 Y 1 E ARG 655 ? A ARG 206 
84  1 Y 1 E GLY 656 ? A GLY 207 
85  1 Y 1 E SER 657 ? A SER 208 
86  1 Y 1 E ALA 658 ? A ALA 209 
87  1 Y 1 E SER 659 ? A SER 210 
88  1 Y 1 E GLY 660 ? A GLY 211 
89  1 Y 1 E LEU 661 ? A LEU 212 
90  1 Y 1 E GLU 662 ? A GLU 213 
91  1 Y 1 E VAL 663 ? A VAL 214 
92  1 Y 1 E LEU 664 ? A LEU 215 
93  1 Y 1 E PHE 665 ? A PHE 216 
94  1 Y 1 E GLN 666 ? A GLN 217 
95  1 Y 1 H MET -18 ? B MET 1   
96  1 Y 1 H LYS -17 ? B LYS 2   
97  1 Y 1 H CYS -16 ? B CYS 3   
98  1 Y 1 H SER -15 ? B SER 4   
99  1 Y 1 H TRP -14 ? B TRP 5   
100 1 Y 1 H VAL -13 ? B VAL 6   
101 1 Y 1 H ILE -12 ? B ILE 7   
102 1 Y 1 H PHE -11 ? B PHE 8   
103 1 Y 1 H PHE -10 ? B PHE 9   
104 1 Y 1 H LEU -9  ? B LEU 10  
105 1 Y 1 H MET -8  ? B MET 11  
106 1 Y 1 H ALA -7  ? B ALA 12  
107 1 Y 1 H VAL -6  ? B VAL 13  
108 1 Y 1 H VAL -5  ? B VAL 14  
109 1 Y 1 H THR -4  ? B THR 15  
110 1 Y 1 H GLY -3  ? B GLY 16  
111 1 Y 1 H VAL -2  ? B VAL 17  
112 1 Y 1 H ILE -1  ? B ILE 18  
113 1 Y 1 H SER 0   ? B SER 19  
114 1 Y 1 H GLY 134 ? B GLY 153 
115 1 Y 1 H ASP 135 ? B ASP 154 
116 1 Y 1 H GLY 219 ? B GLY 238 
117 1 Y 1 H PRO 220 ? B PRO 239 
118 1 Y 1 H THR 221 ? B THR 240 
119 1 Y 1 H ILE 222 ? B ILE 241 
120 1 Y 1 H LYS 223 ? B LYS 242 
121 1 Y 1 H PRO 224 ? B PRO 243 
122 1 Y 1 H CYS 225 ? B CYS 244 
123 1 Y 1 H PRO 226 ? B PRO 245 
124 1 Y 1 H PRO 227 ? B PRO 246 
125 1 Y 1 H CYS 228 ? B CYS 247 
126 1 Y 1 H LYS 229 ? B LYS 248 
127 1 Y 1 H CYS 230 ? B CYS 249 
128 1 Y 1 H PRO 231 ? B PRO 250 
129 1 Y 1 H ALA 232 ? B ALA 251 
130 1 Y 1 H PRO 233 ? B PRO 252 
131 1 Y 1 H ASN 234 ? B ASN 253 
132 1 Y 1 H LEU 235 ? B LEU 254 
133 1 Y 1 H LEU 236 ? B LEU 255 
134 1 Y 1 H GLY 237 ? B GLY 256 
135 1 Y 1 H GLY 238 ? B GLY 257 
136 1 Y 1 H PRO 239 ? B PRO 258 
137 1 Y 1 H SER 240 ? B SER 259 
138 1 Y 1 H VAL 241 ? B VAL 260 
139 1 Y 1 H PHE 242 ? B PHE 261 
140 1 Y 1 H ILE 243 ? B ILE 262 
141 1 Y 1 H PHE 244 ? B PHE 263 
142 1 Y 1 H PRO 245 ? B PRO 264 
143 1 Y 1 H PRO 246 ? B PRO 265 
144 1 Y 1 H LYS 247 ? B LYS 266 
145 1 Y 1 H ILE 248 ? B ILE 267 
146 1 Y 1 H LYS 249 ? B LYS 268 
147 1 Y 1 H ASP 250 ? B ASP 269 
148 1 Y 1 H VAL 251 ? B VAL 270 
149 1 Y 1 H LEU 252 ? B LEU 271 
150 1 Y 1 H MET 253 ? B MET 272 
151 1 Y 1 H ILE 254 ? B ILE 273 
152 1 Y 1 H SER 255 ? B SER 274 
153 1 Y 1 H LEU 256 ? B LEU 275 
154 1 Y 1 H SER 257 ? B SER 276 
155 1 Y 1 H PRO 258 ? B PRO 277 
156 1 Y 1 H ILE 259 ? B ILE 278 
157 1 Y 1 H VAL 260 ? B VAL 279 
158 1 Y 1 H THR 261 ? B THR 280 
159 1 Y 1 H CYS 262 ? B CYS 281 
160 1 Y 1 H VAL 263 ? B VAL 282 
161 1 Y 1 H VAL 264 ? B VAL 283 
162 1 Y 1 H VAL 265 ? B VAL 284 
163 1 Y 1 H ASP 266 ? B ASP 285 
164 1 Y 1 H VAL 267 ? B VAL 286 
165 1 Y 1 H SER 268 ? B SER 287 
166 1 Y 1 H GLU 269 ? B GLU 288 
167 1 Y 1 H ASP 270 ? B ASP 289 
168 1 Y 1 H ASP 271 ? B ASP 290 
169 1 Y 1 H PRO 272 ? B PRO 291 
170 1 Y 1 H ASP 273 ? B ASP 292 
171 1 Y 1 H VAL 274 ? B VAL 293 
172 1 Y 1 H GLN 275 ? B GLN 294 
173 1 Y 1 H ILE 276 ? B ILE 295 
174 1 Y 1 H SER 277 ? B SER 296 
175 1 Y 1 H TRP 278 ? B TRP 297 
176 1 Y 1 H PHE 279 ? B PHE 298 
177 1 Y 1 H VAL 280 ? B VAL 299 
178 1 Y 1 H ASN 281 ? B ASN 300 
179 1 Y 1 H ASN 282 ? B ASN 301 
180 1 Y 1 H VAL 283 ? B VAL 302 
181 1 Y 1 H GLU 284 ? B GLU 303 
182 1 Y 1 H VAL 285 ? B VAL 304 
183 1 Y 1 H HIS 286 ? B HIS 305 
184 1 Y 1 H THR 287 ? B THR 306 
185 1 Y 1 H ALA 288 ? B ALA 307 
186 1 Y 1 H GLN 289 ? B GLN 308 
187 1 Y 1 H THR 290 ? B THR 309 
188 1 Y 1 H GLN 291 ? B GLN 310 
189 1 Y 1 H THR 292 ? B THR 311 
190 1 Y 1 H HIS 293 ? B HIS 312 
191 1 Y 1 H ARG 294 ? B ARG 313 
192 1 Y 1 H GLU 295 ? B GLU 314 
193 1 Y 1 H ASP 296 ? B ASP 315 
194 1 Y 1 H TYR 297 ? B TYR 316 
195 1 Y 1 H ASN 298 ? B ASN 317 
196 1 Y 1 H SER 299 ? B SER 318 
197 1 Y 1 H THR 300 ? B THR 319 
198 1 Y 1 H LEU 301 ? B LEU 320 
199 1 Y 1 H ARG 302 ? B ARG 321 
200 1 Y 1 H VAL 303 ? B VAL 322 
201 1 Y 1 H VAL 304 ? B VAL 323 
202 1 Y 1 H SER 305 ? B SER 324 
203 1 Y 1 H ALA 306 ? B ALA 325 
204 1 Y 1 H LEU 307 ? B LEU 326 
205 1 Y 1 H PRO 308 ? B PRO 327 
206 1 Y 1 H ILE 309 ? B ILE 328 
207 1 Y 1 H GLN 310 ? B GLN 329 
208 1 Y 1 H HIS 311 ? B HIS 330 
209 1 Y 1 H GLN 312 ? B GLN 331 
210 1 Y 1 H ASP 313 ? B ASP 332 
211 1 Y 1 H TRP 314 ? B TRP 333 
212 1 Y 1 H MET 315 ? B MET 334 
213 1 Y 1 H SER 316 ? B SER 335 
214 1 Y 1 H GLY 317 ? B GLY 336 
215 1 Y 1 H LYS 318 ? B LYS 337 
216 1 Y 1 H GLU 319 ? B GLU 338 
217 1 Y 1 H PHE 320 ? B PHE 339 
218 1 Y 1 H LYS 321 ? B LYS 340 
219 1 Y 1 H CYS 322 ? B CYS 341 
220 1 Y 1 H LYS 323 ? B LYS 342 
221 1 Y 1 H VAL 324 ? B VAL 343 
222 1 Y 1 H ASN 325 ? B ASN 344 
223 1 Y 1 H ASN 326 ? B ASN 345 
224 1 Y 1 H LYS 327 ? B LYS 346 
225 1 Y 1 H ASP 328 ? B ASP 347 
226 1 Y 1 H LEU 329 ? B LEU 348 
227 1 Y 1 H PRO 330 ? B PRO 349 
228 1 Y 1 H ALA 331 ? B ALA 350 
229 1 Y 1 H PRO 332 ? B PRO 351 
230 1 Y 1 H ILE 333 ? B ILE 352 
231 1 Y 1 H GLU 334 ? B GLU 353 
232 1 Y 1 H ARG 335 ? B ARG 354 
233 1 Y 1 H THR 336 ? B THR 355 
234 1 Y 1 H ILE 337 ? B ILE 356 
235 1 Y 1 H SER 338 ? B SER 357 
236 1 Y 1 H LYS 339 ? B LYS 358 
237 1 Y 1 H PRO 340 ? B PRO 359 
238 1 Y 1 H LYS 341 ? B LYS 360 
239 1 Y 1 H GLY 342 ? B GLY 361 
240 1 Y 1 H SER 343 ? B SER 362 
241 1 Y 1 H VAL 344 ? B VAL 363 
242 1 Y 1 H ARG 345 ? B ARG 364 
243 1 Y 1 H ALA 346 ? B ALA 365 
244 1 Y 1 H PRO 347 ? B PRO 366 
245 1 Y 1 H GLN 348 ? B GLN 367 
246 1 Y 1 H VAL 349 ? B VAL 368 
247 1 Y 1 H TYR 350 ? B TYR 369 
248 1 Y 1 H VAL 351 ? B VAL 370 
249 1 Y 1 H LEU 352 ? B LEU 371 
250 1 Y 1 H PRO 353 ? B PRO 372 
251 1 Y 1 H PRO 354 ? B PRO 373 
252 1 Y 1 H PRO 355 ? B PRO 374 
253 1 Y 1 H GLU 356 ? B GLU 375 
254 1 Y 1 H GLU 357 ? B GLU 376 
255 1 Y 1 H GLU 358 ? B GLU 377 
256 1 Y 1 H MET 359 ? B MET 378 
257 1 Y 1 H THR 360 ? B THR 379 
258 1 Y 1 H LYS 361 ? B LYS 380 
259 1 Y 1 H LYS 362 ? B LYS 381 
260 1 Y 1 H GLN 363 ? B GLN 382 
261 1 Y 1 H VAL 364 ? B VAL 383 
262 1 Y 1 H THR 365 ? B THR 384 
263 1 Y 1 H LEU 366 ? B LEU 385 
264 1 Y 1 H THR 367 ? B THR 386 
265 1 Y 1 H CYS 368 ? B CYS 387 
266 1 Y 1 H MET 369 ? B MET 388 
267 1 Y 1 H VAL 370 ? B VAL 389 
268 1 Y 1 H THR 371 ? B THR 390 
269 1 Y 1 H ASP 372 ? B ASP 391 
270 1 Y 1 H PHE 373 ? B PHE 392 
271 1 Y 1 H MET 374 ? B MET 393 
272 1 Y 1 H PRO 375 ? B PRO 394 
273 1 Y 1 H GLU 376 ? B GLU 395 
274 1 Y 1 H ASP 377 ? B ASP 396 
275 1 Y 1 H ILE 378 ? B ILE 397 
276 1 Y 1 H TYR 379 ? B TYR 398 
277 1 Y 1 H VAL 380 ? B VAL 399 
278 1 Y 1 H GLU 381 ? B GLU 400 
279 1 Y 1 H TRP 382 ? B TRP 401 
280 1 Y 1 H THR 383 ? B THR 402 
281 1 Y 1 H ASN 384 ? B ASN 403 
282 1 Y 1 H ASN 385 ? B ASN 404 
283 1 Y 1 H GLY 386 ? B GLY 405 
284 1 Y 1 H LYS 387 ? B LYS 406 
285 1 Y 1 H THR 388 ? B THR 407 
286 1 Y 1 H GLU 389 ? B GLU 408 
287 1 Y 1 H LEU 390 ? B LEU 409 
288 1 Y 1 H ASN 391 ? B ASN 410 
289 1 Y 1 H TYR 392 ? B TYR 411 
290 1 Y 1 H LYS 393 ? B LYS 412 
291 1 Y 1 H ASN 394 ? B ASN 413 
292 1 Y 1 H THR 395 ? B THR 414 
293 1 Y 1 H GLU 396 ? B GLU 415 
294 1 Y 1 H PRO 397 ? B PRO 416 
295 1 Y 1 H VAL 398 ? B VAL 417 
296 1 Y 1 H LEU 399 ? B LEU 418 
297 1 Y 1 H ASP 400 ? B ASP 419 
298 1 Y 1 H SER 401 ? B SER 420 
299 1 Y 1 H ASP 402 ? B ASP 421 
300 1 Y 1 H GLY 403 ? B GLY 422 
301 1 Y 1 H SER 404 ? B SER 423 
302 1 Y 1 H TYR 405 ? B TYR 424 
303 1 Y 1 H PHE 406 ? B PHE 425 
304 1 Y 1 H MET 407 ? B MET 426 
305 1 Y 1 H TYR 408 ? B TYR 427 
306 1 Y 1 H SER 409 ? B SER 428 
307 1 Y 1 H LYS 410 ? B LYS 429 
308 1 Y 1 H LEU 411 ? B LEU 430 
309 1 Y 1 H ARG 412 ? B ARG 431 
310 1 Y 1 H VAL 413 ? B VAL 432 
311 1 Y 1 H GLU 414 ? B GLU 433 
312 1 Y 1 H LYS 415 ? B LYS 434 
313 1 Y 1 H LYS 416 ? B LYS 435 
314 1 Y 1 H ASN 417 ? B ASN 436 
315 1 Y 1 H TRP 418 ? B TRP 437 
316 1 Y 1 H VAL 419 ? B VAL 438 
317 1 Y 1 H GLU 420 ? B GLU 439 
318 1 Y 1 H ARG 421 ? B ARG 440 
319 1 Y 1 H ASN 422 ? B ASN 441 
320 1 Y 1 H SER 423 ? B SER 442 
321 1 Y 1 H TYR 424 ? B TYR 443 
322 1 Y 1 H SER 425 ? B SER 444 
323 1 Y 1 H CYS 426 ? B CYS 445 
324 1 Y 1 H SER 427 ? B SER 446 
325 1 Y 1 H VAL 428 ? B VAL 447 
326 1 Y 1 H VAL 429 ? B VAL 448 
327 1 Y 1 H HIS 430 ? B HIS 449 
328 1 Y 1 H GLU 431 ? B GLU 450 
329 1 Y 1 H GLY 432 ? B GLY 451 
330 1 Y 1 H LEU 433 ? B LEU 452 
331 1 Y 1 H HIS 434 ? B HIS 453 
332 1 Y 1 H ASN 435 ? B ASN 454 
333 1 Y 1 H HIS 436 ? B HIS 455 
334 1 Y 1 H HIS 437 ? B HIS 456 
335 1 Y 1 H THR 438 ? B THR 457 
336 1 Y 1 H THR 439 ? B THR 458 
337 1 Y 1 H LYS 440 ? B LYS 459 
338 1 Y 1 H SER 441 ? B SER 460 
339 1 Y 1 H PHE 442 ? B PHE 461 
340 1 Y 1 H SER 443 ? B SER 462 
341 1 Y 1 H ARG 444 ? B ARG 463 
342 1 Y 1 H THR 445 ? B THR 464 
343 1 Y 1 H PRO 446 ? B PRO 465 
344 1 Y 1 H GLY 447 ? B GLY 466 
345 1 Y 1 H LYS 448 ? B LYS 467 
346 1 Y 1 L MET -19 ? C MET 1   
347 1 Y 1 L GLU -18 ? C GLU 2   
348 1 Y 1 L SER -17 ? C SER 3   
349 1 Y 1 L GLN -16 ? C GLN 4   
350 1 Y 1 L THR -15 ? C THR 5   
351 1 Y 1 L GLN -14 ? C GLN 6   
352 1 Y 1 L VAL -13 ? C VAL 7   
353 1 Y 1 L LEU -12 ? C LEU 8   
354 1 Y 1 L MET -11 ? C MET 9   
355 1 Y 1 L PHE -10 ? C PHE 10  
356 1 Y 1 L LEU -9  ? C LEU 11  
357 1 Y 1 L LEU -8  ? C LEU 12  
358 1 Y 1 L LEU -7  ? C LEU 13  
359 1 Y 1 L TRP -6  ? C TRP 14  
360 1 Y 1 L VAL -5  ? C VAL 15  
361 1 Y 1 L SER -4  ? C SER 16  
362 1 Y 1 L GLY -3  ? C GLY 17  
363 1 Y 1 L ALA -2  ? C ALA 18  
364 1 Y 1 L CYS -1  ? C CYS 19  
365 1 Y 1 L ALA 0   ? C ALA 20  
366 1 Y 1 L ASN 218 ? C ASN 238 
367 1 Y 1 L GLU 219 ? C GLU 239 
368 1 Y 1 L CYS 220 ? C CYS 240 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 2-acetamido-2-deoxy-beta-D-glucopyranose NAG 
5 FORMAMIDE                                ARF 
6 water                                    HOH 
#